3ELFA

Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
345
structure length
332
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalysis of a tetrameric class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
total genus 132
structure length 332
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3elfA00
4UTKA 4DF0A 1GVSA 3N9RA 2Y88A 3T7VA 1KM2A 4I7WA 4FX7A 4HHPA 4M19A 3IIPA 4BR1A 5D09A 3VE9A 3OVQA 2A4AA 5D33A 2GVGA 2QCHA 2E5DA 4M7SA 5HMSA 2CZEA 3M43A 4MLJA 1W37A 4AWSA 1GG0A 3CIWA 1Z41A 3BLFA 3GX9A 4EOUA 4NJJA 1J2WA 1VPXA 3LV6A 4GNJA 2Q8ZA 3KVMA 1VYSX 2QCDB 3W7EA 5FI8A 1DOSA 2ATSA 3S1WA 1L6WA 3MYPA 1A5BA 2QF7A 3QZEA 1KFCA 2Q3OA 3W7IA 4YL2A 4E38A 3W7PA 3G8RA 5FEWA 4DELA 2WOQA 3G1SA 3W88A 1GG1A 5CGQA 1K8XA 1R47A 2R91A 5C5YA 3BV4A 2OX1A 2CLMA 4IMGA 5G2WA 4FIQA 3M0ZA 2E5BA 1GEQA 2QUUA 2YSWA 2NX3A 4LTSA 1WXJA 3P7YA 3OIXA 3QM3A 2YW4A 3NR0A 3FYPA 4O19A 4O0ZA 2YYTA 4ONVA 3BW2A 3C2VA 1OYAA 3MP3A 3UWUA 1SZGA 4RXFA 2A1YA 4JICA 1LTDA 3BG5A 1MEIA 5F1UA 4U4MA 5I3HA 5AFDA 1QNVA 4MVAA 3EWYA 1XM3A 4FNPA 2X1SA 2XN0A 4UR8A 4M5PA 2BXVA 3OG3A 3SGZA 1FWRA 1CW2A 3T4CA 4TR9A 3G3MA 1KM5A 1L6SA 5FESA 2ALDA 4OV9A 5J5DA 1N8FA 4PL1A 3BW4A 1D3HA 4S1FA 3OA3A 3TW7A 1Q6LA 2CZ5A 1W3TA 3HMJG 3W71A 1W3IA 3TSDA 2LLEA 4PODA 1W31A 5KZMA 3D0CA 1FUYA 3C56A 1H60A 3A5VA 3G0XA 1EA0A 4O1BA 5DY3A 4PC8A 4RV8A 3TUUA 3FLUA 1GVOA 3KVJA 4MY8A 3G24A 5I3FA 1JJKA 4CNNA 2DZWA 3VI2A 1YADA 4GUFA 3W7JA 1JCJA 3P5ZA 1EIXA 1W0MA 3GXTA 3NQGA 5TIMA 5D2YA 3O6DA 1LBMA 2PURA 3P60A 3PR2A 2CWNA 4LOCA 4LNYA 2E5CA 1H7RA 2QJGA 5DBTA 1FBAA 1FCUA 2J6XA 4UMAA 2TRSA 2VENA 2E6YA 3NPUA 3NL6A 2QCDA 1D9EA 2BSLA 4DEFA 3HG5A 5HUPA 5E0KA 5KZEA 4HSNA 2TPSA 2F84A 4FNTA 1GPWA 4HT3A 1YXDA 2QUVA 2VEMA 3EX3A 2OMAA 1TV8A 4OHQA 1H7PA 2WNNA 3DI0A 5EL1A 2Y62A 3MUXA 3GR7A 3HBLA 5AHIA 1PE1A 3GDKA 3WJSA 2ZRYA 3P8JA 5CZTA 3V1PA 2DZUA 4FEZA 4JTLA 4OQVA 5BRBA 4GFSA 3WJYA 4HNUA 1TREA 5SWUA 4O1AA 4O10A 3WK1A 4EVZA 2P10A 3NQDA 2CZFA 3H53A 4P2VA 4O18A 3SJ3A 5FF0A 2NX9A 1QPNA 3C2OA 2OCZA 3G1HA 3HPSA 1ML1A 3LLDA 3PS7A 4K38A 2A6NA 2DZTA 4MFDA 5FF3A 4WY0F 4LV4A 1NVMA 3V75A 2WSYA 3W7MA 3L5AA 2A7PA 1F5ZA 5DCBA 2DZPA 1JUEA 3E9AA 2Y7GA 1YDVA 3O15A 2RKXA 5FEPA 1OF6A 3F4NA 2QJIA 1SZEA 4DF2A 2FPYA 3B04A 2QKFA 4NX5A 4O57A 1BEUA 2Y63A 1IIGA 1FY6A 3W7KA 1S5TA 1LOSA 1VS1A 4A29A 4O17A 5E1QA 4JTKA 2NXGA 1ZY9A 4IXXA 2E6FA 1TV5A 5AYXA 1B4KA 3QF0A 4JD4A 1Q6OA 2ZTJA 4IMEA 3W7GA 3ZWTA 2NUXA 1OJXA 3W1TA 2NUYA 3LHWA 1ME9A 3W73A 1VC4A 4BFAA 3LBMA 1YPIA 2H6RA 3S1VA 4WZHA 2BZNA 1OFAA 5D04C 4N4QA 2CLFA 3QMTA 2R8WA 3A24A 4Y8FA 4FIRA 3DFQA 1P0NA 3S8HA 3W1AA 2J27A 2A0NA 1XBYA 3O6YX 3W07A 1W5NA 1M7PA 5D2WA 4QISA 3TX9A 4BWLA 4MZ1A 1TPVA 3TIMA 3GR8A 2V9DA 1WAUA 1OX6A 1GYNA 3LTPA 3H55A 1TCDA 1JQVA 1DQWA 1UASA 3N9SA 4Y6GA 2JKPA 3L67A 4IMDA 3W7DA 2R14A 3U8GA 2PRMA 5A5WA 5FF4A 2QAFA 2YXGA 4ICNA 4HIBA 1ME8A 3UY8A 3LV5A 4RZ4A 1B3OA 1OYBA 1OHLA 1UUOA 3C2FA 4NNCA 3G1YA 3RF9A 1AMKA 3TNOA 3IRDA 3IVUA 1SO6A 4UR7A 2VOMA 5KTLA 4GC4A 2AQWA 1LRTA 3WK0A 1JRCA 2H90A 5L6UA 3IVTA 4MY1A 3TFCA 1R2SA 1J4EA 3M5XA 1TPC1 5F4WA 5FEZA 1FCQA 3LRMA 2E68A 4RX0A 1QR7A 3NEVA 1KFBA 1W1ZA 3F1QA 3CPRA 3DZ1A 3LX9A 1LM1A 2AAMA 4UMCA 5FF2A 1X8FA 1QPQA 2ZZ3A 4HNNA 4HPXA 5HWNA 2WJZA 4FX6M 3PG8A 3W7HA 2C6QA 5AHNA 4NZFA 3L0GA 2Y61A 4AHOA 5U4NA 2GJLA 4JTUA 4UTWA 3L9CA 2Z6JA 1G6CA 3TAOA 3GAYA 3NQVA 2V2DA 3NQ7A 4FXSA 1N55A 4A2RA 5F2GA 1EUAA 5D2VA 3T44A 3ABOA 3M5ZA 1FCBA 5DCEA 3UPBA 3TSMA 3NAVA 2X1RA 1KM4A 4H6KA 1H7WA 1KFKA 1G4TA 3PUDA 1LRNA 3OBKA 4I7UA 1H63A 3MI3A 1QDSA 2EF9A 4A22A 4HSOA 5C55A 1C9DA 3BG3A 1ZAHA 1G4PA 1VCFA 1D3GA 3UD6A 3IIZA 1RZMA 1RVGA 1VRDA 4KFNA 2FQIA 1O95A 4UNLA 1KFEA 1EWDA 3HJZA 4NQ1A 4NJHA 1YDOA 3DU0A 1VYRA 2YW3A 4MFEA 4BF9A 3LTYA 1SPQA 3W1QA 3EX4A 1WDWA 2RHGA 1O94A 3SSJA 4JTJA 3T55A 1O60A 3PBVA 2C14A 3S5YA 4LVFA 3O05A 1VYPX 4MIMA 5D03A 3MBFA 3GVGA 3GDRA 1CX9A 2ZRUA 1F6PA 1LLZA 3W7QA 3BGGA 2HMCA 3NQ8A 2YFNA 1U83A 4XWUA 3I68A 2YDAA 3NXFA 4YCPA 1ZAIA 3EKZA 5DY2A 2RDWA 3S42A 5HQEA 4M6PA 2DJXA 2CLEA 4NT0A 4XKYA 5AHMA 3O63A 2WKJA 5K9DA 5AOUA 1B9BA 1JRBA 1N7KA 4MKNA 3UYCA 2QAPA 5G5IA 3G3DA 3ATYA 2QCMA 3ELFA 2C13A 3PG9A 3G0UA 1ZFJA 3CWOX 5EY5A 1ICPA 5F2MA 5HNRA 1TRIA 2A21A 2XN2A 1KM6A 1TQJA 3THQA 1W8SA 5AHEA 2BLEA 3AO0A 3HG2A 5BW6A 2DJLA 3I6RA 3AJXA 4X22A 1GYLA 2YZRA 3I7RA 4O14A 3EX1A 2OT0A 1OFRA 4CNPA 1Q45A 1O4UA 2ZZ5A 3STEA 3B0UX 4O50A 2VKZG 3I7SA 3MJYA 4RJEA 4UMBA 2G5WA 4IMCA 4JXCA 4JTTA 4JDBA 4IX0A 1JUKA 2B7PA 3N3MA 3B8DA 2CFFA 4PH6A 4Z1BA 2Q8LA 1OF8A 1K8ZA 2KZHA 2G95A 1K7EA 3RK8A 3LCIA 4H3DA 1OK4A 3C2RA 2ZRXA 3S5OA 1TPDA 3C52A 3H54A 3I65A 1SW0A 3WJWA 3QPZA 3N73A 4GWEA 4JTEA 4MY9A 1WOAA 1MEHA 2GVJA 1IGSA 4PL2A 3SI9A 3NVTA 3TROA 4AHPA 3C3NA 3W74A 1G7UA 5LGXA 3L5LA 1A5CA 1NF7A 3QC3A 3W1MA 1FDJA 4K8EA 1MZHA 1DHPA 3ZS4A 3OVRA 4FXRA 1EB3A 1GWJA 2Z1BA 3DAQA 5DXYA 3GAKA 3BO9A 4DO5A 5LNRA 4FNQA 1KA9F 3MHUA 2ABAA 1H7NA 5CPNA 3NZRA 3KXQA 2JBMA 2FLIA 1L9WA 4PFMA 3CIXA 1XBXA 2PRHA 4ZQPA 2TSYA 2FPTA 3N2XA 3VCRA 3ABQA 3SW6A 1YXYA 3Q58A 4MZ8A 4ADTA 5G2IA 3BLEA 3G1DA 4IOTA 3EXTA 3TMLA 5AC8A 1PHQA 3M7WA 5LGZA 4DO4A 4D2JA 4W9TA 1EP3A 1P1XA 3NQ2A 1DORA 3DXIA 2NV1A 5G2HA 1QAPA 3O07A 2ZBTA 1EWEA 3MBDA 2ZZ6A 4Y90A 3P74A 4K7YA 4JYFA 1LZOA 5HUOA 2ZZ4A 2E6DA 3U2OA 1J5TA 2RH9A 1KV5A 4MPQA 1EP1A 4XQ6A 1GJPA 4AB4A 4LRTA 3W70A 2A2IA 3KRUA 4L4MA 5FF7A 3NM3A 2JGQA 2PC4A 4LVBA 1O5KA 4DBEA 1JCXA 4O8RA 3RFAA 5LNVA 2ZRVA 4XBSA 2VFDA 1ZENA 3FJ6A 3MP5A 4O1DA 3SIZA 1TV7A 4JX4A 2Y7DA 2P1FA 4ZQRA 4UFMA 4RXGA 1JCLA 1WBHA 4ZL1A 5K2ZA 4A3UA 1G4SA 2J9XA 3FEMA 1QOQA 1FXPA 3G1AA 2O7QA 4TO8A 2TMDA 1W5OA 1Q6QA 2D73A 1SQ7A 4YCOA 4P61A 4NJKA 3HPZA 3B4UA 4RZ6A 4O28A 4TIMA 3EKLA 1JULA 3W2KA 4IJBA 3ABSA 2ZTKA 3S5ZA 5D2TA 2VXNA 5AYZA 1FXQA 2PRLA 1W3NA 1P0KA 2O7SA 2YX0A 1I2QA 1KFJA 4GUHA 1SFJA 2IQTA 4RR4A 4AH7A 2NX1A 4LC6A 5HJLA 2Z6IA 2PE4A 3HPXA 4UNKA 3TMQA 3HG3A 2VFFA 3P82A 4LS2A 1NAL1 1P5BA 2NXHA 3DKJA 2EPHA 3DFOA 4MJMA 1SSGA 5D38A 2B7QA 5KMYA 3OHIA 3W83A 3W7NA 1RV8A 2QCEA 2BWGA 1Z42A 4WOZA 3QEZA 4O11A 2J88A 4OE7A 4IMFA 4UFLA 3QH2A 4JIPA 5DLCA 4KWVA 4UTJA 2VC6A 3O1NA 1A5SA 1YTKA 1V5XA 3NQCA 2YYUA 4MZYA 5K7JA 3TSBA 4I7VA 3UXDA 3W85A 4E2BA 1SSDA 4PEKA 1XI3A 3W2UA 1DQXA 2CZDA 2W0UA 1X1ZA 1K7FA 3EWXA 2WV8A 4NJGA 2VFEA 3TC7A 1PHWA 3GDLA 3MYOA 2CLHA 4WY0A 4UUIA 4ZVJA 2FPVA 1X6UA 3A5FA 3GYEA 1S5VA 3IIVA 4LS1A 1VCVA 3P61A 1NSJA 1OG0A 4UFIA 3FS2A 3TDFA 4AWUA 3LHYA 3KFTA 4WJEA 4R7JA 3MHFA 4O4WA 3CB8A 4A2SA 2Y6ZA 1THFD 2C3ZA 2HSAA 2CLIA 4QNEA 1BKSA 1T0OA 1WA3A 4FNUA 1PV8A 2WSRA 3GXPA 4ORMA 3L21A 3M47A 2CLLA 1B4EA 4OGZA 2G97A 1LRQA 2ZDRA 1U5JA 4Q33A 1O5XA 2DZSA 3PY2A 3MW7A 4S2CA 4JTSA 3Q2DA 4DPQA 3BLIA 4KFPA 5HR7A 1SW3A 3GDMA 1OFPA 1KTBA 5AB3A 1VR6A 5U7SA 3NPWA 3IV3A 2HS6A 3L68A 3PUOA 4AVFA 5I3GA 3N19B 4Z1AA 2W6RA 1H50A 3BARA 4NNBA 3TE9A 4E0CA 2Y7EA 1Z48A 3INPA 4HNTA 4O12A 3IVSA 2OJPA 5AC7A 1HO4A 3L0NA 3G8EA 4UCGA 1R30A 1LORA 3TH6A 3TU9A 3PB0A 5EA9A 3T40A 3E96A 1QCWA 1GZGA 3NL3A 1IXOA 1X1OA 2WPBA 1OK6A 4DF1A 3QQ0A 4NZJA 4Y9AA 3LOTA 5HR6A 3MI2A 1MSSA 1P4CA 4JN6A 2EHHA 3P67A 3W1RA 4I9AA 1JR1A 3BW3A 3HGSA 4TMBA 1AW1A 1I2NA 1I2OA 1GVRA 4CQ8A 2V81A 4B5NA 4AMAA 1F73A 1KLYA 2FDSA 4M6VA 3UY7A 2V5BA 1WV2A 3RLUA 3P8IA 5EPDA 1SZFA 4GUJA 4CCEA 5LZLA 3UWQA 4POCA 3NQFA 1W5PA 5I3IA 1PIIA 3IGUA 4QM1A 2ISVA 1DV7A 1UBSA 3NDOA 4ALDA 3R5EA 5ABTA 5IBXC 4K39A 3PULA 2C0AA 3FOKA 1K02A 1X7FA 5T26A 1UUMA 3HGJA 3WK2A 4AAJA 3W1XA 3B03A 3HB9A 3TQVA 3LCWA 4TU1A 2ZQ0A 3IIXA 1HTIA 3KVLA 3W1PA 3DFTA 3KOFA 1SW7A 2XFWA 3GKAA 4O0KA 1LDCA 2QEZA 5G4WA 3HGOA 3IIOA 3M9YA 1KBIA 1L2UA 4UIOA 2V82A 1PCKA 3LHTA 5DN1A 2G96A 1TPFA 2GOUA 3SGUA 3GXNA 1GVQA 1FWTA 2DZVA 2QUTA 3SR7A 1OFEA 2Y70A 3UWVA 4PA8A 3G1XA 4DXVA 3WJXA 1EEPA 1H7OA 4WXYA 2Z2UA 3G18A 1ICSA 3DI1A 1UB3A 4JS3A 3TXVA 1IF2A 5K4XA 2V8ZA 1S3HA 1IXPA 1GTEA 6ALDA 2YGYA 5HWMA 3TXZA 3NGJA 3VKJA 1E51A 1F2JA 1SFLA 4CQ9A 2E6AA 4R53A 3LRKA 3LDVA 3NO5A 3W72A 1KLZA 3LLFA 1SR9A 3PBYA 2HTMA 5FEXA 3TQKA 1A50A 5GVJA 3BPWA 4ADUA 3NPVA 3LXCA 3DENA 3G1FA 1F76A 3W2NA 4N9BA 4LRSA 3GLCA 4QIUA 2QDGA 1A53A 3EWWA 1RQEA 1TQXA 3LBCA 5CPLA 3FYOA 6TIMA 2Y7FA 2OZ0A 1ZNNA 4NXKA 1FDZA 1TB3A 2H3BA 2B0MA 3L5MA 3QRHA 1YYAA 2ISSA 2W79A 2NXIA 3GB6A 5KZDA 1PL9A 3VNDA 2QJHA 2ZZ1A 5DELA 3T78A 2GQ9A 4EWND 5IM51 1Q6RA 3TJLA 4R33A 2QR6A 3W1LA 1RPXA 3E0IA 3LRLA 5E93A 4DBDA 1TYGA 5DBUA 2GPTA 3W1UA 4NNAA 3MO7A 4QSHA 4J9JA 3M44A 4K7VA 4FX8A 5HINA 3U6WA 4O4VA 4JY9A 2B4GA 5F2IA 1XXXA 4CNOA 3LGEA 4M7TA 4YLWA 3W7OA 5K9CA 2NLIA 4GRSA 4JX6A 2Q3RA 5CZJA 3KRSA 1XL9A 2EKCA 2A85A 4R34A 5CPOA 3TKFA 3CM4A 4IXHA 5EBUA 3HGRA 1UJPA 1VZWA 3UZJA 5AHFA 1ZHAA 1KBJA 2JGYA 4FNRA 2YPIA 2CU0A 3LM7A 4GUGA 1K03A 2FB2A 3TQ0A 4JYDA 4K36A 4Q32A 4HKPA 1JVNA 1LLWA 4IPJA 4Z08A 3QSRA 3W1NA 3SFKA 3O16A 3ZWSA 1I4NA 2C15A 4UTUA 4WY0B 3TCEA 3R8RA 1VCGA 1JCNA 1GVFA 3S0CA 2FTPA 5C2XA 2ZFAA 5BMWA 1M7OA 1ZALA 3IGXA 3BVJA 4OBTA 1HO1A 3M5VA 4N02A 3B0VC 4O15A 5KITA 2X1TA 1T99A 1TRDA 3STCA 2TYSA 1I2PA 4BWLC 1ZJIA 1WX0A 4RCXA 4DO6A 4NJIA 4FHAA 3CHVA 3UWZA 3OEXA 7TIMA 2XN1A 3EX2A 5LNUA 3S5NA 3EX6A 4NUWA 1R2TA 4YWIA 2NZLA 2BTMA 2F7FA 2I9EA 3W2MA 2RDUA 2ZA1A 4G1KA 5DCDA 4ZQCA 3LTSA 3JRKA 1QPRA 3MP4A 4U28A 2C18A 1XBZA 4IPIA 3FJLA 3PSWA 1HG3A 3JR2A 4LVGA 3I7QA 3C6CA 3FFSA 3EWUA 2ZZ7A 2JKAA 3M5YA 3R89A 1WYIA 4LVAA 4OT7A 4IWWA 4RK8A 2FB3A 5TQLA 4O16A 4N2YA 4ZMGA 3NM1A 3N34A 4EF9A 3DHDA 5AHLA 1QFEA 1XDLA 1JCMP 3UQNA 1PCWA 2E09A 3NQMA 2J9YA 4O52A 4Q4KA 4ZZ9A 4BI6A 2NWSA 5I3KA 5F2LA 3FIGA 1TJPA 1C29A 3FKKA 3TV8A 2VFHA 1IIHA 4TMCA 2HS8A 5LSMA 1PVNA 4XTIA 1DVJA 4UTTA 3PM6A 4LS0A 1BWLA 3W84A 2E1DA 2C16A 2X2GA 3A23A 3GNNA 1AL7A 3LCFA 3QSTA 1TJRA 3LI1A 4XTDA 4FB7A 4ZQOA 2ZRWA 1AW5A 1OFDA 2J24A 3UPWA 1OABA 1C8VA 2DU2A 1RQHA 3W7RA 1RQBA 3UXAA 3NL5A 5K4ZA 3A21A 3QW4B 2QCLA 3QW3A 3RLVA 1YLVA 5IBXA 4AXKA 2CW6A 3SECA 3LHUA 4EF8A 1FDYA 1OFOA 3P80A 2GVLA 3TA6A 4ORIA 3EXRA 5C54A 4JX5A 3THAA 4FO4A 5EYWA 3W9ZA 3WFAA 4CLMA 1F7BA 4WOQA 3UNDA 1ME7A 2GJNA 3DFSA 5LNWA 3W75A 1KTNA 4TX9A 2PCQA 3DHFA 3GZ3A 3CT7A 1I2RA 5F4SA 1RD5A 5K3VA 1GTHA 2V2CA 3FKRA 3LHZA 4LVDA 1VLWA 3QQ1A 2VFIA 3C4UA 2Y85A 4UXDA 2WNQA 5KSWA 1FX6A 3KVKA 4OV4A 4LW7A 1KV8A 1TSIA 3L65A 1HUVA 1XCFA 1SO4A 1AK5A 3P62A 1TPEA 3NA8A 3QFEA 3A22A 2Z0IA 2NUWA 2DP3A 3O8AA 3DKLA 3CU2A 5AN7A 3BG9A 4Z1DA 1V7YA 1FQ0A 4NXSA 1W5QA 5L9FA 2FFCA 2H8ZA 1LOLA 5LKYA 1F74A 4DQWA 1H51A 5BOOA 3Q94A 3ATZA 5G1YA 3W76A 4X2RA 3R13A 4JIQA 1TMHA 3HIJA 4S2BA 1KM0A 4JGDA 4NX0A 4LWWA 4RZ5A 2V30A 4WD0A 8TIMA 1OFQA 2V2HA 4XBKA 2YCEA 3S6DA 1VHNA 1I8JA 1TTQA 1NEYA 5D2XA 3G22A 4NU7A 4Y96A 4UTLA 1IXNA 1NFBA 3B06A 3SY5A 3WK3A 3QJAA 5H2ZA 4UTIA 3ZFHA 2WSQA 1HL2A 2V5LA 2OT1A 2ISWA 3S1XA 3GDTA 1VHCA 1OFBA 3W23A 3PVFA 5HULA 4C1LA 2I14A 3PBUA 1Q3NA 3W87A 5LHEA 3MHGA 1IXQA 2ZA3A 3W3OA 2YFOA 1F05A 1TPH1 1XUZA 3TAKA 4IX2A 4JNMA 1JQXA 1LOQA 4JR5A 1R2RA 1XBVA 1T96A 1LP6A 1FWWA 5CSRA 3CTLA 1F6KA 4O13A 3UZ5A 2DZXA 3O06A 1L6YA 5CSSA 3NOEA 1Y0EA 3NG3A 5LNSA 2ABBA 4O54A 1MO0A 5G1TA 4BK9A 3LCGA 3W2JA 2WNZA 3HOJA 4RKAA 3E49A 1KW1A 4QJ1A 1K8YA 3S1UA 3LCHA 3UWWA 3PBWA 1SO3A 2B7NA 4BI7A 3JS3A 1MEWA 3RU6A 1EP2A 3USBA 1M6JA 2UV8G 3WJZA 1H61A 1PS9A 3PUEA 1YTEA 4N6FA 5D05A 3NNTA 4PCFA 3L0KA 5A8GA 4OWGA 2J9ZA 5D32A 3L2IA 3ABRA 3TC6A 3LI0A 1HFBA 1QPOA 3MI6A 4IGHA 1NF0A 3NQEA 4N9DA 5F1VA 3N14A 2R94A 3NQ6A 3BK0A 4ML9A 1WQ5A 4N9CA 2X1UA 1KM1A 4JTGA 3LXBA 4XKYB 3YPIA 3KAOA 1LCOA 4UFHA 1VJIA 4X9SA 4ZQNA 3M1ZA 1FCVA 3M6YA 5C6MA 3KX6A 3PAJA 5MHBA 1TPUA 1AL8A 1QMLA 1EX5A 4MYXA 3M16A 4UTHA 3R12A 1M5WA 2WO5A 4YXGA 5D30A 1VGAA 3VE7A 2A7NA 3LERA 1QO5A 3C2EA 1MXSA 3N2MA 1XFBA 4LV9A 3RNDA 3PC0A 4NVTA 1YPFA 2ZZ2A 4EIVA 3ZR4A 1UCWA 1YXCA 3GKFA 1G67A 2QDHA 3P81A 4N6EA 4UC5A 3STFA 3CWNA 2CLKA 4JTFA 3P84A 5LHFA 4MUZA 3EB2A 3DH7A 3HF3A 4K6AA 1RR2A 4KKXA 2ATMA 4MYAA 5BNKA 4BI5A 1B57A 3B0PA 4JY8A 4JTHA 4GUIA 1GT8A 3IEBA 3E02A 4GJ1A 4K37A 4YMZA 1W56A 5I3JA 3PB2A 1DBTA 1QO2A 4RLIA 4WQ6A 5DXXA 2QCNA 3PWAA 5H91A 5AYYA 2FJKA 1GOXA 1DL3A 3G1VA 1BWKA 1AG1O 3O6CA 4WUIA 2V0TA 4HPJA 3QPYA 3TJXA 3TR2A 4LT9A 1SZNA 1ZCOA 1TIMA 1W54A 3B05A 1TPWA 1ICQA 1H7XA 5G4EA 4KFOA 1LYXA 1LBLA 2ZYFA 4X3ZA 4UFJA 1TTPA 5AC6A 4LY8A 3RMJA 1JCYA 4UTMA 3L66A 3QYQA 3MMTA 1KM3A 4OU1A 2NWRA 3EEGA 4GXMA 1S5WA 3R2GA 2VFGA 3A9IA 3GIYA 3C0JA 3G0SA 4QQ3A 4N4PA 2E77A 4JDYA 4O53A 2C1HA 4FNSA 4MJZA 3W2LA 3DBPA 3LCXA 1FWNA 4Z0SA 1XC4A 4CCDA 4DPPA 4PTNA 2I1OA 1R46A 4KWWA 3LCLA 1SU5A 3KHJA 4XZ9A 4WXZA 2WQPA 3E12A 3W7CA 1LROA 3BGJA 4UFKA 2RFGA 4IUOA 1OX4A 2QCFA 3HO8A 4JTIA 1AW2A 4LUIA 1K7XA 1SO5A 1QOPA 5CPMA 2FIQA 3P5YA 3CEPA 2AGKA 1TTIA 3ANYA 4C1KA 1ALDA 3CQ0A 2JKEA 1TO3A 1XUUA 2H8XA 4JEQA 3EXSA 4UTWC 4JYEA 5D02A 2Y89A 1H62A 4LU0A 1K3UA 3W86A 3NPXA 3QMSA 1SUXA 3CLMA 3HG4A 1DJNA 2X16A 3F03K 4WX2A 1TPB1 5KINA 2GQ8A 4Z1CA 1H5YA 1G4EA 5HWJA 2VEIA 3S9YA 4QNWA 1GQNA 3W22A 4O1CA 3DFNA 3Q37A 2H3DA 3DGRA 1LBFA 2NV2A 1W5MA 1YTDA 3PF3A 3W6YA 4Z0JA 3MWAA 1XKYA 3LXAA 5CZSA 1DJQA 4CQAA 2DORA 3C8FA 5D37A 4AWTA 3SZ8A 4LUJA 3NQAA 1ZAJA 1BTMA 1YDNA 2RDTA 1JUBA 5EMUA 1I45A 3F4WA 1ONRA 2EGZA 3STGA 4QAIA 5CG7A 3GNDA 5CZ0A 2X30A 5BMXA 3CC1A 1FWSA 3HQ1A 2A7RA 3VFLA 4A21A 1H1YA 3FA5A 3LHVA 1VLIA 2EAWA 2CLOA 1XDMA 5K9XA 1T8XA 1WOBA 3UWYA 2GQAA 4ZQMA 4AF0B 1OVDA 5EKYA 4AF0A 2GUUA 4L4LA 4ADSA 3CEUA 2P0OA 2QCGA 1H1ZA 4MOZA 3W7LA 3M41A 3IGSA 3TW6A 1QWGA 4GBUA 2A6LA 2VEPA 3GK0A 1WBJA 4H4IA 1KTCA 3TK7A 4QITA 3KRZA 1EUNA 1A5AA 1VQTA 2YR1A 3OVPA 4UTTC 3DFPA 4IQLA 3C61A 3K30A 3QMRA 4AEOA 3PSVA 3TFXA 4HN4A 4LC8A 1G69A 1TTJA 2A5HA 2ZA2A 1DKWA 1OYCA 2ZRZA 3EWZA 4MLRA 4N9EA 4XUGA 2JK2A 1OX4B 2VELA 2B7OA 4CCCA 3EWBX 2C19A 1G7VA 1OX5A 4M6QA 1CI1A 5F4XA 2QCCA 5J5RA 3NL2A 1EPXA 4GE8A 5CKSA 2ZCGA 3LB0A 3NYZA 4E2DA 4K8HA 2VEKA 1Z44A 1KFLA 5TBOA 1ADOA 4FF7A 3NZ1A 4HNVA 1VH7A 2BX7A 4AHQA
chains in the Genus database with same CATH superfamily
4NAEB 4UTKA 4DF0A 1AQ0A 4AISA 3IUDA 4HHPA 3B0XA 4M6UA 4FAMA 1PUDA 3IIPA 3VE9A 2CXGA 1BHGA 3A64A 3POCA 1LLOA 5HMSA 2CZEA 3KUMA 1ISYA 3GTIA 1KO0A 4AWSA 3U2ZA 3TP4A 1WAWA 2BHZA 1GG0A 4ACZA 3CIWA 1XLGA 4FXFA 3PAOA 2CBJA 4EOUA 1E0WA 1J2WA 2WANA 4GNJA 3EOLA 1VYSX 1WB0A 5C9ZA 1R86A 3VMNA 4WSJA 5GNXA 4MF4A 3K4DA 4QX4A 1A5BA 3PN8A 1KFCA 2Q3OA 3DECA 3W7IA 2P8CA 5FEWA 3SDOA 3W88A 3VTRA 5IDIA 4WKHA 4D8AA 1K8XA 4PCPA 2OX1A 4IMGA 5JIPA 3EPOA 2XGIA 3M0ZA 3N15A 1GEQA 2W4XA 2BASA 5EFFA 2ZUMA 3DIPA 2YW4A 2H9AA 4O0ZA 3MP3A 1K77A 4NIRA 4JICA 4IZGA 5A6MA 1V6VA 1BPLB 1JAKA 3N2BA 5I3HA 4D6GA 1XM3A 1EYWA 2X2YA 1FWRA 3T4CA 4TR9A 1XV8A 4ATLA 2ALDA 5J5DA 1E9ZB 1QI3A 4DUOA 3SN4A 3BW4A 1NOUA 2YB1A 3OA3A 3H7VA 3U5UA 3ID7A 1TELA 1UWQA 2PTXA 2GUBA 3W71A 3SQSA 5BYWA 1W3IA 2NSXA 3PZMA 2EG8A 3WQVA 4OIFA 4PODA 4AY1A 3C56A 2E9LA 3G0XA 1HJQA 4J28A 4PC8A 4RV8A 4NASA 3FLUA 2VVSA 4DXXA 4CNNA 1M53A 3W37A 1IT0A 1EIXA 5I03A 5TIMA 1F3EA 3LS9A 4OBRA 4QQUA 2A79A 3PR2A 4HZMA 1TA3B 4LOCA 4UZUA 1QI4A 2P3ZA 3GE7A 1H7RA 3VKAA 3UVAA 1XLEA 4H9YA 5HQMA 2BSLA 3NIYA 1R38A 5KZEA 2TPSA 3HQNA 4FNTA 3GFZA 1GPWA 1YXDA 3RPMA 2VEMA 1XG4A 2J7EA 1J11A 1H7PA 3RJYA 3EPNA 3CHFA 5AHIA 1P0BA 1QW9A 1B9ZA 3AXKA 4JTLA 5BRBA 3ZLFA 2I17A 4GFSA 5E6YA 1TREA 4ZOEA 1XPYA 4O10A 5M1TA 3GQYA 1WDRA 2YIHA 3S2LA 1E1FA 2HBXA 4ROPA 5LIUX 3HPSA 1RA0A 2GSJA 5DX7A 4DUVA 4KCUA 4NAFA 1TZ7A 4QJ4B 1HNYA 2DZTA 3T1GA 2WSYA 3W6MA 2A7PA 2O4QA 2IKHA 3ZSTA 4GQGA 2RKXA 5FEPA 3F4NA 4AIUA 3L12A 3SUWA 1JG9A 2FPYA 3B04A 2QKFA 4NX5A 1MNZA 3NWRA 4O57A 1BEUA 1PZ2A 1FY6A 1A5KC 1CWYA 1MUWA 1LOSA 1VS1A 2OPJA 4O17A 5E1QA 2OLAA 3T07A 3U57A 3QF0A 1V6TA 3W7GA 1UQYA 3ZWTA 3BUVA 3RILA 1PDYA 1ME9A 2HPMA 1VC4A 5A3HA 1YPIA 3LBMA 3AYSA 3CUZA 2QYGA 4D8ZA 1OFAA 4PMRA 3BURA 1A0CA 1KCZA 2CLFA 4U5IA 1P0NA 6REQA 1AQFA 2CBVA 3W1AA 2A0NA 1XBYA 3O6YX 3CH0A 3O0KA 3QTGA 2NV9A 3MUAA 4QISA 3TX9A 3LEPA 4MZ1A 1TPVA 2BVWA 3ITYA 1OX6A 3KTCA 3S5SA 1GYNA 3BH4A 3WDPP 1K9EA 3H55A 1R0MA 1TCDA 2VI0A 1JQVA 1DQWA 2JKPA 1H41A 4CNUA 3W7DA 3U8GA 3E0WA 3VX0A 2QAFA 5CG0A 4HIBA 1D3CA 1HVXA 4RZ4A 1ZP4A 1B3OA 3VNKA 1OYBA 1R3YA 1UUOA 3C2FA 4R27A 4C6BA 3G1YA 4GZIA 4MKSA 1TMLA 3K4WA 4P7QA 4JQ3A 4GISA 1OQFA 1JRCA 5L6UA 3CQKA 1TA3A 3IVTA 2PP3A 3AHVA 4LCSA 1S46A 2PBGA 2W66A 2WMHA 1OGGA 2V6AA 5C2CA 4XD5A 5A8MA 4V33A 3T08A 3VOJA 5FEZA 2I5QA 1IEIA 1ZZMA 2ACQA 3S6OA 2P50A 2Y4SA 4PMYA 5A6AA 1LM1A 4DLMA 3IUHA 2AAMA 5FF2A 4GQRA 3QOKA 1X8FA 3LENA 3M0YA 4X2PA 3U4AA 4QCFA 4TX8A 5EMJA 2C6QA 3URBA 2GJLA 3MTWA 1R3SA 1CXKA 2BOGX 5BXTA 2Y5JA 3AYVA 4FLQA 4Q8MA 1BVZA 1E56A 5D2VA 1X96A 3P3BA 3NGFA 2WPGA 4M82A 4QDWA 3DESA 3ARZA 1W3HA 1KM4A 1XRSA 2XVLA 1EDGA 4I7UA 3MI3A 4A22A 3QGVA 3S4TA 1C9DA 5IHSA 1UZDA 1OIMA 1D3GA 4R3UA 2QIIA 2XM2A 3V4BA 1KFEA 1EWDA 1BVWA 3MWCA 2OX4A 4NJHA 2YW3A 1DWJM 1US0A 4IQEA 1U22A 3N6HA 3LSBA 3ZLHA 4EXBA 4LVFA 1PSCA 1KGWA 4HA1A 1VYPX 2HDJA 4MIMA 2QPSA 1AJ0A 5I09A 1FOBA 3GDRA 3PZOA 1LLZA 1S5MA 1DEDA 1LG1A 2HMCA 3TN5A 4MG4A 1DYSA 1ZBCA 2J66A 2Z24A 3NQ8A 2D3LA 4XWUA 2PZ0A 4GNKB 3S83A 1ZAIA 4KETA 4Z2GA 4BQ5A 2RDWA 2PGFA 1PYFA 3TQPA 2DJXA 3T42A 3WNMA 4PGLA 2WKJA 2F8QA 1VRXA 2ZIDA 4HMNA 1V3HA 3GS6A 2OR2A 3G3DA 1X6LA 3MUCA 3ELFA 1I0BA 1XD0A 2YL5A 4NZ3A 3PG9A 1IV8A 3G0UA 4MGGA 1ZFJA 5EY5A 1Q7QA 5F2MA 1KM6A 1EJTC 2QVHA 1W8SA 5AHEA 1BGGA 2OGJA 3HG2A 3GWQA 2PLJA 1TCMA 3B40A 2YZRA 1EPVA 1ZP3A 4J3VA 1OFRA 1NWUA 4ECLA 4B9ZA 1E0XA 1Q45A 3B0UX 3F5LA 4EAMA 1XKJA 4O50A 2VKZG 4KRTA 3MJYA 5I00A 4IMCA 2J7GA 1E9YB 3UJSA 1BFNA 4IX0A 1JUKA 2B7PA 2E7FA 4NZCA 4PH6A 2Q8LA 4V2XA 2G95A 1K7EA 3RK8A 5B80A 2DT1A 4H3DA 3VOHA 3C2RA 2ZRXA 1GKPA 3S5OA 4PMZA 3ZIZA 4PUNA 4JTEA 3PJXA 1TZZA 4GJIA 3B9DA 3SI9A 3NVTA 3TTSA 3UZXA 3C3NA 3W74A 4GINA 2FVMA 4ZR8A 3U0HA 3T0TA 4FALA 3VPLA 3MPGA 1S2WA 3QC3A 3OVRA 2Z1BA 3ARYA 1HT6A 3I6EA 5DXYA 3BO9A 4DO5A 4FNQA 1KA9F 5TNVA 4GQQA 1H7NA 3WQOA 3NZRA 4BEUA 3R1ZA 2FLIA 3AI0A 1L9WA 4WGXA 5FJRA 4I9TA 4EXAA 4PB5A 5C8BB 3IANA 4W7UA 3G1DA 3TMLA 3EXTA 2OSYA 3PHAA 2XGZA 1MDLA 1E6NA 5C9RA 3FYYA 3T8LA 4DJED 2J7CA 1VBJA 1DWIM 3NQ2A 2NV1A 3O07A 3OZOA 2EJ1A 1EWEA 4MJ4A 5EMYA 3MBDA 2ZZ6A 4ACYA 4DWSB 1K9TA 9CGTA 1YIXA 4JYFA 1LZOA 5FJPA 5HUOA 3U2OA 4F2TA 3P2VA 1UPMB 2RH9A 3BLOA 3OYXA 1QATA 4LRTA 2PDYA 4EP8C 4JKMA 2A2IA 1LF1A 5FF7A 2AQOA 4PRTA 4LVBA 1O5KA 1AH3A 1LQAA 4DBEA 2Q09A 4PUJA 3W0KA 1C8YA 3MP5A 3UJFA 1IQ8A 2Y7DA 3S2CA 2P1FA 3AROA 3DCPA 4YTUA 4RXGA 1JCLA 2VCCA 3ENLA 4HJWA 2YL6A 4A3UA 3TOYA 2TAAA 3IWPA 4LEFA 1QOQA 2FMOA 2W27A 2VO5A 3I3BA 3MVIA 3ZJ8A 1K6AA 3HPZA 2R1PA 4W7WA 4CD4A 3DGBA 4O28A 2XVKA 4IJBA 2ZTKA 5EB8A 3WSUA 1SMDA 4R5EA 3MUIA 3D5HA 3ITTA 5FJJA 3BL3A 1I2QA 1KFJA 1SFJA 1SR0A 4LC6A 2BV9A 2C1GA 3HV9A 3HG3A 4LS2A 1JF5A 1NAL1 3N17A 2NXHA 6PTDA 4V15A 1A0EA 2A3HA 4MJMA 2GK1A 3W83A 4S3GA 2BFGA 2QCEA 2BWGA 4Y8EA 5HMEA 4O11A 4OE7A 3DC0A 2C1IA 5A6TC 3CL7A 3ALFA 3CZLA 3O1NA 1V5XA 3NQCA 4MZYA 1X97A 1V3KA 3UXDA 1Q4NX 3T81A 1JD9A 1M7XA 4DBSA 3KOWA 2ALRA 3GDLA 3JZUA 2BY3A 3PP7A 1NDVA 3MYOA 4UQAA 5A69A 5LA2A 1GOWA 4WY0A 1HKVA 2QIWA 5HATA 3OLIA 4OKDA 4U10A 1OG0A 3FS2A 4M56A 2NQZA 2VC7A 4R7JA 3E5BA 1THFD 2HSAA 3VD9A 5CJNA 1BKSA 3LU2A 1T0OA 5M5DA 4N0RA 4DJEC 1BWVA 4K2SA 3W4RA 5FAGA 2CLPA 2P3EA 3WF3A 2SFPA 1B4EA 1CTNA 4GMEA 4Q33A 1TE1A 2FGZA 1O5XA 3BAJA 4YN5A 4X9YA 3R43A 3AQUA 4JTSA 3I3EA 3BLIA 4GXWA 1OG6A 1SW3A 3GDMA 4KS0A 2PB1A 4V1YA 1OFPA 5AB3A 5U7SA 1N8WA 3PNUA 3M6DA 3N19B 3CUHA 1Z6KA 4E0CA 3BARA 4NNBA 3TE9A 2Y7EA 1Z48A 1SGJA 2L5HA 5AC7A 1HO4A 2Z28A 3L0NA 5KETA 1SFTA 4XAYA 1E1CA 3PB0A 4HYWA 5EA9A 2HBVA 3GBDA 2JEQA 3VMPA 4DNHA 4ENLA 1VFLA 1U1UA 3CTTA 1DE6A 1ONWA 5LXXA 2EHHA 3W1RA 3WQGA 1JR1A 1FHLA 1AW1A 3WLHA 1NTHA 2NQ5A 4B5NA 4MSSA 2IPFA 2V5BA 1WV2A 2F6UA 3P8IA 5EPDA 3BLKA 4GUJA 4CCEA 1HGYA 1ZU8A 3CV7A 3G1RA 1GUVA 2I16A 3NDOA 2ZXAA 3DC8A 3PULA 3AMKA 1CXFA 1UUMA 3WK2A 4AAJA 2ISFA 3PZUA 3W1XA 3VCNA 3HB9A 4QTGA 1U5VA 3TQVA 5D8ZA 3LCWA 4TU1A 2GK1B 3IIXA 5C70A 2ICSA 1HTIA 5CC5A 1OCQA 2QV5A 1E0UA 4XG1A 3GW0A 3KZPA 1EF3A 3HPAA 4RPQA 1F07A 2PI6A 4FZIA 1X98A 1KBIA 1L2UA 3R0UA 5DN1A 3VOGA 3D6NA 3MANA 4PCNA 1HF6A 2WLYA 3KHDA 5GQBA 1GVQA 4Q22A 2PLCA 4Y2WA 2QUTA 1OFEA 3LQLA 1EEPA 1XH2A 1XD1A 4WXYA 4DN1A 2OWWA 3DI1A 4JS3A 1NIUA 2EBNA 1GTEA 2PDJA 5HWMA 4H9VA 3HA1A 1E51A 1A3XA 1F2JA 4PTXA 2E6AA 4R53A 3ANVA 5C7VA 2J6VA 2VX7A 1KLZA 2IXUA 1VBGA 3QR1A 2W5FA 5FEXA 3TQKA 2WZTA 5GVJA 2E0PA 1F76A 1GNXA 2ZC8A 4N9BA 1VEOA 3C0QA 1QWKA 3GLCA 3VIIA 1A53A 3MQTA 3LBCA 4QE1A 1W9BM 1JPIA 4IISA 2OZ0A 1ZNNA 1QNOA 4CVWA 3RCNA 1P43A 1WXYA 2OKOA 1XDJA 4P7NA 1JDCA 4FOKA 5D9PA 3GB6A 1X1NA 4IIBA 3GO2A 4AD2A 4EWND 3DYPA 2IQDA 1Q6RA 2IW0A 3PZVA 3E0IA 1W91A 1K8CA 1TYGA 2ACSA 1KRCC 1REQB 4JTQA 4NNAA 4J9JA 3M44A 1BRLA 4K7VA 2JALA 1YBQB 3U6WA 4J1OA 1ZUAX 4O4VA 3RN6A 3W26A 5F2IA 1V6WA 1XXXA 3UPMA 3LGEA 4M7TA 3OOQA 1PAMA 4GRSA 2Q3RA 1XL9A 3SEPA 2A85A 3N18A 1ISXA 2VQTA 5CPOA 4IXHA 3JVAA 2JGYA 4FNRA 4X0NA 2CU0A 1NU5A 1QTWA 4GUGA 4AD1A 5I2UA 4JYDA 4K36A 4Q32A 4IP7A 4Z08A 4U3CA 3O16A 3ZWSA 1Z32X 3WX7A 4WY0B 3U7VA 3WN6A 1XLMA 5C2XA 1QW8A 5E9XA 2AL2B 4CD5A 3FW6A 2BY1A 5BMWA 5GPRA 1ZALA 3BVJA 2UWFA 2OGYA 3M5VA 3WBWA 3UZZA 2TYSA 3QR3A 1WX0A 3W02A 4RCXA 3CHVA 4GCXA 2XN1A 3OYZA 1XLLA 2DZAA 2Z29A 2Y5SA 3CNYA 2F7FA 1RXOB 4ZQCA 1EGMA 1XBZA 4IPIA 4IFKA 4AFYA 3GVVA 3WUBA 2EO7A 2GQ3A 3S47A 3FFSA 4HOWA 3AIWA 3SAZA 4YVXA 2IXVA 1WYIA 4RK8A 4IWWA 1A5OC 2YBUA 4A3RA 4UNIA 1VFTA 5DQPA 1A4LA 2C0HA 4B4FA 4Q4KA 2J9YA 3MZNA 4D1IA 3VZZA 3FIGA 3TYEA 1TJPA 4A3QA 3AC0A 2PP1A 2QJNA 1MW2A 1PVNA 2FZMA 1DVJA 1GHSA 1CECA 1VJZA 4PMJA 1FKXA 1MXDA 3PM6A 3RX4A 4WEVX 2GLKA 1J93A 2C16A 5AZ1A 2P8BA 1TMQA 3QSTA 1TJRA 1ZTVA 1KGXA 2BB0A 2ZRWA 1GKQA 2ODOA 2R9RA 1JZ6A 3U48A 3BSHA 4WGHA 3UXAA 1DJGA 1DIKA 2CC0A 1YLVA 3CMJA 3SECA 1NDYA 2ESCA 4LAKA 3VOIA 1EBGA 1QBBA 4ORIA 3BOFA 3EXRA 5C54A 2DW7A 3CMGA 4FO4A 4Z2JA 3W9ZA 1XWYA 4JN8A 2X8RA 3UNDA 4HPHA 3FJ4A 3F2DA 4TX9A 1PZ1A 2PCQA 1I2RA 5F4SA 3AS0A 4E8GA 5K3VA 1VF8A 1GTHA 3FKRA 1FHVA 5LXEA 2O0TA 3BTNA 1WKEA 4LVDA 3QQ1A 2Y85A 4UXDA 3T0BA 4QEHA 5IDZA 4L5ZA 1FX6A 2G4FA 4OV4A 2PDIA 5CJMA 1KV8A 1TSIA 1HUVA 1XCFA 5T9BG 1W3JA 3AMDA 3CZEA 3NA8A 3QFEA 2Z0IA 2NUWA 2DP3A 3EMQA 4IL0A 1H3GA 3CU2A 3L4VA 5E9AA 5AN7A 4HA3A 1FQ0A 3FDKA 5L9FA 3OO2A 4BF5A 2FFCA 1LOLA 5DMNA 3ATZA 4XUYA 1UC4A 4MJ2A 4DZAA 2QV4A 1GOQA 1N2VA 1X38A 1Y65A 4LWWA 3FA4A 4WD0A 1MRAA 1OFQA 2V2HA 4HYRA 2Y8KA 4MADA 4B15A 2YCJA 4PZVA 4GHRA 3JUGA 3BCDA 2ASHA 3QJAA 4IT1A 4FOJA 5CAHA 2MANA 3W23A 1GVEA 3W87A 3TYAA 4GFIA 2TODA 2O9OA 2YFOA 2BVTA 1TPH1 1XUZA 3TAKA 1LOQA 1M9HA 4DWSC 1BF2A 2B81A 4Z2LA 3T8QA 3UZ5A 4IICA 3IPWA 4D9PA 1CGXA 1ZBVA 2DUAA 3LCGA 2ZVIA 2PGRA 1EDTA 5G1MA 3CQIA 4F2BA 2V3DA 3OA5A 3CBWA 3PZIA 3E5PA 1C9WA 1CGWA 5LIWX 1XSJA 1MEWA 1EP2A 1M6JA 2UV8G 3GH7A 4ZO7A 5D05A 4PCFA 4RE3A 3L0KA 4Q4SA 4OWGA 4MB3A 2Z00A 5CQ1A 2J74A 4MB1A 1HFBA 3THCA 3K1GA 3OGVA 3ITOA 1XGZA 3OGRA 1NDZA 4RNHA 3NQEA 3F2BA 4DIAA 2R94A 2P88A 2PDWA 3T0AA 4W4QA 4AVOA 1XRTA 4UFHA 4YPJA 1HKKA 1VJIA 2R1KA 2CHNA 2QHAA 3STPA 1TPUA 1AL8A 1JDAA 1JF6A 4FI4A 7ENLA 4UTHA 1M5WA 2BS9A 1JIBA 3K1DA 2WO5A 3OQEA 3OVGA 4YXGA 3VE7A 3CV6A 3LERA 1QO5A 1XFBA 2WZEA 1X6NA 4DHGA 1WZKA 2WM1A 4LV9A 4EANA 4ZSUA 3PBMA 2QDHA 1F3XA 3VKKA 3P81A 3STFA 2CLKA 4JTFA 2I9UA 1B5TA 4US5A 4D8LA 1UWTA 3N6QA 4K6AA 5AVNA 1BYAA 1R87A 3IAPA 5H1WA 5BNKA 4INFA 3QHMA 2PFHA 3E02A 4GJ1A 1EJ7L 3GTHA 2QCNA 1W3LA 2XYLA 3AMGA 1Y5XA 4LYQA 1D7KA 1A5MC 3LBOA 1P48A 3UXIA 5TAOA 3QPYA 3TJXA 2VZUA 1JPKA 4AWEA 4F79A 4B4HA 1SZNA 3WF4A 1XLFA 2X40A 1ZCOA 1A0DA 1TIMA 1W54A 3QPEA 4KFOA 1LBLA 4UQCA 3SCUA 2VDHA 1JCYA 2Z2AA 2NWRA 1GHRA 4GXMA 1S5WA 3EEGA 3GIYA 1UIPA 3G0SA 3HJEA 4QQ3A 5H6HA 4N4PA 2GVEA 3AUJA 3QR0A 4Z0SA 5TF0A 2Y2WA 4PTNA 4LY4A 4XZ9A 4K8GA 3POHA 5PTDA 2WQPA 2O92A 5E70A 3W25A 4IUOA 1AJ2A 1OX4A 2QCFA 2CKSA 4G1NA 1LL7A 3T05A 1V6YA 2ZX8A 2HVNA 2AGKA 1A3HA 1O68A 1TTIA 4C1KA 1ALDA 3KS5A 1RK5A 2H8XA 3ZYZA 5CGMA 3BLLA 2PWUA 4JYEA 1K3UA 1TJ0A 3CLMA 3ABXA 4WX2A 2EPKX 4EAYA 1QHPA 4HPGA 2GQ8A 3KL0A 3RLGA 3VGBA 4AVNA 3TONA 5HWJA 1BQCA 1GONA 2H3DA 1TJ1A 3GH5A 2PWFA 1KGUA 4B92A 2QULA 4Z0JA 3MWAA 3M0IA 4LBSA 4HB7A 5CZSA 1Q6EA 4MAZA 4RW5A 3UU0A 6REQB 4L1GA 1E55A 6TAAA 2DORA 3C8FA 3CMFA 1NFGA 3S9ZA 4XIAA 1ZAJA 3TYUA 2BHUA 4NG3A 3E2VA 1JUBA 3IJQA 3STGA 4Y9OA 3QN3A 1Z9AA 4EWJA 1GVYA 2A7RA 1UD2A 1IZJA 2CLOA 1PYMA 1Y7VA 2F2KA 2FMNA 4FF5A 2GQAA 4ZQMA 5EKYA 2GUUA 2OXNA 2VGIA 2P0OA 2QCGA 3VD3A 1FWAC 3IGSA 2ZICA 1W1IE 5BXSA 1TV3A 4A8NA 2A3EA 1EUNA 5M17A 1A5AA 4IQLA 3C61A 2PWHA 3G6LA 4QCEA 3QMRA 1R5YA 3GY1A 2FZBA 1MDRA 1EJXC 2A5HA 2MNRA 2ZA2A 4O0QA 1VKFA 2CBUA 1KBLA 1B3XA 3BJSA 1CI1A 4GY7A 3SCOA 5F4XA 5J5RA 3NL2A 5A6JA 1YQ2A 1R3WA 1UP3A 2ZCGA 4EPKA 1OIFA 1KFLA 2O9PA 3NZ1A 5MKGB 1UPPA 4DI8A 3GSMA 3IJ7A 4W93A 3WQCA 3N9RA 2Y88A 1KM2A 4LUTA 4A4AA 1HL8A 1Y5VA 3N13A 2A4AA 3TZFA 6A3HA 3RX3A 3VGGA 1F6YA 1TWZA 2D20A 3EBVA 4JPGA 4MLJA 3NO1A 2GGJA 1UIOA 4NJJA 2OU4A 2E1WA 2GJXB 2HCVA 4MWAC 1TV4A 2W3ZA 2Q8ZA 1UH2A 3QVQA 3VABA 3W7EA 5FI8A 2ATSA 3LGDA 4IGMA 3SRKA 3S1WA 4OUEA 3V0SA 2QF7A 4E38A 3G8RA 5AYBA 4DELA 2DY3A 1UA3A 1GG1A 2DZBA 3VGEA 2PDMA 5CGQA 4G5DA 4L64A 2R91A 5C5YA 5G2WA 4FIQA 4M24A 1HGWA 4M3PA 3PJWA 2E5BA 4HK6A 2YSWA 5A6KA 5I78A 4LTSA 3LUTA 2QMKA 3P7YA 4DBUA 3NR0A 3AZTA 2QGYA 3BW2A 4QAWA 3UWUA 3KE0A 2Z7KA 3FSUA 4MVAA 1DHKA 5CGTA 2BGQA 2XN0A 4HZ8A 3SGZA 3ARSA 1E4IA 5DMMA 2VEGA 1SM9A 3LYEA 1UG6A 1KM5A 5FESA 5T8GA 1VBUA 4EX4A 4QS5A 4F40A 2I5IA 1N8FA 2JF6A 4JTCA 1W2VA 3URNA 4ZGYA 1I9CB 1HW6A 1MW1A 2RAGA 1E1EA 2HK1A 4U2ZA 3B0YA 3ITXA 4WIWA 3GU2A 3RRAA 2NVAA 2XGBA 5KZMA 3D0CA 3K4AA 1MW3A 3A5VA 3PPCA 1IZKA 2AMGA 3FSTA 4FS9A 1MVYA 3KVJA 4G7EA 3RG6A 3WY1A 4E2VA 1JJKA 3LPOA 2DZWA 2PDQA 1AD4A 4GUFA 4MTVA 3P5ZA 4ZB5A 3TYCA 3GXTA 1QW7A 5CPQA 1BTCA 1RHCA 4KMQA 5JQ9A 1AMYA 3GVRA 1V6XA 4LNYA 2E5CA 1DTUA 3FA3A 3QHNA 4IFRA 5DBTA 3S1GA 2J6XA 4UMAA 1JPHA 3I4KA 4DAFA 2QCDA 4I8DA 4D71A 1RY8A 1D9EA 1TE6A 3RAOA 3RUBL 2WBKA 3GW3A 4J5NA 5JH1A 2DFAA 1XISA 1TV8A 4M1BA 5BXPA 2WNNA 5EL1A 4GIYA 1XICA 3A13A 4LAOA 1XGDA 5DMLA 4ZBCA 1ZBWA 4AY7A 2ZRYA 3P8JA 2DZUA 5BRQA 1H11A 4M1RA 3E2SA 3LNMA 3WJYA 8XIMA 3GBEA 2YDRA 5SWUA 2VT0A 4QE4A 1KR0A 3NQDA 2CZFA 3H53A 4P2VA 3PTKA 1VB9A 3NSNA 3LLDA 3PS7A 1QHZA 2A6NA 4MFDA 2WK2A 4P7LA 3P0XA 3W7MA 4DUXA 3JU2A 4QGCA 3L5AA 1B0IA 1F5ZA 3OIHA 2XIJA 2DZPA 1JUEA 3E9AA 4PR4A 1OF6A 1NY1A 3CAQA 2QJIA 3WDRA 4YS1A 2XSBA 1OC7A 3LSCA 5EMLA 3DDMA 1IIGA 3W7KA 4Q6JA 3II1A 4JTKA 3VNLA 2XVPA 2E6FA 4KEZA 1TV5A 4D6HA 4KF1A 2X41A 4JD4A 1M01A 3TA9A 1ZSXA 3TTYA 2OTDA 3B97A 4IM4A 3CAVA 1B3WA 3H24A 2WMFA 3S1VA 1UH3A 2GJRA 5D04C 4XKMA 3QMTA 4FIRA 3EDFA 3DFQA 1VFMA 2PP0A 2J78A 3C5QA 1IT8A 1RBLA 4JKLA 1KBBA 5HANA 2YDQA 4BWLA 3GR8A 2GDVA 1WAUA 4NZ5A 1WUFA 1M1BA 3WQ4A 4GJJA 2PD9A 3ZOAA 1UKSA 3L67A 4IMDA 3VA8A 3ZJ7A 1KQZA 5A5WA 4WR3A 5FF4A 2WLZA 1ME8A 3UY8A 5BCAA 2J79A 4GH1A 4MMWA 3C2YA 1OHLA 2IPGA 2HXTA 3H12A 4NNCA 3T9PA 3R25A 3TNOA 3IRDA 3IVUA 4LX4A 1ZGDA 3FDGA 4AEFA 1QBAA 3UF9A 1LRTA 2YBVA 4UQ9A 2H90A 1TJ2A 4HHHA 3B8VA 1DWHM 1FWHC 4MY1A 2D0FA 3CUIA 4E4PA 1XINA 3M5XA 4WDUA 5F4WA 1JZ7A 2EPNA 3G5EA 2VGFA 3OLEA 1JXKA 4QBXA 3LRMA 4KPLA 4RX0A 2GFTA 2B31A 2P53A 5GJMA 1Q63A 4UMCA 4MUPA 3E6EA 3TC3A 1QPQA 4KGLA 3ITLA 1VFUA 4FX6M 3PG8A 4H6QA 4IP5A 4NZFA 3L0GA 4R9OA 4GI4A 3OLDA 3W38A 3WNOA 1LL6A 4AHOA 4CQDA 5U4NA 3TZNA 2WCSA 1P1MA 1EHAA 4NZ1A 1T41A 3PJTA 4PUEA 1E73M 1HKIA 3TAOA 4AU0A 1Q2RA 4JCLA 5F2GA 8CGTA 4S3EA 4XD6A 2DEPA 3NFUA 4GVIA 3AISA 3BMWA 3D3AA 2DSVA 4H6KA 1H7WA 3V3WA 1G4TA 2E28A 3VKBA 1H63A 1OC6A 2X0SA 4IMAA 1UR1A 2HV5A 3PPHA 2EF9A 1FFQA 2WMIB 2D0GA 3VDHA 3QKEA 3QTPA 1VCFA 3WELA 3IIZA 1RZMA 1VRDA 2FQIA 2D69A 1V02E 3K8KA 4HN8A 1M65A 3O2LA 3BZGA 1VYRA 4MFEA 3W1QA 1HKMA 4DJDD 3VKDA 1ONXA 1RY0A 4CKQA 3PBVA 1RJPA 3SM0A 2HK0A 5HAOA 4LF2A 3W7QA 1F6PA 3CZGA 4PULA 2YDAA 4YCPA 5LIKX 4CGTA 1UOKA 4DJDC 2P0IA 5I06A 3MS8A 3O63A 5AOUA 3L4TA 1N7KA 2WSKA 4ILSA 4X0VA 3ZM8A 1AJZA 4H41A 2BOEX 2CIPA 2FZNA 4FOUA 4Q4RA 2DVXA 5F7UA 1FA2A 3CWOX 1ICPA 5HNRA 4XO6A 5HDRA 4WJ8A 3THQA 5A6LA 4K3ZA 5BW6A 4KT2A 4X22A 4YJ5A 3I7RA 3BWWA 2OT0A 3KM8A 4CNPA 3KCJA 2VUNA 2ZZ5A 1V93A 3STEA 2A3BA 3KP0A 4RJEA 2FVLA 1RA5A 1XS2A 4F2UA 6ENLA 4GG9A 1PXGA 3O9NA 2ZXDA 3N3MA 1R6WA 2BOFX 2PDKA 4L6HA 4QJ3B 3N2OA 4I5UA 3URQA 4QLJA 2DH3A 3C52A 4H9UA 4ZOCA 3VC6A 3MVTA 4MY9A 2GVJA 1IGSA 3H2MA 4BJHA 1XIJA 1MQRA 5E6ZA 2PDCA 3KTXA 4C6EA 5JMUA 1G7UA 1HVQA 3CGTA 2XUCA 4HVXA 5FOOA 3T4WA 4L80A 2Y5EA 5BWAA 1GOKA 3KXQA 2JBMA 5T91A 2DQWA 4PFMA 3CIXA 1XBXA 2PRHA 3MSDA 3KBJA 2FPTA 4IFOA 3F4CA 3VCRA 3SW6A 3IRSA 1V08A 2QUNA 4ADTA 5DMYA 3WDQA 3M7WA 5LGZA 2Q8XA 1PKYA 4DO4A 3M0JA 4D2JA 1EP3A 2GSHA 2WYSA 5G2HA 1QAPA 2ZBTA 1PWLA 3WF1A 3CXOA 4C6KA 2WJEA 1MQQA 2YDSA 2ZZ4A 1J5TA 5HXMA 7CGTA 1KV5A 3WDIA 4EKJA 3UXKA 1E15A 1XLHA 4NP7A 3KRUA 4L4MA 4DWSD 3WD0A 4XX6A 1YPXA 4XZLX 4XBJA 3RFAA 4JHZA 1WKFA 4NAEA 5HNUA 3FJ6A 1ZENA 2VWTA 4CUCA 3ARTA 3EWCA 1VFHA 1WBHA 3UCQA 3BSMA 1CGVA 5K2ZA 1G4SA 2J9XA 3FEMA 4H04A 4X60A 1RCXB 3DYMA 1ZBKA 1W5OA 1Q6QA 4US5D 5J04A 4P61A 3MMWA 4NJKA 1CXEA 4L9XA 4U31A 4DYJA 4TIMA 3EKLA 2Y0FA 2Q01A 3W29A 1GYMA 3GHUA 1V7AA 1FXQA 4FSAA 2E9BA 4F3HA 2F9RA 1W3NA 1P0KA 1FP9A 2VP8A 2IQTA 2WMIA 4AH7A 1KR1A 1CLXA 3TMQA 4EACA 3LZ5A 3AHTA 3P82A 4BQ3A 2GL5A 3T0CA 3DKJA 4BZYA 2DT3A 3PNZA 1ISWA 2B7QA 1JYXA 4KWSA 4WOZA 1EC8A 2J88A 4RZBA 2VWSA 4IMFA 3QH2A 3BAKA 1P0EA 3EA1A 1QUMA 1W3KA 5KEZA 4WLCA 4EPBC 2VC6A 4IFKB 1YTKA 3VIJA 3L7RA 4I7VA 1J0IA 4PEKA 3GVQA 2W0UA 2QPXA 1X1ZA 2VC9A 3EWXA 1V0KA 5I07A 1J79A 2VFEA 1XYCA 4IIEA 4RE4A 3A5FA 3GYEA 2PLKA 4JTAA 3WH7A 1VIZA 1E9LA 3H7UA 4LS1A 4NRSA 4IGNA 1AZ1A 1B1YA 1A5UA 3KFTA 4JTRA 1GZ1A 1OCJA 2J7FA 2Y6ZA 2QS8A 3WFZA 4FPSA 3U2CA 4O1FA 3WLOA 3VNMA 1PZ0A 4C6NA 4JNZA 2WSRA 2CLLA 4OGZA 4W85A 1LRQA 3GNPA 3GXMA 2DZSA 5IXEA 2IKGA 3VNYA 3V5FA 2BVYA 4E6MA 5HR7A 4AZGA 5C7HA 3WF2A 4UOQA 3EDKA 3H21A 3HV8A 5HOSA 4REQB 1HKWA 3PUOA 4AVFA 1XW8A 1W9UA 4Z1AA 1TUFA 4A8IA 1W2PA 1H50A 3IVSA 4ZO9A 2OJPA 5FJOA 2DIJA 3G8EA 1NFPA 1MXGA 3N2TA 3TU9A 1FWDC 1DJIA 3WF0A 1FWCC 4PBGA 4DF1A 1BSIA 3F5JA 3LOTA 4QLKA 1P4CA 3OODA 1ADSA 4JN6A 1FH9A 4J27A 3U7BA 3L2MA 1UBPC 3BW3A 1GQLA 4C65A 3SCWA 3JW7A 1I2NA 3EOOA 4CQ8A 1GVRA 4EXQA 3WBYA 5EGRA 1KLYA 5A6BA 2I5GA 1SJCA 4TUFA 3UY7A 3VDBA 1SZFA 1XIFA 5CBBA 4CEXC 5I3IA 3PWIA 4LYRA 4QM1A 4YVPA 5JU6A 1DV7A 4KIEA 3K5XA 5GNYA 2VD8A 2J8TA 1VIWA 3B03A 1OM0A 1JGIA 3ARPA 2V68A 1EGVA 3WIJA 3APYA 1YNYA 2YBTA 1JFXA 1Z3NA 3KDOA 3H2FA 2DV0A 5FA5A 1SW7A 1B2YA 5AECA 2CERA 5G4WA 4GYPA 4UIOA 2FDMA 4LSBA 5AZ0A 2A3CA 2VTFA 1R8LA 3LHTA 5HK4A 2GOUA 2DUZA 3WD1A 4PSRA 1FWTA 3UWVA 5FSEC 3ARQA 2WQDA 1NP2A 3WJXA 1UR2A 3RCYA 2DH2A 1S3TC 5E0CA 1H7OA 5H8MA 1IEXA 3G18A 2V8ZA 2UY2A 1V0MA 1SFLA 4A6GA 3NO5A 1SJAA 3E3HA 1DXFA 2HTMA 1ITCA 3M07A 3VZXA 3DERA 3LXCA 4W5ZA 3VD5A 2FHCA 1J6OA 3WYZA 3EMCA 3B9OA 2DVUA 4LRSA 3EWWA 1RQEA 1L6FA 2W92A 6TIMA 3TYBA 1GQKA 4QROA 4GQ0A 1TB3A 3FEQA 1V8EA 5DFAA 3T78A 2NQJA 4R33A 2ZX6A 5I02A 4QS6A 3LRLA 1WDPA 2WVTA 2GPTA 2CKRA 1WDDA 2OLHA 1KB3A 4QSHA 2YCLB 1XLBA 3E0VA 4FX8A 1UD3A 5HINA 4C6IA 3UYIA 4JFSA 1XP3A 4NYUA 8XIAA 1WZMA 4ICMA 5K9CA 2NLIA 4DM2A 4L6DA 2XH0A 4XVDA 1E9IA 4FMVA 5EBUA 3CM4A 1KCKA 1UJPA 1UOZA 4CNSA 1JNEA 2YPIA 3LM7A 2FB2A 1JZ8A 4E4FA 4HKPA 3RIKA 1LLWA 3U2EA 3W1NA 2CHOA 3SFKA 2V5JA 2C79A 3DG6A 3ZLGA 3AZRA 1M3UA 3CHEA 1Q8JA 3KZSA 3TCEA 2FTPA 3VIMA 4A3YA 1O6IA 1GGOA 1U30A 4WSKA 4OBTA 1F9CA 1HO1A 3H4XA 5KITA 1TRDA 2YL8A 1V3MA 1ZJIA 3TR9A 1OGSA 3H22A 3UWZA 3ITVA 1E5NA 3EX2A 3S5NA 4JAWA 2NZLA 1QI5A 2BTMA 2I9EA 3W2MA 2ZA1A 3LTSA 4GYKA 3JRKA 3AIRA 2C18A 3UZWA 3OJGA 2Y8VA 3L4WA 3GU1A 3E0FA 4C90A 3REQB 2VM8A 4GZJA 1LL4A 3EWUA 2ZZ7A 4C6FA 1V79A 4OT7A 2FB3A 1GJUA 4O16A 4ZMGA 3F7JA 3MV11 1DJHA 3QV6A 3BOLA 3LD5A 2EJAA 1XDLA 2VRJA 3H2OA 3KEHA 3NOYA 2E09A 3NQMA 4O52A 4ZZ9A 2NWSA 3LPGA 3IJLA 1OBAA 4WVXA 1C29A 6XIMA 3TTEA 1YNQA 5LSMA 2ONEA 2PCEA 1TV2A 1BWLA 2ZC1A 2E1DA 2X2GA 4C5YA 3A23A 1RK6A 3H2CA 2GGEA 2H9AB 4XTDA 4Z2IA 3GIPA 4AD0A 1OFDA 4KRUA 3SUSA 4NHVA 1OABA 2QMJA 3CYJA 2QCLA 1OCBA 4AXKA 4F0HA 3LHUA 1OFOA 2O55A 2GVLA 1H09A 1SFSA 1LQ0A 4L6OA 3VIGA 1ME7A 3DFSA 5LNWA 1F3WA 1KTNA 3DHFA 1T8QA 3CT7A 1RD5A 1NOFA 1U1HA 5FJIA 1CCWB 2VURA 2VFIA 3C4UA 3E0LA 5KSWA 3WLIA 2G41A 3AIVA 4LW7A 4LUTB 4RDZA 4I3GA 5C2GA 3S3GA 2VYOA 4HTYA 2PBOA 1TPEA 4CN6A 3O8AA 3BG9A 1SZRA 4Z1DA 1V7YA 4UZSA 2UBPC 4NXSA 4H8NA 3P6LA 2H8ZA 5LKYA 1F74A 4XAFA 4QXIA 1DE5A 1WKYA 2O56A 2WVVA 4QDPA 3W76A 1M04A 1H5VA 2BGSA 4JIQA 1TMHA 5IFPA 3RR4A 4S2BA 1G1YA 4NX0A 3GNRA 4JFVA 1KBKA 4XD4A 4XBKA 4PMUA 3AUOA 5D2XA 3Q4DA 4RNIA 3G22A 4NU7A 4PSPA 1NFBA 1T5AA 3B06A 1XJBA 2YCLA 1Q7ZA 3AXMA 4PEEA 1Q66A 3SO7A 4UTIA 2DSZA 4H83A 3S1XA 4RW3A 3H6OA 5HULA 4C1LA 2OWXA 3PBUA 1W9PA 1KWKA 3EPMA 1E4MM 2FVKA 1US2A 4QDMA 4ROQA 3CB3A 4IX2A 3Q67A 4JNMA 5M03A 1JQXA 4L61A 4M8UA 4NAFB 1XBVA 5AYIA 3V0TA 4OTKA 3CTLA 3FK4A 2V5DA 2ZWYA 1ZJAA 3O06A 1L6YA 3KL5A 5CSSA 4AXNA 3RYSA 4J40A 3AIQA 4XD3A 4XZHA 1UZ4A 3KCOA 5G1TA 1KNWA 2Q02A 3W2JA 2WNZA 1MNSA 3HOJA 4RKAA 1A47A 4B2DD 3HU7A 3R4IA 4HJFA 2Z1KA 2J8FA 3NSXA 1NDWA 5D9NA 4BI7A 3RU6A 3USBA 1ODZA 1PS9A 1RAKA 3UXLA 1J96A 1OZMA 1QNPA 1IWAA 3IAQA 1G0CA 1HP4A 3ABRA 3MJMA 3LI0A 2GVYA 4N9DA 5F1VA 1C92A 3NQ6A 1UWIA 3BK0A 4ML9A 2GZXA 5CBJA 4JTGA 3LXBA 2FJUB 3SGGA 4XKYB 4DO7A 3M1ZA 3TJ4A 2YLAA 3MCMA 1XQKA 5CLTA 5MHBA 2O4MA 3WO8A 2W62A 4MYXA 3R12A 2REQA 1JDEA 2A7NA 3C2EA 1MXSA 4L56A 5CXPA 3L4ZA 5HPCA 1YPFA 3EDEA 2Z25A 3GKFA 4FLRA 3D46A 2DSWA 4CU8A 3P84A 3A3XA 5B7ZA 3GHSA 3BICA 3QZ6A 3HF3A 5T9CE 1EHNA 3DFHA 4ERGA 1CGUA 4KKXA 4MYAA 3WDJA 3B0PA 3BQ5A 1D7FA 4L1WA 1GT8A 2DT0A 1PB0A 1AZ2A 4H2CA 4YMZA 4NF7A 5I3JA 3PB2A 1DBTA 4AY8A 4RLIA 5DXXA 2G37A 3PWAA 2WC3A 5H91A 1P6BA 3N6JA 4S3KA 5AYYA 1FWFC 3AS2A 1GOXA 1DL3A 3G1VA 2PDGA 5BROA 3SCSA 2QDEA 1VJSA 4WUIA 4HPJA 4B3LA 3UT0A 1DQUA 1L8PA 1R9YA 4LT9A 3HFTA 3WUGA 4G56A 4JHOA 1ENUA 3B05A 1TPWA 3E38A 5G4EA 3CV2A 4ERIA 4KIRA 1LYXA 2ZYFA 4X3ZA 2ZOXA 3LMYA 1TTPA 4C7FA 4LY8A 3AS3A 3WEOA 3RMJA 3MUY1 3SCPA 1DXEA 3VAVA 1S39A 1RBOB 4MB5A 3EA2A 3R2GA 3A9IA 1QK0A 4W89A 3V35A 2C1HA 3HQPA 1OD8A 4RUBA 7TAAA 4BY3A 3DBPA 1FWNA 2FHFA 3ARXA 2I1OA 1R46A 3MT1A 3WQFA 3ITGA 3W7CA 3BGJA 1J0ZA 2JE8A 3HO8A 2Y8UA 1SO5A 1ZLPA 1QOPA 5CPMA 3VIOA 1PKMA 3LQGA 4LPCA 3CEPA 2VC5A 1Z69A 2PF0A 3CQ0A 5FSDC 1S2TA 2JKEA 1TO3A 1XUUA 3C86A 3VVGA 3TWBA 3W86A 4LB4A 1QXLA 3CZ8A 2G3NA 4GNVA 4Z1CA 1H5YA 3VGFA 3ONBA 4XZNX 3FCPA 4ICCX 1LBFA 1W5MA 3K2GA 2YZ5A 4KWUA 3OLGA 3AYRA 4B5SA 2AQVA 4MNMA 2EKGA 2WC7A 4UWMA 5EU9A 2INZA 3NQAA 1EJUC 4F4RA 3XIMA 1BTMA 1YDNA 2RDTA 2ZDSA 3A4AA 5EMUA 2EGZA 4QAIA 4GPNA 3OBAA 2I56A 4PUDA 4H9TA 3G77A 3QGAC 2X30A 2AL2A 5BMXA 1FWSA 3HQ1A 3VFLA 2BGNE 1VLIA 4TTGA 3RX2A 1XIIA 2EAWA 2HPIA 3ORWA 1T8XA 4GC3A 2Z26A 4Y7EA 2QT3A 3WMBA 4AF0A 3UR5A 3M41A 3DOPA 1QT1A 2RGMA 5BZAA 2J62A 2VEPA 4H1ZA 1KTCA 3O6AA 1VQTA 3OVPA 4B5TA 3C0LA 5CEWA 3K30A 3PSVA 5A8OA 2YJQA 5A8QA 3WNKA 2O9TA 3U3HA 2QJJA 4AZ7A 2FZ9A 3B8UA 3ISIX 3THUA 1R3VA 3WH9A 1MW0A 5I6SA 3VZYA 2WCGA 4DJFD 1WZLA 2C19A 3BE7A 1G7VA 3NCOA 3N4AA 3TN3A 3FN9A 2XIQA 1X8CA 1YDYA 3XINA 5CKSA 3CL6A 3CJPA 3M0LA 1PKNA 1UKQA 4D72A 3DG7A 2XH4A 3WBAA 1JXJA 2REQB 2HXUA 5D9OA 1UR9A 1ADOA 4DX3A 1VH7A 4DJFC 5FD0A 3CT2A 4IPPA 2Z2BA 1EDQA 3MCNA 4UOZA 1FH7A 2BG5A 3T7VA 4NZ4A 1IHIA 5HNTA 2XPKA 1Q5MA 4FX7A 3AOFA 3M0XA 1P6WA 5D09A 3OVQA 1FWIC 4Y9MA 2GVGA 1T7LA 2QCHA 5D33A 3W81A 3GNOA 2E5DA 4CQCA 2GGHA 3M43A 2YA0A 3THDA 1W37A 4GCAA 1Q13A 1UKTA 3BMVA 3GX9A 2ZKMX 1VPXA 3H23A 3KVMA 4F66A 3WD4A 1DOSA 2Z7GA 1L6WA 1UD4A 4YL2A 4GY0A 2X05A 3G1SA 1JFHA 3OQ8A 1R47A 4EPDC 1JNDA 3BV4A 5JBFA 2CLMA 4GX9A 2XFFA 2V38A 2V63A 2OOFA 1I75A 3TYDA 2OQHA 3OIXA 3QM3A 4P8VA 4ONVA 1OYAA 4RXFA 1LTDA 3BG5A 1E72M 4U4MA 2X0HA 3SY1A 3S9IA 2BVDA 3UERA 5AFDA 1QNVA 3VOCA 4G2DA 3EWYA 5ENLA 2X1SA 1F8IA 4UR8A 4HOZA 4M5PA 4CD7A 4KW2A 3VYLA 3G3MA 4AX7A 3WDHA 3SQLA 3KBWA 1L6SA 4RDYA 4I9MA 1SJDA 2R1MA 1HP5A 2ACRA 2WHKA 4PL1A 2ZX7A 4B16A 4B5WA 2J75A 2V3EA 4PCTA 1AD1A 4NRRA 1DTNA 3DHUA 1W3TA 4G9PA 3MA8A 3HMJG 2G3JA 2E40A 1R7OA 2LLEA 1WP6A 2Z27A 1W31A 2XIIA 1H60A 2PU0A 1EA0A 4O1BA 5DY3A 1KCXA 4HZ6A 2PWGA 2ZUTA 1GVOA 3G24A 3FJNA 5GJPA 3VI2A 1F61A 3TN4A 2HNHA 1JCJA 1EO7A 2YLLA 3NQGA 2XVNA 1J8VA 5D2YA 3MC5A 3O6DA 1LBMA 1ZRQA 3P60A 4QE5A 2PA6A 4J3XA 4HBKA 1E71M 1FCUA 1TKKA 2TRSA 2E6YA 2V5CA 3ABZA 1W32A 3A6OA 4N7QA 5D9MA 5E0KA 4Q4MA 2J4GA 4HT3A 4JBRA 4W86A 1U5HA 4E8CA 2OMAA 2X0YA 3DI0A 2Y62A 4BA0A 1PE1A 3GDKA 4GVFA 3WJSA 4M81A 4BHYA 5CZTA 3V1PA 3SRFA 3EB4A 3WLMA 4HNUA 1SJBA 4G7EB 2WHJA 3QBUA 1UR3M 3WK1A 3DFYA 1ECEA 3R10A 1XYLA 2NX9A 1EXBA 1QPNA 3EAUA 2OCZA 3G1HA 1UR0A 1JPMA 1NWSA 5FF3A 4WY0F 2VJXA 2QW5A 4LV4A 1NVMA 1WPCA 1F4AA 5DCBA 5AY7A 5JBDA 2XISA 2WJFA 3BXWA 3FAWA 2IPWA 2Y7GA 3BSGA 4GO9A 4H01A 4JN7A 4DF2A 2ZX9A 4NSBA 1XYZA 1ADDA 3F4DA 2DUXA 3HFYA 4XIMA 4QG8A 4QP0A 1BQGA 2OO0A 4AIOA 4HNOA 1S5TA 4A29A 1OT2A 4HA0A 4RL3A 5AYXA 5HJXA 2BMBA 1Q6OA 2ZTJA 4OFCA 3SADA 2NUXA 4D6DA 5GNZA 5E5CA 1WXZA 1R85A 1TWSA 2WVSA 3W1TA 2XIMA 3N9KA 3CAKA 3LK6A 2AL1A 3LHWA 2CXEA 4DJFA 3W73A 4BFAA 2H6RA 3K8LA 4N4QA 1UD5A 4Y8FA 2OZ8A 1A5NC 4DXKA 3W07A 1W5NA 4QEEA 1M7PA 3QKZA 5D2WA 2C71A 3V16A 1GOMA 3TIMA 2FH8A 4D6IA 3N9SA 4LEQA 4JQ4A 4TOQA 3IJ8A 2R14A 2PRMA 3I10A 3SBFA 2YXGA 2J8GA 3LV5A 4S3CA 3ARRA 5B7YA 3ZJ6A 1SO6A 2A3LA 2OLSA 4GC4A 2AQWA 2HWGA 2ZWZA 4JOMA 7XIMA 2XFYA 1S5NA 3ITCA 1XSKA 1YKWA 5A2CA 4M51A 3TFCA 2BP1A 2INFA 3KBSA 1J4EA 3NYDA 3ARVA 4DRSA 1AODA 1XIMA 3QV9A 4MNJA 1FCQA 2E68A 3MMUA 3NEVA 1KFBA 1TVLA 1W1ZA 2OYLA 3CQJA 1S1PA 3DZ1A 1WDQA 5XIMA 9XIMA 2PC8A 1Y8BA 2ZZ3A 4JKKA 4B9YA 1I6NA 3E2RA 3UCCA 3W7HA 2PDHA 1EO5A 1O5QA 1PTAA 5EMKA 2VDGA 4Q8UA 3DHPA 4ZE5A 2PU1A 3CAWA 3GZAA 1XLAA 4E3VA 2XH7A 2Z6JA 3NJ3A 1G6CA 3NQVA 2V2DA 4HCLA 4PYSA 1IR2A 1LUCB 3NQ7A 1N55A 4A2RA 1JYWA 2ZX5A 2CETA 3ABOA 3GR4A 1J6PA 2GJPA 2IPJA 4AD4A 3UPBA 3UETA 1UUQA 4YVVA 3ES7A 1ZJHA 1U1JA 3CHDA 2ANUA 2G50A 3PUDA 1QRQA 3OBKA 3VM7A 1OCNA 4Q8WA 3CYVA 1IEQA 5CAKA 3WH6A 5C55A 1A5LC 3BG3A 1G4PA 1REQA 4F0RA 2POTA 3UD6A 1RVGA 1NM9A 3CUFA 3WLRA 4FK9A 3V5CA 3DU0A 4PBFA 1TX2A 3L2LA 1NQKA 1SPQA 3H70A 4LUYA 4KRZA 1WDWA 2RHGA 1YRRA 3RGTA 1O94A 3SSJA 4JTJA 3T55A 3FAXA 2G4JA 3SB0A 3VIPA 2C14A 3M0HA 3O05A 2XH2A 5D03A 3WL1A 3CUGA 2ZRUA 3GC5A 2X1IA 3CUJA 3BGGA 1IT7A 4YYCA 4LNCA 2ZUNA 1KXTA 1U83A 3UP8A 3I68A 1UMLA 1JI2A 4QR6A 1VP5A 3NXFA 4PTVA 5DY2A 4HSHA 2ZE3A 3S42A 4FP1A 5AHMA 2OVLA 2NLYA 2VEFA 3GTFA 5K9DA 1B9BA 1JRBA 4IUGA 5DO8A 2DDXA 5E09A 5G5IA 2QCMA 3DBNA 2C13A 1FFRA 3MUZ1 3DN5A 2X42A 1Q6GA 2A21A 1TQJA 2J13A 2YL9A 2BLEA 4TQTA 1X7IA 3BJFA 3AJXA 4MDOA 4O14A 3EX1A 1DIEA 3A47A 2DVTA 3VC5A 1K4GA 1GOIA 1EIBA 3MKVA 1PWMA 4UMBA 3I7SA 1ZL1A 2NW0A 1XLDA 1WE5A 2G5WA 2IUZA 2QQ6A 3AXHA 4XZWA 4I6VA 3G6MA 4Q7NA 3LPPA 3N1AA 4HMEA 3B8DA 1C93A 2CFFA 4Z1BA 4E5TA 1W1A1 3KL3A 3LCIA 2WKGA 4GQBA 3I3DA 2WB5A 1B30A 4LAUA 1XG3A 2PTDA 1SW0A 3QPZA 4GWEA 1ZQ5A 1MEHA 4PL2A 1UROA 3TROA 3H2NA 4P5UA 3TW9A 5LGXA 1HN1A 3L5LA 1A5CA 1NF7A 4J7RA 3R7MA 2YCKX 4B5UA 1FDJA 3GHRA 3OTRA 1DHPA 1AQHA 3ZS4A 1CPUA 1EB3A 4AZIA 3DAQA 3B8SA 1I0DA 5LNRA 3MHUA 2ABAA 5FAJA 4JCMA 6XIAA 1I1WA 2TSYA 3UR8A 1ZB5A 3N2XA 1I1XA 3N4FA 1YXYA 3Q58A 1CB7B 4MZ8A 3BLEA 5AC8A 1WNOA 3MO4A 1PHQA 1RBAA 4DM1A 4ES4A 1P1XA 1DORA 1BYCA 1VEPA 2P76A 3VU2A 3BAIA 4C6PA 3P74A 4Q4QA 3IACA 3KS6A 2F6KA 2E6DA 3N11A 4D6JA 1EP1A 4XQ6A 3S2NA 1GJPA 4AB4A 3W70A 2WXDM 2JGQA 2WW5A 1UWUA 5CLWA 3RJXA 2PGWA 2IMRA 4XBSA 2VFDA 3SIZA 1XIEA 4JX4A 3T2OA 4ZODA 4ZQRA 4UFMA 1PPIA 2PWDA 2HROA 3WMCA 4YHEA 5HA7A 3L23A 3G1AA 1YE6A 3GFXA 2O7QA 4CVUA 4TO8A 2PUZA 2UZ9A 4BS0A 4ZCWA 4YCOA 4PUWA 1O7AA 3WH5A 2QGHA 2GJXA 4BEQA 2AMXA 4IG2A 3LNPA 3V1HA 5D2TA 2VXNA 5AYZA 4D6CA 4LXFA 3FGCA 4GUHA 4RR4A 4RNFA 1S2CA 3QZAA 2Z6IA 2PE4A 2XIBA 1QOXA 5JXQA 5J8LA 1YMYA 1E1CB 1P5BA 5XINA 3V0UA 1UQZA 2RJHA 1D8CA 4H8HA 5A8NA 2EPHA 3DFOA 2OSXA 4UOJA 5KMYA 3OHIA 4DYKA 4RV3A 3W7NA 1Z42A 2F2HA 2VRQA 9XIAA 4HA4A 1OD0A 1UKOA 1WZAA 4F8XA 5IFTA 2XTKA 4DBWA 4UTJA 1A5SA 3GD6A 1BXBA 4LUSB 1G01A 3W85A 4XK2A 4E2BA 3N3TA 3W2UA 3M64A 2CZDA 1K7FA 3TC7A 1Q4WA 1FHDA 1EKOA 1FP8A 2CLHA 3B8TA 4UUIA 3PPGA 1C3FA 1NQ6A 2FPVA 1X6UA 1S5VA 3FX4A 1VCVA 3P61A 3VK5A 3TDFA 2XWDA 4WJEA 4QJ5B 3UR7A 3MHFA 4O4WA 4NY2A 4A2SA 4Q8NA 1OADA 4AZ6A 3KBMA 1PKLA 3S46A 1WA3A 1RJRA 5BWFA 1BD0A 1PV8A 3ZJKA 3GXPA 4ORMA 4PTMA 3M47A 2OG9A 4IJRA 2G97A 2ZDRA 5GJNA 1U5JA 3PY2A 1GVIA 3S2JA 3Q2DA 3VIHA 4KFPA 4XISA 1VR6A 3NPWA 3IV3A 2WBGA 1WKDA 4W7VA 2Z1VA 3CPUA 2CESA 3EDDA 5FKYA 4HMDA 3INPA 4O12A 8A3HA 4NI8A 1MQPA 2WHMA 5A6SA 4UCGA 3VNZA 1R30A 3JZEA 2YA1A 3WMSA 3TH6A 3FHQA 3WFLA 1GZGA 1UD6A 3NL3A 1W1VA 1OK6A 2WPBA 3QQ0A 4PMNA 5HR6A 1MSSA 3RO6A 2IS7A 4H00A 2OQLA 1KKOA 3AFBA 3P67A 4I9AA 3HGSA 4TMBA 2VCBA 3MV01 1JZ5A 4ZFMA 1Q8AA 2HEJA 4W8LA 4AMAA 5BOFA 1EF2A 1JAEA 2VUYA 1F73A 4M6VA 2E9MA 4JIHA 2I57A 1AVAA 3UWQA