2O55A

Crystal structure of a putative glycerophosphodiester phosphodiesterase from galdieria sulphuraria
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
254
structure length
254
Chain Sequence
SKVIIPKIVGHRGVGKEGLAPENTLRSFVLCMERNIPYIETDLRVCKTGEIVLFHGTPEGTIPFYKDGTSRIGDLSLEELKRLDVGGGHTIPSLEELFVAIEEQKFNLKLNLELKGEEWKRKESGDHQRLLLLVEKYHMQERVDYCSFHHEALAHLKALCPDVKITYLFNYMGQPTPLDFVEQACYGDANGVSMLFHYLTKEQVCTAHEKGLSVTVWMPWIFDDSEEDWKKCLELQVDLICSNYPFGLMNFLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative glycerophosphodiester phosphodiesterase
publication title Crystal Structure of a putative glycerophosphodiester phosphodiesterase from Galdieria sulphuraria
rcsb
source organism Galdieria sulphuraria
total genus 74
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2006-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2o55A00
4I9MA 1DJIA 4Q6XA 4R7OA 2P76A 4I9JA 5T91A 5T9CE 1VD6A 3V18A 2OTDA 1V8EA 4F2TA 4PTDA 1AODA 4I9TA 1DJWA 4RV3A 3PTDA 2PLCA 3V16A 2F9RA 5T9BG 4F2BA 3QVQA 3CH0A 4RW3A 3RLGA 3H4WA 3EA2A 3L12A 1T8QA 1DJHA 2ISDA 3V1HA 3KS5A 4S3GA 3MZ2A 3I10A 3QR1A 3EA3A 4OECA 4QJ5B 1XX1A 4QJ4B 5PTDA 2ZKMX 3KS6A 1GYMA 1DJYA 3H4XA 7PTDA 6PTDA 1ZCCA 1QASA 4I90A 1PTDA 1O1ZA 3EA1A 4GNKB 2FJUB 2O55A 2OOGA 1QATA 3NO3A 3QR0A 1PTGA 1T6MA 4QJ3B 3RLHA 4I8YA 2OR2A 1DJZA 1DJGA 2PZ0A 4RW5A 1DJXA 1YDYA 4F2UA 2PTDA 3OHMB
chains in the Genus database with same CATH superfamily
2ZICA 3S0CA 1VYPX 1C90A 1W3HA 3OGSA 1B90A 1BAGA 1BSLA 4J2PA 3GBEA 4H9UA 2WCSA 3JR2A 3QMRA 4MNKA 2FKPA 5T9BG 3LXCA 3ARWA 2BVTA 2XH2A 1TV7A 1B3VA 2J7BA 5FJOA 1D2KA 3PG9A 4O4WA 4ZQCA 5CH9A 3UPBA 4LANA 3EDJA 3I6RA 3LM7A 3N18A 2QMKA 1E73M 2XJ7A 2J7EA 1HTIA 1I2OA 1IQ8A 3UZJA 3V0TA 1M7OA 3W0KA 2EKGA 3GU2A 5E9XA 4AZBA 5CPMA 1T96A 2YA2A 2XGIA 3L9CA 4RZBA 1J0IA 2FLIA 2GQ8A 3TWAA 3MWAA 4CQCA 3CUXA 4A4AA 3N29A 5FSDC 1DJZA 1RCOB 3GXTA 3PAOA 1UWSA 1VP5A 3BPWA 4S2BA 1MXGA 4DWSB 1O68A 4XZHA 3A3HA 1VS1A 2PTYA 2CFFA 2BASA 2BODX 4R9XA 1BKHA 1J01A 2ISSA 3WMCA 2ACUA 2AAAA 1FH9A 3V18A 4RDWA 4TX6A 1QO2A 1X8FA 3DAQA 4QAWA 2PSNA 3ARUA 3RJXA 1X39A 4GCAA 3TUUA 3NQFA 4ZQPA 2OLSA 2W3ZA 1R3TA 1VYRA 2GGIA 5CG0A 2J77A 4HBKA 3HFYA 3W87A 1F6PA 4NJKA 3KWSA 1GKPA 2P0IA 3APGA 3WD4A 5CPTA 4BCEA 1ITCA 3CHEA 5H1WA 3EX1A 2OWWA 2OQLA 4PMJA 4OIFA 2J8TA 4H1ZA 2NVDA 3IJLA 2WKJA 1NFPA 1LF1A 1UASA 1K8YA 3I4KA 4K2SA 3KX6A 3PPCA 2HBXA 5D33A 3FGCB 2B7OA 1LUCA 5CSSA 2ZUSA 4J27A 3EXRA 4PTWA 3E9AA 3H2OA 3WQ8A 4DLMA 4NASA 4OJYA 3NURA 2C16A 2GSEA 2QGYA 2GUYA 1L6WA 1IWAA 4FPSA 3N3TA 5K9XA 5EB8A 1NY1A 1R46A 3HFTA 2G3FA 2BY3A 4CD8A 2R14A 3TJIA 2BMBA 5BOOA 1V03A 3O9NA 5HMFA 2NSOA 2WZEA 4ORMA 1TPB1 1RD5A 1V51A 4F8XA 3AIUA 3PN8A 4C6FA 1KFBA 1UD5A 2NLIA 4A2RA 1HKKA 3RCNA 2DVXA 2DT0A 4NNAA 1KR1A 1R86A 3SCVA 1LQ2A 2DT3A 5LSMA 1CB2A 3AHXA 3VTRA 4AZ7A 1OFOA 1UR9A 3QTGA 4C6JA 4GXMA 6XIMA 4HZ7A 3BCDA 3NM3A 1D3HA 1ALDA 1CGYA 2OT1A 3I3BA 4KMQA 3V5CA 2I56A 3TJ4A 5BRPA 1RY8A 1YXDA 3KOFA 3Q37A 3LTSA 1S38A 2Q01A 3GYCA 3AJXA 1I75A 2CBIA 3OVGA 1QASA 3L5MA 3AC0A 3KL5A 1K9EA 3AXXA 3UBPC 3W1XA 3VXGA 3AJ7A 3EWXA 1TQJA 3VD4A 2XFRA 1F8MA 4B92A 1ITXA 4WSKA 1JULA 4DI8A 3WQ6A 2DZBA 4FXSA 1HXJA 2YBUA 4XKYB 5I3DA 3L4UA 3T0DA 1WDDA 1SYTA 3LV6A 4NZ3A 3HGRA 3PF3A 1JD9A 3RHGA 5G1TA 3WJWA 3VE7A 1QPKA 3TLLA 3IK2A 4DEFA 5T91A 2P3EA 3V4BA 1MXDA 2G5WA 1P7TB 2GQ9A 1K1DA 2EBNA 3OU8A 3T1GA 2WBGA 4DLFA 4I9TA 5ABHA 3NYDA 4LUSA 4H3DA 3LM3A 3RDKA 3GW3A 3W1TA 4M80A 1EXBA 1V3HA 2X7WA 1EPXA 3MBFA 3TTQA 3IIVA 3MP5A 4DXKA 1C3FA 4R85A 1XH0A 3H54A 3PTQA 2PLJA 3QYQA 2E09A 1CECA 2WHJA 3EKZA 1N7KA 4NSBA 3U2OA 1JGIA 2VEGA 2DZPA 4YHEA 1FCQA 4QP0A 1AD1A 3R89A 3R4IA 1KFCA 2PTXA 3NQCA 3HGJA 1VQTA 1H09A 2QUMA 3LLXA 3WK0A 1ZY9A 3LHUA 3MW7A 3MMUA 4EVZA 2C13A 2G97A 3FXYA 3GTXA 4XIAA 3BW3A 1F9CA 1KCXA 4AU0A 4US5A 3NAVA 4B5WA 1A53A 4WZHA 3BL3A 1KKRA 4KWSA 1PTAA 4RE3A 1OSEA 1GYLA 2A0NA 3W81A 1JPHA 1TWWA 4CD6A 1FWCC 4C1LA 2BB0A 3IUIA 2HCVA 1YIXA 3WMLA 3NSNA 2PDUA 3MCNA 4HTYA 1NDZA 1XUZA 3AUOA 3S2CA 5JIWA 4PUWA 1GJUA 1B30A 2WMIB 3SI9A 2EJ1A 4ZQOA 2XIIA 3MY9A 4KIRA 3EWUA 4MKNA 2OOFA 1IT8A 3QW4B 3SM0A 1W6TA 1E0TA 2PWGA 4ZO9A 3IJ7A 3AMCA 3QY7A 5AZ1A 2CW6A 2VOMA 2JKPA 4LBUA 4DWDA 1GTEA 2ISWA 3UGVA 3AQUA 5H8MA 6PTDA 3DBPA 1A47A 3AMDA 2FPYA 2JEQA 4H6QA 2ADAA 1CXHA 4M6PA 3NL2A 3K5XA 4R53A 5BXRA 2WMJA 2OO6A 2PP1A 4GNVA 1FWBC 1F07A 4I8YA 2OR2A 2VZSA 2OFJA 3TSDA 4QG6A 2X05A 1W1B1 1DPMA 1H7OA 4A05A 4AHPA 3DUGA 2NV9A 3M6YA 3LN3A 2FHFA 2CBJA 4D6DA 4BEQA 1HKMA 4JTJA 2J25A 1GZJA 2ZIDA 3VZZA 1SZEA 4EWND 4F0SA 4YWSA 2PD9A 1FY6A 3VFLA 3F2CA 2A6NA 3URNA 2POTA 1VEPA 4A3QA 1OIFA 1V6UA 5FEXA 4D72A 1X97A 1QK0A 1ZU8A 1N8WA 4EKJA 3V0SA 3I3EA 1E1CA 1E1EA 1Z42A 3PZOA 4GIYA 3WEZA 3LY0A 3VM5A 2ZXBA 2PB1A 4JX6A 3CUZA 3PC0A 4HQVA 4LB4A 3GC4A 2VFHA 1QWKA 5LNSA 4DELA 1Z48A 4CQ9A 4W4QA 3GNDA 1MFVA 4QJ4B 2G41A 2QJNA 2NXHA 3O8AA 5ECVA 4DJDC 1LORA 2ZVIA 5F2MA 2VKZG 3A5VA 5DCBA 3M46A 1FWAC 4CU8A 1OADA 2WM0A 5TNVA 4EACA 1M7PA 4BEUA 1PZ2A 2DV0A 4MPQA 3NL3A 3NQEA 4AXNA 2E1WA 1P4CA 2EEXA 4K36A 2H3BA 3REQA 3SUUA 1I6NA 2QCFA 1DIKA 5DF0A 4JTAA 1EJUC 4G2DA 4G9PA 4C5ZA 1XIEA 2VZVA 4GUIA 1GOWA 4PE8A 5CJMA 2IKJA 3MUZ1 3ZM8A 1WUFA 3QHMA 4WRHA 3V1PA 4ES4A 5JBEA 2QJGA 4NUWA 4H41A 3QRHA 2Z00A 1DHKA 5LZLA 4S3AA 2UY5A 3O06A 1FWRA 2Y63A 4WR3A 5HINA 1CGVA 5A6JA 2E6AA 1V6XA 2F61A 1A3WA 1CIUA 4X9YA 1UKSA 3F2DA 1K6WA 4PBEA 3E0VA 2RH9A 3QHNA 3T0AA 4P5UA 3AI0A 3RUBL 2IQTA 3CK5A 3G1YA 3AMLA 4IX2A 2V3EA 2YCLB 1YBQA 4ML4A 3M5YA 1IEIA 1F3TA 4WY0F 3AYRA 3F7JA 4HD5A 1AVAA 1ZCCA 5AYBA 3BLLA 3M47A 1W3LA 3D3FA 4YVXA 1ME7A 3PULA 4F0HA 1P6BA 1HIZA 1XFBA 5TAOA 1DE6A 5CQ1A 3KCOA 3U4FA 4HNNA 3FKKA 3L7RA 1V3MA 3W7OA 4AZGA 3KRZA 3MSYA 5DY3A 1UQZA 1XGZA 4J4KA 1IZKA 1AQFA 3H24A 4LPCA 3PPHA 3PK7A 1BWKA 4WDUA 4LCSA 2IS7A 4JTEA 3WNLA 1OC6A 1VCGA 1RBLA 4XB3A 3QZ6A 3FOKA 4IF2A 5EGRA 1YLVA 3MP3A 1XD1A 5CJ5A 5J5RA 5I0DA 3FDKA 4RV3A 4XUGA 2Z28A 4GI9A 4DJFC 4ILSA 5C9XA 3TYDA 4L1XA 1E71M 3QH2A 4AF0B 3HM7A 3KS5A 4IM4A 3AS1A 1RQEA 2ZE3A 3C2YA 5T26A 3N9RA 1SO4A 3WBWA 2JKAA 1EYEA 3LCXA 5E93A 4KFPA 1YE4A 2ZUUA 2ABBA 3NQBA 1KV8A 1V3LA 4K3ZA 1W9BM 3POHA 4Q8WA 1FUYA 2QF8A 3AIVA 2X1IA 4GXPA 6ALDA 4P2VA 1ADDA 2DZTA 4HU0A 1NWRA 1XW8A 3VKCA 4FI4A 2OWXA 4YCPA 3CC1A 2XVKA 3KTSA 4H9TA 1M53A 3WNOA 3M0HA 3CMGA 3IGHX 3SCNA 1J79A 7REQA 4TMCA 1X6UA 1A5AA 3VOGA 4Y2WA 1JPMA 2W0UA 3ITXA 1MW3A 4DJDA 2RDWA 4GD0A 2RDUA 1GVSA 5A6BA 2WCAA 4GYJA 1QWGA 3KE0A 2V0TA 3RMJA 4FX6M 1HF6A 2FPVA 7ODCA 4IH3A 4UQBA 4YTUA 5BROA 1HFBA 3VYLA 2WYSA 4AIOA 2EG6A 4CNNA 1DHPA 1XC4A 5CSYA 2B4GA 2W9MA 3WH6A 3W6YA 4UB9A 5AHMA 1ZSXA 4UTMA 4DWSC 4WLCA 1CDGA 1AH0A 1DWIM 3UERA 4LAMA 4O8RA 4V27A 1Y8BA 3IV3A 2Z1WA 4QXIA 2DJXA 1NARA 4PMRA 3ARZA 4LS2A 1QAPA 1XH1A 3GDBA 2DSVA 2UV8G 1OG0A 4LVAA 3Q58A 4TQTA 4QROA 2C3ZA 1EC7A 3M6DA 1HJQA 2AMGA 4RE4A 3BGAA 3UWVA 5HNTA 2OT0A 2X1SA 1GQIA 1XI3A 4JFUA 5KZMA 1V79A 3IIZA 1TTJA 4IZGA 2J66A 1CXLA 4O1CA 4O1FA 4US5D 1A0EA 3RLHA 2DT2A 2F6KA 3DN5A 1XXXA 4MHBA 4AHOA 1EOKA 3G1AA 4MJZA 2J78A 3VKBA 4FLSA 2YR1A 5LKYA 3SRDA 1UYQA 3Q4DA 3VNJA 3CIWA 4KQNA 5GNZA 3OOQA 2VYOA 5HQEA 1CEOA 4K38A 1FWTA 3EWDA 3N1AA 3G1VA 3TFCA 1MO0A 1P5BA 2RDXA 5EBAA 5CZTA 4HHPA 4QS6A 1XF0A 4C7DA 5LIKX 4ZOBA 4JIEA 4WY0A 3TTEA 2QPUA 4BI6A 3C3UA 2VUYA 5BOEA 3CM4A 3KTCA 3SB0A 4YLWA 3QMTA 2DZUA 3QC3A 4GLEA 3ABOA 2I16A 4NI8A 3VCRA 5A6AA 1PIFA 2GDUA 1J8VA 4AZHA 3BLKA 4DPPA 4E2BA 1RJPA 2O9PA 3WQOA 3LTYA 2WJFA 2R8WA 2J75A 4JGDA 1TE1A 3KLKA 1GVRA 2B31A 2HSAA 3CAVA 3P5ZA 4MKSA 2PMQA 2CXGA 3BMXA 2W92A 2VRJA 4IFKA 1IEXA 2IKHA 5DY2A 3TN6A 4LEQA 4GG9A 3E0IA 5D02A 3ISIX 2HS8A 4Q8TA 5JU6A 5MKGA 3T2OA 2GUUA 4YU1A 1R2RA 3ITTA 4MJ2A 2VXNA 4ACYA 4GZJA 3WQ5A 5HNUA 5AECA 1SSDA 1KV5A 2ZXAA 3ELFA 4C7FA 3U6WA 1E6ZA 3GNOA 2HMCA 3T4CA 3WLOA 1TZ9A 4AW7A 3TV8A 2NV2A 5T9CE 2ZWZA 4F0KA 5LIXX 1XRTA 4EAYA 4KERA 3KDOA 1OABA 3POCA 4R7WA 3VOJA 1Q3NA 3DXIA 4IJBA 4JNMA 3O7UA 1X98A 4I7VA 2EPOA 4JIHA 3WUFA 1W5MA 5HULA 4C91A 1YMYA 3IJQA 2XZ7A 2FH6A 3KFTA 1XC6A 2VRQA 2E25A 4E0CA 1XYFA 3G0SA 1V0LA 4MJMA 3ZT6A 4K8GA 4MB1A 5C71A 3SCUA 1ZJBA 4XD4A 2OG9A 5GQBA 5AOUA 2QAPA 5GVJA 5BOFA 5DMYA 2XN0A 3G77A 3KL0A 1VEMA 1BEUA 4DWSA 1UPPA 1XIBA 2HXUA 2O9OA 4Z1BA 5D2XA 1KM3A 2YW3A 2YIHA 4DM2A 4UR8A 2C6QA 2VM8A 4H2HA 1RVGA 4PUKA 1QPNA 3VD7A 1UC5A 1JD7A 3GUGA 4XZ9A 4F2UA 3S5OA 2V3FA 3HF3A 3WF4A 1S2TA 3VGFA 3A64A 4IG2A 3RAOA 4LEFA 4F40A 3B9EA 1ZHAA 4PCNA 2GPTA 1Q8JA 3W1LA 2F84A 1AL8A 3NYZA 4ENLA 3GNPA 3AU2A 3G24A 4DQWA 4K1GA 4W8BA 2YDSA 4LV9A 3DG7A 4MOZA 3KOXA 1IE7C 4KFOA 1PZ3A 4TO8A 4QRNA 2YBTA 1KXHA 3SN0A 1ZAIA 4IFOA 3LRMA 2NZLA 4LVBA 4RNJA 3O6DA 1QPQA 1JDCA 1GOMA 2POZA 2BOEX 3VC5A 1KNWA 1R6WA 4HZ8A 1E6XM 1XSKA 3LMZA 4QDWA 3FJLA 1XLBA 4UWMA 3UPMA 1IIHA 4KCVA 3MDUA 4XK2A 3GDLA 2Y1HA 4Y8EA 1W5NA 3FVMA 3BTNA 3BSGA 5FOOA 1C9WA 3ABQA 3HG3A 2RJGA 1NM9A 2ESCA 3V3WA 2YXGA 4FLQA 2SFPA 4QJ3B 5CZJA 1LG2A 2A3AA 3FS2A 3RR1A 4F3HA 1CW2A 2I57A 1VBUA 1ZCOA 2G8ZA 3IWPA 5K9CA 4HYRA 5HK4A 1K6AA 1EXPA 1S3TC 1RH9A 1P6CA 4PBFA 3EKGA 3L66A 1JL8A 1K8ZA 4JYEA 3LPFA 3FX4A 4GUFA 5A8OA 1V8EA 3TJLA 1V3JA 5KZEA 3LGGA 1PKYA 4JPGA 2WSPA 2WSYA 3H70A 3EOOA 1MI3A 2J6VA 4G1KA 2BWGA 2A5HA 1RV8A 2BGQA 1JJKA 4HVXA 3L0KA 2ZVRA 1EJSC 1E51A 1N82A 4R9OA 1XGDA 3T6CA 4RV8A 2W6RA 1UPMB 1NOFA 2GSHA 1E4LA 1LL7A 2EAWA 1UUMA 2QV4A 2C15A 3ZT5A 3SCWA 4AZ5A 3HG2A 3BLDA 1IGSA 4PODA 5JH1A 2IXUA 3A23A 3WZ0E 5ENLA 1EA9C 1XD0A 2A7RA 2DZAA 5M1TA 4L9XA 2ZX8A 4M6VA 4X63A 4O15A 1GG0A 4GX9A 3IEBA 1PDZA 2QUVA 3W1AA 3GHTA 1VIZA 3OG3A 4JTUA 3INPA 3LI1A 1JCJA 1TUXA 4DJDD 4ECLA 2ZUMA 5A6BD 1U1UA 1DE5A 3KWXA 4I9MA 1WKYA 4S23A 3RF9A 2YCEA 4GY1A 3AROA 1W1YA 3TNBA 3PFRA 2Y85A 5DCEA 3GG8A 1QNPA 4O17A 2C1GA 3KVMA 3BK0A 1C93A 4M6QA 4NY2A 3P2VA 2DQXA 1V6YA 4B3ZA 1JQVA 3XIMA 1PSCA 2QCGA 4NU7A 5LHFA 5I6SA 4GACA 1GEHA 3N4FA 3PWAA 1ONXA 2ONEA 2D23A 2H8ZA 4NJHA 5B80A 1MRAA 3B9DA 1VCFA 2E3ZA 5K4XA 1F61A 1QOXA 3DDMA 1FXPA 2CCRA 2CBVA 3EX6A 4ZBCA 4BS0A 5AYYA 3CNYA 3DFSA 3TZFA 2HVNA 4Q33A 2V5CA 3G1HA 3WUBA 2WZTA 1LRQA 2PWEA 1EJRC 2E8ZA 2FZDA 4NRSA 5LYRA 1JNEA 5JVLA 3D0CA 5BW6A 3P7YA 1XCFA 3B0XA 1JZ3A 1PBGA 2E67A 3O2LA 2HVMA 1X1NA 1T7LA 5L6UA 5LNRA 3O1NA 1FDJA 1XPGA 1YXYA 2B7QA 3WDJA 1TR1A 5A94A 3BGGA 3SUWA 4AZCA 4LGXA 1K8XA 1S5TA 1EJVC 4NXKA 1SW3A 3CB3A 4NZ4A 5AB3A 3WNMA 3OIXA 1EKOA 3W71A 3APTA 1REQA 1SJAA 2WCGA 1BKSA 4AWUA 4M29A 2P10A 4J3ZA 3TQPA 4KEZA 3GKAA 3IIXA 1XSIA 3WFZA 4PUDA 1ISXA 1JYWA 2J9YA 1H3GA 3LSCA 1E15A 3T8LA 4IPJA 4S3GA 3T07A 2F7FA 4YTSA 3W86A 4O0ZA 1SO3A 4RE2A 1FWGC 3IS4A 1WXYA 3GR8A 4M1RA 4ASTA 4DBWA 4JL1A 4Q8OA 1UD6A 2QAFA 4DJFD 3QSTA 1XDJA 4DF1A 1EHNA 4RX0A 4JQ4A 2ZZ7A 3EDEA 4DM1A 5HUOA 4M82A 1EP1A 1R3QA 1GQKA 4HA1A 3S5ZA 3L2IA 3GTFA 4XQ6A 2PDKA 1YE6A 4KRZA 4M81A 2XU2A 4JHMA 4CQAA 1AW2A 1I9CB 1JDDA 5E6ZA 2FZMA 4ZGYA 1TPH1 4XZBA 3GDKA 4X60A 1CCWB 3GNNA 3ALFA 1ONRA 2FHCA 1YDOA 2WB5A 2P76A 1M41A 4JNZA 1OB0A 3RK8A 2FYMA 2WPBA 1TUFA 3MPGA 4N9CA 1SU5A 1JQXA 3HJEA 1A50A 5A95A 1HQTA 4O1BA 4CEXC 4DXVA 1OGSA 4ZXLA 4F48A 3DBNA 3MA8A 4JQ3A 1YRRA 1BG4A 4L4OA 2JGYA 2NQHA 4DUWA 2VC5A 1QDSA 3ONCA 4NAEA 3QPYA 4JYDA 2PS2A 4RL3A 3HIJA 5CGTA 2CLLA 4CUCA 3EX4A 3WNPA 4UR9A 4J35A 1LL4A 3Q45A 3QOKA 4GNJA 1A5MC 3KTXA 3EEZA 1FX6A 1JZ5A 4IGMA 3N2XA 4NZ5A 2KX9A 4FMVA 3V0UA 5HJYA 1QOQA 2RFGA 2H8XA 4IPIA 4LQ1A 1JDFA 3UJSA 3EX3A 2ZCGA 2OX1A 3SW6A 3GYEA 4DWSD 4IQLA 2X30A 2ZOXA 3BG3A 4F66A 2KZHA 1YPFA 3CL6A 5FD0A 4UXDA 4JKKA 4OTKA 1RK5A 3S3GA 1UIOA 2BP1A 1DIOA 4MYXA 2HPIA 4ZB5A 3W37A 2YL9A 4U3AA 3PANA 2V6AA 1FVPA 1W8GA 3EXTA 2BVWA 3URQA 3QQWA 4Z0JA 4IMAA 5G4EA 2VNCA 1G1YA 4LWWA 3WKZA 4JS3A 4DO7A 4ZA0A 1GWJA 2PEVA 1KTNA 4DBSA 3ZVHA 1YTKA 3BAKA 2PDLA 4GGHA 1E55A 3ARPA 3BZGA 3I6EA 1BYCA 4KGLA 3USBA 1I2PA 3Q65A 5FJTA 3MI6A 5I23A 3AIBA 4R88A 1XPYA 4DBDA 1HL9A 1C8QA 5A8QA 1S1RA 2EJAA 4NJGA 3WLTA 1JZ6A 3GDRA 2VGIA 1S5NA 3M0KA 5FF0A 3WLRA 2GWNA 2AL1A 2DW6A 4NAFB 3JVAA 3B8UA 3LQGA 4FZIA 4HP5A 5BZAA 2J47A 3IVSA 3A4AA 2DUAA 3ECQA 1OYAA 5FF2A 1AJ2A 3NPXA 1TJRA 1WV2A 3MYPA 2FPTA 4IICA 3WH9A 3DG6A 4LAUA 2ZXDA 3LCFA 1UR0A 1G94A 3T2QA 3W1UA 2FB2A 3ARVA 4NILA 3WDQA 3ARSA 2QJJA 3C2OA 2OELA 2FVLA 2CIPA 2IPJA 2HDJA 2E1DA 4KS0A 1XYCA 3AS2A 1ZALA 5G2IA 5A6TC 4AEEA 3FKRA 3GAYA 3W84A 1T5AA 3ERPA 4RW5A 3WX7A 4AC1X 3NO5A 4OU1A 2PDYA 3LHZA 3LYEA 4V33A 2ZE0A 1OCBA 5JQ9A 1V02A 3CPGA 3W01A 3HPZA 3ZQ9A 4U2ZA 3M0VA 4LT9A 4DVOA 4AD1A 2VR5A 3PTDA 4O0QA 5FL0A 1RALA 3VX1A 3VE9A 4OFCA 3IIOA 2G3IA 1DIDA 3NM1A 3DI0A 3GHUA 2D0GA 3ZLFA 4LFYA 4XWUA 1XIMA 3VD5A 2O9RA 1UMLA 1Z41A 1JPKA 1ZLPA 1GZ1A 1TWSA 2BGNE 2G3MA 3C2EA 4G7FA 3P62A 3IPWA 3UFYA 4N6EA 2PWDA 1PCKA 5DELA 1XX1A 3G1FA 2VC9A 3SN1A 3PJWA 2QV5A 3WD1A 1LZOA 3SCSA 1F76A 4PH6A 4YJ5A 5C70A 5CLWA 4DF2A 1K4GA 3VC6A 3BW4A 3VOIA 3VGHA 3QTPA 5FACA 4I9AA 3CV2A 3UCDA 1QT1A 4B91A 1H60A 4UNIA 2R1LA 2Y8VA 4ATWA 4I5RA 1VB9A 4GHRA 4UOZA 4PMZA 5LGXA 3N19B 1WOBA 3RM9A 3FSUA 4JQAA 4OV4A 2ACSA 3VFCA 4LV4A 5EL1A 3EOSA 1V5XA 3GXIA 5CAHA 1U2YA 1ZBWA 2Y89A 1QNQA 1PIIA 2GJLA 3MJYA 3UY7A 2W67A 4B2DA 4GH1A 1HUVA 2INFA 4E3TA 2PDJA 3RU6A 3SCOA 1NWTA 1VZWA 4IUOA 3V75A 1DJWA 4HU4A 5DMNA 2YB4A 4AIEA 5HOSA 3AHYA 4I8DA 1JVNA 5LNUA 1VRDA 3KVJA 5IDZA 3USZA 1UJQA 1UP2A 2VO5A 3DYMA 4S39A 3GM8A 1O7AA 2G4JA 3PPFA 3M5XA 4UNLA 3S2LA 2VDGA 3FIGA 3R13A 2PLMA 2F6XA 1UC4A 3C52A 2QVNA 1THFD 3TCEA 4V1XA 3WN6A 1SR0A 2Z2UA 2E9MA 1L2QA 4QG9A 1ZFJA 3L5LA 1BD0A 4RZ5A 4I3GA 4ADSA 2VFFA 4WD0A 3Q2DA 5D4YA 1PS9A 5FJUA 2AGTA 5A2BA 3OBEA 3A9IA 1UBPC 1KBJA 3RFAA 4D8AA 1E3ZA 4WX2A 1WZLA 2CC0A 1D7FA 1A5SA 2Y70A 4WOQA 1J5TA 1NFBA 1JFXA 2YA1A 3SFKA 4E2VA 4DYKA 1TJ2A 3K4WA 3W7CA 4H9VA 4HMCA 3UNTA 4W8LA 1U5JA 4ZQRA 5CLTA 3WLQA 1JZ7A 3R7MA 2XHYA 1PB0A 3EPMA 3ZLGA 3CZ8A 4D6GA 5DN1A 3ME3A 3TONA 1QNVA 3HB9A 3O0KA 3W75A 2JALA 3S1WA 1QR7A 4MZ8A 4UTTA 4RW3A 3HURA 4YCOA 3W1PA 3SRFA 3EB2A 4DBUA 5J8LA 3T44A 3LCHA 3SECA 1XG3A 4O1EA 1T8QA 5D9NA 4XZIA 4FX8A 1ELSA 2Y8UA 3CAKA 1ZQ5A 2QDGA 4N02A 4TX8A 1XGEA 3TEVA 4IGNA 3QGKC 2J74A 3VDAA 1O5KA 1UWRA 4GJ1A 1OX5A 3GNXA 4D8LA 1J4EA 3FNDA 2CHNA 4AC7C 2HE5A 2PBGA 3CHVA 3MO7A 1NH6A 3GXMA 3O15A 2PRHA 4IXXA 4FR6A 3H4XA 1GW9A 1IXNA 1KGWA 4EK7A 4KEMA 3M9YA 3KUMA 1E5NA 1GOXA 3QEZA 1KC7A 3MI2A 1UH4A 4HA4A 2BFGA 3VAVA 1F3EA 1PYFA 2X1TA 4HSOA 1AQMA 2QDHA 3CB8A 3LSBA 5F1UA 5TD4A 1HL8A 3UGRA 5IHRA 1MUWA 2AMXA 2Z2AA 4HHLA 4H01A 4B90A 4YL2A 4G6CA 2WMHA 3OZOA 1DJGA 4QCFA 3B8IA 2R9RA 1WZAA 3KBSA 4ZMGA 4KWVA 5TF0A 1XQLA 3LHWA 2IKGA 3AYVA 1PX4A 4Q6XA 1VFHA 3CL7A 4G56A 4QCEA 1SZGA 3TTSA 4Z0SA 1EUNA 2WZHA 4CN4A 2AQOA 4MFEA 2TRSA 1NDYA 3NPVA 5HNNA 4GBDA 1LT7A 3W83A 1GPWA 2BG5A 1UOZA 2YZ5A 1RSCA 4MMWA 2AGKA 4F0MA 2WNNA 3NOYA 1G67A 3GS6A 3MB9A 4FAMA 1AZ2A 1KGXA 1Q6FA 3JRKA 3C8NA 4QBXA 4CNPA 1ODZA 4O4VA 1A3HA 4JEQA 5AC8A 4U2YA 2NQLA 3GR4A 3UXLA 5A6KA 2XSXA 3A13A 5GNXA 1U83A 3HMCA 1VFLA 3MCMA 4Q7IA 3AIQA 2WZMA 2OO0A 2DORA 3BAJA 4TUFA 2QCDA 1BFNA 3C61A 4DZHA 2ATSA 2Y61A 2IQDA 4C6NA 2V69A 2CZEA 1I0DA 3W6LA 5AHEA 1PTGA 2VX6A 1WZMA 1POKA 2OSWA 3TA6A 3OBAA 4UTWC 3T42A 1ME8A 2QJIA 2DSKA 4ZQNA 3UETA 4ZODA 3LX9A 1NOWA 3S6DA 1A4LA 1HG3A 4CLMA 4V1YA 5D9OA 4H8VA 1RJRA 4ACZA 3WJYA 4F2BA 3UZ5A 4EF9A 2A1YA 1PJ9A 1TYGA 2QULA 1TA3A 1B5TA 4XBJA 3WG6A 4QX4A 3BOXA 3RM4A 4UQAA 2DSWA 1WDQA 4PFHA 5ABFB 2GOUA 4GPNA 2X41A 5HWMA 4XAYA 4LXFA 1H7XA 1J0JA 1QNSA 3AZRA 1TZZA 3P61A 4JX4A 4DPQA 1Z9AA 3WH8A 1FWDC 2WHMA 4Y9NA 1PDYA 1I2NA 4X22A 4O13A 3UZZA 4WIWA 1GEQA 3M4HA 1OX4B 3T81A 1QATA 3ABRA 1TG7A 3N2OA 1OINA 5HNRA 3HV9A 1W9UA 4PYSA 2NX1A 3E0WA 3S46A 1TR9A 2J27A 3R0KA 4WXZA 1KCKA 1FHDA 4JZ5A 5IOBA 4Y9AA 1SFTA 3B40A 3FCPA 1GJPA 1ZPTA 3LHYA 1B3YA 4A22A 5K9DA 2R94A 3C2RA 1CX9A 1VF8A 3URAA 1AJ0A 2OMAA 2V81A 5CC6A 2TODA 1K7XA 1O5XA 1BWVA 1VC4A 1E6QM 5CXPA 1WB0A 2OPJA 1MWOA 3PZNA 4MSSA 4GH3A 2BVDA 1NWUA 3KBNA 4IQEA 1BTMA 2YFOA 4K39A 1H4PA 1JUBA 4QSFA 1SJCA 3G6LA 3SSZA 3WH7A 4E8DA 3SQSA 3QSRA 2XINA 2NVAA 2PU1A 4KT2A 2E0PA 3D6NA 2P3ZA 1GT8A 3Q67A 3AYTA 4WDWA 2V67A 4US6A 5DEZA 1LWIA 3DESA 1FHLA 1WX0A 2C19A 4LALA 2NW0A 4A8IA 1TMLA 3P80A 1JUEA 3UG3A 3NQGA 3TN4A 2HZGA 3IGXA 4ROPA 1H7RA 3N9SA 1S2VA 2XWEA 2CEQA 1C29A 4GJJA 3QQ1A 4P8UA 3VCNA 5F1VA 1EX5A 1CXKA 1JPDX 1GOIA 3CZEA 4BWLC 4MLRA 4GK8A 3LHVA 1L8PA 3DFTA 1SFLA 2XGZA 4B2DD 4GUJA 4GZ7A 4WDTA 3VGBA 3VIJA 2ZTKA 3URBA 4JCLA 3W1RA 2DP3A 2FGLA 3MZNA 4HYWA 4FR1A 3OW1A 2P50A 2AL2A 3AXKA 3OJGA 2JF7A 1P48A 4F2TA 1BRLB 1CXEA 2HK1A 4IFRA 1RR2A 4BF7A 2VOTA 4RDZA 1N8IA 3EMCA 1TMQA 1KWGA 2QIWA 3H2CA 3QVQA 4J3TA 3B8VA 1EO5A 3TQVA 4QNWA 4J9JA 6CGTA 3BUVA 2WLZA 2VEPA 1IEWA 2VFEA 1KWKA 2W63A 3F03K 2XIJA 5JUVA 2CLOA 2Q6ZA 4JAWA 4FIRA 1UG6A 1AG1O 3LZ5A 4OVXA 5A5WA 3WQCA 4L5ZA 2W66A 2REQA 2XVPA 4BQ5A 3AIWA 1ENUA 1OD8A 3OA5A 3QFEA 1NTHA 1CTNA 4TOQA 2D2GA 2WHKA 4O8AA 1TWDA 1G4PA 4KKXA 1DXFA 2GVEA 5HMSA 3THCA 2Q71A 3GXPA 4JIPA 4RDVA 3U2ZA 4FALA 1EH9A 2DGAA 1IEVA 3DEQA 1JZ2A 3VOFA 1TJ0A 1KD0A 1Z69A 3VIMA 3WLJA 1FHVA 1XYZA 3B3DA 4YXGA 4ZSUA 4GI8A 1GOKA 2OZ3A 4IGSA 1NSJA 4UR7A 1E56A 2C14A 2VFGA 1WZKA 3H55A 4J3XA 1FH8A 3V36A 4CVUA 1E9YB 4NZJA 3W02A 1K02A 2R82A 2V3DA 2W62A 3ALGA 5EPDA 3WQFA 3BLFA 4UC5A 1E4IA 2WNQA 4LVDA 1DP0A 1RCXB 4IMEA 3NZRA 1X7FA 2Y7FA 3EDDA 4JXCA 2Y24A 3KRBA 1JIBA 2YFNA 4MJ4A 2HQAA 1PX8A 3BCJA 3HTWA 5A1AA 4I6VA 7TIMA 1Q7ZA 3W82A 1TX2A 3B0VC 1K7EA 1TRIA 2IPWA 1B3WA 4FIQA 3FV9A 5AHNA 4Q4SA 1NFGA 1VRXA 1RHCA 2Q8XA 3HO8A 4PCPA 2FQIA 2QUUA 1H62A 2FVMA 2VR2A 3VZYA 1AMKA 2P8CA 3L4XA 1H51A 1EGMA 2G37A 3NA8A 4GVGA 2VDIA 2CNCA 1C8XA 3PZMA 5PTDA 4HPJA 2E4TA 4E4PA 1G6CA 1PWLA 4GI6A 4UBPC 2CERA 2GSJA 5E70A 4Q7NA 1HJXA 1OFPA 5I3FA 4NYUA 1HJUA 4QQUA 4LX4A 2G3JA 3PUEA 4O54A 2V9DA 1SUXA 3P5YA 4O0KA 4RXFA 3VIGA 3RILA 3EWCA 3SDOA 2X1RA 1OC5A 4QE5A 2CZ5A 3RYSA 3V5FA 5JIPA 4LUJA 1DOSA 1KTCA 5E0FA 4LAOA 5GJPA 2WV8A 5A8PA 2YSWA 2D22A 5CPQA 1V7YA 3W4RA 2XFFA 2I5QA 4B5SA 1PHQA 4WKHA 1JYNA 4JFVA 3M0IA 1RQBA 4ZSTA 3W7LA 4HPNA 3K2GA 1PKLA 3XINA 3VNLA 3U2EA 1ZTVA 2FVKA 3U7VA 3GFYA 3JUGA 1JF5A 1GKQA 3TYZA 1FKXA 2QIIA 4UFIA 4EANA 4Q8NA 1TELA 1QW7A 1F4HA 1BSIA 1UP3A 5DX7A 4Z17A 1OFAA 3S4TA 1EIBA 1XLAA 1FWFC 4PTNA 4Z2JA 4ATLA 2QCHA 3HQPA 4LTSA 3FAXA 1YTEA 2ZFAA 2NWSA 3P60A 3THAA 1PIGA 4E8CA 4QE1A 5AYIA 4EXAA 5TIMA 1NP0A 2FTYA 5LHEA 4FNRA 2QCNA 2X8RA 1Q6RA 2OODA 3W24A 4YTRA 4GVHA 3B9NA 1VR6A 4HYVA 3WQVA 1FH7A 4GYPA 1JR1A 3ITVA 3LHTA 4XO7A 1LYXA 3R12A 5AYZA 1AZ1A 3F1QA 3EB3A 4MY9A 5M5DA 4CCEA 3MUAA 2RJHA 3S6OA 3H2FA 3MQTA 3OTRA 3CQHA 1OHLA 3B0UX 3BXWA 1H11A 1LCOA 1VD6A 3BARA 3G3MA 5A6MA 4GX8A 3BSMA 1BXCA 1H2JA 4LUIA 5FJRA 4MWAA 3W9ZA 3FVDA 4C6PA 3AMGA 4UTLA 4CN6A 2EHHA 3VNYA 3P3BA 3VGGA 3QV7A 1XLIA 4FF7A 2PDPA 2OU4A 1E1FA 4E6MA 1KQZA 4HCHA 1XR2A 1E4MM 3NZPA 4RNHA 4FXRA 4UTJA 3GRIA 5A3HA 2V5DA 3BSHA 4UTUA 3AALA 2GK1A 4BQ3A 2AOSA 1TPEA 2VFIA 3P67A 3S83A 3EA3A 2X7VA 4J5NA 2ZUTA 4MZYA 3ABSA 2JIWA 3VKKA 3E2QA 3VKJA 3ZOAA 3W26A 4V15A 3O6CA 3WFAA 2VWSA 2A21A 4PSPA 3SZ8A 3UU0A 2EQDA 2DZWA 3NOEA 4C5YA 5CBJA 3AS3A 5CC5A 3S8HA 3H12A 3TFXA 2WNWA 4QISA 4IP4A 4DF0A 1QHOA 4GBUA 3GX9A 3CUJA 2WZIA 3VA8A 5ABEA 2VRKA 2NUYA 4PMNA 4NP7A 4H9XA 3UZWA 4XKMA 4FLOA 4F4RA 2EXOA 3HQOA 3I6TA 1IR1A 1JGMA 3S2MA 1OCJA 2ZQ0A 3MSGA 2I17A 4BKNA 2D0HA 1OK4A 3G1DA 2QMJA 1UD4A 5G2WA 1N55A 3EB4A 3HBLA 2PGRA 1QVBA 3AFBA 4G7EA 1A4MA 1ECEA 3IVTA 5EFFA 1IGWA 1G4EA 1TPUA 3K8MA 4J7RA 3B9OA 2WSRA 4YIWA 3K8KA 5CJNA 2WC4A 1PV8A 3ONBA 4PC8A 4D8ZA 1HJWA 3U5UA 3I3DA 3G0XA 1UR8A 2NX3A 4X2RA 3UZYA 4L4PA 4ZXOA 5EMJA 4GE8A 1MFUA 3TR2A 3U5YA 4U28A 2R1MA 3HPAA 1E9LA 3Q94A 1ZENA 1Q65A 2MNRA 4HZMA 1L8NA 3B06A 2OXNA 2DT1A 3M0XA 1LWJA 1R87A 1ICSA 3OLEA 1ESWA 3RX4A 1VFOA 3KRSA 4WVXA 4NG3A 3RLUA 3AIRA 4GC4A 1RD6A 1DQWA 1T40A 4KCUA 4F79A 3C5QA 2NSXA 3DU0A 2G50A 4A6GA 1DTUA 1P43A 1TZ7A 3G22A 4Q4RA 2P53A 4GQGA 4QGCA 5HJXA 2X16A 4XZWA 2F8QA 1GVYA 4O28A 1TSIA 3C0SA 1UZHA 4CU7A 4PUEA 1Q8AA 2RKXA 1XBYA 4S3FA 3UR8A 1OQFA 4OT7A 5I03A 3BLEA 3NR0A 4H9ZA 4LAZA 3MUY1 5TBOA 2PI6A 2E5DA 3MP4A 2QLYA 4LYKA 2GFTA 2EPHA 2WM1A 3RLGA 3DERA 4RDYA 2V2DA 2Z6JA 2Y8KA 2OEMA 5TQLA 4FLRA 2GVYA 1VCVA 3NL6A 1HO1A 3IV8A 3OLDA 3MJMA 2BXZA 4PB3A 1TPDA 2G3NA 2YA0A 2QQ6A 3UCCA 1J0YA 4JTCA 2F2HA 2A79A 1QI3A 3MBDA 1FDZA 1MXSA 1I4NA 4IXHA 2QNEA 3UXDA 2X09A 2YXOA 1NWSA 3NZGA 2J7FA 1RP9A 1IF2A 3WDHA 1G4TA 1IIGA 5D09A 5AHIA 3CT7A 1XHGA 1QCWA 1WKDA 2FJUB 2GWGA 2OOGA 3CO4A 1YDNA 3CIXA 5I3KA 3W27A 1PYMA 3W7HA 5AKQA 4IP7A 3RGTA 3SUTA 3WJZA 3VMPA 4GRSA 4L9ZA 4PSRA 1VKFA 3H21A 2VFDA 2YYUA 3LTPA 5D30A 4EXQA 1YDYA 3PBWA 3GZAA 3E12A 3UVAA 3WQGA 4PTXA 3R94A 4IUGA 4C6BA 4A8NA 2PE4A 3B9AA 2AAMA 4LW7A 2PPGA 1NEYA 1UMYA 1MW2A 2VCBA 3OO2A 1MDLA 1WAUA 3MYOA 2GUBA 5XIMA 3T09A 4HOXA 1LUCB 5HR6A 3KHJA 3FLUA 1MYRA 1GOQA 3UG4A 4U33A 1YKWA 2PRLA 2OEJA 3K30A 3TC7A 1AA1B 1VHNA 3L12A 3FY1A 2PAJA 3QMSA 3W76A 4ZOEA 4UZUA 1HVXA 5F2GA 5F4XA 4XSLA 3W23A 1JI2A 4KCWA 4P8VA 3RXZA 4PMQA 4H6RA 2Z4GA 2XN2A 4N6FA 3GTIA 2A3EA 4IMDA 3W22A 1CZ1A 4MB5A 3T78A 2ZRYA 4E5TA 1Q6OA 1WYIA 4LF2A 5KINA 1BYBA 3B4YA 1V0KA 2BVYA 3K8LA 5HXMA 3GVVA 1P0BA 5KMYA 1TFVA 3S1XA 4PUUA 2W4XA 3L4YA 3FA3A 3IJ9A 4RNFA 1A5BA 3W7KA 4TV6A 2A3CA 5DO8A 3TMQA 3WENA 5HUPA 1NAL1 5D9MA 1D3CA 3NXLA 1BXBA 2VEIA 3MU7A 2IKIA 1K03A 2OJPA 4CD7A 1PPIA 3E1F1 4DRSA 1UWUA 4N2YA 1GVEA 4NNBA 2OSYA 3GH7A 3CUIA 2CLKA 4HNOA 3K1GA 5DMLA 3TVAA 3OIHA 4DBEA 2D2OA 2CLPA 5LGZA 1K9DA 1XINA 2JKEA 5AZ0A 3A3WA 4WGHA 2BY0A 1LM1A 3D46A 4W8AA 5XIAA 3W2NA 3GZ3A 2NQZA 3E2VA 2IPGA 1YNYA 2DZXA 1K9FA 4AH7A 4LYPA 3ES7A 2D73A 3ARYA 4AEOA 3PUGA 4FXJA 3UP8A 4AD5A 4YTQA 3SURA 1GG1A 1BQGA 5EYWA 1W5PA 2H9AA 4EF8A 2WQPA 5CSUA 2HE8A 4DIAA 4AD3A 4DUXA 1X38A 4JL2A 3HQ1A 4DYJA 4LUSB 3DFPA 3B04A 3WQ4A 3DHFA 1S2AA 4PGLA 3N2TA 3AISA 3M41A 1EC9A 2G0WA 3FEMA 2YLAA 1N8FA 4DNHA 3BOFA 2ZRUA 4OE7A 3F4WA 4BQ4A 3LPOA 3NVTA 2QJMA 1NVMA 3GB6A 3VUSA 4Y90A 1W3KA 2P88A 2VWTA 3ITGA 3QF0A 2W5FA 4C60A 1PKMA 3CEUA 3BGJA 1N2VA 1QK2A 3RG6A 3TWBA 3NQVA 4MWAD 1LP6A 5A8GA 3MCOA 4Q4KA 7TAAA 3N9KA 2JE8A 3R8HA 3QZEA 1UKTA 1KB3A 1SQ7A 1M3UA 2ZC8A 1V4YA 1ISVA 1Q13A 3D47A 3CMFA 4JDBA 4EPDC 2PZNA 3GR7A 2XISA 2O7SA 1DXEA 2A7NA 4KWWA 2PDBA 4OBSA 4M7SA 5MF5A 3NG3A 3MKCA 1KW1A 1G7VA 1BTCA 1UIPA 5FIPA 2Y4SA 3WD0A 5RUBA 1VEOA 4AY7A 1D8WA 1CBGA 4AG0A 1OX4A 4DB7A 1GPFA 1W1VA 1CB7B 4QR6A 1NP2A 1JZ4A 1R9XA 1WKFA 2GOKA 4JY8A 1KCZA 1ZS2A 1MQQA 2A85A 2CPUA 2DDXA 1KM1A 2FDSA 1EGZA 4AWSA 4L64A 4AQLA 3OODA 3MV01 4BZYA 4RCXA 1W1IE 1W1PA 3B97A 7ENLA 3RU8X 4UQDA 3O05A 1US0A 4J1OA 3LLDA 4ERGA 1EB3A 1C9DA 3CMJA 3TK7A 4FX7A 4NI3A 2PZ0A 2FFCA 4IIEA 1J12A 5IBXC 4MB3A 4DAIA 3E49A 3TJXA 3STEA 4IQDA 1UROA 5G1YA 1QI2A 1W9VA 1EDTA 3ARTA 4ZR8A 3W1MA 3VUPA 3SN4A 2JF6A 4HCDA 2PC8A 5AFDA 3LZ3A 1AODA 2CESA 4OBTA 4M51A 2EG7A 3E0LA 3TYAA 2PLCA 3U4AA 1HP4A 4D6IA 4AYGA 5LNVA 1IZCA 1CNVA 2HRWA 4Y9MA 3WF1A 4JTHA 3W7RA 3GK0A 4O16A 1I2QA 2PDQA 3VK5A 1W56A 3WBAA 3KM8A 1YADA 1D8CA 2O92A 6REQA 3RM8A 4Q8UA 3WNKA 3CWOX 1FWSA 5GJNA 3ZFHA 3CGTA 1E4NA 1L9WA 5CZSA 3LPGA 3FYYA 1EZWA 4PMDA 1OF6A 3R79A 4M8UA 3GE7A 3EWBX 5C2GA 3A22A 3P8IA 4JR5A 3VCCA 3FSTA 1S3HA 4LU0A 2BDQA 3C3NA 4C90A 1E1CB 5LIYX 1NELA 4MDPA 3RMEA 2C71A 1ADOA 1BRLA 1GZGA 5FA5A 3L68A 4PL1A 3I68A 3TOPA 4GC3A 1YQ2A 3UW6A 4QSHA 4BI5A 4W5ZA 2GVLA 3PS7A 2Z2BA 4YYFA 5C5YA 5CPNA 4GO9A 1LG1A 3TN3A 1WNOA 4DUVA 3L4VA 3BVJA 2QT3A 1EWEA 1KGUA 2C0AA 2E9LA 2YKKA 1XYBA 3VINA 2OGJA 4QITA 3CH0A 1Z3NA 4C6KA 3KL3A 4C1NA 2FMNA 1RPXA 1YTDA 1F7BA 3REQB 4YPJA 4KCTA 5HDRA 3TIMA 3UQNA 5HAOA 2CZDA 3LQLA 2ZDSA 3NPWA 4AD2A 2GGJA 2GJXA 4GFIA 2FHBA 3N6QA 2QHAA 2DUXA 3NQDA 3K4AA 3VNMA 3NUKA 1TMHA 2O7QA 5AVHA 2CKSA 1E0WA 3V7PA 3O63A 2HBVA 3SIMA 4LCRA 3WQPA 2D3LA 1VAHA 1QUMA 4HJWA 1A0CA 3B8TA 4ZTXA 4KFNA 2J9XA 1T6MA 2W79A 4KGJA 4PA8A 1XKJA 3OQ8A 4M5PA 3DI1A 4JTIA 5M17A 3HN3A 2HEJA 3PB0A 4GKTA 4P7OA 4C7GA 2GJRA 1YBQB 4R7OA 4D9PA 4GKLA 3LERA 4XD3A 5E1QA 3LGDA 2ACRA 3OGVA 3ZXWA 3NQ2A 1Z89A 5C2XA 1C7SA 4H4IA 3GW0A 4IMGA 1KFJA 3S47A 1ONEA 2X40A 3MMTA 2J6XA 2WVVA 3MC5A 1MEIA 4PN2A 3QW3A 3VIFA 4LYRA 4E2DA 1XLGA 1C92A 4JTFA 4V2XA 2QCCA 4X2PA 1OFRA 1F4AA 1FDYA 5D05A 4P8XA 3ZJ7A 1NF7A 1XLLA 2D3NA 4GY0A 1Q4WA 4OECA 4UFJA 4XAPA 3UF9A 2A2IA 1J11A 1E9IA 2INZA 1VBRA 1UZDA 3CWHA 3UYCA 4NIRA 1YXCA 3VIIA 3PG8A 4PEEA 3VI2A 1E0XA 3WUGA 2OSXA 3BV4A 2PDNA 1ZJIA 1W9XA 4IHCA 1UD8A 4BF9A 1LLWA 4AXKA 3TP4A 3TROA 1SW7A 1MZHA 3STFA 3W2MA 3CQIA 1RZMA 3IJ8A 3IIPA 3UR7A 1MW1A 4REQA 3PVFA 3EPOA 3FDGA 4KPLA 3C0LA 2BHYA 3ITYA 1QOPA 2JK2A 4UNKA 3FJ4A 1B3XA 3VILA 4Q3MA 2PDHA 4FK9A 2C91A 2CLEA 3SAZA 4E4UA 1XLKA 3C86A 8XIAA 2O4MA 1Q6DA 2YL6A 3CZKA 2OKTA 3M0ZA 4B9ZA 3G0UA 4MADA 1Y0EA 5IHSA 4O19A 4L1WA 4HNTA 1I0BA 2DFAA 2GL5A 2ZA2A 3LEPA 4CU6A 3N34A 4OHQA 4F9JA 4D1IA 4UCGA 2ISFA 2JIEA 6TIMA 4S38A 4EAMA 1A3XA 3UA4A 2VCAA 3RO6A 7REQB 1H49A 2YLLA 1L6GA 5REQA 4FS9A 1OD0A 3DHPA 2WQDA 5FJIA 5KZDA 1A5LC 3PBVA 1EEPA 5LNWA 3WO8A 1F3XA 1NQ6A 1Z32X 2ZKMX 4XAGA 2JGQA 1UZ1A 3CBWA 5IDIA 1XV8A 2NWRA 3TZNA 4FNUA 4MY8A 4N4QA 1PWMA 2E5BA 3T8QA 3PFMA 2V5JA 3TYEA 4GO8A 4LS0A 3GSMA 2BHZA 5M03A 4AAJA 1ML1A 3S1UA 4RKAA 1ZRQA 3OQEA 5I07A 1TPFA 1MEWA 2EPLX 1HGWA 1G0CA 3L2LA 3RX3A 1EL3A 2NT0A 3VU2A 1UD3A 1Y5WA 4M1BA 1O5QA 4H9YA 5HPCA 2BY2A 3TTYA 4Z2KA 4QTGA 3LRKA 3PM6A 5FEZA 2EF9A 1AH3A 4XIMA 1FBAA 4PCFA 1RY0A 5EFDA 1JRBA 4A35A 2PDIA 3E5BA 1SSGA 1B2YA 1XYMA 4U5IA 3WBEA 1IWBA 2AKZA 3MUIA 3E2RA 1CPUA 1O6IA 2H90A 3VDBA 3W2JA 1OCNA 1OJXA 3CWNA 4KRTA 1R30A 5GJMA 1EBHA 4DJFA 3NSXA 1MNZA 2DU2A 1H1NA 4PR4A 4YWIA 5EKYA 5IFPA 2A3BA 3ANUA 5EA9A 1VBHA 4AMAA 3A24A 1J0ZA 4HN8A 3WLNA 5AC6A 3CIVA 1J0KA 4WJ8A 3L21A 1OIMA 3EPNA 4O50A 1EX1A 2XIBA 2ON3A 3WCZA 2NUWA 2C8NA 1LRTA 4C6DA 4L6HA 1LBLA 1H5VA 2LLEA 3W7IA 1BF6A 4LY4A 3KVKA 3SRKA 2ZRVA 3MV11 3NO1A 1O1ZA 3UJEA 2V68A 4IX0A 3A4XA 4ROQA 2DIEA 1KFEA 4HK6A 4HA3A 3F5KA 3W2KA 4WY0B 3QR0A 1TB3A 2J8GA 2XTKA 1E40A 4O11A 4KH2A 3IJIA 4GOAA 1LTDA 1FWNA 2Z0IA 2CBUA 2V38A 4F0LA 3EWWA 4EPBC 1T41A 4L7ZA 4PULA 1K8CA 3CQJA 1CLKA 1BQCA 5CSRA 4XV0A 5DLCA 3QV6A 1MRQA 2X42A 4G8TA 5H8PA 3EOEA 3NSMA 2VELA 4MB4A 4ADTA 2AQWA 4XAFA 3T2PA 2PP0A 3A4JA 3LXBA 4IFKB 2OCZA 3OYXA 3EWZA 3EBVA 1RVKA 4BR1A 3UPWA 4EPKA 1XLJA 5MKGB 1DJQA 1S2WA 3RRXA 3UJFA 4CNOA 1W31A 3O0FA 1OZQA 1NOUA 4H7VA 4XUYA 3TYUA 3VGDA 1F73A 2GDVA 3UXIA 1K4HA 1QO5A 5FF3A 3G5EA 2NT1A 1H7NA 1EJXC 5KEZA 1I45A 2MUCA 1MQRA 5D37A 4RPQA 4UZSA 1EP3A 2Z1XA 4ZOAA 2VEMA 4I90A 4GY7A 2EO7A 3L65A 3H2NA 3RITA 2YJQA 5FSEC 1DORA 1Q63A 4NJJA 1GTHA 1DV7A 4EE9A 1FHUA 1CGUA 3AICA 4BJHA 4OWGA 3LU2A 3CH9A 2V30A 9RUBA 3UJ2A 2ALRA 4HPHA 3HGOA 1R3WA 1QMLA 3VM7A 1LBFA 4B4HA 1FTXA 1EO7A 4KESA 1EUAA 3L4TA 3CS2A 1AK5A 4CCDA 5EMLA 3BE7A 3FGCA 4JIQA 4LJ3A 1JDAA 4N4PA 5A69A 1RQHA 3HMJG 3CYJA 3TYBA 3NQAA 5I3IA 1RP8A 1LLZA 1B9BA 1B54A 1XS2A 1V0MA 2J24A 3GVQA 3VNDA 3BJSA 2ZDRA 3G8EA 5F4SA 3DENA 4NHVA 3IRSA 4TIMA 4S3EA 8RUCA 4LS1A 4RE0A 3CTLA 3SUSA 4HPXA 5C54A 1X7IA 2VCCA 2BXVA 4L80A 3VX0A 3AHVA 3QJAA 3T7VA 3ES8A 4DAFA 1RXOB 2VD8A 2QDDA 5LA2A 1O5RA 2EKCA 1CXFA 1JRCA 4IG2B 2E6FA 3CPUA 4HN4A 3SCRA 1XYAA 1OGBA 3PAJA 3ANVA 1EQPA 3F5JA 4DO4A 3R58A 4WGXA 5I06A 3VPLA 1HKIA 3SCTA 2WO5A 2A4AA 2RGMA 4Q4OA 3R10A 1JZ8A 1A5OC 4TU1A 2HVOA 3C0JA 4MVAA 2D69A 2WLYA 2QDEA 2FIQA 3CHFA 4MNLA 1OFQA 2BY1A 5L9FA 3ZSSA 3TC3A 4NZ1A 3R43A 3VGEA 3ARXA 4DZIA 1LQ0A 1XRVA 1VBGA 1BVZA 2GDQA 2VGFA 4D6JA 2XDFA 4JQ1A 4TVCA 3IRDA 1KXQA 5GNYA 5DT5A 3MS8A 1SMAA 1DWJM 1QRQA 4FOKA 1AUSL 1UP0A 1XWYA 1KRBC 3KZPA 3TTOA 5F7UA 1AW5A 3W88A 5BU9A 1O60A 1TPVA 3WLPA 2YCIX 4I6KA 4ZVJA 4TMBA 3S9YA 3QPZA 4FSAA 3AXHA 1BVNP 3PTKA 2PWUA 2X2YA 2Q8ZA 3WELA 1ADSA 4OV9A 4XKYA 3WL1A 1Q6EA 3B8WA 1XBVA 1GJWA 1H1ZA 2D1ZA 1VFTA 3P6LA 4UTFA 2NXGA 3UWEA 2OGYA 3WY1A 2VX7A 4Z1CA 1FRBA 2BXYA 3W7QA 2NX9A 1P7TA 4DUOA 4Z2IA 2CLIA 3C56A 3DFNA 1DWHM 3LRLA 3AHZA 4JTKA 3W1NA 2PCEA 2X2GA 2ISVA 1SVDA 1E6NA 3QPEA 1TTIA 3CU2A 4H00A 1ICPA 3CXOA 4OKDA 1G4SA 5JH2A 2A3LA 1GONA 2X1UA 4PBGA 1XICA 3TH6A 1UA7A 3VDCA 3W73A 3OG2A 1BPLB 1W9DM 3RJYA 3TCSA 1DVJA 4L4LA 4PB5A 3HGSA 3BMWA 4TX9A 2Y7DA 4AWTA 4OBRA 3GG0A 3QQ0A 4O1DA 2HXTA 5D04C 3AWOA 5ABGA 4KW2A 1HGYA 1FCBA 2ICSA 3DZ1A 2OB3A 1XM3A 2VENA 2ACQA 3AOFA 1LLOA 3UVIA 1Y7VA 5HPOA 2XIQA 2ZRXA 3MO4A 2DH3A 3BQ6A 3M0MA 1B0IA 4QLKA 3M0YA 4ADUA 2Y2WA 2IQ0A 4MAVA 2XH0A 3QLLA 4QJ1A 3H2EA 4CNTA 1D3GA 1DWGM 1QHZA 9XIAA 3IAQA 3CV1A 4W87A 4WSJA 2DPEA 1OWQA 4Q22A 4GZEA 5FEPA 4RJEA 3KBWA 3IANA 2E77A 3AS0A 1K3UA 4UMAA 2ZC1A 2CETA 3W85A 1KM5A 4AWEA 2DY3A 2BLEA 3SCPA 2OLAA 1V0NA 3O16A 4Z1AA 4U31A 3DKLA 4RZ6A 2Q02A 3R8GA 4MNJA 4B16A 4DI9A 4AMCA 1RK6A 3W6MA 3H22A 4OQVA 2OQYA 3EOUA 3M5VA 4B3KA 2HV5A 1WA3A 4GWEA 1X8CA 5HQMA 1I60A 4HOZA 2WMIA 3H2AA 3A21A 5KITA 4ZO7A 4HMEA 4WSHA 2PTDA 3KRUA 5I02A 3GTHA 3S2NA 5I79A 3U3HA 3GIYA 1EEXA 2C7FA 2PU0A 3STPA 9CGTA 2DW7A 4B5XA 3OPSA 4HT3A 2XSAA 1VGAA 4Z1DA 2BBFA 4MY1A 1UWQA 1ZAJA 1TPWA 5FJPA 2XIMA 3HG4A 1VLIA 4JIRA 3GLCA 4C6EA 5A6LA 2UY2A 1VENA 2QYGA 1UCWA 3AWNA 4LH8A 3PZIA 4NNCA 4Q8MA 3NQMA 1WCGA 1IZJA 3LGEA 5U4NA 3ZSTA 2VGBA 2CLFA 1LBMA 1H50A 1JI1A 1SJDA 3MZ2A 2AQVA 1US2A 1PZ1A 2I14A 4AZCB 1KM0A 5EY5A 4X0VA 3F4DA 4GINA 3MTWA 1F2JA 3PWIA 4FOJA 1I2RA 1ZBVA 4AVNA 1E6PA 3J7HA 1REQB 2BV9A 2F2KA 3LV5A 3T0BA 1R38A 1FCVA 4QIUA 4UFKA 3ZO9A 1H61A 2R91A 2WNZA 3RIKA 3EA1A 3WF2A 4ICNA 3B05A 5G2HA 1W1A1 3CUFA 4B9YA 5AC7A 3SADA 1XKYA 3LB0A 3NCOA 1JFHA 1JPIA 3HJZA 4MNMA 1J96A 4AIUA 3S1VA 1DBTA 3G18A 1CI1A 2XFYA 4TXEA 5G4HC 4HNUA 4HTBA 3N14A 3HG5A 1DKWA 3FHQA 1QPOA 3FN9A 3BLIA 3SY5A 3H23A 1S5WA 4UMBA 2E6YA 1O95A 2VMFA 3DG3A 3FJNA 1EJTC 4O53A 3QBUA 4RLIA 1YX1A 2WW5A 1KLYA 3B0YA 1OG6A 3VNZA 1JYXA 2RGLA 3B8DA 2ZA1A 1AQHA 3MMDA 3PBMA 3C8FA 3DYOA 3BW2A 5J04A 2ZX6A 1TCDA 1DJHA 3S1GA 3LPPA 2Q09A 3W7GA 5FESA 4JTDA 2WHLA 2EPNA 3RPTA 1WDPA 4O52A 1Q2SA 4HSHA 2FDMA 3KEHA 4FA3A 3K4DA 1FWIC 1A0DA 3BV7A 2Z6IA 2UZ9A 5LXXA 2WKGA 3FYOA 6ENLA 3E6EA 4LUTB 3VKAA 1CENA 1BG9A 3KXQA 5C9ZA 1KTBA 4WXYA 3OHIA 1XQKA 3NZ1A 1G9HA 4PEKA 4XISA 5G4WA 4B5VA 3ZT7A 3LNPA 2Z24A 1Q6LA 1ZAHA 3AHTA 4HHHA 3LNMA 4NAEB 4P7QA 2WWDA 1V3IA 5BXTA 4X9SA 2J7HA 3PUOA 3IACA 4H2CA 3V35A 4B3LA 5C2CA 3GU9A 2YCLA 1DJNA 2WPGA 4D6FA 1Q6GA 1W9PA 2V2CA 1W37A 5I24A 2YYTA 1SZFA 3EDFA 4IP5A 5CPLA 3W2UA 1WUEA 4L65A 2VT0A 3G8RA 4UUIA 3SY1A 3CQKA 1KFLA 3ABZA 3LBCA 3E38A 1M1BA 2BSLA 1ZJHA 2A7PA 1E6RA 2B81A 2W27A 3GHRA 3S6TA 2OWCA 1U5VA 4W89A 3PZQA 3QV8A 4O14A 3T08A 4JTQA 2XM2A 4YTTA 1FP9A 2D24A 3D5HA 2QEZA 1XLHA 1B31A 1IYXA 1S2UA 1P0DA 5LIUX 1MUCA 1TX0A 2Y7EA 3CUHA 3L4ZA 4TR9A 1Z44A 5KTLA 3ZVHB 3GQYA 4MGGA 1U33A 1Q5MA 3WDRA 2PUZA 1G7UA 1S5MA 2Q3OA 3N2MA 3BH4A 1JG9A 5BWAA 5IRPA 3RNDA 3W7EA 1EWDA 4H19A 4ALDA 3T0TA 1W2PA 2XFWA 1DQXA 1Q4NX 3NNTA 3AYSA 2ZX7A 4HNVA 2X0SA 1YEYA 3WDPP 3ATYA 3KOYA 4AF0A 1OFBA 3WL0A 2WJZA 3PTMA 1TE6A 4JD4A 3LS9A 2RDTA 3E2SA 4Z2GA 3CEPA 2XYLA 4UQ9A 1ISYA 3CZLA 3W7DA 3IGUA 3MVTA 3TAOA 3SQMA 3C2VA 2XWDA 4G1NA 3W1QA 2JEPA 3SEPA 2C0HA 1M65A 4PTDA 5CGMA 1G5AA 4W5UA 3EKLA 1AL7A 4KETA 4N7QA 2VVSA 1F05A 4RUBA 1UQYA 5AVNA 1GQNA 3B4UA 1QNRA 3A6OA 1IEQA 4ZOCA 2VHLA 4I5UA 1ME9A 4HNCA 1ZL1A 1ZZMA 2QS8A 3E5PA 5C0QA 4HCLA 3TA9A 4Y9OA 4B5TA 3L4WA 4JHZA 3SGUA 4NF7A 1DEDA 1P1XA 3GDTA 1IHIA 3RLVA 1JAEA 3HOJA 1ZGDA 1B4EA 4RR4A 1UBSA 2PTWA 2PDWA 1C8VA 3WQDA 3TXZA 4ZO8A 1RCQA 1OFEA 4D6EA 1Y5VA 2DEPA 4ZE4A 3WQWA 1WDWA 4ICCX 2XM1A 3HPSA 2OYMA 3R0DA 3WLKX 4LSBA 4NYYA 4CEUC 1ZNNA 3TYCA 3E74A 3KP1A 4R3UA 4PMYA 4Z1YA 1FP8A 4H8UA 1OGGA 2YZRA 4E4FA 4KWUA 4HU3A 3F4VA 4DN1A 4L9YA 2Y6ZA 1B3OA 3CV6A 3CZJA 3ZJ6A 3WK2A 3VIPA 4JNYA 1I1XA 4R5EA 2WWCA 3MT1A 1HKWA 4M7TA 1OK6A 5C9WA 3L23A 1BYDA 1UR2A 2PCQA 4LRSA 5I7GA 1XIIA 1XIDA 2FTPA 1B1YA 3JW7A 3K13A 4A8LA 3N25A 4JBRA 1R47A 1KFWA 4KEVA 4IT1A 2G96A 5D8WA 2WJDA 3BJTA 4GQRA 5BRBA 5FF4A 3M5ZA 4PUNA 4R27A 3QR3A 2BX7A 4TTUA 3M7WA 4RPPA 4JFTA 2AKMA 2WJEA 2R1NA 3PZ9A 3TX9A 3WDIA 3UJRA 2Z1BA 1Q45A 1SR9A 4NT0A 2QKFA 3UESA 3NEVA 4UQEA 3ZYZA 1S46A 3P0WA 3QGAC 3UD6A 4U5KA 1XCWA 1HT6A 3OZMA 4PFMA 3JZEA 1VFMA 3KS6A 4F0RA 1Z6KA 2WK2A 3HPXA 1S5VA 4GUHA 3PJTA 4YHGA 3E96A 4PUJA 4JKLA 1D7KA 1SO6A 3KLLA 3WIJA 4QE4A 1DWAM 3LCIA 2R1KA 4LAKA 4A3HA 5GPRA 2B7PA 1O66A 3GC5A 1DWFM 4ERIA 4LY8A 5U7SA 1WAWA 1WKEA 1PCWA 1BYAA 4XG1A 1R0MA 3N12A 1MNSA 1OF8A 5LA0A 5M2FX 4QM1A 3HV8A 4Z08A 4P7LA 5DXYA 1OEPA 3SUVA 2PDFA 3W29A 3ITCA 3GKFA 2FZNA 3N6HA 1SW0A 2C79A 4HU8A 1ONWA 2FMOA 1J2BA 5JBFA 1ITUA 4NL1A 3A3XA 1UUQA 3VNIA 3MKKA 3OZPA 1L6FA 5CAKA 3WMSA 3GAKA 3VMNA 1LOLA 1M01A 3KBVA 3WQEA 2ZYFA 5IFTA 2VZOA 3II1A 1SJBA 1JF6A 8A3HA 4XZLX 4JTTA 5BNKA 3PBYA 4NXSA 1V02E 1CGWA 3QY8A 4FXFA 4BA0A 5D2WA 3UA3A 3W74A 3NTYA 1OC7A 1SO5A 1HX0A 1JXKA 1OX6A 1KRCC 4IMCA 2ZRWA 3GH4A 3WNNA 5D2VA 1PEZA 3PBGA 4UTKA 4M19A 2TAAA 4A3YA 1OT1A 3H7UA 2CZVA 5I77A 1EZ2A 1H7WA 1PHWA 2J88A 7A3HA 3CQ0A 1V77A 3ZWSA 4NJIA 3WLHA 3UT0A 1VJSA 4FNQA 1KKOA 5CC7A 4M56A 3RPDA 3QOMA 4HJFA 5DCDA 3KBJA 3M64A 4GI4A 3WJSA 7PTDA 2BGSA 3MUCA 2ZZ2A 3AAMA 3KP0A 1EA0A 1LRNA 3XISA 2E9BA 1V6VA 3SJNA 3GFZA 3S2JA 2FGBA 4A8RA 2D0FA 5CGQA 4IGHA 3MSDA 1EQCA 3EGJA 2QW5A 3JU2A 6A3HA 3PY2A 4X61A 1DJXA 1JNDA 4Z2HA 2PF0A 4AHQA 5I3JA 1UH2A 4Q4QA 2L5HA 1R2TA 5I5RA 3N13A 3R6IA 3QLDA 1KXTA 1IWPA 1O1HA 1HJSA 3NGJA 4KBXA 4ZB0A 1FWWA 3EX2A 5F2IA 1TVPA 3VD9A 4NX5A 3NL5A 4ZFCA 2WSKA 3SR7A 1L6SA 3EAUA 2C18A 4CQ8A 4N9BA 5HWJA 1K7FA 3R0UA 5BU6A 4IIDA 2VEKA 3GO2A 4FNTA 1L0PA 2OYLA 1EP2A 2I7GA 2VVNA 8XIMA 2QCMA 1VFFA 2GGEA 3K1DA 4J3SA 1HJVA 5E09A 3BLPX 4D6HA 3WYZA 1TIMA 1AQ0A 4HK7A 4Q6JA 3VMOA 3EOLA 1SM9A 4MFDA 3KAOA 4NVTA 1FCUA 3NXFA 1UJPA 4GYKA 4LC6A 5ABTA 4HMDA 1KA9F 1B57A 3C2FA 1E70M 5H91A 2Y5JA 1HZYA 4QDPA 1KXVA 1US3A 1XLEA 3T0CA 3RPMA 1K77A 3LBMA 4XBKA 3OHMB 4H7ZA 1YDVA 1RLCL 5CKSA 1EJ7L 3THQA 3M44A 3RX2A 2XVGA 5CBBA 3BQ5A 1WXJA 4N9DA 3T9PA 1R2SA 4R7JA 1V6TA 1ICQA 3MDWA 4H7CA 4WEVX 4AIBA 1FFRA 4AZ6A 3DHDA 1AFSA 1OM0A 4MF4A 3SFWA 2Y0FA 5FEWA 3GBDA 1TVNA 2QCDB 4ZCWA 2PWVA 2ZADA 1A80A 1NDVA 2HJPA 1PZ0A 3ARQA 3VABA 1WO2A 3WLIA 4QAIA 1J93A 3CASA 3WLLA 1TPC1 3V1HA 3C0QA 1Q85A 1HO4A 3R11A 3OVPA 5C6MA 2QPXA 3NZQA 1UR3M 2J7DA 3O6YX 3CLMA 3DIPA 1JCXA 1XUUA 1GHRA 4D1JA 3LCGA 3DFOA 1JCNA 2E6DA 3MANA 3SBFA 3S9ZA 4WUIA 3G2GA 4Q8QA 4LBRA 1G69A 2PGFA 3ZR5A 2ABAA 3SRHA 4YNGA 1OFDA 5DT7A 3SCQA 1KRMA 4JEJA 1UKPA 2VJXA 2PFHA 4ACZB 2YGYA 4ZENA 4IIBA 1H63A 5HA7A 3SQLA 4S3KA 1TA3B 2RUSA 4XO6A 2IUZA 2PDXA 3FYPA 1M5WA 3AO0A 2XN1A 1ITQA 3PJUA 2ODOA 3GVRA 4J2MA 3UG8A 4C6LA 1H0IA 3VIOA 3SGGA 2XZ9A 1KLZA 2R6OA 3TQ0A 4JOMA 4I7UA 4HNLA 5DMMA 2PBOA 3VDGA 1GK8A 1CYGA 3N3MA 2Z1KA 4O57A 3LCLA 3DFHA 4GISA 4ONVA 2WBKA 1W1ZA 1LOSA 3UXAA 2VD9A 4DZAA 2DQWA 3N4EA 3I7QA 2JQXA 2I9UA 4CNUA 4J3WA 4HZ6A 7CGTA 3VIHA 4A21A 4XBSA 1JXJA 2P5NA 5FL1A 4PCSA 1VFUA 5EMUA 3UG5A 2DZVA 3BLOA 1ZBCA 3A47A 3C4UA 4CN1A 2P1FA 1EOMA 2PURA 3QYSA 4PL2A 3WLSA 4ZE5A 4W85A 4JHOA 4X0NA 3TR9A 2HS6A 1A49A 3PNZA 3PNUA 5K2ZA 2PA6A 1CXIA 4JFWA 1MEHA 2J13A 5I2UA 2DJLA 3PZGA 2HK0A 5EU9A 1GCYA 6XIAA 9XIMA 3PBUA 2QUNA 1QW9A 1UB3A 2ASHA 4YS1A 4C65A 2R24A 3W07A 1UA3A 2V63A 2VL4A 5AN7A 4U4MA 2OYKA 4ZZ9A 2ZX9A 5AHFA 4XSMA 4XZMX 4Q4PA 4I7WA 5HBFA 2GLKA 2OZ0A 1Q7MA 2PDGA 4F9DA 1HN1A 4OOUA 4QDMA 3QKEA 3SO7A 1QU4A 1TJ1A 4AUBA 1DQUA 3VOHA 1F5ZA 3W25A 2O9TA 3H4GA 5HJLA 3CAWA 4UTWA 5CBIA 4XD5A 3GHSA 3TOYA 4UTIA 5FAJA 5H2ZA 1GQLA 3WK1A 4GYFA 1GVIA 3GIQA 4P61A 3PWGA 1KBLA 3TLQA 2BOGX 2F9RA 2BS9A 4FO4A 3S5NA 2GJPA 3NPUA 2YW4A 4K8HA 4PMXA 3LENA 3DC0A 3WBXA 3DYPA 3OVRA 2UY3A 1O94A 5K7JA 1FWJC 4B15A 4U3CA 1RAKA 4PRWA 4K6AA 5LIWX 1CT5A 1E72M 3CAQA 1XLMA 2DVUA 4UMCA 4LCQA 1TIWA 3PJXA 4Z2LA 2YOCA 1LT8A 3OB8A 2AL2B 1MMFA 1XBZA 1R5YA 4D2JA 2CYGA 4MAZA 3H6OA 3P8JA 4AX7A 2GJNA 3KCLA 4LYQA 4MUZA 1TV3A 1E43A 1KM4A 3P82A 2YB1A 3LCWA 2WVUA 2C1HA 1TTQA 2PTZA 5H6HA 1JCTA 1E5JA 4UIOA 3IGSA 4POCA 5CPSA 2E68A 3L5AA 2OQHA 5FI8A 5AYXA 4S3CA 4UCFA 2REQB 3GNRA 4D6CA 3PB2A 5JMUA 3TDFA 2ZUWA 3QM3A 1XRFA 4GABA 2VI0A 1XG4A 2KAUC 3QC0A 4LNCA 3EXSA 3NVDA 3PSWA 1KM6A 1JAKA 5CCZA 1JDEA 4C6QA 4L1GA 4WOZA 1W3JA 4WK9A 3ZVIA 4GIRA 2CZFA 4S2CA 4LVGA 1JUKA 2BNJA 2DUZA 3GC2A 4PMUA 1YPXA 3TW9A 2ZZ3A 2CLHA 4YYCA 2ZZ5A 4W84A 1EF2A 4S3BA 4JN7A 2BTMA 5HMEA 4EXBA 3F4NA 5KETA 4WKFA 4DY1A 3CYVA 2J4GA 1GNXA 1LL6A 4FB7A 1MQPA 3PZVA 1HP5A 3BC9A 2WOQA 1TREA 1EF3A 4Y7EA 3RR4A 1GOOA 2XUCA 2V82A 4PRRA 2DIJA 3TSMA 2PF8A 3UWWA 4R33A 1XISA 4MPKA 1WDSA 4QNEA 3YPIA 1W5QA 4ATDA 3QN3A 2WC7A 3NO3A 3MKVA 3N2BA 4X3ZA 1TV4A 4Y9PA 4HMNA 3TSBA 1IT0A 2UWFA 4OUIA 1MUMA 3MUXA 5D38A 4JDYA 3OP2A 1VYSX 5CEWA 5EMKA 4NKCA 4MM1A 4BWLA 5F2LA 3M43A 3L2MA 3M07A 4CCZA 4W93A 3B8SA 1RLDA 1U5HA 3FW6A 2YX0A 3G1RA 3HPFA 5T8GA 4ZFMA 3FFSA 2E7FA 3UYIA 2V8ZA 4H8HA 4HSNA 1PL9A 1OCQA 1BHGA 2ZA3A 1SFSA 2VQUA 4GVIA 4PZVA 4PMVA 3W53A 3GVWA 4OOZA 3R8RA 1E9ZB 3BAXA 3TW7A 4LUTA 1IXPA 4HKPA 3WUEA 3CHCA 2ZBTA 3C6CA 4C6OA 5A2CA 3OVQA 4EPEC 2XGBA 2RAGA 1UD2A 2WVTA 2E5CA 3MSRA 4QJ5B 1V93A 2C1IA 2VZUA 1POJA 2D20A 3GUWA 3EYPA 3VNKA 4Q32A 1Q2RA 3F2BA 1A5CA 4AY1A 2QJHA 2VTFA 1NU5A 1SGJA 2VC7A 1TV5A 1QPRA 4W7WA 5A8MA 2FH8A 3QZAA 2YDQA 1J6PA 1TO3A 1X96A 1V7AA 1M68A 4KRUA 3G1SA 4OZOA 2XIOA 4UQCA 4GGBA 3GXDA 4JN8A 4WJEA 5C7HA 2VC6A 1PXGA 3EWYA 2H6RA 3QHOA 3RRAA 2PDMA 2PRMA 1WBHA 1HKVA 2I5IA 2NV1A 3W70A 4NAFA 2FGZA 4IOTA 5BWFA 3U0HA 1XH2A 3KZSA 1GORA 4C6MA 2GVGA 1QHPA 3QKZA 3O3RA 1KQYA 2QVHA 1CLXA 3WEOA 3T4WA 2B7NA 4CNSA 3W00A 3U48A 4NZFA 3NDYA 4OGZA 1VFSA 1PX3A 3AU6A 1UKOA 4QEEA 1QNOA 1OZMA 1UUOA 3STCA 4JFSA 2VP8A 2J62A 1MW0A 3PSVA 5FJJA 4ML9A 2Y5SA 2J7CA 4M0XA 1UWIA 1W17A 4JQ2A 1O12A 1H1YA 1HL2A 4CVWA 1ZBKA 3ANYA 3UWYA 3BO9A 1I1WA 4XTDA 5EMMA 1WQ5A 3LXAA 1ZJAA 2WC3A 4XTIA 4YVVA 2PLKA 3M0JA 2XVNA 4O1AA 4DZ5A 3QR1A 5HANA 1A5NC 4CD4A 4MG4A 2B0MA 1S1PA 4JYFA 4CKQA 1MZRA 2VX4A 3TU9A 3BICA 3GTNA 3I7RA 1K9TA 4S3JA 2OEKA 3KW3A 1DJYA 3KOZA 5D32A 2Z7GA 4I5XA 1XYLA 4RZ4A 4MWAB 2HNEA 2Q3RA 4DO6A 3OLIA 4AB4A 4IL2A 1XBXA 5B7YA 2O55A 3M7SA 3RCYA 2YDRA 2VUNA 3UWUA 4GA8A 1XCXA 3AXIA 4O10A 4AEFA 1GVFA 2PP3A 3HZ3A 3W7MA 2PC4A 1SFJA 3H7VA 4UFMA 4UTHA 2V2HA 2NQ5A 2WVSA 2O56A 1PKNA 3THUA 5D2TA 1R8LA 1C7TA 5H8UA 2GK1B 4WQ6A 2FJKA 4QG8A 2YL5A 3PZUA 2XH7A 5DANA 4UTTC 2Y7GA 2ZZ6A 3BAWA 4LNYA 4IQJA 3DGRA 3BMVA 1QJWA 1M9HA 2Z27A 1H41A 3CJPA 2NUXA 1XL9A 4IJCA 5FF7A 2DZSA 5EBUA 3BURA 1KM2A 3ENLA 5C8BB 3NGFA 4DJEC 3ORWA 3QV9A 1QI0A 1W32A 2WMKA 2IMRA 3LD5A 3U8GA 1VH7A 3W2LA 4C6CA 4C6IA 4BI7A 2Y62A 3QGVA 1HW6A 2X0HA 4DO5A 4UFLA 1RJQA 4JCMA 4IPPA 4GQQA 4H04A 3QY6A 3JS3A 1IT7A 3VOCA 2E28A 3STGA 1KFKA 5MHBA 3UZXA 4MLJA 4G7EB 1YPIA 1TWIA 3DOPA 5C9UA 4N9EA 3BAYA 5AY7A 3EEGA 2IPFA 2H3DA 3TC6A 3DC8A 4WHBA 3IUHA 1GW1A 1X1OA 1BGAA 4ICMA 5DRCA 2G95A 3OLGA 1VPQA 1QTWA 2Y88A 1UW9A 2GQ3A 1MVYA 1RBOB 2WSQA 4WF7A 4H83A 3VD3A 2PDCA 1KBBA 3PHAA 2YBVA 3H8AA 3OZYA 2OZTA 3ATZA 1GQJA 1I8JA 1VIWA 4GJIA 3PR2A 2ATMA 5BMWA 4LOCA 4MWAE 3FA4A 4DNMA 3D3AA 1GYNA 3BZJA 4IIHA 3SSJA 1FA2A 4W7UA 5F4WA 8TIMA 2I5GA 4Q4MA 4HHMA 4QLLA 4FNSA 1R3SA 4GIAA 2OX4A 2E8YA 1NQKA 4ZQMA 5K3VA 3F4CA 4P8WA 1W2VA 4PCTA 3WH5A 1B9ZA 3I7SA 4K7VA 4GUGA 4AX6A 4AVOA 1PTDA 3ZR6A 1C8YA 2DSZA 5BXSA 4NRRA 5C7VA 4O12A 4IPNB 4GNKB 1BF2A 1V3KA 1G01A 2VEFA 3N2CA 4DX3A 1H7PA 1J10A 3ZMRA 3H7RA 1X6LA 2J9ZA 1P0NA 1XFCA 1XDLA 4XX6A 1F74A 1NF0A 3KDNA 2Q8LA 3UXKA 2INEA 3G6MA 5JBDA 3MMWA 2FTWA 2BZNA 3LBOA 4P7RA 4ZL1A 3QXBA 4XAZA 3FJ6A 3UY8A 3FK4A 3O07A 1M04A 3JZUA 4PTMA 2TYSA 5J5DA 4U10A 3V16A 4J3UA 1O4UA 4W86A 2OZ8A 2QGHA 3W38A 3CZGA 4ZTYA 4A29A 4M6UA 2NLYA 4JY9A 1EHAA 3H4WA 3I4EA 3UR5A 2V5BA 5AC5A 2QCLA 1YHTA 4Y96A 4IWWA 3P81A 5A2AA 4OUEA 1XIHA 4L4MA 3DX5A 5XINA 4QS5A 1OBAA 1QI5A 3NDOA 1PE1A 2VZTA 2QPSA 4PMOA 4BK9A 2D2JA 4UOJA 5LXEA 1EC8A 5CG7A 4PB4A 5DBTA 3S5SA 4URIA 4AFYA 1UH3A 4H8NA 5EMYA 4V28A 4YMZA 4W88A 4A2SA 2F38A 1QFEA 3N17A 1LROA 3NWRA 1D9EA 1RBAA 2XVLA 2ZZ1A 1EPVA 3IARA 2I9EA 3GFXA 4DJEA 2ZRZA 4O18A 2VGGA 1F3WA 4D71A 5BXPA 4E38A 4JTSA 1KRAC 3HQNA 1TVLA 1W3NA 4E2OA 4NQ1A 4TTGA 3FHAA 4QLJA 1AD4A 3N15A 2P8BA 5G5IA 3M1ZA 2BOFX 1U22A 1LOQA 2J7GA 4CGTA 4GIEA 4W9TA 1XSJA 1AMYA 1VHCA 2IW0A 2CU0A 1CWYA 2YL8A 4GQBA 3W7PA 4LB3A 4M3PA 4B4FA 4LRTA 1Y5XA 3N11A 1FXQA 1FWEC 3EMZA 3NQ7A 5IM51 2DSUA 1DXIA 1IXQA 1GGOA 1PVNA 3BG5A 3L67A 1WOAA 2PGEA 3TN5A 1R85A 2QF7A 3GG7A 3N6JA 3KBMA 3KVLA 3G1XA 2CHRA 2YPIA 4JICA 2OKOA 5BYWA 1B3ZA 2QZRA 3AXMA 4GXWA 3LK6A 2Z1SA 2E40A 1E3XA 4EOUA 1R9YA 1OVDA 3R5EA 4HIBA 3ABXA 5FAGA 4RK8A 3TE9A 1EBGA 4P7NA 3U2CA 5KSWA 3WSUA 5E0CA 4JIIX 1KO0A 3R25A 3S9IA 1FFQA 3DKJA 1W1TA 2UBPC 1WDRA 5HQLA 1R3VA 4AY8A 3SGZA 4TVUA 4BY3A 3QFWA 4J28A 3ZS4A 4GVFA 1M7XA 1XLFA 5I00A 3MI3A 4KEUA 3TNOA 5ABFA 5E5CA 1CLVA 4JTLA 3S42A 1EGVA 3S5YA 1DJIA 1J9YA 2WXDM 2H9AB 2J8FA 2CWXA 3GG1A 4K37A 1HVQA 4FP1A 1VBJA 1HNYA 3CT2A 4IPLA 5DXXA 4IMFA 3LMYA 3A4WA 1OT2A 3BANA 1VPYA 1NDWA 2VX5A 4B5NA 3B03A 1TKKA 5CPOA 1OY0A 1XDMA 5CZ0A 3E3HA 1YNQA 3P93A 3NQ6A 1PUDA 4CD5A 1JCMP 4N0RA 1GHSA 2CLMA 4DYEA 1LQAA 5DFAA 2Z25A 2ZZ4A 1L6YA 2TMDA 4QEHA 3I10A 4MYAA 1TTPA 1PO9A 4FNPA 1WE5A 1T8XA 2FZBA 3IVUA 4IJRA 1KBIA 4B5UA 1GYMA 2DH2A 1ZB5A 3N73A 3TMLA 5BRQA 3O6AA 4QQ3A 4MKVA 3KHDA 4MZ1A 4QFUA 1EIXA 3BJFA 1ZP3A 1DIEA 1ISWA 1SPQA 2EPMX 3GDMA 1BLIA 1J5SA 1Q6QA 2VURA 2WMGA 3T40A 3VIKA 6TAAA 3R2GA 4CCCA 2EGZA 2OLHA 2V3GA 1QW8A 1HKJA 4W7VA 1XP3A 3WBYA 3WFLA 5JXQA 3UWZA 1QXLA 1R9ZA 1TQXA 2WKLA 2GYIA 4PUMA 1U30A 2TPSA 5HMDA 3CO8A 3OYZA 3BG9A 2FB3A 3MHUA 4HGXA 4MIMA 2VDHA 1LJYA 1C91A 3AZTA 2EG8A 4IIGA 2Z29A 1VJIA 4ORIA 3CUGA 1ZP4A 4Q8PA 3GIPA 4M24A 4AD4A 3M0LA 2PGWA 5FCZA 5LA1A 4DHGA 2ZUNA 1UOKA