2O55A

Crystal structure of a putative glycerophosphodiester phosphodiesterase from galdieria sulphuraria
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
254
structure length
254
Chain Sequence
SKVIIPKIVGHRGVGKEGLAPENTLRSFVLCMERNIPYIETDLRVCKTGEIVLFHGTPEGTIPFYKDGTSRIGDLSLEELKRLDVGGGHTIPSLEELFVAIEEQKFNLKLNLELKGEEWKRKESGDHQRLLLLVEKYHMQERVDYCSFHHEALAHLKALCPDVKITYLFNYMGQPTPLDFVEQACYGDANGVSMLFHYLTKEQVCTAHEKGLSVTVWMPWIFDDSEEDWKKCLELQVDLICSNYPFGLMNFLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative glycerophosphodiester phosphodiesterase
publication title Crystal Structure of a putative glycerophosphodiester phosphodiesterase from Galdieria sulphuraria
rcsb
source organism Galdieria sulphuraria
molecule tags Structural genomics, unknown function
total genus 74
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2006-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2o55A00
1DJWA 3I10A 1T6MA 4I9MA 4F2TA 3L12A 1DJIA 4OECA 4RW5A 3NO3A 4QJ5B 2OOGA 5T9BG 3EA3A 3V1HA 2OTDA 7PTDA 2PLCA 3RLHA 4F2UA 1PTGA 4R7OA 4I8YA 4QJ4B 2PZ0A 3V16A 4QJ3B 2FJUB 4I9JA 5PTDA 1O1ZA 4RV3A 1T8QA 2ZKMX 3QVQA 3EA1A 1DJZA 1QASA 1DJYA 1QATA 4F2BA 3V18A 1AODA 1V8EA 3KS6A 3H4WA 4I90A 1DJHA 3EA2A 1DJXA 4I9TA 5T9CE 1GYMA 4GNKB 3PTDA 2F9RA 2PTDA 1PTDA 4S3GA 2O55A 2OR2A 4RW3A 3OHMB 1ZCCA 1YDYA 2ISDA 5T91A 3QR0A 2P76A 3MZ2A 3KS5A 1DJGA 3H4XA 3QR1A 1XX1A 6PTDA 3CH0A 4Q6XA 4PTDA 3RLGA 1VD6A
chains in the Genus database with same CATH superfamily
3R2GA 4MMWA 3UXIA 3L2LA 4QDWA 1J11A 2QGYA 3W27A 3MJMA 4FOUA 1XYLA 4M6VA 3GU2A 1EUAA 2V67A 3W7JA 3E96A 2FH6A 4PUNA 3V36A 4JFUA 3C6CA 3LU2A 3RHGA 1XC6A 3SY1A 3FAXA 4DO7A 4RZ5A 4B5UA 1I2QA 4JX4A 2P8CA 1WV2A 2BLEA 5I23A 3WLHA 1KBLA 1JDDA 4QP0A 2YB4A 4NAFB 3VIFA 3P61A 1QNSA 4ADUA 4L4PA 4H6EA 1SO5A 2V30A 2BGQA 1EZWA 3R7MA 6A3HA 3ZWTA 2ON3A 4TO8A 3EX4A 4JDBA 2NWSA 3GYCA 2X8RA 1VS1A 4AZ7A 1QFEA 1UP0A 4K37A 1BLIA 1L6SA 3BCJA 4S3FA 3PTQA 3G6MA 4AEFA 4AWTA 3NG3A 2CEQA 3M9YA 5AFDA 1IV8A 4NYYA 5FJIA 5AYBA 3KDNA 4RE3A 3EB2A 5C7HA 2GSHA 1RPKA 3ALGA 1BHGA 4EF9A 3NR0A 1R7OA 1Z44A 3OGRA 3CH0A 5IDIA 3LPFA 2D2HA 4BA0A 3CUZA 1IGSA 4JY8A 4PTXA 3VUPA 3CAQA 4V1XA 4U4MA 4M3PA 4H8VA 4EWND 3K46A 1KRBC 4OT7A 2D2OA 1YXCA 1I9CB 1YTDA 2OGJA 3FHAA 3ID7A 2W63A 3L5LA 3CZEA 3EWXA 1KR0A 1T5AA 3GNRA 2XZ7A 1D8WA 1Z48A 3GDRA 4C6CA 2CC0A 4O0ZA 1PKLA 3ITXA 4KFOA 1VB9A 2XIOA 1FHLA 2ZRUA 5EY5A 1Q6OA 4WJXA 2XVLA 4W93A 3M64A 3ARRA 2WC4A 3O07A 2YXGA 4Q4SA 2YKKA 3H24A 2XIMA 1FUYA 1W9UA 1DWIM 1HXJA 4FEZA 2E5DA 1GEHA 3GNDA 2FQIA 3GDLA 3A47A 3B04A 1KBIA 1HUVA 4YS1A 3RFAA 4O12A 4D72A 2OQHA 4HCLA 2E7FA 3AIQA 1F07A 1CEOA 4XTDA 1EBGA 1W1IE 4DZHA 1EO5A 3FA5A 2FZ9A 1NDZA 2CLFA 1Q2RA 1S2AA 1A5BA 4XKYA 2C14A 4CU7A 2PDFA 1JGIA 4OV9A 3HPSA 3CPRA 1XBXA 4Q7IA 1C7SA 4HU4A 4D1IA 3P67A 4JTDA 4HPGA 4HMEA 3VOIA 4FIQA 1F4AA 4AEEA 1EYWA 3DECA 2V5BA 1XH0A 2AMXA 1XSJA 4XAGA 4HMDA 1U22A 2PLCA 3P7YA 2E6YA 1TTQA 1TG7A 1WXJA 3WF3A 4WIWA 2YLAA 3WUEA 2PF8A 4F0KA 1QO5A 5LNWA 3T40A 1Z8AA 3ELFA 4RXGA 3V1PA 4W5UA 1Z89A 3TOYA 1GYLA 1GCYA 1O68A 4GRSA 1X6LA 2OODA 4ZQNA 3SBFA 1RK6A 4I6KA 2QCCA 2PDIA 3K4DA 1TMLA 2EKCA 3BG9A 3MMDA 3KE0A 3N29A 3UVIA 1W1B1 1GG1A 4Z2JA 3FFSA 4M24A 5AYIA 5LNVA 4ZVJA 1RHCA 5HMFA 2QCLA 3W7PA 3NQBA 3GU1A 5IRPA 1TA3B 1KTCA 2DIJA 3UWWA 2ISDA 1MSSA 1A5OC 3MZ2A 3LERA 2ZUVA 2V2HA 1WE5A 5D9MA 4FSAA 3UR2A 2OZ0A 3TA6A 4TVUA 4QS6A 4RE4A 3MI3A 2DSVA 5LIXX 3WQOA 4EPDC 4L80A 1YEYA 4RW5A 2QF8A 4UTMA 2PUZA 2WNWA 3VUSA 1RVKA 3K8KA 3C52A 3RRAA 5A6TC 2JIWA 3A24A 4ZB0A 3R5EA 1JZ2A 3EPNA 5A69A 5DT7A 4LX4A 1DYSA 4DWSD 3NL2A 3T6CA 5GNXA 2ZC1A 1TR1A 3CMJA 4GIEA 3PC0A 1AQMA 3RLVA 4WKFA 3S42A 1H7OA 6REQB 5HUOA 2J4GA 1S5MA 1TPDA 3EX1A 4JGDA 3R43A 1EF2A 1KM4A 2Y89A 1KRAC 4KFPA 4D2JA 4PTNA 3M44A 4Y9PA 3TMLA 4MNKA 3TN5A 2Z2BA 5HR6A 4I9TA 1UIPA 1CGTA 4E6MA 5AVHA 4B92A 1AD1A 4MIMA 3M0IA 1Y5XA 3LHVA 1JR1A 3FX4A 4EE9A 2OG9A 4HU8A 3NL3A 3EDEA 4DLFA 3MTWA 2Z1SA 3LLDA 2AOSA 4NJGA 2QJNA 1A3WA 1TV5A 4OFCA 1TSIA 3U7BA 4Z0JA 4UTLA 1BTCA 1E73M 4LPCA 5CPOA 1VEOA 1QO2A 3M7WA 3QC3A 3RJYA 4A3HA 6TAAA 2ALDA 2J9ZA 1FWEC 2WVVB 1K6WA 2DT2A 3L4ZA 3PB0A 4YNGA 1GWJA 3WEMA 3S2MA 5FJUA 3H7RA 5BZAA 2E28A 5A6BD 3VMNA 3DFNA 1GOKA 3GVQA 4HOZA 4S2CA 1GW1A 4I8YA 2P5NA 3FAWA 3WLPA 3MQTA 1BPLB 3W7RA 2F2HA 4EXBA 1W5QA 5KINA 1W3HA 3VOGA 3ARUA 3L0NA 4LU0A 1OFBA 3B8TA 4W7WA 4AIEA 2WKLA 4RNJA 3THDA 4LAUA 5CPLA 1DTNA 2ACUA 5M3WA 5AYXA 3GTFA 2Y61A 4KMQA 5ABFB 4PUDA 2A7PA 5J8LA 4X63A 4ZXLA 2VX5A 2JGYA 2XUCA 5HATA 3OQEA 3W0KA 4AWUA 1VBUA 3CS2A 3VGDA 1PXGA 4CUCA 2PD5A 4O8RA 2HXUA 3F1QA 5L9FA 4OOUA 4Q8UA 4JTIA 3EX2A 3TQVA 3KBMA 3STFA 2CLMA 4QJ1A 3PZVA 1Q7ZA 5FEXA 3H4XA 1JD9A 1UUMA 3HGSA 3VNMA 2QUTA 1JIBA 1ICSA 4IPNB 2J27A 3QHMA 4ERGA 1SGJA 2GQ9A 4Z2HA 3UBPC 1BXNA 5HUPA 3GD6A 3A12A 4C1KA 3I6RA 4DN1A 1IIHA 3WJSA 3SCUA 3V7PA 3M07A 5DQPA 1M68A 3CHCA 4M6QA 3W7NA 5A8MA 2EPNA 2XVPA 3RUBL 4QLKA 4X3ZA 1ME7A 3OIHA 2C71A 3F2BA 2HTMA 1B3WA 4ZSTA 1EJWC 2E6AA 2GVLA 3KDOA 3OEXA 1YDNA 4IHCA 4JS3A 2VVSA 4C6KA 3W24A 4MF4A 1K77A 4UFIA 3KHDA 1QHPA 2E67A 1RQBA 4AFYA 2VCAA 3HG4A 4AW7A 1QRQA 4L9ZA 3FDGA 4XAPA 1YNQA 4C65A 3AHYA 1PDZA 1FWJC 4DNMA 3UD6A 5HMSA 1IXQA 2DP3A 4AD1A 3IJ7A 4NAEA 1FWBC 3NJ3A 5HPCA 4PULA 3LS9A 1GTHA 2HE8A 3CZLA 5G1MA 3DBPA 1HFBA 2QVNA 2YBVA 2PTDA 4BR1A 1S5TA 2Z29A 1ZAIA 3S6DA 3GC2A 3WMBA 1E6PA 1XIFA 1LF1A 3CYVA 3TK7A 3TXZA 1EWEA 4O17A 1VEMA 3DGRA 5D38A 2L5HA 7XIMA 3N2OA 3U2EA 4C6QA 2ZXBA 2XM1A 3WENA 2FH8A 4CEXC 1FWAC 3AHVA 1NJJA 1PKNA 1EZ2A 2WWDA 1QNOA 4NQ1A 1EGVA 1JZ8A 3W7OA 4W7UA 4XZMX 1WNOA 5A6BA 1NQKA 3V1HA 5AC8A 3F7JA 4Q8NA 3THAA 3S1VA 1W1PA 1W8SA 2EJAA 3HF3A 2XVGA 1SVDA 2QQ6A 1A0CA 3L2MA 4QJ3B 3TTEA 1MEWA 1QI3A 3NGFA 1ZL1A 2C3ZA 4IGSA 1XPYA 2NVAA 2HNHA 4CEUC 4MB3A 1UJPA 1W32A 3VKAA 3FNDA 4JKMA 3EB3A 4D6GA 5A6AA 5I02A 2NWRA 1VFLA 2E1WA 2ZTKA 1TMHA 5F4WA 3K13A 4KERA 1NF7A 1O7AA 4NZJA 3IUHA 3UF9A 4F0HA 3EA2A 3IJLA 3WQ8A 1LYXA 2JKAA 2VEPA 4Q8MA 3QV7A 4GQQA 3GQYA 4FAMA 2Q3RA 4LF1A 3TTOA 1S2WA 2C13A 3P3BA 4X2RA 5I09A 2YLLA 4RE0A 4CCDA 3EEGA 1PZ0A 3EMQA 3WUBA 3CEUA 2RUSA 1EB3A 2VR5A 4R34A 2D3LA 2PD9A 2ZA1A 3H23A 2PBGA 2IQ0A 3OZPA 2QJJA 1KWKA 5HJYA 3BARA 5CC3A 4Q7BA 2SFPA 3U3HA 4REQB 1UPPA 4OBSA 4XWUA 2ZBTA 3PULA 1TUXA 1ODUA 8CGTA 3VM5A 4A3QA 4UQCA 4XAYA 3H21A 2IPGA 4FX8A 3AIUA 3V5OA 5D37A 1NARA 3C2YA 3QMTA 1W54A 1OFRA 4E8GA 4GVHA 5K4XA 4MFDA 4AZIA 4LXFA 3M0LA 5H1WA 2NVDA 3K8MA 4LALA 3OW1A 1CX9A 3O9NA 2H8XA 4MYAA 3TKFA 1XYBA 5IDZA 1JAKA 4DWDA 3N04A 4ICMA 2TRSA 5BXRA 5E6ZA 1GOOA 4EPKA 2G8ZA 2VO5A 3OYZA 4C6MA 3Q67A 1O5RA 1DHKA 5C2CA 3WLLA 5CZ0A 4I9AA 4JIEA 1BYBA 1C7TA 1DWFM 3UWEA 1CLKA 1V3KA 4XSMA 2I5GA 2PGRA 1ECEA 1UHVA 3QKZA 2WSQA 1Q7QA 3SGUA 4Q7NA 1C29A 1DIOA 2DSUA 2QCHA 2VZUA 2XWDA 4GG9A 3URNA 2TAAA 1E1EA 3H7VA 3N4AA 1MEHA 1GUVA 1XIMA 1UC4A 1ZBWA 1SR9A 2OO0A 1AMYA 4AF0A 3KRSA 1A50A 3TVAA 4LS2A 1J8VA 4L64A 3RX3A 1TX2A 5FKYA 4HA3A 1A0EA 5GPRA 4X9SA 1DHPA 2WCAA 2PP3A 2F61A 3M47A 4MWAD 5AYZA 1OK6A 2TODA 1IWAA 3IRSA 3S2JA 2Z25A 5XIMA 4DM2A 4W8LA 1LWHA 3CK5A 1W3LA 1K1DA 1U30A 4N9BA 7PTDA 5BXSA 4HK6A 3MWCA 3WEZA 2ZUTA 2EPKX 4PB3A 1ME8A 2ZZ5A 1YADA 1UWQA 4H1ZA 4XUGA 2UY3A 4IT1A 2F6UA 1T0OA 2J78A 3MSRA 1BQCA 4YYCA 1GVIA 2NT0A 4QAIA 1SZNA 4EXQA 2QYGA 1BFNA 2DUAA 4IFOA 4N7QA 4C6BA 4JN7A 1L6GA 4MADA 1C9WA 4H7ZA 4DXKA 4GZJA 3F4DA 3H8AA 5H8MA 3E74A 1S5NA 3W6MA 1C90A 4A8IA 3AS1A 3BUVA 2W9MA 3UYIA 4LF2A 2J9XA 3H4WA 3K1GA 3O6YX 3TYZA 4NZ4A 4U31A 1UWUA 1JPMA 1SU5A 4ERIA 3HFTA 2WSRA 1E0WA 2QCEA 5D30A 2XGIA 1M9HA 3G1RA 4D6JA 2FFIA 2J66A 2X1UA 3CT7A 1EJSC 3BXWA 4UUIA 3ZS4A 3B8DA 4WSJA 3TFCA 2YA2A 1J6OA 3IAQA 4ONVA 1MW3A 4U2ZA 3FEMA 1UJQA 5DBUA 3GO2A 3P6LA 3C2OA 2J79A 4PCFA 5BRPA 1EO7A 4J28A 2J7HA 1K9TA 8RUCA 1L8PA 2OOGA 5RUBA 2ISSA 5EMLA 1V3MA 4LEQA 4W5ZA 4QE1A 4GI4A 1GOIA 2ZX9A 4QHRA 2Q3OA 2PCQA 3DDMA 1PIFA 9CGTA 4BQ5A 3URAA 4R7OA 1X7FA 4R7JA 4K39A 4P61A 1KM5A 1W9XA 4IM4A 1AVAA 4FP1A 1FHVA 4I9JA 3LSCA 2BOGX 4EKJA 2NV9A 4U3AA 3AU6A 2D24A 1HTIA 2WJEA 5AHNA 4AZHA 2Y2WA 5A8PA 3AXIA 7ODCA 4UR8A 1POKA 4JTAA 3LCGA 1XINA 1W5PA 4JEQA 2Z6JA 3O3RA 1QK2A 2G3IA 2VZSA 3RGTA 3VNDA 4GINA 1NOWA 1UKTA 3NPVA 2J7BA 5IHRA 2DVUA 3CMFA 1BEUA 2PDBA 3AS2A 2PTZA 4GBUA 4WRHA 3T44A 3MSGA 2CIPA 2PAJA 3FXYA 1NH6A 1BAGA 1HJWA 3R4IA 4PSRA 1KCXA 4FLSA 4UZUA 1E9YB 2PSNA 3RPMA 2CWNA 4FA3A 2YXOA 4RNFA 1QR7A 1UKSA 1W3JA 1KM2A 1DJWA 3MHGA 3I10A 1S2UA 3M6DA 3THUA 3ZR4A 2ZZ2A 4D8AA 1P0KA 1XLJA 1GVQA 2AL2A 4JIHA 1ELSA 2P3ZA 3VK5A 2BHYA 4S3DA 4NJIA 3P62A 4MWAB 1KRMA 3LQLA 4DVOA 1TB3A 2WNZA 3L66A 1DIEA 3HFYA 4IP7A 2C0AA 3UJ2A 4BF9A 2JIEA 4LY8A 4MY8A 2C6QA 3FA4A 1XD0A 1DJZA 4URIA 1JYNA 2WC3A 2WO5A 4PMDA 5I5RA 4DX3A 2XWEA 1U2YA 3U2OA 1VBGA 1U33A 1OINA 2VC9A 4IQEA 5A3HA 1OYAA 1V02E 1BWLA 4G2DA 2R6OA 1YDVA 4B5TA 3PG9A 3OB8A 4AD4A 4YTUA 1J9YA 2QJMA 1NFGA 4AX6A 3NZ1A 1V5XA 3WF0A 4NAFA 2RDWA 1Q13A 2WAGA 2VURA 4OGZA 1MDRA 4N6FA 5AN7A 4E5TA 3NZGA 5KTLA 4F79A 1LZOA 3CWNA 1PHQA 3LA4A 1B54A 4L61A 2PWFA 5ABEA 2PDUA 1Y65A 3QV8A 3ARSA 3SIZA 2R14A 2HWGA 2OWCA 4LBUA 2VD9A 1XLCA 2Q01A 3HIJA 4DBSA 2X41A 4XIAA 2DQXA 2ZTJA 3E3HA 4WDTA 4JTFA 3C86A 1AQFA 4LNCA 3K4AA 4LUJA 1VHCA 4IQDA 5HNRA 1XQKA 2WLYA 4YMZA 1VENA 1MZHA 2BOFX 3FYYA 1QU4A 1HKJA 3VIPA 5CPTA 1E51A 4LYRA 4H2HA 3N17A 4Z1AA 1W2VA 3LEPA 3M6YA 1L9WA 2R1NA 1MEIA 1SZGA 2Y7GA 4FO4A 4B3LA 4GIRA 1O12A 3SM0A 5FF2A 2PU0A 4BQ4A 5I79A 2HNEA 5DMMA 3LM3A 2OEJA 2G95A 1WUEA 4V15A 4FXFA 3QR3A 4TOQA 3CUIA 5AC6A 4NRRA 1KCKA 4UFHA 4Q4MA 2J47A 4IMAA 3NAVA 4I7WA 4IP4A 1LBLA 3WJYA 2ZWZA 5BRBA 3T4CA 3UZJA 3RM4A 4D6CA 2QCNA 1ZNNA 3WH8A 4AY7A 2NXIA 5HR7A 1ISXA 4B5WA 2VEKA 3B40A 4JL2A 1NFPA 3R1ZA 4JD4A 1EIBA 4X61A 2Q8XA 4Q4QA 2GQ8A 3N6HA 1IEXA 4C7DA 1IZJA 3SURA 3QGVA 2PA6A 4ZXOA 1XXXA 2ATMA 1ENUA 1MFVA 2H9AB 1EPVA 3IJIA 3RDKA 3GHSA 4M7TA 2VEIA 2Z1BA 1IWPA 4OJYA 4J3SA 4LAOA 4E8DA 2E6DA 2XDFA 4XSLA 5I78A 3F4CA 3LENA 1R3TA 3BOXA 4IMCA 4FXJA 3MVTA 1W1ZA 2OLSA 1R0MA 4QDMA 3RK8A 4J3TA 4LTSA 4OV4A 4AYGA 4PMXA 1KKOA 3Q37A 3UWUA 1SJCA 3MT1A 1H11A 3CLWA 3C5QA 2CITA 3CV1A 5C7VA 4C6LA 1HJSA 3QN3A 4U10A 1OFEA 1PL9A 2HVOA 2J7GA 3IV3A 3VNKA 2GPTA 4G56A 5EKYA 1S2CA 3N6JA 4UQEA 4FXRA 3WD1A 1A80A 4DJDD 3TJXA 5E9XA 2V82A 1KXVA 3MP4A 4AHOA 4GY1A 4PBEA 1KM0A 1C8VA 4H00A 2CYGA 2ADAA 1EP3A 1S3HA 1ITUA 4L9YA 5C9WA 4M1RA 1K9FA 4B4HA 4GC3A 2VHLA 3NNTA 3EGJA 2HROA 1XQLA 2CBIA 2YFNA 4K38A 1SW0A 3P2VA 4XZWA 4MUZA 2GDQA 1QOPA 3O16A 3GE7A 1KFBA 3PFRA 5CPSA 5AHMA 1F3EA 3WQEA 1HKKA 3TNOA 1IWBA 4LSBA 3R10A 2WNNA 5FSEC 4AVFA 3WMSA 3BC9A 1CI1A 4ACZB 4N9EA 6XIAA 1V3HA 2DVTA 4ZL1A 3KBVA 1V8EA 2OWWA 4PMVA 2X7VA 1DBTA 3SEPA 1RD6A 1M7JA 1UD3A 2GSJA 2XSAA 3GDBA 4KBXA 5IFPA 1KXTA 1TIMA 3UG4A 1O5XA 1PV8A 4O18A 3MKKA 3WELA 4B16A 1B31A 4KWVA 4H83A 3ITGA 4HCHA 3O05A 6REQA 4OOZA 3NA8A 3R13A 3SCWA 4Q22A 3IIZA 3ZOAA 1R9YA 4MPQA 2Y4SA 3E0FA 1D7KA 1FXQA 2WJZA 1CIUA 1GORA 3PUEA 3PN8A 3WQCA 2GJLA 2BSLA 1OQFA 2F2KA 3NZQA 3WQGA 4JY9A 3ES8A 4UR7A 1EQPA 4Y6GA 4HNNA 1GONA 1QBAA 3DXIA 3TU9A 1G1YA 1AUSL 4YWSA 5DFAA 4GABA 1JL8A 2YXXA 4E2VA 4GI9A 2DJLA 2V6AA 4LGXA 4NZ1A 1VJZA 4JQ2A 2BWGA 1JCTA 1ONEA 1K4GA 4MHBA 4JQ4A 2YL9A 1HNYA 3CC1A 1ZBCA 4KEUA 4LYQA 3NQMA 3W07A 1XGZA 5D4YA 1F6YA 1ODZA 4WXYA 3B03A 4P7RA 4F2BA 1TREA 5IHSA 2E40A 3RMEA 3S4TA 2X30A 2VEFA 4KF1A 1J0KA 2W5FA 1J4EA 3NXFA 4JTTA 1YE4A 3UJSA 4AQLA 3GTNA 4HJFA 2R1PA 4BHYA 1HGYA 2OO6A 1QPOA 3SIMA 4GIAA 4O54A 1N8WA 1F8MA 3ARTA 2IKIA 1NIUA 3ANYA 4TU1A 1HZYA 5C70A 2BASA 3MO4A 5AC5A 1KWGA 3TC3A 5J5RA 4RK8A 3B0UX 3KL5A 4U2YA 4B3ZA 5ABFA 3IIVA 3SGGA 1E43A 5BXPA 4M81A 1QVBA 1RA5A 2XYLA 2YL8A 2YA1A 2DU2A 1LL6A 5FEZA 3CASA 3TAOA 3BOLA 1FXPA 3KXQA 4LT9A 4EP8C 2CZVA 1PHWA 1ZGDA 5FIPA 4C6PA 2JF6A 4S3JA 2NQ9A 1GQIA 1R3RA 3ONBA 5F2MA 3AXXA 1VLWA 1EA0A 1A3XA 1E72M 4JL1A 4CKQA 2R94A 4H9YA 2OKTA 4JICA 1V02A 3WDJA 4US5A 1ZRQA 3DBNA 1AA1B 2DFAA 1UWIA 5M1TA 1FDJA 3MDWA 3VGGA 3LLXA 4YVVA 3A6OA 3W1PA 4EPEC 1G5AA 3P93A 1SFJA 3O6CA 1AH0A 5G4HC 5KEZA 4H7VA 3L23A 3UNTA 5M03A 2BY3A 3WMCA 3ZJ6A 1EWDA 1WXYA 2Z00A 4LYPA 2WWCA 1F7BA 3LI1A 3MMUA 3VABA 2ZICA 9XIAA 2GUUA 2VFDA 3CLMA 3M7SA 1XR2A 2P50A 2C91A 1VYPX 2VFFA 4MWAE 1MI3A 4C6FA 5A8NA 7CGTA 3TTYA 2NUYA 4MY1A 3VE9A 3KW3A 2MUCA 3H55A 1IEQA 1R38A 2EG6A 4MLJA 3GXPA 3VD5A 4ATWA 2OJPA 3NQAA 4GBDA 3BLPX 1GHRA 2OEMA 3UXDA 4N9DA 5LNUA 3UU0A 3W70A 3RLHA 1NY1A 2QS8A 1XIBA 2VMFA 1R47A 3ISIX 1KBJA 2BMBA 2W0UA 4GJIA 2VGIA 1QDSA 4MVAA 4BS0A 1CXEA 2V9DA 3E2SA 1PYFA 4FZIA 5FJTA 3IGHX 1WKEA 1FWDC 2ZIDA 1OCBA 4JYFA 4ML9A 2D22A 3TJIA 1EPXA 4MB1A 3GAYA 3WLTA 3CB8A 5CG0A 1GVRA 1E4MM 2YFOA 3ABSA 3AUJA 4I90A 3P8IA 1M7PA 2AQVA 2R24A 4GVGA 4NXKA 1AMKA 4YU1A 3F4NA 4AX7A 3NOEA 1KTBA 4O1CA 4RL3A 3W7KA 1TWWA 4KEZA 1PTDA 3NSXA 1DWJM 4O14A 4QITA 3GHRA 1ZP4A 3N3TA 3VNZA 1T8XA 4KCVA 4EAYA 1XLMA 2DEPA 3GWQA 3W22A 3GX9A 3GH7A 4QQ3A 1IE7C 1KGWA 1K7EA 1AFSA 1OF6A 4E38A 2RDTA 1PSCA 3OP2A 4DEFA 1TJRA 1VQTA 4IZGA 4LBSA 3NO3A 3MA8A 1YPIA 4PUKA 3AAMA 1RLCL 4KIRA 3ZSTA 4PEEA 4F66A 1XBVA 2VDHA 5CCZA 3W1XA 3PB2A 5JBEA 5CZKA 2NQZA 2Z1VA 3MWAA 5D02A 1W9DM 2Y7FA 4F40A 1Y0EA 4CQBA 3C2VA 2YSWA 3PZGA 3EDJA 4IJBA 1CT5A 4J2MA 1VBRA 1W91A 1X39A 4KFNA 1HKIA 3WD4A 4JTEA 4PUJA 3OODA 4EK7A 3C0LA 1FH9A 4W8BA 2YR1A 4S39A 2FB3A 1RA0A 1AG1O 3EOSA 4MB5A 3KBSA 2Z24A 1GHSA 3PAJA 1PX8A 2DY3A 1W5MA 2E25A 1F2JA 4KCTA 4KGLA 3QQ0A 3GVRA 4ZFMA 5HK4A 4LVGA 4QEHA 1JF5A 1H5YA 4A4AA 3DKLA 1FFRA 1AK5A 3H54A 1LDCA 2FPTA 2W92A 1H09A 4MNJA 4F0RA 3EOUA 4JTJA 3GVVA 1WKDA 1IT7A 3CM4A 3UESA 2GJXB 2WCGA 1F05A 2WNQA 4KIEA 3SUSA 5IXEA 3EX6A 4JFTA 3KTCA 1OYCA 2FZNA 1D3HA 1TUFA 1V7AA 4IG2B 1FWWA 5D32A 3W7EA 1A4MA 2Z28A 4AVOA 1FWIC 5TBOA 2J7CA 3LHYA 3D3FA 4DJED 5E0CA 1TQXA 4W86A 3Q58A 1WDQA 2BBFA 3AU2A 3VCRA 1NOFA 4O28A 4JTUA 2WMHA 1GKPA 4AWEA 1MO0A 4S23A 3QY8A 4QG6A 4XD3A 1OY0A 3NDOA 1PKYA 1Q66A 2ZRVA 1DV7A 4CD5A 3EZ4A 4ZTXA 1KD0A 2ZZ4A 2E9BA 3H2OA 4J9JA 4CNUA 1X7IA 3PUGA 3T0DA 4H2CA 1ZZMA 4LJ3A 3CQHA 1EDTA 2J77A 4R7WA 3H7UA 3S2LA 2QZRA 3PWGA 3SB0A 2HXTA 3Q4DA 2AKZA 2YGYA 1A3HA 3A3WA 3CBWA 5JUVA 4A8LA 3GBEA 4JTCA 1HL8A 4EIVA 1ZJIA 2FVKA 3TC6A 2BTMA 4M6PA 1RP9A 2XSBA 3FV9A 4M29A 3KP0A 2QIWA 3ANUA 5G1YA 3EMCA 1H51A 2V69A 1OX4B 1DJGA 1CGXA 4E4PA 4KWWA 2QLYA 2D69A 3KBJA 3H2EA 3LXCA 3ATZA 5D2TA 2YCEA 2ZE0A 1B3ZA 3LTPA 3BZGA 2W79A 1T7LA 1JJKA 3F03K 4U5IA 4PYSA 3CEPA 3EKLA 3ZLGA 1TCDA 5HWMA 3SI9A 3S1XA 1TJ2A 1BKSA 3MV01 5FL0A 4C5YA 4NKCA 3APYA 3GNXA 3BV7A 4JFVA 3HZ3A 5DXXA 3G5EA 1V93A 2W4XA 4ML4A 4Y8EA 1IZKA 5FEPA 3LBMA 2XIJA 5FSDC 2Z2AA 4GYKA 5A2AA 5D9OA 1W9VA 4MAVA 1ZB5A 3AXMA 3DI1A 3K30A 1HKVA 3GB6A 2GFTA 3NQVA 5C71A 5BOEA 2FGLA 2REQA 2PTYA 3W7GA 3LXAA 1R9XA 4FNSA 2CBJA 4JIQA 4QLJA 3W6LA 2CBVA 3RX2A 2YCJA 2QDDA 2A2IA 4IP5A 4TV5A 1RQHA 4ZO7A 1O66A 3ZVHB 4ICNA 1RJQA 4IF2A 5FF7A 1H1ZA 4HTBA 2J74A 1FWNA 3LGEA 1JZ7A 3EBVA 3FYPA 3SY5A 3BAXA 3BJSA 1Q6FA 4FPSA 5H91A 4AISA 3M0HA 5CJNA 3YPIA 1E0UA 3IPWA 2OT1A 4PTDA 1H3GA 1Q6EA 3OVPA 2GK1B 3G6LA 4Y2WA 4XZNX 1JFXA 5G2HA 3BANA 1W3TA 1VHNA 3QHOA 1FRBA 1H1YA 4E3TA 1S2TA 2EHHA 4JNZA 3PBVA 4I7VA 1E5JA 5EA9A 3KLKA 3FN9A 3B9OA 3GVWA 5F2IA 3NQDA 3WL1A 1FOBA 4LWWA 2XH4A 2O9PA 1PIIA 4H9ZA 1QPKA 1TZZA 2VDIA 2X1TA 3AXKA 2NZLA 1CGWA 5TNVA 3DHUA 1IXPA 4GY0A 1F3WA 5FF0A 2DT0A 3G3DA 1XW8A 3NGJA 4J2PA 2CKSA 4HYVA 1B0IA 3FYOA 4Q3MA 5G4EA 1W3KA 3E0VA 1MUMA 3G1SA 4JNYA 3B9AA 4FNTA 3NDZA 5AY7A 3W9ZA 1J5SA 1VC4A 3SECA 1A5MC 3HG3A 3VGBA 3CAKA 4TTUA 1EJXC 3G24A 1YIXA 5DLCA 2ALRA 4V33A 3QPZA 3QZAA 3EPMA 4Z2LA 4MWAC 4E4FA 5E09A 5F1VA 4EOUA 1XX1A 3A21A 3FSTA 4I8DA 1EDGA 3W84A 4HQVA 3STGA 1XCWA 4MJ4A 5XIAA 2FB2A 3W01A 4LAZA 1WOBA 1AH4A 4I9MA 1FCBA 5EGRA 3S83A 3WEOA 3SQMA 3AYSA 1EUNA 2J6VA 3HJEA 4H4IA 1B1YA 3PZUA 1V79A 2AQWA 1R6WA 3EA3A 2DW7A 3H2CA 1LL7A 1BKHA 5I3HA 4Q8WA 4NX5A 1LQ0A 2ZZ7A 2FGBA 5D05A 1TPWA 1OIFA 2I5QA 4AD2A 5LHEA 3BLOA 2Z27A 4WZHA 3I7SA 2EJ1A 3RCNA 2YBUA 3KZSA 9RUBA 4P2VA 3RLUA 4CVWA 2GOKA 4Z2IA 3C4UA 1ITQA 4LV9A 3SJ3A 2FVMA 1TVNA 3W37A 4UNLA 1MRAA 3SW6A 1JUBA 2X42A 2GUYA 5EL1A 4QX4A 4AZ5A 1ISVA 4F9JA 1TE6A 3UWQA 4KRUA 2R1LA 1T41A 3MBFA 2B7OA 3G0UA 8XIAA 1H7PA 3AZSA 4RZ6A 2QEZA 4Z1DA 2DH3A 4IJRA 4YTTA 4CQAA 1CPUA 3U8GA 1OYBA 2OYLA 3CV6A 3GIPA 1WAWA 3VDCA 5BCAA 4MAZA 3BLIA 1C8XA 2O9TA 1QWKA 4OBRA 1O60A 4HP5A 3LB0A 4KWSA 2FDMA 3G1VA 1Z6KA 3PPHA 2GWGA 3W29A 3QY6A 1FTXA 1IR1A 1U5JA 1Q6RA 4W8AA 2ZOXA 4GISA 4LRTA 3QF0A 4AHQA 1QAPA 3IAPA 3WQ5A 3O63A 2HBXA 5BOOA 5K3VA 2IQTA 3VDGA 3VDAA 5I07A 4M7SA 3W23A 2BODX 3RPDA 4ZGYA 1K9EA 2HV5A 3UQNA 4NJJA 5CQ1A 5PTDA 3CWOX 3TMQA 4HHPA 3MPGA 1E3ZA 1F6KA 1OEPA 1JXKA 4FX6M 1BXBA 2VJXA 1JCLA 1RBAA 3B0XA 4Q4OA 1GOXA 4CD8A 2PP1A 1WZLA 4B2DD 1NDWA 2CHNA 5CZJA 1I8JA 4DF1A 2WHMA 2OZ8A 1O5KA 3LPGA 4MG4A 3HTWA 3SUTA 3I6EA 5CSRA 4UTUA 3AS3A 4OUIA 2OKOA 3A9IA 3TWAA 1VFSA 1H61A 1G4SA 3C61A 4PE8A 4DYKA 3W71A 3AALA 3GR7A 1NM9A 1QHZA 1SZFA 3FSUA 1T99A 3P8JA 3UJEA 2H9AA 3NYZA 3VNJA 4AZ6A 4HN4A 2QJGA 3NM1A 3PPGA 2B4GA 4JHZA 1XYMA 5ENLA 2YCLB 3UG5A 4KEMA 3STPA 3H53A 4N6EA 1TRDA 3USZA 4O16A 5LXXA 4KT2A 2BXYA 4JEJA 4X60A 1UH4A 3GRIA 1JULA 1TZ7A 1ZUAX 3NQGA 4GKTA 4C6JA 2WLZA 2JQXA 1W0MA 5D8ZA 1OWQA 2ZUUA 5MKGB 3DG3A 1GQKA 4GJ1A 4GWEA 3KP1A 8TIMA 2VZOA 3NIYA 5A95A 1P6WA 3LMYA 2IPJA 2OWXA 3BGJA 3A22A 4BK9A 2OU4A 3G8RA 1XRSA 4WD0A 3FKKA 2BG5A 2Y5SA 4AD5A 5FJJA 3VDBA 4JQ3A 1MFUA 2RJHA 4A29A 2FMNA 1KCZA 2JF7A 4ZE4A 1FP9A 3XISA 2A4AA 3O06A 2VX6A 2H3BA 1MXSA 1V0MA 4RE2A 4JX6A 1DORA 3CNYA 3HPAA 1KXHA 3TJLA 1RP8A 3UWYA 5DMYA 1IGWA 3CIXA 1F76A 3JUGA 4FOKA 2YDRA 4GUFA 4ACZA 2YOCA 1M53A 2Y70A 1NWSA 3UG8A 4S3BA 4Z0SA 1WCGA 4BCEA 3KBNA 1Q8AA 2DZVA 3SSZA 1UROA 1LRTA 3NPWA 4NI8A 2XGZA 1BQGA 2GGEA 4JR5A 3ZO9A 3OHIA 3IVUA 1NWUA 1DQXA 1K8CA 2VRQA 4ZOBA 5HJLA 2XVKA 3GSMA 4K68A 2G5WA 4P8WA 3C8FA 3K1DA 3WLOA 1V51A 4QSFA 2QHAA 1YPFA 1SFLA 2QUVA 4G8TA 1BG9A 4TVCA 1LL4A 1ZQ5A 1B3YA 1H0GA 1TZ9A 1V0LA 1FFQA 2X0SA 1UG6A 2QCDB 1RCQA 3LUTA 4DB7A 3FY1A 1A5KC 4PC8A 3HV9A 4RDYA 4XG1A 2D0HA 3LPOA 2CPUA 4FI4A 5HQMA 5CSYA 2PWHA 1I2NA 1XHGA 1VFTA 3CYJA 2DZPA 1W2PA 5AC4A 4GGHA 1PB0A 3M0KA 1FBAA 3PJTA 2YL6A 3G1AA 1RALA 3DFPA 4R88A 1VYRA 2HK1A 4DELA 5A6JA 3R8HA 1D9EA 4QG9A 1VBHA 4F0LA 1EC9A 4E2OA 3STCA 1YLVA 3INPA 1MQQA 4H8HA 1MQPA 2YPIA 4NF7A 4FR1A 4WCJA 5M5DA 3BK0A 3MSYA 5I7GA 2WZMA 1R3YA 2ZX5A 3LHUA 4UZSA 1O95A 3N2XA 3ANVA 4YYFA 4QG8A 1FQ0A 1R7AA 2XN2A 2XINA 3AI0A 2EBNA 3ZJ8A 1WP6A 2WVTA 1V0NA 4NJHA 2E9MA 3PY2A 2I9EA 3E2QA 3T7VA 5K9CA 3WK3A 3AMLA 4CU6A 2YDSA 1P6CA 2NX1A 1Q4WA 3IVTA 4UTIA 1G69A 1YBQA 4XV0A 3OGSA 3N4FA 5DRCA 4IH3A 3QVQA 2ZXDA 1RQEA 2BZNA 3P0XA 3M0YA 4A6GA 1IEIA 3CB3A 4H04A 1AODA 5AVNA 2G37A 3AOFA 4G7FA 2VL4A 1CXLA 4Y9NA 3V35A 4XO7A 2WMFA 4L4OA 4LEFA 1XUZA 1O94A 1Q63A 1HX0A 4HPJA 3SCOA 3P80A 3PNUA 3K2GA 3P81A 3A4WA 3OHMB 2VOTA 3EAUA 3SCVA 4KS0A 3W76A 3WK2A 1LOSA 5FF3A 3FJLA 4CD6A 1HVQA 5C8BB 2VGFA 2RJGA 3DFTA 3OG3A 3VZYA 1OFPA 3P14A 3WLKX 2VX4A 1D2KA 4NYUA 4LB3A 3VIKA 4UOQA 2OQYA 3KOZA 2E0PA 1Z42A 1X6NA 3GHTA 4A3YA 3L5AA 2WVSA 2VTFA 4UXDA 1CTNA 3BMVA 4WDXA 3L4WA 1XUUA 2XU2A 3W38A 3IARA 3N2MA 1IZCA 3WCZA 2WJFA 1SMDA 1OFQA 1UR8A 1XPGA 4MNLA 2A3BA 4Y9MA 3SQLA 3CUGA 1LLWA 1LP6A 4BI7A 3OZYA 4L6DA 2B7PA 3CTTA 1SUXA 5C2XA 2ZRZA 4FF5A 2QIIA 3WNOA 3SCNA 1REQB 2VC6A 3E1F1 4K1GA 3KS6A 4NX0A 4J7RA 3VYLA 1IYXA 4F8XA 3E02A 4I5UA 1SZRA 2AGKA 4MYXA 3GKAA 4P7LA 4MJZA 1UKQA 3BVJA 4O13A 1UA7A 4PFMA 4TX9A 4UQDA 1QXLA 4UTJA 1UW9A 4N4PA 1FKWA 1JEZA 4HSHA 3OIXA 3GH4A 3DYPA 4JX5A 1V6XA 4FXSA 3MO7A 2C16A 4Z2GA 4HIBA 3IEBA 3PZQA 4JXCA 5AECA 4Q8VA 1HF6A 3BAJA 4HCDA 3G1YA 4HNCA 4J40A 5D2WA 4AUBA 3DG7A 3ZT5A 3GHUA 1CECA 1GZGA 2HS6A 5LHFA 2INEA 4B9YA 2IUZA 1PUDA 3BE7A 1SO3A 4F2TA 1AJZA 1OADA 4OBTA 1AJ0A 4MSSA 1ICPA 3FGCA 2CZDA 2FVLA 3APGA 2XH0A 1V08A 2PZNA 1CW2A 2EGZA 4Z1YA 3I7QA 3L0GA 2O7QA 3TYUA 3LDVA 4H01A 1KBBA 3R0DA 3AIRA 2PWDA 3DFHA 1K8ZA 1JPHA 2PDWA 1ZTVA 1P7TB 1U83A 2VM8A 3NCOA 2OFJA 5I06A 2G3NA 1D3CA 3R89A 3DFQA 3L68A 1R3SA 1K8YA 2CLPA 3W2LA 2R1KA 2C1IA 3FOKA 1V03A 4ROPA 4V1YA 1RCXB 1TPEA 2UY5A 2GDUA 3R0UA 4M82A 3CZJA 5HANA 4GNKB 5AHFA 2G3JA 1FCVA 5FA5A 5D2VA 1T40A 2R8WA 1ZALA 3ARYA 2HS8A 2DZUA 2IKJA 4WX2A 3TFXA 4JTLA 1EJUC 3WD2A 5ABTA 1XI3A 3B05A 5CGTA 3E5BA 1F3TA 1JQVA 4UNIA 1TV3A 1Z69A 3HOJA 1S1PA 2NUWA 4BEUA 1I0DA 2FTPA 4ZB2A 3BSGA 4LAKA 5M17A 3S6TA 1OBAA 4WQ6A 1QPQA 3W2MA 2JALA 3NDYA 4AEOA 1MMFA 4QNWA 3CL7A 3L9CA 1KA9F 3MSDA 5C2GA 3DHFA 4GACA 4EWJA 4M6UA 2DT3A 1JAEA 3ZLHA 5CC7A 5F7UA 3UXKA 4B90A 4NUWA 2IKGA 4S3EA 3VD3A 4RXFA 4PMQA 3GDTA 5ECUA 4ROQA 3GC4A 1B9BA 5I24A 2W6RA 3JRKA 5CGMA 3VZZA 2PC8A 2BY0A 1G6CA 3GDKA 1WDPA 1TPFA 3NQ6A 3CUHA 1J01A 1TPB1 3W7MA 1NF0A 2V2DA 1YQ2A 3LV6A 4ZB5A 1D8CA 4JYDA 2PDLA 1O6IA 3KX6A 3N2BA 1XG4A 4DHGA 1KFLA 4IG2A 4UIOA 3N9SA 3AMCA 4H9UA 1WPCA 3A4XA 3K8LA 3I65A 3L2IA 3QC0A 4XUYA 4DPPA 3E5PA 2V5DA 4P8UA 4Z1CA 4EXAA 3TW7A 3COTA 3W1MA 4ZOAA 5C9ZA 3FW6A 3NQCA 1HKWA 2E8ZA 4Q8TA 2X05A 3II1A 5U4NA 4XKYB 2WQDA 3PVFA 4KGJA 1NAL1 1ONRA 3IS4A 2QDHA 4GD0A 1UZHA 4NNAA 4Q4PA 3UERA 4HB7A 2DZSA 3WH6A 1M6JA 3RIKA 2ZRXA 1UMYA 1QNVA 2CLHA 2FYMA 4HHLA 2P8BA 1GZJA 2WANA 3VD4A 3L4YA 3GUWA 3GXFA 3PZMA 5I2UA 3AC0A 4DJFA 1K6AA 1QTWA 3LBCA 3R79A 3EDKA 3S9ZA 2X16A 1W1TA 5AYYA 3WD3A 3GFYA 3TNBA 4RNHA 3QPEA 2RGMA 1Q45A 2PGFA 1HO4A 1UD8A 1JYVA 4AY1A 2QCFA 4Y9OA 3VMOA 3R8GA 4DJFC 8XIMA 3BWWA 3SJNA 1OX4A 6XIMA 1H63A 3LCWA 3W7IA 2HMCA 3GDMA 3DHPA 4MZ1A 3GR8A 1PE1A 3G0XA 3TTSA 1TJPA 3T09A 2O92A 3MP5A 1UWRA 5HBFA 6ENLA 3V18A 3RM8A 3UXAA 4IIHA 4H9MA 2FPVA 4ZQRA 1E0TA 3QFEA 4WDUA 1G9HA 4YCPA 1WQ5A 1UWSA 3QLDA 4YTRA 1DJXA 1KFCA 3O7UA 3LZ5A 3C2EA 5I3KA 2ZE3A 2DUZA 3ZXWA 1B9ZA 1EEPA 3I68A 2HZGA 3MS8A 3VIMA 3LZ3A 1FCQA 4CN1A 4O52A 1POJA 2VCCA 3TSDA 3SN0A 1YDYA 5HMEA 2LLEA 3PG8A 1CXIA 3TCSA 1BVWA 2BY1A 3LQGA 4HZ7A 1J6PA 2YW3A 1H5VA 3A9BA 3LLFA 4PUEA 3GIYA 3OQ8A 4GPNA 3GK0A 4QS5A 5LGZA 1TWIA 4PRTA 5LKYA 3QPYA 4XD6A 1DJIA 4KESA 3NSNA 2YYTA 4KWUA 4I7UA 1UUQA 1FCUA 3DCPA 3N14A 4FR6A 3W26A 4AIBA 4Y9AA 3GS6A 3TP4A 3F2CA 1B3XA 3T4WA 5A6MA 2PTXA 4W88A 1YMYA 2I14A 3UA4A 5DXYA 1GVYA 3LMZA 3PBWA 2XJ7A 1UWAA 1KV5A 3QLLA 1DWAM 1DOSA 3T08A 1IHIA 4HSOA 3SRHA 1LT7A 3S8HA 1GVOA 4AZCB 1P43A 3EA1A 4LVDA 4GKLA 3D47A 4AC7C 3KCOA 1SM9A 4GUHA 4O0QA 4WY0A 1Q6DA 2PWVA 1GVFA 3VD7A 3DC8A 3I3BA 4TX6A 1BF6A 1UASA 2DQWA 3KVJA 4TXEA 3NEHA 3EXSA 1XKJA 1J0YA 3G18A 1UIOA 3UY7A 4W87A 1I0BA 2WZIA 5JU6A 4PRWA 4RDZA 2YCIX 1XLBA 3DKJA 2YL5A 3UWVA 3KS5A 2V0TA 4TMBA 2XFYA 1DE5A 2Z1WA 1N8IA 2JEPA 4GA8A 2WMIA 4UTFA 3AHXA 1OX5A 4WGHA 2UWFA 4JIIX 3FDKA 1DE6A 4NU7A 1A5AA 3W7LA 1XIDA 4ZENA 4IL0A 3UW6A 1Z3NA 4WHBA 1X38A 1MNSA 5HWJA 4XVDA 2F8QA 3CQJA 3M5VA 4QQUA 3VILA 1JYWA 4LC6A 4C6NA 3QRHA 5C9UA 1MW2A 2DZTA 3I7RA 4AC1X 2QXWA 5DCDA 3KOWA 2CBUA 1XRVA 1AW1A 3P5ZA 2PDQA 5A6KA 3WDPP 2HBVA 2BGSA 3IJQA 1OABA 1O1ZA 2HPIA 4MGGA 2NQHA 3KBWA 2ZUWA 3QW3A 3UPMA 4XBJA 3VC6A 3TYBA 4YWIA 4IIFA 2CERA 4WKHA 2QUMA 5HDRA 3TZNA 4HKPA 3E0LA 3GFXA 2C0HA 3MANA 4J4KA 3KHJA 3WFZA 2JKEA 1GTEA 2FHFA 1HJUA 3PBGA 4ZQOA 3VX0A 4F9DA 2E3ZA 4HPHA 1DP0A 3V5FA 4WXZA 4PZVA 3W1RA 3BTNA 1A47A 1NTHA 4W84A 1EGZA 4J3VA 3ZYZA 5LA0A 1OC7A 2X2YA 2PDKA 3F5JA 4PTVA 1E6ZA 1JGMA 4Z42C 4L5ZA 7TAAA 2GGJA 4R3UA 4YPJA 6PTDA 2G3FA 2WQPA 2WPBA 4XIMA 2WYSA 4DWSB 1T6MA 3GZ3A 1E1FA 3LG3A 1ZJHA 3EOOA 2KAUC 4AIUA 1V6WA 1FWHC 3EYPA 2A3EA 3NVDA 4KRZA 1P4CA 4RR4A 3L7RA 1TMQA 4US6A 2J9YA 4L7ZA 3HB9A 1AZ1A 3MUY1 3WQ4A 4ZO6A 3GLCA 4DBDA 4N9CA 1UCWA 1G0CA 1A5SA 2GYIA 3PP7A 2CLIA 3M0JA 3UR7A 1OFAA 3GG1A 3GVGA 2F7FA 1G94A 2V68A 5EFDA 5E1QA 2PGEA 1J12A 4HJWA 2ZQ0A 1N2VA 4JFWA 1B4EA 2OPJA 3RXZA 1DQUA 2YYUA 4XKMA 4JKLA 4BWLA 1SJAA 1M01A 3HGJA 3I4EA 4KETA 4ERAA 1JG9A 2UV8G 3KVMA 1EP1A 3MCNA 4GCAA 5A5WA 2DVXA 1IXOA 3RR1A 3AIEA 1VZWA 2PRLA 1GVSA 4QFUA 2YCKX 4ZA0A 1ZPTA 4DY1A 1HJXA 1WDWA 4K8HA 5HMDA 4PMZA 1GQJA 5CC6A 4DAFA 4FB7A 3B4YA 2BNJA 4DYEA 4BWLC 1QCWA 1MQRA 2OZTA 1M03A 1TWSA 2ISVA 2B0MA 4OECA 3UPWA 3KCJA 1CWYA 4HYRA 1FVPA 2QJHA 3VVGA 1JCYA 1L0PA 3GYEA 1H7RA 4X2PA 4FNRA 3AYTA 2DT1A 4XBKA 3F5KA 1MVYA 5EMMA 3ONCA 4WGXA 2V5JA 3QHNA 4DUWA 3HG5A 4LCQA 2UZ9A 2UY4A 2VFIA 3FHQA 1KNWA 1UP3A 2EPLX 2ZVRA 3AJ7A 2CLOA 3TIMA 3NM3A 4DZAA 2OSXA 2YCLA 5REQA 3D3AA 3FVDA 2G3MA 4B5XA 1EHAA 4MKSA 1SW3A 2OYKA 4PMRA 2J7FA 4D6EA 1B5TA 2NXHA 2A1YA 3EXRA 3L67A 3VCCA 2GGHA 3PTKA 5T9CE 2VQUA 5HWNA 2XIQA 3ZZ1A 1VCFA 1QI2A 1BF2A 3N9RA 2NW0A 3LSBA 4AMCA 1E0VA 2HE5A 4BF5A 1QPRA 3GXNA 3LGGA 2EO7A 2WOQA 1DIKA 4JIPA 4RZBA 4PUWA 1S5WA 2HEJA 3BLFA 3BURA 3W00A 1XRFA 3AS0A 4AD0A 4UTTA 4GZEA 2XM2A 1CLVA 3HPFA 3MUAA 2RDUA 1DL3A 5JIPA 3MUZ1 2F6XA 3HN3A 4EPBC 4HGXA 3G77A 4LUSA 1PZ2A 1SFSA 4AH7A 4IUOA 1WBHA 1EH9A 3N3MA 3B9NA 2ZRYA 3BG5A 1UWTA 2HVNA 4UTTC 1S39A 3PUOA 1XDLA 3NPUA 4A3UA 2ZVIA 1UUOA 1LLZA 4D6IA 4LVAA 2GL5A 1EX5A 2GLKA 4IIBA 3UA3A 2ZA2A 2J25A 3AROA 4MKVA 1RXOB 3MKVA 4Z2KA 1I1WA 2EPMX 4B91A 1ISYA 1U5VA 4QE5A 3AMDA 1QASA 1I2RA 3NWRA 1A4LA 1N8FA 4C7GA 1AQ0A 3J7HA 3VM7A 3NXLA 4G7EB 3ME3A 3QM3A 3TV8A 2QR6A 5H2ZA 1LM1A 2OOFA 3OG2A 4O1DA 3TYAA 2I5IA 1VH7A 3EDFA 5CLWA 1ZENA 2AAAA 3IIPA 1ADSA 4H6QA 5A6LA 4YLWA 3C0JA 4QCEA 2Y7EA 4N2YA 4AF0B 2VXNA 1BRLA 3BLKA 1VPXA 1H41A 1ONWA 4LC8A 3HU7A 4PMJA 2VOMA 1PWLA 2QT3A 3JR2A 4CD4A 3N25A 3NEVA 2Z7KA 3KM8A 2QPSA 5K4ZA 2XPKA 1V77A 1JRBA 1WZMA 2XIIA 2AQOA 3W7DA 2IPFA 2BY2A 3NL6A 5DEZA 3U9IA 5BROA 2DPEA 3SRFA 3WO8A 3ITLA 2CLLA 1Q7MA 3RM9A 5G2WA 1WA3A 3PBUA 2BS9A 3NQ2A 2D0FA 4TIMA 3FIGA 1VFMA 4C6DA 4ZCWA 3NO1A 2PLJA 3FEQA 1XCXA 3ZLFA 3UVAA 2CESA 4BF7A 4HBKA 4H41A 2IXUA 1X96A 3CQKA 1M04A 2XH7A 2HPMA 3IRDA 4V27A 5AOUA 3BQ5A 4A8RA 2RFGA 2D1ZA 4QGCA 1S5VA 1XISA 2E77A 4PCNA 3EWWA 5TF0A 1WB0A 4XAZA 1S1RA 4HU0A 1C9DA 3VIIA 2X0HA 3GXMA 1PPIA 5IBXA 1KM3A 4LW7A 3W2NA 1VFOA 1CNVA 3GNOA 1TIWA 3TR9A 3IJ6A 4J3XA 1UH2A 1K02A 1QW8A 2CHRA 4P7OA 3QSRA 1HW6A 3NZPA 1RY8A 3P84A 3EKZA 3WYZA 5KITA 1G4EA 1DQWA 3PWIA 4MOZA 1UR9A 4K1WA 3CPGA 3UJFA 3OLGA 1XBYA 1EA9C 4R9OA 3T0CA 4S3CA 5F1UA 5IBXC 2QPUA 1RJRA 4ALDA 3O6DA 1PCWA 1RY0A 3ITYA 2XHYA 1RUSA 3MVIA 4JHOA 3IWPA 1LORA 4MPKA 4LVFA 1Q2SA 3OYXA 1QOXA 4IGNA 9XIMA 3URBA 2ATSA 4GLEA 4K36A 3EDDA 2D23A 3TX9A 4NZ5A 3CUJA 3KTSA 4XTIA 1BYAA 3A13A 1OK4A 3AMKA 1X6UA 1RJPA 2X7WA 4IIGA 3G1DA 4O57A 4FIRA 2DZBA 1BD0A 1BSLA 4KQNA 4GVIA 2WMJA 3L4VA 3QZEA 3N73A 2A7RA 1LUCB 2DUXA 1K7XA 3GXTA 1AL8A 1ESWA 3W2JA 3HO8A 3FS2A 5CLTA 4HYWA 1UH3A 3H12A 3CZGA 2EG8A 1J0ZA 1A5CA 3AIBA 4FHAA 1C3FA 2CCRA 2BVDA 3DHDA 5CGQA 3T05A 1WBJA 4WDWA 3W53A 1E6XM 1E4NA 3V0SA 1TV7A 2OQLA 1LWJA 1REQA 4BY3A 4KWOA 1VEPA 3V3WA 1G01A 1XLAA 1LT8A 3UEQA 4HVXA 4UTKA 5DANA 4U33A 4UB9A 3QGAC 3VKKA 1PX4A 3L4UA 3RO6A 1M3UA 2NX3A 2VC7A 1U1JA 2P10A 1TTPA 4F2UA 3KRUA 1JDCA 2V63A 3B9DA 3TYEA 3M0ZA 1R5YA 2QDEA 3DYMA 4XZBA 1SSDA 1ZBVA 1S3TC 3VKJA 4U3CA 2WXDM 2DIEA 4QCFA 3E6EA 1VAHA 2WW5A 3O2LA 1KLYA 2W61A 5C9RA 1GEQA 2WJDA 4QTGA 5CBJA 3UZ5A 1PTAA 2DSKA 3W4RA 3VGHA 1X1OA 1JFHA 3RU6A 2ZDSA 3HMJG 1EYEA 5C5YA 1RH9A 4OZOA 2PWUA 4CCEA 4PCPA 5DRIA 3SN1A 1P7TA 3GXIA 4CQ8A 4GH1A 1JI1A 3RRXA 1VFUA 2XSXA 1CGYA 4AVNA 5D33A 3HURA 2GJRA 3WBYA 4M5PA 2OB3A 3TQPA 2R91A 4JTQA 4C90A 1GOMA 4DF0A 1WO2A 2QKFA 3PJWA 2ICSA 3DI0A 4QJ5B 3QJAA 3OBEA 4IISA 5M2FX 2QAFA 3GW3A 3TTQA 5FCZA 4A3RA 3KTXA 1XLKA 4A05A 1RLDA 3CV7A 4NT0A 4S2BA 1R3WA 1SJBA 3PZ9A 2V2CA 1YRRA 4UTWA 4WJ8A 1HL9A 3IUIA 1QI5A 2PP0A 3BW3A 1BTMA 3DX5A 1BG4A 4IJCA 1JPKA 2VZTA 2GVJA 5HULA 2ZZ6A 2GSEA 3H6OA 2O4MA 1LOQA 2AGTA 4U28A 3T2QA 2GQ3A 3CHVA 3W87A 5BWAA 4AHPA 3LHWA 6ALDA 4UTWC 4I5RA 3VNLA 4UQAA 4E3VA 2PLKA 1GW9A 2VZVA 4IMGA 2FJKA 2YDQA 2G41A 4HA0A 3EWDA 4AIOA 1G67A 2Y85A 1JNDA 1W56A 2VRKA 2Q6ZA 5CZSA 2P88A 3W6YA 3T07A 4JNMA 3TSBA 3W85A 2ZXQA 1GOQA 2TSYA 2P0OA 2TYSA 3TW6A 1QBBA 4Q6XA 5I77A 2DDXA 1NVMA 1XLEA 4XB3A 2BVYA 1HVXA 4C60A 4KW2A 5L6UA 2HCVA 2DJXA 2INZA 3TJ4A 1E15A 3HJZA 3NOYA 4ES4A 5EMKA 4ECLA 4KH2A 3VU2A 5BMXA 3KUMA 4MZYA 3GBDA 3MJYA 3F4WA 1EJ7L 4UTHA 2PF0A 2ZUNA 4LCRA 3FA3A 2PODA 3VAVA 3ITTA 3LNPA 1OZMA 3O1NA 2WPGA 1EOKA 3MUXA 4O1BA 3EOEA 4DZIA 5I0DA 3JZEA 1H2JA 3C8NA 4FNQA 4DI9A 2ZCGA 5T8GA 3GIQA 5KETA 4RV3A 2A0NA 3OA5A 3R58A 3CU2A 1LBFA 2VP8A 1TV2A 3AMGA 3WJXA 1MDLA 5HQLA 2C8NA 4H9XA 4TR9A 3EWZA 3ABQA 3ITCA 4GHRA 4HZ6A 1OM0A 4GC4A 4H6KA 4XX6A 4KCWA 1EEXA 1MW1A 2CZEA 2R82A 3PANA 2ZADA 4LUYA 3KVLA 3WBXA 2IS7A 1S46A 2OX4A 1EKOA 4AD3A 1TV4A 3LXBA 2JE8A 1HO1A 1JUKA 1MUCA 1TJ1A 3OLEA 1QNPA 3FK4A 3LCXA 4IPLA 1QW7A 2XISA 1E6RA 2A79A 2VEMA 2W66A 4CN6A 1TELA 3GUGA 2P76A 2NQJA 2CHOA 4HNLA 3BL3A 1K3UA 1KR1A 1VFHA 2Q8LA 5DY2A 4GXWA 2RH9A 4XZLX 3ERPA 3ZR5A 4C91A 1N7KA 1TA3A 4P7NA 1ZSXA 3LX9A 4EVZA 3H2FA 2VI0A 1PVNA 2W62A 5B7ZA 2WBKA 2YZ5A 1EC7A 2QUUA 2D0GA 3BAYA 1UC5A 3TROA 4GH3A 1Q8JA 1Q5MA 4IPPA 1HP5A 2O0TA 2QCMA 4J3WA 5IOBA 3W83A 4GX9A 3WF2A 2JKPA 4US5D 4HN8A 2QJIA 4DXVA 3LCFA 4DIAA 5U7SA 3V16A 2V3DA 3BMWA 3AIVA 5HJXA 5A8GA 5CEWA 2FZBA 2ABBA 3UZYA 3ABZA 3SCPA 3V0UA 4FLRA 4ADSA 2P1FA 4NG3A 1LOLA 5BNKA 3VC5A 3G8EA 3OZOA 5GQBA 5B7YA 3OLIA 3EX3A 1BYCA 1EQCA 1ADOA 3DERA 5JIWA 4MDPA 3C3NA 3TOPA 3WH7A 1RAKA 1J79A 1RK5A 1CB7B 4HHMA 1U1UA 5FAGA 1KCLA 2VENA 2QUNA 2OSYA 3F4VA 4QROA 3UCCA 3ZT7A 2MANA 1F8IA 3CQ0A 1PDYA 1FHDA 1VCVA 4DPQA 2PC4A 1TWZA 4IXHA 4AZCA 4JCLA 2X1SA 2NLIA 1VFFA 4DAIA 4WEVX 4UFKA 1UB3A 2Z26A 2PWGA 3VXGA 1EX1A 2OX1A 4ENLA 3ES7A 4CCZA 3MI2A 1KFWA 3KRBA 3BV4A 3M1ZA 3VA8A 3O8AA 3AWNA 2NT1A 2EPOA 3GR4A 2ACSA 2OCZA 1JCJA 1UR0A 2J88A 1O1HA 4CNOA 3REQB 2DZAA 1VR6A 7A3HA 1XFCA 2PFHA 3B8UA 2WVVA 4DO5A 1ITCA 1Y8BA 4H8UA 2PZ0A 1P0BA 3WX7A 2G4JA 3G1XA 2OT0A 5EMJA 1Q65A 1XSIA 3TSMA 3WQ6A 3NUKA 2PPGA 5GNYA 4IQJA 4QNEA 1U5HA 3WH9A 1GT8A 1JF6A 1A5LC 1CZ1A 2E6FA 4Q32A 2EF9A 4H9VA 1DXFA 2PMQA 3VOHA 2G4FA 5GJPA 3TEVA 1K03A 2BHUA 4IIDA 4G5DA 3UZZA 2PU1A 2D3NA 2B81A 1Q6GA 1F73A 5FD0A 4FLQA 4UBPC 2H90A 2ZWYA 3TR2A 3W75A 4GFIA 2WMKA 3O6AA 4WOZA 2EPHA 4RW3A 3PUDA 5CJ5A 4J1OA 2YIHA 1Z9AA 1JPIA 5T91A 1YPXA 3NPXA 2C19A 3IJDA 3KFTA 4IOTA 1YNYA 4YXGA 1R2TA 2G0WA 3R94A 4GUJA 4HZ8A 2IMRA 1CCWB 3WQFA 3AIWA 1LTDA 3B3DA 3AZTA 4YVPA 3VKDA 4W85A 4E0CA 4P8XA 1R3VA 1RV8A 3VIGA 4PR4A 1B4KA 2Z0IA 1O4UA 5AB3A 2ZDRA 2V81A 1OVDA 2V8ZA 3VIOA 5HAOA 4JPGA 3M0VA 5BMWA 5TQLA 1X97A 3H70A 3G0SA 3URQA 1R87A 4B5NA 2WK2A 4YVXA 1GKQA 4JTRA 1TFVA 4OKDA 4OWGA 4BZYA 4AAJA 4DWSA 3FJ6A 4OIFA 5FAJA 5CXPA 3FLUA 1KM1A 3F2DA 5KSWA 2DW6A 4DF2A 3BLDA 3U48A 2YBTA 4P5UA 3F5LA 4YL2A 4Q8QA 3EPOA 1ECQA 3SCSA 3GY1A 3M4HA 2VC5A 3M43A 1YTEA 4X0VA 2OR2A 4DWSC 2QAPA 1DXEA 3PK7A 1NQ6A 5BU9A 4ZOEA 4CGTA 3RAOA 3TXVA 1UKOA 2P0IA 3MBDA 1FDZA 3U7VA 4GYPA 2Y7DA 3MMTA 4A35A 4LRSA 3FXGA 5AHIA 1EOMA 1TKKA 4ICCX 3CUFA 4YCOA 3ENLA 4MNMA 5JBFA 1FWGC 3BAWA 1G7VA 5E0KA 5LIKX 3OZMA 3MMWA 3QYSA 3SGZA 3FCPA 3PBYA 2ZXAA 2JK2A 3WQVA 4XZIA 3LCIA 2BVWA 4GYPC 3RILA 2Y8VA 3RF9A 1OSEA 3RCMA 2RGLA 2VQTA 2QPXA 4GQBA 4A21A 3RU8X 3U0HA 2J6XA 3L5MA 4JTSA 1QATA 1EJTC 1IXNA 5FEWA 1XYCA 3WLIA 1MNZA 3ECQA 3OBKA 1OX6A 4M80A 3RMJA 1AJ2A 3LGDA 2CZFA 3UFYA 3LRKA 4W89A 4GUIA 1PBGA 1R3QA 3AZRA 5F2GA 3T1GA 3U6WA 3UETA 4DO6A 1KBKA 1KKRA 1PYMA 2QVHA 1DEDA 1M7OA 4IFRA 3EKGA 1XM3A 1M5WA 3DZ1A 4PN2A 4AXKA 4NP7A 1FDYA 1GG0A 4NXSA 3QYQA 5HQEA 4H7CA 3TDFA 3IACA 1G7UA 4IPJA 3WN6A 3H2AA 3ZWSA 5LA1A 5F4XA 5FESA 3DC0A 1DVJA 4IUGA 2Q02A 1CBGA 3R25A 3GG8A 1IIGA 2WBGA 1P48A 3LD5A 2A5HA 1K8XA 3G2GA 1V6YA 4BEQA 2E5BA 3QZ6A 3WNNA 3M5YA 4PMOA 3W2KA 2CWXA 3SRDA 2BDQA 2OTDA 3OOQA 1W5OA 1ZS2A 2UY2A 2WMGA 1JQXA 4DZ5A 4REQA 3PFMA 5E5CA 4PTWA 2QF7A 4A2SA 1JZ5A 4CQDA 1UD2A 1LQ2A 4MB4A 4P8VA 1RPXA 3E49A 4H6RA 3DH7A 1HJQA 4IPIA 4O11A 1R46A 5FJPA 3T42A 2GGIA 2GJNA 4J3ZA 4PEKA 1LBMA 4UR9A 5E70A 1Q6CA 1NELA 3P5YA 1NEYA 2VR2A 3SN4A 1R85A 2NLYA 1OGSA 4C5ZA 3S1UA 4CQCA 1GYMA 4Y7EA 4H9TA 4C6EA 1YW1A 5EBAA 1CDGA 1LG1A 2PDMA 2I16A 1OZQA 4LUTB 2VFEA 3W1AA 1VPYA 3CJPA 1QMLA 1Q3NA 3IIOA 3WY1A 4ZSUA 1IT8A 1QI0A 1H7NA 3GTIA 3LM7A 4Z1BA 2FZDA 2IW0A 5EMUA 1VIWA 5H8UA 3B4UA 5D9NA 4LUIA 3IJ9A 3IIXA 4YTQA 4G7EA 4ATLA 4IICA 2WV8A 1H7WA 4BI6A 4E8CA 4UFMA 3RO8A 3LY0A 3BAKA 1XKYA 3H2MA 4HHHA 4G9PA 1KRCC 1RBLA 1V0KA 3CL8A 1XLLA 4GUGA 3WQWA 1PTGA 1SZEA 2VEGA 4ZOCA 3QFWA 4K7VA 3TW9A 4TUFA 4YN5A 1LRQA 3POCA 4MDOA 4NNCA 1B57A 1LRNA 1MWOA 1OB0A 5A8OA 1E4LA 3BGAA 3IANA 1WAUA 5C54A 1OGBA 4OQVA 2X40A 3U5UA 4DBWA 5TIMA 3DUGA 4CD7A 3BG3A 2B7NA 4NI3A 4MJMA 1XG3A 2E8YA 3N11A 2WKJA 2FIQA 3S46A 1ITXA 4ORIA 4O4WA 3KLLA 3ZFHA 1FP8A 5IFTA 2QULA 4AZBA 4JCMA 3CHDA 2XG9A 1R9ZA 2D73A 2O9RA 4IQLA 3OA3A 2QGHA 4J27A 3B0VC 2PRHA 4PH6A 3I3DA 2HVMA 4L6HA 5DMLA 1W6TA 1NFBA 3KVKA 1YYAA 3AISA 3LPPA 4Z08A 3OO2A 1I75A 3GNPA 2NUXA 2VYOA 1E1CB 2WZHA 3EWBX 4XD4A 5CC5A 1ADDA 3L0KA 1LQAA 3VKBA 1K7FA 3O0FA 3W72A 4G1KA 4X22A 3DIPA 3UCQA 2WSKA 4JDYA 1V7YA 3Q65A 1XGDA 3K5XA 1OFOA 2NXGA 3LCHA 1OG0A 1M1BA 6CGTA 2VDGA 1R30A 1R2RA 1V3IA 3UP8A 4E4UA 4L65A 5HNUA 3BO9A 2REQB 3QGKC 1BXCA 1FX6A 7REQB 4WVXA 1CGVA 1W37A 1EIXA 3N6QA 3FJNA 1EXPA 3I3EA 1FH7A 1E55A 4FMVA 3QOMA 3WD0A 2F6KA 1DJYA 3GTXA 1YX1A 3OTRA 2GZXA 3SFWA 1RBOB 1I6NA 4HOXA 2J8FA 4HPXA 4C7FA 3UXLA 2J8TA 3T2OA 3BJTA 3QQWA 1AZ2A 1YXYA 4K6AA 4HPNA 3PSWA 3ZR6A 1ZFJA 1Q4NX 4UMAA 1DXIA 2DZWA 2H6RA 2GJPA 4F0MA 1EC8A 3N1AA 2I7GA 1SO4A 2QV5A 3V4BA 1ZLPA 1VIZA 5A2CA 1Q85A 5EFFA 1O5QA 3C2FA 1Y5VA 2PDGA 4JAWA 4G1NA 4QIUA 2EEXA 3WNLA 2QV4A 1E6NA 2PBOA 3MUIA 3QR0A 4GIYA 2WZEA 3P74A 3B0YA 4PODA 1WOAA 5LA2A 1OC5A 4QEEA 5GNZA 3PJXA 4M56A 4QXIA 2Y88A 3FKRA 4Q8PA 1LUCA 1V6UA 1H0IA 2FKPA 1AH3A 4ZBCA 4MTVA 5G2IA 1ME9A 4ZODA 1HJVA 3PHAA 5J04A 1VYSX 3JS3A 3RR4A 3GH5A 4FX7A 4AZGA 3VIJA 3WLJA 1XLHA 3WLSA 4WR3A 1MYRA 3SUWA 4D71A 1KXQA 3GFZA 1KFKA 3WUFA 1Z7AA 3N9KA 4MWAA 5D8WA 3THCA 1H7XA 3PR2A 3WUGA 1JDEA 4HOWA 2VVNA 4OU1A 3PPCA 3TH6A 4F0SA 2WHLA 3N12A 2WZTA 3RCYA 4NZCA 1JRCA 2BFGA 2I57A 3SSJA 4KKXA 3CHFA 2ZUMA 2ZX8A 3IJ8A 1QJWA 4L1XA 1B90A 1JVNA 4O50A 2OYMA 2C7FA 4RZ4A 3U2CA 3S5YA 3HV8A 3VKCA 3WLNA 2BP1A 3USBA 1BVNP 3PWAA 4XQ6A 4O53A 2CLEA 1QT1A 2VWSA 3WZ0E 3ITVA 3S6OA 4XZHA 5HXMA 2C15A 1ISZA 1W1VA 1XV8A 3WF1A 1TTJA 3CAWA 1A0DA 1KGUA 2X09A 4GYFA 4R53A 4P7QA 3UGVA 4PGLA 5JH2A 3QTPA 1SQ7A 4HA4A 3DFOA 3SQSA 4B15A 2WHKA 7TIMA 1SYTA 3QMRA 3GZAA 2EQDA 2EAWA 3TN3A 4NSBA 3C3UA 3RYSA 1UOZA 3W1UA 3CTLA 4ZO8A 4EAMA 3EWCA 2J7DA 2R9RA 4TQTA 4WKAA 4MLRA 3IGXA 1XIJA 4ZQMA 5CG7A 3UWZA 5LSMA 1US3A 3NL5A 3U2ZA 1EXBA 2E5CA 4BFAA 1GZ1A 3PZIA 3S2NA 2V5KA 3WLMA 1G4PA 1QUMA 4PFHA 5T26A 4F48A 2PDCA 4F4RA 4UWMA 2VCBA 1R8LA 3PPFA 3HGOA 2FHBA 4IFKB 3WL0A 3LI0A 1SPQA 4PL2A 1IQ8A 5I3JA 1WYIA 3DYOA 5DMNA 1I4NA 1JNEA 2G96A 3RLGA 3CT2A 4LH8A 4R5EA 5AC7A 4CNPA 2JGQA 1NWRA 1X98A 4YHEA 2OMAA 3AHZA 1UQYA 5D09A 1JI2A 1DWGM 3S5ZA 4QSHA 1J0IA 1UYQA 3I4KA 5I00A 3V5CA 4J5NA 2R1MA 3PNZA 5ABHA 4LS1A 1HGWA 4DM1A 5EU9A 1XH1A 1E40A 3DESA 3TQ0A 2Y1HA 3W82A 1L6WA 2HDJA 3HGRA 5EB8A 4CQ9A 2AMGA 1OCNA 4S38A 4EANA 4OVXA 5I6SA 1NU5A 1WKFA 3E0WA 4WUIA 4F3HA 5CZTA 3L4TA 4RX0A 4Q4KA 4BKNA 2GUBA 4C6IA 1QNRA 3A5FA 4KRTA 4BQ2A 2V5LA 3CV2A 2D2JA 1TPUA 1IR2A 1K9DA 5LNSA 1XP3A 4RPPA 2BXZA 1TQJA 4UMCA 2W67A 3JU2A 1J0HA 1JD7A 3WDQA 3VMPA 5EMYA 3U57A 2NQ5A 4Y8FA 3VNYA 1EL3A 2FZMA 1R2SA 1GOWA 1ISWA 1UP2A 1SR0A 1XWYA 3RPTA 4DBUA 3ABRA 3MY9A 4GXMA 1EJVC 3IGUA 1DKWA 1B3OA 1HIZA 2ZYFA 3H2NA 3GKFA 3W28A 3WKZA 1FH8A 2FGZA 4UOJA 2WB5A 3W7CA 1ZJBA 4ASTA 2BB0A 3OBAA 1A5UA 3M16A 5HA7A 3ICJA 4LOCA 3DU0A 4S3KA 3RX4A 3P0WA 4WY0F 4B9ZA 2A6NA 3TYDA 1GPWA 3ZIZA 3JZUA 3QH2A 1UMLA 4NILA 4RCXA 1EFZA 3VZXA 2PB1A 2RDXA 5FI8A 4XO6A 3HMCA 2JBMA 3U4FA 3WMLA 1L6YA 1AD4A 1PJ9A 3N13A 1PCKA 3E38A 3WG6A 3LCLA 2PI6A 3E2RA 2V3FA 1WZAA 4DLMA 4XVEA 3AXHA 3WQPA 3B0PA 3H4GA 3W2UA 3VGEA 1XDJA 4YHGA 5LIWX 4S3GA 1E9LA 4PMYA 3W1QA 3UJRA 4JZ5A 1ZY9A 1KB3A 5JXQA 3MI6A 4JOMA 1JZ6A 5B80A 1VJIA 2NSXA 2AKMA 4ZE5A 1XLIA 2OELA 4NRSA 1FKXA 3M46A 1SMAA 2ACRA 4GYJA 1US0A 2VNCA 3G1FA 4Y96A 2I9UA 2OVLA 1CENA 3BSHA 3VIHA 2FPYA 3PAOA 1D3GA 2O56A 4NVTA 3DEQA 3KL3A 2CW6A 4S3AA 1PZ1A 5CKSA 1EJRC 2RHGA 6TIMA 1FWTA 4R33A 1VLIA 3PSVA 3MYPA 3LTYA 4UNKA 5GVJA 2PCEA 4GVFA 3MCOA 1NDYA 4GNVA 2OLHA 2YDAA 3S5SA 1DJNA 2FJUB 4PB4A 5HOSA 2GGGA 3VFLA 4PB5A 5A94A 1US2A 3D0CA 3TN6A 4BQ3A 2ISWA 2HISA 2P3EA 1JPDX 3VFCA 4DUOA 3MW7A 1P5BA 2OGYA 2PDHA 1ZCOA 2FTWA 4HTYA 3QXBA 1ONXA 3WBAA 1XRTA 3EOLA 1J96A 4PRRA 4ZTYA 2ABAA 5K7JA 1C92A 1OD0A 3HQ1A 2A3LA 3REQA 2XH2A 3W3OA 3S3GA 3VDHA 1A5NC 1WZKA 1SJDA 4FNPA 3T8LA 3BGGA 4MJ2A 4YIWA 3VCNA 3WFLA 1E71M 5K9XA 2ZFAA 1HP4A 3TYCA 1BYDA 4GOAA 4JFSA 3SZ8A 1YDOA 3A3XA 4L4LA 3VOCA 3N4EA 5F4SA 4OTKA 3TC7A 1PO9A 1JZ3A 5LZLA 1A53A 1M65A 1W1A1 3WNKA 1AW5A 3LRLA 1NOUA 5BXTA 5G4WA 1P0DA 3AJXA 4JQAA 4IIEA 5LGXA 2YA0A 2EKGA 1VKFA 3S5NA 3NVTA 3AUOA 5H8PA 4FOJA 4Y90A 4W7VA 2CXEA 2WVUA 4ZFCA 2F84A 4QBXA 2DSWA 1J10A 1YBQB 1C93A 4UOZA 3AWOA 4DJDA 2HK0A 2VUNA 4MFEA 2C79A 4WSKA 4DBEA 3GAKA 3TWBA 3CL6A 2QCGA 4KEVA 3AYRA 1YNPA 4GY7A 3LK6A 3HG2A 1W3IA 3UNDA 4GXPA 1LG2A 4DJDC 3SR7A 3SCQA 5I3FA 2J13A 2I56A 4XBSA 2B31A 4V2XA 2V38A 3NQEA 2GVYA 4IMFA 5KZ6A 2BVTA 3WH5A 4HNTA 2ONEA 1QOQA 5K2ZA 1WDDA 3E0IA 2E9LA 3T2PA 4JTGA 5BU6A 3CAVA 1KGXA 3NQFA 1TE1A 4HD5A 1J93A 4RDVA 3NQ7A 2HQAA 2HJPA 3UR8A 2FMOA 2ZX6A 3HQPA 4CLMA 1ZCCA 5EBUA 1P1MA 1BWKA 1OT2A 1OT1A 1OF8A 2A3HA 1VD6A 1RZMA 1I60A 4WLCA 1UR1A 3KAOA 1TX0A 4RUBA 3WDHA 3B8WA 3GM8A 4HU3A 4NY2A 3TQKA 2ISFA 4UC5A 1LLOA 1DJQA 4PBFA 1N55A 1KW1A 3W7HA 3NYDA 1GQLA 1JXJA 1PKMA 3WF4A 3BCDA 3T8QA 2WM1A 4C1NB 3S1WA 1YTKA 3POHA 3T55A 3L21A 4GQGA 5KMYA 4BI5A 3RG6A 3W7QA 4GCXA 1F6PA 4JTHA 5TD4A 3WNPA 3TLLA 5CAHA 2CKRA 3ABOA 3HQOA 1OD8A 1MXDA 1MUWA 4GI6A 3DFSA 1E70M 5MHBA 4HNVA 1P0EA 3CO4A 3OU8A 1OIMA 3WSUA 3C2RA 1TR9A 4NL1A 4ZO9A 2Y8KA 2I17A 3BH4A 1PAMA 2WHJA 1RR2A 2Y62A 2QDGA 1XIEA 5C0QA 2J75A 3S1GA 4HSNA 5JQ9A 3BJFA 3VINA 1WKYA 4DJFD 4LS0A 3H22A 4NASA 3MKCA 3A4JA 3T81A 1LROA 2J24A 3E9AA 4DUVA 1C8YA 1ZU8A 3TN4A 3T0AA 3M5ZA 4HT3A 4D1JA 3UZXA 5TAOA 1UR4A 3FGCB 2E09A 5IM51 3G1HA 3QQ1A 4PA8A 1TPC1 1K70A 3O15A 4FK9A 5JVLA 1CXFA 3EXTA 2DIKA 1GVEA 1JCMP 4MY9A 2EXOA 1QPNA 2WKGA 4YTSA 2Y63A 3WDIA 4D9PA 1PEZA 1CLXA 4AU0A 4DNHA 5GJNA 1XDMA 1BGGA 3OPSA 4O1EA 4PUMA 4L6OA 1FWCC 1PWMA 1QK0A 8A3HA 3C0SA 2VR4A 4XD5A 3R12A 1ML1A 2VUYA 1CXHA 4CNSA 3W1LA 4HMCA 4XISA 1W1YA 2Z1XA 4UCFA 4ZEPA 4CN4A 5LXEA 1B2YA 1FHUA 3QV6A 5J5DA 2GVGA 3VNIA 2FDSA 5A2BA 4GFSA 1GJUA 3THQA 2O9OA 4E2DA 4QAWA 3W88A 1RVGA 3ATYA 3SAZA 2HSAA 2Q71A 1H60A 1GYNA 2VX7A 2XVNA 5HPOA 4EF8A 2CNCA 2BOEX 4UFLA 4L1GA 4FLOA 3S9IA 4PCTA 2QMJA 3T9PA 4RPQA 3VX1A 1J18A 1E5NA 1J2BA 1I2PA 3HQNA 4TTGA 1KM6A 3KRZA 3CPUA 3V0TA 3EMZA 2I1OA 4JQ1A 4FF7A 4ILSA 1VRDA 2VT0A 2XFFA 2A85A 3TZFA 1PX3A 3ARWA 2J7EA 1GNXA 1W8GA 4RKAA 4J3UA 3R8RA 4XZ9A 2ESCA 4IX0A 2XN0A 2Y6ZA 1XLGA 2GJXA 1SFTA 1MW0A 2GWNA 3R11A 2DZXA 3W02A 4ORMA 1J0JA 4I5XA 3IVSA 4J35A 4LUTA 4CVUA 2MNRA 2X0YA 2NVCA 2WCSA 4PSPA 4M51A 1UKPA 7ENLA 4DI8A 4TMCA 5A6SA 3SUVA 4A2RA 2YX0A 5DX7A 5KZEA 4E2BA 4IGHA 2E1DA 1JCNA 3ZMRA 2ZX7A 5AZ1A 2ZZ3A 1B30A 2OLAA 3M5XA 2XTKA 4WJEA 1HL2A 2CXGA 2YW4A 2QNEA 1QI4A 3DG6A 3ORWA 4PTMA 2PGWA 1MRQA 4QM1A 4HNUA 4WK9A 4R27A 1E9IA 2A6LA 1N82A 1XLFA 1IEWA 2EG7A 5K9DA 3FVMA 3CXOA 1KV8A 4MM1A 3VI2A 4NZ3A 2CU0A 1IEVA 4NHVA 4ADTA 3PZOA 4UCGA 3N34A 4QISA 1GJPA 2QMKA 4RDWA 2W91A 4LAMA 1XFBA 1RCOB 4B5SA 3LHZA 2DV0A 1G4TA 2CZ5A 3LHTA 4O10A 1UR3M 2GOUA 1UR2A 2DORA 3XINA 4GZ7A 2BX7A 5FL1A 5I3IA 2J62A 1UD4A 1I45A 2PS2A 3QOKA 3BMXA 5H6HA 1CGUA 2DH2A 3EWUA 3A3HA 3S9YA 3IK2A 5CJMA 3T0BA 4Q6JA 1JCXA 1Y7VA 3HPZA 1IF2A 3W81A 3WK0A 2WSYA 1HN1A 2XN1A 2PURA 1MZRA 4GE8A 3WBEA 5HNNA 3BSMA 1TCMA 3AHTA 4G6CA 1LWIA 4ACYA 3ABXA 5A8QA 5FOOA 1XSKA 4O15A 1AW2A 4DRSA 3SCTA 5HINA 1E1CA 3CH9A 3GXDA 2IKHA 3B97A 3C0QA 1UZDA 4X0NA 1XGEA 4KCUA 1ZBKA 1EF3A 4IMEA 3TCEA 5SWUA 3GW0A 4QLLA 4WF7A 1TRIA 4TX8A 1XF0A 3ARPA 1DJHA 3RN6A 1P6BA 2QW5A 3B9EA 3BLLA 1H50A 2FZ8A 3RNDA 2X1RA 3AICA 1XYAA 3WNMA 4M8UA 1W5NA 2ANUA 7REQA 4LQ1A 3BOFA 4LBRA 1XH2A 2YJQA 3KWXA 2OXNA 4INFA 3ZVHA 1OHLA 2AL1A 2W27A 3EEZA 4D6FA 2VD8A 3CO8A 3G3MA 3ZQ9A 3B8SA 1U1HA 2G97A 1JZ4A 1L2UA 5AHEA 3NQ8A 1QNQA 3VE7A 1PZ3A 3ARQA 3ZVIA 4L4MA 1XIHA 1UBPC 2GK1A 3TE9A 2ZRWA 3MU7A 2VFHA 2PDXA 2XZ9A 1C91A 1XJBA 1CXKA 5BW6A 3BDKA 3VPLA 2KZHA 3LN3A 4WY0B 3BCFA 3S47A 4I3GA 4DJEA 5FF4A 1BWVA 4IX2A 3GU9A 1SO6A 3HM7A 2A7NA 3NO5A 3LBOA 3QBUA 1GKRA 2GVEA 5FACA 2CLKA 3UG3A 1E6QM 3CGTA 5KZMA 2V3GA 3KZPA 3PBMA 2PE4A 4GMEA 1KC7A 5GJMA 3E12A 1F9CA 3S2CA 2GDVA 4U5KA 4H3DA 4DJEC 3B06A 1E6SM 2Z4GA 1V3JA 2ZUSA 3CHEA 3CIVA 3HPXA 3IUDA 3A23A 1TPVA 1D7FA 4LB4A 2WMIB 5DF0A 3MCMA 3N2TA 2CFFA 1UD6A 1WDRA 5C9XA 3CQIA 2VRJA 5I03A 3W25A 1V4YA 1THFD 4NJKA 5LYRA 3NURA 5CPMA 1JUEA 3TLQA 1F3XA 4JTKA 4LANA 4R85A 1UZ1A 4DQWA 3WLRA 4NNBA 3SUUA 1IT0A 4YJ5A 4D8LA 2VGBA 3CUXA 2PRMA 1H1NA 1KFEA 1YXDA 4LY4A 5G1TA 1JDFA 3N18A 1Z41A 4N0RA 1TVLA 4UMBA 3UPBA 1QWGA 3UYCA 5I3DA 1GPFA 1KQZA 2X1IA 4GO9A 3WJZA 1BGAA 4W4QA 1JDAA 4S1FA 3MB9A 4K3ZA 1S38A 3MYOA 3NZRA 3BPWA 3QV9A 3PS7A 1V3LA 2WM0A 5JMUA 1ZAJA 3GG0A 4EACA 4HMNA 1GGOA 3BW2A 3G22A 4AG0A 1YHTA 4N4QA 1P1XA 1F4HA 3QY7A 2PDPA 4IGMA 3TA9A 1VRXA 3A4AA 3RITA 1K4HA 1H49A 1BVZA 1XBZA 3CIWA 3DENA 3JW7A 2BGNE 2C18A 3PF3A 1TVPA 1YE6A 1TTIA 2Z7GA 3BZJA 3WLQA 1X8CA 3PTDA 3MZNA 4L9XA 3ZSSA 2Z1KA 1KLZA 1WDSA 2VKZG 4CCCA 5DT5A 4ZR8A 1F74A 3UGRA 3APTA 5CAKA 4UFJA 2NSOA 2TMDA 1ZJAA 2VWTA 1FWFC 5I3GA 2DGAA 3IK4A 1TJ0A 2INFA 4Q33A 2BXVA 3AYVA 4NZFA 3LOTA 3ARVA 1SSGA 4GQ0A 1SW7A 3KL0A 1W31A 4OHQA 3PZNA 3EB4A 4IWWA 4GQRA 4H8NA 3WIJA 1H62A 1OCQA 3L65A 4QRNA 3DGBA 1TWDA 4JN8A 4NAEB 1OC6A 2V3EA 4AYSA 1T96A 2JEQA 1R86A 1RD5A