3ELFA

Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
345
structure length
332
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalysis of a tetrameric class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
total genus 132
structure length 332
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3elfA00
3BO9A 3S42A 2XFWA 2CZFA 4LC6A 3PF3A 5K9XA 4K7YA 3TC7A 3GB6A 1LYXA 2PCQA 4GE8A 3IIZA 4UMCA 4YXGA 3AJXA 4ZZ9A 3O15A 2P0OA 5F4XA 1RQHA 1QMLA 3OEXA 2YGYA 4QNWA 3FFSA 3TW6A 4AH7A 4RXFA 4RZ5A 2PE4A 3W75A 4Q4KA 2R91A 3PWAA 4FIQA 3LHYA 2QUTA 2KZHA 2QCEA 4I7WA 2NLIA 3NL6A 1PHWA 2YPIA 1K8XA 3C56A 1OHLA 1W3NA 4MYAA 4PA8A 1P4CA 3DFQA 4JXCA 3TQVA 2A21A 1F2JA 4Z0JA 3RK8A 4N02A 4O15A 4M7TA 4FXSA 2GQ9A 3M43A 3M7WA 3N34A 2VENA 5CGQA 1GEQA 1G69A 4BI7A 1OX4B 3BARA 3LTYA 2QCCA 3TFXA 5K9CA 2X1SA 3HJZA 1OK6A 3W1MA 3W2UA 4A3UA 4CNPA 2Y85A 1VZWA 4JX4A 3W84A 3C2EA 4UTIA 1HL2A 1TSIA 5G4WA 4K39A 3W22A 5K7JA 5E1QA 3S5YA 3FJ6A 3EWBX 2V2CA 1VLIA 2ZZ4A 5DCBA 4N9BA 2NX9A 4LVDA 4HNNA 5AC8A 4TO8A 4JTFA 3W3OA 3KRZA 4LV9A 4FNUA 1IF2A 4KFOA 5D37A 5J5DA 1K7FA 4JYFA 3W1XA 1OFRA 4WY0B 3LI1A 5CG7A 1KFCA 4AF0B 2NV2A 1ZJIA 1KLZA 3HMJG 1W37A 4AAJA 3W6YA 4XKYB 4BK9A 1YADA 5AHLA 2ZRYA 1ONRA 1T99A 1KM0A 3WJZA 5DY3A 2XN2A 3N9RA 4RZ6A 1ME9A 4QNEA 4NNBA 4X3ZA 3EEGA 2C14A 4Y9AA 5AHEA 5AHIA 3UWVA 2Q8LA 3PUOA 2GJNA 4O14A 4Z1AA 2ZA2A 2C15A 2CW6A 2Q3RA 4MVAA 5KZDA 4A2SA 5D30A 1WYIA 1ZHAA 4XTDA 3PBYA 4DF1A 4PCFA 1F05A 5CSRA 1G6CA 3DHDA 3YPIA 3DFOA 3FA5A 3F03K 2E6FA 3LX9A 4RXGA 1N7KA 4DO4A 3JS3A 1BWKA 1DORA 2AAMA 4JX5A 1H63A 2ZDRA 2XN0A 2TMDA 2QEZA 4JTIA 2DZTA 3NGJA 6ALDA 2B7PA 2CFFA 2VEIA 3KRUA 3CM4A 2CLIA 2ZTJA 3QH2A 1SW3A 3LI0A 3NPUA 1Q3NA 5FEZA 2VKZG 2UV8G 1OVDA 1TV5A 3LXAA 1W56A 3FS2A 4K38A 1DJNA 1FCUA 4M6QA 3M44A 5K9DA 4EF9A 4MY8A 3L65A 5SWUA 1KFBA 3LCFA 5DXYA 3TDFA 4BI5A 1JCJA 4UFIA 1FXPA 3PG9A 4E2DA 2WJZA 1XBXA 3I7QA 3LXCA 1MZHA 3TMLA 1OFQA 2ISWA 3PBUA 1W31A 3ZS4A 1NF0A 2ZZ5A 1V5XA 2NZLA 2Z2UA 3KRSA 4UFMA 4R34A 1FDZA 3G8RA 1G4SA 3O06A 1SFLA 1ZAIA 1E51A 1D3GA 3L0GA 5HUOA 1KFEA 1LLWA 1KTBA 2FJKA 1GTHA 4NJGA 5TBOA 4N6EA 2Z1BA 4HKPA 2QJHA 5CKSA 2J9YA 3S5NA 2F7FA 5LGZA 3LHTA 1W0MA 2FLIA 5AC6A 2HMCA 1AG1O 3OG3A 1OG0A 4YMZA 3D0CA 2I14A 4DO5A 5EMUA 2FQIA 4GUHA 3NEVA 5AB3A 4UTHA 5T26A 2Y6ZA 2A4AA 4ZL1A 1TIMA 3N2XA 3N2MA 3FYOA 1LDCA 2PRLA 1YTEA 1TYGA 3LRMA 5KMYA 5ABTA 3KVMA 1O5XA 3GK0A 1D3HA 1JCXA 1GWJA 2QAFA 1KM4A 4FNTA 3QSTA 2YYUA 5EA9A 1OFPA 1JCYA 1XBZA 2BZNA 4DXVA 1MEWA 4XZ9A 3ELFA 1SPQA 4P2VA 3MMTA 1SW7A 4XUGA 3PAJA 2NXHA 3MHUA 3OVQA 1PCKA 3LERA 1TCDA 2ABAA 2CLOA 3MHGA 1DBTA 2C13A 2WKJA 1TPVA 2OJPA 3NG3A 4M6VA 3P8JA 1PHQA 3BK0A 1EA0A 2ATSA 1KA9F 3EX4A 5TQLA 4IMGA 3TNOA 1L6YA 3BW4A 2O7QA 1RPXA 4FIRA 4N4QA 3A5VA 3JRKA 4PTNA 4UTTA 5AYXA 3KX6A 1BWLA 1H5YA 2E5DA 3PUEA 5G2HA 3E96A 2VEKA 1TJRA 1EP3A 1EUAA 4O1BA 1YXDA 3NAVA 1HG3A 1VJIA 1FUYA 1KBIA 1O4UA 2C3ZA 4GUJA 5AOUA 4LWWA 4PC8A 2CZ5A 3BLFA 4LRTA 3QRHA 3WK1A 1RQBA 3TR2A 4ADTA 1S5TA 5BNKA 2WPBA 3UD6A 4JTHA 2QKFA 1TPEA 2DP3A 1LM1A 1G4PA 4WX2A 3T7VA 3C4UA 1BKSA 3LBMA 4ZQMA 2VXNA 2WNNA 4RX0A 1ZFJA 1RQEA 1ME8A 2VFEA 4MY9A 5KINA 3INPA 2V2HA 3W2MA 3TH6A 2YDAA 3P5ZA 4I7UA 1PS9A 2NV1A 1XI3A 1F74A 4CCCA 3FOKA 2J24A 2ZZ7A 1K3UA 1HO1A 3LCWA 1OFBA 2Y88A 3RU6A 3VE9A 2VEMA 1GPWA 2JBMA 2NXIA 1QO2A 3DKJA 1XXXA 3W7RA 1QPQA 1ICPA 3STCA 3EWXA 1QR7A 4O1CA 1SZGA 1TQJA 5K4ZA 4E38A 1ZY9A 2BLEA 3FKRA 4XQ6A 1J2WA 2Z0IA 3H55A 1QOPA 2V30A 1CI1A 2QCDA 5AYZA 4RCXA 1X1OA 4Y8FA 4QSHA 4O52A 1LTDA 3PM6A 3KVLA 4S2BA 2H6RA 3C8FA 3MWAA 2HSAA 4HHPA 4UNLA 4L4LA 4DBEA 5LKYA 3PC0A 3E02A 4WOQA 3MYPA 3DI1A 2A6LA 5TIMA 3OVPA 1WQ5A 1JUBA 4AXKA 1F6KA 3ZFHA 1IXPA 3QJAA 4NJKA 4CQ8A 3CT7A 3IIXA 5D02A 2GQ8A 2J9ZA 3QSRA 2GVGA 1B3OA 3P67A 1OFEA 4E0CA 1W1ZA 3DFPA 4IMFA 1XUZA 1JUEA 4UMAA 3O6CA 1KBJA 2EHHA 3SSJA 3IGUA 1THFD 3KXQA 1C9DA 1Z42A 3H54A 3HG2A 3P80A 3UXDA 3W9ZA 5FEWA 5E0KA 1DL3A 1GVRA 3I68A 3W07A 1VPXA 3Q37A 2E68A 1P0NA 2EAWA 3CB8A 2Y7FA 4GC4A 3A5FA 3W7OA 3I7RA 1JRBA 1ZNNA 1KLYA 1J4EA 4AB4A 4WZHA 4X9SA 1R2RA 8TIMA 2Y7EA 3BLEA 7TIMA 1X8FA 1W5NA 3HB9A 1UASA 3E0IA 2WSRA 5AHMA 2PRMA 3IIPA 3IIVA 5D09A 1I2OA 3KOFA 1F76A 4I9AA 3IVSA 5DXXA 1KW1A 3G1XA 1IIHA 3NQAA 4ZQOA 2OCZA 3UXAA 5KSWA 3EB2A 2QCNA 2DJXA 2FB3A 5EKYA 3M6YA 2QUUA 5F1VA 4QITA 1LRQA 3GNNA 1L2UA 4JTSA 3GXPA 1TV7A 3LDVA 3NQ6A 5D2XA 1KM2A 1N8FA 4KFPA 4UTWC 3WFAA 1OX4A 3S1WA 3L0NA 1OYAA 2JGYA 3G1HA 3UYCA 2DORA 3C2VA 3R13A 3P8IA 4OWGA 1N55A 2E6AA 2ZZ1A 4HSNA 1KM1A 1X7FA 4OU1A 1A5BA 3WJWA 3W7IA 3QW4B 2VC6A 3M5ZA 2VFGA 1Z48A 4Q32A 3EX1A 3NL3A 3UWZA 1I8JA 5HWMA 1P1XA 1TTPA 1DKWA 3NM3A 3A24A 4OV4A 1DQXA 2C1HA 4AMAA 3FJLA 1VHNA 4NUWA 3NYZA 1VCVA 4X2RA 3W2NA 1W3IA 3DFNA 3KVKA 3EXRA 1SFJA 3TKFA 5D33A 1BEUA 3F4WA 3M0ZA 3QW3A 1UBSA 1QWGA 3UWQA 3M16A 4XKYA 4Y90A 4MOZA 2GUUA 4N9CA 5D38A 1JULA 4LC8A 3IVTA 3S1VA 1JQVA 2ZZ2A 2JK2A 1W54A 3MJYA 3NNTA 1FCQA 5HMSA 3W1AA 3KAOA 2Z6JA 3LHWA 1FDYA 2QJIA 2Q3OA 4IMDA 3BV4A 3OVRA 2OZ0A 1AL7A 1MO0A 4JNMA 6TIMA 5J5RA 2RKXA 4CCEA 2V82A 4U4MA 4AHPA 1XM3A 2GQAA 3W1NA 1S5WA 1EIXA 4M5PA 3STGA 3TK7A 3BPWA 1KFLA 1UJPA 1W5OA 3E9AA 1VQTA 4DPPA 5I3HA 4K8HA 3LCIA 1WBJA 3WJXA 4LVAA 2DZSA 1I2PA 3GDMA 5LNWA 1K7EA 3UZJA 1KM5A 2YW3A 3HQ1A 3WK2A 3MUXA 3T78A 1B4EA 3CWNA 3W1QA 3QYQA 3DXIA 4K36A 1M6JA 2TPSA 3PR2A 4UFHA 1JJKA 4HNTA 3O6YX 5C54A 1NVMA 3LHZA 1QCWA 2V5LA 3E49A 3B05A 4ADSA 1XL9A 5BRBA 2X1UA 2PURA 3W2KA 1VCFA 4JY9A 4WXYA 1FBAA 1MEHA 4FNSA 3BG9A 4O4WA 5D2WA 4O17A 2C19A 4XBKA 4K8EA 4NX5A 3BG3A 5BW6A 3ABOA 1WX0A 2R8WA 3CEUA 4IMEA 4L4MA 1TMHA 2FIQA 3EWYA 5D03A 4UMBA 1H60A 1JCMP 1WV2A 2RHGA 1H7RA 3O05A 3NQ8A 2ATMA 1HO4A 1H61A 2ZA1A 5I3KA 4CCDA 4K6AA 2EKCA 3NQDA 3SY5A 5K4XA 4OHQA 1FWWA 3M5VA 5CPNA 5HUPA 5F4SA 2J88A 4A21A 5C6MA 1M7OA 5CSSA 1SZFA 3C52A 3NPXA 4IQLA 3EKZA 1ALDA 3G0XA 4XTIA 4NU7A 5F1UA 2WNZA 3N14A 4JEQA 4ORMA 4GNJA 2Y63A 4YWIA 2X16A 1IXQA 1ME7A 5LHEA 5BMWA 3LB0A 5EY5A 3Q2DA 4W9TA 3A22A 5LNRA 3RF9A 2I9EA 3A23A 5K3VA 1A5AA 4ALDA 2ZZ6A 1JUKA 4H6KA 1XKYA 4ADUA 1YPIA 3LCGA 1EUNA 3W7MA 1LRTA 2X2GA 4RLIA 1VGAA 3FIGA 3GAYA 1DV7A 3F1QA 4RKAA 2QUVA 3GKAA 3IRDA 2EPHA 4EWND 4I7VA 1S3HA 1ZALA 4IGHA 5CZ0A 5LNSA 2C16A 3CEPA 4O54A 3MI6A 4N4PA 3DHFA 4DEFA 4H3DA 3R89A 3OIXA 5FI8A 4NQ1A 4G1KA 3MI2A 3GDRA 4UFJA 3B4UA 1TQXA 1WDWA 1DVJA 2CZDA 3VKJA 3EX2A 1P0KA 5KITA 1JRCA 3G1DA 3I7SA 3LHUA 4JTKA 1VR6A 4O28A 3TIMA 5LNUA 5F2MA 4ONVA 1NF7A 4NT0A 3U8GA 3MO7A 3L9CA 4LS0A 3V75A 5F4WA 1LBMA 2R94A 3W2LA 3DENA 3NM1A 5CZTA 2E77A 1TTQA 1X6UA 1OF8A 3W1UA 4DELA 2WNQA 1A50A 1SO3A 2W79A 4NJJA 4HPXA 2HS6A 1GJPA 3HIJA 5EPDA 2VFDA 3NQCA 1K03A 5FF0A 4MZ1A 3UPBA 1VRDA 1W5MA 3TFCA 1VS1A 5G4EA 4TIMA 1W3TA 3SJ3A 1WOAA 2B7NA 3ATZA 3QC3A 4MZ8A 3W73A 2QJGA 2A7NA 4ZMGA 5HULA 4LNYA 4NJIA 3TE9A 4WY0A 1R46A 1TPB1 2D73A 4LTSA 4IMCA 2IQTA 1YDVA 3C2FA 1W5QA 5AHFA 3VFLA 2WQPA 2ZQ0A 4GUIA 4MKNA 4JGDA 3S0CA 1PIIA 1OX6A 4O16A 2Y7DA 5D32A 1SO4A 4LS1A 3NQMA 1FDJA 3B04A 4MLJA 3G3DA 4OBTA 5IBXA 3ZR4A 1SQ7A 4A2RA 4IOTA 1TTJA 3PY2A 1I2NA 2TSYA 2V81A 2AQWA 4ORIA 1O60A 3PUDA 3TCEA 1MSSA 2QCDB 3L2IA 3K30A 5GVJA 2E6DA 3CLMA 2A2IA 1I45A 3A21A 3VE7A 4K37A 2YW4A 3LBCA 4JX6A 5CPOA 3TAKA 5DELA 5LHFA 5G1TA 4DF2A 3NR0A 3FLUA 3MHFA 3THAA 1TPWA 3GNDA 4Q33A 2ZBTA 1Q6LA 4TX9A 4UC5A 1XFBA 3P7YA 3GR8A 3THQA 1B4KA 3G0SA 1FQ0A 1SR9A 1Z41A 3RFAA 1IIGA 3CIXA 4MFDA 1ADOA 3MP5A 3DBPA 1ML1A 3TSBA 3C2RA 4B5NA 3CIWA 3EX3A 2YFNA 3BGGA 4H4IA 4LVFA 1B57A 2HS8A 3CTLA 3P5YA 3R12A 5EYWA 3W7KA 3W7HA 5F2GA 2CLFA 1ICQA 3G22A 4RK8A 1Q6QA 4M6PA 1NEYA 5KZEA 2BTMA 4R33A 3L68A 3W7EA 2RDUA 2AGKA 2JGQA 2YCEA 2PC4A 3ABSA 3SW6A 3LGEA 4BI6A 4UTMA 5F2IA 3TQ0A 1I2QA 2J27A 3Q58A 2YXGA 4BWLA 4O10A 3RLVA 3W7PA 4WD0A 3HBLA 1IXOA 2C0AA 3C61A 1GZGA 3WK0A 4QIUA 5G2IA 3FEMA 2A0NA 3HPZA 3NA8A 5FF7A 4AHQA 1GVOA 1ZCOA 5DCDA 1GOXA 1Q45A 3LCXA 5CPLA 5IM51 1FWNA 3W83A 1OJXA 3OA3A 5FF3A 2VFIA 1M7PA 5HJLA 3HGSA 1U5JA 2J6XA 4OGZA 3MBFA 1JCNA 1TPC1 4LS2A 2B7OA 1GG1A 1LROA 3NZ1A 4JTEA 4OE7A 4UNKA 3NQVA 5IBXC 1EP2A 4HN4A 3TMQA 4A29A 1OF6A 4WUIA 4GWEA 2DZWA 3MP4A 2VFHA 5HR7A 2CLLA 3NQFA 2ZFAA 1SUXA 1WA3A 3C2OA 4O57A 2EF9A 2NUWA 3NL5A 3PULA 3S5ZA 1KFJA 3S5OA 1X1ZA 1TPFA 3SECA 1TPUA 5DBTA 1GVQA 3AO0A 3LXBA 1AK5A 3W7NA 3B0PA 3OBKA 3SI9A 4Y6GA 3GDKA 4IPJA 2LLEA 3P81A 2G5WA 3GIYA 4GUFA 3WK3A 3QF0A 1G7UA 4MLRA 3PS7A 2BSLA 4AWTA 1SW0A 4JYDA 3IIOA 1XBVA 4C1LA 1U83A 4UTTC 4MIMA 5I3JA 3NPWA 3QQ1A 4OQVA 3PB0A 1LRNA 3B06A 2E5BA 3NL2A 4FX7A 2NXGA 4M7SA 1F73A 3KVJA 3TSDA 2NUYA 2WO5A 3LTPA 3W76A 5CPMA 4NXKA 3W7JA 3RLUA 1FWRA 3NVTA 5A5WA 4JYEA 3LV6A 3ATYA 3MYOA 1Z44A 4WQ6A 3P74A 4DF0A 1VC4A 2Y62A 3GKFA 4JTGA 5I3IA 3HO8A 3R2GA 3MBDA 4O1AA 3L67A 1FCBA 1OYBA 3GVGA 1DQWA 4UFLA 2QDGA 1KFKA 4UXDA 4BF9A 1M5WA 3CQ0A 3RNDA 1LORA 5LGXA 3HPXA 3NQ7A 3W7LA 1SU5A 1G4EA 1G4TA 5HNRA 2A1YA 3M9YA 4AF0A 1FXQA 2G97A 4IWWA 3PB2A 1G7VA 1B9BA 4D2JA 4CQ9A 1YLVA 3SGZA 1GYNA 1JQXA 3HGOA 4UTJA 4IPIA 3UQNA 2DZXA 4IUOA 3LV5A 4FNRA 4AWUA 3R5EA 3O1NA 3W88A 5BOOA 3QQ0A 4LRSA 4DO6A 3QPZA 1W5PA 1J5TA 4DQWA 4AWSA 3STFA 5AHNA 4S2CA 3UPWA 4J9JA 5AYYA 4LW7A 5I3GA 3G18A 4N9EA 4UTWA 3BW3A 5BMXA 1H1ZA 2DZVA 4LV4A 3QMTA 1GVSA 4O50A 2NUXA 3I6RA 3QEZA 1FY6A 4HT3A 1ICSA 2QAPA 1XBYA 4TMBA 1LZOA 4NVTA 3NO5A 2Y70A 5E93A 3P62A 3G24A 1R2TA 4DBDA 1PL9A 2C18A 1KM6A 1TTIA 2ZRXA 4U28A 2B7QA 1GTEA 3M41A 1Y0EA 3W87A 1RR2A 4UR8A 3GYEA 2WOQA 1DOSA 1TRDA 1NFBA 1K8ZA 4LUJA 3G1VA 4GJ1A 2CU0A 4MFEA 1OK4A 2FPVA 4GFSA 2Z6IA 2QF7A 4GRSA 2CZEA 3W1TA 4YCPA 3W1PA 1H50A 1K8YA 3GX9A 4GBUA 2QCLA 4AEOA 1FCVA 3Q94A 2NX1A 4BFAA 5HWJA 1R47A 1UB3A 2GOUA 1NSJA 4FF7A 4FB7A 3W23A 1FWSA 3SIZA 1KTNA 3P60A 3L5LA 4FX8A 1HFBA 1HTIA 2O7SA 3NDOA 1FX6A 3EWUA 4O1DA 4Z08A 1JR1A 3TSMA 3IGXA 4HSOA 5G5IA 3O07A 4JTJA 3G8EA 2JKEA 3O8AA 3C6CA 1TRIA 2A7RA 1H1YA 2NWRA 2ZYFA 1XUUA 3UWUA 1D9EA 3NQ2A 1MEIA 1QPRA 4OV9A 3TXZA 3SZ8A 3QPYA 3BGJA 4FHAA 4WY0F 1F6PA 4C1KA 1IGSA 4GXMA 2ABBA 4O8RA 3N19B 1P5BA 4Z0SA 3TROA 4Z1DA 1TPDA 2E5CA 3T40A 3HG3A 2H8XA 3KHJA 3DU0A 3UWYA 1WBHA 4ZVJA 2XN1A 3PVFA 5D04C 4N6FA 1PE1A 4RR4A 2TYSA 1XDLA 1OYCA 3MW7A 2ALDA 1DHPA 3TA6A 3BG5A 3VNDA 3C3NA 1H7PA 2ZRZA 3FYPA 3W7GA 4FX6M 2OX1A 1YDNA 1NAL1 3GXNA 5I3FA 1T0OA 5D2YA 2ZRVA 4KWVA 3VI2A 3HGRA 2ZA3A 4RJEA 3P61A 3G3MA 1VYRA 5HINA 1EWEA 3E12A 3LM7A 4DPQA 3NPVA 4NNAA 1R2SA 3F4NA 5HWNA 1F7BA 2YZRA 3PG8A 4FNQA 2A7PA 1JVNA 4ZQRA 4AVFA 5AFDA 2Y89A 3LTSA 1H7OA 4R53A 4YL2A 1H7NA 3G1FA 5H2ZA 4QJ1A 3SFKA 2YR1A 1OFDA 1VH7A 4MY1A 4HIBA 3TUUA 3HPSA 3NOEA 5H91A 3P84A 2WSYA 3QMSA 3S1UA 2P1FA 4PEKA 4RZ4A 3LRKA 5FEXA 3GXTA 3DI0A 1OFOA 2OT1A 3CC1A 1OFAA 3L5MA 3T55A 3HGJA 3TQKA 2VEPA 1C29A 2HTMA 4TR9A 1MXSA 2V2DA 4AHOA 1SSGA 3CWOX 1PV8A 4ZQNA 4MJZA 4S1FA 2YFOA 1EX5A 1QO5A 4HNVA 4LVGA 2DZPA 1TV8A 1EPXA 3T44A 2E09A 5C5YA 5CZJA 3V1PA 3FKKA 1L6WA 4Z1BA 4O0ZA 4KKXA 3LLDA 4QAIA 3CPRA 4JDBA 5U4NA 1TREA 5F2LA 3GLCA 3NZRA 1SZEA 5FESA 3TAOA 3B8DA 1YTKA 4LT9A 3HG4A 2PRHA 1F5ZA 4UTKA 3PBVA 1R30A 1OX5A 2CLHA 2P10A 4UTLA 5D2TA 1UUMA 1A53A 3QZEA 2CLMA 1WOBA 2X1TA 3N9SA 4UCGA 1YXCA 3STEA 4P61A 3QM3A 4Y96A 1TO3A 3W2JA 1AW1A 4CLMA 3LCHA 2B0MA 4QM1A 5LSMA 1RD5A 3W71A 4UTUA 1KV8A 2W0UA 1EB3A 3MI3A 2OT0A 3UWWA 4NX0A 4IXHA 1BTMA 1S5VA 3QFEA 4R7JA 3DH7A 3W85A 4LOCA 3W7CA 2WV8A 4PFMA 2GVLA 3O63A 1XDMA 2NWSA 5FEPA 4JTTA 3U2OA 3EX6A 2GPTA 1V7YA 4A22A 2Q8ZA 5C2XA 5FF2A 3SGUA 4JD4A 2G96A 3IV3A 1G67A 4FNPA 4ZQCA 4O53A 4JTUA 1K02A 1GG0A 3TW7A 5LZLA 5KZMA 3PSVA 1EWDA 3EWZA 1QFEA 2VELA 3UZ5A 1QPNA 3W70A 4GUGA 5EL1A 4LUIA 3DZ1A 3OHIA 4POCA 1YYAA 1H62A 1QAPA 2NX3A 5HR6A 1AL8A 2GJLA 4ML9A 3LOTA 2ZRUA 1DJQA 2CLKA 3GDTA 3W7DA 3S9YA 1YPFA 4UUIA 2JKPA 3IVUA 1Q6RA 3L21A 3TX9A 3L66A 2YYTA 1AMKA 5CZSA 3CU2A 1O94A 3C0JA 3O6DA 1OABA 2V9DA 4EOUA 4MYXA 5DY2A 3W74A 4UIOA 1SO6A 2YSWA 4EVZA 4FEZA 1RZMA 4X22A 4WXZA 3EKLA 1YXYA 4MZYA 4HNUA 2V8ZA 1IXNA 3IGSA 3S8HA 1T8XA 3USBA 2Y61A 1LOQA 3BW2A 3N73A 4PL2A 1TB3A 4HPJA 3TJLA 4PL1A 4O18A 2RH9A 2X1RA 3O16A 1L9WA 3B0VC 3DFTA 4JIQA 5FF4A 4LVBA 3U6WA 2C6QA 2GVJA 4CQAA 4MUZA 1H51A 2ZRWA 1C8VA 5AC7A 4O0KA 2I1OA 3TJXA 2H8ZA 3W1RA 4O13A 4CNNA 1VCGA 4UFKA 2FTPA 3S1XA 1VYSX 3A9IA 5DN1A 1ZAHA 3M1ZA 1AW2A 2QCFA 4JIPA 3DKLA 4PODA 1W8SA 2CWNA 4NJHA 4OT7A 2EGZA 4JDYA 3PBWA 1SO5A 2E6YA 4NZFA 4IX2A 1YTDA 1RVGA 3GR7A 3BVJA 4NZJA 1TPH1 2QCMA 2V5BA 3N3MA 3ZWTA 2BXVA 1JCLA 2FDSA 2FFCA 1LBFA 3WJSA 5L9FA 3TV8A 5L6UA 1LOSA 4BWLC 4N9DA 2FB2A 2ZTKA 1LOLA 1LCOA 4JICA 1I2RA 1H7WA 4N2YA 5HQEA 3PSWA 1SZNA 3TXVA 1VHCA 1QPOA 3LLFA 5MHBA 2ISSA 4K7VA 3LHVA 5G2WA 2B4GA 4WOZA 1K7XA 1QOQA 4KWWA 3G1YA 1Q6OA 1CW2A 3CHVA 3W86A 4YCOA 2TRSA 4RV8A 1EEPA 4ICNA 1PVNA 4TU1A 1ZAJA 1ZENA 3NQEA 4JR5A 3M47A 2BWGA 4E2BA 5EBUA 1XC4A 3ANYA 2W6RA 5K2ZA 1KTCA 5C55A 4QISA 3TU9A 1HUVA 2V0TA 3JR2A 1YDOA 1GQNA 4CNOA 2QCGA 4O19A 1KV5A 1A5SA 3W72A 2DU2A 3GAKA 2BX7A 3LCLA 5D05A 2OMAA 4NXSA 4EIVA 4TMCA 1VYPX 4NNCA 2DZUA 2WSQA 4IX0A 1O5KA 5A8GA 3R8RA 3L0KA 4MJMA 3NQGA 1KM3A 4LU0A 2E1DA 2DJLA 1SSDA 1QDSA 4O12A 2ZCGA 3UY8A 3TC6A 3GDLA 1QNVA 2QCHA 3M5YA 3I65A 4XBSA 3WJYA 3B03A 1XCFA 3EXSA 1T96A 2H90A 5KTLA 2YX0A 3EWWA 3G1AA 3IEBA 1UCWA 3DAQA 1PCWA 3SR7A 3HF3A 1EP1A 2RFGA 4XWUA 3UNDA 5U7SA 3DFSA 3EXTA 5AN7A 3ZWSA 3MP3A 2FPYA 4IXXA 2RDTA 1L6SA 1O95A 2X30A 3G1SA 4BR1A 1AW5A 3HOJA 4FXRA 4LY8A 1I4NA 2F84A 1LP6A 1CX9A 1FWTA 1GVFA 3HG5A 2A85A 2ZZ3A 4KFNA 1RV8A 4EF8A 2ISVA 5DCEA 3GZ3A 5DLCA 3S6DA 2R14A 3W7QA 4UR7A 2G95A 3UY7A 3DGRA 4O11A 3RMJA 4O4VA 3QMRA 4PH6A 2JKAA 1LLZA 2QDHA 2H3DA 4FO4A 5D2VA 3NXFA 2A5HA 3W1LA 3M5XA 4YLWA 4ZQPA 2CLEA 3VCRA 1UUOA 3H53A 2H3BA 4JN6A 2RDWA 4JTLA 3KFTA 3G0UA 4MPQA 1GT8A 1WAUA 3BLIA 3L5AA 2VFFA 1A5CA 5LNVA 2QR6A 1WXJA 1TJPA 3B0UX 2J9XA 3T4CA 2Y7GA 3P82A 5G1YA 1H7XA 1LBLA 5DBUA 4JS3A 1GYLA 3ABRA 3ABQA 4WJEA 4M19A 3LRLA 2FPTA 4Z1CA 4JY8A 1VLWA 2VOMA 2A6NA 4QQ3A 4IJBA
chains in the Genus database with same CATH superfamily
3BO9A 2A79A 2XFWA 4LC6A 3PF3A 4G7FA 4K7YA 3KZSA 3TC7A 4ZA0A 2VGGA 3IIZA 4UMCA 4YXGA 4US6A 2XFRA 4ZZ9A 1GUVA 4C1NA 5CAHA 1G94A 3AHXA 1DQUA 1RQHA 4HN8A 1WZKA 3GC2A 3LMZA 4AH7A 4RXFA 1JPMA 4RZ5A 2R91A 3SM0A 1AMYA 4FIQA 3LHYA 4FPSA 3T09A 3VM7A 2FVMA 1QTWA 2QUTA 3QV7A 3IK4A 5JBDA 1QNRA 3NL6A 1PHWA 2YPIA 2QQ6A 4JXCA 3B8IA 2X0HA 4H7ZA 4PUEA 3RK8A 3M43A 3M7WA 5E6ZA 4YYCA 4S3JA 2VP8A 5M2FX 5DRCA 3BARA 3LTYA 2OWWA 4DM2A 3TFXA 4JN8A 1IZKA 2FTWA 1B1YA 3WD0A 1OK6A 3W1MA 4KCTA 4A3UA 1W9DM 1VPYA 4UTIA 1HL2A 5K7JA 3ERPA 1R3WA 3S5YA 4QE5A 3PBGA 2NQ9A 2D0FA 5AC8A 4GD0A 2G8ZA 3H2NA 4KFOA 2GWGA 1ISVA 3GFZA 2OKOA 1BKHA 1K7FA 4JYFA 1YW1A 3VCCA 2ZKMX 1OFRA 1X6NA 4F0HA 3ONCA 4G56A 1KFCA 2IW0A 4DJDA 1MUMA 2HROA 4ASTA 3HMJG 4XKYB 3O2LA 2CKRA 5LA0A 2PDBA 2ZRYA 3WQEA 1XLGA 1KM0A 5CC5A 3N11A 1QXLA 1ME9A 4QNEA 1UZ4A 4C7GA 1KC7A 5AHEA 4YN5A 1ZUAX 3P0WA 1XYCA 1UR1A 4KEMA 3BCDA 5KZDA 3U2CA 4A2SA 1WYIA 2OX4A 3CB3A 1G1YA 1KKOA 4DF1A 2PAJA 1F05A 3YPIA 3C0LA 4ILSA 3CAWA 1DWIM 4DO4A 2CXEA 3JS3A 1BWKA 2XN0A 4WK9A 1HKKA 4C1NB 4Q7BA 2KAUC 2B7PA 2CFFA 1ZP4A 2VEIA 3K4WA 3WLPA 2IUZA 3RPTA 3CM4A 3NPUA 1Q3NA 3E3HA 3LXAA 4C65A 4K38A 1DJNA 3VNKA 4HNOA 1FCUA 2WVSA 3G2GA 5FAGA 2R9RA 1Z69A 4MY8A 1L8PA 1KFBA 1QHZA 3WYZA 1MUWA 1X38A 4BI5A 3R94A 5A2AA 1YDYA 4OOZA 3LXCA 1OFQA 2R1KA 2VNCA 2D1ZA 2VX4A 1V5XA 2Z2UA 3KRSA 4UFMA 2ALRA 4OECA 3OW1A 4IIDA 1R9XA 1G4SA 6XIAA 2QVHA 4PBEA 4IGMA 4NIRA 4J3WA 4HKPA 2TODA 2YOCA 1W0MA 5AC6A 2HMCA 1AG1O 3OG3A 4JNZA 1OG0A 3OYXA 4OOUA 4FOKA 4GUHA 1FP8A 1G01A 2C0HA 2CKSA 3VC6A 1J0IA 3F5LA 4AX7A 2PRLA 1W1TA 3LRMA 1SMDA 3KM8A 3GK0A 1BXCA 1POJA 1KM4A 3QSTA 1OFPA 3ONBA 3MUIA 2PODA 3WQ4A 4WSJA 1JCYA 4UWMA 1MEWA 1IWPA 4XAFA 4R9XA 1JZ5A 3PAJA 4UOJA 4E8CA 2NXHA 2BY0A 1TCDA 3WNKA 2XIOA 2CLOA 2JALA 3I6EA 1WP6A 5I5RA 3AIRA 3SQLA 1JAEA 4G6CA 1VFOA 4M6VA 3WZ0E 4PUUA 2V69A 1SJAA 2ATSA 5IDIA 3NFUA 3MTWA 4DUWA 1UWUA 3L4UA 3QFWA 3ITXA 3MCNA 5FJOA 3STPA 2UWFA 4LB4A 2BXZA 2O4QA 3AMCA 7ODCA 3KX6A 1BWLA 5G2HA 3E96A 1EUAA 4YTSA 3URNA 4U5IA 3GTXA 2YXXA 1VJIA 3B0YA 1NU5A 2UY3A 1V3IA 3QOMA 3TR9A 3LGGA 4GUJA 5AOUA 4B92A 3BLFA 1ZBCA 1FWCC 1R3YA 4UR9A 2F9RA 4DZAA 1WKEA 5JH1A 2QT3A 2Q02A 4J2MA 3UD6A 3U5UA 4CD5A 1G4PA 1KR1A 1F8IA 3C4UA 4IM4A 2J8FA 1U1UA 3K8KA 4ZQMA 1J10A 2C91A 4RX0A 1ZFJA 2ZIDA 1BVZA 1RQEA 4MY9A 5C7VA 1CLKA 2V2HA 4M29A 5CBJA 2YDAA 1Y5VA 4U33A 3RCNA 4HZ7A 4FS9A 4GFIA 4QXIA 3IJIA 1A5NC 4R27A 1FVPA 2J24A 1HO1A 2ZUMA 3WNNA 3VE9A 2JBMA 3W6MA 3PPGA 2X0YA 3DKJA 3EWXA 2YA1A 1CIUA 1RCOB 3HFTA 1EJXC 4HQVA 4NRRA 5K4ZA 2C8NA 3K4AA 2BLEA 3CBWA 3WH5A 3FKRA 1J6PA 2FZDA 2UY5A 2QCDA 3T6CA 1X1OA 1RBAA 3PTKA 4D6GA 3PM6A 2P0IA 3KVLA 4S2BA 1E6NA 3C8FA 5C70A 3MWAA 4MWAC 3AS2A 3V3WA 3CUFA 4L4LA 5LKYA 3SCVA 3DI1A 2A6LA 1R85A 1WQ5A 4IGSA 4AXKA 5EFFA 4NILA 2FZNA 1F6KA 3ZFHA 4KEUA 4NJKA 5CG0A 5CEWA 1VB9A 1NDWA 3H2FA 1B3OA 1J79A 3PUGA 1TUFA 1OFEA 2J7GA 4E0CA 2Z28A 1DWFM 1W1ZA 4NG3A 5A8MA 2IS7A 1S2VA 4UMAA 3O6CA 3KE0A 4MJ2A 1KNWA 4GZ7A 3V35A 3KXQA 3BDKA 3S3GA 4P8WA 5FJUA 4Q7IA 3W07A 4LX4A 3T0DA 1FHLA 2DUAA 2VCBA 2CXGA 1P0NA 1TV4A 3GO2A 3B9DA 3CB8A 4PMOA 1ZJBA 1JRBA 5A1AA 1Q6FA 1ZNNA 2CESA 1DE5A 2DT0A 3VUPA 4X9SA 2Y7EA 4DRSA 1H3GA 3I4EA 3HB9A 2BMBA 4W5ZA 2OEKA 3SY8A 3IIVA 1I2OA 4ICCX 2FH8A 3T81A 3DYMA 3IVSA 2C7FA 3NQAA 1NARA 3MCOA 3UXAA 4B3LA 5GNZA 4X2PA 5I77A 2DJXA 1HGWA 1OC6A 2QPSA 5LIKX 4PTVA 3GXPA 3QTPA 3GTHA 2AMGA 5D2XA 2DSKA 1KM2A 3HQNA 2CETA 1OX4A 3ARYA 1CXHA 5A6KA 1DJGA 2BXYA 4NY2A 3WUBA 3PZ9A 1JFHA 2JGYA 3G1HA 4NASA 2OYLA 2DORA 3R13A 5C0QA 1KM1A 2E9LA 1X7FA 2Y4SA 5CAKA 4V28A 1CB7B 4V15A 1WUFA 1Z48A 3UWZA 1P1XA 1DKWA 1DQXA 3OLEA 3REQB 3P6LA 4AMAA 3FJLA 3GTFA 1VCVA 1W3IA 1J93A 2VR4A 3M07A 2DIKA 2HPMA 3TKFA 1A5OC 5D33A 1J2BA 1DWGM 1XISA 3M0ZA 3QW3A 1UBSA 3MQTA 3M16A 4U10A 5DT7A 4MOZA 2KX9A 4FK9A 4YPJA 3SEPA 3VCNA 4LC8A 3IVTA 3E2QA 4PRTA 3VU2A 1R3TA 1W54A 4LAKA 4D6FA 2XVKA 2VEGA 3P0XA 2O9RA 3W1AA 2OODA 1E70M 4MSSA 3LHWA 4XZHA 4IMDA 3BV4A 4S3EA 1AL7A 1MO0A 4RV3A 6TIMA 4A3HA 3BAKA 3MMDA 1XR2A 2YDSA 4L9XA 3GVWA 5GNXA 4PMQA 4MDOA 1XM3A 2PTXA 4XD4A 3N9KA 5BXRA 1JYVA 1S5WA 3B0XA 3AXMA 3BPWA 4A3YA 4EPBC 3L4VA 1VQTA 4DPPA 3V5CA 4JCMA 5FL1A 3M0HA 4K8HA 3FK4A 4U3AA 4ERIA 1L6FA 1M01A 3WX7A 2XG9A 4QJ4B 4W85A 3NQBA 1K7EA 3UZJA 3U2ZA 4IQEA 3CZ8A 2YW3A 1M53A 3WK2A 1OCQA 3PZVA 3MUXA 1B4EA 4FXJA 4GI9A 3QYQA 3AI0A 4PCNA 2F6UA 2Z2BA 3P3BA 1M6JA 3LSCA 4UFHA 3SCRA 1NVMA 4H1ZA 1A4MA 4PGLA 1MW2A 2VL4A 2X1UA 1A0EA 4GYPA 3S9ZA 2PURA 4WXYA 4JY9A 1MEHA 4FNSA 2O9OA 5FAJA 2PDFA 1H41A 1VFFA 4I5UA 4NX5A 4BF5A 1EHAA 2V5DA 3AYTA 2R8WA 4UMBA 1MFVA 1TIWA 4GO9A 3LEPA 1EGZA 1HO4A 5I3KA 3AUJA 3AC0A 1EQCA 3GWQA 1B2YA 2OLHA 3GDBA 3M5VA 8XIAA 5CPNA 4TTUA 2J88A 1M68A 2IQ0A 2PDYA 1SZFA 1ALDA 4LF1A 5F1UA 3U4AA 4MPKA 2WNZA 3N14A 4R5EA 4YWIA 3DUGA 2X16A 1UPMB 5IRPA 2CHNA 5FKYA 3WNLA 4HOZA 3Q2DA 4IH3A 1PBGA 5FJPA 5LNRA 2I9EA 3A23A 1DHKA 4ALDA 3UJ2A 3TLQA 1QT1A 2GGJA 4H6KA 5I09A 5DQPA 1IEVA 4D8LA 3LCGA 4WLCA 3W7MA 1LRTA 2WM0A 3AYSA 3IAPA 3GUGA 2QUVA 3IRDA 4EWND 4Z2LA 6A3HA 5CZ0A 5LNSA 4GQGA 3MI6A 4S3BA 4H3DA 3VAVA 2J77A 4NQ1A 3B4UA 1WDWA 1DVJA 5BZAA 4RPQA 1UIPA 1YE6A 3GTIA 2P76A 5KITA 3G1DA 4M1RA 4QLLA 3GW0A 4NT0A 4TV6A 3GW3A 3RILA 4H8VA 1E9IA 2F6KA 3NM1A 5I0DA 2PUZA 4MM1A 3FGCB 4HA1A 2WNQA 1A50A 3UG5A 2VWTA 2W79A 4NJJA 4XKMA 4C6MA 4M81A 2PWFA 3HIJA 4OVXA 3T2QA 3BLDA 5FF0A 4AYSA 3B97A 3FHQA 1W5MA 3TFCA 5G4EA 4TIMA 3SJ3A 3QLDA 1D2KA 1R87A 1WOAA 2HBXA 4GZIA 2B7NA 3W73A 3GYCA 3QC3A 4MZ8A 2A7NA 3GVQA 4M8UA 1LL7A 1CCWB 4S3KA 4LTSA 3NSMA 4IMCA 1YDVA 2P3EA 2X2YA 3GHRA 3UG4A 1F3XA 3AFBA 1PIIA 6ENLA 3OTRA 5D32A 1SO4A 4CNSA 4LS1A 3NQMA 3B04A 4MLJA 2AQVA 2J25A 1SQ7A 1N8IA 2AKZA 4IOTA 3UR7A 3T05A 4J7RA 3B9EA 2E6DA 1JD9A 4ZO8A 4Q8PA 1GOQA 1TX0A 2YW4A 4XD3A 4NYUA 3LBCA 4JX6A 2OVLA 2VHLA 2VRJA 2WJDA 4J3SA 4QAWA 1R86A 3NUKA 3FLUA 5GJNA 3U7BA 4KRZA 3W24A 4TX9A 4YU1A 4XO7A 2DFAA 3NO1A 1SR9A 1Z41A 2WJFA 3CS2A 1IIGA 4ZO6A 3CIXA 4MFDA 2EG6A 5TF0A 3DBPA 2FJUB 3RRAA 3WNMA 1ZBVA 3CUJA 2YFNA 2SFPA 4H4IA 4LVFA 2HS8A 3W53A 1P7TA 1ICQA 3UZYA 1Q6QA 4M6PA 3ANVA 4R33A 2AL1A 1BSIA 4S39A 1E4MM 3FGCA 2RDUA 2AGKA 2VGBA 2YCEA 3UXIA 2CEQA 3Q58A 2BOFX 2V67A 2AL2B 4S23A 4BWLA 4FA3A 1JI2A 3HBLA 1IXOA 2C0AA 5FIPA 3C61A 3PZQA 4MB4A 1GZGA 3WK0A 5G2IA 3ITYA 4H83A 2GYIA 4AHQA 1EBHA 3JUGA 1GOXA 5FJTA 3HFYA 5FF3A 3FVDA 3KBNA 3GS6A 2J6XA 3HURA 5C9XA 3VD4A 2ZX9A 3ZR6A 4OE7A 4JTEA 3HA1A 4IP7A 3WDHA 1JF6A 1PKLA 4WUIA 4GWEA 2NVAA 1PB0A 3HQPA 5EMJA 5HR7A 2ZFAA 2EF9A 4HPNA 1VP5A 3BANA 2NUWA 3NL5A 1T8QA 2YA2A 3S5ZA 3W29A 4G7EA 1JCTA 4RNHA 3LXBA 1AK5A 4GBDA 4BEQA 2EPOA 4HK7A 1GHRA 1OCNA 4PUJA 1HJSA 1W3JA 2I9UA 5AC4A 4HD5A 1F9CA 3IJDA 2G5WA 3H26A 1OCJA 1G7UA 2O9TA 5DMNA 1UR9A 3VKKA 4JL2A 4W7WA 4YVPA 4UTTC 1FTXA 5I3JA 2NQJA 2OR2A 3UF9A 3B06A 4FX7A 4B5WA 4RNIA 4FR6A 8RUCA 1ISWA 3QZAA 2NUYA 2GK1A 1KBLA 3W76A 5CPMA 3ZIZA 4CKQA 5HA7A 5A5WA 4JYEA 1KGXA 3TWBA 4MB3A 4WQ6A 3WBXA 3AXIA 1B31A 4DF0A 2WVVB 4PB5A 2PA6A 1OM0A 1K4GA 4JTGA 3HO8A 1XCXA 1FCBA 2Q8XA 3G6MA 1EZWA 3KW3A 4RNJA 4UFLA 2QDGA 1EOKA 1W9VA 4BF9A 1GOKA 3KCLA 2FZ9A 3QGVA 1BGAA 3W7LA 5IFTA 4NRSA 3SGGA 1SU5A 4NI8A 1NQKA 1FXQA 4FSAA 3T0AA 1G7VA 1YLVA 4UTJA 3U57A 4UNIA 4HMCA 1XP3A 1Q6EA 1UMYA 1EYWA 2J78A 3R5EA 1Q4NX 1IEWA 4AWEA 3QQ0A 4H04A 4C6FA 4F66A 1T40A 2DPEA 2BG5A 2GSHA 4S2CA 5AYYA 4LW7A 3TOYA 3E0VA 3G18A 1TELA 4UTWA 1TJ1A 5BMXA 3QMTA 1GVSA 4CQDA 1ODZA 4ERGA 1FY6A 2V5KA 4HT3A 1ICSA 3AU2A 4W86A 1UIOA 3CAVA 2BGQA 3H24A 4NVTA 2IKIA 3NO5A 2BHYA 3G24A 4LAOA 2W92A 2BY3A 3M41A 1BSLA 4LUJA 1C93A 3NDYA 1WKFA 2VRQA 2QF7A 4GRSA 1MYRA 1W6TA 2CZEA 4PTXA 3W1PA 2GK1B 1K8YA 1FCVA 4BFAA 1QI3A 4P8XA 1U22A 2PCEA 3W23A 4H9UA 1KTNA 3TCSA 4W8BA 1HFBA 1US3A 1HTIA 1XGEA 1RY8A 1XG3A 2OB3A 3IWPA 2MNRA 4XAGA 1W8GA 3O07A 3G8EA 3AJ7A 4AIOA 3O8AA 3C6CA 1E73M 2A7RA 2ZYFA 3UWUA 1MW3A 3NQ2A 1QPRA 3TXZA 3SZ8A 3JVAA 4FHAA 4WY0F 4DBWA 1XIHA 4HGXA 2Z27A 3WD3A 4CNTA 1TPDA 2XWEA 1KCXA 4DB7A 2ZC8A 3J7HA 3Q45A 4E3VA 4RR4A 2WMJA 3MW7A 1WCGA 2ALDA 3OLDA 1NJJA 1ZJHA 2WPGA 1H7PA 4XZWA 4C6LA 2OX1A 4GY0A 2PGFA 1NAL1 4DJED 2ZRVA 3MCMA 2IPGA 1OCBA 3IJ6A 4RJEA 4GNKB 1GOIA 4XD6A 2GDQA 1VIZA 3ZJ6A 1UD6A 5E6YA 4NNAA 3L4TA 3A6OA 3V36A 1UKOA 3F4NA 5CSUA 2A7PA 3H70A 4F3HA 1IWAA 4G8TA 2Y89A 4YL2A 4DYJA 2WWDA 4MWAB 4GYJA 1VH7A 4A6GA 4GISA 3ZLHA 4NZCA 4MY1A 4MWAD 5HPOA 3TUUA 3VGEA 4L9ZA 1HN1A 3E5PA 1FP9A 4RZ4A 5FEXA 4V2XA 3GXTA 4B3ZA 1UKPA 4FR1A 4TX8A 3RDKA 1X97A 1IT0A 4HYRA 4CU8A 4IPNB 3T55A 3XISA 2VEPA 3ZO9A 3TONA 2X41A 2V2DA 3M0JA 4AHOA 1SSGA 4P7OA 4S1FA 1QHPA 2YFOA 2D2JA 4YTQA 3ZMRA 1EX5A 1QO5A 1P6CA 4HB7A 4H9VA 1IR1A 2DVXA 3F5JA 5C5YA 4DUVA 3V1PA 3EWCA 4QJ3B 3FKKA 2NT0A 1K70A 3CPRA 1F61A 4MG4A 2IKHA 3VIIA 4XO6A 5CJ5A 2JEQA 5A8PA 1BLIA 3WUEA 1W17A 3TAOA 4IF2A 3K5XA 4LT9A 3I3EA 4Q4MA 4UTKA 3WO8A 1PEZA 4UTLA 1QNQA 1A53A 4IICA 3NDZA 1H2JA 2X1TA 3VDHA 1BYCA 1NTHA 3LA4A 3QM3A 4PTDA 2ZVRA 1SJBA 2HNHA 5AC5A 1W1VA 2CBIA 4QM1A 5LSMA 1RD5A 3WDRA 4GX8A 4UTUA 1KV8A 1OC7A 3LLXA 3UWWA 4NX0A 1NP2A 4IXHA 4I3GA 2HE8A 4V1YA 1XYAA 4M24A 1YQ2A 2XZ7A 3DH7A 3ICJA 3IUDA 4LOCA 3SFWA 1L2QA 1QI2A 1XGDA 3GTNA 3WQWA 2W4XA 2VRKA 2NWSA 2EBNA 1FWGC 4A22A 5C2XA 3SGUA 1OG6A 3DCPA 1B30A 1G67A 3CQHA 3UPMA 1LUCA 3OPSA 4JTUA 4H8UA 3OYZA 1K02A 4H6EA 3ZQ9A 2XVLA 3PSVA 1EWDA 1QFEA 5LA1A 4I9JA 1QPNA 3IAQA 2EO7A 1M3UA 2CERA 3W70A 4POCA 1QAPA 1AL8A 3R0UA 3LOTA 3B8UA 4EKJA 2Z29A 4HJWA 2JKPA 3IVUA 2WMFA 3L21A 3SCQA 1OZQA 3E0LA 2VTFA 4RDVA 3EDFA 2HVNA 4B2DA 5CBBA 1VENA 3O6DA 1PTGA 2CHRA 1Z89A 5JU6A 3T0BA 4EVZA 8XIMA 4FEZA 1DIEA 2YL9A 3F4VA 3AHVA 3W27A 1BVNP 4CN6A 4MZYA 1B9ZA 1OT1A 3S8HA 3USBA 2YXOA 1R3QA 1LOQA 3BW2A 1FHUA 4ZCWA 3OO2A 1WDRA 2RH9A 2XSBA 4JIQA 4CQAA 4MUZA 5AC7A 3TJXA 4O13A 3DIPA 2ONEA 1PSCA 2Z26A 3BCFA 2QCFA 4JIPA 1FWHC 1DPMA 2D0HA 3PPFA 2CWNA 4OT7A 3ZT7A 2XH4A 4XSMA 1UWQA 1IEIA 2J7EA 3BVJA 1BF2A 1Q65A 3LN3A 3SUWA 3WQVA 2FVLA 1XIDA 3AMDA 3RR1A 4DWSA 3DG3A 3TVAA 3WJSA 2BVTA 3VOCA 2ADAA 3OIHA 4ZODA 3TV8A 2PWVA 4BWLC 2PU0A 4Z42C 1KRBC 4DJDC 4LBSA 1SZNA 2PF0A 4JTAA 4WOZA 1K7XA 4KWWA 3FA3A 3G1YA 3N2BA 1O68A 1Q6OA 1J5SA 2NSXA 5JUVA 3W86A 4YCOA 1ZAJA 1ZENA 3AWOA 1JDDA 4Z2JA 4JOMA 3S6OA 3W25A 4E2BA 1N2VA 1XC4A 1MNZA 2HXTA 5ABEA 1KTCA 5C55A 3MPGA 1HUVA 2DUXA 2V0TA 3EAUA 1RCXB 3RXZA 4P8VA 1XRSA 1A5SA 2DU2A 3GAKA 5DMYA 2PLCA 2OMAA 2Y8UA 1FWDC 5CC7A 3CPUA 3L0KA 3FDGA 2XFFA 1MXDA 1IWBA 4PMNA 3U5YA 3QHOA 1U30A 4XISA 5A6LA 4EACA 2OQYA 3DN5A 3M5YA 1E40A 4HU0A 3MKVA 4HU8A 4L56A 1T96A 2H90A 2PLKA 4AC7C 4ZFCA 4XSLA 4PMUA 3UNDA 7REQB 4QDWA 4US5A 4HK6A 3WLRA 2DQXA 3LSBA 1RY0A 5C7HA 1LP6A 4HTYA 4YNGA 3HG5A 3GU9A 3UYIA 3Q67A 1GHSA 1RV8A 1GOWA 2YJQA 2WXDM 3PNZA 3GZ3A 5DLCA 3THDA 3W7QA 1EHNA 3UY7A 4O11A 4O4VA 2QDHA 3QGAC 2J8GA 5DEZA 4MNLA 4NSBA 5I02A 5D2VA 1E3XA 1I1XA 3M5XA 4JKLA 5HJXA 3ZVHA 1UUOA 4I5RA 5A2BA 4JN6A 3W00A 4F4RA 4F8XA 2J7HA 1VJSA 3T2PA 1XH2A 1MXGA 2IKJA 1DJXA 4GACA 1KO0A 1GT8A 3KP1A 3L5AA 1K9TA 1A5CA 1YE4A 4K68A 6CGTA 4GGHA 4IFOA 4Q6XA 5KETA 3CV6A 1EXBA 5G1YA 3EOOA 4OTKA 4JFSA 3ABQA 1ZJAA 4M19A 1KD0A 3CV2A 4JY8A 3VGHA 4IJBA 3WBYA 1VBRA 1Q5MA 3LMYA 4AXNA 3R8HA 1LYXA 3QZ6A 1XLMA 1OIMA 3Q65A 3CK5A 5I79A 5T9CE 1AJ2A 8A3HA 1PYMA 1E1CA 1P48A 3OEXA 2HWGA 1YHTA 1MRQA 5H6HA 1AD4A 4L1XA 3VIMA 5ENLA 1HJWA 4NAFB 3TTYA 2KZHA 4I7WA 3WLNA 2HRWA 2NLIA 4C6DA 1OHLA 4MYAA 4E5TA 3TQVA 4GI4A 4N02A 4O15A 3VYLA 2GQ9A 2VENA 3A13A 3WLOA 4TV5A 1GEQA 4D71A 1MVYA 3S2MA 1HL8A 4UCFA 2OXNA 2VD8A 2X1SA 2Y85A 4PMVA 4FLQA 2YCIX 3IRSA 3B9OA 5A69A 3N4EA 3FJ6A 1V51A 5A6BD 4H00A 1VD6A 3EWBX 4U2YA 2V2CA 5DF0A 5REQB 2E8YA 3OOQA 5DCBA 4ACYA 3CMFA 4TO8A 1SR0A 1PAMA 3W3OA 3KRZA 1UROA 5JMUA 1IF2A 5D37A 1TKKA 5C2GA 4F40A 3RJYA 3FW6A 5CG7A 1XIFA 4AF0B 4F0LA 5E0CA 4AW7A 4HYWA 3RG6A 2X40A 1E6QM 3WJZA 2XN2A 6REQA 4UQBA 4NNBA 3EEGA 5IFPA 3AUOA 4GHRA 3GIPA 3GC4A 1EO5A 3PUOA 2GJNA 3VO0A 2GVYA 4B5SA 2ZA2A 2C15A 2CW6A 5D30A 4O1EA 1O6IA 3PBYA 4PCFA 5CSRA 4DZHA 3KOZA 1XSJA 3F03K 2E6FA 4RXGA 1N7KA 1KXTA 1DORA 3SCWA 1H63A 2ZDRA 2QEZA 3G6LA 6ALDA 1YRRA 3FSTA 3NJ3A 1XS2A 3FEQA 2CLIA 3LI0A 1TVNA 5FEZA 1OVDA 3FS2A 4GQQA 4M6QA 3SCNA 3A9BA 4WSHA 3L65A 5SWUA 4M0XA 4IMAA 3CZKA 5DXYA 1EJ7L 4L6HA 1E0UA 4ZXLA 4UFIA 2WJZA 1GVEA 1XBXA 3I7QA 1MZHA 3TN5A 3PBUA 1W31A 4MTVA 3CHCA 5XINA 3ZS4A 1NF0A 1J0KA 4NL1A 3WF1A 2NZLA 3RPDA 5C9ZA 3E74A 1FDZA 1U2YA 3N4FA 1RJRA 2RGLA 1Y5XA 1GTHA 3N2CA 3IS4A 2Z1BA 3R8GA 3QY6A 5CKSA 1MI3A 2PWDA 1IZJA 8CGTA 1S3TC 1LJYA 5I06A 4AD4A 2J66A 5T26A 1V93A 1W2PA 1XIGA 4NAEB 1E56A 3N2MA 3RU8X 2XVPA 4QJ5B 1LDCA 1X98A 1YTEA 4JKKA 1EDGA 3T8QA 4X61A 5ABTA 2BOGX 3V4BA 2JE8A 1TZZA 1AD1A 1JCXA 6REQB 2ACRA 2YYUA 5EA9A 3CHDA 4DXVA 3ELFA 4XUGA 1PCKA 3LERA 4O8AA 3CL7A 5E9XA 5BU6A 3R4IA 4H9MA 2C13A 1JXKA 2ZUVA 1EGVA 2ASHA 1F3WA 4LYPA 1DXIA 3NG3A 3P8JA 2ZUWA 1EA0A 1V6YA 3EX4A 5TQLA 1L6YA 3GE7A 4YTTA 2O92A 2WC3A 3QY8A 4NF7A 3BW4A 3DOPA 4N4QA 4WDWA 3A5VA 2DEPA 1XF0A 4PTNA 5AYXA 4GQRA 2ISFA 4HPHA 4MUPA 4AZGA 1EP3A 1Z8AA 4RDWA 4GYFA 2WZHA 1KBIA 1ISXA 2NLYA 1QI4A 2CZ5A 1LF1A 5BU9A 4I8DA 3WK1A 3CH9A 3IARA 4ADTA 1JYXA 2WPBA 4LSBA 1U1HA 1WDPA 2QKFA 5AY7A 2WZEA 2WZMA 1LUCB 1LM1A 4HJFA 3BMXA 3M0VA 3LBMA 1SJDA 3LQGA 2XIIA 5HNNA 1DXFA 3FAXA 4XAZA 1E4NA 2DVUA 4CEXC 3TH6A 1BTCA 1S2WA 3P5ZA 3HU7A 3MVIA 1PS9A 1XI3A 5E09A 3OBEA 4NAEA 2CBUA 4RE0A 2ZZ7A 1K3UA 2L5HA 3LCWA 4FXFA 2G3JA 4PMYA 3DHUA 4A8LA 2VEMA 1GPWA 2HDJA 4F2TA 3GG1A 4YIWA 4Q4RA 4FMVA 4S3GA 4KPLA 1SZGA 3GBEA 1TQJA 4L4OA 4QCEA 1WXYA 4XQ6A 1J2WA 3E6EA 2Z0IA 1QOPA 1TWIA 4UBPC 4RCXA 2WMKA 2I16A 4Y8FA 1SVDA 5ECVA 1LTDA 3VMNA 1X96A 4UOZA 5HJYA 4J4KA 3GSMA 4LPCA 4QQUA 1K9FA 1QRQA 2HSAA 1FWFC 3ITCA 5FJRA 3UWEA 4UNLA 4DBEA 3WEZA 1S39A 4WOQA 1RXOB 3E02A 4R7OA 4WRHA 5MKGA 2P53A 4PCTA 4PN2A 2OTDA 1V3JA 2Z24A 4KEVA 3CT7A 1JAKA 2DVTA 3MVTA 4LUTB 2GQ8A 1NFPA 3AZSA 4S3AA 4IUGA 3PZUA 3RX3A 1OZMA 4BQ4A 1XUZA 3IACA 1KBJA 3PPCA 3SSJA 1THFD 3MSYA 3WLTA 3HG2A 1V02A 2QNEA 5FEWA 2X09A 4AIEA 4L80A 3PPHA 1EQPA 4GH1A 1UH2A 4GY7A 3WLLA 3Q37A 3N3TA 3TYAA 2E68A 2Y7FA 4GC4A 3A5FA 3W7OA 4HNLA 3I7RA 4J2PA 1KLYA 1T6MA 2YL8A 4AB4A 2VGFA 3QHNA 3P93A 2Y1HA 3VTRA 7TIMA 1W5NA 1HT6A 3E0IA 2NQHA 2VR5A 2PRMA 3KOFA 3BJTA 4I9AA 4JL1A 1TR9A 1UR8A 5RUBA 3GZAA 3PP7A 1CECA 3GC5A 1E6SM 1ESWA 1JYWA 2QCNA 3D6NA 2HQAA 5EKYA 4QITA 1LRQA 1M1BA 2MANA 4D6DA 3LDVA 1PIFA 1I1WA 1GJUA 2HK1A 4R88A 3OBAA 3AIVA 3DC0A 3CO8A 2HEJA 1N55A 1Q7MA 3GRIA 2E6AA 4DJFC 4F48A 3WJWA 3W7IA 3HMCA 4KIRA 2VFGA 1XPYA 4Q32A 3NL3A 2EPLX 5HWMA 1BG9A 1PYFA 1ZRQA 4JFTA 4QS5A 3T8LA 2C1HA 2EJAA 4NUWA 3NYZA 3W2NA 1PZ2A 2PLJA 1XKJA 3EXRA 1HKMA 2A3EA 1BEUA 4QX4A 1QWGA 4Q8WA 4XKYA 3RX2A 2GUUA 2ZXDA 4QE4A 3S1VA 2YCJA 4D1IA 1ITUA 1JQVA 3B40A 2ZZ2A 3UG3A 2JK2A 3QY7A 2J7FA 3MJYA 3NNTA 1FCQA 2ZX7A 3KAOA 3DBNA 4MNJA 2QJIA 2OZ0A 1OD0A 4JNMA 1KRCC 1NDVA 5J5RA 2BGNE 1J6OA 1BRLB 3KL0A 4CCEA 3ZLGA 3A3XA 3NOYA 2NSOA 4BQ3A 1GQKA 3TK7A 1KFLA 1UJPA 2DIJA 2XGZA 1KXHA 3KLKA 4DZ5A 1FRBA 3H21A 1WE5A 3LCIA 2CC0A 4A3RA 1I2PA 5LNWA 3A3WA 3R79A 5I23A 5BWAA 1KM5A 1ZSXA 4L1GA 2WC4A 3MSDA 3CWNA 3VNJA 3VOHA 1GW9A 4B4FA 3DXIA 2QIIA 3CMJA 3PR2A 4JQAA 3AHZA 3RHGA 2G3MA 2ISDA 4ADSA 1XL9A 3HV8A 4GXWA 3W2KA 1ZU8A 1I60A 1YMYA 1J0HA 4O4WA 1PO9A 1BWVA 4DIAA 1UR4A 5D2WA 3FYYA 3DGBA 3RO8A 4P7NA 3CEUA 4IMEA 5FL0A 1TMHA 4MHBA 3EWYA 2Z1VA 1H60A 3BUVA 3O05A 3NQ8A 3KWSA 4CCDA 2G0WA 3BCJA 1XDJA 2RGMA 3NQDA 5K4XA 4OHQA 5EMKA 1Q63A 1YKWA 2GJPA 3K2GA 4JNYA 4HVXA 3GH7A 5CSSA 3NPXA 4PB4A 4XTIA 4N0RA 4NU7A 1CLVA 3N18A 4ORMA 2NQLA 2Y63A 3UR5A 1CGYA 4YHEA 3WQDA 3EZ4A 1XLEA 2V63A 3QYSA 1QI5A 1XIJA 1NELA 3W0KA 2ZZ6A 1X6LA 1JUKA 3H2CA 3BTNA 4K3ZA 3POHA 4GQBA 2EG7A 1XKYA 3FJNA 1QK2A 3FIGA 3GAYA 3O0FA 9XIMA 2WYSA 3GKAA 3AIWA 3RCMA 2EPHA 3EOEA 1HIZA 4JHZA 1S3HA 1ZALA 5D8WA 4WKAA 3H2MA 3K1GA 4OZOA 5FI8A 4Y9MA 1EC8A 4G1KA 1EJRC 4HHMA 2AAAA 4UB9A 3VD7A 1LG2A 4D1JA 3E0FA 1AZ1A 3LHUA 5LNUA 1EC9A 5F2MA 4ONVA 5AVHA 5F4WA 2R94A 1EC7A 2Z4GA 4HHHA 3VGGA 1X7IA 2E77A 3L4XA 3W1UA 1GEHA 2PDGA 3N4AA 4HPXA 3QV6A 1QOXA 5EPDA 3CUZA 1GQJA 4D8ZA 5I07A 4EXBA 4MZ1A 3UPBA 1K77A 1W3TA 1GVIA 4YVXA 2R1NA 5GPRA 2QJGA 3SRDA 5AKQA 4FLSA 4LNYA 3TE9A 4CN4A 4W88A 4WY0A 2D73A 5ABGA 4KQNA 3VFLA 2WQPA 1IT7A 4LCRA 2ZQ0A 4IIHA 4LEQA 4PZVA 4L64A 4O16A 1T41A 2EPKX 5BXPA 3ZR4A 1UD5A 3O9NA 4A2RA 1B0IA 2TSYA 2AQWA 4HOWA 2CZVA 2FKPA 1MSSA 4QE1A 3B8WA 2QCDB 3BAIA 3L2IA 3K30A 5GVJA 3CLMA 4C5ZA 3VIPA 1I45A 3VE7A 4AQLA 3KHDA 1ISZA 4K37A 5DMMA 4TQTA 5G1TA 3NR0A 3QV8A 1XIMA 1TPWA 2ZBTA 1Q6LA 3SCTA 4RL3A 1EEXA 1E43A 4ATWA 5TD4A 3THQA 4L4PA 3GVRA 3HV9A 3MP5A 1TJ0A 1ML1A 1VRXA 2W67A 4C90A 3AOFA 3CIWA 4CEUC 3CTLA 3R12A 5EYWA 4C6BA 3G22A 5EGRA 2PBGA 3ZVIA 4Q3MA 5KZEA 3IJLA 2NQ5A 5A8OA 3BLLA 3L68A 2QJNA 2JGQA 3KL3A 2PC4A 2BGSA 1WKYA 3TQ0A 1I2QA 2Z1SA 5E9AA 3RLVA 4IT1A 4EAMA 4WD0A 2E8ZA 1GK8A 2QJMA 4Z2GA 3NIYA 1SJCA 2A0NA 3NA8A 5FF7A 1U33A 1ZCOA 4JTDA 4ZTYA 3QR1A 4DAFA 2WW5A 3ARUA 5HJLA 2VZTA 4OGZA 1E0WA 4LS2A 4OBRA 1LQAA 2B7OA 1LROA 3NZ1A 4CN1A 3NQVA 3N15A 4Q8UA 3MP4A 3KOYA 4O57A 5T9BG 1A47A 2PS2A 1M41A 4HU4A 1TPFA 1BHGA 4CQCA 3AYVA 3W7NA 3VINA 3OBKA 4Y6GA 3CLWA 1Q7ZA 4D6HA 3GIYA 3GU2A 3VGBA 3WK3A 4ACZB 1UD4A 5TNVA 3L4WA 4LXFA 3WEMA 1CNVA 2Z00A 3MMWA 5I2UA 5FD0A 5EU9A 5CH9A 1XBVA 1Q85A 4JTCA 1WUEA 2D22A 3NPWA 3GG0A 4OQVA 2YL6A 4GZEA 1LRNA 1ODUA 2WHLA 2E5BA 4AVOA 4R3UA 4EK7A 2D20A 4XIMA 4DI8A 2VCCA 3TSDA 4Z2KA 1KCZA 1RPKA 3H7UA 3LTPA 2OZTA 2ODOA 4NXKA 1XLKA 3JW7A 1HX0A 5LXEA 3NVTA 3GG8A 1H4PA 3KBMA 2HBVA 2VM8A 4Y7EA 5JIPA 4UTFA 4H9ZA 1UW9A 5BROA 2X42A 4LUTA 1KKRA 3MBDA 3L67A 1F3EA 4ECLA 1OYBA 4HZ8A 5HPCA 2G50A 4HZ6A 1LORA 4AY1A 5LGXA 3MKCA 3BOLA 1Q2RA 1G4EA 2A1YA 1Q6DA 2JIEA 3AHYA 1BQCA 2QGYA 4KBXA 3DDMA 4ZOCA 2QMKA 4ATDA 3SGZA 2FGLA 3UA3A 5I78A 3HGOA 5M1TA 5I6SA 4IUOA 4M82A 3W28A 2VUNA 1LT8A 1JDAA 3O1NA 1NOWA 4D9PA 4LRSA 3U4FA 4DO6A 1N82A 5J04A 3KOWA 4MMWA 1TJ2A 2PDMA 2VO5A 1H1ZA 2DZVA 1S46A 2NUXA 3I6RA 2E28A 1L8NA 1LWJA 1TWZA 3WMSA 4TMBA 4BQ2A 1E9YB 1LZOA 1XYBA 1R7OA 2Y70A 1M65A 3AISA 4G5DA 4DBDA 1YBQB 5TAOA 2WCGA 3HQOA 4DWSD 3K8MA 2C18A 2Q6ZA 4U28A 2B7QA 1GTEA 4GA8A 1UJQA 4G1NA 4PB3A 4OIFA 2DT3A 2J8TA 4UR8A 3GYEA 1E1EA 1E3ZA 4DUOA 2FMNA 1TRDA 3G1VA 3BICA 4GJ1A 1OK4A 2QV5A 2OLAA 2FPVA 5C9WA 3NCOA 4IP5A 3GBDA 4G2DA 1W3LA 2QCLA 3M0YA 1RHCA 4AIUA 2CYGA 1J9YA 3MSGA 5HWJA 2EXOA 4D6CA 3TYCA 2A3HA 4ZO9A 3L5LA 4FX8A 3NDOA 1FX6A 4Q22A 2PWHA 4Z08A 3SCSA 3TSMA 3I6TA 5G5IA 4HSOA 4JTJA 2ZUNA 4EANA 1EJUC 4DJFD 1XUUA 4GVGA 3WLIA 1MEIA 3UERA 4OV9A 1POKA 3QPYA 4OUEA 3BGJA 4C1KA 3RJXA 1UZ1A 3ARQA 3WLHA 3IUIA 4Z0SA 3TROA 2WNWA 1PX3A 1B54A 5LIWX 3DU0A 1RUSA 2XN1A 3PVFA 5D04C 3LQLA 1PE1A 1U5VA 2GDVA 3WQPA 2XM1A 1NDYA 2HVMA 4ZB5A 1XDLA 2XIMA 4RE3A 3WN6A 3BG5A 3VNDA 1SMAA 3FYPA 4FX6M 1YDNA 4WCJA 1NWSA 3HGRA 1FWAC 2ZA3A 1Y7VA 5CJMA 1VYRA 2D24A 5HINA 1HKIA 1P0EA 4PULA 3NPVA 3AALA 1XLHA 1JPKA 1A3XA 5HWNA 1F7BA 4GY1A 2YZRA 4P7LA 3BQ5A 2QULA 3M4HA 2E7FA 2AQOA 4ZQRA 1WZAA 2FZ8A 1RAKA 4H8HA 4AVFA 1IEQA 2VVNA 5H2ZA 2EQDA 1XGZA 3WELA 2ZOXA 2VURA 1XYFA 4IJCA 2QV4A 1E72M 3TTQA 3NOEA 1X39A 1DIOA 3QMSA 2CLPA 4PEKA 4WGXA 1CGTA 2VYOA 3LRKA 1TWWA 3T0CA 1GKRA 2DT1A 3CC1A 2PDHA 3L5MA 1IHIA 3HGJA 3TQKA 3W82A 4TR9A 1REQA 1MXSA 3CWOX 3VIHA 3GFXA 1EPXA 3T44A 2E09A 1MUCA 3EA2A 3SUTA 4KKXA 3M46A 4H2CA 4QAIA 4ML4A 5DFAA 2GSJA 4IGNA 4B15A 1P43A 5U4NA 5HMEA 3TTSA 1J8VA 3KUMA 2PTZA 2G3NA 3HG4A 2PRHA 1F5ZA 5A3HA 2CLHA 5A6SA 3A4AA 3TC3A 1WOBA 1AH4A 4MADA 4ZTXA 4X9YA 2RJGA 3WD4A 4Y96A 1S38A 1JZ6A 1UD8A 2HE5A 3RIKA 4DYKA 1VFUA 4BKNA 4L65A 2DZBA 1F4AA 4Z2HA 4EAYA 3MI3A 1AUSL 1BTMA 1S5VA 1UQZA 2JEPA 4B16A 3W85A 5CPSA 1OC5A 1I0BA 3W6LA 2WV8A 2GVLA 4CD7A 4GCXA 1V0KA 2ACSA 5FEPA 1UWIA 2G37A 4GABA 5ABFB 3MUY1 4AISA 4JD4A 4MWAE 3IV3A 2D69A 3AMLA 4FNPA 1RD6A 4O53A 1JDEA 3TW7A 1HKVA 7PTDA 2DH2A 5KZMA 2VELA 1AJZA 3F2CA 3V1HA 3W01A 3UCQA 1NY1A 4CNUA 3DZ1A 1YYAA 2NX3A 2D23A 4K2SA 1Q66A 3S1GA 4ML9A 1ZPTA 2ZRUA 2CLKA 1YNYA 2PGEA 3L4YA 4ICMA 3H4WA 2BFGA 1Q6RA 3TX9A 2FH6A 3L66A 4KERA 3CAKA 1F07A 4JTRA 1XLJA 2DQWA 4GJIA 3G1RA 4BCEA 5AYBA 1VBUA 5CZSA 3C0JA 4I90A 2ZE0A 2QS8A 5DY2A 1QPKA 2YSWA 1QJWA 3CUXA 1RLDA 1PWMA 1A5MC 3EKLA 2A3AA 4BF7A 1ZGDA 3N2OA 3WY1A 3FJ4A 2ZX5A 1Z9AA 2Y61A 1MW0A 4O18A 3CH0A 1L9WA 3DFTA 2JF7A 3MDWA 4CCZA 4LVBA 3U6WA 4GI6A 2GVJA 1W2VA 2ZRWA 4O0KA 2GJXA 2GGIA 3AIEA 2FTPA 3S1XA 4OJYA 2FZMA 2V5CA 2WLYA 5DN1A 1JPDX 1UOZA 1ZAHA 1AW2A 3M1ZA 3A47A 4CGTA 2QVNA 4PODA 4NJHA 2EGZA 4I9MA 4JDYA 3PBWA 4NYYA 3OQEA 4F79A 4NZFA 3ZOAA 3UXKA 4DO7A 2QCMA 2FFCA 3V7PA 4KMQA 1ADSA 5L6UA 1HW6A 1LOLA 4GGBA 5HQEA 1QPOA 2ISSA 4X60A 4K7VA 4FLRA 2PZNA 2J6VA 1QOQA 3MB9A 1ITQA 2PD5A 2X1IA 1EJTC 2HZGA 3N1AA 4ICNA 1EOMA 3CO4A 3CNYA 4S3FA 2PWUA 3M47A 4CQBA 3GXMA 5EBUA 3NURA 2W6RA 5K2ZA 4LCQA 3L4ZA 1YDOA 3AICA 2QCGA 3W72A 1DEDA 2BY1A 4TMCA 7TAAA 4NNCA 2WSQA 4IX0A 4MJMA 3NQGA 4D72A 3SSZA 3CMGA 3WMCA 3H22A 2ZCGA 2YIHA 4TX6A 4GVHA 2Y5JA 1Z32X 3UR2A 1QNVA 3RUBL 2ZX8A 1D3CA 2OKTA 1XCFA 3EXSA 4ZE4A 1FKXA 3URAA 1PCWA 3SR7A 3HF3A 4REQB 2OFJA 4QG8A 2PP3A 3DFSA 3EXTA 3ZWSA 3MP3A 2RDTA 1S5MA 2VDGA 5T8GA 4LAUA 1DJWA 1PWLA 4H6QA 4WVXA 4FXRA 4LY8A 2F84A 2D2OA 1FWTA 1XQKA 3ZR5A 2ZZ3A 4KFNA 1XSIA 1E0VA 5DCEA 4J27A 4UR7A 2VX5A 3DGRA 4YTUA 4IZGA 4GPNA 3QMRA 3QKZA 4PH6A 1SFTA 1LLZA 2XINA 4YLWA 2X8RA 1B3YA 3I3DA 3DYOA 4MWAA 2H3BA 1XLBA 2RDWA 5HANA 1HF6A 2P88A 4GCAA 1VF8A 4AD2A 2UBPC 2OO0A 3BLIA 4LBRA 2VFFA 5LNVA 2QR6A 1WXJA 2YA0A 4L6DA 2Y7GA 3BAXA 3P82A 1H7XA 1TUXA 1GYLA 4WJEA 4C7FA 4DJEC 2OGYA 2A6NA 1ONEA 1GKQA 4H6RA 3AXXA 2XISA 3S42A 3AROA 5E5CA 1LLOA 1HP5A 1M7XA 2CZFA 5K9XA 4TTGA 3GIQA 3WLMA 3UR8A 3VIFA 2PCQA 4GE8A 5EFDA 2B31A 4H19A 3AJXA 4QEHA 1JGIA 1B90A 2P0OA 3I10A 5F4XA 3WBAA 1QMLA 1O5RA 3RM9A 3O3RA 2WSPA 3FFSA 3ITGA 3W75A 3PWAA 1UZHA 1PDYA 1P6WA 3VA8A 1MDLA 1K8XA 3C56A 4PA8A 1UOKA 3P2VA 3QHMA 1F2JA 4Z0JA 3EPOA 3GY1A 4M7TA 2R1LA 4H2HA 4TVCA 4J3ZA 5CGQA 4F9DA 1E4LA 1G69A 1WKDA 4KW2A 4AEEA 2DY3A 4WGHA 2FGBA 4CNPA 4UOQA 1VZWA 4JX4A 3C2EA 5G4WA 1LWHA 3W22A 4XX6A 3OZYA 5E1QA 4JIEA 3TJ4A 4AMCA 2WKGA 1VLIA 2ZZ4A 4XK2A 6PTDA 3CL6A 4LVDA 4HNNA 3N04A 4CU7A 2C71A 4JTFA 3KLLA 1K9EA 1EGMA 5J5DA 4EP8C 4ZO7A 3RLHA 3SB0A 3SY1A 1EYEA 1GPFA 5G1MA 4IFKA 4KETA 5A94A 2F8QA 1W37A 3W6YA 4GKLA 2E40A 4BK9A 1YADA 1T99A 4XVDA 4RZ6A 1A80A 3N9RA 1CDGA 4Y9AA 2GFTA 2REQA 4Z1AA 3LPGA 2Y8KA 4IFRA 3M0MA 4MVAA 1ZHAA 4XTDA 1O1ZA 2VEFA 3DHDA 3CZJA 2BOEX 3FA5A 3LX9A 3GXIA 1Q8AA 5C9RA 1K4HA 2AAMA 3PZMA 2UY2A 5BXTA 4JTIA 4XAPA 4ZOAA 3KRUA 1RCQA 1WDQA 1V0LA 1ZCCA 3QH2A 1FH9A 2VKZG 2UV8G 4LF2A 1TV5A 1W56A 3M44A 1ITCA 5K9DA 4EF9A 4LYRA 5FOOA 3ITTA 3TDFA 1JCJA 1FXPA 3PG9A 4E2DA 3TMLA 2ISWA 2E25A 5GJPA 1W9XA 2ZZ5A 4R34A 3O06A 4KS0A 1SFLA 3O0KA 5HUOA 1D3GA 1FA2A 3VM5A 2FJKA 3HM7A 4NJGA 5TBOA 4N6EA 5D9OA 5HDRA 2J9YA 4P7RA 3KZPA 2F7FA 3W26A 4E4UA 3VIGA 1SZRA 3SN4A 3G77A 1UP3A 2FLIA 1E5NA 3PFMA 1VBGA 4DO5A 2FQIA 3W4RA 3PNUA 4X0VA 1CTNA 4DJDD 2Y6ZA 1VEMA 2A4AA 2FFIA 4PSRA 4J3VA 1A0DA 5EBAA 3N2XA 3FYOA 3AHTA 3TYDA 1GOOA 4CD4A 2PC8A 1TYGA 5KMYA 1D3HA 4IQJA 2CCRA 2Z25A 4OBSA 2WB5A 4IJRA 3PJTA 3CYJA 2BZNA 4WEVX 1MQPA 1SPQA 4P2VA 2PDQA 1SW7A 2OWXA 3VDAA 4G7EB 4MNMA 2QIWA 3MHUA 3OVQA 3GU1A 3M64A 1ZBKA 2ABAA 3MHGA 1DBTA 4C7DA 2QGHA 2WKJA 1ECEA 2OJPA 4JKMA 1QW8A 2IKGA 2ACUA 1MZRA 1PHQA 3VNYA 2XSXA 3MMUA 2PDPA 3TNOA 1PZ3A 5CLWA 1M7JA 2O7QA 4FIRA 5GNYA 4B5XA 1PPIA 4IP4A 3G5EA 3A64A 3LGDA 3F2BA 3PUEA 1TJRA 4O1BA 3QC0A 1KBBA 4MDPA 1FUYA 4JTQA 1O4UA 2C3ZA 3R43A 3EDKA 2Y8VA 4XVEA 3ZJ8A 1H0GA 3CJPA 4RW5A 1ZQ5A 2GWNA 1RQBA 1S5TA 2W91A 5BNKA 4WR3A 1JG9A 3N6JA 3DYPA 1TPEA 2DP3A 4WX2A 3T7VA 3R10A 1BKSA 4CVUA 2VFEA 2WZIA 1K6WA 1UKSA 5KINA 4PSPA 3BURA 3WNOA 3GHSA 3GNXA 3SCUA 3TNBA 3BAWA 2XGBA 4DN1A 2NV1A 3VMOA 4ZBCA 1PDZA 3K8LA 3MUZ1 1F74A 5H8PA 2EG8A 5DX7A 3OGRA 1UYQA 2ESCA 2Y88A 3RU6A 3RPMA 3AIUA 2NXIA 4PCSA 1QO2A 3C8NA 3STCA 1ICPA 4LALA 3S4TA 4O1CA 1R7AA 2EPNA 4E38A 1ZY9A 1XLCA 2XWDA 1F3TA 1XPGA 2BASA 3H55A 2PZ0A 1CI1A 1DIKA 3EEZA 5AYZA 1GKPA 2AMXA 1V3KA 1NWRA 4XBJA 2QUNA 2YCLB 4O52A 1C8YA 4DUXA 4IIGA 5GJMA 3PK7A 1GZJA 3RN6A 1WAWA 4HHPA 3UG8A 3GH4A 1W9PA 1E1CB 3MYPA 5TIMA 2Z1XA 3OVPA 4MJ4A 2WMIA 4ZEPA 9RUBA 4YYFA 1NIUA 1E9ZB 1IXPA 3QJAA 5A2CA 1DJIA 2J9ZA 3QSRA 3B9NA 1RA5A 3P67A 2Q09A 1PZ0A 4IMFA 3Q4DA 3V0UA 3H4GA 1JUEA 4IPLA 2WLZA 4J1OA 3IGUA 1HNYA 3VOFA 1Z42A 2INZA 3KBVA 3P80A 4FLOA 3UXDA 3SRHA 4N42A 4KIEA 3VIJA 5E0KA 1DL3A 1GVRA 3I68A 4QRNA 3PN8A 3PFRA 2PWGA 4J3UA 2OEMA 4XZBA 1BXBA 1XH1A 3N25A 4LAZA 5H1WA 2ZVIA 1J4EA 2J79A 2ZUUA 3O6AA 4WZHA 3A12A 3CUIA 1X8FA 5HAOA 1RLCL 1UASA 4U3CA 3ZSTA 2WSRA 4ZOBA 1UP2A 5D09A 1F76A 3LD5A 5I24A 1JZ4A 1TX2A 5DXXA 2F2HA 1V08A 4DZIA 3TYZA 4ZQOA 2DW7A 3GHTA 3EB2A 2FB3A 2BB0A 3M6YA 5F1VA 3GNNA 4QDMA 3WDJA 3BC9A 4FF5A 1N8FA 4KFPA 3OGVA 4UTWC 3S1WA 2IXUA 4L61A 1OYAA 5FJIA 2YCLA 1ISYA 3C2VA 5FCZA 4OWGA 2DSVA 1J11A 4OU1A 1A5BA 1TVPA 2VC6A 3M5ZA 1RBLA 3EX1A 4DAIA 1RP8A 4AZHA 1TTPA 2ZUSA 4GX9A 3MZ2A 2PDWA 3TYBA 5I00A 4AEFA 1DWJM 2XIBA 1VHNA 4WDTA 4X2RA 2WVUA 3B8SA 3KVKA 3UETA 1SFJA 2DIEA 2W27A 4A8NA 2J74A 4ZSUA 1XW8A 3TTOA 1NWTA 2XFYA 1BD0A 1W1IE 1AVAA 1WZLA 5JQ9A 4W5UA 2J62A 1JFXA 5D38A 1JULA 4W7VA 1XRTA 3SQSA 1A5LC 3WH9A 5HMSA 4PUWA 3FXGA 4WJXA 1CT5A 1TCMA 2Q3OA 4QEEA 3OVRA 2W62A 4RDZA 4IL0A 3VFCA 2GDUA 3BZJA 2JQXA 4L6OA 2RKXA 3XINA 4JPGA 1CXEA 2V82A 2Z2AA 4AHPA 3VOGA 2GQAA 3W1NA 4HHLA 4LFYA 1VFHA 4DX3A 5M17A 5MF5A 3LM3A 4XZIA 1WBJA 2RJHA 3VKAA 4X0NA 3GDMA 1UR3M 1W1A1 3M7SA 4EE9A 3TZNA 4YVVA 2YLAA 4NZ5A 1EF2A 1GCYA 3CPGA 4TXEA 2Q01A 1UZDA 3ITOA 2VDHA 1PXGA 3T78A 3MC5A 3MUCA 3W1QA 3RLGA 3OJGA 2X7VA 4K36A 1E4IA 2TPSA 1JPIA 5C54A 3LHZA 1QCWA 2V5LA 3E49A 3B05A 1AQHA 2VC5A 4DHGA 1VCFA 2YBTA 1Q6GA 2J7DA 3BG9A 4UQEA 4XBKA 3PZOA 4K8EA 1BXNA 3BG3A 5BW6A 3WG6A 3ABOA 4H41A 3OODA 1CWYA 4EPEC 7CGTA 2RHGA 1WV2A 1H7RA 1H61A 4XIAA 3DG7A 3PANA 4K6AA 3GFYA 1BAGA 1FWWA 4LUSB 5HUPA 5F4SA 4A21A 5PTDA 3C2YA 3H12A 1M7OA 5E70A 3T9PA 4IQLA 3WLKX 1IXQA 1Z6KA 2WWCA 1PTAA 5LHEA 1XG4A 2IMRA 4QBXA 2XH7A 4W89A 3ES8A 1CENA 3RF9A 4DM1A 5K3VA 3CXOA 3ANUA 1ZZMA 2E1WA 3SUVA 4QFUA 4ADUA 1YPIA 1EUNA 4C6PA 3ZT5A 4B91A 3UJFA 1DV7A 1GQIA 3F1QA 4JN7A 1E15A 2YKKA 1KRAC 4IGHA 3WLJA 2VUYA 3CEPA 3L2LA 3CL8A 4O54A 4N4PA 3AXHA 3EB4A 1QATA 3R89A 4DEFA 3UFYA 3MI2A 4HA0A 1VFTA 3MDUA 1TQXA 4LGXA 2CZDA 3EX2A 4B2DD 3CTTA 3QN3A 1FWJC 1OADA 1P0KA 1JRCA 2OOGA 3ES7A 6TAAA 2R24A 4IIEA 1VR6A 4O28A 4ZFMA 3TIMA 1E6PA 3JZEA 4PEEA 2ZXQA 3U8GA 3MO7A 3V75A 3W2LA 5HK4A 1X6UA 4QDPA 1IT8A 1SO3A 3D3AA 5I7GA 5AZ1A 3U48A 3MWCA 4PCPA 3JU2A 2I57A 3NQCA 1K03A 1CEOA 1VS1A 4Y9OA 3FSUA 3E1F1 3WQ8A 3ZLFA 2ZX6A 2WHKA 1JPHA 4LJ3A 4ZMGA 4GYKA 1R46A 2WVVA 1ITXA 3UJEA 4K1GA 1JZ8A 3C2FA 1W5QA 4GUIA 2A3BA 3DECA 3WDIA 2ICSA 4KGJA 1OX6A 1R3RA 3RAOA 2POZA 3WLQA 4QTGA 5DT5A 5H8UA 1TTJA 3PY2A 1I2NA 1QI0A 2V81A 1O60A 2A3CA 3PUDA 3TCEA 3IV8A 3VZYA 2A2IA 5E0FA 1A3WA 1Q13A 3A21A 1A0CA 3LG3A 2DDXA 5C8BB 5DELA 5LHFA