3ELFA

Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
345
structure length
332
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Structural basis for catalysis of a tetrameric class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 132
structure length 332
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3elfA00
4TMBA 4XQ6A 4TMCA 2WO5A 1RR2A 2D73A 3EB2A 4RX0A 4FXRA 1P0KA 1YXDA 3W76A 3L5MA 4YMZA 4XBKA 4LW7A 5E1QA 3C2VA 3R13A 2F7FA 4UXDA 1FY6A 1AL7A 3W7CA 4AXKA 4PH6A 1K8YA 3HPXA 2CZFA 1DQXA 5DY2A 1EEPA 1YPIA 4Y8FA 2CLHA 3JR2A 3NQAA 3D0CA 4O8RA 1LORA 3CU2A 4LUJA 5K4ZA 1WBHA 1M5WA 3SECA 5KINA 5LNRA 1UASA 2Y7FA 3EX1A 1SW0A 2OX1A 4MZ1A 3BG3A 1Q45A 3DH7A 3FJLA 3OBKA 1TMHA 2EPHA 3G1FA 3JRKA 2GVGA 4DF1A 1YTEA 2E6AA 3S5NA 3NA8A 1VLWA 4O10A 1H5YA 1W31A 1QPQA 4KWWA 4FB7A 3W7KA 1NVMA 3KFTA 3L66A 5I3JA 4WZHA 2YYTA 3M1ZA 4GFSA 4O1DA 2BX7A 3UWYA 2V81A 4FO4A 2P0OA 2VFIA 1ZJIA 1D3HA 1V5XA 3E0IA 2YPIA 1SR9A 3SJ3A 5AYZA 1EA0A 2ZZ7A 1YYAA 4JEQA 3I68A 5G5IA 1H7OA 4YWIA 4U4MA 3TSBA 1JVNA 1TREA 4JYDA 3EKZA 2CZ5A 4MIMA 1FXPA 4IXXA 5BOOA 3W3OA 3RMJA 1FBAA 4HHPA 1AW5A 5F1UA 3HOJA 5I3FA 2OJPA 3NL3A 1TTIA 4FNRA 2AGKA 3LCGA 2H6RA 3N9SA 5K4XA 2XN0A 3O6CA 4WJEA 5AYXA 3S9YA 3LLDA 3RF9A 5AHLA 3CB8A 3TSMA 4M19A 3LCHA 4LS2A 4JR5A 3BLEA 3W71A 5CSRA 3U2OA 3IGSA 3W2LA 3W7EA 2ZRWA 2NUYA 4M6QA 2J24A 1RD5A 1FWRA 1XBYA 1YXCA 1KV8A 5H2ZA 3KVJA 3NM3A 2Y61A 1WAUA 4JS3A 4JTTA 4MY9A 3C6CA 2FPTA 3M43A 1W5QA 2V2CA 5LHEA 1W3TA 3LI0A 2E77A 1R30A 3C2FA 4OBTA 3F03K 5KSWA 3G18A 5BRBA 5CKSA 3TFCA 3DHDA 3GAKA 5SWUA 1LOLA 3DHFA 4O1CA 3FEMA 3SR7A 3W87A 4JICA 4Y6GA 2CLMA 5FF2A 3PB0A 1OX4A 2VKZG 3GDKA 1Z41A 4L4LA 5A5WA 2BZNA 1KLYA 1S5VA 1YTDA 1ZY9A 2ZZ2A 4N2YA 1TV8A 4QSHA 3P84A 2R14A 4O19A 2DZWA 3T7VA 5DN1A 1N8FA 1SSGA 1YDNA 1IXQA 2X1TA 4K6AA 4JTFA 3IVSA 2QCDA 1LZOA 4ADUA 1H1YA 3M16A 3BLFA 4KFPA 2H3DA 2HS8A 1KV5A 1LROA 2Z0IA 4BI5A 3NO5A 1QR7A 3G1YA 3HGRA 4FNTA 5BMWA 2TYSA 4WY0B 4E2BA 1SO3A 4UMCA 1SFJA 1SZGA 4UTJA 3LCFA 5AC6A 4DF0A 1TRIA 3NQ2A 3MP3A 3A23A 4GNJA 1VRDA 4O54A 5F4SA 4MFEA 4LT9A 5G2WA 4XKYA 4CQ9A 4IOTA 1IXOA 3W1PA 1KBJA 4R34A 2E5DA 4ZQNA 4OWGA 3LRKA 3MHGA 3ZWSA 4TX9A 3M6YA 1Q6OA 4WD0A 1OFAA 1TTPA 3WJWA 4UMBA 3DU0A 5FEPA 1J4EA 3GXTA 2H8ZA 1I2QA 1F7BA 1A5CA 1GVFA 1C9DA 4QITA 3F4WA 4GUHA 3Q37A 1ZFJA 3QYQA 4E0CA 1QFEA 3C0JA 1IF2A 1BEUA 4CQ8A 1GEQA 4EOUA 1N7KA 1LYXA 2B7PA 3I6RA 3BG5A 1KM5A 1QO5A 2DJXA 1OABA 2J27A 3HGSA 2VEKA 5HINA 2Q3RA 1VYPX 5DXYA 3W7IA 1OYCA 2GOUA 2A0NA 2PRHA 4XUGA 3YPIA 2Y7DA 4O1BA 1OVDA 1DQWA 1M6JA 4TU1A 3GVGA 4S2CA 3W7GA 3PUDA 3M5ZA 3C2EA 1LOSA 1LBLA 3TE9A 1IGSA 1B9BA 3MYPA 3QMSA 3QSRA 1QPNA 3UWVA 3NQ8A 1GVQA 5D04C 3O07A 5BNKA 1G4SA 4O4VA 2NX9A 3BK0A 3VFLA 3VE7A 4LS1A 5HR7A 3O05A 3P80A 5E0KA 1FDZA 2A21A 4O14A 2A1YA 2TPSA 4IMFA 3NL6A 1TV7A 2YSWA 4R7JA 2QKFA 2V9DA 4IPIA 2E68A 3ABSA 4UTMA 3TAKA 3R12A 5AHIA 3T40A 1FWTA 3L0KA 3RU6A 3F1QA 1SW3A 3HJZA 1VYRA 1LRTA 5KITA 1I2RA 3MJYA 3M7WA 1H7XA 1TPB1 1S5WA 5K7JA 3BW3A 1D9EA 3CHVA 3BW4A 1PV8A 1ZENA 6TIMA 4EF8A 3DFPA 4LTSA 5DCBA 3CEUA 3ABRA 3M0ZA 1O5XA 3KHJA 2HS6A 4UNKA 3RK8A 2DZUA 4UMAA 1OYBA 3NDOA 1GTEA 4K39A 3MMTA 4AHPA 2JGQA 2Y6ZA 1Z48A 3G1SA 4WY0F 3SGUA 4X9SA 3TJXA 1PCKA 2E6DA 1RZMA 4JYFA 5HWJA 1KTBA 2WNNA 4DO4A 4GUJA 1FX6A 4CNNA 2WPBA 3MI6A 2NXGA 3LXBA 4OU1A 4S2BA 4NNCA 2ZYFA 3DKLA 4Z1AA 1WOAA 1K03A 3NL5A 3WJSA 3BGGA 4AH7A 4A21A 3GX9A 4UTWC 3UWWA 1L6WA 3UPBA 1VCVA 1SZNA 3GDTA 2NXIA 4ML9A 4AMAA 5LKYA 3W7NA 4AF0A 2CLLA 1H61A 4HNVA 5IBXC 1SO4A 3IIVA 1P4CA 5LZLA 2NV1A 3LBCA 4C1LA 2C6QA 5LNSA 4LV9A 3W84A 3GIYA 3G3DA 5CPMA 1OFDA 1ICPA 3NQCA 5FF7A 4AWTA 1GVOA 4JTHA 3KVMA 2J9XA 7TIMA 1R46A 3HF3A 3NQ7A 3PG9A 3ZFHA 3G3MA 4HSNA 3MUXA 3NZ1A 3S1UA 4JTSA 3E12A 3FLUA 3BARA 3Q94A 1O94A 3PS7A 1OFPA 1P5BA 4GC4A 4O57A 3B0UX 2AQWA 4AB4A 4D2JA 4X2RA 2GQ9A 3QSTA 4JY9A 1TJPA 3KRZA 4O0ZA 4GUGA 5ABTA 3I7SA 3TFXA 1JCMP 3W1LA 2RDTA 1EP1A 3UY7A 1KM6A 3B06A 4B5NA 4GBUA 2Y89A 3MW7A 4NXKA 4IWWA 3DFQA 2ZCGA 3HPSA 1EWDA 4UTLA 3TQVA 3W1AA 1IIGA 3W1MA 1GPWA 1C8VA 5FESA 2DJLA 3B8DA 3S5ZA 2WSYA 1PL9A 4J9JA 4AEOA 2Q8ZA 3QW3A 2BTMA 3W2UA 1ME7A 3MO7A 1K8ZA 1MXSA 3I7QA 3C4UA 1I2NA 3M5VA 2A7NA 1TYGA 2VEMA 4NJHA 3LRLA 1OX6A 1VPXA 3EWBX 4Z1BA 4IMGA 5HWNA 3TCEA 1QAPA 3FKKA 1T0OA 3W74A 1MEWA 3NOEA 5F4XA 5D37A 4IXHA 5HUOA 1ME9A 1UUOA 4LC8A 4CCCA 1IXPA 2OMAA 3N19B 1XBZA 2DZSA 2CLEA 5EBUA 4JXCA 4K7VA 3W1TA 3C61A 3NPWA 4I7VA 5CPNA 1QOQA 4HNNA 3VE9A 1GJPA 1MSSA 3W23A 3KAOA 3B05A 3LERA 3GKAA 5D09A 4RV8A 4OV4A 1Q3NA 3W7PA 3INPA 4BFAA 2GVJA 3V1PA 4EF9A 5HNRA 2Q8LA 4N9CA 3NVTA 3PB2A 2WQPA 5D2VA 2GQ8A 3O6YX 2WNQA 4GXMA 1JCLA 4MFDA 1FCQA 1PHQA 3O8AA 1FCBA 3DZ1A 4MY1A 1F2JA 4OE7A 2XN1A 4OHQA 2DZVA 1XL9A 1XUZA 3G1VA 3MWAA 1J2WA 1NF0A 1RV8A 1SQ7A 1L2UA 3LTPA 3OVQA 5CSSA 1FCVA 4LVAA 3G0UA 2FFCA 1HUVA 1ME8A 5AHFA 1OF8A 2WV8A 4Q32A 1LBMA 1WDWA 3OIXA 3QPYA 1QPRA 2G97A 4ZZ9A 3QC3A 5IM51 3KRUA 4R53A 3LTSA 3TW7A 1VCGA 3L0NA 4GUFA 3FS2A 2PC4A 2XFWA 2B7NA 1VJIA 3PR2A 3LDVA 1Z44A 4JTJA 1TPEA 4BI6A 1K7XA 1I4NA 3S42A 5CPLA 1JCXA 1W56A 1W1ZA 3G1AA 1JUEA 5F2LA 3GKFA 3TMQA 4W9TA 1G69A 4P61A 3GXNA 3DFTA 5L9FA 3G1DA 3KVLA 4HNUA 3TJLA 1MEHA 3QF0A 4NJKA 5AHMA 5F4WA 4WUIA 1QWGA 2Y63A 2J6XA 2YW4A 3EXTA 3TIMA 1HTIA 2GVLA 4Q33A 1LP6A 3R2GA 2YXGA 3LM7A 1DORA 3QMRA 5FF4A 4NNAA 5FEXA 1LBFA 1PS9A 3LHUA 4UFIA 5BW6A 5DBUA 1J5TA 4G1KA 4AHOA 1YLVA 2ZZ1A 3M9YA 3LI1A 1OFEA 1KBIA 4N6FA 1JCYA 4DBDA 4UFHA 3PC0A 3PULA 3BLIA 4DO6A 5LGZA 1B4EA 1DL3A 2V5BA 3L5LA 4JDBA 4CNPA 1LCOA 1WBJA 4LS0A 3TC7A 3W7MA 3LV6A 4YXGA 3SGZA 1JUKA 3HB9A 1M7OA 3MBFA 4WOQA 1VHCA 1GQNA 5FF0A 3DFSA 2HMCA 4RXGA 3LCXA 3CIXA 3WJXA 4ZQRA 1XCFA 1QOPA 4N6EA 4XTIA 2ZTJA 1S5TA 1W3NA 2V8ZA 4AAJA 1U83A 5FF3A 3CPRA 1NAL1 3PSVA 4PEKA 2VC6A 2ZA3A 1G7UA 1L6YA 3NQ6A 1K8XA 2ISSA 2ATSA 4LRSA 3CM4A 1S3HA 2VFHA 1KFKA 5G2HA 1KFLA 4LUIA 3DGRA 3TH6A 1IIHA 4YL2A 4NQ1A 3AJXA 1TB3A 2CZEA 2QCEA 3HO8A 1Q6LA 2XN2A 3NPUA 3DBPA 3RLVA 3S1XA 4WY0A 1Z42A 1ZALA 4QNWA 3DXIA 1GOXA 4LVGA 1ALDA 3P62A 3MHUA 1LDCA 1I45A 2ZZ4A 3P7YA 3P8JA 4QQ3A 2C15A 2PRLA 3G1XA 1UUMA 4K8HA 3DFOA 2NLIA 4UFKA 1OFQA 4UFLA 1WQ5A 1ZAHA 1XKYA 1SUXA 1GYLA 2WKJA 1LOQA 2NZLA 4NX5A 2NWRA 3JS3A 4OQVA 3CIWA 2V5LA 4QJ1A 2JKAA 4I7WA 4LVBA 1LRNA 4JIQA 4JYEA 2ZFAA 4XZ9A 2EGZA 2A7PA 3LHVA 1OG0A 2H3BA 4BF9A 2AAMA 3IIZA 4K8EA 2ATMA 3UD6A 5K2ZA 1LRQA 3TKFA 5AHEA 4MPQA 2ABAA 4XWUA 2ZA2A 1BWLA 2Y7GA 2GJLA 2R8WA 3NQGA 3V75A 5AYYA 1A5BA 1G4TA 1ZCOA 3DENA 1G6CA 4C1KA 4FNSA 1H7NA 2FB3A 2Y85A 1TPVA 1Q6QA 3LLFA 5K9DA 4MJMA 5KZDA 4N9BA 4JD4A 3TK7A 3ABOA 2QAFA 5KZEA 3VCRA 1XDLA 5HULA 2A2IA 3BV4A 4DXVA 2B0MA 3PUOA 4DF2A 4UCGA 2BXVA 1X8FA 1GYNA 1YPFA 2V82A 3A24A 4PA8A 4RJEA 1EIXA 3PM6A 3HIJA 4JNMA 1AW1A 1SZEA 2ISVA 3IGUA 3WK2A 3QMTA 2Z6JA 4JTGA 1XUUA 3W88A 5LSMA 3GDLA 4WXYA 4HN4A 3FFSA 4S1FA 2I14A 5D05A 4ZQMA 1FDJA 2TMDA 4MYXA 6ALDA 1RQEA 1R47A 2A4AA 3W72A 4A3UA 3FOKA 1XDMA 2E6FA 4UFJA 2X16A 3PBWA 3M5YA 4CCDA 4NXSA 2FB2A 4LVDA 4AWUA 1KFBA 3ZR4A 3IRDA 1W5MA 1R2TA 4NNBA 1A50A 4ZVJA 4Y96A 3EWYA 3L5AA 4IMCA 1QCWA 3THQA 4L4MA 3A22A 2VFGA 3BG9A 4UR7A 3USBA 1QPOA 2BLEA 3QW4B 1UBSA 2FPYA 2V2DA 2ZRXA 1WA3A 4WQ6A 3RNDA 3BVJA 4LC6A 3EX2A 4KKXA 3ANYA 1MO0A 3NG3A 4LVFA 3B4UA 3N9RA 4ALDA 3EWWA 2VXNA 3G8RA 3K30A 4RZ6A 1OK4A 3TV8A 1BWKA 1T8XA 2G5WA 3E02A 3W7QA 3TA6A 2C13A 1SW7A 4OGZA 1FWNA 1M7PA 2J9YA 1YADA 4N4QA 3STFA 3E49A 1GZGA 1H7WA 3DI0A 1WXJA 2VELA 2YYUA 3M41A 4FNUA 3W7JA 3W7OA 3IIPA 3S5YA 2E5CA 2NX3A 5EMUA 4UNLA 4BK9A 1EUAA 2ZTKA 5CG7A 1NFBA 4K36A 2O7SA 3C2RA 1VHNA 2W79A 3UQNA 4ZQCA 2KZHA 1X1ZA 1OJXA 1O60A 3WFAA 1HG3A 3ATZA 2QCMA 2QUUA 1P0NA 4AWSA 3TQ0A 3NL2A 5G2IA 2QCCA 2YDAA 1W3IA 2ZQ0A 2ZRVA 4QM1A 3T4CA 2VEPA 3QJAA 3SZ8A 2C3ZA 1KM2A 3S8HA 1JR1A 1EUNA 1YDVA 3G0XA 4NZFA 5DELA 1VR6A 2WJZA 1XI3A 1KTCA 3E9AA 5LNUA 2YX0A 4K37A 1I2PA 3N14A 4Z0SA 5EY5A 1FWWA 1C29A 3NYZA 5FEWA 3L2IA 4MJZA 4E38A 3SFKA 1JCNA 3IV3A 4NUWA 1EWEA 5EPDA 3IIOA 4Y90A 3IGXA 3M44A 3O15A 4KWVA 4UTWA 4Z0JA 5GVJA 1EPXA 2GUUA 5E93A 2W0UA 3TUUA 1XBXA 3WK3A 3S1WA 3SIZA 3NNTA 1VZWA 5IBXA 2ZDRA 3W1XA 3FA5A 2Z1BA 2QDHA 3ATYA 3QZEA 1AG1O 3GYEA 3R5EA 1HFBA 3T78A 3NPVA 3EX4A 2A85A 3N34A 2DORA 5HR6A 1DOSA 1F74A 1OFBA 3B0VC 2WNZA 4TIMA 1I8JA 1FUYA 4O12A 1OX5A 2E09A 1K7FA 1VS1A 3W2JA 2ALDA 1PCWA 3MYOA 3TSDA 3W1RA 3B03A 4FNQA 3PWAA 2QJIA 1TIMA 5DY3A 3G1HA 3OEXA 5EL1A 3BGJA 4JTLA 3CWNA 4NT0A 2WSQA 5K3VA 3WK0A 3G8EA 1RQBA 3L67A 2PCQA 2IQTA 3ZS4A 4DEFA 1FDYA 4UTKA 3LX9A 4Q4KA 3TW6A 4ORMA 3LXAA 4K38A 1FQ0A 3EX3A 5C6MA 1PE1A 1WOBA 3PVFA 2RHGA 4NZJA 2CWNA 4ZQPA 4P2VA 4EIVA 4GRSA 1TPFA 5D03A 3CT7A 5FI8A 4ZMGA 4HPJA 4DPQA 4UTUA 2QCHA 3LV5A 4QISA 3IVUA 1B3OA 1PHWA 5LNWA 3EWXA 3FIGA 4FX7A 3TXZA 4O28A 5J5RA 4RCXA 5CZTA 1EX5A 1Q6RA 4JTKA 5K9CA 4ADTA 3UZ5A 3NQMA 3P5ZA 4UTTC 1NF7A 1YXYA 2A7RA 3LXCA 2A5HA 5L6UA 3W83A 2GQAA 5D2XA 2X2GA 1FXQA 3QH2A 2FTPA 3ELFA 3L65A 3STGA 1LLWA 3NZRA 5TQLA 1H1ZA 4JX6A 3GDMA 1KM4A 1TRDA 3SY5A 1XBVA 1H51A 4JIPA 2J9ZA 3OG3A 4MZYA 4O13A 4HIBA 3DI1A 4PFMA 1AK5A 3BO9A 3LGEA 2BWGA 3AO0A 3UYCA 1R2RA 2RFGA 4ONVA 2DZXA 1WYIA 4BWLC 3MP5A 4IMDA 1XFBA 3A9IA 4PL1A 3GNNA 2QCFA 5G1TA 4M6PA 3M5XA 2QCLA 1ZAJA 1TQXA 4NJGA 2G96A 4O4WA 5LNVA 1A5SA 1HO1A 3C8FA 3GK0A 5TBOA 1GT8A 3TDFA 2DP3A 4X3ZA 2C1HA 3PBYA 5DBTA 3P81A 3P82A 3LB0A 1A53A 1OFOA 3MHFA 3R89A 4CLMA 3CQ0A 2JK2A 5HMSA 3NQFA 1B4KA 1EB3A 5MHBA 5DCEA 1K3UA 3BW2A 1JULA 2I9EA 8TIMA 2CLOA 1TJRA 4H6KA 1LTDA 1T99A 5AN7A 4AHQA 3HPZA 4UR8A 4JX5A 2LLEA 2HSAA 3W7HA 1VC4A 5EKYA 2V0TA 3IIXA 3Q58A 4WXZA 1JRBA 4Y9AA 2QDGA 1WX0A 3VKJA 3S0CA 2PE4A 5C2XA 4U28A 4HPXA 4EVZA 3TAOA 2NXHA 4I7UA 3PSWA 2FIQA 1R2SA 3CEPA 3N3MA 3W1NA 3NQEA 2QR6A 3KXQA 2JBMA 1H62A 4RZ5A 3IEBA 1T96A 1F6PA 2NUXA 2QUTA 5T26A 4GJ1A 1SFLA 1KFCA 3WK1A 1ZAIA 3L9CA 1DVJA 4LOCA 4MLRA 3GDRA 1EP2A 1LM1A 1QNVA 3HMJG 1H60A 2FQIA 2B7QA 4JX4A 3THAA 2FLIA 4NU7A 3P67A 1TPDA 4NJJA 3WJZA 2ZZ5A 1GG0A 1OF6A 1GTHA 2JGYA 4MUZA 4RLIA 1F05A 2QEZA 4LRTA 2OT0A 3CWOX 4M5PA 4ZQOA 3QQ1A 2V30A 2TRSA 5AB3A 2R91A 4MLJA 4IPJA 3LHWA 3ABQA 3G24A 2X1UA 3NR0A 4YCPA 1F6KA 2H8XA 3STCA 1DJNA 5CZ0A 5G4WA 2DZTA 4FIQA 5AHNA 3KX6A 4MZ8A 1DJQA 4HKPA 5A8GA 3C3NA 3O06A 3R8RA 4PODA 1XC4A 4Z1DA 2ZRUA 1YTKA 1D3GA 3TQKA 3UZJA 5LHFA 1TPUA 2ISWA 3RLUA 2JKPA 4XBSA 5BMXA 2YW3A 1W0MA 4UC5A 3MBDA 1W54A 1OFRA 2VENA 3PY2A 1THFD 2C18A 4PCFA 4O17A 1X6UA 5AOUA 3PBUA 5F2IA 3N2XA 5D02A 1CW2A 3GLCA 1SSDA 4TR9A 3TX9A 1AMKA 4JY8A 4CNOA 1ADOA 3PF3A 4A2RA 3GXPA 1U5JA 3P61A 1JCJA 3TC6A 3BPWA 4JTEA 4RKAA 4K7YA 1BTMA 4PTNA 1KM1A 3NAVA 1VCFA 3EWUA 3W86A 1KM0A 1UJPA 4IX0A 2GPTA 4LNYA 3EKLA 1F5ZA 3H53A 2EF9A 4LY8A 4CQAA 4ZL1A 3QFEA 1SO5A 5D32A 2ZRYA 5C5YA 1W5OA 2NX1A 2CLFA 4XTDA 3LRMA 3UWUA 1VH7A 1XM3A 1BKSA 3PG8A 1JQXA 1HO4A 3HBLA 3L21A 3W2NA 4M7SA 1HL2A 3NEVA 4AVFA 4IMEA 3W85A 3HG4A 1X1OA 2X1RA 1KFJA 3UPWA 3W70A 4FX8A 1GG1A 2PURA 2QAPA 3W07A 5D2TA 1TTQA 3S5OA 4JDYA 1I2OA 3W1QA 3IVTA 1TPWA 5TIMA 3W7LA 5D2YA 2EKCA 1W8SA 3L0GA 1DV7A 5EA9A 4O52A 5HQEA 2YZRA 1N55A 2A6LA 3TROA 2E5BA 3H54A 4O53A 2EAWA 4IQLA 4RR4A 4O16A 4RK8A 1K02A 5KMYA 2VFDA 1OHLA 5DXXA 1OX4B 1EP3A 1KM3A 1KLZA 3DFNA 3I7RA 1VYSX 1RVGA 3OHIA 3LHYA 1F73A 3TMLA 3FYOA 1KTNA 5D2WA 3O63A 1CX9A 4JGDA 4DELA 4FIRA 3W73A 4UTHA 1GVRA 1TPC1 3ZWTA 2YFOA 2F84A 1VGAA 3HG5A 3P74A 3WJYA 2VFFA 1SPQA 2QCDB 3W9ZA 2B4GA 3RFAA 2Z6IA 3LHZA 4UIOA 1OYAA 2QF7A 2UV8G 4FF7A 2V2HA 1IXNA 3W1UA 2W6RA 3UNDA 2CLIA 5HWMA 4QIUA 1TSIA 3W6YA 2H90A 1QMLA 1KW1A 4MKNA 5AFDA 2WOQA 1A5AA 4UFMA 5J5DA 4E2DA 1O5KA 1TCDA 4JTIA 2X1SA 2Y62A 3A5FA 2E1DA 1PVNA 3UY8A 3QRHA 5EYWA 3NGJA 3P60A 1H63A 1LLZA 2ZBTA 4XKYB 1QO2A 1VQTA 2HTMA 4FNPA 1CI1A 5CGQA 5F1VA 1TQJA 3TR2A 3EEGA 4O0KA 3B04A 4IGHA 4OT7A 3TXVA 4OV9A 3CTLA 3PBVA 5U4NA 4RZ4A 4ICNA 3W7RA 2J88A 4HNTA 1L9WA 1ONRA 3DKJA 5AC8A 3HG3A 1GVSA 1V7YA 3GR8A 2YCEA 3W2KA 2CU0A 1QDSA 3W2MA 4HT3A 4BI7A 3C52A 3T55A 5H91A 5D33A 1JRCA 3E96A 2OT1A 1TTJA 1Y0EA 5FEZA 3GAYA 5LGXA 4WX2A 2QJGA 4EWND 3TNOA 4M6VA 4O1AA 3DAQA 2CZDA 3NQDA 3GR7A 4MYAA 3NXFA 1JUBA 3CLMA 1ICSA 1ICQA 2I1OA 2P1FA 3GNDA 4WOZA 4Z08A 4QAIA 4H4IA 1H50A 4KFOA 3STEA 5D30A 3LCLA 1G7VA 4UUIA 1ZNNA 2ZZ6A 1K7EA 2FPVA 2TSYA 4N9DA 4N4PA 3HGOA 4M7TA 4QNEA 4YCOA 4IUOA 3S6DA 2PRMA 4A2SA 5D38A 4ADSA 3VI2A 3QM3A 1RQHA 1NSJA 4LU0A 2ZA1A 3O16A 4IX2A 1F76A 2C16A 2YFNA 1SO6A 1W37A 2Z2UA 4MOZA 5HUPA 3W75A 1P1XA 5DLCA 1G4PA 5CPOA 1L6SA 1W5PA 3MI3A 5KTLA 3KOFA 3LHTA 3W7DA 4NX0A 1TPH1 5HJLA 4GWEA 5DCDA 4R33A 3FYPA 2RKXA 3A21A 3Q2DA 4MVAA 2FDSA 1DBTA 2ZRZA 3HG2A 3LOTA 4GUIA 3U6WA 3N2MA 2RDWA 1DHPA 3HQ1A 2RDUA 2EHHA 3F4NA 5K9XA 4O15A 3UXAA 4O18A 5G1YA 3P5YA 2C19A 2QJHA 4DO5A 4UTIA 4FHAA 5G4EA 1UB3A 4A22A 1SZFA 4NVTA 3I65A 1VLIA 4PL2A 1DKWA 1AL8A 1W5NA 2E6YA 1H7PA 4BR1A 2FJKA 2C14A 2O7QA 4FEZA 3FJ6A 2A6NA 2QUVA 1GWJA 2P10A 2R94A 3NQVA 4PC8A 2OCZA 3OVPA 4Z1CA 1WV2A 3O1NA 1SU5A 3MP4A 4IJBA 4H3DA 4X22A 2CLKA 1RPXA 5I3HA 4LWWA 3SSJA 3SI9A 2RH9A 3OVRA 1ZHAA 3HGJA 2ABBA 1H7RA 2Y7EA 1G4EA 2Y70A 1TV5A 2VFEA 3G22A 4YLWA 4CCEA 3GB6A 3UWZA 2CFFA 2QCNA 4KFNA 4MY8A 5AC7A 4FXSA 1JJKA 4A29A 5KZMA 1KFEA 4O11A 2DU2A 4GE8A 3C56A 4N02A 3PAJA 5CZSA 1YDOA 5C54A 3OA3A 3KRSA 1XXXA 1MZHA 4AF0B 3H55A 2NWSA 5I3GA 5CZJA 1E51A 4I9AA 3EXRA 3FKRA 2VOMA 2C0AA 3GZ3A 3M47A 1FWSA 1B57A 4FX6M 3TU9A 3L68A 3C2OA 3NM1A 1TO3A 2ZZ3A 4HSOA 5F2GA 1G67A 1JQVA 3EWZA 3SW6A 3UWQA 3UXDA 1FCUA 2VEIA 1PIIA 2X30A 4UTTA 3VNDA 2CW6A 3CC1A 4N9EA 4ORIA 4JTUA 2OZ0A 2Y88A 2JKEA 4O50A 3LCIA 3MI2A 2YGYA 2G95A 5I3IA 3A5VA 2DZPA 3W22A 1OK6A 3NPXA 3P8IA 3O6DA 2BSLA 3N73A 2GJNA 1KA9F 2QCGA 4RXFA 3LTYA 3PUEA 3T44A 1X7FA 5I3KA 1UCWA 4NJIA 4LV4A 5F2MA 4TO8A 4BWLA 1ML1A 3U8GA 3EXSA 1MEIA 3G0SA 4DBEA 2NUWA 2Q3OA 2B7OA 2NV2A 4DPPA 3QQ0A 4DQWA 3B0PA 3EX6A 3LBMA 4JN6A 4POCA 1O95A 2WSRA 2YR1A 3QPZA 5U7SA 3QEZA 1O4UA 1AW2A 3LCWA 3S1VA 5C55A 1NEYA 3KVKA
chains in the Genus database with same CATH superfamily
4TMBA 3WBWA 4GKTA 2WO5A 1RR2A 1XQKA 3AZTA 3PNZA 1YQ2A 4IP7A 4A3HA 3C2VA 2PC8A 4JTQA 1AL7A 4AXKA 1K8YA 4A3QA 4Y8FA 3IS4A 3GTNA 1LORA 4F66A 4LUJA 5KINA 1WDRA 2DEPA 4HU3A 1V3IA 3URNA 2XISA 5ENLA 1GEHA 2PA6A 3WQGA 1XYZA 1RK6A 3BG3A 1Q45A 3DH7A 3FJLA 5A69A 2CXEA 1V0KA 4AW7A 2GVGA 5ABHA 3WDJA 4DF1A 1QT1A 3S5NA 1KBKA 1VLWA 1DE5A 2O9OA 1H1NA 3M0KA 3T81A 3LLXA 2XH7A 1PWLA 4FB7A 1NVMA 2FMNA 1JEZA 2CYGA 1UKOA 1KCXA 4JCLA 2VFIA 1ZJIA 1D3HA 1I6NA 3E0IA 3SJ3A 3M46A 5AYZA 2ZZ7A 5G5IA 2PF8A 1JVNA 5JBFA 4M8UA 5FIPA 1I9CB 3W3OA 8XIMA 5F1UA 4JQ2A 1B3VA 1JYWA 2OJPA 1S2TA 2HVNA 2H6RA 2YOCA 3O6CA 4WJEA 5AYXA 1NARA 3RF9A 3L4XA 1TUFA 4JR5A 3W2LA 4U2YA 4M6QA 2VUYA 5D8WA 4HPGA 3TTQA 1KV8A 2EO7A 4ICMA 3KVJA 4PTVA 2QLYA 1R9ZA 4DNHA 4JS3A 4MY9A 2FPTA 2GOKA 1BVNP 3BICA 4RPQA 2V2CA 5LHEA 1WPCA 5I6SA 2E77A 1RP9A 1R30A 4QS5A 1NWSA 5BRBA 4PUUA 1VBUA 3HV8A 4N7QA 1E4MM 2HDJA 1JDCA 5SWUA 1LOLA 4D8AA 4O1CA 2CC0A 5XIAA 4LBRA 4JICA 2H9AB 5FF2A 3CAWA 4TTGA 3GDKA 1Z41A 4G8TA 2VD8A 1EO7A 1S5VA 2ZZ2A 3M7SA 1TV8A 4QSHA 4L4PA 3CAVA 4OBSA 3JW7A 2G50A 1SSGA 3WZ0E 3CGTA 3IVSA 1H1YA 3M16A 2OGJA 4AIOA 3EB3A 1GOWA 4JIRA 2NT1A 1QOXA 3HGRA 2AAAA 3WLLA 2QMJA 5FA5A 1SFJA 4UTJA 3TR9A 5AC6A 1M04A 3U5YA 4ZB2A 3MP3A 1XW8A 1M68A 5F4SA 2IKHA 4IP4A 4D8LA 5G2WA 1UH3A 4IOTA 3UPMA 4R34A 1G94A 3F2CA 2PPGA 4TX9A 1Q6OA 2J79A 4WD0A 1V3MA 2X0HA 3DU0A 2INZA 1F7BA 2XGBA 5T91A 2XGZA 1VBHA 1C9DA 4QITA 1J0YA 4C6IA 1C90A 1LJYA 3THUA 2ZVIA 1VFOA 4I9JA 2QT3A 2ZX5A 4D6FA 3N15A 4EOUA 2B7PA 3I6RA 2F61A 4DZHA 1KM5A 2DJXA 5BYWA 2J27A 4C6KA 1ZJBA 4UBPC 1ODUA 1DTUA 5H8UA 3CXOA 5DXYA 1SMAA 1EQPA 1J12A 2A0NA 3KCOA 4MWAE 4O1BA 1M6JA 4QE1A 3PUDA 3M5ZA 3C2EA 1SJCA 4J3ZA 3C0QA 3DYPA 1IGSA 1B9BA 3QSRA 5G1MA 1CGVA 3TTYA 2E4TA 1Q85A 3O07A 1G4SA 3W29A 5FJRA 1O1ZA 4YPJA 3S6OA 3VFLA 3CJPA 5I24A 4JN7A 3IJQA 5HR7A 3AXKA 3RMEA 5I23A 3WNOA 1KKRA 1Q6CA 3U9IA 4H7ZA 4M82A 3L4YA 2TPSA 4IMFA 2WK2A 2CNCA 4HSHA 2V9DA 4IPIA 1WNOA 1O7AA 4F2UA 3F1QA 1VYRA 3TN6A 1JG9A 3VGGA 5DRCA 3AUJA 3ITXA 1H7XA 1TPB1 4XSMA 3BW3A 2FFIA 4W86A 1KXTA 5CPTA 4GYJA 4X0VA 3TJ4A 2WMFA 1PV8A 4QLKA 4BJHA 1XRFA 1W3LA 3G6MA 3CWHA 4L4OA 4IISA 1DPMA 4F0MA 3QR3A 2YJQA 3WD4A 1Q8AA 3V7PA 2XSBA 5I09A 1DIEA 3MMTA 1BKHA 2JGQA 3SGUA 1Z48A 2E6DA 1RZMA 4LYQA 5AVHA 2WNNA 3VDAA 5HDRA 3LXBA 1SZRA 3SSZA 3N6QA 4Z1AA 4AQLA 2YDQA 1WOAA 1K03A 2F6UA 1TJ2A 4WGHA 4CQDA 2OWWA 3GX9A 1L6WA 1SZNA 1E56A 3W7NA 4AF0A 1H61A 3GXFA 4HYWA 5IBXC 1SO4A 5EU9A 1ZUAX 3A4WA 4IM4A 5LNSA 4M1RA 3SCPA 3VDGA 4JTHA 3HMCA 2J9XA 4IPPA 3CQJA 4CUCA 3B8SA 1DWIM 1OZQA 2QDDA 1JIBA 3GUWA 2OOFA 4XD6A 3S1UA 3AHYA 4MG4A 3SURA 4ENLA 4D2JA 2IQ0A 4NYYA 2GQ9A 3QSTA 1XR2A 5ABTA 3I7SA 2E8YA 1JCMP 2PTZA 3UY7A 4DZAA 3B06A 3DFQA 4UTLA 3TQVA 1IIGA 1J0ZA 4W7UA 5FESA 5CEWA 3B8DA 3PK7A 1PL9A 2BV9A 3QW3A 1K8ZA 3I7QA 4H7VA 4Q6XA 3TVAA 3W81A 2GYIA 3TN3A 1TYGA 9CGTA 1PZ0A 3RU8X 5I5RA 4YTRA 2YA0A 1IR2A 1C8XA 3SADA 4IJCA 3CYVA 1QAPA 4V1YA 3IV8A 1R3TA 2IPFA 1MEWA 3NOEA 5F4XA 1C93A 2XIIA 4IXHA 4XAGA 4CCCA 1IXPA 2OMAA 4JIEA 1WUEA 1GJWA 3VCNA 3VOFA 4JXCA 4GPNA 4I7VA 4V27A 1QOQA 4NIRA 2AL2B 4IIHA 3KAOA 3B05A 4KESA 4UCFA 4Z2HA 4I8YA 1AJ0A 2IQDA 3SY8A 4PUEA 4RW3A 4JTRA 4TX8A 4EF9A 2WQPA 3RITA 1UWUA 4ZB5A 4GXMA 1UPMB 1VFUA 2CKSA 3O8AA 3DZ1A 2YB4A 3U4FA 3B0YA 3UCDA 3HTWA 1XICA 2DZVA 4KCUA 3MWAA 5M03A 3G1RA 1J2WA 3S83A 1P0EA 1FCVA 2PDFA 2ZWZA 2WHMA 3G0UA 1QI4A 4E8CA 1HUVA 4NRRA 1KGUA 1ME8A 4XZLX 2V69A 4RPPA 4NF7A 1X97A 3WD0A 1QPRA 2Y4SA 3WFZA 4ZTXA 3W26A 3VNMA 4YTTA 3NZGA 3TW7A 4M6UA 1JAEA 2KX9A 4GUFA 1K1DA 4F4RA 3PR2A 1ADDA 1K8CA 1VFMA 3MANA 5F2LA 3GKFA 4IGSA 1G69A 3GXNA 1XYLA 3G1DA 3LENA 4HNOA 2VRQA 4QG8A 2ACSA 3ZJKA 2XGIA 1NQKA 2J6XA 2YW4A 1BYCA 3EXTA 1VJZA 3TIMA 3GO2A 4PMRA 5HXMA 1GQLA 2V3EA 4Q33A 1LP6A 3B3DA 3LM7A 3WL0A 4U5IA 3IUIA 3AXMA 4UFIA 3WN6A 4G1KA 1OFEA 1EXPA 3PC0A 4DLMA 2V5BA 3L5LA 5HQLA 2Y8KA 4UQDA 1LCOA 2OLAA 3BMWA 1WBJA 4LS0A 4Q8QA 3CZLA 4AZ7A 1UP3A 3HB9A 5FJIA 4M51A 2ZC1A 3GIQA 4PCTA 3LCXA 3WJXA 4N6EA 3TZNA 5CLTA 3EWCA 3PANA 5FF3A 1NAL1 1HVQA 1L6YA 5FJUA 3NQ6A 3H70A 3UBPC 4CKQA 3CM4A 3WUBA 4DWSD 1TVPA 4WKFA 1KFKA 4ZO8A 2PLJA 3S2MA 2QCEA 4NAFB 3V5FA 3DBPA 3IUHA 2BHYA 2ALRA 4IGMA 5LA1A 4S3JA 2WW5A 3W6LA 3P62A 3P8JA 2C15A 1HXJA 3G1XA 4DAFA 3WD2A 4JTCA 1OFQA 5D9MA 1XP3A 2BS9A 1OC6A 3B0XA 4AFYA 3E2RA 4Y9NA 3GHRA 4E3VA 1KC7A 1KNWA 3I4KA 1BG9A 2DQWA 4I7WA 5D9PA 1RJPA 2YCJA 4HMNA 2A7PA 3OU8A 1OG0A 2H3BA 4BF9A 1A0EA 3EOLA 2VC7A 2DSWA 1XF0A 1XISA 3ISIX 3G2GA 3NSXA 2FH6A 4PTMA 1U1HA 2GJLA 4QP0A 2R8WA 3NQGA 3JVAA 5AYYA 1K9DA 7A3HA 2WSPA 1G6CA 1WB0A 2XIMA 1H7NA 2Y85A 1TPVA 2G4FA 3EOEA 4MJMA 1G1YA 1FTXA 3SCUA 4HJFA 3RRAA 3VU2A 3ZZ1A 1ISZA 1R7AA 5LXEA 3SDOA 1XDLA 3JZEA 3OOQA 2A2IA 3VC6A 1WKEA 2GWGA 1TKKA 1X8FA 5C9XA 4RJEA 3HIJA 3UG4A 3IGUA 1FRBA 3OQEA 3WH6A 1XUUA 1WE5A 3W88A 4WXYA 3DCPA 2IPWA 2MNRA 4JFSA 4S1FA 5REQB 1E6XM 1E0UA 1FDJA 3EEZA 2TMDA 4C90A 1US0A 2A4AA 3W72A 3UR7A 2E6FA 4UFJA 1HW6A 3PBWA 3M5YA 1U1UA 5E09A 4J5NA 4FMVA 2VGBA 1V6VA 1A50A 1PZ3A 2UWFA 4ZVJA 1GORA 4N0RA 4D9PA 1BXBA 4PBEA 7ENLA 3PHAA 5KEZA 4C6PA 2ESCA 3USBA 1XH2A 3G5EA 3QW4B 3CZJA 2FPYA 4X2PA 1WA3A 3BVJA 3ARSA 1JPKA 3EX2A 4LC6A 3N29A 3B4UA 4Y9MA 3KWXA 2VXNA 2ZXAA 3ITGA 1BWKA 3ITVA 2RJGA 2JIEA 2WYSA 1M7PA 2Y24A 3MDUA 4LYRA 4JFUA 1V6UA 4NSBA 3DI0A 2DT3A 2YYUA 1I0BA 1BSLA 3XIMA 3MVIA 1GQIA 5EMUA 2EXOA 3WQVA 1YIXA 4DBWA 2O7SA 2XWDA 4HZ6A 5LA0A 1X1ZA 1RCQA 1UR4A 2PZNA 2QUUA 1YNPA 2NV9A 4AWSA 4YTSA 1W3IA 4QM1A 5CBJA 3QJAA 3SZ8A 4GVIA 1S1RA 1JR1A 3QV6A 4E4PA 1RUSA 2QULA 3KUMA 2ACUA 5LIUX 4MGGA 2GJPA 4GZJA 3E9AA 1BQCA 1AH0A 4KCVA 4IP5A 2HK1A 3EDJA 1I2PA 1R3RA 4Z0SA 1CLXA 4F40A 3IPWA 3HN3A 3ITLA 3UG3A 3ZT6A 3BC9A 4R9OA 4ATDA 3IV3A 2OZ8A 1OBAA 1UZDA 5BXTA 3IGXA 4KWVA 4UTWA 5I77A 3N4FA 3UJSA 2W3ZA 1EPXA 2GUUA 3FJNA 3ZVHB 2W0UA 3TUUA 1QW8A 3VDHA 5DANA 4S3FA 3ZLGA 1VZWA 2HVMA 4ZSUA 4PMVA 2Z1BA 4RE3A 3SUTA 1TA3B 1AG1O 3C0LA 3GYEA 4DYJA 3E0LA 2DORA 3SO7A 1DOSA 4EWJA 2Z25A 1F74A 3H2AA 1EEXA 3B0VC 4UWMA 2WNZA 4J7RA 2XSXA 1UQYA 3N11A 3MVTA 1EYEA 1K4HA 4I8DA 2W61A 3OIHA 3B03A 2Z00A 1TIMA 3ALGA 3G1HA 2PCEA 2VZSA 3SN4A 1BPLB 4Q7NA 2P88A 5EL1A 2QGYA 4MAZA 2WSQA 4FLRA 3WK0A 3G8EA 5M17A 3RRXA 1XIBA 1R85A 4I5XA 2C91A 4M1BA 1FDYA 4UTKA 3LX9A 3LXAA 2TAAA 1FQ0A 4JQAA 3VD5A 1F9CA 3PVFA 2YA2A 2CWNA 1EYWA 4GRSA 3VOCA 2V5DA 3MT1A 1U2YA 4HPJA 3LV5A 3N13A 5HNNA 3UR8A 1B3OA 5A6MA 3N2OA 2GWNA 5IXEA 4NYUA 4ADTA 4XD4A 3AHXA 4UTTC 1NF7A 4GCAA 1RCOB 5BOFA 2A5HA 1RK5A 3PJXA 4WSHA 3VTRA 5L6UA 3N4AA 1XFCA 4CN6A 4RNIA 1BSIA 4ERIA 3STGA 1FHVA 3T0AA 3NZRA 3QV8A 4KEUA 1EOMA 3GDMA 3QXBA 4O1FA 3UA3A 2IKJA 1FHLA 4PFMA 1XKJA 3AU2A 4LB3A 4PUWA 4EXBA 1QI3A 2ZWYA 5HATA 3AO0A 1R2RA 2RFGA 2DZXA 2AMXA 4BWLC 2OO0A 3IACA 3GNNA 5G1TA 1CBGA 1A5LC 3M5XA 4KGLA 3NDYA 2GDUA 2OSWA 3N4EA 4O4WA 4GMEA 2HWGA 4XO7A 4LXFA 3VUPA 1ZCCA 1HO1A 1GT8A 2DP3A 4GYFA 1Q7MA 3PBYA 4BZYA 4QRNA 3AJ7A 4Z2JA 1HT6A 2VX5A 4UQBA 3R89A 4BEQA 3CQ0A 3EMCA 2JK2A 5HMSA 1UWQA 5DCEA 1LL6A 4H41A 1TR1A 1LTDA 2QUNA 3MUIA 3OGSA 3HPZA 3GE7A 3V1HA 3W7HA 3WENA 1FWEC 2PWDA 3L2MA 1GQKA 3O9NA 2Z4GA 4MMWA 4M24A 4IL2A 4Y9AA 3OO2A 5C2XA 4MNMA 3C86A 4NZ1A 2J75A 2XUCA 3BAYA 1S3TC 3UZYA 3PSWA 4NAFA 4KMQA 4HPNA 3NQEA 4H6EA 3RGTA 4KW2A 1PX8A 1C7TA 2JBMA 4GJJA 5T8GA 4HHLA 2HXTA 1F6PA 3KZPA 4UOZA 4GGBA 4RE0A 5T26A 4GJ1A 1B5TA 4Q8PA 4L1WA 2NQLA 1DVJA 1CLVA 1FWIC 1LM1A 1QNVA 3LA4A 2B7QA 1GOQA 2IKIA 3WQDA 3P67A 1DXFA 1GONA 1GOKA 1R3YA 2EQDA 1GG0A 2ZZ5A 2QEZA 4LRTA 5HPOA 3CWOX 1MI3A 5AB3A 3FA4A 4C6LA 4QX4A 4MLJA 1A0CA 3LHWA 3G24A 2WVTA 4YCPA 3RCMA 3EB4A 5J8LA 1ISWA 2RGMA 2H8XA 3TTEA 5G4WA 1JXKA 2DZTA 3GG8A 3LK6A 4FIQA 2JF6A 4DJFA 1DJQA 5CPSA 5A8GA 1W91A 1QI0A 1AJ2A 4LUSB 4ZE5A 3R8RA 2DIJA 2ZUWA 5C2GA 1V4YA 3PPGA 5EFFA 2XH4A 2CBJA 2ISWA 4KRTA 2VX6A 1UR3M 1OQFA 4XIAA 5AC5A 2YW3A 1W0MA 1ZTVA 5E70A 1UD5A 3VNLA 3QY6A 3BANA 3PBUA 2PGWA 2Y5SA 4D6DA 3S3GA 3TX9A 1Q6EA 4JY8A 3TNBA 4CNOA 4R88A 2WHLA 3ORWA 2YL8A 3HFTA 4RKAA 3AMDA 3PFMA 1CXIA 1VCFA 3EWUA 3UF9A 4HK6A 4H01A 3OG2A 5HOSA 2EF9A 1DJHA 1J18A 4ZL1A 2P8BA 3LZ3A 3QFEA 5D32A 1XD0A 3K1DA 1W5OA 1UD2A 5A6JA 4XTDA 4PMNA 1EH9A 3LRMA 3UWUA 1XM3A 1F6YA 4Q4OA 4PUDA 4QDWA 1JNEA 2BB0A 5GNYA 4AVFA 3HG4A 1RBLA 2X1RA 1OGSA 1KWGA 3OA5A 3AMLA 3SUSA 3W07A 3DDMA 1IZKA 3EDKA 1A3XA 3S5OA 1N82A 3W1QA 4H1ZA 3W7LA 5BROA 4XZWA 1DV7A 5CC6A 4DAIA 5C7VA 4NL1A 2D69A 1FWFC 4H00A 4AZ5A 3UW6A 4O53A 1KFWA 3GFZA 4RR4A 1AFSA 3SCOA 5KMYA 3LUTA 3OLEA 1KM3A 4KETA 3DFNA 1KQYA 1VYSX 4YNGA 1RVGA 3OHIA 5AZ0A 1I1XA 2PGEA 4BF7A 3TMLA 3FYOA 3NDZA 3O63A 3W73A 4NZ4A 1EIBA 3NIYA 1OY0A 1H0IA 4GIRA 4A8RA 2INEA 2F84A 2QCDB 4HB7A 3TYAA 1MW1A 2B4GA 3WDHA 2F8QA 2Z6IA 3UVIA 1OYAA 5BWFA 2QF7A 2UV8G 5HMFA 4Y8EA 3QKZA 3CQHA 4FXFA 2H90A 2PDKA 3S9ZA 1KW1A 5HANA 3SRDA 1A3HA 4MKNA 5J5DA 1A5AA 1V6WA 1O5KA 1PKMA 1XLFA 2E1DA 4HA4A 1KXQA 3QRHA 4L7ZA 3S2NA 1H63A 3ARXA 1IEVA 2ZBTA 4BY3A 1VQTA 3TR2A 3HQNA 3EEGA 3OLIA 4IGHA 4OT7A 3SAZA 4OV9A 4AU0A 5U4NA 4RZ4A 4ICNA 5BRPA 2J88A 5CG0A 1L9WA 2D1ZA 3L23A 2E28A 5AC8A 4GQQA 4RV3A 1XYAA 3H2NA 3W2MA 4IL0A 3C52A 8CGTA 3UVAA 1JRCA 3EPMA 1L8NA 4XD3A 1BG4A 3K13A 3UZWA 4LUYA 3TYZA 3VABA 4XZIA 3TNOA 3QGVA 3F5JA 3ZVHA 2ICSA 4O1AA 2CZDA 3GR7A 4MYAA 3AROA 2D3LA 1TA3A 3PAOA 2P1FA 4PR4A 4QAIA 4R7OA 1A4LA 3OZMA 1EBGA 3STEA 5D30A 3LCLA 3SFWA 1J10A 4I3GA 2OLHA 4N9DA 3HGOA 3WNLA 4PUJA 2BOFX 4IUOA 1JPHA 3H2CA 1BGAA 4PE8A 4ADSA 3VI2A 1RP8A 4HGXA 3ZXWA 3S4TA 4GVFA 4IX2A 2C16A 2YFNA 4AZCB 2FGBA 1W37A 2DY3A 5HUPA 5CJNA 4QJ3B 2X0YA 1XLHA 1MYRA 5KTLA 1E6SM 2DH2A 1E43A 1AH4A 3V16A 1S2CA 2JQXA 1C9WA 4W84A 1FWDC 2VWTA 4Y7EA 1FVPA 3C3UA 3VIKA 2EHHA 1W3JA 5TAOA 3R0KA 4O15A 1W1PA 4O18A 3WNMA 3WBEA 4DO5A 5A8NA 4US5D 2EG6A 3I65A 2WHKA 4J3TA 4PL2A 1VLIA 4AXNA 1PIGA 2E6YA 2FJKA 1H41A 3FJ6A 1GWJA 3ZR5A 3NQVA 4Q8MA 2OCZA 2R82A 4DXXA 3IAQA 3O1NA 2WCAA 4G2DA 3K4WA 2PU0A 2CLKA 4LWWA 1A3WA 3SGGA 3SI9A 4LNCA 3KTXA 4LAZA 3UP8A 1QK0A 2Y7EA 1DJYA 3VGDA 3GHUA 1GVEA 3DUGA 4YLWA 3GB6A 3UWZA 2XINA 3DOPA 3EDDA 3VX0A 2QCNA 1DIOA 4FXSA 4A29A 4FLSA 1XIIA 3BCJA 2X09A 4G9PA 4EK7A 3A4XA 3C56A 1E1EA 1MZHA 2G3NA 2VJXA 3I3BA 4YJ5A 3T09A 3FKRA 1HJQA 3VMNA 1OSEA 3RJXA 3W25A 1B57A 1V0NA 3C2OA 3NM1A 3MCNA 2EPOA 4TTUA 3UXDA 2Z24A 3MUZ1 3M0YA 1PIIA 3B9AA 4W88A 1J5SA 2R6OA 1AQMA 1NDWA 5ABGA 1LLOA 4N9EA 5MKGB 2OZ0A 2Y88A 3BSHA 5T9CE 3MY9A 3WQWA 5CCZA 2PWUA 3LCIA 4LX4A 3MI2A 3BDKA 2CESA 5I3IA 2VVNA 2GGIA 2FZBA 3R58A 3PTDA 2GJNA 3VFCA 1QWKA 3K46A 4AY7A 3PUEA 1LWHA 2VX7A 2CWXA 5HPCA 4GX8A 1SJBA 3TEVA 4NJIA 3AXXA 4LV4A 3WEZA 1J0HA 2R1NA 3EXSA 3UETA 4DJEA 3G0SA 2VD9A 1UR0A 3B0PA 2WSRA 1US2A 2HEJA 1P6CA 1AW2A 3LCWA 5C55A 2PWGA 2WMJA 1UD6A 2WCGA 1XIMA 4TMCA 3EB2A 1P0KA 1YXDA 3MKVA 4YMZA 4LW7A 4FSAA 5E1QA 2Z28A 1PX4A 3FHQA 4UXDA 1QNSA 3OVGA 4JZ5A 3HPXA 3SQMA 3ZIZA 1EGZA 3GIPA 1YPIA 1UH4A 3BE7A 3F5LA 3CU2A 4GGHA 4X61A 5JH1A 5K4ZA 1WBHA 1M5WA 2IKGA 3WNPA 5LNRA 4ACYA 1M01A 4M0XA 1DWHM 4K3ZA 3OBKA 3D3FA 3FYYA 2EPHA 1GOMA 2ZX8A 4L5ZA 5LIXX 4QTGA 4J4KA 2WC4A 3JRKA 4LUSA 1BWVA 1YTEA 3W28A 3NA8A 3DGBA 1JZ2A 3SB0A 1H5YA 1WAWA 1Q4WA 2ISFA 3VGFA 1TWDA 2BODX 3DX5A 3FX4A 4AY1A 3CASA 3KS6A 3PWGA 4Q8OA 1XIFA 2HROA 5I3JA 4PB4A 3E1F1 4URIA 3M1ZA 4O1DA 2BX7A 3UWYA 3AYVA 2V81A 4FO4A 5D4YA 3CH9A 1KRBC 1PDZA 3VOHA 1V5XA 4RL3A 4MNJA 1KXHA 2XTKA 4ERAA 3CIVA 2NVCA 3UXLA 2C1IA 2ANUA 3BLPX 3EKZA 1HNYA 2CBIA 4IXXA 1FBAA 2CCRA 4INFA 5I02A 1ECEA 2UY4A 5KETA 1W17A 4F0RA 4CNUA 3WLMA 4YWSA 2AL1A 3DIPA 3APYA 3T2QA 3NL3A 1TTIA 4FNRA 4MWAD 4PCSA 3R0UA 3F7JA 4PUMA 2XN0A 2BMBA 1WZKA 5BCAA 4LY4A 3NCOA 5AHLA 4AD1A 3CB8A 3V3WA 3GXMA 5CSRA 3U2OA 1TE1A 2QJNA 1FHDA 2HZGA 3RCYA 9XIMA 1VFLA 1YXCA 3EPNA 3NM3A 1JFHA 2Y61A 1WAUA 1DTNA 1AQFA 3M43A 2ZUVA 3GH7A 3IWPA 3GRIA 4P8XA 1DE6A 3F03K 5KSWA 3G18A 2OLSA 4DO7A 2ACQA 3GUGA 3M07A 5JIWA 4WKHA 1VP5A 3NSNA 1MZRA 3VA8A 3FHAA 3ENLA 2QIIA 3R25A 4RNJA 1AZ2A 2D24A 2HV5A 4JQ1A 2BBFA 1MQRA 2BZNA 4Y9OA 1ZY9A 3T6CA 4N2YA 4EPDC 3P84A 1K70A 7PTDA 2FZNA 2DZWA 3FA3A 3DC8A 4HMCA 5DN1A 3EOSA 2OYMA 4JTFA 2QCDA 3S2JA 3BLFA 1O6IA 3FW6A 1OC5A 1KV5A 1LROA 2PI6A 1HJVA 2DFAA 1VRXA 4P7NA 3G1YA 2QXWA 3UGRA 3VOIA 4H19A 1BYBA 1CGXA 4WY0B 3LCFA 5DFAA 4DF0A 1MVYA 3A23A 1IYXA 4O54A 4PMQA 1CGYA 4MFEA 2Q01A 3IRSA 2BXZA 1IXOA 4JAWA 3HPAA 4ZQNA 5C9RA 3FY1A 5HNTA 3WD1A 3FNDA 3LRKA 4RE2A 1E72M 3ZWSA 3M6YA 4NY2A 4Q8NA 6A3HA 2ZE3A 3WJWA 4GNVA 3NURA 4KBXA 3BWWA 3CO4A 1A5CA 3F4WA 1V6XA 4NZ5A 2GGEA 2VUNA 4TX6A 1TWIA 4GUHA 3Q37A 4S3EA 3VIFA 3QYQA 3C0JA 4CQ8A 1E4LA 1E6QM 3KCJA 1V6TA 4B5VA 3BG5A 4EANA 1OABA 2GQ3A 1M1BA 1POKA 4IHCA 4IIFA 1NWUA 1XLAA 1UMYA 1XSJA 3WL1A 3FDKA 3BZJA 1WZMA 1RD6A 3VMOA 4PMXA 3W7IA 3REQB 1NDZA 4XUGA 2Y7DA 1OVDA 1T6MA 3AYTA 2EBNA 4TU1A 4K1GA 3W7GA 1QI2A 3BAWA 4AZBA 1PSCA 1X39A 4AZCA 8A3HA 3TE9A 1E0WA 1EF2A 1V3LA 4MB4A 5TF0A 3ZOAA 3RM9A 4AEEA 3AU6A 1ZLPA 1NQ6A 3ZVIA 3VE7A 4C6MA 3CAQA 4QJ4B 5DRIA 1UYQA 4JCMA 4WDTA 1X98A 4C6NA 1TV7A 1BVWA 5IHRA 2QKFA 3AS1A 1VEOA 4LEFA 3T40A 1FWTA 3RU6A 3HJZA 1SW3A 4CU7A 1LRTA 3LGDA 2VZTA 1D9EA 5HNUA 4ES4A 2QV4A 3GU2A 3AIEA 1BFNA 3B8TA 3O3RA 4HHMA 1ZENA 3WLHA 2CKRA 3EMQA 6TIMA 2J8GA 4IJRA 3DFPA 3HPFA 1JGMA 3GXDA 3CEUA 1XSKA 1EQCA 3GU9A 3MB9A 2HS6A 1OYBA 3UJFA 3B4YA 4AHPA 4HVXA 3TJXA 3PZTA 2WVSA 3FEQA 5BU6A 4DO4A 4GUJA 3WF1A 3FK4A 4DBSA 4CNNA 4OU1A 4S2BA 3TZFA 3MMWA 2DVTA 1IV8A 3NL5A 3WJSA 4Y9PA 3P0WA 4UTWC 3P3BA 3UPBA 1CPUA 1J9YA 4ML9A 3VVGA 1AVAA 3BZGA 3QBUA 2QVHA 4M81A 4E8DA 1NDYA 5EMLA 4WVXA 2NV1A 4K1WA 1GVYA 2J62A 2C6QA 4QJ5B 3G3DA 3I3EA 3K4AA 5CPMA 5E0CA 3IJ6A 1UZ4A 3NQCA 1GVOA 2ZX7A 7TIMA 3SCVA 3VIMA 4IQDA 4QROA 4A05A 1TWSA 3BAXA 5MKGA 2V68A 4XAPA 3M4HA 1AD1A 3BOXA 4AEFA 3MU7A 4PMYA 1JXJA 3E12A 3FLUA 2EJ1A 5AKQA 3PBMA 1M41A 4IMAA 2OOGA 4V33A 1P5BA 2AQWA 1B3XA 3OLGA 2F9RA 1TJPA 2ZXBA 3KRZA 4GUGA 3VGBA 2BASA 1EP1A 4XUYA 4ZA0A 1WXYA 3PPCA 3WEMA 3MW7A 2G3IA 1R8LA 2O56A 3B8WA 2V5CA 3HPSA 1JYNA 1TELA 2OTDA 2DT2A 2QHAA 4HD5A 2PDGA 1NFGA 1C8VA 2WMHA 4S3CA 1Z32X 3ITCA 2DJLA 2ZE0A 3CZGA 1AMYA 2WSYA 4XIMA 4J9JA 5PTDA 3QY8A 3HV9A 3C4UA 1TZ7A 4EPKA 5EBAA 3ZT5A 2QF8A 2OYLA 2PWEA 3VINA 2VEMA 5EMMA 3APTA 5HWNA 3FKKA 3CV2A 5I2UA 2QS8A 3FSUA 3W74A 1GW9A 4GYKA 4PMDA 5D37A 1I0DA 1ME9A 4LC8A 5BWAA 1O12A 4W8LA 2CLEA 5EBUA 4K7VA 3W1TA 4C6OA 3GYCA 3MSDA 3CHFA 5CPNA 4F0SA 3VE9A 1H5VA 3W23A 3PZ9A 4XK2A 3QTGA 3LERA 1NJJA 4D1IA 4DUXA 1MW3A 1QUMA 4IH3A 3W7PA 4BFAA 3CMFA 3BQ6A 5HNRA 3WQ5A 2Q8LA 4N9CA 3KEHA 2WKGA 5D2VA 3UCCA 1I1WA 3V35A 2GQ8A 3O6YX 2V3FA 2WNQA 3OLDA 4MFDA 4AY8A 1F2JA 1HGWA 4H9VA 3V18A 4ML4A 4OHQA 1XQLA 3BJSA 1ZJHA 1LUCA 4IG2B 3B40A 2BG5A 4P8VA 3WY1A 1SQ7A 3LTPA 2DDXA 2PGRA 2FFCA 3T2PA 3AFBA 2AOSA 1LBMA 1WDWA 4PB3A 3QC3A 3H2EA 5IM51 3KRUA 1RVKA 3LTSA 1VCGA 2Z1XA 3A3HA 1ONEA 3IK4A 1ZBWA 2PC4A 3FS2A 2EG7A 1VJIA 3SUVA 3LDVA 4BI6A 2J74A 3GZAA 1K7XA 3CTTA 3S42A 5CPLA 1W1ZA 4W9TA 2OG9A 3KVLA 2ZVRA 3TYEA 4NJKA 3VNKA 4DUWA 4WUIA 1QWGA 3W27A 3R43A 2YZ5A 3E0WA 5B7YA 3R2GA 1DORA 3QMRA 5FF4A 4NNAA 1LBFA 3GY1A 1B3ZA 3LHUA 3KOZA 4GBDA 5BW6A 5DBUA 3TQPA 2XVLA 1PX3A 2ZZ1A 3MZ2A 2ODOA 5JXQA 4DM1A 2XZ7A 2Y5EA 4DBDA 4UFHA 4ASTA 1J6OA 4DO6A 4GQ0A 1XLEA 3SRFA 1MNSA 3W7MA 1WP6A 1EA9C 3QLLA 4ZXOA 2J7GA 2ZTJA 4AAJA 3CPRA 2BGQA 1ZQ5A 3PSVA 1G7UA 4DJFC 2ISSA 1P1MA 4LRSA 4HYVA 4LUIA 4YL2A 1FH7A 1TB3A 3TLQA 1TVNA 2CZEA 2WPGA 2XN2A 3NPUA 4EAYA 3RLVA 3V5CA 1LL7A 4ZO7A 4HNCA 4WY0A 1ZALA 1H3GA 1IT0A 3BSGA 1GOXA 3MHUA 1XCWA 3ZLFA 2PRLA 1TMQA 3KP1A 1P7TB 1UUMA 4K8HA 3DFOA 2E7FA 4AD5A 4P7RA 1BXNA 2YBTA 2QUMA 1PXGA 3CT2A 1WQ5A 1NWTA 1Q6GA 4B16A 1E9YB 1GYLA 3QR0A 3N2TA 4LJ3A 4ROQA 3GNOA 1XH0A 4NX5A 2NWRA 4QJ1A 3CIWA 2V5LA 2JKAA 4LVBA 1LRNA 2ZDSA 2ZFAA 1UKTA 2EGZA 3L4ZA 4C7GA 3CQIA 4XB3A 4FPSA 1LRQA 2PDWA 5IDIA 4AZHA 1YDYA 4XWUA 2Y7GA 3TW9A 2NSOA 2XH0A 4C6CA 3SQSA 1XLGA 3V75A 2J7CA 3NJ3A 1VEPA 4OBRA 2OZ3A 1ZCOA 3DENA 3GW0A 3REQA 1EXBA 3AWOA 1QU4A 5KZDA 3E0VA 1RXOB 3ABOA 3KZSA 1RY8A 4TQTA 3RR4A 5C9ZA 1KCLA 5KZEA 1ZL1A 3R10A 3VCRA 2VRJA 2WXDM 4MB1A 1E9IA 3CQKA 5BRQA 2IPGA 2Z1WA 2CLPA 4M56A 3KBVA 3PUOA 1G01A 3CPUA 1GYNA 1YPFA 2A3BA 4WCJA 2EKGA 1HJUA 4CQBA 1EIXA 1HGYA 3PM6A 1S2WA 3PTKA 1AW1A 4C7DA 4B9ZA 2OQHA 2Z6JA 3I6EA 4JTGA 3AMGA 1KO0A 1UA3A 3H12A 5C0QA 4XAFA 3GDLA 1R38A 3W01A 4LANA 1A5MC 4ZQMA 1L6GA 1WKDA 1XYMA 4A3UA 2PDYA 1EHNA 2R1MA 2X16A 1PZ2A 3E2QA 4NXSA 3STPA 4QDPA 2PWHA 4H9TA 3IRDA 1R2TA 3UXKA 1JDDA 1KQZA 4DLFA 3BQ5A 1IWBA 4Y96A 3KBWA 3EWYA 3L5AA 2HCVA 1QCWA 1JGIA 5IFPA 6REQB 3NO3A 4HOWA 2WLYA 4JNZA 2BNJA 1UMLA 2GLKA 3VD7A 2V2DA 3UR2A 4D6JA 4WQ6A 1CTNA 3OZPA 4YN5A 3ANYA 3N9RA 2PTYA 4ALDA 3EWWA 3EOUA 3PJUA 4KIRA 1T8XA 5EMJA 3KOXA 4K2SA 3TA6A 4E6MA 1SW7A 4OGZA 5F7UA 1VBJA 4N4QA 4GZ7A 3STFA 4LAOA 1CXLA 2YDSA 2PP1A 1GZGA 3ARPA 1UWSA 1WXJA 1NP0A 5AZ1A 4LALA 2E5CA 2QMKA 3QC0A 4V15A 4BQ3A 3AS2A 1NFBA 4ACZB 4LCQA 1QW7A 1ELSA 2A3LA 2DPEA 1O60A 3WFAA 1M7JA 4R3UA 3ATZA 1F3TA 2QCMA 4Q8VA 2D0FA 3TQ0A 5G2IA 2PBGA 1QXLA 5DO8A 3JU2A 2YDAA 2BY1A 1DHKA 3TOYA 5AC4A 3NXLA 1KM2A 1LG2A 1PTAA 4L9ZA 1EF3A 3SBFA 2DUAA 5DF0A 1YDVA 1TWWA 2Y8UA 5DELA 2WJZA 2VGFA 4TXEA 1KTCA 1BTCA 1XLBA 3LGGA 2DSZA 3AS0A 4K37A 1HJSA 3N14A 2GFTA 3E5PA 1C29A 4BF5A 2WM1A 1MDLA 4QSFA 4MJZA 4E38A 2VT0A 4G56A 4NUWA 2OWCA 4WHBA 5EPDA 4Y90A 2EJAA 4Z0JA 1XBXA 3LMZA 3WK3A 1QJWA 3S1WA 4XD5A 3SIZA 3NNTA 3PZVA 2ZDRA 3FA5A 2DUXA 4IICA 3ATYA 1EJSC 2I57A 3U2ZA 3T78A 2A85A 3N34A 1UOZA 1Q5MA 4ZB0A 3CO8A 2ZIDA 4TIMA 3E6EA 4C5ZA 4XAZA 1VS1A 5A2AA 3NZPA 3MYOA 4MHBA 4HPHA 4Z42C 4FNQA 1OZMA 4C6JA 1RLDA 4MB3A 1FH8A 1RALA 1J93A 1W6TA 3L67A 3TC3A 4MAVA 2I5GA 4DEFA 2HXUA 2P50A 4Q4KA 4ORMA 1WO2A 4NZ3A 4K38A 4OTKA 2VGIA 1PE1A 1Z3NA 3CB3A 3RN6A 4PEEA 4B4HA 2O0TA 1CYGA 3U4AA 5FI8A 2GZXA 4FZIA 1ZBVA 2QCHA 4IQEA 3RPDA 3IVUA 1MUWA 1PHWA 4I5RA 1EX5A 1E71M 4JTKA 1TZZA 4OJYA 3WUEA 3UZ5A 3NQMA 2OEMA 4LQ1A 2A7RA 3LXCA 1MDRA 3IGHX 2Z26A 3W83A 4GIEA 1PJ9A 4S23A 1FXQA 2ACRA 4G7FA 2J7DA 3WBXA 2FTPA 3ELFA 3BH4A 1LLWA 1N8WA 4ZOBA 5TQLA 3IJ8A 1H1ZA 3ERPA 2NVDA 4NI8A 4ZCWA 1UKPA 3SY5A 3HFYA 2REQB 5ECVA 3WF4A 1K9EA 1WCGA 3N6HA 2GJRA 3UYCA 4AZIA 3RX2A 3GSMA 3MP5A 4IMDA 5A8MA 4DJEC 3A9IA 2ZC8A 4L61A 1EGMA 5HA7A 1S39A 4I5UA 4GD0A 1KRAC 2RUSA 3EYPA 3OBEA 1F3WA 4W5UA 3H7VA 3P93A 5LNVA 5DMMA 2A3AA 4X9YA 4JEJA 3GK0A 1EZ2A 1PB0A 5TBOA 4H9MA 2XIBA 4LFYA 3AYRA 4EX4A 2C1HA 3P82A 4PMJA 2WWCA 4MPKA 1VBRA 4JFVA 3WLRA 4FF5A 2QW5A 2D2OA 4FOJA 1QRQA 3EWDA 3MSGA 1DJXA 3OQ8A 4J35A 2E1WA 1BXCA 1K3UA 1AQ0A 3F4CA 5BXPA 8TIMA 2CLOA 1TJRA 4D6GA 2OQLA 1T99A 5AN7A 2YCKX 4Q8WA 2LLEA 2HSAA 1RHCA 1VC4A 3ABZA 5EKYA 2R24A 1X96A 3IIXA 3AZSA 3WDRA 3IJ7A 4WXZA 4F48A 1JRBA 5DEZA 2D3NA 3VKJA 1WX0A 3S0CA 4IIBA 2Z7GA 3J7HA 1EJUC 2NXHA 1LG1A 4I7UA 1EJWC 4L9YA 1D2KA 4WLCA 4FAMA 3PZNA 1SGJA 3SUUA 3AUOA 3A13A 3LN3A 5BXRA 2QUTA 2NUXA 3CK5A 1X7IA 1P7TA 1SFLA 3WK1A 4TUFA 1V3HA 3W4RA 4LOCA 4MLRA 1MMFA 1EP2A 3HMJG 2CHNA 4GH1A 1H60A 2FQIA 4WSKA 4LPCA 4NJJA 1ZP3A 1IHIA 1MXDA 2JGYA 4MUZA 4RLIA 5D9OA 4HK7A 4RE4A 2OT0A 1QASA 2WC7A 4ZQOA 2V30A 4QS6A 2R91A 4PBGA 4XO6A 3WF0A 1E3ZA 3LPGA 4HTYA 1GZJA 1R9YA 4AUBA 1Z7AA 3GBEA 2WMKA 4Z1DA 2ZRUA 1WUFA 1YTKA 1D3GA 3ZJ7A 3WFLA 1TPUA 3OTRA 4AWEA 2A79A 4XBSA 5BMXA 5CC5A 1J11A 3MBDA 1W54A 4AD4A 3WF2A 2AGTA 3E5BA 4JL1A 1UWIA 5D02A 3N2XA 2SFPA 1ZP4A 1AMKA 4GACA 1J0IA 1IEXA 3AMCA 5A8OA 2XVPA 3NEHA 4H9UA 1E0VA 1XGZA 3TC6A 4RNFA 3EA2A 2FHBA 4PTNA 1UJPA 3SY1A 4KCWA 3EKLA 4DX3A 1VIZA 4CQAA 4NAEB 4F79A 3T8QA 2ZRYA 1V02E 3L4TA 2CLFA 2VEFA 1RCXB 8RUCA 2OX4A 4B5XA 1BKSA 2WC3A 3AXHA 3FAXA 1JQXA 3L21A 4GX9A 3URAA 1XINA 3W53A 4IMEA 3W85A 1X1OA 1HKMA 3W70A 1R3SA 4ERGA 4FX8A 6REQA 3T1GA 1YBQB 1A47A 5D2TA 4ATLA 5I78A 1W8GA 3IVTA 4DXKA 5D2YA 2EKCA 1SVDA 3L0GA 5EA9A 2B81A 4O52A 5HQEA 2FZMA 3A64A 4R5EA 2YZRA 1N55A 2GSHA 4GY1A 3BCDA 2XJ7A 4GNKB 3NOYA 2PAJA 2G3FA 4NP7A 4RK8A 4B4FA 3EZ4A 1R9XA 2VFDA 1UR2A 1EP3A 2CETA 1KLZA 2FZ8A 2D0HA 1EJXC 3LHYA 1GPFA 4ZSTA 1TJ1A 3NVDA 1LT8A 1KTNA 1CX9A 4UTHA 3ARUA 2PLKA 3UU0A 3DFYA 1W1YA 2YFOA 4P8UA 4ACZA 1PO9A 3P74A 1EPVA 1U5HA 1Q2RA 3ARRA 3LHZA 3CUFA 5T9BG 1HP5A 1IXNA 1FKXA 4NASA 3Q4DA 2QVNA 1TR9A 4QIUA 1JZ5A 1VKFA 2IXVA 3VK5A 2WOQA 4UFMA 4E2DA 3GWQA 3WNKA 1UKSA 2Y62A 3A5FA 4DJDA 1PVNA 5H6HA 3BV7A 5EYWA 3P60A 1LLZA 4XKYB 4IZGA 4FNPA 1CI1A 5F1VA 1TQJA 1IGWA 4O0KA 3B04A 1X38A 3TXVA 4HNTA 2W91A 1ONRA 3DKJA 1V7YA 5A6TC 4HT3A 3T55A 4QE5A 2A3EA 5D33A 3ZYZA 2OT1A 1TTJA 4CQCA 3N04A 1GYMA 3GAYA 4S3DA 3V36A 4M29A 3WUGA 3B9DA 3DAQA 3NQDA 4HA3A 3VUSA 4MDOA 2VMFA 1JUBA 5HMEA 3LPOA 2G3JA 4WOZA 4Z08A 2PDMA 4JBRA 4LAMA 1NY1A 2BOGX 1XJBA 1DIKA 2WANA 2NW0A 2ZZ6A 1L0PA 4OFCA 3T07A 1K7EA 2W92A 4N4PA 3ECQA 4M7TA 4D1JA 4YCOA 4IQJA 1DWAM 2PRMA 3BJTA 4QCEA 3QM3A 1F76A 2XIQA 1K6WA 4MOZA 1VIWA 2L5HA 3W75A 3WQ6A 4DHGA 1G4PA 4YS1A 1FP9A 1VENA 4GOAA 1L6SA 1W5PA 3MI3A 1KRMA 3LHTA 1V79A 2E3ZA 3W7DA 3C2YA 7ODCA 2E9MA 2PWVA 4GWEA 4L65A 3HQOA 2ZRZA 3HG2A 3U6WA 1JZ8A 3N2MA 2PF0A 4OUIA 3HQ1A 3F4NA 1UD3A 4ZBCA 3T9PA 2Q8XA 3UXAA 4OVXA 3NYDA 3P5YA 1AA1B 4B5TA 4UTIA 4QG9A 4FHAA 2ZUUA 2Q6ZA 4QAWA 5DMYA 2MANA 2VZUA 3PJTA 4XZHA 1AL8A 2D2HA 4REQB 4CEUC 3VDBA 1H7PA 4BR1A 1KKOA 2O7QA 3UEQA 1UW9A 4FEZA 5BOEA 2A6NA 2P53A 2P10A 2R94A 4K68A 1OD0A 4DNMA 4Z1CA 1SU5A 1ZBCA 6ENLA 3UCQA 3WQ4A 2F2HA 5CJ5A 3DYMA 5I3HA 1OADA 3SSJA 5A8PA 2RH9A 1ZHAA 3A9BA 2ABBA 3R1ZA 1WDQA 2PDCA 1DJGA 1H7RA 3WDPP 1ITQA 2VEGA 2XVGA 1TV5A 3MCOA 3G22A 2REQA 2CFFA 2I56A 3BMXA 5FKYA 1VFTA 2J4GA 2W9MA 3S2CA 2VR4A 3GVQA 3O0KA 4GE8A 4V1XA 4N02A 2XG9A 3OA3A 3ES8A 5CZJA 4H83A 3OYZA 2VOMA 2V38A 3NO1A 2YL6A 1NP2A 2C0AA 3RPMA 3TU9A 2Z2AA 4ZFMA 5F2GA 1G67A 2WHJA 3UWQA 2XDFA 2VEIA 4GIYA 3VNDA 2CW6A 4Q7IA 1V3JA 2NQ5A 3CC1A 4ORIA 4JTUA 1Y8BA 2ZADA 2JKEA 2QNEA 1E5JA 2JIWA 1BLIA 1MUCA 2VL4A 2G95A 3A5VA 3BTNA 5D8ZA 4E2VA 3P8IA 3V0SA 2PSNA 2NT0A 1J6PA 2QCGA 4RXFA 3LTYA 3QKEA 3T44A 4PUNA 4Q22A 2YLAA 3ZQ9A 3W24A 3P6LA 2VO5A 4FLOA 4FR1A 1MEIA 4PUKA 4DBEA 2VWSA 1KBLA 2NUWA 5HJYA 3RO8A 1KWKA 4JL2A 1ONWA 1GCYA 3LBMA 4JN6A 4POCA 4CD6A 2J8TA 2NQZA 3T8LA 3ZJ8A 1LT7A 3QPZA 5U7SA 5HQMA 1O4UA 3AOFA 3H23A 1RH9A 3S1VA 3N1AA 3KVKA 2D73A 4RX0A 1W9BM 1O66A 3R13A 1TV3A 1FWGC 1FY6A 4IFKB 4PN2A 4PH6A 2CZFA 1DQXA 3MV11 1XG4A 2NQHA 5JBDA 3NQAA 3D0CA 2ZUSA 3AS3A 4O8RA 4F0HA 1MWOA 1ZRQA 5DT7A 1DP0A 4ECLA 2WZTA 1UASA 4ZTYA 3EX1A 1SW0A 4MWAB 3BAIA 2OX1A 4MKVA 4MZ1A 2PEVA 3OBAA 4CU6A 3RYSA 3H7RA 2O92A 2PTWA 1TMHA 2F38A 3QVQA 2BY3A 1GOOA 3G1FA 1QK2A 1PUDA 3AQUA 3UG5A 1DJWA 1QNPA 1FWJC 2FGZA 1ZGDA 1W31A 1QPQA 2EPNA 4KWWA 3KRBA 3W7KA 4PSPA 4DRSA 3ARQA 1V8EA 3L66A 4GI6A 2W62A 2BGSA 4Y2WA 5TNVA 4P7LA 4IF2A 2W63A 2YYTA 2P0OA 4WKAA 3EA3A 3H4XA 1SR9A 4RNHA 1TX2A 1EA0A 3KBNA 1YYAA 2P5NA 3P2VA 3I68A 1H7OA 4YWIA 2O9PA 1TREA 4JYDA 2CZ5A 2OVLA 5E9XA 1RJQA 3VIGA 1FXPA 4AYSA 2H9AA 4FOKA 3PZMA 2HBVA 2GK1B 5I3FA 2AGKA 3LCGA 4NAEA 4ZXLA 3FXGA 3S9YA 3LLDA 3VGHA 4GJIA 3AHTA 1B3WA 1IWAA 3WCZA 2FYMA 3N25A 3TSMA 2FHCA 3LCHA 4LS2A 3W71A 5RUBA 4J1OA 3W7EA 2I16A 5CAHA 4WDXA 1FWRA 1XBYA 5H2ZA 1EZWA 1WDSA 1MFVA 5AECA 4JTTA 3ALFA 1YBQA 3LY0A 4W93A 3D3AA 1W3TA 3LI0A 4MM1A 2PD5A 4H8NA 4OBTA 3AALA 4Q8UA 5IDZA 2J77A 2J47A 4E8GA 3MA8A 1AJZA 3DHFA 3SR7A 3W87A 3SCTA 4Y6GA 4AZ6A 1PAMA 2WMGA 3GG7A 1AZ1A 3PB0A 4GYPA 3O2LA 1Q8JA 3CUHA 1ECQA 5A5WA 1YTDA 4M3PA 1HL9A 2BY0A 1YE4A 3AIBA 2PP3A 4O19A 3H2MA 2PDQA 3U2EA 3VKCA 2I5QA 1N8FA 3OHMB 3RO6A 3MS8A 1WKYA 1YDNA 1QW9A 2X1TA 4K6AA 1LZOA 2XFRA 3VYLA 4KFPA 1Y5XA 2HS8A 1JZ3A 4BI5A 2XH2A 5BMWA 1V51A 3GTFA 3ZJ6A 4E2BA 2VDIA 3MMDA 1SZGA 3W38A 2FJUB 2C0HA 1TRIA 4GNJA 4PCNA 2E67A 3N18A 1PEZA 4LCSA 3UNTA 2DUZA 4XKYA 1LWJA 4CQ9A 1OB0A 1KBJA 4HCLA 3QTPA 3K8MA 3K1GA 3MHGA 1OFAA 4NILA 1TTPA 1E1FA 4BKNA 1UIPA 3BAKA 3GXTA 4XBJA 1PYFA 1JD7A 2Z1VA 4W8BA 1GVFA 3WLPA 4L6HA 2XM1A 1E15A 3FAWA 1NTHA 4E0CA 3WLJA 1BEUA 3BJFA 1LYXA 1F8MA 3WH5A 1V93A 3ANUA 4US5A 2VOTA 1P6WA 1S2UA 2VI0A 3HGSA 2VEKA 1VYPX 4HU8A 5CSYA 2V63A 5HK4A 1JYXA 4Q4PA 1OYCA 3GVVA 4HZ8A 3UJ2A 2DQXA 3UFYA 1S46A 4A35A 3YPIA 5GJMA 1DQWA 4HOZA 3GVGA 4S2CA 5A8QA 4IGNA 1PIFA 1BQGA 1LBLA 5CSUA 3MYPA 3QZAA 4B3KA 1T8QA 3XINA 5JIPA 1GVQA 5BNKA 3ZT7A 1ONXA 1WXZA 2NX9A 3FGCB 4O4VA 5E9AA 3V5OA 4LS1A 5CXPA 1ITXA 2D2JA 3O05A 3CV7A 3BOLA 2OEJA 4O14A 2PMQA 3CUJA 4GO9A 4LYPA 3VX1A 2E68A 4UTMA 3R12A 5LIWX 2F6XA 3BSMA 3WLSA 5TD4A 4UB9A 1YEYA 5KITA 4EAMA 2G0WA 1S5WA 2XHYA 4H6QA 4B91A 2PD9A 4REQA 3QV9A 1AUSL 5AY7A 3KLLA 1Q2SA 1H49A 5C7HA 3GBDA 5DCBA 2JE8A 5LYRA 1O5XA 1V08A 3Q65A 1WDPA 4JIIX 1MUMA 4UMAA 3WQOA 1GTEA 4K39A 1VJSA 3Q67A 2Y6ZA 1CECA 3D47A 4WY0F 4X9SA 4DBUA 5HWJA 1KTBA 3OPSA 1FX6A 5CZKA 2VM8A 3DKLA 4WSJA 5GPRA 2Y5JA 1VPQA 2FMOA 3BGGA 1TV4A 4I9MA 3UWWA 1VCVA 3GDTA 4ILSA 2AKMA 1J79A 2DIKA 4P7OA 1YW1A 4CU8A 4I6KA 2C7FA 3IIVA 5C8BB 5LZLA 1K77A 1M53A 3VNYA 1FWCC 1TJ0A 1EKOA 3W84A 3GIYA 1OFDA 4WEVX 1ICPA 4AX7A 4AIUA 3WH7A 4ZO6A 4DI8A 1DWJM 3ZFHA 3G3MA 2PDUA 2XFFA 3BCFA 1W1VA 4HSNA 3MUXA 4IFOA 4MB5A 1W9XA 3NZ1A 3UJEA 3Q94A 5AVNA 2R1LA 1OFPA 3B0UX 3ARWA 3KL0A 5MF5A 4X2RA 4JY9A 4O0ZA 2XVNA 5FJTA 1A5KC 2W5FA 1PTGA 3MSRA 4WIWA 4FLQA 4B9YA 4GBUA 3VKKA 1PKYA 2Y89A 3N6JA 4IWWA 4PB5A 4H8VA 3VNIA 4XSLA 2AL2A 4LYKA 1GPWA 5C71A 3AICA 3S5ZA 2DV0A 3OZOA 4AEOA 3FXYA 2BTMA 1ME7A 3MO7A 2VR2A 1I2NA 3M5VA 4JN8A 4FI4A 1XYBA 1W9DM 3DFHA 3GH5A 3LRLA 1OX6A 1VPXA 1XIEA 3B97A 1E1CB 4IMGA 3TCEA 3CZ8A 1O5QA 4CN4A 4J3XA 4IFKA 3WLNA 4PMZA 1UUOA 1QI5A 1XIDA 2O9TA 3WX7A 2DZSA 5LIYX 3C61A 4B92A 2NSXA 1Y7VA 4JKKA 1GJPA 1MSSA 1KGWA 4LGXA 1R3QA 3GKAA 3COTA 4RDWA 4WK9A 4YYFA 4RV8A 4CVWA 1Q3NA 3INPA 2GVJA 4MSSA 2DIEA 1JFXA 1JF6A 2WZHA 1BAGA 1JCLA 5FJOA 1FCQA 1PHQA 1KCZA 4KS0A 2VURA 2Y8VA 1FCBA 4MY1A 2ON3A 4CD4A 1F4AA 1XL9A 1XUZA 3G1VA 3UXIA 5M1TA 3LEPA 4ZO9A 3CPGA 1NF0A 3CZEA 1L2UA 3OVQA 4LVAA 4CN1A 5I0DA 4HTBA 3KBMA 3OIXA 4XZBA 4PBFA 5I03A 4GQRA 1LWIA 3H7UA 2XFWA 4OOUA 2GVEA 4G1NA 1Z44A 1TPEA 2GK1A 2XSAA 1I4NA 1JCXA 2BVWA 3G1AA 1OGBA 6XIMA 4P61A 2VDGA 2WZEA 1JPDX 1MEHA 2X1IA 4MKSA 3VIJA 5AHMA 2J78A 4L64A 3RAOA 3NZQA 4EXQA 4WJ8A 3ME3A 3SCNA 4G7EB 1QBAA 3QOMA 2XPKA 2FHFA 1CXFA 2CBVA 2VR5A 5FCZA 1J5TA 1UKQA 4AHOA 1YLVA 3OGVA 4PCPA 3LI1A 5JH2A 1AH3A 1KBIA 4N6FA 1JCYA 1TE6A 3HURA 2OO6A 3PULA 3K8KA 5LGZA 1DL3A 2XIJA 5CBBA 1OWQA 1XRTA 5DMNA 1OCQA 3TC7A 3LV6A 4AC1X 4YXGA 3SGZA 3U48A 1M7OA 1GQNA 2HK0A 5FF0A 3DFSA 1X1NA 1UG6A 3BLDA 4RXGA 3CIXA 4LAKA 1QOPA 4XTIA 1S5TA 4ROPA 1TUXA 1QNQA 1U83A 1NFPA 5HJXA 1K8XA 1HJXA 3FVMA 1IZJA 4RDVA 3DG3A 1W32A 3DGRA 1IIHA 1MW2A 3WDIA 3HO8A 3T0TA 3MPGA 4GISA 1E3XA 1Z42A 3TWBA 4DUOA 4HU0A 3DXIA 4LVGA 1ALDA 1I45A 2ZZ4A 4MJ4A 3H6OA 2VQUA 1I60A 2O4QA 2NLIA 1HQTA 1IZCA 1HL8A 4UFLA 1WKFA 1XLLA 2W67A 1SUXA 2WAGA 2WKJA 2NZLA 2YCLB 3JS3A 3DECA 1TVLA 2XU2A 3A12A 4XZ9A 4BEUA 3ONCA 3FN9A 3LHVA 3AIWA 2AAMA 4ZOEA 4ZOCA 1Q65A 1G5AA 3IIZA 4K8EA 3DHUA 2ATMA 3UD6A 5REQA 3TKFA 1JYVA 4MPQA 1BWLA 3E2SA 3UERA 2CXGA 4C6FA 1A5BA 3PZQA 3MC5A 5CQ1A 1G4TA 4WGXA 2AMGA 4C1KA 5KZ6A 4AZGA 5ABFB 5FSDC 2PDHA 3LLFA 3VAVA 2Q02A 1JPMA