2O55A

Crystal structure of a putative glycerophosphodiester phosphodiesterase from galdieria sulphuraria
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
254
structure length
254
Chain Sequence
b'SKVIIPKIVGHRGVGKEGLAPENTLRSFVLCMERNIPYIETDLRVCKTGEIVLFHGTPEGTIPFYKDGTSRIGDLSLEELKRLDVGGGHTIPSLEELFVAIEEQKFNLKLNLELKGEEWKRKESGDHQRLLLLVEKYHMQERVDYCSFHHEALAHLKALCPDVKITYLFNYMGQPTPLDFVEQACYGDANGVSMLFHYLTKEQVCTAHEKGLSVTVWMPWIFDDSEEDWKKCLELQVDLICSNYPFGLMNFLSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative glycerophosphodiester phosphodiesterase
publication title Crystal Structure of a putative glycerophosphodiester phosphodiesterase from Galdieria sulphuraria
rcsb
source organism Galdieria sulphuraria
molecule tags Structural genomics, unknown function
total genus 74
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2006-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2o55A00
1PTGA 1DJHA 1DJXA 3OHMB 3QVQA 3QR0A 4RV3A 3RLGA 3EA3A 1DJIA 2PLCA 1YDYA 3QR1A 4S3GA 1ZCCA 2ISDA 3MZ2A 1DJYA 3H4WA 4I9JA 2FJUB 4I90A 1V8EA 4OECA 3L12A 1AODA 4I8YA 3V18A 2OTDA 4Q6XA 4F2UA 7PTDA 3RLHA 2P76A 3V16A 1DJWA 4RW5A 2ZKMX 3I10A 1QASA 1T6MA 3CH0A 5T91A 2OOGA 1PTDA 3KS5A 3V1HA 4I9MA 5T9BG 4RW3A 4I9TA 2O55A 4QJ4B 3NO3A 2PZ0A 2PTDA 4QJ3B 3KS6A 4F2BA 4PTDA 1T8QA 2F9RA 3PTDA 5T9CE 4F2TA 1O1ZA 1XX1A 1DJZA 4GNKB 1DJGA 2OR2A 1GYMA 1QATA 6PTDA 4R7OA 3EA1A 1VD6A 4QJ5B 3H4XA 5PTDA 3EA2A
chains in the Genus database with same CATH superfamily
1IR2A 3SRFA 3M0JA 2CHNA 1C7SA 3W1TA 2GZXA 3KL3A 4YHGA 4JYDA 3SADA 2E9BA 1GQNA 4TU1A 2J9ZA 3CZKA 3QR3A 3ZLFA 1NQKA 4DBEA 2VURA 4QJ1A 3V5OA 1DWIM 2I16A 4KWSA 5TF0A 4IWWA 5C7VA 3EX4A 1I60A 1EC7A 4O8AA 1A5LC 1AH4A 1LG2A 4Q4OA 1EWDA 1M68A 2C79A 1VRXA 3CPUA 4JTDA 2OT0A 4GKLA 1BGGA 3VNDA 4JNYA 3THAA 4HCDA 3GVVA 4GYJA 2VDIA 1XIEA 4HYRA 4N02A 2FZNA 4H9TA 3WENA 4RW3A 4XZWA 3RPMA 5AC4A 4RR4A 4Z42C 2I1OA 3KS6A 3L67A 4C6BA 3PSWA 1TVPA 1DVJA 5F4WA 3VUSA 1T8QA 3DHPA 4GY0A 1HJXA 4PB5A 2E8ZA 3LZ5A 4MNLA 5C2GA 3RN6A 1DJZA 3PPFA 1R86A 5DCBA 1D8CA 1P6BA 4R85A 4DF2A 2VVNA 3LBOA 5A6BD 3QYSA 4QG9A 1CBGA 1UD5A 4XISA 3W4RA 3C61A 4B2DA 4PMQA 3PTQA 3URBA 3BW3A 3R1ZA 1BTMA 4ALDA 3FJNA 1Q7MA 4DEFA 5CXPA 3N29A 3S5ZA 4UB9A 4MKNA 3D6NA 4B91A 1AH3A 2B7PA 2J66A 4NJIA 4QNEA 2YFNA 3M6DA 2DUAA 3VK5A 4DUWA 3MP4A 2NQ5A 2AMGA 3P5ZA 3MP5A 1OX4B 4IIDA 1JCXA 2VHLA 2EPMX 1TJ2A 4GIYA 5HATA 3SRKA 1SZFA 1UUOA 2BG5A 4FS9A 1OC7A 1ZENA 1X8FA 3VIHA 3BW2A 2WJFA 1Q4NX 3S46A 1NQ6A 1EJRC 1XDJA 3LI1A 4Z2JA 4K2SA 3E49A 3M64A 3WD2A 3ZMRA 4IP7A 1TV7A 3L68A 3W86A 3BZGA 3I65A 3KL0A 3L5AA 3ORWA 1UD8A 4IMCA 4KETA 4R33A 3K8KA 5FL1A 5DY2A 1KNWA 2PWGA 1G0CA 3EDJA 2RDXA 2F9RA 3TLQA 1FH8A 5AKQA 1M7XA 1V5XA 2RFGA 3UF9A 1SZNA 4KCWA 5EMJA 4I5RA 3W22A 1EX5A 4ZB5A 4JTSA 4AISA 4F3HA 2XUCA 3BGAA 4DYEA 3QEZA 3QPYA 3UXAA 1QPOA 4YWSA 5AECA 4MMWA 1Q2RA 1EDGA 5AHNA 3SO7A 3GU9A 1OABA 3RYSA 4L65A 2ZYFA 3MSRA 2D24A 3H6OA 1ZNNA 2ATSA 3KVJA 3M46A 3NQBA 1OFQA 4IIGA 4LJ3A 4QQ3A 4PMJA 2OYKA 3VGEA 1ODUA 2ZWYA 4BQ2A 3ABXA 1RD6A 3W1RA 3QOKA 3H4GA 1TREA 3BANA 1Q6QA 7TAAA 1RCQA 3EX3A 5A8MA 5M5DA 3WNNA 1C7TA 3Q45A 3CHCA 4YTSA 2Y7EA 3D3AA 1QO2A 4IXXA 4RKAA 4KEZA 4GYKA 2GWGA 2BDQA 3VO0A 1RK6A 1B90A 3JZUA 2J77A 3CUHA 4BWLC 3TEVA 3IJ6A 2J7HA 5DRIA 3C2FA 3U5UA 4INFA 3SW6A 1YX1A 1IEVA 4LAZA 1V7YA 4Y2WA 1OEPA 3ZJKA 5AC8A 3NXFA 3BLFA 5E0KA 5CPNA 3VDHA 1JEZA 1PIGA 4Z2IA 2PC8A 1XWYA 1OFEA 3UXDA 1JUEA 2WCSA 3LMYA 3VIGA 2GQ9A 3S3GA 3VKKA 1XLDA 1EXPA 5CGQA 4DBSA 5FJUA 3HO8A 2IQTA 1EL3A 2WPBA 4HPGA 4A8LA 4B3LA 1XYLA 4ZO7A 4GCXA 5CPMA 2H90A 5AHLA 2QCLA 3RCNA 2WB5A 1F74A 2VC7A 1KM6A 1JF6A 4ML4A 4DLFA 1B3OA 1O1HA 2RKXA 1PZ1A 4G7FA 1ITQA 3DGRA 4W7UA 4KCUA 1KFJA 1EIXA 5CAKA 1JULA 4QG6A 1XC6A 4LC8A 1FKXA 1DPMA 2WHJA 2AKMA 2V30A 4NX5A 4A6GA 3MCMA 2V2CA 4A21A 1NWSA 2DZTA 3J7HA 4US5A 3AU6A 3ARUA 4LCRA 4JIRA 2B81A 3FHAA 4P8WA 1B31A 2O9OA 5FJTA 4DNMA 1GVOA 4FOJA 5TIMA 3ZT6A 4HQVA 3DX5A 2RDTA 5MKGA 1XIHA 4M6VA 1BLIA 2BOEX 1JDEA 4JQ2A 2BZNA 1R9YA 4ZGYA 3KDNA 4RDYA 2HQAA 3AXXA 1YPXA 4C65A 1TWSA 3CH9A 4RX0A 3OGSA 2DVTA 2QUTA 2FZMA 5A5WA 4PL2A 3AZTA 3SUVA 3W84A 1LZOA 1HKIA 2NVAA 3N2OA 4BA0A 2PTYA 4E8GA 1XQLA 2QJMA 1ALDA 4OFCA 1WQ5A 1HNYA 2PDNA 3GVQA 3IRDA 1FXQA 1Y5XA 1HG3A 2F38A 2V6AA 3G24A 5H8PA 4RZ5A 3UCQA 2VMFA 1XSJA 5I79A 3MHGA 1UUQA 4AMCA 4J2MA 4YPJA 1Q7ZA 3K5XA 2XJ7A 4IJBA 5FF7A 2CERA 3UEQA 3G6LA 4J3XA 4G1NA 1JFHA 1Q3NA 4XIMA 3PG8A 3HG3A 2OQLA 5C2CA 2Y2WA 4HZ7A 3UYCA 3G1SA 5ABHA 3A4AA 1XSIA 4B4HA 3GU2A 3VDCA 1RLDA 2VR5A 3APGA 1K4HA 3H55A 1U22A 4UOJA 2HJPA 4RZBA 3E1F1 1SMDA 3M0IA 1GOWA 3SCSA 2OO6A 4PCFA 3P67A 4XZ9A 2DZWA 1J96A 2QMKA 2EPOA 1LQ0A 4GXWA 3OO2A 3PWGA 1VPXA 4FNQA 2C19A 4F9JA 1RJPA 1VFUA 2P3EA 4H1ZA 4E3VA 2EAWA 4RL3A 1UP0A 1GVYA 5D4YA 3T0DA 3O6CA 4MHBA 1XIMA 3BOXA 1D8WA 1BG9A 2D3LA 2V2HA 4DRSA 4LRTA 1XGZA 1J10A 4MOZA 3VIIA 1XINA 1P0BA 3FSTA 2QR6A 1AH0A 4HTYA 4HA0A 4B90A 2VD8A 3EA1A 1QCWA 4JQ3A 1JAEA 5I3DA 2VX6A 2YL8A 1VLIA 3QR0A 3OYZA 5LIWX 3FYYA 4QM1A 4ZQCA 1V0LA 4LQ1A 4LB3A 2Z2BA 3SN0A 1NOUA 3V5FA 1Q5MA 3VABA 3W7HA 5ABFB 1US2A 4GMEA 2PRHA 1QHZA 3M5XA 1UOZA 1LTDA 4LNYA 3IAPA 5FCZA 5JVLA 4C6LA 4GJIA 1KFEA 3B9NA 4IIBA 1X96A 2XFYA 3L12A 3N12A 1V79A 2OSYA 3KW3A 2ZDRA 2ZUWA 3LI0A 3HGRA 4N9BA 3MBFA 3UCCA 3GUGA 3SZ8A 2V5JA 1XLLA 4PA8A 4P5UA 2YGYA 1XG4A 2WHLA 4K37A 2IQDA 1C9WA 1VS1A 3S0CA 3EGJA 5T9BG 1GYLA 2ZRYA 5D8WA 3S2JA 2GGEA 3GXDA 4MUPA 4JHMA 2PZ0A 3A4JA 3CEPA 3Q4DA 4NUWA 2A7RA 1KXHA 4LWWA 1NOFA 1DORA 3DHUA 1DYSA 3M0VA 2OSXA 3CU2A 2GJXB 3SCWA 3VILA 4O1AA 3CAWA 4TVCA 4D6JA 1SW3A 4HA1A 1CGWA 3WDHA 1Q8JA 2GFTA 4HGXA 4CU7A 3KP1A 2QF7A 4PTVA 5IFPA 3EX6A 2Y63A 1YLVA 2PDFA 1CCWB 4QBXA 1WBHA 4LUYA 1B54A 5EB8A 2YR1A 3G0SA 4MB1A 4GIAA 3H24A 2ZIDA 3CIVA 4P7QA 1KXVA 2VFIA 4LH8A 1DXEA 4F2UA 3W7IA 3G2GA 1IZJA 2VFGA 5EYWA 3PBMA 1OY0A 1A5UA 2J79A 4MGGA 3LHVA 4P2VA 3PR2A 3ECQA 3G1FA 1ZJBA 4I3GA 1GOXA 3CEUA 2C0AA 3VE9A 4PZVA 3UWVA 4TQTA 3DI0A 1QTWA 2QMJA 3TZFA 2VEIA 5I03A 3R0KA 4KEVA 4MAVA 3UY8A 3COTA 4DZHA 4UTHA 1UD6A 4JTHA 2KX9A 1SR9A 2RJGA 1UQYA 1FQ0A 4F79A 5LYRA 1KGXA 4HHMA 5G1TA 3W7MA 4PE8A 2Z0IA 3HGJA 1ISVA 2A6NA 1B3ZA 1SO4A 5FJOA 1TJPA 1W32A 4UTJA 3VZYA 3IGUA 3BWWA 3R5EA 1BTCA 1A5CA 4FNRA 4S2CA 1A4MA 3W0KA 2J62A 1J18A 3INPA 4DJFD 3RDKA 3OP2A 3TQPA 4C6IA 3QN3A 2WMHA 1AA1B 1TJ1A 4KRZA 2FZBA 1K8YA 2TPSA 4RE3A 4K7VA 2CC0A 4UNLA 2PWDA 4NQ1A 5H8UA 2HK0A 4E6MA 1Z8AA 3CQJA 1GCYA 2FFIA 2OZ3A 1YW1A 1TUFA 2FMOA 3MU7A 3RG6A 3VKJA 1PYMA 4OUEA 4WD0A 5J04A 4XK2A 3BSGA 1TTJA 3KHDA 3PBYA 1XFBA 2W0UA 1TTQA 4Q3MA 3LM3A 2WM1A 3DFNA 4EWND 3ARXA 1P1MA 1WZKA 2V69A 3OOQA 3ZJ6A 4WY0F 1ME9A 4MWAA 1OYCA 3IGSA 2X8RA 4JDBA 3TCSA 3TOPA 1VYRA 4I9AA 2AGTA 3QSRA 4JCMA 3EDDA 1F7BA 4UFKA 5FF2A 5T9CE 1BYDA 4ATDA 3R10A 3TTQA 5AVHA 3R58A 4MZ8A 2YL6A 3W9ZA 5B80A 5E93A 4F0MA 2QXWA 7TIMA 4IJCA 1EQCA 4LVGA 3AROA 4LY4A 4J3VA 4E2DA 1EEPA 3OZOA 4L61A 2PBOA 3LTYA 5CC7A 4ZZ9A 1QNSA 1YTKA 3FYPA 4DXKA 2QUVA 1FWWA 3SY5A 3ARWA 3M0LA 3EOUA 4I7VA 3T2OA 3QC3A 2PTZA 5LIYX 3A47A 1LT8A 1EWEA 3W7NA 4PFMA 2D2GA 3SM0A 1NU5A 3RU8X 4CD7A 1E1CB 4JL2A 1F07A 1J0IA 4S38A 5K9XA 4OWGA 1G7UA 4X61A 4UTWC 2PDKA 3H2AA 4A3YA 3GY1A 2CLOA 4JIQA 1GHSA 2XIJA 1BWLA 4GXPA 2IS7A 3ZIZA 3QYQA 1IIHA 2X2YA 2BVYA 3NM1A 3WUFA 2V3DA 3ISIX 4E0CA 1B0IA 1OCBA 4IFRA 2G4JA 5M03A 1FVPA 2J8TA 3WK2A 1A53A 4AC1X 1XM3A 5D37A 5I7GA 5HR6A 3VDGA 3TOYA 4JKMA 2YCEA 4XO6A 3VI2A 1F8IA 3E2SA 3BQ5A 2GQAA 1UR4A 2G3NA 3TAOA 1A5OC 1E6PA 3WLTA 4LAOA 2Y7FA 3DFTA 5ENLA 1UZHA 1UWQA 4KQNA 1XLAA 3TLLA 2WKLA 1G4TA 2BB0A 3N2XA 4A2SA 2VZVA 1P43A 3JVAA 1E1FA 2VZSA 3DECA 4S3GA 4W5UA 2D20A 4CCZA 4RLIA 4QNWA 5CZJA 1YTDA 3KBNA 4PCTA 3U2OA 2YSWA 4IF2A 4S23A 1KFLA 3A9BA 2PURA 4HCLA 4RE0A 3T42A 1QJWA 3N34A 4DUVA 3ITXA 1H1ZA 3N15A 5DFAA 2O7SA 4IL2A 5U4NA 3EPMA 1GORA 2HPIA 3TYCA 5HMEA 2GGIA 3OBEA 4PMDA 4Y9NA 4ZOCA 1SW0A 2ZRUA 4LS2A 1FH9A 3HMJG 1CXEA 1HGYA 2BVTA 4DYJA 1LUCB 3NQ2A 2PZNA 1KFWA 3TN3A 2E6YA 4B5XA 1MFUA 3GLCA 3WQDA 2XZ7A 2V0TA 5XIAA 2Z1VA 3ARQA 4GUIA 3TE9A 1ESWA 3PBWA 4V27A 4O1CA 4NNBA 3EWXA 1Q6LA 3LY0A 4OGZA 5GJNA 5HMSA 5BMXA 3W6MA 2QGYA 1CENA 2D0GA 1QATA 1EGMA 1ZQ5A 5A94A 2GUUA 4EXBA 3F1QA 4AVFA 1ADDA 1TZ7A 1JRCA 3OU8A 3W1XA 3BL3A 3ARPA 4HD5A 1EF2A 4KWUA 4X9SA 5I6SA 4RK8A 2NV1A 3N18A 1TFVA 1AVAA 4W4QA 4JIPA 1XYCA 2XVLA 4M82A 2NQZA 1BYAA 1PAMA 4B15A 1G6CA 4R53A 2Y85A 3I6TA 4DZAA 4M80A 3MUXA 3IJDA 4LUSB 3ONBA 1NFGA 3TNBA 3TWAA 3A23A 2ZICA 3LLXA 5AOUA 1P4CA 2INEA 4TXEA 1W2PA 3NL3A 5A3HA 3P62A 4B5SA 1VBGA 3AHZA 3G5EA 1GYNA 4DAFA 2DUZA 2HK1A 1JGIA 2W62A 2IKGA 1KBIA 1GQLA 1GJWA 2YLLA 1E0WA 1VPQA 3FIGA 4GRSA 5DCEA 3NQ8A 2A3CA 2QDDA 1MUWA 3STCA 1W8SA 1QWKA 2ZTKA 2QCFA 3PNZA 1IWBA 5DO8A 2G8ZA 4PMYA 3S9ZA 2VGFA 3F5LA 2QHAA 4EE9A 1HO1A 1QMLA 2VEPA 4AZIA 4BF9A 3VZZA 3W1UA 1OADA 3DFYA 3UWWA 3BOLA 5CH9A 5C5YA 1Y7VA 3F5KA 2VEGA 3A12A 4JQAA 2A7PA 1NDWA 2VEMA 2A3HA 3M4HA 1RJRA 4JZ5A 2ESCA 3CB3A 4AC7C 2HPMA 4IIHA 3UFYA 3C0LA 3APTA 5IM51 2WCAA 3VKDA 1K8XA 4WZHA 1C92A 4J3UA 1Z42A 1EP3A 5I5RA 1JCTA 2GVYA 2IKJA 1HVXA 1QPKA 4GX8A 1JQVA 3HV9A 3DIPA 5BXPA 3GKAA 2ZKMX 3I10A 3K13A 1V77A 1Z41A 2MUCA 5HULA 5AB3A 2DP3A 1SM9A 1K4GA 2WZHA 5CBIA 3E74A 2PDGA 1UR2A 2XWEA 1C8QA 5CSRA 4YL2A 1E6ZA 3GBEA 1FWGC 1PX8A 2O92A 4H6RA 4JEJA 1IV8A 1DEDA 3C2VA 5GNYA 1ISXA 4MFDA 1HX0A 3PTDA 1LWJA 4J4KA 4FF7A 1QI0A 4JN7A 4CQDA 1UJPA 3LPPA 3ZM8A 3BSHA 2OR2A 4W85A 3AYRA 1EYEA 4UOZA 3BAJA 1KW1A 3IS4A 1E4MM 4QS5A 1I1XA 4HNVA 3QH2A 3WLIA 2DIKA 3ERPA 3GXNA 1EJXC 1U1UA 1E55A 2WZMA 4IT1A 2X40A 2ICSA 4LCSA 3MYOA 5GJPA 1XIBA 4REQB 1O4UA 1J5SA 4GUFA 1T99A 2Y7GA 4HNLA 3F4CA 3IIPA 4HU3A 1PSCA 2PDHA 5BXRA 4B3KA 1AUSL 5HQLA 3VC6A 3BVJA 3S2MA 1OX5A 1J0ZA 1NTHA 3VOHA 1UKQA 3L4VA 3VZXA 4AIEA 3BURA 3R11A 2QPSA 1F6YA 2E4TA 2VCCA 5HQEA 1FDZA 4N7QA 1GZJA 2CBVA 3DU0A 4PUEA 5E6ZA 3CJPA 2QDEA 2WO5A 3STEA 1J0HA 4CN1A 5E1QA 3GDRA 1XLHA 3TZNA 5D9OA 3FN9A 2J7BA 4GO8A 4HMNA 1LM1A 1OYAA 4S3KA 3KM8A 1WO2A 1LL7A 3UG8A 4AZ5A 3PZIA 1B1YA 1PYFA 3B05A 3QV9A 4XSMA 4JGDA 5M17A 3NEHA 3TYEA 4AIUA 4E2BA 3CUFA 4I8DA 1QWGA 4ZO9A 3VINA 4PN2A 3HPZA 1EF3A 4C1NA 4GY7A 1FUYA 4IMEA 3R4IA 3MJYA 1ZL1A 1G1YA 2PAJA 4LCQA 3UT0A 3VIJA 3VIPA 1V51A 2OJPA 4AUBA 4IQDA 2CZEA 2XSXA 4JTKA 2ZUUA 4C6OA 2ZUTA 1R7OA 6PTDA 1I4NA 4QITA 2W5FA 4PUMA 3W7CA 4NL1A 2PCQA 1GVQA 3UR7A 2PWEA 4UZSA 1DJHA 1TZ9A 2R8WA 1ONXA 3LERA 3D47A 3G8RA 4PYSA 1R5YA 4DF0A 2J75A 1XUUA 3USBA 3SGZA 4DUOA 3GC2A 3M5VA 3IGXA 1YDNA 4P8XA 3U4FA 5HNNA 3E3HA 1QT1A 1R87A 1B30A 1ZCOA 3V18A 4IPLA 5G4EA 1JIBA 3EWCA 3T2QA 1R3YA 2PGFA 4KRUA 1YTEA 4ERGA 3NG3A 2YDSA 1O7AA 4W86A 1Q2SA 3GE7A 4JIEA 1SW7A 4O4WA 4ZFCA 2UZ9A 5J8LA 3G8EA 3UJEA 1TPEA 1CPUA 1TWWA 1VFTA 3G1YA 3LCWA 2WLZA 5I09A 4YXGA 2R94A 4N4QA 4MDPA 3PZGA 1NEYA 3NTYA 1B3YA 3W70A 1JJKA 4FXJA 4LSBA 3AIWA 1AJZA 3CWOX 3CB8A 5JBDA 4D9PA 3IUDA 3XIMA 4HZ6A 1EA0A 1ADSA 3HGOA 2WVVB 3ALGA 4XIAA 3MHUA 1YXDA 3NNTA 3CMJA 1FHUA 3OEXA 1UD3A 5CJ5A 2CWNA 4D72A 3GDLA 5HXMA 1LBLA 4NG3A 2JKAA 2F6KA 4CNUA 4O54A 1R30A 1XIGA 2J9YA 3EWWA 3T4WA 1A47A 1LBMA 3HURA 1KBKA 1X39A 2NV9A 2XVGA 2D0FA 1Q85A 2FZ9A 1RBAA 2DVUA 2VR4A 2C18A 4M19A 4DBWA 3ITVA 1WKEA 3HQPA 5CSYA 4I8YA 3HU7A 3HF3A 2AL2B 5AC6A 2WZEA 4YTUA 4CD6A 4Q6XA 2P76A 1V02E 4EXQA 2J7DA 3S6OA 4QP0A 3VOCA 3TN5A 5LHEA 2G3MA 3A3WA 1N8IA 3Q37A 1DWHM 5E0CA 5D2XA 4ZQNA 2VYOA 3EDKA 1UJQA 3WH9A 2E28A 3NL6A 4LYQA 2X0YA 4XWUA 3KLLA 3IJLA 3FSUA 1VF8A 1RY8A 3B9OA 4WKFA 2Y7DA 3QMRA 4L80A 3NR0A 1OFPA 2VOTA 1S2VA 4L64A 5A8GA 5E70A 1Z9AA 3DH7A 4UR8A 3SI9A 5CZ0A 2W27A 1XSKA 3NPVA 3WKZA 3BMVA 4G56A 3LCIA 1PS9A 4K68A 1LROA 4Q4PA 2G37A 3WLHA 4A3QA 3UPBA 2Z27A 2ZZ5A 3MJMA 1W37A 2W3ZA 2PDYA 4GX9A 1MRAA 3P82A 4KGLA 1K7XA 3BGJA 3NXLA 2QVHA 4I7UA 2ZRZA 1QOPA 5E6YA 3UNTA 2EEXA 1HXJA 1EZWA 4CVUA 3DC0A 4RZ6A 3I68A 2H8ZA 1E56A 3TYDA 3CQKA 3H2FA 3ABRA 2UY5A 3CQIA 3EX2A 1F3EA 2C8NA 2GSEA 1XP3A 4NZFA 5LA0A 2INZA 3DDMA 3PFMA 3VAVA 3OVGA 3H4WA 2WC7A 4I90A 2RGMA 1TQJA 4UQ9A 3GVGA 1OFRA 3LLFA 4BF5A 4WIWA 3GH5A 4JQ1A 1HKKA 4LUTB 1OQFA 3OLGA 4DHGA 3VX1A 1FA2A 4ECLA 1WZLA 3MUAA 2P0IA 4TTUA 3ANUA 2BNJA 4W84A 4Q8MA 1BXBA 1R3TA 2NXIA 1XKJA 4OBSA 3GFYA 1TELA 3NO5A 5CZKA 3MZNA 3LTPA 5C0QA 4IZGA 2WJDA 3IWPA 2CLMA 3N25A 4WEVX 5FF0A 1C29A 4X2RA 3RF9A 3WD0A 3M41A 3BLDA 2FZDA 4GYPC 5ABGA 5CBJA 3T0TA 3WF4A 4HZ8A 3BAYA 2HV5A 3H2CA 3ABZA 3H2NA 3MKCA 1GKPA 2BGNE 5LNUA 5AHIA 1LCOA 1EO5A 2OFJA 3ZLGA 1K7EA 4P7OA 3LGEA 3S5NA 4D1IA 2Q6ZA 3N3MA 2VWSA 3KBMA 4QFUA 2YBTA 2VRQA 4XD5A 3KTCA 4MY1A 5U7SA 3QPEA 1BD0A 2X1IA 2Y4SA 5TBOA 2QIWA 1DHPA 1EP2A 3MSDA 4GK8A 2ISVA 5GNZA 4NZ4A 3PP7A 5IFTA 2J74A 4K39A 1FDYA 2HXUA 3PC0A 1ME7A 2OT1A 2NSOA 3QZ6A 4PCPA 3JS3A 3CV7A 1GOQA 2CNCA 1UROA 1NDZA 2YL9A 1V93A 1UD4A 1P0KA 3RNDA 4JYEA 3I4KA 4JTAA 2GUBA 4BEUA 2CBJA 3BG5A 4DELA 3A24A 4NXKA 3C6CA 1UKPA 4BS0A 4FZIA 1ZBCA 4CNOA 1XLBA 5CPOA 2RH9A 3ICJA 4KPLA 1FWNA 1YMYA 1W9XA 5H8MA 3E0WA 1QK2A 3N4EA 4HMCA 4H2CA 4NRSA 1S5MA 3WQGA 5KMYA 1TPC1 3ALFA 5T26A 4LVAA 2BHZA 1FWEC 3WMCA 2J47A 3AYSA 3ABOA 1EHNA 4F9DA 2NLIA 4AIBA 4DF1A 4Q33A 4K38A 3ZZ1A 1KGWA 1JRBA 3B9AA 3QGAC 5F1UA 2QGHA 3W7JA 3P5YA 4V15A 4Q7BA 3GNNA 3PAOA 2IMRA 3OVPA 4HK7A 3VCNA 1NIUA 1OC5A 1YNYA 3UJFA 4Q4MA 5FOOA 3STGA 3VFLA 4AZ7A 3SQMA 5ABFA 1TSIA 5I3JA 3I7QA 1GJPA 5EU9A 3PFRA 1ISYA 2OWCA 2B4GA 1GTHA 2R9RA 4HMDA 5LNVA 4RW5A 4B3ZA 1OSEA 4GGHA 2CHRA 2F7FA 4O4VA 1AQFA 4TMBA 3ZT7A 3HG5A 3EPNA 1Q6EA 5IOBA 3W7EA 3MMDA 4KERA 1SPQA 4N42A 3VOJA 1R46A 4V28A 3FXGA 1HUVA 4MLRA 3WSUA 3UZWA 4GH3A 4U5KA 3GSMA 4LNCA 2WPGA 3MANA 3O0FA 2GGJA 3WLOA 5HPCA 1SYTA 3KBWA 4Q8WA 4XKYB 4Z1BA 1D7FA 3TW6A 4JAWA 1WXYA 2EPKX 1D9EA 1RXOB 1HQTA 1KA9F 1SJBA 2GJXA 4WXYA 1P6WA 2PWHA 1ONRA 3SSZA 3WEZA 2HDJA 1THFD 2CLEA 3RHGA 3B0VC 1DTUA 3HPAA 3TXVA 5E9AA 4UTMA 4N9CA 3S9IA 3VPLA 4X9YA 2IPFA 2PDLA 2POTA 3AISA 1ZTVA 4LYKA 2BMBA 3URNA 3KDOA 5FEPA 4AFYA 1MI3A 3B3DA 1VHNA 3W6YA 3V4BA 5I07A 3FXYA 3W72A 4XBJA 3T7VA 4MY9A 3VDBA 1CLXA 1TMLA 1CXFA 2WSKA 4O19A 5MKGB 3E12A 2V2DA 4WY0B 3S5OA 1H5YA 3NVTA 5BCAA 1IGWA 2OTDA 2E25A 1R2RA 1NWRA 4RNJA 3MBDA 1L2QA 1RQHA 1S3TC 2I5IA 1EPXA 3G1VA 2YDRA 4EKJA 3PTMA 4PTNA 1EUAA 1K1DA 3CBWA 1WOAA 1FFRA 1A3HA 4PBGA 1YDVA 1VEOA 4OV4A 5GPRA 5CAHA 1OC6A 2PLMA 2GVGA 1J0YA 5GVJA 3UJ2A 4JN6A 1F8MA 4LYRA 2YCIX 4ERIA 4I5UA 1BRLB 5C9XA 1BPLB 3PN8A 4H19A 4C6JA 3HOJA 4PUKA 5LIUX 3P74A 1JCMP 4B5TA 3QGKC 5A6SA 4RV8A 4GUGA 1UIPA 2G95A 3PAJA 2QF8A 3UPMA 3P0XA 2Y6ZA 5CC5A 3FGCA 4HCHA 2QDGA 4NF7A 4DY1A 4ZQPA 4RCXA 4W87A 5T8GA 3EA3A 2EHHA 2BXZA 4H00A 4GOAA 3G6MA 3WMSA 2OEKA 2G41A 5G1MA 3VNKA 1VBJA 3LEPA 1FXPA 4AD1A 1XXXA 1A5MC 1P0DA 3I3DA 1KXQA 2Z28A 3HG2A 1VBUA 4XUGA 1UA3A 2VC9A 2PDIA 3W75A 5F2IA 3NO1A 5JIPA 4PODA 1V4YA 1VB9A 3KCJA 1W17A 3EPOA 1G4SA 1A0DA 4UBPC 3SRHA 1YADA 4Z2HA 3KLKA 3S9YA 3C8FA 4R9XA 4H6KA 4GCAA 2YOCA 3H22A 2PWUA 2OB3A 1KBBA 2C71A 4DJEA 3PSVA 3FJ6A 3WK0A 3PJWA 3B8UA 4IP5A 4HNTA 2Z26A 4F0LA 3IJIA 4ZENA 2GWNA 2CBUA 3HIJA 8RUCA 2ZRVA 4MWAC 3F2DA 2AGKA 3P61A 4JTEA 4C6KA 2O9PA 4O13A 2XSBA 4BZYA 3CPRA 1MQQA 4HJFA 4Q7NA 2PP3A 3CL6A 3GQYA 1GQIA 1L6GA 3AUOA 3GTIA 3O63A 2CFFA 4H7VA 4GC4A 3GTHA 1VAHA 3CQ0A 1IWPA 4ZTYA 4GACA 4IMDA 3E0VA 3L4WA 4ML9A 4KS0A 3LCFA 1DP0A 4FI4A 5FJPA 2Z29A 3K8MA 3VNIA 3URAA 4IGMA 3W82A 3IVSA 3P0WA 4JYFA 1XLFA 1C93A 4C1LA 1S5WA 1VIZA 4M7SA 2QPUA 4IUOA 3PBVA 2BBFA 4Q8OA 4PH6A 4S39A 4Z2GA 2HSAA 1SO6A 3CC1A 1E1CA 3LA4A 1MZRA 4J27A 3NYDA 4GNJA 1PCKA 1LYXA 3N6HA 2VZOA 3R25A 1EA9C 1XS2A 1L6FA 4CEUC 3L66A 5A6MA 4XD6A 4H41A 4O12A 1AK5A 1W5OA 1NARA 2ACUA 4HPHA 3SCPA 2Z7GA 2G3IA 1TWZA 1HFBA 3U5YA 1TWIA 3N2TA 4LOCA 3BLPX 1CXHA 1AQHA 2CWXA 3DAQA 1N55A 1FWSA 2B7OA 1SR0A 3FY1A 5HUOA 1ZAJA 3N4FA 4NAFA 3UJSA 3PWIA 3RRAA 1PZ0A 2I5QA 2DH2A 5EMYA 1AL7A 3N11A 4UQBA 1R0MA 1MMFA 1W0MA 1TPDA 3S5SA 4A22A 2BOFX 1E3XA 2ODOA 4ZE5A 2I17A 2QKFA 1S5TA 1LWIA 3H23A 1UR3M 3OHIA 2DQWA 4W9TA 1XQKA 2W91A 4ACZA 4O14A 5CGTA 1X6NA 3UWYA 2P8CA 4NI3A 2QUUA 3DFOA 5DY3A 2QLYA 2OYMA 4D71A 4HNUA 1TV5A 1UW9A 4AZGA 4KWVA 2YCLA 4YS1A 3JR2A 1CGVA 5HJYA 4RUBA 4JICA 5A8NA 1LOSA 3V35A 1LORA 1OZMA 3DBPA 3CM4A 1M04A 1F4HA 3BQ6A 5EGRA 1ZB5A 1Q13A 1RALA 1M7JA 3URQA 1TRDA 3R8GA 4AYGA 4PMNA 1ZUAX 3DUGA 1LUCA 1NJJA 4M8UA 1HGWA 4BQ3A 4FIQA 1QR7A 2HBXA 4RXGA 4NJJA 4M7TA 4ZEPA 2EG8A 3L21A 4JFWA 5B7ZA 1V0MA 2A0NA 2CESA 2RHGA 2WAGA 2G0WA 4IGNA 4ILSA 2ACRA 3TSBA 1GNXA 4BHYA 4AX6A 5C6MA 4JDYA 3QJAA 2JQXA 1WZMA 3LGDA 4MWAB 4U3AA 2X1UA 4LGXA 3KTSA 3S2CA 1W1YA 4GH1A 3OGRA 5FSDC 4KCVA 5A6JA 1MZHA 3EDEA 3BC9A 1GVEA 4D6DA 3ZFHA 4X0VA 3PUEA 2AQVA 5LGXA 1F6KA 4D8LA 1GOIA 4PL1A 3THUA 1JD9A 4N4PA 2QW5A 2F6UA 1HL8A 3A5VA 3N2CA 3W7RA 4QIUA 1U33A 4ZCWA 3GIYA 3LHYA 4QHRA 3R8HA 3F5JA 4H6EA 3WEOA 1SFTA 3GTXA 3UY7A 3QMTA 2VR2A 2FVMA 4AQLA 3WFAA 3LQGA 2PRMA 3GWQA 3PZVA 8XIAA 1JCNA 1V6VA 2QCEA 3IACA 3PJUA 3PUGA 3G0XA 4BQ5A 1XI3A 3KP0A 2CXEA 2NUWA 4GFIA 3GHRA 3IK4A 1SFJA 4F2TA 2QCNA 2Z6JA 2QDHA 1BSIA 1OCNA 3W87A 4ATWA 3LRMA 2Y8UA 2DEPA 2VEKA 4ATLA 3LNMA 1T96A 3AHXA 4TUFA 4W89A 4WOQA 4DI8A 3DXIA 2DT1A 5D32A 1XBZA 1JVNA 3N2BA 4PBEA 3UR2A 4AHPA 1ZY9A 3FS2A 1RQEA 1TPWA 2VTFA 1FWJC 1VFLA 3FLUA 3W7PA 2B31A 1W3JA 1H61A 2ZUVA 1TJRA 3TJIA 4AWEA 2A3AA 1RA5A 1DBTA 1LF1A 4RXFA 4DPQA 4LAKA 1RV8A 3FEQA 3EEGA 1XBYA 5M1TA 1GQKA 1JUKA 3GAYA 4P7NA 1GVSA 4JHOA 4F66A 1PPIA 2VGIA 3KL5A 3WBWA 3V5CA 3N04A 4PMRA 2JKPA 3MC5A 1DWJM 6TAAA 3TFXA 1EO7A 3RK8A 2VDGA 1BF6A 1DWFM 1WE5A 4QE5A 1PKMA 1VBRA 5HWMA 4IMGA 4JTLA 1QK0A 2ZZ3A 1VEPA 3TNOA 4TV5A 2YBVA 2G3JA 1TVNA 3TDFA 3DKLA 4NKCA 1WNOA 7A3HA 1AMYA 3QZAA 2O55A 1AD1A 2ZOXA 4UR7A 3W83A 1L6SA 1A3XA 5LNSA 4DLMA 1ZP3A 2JIWA 4JTIA 2B0MA 4Q4KA 2C1GA 2NSXA 2PUZA 4K1WA 3OBAA 1KV5A 3IEBA 3NZPA 3FW6A 1EJUC 4C60A 1JNEA 4AMAA 5JH2A 2FMNA 3DC8A 1XICA 4RNIA 2NXHA 3LK6A 3VGHA 1EDQA 1REQA 3UWZA 4K8HA 2IW0A 3TONA 3TA6A 4Y8FA 1E9ZB 3PG9A 4LUIA 3ZVIA 1WOBA 3DERA 5K3VA 1WV2A 1YHTA 2VVSA 3M6YA 3BCJA 4JTUA 4REQA 1KM5A 3V0UA 3MVIA 1QNOA 3JRKA 1PWMA 4JL1A 3DOPA 1OF8A 4JIHA 5BZAA 1OD0A 4WGHA 3REQB 3STPA 1TX0A 3OW1A 4F40A 2OZ8A 1H11A 2YBUA 2PDWA 2BX7A 4BF7A 2XSAA 3QRHA 3NJ3A 4LF1A 3UBPC 4EPEC 4F8XA 3GRIA 2Y61A 4UQDA 1M7PA 4XKMA 3WYZA 3AIQA 3QC0A 3MYPA 2QJGA 1WDQA 3F2BA 1RPKA 2V5BA 3F4NA 4K1GA 3O06A 3UW6A 3BJFA 1OT2A 3KWSA 2DPEA 5LXXA 3RLVA 2DFAA 3FAXA 2OX4A 4AB4A 4JPGA 2NXGA 3RRXA 3L9CA 3PZTA 3AXMA 3KRZA 1VH7A 3NIYA 1TA3A 4N6FA 1JZ4A 3UETA 1IE7C 3VD4A 1V6YA 4LV4A 1OFDA 1MW3A 4LBSA 3WJZA 3NSXA 1L2UA 2ABAA 3W1AA 1F73A 3II1A 3AFBA 2ALDA 3SJ3A 1OIMA 2I9EA 1PZ3A 1FWCC 5CLTA 4HP5A 4FNTA 2IPGA 3WF2A 1AZ2A 4GG9A 3S8HA 1JZ3A 2P88A 4KMQA 3WJSA 1MXGA 5D33A 3I3BA 3AI0A 3WNMA 1V7AA 2WZIA 3TMQA 3VTRA 3WQ8A 2OGJA 1JAKA 5HWJA 4KBXA 5BXTA 2GK1A 2L5HA 1Q8AA 4MKVA 4X0NA 3EBVA 4FX7A 5DN1A 3TQ0A 1QRQA 3KEHA 4JTTA 5CPQA 4LW7A 2CZ5A 5AC5A 1MW2A 4B5WA 2G50A 1CGUA 1DIOA 3LENA 4ROPA 1WUFA 3QKZA 4E5TA 1PJ9A 3P93A 1OJXA 5AFDA 4O57A 3CS2A 4Z1DA 4ZXOA 3HG4A 3BLKA 2WC3A 4XV0A 1V3IA 3RPTA 3I6EA 4X2PA 2JEPA 3W02A 2PGRA 4BQ4A 4MTVA 5AHFA 2EPNA 4NI8A 2VFEA 5D9PA 3WCZA 4M5PA 4AZCA 4Y9MA 4ZB0A 4WSKA 4QX4A 3KBJA 4W8LA 2VWTA 1UH3A 3C3NA 3L2LA 2UY4A 3M1ZA 4LALA 3B8SA 1EEXA 2J78A 3TVAA 2V5LA 1PCWA 4A05A 2UY2A 4DWSA 2OSWA 3LUTA 3AC0A 1QBAA 3TTOA 2H3BA 1W91A 1PB0A 3KZSA 3TUUA 1OD8A 4WOZA 2DSKA 4I9JA 1J6OA 5JH1A 3TROA 3MUY1 4J3WA 2BLEA 3RM4A 5GNXA 3LSCA 3KOZA 1XLEA 4AY8A 2YDAA 5CZTA 1NFBA 3GAKA 2AL2A 3DYOA 1ZAIA 4RZ4A 5CJNA 1HJUA 4QR6A 3VC5A 5LZLA 2V3GA 3KXQA 1TV4A 3E2RA 3CL8A 2YLAA 2Z1KA 5LKYA 4HHHA 1XG3A 4CQ9A 3E0LA 3M43A 4NXSA 2E9LA 4NAEA 2Q8ZA 4HBKA 3AZRA 5A95A 1H7XA 5F7UA 2X09A 3G1HA 3NAVA 4PCNA 4Z17A 1IT8A 1U30A 4NNAA 3ZWSA 3EOOA 4XZMX 2DZUA 2OU4A 3LMZA 4IMFA 4R3UA 3GO2A 3AWOA 4ZR8A 6XIMA 4IM4A 4B2DD 6REQB 3POCA 4UTKA 2VGBA 3TSDA 1E5NA 2Z00A 2Q01A 1WDDA 3EB4A 3NYZA 3ES8A 3NWRA 3ARVA 5C7HA 4R7OA 1VYSX 4H9ZA 2Y88A 4H8UA 4XQ6A 2GOKA 2BVWA 3IAQA 4MY8A 4J40A 1O60A 2PLCA 5LA2A 2OKOA 3OVRA 3CHEA 3ZSTA 3W01A 3ZYZA 4PCSA 3R79A 1EKOA 2VI0A 4OJYA 4GIEA 4FA3A 1YYAA 3GG1A 1KC7A 4Y9OA 2EGZA 2FYMA 1ODZA 3PUDA 1D3CA 4FNPA 4IIFA 4EF8A 4KWOA 2JBMA 3UZ5A 4JTJA 3CIXA 4GVFA 1UP2A 3FEMA 3HJZA 4QROA 4UTIA 1XPGA 1TV2A 2QQ6A 4KEUA 1Z89A 4C1NB 2E09A 3GR8A 4UFIA 4Q8VA 4PUUA 4S3AA 4Q4QA 3UQNA 3CAVA 4UWMA 2HZGA 3ABQA 4PFHA 2HE8A 4HPNA 4LUTA 2ZE0A 3MQTA 3C2YA 5TQLA 3GG7A 4HT3A 2Z1WA 3MO7A 4PMZA 1G94A 5D8ZA 2SFPA 5G2HA 1M03A 4LT9A 1E15A 4PTDA 5A6KA 5DEZA 3OVQA 3JZEA 3KX6A 5M2FX 2ABBA 3M0MA 1FP9A 2AAAA 4KFOA 2ON3A 2X7WA 3LCXA 1EB3A 1JL8A 1TIMA 2XVPA 3TR2A 5E9XA 3DBNA 1WKYA 4NY2A 2VNCA 4ENLA 4GFSA 3OIXA 3TW7A 1XH2A 1Z3NA 2X05A 4OBRA 5HANA 1IT7A 1M01A 3KOYA 1HL2A 2PDUA 3KRSA 4XZHA 3VNYA 2CW6A 3NA8A 3H21A 3V3WA 1YRRA 4MWAE 4E2OA 3A13A 3SEPA 4W93A 4QG8A 1JXKA 2XIOA 3HFYA 2PDBA 3BCDA 1FHDA 4MKSA 1FWIC 3P14A 5DRCA 1JYXA 5LHFA 1LOQA 2FIQA 3RILA 2BY3A 1VYPX 5FF4A 4TX6A 2V5CA 2YZRA 1NOWA 4S3FA 3ITYA 1OFBA 2H3DA 5A2AA 1L8NA 2EBNA 3KCOA 2BY2A 3HPFA 3ANVA 3GYCA 4W7VA 1WBJA 3ELFA 4AD2A 4XBKA 3WBYA 1FCBA 1TVLA 4KESA 5FESA 4E8DA 1IZKA 2W4XA 3ZR6A 3MKVA 2PTDA 3KVLA 1YXYA 3NZGA 3W37A 1XRVA 3LS9A 3WLPA 2NVDA 4U3CA 2WBKA 3CO4A 5AVNA 1O5RA 1F61A 3GVRA 1FCQA 3N17A 4H8VA 1EOKA 2WOQA 3BMXA 4AD0A 9XIAA 3ZQ9A 3BV7A 4Y96A 3D46A 3QQWA 5FACA 2GL5A 1WYIA 4ZQMA 2W79A 2UV8G 3PB2A 3JW7A 4QE1A 3AIEA 2RJHA 3T07A 2DT3A 3WQOA 3IJ8A 3T8QA 1TPUA 1AFSA 4LXFA 1ECQA 1A5KC 1S2CA 3SJNA 2Q02A 4R27A 4HSOA 3CQHA 1BG4A 3S6DA 2PPGA 2ISDA 3N2MA 3RJXA 1N8WA 2B7QA 3UZJA 1E1EA 3NQMA 3AIUA 4XX6A 1VEMA 2WKJA 3MP3A 5CPTA 1R7AA 4F0KA 3UNDA 3O6YX 1ZPTA 4CVWA 1ZALA 2ZX5A 4US5D 3EMQA 7PTDA 4D2JA 2R1PA 4D6IA 2I14A 3ZT5A 3S1UA 1ZFJA 4D6CA 4GA8A 1QASA 4JX5A 3B40A 1K3UA 4OKDA 4ZQOA 3IARA 2D23A 3LHZA 3GUWA 4IQEA 1CLVA 2VOMA 4DAIA 3RX3A 5KZDA 3KAOA 4GZJA 1AW1A 1TQXA 1ITXA 4F2BA 4ZA0A 1DE5A 1QXLA 4P8VA 3TH6A 3DFHA 3W73A 3GX9A 4A2RA 4P7RA 4XAYA 1UD2A 1XIIA 1O1ZA 4JIIX 3WL1A 4W8AA 4FNSA 1BF2A 2F6XA 3AXHA 3QV7A 3VGBA 1MEWA 2FTYA 3EB3A 3S6TA 4XKYA 3MS8A 2POZA 1R3QA 5G2WA 3L2MA 4LVFA 3WNKA 2PI6A 4Z0SA 3AHVA 1WCGA 5C70A 1SZEA 1QVBA 2TAAA 1QI5A 4IPIA 1HKJA 3OQEA 4GYPA 1YPFA 4O18A 2OXNA 4CU8A 3PHAA 4LF2A 4DO6A 1JCJA 1SO3A 3WDJA 3NPXA 3W27A 4RNFA 3PULA 3LM7A 1Q6OA 4UTTA 1DTNA 1V8EA 1JPKA 1H7NA 2ZDSA 3QQ0A 3P6LA 5A6TC 3VU2A 1JYVA 3RMEA 4WY0A 1K8ZA 4LC6A 4HYVA 4Y9PA 4YYFA 1E71M 1FWTA 1KV8A 1QNRA 2E6DA 4JN8A 4YHEA 2OLAA 2WMIA 3TJ4A 4MSSA 3EOLA 2WM0A 3SUWA 3G1DA 4HJWA 3HGSA 3W7KA 3DN5A 1EBHA 2C1HA 1Q7QA 2HBVA 5JBEA 2KZHA 2QYGA 1OGGA 1N82A 3T09A 4UNKA 1Q65A 3MW7A 3RU6A 1S2AA 3ZJ8A 1H0IA 1BRLA 3L4UA 5BOOA 4EWJA 3B8VA 1O5XA 7REQA 3LLDA 1Q45A 3VFCA 3PPGA 4HA3A 4WDUA 2UBPC 3ITOA 3GZAA 2DW7A 4OVXA 4B5NA 3GXFA 5FEWA 5G1YA 3ID7A 3SCRA 3CAQA 4Q8QA 4ERAA 4QJ5B 4I6KA 1W5NA 2X16A 3VXGA 2WVUA 2XFWA 2JGQA 2EG6A 1W1B1 3IANA 1GOKA 5KZ6A 2V63A 3TTSA 4RDWA 1ZJHA 3EXSA 5A8QA 3S1XA 2R24A 2VP8A 3KZPA 2VCAA 3WL0A 3SRDA 3W24A 2AL1A 2J8FA 2WK2A 1HKVA 2XIQA 4O1BA 4LTSA 3GH4A 2E67A 1UBPC 3P8JA 1XCWA 2OG9A 3TC7A 4JNMA 3QHOA 1KTCA 1AJ2A 3UD6A 3WDRA 1LQ2A 2OQHA 4WUIA 1IGSA 5G4WA 3D5HA 4JCLA 5XIMA 4QLJA 4Y90A 5EMUA 4PRTA 4M24A 1T8XA 4URIA 5D03A 1EJ7L 4V33A 4TX8A 3MSGA 3NO3A 2ZFAA 4C7DA 3C8NA 3DZ1A 1E4LA 3LU2A 1KM0A 3ITTA 1NAL1 4Y6GA 5HWNA 3V1PA 4O17A 3N6QA 1W5PA 2NQLA 4ZL1A 1C8YA 1JI2A 1F05A 4PEKA 1P7TA 2JFEX 1KLYA 1XYFA 2DQXA 1M1BA 3IJ9A 2HROA 3STFA 1FFQA 4DJEC 3OLEA 3B8DA 3XINA 5ABEA 5DMLA 2I5GA 3RCMA 3LNPA 4OOZA 1XLGA 1BYCA 1HN1A 4AZBA 1H7OA 3WUGA 1ELSA 4WJ8A 3TCEA 4HU4A 5D9NA 3GW3A 3IK2A 3B06A 3GG8A 3L7RA 3W7QA 4L1XA 1JPDX 1H2JA 1V0NA 3AS2A 5G4HC 2FJUB 3SIZA 2RDUA 1IWAA 2H6RA 3CUGA 3W1LA 3P60A 3N9RA 4NRRA 1SMAA 1EJTC 3I3EA 2R1MA 3VUPA 1XRSA 3WQEA 3KOFA 4GNVA 3K30A 3KRBA 3GNXA 3QW3A 3VMNA 4H9YA 1PWLA 4XVEA 4N2YA 1OG0A 3C52A 3N13A 3SAZA 3VNLA 3BG9A 4OZOA 5F4XA 2WMJA 4GI9A 4QEHA 3DKJA 2C15A 1UC5A 1JPHA 2I56A 3W38A 1KM2A 3VDAA 3TYBA 3U2CA 3ARYA 4ADTA 3GXIA 3C0SA 4BK9A 1B4EA 3C2EA 1EUNA 4DZIA 3KHJA 5IHSA 3SUUA 5IHRA 2P1FA 3QTPA 3ME3A 5BU6A 2VX4A 3W2MA 3PTKA 1EBGA 1QNVA 4HKPA 2YIHA 3YPIA 3WQPA 1TCDA 4B4FA 1E0UA 3FOKA 1XIFA 2VDHA 5D2WA 2DIJA 1KFCA 3UXLA 4C90A 3MA8A 1KXTA 1OB0A 3CLMA 1GQJA 1DJYA 3NSMA 1P6CA 2E1WA 5F4SA 5FI8A 3BAIA 1JUBA 3W07A 4EAMA 1IF2A 1ENUA 2J4GA 3RLHA 1PIIA 4IH3A 1NDYA 4AG0A 5LIXX 4MWAD 2J7GA 4E2VA 1GW1A 2XIMA 2EKGA 4W7WA 3FFSA 2JF7A 1POKA 4L6DA 4I9MA 3SCTA 3ITLA 2XG9A 3AMCA 3FGCB 4NJKA 3M44A 3KBSA 3LPOA 2OX1A 4Q22A 4HSNA 1DE6A 1K02A 4IFKB 1RBLA 4Q8NA 3RCYA 3GDBA 4PULA 3WFZA 1VFSA 1QI3A 1XJBA 4MG4A 3W1MA 3BZJA 1QW8A 1R3WA 1DJGA 2AKZA 3H26A 2IKIA 4Z08A 1RP9A 3FV9A 2XH2A 5JUVA 4WSHA 4Q7IA 4ZSTA 3K46A 4N9DA 3B8IA 4Y8EA 4DJDA 1KFKA 1SZGA 3HN3A 1D3HA 1MXSA 1XIDA 4AD5A 3LGGA 2ZRXA 4IPJA 1TR9A 1F2JA 3LX9A 4NYUA 2Y5JA 3A22A 2DSUA 1V03A 1WXZA 1AODA 4FIRA 1D3GA 3M0XA 4EXAA 2DZBA 1Q6FA 2E7FA 3M5ZA 1NH6A 3N14A 3FX4A 3U48A 5DT7A 3ATZA 5AYZA 3PNUA 1OGSA 1PL9A 3K4WA 1EH9A 3QPZA 2G3FA 5HMFA 1AMKA 5K9CA 1TPB1 4CQ8A 1MDRA 4EAYA 3BAXA 3T6CA 1O95A 4NILA 2ZVIA 1CXKA 3HQOA 1MWOA 4NZ1A 3EWUA 6A3HA 2O9RA 1WZAA 1W5QA 3NDZA 4LANA 2QUNA 3ARTA 1L8PA 4UFMA 1OK4A 2ZX6A 1C91A 1U5HA 1CNVA 5FAGA 1C3FA 4O0KA 2FJKA 2X2GA 3P84A 3OQ8A 3WNLA 4PEEA 2VM8A 1BVZA 4UC5A 4YU1A 3AHTA 3NSNA 2YB1A 4HPJA 5FL0A 3TW9A 3H4XA 5A6LA 2VZUA 1UMLA 3CAKA 3ARZA 3OHMB 4IUGA 3QVQA 3VMOA 2V68A 5HINA 1BYBA 3WDPP 1ME8A 1NSJA 5KITA 1S1PA 4US6A 1JD7A 4S3BA 1KRCC 3VKBA 4GQGA 4ZOEA 2VT0A 2ZUSA 1ITUA 1K77A 3CZLA 5BRQA 1XL9A 3WLQA 2WANA 3IIXA 1QAPA 4PSPA 4UZUA 4JX4A 4GWEA 2BASA 2XH4A 3S1GA 4EPBC 3LOTA 4NAFB 3T2PA 1FWFC 2UY3A 1I8JA 2WNQA 3CV6A 1QU4A 2OOGA 1IQ8A 2OKTA 3GHUA 1G4EA 3KS5A 2DSZA 1CB7B 4J3TA 4GJ1A 3OZYA 4PB3A 3O3RA 3GC4A 3T4CA 1QFEA 3EWDA 1MXDA 4UMCA 3WLJA 3OB8A 5AYIA 3GW0A 3K8LA 5HA7A 4GE8A 4ACZB 2DT2A 3B9EA 3OGVA 6TIMA 4WQ6A 1BXCA 1DXIA 2CYGA 3EDFA 4JX6A 4XB3A 3PBUA 3HQNA 1JDDA 2YCJA 4F0HA 4F4RA 4DXXA 3NDYA 1KTBA 4BY3A 3SQSA 2YCLB 2HS8A 1W8GA 3WF0A 1KRBC 3CL7A 1X38A 5FIPA 1ZRQA 2O9TA 4FHAA 3U2EA 1P0EA 2EKCA 1RJQA 5E5CA 3LXCA 2ZX8A 2XFRA 4W5ZA 2E5BA 3TYZA 2HVMA 3UU0A 1QUMA 2ZA1A 3V0TA 1SUXA 4FOUA 1ZJIA 1AQMA 3NOEA 3VOFA 5A8OA 1I45A 1EC8A 1FWAC 3A64A 5C9UA 3O6DA 4Z2KA 1QDSA 5CKSA 3WUEA 4KEMA 4QDMA 2FZ8A 3REQA 1HTIA 3W76A 2YW4A 1Z48A 3BCFA 1UR8A 1Y5VA 3M0YA 3ATYA 5JQ9A 5REQA 2D69A 1W1PA 4J5NA 3BMWA 1VLWA 2GPTA 4D6HA 1FWDC 2R6OA 3MKKA 4GGBA 4LFYA 4PTWA 3TV8A 2P50A 2QNEA 1R2TA 1EDTA 3NQEA 2ZZ4A 4IPPA 1VCGA 2ZC1A 4D6GA 4DO5A 3GKFA 3WLLA 4AAJA 2DU2A 4H7CA 1HKWA 2Z2UA 3NQDA 3VD3A 1YKWA 1DQXA 1YNPA 3F4DA 4Y9AA 3T1GA 4OIFA 2W63A 1W3IA 3NGJA 3NPWA 2CEQA 1NP0A 2G4FA 4O0ZA 1OCJA 3A5FA 5CSUA 3UXKA 1DOSA 3VM7A 4CEXC 4KH2A 3F2CA 3H12A 4L5ZA 4HK6A 4JQ4A 1HJVA 4GHRA 2ISWA 1E6NA 1XD0A 2WMFA 4BR1A 2P0OA 1F6PA 4GI4A 1JXJA 2PF0A 1VR6A 3GH7A 1PXGA 2DZSA 4S1FA 3S5YA 2A4AA 4DB7A 3WUBA 3QHMA 5HUPA 5CLWA 1WDWA 3DG7A 3A4XA 1K9DA 1E9YB 1KR0A 3HJEA 4QDPA 1MQRA 4JKLA 1CYGA 2BGSA 3WNPA 3SN1A 2Y1HA 2WSPA 4KRTA 1G01A 1EJSC 4DNHA 3U6WA 3TSMA 1JCYA 3SIMA 3F4VA 2IPWA 1VP5A 5TAOA 5HQMA 1C8XA 1JNDA 3R89A 3G3MA 3TMLA 3HPXA 1V3LA 3CHDA 4DXVA 5H6HA 4S3DA 4WVXA 4DM1A 4U5IA 1K6WA 4AD4A 3DFQA 3T78A 2WVSA 3TN6A 2GDUA 2DW6A 2NQJA 1ITCA 4PRRA 1UMYA 2PB1A 2TRSA 3P7YA 3EWYA 4ROQA 1SJCA 4UCFA 4XUYA 2E1DA 2QJJA 4DBUA 1KCKA 5DXXA 3OA5A 4H9MA 1EXBA 4HMEA 2X0HA 3W85A 2PGEA 4YWIA 1ZZMA 1D7KA 3R0DA 3ZSSA 1KFBA 2CBIA 2E9MA 4O16A 3QBUA 3TJLA 3NVDA 3MT1A 1E6QM 5BU9A 1EGZA 4G6CA 4YIWA 3DESA 1EX1A 4K6AA 3S47A 1JCLA 3GS6A 4J1OA 4HB7A 3SY8A 3EB2A 5LIKX 4HOXA 1E0VA 2ASHA 3PY2A 1BQGA 1UKSA 3LDVA 3WD4A 4DWSC 4ZMGA 3L5LA 2Y62A 1UZ1A 3TJXA 3L5MA 5L9FA 1GPWA 5I00A 1LBFA 4L9ZA 3DHFA 1ZAHA 3WMLA 3IIOA 3VD7A 1YDOA 2VX7A 1Y65A 3DYPA 3T0CA 6CGTA 3VGFA 2ZZ1A 1REQB 1WA3A 3NQAA 3HQ1A 1O94A 4AU0A 1H50A 2QCCA 4FXSA 1MYRA 1LJYA 5CSSA 3K1DA 1H3GA 1E6SM 4Y7EA 4GQRA 3CXOA 3S1VA 3AXKA 4XZNX 1OFOA 1LWHA 5D09A 1BHGA 2J88A 1M7OA 1JZ2A 2HVOA 1YIXA 3L4XA 4FNUA 5DCDA 4AHOA 4TV6A 2CLPA 2BHYA 3VGGA 4JFVA 4DQWA 6REQA 3BLEA 1U2YA 2DY3A 3W3OA 4O10A 1MVYA 3CZ8A 5A6BA 1DJXA 2PE4A 2V3FA 1UR1A 2VO5A 3WNOA 3W81A 4AWUA 2NQ9A 3AWNA 2ZX9A 4XZLX 3IJQA 3VNMA 4WCJA 3NUKA 5BYWA 3WIJA 3NQ6A 4R9OA 4GABA 1WDPA 3VIMA 1U5JA 2D73A 4NVTA 1MFVA 5EY5A 1UZDA 4NHVA 1MNZA 1Z44A 1P48A 1TA3B 2ZXQA 4MNKA 1SJDA 2DZXA 2P5NA 5JXQA 3H54A 1WB0A 4NZ3A 4K3ZA 1EJVC 2QZRA 6XIAA 1E0XA 2XYLA 1TIWA 3VYLA 2VX5A 3BLLA 3BW4A 1J4EA 4EPKA 4ADSA 3TC6A 3ZR4A 4WRHA 3GG0A 3U57A 4PMUA 1PZ2A 5KZEA 2HNEA 3CWNA 3NQVA 3ZS4A 3UVIA 2DIEA 2V9DA 2OPJA 2V82A 1NDVA 4H9XA 3ZR5A 2PCEA 3LBCA 1PDZA 3TAKA 2WJEA 4ZSUA 3QOMA 2WMKA 4TO8A 4HN4A 2R1LA 5HJXA 2HEJA 1BWVA 3LCGA 1KCLA 1Q6RA 3VIOA 2PP1A 4OT7A 4QTGA 2DZAA 1F3XA 1M3UA 1ZJAA 2FPYA 3IIVA 2GK1B 4Z2LA 1S2WA 2FGLA 2FH8A 3I7SA 3WLRA 3ANYA 1VCVA 5FJRA 3T08A 2Y24A 4FLQA 2WNWA 2JALA 5XINA 1H4PA 3WQ4A 2Y89A 4U2YA 2CCRA 4GVHA 2FHCA 5IRPA 5EPDA 2ANUA 1UC4A 1KO0A 1EYWA 2GVLA 4G8TA 3QR1A 3BE7A 2NQHA 4UTLA 3LB0A 3RJYA 2EXOA 4WDWA 4JOMA 4BI7A 3MUZ1 5EMMA 2DT0A 4DI9A 1DIKA 4HHPA 3A9IA 3GDMA 1EPVA 4D8ZA 4DWDA 3SBFA 1GUVA 1FTXA 2WSRA 3CK5A 2PU0A 5ECUA 2WQPA 3LSBA 3UPWA 3AMLA 4LBUA 5F2GA 2R1NA 1OZQA 3E38A 4O1FA 3M7WA 3FVMA 2E40A 4AZCB 3GB6A 1HT6A 1D2KA 1XR2A 4IHCA 4MLJA 1TKKA 3B97A 1ICPA 4HK5A 4QJ4B 1TPFA 3VD9A 3VKAA 2YPIA 5D30A 3QW4B 3T55A 4AVNA 1H1YA 4DWSB 4U4MA 1DQUA 1QW7A 4LB4A 1S39A 3B0YA 3W7LA 2OQYA 3CT2A 1A50A 1F9CA 1G67A 1QO5A 2QAFA 3A4WA 1Y0EA 4U10A 2ZBTA 2PSNA 1BQCA 5HMDA 4MZYA 2GGGA 4M1BA 3MTWA 3BTNA 3ZVHA 4NZ5A 4MJMA 4HA4A 2GUYA 3DEQA 4XSLA 3SN4A 1LDCA 3LHWA 3B0XA 1WKFA 3TYUA 1YDYA 5C71A 3GFXA 2J27A 2PS2A 2QIIA 3BUVA 4AWSA 2PDXA 3ZWTA 2YW3A 2WNNA 3I4EA 4NAEB 4ZODA 1XYZA 3V0SA 3Q67A 3U3HA 5MHBA 4J28A 1E4IA 1KBJA 3WLNA 4D8AA 4UMAA 3EAUA 1SSGA 4B92A 4E4PA 3QLDA 4YTRA 2CZVA 2GQ8A 1GGOA 4GY1A 3ARRA 2REQB 3TQKA 4XAPA 1XD1A 3QKEA 5D2VA 3K4DA 2YKKA 3G1AA 1XW8A 3SY1A 3DYMA 4CUCA 4QSFA 2P10A 1IXOA 4QAIA 4QJ3B 2OVLA 1JZ8A 3LZ3A 1H63A 2ZZ7A 2VC5A 1FWBC 3WEMA 4IG2B 1X7FA 1FWRA 2XINA 3UZXA 4FLRA 3WH6A 3RO6A 1H51A 2HISA 2DGAA 3GXMA 3IGHX 3RFAA 5BXSA 3FA3A 4H3DA 4QRNA 3R0UA 1XBVA 9RUBA 1KCZA 1QI4A 3GNRA 2XIBA 3APYA 1CX9A 4YCPA 5LSMA 5BOFA 4QCFA 4CNTA 3E02A 1FKWA 3KWXA 1TX2A 1VC4A 5DF0A 3EX1A 4MIMA 5AY7A 4JNZA 4C6FA 5I78A 3QM3A 3QFEA 2OLSA 3N3TA 4C6MA 5HNUA 1EZ2A 3O6AA 2FB3A 4FLOA 1JPIA 1SZRA 1ZP4A 3AS0A 1GG1A 5AZ1A 3VGDA 2Z1XA 2V5KA 3LV5A 5K4ZA 3A3XA 1VENA 4A29A 1E40A 2PFHA 2CETA 3BAWA 2EPLX 4U33A 3PZOA 3WF3A 1UB3A 4G9PA 3QXBA 1NF0A 4UTTC 2ZC8A 4O1EA 3ZLHA 4FMVA 1UPMB 2VEFA 1ADOA 3M0KA 1WPCA 5LA1A 1GPFA 2WYSA 1I6NA 4L4PA 2QT3A 3WBEA 2F2HA 1E3ZA 4WKAA 4YTTA 4FP1A 5EA9A 5F1VA 5LGZA 1J0JA 2YYUA 1OM0A 2IPJA 4UOQA 3UGRA 3QF0A 1A5NC 2FH6A 5I23A 3LPGA 1NF7A 1R2SA 2PD9A 3S1WA 5CPSA 1XFCA 2F2KA 3B0PA 4I6VA 4YN5A 3D3FA 1P0NA 3E5PA 1A0EA 4UQCA 3HV8A 4C7GA 3GZ3A 1X8CA 4TX9A 2XWDA 5BWFA 4Z1AA 3MCNA 4E3TA 1H5VA 3AS3A 2OO0A 3KRUA 1LRQA 5ECVA 4TTGA 3EEZA 9CGTA 4ZTXA 4I5XA 1IEWA 4LUJA 3CMFA 5CG0A 4FF5A 3CPGA 4AHQA 2XVNA 2Z1SA 1UPPA 3GNOA 4OECA 1SJAA 4QDWA 2VFFA 4LAMA 5CPLA 3K4AA 3THDA 1W3HA 3IUHA 1K7FA 3MY9A 3V16A 1A0CA 1LRTA 4C5ZA 2J7FA 5C8BB 4GO9A 3WN6A 3GHSA 3T8LA 3B04A 3QY7A 2YXOA 4KWWA 1JYNA 2J7CA 4MB3A 2YB4A 2XDFA 3IRSA 2HXTA 1GW9A 2GJRA 1OCQA 3GFZA 2CITA 1H62A 3RUBL 4WR3A 2O0TA 4BKNA 1X1ZA 2GVJA 4AIOA 2A79A 3EKZA 2YZ5A 3W2UA 1PV8A 5KZMA 1RBOB 3C4UA 2W67A 1XX1A 4GYFA 7XIMA 1US0A 1LG1A 3RAOA 4ZO6A 1TJ0A 3O05A 3E9AA 1EQPA 1DL3A 2VRJA 1I1WA 1M6JA 3VIKA 3GYEA 2IQ0A 2XZ9A 1US3A 1BAGA 3MWAA 1RH9A 1QHPA 2BTMA 1FWHC 3DCPA 3UWQA 3VMPA 4GBUA 3CZEA 3G3DA 5AYBA 2OWWA 2WWCA 2VCBA 1ZCCA 3CZJA 3SUSA 1FH7A 3T40A 4WKHA 4DUXA 3MMWA 3SCVA 1EP1A 5D2TA 4ZXLA 5BWAA 4MAZA 3MUIA 1CWYA 2R1KA 4GQBA 4DO4A 1VJSA 2WJZA 3N19B 1KM1A 1W31A 4LEFA 5EBAA 1GK8A 1QNPA 4IFOA 1DJNA 2YFOA 1IEQA 3EKLA 1XLKA 4QISA 3TTYA 1OIFA 4XO7A 2FLIA 1M65A 3OJGA 3UZZA 4ZO8A 1Q6DA 3E0IA 3GBDA 4MYAA 4UQEA 4MADA 2P8BA 1V6TA 1R9XA 2PWFA 3UZYA 4QEEA 4JTQA 4GISA 4JD4A 4A3HA 5LNWA 1EJWC 3MO4A 2CPUA 3T81A 3CYJA 2JIEA 1TCMA 3UWUA 1EIBA 3OYXA 3KTXA 4CN6A 3GC5A 3L4YA 4G7EB 2Y5SA 3W29A 4N0RA 2CLLA 4JFSA 4NYYA 2ZXDA 5JMUA 1PTGA 2C1IA 2IXVA 6ENLA 3LCLA 1P5BA 3L65A 2QPXA 2NWSA 1HJSA 5DX7A 3P3BA 3Q94A 1UQZA 4J7RA 1RY0A 5BROA 3GDTA 2RGLA 3WJXA 2X7VA 1UWSA 1S5VA 4JY9A 4GKTA 2PLJA 2DZPA 1PE1A 2QCDB 2ZE3A 2WMIB 4DJFA 5IXEA 4MUZA 5HNTA 1GEHA 3PWAA 3EMZA 3U0HA 2XVKA 1BWKA 3GNPA 5FD0A 3W2KA 3OG2A 3DFPA 1UWRA 4A35A 4UR9A 3FJ4A 1AL8A 1IXQA 1W2VA 3OODA 4A4AA 3AHYA 3AICA 1QOQA 7REQB 2V8ZA 1U5VA 1OFAA 4V2XA 1DXFA 4DJED 1GEQA 2HNHA 5EBUA 4GUJA 3TA9A 1XGEA 4G2DA 1KM3A 5BW6A 4OUIA 1NWTA 4L9YA 4HTBA 2ATMA 2BSLA 3NGFA 1X1OA 3OZPA 2TODA 4WF7A 3I6RA 4IFKA 2X41A 2VFHA 2Q3RA 3WO8A 3WJYA 2V67A 4AZHA 5D2YA 1M41A 1F76A 3C0JA 4XVDA 3OTRA 3U9IA 1T7LA 7ENLA 4JEQA 1B3VA 4IJRA 2XM1A 3UG4A 3L0NA 4NT0A 2GOUA 1CXLA 1VD6A 3C56A 4J2PA 4JTGA 5DT5A 1TG7A 3WQ5A 1RD5A 3GXPA 2BHUA 3NQCA 4H6QA 5BMWA 2EG7A 2XTKA 3VE7A 5LNRA 4EACA 4NSBA 1KWKA 1GHRA 4GZ7A 4PMOA 5K7JA 1M5WA 2J9XA 3TXZA 4LYPA 2WWDA 3SUTA 3GTNA 1NY1A 1BSLA 3POHA 4DJDC 4A3RA 3KE0A 5A2CA 2OELA 3FCPA 4ZFMA 5J5DA 4Q8PA 1IEXA 9XIMA 1ZGDA 3VD5A 1V08A 4YVPA 1R47A 1VFOA 1BXNA 3LCHA 2A1YA 2TSYA 3HPSA 4O28A 1WDSA 1W6TA 1P1XA 3HMCA 1P7TB 4H9VA 5FJJA 2DVXA 1PX3A 5AC7A 3MI3A 4LBRA 3UJRA 2LLEA 4GPNA 5EFDA 3UXIA 1H7WA 3WZ0E 3AQUA 1NWUA 4IGSA 4UQAA 1R8LA 5B7YA 3IJ7A 3RX2A 1Q63A 4O11A 3P8IA 4NNCA 2E5CA 4AF0A 3E5BA 3TN4A 2H9AB 3B4YA 2D2OA 1E51A 1LOLA 3WG6A 2EQDA 1IEIA 1X1NA 3UR5A 1YBQB 1PDYA 3ABSA 2WSYA 1MRQA 2C6QA 3S4TA 4LS0A 2QVNA 3QLLA 3GIPA 2PBGA 5CQ1A 1W1A1 1GKRA 4MJ4A 2NT0A 2E0PA 1BFNA 4ASTA 4FOKA 2XPKA 2JGYA 1IZCA 3WY1A 1FOBA 1ML1A 4JBRA 3SCOA 1VHCA 4XBSA 3RM9A 2A3EA 1A4LA 3PZMA 3WQ6A 2BFGA 1OWQA 2PC4A 4PMXA 4XAGA 1LLZA 2TYSA 4R7JA 4DN1A 2OLHA 3SDOA 4KGJA 4JXCA 1TB3A 4QXIA 3UESA 1XV8A 3M0ZA 3DFSA 2XN0A 1UR0A 1Z32X 3W2LA 1FHVA 4WGXA 1X7IA 4H01A 4J3ZA 4C6PA 2DUXA 3C5QA 2OCZA 1FHLA 2MNRA 2ZZ2A 4RE4A 3W53A 1GJUA 3MDUA 1GTEA 2GGHA 3R7MA 3GNDA 3N9SA 3WQFA 4ONVA 1VFMA 4DBDA 4L6HA 3CV1A 5A69A 1W1ZA 3WLMA 3EA2A 1KKOA 4FLSA 1I75A 1I2QA 3CUIA 4GXMA 4RV3A 5KINA 1CW2A 2FKPA 4M51A 3DGBA 1WAUA 1F3WA 2VQUA 3LTSA 1MW1A 1UBSA 3NL5A 3CHFA 5IBXC 5CJMA 1W9BM 3VCRA 1WDRA 3AZSA 3PZUA 3WDQA 4HNCA 2ISFA 1UA7A 4B16A 4MB5A 3LXBA 3AJ7A 3FKKA 4MNJA 1A5SA 1I2PA 3BK0A 4UCGA 4CD8A 2ZCGA 1LRNA 3O1NA 4C6NA 3FAWA 1A80A 3T0BA 1W3TA 4ICMA 3TX9A 1DIEA 4JFUA 4CGTA 3L0GA 1MSSA 4NJHA 4O50A 1OVDA 3QV6A 3W26A 1GZGA 3CGTA 1E9IA 1KBLA 1B9BA 3I7RA 2YJQA 4QSHA 5HJLA 4HU0A 3BG3A 2VD9A 4OHQA 3V36A 1DV7A 3GHTA 2GJPA 2XM2A 5DMMA 4NP7A 1G69A 1T40A 3TTEA 2I9UA 1HIZA 2XGIA 3N1AA 4K36A 1V6WA 2QULA 2C91A 5BRPA 4MFEA 2X30A 3T44A 4R88A 2FPTA 4CCCA 3NZRA 2WBGA 3M47A 5FKYA 4V1YA 3TIMA 2D2HA 1XLCA 1W9PA 5FEZA 1J2BA 3BGGA 2C14A 2XN2A 2HTMA 2Z4GA 4C6QA 5HNRA 4Z1YA 2XIIA 4PUWA 3M16A 4OBTA 4AD3A 4XAFA 2WVTA 4GZIA 3GR7A 2RUSA 2FB2A 4XZIA 3MV01 2GSJA 1PEZA 5G2IA 3USZA 4D6FA 4Q8TA 4RJEA 3SGGA 1R85A 3QHNA 4FSAA 4DPPA 3LHTA 3PJXA 4HPXA 4DZ5A 3SB0A 3EMCA 2H8XA 4CLMA 2PDQA 5HR7A 1TMQA 8A3HA 1CGTA 1L6WA 1FRBA 4CNSA 1IHIA 1VFFA 3QMSA 3ZOAA 3CV2A 1KR1A 3WX7A 4PTMA 1PX4A 3RLUA 3KVMA 1GWJA 2A5HA 6ALDA 5IDZA 2VJXA 4PUNA 1GONA 1UHVA 2HCVA 4UNIA 3EOEA 1KWGA 2C13A 4YCOA 1UCWA 4HU8A 3EWZA 1J8VA 5D02A 3O7UA 4XZBA 3OLDA 1E73M 4X3ZA 3PF3A 3ENLA 3NPUA 2QUMA 1KRMA 1QPRA 3LBMA 1Y8BA 2G5WA 2PU1A 3H2MA 2GJLA 4ORIA 3F7JA 1CECA 1H0GA 1YE6A 3TKFA 1CDGA 1DJIA 4QLLA 4MZ1A 1RHCA 3CIWA 3CLWA 3W7OA 2D1ZA 1GOMA 4HOWA 5DBTA 2AQOA 4F0SA 1B57A 2P3ZA 3H70A 4CD4A 1DIDA 3C2RA 3GM8A 3S2NA 4A3UA 4LY8A 5TD4A 1A5AA 3UCDA 4MF4A 3QV8A 3DG6A 2Z24A 4KIEA 4E4UA 4NJGA 4E4FA 4D6EA 1JR1A 2XHYA 1S46A 2OGYA 5T91A 4BEQA 4Z1CA 2YA0A 4PMVA 3N73A 4WDXA 2OMAA 1DWGM 2OEJA 4I9TA 3K1GA 1OX4A 2R91A 3HA1A 1NVMA 4P8UA 3BDKA 3NM3A 1FP8A 4L4OA 1FCVA 3THQA 3NURA 3W7GA 3W1QA 3VCCA 1RSCA 4ORMA 1BGAA 1E70M 3HTWA 2XGZA 5FSEC 1W5MA 3DENA 3RX4A 5TNVA 2X0SA 3CT7A 4M6UA 3E96A 5HDRA 2EJAA 3QSTA 1R9ZA 2CLIA 2G96A 1JDAA 4CQAA 2V3EA 4RDVA 2XH0A 3R13A 1TUXA 1DJQA 2PTXA 4MPKA 1PBGA 3WDIA 4A8NA 4WK9A 4N6EA 3NQGA 4JFTA 3WD1A 3UA4A 4GBDA 5REQB 4FR1A 1K03A 4IL0A 4L56A 5DQPA 1E5JA 1OF6A 2BOGX 1OX6A 3KOXA 2JEQA 1I0BA 2IUZA 1M53A 1Z7AA 1LP6A 3LXAA 3PANA 2BXVA 2CXGA 4I7WA 2NX1A 2PWVA 1TV3A 1NELA 4AYSA 1JZ7A 4AY1A 3CUJA 3W88A 3C86A 3NL2A 2CHOA 3CUZA 4H7ZA 1PHQA 1UP3A 4WJEA 2FDMA 5F2LA 1YQ2A 4FB7A 4BI5A 1PTDA 1QW9A 1Q4WA 3SCNA 4GIRA 3RPDA 1PKYA 2E5DA 3W1NA 1ICQA 1CXIA 4UMBA 2NLYA 1JI1A 2WSQA 4M6PA 3ITGA 1PKNA 2PEVA 3N9KA 2NUYA 4S3CA 4UFHA 2JE8A 2NT1A 3CTTA 3A6OA 3IUIA 3W7DA 3AJXA 1N8FA 3RM8A 4LAUA 3VKCA 4X60A 3RR1A 2CKRA 3WH5A 3UYIA 1UWIA 2FDSA 5C9RA 5CC6A 4DWSD 1Q6CA 3FVDA 4BJHA 3BLOA 3B03A 5EKYA 2HMCA 3OIHA 1HW6A 3CYVA 1X6UA 4FXFA 4HYWA 1RUSA 2W6RA 2ALRA 4M56A 3CNYA 5FJIA 3UERA 3WD3A 2E6AA 1JFXA 3CO8A 1AJ0A 2DSVA 3E2QA 4FK9A 5F2MA 4HVXA 3H7UA 3FDKA 4FO4A 4GI6A 5BRBA 2MANA 1MEIA 3DI1A 4EPDC 1F3TA 3MV11 4L1WA 3WK1A 2FPVA 2PRLA 4YLWA 1O66A 1MDLA 1XGDA 2C0HA 1KLZA 2WV8A 1WUEA 2DJXA 4JHZA 2W61A 4ZQRA 1VCFA 3UP8A 5A6AA 1I9CB 3G77A 2QAPA 1XC4A 1UIOA 1AW5A 4J35A 5DMYA 3PM6A 1CGXA 1OT1A 2Y5EA 2WCGA 3R94A 1XDLA 3BICA 1WKDA 2DJLA 4UIOA 4LPCA 1XPYA 2ZXBA 2FTPA 5LXEA 1V6XA 1LLOA 4FEZA 4MYXA 4HSHA 2XH7A 1KGUA 1ECEA 1GYMA 5J5RA 4JS3A 4A8RA 4L4LA 4E8CA 1H7PA 2ACSA 4AXNA 5A2BA 2OOFA 3M0HA 5DELA 2A6LA 4ZB2A 2RDWA 3QGVA 3UG3A 4EIVA 2R82A 2W9MA 1CI1A 1LQAA 1HL9A 1O12A 4DO7A 2GVEA 2VZTA 2ZX7A 3GK0A 3LQLA 1W56A 1X98A 4QLKA 5DBUA 4YVXA 2G97A 2F84A 3ZXWA 4R5EA 1FDJA 4L1GA 3C3UA 2YCKX 3L4ZA 3AOFA 3AMKA 1AW2A 4R34A 4F48A 2WC4A 4UTFA 4K8GA 2J8GA 1Y5WA 1QHOA 3V7PA 4OE7A 3C0QA 4NIRA 3OLIA 2VXNA 4KFPA 3L4TA 3PUOA 3AO0A 3AIBA 1T6MA 3DHDA 4CCEA 3PZNA 4Q32A 4EK7A 1Q66A 1XRFA 1DWAM 4PUDA 1WXJA 3MUCA 3DG3A 3TFCA 4IX2A 3BAKA 3SR7A 2REQA 1MNSA 4B5UA 1MUMA 3RMJA 1RCOB 4YMZA 5I24A 1PUDA 1VBHA 4L7ZA 3W23A 3R6IA 1HF6A 4MB4A 2X1RA 2Z25A 2PF8A 1L6YA 3S2LA 2ONEA 2BXYA 1CEOA 4GJJA 1TPVA 3QY6A 3AU2A 1KTNA 5M3WA 4EF9A 3VNJA 1IT0A 4IG2A 4YJ5A 1PKLA 1J12A 3KOWA 5DLCA 1OBAA 1XISA 5I3KA 5C2XA 3G18A 2GYIA 3LRLA 3H7VA 3N6JA 4IMAA 2ZWZA 4FX6M 3L0KA 1LL4A 4WJXA 5L6UA 1XLIA 5KEZA 4O1DA 1X6LA 5AHMA 1AZ1A 3UR8A 1EC9A 1W9VA 2QJIA 1W3NA 4WX2A 2INFA 4C6EA 3WMBA 1UKOA 1UG6A 4ZOAA 1B5TA 1EFZA 4DVOA 4UFJA 1VZWA 2PDPA 1KM4A 4BWLA 1E9LA 5DXYA 1OG6A 3IVTA 3QTGA 4HNNA 2GSHA 1B2YA 2OZTA 4JTFA 5ABTA 4D1JA 3WLSA 4TVDA 3LPFA 3G1XA 4C91A 4M3PA 2WXDM 5CGMA 3W6LA 2PA6A 5D9MA 4TOQA 5I3HA 3MI2A 2QS8A 3GTFA 5H91A 4POCA 2A2IA 3FNDA 3LV6A 1QOXA 2A7NA 1K9EA 2Y8VA 4KT2A 1QPNA 3RO8A 5H2ZA 2QJNA 4UXDA 2NWRA 3MVTA 4WLCA 4LV9A 3GVWA 3RXZA 4PB4A 1OHLA 3W2JA 1H09A 4AEFA 2A3LA 3JU2A 1O5QA 3HZ3A 4IIEA 1JZ6A 3W2NA 2V81A 1RAKA 2BV9A 2DZVA 2WHKA 1E0TA 1BVWA 1XBXA 3VA8A 1U1JA 4U2ZA 5D04C 1RR2A 3MB9A 1J5TA 1K9FA 1U83A 1TRIA 2HRWA 1RA0A 2DDXA 2ZADA 3LN3A 2ZQ0A 3G1RA 5I3IA 3VIFA 3PK7A 3WQWA 4FALA 1I2RA 1TV8A 1XYAA 2Z7KA 1ONWA 3BLIA 2BVDA 2WW5A 1O6IA 3A21A 4PUJA 5CBBA 3L2IA 4KCTA 4H8NA 3OA3A 4JTRA 3BV4A 4M1RA 1S5NA 3M7SA 1DJWA 1EOMA 3BXWA 3EOSA 4TR9A 2AMXA 3OBKA 2PTWA 4GVGA 1XDMA 2WMGA 1JPMA 4ZE4A 4B5VA 4DIAA 2O56A 1DHKA 4ICNA 5KTLA 4PRWA 3ZJ7A 2BY1A 3FDGA 2A85A 4Q4RA 5CCZA 1AG1O 1TZZA 2YXXA 3EXRA 3ZVHB 1MO0A 3KCLA 2FTWA 1V0KA 3U4AA 1S38A 1W1TA 5EMKA 1UH4A 4CU6A 4CQCA 1K6AA 2X1SA 4P7LA 2E68A 4GINA 1G7VA 2ZTJA 3TWBA 3Q2DA 2YL5A 1MW0A 3BJSA 3W71A 1FY6A 4NZJA 8TIMA 3HBLA 3M5YA 2CIPA 3RIKA 4M29A 1L0PA 2OZ0A 4IQJA 1KRAC 4AXKA 2PGWA 1GT8A 1HO4A 2ZZ6A 4XTIA 2CLHA 1W54A 1NP2A 3ZO9A 1GVIA 1QI2A 4LVDA 2QEZA 1T5AA 3S83A 3IV3A 3AUJA 3O16A 5K2ZA 5AYYA 5K9DA 3UGVA 4O0QA 3WQCA 1XUZA 3NEVA 3CMGA 4QAWA 2J6VA 1IYXA 3MZ2A 1LLWA 1H41A 1WX0A 2B7NA 1PIFA 3UA3A 4ADUA 1YEYA 1UASA 4EOUA 2Z1BA 5FAJA 2GJNA 4ZBCA 4WDTA 1F4AA 1I2OA 3W74A 3O15A 2GDVA 4IICA 2IXUA 1N7KA 1POJA 1J93A 2BP1A 2ZA3A 3QZEA 4ZVJA 2P53A 3RGTA 3P2VA 3LRKA 3CH0A 3UVAA 4FR6A 4O52A 1I2NA 2DH3A 5FA5A 4HOZA 1R6WA 2WQDA 4ZOBA 5FEXA 4H4IA 2I7GA 1ZBVA 1ZBWA 3FKRA 1MEHA 4FPSA 3B0UX 3AXIA 4AEOA 2ISSA 2XFFA 1O5KA 1B3XA 2CU0A 3VX0A 2V38A 4GI8A 4CCDA 2Z2AA 3RITA 1QBBA 3BOFA 3VM5A 1PHWA 2W66A 3LYEA 4EVZA 4L9XA 1KB3A 4KIRA 2BODX 2YX0A 2E6FA 2AQWA 2PODA 2OODA 1TTPA 4Z0JA 4G1KA 1W9UA 4S3EA 3WJWA 1IXNA 1OK6A 1N2VA 2ZA2A 3GU1A 3E2VA 1DQWA 2GQ3A 4G7EA 4GUHA 3FK4A 3GDKA 2V5DA 3NZQA 5I3FA 3R43A 2HWGA 3PPHA 2XU2A 2E3ZA 2WZTA 2CZDA 2VQTA 2J6XA 1SQ7A 3B9DA 1U1HA 3PBGA 2PP0A 2QCDA 1SVDA 1I0DA 2FFCA 2F8QA 7ODCA 3TK7A 1K70A 4EX4A 4DX3A 1RLCL 3CZGA 3MWCA 4PGLA 3EWBX 2NZLA 1UKTA 1XYBA 4GD0A 3NFUA 4DJFC 1XYMA 3NDOA 3K2GA 1VJIA 4WXZA 1TWDA 1ZS2A 1KQYA 1ZLPA 3SSJA 4NASA 5GQBA 5AZ0A 1RK5A 3CASA 1PO9A 1V02A 1C90A 1W3LA 4IXHA 1GZ1A 3F4WA 5C55A 1W9DM 2NUXA 5A8PA 3W1PA 4QE4A 2D3NA 5C9WA 2NX3A 1X97A 1H49A 2QV4A 3F03K 3T05A 5I06A 1EHAA 4AW7A 2NX9A 4UTUA 4LU0A 2F61A 3O0KA 3SCUA 2GDQA 3E0FA 4TMCA 1ZSXA 1V3JA 2PDCA 4YTQA 2NW0A 4YYCA 3FA4A 3OZMA 1R3RA 1E4NA 1L9WA 1XH0A 4KW2A 2D0HA 4AEEA 3ES7A 4GVIA 4OV9A 4OOUA 1G9HA 2EF9A 1KD0A 4M6QA 4MNMA 2X42A 1IIGA 1MUCA 4B9ZA 3AIVA 2VELA 1MQPA 3U2ZA 3FHQA 4B9YA 1TR1A 3AS1A 3TQVA 4DYKA 1RCXB 3H7RA 3A3HA 3QQ1A 1W1VA 4NX0A 4OU1A 3M9YA 3D0CA 3MHFA 3MSYA 2AAMA 3B8TA 5I0DA 2VKZG 1A5BA 5EFFA 1YPIA 4QCEA 3WBXA 3G22A 4IISA 2OWXA 3MI6A 4XG1A 2QCGA 4QS6A 3WH8A 3PZQA 3H2OA 5RUBA 3GR4A 3CHVA 4LS1A 2ACQA 2GLKA 3ARSA 2RAGA 1GVFA 2W92A 2HE5A 2ZVRA 2ZUMA 1SU5A 3EXTA 3IIZA 3OG3A 3T0AA 4YVVA 3FJLA 2H9AA 4Q8UA 5CEWA 3NCOA 4KKXA 1CGYA 1UOKA 5CG7A 1XF0A 1ONEA 1NFPA 4HZMA 4RDZA 3CTLA 4X22A 5I3GA 2QCHA 2ZUNA 5G5IA 2C16A 1G4PA 4IP4A 1JDCA 2EPHA 5MF5A