3PTMA

The crystal structure of rice (oryza sativa l.) os4bglu12 with 2-fluoroglucopyranoside
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
478
structure length
478
Chain Sequence
PVSRRSFPKGFIFGTASSSYQYEGGAAEGGRGPSIWDTFTHQHPEKIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKNWITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGREPYTACHHQLLAHAETVRLYKAKYQALQKGKIGITLVSHWFVPFSRSKSNNDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGLNYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLYVKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-glucosidase Os4BGlu12
publication title The crystal structure of rice (Oryza sativa L.) Os4BGlu12, an oligosaccharide and tuberonic acid glucoside-hydrolyzing beta-glucosidase with significant thioglucohydrolase activity
pubmed doi rcsb
source organism Oryza sativa
total genus 192
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ptmA00
5IDIA 1GOQA 1WKYA 1A47A 3K8KA 3AS2A 4HMEA 3MUY1 1HJSA 2OYLA 4TOQA 4D71A 1EOMA 1QNOA 1F4AA 5I6SA 1ODZA 1D2KA 1NOUA 4JFTA 4KWUA 4H8UA 5A8QA 2BVYA 1HP5A 1SMDA 2ZX8A 1QHPA 3BMVA 2XM1A 3HN3A 3LPFA 5D9MA 2WZEA 1UWUA 3T0AA 4PCSA 1HJXA 3WD4A 2YL5A 1OCQA 4LX4A 2AMGA 3SUWA 1KGUA 4C7DA 4JKMA 4HP5A 2VMFA 1W1TA 2XSBA 4V27A 2CESA 3OLGA 5FL1A 3PTMA 2WYSA 1E40A 3L4WA 3VPLA 1G94A 1G01A 5EFFA 4YPJA 2GDUA 1E6RA 1BTCA 2DT1A 3AMCA 1UZ4A 3FW6A 4FLQA 4AIOA 3POCA 2Y2WA 3A6OA 1EHNA 2VX4A 2DIJA 1ODUA 1FP9A 2WLYA 5BXTA 1E0VA 1BF2A 1UKSA 2ZUTA 4TVDA 3CUGA 4AISA 2QLYA 1J0JA 1TA3A 4MNKA 2YOCA 5IHSA 5BWFA 3VTRA 1VF8A 5IFPA 2PI6A 4J3XA 5E0FA 5GNYA 2CHOA 2O9OA 4H8VA 4MNLA 3L4VA 2VX7A 2J77A 2DT3A 1PX4A 1FH7A 3AS3A 3KEHA 4U2YA 5GNZA 3EDDA 2FHCA 1PJ9A 5DMYA 2OSWA 4PMZA 4JL2A 2W4XA 3W4RA 2VL4A 1GOIA 4AEEA 4TTGA 2FHBA 1I1XA 3BMWA 3WUEA 3WUBA 1BG4A 2A3HA 1BVNP 3AOFA 3OGRA 3BCFA 5A8NA 1IZJA 1JFHA 3PN8A 4GKLA 4D6GA 3UCQA 1OGGA 3WMBA 1KXQA 1GONA 3HJEA 4PTVA 4UQ9A 1QI0A 1C93A 3AMKA 1JDAA 1R8LA 2BY3A 4JCMA 1E6QM 5E6ZA 1UG6A 4K68A 2BHUA 1JFXA 3VGGA 1ITXA 2HVMA 2YDQA 1NH6A 1UWRA 1OBAA 1UH2A 3S6TA 4ATLA 5A8PA 1H11A 1PZ3A 4W7UA 4RE3A 4GO8A 3WY1A 4WK9A 3ZR5A 2WC7A 1UKQA 4H8HA 1W1VA 1LLOA 4IPNB 3GH5A 5ABFB 3F5JA 1EDTA 1M03A 3OB8A 1W1YA 3MUZ1 4TXEA 4AD1A 1E1EA 3CMJA 4PTWA 2ZX7A 6A3HA 4AZCA 1NP2A 2PF0A 4AIEA 1VEMA 1ISYA 1E4MM 3T0DA 3SCSA 4LYRA 4YHGA 3M46A 1J0ZA 3WQ8A 2D1ZA 2WNWA 4HU8A 3CHDA 4XB3A 4CD6A 1EIBA 4DUVA 1WDPA 3CZ8A 5JBEA 1I75A 3BAXA 2VZVA 2NT1A 1DP0A 3MMWA 3A4XA 3U5YA 4AZGA 5CGTA 1E72M 4M29A 1H41A 4DWSC 3OZOA 3ZSSA 3L2MA 3WNOA 3WDQA 3ALFA 1BG9A 1B3VA 1CGYA 1CGTA 5F7UA 1JZ5A 3AROA 1W9VA 1RP9A 3SCRA 2YA0A 2WKGA 5GPRA 3B9AA 3EMCA 1JNEA 5CXPA 3WDJA 1E3ZA 1V0MA 2X05A 1B90A 4QAWA 2WBKA 5BCAA 1UZ1A 1XCXA 5DF0A 1UHVA 2EPKX 2ZUMA 2E9BA 3BAIA 2CHNA 2VO5A 2CBVA 1KQYA 3VIIA 5BROA 3CH9A 4NRSA 2OYMA 2CCRA 1FHLA 3T2PA 1V3JA 4D1JA 1UQZA 4JKKA 2V5CA 4CVWA 1DEDA 1YHTA 1LWJA 7CGTA 3AIWA 1EH9A 5CLTA 1S46A 2BV9A 4A3HA 1GOWA 2XWEA 4PTXA 4HMDA 4JAWA 3CUJA 2V5DA 1GZJA 5I78A 3ZR6A 1PZ2A 3WD3A 3AHTA 4CCDA 1XYZA 3RM8A 4PTMA 5A69A 3FY1A 3EDJA 1E6NA 5IFTA 2ZUWA 3KWXA 1J10A 1Q4NX 1GHSA 2WSPA 4D6JA 2FDMA 5HPCA 1E55A 2WB5A 3OGVA 4W8BA 4S3JA 1VBRA 3AZSA 1NP0A 1CDGA 2EPNA 1UD4A 3GTNA 3KZSA 3BLPX 4PBGA 1BSIA 3WL1A 1GOMA 2WVVA 2GK1B 1HKJA 3W81A 3K8MA 2C8NA 5HNNA 1CGUA 3L4XA 1WPCA 1CLXA 1LL6A 3MU7A 2VR5A 1JAEA 1UR0A 1JGIA 3NDZA 2WZIA 1W91A 5ABEA 2X2YA 4W8LA 2XHYA 3K1DA 2XJ7A 3MSGA 1DHKA 2W62A 1XD1A 3CUIA 3DHUA 1W9PA 2EJ1A 1XSKA 1Z32X 4UFMA 1OM0A 2W63A 4OIFA 2YJQA 3ZJ7A 3WN6A 4L4OA 3OLDA 1W32A 1BYBA 4M1RA 1CGWA 5A6KA 2D23A 3M07A 3U5UA 1VBUA 1CNVA 4OUEA 4UTFA 1BYDA 1QBAA 1WDRA 2V3EA 4ACZB 1V08A 2J7CA 1V6UA 3WDPP 4OJYA 3OLEA 2DIEA 1HL8A 4U3CA 2V3FA 2CETA 1QNSA 2YA1A 3DYOA 4MNJA 4GIAA 1BGAA 1QNQA 2D0GA 2ZWYA 3SURA 3VGEA 4QDMA 3VINA 3BXWA 3D5HA 4JKLA 1CBGA 2GJXB 3ARSA 3WBEA 3RCNA 2XGIA 2BS9A 1JI1A 3ZOAA 4D6DA 1UR8A 2WXDM 1EQPA 3AXXA 3KL3A 4HU0A 3WDIA 5HXMA 1G5AA 3NSXA 1TMQA 1V03A 2MANA 2OWXA 3SUTA 1AQHA 4ATWA 4PMNA 1EOKA 2EPLX 2WVSA 5FKYA 3TOPA 2WVUA 4Y7EA 1MW1A 3AJ7A 2XVPA 1VFOA 1BVZA 1WDSA 4EE9A 2W91A 2J25A 4CKQA 2WZHA 3WELA 3WEMA 4AEFA 3N17A 1H2JA 1QHOA 1V6WA 1UR9A 2VQTA 3NDYA 5BXRA 3L4YA 1E43A 2WANA 1R87A 2JIWA 4TVCA 2ZUSA 4U33A 3BC9A 1IT0A 1BYAA 2WC4A 4AWEA 3AZRA 2WLZA 4P8UA 2WAGA 1DWJM 4NRRA 3VOCA 4W84A 2CYGA 1UH4A 4A4AA 2YL8A 3RIKA 2Y5EA 3RJXA 2Q8XA 4L4PA 1VIWA 1X1NA 3AYRA 2WHLA 1F4HA 1KBBA 2PC8A 2CPUA 3TP4A 4CD5A 3VM5A 3GXDA 2NT0A 1H5VA 2D20A 1UYQA 1B0IA 2DGAA 3LPOA 4KH2A 1K9EA 2Z1KA 4PMUA 1CXHA 1HVQA 1NWUA 3UERA 1CEOA 3GXFA 2VT0A 3BGAA 5D9NA 4AXNA 1E4NA 1PIFA 1UD2A 4WSJA 5A1AA 3K8LA 1G1YA 4M82A 1MXGA 3G6MA 4GQQA 8A3HA 2W67A 1DWGM 5A2CA 1WB0A 1I1WA 3I3BA 2J8FA 1QPKA 2DSKA 4F79A 2GDVA 4DM1A 2WMHA 2ZUNA 4BQ2A 5E9AA 3VU2A 1UQYA 2NSXA 1TVPA 1JYXA 2VTFA 4NSBA 1R7AA 3AIBA 4UFLA 2GJPA 4GQRA 2PBOA 2OSYA 4ZEPA 3ZSTA 3VDAA 1B3YA 1YQ2A 2BY0A 2ESCA 4DWSB 4Z2JA 2VCAA 4XZWA 3VGHA 4N0RA 4TUFA 5M5DA 2XG9A 4W88A 5ABFA 3AMGA 4U5IA 2J62A 1HL9A 4D6EA 3L2LA 4UZUA 3BSHA 2CERA 6TAAA 2BFGA 2V3DA 3FHQA 3SCUA 4F9DA 2GSJA 4RE4A 3KE0A 3ZT7A 3F5LA 2ZWZA 3VDBA 2QPUA 5GQBA 4GXPA 2PWFA 1E4IA 3ZT5A 4D1IA 2BHZA 4AZIA 1MW2A 4CCEA 1J18A 4FF5A 5FIPA 4ZE4A 4Z2GA 1OINA 1WO2A 1OD0A 2YBTA 4CN4A 2RGLA 1W3LA 2VVNA 4MDOA 2YDSA 1ZBVA 4MADA 3SEPA 3MKKA 3VIKA 2GUYA 3CTTA 4PMQA 2XIIA 3VGBA 1PX3A 4AZ5A 1NWSA 4LXFA 1K9DA 4AZBA 2YIHA 3N1AA 1E5JA 3AYSA 3VIJA 5AYBA 1U33A 1CYGA 1E0XA 1J0KA 1WE5A 3U7BA 4KGJA 5CPSA 2O9RA 5M3WA 3CZEA 1C91A 3BAJA 1GVYA 4KRTA 3WUFA 3CHEA 2WC3A 3VVGA 4QFUA 1WZLA 1ZU8A 1W9XA 1SFSA 1OSEA 4XUYA 1VFUA 3ZMRA 4J3VA 2A3EA 2D0HA 1MFVA 4QLLA 3IAQA 3POHA 1GHRA 1CECA 3D3AA 1R7OA 4M8UA 1M53A 3T0BA 1EGZA 4JHOA 1QW9A 1BFNA 3KL5A 3WL0A 3SCTA 1XYFA 1ZJAA 1HJVA 1LL4A 1JIBA 3CO4A 5D9OA 4IISA 2EEXA 3AXIA 2PWEA 2QF8A 3I3EA 1UWIA 3WMSA 1Q6GA 3NIYA 3IJ8A 3UESA 1JDCA 5TD4A 3PHAA 1HJUA 4UOJA 2WMJA 1SR0A 3WNLA 1R85A 3OG2A 5BRPA 1IZKA 2Y8KA 4KRUA 1MQQA 3ARVA 5JIWA 1CTNA 1XHGA 2G8ZA 3VIHA 1RP8A 1J11A 4BQ4A 2GJRA 3DECA 3VX0A 1B3XA 3WD0A 1KWGA 4CCCA 3WD1A 5LA0A 5AY7A 1JF6A 2CNCA 2XFYA 1FHDA 3W26A 2GK1A 2PWDA 1QI5A 1NARA 3II1A 3APGA 3RJYA 1GNXA 4EAMA 1GPFA 1W9DM 4P8XA 4QLJA 1VEOA 2DH2A 1U2YA 2EBNA 4FK9A 4B15A 3VMPA 3PZUA 5A6MA 2XWDA 5I0DA 1V0LA 3M7SA 1MW3A 2X0YA 3CUFA 3WH6A 2QV4A 4WKHA 1X6NA 5CSUA 1J01A 3GNOA 4HA4A 4PYSA 1KBKA 3G6LA 1C92A 4JZ5A 3CIVA 1M04A 3VIOA 4UR9A 1FA2A 1WDQA 4ATDA 4BCEA 1BYCA 4H04A 1ZL1A 1XSJA 5JIPA 1QI4A 4ACZA 1ECEA 2ZIDA 2DQXA 4H7VA 3CHCA 4CUCA 4PSPA 4PMDA 1JYNA 2XIBA 2E9MA 5CPQA 3QR3A 1FOBA 3DHPA 1JZ7A 1RPKA 3W27A 5EBAA 4E8CA 4OOUA 4XX6A 3WDRA 3TTOA 3VILA 2ZXQA 3U7VA 1FH9A 1B9ZA 3DC0A 1H09A 1JYVA 1Y7VA 3K46A 1HX0A 2D3NA 2VRJA 2GJXA 3DYMA 1WNOA 4HPHA 3ZM8A 3IJ7A 1R86A 4NF7A 7TAAA 1U30A 3CZLA 3SUSA 3IK2A 4CD4A 2BXZA 5LA1A 3WBAA 1E6ZA 3UG5A 4CGTA 1P6WA 1D3CA 3WNMA 3M6DA 2DT2A 1VRXA 4PSRA 4W7WA 5A8OA 4F9JA 1HF6A 2CKRA 3ZT6A 3B9EA 1CGVA 3MV01 4AD2A 4HPGA 1JI2A 4P7RA 1UD3A 3GM8A 1C8YA 3E1F1 4CVUA 2G3NA 4CU6A 1CPUA 4HOZA 2JEQA 1GQIA 4BQ5A 1E4LA 1NM9A 2DH3A 2FHFA 4MDPA 4MB3A 1JZ4A 2E8YA 1CXKA 4S3KA 1HNYA 1QOXA 3PTKA 3VIMA 4BZYA 2QHAA 1DWAM 2J74A 5A6JA 5DEZA 3WF1A 1B30A 3PZQA 3W28A 1C8XA 1Q6EA 4PMXA 4B3LA 3WKZA 2O92A 4J3WA 3PZTA 2X0HA 3AHVA 5D8ZA 4MAVA 1GQLA 1TE1A 1UH3A 1JAKA 1BGGA 2JALA 4GINA 1JL8A 4JIEA 1GOKA 4UOZA 2YLLA 4D6FA 1XSIA 1K6AA 3LPGA 1B2YA 2WVTA 1WZAA 3N18A 1EQCA 4UQBA 2XFFA 4URIA 1V0KA 2J79A 3NSMA 5DT7A 5JBFA 1HJQA 3GH4A 1ISVA 5A6SA 2QPSA 3FXYA 1HIZA 1B3ZA 5FL0A 3WH7A 1H49A 1N82A 2EPOA 4BA0A 8CGTA 3T08A 4W8AA 1LWHA 2OWWA 1LG2A 3THDA 1A3HA 4GI9A 4ZENA 3AQUA 1UD6A 1GUVA 2ZX9A 4XZBA 2DEPA 1V02E 2VNCA 4P7QA 4D72A 2J7BA 5BXPA 1CENA 3T09A 1VJZA 1NOWA 3FN9A 3PBGA 4LYPA 1OIFA 4UQDA 3B8SA 5I23A 1W3KA 4EANA 1CIUA 1ZBKA 1OGSA 2XVKA 3GBEA 6CGTA 2XTKA 1H4PA 2Y8VA 3GXIA 3EDKA 4JFUA 4W89A 2W92A 4EK7A 2CKSA 1MW0A 3N04A 1QNPA 2DSZA 2Y24A 1J0IA 4LGXA 1LJYA 1NWRA 2YLAA 3N15A 1MQRA 1C3FA 3GYCA 3NYDA 4Z2IA 2ZXBA 4UNIA 2ZOXA 2VOTA 4QP0A 4WJXA 4WKAA 3VNYA 3QHOA 2ZX6A 5CG0A 3QOKA 1C90A 3VD4A 1O6IA 4ML4A 4C7GA 3CGTA 5KEZA 4WSKA 3IJ9A 3F4VA 5DT5A 5M03A 3RMEA 2XGBA 4QLKA 4BQ3A 1KCKA 4R5EA 2IUZA 3W6MA 4JFSA 2ZICA 2VZUA 1BPLB 4MB1A 1O7AA 1CWYA 4W93A 4CD8A 1E0WA 1FFRA 1JDDA 1XH2A 2CITA 2ZXAA 4LPCA 3S2CA 1J12A 1E56A 1TZ7A 4TVUA 2J78A 2XSAA 3PZGA 3PZOA 1ZJBA 1UKTA 1DWFM 3GBDA 1C7SA 1MVYA 1UD8A 2J7EA 2VX5A 1H1NA 4J3SA 3WNPA 5A2BA 1BLIA 3WQ5A 2WMKA 3ARWA 1KFWA 1NOFA 3SCVA 4AD0A 3QHMA 3MSDA 3MMDA 5I5RA 2WM0A 4R27A 3WNNA 3THCA 1V3HA 3RM4A 1H0GA 1CXEA 1BQCA 3ZJ6A 4FLRA 4PMVA 1V6XA 2EXOA 4N42A 4B3KA 4B9YA 5A2AA 3WFZA 3LPPA 4GZEA 3FHAA 1MYRA 1CLVA 1GJWA 3AHYA 3VKKA 2WMIB 4TX6A 5JBDA 3FAWA 4HMCA 5CSYA 3DYPA 1XV8A 5I24A 1X6LA 1SMAA 3AS0A 4UFIA 2Z1SA 4UZSA 4GZIA 1DWIM 4CN6A 4P8WA 1IV8A 1GQJA 1JG9A 4D6HA 4HOWA 2PBGA 3EYPA 4UQAA 3NUKA 1XCWA 4MB5A 1JXKA 2FH8A 3AMDA 4Q7NA 1OWQA 1ZB5A 1E6PA 3MS8A 5C8BB 4AZ7A 3CZJA 1EO7A 1H0IA 1K9TA 1QNRA 5HPOA 2A3CA 3B9DA 3WQVA 4OOZA 2J7DA 4HTYA 2VJXA 1E3XA 5EFDA 4E2OA 2CXGA 4C7FA 3AHZA 2G4FA 3ARZA 2BY1A 3ARYA 2W5FA 4EKJA 4U31A 4AZ6A 3VD5A 4B16A 2J75A 4V28A 4W85A 3OGSA 3BCDA 4E4PA 3ARUA 1BHGA 3RO8A 4PMOA 5IHRA 3AIVA 1WAWA 3VNZA 1QW8A 1UR1A 3VIPA 3AMLA 4V2XA 3PZVA 1KB3A 1US2A 1E73M 2XVGA 3WF0A 3TTQA 1UOKA 2TAAA 4QCEA 5KZ6A 4OZOA 1LL7A 3ZJKA 1UA3A 2A3AA 1CXIA 3AZTA 2FGZA 1XH0A 4FLSA 3WF3A 3W38A 2BVDA 5CPTA 1PBGA 3GDBA 1GOOA 3KL0A 5AYIA 1LG1A 1XRVA 4W7VA 1FP8A 5DO8A 1Q6DA 1VB9A 4GO9A 4M24A 3QGVA 1MFUA 2WCGA 4RE2A 4MB4A 5DFAA 2WHJA 3A3HA 2JFEX 4PUEA 5D8WA 2D2OA 1XD0A 3AI0A 3CPUA 4OBRA 5I2UA 3NCOA 2XFRA 2J47A 5A6AA 1GW1A 2EPMX 2V3GA 4HZ6A 3L4UA 3VMNA 1EXPA 3CZKA 4Q22A 4CU8A 3EBVA 3PZIA 4GPNA 5CJ5A 2CBUA 1V3LA 5I77A 1ZBCA 1ISXA 3BAYA 3W6LA 2XVNA 5JUVA 2WWCA 2G3IA 2UY3A 4WLCA 4UFKA 3FAXA 1CXLA 2VVSA 4PEEA 1RD6A 1OT2A 3W29A 1JNDA 3VO0A 4Z2HA 4ZFMA 1JD9A 2E0PA 4HA3A 3PTQA 3VDCA 3A4AA 5FOOA 4Z2LA 1ZS2A 1QVBA 3LMYA 3PZNA 5I79A 1HP4A 2ZXDA 4MNMA 4U2ZA 4HZ7A 4XV0A 3WEZA 2J7GA 3T2QA 1OD8A 1VEPA 4J28A 3VGDA 2DSWA 2Y4SA 1ESWA 1UR2A 3AS1A 3AICA 1J0YA 1G0CA 3WFLA 3BSGA 2OYKA 3GH7A 2WMGA 4MJ4A 2WCSA 2DSUA 2C0HA 4HA1A 5CGMA 4AY1A 2VQUA 4A3YA 2BXYA 3WIJA 4D6IA 1US3A 4MJ2A 4U3AA 3BLKA 3WF2A 5C71A 3BAKA 1DTUA 5EMYA 2YKKA 4W5UA 1TVNA 2CIPA 1KQZA 1W9UA 2D0FA 3TTSA 4PRWA 5M17A 1JF5A 3WDHA 1OGBA 2WK2A 1VENA 1GVIA 1UD5A 2WBGA 2QMJA 3AIQA 4W86A 4WIWA 3VDHA 4WKFA 4ACYA 3UETA 1WP6A 2A3BA 1V0NA 5HDRA 5BYWA 1JXJA 2XM2A 4UQCA 4JFVA 3W25A 4P7OA 5ABHA 3U57A 5A6BA 3AISA 3NJ3A 3PZ9A 3WMCA 1G9HA 3SUVA 5E70A 3OBAA 3AIEA 1ZBWA 2VCBA 1PX8A 4H41A 2EO7A 1VFFA 2D3LA 3SUUA 4AD4A 1CGXA 1E71M 3MUIA 3NSNA 5FCZA 1UWQA 3ARTA 1TR1A 1JZ8A 3TONA 4AZHA 1RH9A 1H3GA 4BS0A 3ZQ9A 3AFBA 3F5KA 3WQ6A 2GVYA 2JEPA 1L0PA 2WHKA 3A47A 4MPKA 5A6BD 1MQPA 2HISA 3WH9A 2VI0A 5A3HA 3FNDA 4F66A 2EQDA 2YA2A 4P7LA 1V6YA 4ZXOA 3VMOA 4IUGA 4PMRA 4RL3A 2AOSA 2YDRA 1WZKA 4AD5A 1UWSA 1KWKA 4AYSA 4X0NA 1V6VA 3HMCA 3MO4A 1VFMA 1GJUA 2OLHA 1K9FA 4DM2A 1W2VA 4X0VA 5A94A 3RILA 4AC1X 1HXJA 4PUDA 1C8QA 3AIUA 3N9KA 1TA3B 1MXDA 2V38A 3WF4A 1JYWA 2J7HA 2E3ZA 3GXMA 3MMUA 3VD9A 1UR4A 1V3KA 4PN2A 3W53A 3BAWA 2VRKA 2DPEA 3QOMA 5AC5A 1W1PA 1TUXA 3ARXA 2IXVA 2FH6A 4UFJA 4GI8A 1LF1A 1W3JA 2D22A 1EHAA 1KXVA 4HOXA 2OWCA 1PEZA 3WH8A 2CBJA 3RM9A 1KXHA 2E9LA 2CBIA 1TG7A 3SCQA 3K4DA 4OBSA 3N12A 2ZE0A 2BY2A 1QI2A 4PMYA 4W87A 3BH4A 4TX8A 3W82A 2F2HA 4FMVA 1TCMA 2XVLA 4QCFA 3ZJ8A 3N13A 3HU7A 2ZX5A 3VIFA 3VD7A 2VURA 3CHFA 1NQ6A 3CBWA 3MV11 3SCNA 2YBUA 1E5NA 3L4TA 4KMQA 4JHZA 2UY5A 3OLIA 2ZUUA 3A4WA 1CXFA 1E9LA 5HOSA 2J4GA 3N11A 3EMQA 2G3JA 2JF7A 1ITCA 4M80A 2VX6A 1EDQA 4UOQA 3OIHA 1FH8A 2D24A 1WZMA 1FFQA 1UKOA 2E8ZA 4GI6A 4ZXLA 4AD3A 2E4TA 5E09A 2RGMA 3RPMA 3AHXA 4LQ1A 4AZCB 4WF7A 4P7NA 3GZAA 3ZIZA 1HN1A 2CEQA 2VRQA 3ARRA 2DT0A 1ISWA 4AIUA 2PB1A 3OA5A 3WD2A 1GQKA 1D7FA 3IANA 3VM7A 2AAAA 1JD7A 4PCTA 2WMIA 4OKDA 4FLOA 2NW0A 1E1FA 3CMGA 1QBBA 4DUXA 5IXEA 2G41A 2QMKA 2XUCA 1EDGA 1B31A 4KGLA 3W0KA 4X9YA 3O9NA 4NZCA 4J7RA 4JL1A 4W5ZA 1HT6A 5E0CA 4BF7A 1W3HA 3CZGA 1W9BM 2WW5A 2W66A 4UFHA 4ZE5A 5D9PA 4AW7A 1SYTA 1AQMA 3O6AA 3EDEA 4Z2KA 3UR7A 3GNPA 1KR0A 1J0HA 1VJSA 3L4ZA 4HZ8A 4J27A 2PWHA 1OT1A 2F61A 2VC9A 2VZOA 2G3MA 3IAPA 4DWSA 4MAZA 3ZO9A 3CLWA 3EMZA 2WHMA 1B1YA 2XYLA 4JCLA 2FGLA 1PAMA 1E70M 1HKIA 1VAHA 3RDKA 3O2LA 1TFVA 4M56A 3VGFA 3J7HA 1KGXA 1AVAA 4IM4A 3WNKA 4CU7A 3ARQA 2DSVA 5ABGA 2X09A 3UG4A 3VX1A 1GCYA 2IXUA 3WUGA 3WSUA 1UA7A 1NWTA 4JFWA 1KCLA 3AXHA 4DWSD 3OZPA 1XC6A 3W24A 3CUHA 1V02A 1CZ1A 1XGZA 1AQ0A 1HVXA 1PIGA 1LQ0A 3W37A 2J7FA 2UWFA 3TTYA 3UG3A 3SCOA 3GNRA 2PWGA 4M81A 3QHNA 3VUPA 4TTUA 1MWOA 2F8QA 1UUQA 1E6XM 3UR8A 5I3DA 1M01A 3TA9A 5AC4A 1HKMA 1UKPA 5CZKA 4NI3A 2VR4A 4D6CA 2C7FA 2W61A 3MUAA 4J3TA 1L8NA 1HJWA 5A95A 1EA9C 4DUWA 2DDXA 1WCGA 2OSXA 3SIMA 3EDFA 2WSKA 2BNJA 4LYQA 1W2PA 5E6YA 4MTVA 4F8XA 1OIMA 7A3HA 3WQ4A 3WH5A 2WVVB 5EB8A 5HBFA 1E6SM 1J9YA 1EO5A 3JUGA 3VD3A 4E8DA 2VZSA 2WPGA 1M7XA 2BVTA 1KGWA 4B9ZA 3SCPA 5LA2A 1ISZA 5GNXA 3SCWA 2WWDA 3WENA 2BHYA 3T2OA 4AMCA 3WEOA 1KR1A 3MANA 2ZUVA 2WCAA 5LYRA 2WMFA 3WQWA 2VUYA 3ARPA 2E40A 5A6LA 3VIGA 4YHEA 2B31A 4UQEA 3ECQA 2O9PA 2JE8A 1GORA 3PZMA 3ALGA 2WKLA 1C7TA 4IPLA 5CQ1A 4H2CA 5D4YA 5FD0A 4CD7A 2VZTA 2J8GA 1Q6FA 1V3IA 1PPIA 1AMYA 9CGTA 2VCCA 2O9TA 5A8MA 4U5KA 4P8VA 2X8RA 2XPKA 1JZ2A 1XH1A 3UEQA 4J3UA 2JIEA 1KXTA 1B3WA 1DWHM 1QI3A 2JF6A 2YL9A 1JZ6A 2X1IA 5BXSA 1JZ3A 1BAGA 5CLWA 2UY4A 5C70A 4CN1A 1Q6CA 1HKKA 3K4AA 2YL6A 1OB0A 3I3DA 1QHZA 4YN5A 1E15A 2GFTA 5ECUA 4UCFA 1UWTA 3AIRA 5BRQA 2UY2A 1V3MA 4GZJA
chains in the Genus database with same CATH superfamily
3W2KA 3CLMA 2FLIA 3MUY1 4O1DA 1HJSA 3FA4A 4TOQA 1EOMA 2J27A 1EJUC 3DU0A 1F4AA 3AYTA 3KLLA 1D2KA 5F1VA 4FR6A 5A8QA 4HQVA 1HP5A 3LHUA 1GTHA 1PB0A 4JHMA 1RQEA 3WD4A 2PTYA 1OCQA 3UGRA 3SUWA 3KOFA 3GX9A 3CAQA 4C7DA 4BWLA 3FEQA 4HP5A 1WBHA 3P84A 3BLOA 1TZ9A 6TIMA 2P8CA 4V27A 5C2GA 3GU2A 4O54A 4ADSA 1Z41A 4NY2A 2NXHA 2PDBA 3PTMA 3DC8A 3VPLA 2V2HA 1RZMA 3L68A 3S8HA 2QXWA 4XBSA 4F0SA 3KS5A 1BTCA 3LGGA 5TBOA 2HV5A 4FLQA 3AWOA 1EHNA 2DIJA 1ODUA 4IUOA 4XAPA 1BF2A 3SN0A 1UKSA 1IEQA 2ZUTA 4TVDA 3CUGA 4HHLA 5HNUA 4FX6M 4DZHA 5LIKX 5IHSA 1S5VA 2DY3A 3IJLA 1OF6A 3NZRA 2J66A 1R3RA 4YU1A 3EDDA 1SZGA 4LCRA 3UJEA 4PMZA 4JL2A 4MWAC 4N4PA 3W7QA 1GOIA 4AEEA 2C3ZA 3MT1A 2A21A 1I1XA 3WUBA 2WNZA 4QNWA 2BOEX 3R13A 5A8NA 4GKLA 4LEQA 5DXXA 5CBBA 2YGYA 5AHFA 4BFAA 3GB6A 2GUBA 3HJEA 3CPRA 4JX5A 2A7NA 4UQ9A 1QI0A 3W1NA 4M7TA 1TZZA 3SI9A 3DFNA 4K68A 1JFXA 3FSUA 3DGRA 3B8IA 4RW3A 2HVMA 2YDQA 1NH6A 1UWRA 4ATLA 3S6TA 1H11A 4BEQA 3AXMA 1SW7A 3ZR5A 1UKQA 1W1VA 4QDPA 3RF9A 3HTWA 1J96A 4N9CA 1ZZMA 1EUAA 4TXEA 2OZ0A 3QH2A 3MZNA 3R8RA 6A3HA 1RCQA 3SB0A 1LOSA 3GD6A 1ISYA 1CLKA 1P0KA 3T0DA 4Q4KA 3IIVA 4LYRA 3NVDA 4JN8A 4OFCA 3WCZA 1YXYA 4XB3A 5JU6A 4IFKA 1THFD 4DUVA 1A0EA 1GPWA 1TPC1 5I00A 2PDUA 4GUIA 2QCCA 3TYDA 4IXXA 1TTQA 2NT1A 3G1SA 4JTGA 4M29A 1H41A 1X8CA 4DWSC 3OZOA 3V0TA 3MW7A 3ALFA 1RAKA 1RY8A 4B4HA 4GVHA 5E9XA 1CGTA 3O15A 1XG4A 4LANA 4FS9A 1H51A 3GIYA 5GPRA 2DVUA 2R14A 1JNEA 4ZB5A 1A5OC 2BBFA 3TSDA 1V0MA 3G1YA 1B90A 2WBKA 1UZ1A 5DF0A 1UHVA 4F3HA 4XKYB 5SWUA 1X97A 4DF0A 1SO3A 3H4GA 4UTTC 1XLLA 2V69A 4U4MA 1Q6LA 5XINA 1FHLA 2ALRA 3SN4A 3T2PA 1LBFA 2I57A 4JKKA 1DEDA 1PKYA 1RJQA 4O1CA 3M6YA 1EKOA 3TN4A 1YEYA 3TSBA 5JXQA 2RDTA 1F61A 3SY1A 1XIMA 4DI8A 3H7UA 3KDOA 1KO0A 3CUJA 3UVAA 3ZR6A 2YCLB 4EXBA 2FTYA 3AHTA 4WVXA 1XYZA 5C9XA 3W1LA 4U10A 1RA0A 2DZWA 1GHSA 2WSPA 2FDMA 5HPCA 1XYMA 2DUXA 1F05A 1EB3A 3NQFA 3A21A 4S3JA 3AZSA 2PLMA 3BLFA 1CDGA 2I5IA 2J6XA 3GTXA 2DZTA 2WVVA 3S1VA 4E8GA 4EPBC 3NZ1A 3C0LA 5EGRA 3W81A 4HNLA 2EKCA 4US5D 4DPPA 1LL6A 1UC5A 2VR5A 3VNDA 1UR0A 1JGIA 1JUBA 3NDZA 3CL7A 3UF9A 1GK8A 3F4CA 4JTEA 3W75A 3ELFA 2OJPA 1HKWA 3MSGA 1DHKA 3UU0A 1TJPA 3O6CA 1XD1A 3CUIA 3DHUA 3GAKA 2V2DA 1YXDA 3LX9A 1XSKA 2J9XA 1Z32X 4Q8TA 4UFMA 1OM0A 2W63A 2NUYA 4EPDC 5I7GA 3U3HA 4FF7A 2IKGA 1QBAA 4S1FA 3S9YA 2I9UA 3WG6A 3PAJA 1K8XA 3QLLA 1V6UA 4KWSA 1Y5VA 3QV9A 3MI6A 4NG3A 4ZTYA 1QNSA 1XF0A 3H2OA 2YA1A 3N25A 4F2UA 3DYOA 4JEJA 4L1GA 2Y7EA 1KRBC 4GIAA 2X7VA 2E68A 3ZFHA 3QQ0A 2PUZA 4IGNA 4S2BA 5TQLA 3HOJA 2IPGA 1CBGA 2BOGX 2Y62A 3OP2A 2BS9A 2ISSA 3W1TA 3MHGA 3KL3A 3I7RA 3QR0A 4KCWA 5HXMA 4C6CA 2VKZG 4Q4PA 2MANA 1ZSXA 1F73A 3B04A 1AQHA 2EPLX 5H8MA 5FKYA 3TOPA 3DI1A 3OZYA 4PE8A 3LCXA 3AJ7A 5LKYA 1BVZA 2DUZA 2QUUA 2W91A 4JTKA 3LLXA 4KEMA 2H9AB 4CKQA 3LOTA 1PO9A 1DJXA 3LXCA 4HTBA 4KBXA 3PK7A 4LUTB 3KTSA 2VEPA 2WANA 3SDOA 3Q2DA 4LBRA 1R87A 2I17A 1A3XA 3LDVA 1W5MA 3UZWA 2PTXA 1IEVA 1DWJM 3VOCA 3LBOA 5J8LA 2CYGA 3NM3A 4IQLA 3THUA 2NSOA 1DE5A 2GGJA 2Y6ZA 2C91A 3IVSA 3TW7A 1X1NA 3UJSA 3TP4A 2NV9A 4UR8A 3LYEA 1UYQA 3RK8A 4J1OA 1K9EA 4RDZA 1R3TA 1CXHA 1GVEA 1C9DA 4MY9A 4JPGA 3GXFA 1EJWC 1FWGC 1E4NA 3GIPA 1PIFA 3PB2A 2UBPC 4GFIA 3BQ6A 3C86A 5A1AA 1G1YA 1PV8A 3AU2A 2GGGA 1TV2A 2WZMA 4KRZA 1WB0A 4R85A 3R4IA 4WOZA 4F79A 2GDVA 3U2OA 2ZUNA 5CZ0A 5E9AA 1HGWA 3GDRA 1UQYA 1R3YA 2VTFA 4NSBA 4X63A 2GJPA 5D32A 3F2DA 2OSYA 3ZSTA 3VDAA 1B3YA 3GTIA 3FJLA 1QFEA 2VCAA 4XZWA 3VGHA 5K4ZA 1OK6A 4W9TA 1P0NA 4JTHA 3AMGA 1NDZA 5MKGB 2P8BA 3BSHA 3EB2A 5CAKA 4IJRA 1DJHA 4RE4A 3T40A 4F2BA 1NF0A 1VLIA 3P82A 2P0OA 2J8TA 3F5LA 2ZWZA 3EGJA 3FJNA 3F7JA 4X2PA 1XUUA 4C90A 1RD5A 4AZIA 4YJ5A 3M0JA 4PUUA 3OG3A 1FBAA 1OINA 5D2VA 3VZZA 1OD0A 4QTGA 1XX1A 1TPFA 3DBNA 1MO0A 2YDSA 2Z6JA 1ZBVA 4MADA 3Q4DA 4O53A 2TSYA 3BUVA 3QGKC 3VIKA 3CTTA 1AL8A 4PMQA 3TQPA 1DIOA 4INFA 4ZB0A 1K70A 1GKPA 1IGWA 1E0XA 1WE5A 2PTZA 3U7BA 1O1ZA 2Y7FA 1MEWA 2E09A 5M3WA 3DI0A 3L7RA 1C91A 1GVYA 4KRTA 2V0TA 4KWVA 3ZVIA 4XKYA 3B9NA 3R12A 1ZU8A 1OCNA 4IPIA 4J5NA 3ZMRA 2A3EA 4GKTA 1QPRA 3IAQA 4DI9A 4HYWA 4GE8A 1GTEA 3T0BA 4JQ1A 1R3WA 4NNAA 2O4MA 1ZJAA 2Q02A 4HBKA 3PF3A 4GIRA 1JIBA 1K8CA 3N6QA 3H4XA 2NQ5A 3CO4A 4IISA 2EEXA 4XG1A 2PWEA 2INFA 4GJ1A 3I3EA 1B4KA 3PP7A 3WMSA 2VGIA 1PYFA 1Q6GA 2Z26A 2PTWA 1HJUA 1M3UA 3RRAA 3VKBA 4CQCA 1R85A 3ES8A 2YCLA 4A2SA 1OCBA 3BW4A 1ZY9A 4YWIA 2Y7GA 5F4XA 4PEKA 4KERA 4LBSA 3SFWA 4FA3A 1QJWA 1GG0A 2VGGA 2G8ZA 3HURA 1GYNA 2GJRA 4Q3MA 4IHCA 1OFBA 4LUSB 5D04C 3E0LA 1UP3A 3T4CA 3N9RA 4GJJA 1V93A 3E9AA 4S3AA 1LBMA 1JF6A 3NZGA 5CG7A 4ZOCA 1QI5A 4G7FA 5G5IA 4G1NA 4XZ9A 1A4MA 3WQEA 1GPFA 2YW3A 1W9DM 4PR4A 1VEOA 3N2MA 2YSWA 3TR2A 5A6MA 2ZE3A 2RKXA 1I4NA 4Y96A 4PMJA 4WQ6A 1S3HA 3LHVA 1X6NA 4HK7A 3RG6A 3MI3A 4HA4A 4Q33A 5CPLA 4QE4A 1C92A 4JZ5A 4O1AA 3H2EA 1BYCA 3B4YA 4BHYA 3E2VA 1KRAC 3WLIA 4FNUA 5JIPA 1QI4A 2ANUA 4IGMA 1PE1A 3V5OA 4YXGA 1I2OA 4PSPA 4ZMGA 1V7YA 2HS6A 1UPPA 1UJQA 1BWKA 2E9MA 2TODA 1RBOB 1RPKA 1VPYA 3FDGA 1W17A 3W27A 4E8CA 4OOUA 2IKHA 3M47A 2ZXQA 1FH9A 1PZ0A 3TIMA 3DC0A 1H09A 1J8VA 2HS8A 4GYPC 2RFGA 4PUMA 2D3NA 2C14A 3LNMA 1AW2A 1XIHA 4QJ1A 3ZM8A 4HJFA 4NF7A 1XLJA 2TPSA 1PL9A 3EWYA 1RQHA 3SUSA 3OVPA 3EKGA 3IK2A 2BXZA 2YYUA 3WBAA 3UG5A 4CGTA 4BEUA 1P6WA 2F7FA 3GVQA 4ZGYA 4NU7A 4PSRA 4W7WA 5A8OA 1HTIA 3KCLA 2WQDA 4I6VA 1XKYA 4MJMA 3TQ0A 2E6YA 2VD9A 4HPGA 2H9AA 3KBNA 1JI2A 1UD3A 4H6KA 3ANVA 3E38A 3GM8A 4IMGA 2OQHA 3WLNA 3LSBA 4XD6A 1CB2A 3LHWA 4IFOA 1ME8A 4LUTA 3MYOA 4MDPA 4MB3A 1EBGA 4S3KA 3MUXA 3PTKA 1Z42A 3COTA 3O0FA 5DEZA 1B30A 4Z08A 4NX0A 3FV9A 4IPJA 3URNA 1Q6EA 4PMXA 1AJZA 3ICJA 1J6PA 4UXDA 1UBPC 2PP0A 1GQLA 4AAJA 1ZP3A 3UWZA 2PCQA 3M0HA 3CS2A 1K7FA 2ZZ5A 2PPGA 1KC7A 4GINA 4CNSA 3S5SA 1VCGA 5C9WA 4MF4A 4JIEA 1GOKA 4D6FA 1XSIA 3LPGA 1O5RA 1I9CB 5EBUA 4DYKA 4UQBA 2J79A 3HGRA 3ZWSA 3UT0A 1JPDX 3FXYA 3H2FA 2Z2BA 1HIZA 5FEPA 3JVAA 5FL0A 5DCBA 4UIOA 3MJMA 4B3ZA 3E6EA 4IXHA 4W8AA 1A3HA 4ZENA 4PODA 3WMLA 3MYPA 4ZQCA 4KCTA 3GW0A 1W8SA 2J7BA 1XQLA 2DQWA 3T09A 4GY7A 3U9IA 4UQDA 4DUOA 2HNEA 1CIUA 1ZBKA 3A9IA 4C65A 1OGSA 3GBEA 3BICA 1H4PA 3GXIA 3EDKA 2W92A 5DBUA 2Z27A 3O07A 1J0IA 1TPEA 1B5TA 1ZFJA 4A8IA 3A5VA 3CV6A 3R0KA 5MKGA 4KKXA 4Z2IA 5DY2A 2ZOXA 4WJXA 1TCDA 4WKAA 1BXBA 4O50A 3QHOA 5EMKA 1LOQA 1ZP4A 5H1WA 1J4EA 3ID7A 4J2PA 3VD4A 1O6IA 2X0SA 4M6QA 5KEZA 3F4VA 2OVLA 2BGSA 5DT5A 5LIYX 4M0XA 3QPYA 4BQ3A 5AZ0A 3FYPA 1W3NA 2VZUA 4MB1A 1AH3A 5DRCA 1E1CB 3W1MA 3TNBA 4RZ5A 1FFRA 1JDDA 5KZDA 3GHRA 4LPCA 4HB7A 6REQB 1PIIA 3N4AA 4J35A 3N6HA 3WLSA 5C2CA 3GVVA 1TZ7A 4TVUA 4B2DD 2XSAA 3GLCA 3VC6A 2UV8G 3GUGA 1UD8A 4O1BA 4PCPA 1H1NA 2GL5A 3WNPA 1BLIA 2WMKA 3B9OA 3N34A 2O7SA 4ZTXA 1G4PA 1U5JA 3SCVA 3SQLA 2CZFA 3MMDA 3EKZA 5I5RA 2WM0A 1FWNA 3WNNA 3THCA 1V3HA 4IP5A 1TPDA 2PTDA 1OFRA 1BQCA 2V9DA 4NNBA 4JN6A 2WJZA 4MGGA 4FEZA 1LZOA 7PTDA 4B3KA 4B9YA 5A2AA 1YBQB 3KRZA 5FAGA 3V1HA 1MYRA 3UR5A 1ZGDA 3AHYA 1GJWA 4TX6A 1VLWA 4GH1A 3FAWA 3UWWA 3VK5A 3G8EA 4H01A 4H9TA 3QV8A 5HWMA 2Z1SA 4UZSA 4IMDA 3HM7A 3VYLA 1YKWA 3IARA 4JX6A 3NFUA 1UROA 2POTA 1GQJA 5AHLA 5HJXA 4HOWA 3FSTA 3EYPA 3S1WA 4UQAA 1ITQA 2PLKA 3NUKA 1IEIA 4LC8A 3O1NA 4MB5A 2OX4A 4Q7NA 4GZ7A 3VCNA 3UXKA 1E6PA 4Y9MA 5XIAA 3M43A 1QNRA 4Q8NA 4K8GA 4HTYA 1TWZA 3L65A 2CXGA 3ARYA 3CYVA 4EKJA 4LUSA 4RKAA 3EX1A 3EOSA 4XVDA 3UYCA 3BCDA 3MP4A 3GTHA 4CNTA 2PDHA 1R9ZA 4LAOA 3NA8A 1FWTA 4C6BA 3PZVA 2A85A 2A6NA 1US2A 2BSLA 4FOJA 4JICA 4C6LA 3SQMA 4GG9A 5KZ6A 1QR7A 3BOFA 1CXIA 3AZTA 3WF3A 3OOQA 1R0MA 3P3BA 3RYSA 3BGJA 3BLEA 1M9HA 2A7RA 1LG1A 2C1HA 3TYUA 1W8GA 1VB9A 4GO9A 1BRLB 3QGVA 4ZOBA 2XN0A 2OX1A 3T9PA 3RGTA 4XZHA 4PUEA 5K7JA 1Q85A 1XD0A 3A3WA 1KTNA 1NDYA 3NCOA 1ITUA 2XFRA 5A6AA 5BZAA 2EPMX 3VMNA 3R79A 1PZ1A 5AN7A 5FAJA 1EXPA 3CZKA 1YMYA 2CBUA 3TN6A 3AYVA 2CU0A 1ISXA 3UY7A 1DBTA 3BAYA 1TPB1 5JUVA 2WWCA 4LRTA 1ZPTA 5I3FA 3NG3A 1VHCA 1CXLA 2VVSA 3TZFA 4ZZ9A 4KWOA 3QY7A 3V5CA 4IL0A 3PTQA 3VDCA 5FOOA 2QDHA 4R7OA 4XTDA 4Z1CA 3S2JA 2E6FA 3DHFA 4HZ7A 4XV0A 4XK2A 3V5FA 2D73A 2J7GA 1OD8A 1VEPA 3VGDA 2Y4SA 4PL1A 4WX2A 3WFLA 4OUIA 4C6MA 3BSGA 1FRBA 3W1AA 1XG3A 3LLDA 2C0HA 2P88A 2BX7A 3PSWA 1LLZA 4QE5A 5CGMA 4L61A 4WCJA 5U7SA 1XC4A 3WIJA 4MJ2A 3KP1A 3BLKA 4DJFD 5EMYA 3W7GA 2Q6ZA 4Y9AA 5LNVA 3TTSA 4FAMA 3WLKX 5M17A 4AX6A 3I10A 3WDHA 1IIHA 5HNTA 3ABZA 2W3ZA 1GVIA 1UD5A 1OX4B 3V0UA 5AC8A 2WBGA 1PWMA 3AIQA 4W86A 4AIBA 3FLUA 4WKFA 1R2TA 5C6MA 4PFMA 5FJPA 4Q4SA 5I07A 5BYWA 2XM2A 1MMFA 3W25A 4IX2A 3PNUA 1B3OA 1XCFA 3PZ9A 1Y5XA 3AIEA 1FUYA 1ZBWA 3B05A 2CZ5A 1VFFA 4LC6A 2D3LA 1E71M 3NO3A 1FCUA 2AKMA 4IQJA 4C1NB 2ZRZA 4BS0A 3LEPA 3AFBA 3WQ6A 2QEZA 2GVYA 1R38A 1D8WA 3T4WA 3HPXA 3A47A 4JIHA 2VI0A 3W7LA 1NEYA 3NQBA 3I68A 1V6YA 4GGHA 5CZTA 1LT7A 4IUGA 2XGZA 4J40A 3RPDA 1XFBA 1KWKA 3B8WA 2YCIX 1K9FA 2YB1A 3RLHA 3WQDA 4Z0JA 4B4FA 3RILA 3C61A 1FCVA 1TELA 1IYXA 5IOBA 4PUDA 3AIUA 3PJTA 3WF4A 3VD9A 1O5QA 3EA2A 1V3KA 2VRKA 2QJIA 3QOMA 4I7WA 5HA7A 1W1PA 2Q3RA 2IXVA 4MZ8A 4CLMA 1XRTA 2FH6A 5CAHA 1AD1A 4GI8A 3LS9A 3JRKA 3L0KA 5G4HC 4DBWA 4HOXA 4XVEA 3WH8A 2E9LA 3KVLA 2ZE0A 4XWUA 1OC6A 4BKNA 1AW1A 3W82A 2F2HA 1RSCA 3ITTA 3LD5A 4FMVA 4LAZA 4QCFA 1E1CA 1KNWA 4WY0F 2BP1A 3S4TA 1E5NA 1T40A 4H83A 3P5YA 1VGAA 4XD4A 6REQA 1NFBA 1GQNA 2UY5A 2ZUUA 4NZFA 3OA3A 1JRCA 4I5UA 5HOSA 1CI1A 1X38A 1BWLA 4MSSA 1PUDA 1OFQA 4M80A 2VX6A 5IDZA 4L6OA 4DWDA 2HPMA 2DZUA 2E8ZA 2RGMA 3RPMA 3AHXA 4OHQA 1F07A 3M44A 3B8DA 2VRQA 2CEQA 2W27A 5CSSA 1UPMB 4FZIA 4AIUA 4MFEA 2PB1A 4DF2A 1YBQA 3WD2A 2HXUA 3IANA 4OKDA 3NQDA 3SGGA 1E1FA 2PCEA 2PE4A 1XJBA 5IXEA 1FKXA 4ZQOA 1VZWA 1WXJA 1Q6RA 4X9YA 4FXFA 4J7RA 1XLHA 4JL1A 1HT6A 3ITGA 5E0CA 3VZXA 1T7LA 1W5OA 4BF7A 1IHIA 4CEXC 3CZGA 3C2EA 4UCGA 1I6NA 1ONWA 1VC4A 3HPZA 4ZE5A 4MYXA 1SYTA 4GC4A 4LV4A 3CWOX 3P0WA 1HFBA 4IIHA 1H5YA 2ACQA 4HZ8A 2PD5A 4J27A 1OT1A 2G3MA 1OFEA 1IE7C 3IAPA 1QUMA 1X6UA 1UWAA 2ACSA 4AXKA 3KOXA 3EKLA 4F0LA 4A8RA 3RDKA 3TJLA 1KGXA 1AVAA 2QR6A 3ARQA 3UG4A 3VX1A 2IXUA 4XO6A 4NZ5A 4RCXA 1NWTA 4GNKB 4ZCWA 4RZ4A 1KM6A 3B0VC 3OZPA 3VKDA 3CUHA 3EPNA 5D05A 3STPA 1IXNA 3LTYA 1LQ0A 2Z7KA 3W37A 2UWFA 2J9YA 3GNRA 2PWGA 4H9VA 4PULA 3UXLA 4O14A 1E6XM 1P7TA 4WSHA 1BRLA 2PDGA 3MCOA 3TA9A 6ALDA 3WZ0E 4NI3A 3XINA 3U6WA 1A5MC 2Y5JA 2C7FA 5HK4A 4UTMA 2W61A 4J3TA 5T9CE 1EA9C 2DDXA 5C7HA 3M0LA 1PWLA 4MM1A 3EDFA 2RDXA 2GGEA 2WSKA 5A8GA 2FZNA 4F8XA 4YCPA 1FKWA 3WH5A 2WO5A 1E6SM 1J9YA 4G56A 4K2SA 2OO0A 1M7XA 1YADA 2VWTA 3O3RA 5G2HA 4B9ZA 5LA2A 3VCRA 2BHYA 5FESA 4AMCA 3C8FA 4PBEA 4QEEA 2WCAA 4QISA 2VUYA 1WOAA 4YHEA 4UQEA 1VFSA 2JKEA 3PPHA 3AAMA 1VKFA 3GR7A 4NVTA 2WKLA 3QR1A 4QE1A 4GNVA 5CQ1A 3PULA 4CD7A 4ZO8A 3PB0A 1BXCA 2ZTKA 2PFHA 3VKAA 4O8RA 3W85A 3FCPA 1Q6FA 3S1GA 2C79A 1S38A 2X8RA 4ZOAA 5DBTA 3OYZA 4O0KA 5EMMA 4C6NA 3RFAA 3ZLHA 1FWAC 1QI3A 1Q63A 1JZ6A 2NQJA 1DKWA 3W73A 3QFEA 3DGBA 4B5XA 5DX7A 4H9UA 4JTAA 6XIAA 1Q6CA 1HKKA 1OX4A 1TR9A 1OB0A 5F2MA 3FEMA 1QHZA 3BG3A 1GYMA 3LCFA 4ILSA 1LYXA 4JXCA 2RJHA 1V3MA 2CLFA 2PURA 1WKYA 2YXGA 1VCFA 3AS2A 1KM0A 1EGVA 2XU2A 5AHMA 5I6SA 3WLJA 3TLQA 3W1RA 4U28A 4K8HA 2BVYA 4KW2A 1HUVA 2ZX8A 1H63A 1EX1A 1QHPA 4AWSA 2CC0A 2XM1A 3LPFA 1UWUA 1HJXA 5H2ZA 4C1NA 1ICSA 1AZ1A 2CLIA 3CEUA 1QT1A 2XSBA 2FZ8A 3YPIA 2GLKA 2Y5SA 1T41A 1KV5A 1A5AA 3G0XA 2ONEA 4OV4A 3CWHA 4UNLA 1AK5A 3S3GA 1G01A 1JPIA 2DT1A 1UZ4A 2PA6A 2Y2WA 2PGRA 4UWMA 3E96A 1FP9A 2WLYA 2PP3A 1E0VA 4MUZA 2QJJA 3Q58A 3KOYA 5T9BG 3FKRA 3PY2A 3UY8A 3ZLFA 2QLYA 1QTWA 4R9OA 1TV3A 2I1OA 1VRDA 5HQEA 4H6EA 3G8RA 1Q2SA 2CHOA 4GFSA 4H8VA 3L4VA 2BWGA 1TJRA 3OBKA 1U5VA 4NYUA 4MY1A 1WKFA 3UJRA 2VDIA 2DT3A 2TRSA 4U2YA 2FHCA 5HAOA 1ELSA 3W4RA 4QJ4B 2VL4A 4DJDD 4K1GA 5AB3A 4KCUA 3BMWA 1NELA 1BVNP 3AOFA 3UBPC 1W3TA 1Q6OA 2NX1A 1TWWA 1R9YA 3QTGA 2PMQA 1GONA 4PTVA 3GR4A 2KZHA 4GUFA 2A1YA 3GG7A 3AMKA 1BSLA 1E6QM 1UG6A 2BHUA 3WK1A 3CB3A 2I14A 1OBAA 4HD5A 3TNOA 4WK9A 1W6TA 4RNHA 3PBWA 1LLOA 3WLRA 3GH5A 1QPOA 1M5WA 5CPMA 1M03A 1W1YA 4RPPA 4AD1A 3CMJA 1NP2A 3MBDA 4AIEA 2ZKMX 4AF0B 3HQNA 5DMNA 3NVTA 4LS1A 1XKJA 2BVWA 2ISVA 4IMFA 2QCGA 4HU8A 2D2JA 1WDPA 1LM1A 3NM1A 3CZ8A 5JBEA 4HNNA 3BAXA 3SRHA 1M1BA 3TMLA 2ODOA 3MMWA 4EACA 4L1XA 3U5YA 2VHLA 3PSVA 2HXTA 1O12A 1E72M 4E3VA 2MNRA 3ZSSA 3L2MA 3WDQA 4G2DA 4JYFA 1B3VA 1CGYA 5F7UA 1RPXA 1JZ5A 3AROA 1VP5A 1W9VA 3SCRA 2WKGA 5AHEA 3EMCA 4KCVA 3P7YA 2NX3A 4IF2A 4E4UA 3RO6A 1RALA 3T05A 2YZ5A 2EPKX 2ZUMA 2CHNA 1GT8A 2FZMA 2EF9A 3KBJA 4RV3A 3Q94A 2X1RA 1E9YB 1K3UA 5FJJA 2E5BA 1KLZA 5DCEA 1ALDA 1UQZA 2V5CA 1XYBA 2DZPA 2VC7A 3RLGA 3LRLA 4N9EA 1LWJA 3KDNA 3C3UA 4NZ3A 3AIWA 2NXGA 4A6GA 2B7OA 2EJAA 5CLTA 3P81A 1S46A 5BW6A 1A5LC 4PTXA 4JAWA 3RCYA 1D9EA 2XINA 3GNXA 5I78A 3LM7A 3F03K 3IRDA 2ZC8A 1KFLA 2AQWA 3G24A 1J79A 5FJOA 5A69A 4AHPA 3EDJA 3MZ2A 2O7QA 3UFYA 4DBUA 1J10A 2OB3A 4PZVA 1E55A 2WB5A 3H2AA 3QPZA 2V68A 1A5CA 1W31A 3PVFA 4GX8A 4A3QA 4K39A 3KZSA 3MMTA 1DV7A 3BLPX 4PBGA 4M51A 3KBSA 1NFPA 2GK1B 4Z17A 4P61A 3QYSA 3NL2A 4B91A 4DBEA 4EIVA 3K8MA 2A79A 2X41A 1DJNA 1CGUA 1DJQA 2DIKA 1CLXA 1UC4A 1VJIA 2QGYA 2WZIA 3OEXA 3VDGA 1DXIA 2XHYA 3OU8A 1TQJA 5C54A 4L9XA 1WDWA 2EJ1A 4LB3A 2D2GA 2HSAA 3GC5A 4Y90A 4L7ZA 4O4VA 3ERPA 3WN6A 1M65A 1BYBA 3W83A 2VXNA 3R6IA 4OUEA 1BYDA 3WBXA 4C6EA 1V08A 2J7CA 1A49A 3WDPP 2C19A 3BLLA 4AYGA 4B90A 4LUYA 4JTSA 1KA9F 2ABBA 1ME9A 2HPIA 1PKNA 3GHSA 2ZZ2A 3P67A 4LWWA 3VOJA 2ZWYA 2Y0FA 1POKA 4QDMA 3BCJA 1QCWA 3ARSA 3WBEA 3RCNA 1YDNA 1A3WA 1A80A 3EPOA 2GPTA 4D6DA 3LRMA 4DN1A 3VNJA 3W88A 1ONEA 5IRPA 2OO6A 4HU0A 1G5AA 2RDUA 2A5HA 1V03A 5E5CA 3SUTA 3LMZA 1W56A 3KVJA 4B2DA 1H7RA 1W0MA 2PP1A 1U83A 2WVSA 4Y7EA 2QQ6A 2HCVA 2E67A 1VFOA 4C1LA 1WDSA 4JBRA 4RDVA 3N14A 4MUPA 1G67A 2WZHA 3W2UA 3B0UX 3WEMA 4AEFA 4H00A 1QHOA 4JTQA 2PRMA 2QCEA 2QIWA 4LT9A 1E43A 1V51A 1UZDA 2PC4A 3HIJA 3KHDA 4D8ZA 1BYAA 4AWEA 2HVNA 1OYAA 4W84A 1UH4A 5EYWA 4A4AA 3QSRA 1P0DA 4CCZA 4WY0B 3TH6A 2Y5EA 3RJXA 2ZRWA 4UMBA 4JD4A 4QG6A 1MUMA 4Q8VA 2FB2A 3LENA 4CD5A 3LBCA 3GHUA 2NT0A 1H5VA 2D20A 3NOEA 1B0IA 2DGAA 2G4JA 4E2VA 3LPOA 2VDHA 4PMUA 1HVQA 4I8YA 3PS7A 2RH9A 1KM5A 1FWCC 3DXIA 4FALA 4QQUA 2SFPA 3BGAA 2CLOA 2FJUB 5AYZA 4ENLA 3B97A 3K8LA 5HUPA 3G6MA 3GDTA 1EEXA 2W67A 1Z89A 1DWGM 1GEHA 4RNIA 3ABRA 4H4IA 1I1WA 1OZQA 8XIAA 1QPKA 4JTFA 4ZQNA 5AVNA 4WXZA 3QBUA 5CKSA 1EJ7L 3NAVA 3VU2A 3K5XA 3DZ1A 3IIXA 1R46A 1S1RA 3OYXA 3EX3A 3HB9A 3LCWA 1XIDA 4P5UA 3W6YA 4ZEPA 3N2OA 4GY1A 5K9XA 3EXSA 4OT7A 5M5DA 4U5IA 2ZA1A 4D6EA 3L2LA 1RJRA 4UZUA 3MI2A 1YX1A 4JIIX 5I03A 2XZ7A 6PTDA 2AL2B 2BFGA 3HA1A 1XYCA 1F6KA 2F6UA 2GSJA 4H9MA 3KE0A 1EPXA 2QPUA 5GQBA 1F8IA 3ZT5A 2BHZA 5LZLA 4N02A 5AVHA 5FIPA 4DF1A 2YBTA 3VKCA 3LHTA 1W3LA 2VVNA 4H1ZA 2P5NA 4R33A 1KCZA 2GUYA 4DJED 3KBVA 1GZ1A 3BGGA 4PRTA 3LLFA 3VGBA 3GU1A 4RXFA 4DPQA 1PX3A 3AJXA 2PDCA 2Z1XA 2VD8A 1FWJC 3KVMA 1K9DA 5EU9A 5FSEC 2YIHA 4JIRA 3PUDA 1E5JA 3AYSA 5AYBA 1U33A 5E0KA 1CYGA 3TAOA 1TV4A 1JCJA 4Y2WA 3S42A 4V15A 2O9RA 2ZZ1A 1BQGA 4M3PA 5H8PA 3VVGA 1WZLA 2IKJA 1TPWA 2X7WA 1SFSA 4XUYA 2D0HA 1MFVA 4QLLA 2OR2A 1GHRA 1OX5A 1M53A 5I3JA 1EGZA 1XDLA 2D69A 4G9PA 1Z44A 3WL0A 3SCTA 1XYFA 2HBXA 1EF2A 2QGHA 1LL4A 3EWCA 1Q8JA 3BDKA 1TMLA 3AXIA 2QF8A 3ZLGA 2CZVA 1G7VA 4LVGA 5KTLA 5ABTA 1JGMA 4QR6A 1JDCA 3EXRA 3P80A 1KV8A 3DCPA 3GSMA 1SR0A 4LNYA 4O0QA 3WNLA 4BF5A 3IK4A 3OG2A 1EWEA 5BRPA 3BARA 2DP3A 1HGYA 4GBUA 3UZZA 3LV5A 3ARVA 5JIWA 2VWSA 3IV3A 3VIHA 3ONCA 2W6RA 4US6A 3VABA 1UJPA 1R47A 5LGZA 3VNMA 3BOXA 3DFTA 2YDAA 3MC5A 4WGXA 3MKVA 3ZVHB 3B0XA 5AY7A 1IIGA 3FFSA 2ACRA 2XFYA 5T8GA 1FHDA 3W26A 2GK1A 4E38A 3APGA 1DIDA 1GNXA 3MWCA 3L2IA 2DH2A 1EYEA 4GXWA 4TX9A 3CQ0A 2XWDA 3WLOA 3W2LA 3M7SA 4XD5A 1MW3A 4UTUA 3GRIA 3S5NA 5CSUA 4MHBA 3UZXA 3CUXA 4RE0A 3ITOA 4PYSA 3G6LA 3CIVA 1TTJA 1OHLA 4UR9A 3VIOA 1K8ZA 2TMDA 4ATDA 1XM3A 2ISWA 3ZZ1A 3NXLA 4Y9OA 1SO4A 1GZGA 3NL5A 2E6AA 4XSLA 1RV8A 4ROQA 3PC0A 1UBSA 1JYNA 3MHUA 2XIBA 4MMWA 4H3DA 1R5YA 3NGJA 4GCXA 4ADTA 3WDRA 2AQVA 3U7VA 1B9ZA 5D2WA 3E0WA 1HX0A 1RLCL 4KWWA 1OADA 3URQA 2VEMA 1MDLA 3I7QA 1OABA 5K9CA 1WNOA 3M64A 2HE8A 3LG3A 4HPHA 1A5UA 1G4TA 2GQAA 1R86A 1YTKA 1U30A 4QRNA 3F2CA 1P6CA 2FVMA 5LA1A 2C15A 3SRDA 1K6WA 4JTTA 3EWBX 1D3CA 5G2IA 4NZ1A 3DKJA 5EA9A 3HV8A 2ZDSA 1T0OA 4PCNA 1K77A 4QITA 1WA3A 2XH2A 5FACA 4OTKA 1NDVA 1CGVA 4WD0A 1WOBA 2CLMA 2WSYA 3DESA 3HG4A 3WJWA 3C2VA 3WLMA 3QY8A 1V77A 4IZGA 1KKRA 3C2YA 2X40A 3USZA 4CVUA 3R25A 4Q6XA 4HOZA 3P5ZA 2JEQA 3O05A 2X42A 4OVXA 1O68A 1SM9A 3MA8A 1CXKA 3M16A 3RX3A 3HGSA 3OO2A 4JIPA 1QOXA 4HMNA 3G0SA 1DWAM 2P76A 4B3LA 4WY0A 2O92A 4J3WA 3PZTA 3IVTA 3BVJA 3PJXA 5F2LA 4ASTA 1GG1A 1FWDC 1TE1A 4FXSA 2EAWA 4S3EA 3TYBA 2QUTA 5HJYA 3W76A 4PB4A 2HZGA 1Q7ZA 1OVDA 3HGJA 1PTDA 4HHHA 4D2JA 2XFFA 5D02A 1IF2A 5JBFA 1ISVA 1S5MA 3B06A 2I9EA 1FQ0A 1GVQA 2WJDA 1QNVA 1B9BA 4I9JA 1H49A 1N82A 2EPOA 3RRXA 4R88A 5IBXC 3WQGA 2ZX9A 4XZBA 1DORA 2DEPA 1V02E 3BL3A 2VNCA 3PBGA 3B8SA 4F48A 5I23A 1W1B1 4S38A 1XIJA 5FEZA 2XVKA 5M2FX 2Y8VA 3NEVA 3VNKA 2QKFA 3ABOA 4C6QA 4EK7A 1VS1A 1OX6A 1MW0A 3KRUA 1OG0A 4H9ZA 2Y24A 4H19A 1TV5A 3N15A 5T26A 3TJXA 1C3FA 1FWFC 1F3XA 3NYDA 1KW1A 3C2FA 1Z9AA 3UXAA 1BXNA 4QP0A 3NQAA 2AL2A 3VNYA 3THAA 1TJ2A 3LQLA 5CG0A 4S3GA 1PYMA 4B5SA 4GUGA 1C90A 3B0YA 3CGTA 4WSKA 4AUBA 5M03A 2FJKA 3RMEA 3RX4A 2PGFA 1KCKA 4R5EA 4J4KA 3W6MA 2H90A 1O7AA 4W93A 1XBXA 5FF3A 5J5RA 1E0WA 1WKDA 2ZXAA 1XH2A 2CITA 1J93A 3HO8A 5HNRA 2Q8ZA 1XPGA 2J78A 3PZOA 4MWAB 3P62A 1ZJBA 4QS5A 1UKTA 5FF4A 3QZAA 1C7SA 1MVYA 2V6AA 4XZIA 2YB4A 3PUEA 3WQ5A 3K4WA 2VEFA 5DCDA 3MSDA 2PDYA 4PBFA 1H0GA 1NQKA 3H2MA 1KKOA 2PF8A 2EXOA 1XLEA 2BTMA 3HFYA 2R9RA 4R34A 1NF7A 3BQ5A 4GZEA 4J2MA 2R1PA 3MP3A 1CLVA 4B92A 3VKKA 5JBDA 4Y8FA 3CM4A 2Z24A 4MKVA 1I2RA 2OFJA 1F3WA 5CSYA 3DYPA 5D30A 3IWPA 1U1JA 4MOZA 4IIGA 1TYGA 2YX0A 2ZADA 4YYFA 1YIXA 1KFCA 2C18A 2O0TA 1W5QA 4GQBA 3KBWA 3CMFA 3QC3A 1ZB5A 3DG7A 3MS8A 5C8BB 3CZJA 1K9TA 5HPOA 1QPNA 4ZO9A 3B9DA 4V1YA 5FEWA 4QHRA 3T7VA 4OU1A 2J7DA 3AHZA 4WDWA 1DQXA 2BY1A 5I06A 3ZXWA 4U31A 4AZ6A 3VD5A 4GUHA 3S2LA 3BMXA 4W85A 4AVNA 1DIKA 3ZVHA 3RO8A 3CV7A 2DV0A 4S3BA 5JH2A 5IHRA 2ATSA 3AIVA 3IGUA 1GKRA 3VNZA 1QW8A 1UR1A 1JVNA 1XISA 2PZNA 1KB3A 3VA8A 4K37A 4GX9A 2IQDA 4XISA 2TAAA 2WJEA 5F1UA 4OZOA 4LY8A 3V36A 1CX9A 4FLSA 4KEZA 3W38A 2BVDA 2JK2A 4MKSA 1P43A 3ABSA 1G7UA 3UW6A 1GOOA 3KOZA 4Q4QA 4HSHA 3QV7A 5AYIA 3EEGA 1FP8A 5DO8A 3NQEA 1EJTC 1F3EA 2VFFA 3W7HA 1MFUA 1SZNA 2WCGA 2FGBA 1JPHA 2WHJA 5DANA 1RR2A 4GXMA 3NQ2A 5H8UA 3CPUA 3U2ZA 4OBRA 5I2UA 1MNZA 1U1HA 2J47A 2V3GA 3L4UA 1Q8AA 4Q22A 3EOLA 4N6EA 3DDMA 3PZIA 3ZYZA 1OG6A 2ADAA 3KXQA 2ZVRA 1VQTA 5F2GA 2CFFA 1S2WA 1MZRA 4UFKA 4PEEA 4QXIA 3W29A 3EX2A 4E2BA 3KX6A 4ZFMA 2QAFA 4DJDA 4Z2LA 3GWQA 3LSCA 1FWIC 1HP4A 1A5NC 4H6QA 4RNFA 1Y5WA 2VELA 4K8EA 1DOSA 1SR9A 3AS1A 1MSSA 4UTIA 4LS2A 1J0YA 1G0CA 2BOFX 2Y63A 2WMGA 2WCSA 4F0RA 2Q09A 1EJXC 2DSUA 4HA1A 3P6LA 4YWSA 4IJBA 1MEIA 3VOGA 2VQUA 4A3YA 2HWGA 5CCZA 4U3AA 4HPXA 3H2NA 3WF2A 1WYIA 3EA3A 5C71A 3QPEA 4WZHA 1DTUA 2FDSA 2ZFAA 2RJGA 1EIXA 3M0KA 5HWNA 4AVFA 1KQZA 2GGIA 3KHJA 4LUIA 1KD0A 1JF5A 3CU2A 2QZRA 3CQIA 3IIPA 4IICA 2BZNA 3CYJA 4MY8A 5U4NA 2CLPA 4ACYA 2HTMA 2IKIA 5KZMA 1HL2A 1JXJA 4UQCA 2QCLA 3R2GA 3U57A 1O5KA 4ERAA 1YNYA 3WMCA 1G9HA 3CNYA 5E70A 3W01A 2QS8A 2R1KA 3GTFA 2V2CA 3SUUA 4AD4A 2D2HA 2W0UA 3KTXA 3FVMA 3ANUA 5DLCA 5FCZA 1L6YA 1QRQA 1UWQA 4LB4A 4E4FA 2H6RA 1TR1A 1JZ8A 4AZHA 1YDYA 1RH9A 1H3GA 3F5KA 5DY3A 3RUBL 2JEPA 4DRSA 1DXEA 1L0PA 1IT7A 2WHKA 3JZUA 2HISA 3H6OA 3WH9A 3FNDA 1U1UA 4JQ2A 3SRFA 2EQDA 3M9YA 2HMCA 4LBUA 3GG8A 3M0ZA 4O15A 2Z28A 4PMRA 2AOSA 3TXVA 4IMAA 1QO5A 2YPIA 3R10A 1N8WA 4QQ3A 3GZ3A 4XUGA 3BOLA 2WSQA 3G3MA 3VOFA 2GQ8A 4Z0SA 1XQKA 1OCJA 1R2RA 5G1MA 4G7EB 1HXJA 2Y8UA 2C1GA 1T5AA 1TREA 1TA3B 1MXDA 2CLHA 3MCMA 3LI0A 1DXFA 4IPPA 2E3ZA 3GXMA 1I0BA 3MSRA 3IRSA 3W53A 3E2RA 3VXGA 3T8QA 1LF1A 1DJWA 1GVFA 2D22A 3DIPA 3WQOA 1UUOA 1PEZA 1RCXB 1F8MA 2CBIA 3PWAA 1QI2A 2PD9A 1ADOA 1US0A 3ZJ8A 1D7KA 5EKYA 3CHFA 3CBWA 3SCNA 3MV11 3FA5A 4KMQA 3A4WA 4MWAA 1LOLA 4O12A 3SADA 1PVNA 1Z69A 1TO3A 3N11A 3L0NA 2G3JA 2JF7A 4UC5A 1YPXA 3N9SA 1FH8A 1YNPA 2OOGA 2QCNA 1BD0A 2VGBA 4GI6A 1P0BA 1H7NA 1Q4WA 3G5EA 4ZXLA 4AD3A 4GUJA 5E09A 2DZSA 4LQ1A 4AZCB 1J5SA 3CB8A 3ZIZA 4AEOA 3ARRA 4AC7C 5D2YA 1D7FA 1IQ8A 1JD7A 4K7VA 3KWSA 1QK0A 4X2RA 1KFBA 2PDXA 3DG3A 2MUCA 2FFCA 3CMGA 4LAMA 2BGNE 2G41A 2VP8A 3ABQA 1JCTA 3WK2A 4BJHA 2XUCA 1EDGA 3FX4A 3ENLA 4Q8WA 4KGLA 3TX9A 1H7OA 3OZMA 2Q3OA 4WJEA 1ZAJA 2FTPA 3PG9A 1LQ2A 5DMLA 5CC6A 1T8QA 3IJDA 1MRAA 2WW5A 1IR2A 4UFHA 3L5AA 1UUMA 3O6AA 4JQ4A 1LRNA 3EDEA 3GNPA 2E25A 4FXJA 2CWNA 1FWHC 3BG9A 3NEHA 2VC9A 3ATZA 4DWSA 1XIBA 1TMHA 4O8AA 4PTNA 1X96A 3ZO9A 1Y0EA 2XYLA 4JCLA 4C6PA 4UBPC 1I45A 1PAMA 1HKIA 1VAHA 3O2LA 3PFMA 4JTIA 4TV5A 3J7HA 3NQVA 1X1ZA 4IM4A 2Z2UA 3WNKA 2XN2A 2INZA 2DSVA 3O8AA 3QF0A 1GCYA 4WHBA 3U4FA 3D0CA 3WUGA 3WSUA 4JFWA 1NU5A 3TZNA 2IPWA 3AXHA 3BJFA 3W02A 3H24A 4LRSA 3PUOA 2VENA 1XC6A 3GDLA 1AW5A 1CZ1A 4DY1A 4UTTA 2FPVA 5KITA 2J7FA 3TTYA 2QJMA 1HW6A 2TYSA 3BO9A 3P61A 3QV6A 2XFWA 1FWEC 2HQAA 4Q6JA 1D3GA 1C9WA 3FDKA 1RVGA 5AC4A 4B5TA 4XAYA 3VE7A 4MYAA 5CZKA 2XIQA 4GK8A 3BURA 1G4EA 3L0GA 3W71A 2DVXA 5DRIA 4ZB2A 4RX0A 2NVAA 2OU4A 4LYQA 3WK3A 1YW1A 1TWSA 7A3HA 3WQ4A 5HBFA 4QROA 1ZCOA 4DJFC 4E8DA 2VZSA 2WPGA 2BVTA 4CQAA 2WWDA 4RJEA 1DPMA 1SPQA 3T2OA 2R1LA 1Z7AA 3WEOA 4AWTA 4RLIA 3MANA 2BGQA 3R43A 5LYRA 1OFOA 3W7PA 1SSGA 3VIGA 3OIXA 4C60A 3U2EA 3F1QA 1GORA 2FVLA 4UUIA 4JTLA 3UYIA 3ALGA 4M6PA 5FJTA 4JY9A 4A21A 3EZ4A 4JQAA 2FQIA 2VZTA 2J8GA 1PPIA 4HCLA 1YDOA 1EZ2A 3LGEA 3NPWA 1XLFA 1Q6QA 2C6QA 2XPKA 4CQ8A 5F4SA 4J3UA 2OT0A 3K1GA 1KXTA 3P93A 2NVDA 1PHQA 2YL9A 2X1IA 5BXSA 5KMYA 1BAGA 3ONBA 3SW6A 4HK6A 5I02A 1K4GA 1TQXA 2UY4A 5C70A 2FZ9A 4CN1A 1FWBC 5FA5A 3I3DA 1TV7A 4YN5A 3EA1A 4DAIA 3R11A 5BRQA 2UY2A 4GZJA 3VOIA 3C2RA 4OGZA 3T42A 1DQWA 1TPVA 1A47A 3K8KA 1LWIA 4EXAA 3B8VA 2OYLA 3HQPA 1FCQA 2PDMA 1SJDA 4JFTA 4H8UA 4Q8UA 1KM2A 1SMDA 4X22A 3BMVA 3EX4A 1N7KA 3HN3A 2WZEA 1N2VA 3G1AA 4PCSA 4DJEA 1IWAA 4EVZA 2YL5A 7XIMA 2P0IA 1KGUA 1PXGA 4NXKA 2X30A 2VMFA 4S23A 3KUMA 4M1BA 4DXXA 3L67A 3OLGA 5HQLA 4NASA 2WYSA 4EF9A 3D47A 3L4WA 3UA4A 3ZS4A 1G94A 2RUSA 5D2XA 3GAYA 4AWUA 3TA6A 1E6RA 1L9WA 2FPTA 3CUZA 3FW6A 3POCA 3LERA 3T8LA 4MG4A 3NXFA 1A53A 3GY1A 5G4EA 5BXTA 4G7EA 3WJZA 2NQZA 3MPGA 4AISA 4MZYA 1GJPA 3IGHX 2QVHA 3BLDA 3H22A 1J0JA 1TA3A 5KINA 2YOCA 2WQPA 3Q45A 2QYGA 3VTRA 4HNTA 5IFPA 2PI6A 5GNYA 1EJSC 3JW7A 2VX7A 2B7QA 1PX4A 4I3GA 2YCEA 4WUIA 5DMYA 2OSWA 1XS2A 1UIPA 5F4WA 4GYKA 4TTGA 2FHBA 3REQB 1XLAA 3UQNA 1BG4A 4LFYA 3O6YX 4L9ZA 1IZJA 3UCQA 1A0CA 1OGGA 4QIUA 3AUOA 2GQ3A 4GACA 1B4EA 4XAFA 1KXQA 5TAOA 4DO7A 3GW3A 2HROA 3DAQA 1C93A 3CV1A 1JDAA 2GGHA 2DFAA 1ITXA 5A8PA 5CBIA 1PZ3A 4O57A 2CZDA 3V4BA 7REQA 3WY1A 2A2IA 4AHQA 2WC7A 3M5XA 4H8HA 4YYCA 1TX0A 4M6UA 4V33A 1I0DA 3URAA 5ABFB 3FOKA 3N2XA 3TC7A 3F5JA 4HPNA 1S5TA 3OB8A 1E1EA 4AZCA 2YZRA 3C6CA 3T0CA 1VEMA 3SCSA 1V79A 4JNZA 5CGQA 4ERIA 4LF2A 3M46A 1J0ZA 3WQ8A 2HK1A 2D1ZA 1MUWA 2WNWA 3TJIA 1I75A 1BKHA 1HQTA 2GOKA 1DP0A 4FIRA 3FYOA 1DQUA 3QTPA 3WNOA 3UJ2A 3OJGA 4GGBA 3IEBA 1RP9A 4XAZA 5LIXX 3B9AA 1E51A 2V5JA 2VEKA 3WDJA 5LNUA 2X05A 3S6OA 1XCXA 4I5RA 3BAIA 2E9BA 3P8JA 3CV2A 2CBVA 3GXNA 2WZTA 5BROA 1N55A 1UZHA 3CQJA 3WLLA 3DFPA 5LIUX 2OYMA 2CCRA 5JH1A 1V3JA 4D1JA 1LQAA 2PRLA 3NGFA 3ZR4A 2AL1A 2XDFA 4HVXA 1YHTA 3VI2A 7CGTA 1Z48A 4WJ8A 4AFYA 4KIRA 2BV9A 2C0AA 3WD3A 2QUVA 3NL6A 4UR7A 3KCOA 1UP0A 1XLMA 1ME7A 3RM8A 1YPFA 4L80A 4PTMA 3E74A 3P2VA 2ZUWA 1WUEA 1NDWA 3TVAA 2QPXA 4D6JA 2A4AA 4HCHA 4W8BA 5C9RA 1EA0A 1VBRA 4GI4A 1NP0A 3S46A 2EPNA 3QW3A 1M7PA 3GC4A 1UD4A 3GTNA 1H60A 4S3FA 4H7ZA 1BSIA 3CASA 1NFGA 4IQEA 1XIGA 3OQEA 3RU6A 1RJPA 3WQCA 2E1WA 4XKMA 1XGEA 1WPCA 4GRSA 2F6KA 3MU7A 1JAEA 1W91A 5ABEA 2X2YA 2OODA 4W8LA 3K1DA 3PJUA 2W62A 4UTWC 1W9PA 1QW7A 5FF7A 2YJQA 4IIDA 1S1PA 2PGEA 3ZJ7A 4L4OA 3OLDA 4M1RA 3QVQA 5A6KA 2KX9A 3M07A 2Q8LA 4UTFA 1FY6A 1WDRA 3QRHA 1ZENA 4OJYA 2QNEA 3L5MA 2Y1HA 3EOOA 3LY0A 4GH3A 2DIEA 1REQB 1UR3M 2CETA 2V3FA 1A0DA 3H70A 2V63A 3W2JA 1S2CA 4MNJA 3DERA 3FKKA 4F0MA 1BGAA 2CZEA 4G6CA 3SAZA 1QNQA 4MJZA 5CZSA 3EWZA 3VGEA 3BZJA 2VEIA 3VINA 3T0TA 4ZOEA 3BXWA 3D5HA 4JKLA 1EC9A 2GJXB 4UTKA 3C56A 4TU1A 1JI1A 3ZOAA 3DBPA 4BWLC 3JR2A 1UR8A 1PCWA 1JCMP 3WBWA 3HQ1A 3WDIA 2HEJA 4QSFA 1NSJA 5I3HA 1TMQA 1XL9A 4FNQA 2OWXA 5DELA 5C9UA 2QIIA 1O60A 1XGDA 3EOUA 4C6IA 5LSMA 4LALA 4PMNA 2GSEA 2DZXA 4LUJA 3SZ8A 4C6FA 1MW1A 2XVPA 4KQNA 4DYEA 2VFDA 4K1WA 4YTSA 1LBLA 3LCGA 3MB9A 2J25A 1IXPA 3H53A 5B7ZA 4YNGA 4Q4MA 3N17A 1H2JA 1TIMA 1RK5A 1UR9A 3NDYA 3GQYA 5CEWA 5BXRA 3L4YA 3STCA 4CQDA 4RR4A 1JCXA 4DJDC 4JTUA 2JIWA 4TVCA 3M0IA 3W7NA 1IT0A 1PDYA 3W7KA 4P8UA 3O63A 1GEQA 2WAGA 4XTIA 3G1HA 3R8HA 3S5YA 3LM3A 4XZLX 3RIKA 2AGTA 2Q8XA 3DFQA 5BNKA 3S0CA 1KBBA 3TN5A 1DVJA 3VM5A 1P1XA 1ONRA 1Z8AA 2E7FA 2WPBA 1O5XA 4IWWA 3IUHA 1I8JA 4A3RA 1CEOA 1F2JA 5D9NA 1FXQA 4O19A 3FIGA 3E02A 4ZO7A 1F6PA 4DZAA 4GQQA 8A3HA 2F9RA 3KVKA 2Y7DA 3S1XA 3REQA 4QSHA 4KESA 1TSIA 2J8FA 3GYEA 5H6HA 3UP8A 2WMHA 2V5LA 4JTDA 5LNRA 3QW4B 3T6CA 4CQBA 1TVPA 4GBDA 3R1ZA 4RPQA 5EY5A 1PKLA 4GQRA 2PBOA 4GJIA 1E9IA 4O18A 3AUJA 4L65A 4J3ZA 1YQ2A 1NAL1 2BY0A 4JTCA 1CW2A 1KM3A 2ESCA 2B81A 4QAIA 3PR2A 4N0RA 5LNSA 4DO6A 4IP7A 3LQGA 2XG9A 4W88A 2XZ9A 5ABFA 1TE6A 1HL9A 4N6FA 5C0QA 4NP7A 1ICQA 5MF5A 1UASA 4O1EA 5B80A 6TAAA 2QCDA 2V3DA 3FHQA 3SCUA 4BR1A 3BWWA 3B40A 1VYRA 3WLQA 3GKFA 2C71A 3UPBA 3K30A 3ZT7A 2A3LA 3DG6A 3SFKA 4GXPA 1O94A 2PWFA 1E4IA 4D1IA 1MW2A 1U22A 1J18A 2OZ8A 4FF5A 3GG0A 4Z2GA 4BY3A 2V67A 3E2QA 4QM1A 1SZFA 4MDOA 1P7TB 5FSDC 3SEPA 3MKKA 3N4EA 2PDQA 2XIIA 1OC5A 4LYKA 4ADUA 4E3TA 1NWSA 3Q65A 4AZBA 4PUJA 1SVDA 2JGYA 3VIJA 1TWIA 2PDLA 2OZ3A 2NUXA 3W23A 2E28A 1XBVA 3PM6A 4HSNA 5GJNA 3MUCA 4PB5A 5CPSA 3M0YA 3CO8A 3DFSA 1OC7A 3CZEA 1NY1A 3N29A 3BAJA 1U5HA 3CHEA 1WXYA 2WC3A 3WUFA 1CB7B 1LORA 4QFUA 1SZRA 3TWBA 3NNTA 1K8YA 1IXOA 2PWVA 1OSEA 1VFUA 4FNTA 4J3VA 3L66A 2YCKX 3VNLA 3POHA 1CECA 3D3AA 2F38A 3GS6A 4WRHA 1H7WA 4IMCA 3T81A 1TWDA 4NILA 4H9XA 3TW9A 3TYEA 4JHOA 1BFNA 4ERGA 2VFHA 3B8UA 3L9CA 5HJLA 5D9OA 4EAYA 3TU9A 2WNNA 3RMJA 1UWIA 4LU0A 3SR7A 4YL2A 3NIYA 3M1ZA 3UESA 4FO4A 1V7AA 5REQA 4UOJA 3SY5A 1UMYA 1SQ7A 1Y65A 4JIQA 1RK6A 2Z6IA 1SFLA 3NR0A 2QDDA 3CQKA 3UJFA 3M5ZA 4KRUA 1MQQA 2PODA 2H8ZA 2FMNA 3LZ3A 4O28A 1M7OA 3QLDA 1W3IA 1RP8A 1J11A 4RV8A 3DECA 3V16A 5HUOA 3WD0A 2I7GA 3UD6A 1JCYA 1OFAA 3WD1A 1XIFA 5LA0A 3P14A 3KAOA 1SFTA 2CNCA 2P1FA 3SBFA 2PWDA 1NARA 3KRBA 3RJYA 4POCA 4S3CA 4EAMA 4QLJA 2HK0A 3MSYA 1U2YA 1XFCA 4XQ6A 2EG7A 3EAUA 3VMPA 2H8XA 2DZBA 1XLBA 2X0YA 2WM1A 3CUFA 4H6RA 3IJ6A 2QV4A 1UMLA 1XW8A 1J01A 3S47A 1RUSA 3NPVA 5FF0A 5GJPA 1R30A 1M04A 3CT7A 1WDQA 1TX2A 3UCCA 5BMXA 3PAOA 4BCEA 1ZL1A 2Z25A 1YTEA 4EWJA 1ECEA 4H7VA 1NJJA 4O11A 4CUCA 1KLYA 3W00A 1WDDA 1LT8A 1REQA 3QR3A 1FOBA 1JZ7A 1J2BA 3UGVA 4H8NA 3MHFA 4PRRA 1UOZA 1JYVA 5BRBA 2VRJA 2GJXA 1QOPA 1ZJIA 1VH7A 3M5VA 7TAAA 3ES7A 3CZLA 1I60A 2ZBTA 3FJ4A 4FR1A 4DLFA 3N4FA 3KFTA 5D03A 4GIEA 3VUSA 1TTPA 5FEXA 1EP1A 3GVRA 1M6JA 4IG2B 4NAEB 4L5ZA 1VRXA 3SSZA 3G22A 4F9JA 2F6XA 2ISDA 2CKRA 2FPYA 3ZT6A 4H7CA 4AD2A 1Q2RA 3STGA 1JUKA 4ZO6A 2G3NA 2V81A 4CU6A 3W07A 1GQIA 4BQ5A 4LOCA 1A4LA 1NM9A 1JZ4A 5K3VA 2IW0A 2E8YA 1HNYA 3VIMA 1Q65A 4BZYA 2QHAA 2R82A 1QU4A 5A6JA 3SJNA 3PZQA 4DO5A 1C8XA 3UNDA 3JU2A 3NQ8A 2X0HA 2POZA 3VCCA 5M1TA 3AHVA 3NO1A 3TW6A 4MAVA 3LBMA 3CAWA 3QM3A 4AY8A 1PKMA 4TR9A 1JAKA 2VR2A 4ZQPA 1JL8A 1YYAA 1S39A 1SW0A 2QULA 4HZMA 1ZAHA 4FX8A 1WZAA 3N18A 3W87A 3XISA 1EQCA 2GJNA 3NL3A 1V0KA 4YTQA 4CQ9A 3NSMA 3LGDA 5DT7A 1ZTVA 1VD6A 5A6SA 3U2CA 3U48A 3W72A 4Q4RA 3INPA 4KIEA 2DJXA 3TLLA 1Q13A 3WH7A 1K1DA 4RDYA 1JPMA 4XO7A 1EP2A 3W7DA 1JCNA 8CGTA 3T08A 2OWWA 4QDWA 1LG2A 1FDZA 1UD6A 1F76A 3QZ6A 1GUVA 2ZRXA 4D8AA 3HG5A 4P7QA 1CENA 4S2CA 3W7EA 1NOWA 4LYPA 1OIFA 3B4UA 4IX0A