3PTMA

The crystal structure of rice (oryza sativa l.) os4bglu12 with 2-fluoroglucopyranoside
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
478
structure length
478
Chain Sequence
b'PVSRRSFPKGFIFGTASSSYQYEGGAAEGGRGPSIWDTFTHQHPEKIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKNWITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGREPYTACHHQLLAHAETVRLYKAKYQALQKGKIGITLVSHWFVPFSRSKSNNDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGLNYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLYVKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFLLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase Os4BGlu12
publication title The crystal structure of rice (Oryza sativa L.) Os4BGlu12, an oligosaccharide and tuberonic acid glucoside-hydrolyzing beta-glucosidase with significant thioglucohydrolase activity
pubmed doi rcsb
source organism Oryza sativa
molecule tags Hydrolase
total genus 192
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ptmA00
3TTOA 3VD9A 1UD5A 5HPOA 3GH7A 3K4DA 4HMDA 3DC0A 1QI5A 4WKAA 3SEPA 3PZVA 1WPCA 4AW7A 4TXEA 4CN6A 5HBFA 1CGVA 3GNRA 4A3YA 3OIHA 3VIGA 3T2PA 4B15A 4GI9A 2J7HA 2J75A 2WMIA 3AZSA 1BVZA 3PN8A 3GZAA 1I1XA 1JDDA 1QNSA 1KR0A 3GXFA 2DSUA 4JKLA 1UQZA 4TVUA 3AZTA 3MV01 2IXVA 3GNOA 2G3JA 1VJZA 3M46A 1RP9A 1E4IA 3QR3A 2XSAA 1BPLB 2GUYA 1UKOA 4KWUA 1ODZA 3T0BA 1GQKA 4W88A 4NRRA 1UKTA 1GVYA 3B9EA 3BSGA 3FHAA 3QHOA 2Y4SA 2JEQA 5C71A 1LWJA 4LYPA 4MNMA 5A8QA 1E5JA 3O2LA 6A3HA 3BAXA 3VU2A 1BYCA 1KGUA 4JZ5A 1IV8A 2FH6A 3FN9A 1OD0A 2WVSA 3AROA 4LX4A 1J11A 4MNLA 2XIBA 1WB0A 3BMVA 1GNXA 4AD3A 3MUZ1 2D0HA 2O9RA 1CTNA 1MW2A 1JYNA 3WDPP 1XYFA 1WNOA 5I77A 2CXGA 4CUCA 2VTFA 5EB8A 2CBIA 1DWGM 4V2XA 2YKKA 1V08A 4OBRA 3ZQ9A 3VMPA 3BAJA 3VDAA 2YL8A 3OA5A 5E6YA 1BYBA 4TTUA 3UR8A 2JF7A 4DUXA 4WK9A 3NUKA 2VL4A 4P8XA 1O7AA 1UWSA 1V0LA 1UUQA 1UWRA 1WAWA 4CCEA 5LA0A 3F5LA 5LA2A 2BS9A 3S6TA 2YDQA 2G4FA 2W66A 2X05A 3ARUA 3VNZA 5JBEA 3LPGA 3UEQA 4LYRA 3ZR6A 4PSRA 4PBGA 3WH8A 1B2YA 1UR9A 3QGVA 3WFLA 2WVVA 1QI0A 1WZLA 1BG4A 4HU8A 2DEPA 4A4AA 3EDKA 2XG9A 3AYRA 4Y7EA 3CO4A 1NQ6A 1R7AA 3GXMA 1I1WA 1OT1A 5I2UA 4FMVA 4M29A 1X6LA 1HXJA 2BNJA 1Q6FA 5I23A 4IISA 5FOOA 4UFLA 3F4VA 2D0GA 4EK7A 1GONA 3SUTA 3ZJKA 3U5UA 3CZGA 2CNCA 1XC6A 4MAVA 4M82A 1ESWA 4RE3A 3QOMA 1MVYA 1IZKA 2W5FA 2J62A 3MU7A 3T0DA 1R87A 2E40A 3IAPA 1ZU8A 2DT0A 4CCCA 3AHXA 2VZSA 3AMKA 3WH6A 3VGHA 1EDTA 4TX6A 3ARXA 1Q6DA 4W5UA 3VUPA 1DWJM 4RL3A 2OSWA 4J27A 4DUWA 3FY1A 1U2YA 3MMUA 2WZIA 4AIEA 4UQBA 1XH2A 2C8NA 3EDJA 2DDXA 2AAAA 2YIHA 4H7VA 2NSXA 3WENA 3AS0A 1MQRA 1HJXA 1Q4NX 1TFVA 1VIWA 1JFXA 2VQTA 1QW9A 2F2HA 3T09A 4MADA 7TAAA 2V38A 5A6BD 3T2OA 4C7GA 3OGSA 1NWTA 3GDBA 1GOKA 5ABHA 4UFKA 1BAGA 4WJXA 5DF0A 3MKKA 1HT6A 1FH8A 1UWQA 1Z32X 1HL8A 2C7FA 1HVQA 6CGTA 5A6SA 1CXIA 1EQPA 2YL9A 5A1AA 1L0PA 1C8XA 8A3HA 1C8YA 4WSJA 4D6GA 1CGTA 4OJYA 5I79A 1E6ZA 4V28A 1GOWA 5IHSA 4WKHA 2DQXA 1IT0A 4U3AA 1HJWA 1E1EA 1KB3A 4W89A 5A2AA 5EMYA 5IFTA 5FKYA 2V3GA 1EO5A 4M8UA 3ECQA 1NWSA 5BXSA 1TR1A 1J9YA 2X2YA 1OT2A 3LPFA 1QNOA 1TA3B 3O9NA 4JFSA 3WEMA 3IJ8A 3WQ5A 1W9DM 3BLPX 1E6XM 5DEZA 1F4AA 3PTMA 1E72M 3CZLA 1W9UA 2A3BA 4RE2A 5D8WA 1EO7A 2X1IA 5D9NA 4AISA 5HNNA 3AOFA 3WSUA 2EQDA 4PMNA 1AVAA 4JAWA 4L4PA 3WF1A 1UH2A 2J7EA 2ZUMA 1KXTA 1PX3A 1CENA 4CVUA 2ZICA 4PYSA 3MUAA 1SR0A 1C3FA 3N13A 2Z1KA 2XSBA 3BAKA 4FLRA 3VNYA 4IPLA 2BVDA 3ZSSA 1V6YA 3W27A 4ZXLA 1WZAA 1J0ZA 1B3VA 3SUWA 2ZUWA 4AIOA 5IHRA 1E55A 3ZT5A 1WCGA 5JUVA 3PHAA 5AYBA 3EBVA 1P6WA 1RPKA 4IUGA 2D20A 1OBAA 1MFUA 1JZ3A 2V5CA 1JNDA 1UG6A 1GUVA 1GCYA 1XGZA 5A8NA 4AMCA 3BAIA 4UOJA 2VUYA 4QLKA 4CKQA 2XFRA 5BCAA 5C70A 3CZ8A 1QNPA 1MYRA 3KEHA 4D6FA 3SCSA 3WUGA 2QMKA 1E1FA 1TG7A 2DT3A 2GK1A 3WEOA 4EAMA 4YHEA 1AQMA 2VT0A 1V3IA 1FH7A 5BRQA 2VX5A 5D8ZA 2EXOA 1KBKA 2XVPA 4P7QA 4YPJA 2FHBA 5CPTA 2VRKA 3DYPA 3IK2A 1LJYA 1V3LA 8CGTA 4LQ1A 1DEDA 1HL9A 2VOTA 2PWDA 1M01A 2UY3A 3T2QA 3ARQA 4JHOA 4Q22A 3ZO9A 3WBEA 1K9FA 2WLYA 4H2CA 1CPUA 2J8GA 1V02E 4HA1A 1UR2A 1EIBA 3WF2A 1V03A 3PZGA 4E8DA 2XGIA 4RE4A 3VVGA 1JZ8A 5M5DA 1J0IA 1EXPA 3WL1A 3VIJA 1R8LA 3MV11 3OBAA 1JF6A 2VRQA 2VJXA 3WF0A 1CGXA 3AYSA 4PUEA 5E0FA 2J8FA 2ZX5A 2XUCA 2YA1A 3WKZA 2BVTA 3RM4A 3N17A 4P7RA 4H8VA 3U7VA 3OGVA 5HPCA 4PMXA 5GNZA 2HVMA 4XB3A 1R86A 4JKMA 1VFFA 1E73M 4PMZA 4MB3A 4S3KA 4ML4A 5CGMA 4FF5A 2WWCA 4QP0A 1G5AA 4BCEA 1CXKA 2Z1SA 1E56A 3LMYA 3AIVA 1V0KA 3CHDA 1WE5A 3DHPA 1H09A 1ZBCA 4UFIA 1VEOA 3CHEA 4HA4A 4JFVA 2DPEA 3PZMA 4OBSA 3BAWA 4FLOA 4XV0A 2X09A 4GO9A 1TVPA 1JDAA 2D1ZA 1XSKA 4DWSC 4F66A 1JL8A 1VFUA 3U7BA 2CERA 2CESA 2G41A 2EPOA 1B90A 2ZXDA 5ABFA 3CZJA 3CZKA 1JF5A 2VNCA 5A8PA 4UQCA 1KQYA 1MW1A 4U2YA 5BXRA 2Y5EA 5CLWA 5BWFA 4MTVA 1JYWA 3MO4A 1SYTA 3PZTA 1E15A 2ZUSA 1Q6EA 4JCMA 1UKPA 4QAWA 3UR7A 5CJ5A 2UWFA 4AY1A 2BY0A 4MB4A 1NOFA 3WNPA 1UZ1A 1V3MA 3EMQA 1HVXA 3NIYA 2F8QA 3SCWA 1CXHA 4PCTA 1HN1A 1B9ZA 2PI6A 4AEEA 4P8VA 4WLCA 3EYPA 5DFAA 1JG9A 1DHKA 1U33A 4AZHA 1L8NA 3DYMA 1UZ4A 1GZJA 2WK2A 4BA0A 1EOKA 1UD2A 2WZHA 4ZXOA 3T08A 1V6WA 3L2MA 1U30A 2OYKA 4UFHA 1OGSA 3W29A 1UA3A 3W37A 1GORA 4BQ4A 5HXMA 4ATDA 1WO2A 5CGTA 3VGFA 1CLXA 2CCRA 3UERA 2G8ZA 2WYSA 5ECUA 4XX6A 3WF3A 3WNNA 2CIPA 2WC3A 4HA3A 4HZ7A 5IFPA 4Q7NA 5A6AA 1CZ1A 2WBGA 4GPNA 5A6MA 4Z2LA 2FHFA 3AMLA 1E3XA 1PBGA 1UQYA 4PTVA 4K68A 2XFYA 5A69A 4WIWA 3WH5A 1W1PA 1DWAM 3VMOA 4NSBA 1E6QM 3KE0A 1KGWA 2VZTA 4PUDA 4D6IA 2VX6A 3GBEA 3A4XA 3CUHA 4HOZA 2W67A 1H41A 3VIFA 3WUEA 1VB9A 2PWHA 2XPKA 3N9KA 2A3HA 1VFMA 3FAWA 2E4TA 1CXEA 3SCTA 2C0HA 2QPSA 3FNDA 2DGAA 3EMCA 4DM2A 5CPQA 4MNKA 3ARRA 2BY1A 2WMKA 3NDZA 4HMEA 2OWWA 3WMCA 4KRTA 2V3DA 3LPPA 3BH4A 3IJ9A 2RGMA 1ZL1A 3FXYA 1CECA 5BXTA 1PZ2A 1UH3A 3RJYA 4H04A 5ABGA 4CD7A 4ZEPA 1BF2A 1C93A 1WZMA 2Q8XA 4R5EA 3FAXA 1UD8A 1B3ZA 3EMZA 2BHZA 5I5RA 3ZJ7A 3L2LA 1ISXA 2XM1A 3AXIA 4GKLA 1MFVA 1KR1A 4P8UA 1EDGA 1WDQA 3AI0A 3NSNA 1SMAA 2EPLX 4TUFA 2O9PA 3WN6A 2WBKA 4PMVA 3OZPA 3ZMRA 4JIEA 3F5JA 3ZIZA 1QHPA 4GQRA 2XIIA 2V5DA 2XWEA 3K4AA 4AZCB 2VI0A 3OLEA 3W6MA 2WSKA 2YBUA 2V3FA 2D0FA 4MJ4A 1GVIA 4WSKA 3TOPA 2WVUA 2VVNA 3SUVA 2VR5A 3CUGA 5DMYA 2EPMX 1VENA 1DWHM 2WCAA 1ECEA 3PZQA 2VURA 2XM2A 2PBOA 3IANA 4HPGA 4UQDA 4P7LA 2E8YA 2G3NA 3NSMA 1OSEA 5M17A 1UR4A 1ZBWA 3VDBA 3N15A 2J79A 3RILA 3GH4A 4QCEA 1HIZA 1E5NA 4AZGA 2IXUA 2XVNA 2VCAA 3VPLA 2QMJA 1E4MM 1LL4A 4UR9A 1LLOA 3AXXA 4YN5A 1MQPA 2WZEA 1TUXA 3N04A 3W24A 4ATLA 1ISWA 3OZOA 4IPNB 3TTQA 1J0YA 1J0HA 1FFQA 1V0MA 5A2BA 1JZ5A 4GZIA 2OYMA 3ARSA 2WAGA 5D9OA 1V3HA 2QPUA 4UFJA 1E71M 4GQQA 4U2ZA 2E0PA 3UCQA 2X8RA 3AHTA 2HISA 1AQ0A 1JZ4A 4LXFA 2Y8KA 3ZT7A 1W9VA 4TOQA 1EOMA 3PZUA 4MDOA 3ALFA 1D7FA 2WPGA 1RD6A 1E9LA 1RH9A 2WANA 3VX1A 1LL6A 4J3XA 2GJXB 1ODUA 4OIFA 4P8WA 3SCUA 1H4PA 1WDRA 1HP4A 1V6VA 4DUVA 3HN3A 4PMUA 3ZM8A 3ALGA 2A3AA 1QVBA 2EPKX 3W26A 2O92A 1UOKA 2VZUA 2ZUUA 1JI1A 4PMYA 3U57A 5A95A 2QLYA 4M56A 5KZ6A 1KWGA 4F9DA 5GPRA 1TA3A 1ZBKA 4U3CA 1PPIA 2YDRA 3GBDA 3AICA 3L4TA 2ZXAA 3GM8A 4J28A 3W6LA 1H0IA 2J7BA 2YL5A 3WNKA 1MXGA 1UD3A 2GJPA 1TE1A 3RCNA 2CBJA 3BMWA 4XUYA 5CXPA 3W28A 2JF6A 3AHVA 2EJ1A 3BC9A 3II1A 3RJXA 1UD6A 2E3ZA 3AS2A 3OB8A 2W92A 3TTYA 7CGTA 1FFRA 1CEOA 5D9PA 5A8MA 4CD6A 5GNYA 1PX4A 3AIEA 2E9BA 4D6DA 4MNJA 4E8CA 4DWSB 2WCGA 3W25A 3SURA 2XGBA 3F5KA 4EE9A 1W1VA 3G6LA 1UA7A 2J78A 4D6JA 3L4WA 4UQEA 3NYDA 1EHAA 4PRWA 5E6ZA 4AEFA 1E6NA 3PBGA 1TCMA 1JAKA 3WQWA 2WHLA 1HP5A 4NI3A 4W86A 3CHFA 4TVCA 1RP8A 4FK9A 5CSUA 1JXKA 3A4AA 1KFWA 3AHZA 3TONA 1HJVA 1HKIA 3GXDA 3ZJ8A 3D5HA 4JHZA 1PAMA 3GYCA 2WKGA 3CMJA 3VINA 1LG2A 1W1YA 1CXFA 2XJ7A 4GO8A 3VDCA 1HX0A 3WQ6A 3K1DA 3RO8A 3N11A 4IM4A 2OYLA 1C7SA 4W87A 3K46A 1S46A 2ZWZA 4PTWA 2WB5A 5CLTA 1C92A 3AIBA 2QF8A 9CGTA 2J7CA 4EANA 3FHQA 1W1TA 3RPMA 1D3CA 1E0WA 3APGA 3VIPA 5M03A 1ZBVA 3B9AA 2UY4A 2MANA 5E70A 4AZBA 1V0NA 1KXVA 1PZ3A 4GI6A 3MSDA 4FLQA 1CYGA 1GOOA 1C91A 3VGEA 3B9DA 5A6LA 1ZJAA 2G3IA 3IAQA 1QHOA 3MSGA 2BV9A 4BQ5A 1W2PA 3THCA 3VIHA 2Y24A 3A47A 5DO8A 3SCOA 1ISVA 4NF7A 1WP6A 1B3YA 3L4XA 4KMQA 2YL6A 4R27A 4HU0A 1JZ2A 1CGYA 3EDFA 3VTRA 1V3KA 3KL0A 4URIA 4OKDA 3WFZA 3W81A 3OGRA 3CUJA 4HOWA 4JL1A 4W5ZA 2W63A 1MXDA 3ARYA 2WHKA 4X9YA 3CHCA 7A3HA 4CN4A 1KWKA 4QLJA 3GH5A 1B0IA 1XH1A 2YJQA 3NDYA 3RM8A 1OB0A 4PTMA 1GW1A 5CSYA 4CU7A 4OOZA 3CGTA 2PWFA 2EBNA 1J01A 4NZCA 5D4YA 3G6MA 3ARVA 1XD1A 2AOSA 1QOXA 1H3GA 1EQCA 1J12A 1EDQA 4HTYA 3WMBA 4QLLA 1BTCA 4U5IA 2YBTA 1CDGA 3IJ7A 3HU7A 4B3KA 1CWYA 1GJUA 2VCCA 2CBUA 2UY2A 5D9MA 3WH9A 2PWEA 4GINA 3UETA 3SCNA 4D71A 3OLDA 2YA0A 1JGIA 1G1YA 3L4YA 1K9DA 2UY5A 4N42A 2NW0A 2E8ZA 1KQZA 1JZ7A 5A2CA 3VGDA 5TD4A 1VRXA 1K9TA 4HZ8A 1VEPA 5LA1A 1BGGA 1GOMA 3T0AA 1NARA 2VO5A 3AIWA 1QW8A 2CPUA 3RIKA 3UESA 3N18A 1J0JA 1W9BM 2PBGA 2ZWYA 3WD2A 2D3LA 2XFFA 4OZOA 3ZT6A 3VM5A 1KXHA 1QI4A 1E0XA 3CMGA 3PZ9A 4U31A 3RDKA 4CVWA 2AMGA 2VC9A 1X1NA 1JI2A 4W84A 1QHZA 3NJ3A 3AS1A 4W8LA 3W0KA 5I6SA 1GHRA 4NRSA 2DIEA 1H1NA 5GNXA 2OLHA 4PSPA 1XH0A 1OGGA 4F79A 1W32A 3W53A 1Q6GA 4PTXA 2EPNA 4H41A 2GDVA 4AIUA 1LL7A 1WKYA 1LF1A 4Z2GA 2DIJA 3WY1A 2OSYA 4P7NA 4PMRA 4ATWA 2ZIDA 1M7XA 3POCA 4GI8A 1DTUA 1DP0A 1UR1A 5E0CA 1G9HA 4CD8A 2YLLA 3UG4A 1B1YA 1UWIA 1V02A 2NT1A 4Z2JA 2FGZA 3MMDA 1H11A 1E4LA 4GIAA 4Z2HA 1HJUA 2JEPA 5A3HA 2BXYA 1QBBA 2WMGA 2DH2A 3WBAA 1O6IA 1FA2A 3VIKA 3VX0A 1ZB5A 2B31A 2WW5A 2XWDA 2EO7A 5M3WA 1TZ7A 1OCQA 5BXPA 2XHYA 2J7DA 5AC5A 2QHAA 1W3HA 1XHGA 4B16A 1E4NA 1MW3A 2WMFA 1FOBA 2BY3A 5AY7A 5E09A 1HJSA 4HZ6A 2FGLA 3WNOA 4D1JA 4QCFA 5A6JA 2DSKA 1KXQA 1A47A 1E43A 2WC4A 1B3WA 4E4PA 1KGXA 2IUZA 3K8KA 3VD7A 1SMDA 2RGLA 1LQ0A 4M1RA 4J3WA 2XYLA 4M24A 4XZBA 1KBBA 3I3DA 2F61A 1A3HA 4U5KA 5I78A 1DWIM 1W3KA 2DH3A 1JXJA 4ACYA 3WUFA 3SCQA 5E9AA 4AD1A 1FH9A 1AMYA 4UQAA 5FL1A 1VF8A 3WNMA 4ACZB 1JAEA 2WLZA 2WWDA 1XD0A 2A3EA 2W61A 3A6OA 5KEZA 2ZX8A 1TMQA 1BFNA 2JIEA 2VQUA 3KZSA 3VGBA 3VD5A 4AZCA 4BF7A 3DYOA 4UNIA 4TTGA 4KRUA 1E0VA 1PX8A 2VVSA 3WIJA 3CZEA 4OUEA 3PTQA 4J3UA 2WMIB 1VAHA 4D6CA 4J7RA 2WM0A 2BVYA 1DWFM 4UTFA 4N0RA 1UYQA 2J7GA 1R85A 3VIOA 3CH9A 4JKKA 1OD8A 3M6DA 3WD1A 1GHSA 3UG5A 1US2A 1CNVA 4UZUA 1W9PA 2J77A 4AD4A 3W38A 3K8MA 1B30A 3EDEA 2E9MA 1VBRA 2NT0A 3HJEA 3VILA 2X0HA 1XYZA 3SUSA 2ZUVA 3NSXA 5FD0A 1W91A 1VBUA 4JFUA 4BQ2A 1UKSA 3WQ4A 1SFSA 2ESCA 3I3BA 5IDIA 1PIFA 3AJ7A 4W85A 4TVDA 1CGUA 4LYQA 3AIUA 4UOZA 1V3JA 4A3HA 3WF4A 2XVGA 4CD5A 1NWUA 2W4XA 4JFWA 1JD7A 1EGZA 1UR0A 4J3VA 1C7TA 1PEZA 4CU8A 4UOQA 2FHCA 3SCPA 3WDHA 4BS0A 1JFHA 3POHA 3OG2A 3ZJ6A 1E6PA 4F9JA 4HOXA 4ZENA 4UQ9A 1BSIA 2DT2A 2ZX7A 3WL0A 3PZNA 1G94A 3AIRA 1E6RA 2GJXA 5IXEA 1OIFA 2BXZA 3RMEA 1EH9A 2GJRA 2CKSA 4E2OA 1FHLA 3AS3A 1XV8A 4BZYA 3SCRA 4CGTA 4XZWA 3MANA 2OWXA 3W82A 3ARPA 1GOIA 2GFTA 4AC1X 2ZX9A 4DWSD 2WVVB 4J3SA 1OIMA 3VGGA 1QBAA 3KL5A 4AD2A 1H2JA 3AIQA 2D3NA 3VM7A 5JIPA 2GSJA 5EFFA 3U5YA 2JE8A 1GQIA 3AFBA 3EDDA 3SCVA 4PMDA 2ZE0A 2GVYA 4GZEA 1JD9A 1G0CA 1IZJA 1LWHA 3TTSA 1UWTA 3VMNA 2BHYA 2YDSA 3CLWA 2WCSA 3WDIA 4AZ6A 1J10A 1WDPA 1I75A 4LGXA 3BCFA 4ZFMA 2WHJA 1J18A 4CD4A 2GDUA 4CU6A 1Y7VA 1ZJBA 4MB5A 4DWSA 1JZ6A 1MW0A 1MQQA 4Z2IA 1NOUA 1VJSA 1M03A 2EEXA 1J0KA 3SUUA 3ARTA 4AD5A 4GZJA 4TX8A 5I24A 3BCDA 4W8AA 2D23A 1GQJA 5BYWA 5I3DA 4JL2A 3ZOAA 1WDSA 1E6SM 4KH2A 2XTKA 3L4UA 3S2CA 3WUBA 4D72A 1F4HA 2X0YA 4ZE4A 2XVLA 2VCBA 2ZX6A 1OGBA 1NWRA 4U33A 2O9OA 5EBAA 4LPCA 5CPSA 2WKLA 4PMOA 1HF6A 4AYSA 1W3JA 1GPFA 1JIBA 4P7OA 4PEEA 2BY2A 4M81A 4AXNA 5DT7A 1UH4A 1EHNA 1CLVA 1N82A 3AZRA 1MWOA 1NP0A 1BGAA 3AHYA 1XSIA 1OM0A 3DECA 3WDJA 2VX4A 5A6BA 3K8LA 3WELA 3A4WA 3WH7A 1C8QA 1NOWA 4PCSA 3D3AA 1HKKA 3THDA 2FDMA 3AXHA 3NCOA 5JIWA 3J7HA 3VD3A 4HMCA 3CUIA 5C8BB 2YA2A 1QNRA 4J3TA 1BLIA 1TVNA 3QOKA 3DHUA 1XRVA 3VDHA 5JBDA 2VZVA 1UWUA 3B8SA 5CG0A 1H49A 2CITA 3WDRA 2CKRA 3VOCA 1PJ9A 3WMSA 1CBGA 4Z2KA 2W91A 1V6XA 4H8UA 2CHOA 2BFGA 5AYIA 1GJWA 2WMHA 2D24A 2OWCA 2WMJA 4W7WA 3OLGA 3E1F1 4PMQA 2J7FA 2WVTA 3AMCA 3VKKA 4CN1A 4D6EA 4W8BA 1OINA 1GQLA 2PF0A 2PWGA 3ZR5A 2ZOXA 4UFMA 1K9EA 3PZIA 3VIMA 5DT5A 2WXDM 1NH6A 2PC8A 2CBVA 1B31A 1VFOA 2J74A 1NP2A 3A3HA 3VIIA 5I0DA 2D2OA 2A3CA 3PZOA 1QPKA 3WNLA 4UZSA 3JUGA 1ITXA 5CQ1A 2ZXQA 3GNPA 1H0GA 3MUY1 3WQ8A 1K6AA 2CEQA 2TAAA 2DSWA 1D2KA 3GXIA 1XSJA 4HP5A 3CUFA 2WNWA 4QFUA 1E70M 3TP4A 3WD0A 4WF7A 4QDMA 3VD4A 1FP9A 4KGJA 1BVNP 1FP8A 3WD4A 3I3EA 1CXLA 4D1IA 5FCZA 2CETA 3FW6A 4OOUA 1UR8A 1R7OA 1BHGA 1KCLA 3BLKA 4CCDA 3MMWA 4AZ5A 5HDRA 1AQHA 1LG1A 2Y2WA 1HNYA 1C90A 3QHNA 3N12A 1ISYA 3ARZA 2QV4A 1UD4A 3RM9A 2XVKA 2WC7A 1KCKA 4MPKA 2VZOA 2GK1B 3UG3A 4UCFA 4GXPA 1HKJA 1PIGA 1UKQA 3AQUA 3TA9A 3KL3A 2J4GA 4FLSA 3MUIA 1M53A 3LPOA 3KWXA 5A6KA 1W9XA 1B3XA 2DSVA 2PB1A 5JBFA 1YHTA 2DSZA 2CHNA 4M80A 5FL0A 2Y8VA 5HOSA 4MDPA 4D6HA 4C7DA 5ABEA 4X0VA 1JNEA 2BHUA 4AWEA 1OWQA 3CTTA 1BYAA 1CIUA 5BROA 5EFDA 3M07A 1NM9A 1WZKA 2OSXA 4W93A 3AMDA 1BYDA 1HKMA 1JDCA 4X0NA 1E40A 4L4OA 1XCXA 4V27A 1GOQA 1US3A 2YOCA 4HPHA 3GTNA 4AZ7A 1VEMA 3ZSTA 2VMFA 3HMCA 3MS8A 4MJ2A 4AD0A 1E3ZA 2VRJA 2VR4A 4C7FA 2D22A 1W3LA 3OLIA 3ARWA 2W62A 2O9TA 3BAYA 4YHGA 1ZS2A 5GQBA 3BXWA 1XCWA 2WHMA 1QNQA 3QHMA 4F8XA 4MB1A 4AZIA 4B9YA 2WSPA 5F7UA 1X6NA 4S3JA 2ZUNA 5A8OA 1FHDA 3VO0A 1BQCA 3SIMA 1W2VA 1JYXA 4H8HA 1ITCA 1CGWA 3M7SA 1Q6CA 2JALA 4B3LA 2CYGA 2G3MA 4B9ZA 5CZKA 2J47A 4W7VA 4DM1A 3CPUA 5AC4A 3CBWA 4KGLA 3PTKA 1UHVA 1H5VA 3O6AA 1YQ2A 2V3EA 2ZXBA 3WDQA 4EKJA 3WQVA 2JFEX 2E9LA 2J25A 3WD3A 3BGAA 5A94A 2VX7A 3L4VA 5BRPA 4JCLA 4WKFA 5ABFB 3CIVA 5LYRA 3W4RA 1ISZA 2YLAA 1EA9C 1G01A 4JFTA 1HJQA 1QI3A 3BSHA 2DT1A 3AMGA 3WEZA 1QI2A 1BG9A 3AISA 6TAAA 5FIPA 1JYVA 1M04A 4BQ3A 4ACZA 2FH8A 4PN2A 3L4ZA 4ZE5A 1V6UA 3N1AA 4MAZA 4W7UA 2JIWA 2ZUTA
chains in the Genus database with same CATH superfamily
4G8TA 4Q8PA 4R33A 1NEYA 2DORA 1WKDA 3K4DA 4HMDA 3CJPA 3M0ZA 4C6CA 3LZ5A 2AQOA 1WPCA 2FLIA 4TMCA 5HBFA 3GNRA 4MZ8A 2J7HA 1GVOA 2J75A 2XH2A 2WMIA 1BVZA 2XDFA 4F48A 3GZAA 3CWOX 1UBPC 2JBMA 4L4MA 3DFOA 2OLSA 2QCEA 4IIEA 3OVQA 1VCFA 2DQWA 4FZIA 1RA5A 3DENA 3E0LA 5JQ9A 1S5WA 5T9BG 2GUYA 3LHZA 4KWUA 4W88A 4LBRA 3ITCA 1GVYA 2CZDA 1IGWA 5C71A 2OZ8A 2C79A 3P14A 1ZSXA 4A8IA 6A3HA 3U6WA 3AROA 2WVSA 4LX4A 3AU6A 4E3TA 3BMVA 1NDVA 4KKXA 2D0HA 2O9RA 1W5PA 3KTSA 4UNLA 3WDPP 2A0NA 1WNOA 4K8EA 4LAOA 4CUCA 3FJ6A 1WYIA 3W75A 4LNCA 2CBIA 2YKKA 3PR2A 3TNBA 3UWZA 1W31A 3VDAA 4RXGA 3KW3A 2H8ZA 3UG8A 4K1GA 1ZFJA 2DVUA 2OX4A 3FK4A 1EXBA 3UR8A 2QDDA 2VL4A 1Q7ZA 3UCCA 1EGMA 1V0LA 1UUQA 1UWRA 1FQ0A 5JXQA 2ZRWA 3S6TA 1EF3A 4JIRA 5FJOA 3UEQA 1S5VA 4PSRA 4PBGA 3QGVA 1UR9A 3FVDA 4R7JA 3WFLA 3EWWA 4O1BA 3AYRA 1MI3A 2Z2AA 3DFPA 4S39A 1YKWA 4O53A 1XIFA 4FMVA 1T41A 1EIXA 2BNJA 1Q6FA 1BF6A 4UFLA 4H7CA 3SUTA 3ZJKA 2F84A 3OVRA 3U5UA 3H2NA 2IW0A 2PTXA 1SO3A 1XC6A 4MAVA 4GNVA 1ITUA 1UC5A 2OGJA 4GH3A 1XCFA 3LGGA 3R25A 5RUBA 1YBQB 3CS2A 4HTBA 2VZSA 4HMNA 3AMKA 1IXPA 4TX6A 1G4SA 1DWJM 2QAPA 3VOGA 4RL3A 2Y7GA 3IV3A 4ZO7A 4E2VA 3LBCA 4V1YA 3EPOA 3FDGA 3M4HA 3O63A 4AC7C 3GUWA 2AAAA 3T4CA 5K2ZA 1BSLA 1MQRA 1HJXA 1VIWA 4TV6A 4IQLA 4MADA 5AHLA 7TAAA 1NWTA 4JTHA 1X1OA 3REQA 5DF0A 5CC3A 5KZEA 4FF7A 6CGTA 1E9YB 1SSDA 2AGKA 2YL9A 3UCDA 2QXWA 8A3HA 2PDGA 2O4MA 1CGTA 4WKHA 2HZGA 2DQXA 3H2EA 3MSRA 1FCUA 1OCBA 3R7MA 2V3GA 4M8UA 3ECQA 4IXHA 1TR1A 1J9YA 1S2AA 1OT2A 1QNOA 1JCMP 4CQBA 4M0XA 1SFJA 3R4IA 5PTDA 1H51A 1E6XM 4IIGA 4J9JA 1S1RA 1Z9AA 3CZLA 2Y7FA 2A3BA 2ZRYA 2CLLA 5HNNA 5CGQA 3LV6A 1AVAA 4L4PA 5AECA 2J7EA 1ONEA 1CENA 4JTRA 4MFEA 4CVUA 3BV7A 4AWUA 5HINA 4A35A 2C91A 1RQBA 1XDJA 3N13A 2Z1KA 2DUXA 1ADSA 1J6PA 3BZGA 4ZXLA 3DG7A 2ZUWA 4AIOA 3BQ5A 4S23A 4DWDA 4KWOA 3HBLA 1K8YA 2D20A 4ZB5A 4ENLA 3NQ6A 1JZ3A 4AFYA 4YVPA 4GVGA 1UG6A 3W7QA 5A8NA 4E38A 2IS7A 3TK7A 1YXCA 4PTNA 1YTKA 4ECLA 5BCAA 3P8IA 5A5WA 1QNPA 3KEHA 4JN6A 2FPTA 3W7JA 3WUGA 4HBKA 4LVAA 4K3ZA 3K13A 3F03K 6XIMA 1IQ8A 4K8GA 4E2BA 3P8JA 1EX5A 1AQMA 3NQ7A 3DN5A 1DJXA 1KCZA 2EXOA 2XVPA 3AXMA 4YPJA 2VRKA 3ANVA 2ZRUA 1OFPA 1S5MA 3GNXA 4LYKA 1VQTA 3ID7A 4XKYA 3UXLA 4Q8TA 2J66A 1ONRA 2VOTA 2PWDA 5A6TC 4OFCA 3WBEA 4J35A 1QAPA 2QS8A 5GVJA 2WLYA 1RQEA 1R3RA 1V5XA 3S1GA 1HQTA 4E8DA 4K39A 2PEVA 4XBJA 4RE4A 2A7PA 3CIXA 3BUVA 5FESA 1R3TA 4OV9A 1EXPA 3BG5A 4R3UA 1S5TA 1FWRA 5HUPA 3MV11 1VBGA 3LD5A 3OBAA 1JF6A 1BWVA 2VJXA 3BDKA 1TIMA 1SO6A 3GXTA 3MY9A 3JS3A 4Z1DA 2BVTA 5HULA 3N17A 1RVKA 3PJTA 3A9IA 3KDNA 3HQOA 4N9CA 1XIEA 4PMXA 4XB3A 4JKMA 1VFFA 1FXQA 4PMZA 3AYTA 3O7UA 3HTWA 3EWCA 1JPHA 4PULA 3AWNA 2V9DA 3TJLA 4H4IA 4PB4A 4HIBA 4IQEA 1VEOA 4MY1A 2V5LA 3GU1A 1OYAA 3BAWA 2X09A 5KITA 1EEXA 4K6AA 1JL8A 1VFUA 3MMTA 3R58A 1EF2A 1KKOA 2VEFA 2VEPA 5I3IA 4DBEA 1LYXA 2VNCA 3KAOA 4JN8A 1NF7A 3M41A 3PPCA 5CLWA 4MHBA 4MTVA 3IVTA 1JYWA 5J5RA 4NZFA 1W5QA 1GVRA 4NT0A 4AY1A 1NOFA 3WNPA 1V3MA 3MBFA 4ZOEA 2DW7A 1EJ7L 3Q58A 2ZTKA 1EP1A 2O56A 4RCXA 3F4DA 3RLUA 3SCWA 4FI4A 2QCMA 1G7VA 4AY8A 3CB3A 2PI6A 4DQWA 3VNLA 4WLCA 3KOYA 4KEUA 4JYDA 3FJNA 3BLDA 4HT3A 4HKPA 3E2QA 3RN6A 3V18A 5G1YA 3C0JA 1ZAIA 5FF3A 3T08A 3CEUA 5C7VA 1C29A 1YNYA 2HSAA 4UFHA 4ERGA 4IQDA 4PA8A 3PVFA 4O18A 4MJZA 1GOXA 4GCXA 1EX1A 5T91A 2BASA 2PWVA 5CZSA 1X38A 2PWUA 2A6NA 1IIHA 5A6MA 4XTIA 1O1ZA 2FHFA 4NNBA 3AMLA 4CQCA 1E3XA 4AWSA 2V5KA 2XFYA 5CZTA 4WIWA 1JCLA 1NVMA 5F4XA 4L80A 4L61A 3MI3A 4NSBA 1E6QM 3DG6A 3ZYZA 2VZTA 2G37A 3B97A 4PUDA 4WRHA 5FSEC 3TLQA 4RZ4A 2VX6A 1GT8A 4HOZA 1TUFA 2HXTA 1H41A 2PWHA 3N9KA 3FAWA 4XZIA 4JQ4A 2BY1A 4HMEA 3WMCA 3KP1A 3S4TA 3N19B 1ZL1A 5DX7A 7REQB 3NG3A 3WLLA 3I7SA 1OZMA 1UH3A 4H9UA 4X3ZA 2E6DA 3G2GA 4CD7A 4ZEPA 4M7TA 1K02A 4J3ZA 1B3ZA 1F9CA 3KS6A 4JQ1A 3RR4A 4FNPA 1ZQ5A 2R1KA 2Q71A 1MFVA 1VFLA 4P8UA 1EDGA 1WDQA 5AHFA 4UTHA 4ZOAA 3NSNA 2O9PA 3PPFA 3WN6A 2WBKA 3IUHA 4JD4A 4X9SA 3V5OA 4JIEA 3F5JA 3A24A 2ABBA 3ZIZA 2XIIA 2FJUB 4AZCB 4F0SA 2QIWA 2VI0A 3M1ZA 3ABOA 4DYJA 3KRUA 4RE0A 4WSKA 1DORA 3LCGA 4OQVA 3EXTA 2AGTA 3QMTA 2NSOA 2EPMX 1YBQA 4PUUA 2WCAA 1ECEA 4Q6JA 4WGXA 3WZ0E 3M5XA 2BOFX 4PTDA 1UP3A 2XM2A 2PBOA 2Y5SA 4UQDA 1OX6A 2VM8A 3M0JA 4IFOA 2YW3A 4LS2A 1KM1A 4MF4A 3VDBA 3G8RA 4R34A 1RSCA 3N15A 3CNYA 3S46A 4QCEA 4UMBA 3C0LA 4AYGA 3V0UA 3GVWA 3G1XA 2QMJA 3QRHA 4GYPC 3A4JA 1LLOA 1PTAA 1F07A 1V79A 4KIEA 3T42A 3N04A 2CLOA 3OZOA 2PP0A 4IPNB 3VC6A 3MTWA 3PBWA 5D02A 4GUHA 1V0MA 2GVJA 3CT2A 3L23A 4G6CA 3FCPA 3NGFA 4GFSA 5L9FA 1V3HA 4UFJA 1E71M 2PUZA 3DCPA 1OFDA 4WY0F 2P50A 3MYPA 3RITA 3EOUA 2Y8KA 3VKDA 1W9VA 2PSNA 1A0CA 2VFDA 3W83A 1E9LA 4RLIA 1KM3A 3VX1A 4C6DA 1C9DA 2HPMA 4LAUA 3BANA 3HF3A 4A2SA 2P0IA 4OIFA 1BRLA 1XBVA 3R2GA 4FOKA 1V6VA 2GLKA 1GKRA 3Q67A 3HPZA 3ZM8A 3P6LA 5XIMA 4L6OA 4PMYA 1SR9A 1B4EA 3CO8A 3AAMA 3I7QA 3HO8A 1UZDA 3KXQA 1C8VA 3QEZA 1KWGA 4F9DA 3WFAA 4CQDA 1JQVA 3O1NA 1FTXA 4RZ5A 3R6IA 3GBDA 3AICA 3L4TA 3GM8A 3SECA 1ICSA 3M47A 3MDWA 3WNKA 1TE1A 5C2CA 3BMWA 5FEPA 3W28A 2TMDA 3BG3A 3STCA 2Z6JA 5FJPA 7CGTA 1FFRA 4JTFA 3QXBA 3AIEA 4MNJA 1Q6QA 3DC8A 4DWSB 2FZDA 1WKEA 5CEWA 4GZ7A 1FWHC 3G6LA 4IMCA 1UPMB 5E6ZA 4NIRA 2NX3A 3WQWA 2X0SA 1XINA 4FK9A 1KFWA 3DGBA 3CPRA 1HKIA 3SN4A 3ZJ8A 1KFBA 3THQA 1EYWA 1PAMA 3GYCA 2WKGA 1OK4A 1PWLA 2I17A 3W3OA 3CMJA 1AG1O 2YFNA 1LG2A 1AW5A 1TJ0A 1CXFA 1PTGA 4KF1A 4EVZA 4OV4A 3T1GA 4K7YA 5AYZA 1GK8A 4GO8A 2GSHA 3F7JA 3N4FA 1FDYA 2ASHA 3UJRA 3VDCA 3KCJA 4HSHA 5U7SA 2ZZ6A 5LZLA 1C7SA 4W87A 4MM1A 3TH6A 3K46A 2ZWZA 4ORIA 3FA4A 3HG5A 3DEQA 3OQ8A 2WB5A 3SR7A 3AIBA 2IQ0A 1UB3A 3APYA 3W1MA 4N7QA 1TMLA 3FHQA 3O15A 1YE4A 3RPMA 2PP3A 5M03A 3DUGA 3B9AA 2UY4A 2XH4A 2FPYA 4ZQNA 2IKHA 1HTIA 2ZA2A 4FLQA 1CYGA 1ML1A 1YLVA 3OQEA 2RDWA 2WSQA 3UW6A 1ZJAA 4I3GA 1PV8A 2X1RA 3IK4A 3DKLA 4C6IA 3VIHA 3SCOA 2QT3A 4NF7A 3L4XA 2YL6A 3JU2A 1B9BA 1MMFA 3HG2A 2ZKMX 4OKDA 4IL2A 3V1HA 3W81A 3CUJA 4JL1A 5F2MA 3URNA 7A3HA 1M5WA 4WXZA 3TYUA 1KWKA 2QJHA 4ILSA 2PCQA 3LQLA 4PTMA 4H6QA 4OOZA 4NZCA 3URQA 1UJPA 3UXAA 2AOSA 4Y8FA 4MLRA 1H3GA 3GC2A 4WJ8A 5AN7A 2OLAA 3W7HA 1EDQA 2PAJA 4V33A 4B2DD 3WMBA 4A29A 1BTCA 4H9XA 1XR2A 3BTNA 1CWYA 2EF9A 1Q7MA 3BOLA 2UY2A 3E12A 4GINA 1ZJHA 1IEWA 1PUDA 1G1YA 1P6BA 4CCZA 2YSWA 1KQZA 2E5CA 4MUPA 2WV8A 5TD4A 5FAJA 1WBJA 4N6EA 1F3WA 5LA1A 3DHFA 3L65A 5AC7A 5AZ1A 3W85A 2VO5A 3V35A 3AIWA 4WJEA 1QW8A 2CPUA 1AD4A 2YCLA 1J0JA 1W9BM 2ZWYA 2XFFA 3ZT6A 4ZQOA 2NX1A 3W76A 5AC8A 1QI4A 1ZALA 4CVWA 2AMGA 2C0AA 5F4SA 3NL3A 2G97A 1X1NA 3B05A 2V2HA 4W84A 1ADOA 3TXVA 1TPFA 3O0FA 1GHRA 3ERPA 4C6MA 5I6SA 5CBIA 3GO2A 1H1NA 3GXPA 2R14A 1OGGA 3FEMA 4F79A 1PYFA 3N6QA 4PTXA 1QTWA 3E2SA 2YYTA 1VJIA 4PMRA 1AD1A 4IPJA 1DTUA 1DP0A 4K8HA 4F0RA 2CWNA 4MZ1A 3MMDA 4XTDA 1O66A 3L0NA 2JEPA 3UVIA 2BXYA 1FX6A 2WMGA 2DH2A 2GQ8A 1O6IA 4G1NA 4L56A 3FGCB 3MA8A 1OCQA 4TIMA 4TV5A 3H12A 1CLKA 5XINA 8XIAA 1W3HA 1MO0A 4C90A 3SSZA 1A80A 4UIOA 2WMFA 1K70A 2BY3A 1QWGA 5AY7A 3ABQA 4HZ6A 2FGLA 3CYVA 4QCFA 1KO0A 2RDTA 5A6JA 2DSKA 1W5OA 3AWOA 3NPWA 2R82A 3K2GA 5BRBA 1LOSA 3K8KA 3O6YX 3VD7A 1KNWA 6REQB 7REQA 4G7EB 3G1DA 2OEKA 2XYLA 3UA4A 3STGA 4PEKA 4XZBA 1KBBA 4Q7IA 4JTEA 5H8MA 3TSDA 3PC0A 4FNRA 4UTWA 5I78A 3BE7A 3QC0A 1DWIM 2DH3A 2FZ8A 4ACYA 3WUFA 1XL9A 4B92A 4UQAA 2X7VA 1CB2A 4ACZB 4QG8A 1JAEA 3FA5A 3BLIA 2WWDA 4XD3A 4FS9A 2V63A 3W01A 2W61A 1RXOB 4BHYA 2Y62A 3BURA 5KEZA 5D30A 3KZSA 3VD5A 4AZCA 1K8CA 3QLLA 4BF7A 4UNIA 3IACA 7XIMA 2PA6A 3W73A 1PX8A 3QM3A 4WCJA 5E1QA 3N2MA 3F4NA 1VAHA 5HANA 4LRTA 3CAVA 3GG7A 1Q66A 3QW3A 3B40A 4PODA 3WJSA 5DY3A 3GIPA 1OD8A 4GC3A 1EJSC 4YLWA 1CNVA 3TCSA 2J77A 3W38A 1DL3A 3K8MA 1B30A 3L5MA 5FACA 3E3HA 3EWZA 2P8CA 2X0HA 1XYZA 4HK7A 4QIUA 4JTIA 2BDQA 2Y61A 4Z08A 1AL8A 1J4EA 3NGJA 4W85A 3P7YA 2RAGA 3AIUA 5B80A 4YTQA 4UOZA 3WF4A 1NWUA 1ZP3A 4O13A 5CBBA 1C7TA 1VBHA 5HR7A 2DZXA 3WMLA 4A21A 4UOQA 1O60A 1E6PA 3H22A 4F9JA 5CC7A 4UQ9A 5DMNA 1BSIA 1T5AA 2ZX7A 3PZNA 2PDKA 4ERIA 1G94A 3AIRA 4CNNA 3LX9A 3PB2A 4E2OA 1MUWA 4ROPA 1XV8A 3B03A 3E38A 4ASTA 1EBGA 3H6OA 3E5BA 4G9PA 2WJEA 3NURA 3MANA 4IG2B 4DBUA 4DBDA 1QBAA 5U4NA 1A4LA 4EF8A 4Q8MA 3GVGA 4Q4PA 5LXEA 3MO7A 4Q8VA 2HS6A 1YTDA 4MGGA 2GVYA 4GZEA 1JD9A 2OXNA 1G0CA 1RQHA 1LWHA 1YADA 2PFHA 4GQGA 3P0WA 3WLKX 3KRBA 2BHYA 2YDSA 3LXAA 1V4YA 4UTTA 4ZFMA 4MJMA 5HMEA 4R7WA 1Y65A 1ZJBA 4DWSA 1TQXA 1YDYA 1XBZA 3GC4A 1WQ5A 1JZ6A 4I5XA 1K8ZA 3QKEA 4Z2IA 1KW1A 3L0KA 1JJKA 1Q85A 2FTPA 3RRAA 3M0VA 4WDTA 4TX8A 4HK5A 5BYWA 4MYXA 3ZOAA 1WDSA 3C86A 4IGMA 3L4UA 3S2CA 3PWAA 1S2VA 1D3GA 4MY8A 2ZX6A 3H24A 1YXDA 4NAEB 1NWRA 4QEEA 4A6GA 5E9XA 1ZHAA 5EBAA 1QR7A 1PXGA 4LPCA 5CPSA 2NQJA 4AYSA 3V0SA 1W3JA 1GPFA 4FNTA 1JIBA 4PEEA 3TAOA 1DJYA 2BY2A 4NJKA 1CLVA 3AZRA 4DNMA 1SJCA 3AHYA 2C71A 1XSIA 5E93A 1OM0A 3DECA 1HZYA 1PDZA 3R5EA 4IQJA 2VX4A 5AB3A 3S9IA 2ZCGA 3V0TA 3K8LA 3R8HA 3UJ2A 3WH7A 4M3PA 2ACRA 2FDMA 4BF5A 1Z44A 3HGSA 1WOBA 1OHLA 1A5SA 3EKZA 4HMCA 2XGZA 3PUOA 4ZOBA 1XUUA 1XW8A 4QITA 4FSAA 2O0TA 3DHUA 1XRVA 5IM51 2XINA 4PH6A 5CG0A 4XQ6A 3WDRA 1CBGA 1QRQA 7TIMA 4H8UA 1R38A 5BOEA 3O16A 4IX0A 4M6PA 1RV8A 2BFGA 3IS4A 4LEQA 2OOFA 3OHIA 5C55A 1H62A 4L64A 1OY0A 4DBWA 3W1LA 4FIQA 2WMJA 4AIBA 3R94A 4D9PA 1GQLA 2X41A 2PWGA 3P81A 3ZR5A 2ZOXA 2H6RA 1OFAA 2WNQA 5DT5A 5EPDA 1UW9A 2J74A 3A3HA 3VIIA 3RCYA 4WQ6A 3D47A 3KLKA 3EPMA 1L2QA 2CLIA 3PZOA 1IYXA 1JUBA 1QPKA 3WNLA 3JUGA 4XUGA 3LENA 4HK6A 1TTQA 5LIYX 5H1WA 1CCWB 2CEQA 2DSWA 3DKJA 2J9XA 3GXIA 3MCOA 4XIMA 5HJLA 3BO9A 2WNWA 4QFUA 4G5DA 3TP4A 3IV8A 1LBFA 4IPIA 2GZXA 4NASA 3R0DA 4LF2A 2IKJA 2Y70A 1OZQA 4BEUA 1TZ9A 2J27A 5FI8A 2PDXA 3I3EA 1CXLA 3VZYA 2CETA 3FW6A 2INEA 3VKAA 3LRKA 3TR2A 1LZOA 1DXFA 1FWEC 1HNYA 1C90A 5K4XA 1ISYA 1TJRA 5CSSA 4KIRA 1VKFA 4HSNA 2QIIA 1KCKA 2Q3RA 4YTUA 4HYVA 4MPKA 3CV2A 1SO5A 2Z2UA 4C6LA 3LLDA 5HMSA 4C6NA 1HKJA 2QUVA 3FXGA 4B5XA 3TA9A 2J4GA 3EPNA 1UMYA 4FLSA 3KWXA 4GK8A 1B3XA 2DSVA 2PB1A 2DSZA 2P3EA 2F6UA 5XIAA 4LVFA 1XIGA 2Y8VA 3C3NA 3CL7A 1WXYA 4WD0A 1CW2A 1JNEA 1LRTA 2BHUA 1MNSA 4PL1A 5EFDA 1H1ZA 1NM9A 1WZKA 2PD5A 3GG1A 4ES4A 1I2PA 1E40A 3PPHA 4I5RA 5EMJA 1GJPA 3H2OA 1YIXA 4V27A 3RUBL 5REQB 3GTNA 4AZ7A 1TTJA 1RZMA 1VYSX 3MS8A 4MJ2A 5GJMA 2UBPC 3FGCA 1KFLA 3TU9A 3T0CA 1ME9A 2WJFA 5KINA 1RUSA 2PGWA 3EA2A 2WHMA 3QY6A 4F8XA 4K38A 4MB1A 4B9YA 2WSPA 3DI0A 5F7UA 4DY1A 3DGRA 1KLYA 1FHDA 3VO0A 3TUUA 4I90A 5DXYA 4RKAA 1P7TA 3NL2A 1VHNA 4GX9A 5F1UA 4GNKB 1NY1A 4NZJA 1CGWA 3M7SA 1VHCA 3SGUA 2Z1BA 3C2YA 4YCOA 1UHVA 2V3EA 1H5VA 3PTKA 5K9DA 2DUZA 3WQVA 3QQ0A 4B5SA 5DRIA 3UA3A 3GX9A 5C0QA 4G7EA 1YMYA 1RY8A 2J25A 3V16A 3WD3A 3BGAA 2RJHA 1Y5WA 4LTSA 5ABFB 4C60A 3APTA 4JFTA 1HJQA 4FO4A 4AVNA 3SQSA 1BG9A 1SJBA 3KLLA 1M04A 3B8UA 2IPGA 2FH8A 4PN2A 3L4ZA 4ACZA 1HO1A 1RR2A 4J40A 1GVSA 4MAZA 2HCVA 3L0GA 2V82A 4XG1A 1L6GA 5DY2A 3TTOA 3VD9A 1UD5A 1XJBA 1MUMA 2WQPA 3EWUA 2OB3A 4WKAA 2GQAA 1EEPA 3PZVA 1GG0A 4CN6A 1KRAC 4ZCWA 4A3YA 4JHMA 3VIGA 4B15A 4LEFA 1LDCA 3BOXA 1Q8AA 3XISA 3R43A 1KR0A 3TW9A 2DSUA 2HK1A 1CI1A 1UQZA 4O1AA 4QS5A 3AZTA 5H8UA 2C1GA 3UY7A 1M68A 3KBWA 3RK8A 1S2UA 3QR3A 2XSAA 1FDJA 2PDUA 1V93A 3OYXA 3FHAA 1LWJA 4LYPA 1XG3A 5CH9A 1N8WA 3RHGA 1GGOA 1GYMA 3O2LA 4X2RA 3VU2A 1BYCA 4FXSA 1FWAC 4DUOA 2FH6A 3FN9A 1OD0A 2YXOA 1GNXA 3MUZ1 3UD6A 3GNDA 3HB9A 3M9YA 5I77A 2CXGA 5EB8A 4V2XA 3ZQ9A 1W54A 3ICJA 3VMPA 1VPXA 2YL8A 2PLKA 3VOHA 5E6YA 3U4FA 1BYBA 1MSSA 4O57A 4LAZA 2YCIX 4DUXA 2OG9A 3NUKA 4WK9A 4OUIA 1ICPA 3BJSA 4FXRA 1UWSA 1KFEA 1TV7A 5DN1A 1F6YA 4R85A 5FEZA 3DG3A 3QSRA 1KV8A 3CPGA 3F5LA 3SSJA 1U22A 2YDQA 2W66A 2X05A 4JS3A 3S5ZA 2IQDA 1OF6A 4LYRA 3ZR6A 5G2WA 1B2YA 4MLJA 3SN0A 1QI0A 1WZLA 2EPHA 4NI8A 4TU1A 4GVHA 4A4AA 4N9BA 4PUKA 4ZSTA 3LRMA 2X42A 3SQLA 4A3UA 4Y7EA 3DI1A 1I1WA 5I02A 4Q8OA 3QGAC 1X6LA 3LQGA 1HXJA 3O8AA 3W6YA 2ZE3A 4PFHA 4IISA 3F4VA 5HR6A 2D0GA 4QNEA 3IJLA 4Z1AA 2CNCA 1OYBA 4OTKA 2OR2A 4M82A 3MB9A 1KM4A 4NVTA 2W5FA 3QV8A 2J62A 2UV8G 4LUYA 1DVJA 3WJZA 4AXKA 4CNUA 1IE7C 1TO3A 4LW7A 2Z26A 3VGHA 1EDTA 3ARXA 1U5VA 3TVAA 3KRZA 3VI2A 4NNCA 3VUPA 3CAWA 3GC5A 3LM3A 2ZA1A 3EKLA 3NL5A 5EA9A 3MMUA 3UWUA 3CAQA 4AIEA 4NAEA 1XH2A 3GIQA 3LNMA 4H6KA 1W5MA 3TOYA 3TC3A 3WENA 1TJ2A 2X1UA 2P76A 5EKYA 1UIPA 2VQTA 1QW9A 2F2HA 1TV8A 2V38A 2DIKA 1GVQA 4B90A 1GOKA 3T9PA 1BAGA 2DZTA 3HFTA 3RMJA 1HT6A 1HL8A 2RFGA 1XRFA 4KETA 4UUIA 2QULA 2UZ9A 1GEQA 3HV9A 2GVLA 5BU9A 1RJQA 5A1AA 1L0PA 2E5BA 1C8YA 4OJYA 4NKCA 5F2GA 2PGEA 2Q01A 1E1EA 1KB3A 4W89A 1XIDA 5EMYA 5IFTA 3VNIA 4WDXA 2OX1A 1IEVA 4GYFA 5I7GA 3GKFA 4JFSA 3PUDA 4AU0A 3IJ8A 5DEZA 3H55A 3C2OA 2Y63A 1F4AA 1E72M 1W9UA 4RE2A 1EO7A 4XIAA 2NXGA 3WSUA 1XUZA 2IQTA 3G3DA 4JAWA 2VD8A 2CHRA 1NFGA 1UH2A 2ZUMA 1RBOB 2ZICA 4GRSA 3GG0A 3P67A 4GC4A 3F2BA 1SR0A 2FVLA 3SY5A 1Q65A 1FY6A 1ZJIA 1A5NC 3FLUA 2BVDA 3ZSSA 3CUZA 4B4HA 3W27A 1ZAHA 3T4WA 1J0ZA 4NYYA 1E55A 5C5YA 2V67A 2XISA 3E02A 5C2XA 4QR6A 4HHMA 3CHVA 1P6WA 1UZHA 4J5NA 2V5CA 4E2DA 1GUVA 1XGZA 3BAIA 4UOJA 2ZC8A 2A6LA 4CKQA 3IGSA 2XFRA 2E1DA 2D2GA 2J9ZA 1MYRA 1Q2RA 1R2TA 1W56A 4FP1A 4D6FA 2QMKA 1E1FA 3ITYA 4QE5A 4S3CA 4PE8A 1TG7A 2DT3A 3WEOA 1NQKA 2V8ZA 1K4HA 3MDUA 4YHEA 2VEGA 1IWPA 4HHLA 1GW9A 4P2VA 1FH7A 1FWSA 2YYUA 5D8ZA 1KBKA 5LNSA 4P7QA 3QZAA 3UP8A 2ZZ5A 2NQ9A 2FHBA 3QLDA 3KOWA 3RU6A 4AX7A 2OCZA 1V3LA 8CGTA 4LQ1A 4D2JA 1DEDA 3L5AA 3ARQA 1PZ0A 4JPGA 1VFHA 4HJFA 2HE8A 1V02E 4HA1A 3TYDA 1UR2A 3USZA 1DQWA 4Y9MA 3TCEA 1Z6KA 4ZQCA 2ZRVA 4S2BA 4Q4OA 4IZGA 3QBUA 1W8SA 1JZ8A 5AKQA 1FKXA 1L8PA 1J0IA 3TQVA 4G7FA 3UR5A 3BQ6A 3WL1A 4DI9A 1YXYA 4C6OA 1UROA 4ONVA 3NQ2A 2Y88A 4JTQA 3AYSA 2J8FA 3LHTA 3O6CA 4H8VA 4GH1A 1GTHA 2GOKA 5D03A 4Y90A 3STFA 2EHHA 2HVMA 4O1FA 1E73M 4RDZA 1FVPA 4ML4A 5D2VA 5CGMA 3KHJA 4IMDA 1G5AA 8XIMA 1R9YA 4S3GA 1QDSA 2Z1SA 3LMYA 3TROA 3AIVA 1OFEA 4IOTA 2V81A 1H09A 3TSMA 4V1XA 3FOKA 3SRDA 3EEGA 4JFVA 2DPEA 2F38A 4FLOA 4GO9A 5FF4A 2D1ZA 3UBPC 5HQMA 3W22A 1XSKA 3W2LA 4F66A 3U7BA 2CESA 5ABFA 3GD6A 3EA3A 3CZKA 3VUSA 3M6YA 2WZTA 2BP1A 3KVKA 2Y5EA 2XU2A 3TA6A 2DY3A 3QV7A 2I5GA 1DYSA 3PZTA 1Q6EA 1GPWA 4QAWA 4QJ3B 2BY0A 4IT1A 5DMMA 2E6FA 4U4MA 2F8QA 1FHVA 3ORWA 4LUTB 4US5A 3FSUA 4F0MA 3R79A 4WZHA 2KZHA 5BOOA 3UGRA 3EX2A 3GK0A 4P8VA 3QQ1A 3IEBA 5DFAA 1DHKA 1U33A 3DYMA 1UZ4A 1GYNA 2WK2A 2HVNA 4BA0A 1ZY9A 3HGJA 4A3QA 1UD2A 4ZXOA 1C9WA 4IFRA 1OG6A 2PU1A 1SSGA 1A5LC 4O0ZA 5FEWA 1OVDA 1GORA 4M51A 1XQKA 1OADA 2X30A 4ATDA 1LBLA 3DXIA 1V51A 3VGFA 2GQ3A 2CCRA 3UERA 3G5EA 3IIXA 3O3RA 2WYSA 2R6OA 3FSTA 5ECUA 4XX6A 3QY7A 2NUXA 2WC3A 2XSXA 5A6AA 4GPNA 3PFRA 1KFJA 4Z2LA 1PBGA 1K8XA 4PTVA 4BWLC 5A69A 2WNZA 1YNQA 2DZPA 3T8LA 4DXKA 3JZUA 3PJXA 1T7LA 1PTDA 2L5HA 3A4XA 1THFD 3CUHA 3BW2A 3D3FA 3VIFA 3ZWSA 2HE5A 1VFMA 2E4TA 3SCTA 4QROA 1EBHA 2QPSA 4DM2A 4MNKA 3OW1A 1E0UA 2GWNA 2WMKA 5H8PA 5JH2A 1O12A 2I5IA 2RGMA 3RU8X 3R10A 4A8NA 4KWWA 3FXYA 1CECA 3RJYA 4H04A 1DE6A 1BF2A 1WV2A 3D6NA 3ITTA 3DZ1A 3EMZA 5I5RA 2NUWA 3L2LA 3SFKA 1IR2A 3KOZA 4IJCA 5KZMA 3AI0A 4L9YA 3SRKA 2EPLX 2XIMA 3ZMRA 1V8EA 2DFAA 1QUMA 1EJTC 2DVTA 3W6MA 2WSKA 2YBUA 1XYCA 5EGRA 3W1NA 1DJHA 1GVIA 3TYBA 4M6QA 3SUVA 4ZOCA 3P60A 2A7NA 3NQDA 1VENA 1W6TA 3E2VA 2VEIA 4LT9A 5D2TA 2VHLA 5D2YA 3WK1A 4JQ2A 3OP2A 5G1TA 3OZMA 1B54A 1ZBWA 4QQUA 3H2MA 3VE9A 4M5PA 3RILA 3GH4A 1HIZA 2V30A 2OO6A 5G4WA 2IXUA 2XVNA 2OEJA 4RR4A 2CLMA 1E4MM 4MVAA 5CJMA 2IKIA 4GACA 1LL4A 1J96A 4YN5A 1MQPA 4Z0JA 2WZEA 3AU2A 3U4AA 1J0YA 1J0HA 4E8GA 1FFQA 5A2BA 2A85A 4S3AA 4GZIA 2OYMA 4C6QA 1XM3A 3ARSA 4LCSA 5D9OA 2XH0A 5EBUA 4TR9A 5KTLA 1AQ0A 4LXFA 3PF3A 3W2JA 3P74A 3PZUA 4XAZA 4I7VA 1D7FA 1RD6A 4AHPA 1VIZA 2BOGX 3M0MA 4G2DA 4K7VA 2NQHA 3RCMA 4J3XA 4IUOA 4H2HA 3NOEA 3VK5A 3M0XA 2TYSA 4P8WA 1WDRA 2P0OA 1HP4A 3IWPA 1XLIA 3HN3A 1P0DA 4PMUA 3W26A 5GJPA 5G1MA 4PGLA 3W7RA 2O92A 4O14A 4ZGYA 2OQYA 2Q09A 2QLYA 4ORMA 3BJFA 4M56A 2PD9A 5CPOA 3BICA 1J79A 3H2FA 4UTLA 2YDRA 2ISDA 5DXXA 1MXGA 1UD3A 5HMDA 3RCNA 2CBJA 2QJGA 1QJWA 4GVIA 3WQDA 2QYGA 3AC0A 2EJ1A 4WXYA 3BC9A 3II1A 3FYYA 1P48A 3P93A 2E3ZA 3LCLA 2W92A 3GS6A 4L7ZA 4O19A 3TTYA 2JGYA 5HK4A 1VFTA 3UVAA 1LLWA 4CD6A 3A23A 3E0VA 3QV9A 1SJDA 2OVLA 3TYCA 2E9BA 2HJPA 1XYMA 1I2RA 1F7BA 4E8CA 3WQEA 3SURA 3M44A 4HN4A 3OHMB 4DJFA 4I9MA 3M0HA 1F3TA 2DU2A 3GUGA 1ZTVA 1F2JA 3TJ4A 2J78A 2RHGA 4EX4A 1QT1A 1H7PA 3L4WA 4UQEA 4PRWA 4AEFA 1E6NA 1A5OC 1HP5A 3INPA 1RP8A 1NDZA 3N73A 3AHZA 3TONA 4UTJA 5D09A 1HJVA 3OBEA 3VABA 1XDLA 2Z25A 3FV9A 3OO2A 5EMMA 1JUKA 1OF8A 1W3IA 1L6WA 1L6SA 4YL2A 1JCJA 2WJDA 4H1ZA 1QPOA 4HYWA 3QY8A 3LRLA 5DCDA 2XJ7A 4OWGA 1OX4B 1FWNA 3H4XA 4PUJA 5IBXC 3ME3A 4CEUC 5MKGA 1DQUA 3F4CA 3HQ1A 4Y9AA 3PBMA 4MKVA 5CLTA 9CGTA 3PUGA 4Q4QA 3PAJA 4EANA 2B7PA 1JVNA 1W1TA 2OEMA 1KFCA 1D3CA 4JDBA 1ZBVA 4MWAE 5KETA 1KXVA 3KBNA 3HG4A 4A8RA 3N9RA 4YTSA 1OC7A 4IMAA 1X7IA 4MZYA 4P5UA 1O5KA 5KMYA 3LI1A 4NXKA 4NZ3A 2BV9A 3A9BA 1KM0A 1QOQA 1RLDA 4EPKA 5DO8A 3A47A 1WP6A 3VCRA 4ZL1A 4Y6GA 2BVWA 2PU0A 3LZ3A 1TX0A 1CGYA 3ZZ1A 3KL0A 1UJQA 1T99A 3MHFA 4FPSA 2PTZA 3ARYA 1E51A 2ZQ0A 3S5YA 3CHCA 3MBDA 2CLFA 2HPIA 3V3WA 4QLJA 3W2MA 2PE4A 3IGXA 3NDYA 1OB0A 1GW1A 1XDMA 5CBJA 1WXZA 1TV3A 2PWFA 2EBNA 3G6MA 1YDNA 3ARVA 4H9MA 1XD1A 3CQIA 3NFUA 2OQLA 3P62A 5JVLA 2YBTA 3OODA 2FPVA 1HFBA 1CDGA 5H6HA 4AAJA 2VCCA 2CBUA 5D9MA 3WH9A 1EKOA 3UETA 3SCNA 3GG8A 3OLDA 3IJIA 1IEXA 3EX4A 2YA0A 4DX3A 3L4YA 4N42A 3LSCA 3QPEA 5MF5A 3WBXA 5A2CA 2YCJA 3VGDA 5M1TA 1VRXA 3RX3A 3NZ1A 3VAVA 4AMAA 3UESA 2ZZ1A 3N18A 1EC7A 3WD2A 2Z1WA 3T0TA 3UZXA 4OZOA 4O10A 2ZRXA 4IP5A 1G4EA 1US0A 4Z1YA 1E0XA 1IWBA 2V5JA 3EWYA 1OC6A 4B5VA 3MHGA 3U3HA 5DQPA 3BOFA 5HWNA 1L6FA 1QHZA 3NJ3A 4US5D 3GU9A 3W0KA 4C5ZA 2DIEA 2OLHA 4PSPA 1XH0A 1AH0A 4KCWA 4F2UA 3B3DA 2XIQA 3G0XA 2CU0A 2SFPA 3Q65A 4H41A 1QK0A 1LL7A 3EA1A 4AIUA 1TSIA 4Z2GA 2DIJA 4P7NA 1WUEA 1W17A 2Z0IA 3FVMA 3SFWA 1M7XA 4E3VA 6XIAA 4IX2A 3WLJA 4FNUA 4CD8A 4EXAA 1V02A 3IIZA 4H01A 4KS0A 2F9RA 2C15A 4R53A 2VDHA 5CZ0A 3U48A 3R12A 1SZEA 1FKWA 4Q32A 3M5ZA 1DIDA 2R1PA 4L65A 4J2PA 3CAKA 4Z1BA 2B31A 2X1TA 4LVGA 2XWDA 4J2MA 1TZ7A 1BXBA 4LUIA 4C91A 5DBUA 2E7FA 1MEIA 4ZQRA 2NVCA 3FX4A 3OA3A 2I57A 1QFEA 1N2VA 2OTDA 5C2GA 1KCXA 4X63A 3QJAA 5C9WA 1W5NA 4JIIX 4C1NB 9RUBA 3QN3A 3QH2A 1HJSA 4JTJA 5KSWA 3QR1A 2B7QA 1B3WA 3D46A 4E4PA 1D8WA 1QCWA 1LROA 5JU6A 1XLAA 2NQ5A 4M1RA 1ENUA 4YMZA 4GVFA 3QTPA 5ECVA 4LS0A 3F2DA 2PTWA 1QPQA 3I3DA 4F2TA 3PFMA 2ATMA 4DEFA 4U5KA 1W3KA 3LHVA 1JXJA 1TTPA 4GMEA 2VXNA 1DXIA 1GVEA 1MRAA 4CNTA 1AMYA 3UZWA 1SZFA 2P1FA 5SWUA 2WLZA 3IVUA 1UASA 3VZXA 4ZMGA 2OU4A 1JPMA 2A3EA 3TXZA 3PK7A 1BFNA 2JIEA 2VQUA 2C19A 4HCHA 1PKYA 3DYOA 4BFAA 1JPIA 1YDVA 3DBPA 4PMJA 2VFHA 3WIJA 5IBXA 4OUEA 3PTQA 4J3UA 1E9IA 5T26A 2FZNA 2GVGA 4O1EA 2P8BA 4J7RA 2WM0A 2BVYA 3LDVA 1A50A 3WQCA 4HPXA 3NDOA 2FFIA 1E0TA 2PGFA 3VIOA 3CK5A 4O12A 1TWWA 3M6DA 1LRQA 3WD1A 2QCLA 1K77A 3H53A 5M2FX 3S3GA 3GWQA 3KFTA 4PCFA 4UZUA 2NV9A 3E5PA 3G24A 4JR5A 3EDEA 3FA3A 1M3UA 1VBRA 1VP5A 2ZUVA 2NUYA 1W91A 1VBUA 1UKSA 3LXBA 1XC4A 4WY0B 2NLYA 1SFSA 1YYAA 1OYCA 5CJNA 4ALDA 4QS6A 1B5TA 4GHRA 3E74A 1V3JA 4A3HA 3LI0A 4CD5A 3TR9A 4NZ5A 2W4XA 4CQ8A 4MOZA 1YPXA 3P2VA 4B5UA 4BS0A 4F0LA 3EX1A 3QMRA 3LN3A 3V4BA 3NQEA 4F2BA 3ZJ6A 3U8GA 5HWJA 1YPIA 4BR1A 1XPGA 4HGXA 1XISA 2GGIA 1JCYA 5AVHA 1UBSA 1QO2A 4UBPC 3GDKA 4QSHA 3RO6A 1DE5A 1HG3A 4QTGA 3NPVA 2P3ZA 1J8VA 4CGTA 2BB0A 3PSVA 4ICMA 1R0MA 1DJIA 4GY7A 2FQIA 2QGYA 1X7FA 3HGOA 4C6KA 1VR6A 2OWXA 3GW0A 1AH4A 2V5BA 4FNSA 3W82A 2MNRA 3N2OA 2YZ5A 5I3HA 4J3SA 3VGGA 2Q6ZA 4AD2A 5EFFA 1GZGA 2A4AA 3U5YA 2JE8A 3SCVA 4PMDA 1DJGA 2QF7A 3IIOA 1TPUA 1PS9A 2CLPA 1XX1A 3WDIA 4HCLA 2Y7DA 3BCFA 4X61A 2EG8A 2WHJA 4XVEA 3CIWA 3KS5A 3EXSA 3WLTA 1Y7VA 3V1PA 3CYJA 4GE8A 4FXJA 5FJRA 3IJDA 4GUJA 1D9EA 1ELSA 1XXXA 4AY7A 3NYZA 3NZPA 3GNNA 1BXCA 1QOPA 4GZJA 5I24A 1AL7A 1GQJA 2QW5A 3N9SA 3FYPA 2XTKA 3WUBA 1YEYA 2OOGA 2HTMA 4N6FA 1HF6A 3ELFA 1EYEA 1DV7A 4P7OA 1KM5A 4M81A 1EHNA 1N82A 1KA9F 4F0KA 1MWOA 1NP0A 1OX4A 3GHRA 5EYWA 2G96A 3VYLA 3C52A 5A6BA 4YWIA 3IJ6A 5DANA 1QO5A 2QCCA 1NOWA 4S3DA 4LF1A 3D3AA 3QYQA 1DJWA 3NCOA 3VDGA 3J7HA 4FA3A 1W3NA 1KBLA 2YA2A 1QNRA 4J3TA 4FX6M 1U5JA 1TVNA 3ABZA 4BKNA 3G1RA 3OU8A 3VDHA 2VZVA 3BSMA 3B8SA 2CKRA 3EGJA 3WMSA 3GYEA 4XISA 1EUNA 1SUXA 3LHYA 5C7HA 3N6HA 4AB4A 4S2CA 5ENLA 3B0VC 3SY1A 4W8BA 1OINA 4GCAA 2PF0A 2G50A 1P0BA 3PULA 3ISIX 4BF9A 3PZIA 3VIMA 1EWEA 3FIGA 3RRXA 2CBVA 1IXQA 2RKXA 2E5DA 3BL3A 2PDYA 4UR8A 4O8RA 1EGVA 5H2ZA 3RPTA 1ITXA 3CUXA 5D37A 1Z48A 2Z1VA 3MUY1 3ANYA 3TFCA 1PCWA 2TAAA 4HZMA 2NV2A 1AJ0A 1GVFA 4K37A 3BW3A 1I2NA 4UTUA 1BKSA 4OT7A 4PFMA 4WF7A 3LA4A 4Y96A 4H7ZA 4IJRA 2QNEA 3DX5A 1X1ZA 4RJEA 5GJNA 5FCZA 3MT1A 2D2HA 3TC7A 1K7EA 3B0YA 4LBSA 1P0KA 1R7OA 1TIWA 2DV0A 4PRRA 3HZ3A 2CWXA 1R2RA 2A21A 1VPQA 4YS1A 1LWIA 3UGVA 4ADSA 4CCDA 3STEA 1FCQA 3MMWA 5HDRA 4AZ5A 1LG1A 4IIBA 2ZFAA 3DFHA 3KBVA 1ME8A 4LALA 2QV4A 3GFZA 2ZA3A 3RM9A 2XVKA 4DZIA 2W6RA 4LJ3A 2VZOA 4JTTA 3WLNA 3CC1A 4MG4A 1X96A 3PG8A 3MUIA 3ZLGA 4XAFA 1FWIC 1W9XA 1J2WA 1P1XA 1N8IA 4UC5A 1W1B1 2CHNA 1RLCL 4M80A 3WLMA 5HOSA 1LP6A 1VYPX 1CX9A 5AOUA 3T8QA 4C7DA 4X0VA 3NQAA 5E0KA 1Q6OA 1OWQA 2BX7A 3CTTA 3NXFA 2VKZG 4XVDA 1A0DA 2HNEA 2XZ9A 3W74A 1ZAJA 1BYDA 4X0NA 4ERAA 4HD5A 1XCXA 1RCXB 4B91A 3A22A 5K3VA 3ZSTA 4QE1A 2VMFA 5I03A 2ZYFA 4AD0A 2WSYA 3H2AA 4CNSA 1H7XA 2D22A 1W3LA 5LKYA 3WO8A 3OLIA 2W62A 2E09A 2O9TA 4LBUA 1NAL1 4YHGA 5MHBA 4EACA 4LV9A 1XCWA 4KT2A 2RDUA 3QHMA 3TZFA 4AG0A 2ZC1A 4J4KA 3GVRA 3TN5A 4S3JA 1O5RA 2ZUNA 4GNJA 4KWSA 4H19A 4B5NA 3G1SA 2PDWA 4C1NA 3G1HA 1KRCC 1R2SA 2ZVRA 5FF7A 3LCHA 1Q6CA 4RNJA 1XLCA 4NJGA 1EPVA 1FWFC 4DM1A 3CPUA 3CBWA 4B5WA 3GVQA 2ZXBA 3WDQA 4EKJA 4NAFB 5E5CA 2JFEX 2E9LA 1XG4A 4IIDA 3LYEA 4MUZA 3L21A 4NU7A 1EB3A 2ALDA 3CIVA 5FAGA 1ISZA 2DZAA 2YLAA 2FFCA 5CSRA 2QKFA 4ZZ9A 2C13A 3AMGA 3WEZA 1XLLA 1QI2A 9XIMA 5FIPA 2JGQA 3TMLA 1Z8AA 4BQ3A 4GUFA 1MDRA 2DP3A 1JCTA 2DZSA 2QDHA 1V6UA 3LM7A 4W7UA 3RFAA 1U83A 2JIWA 5CZJA 3W2KA 2DZWA 4QJ4B 4JOMA 5I06A 5HJXA 3DC0A 1VGAA 1AW2A 3SEPA 4AW7A 1U1UA 2NZLA 2YDAA 5EMUA 5C6MA 2PDIA 3OIHA 3T2PA 2RUSA 3THUA 4W9TA 3AYVA 1DIKA 3AZSA 1LUCB 5D04C 3PN8A 1I1XA 4GQBA 1QNSA 1ZLPA 3GXFA 1TWIA 4PB5A 4XZMX 3PB0A 4GIRA 1JGMA 4TVUA 3MV01 2BZNA 2IXVA 3GNOA 1KRBC 5A8GA 2J8TA 2QVHA 2VFEA 1VJZA 4GXMA 1Q8JA 1RP9A 1E4IA 1BPLB 4XD5A 2EAWA 3R0UA 1SFLA 3U2OA 3TWAA 4O17A 1LOQA 4NRRA 2Z24A 4Y9NA 3BSGA 1LLZA 3QHOA 2JEQA 4DXXA 2Q8ZA 2ACSA 4HNOA 5A8QA 4Y9PA 3CU2A 4O15A 4WY0A 3UPBA 3GDLA 1I4NA 3N4EA 3QR0A 3P0XA 1IV8A 4OBTA 1BWLA 3KBMA 1J11A 5AYXA 4MNLA 2DJLA 2XIBA 1F05A 4AD3A 1CTNA 1GZ1A 1MW2A 1JYNA 1G4TA 1XYFA 2X1SA 4XBKA 1A5AA 1DWGM 1V08A 3ABRA 3I10A 2H9AB 3VFLA 5HA7A 3OA5A 1Y0EA 4H3DA 3QW4B 2CZEA 4TTUA 3NO3A 3GHSA 2DZBA 4S3EA 4CLMA 1IR1A 1O7AA 3B9NA 1WAWA 4CCEA 4I7WA 5LA2A 9XIAA 2BS9A 2PCEA 4PCPA 2G4FA 3GR8A 4O50A 3LPGA 3OG3A 3WH8A 1CT5A 2VEMA 5AHEA 1WBHA 3LNPA 3G1VA 4XSMA 4HU8A 4KW2A 1KM2A 1TWSA 3EDKA 2XG9A 3HG3A 3CO4A 4H9YA 3GXMA 2POTA 1OT1A 5I2UA 3IIPA 4DLMA 5TBOA 3S5NA 5I23A 5FOOA 4ICNA 2C14A 2AQVA 1GONA 2Z6IA 3CZGA 1PE1A 3QKZA 4LNYA 1ESWA 3OPSA 4RE3A 5IDZA 3QOMA 4Q8NA 1MVYA 1IZKA 3WJXA 2D73A 3T0DA 2E40A 4RK8A 1KKRA 1ZU8A 4CCCA 1XLFA 2NWRA 2NLIA 4GJ1A 3GZ3A 3OIXA 3IRDA 3S8HA 1PDYA 1Q6DA 2BBFA 3GLCA 3B8WA 4HN8A 4W5UA 4DO4A 3CL8A 4QQ3A 2Z7KA 2OSWA 4J27A 4DUWA 3FY1A 3SRFA 3W87A 2I9EA 3EB2A 3T55A 1T40A 2X2GA 3MZNA 4UQBA 2C8NA 2FB2A 3EDJA 1PO9A 3O0KA 1WA3A 1AJZA 2PC4A 2YIHA 2NSXA 3NQGA 1SGJA 1ZZMA 2QUNA 3LU2A 1F73A 2QCNA 1TFVA 3S9ZA 2TSYA 4WDUA 5A6BD 4JX4A 1JDFA 3OGSA 3GDBA 3U2EA 5ABHA 4WJXA 3MKKA 5CKSA 1KTBA 1AFSA 1Z32X 5DELA 2C7FA 1HVQA 4L4LA 1NELA 2HV5A 1EQPA 3HGRA 4N02A 4ZQMA 4PUNA 3ONCA 4LY4A 5T9CE 1C8XA 1A0EA 2NQZA 4DLFA 4WSJA 2E1WA 4D6GA 4JDYA 3W7MA 1E6ZA 3OYZA 4V28A 1GOWA 5IHSA 4YNGA 3LBMA 4U3AA 1HJWA 5FKYA 4Q4RA 1EO5A 3PG9A 3VOFA 5BXSA 2I14A 2NXIA 1HW6A 1QMLA 2OQHA 3WLPA 2C1HA 3PY2A 2F6KA 1O1HA 2PDLA 3O9NA 4FR6A 3WEMA 3I6EA 3WQ5A 1W9DM 2FGBA 3DFSA 1Q3NA 3NTYA 2NWSA 2X1IA 3KUMA 4AISA 1V77A 4Q4MA 4UTWC 4PMNA 2QUUA 1DKWA 4QJ5B 4Q4SA 1T8QA 4IL0A 1PX3A 4AF0B 6TIMA 3MUAA 3SN1A 4AQLA 1QU4A 4IF2A 3I68A 3M0YA 3I6RA 1C3FA 4EAYA 3VNYA 1N55A 1M7JA 1WZAA 3SUWA 4GA8A 5IHRA 1WCGA 4QSFA 3PHAA 3B8TA 5AYBA 6PTDA 4C5YA 2QCDB 4WGHA 4LOCA 2GL5A 1OBAA 3TTEA 1M6JA 2VWSA 2BGSA 1T96A 1GCYA 4AMCA 2OMAA 2V68A 2VUYA 3BCJA 4RPPA 2ODOA 3W86A 3VNKA 5LIKX 4ZTXA 3P5YA 4XZ9A 5C70A 3CZ8A 4TMBA 4C6JA 3W1QA 3KDOA 5K7JA 1UP2A 4OECA 3LBOA 3RX4A 1OABA 3IGHX 2QGHA 4MSSA 3N2BA 1W37A 5K4ZA 3ANUA 2JKEA 1JRBA 3HQNA 5BRQA 2VX5A 3SZ8A 5B7YA 1Z89A 3DYPA 4KERA 3IK2A 1LJYA 5I00A 2G95A 4DNHA 5HJYA 1AUSL 2OGYA 3LCIA 3R13A 4Q22A 4H9TA 3KZPA 3NQVA 1DBTA 4L9XA 4NX5A 1CPUA 3BGJA 2J8GA 1SFTA 1XLBA 3PZGA 2XGIA 1FXPA 1UC4A 3VVGA 5M5DA 1UP0A 2W3ZA 1DQXA 5HNUA 3TJIA 3GTIA 4XAYA 4I8DA 2QPXA 4LUSB 3VIJA 3FYOA 4B3ZA 2R1MA 3WF0A 2XIJA 5E0FA 2P53A 2YA1A 4N2YA 4P7RA 1WAUA 4JEQA 3U7VA 4DELA 4YU1A 1AMKA 3GXNA 3KHDA 1F61A 3NAVA 4HHPA 1QATA 4MB3A 2Q8LA 2WWCA 4QP0A 1CXKA 1I8JA 4B5TA 4FAMA 2FKPA 3DHPA 1UUMA 2EG6A 4UTTC 4AHOA 4HA4A 3PS7A 4NAFA 3AXKA 3PZMA 4O54A 4OBSA 4UMCA 3GTXA 4XV0A 2BXVA 4WX2A 1JDAA 3ITVA 2PRMA 3WG6A 1RJPA 4DWSC 5HATA 2CERA 2EKGA 4MKSA 5J8LA 2G41A 3ZLHA 1HGYA 1EPXA 3FDKA 3CZJA 5A8PA 1XYBA 5G5IA 2G3FA 1KQYA 2BOEX 4LAKA 5BWFA 3LCFA 3N25A 3MO4A 4IGHA 4X2PA 1XFCA 1SYTA 1XRSA 1E15A 2GJLA 2AKMA 2ZUSA 2XN2A 4JCMA 3LCXA 1VC4A 1UKPA 3UR7A 3W7IA 4RX0A 5KZDA 5CJ5A 2ZTJA 1Y5XA 4MB4A 5C9UA 4Q3MA 3D0CA 3W1UA 1HVXA 3CT7A 4DO5A 3NIYA 3URBA 1A5BA 2V69A 3EWBX 2QUMA 1TPVA 4PCTA 3A12A 3DOPA 4WUIA 1B9ZA 4AEEA 2RDXA 3GR4A 3W7LA 2J88A 5AFDA 3P61A 1FHUA 1LUCA 3WCZA 3T44A 2ISVA 3UXDA 5LGZA 2QV5A 1NIUA 1BVWA 3A5FA 1U30A 2QVNA 1S2WA 1OQFA 3ENLA 3ATZA 1OGSA 1UA3A 5LNUA 1H61A 1TELA 2OT0A 4BQ4A 3TC6A 1WO2A 3CEPA 1TJ1A 3WQPA 2G8ZA 4ZBCA 3ATYA 3MJMA 5K9XA 2ADAA 3TQPA 2CIPA 2RJGA 4HZ7A 2Y8UA 5IFPA 4Q7NA 1CZ1A 3C0SA 2HMCA 2ZZ3A 3RXZA 3C2VA 1UQYA 1PSCA 1I6NA 1GQNA 1EJVC 2PMQA 3NZRA 4ZFCA 3W7DA 1JDEA 4H9VA 3WH5A 1KRMA 1A5MC 4R9OA 1KGWA 4JBRA 3GBEA 4POCA 3P84A 2W67A 4KQNA 3TSBA 5F4WA 1VB9A 2ANUA 2H9AA 2XPKA 4D8AA 2A3HA 1TPB1 3L67A 1XKJA 2C0HA 3FNDA 2DGAA 4MYAA 5CPQA 3ARRA 3HPSA 2C18A 2H3DA 5TF0A 4KRTA 3TWBA 5HQEA 3BH4A 3IJ9A 3GB6A 1A49A 2R1LA 5LIWX 3WQOA 3LEPA 3VC5A 3STPA 2PRLA 1WZMA 3F4WA 2Q8XA 3L2IA 3FAXA 3QMSA 2P10A 3WLQA 1W1A1 2VDIA 3ZJ7A 5D33A 2A3LA 1X8FA 4QISA 4YYFA 2XM1A 3H54A 3AXIA 4GKLA 3GE7A 1FDZA 1KR1A 4US6A 3V5CA 1S38A 2HEJA 5HAOA 1HGWA 1ZCCA 4TUFA 3C61A 4PMVA 1P43A 3B06A 3LHUA 1QK2A 3DH7A 3TV8A 4GQRA 2V5DA 3K4AA 1FWCC 2PDBA 3OLEA 1SW7A 5EL1A 3CMFA 2AL2B 4A3RA 3K5XA 3EAUA 3TOPA 2VR5A 1FWJC 3CUGA 4ZO8A 4M19A 3WYZA 1DWHM 3S1VA 2PRHA 1X98A 2Z29A 3NZGA 3DDMA 3UT0A 1O4UA 3IANA 3NQFA 3VA8A 2E8YA 1TMHA 2G3NA 3TMQA 3PPGA 2QCFA 1GYLA 1OSEA 3B0UX 1WOAA 3E0FA 1IXNA 3QPZA 3SDOA 1E5NA 4DIAA 4UB9A 3O07A 3ES8A 1I60A 2VCAA 4M1BA 2POZA 2ZDSA 3L12A 3UYIA 3GSMA 4MPQA 2OFJA 3W24A 4ATLA 3GW3A 3NEVA 4I8YA 1ZP4A 1AH3A 5ABTA 4Z42C 3LB0A 1I9CB 1AK5A 2QPUA 3NNTA 4GQQA 2E0PA 2QCGA 3UCQA 2X8RA 3AHTA 2HISA 1JZ4A 3CQKA 3ITLA 2GWGA 2XH7A 3ABSA 3ZT7A 4MDOA 4IFKB 3ALFA 4Z1CA 2WPGA 4REQB 1EWDA 4JNZA 4IXXA 3I4EA 2CW6A 2OODA 3G18A 3TN3A 3B04A 2GJXB 4YJ5A 3W70A 2PDMA 4RPQA 3ALGA 2A3AA 5TQLA 4YVXA 1UOKA 2VZUA 2ZUUA 3U57A 5A95A 3GHUA 4X60A 3HPFA 2B7OA 2VGFA 4HCDA 5KZ6A 4FALA 5GPRA 2LLEA 3H4WA 1NTHA 1PPIA 2ZXAA 3E49A 3W6LA 2J7BA 2Q02A 1AZ1A 5CXPA 3AHVA 1YDOA 2VEKA 3QSTA 4S3BA 1BRLB 5L6UA 1CEOA 3EOEA 5D9PA 4BI5A 4AF0A 2HS8A 2OELA 1EUAA 1R6WA 4D6DA 2FYMA 3O06A 2WCGA 4YXGA 3M43A 3W25A 2XGBA 4EE9A 4PC8A 1K7FA 4U10A 3OVGA 1UA7A 4D6JA 4HYRA 2QCDA 3PBGA 3GDRA 1JAKA 4OVXA 3G3MA 4NI3A 3CHFA 4TVCA 5CSUA 1JXKA 2PDQA 3UPWA 4QAIA 3GXDA 2Y0FA 3UYCA 4GGBA 3W88A 2O55A 3EB3A 1UWAA 3DBNA 3VINA 1V6TA 1W1YA 1LTDA 2JKAA 5CG7A 1MUCA 3AUOA 2PP1A 3B0PA 4AEOA 3MSYA 4FOUA 1HX0A 4IM4A 1R3QA 1R47A 2I7GA 5CPMA 2OYLA 3TYAA 3HMJG 2JKPA 3S6DA 4LU0A 4UTKA 4XWUA