3ELFA

Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
345
structure length
332
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
publication title Structural basis for catalysis of a tetrameric class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 132
structure length 332
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3elfA00
3RK8A 3ABOA 5MHBA 3GK0A 3I65A 4QAIA 4ZMGA 4TO8A 3S8HA 4X9SA 2V0TA 1LBFA 3M1ZA 5HWJA 1TIMA 4AHQA 1FCBA 1K03A 4Z1CA 1K02A 1TJPA 2V82A 1FWSA 4QM1A 1UCWA 2ISWA 1I4NA 1SQ7A 1G69A 3CEPA 4POCA 1ME7A 5F1UA 4MFEA 1SR9A 4XBSA 2VFDA 3YPIA 3TK7A 5BMWA 3L0GA 2TSYA 1FWNA 4XZ9A 3L66A 1WQ5A 5F2IA 1XXXA 4ADUA 1MZHA 1FY6A 2HS8A 1SO3A 4HT3A 4JIQA 1C9DA 1BKSA 1IIGA 2CLLA 3FIGA 1IXPA 1LRQA 4S1FA 3W70A 3HGOA 1FCUA 4LRSA 1Q6RA 1LORA 2VEPA 4RZ6A 3TXZA 3WK1A 3DFTA 1LBLA 4ZQRA 1NEYA 4H3DA 4EIVA 1TCDA 3LHVA 1JVNA 4JYEA 1EWDA 2DP3A 1VS1A 2ZZ1A 1GYLA 3NQMA 4Z1AA 3TMQA 4JYDA 2LLEA 4IQLA 1R47A 5AFDA 1ZJIA 5FEXA 4O4VA 4IPIA 3QH2A 3BG9A 1W31A 2CLIA 4NX5A 4IMCA 3Q94A 4IWWA 3S0CA 1VJIA 3GAYA 1JRBA 1TPDA 1DQXA 3TKFA 3M16A 1KTCA 3NQDA 2A6LA 2CLFA 5G4WA 1JUBA 5I3HA 3TDFA 3OVQA 3A5FA 1JCXA 2C3ZA 1V7YA 3QMRA 4S2CA 3M43A 2YZRA 3QW3A 3M9YA 3GR8A 2C16A 1QDSA 4DF2A 4K38A 2ZZ4A 1T96A 1XDMA 1EP3A 1M7PA 3IV3A 4IMGA 4LWWA 3UD6A 2J9XA 5DCDA 4K36A 1Z48A 3P8JA 3CWNA 4HNTA 2W79A 3DENA 4GUJA 4K7VA 3TQVA 1ZAJA 2ATSA 3NL3A 4KWVA 3BLFA 5D03A 1PCKA 2PCQA 3O63A 5HNRA 3ZWSA 4FHAA 1XI3A 1J2WA 3NQ8A 2VFEA 4O52A 3FJ6A 2H3DA 2RFGA 1QR7A 4XQ6A 3QJAA 5AHMA 2BZNA 1JUKA 2X1UA 4O28A 3RLVA 3KRSA 1RZMA 4PH6A 4LV9A 4YMZA 3I7RA 4TIMA 3JS3A 1ZFJA 3DFSA 3EWZA 1OF8A 4PEKA 4N02A 3T44A 4LS2A 2PRLA 3NAVA 2NX9A 7TIMA 3UZ5A 5AN7A 3C2EA 2A1YA 3G0SA 5TBOA 3O15A 2CZ5A 5CG7A 1I8JA 1I2PA 1VHNA 4LV4A 2H6RA 1R46A 4N6EA 4AXKA 1VHCA 1VYPX 4YWIA 2PE4A 5F2LA 4ADSA 2VENA 4Y9AA 3W7KA 2BX7A 4UMAA 2Q8ZA 2V30A 4I7WA 1L6SA 4UXDA 4AB4A 4NX0A 5J5DA 1QOQA 3B8DA 3W7DA 1R2TA 5IM51 1TRIA 3BLEA 5DY3A 1GTHA 3W87A 4X3ZA 3HG3A 4LVGA 4MFDA 3E49A 2V2HA 2WJZA 4Q4KA 4O54A 3T40A 2JKEA 2WSRA 1OFRA 1PHWA 3G1FA 4OT7A 2O7SA 3LLFA 5G2IA 1FUYA 2QDGA 3GVGA 1TPH1 3HG2A 4UNLA 1ICPA 3LBCA 3OHIA 3CPRA 1YDVA 3S1XA 3HPZA 5DXXA 3R12A 3EWYA 2NWSA 5AC7A 1SFJA 2B7PA 3C2OA 3GDTA 4O10A 3G22A 1NAL1 2YFNA 2V8ZA 4ML9A 4ZL1A 3KX6A 1VH7A 2VKZG 4AEOA 5AB3A 3TFCA 3IIXA 3W71A 4FIRA 1VGAA 2CZFA 2ZA2A 2JGQA 3NPXA 3FEMA 5TIMA 1F5ZA 1XC4A 2FFCA 4IJBA 5AHFA 3IVTA 2E09A 4UTMA 3TROA 1H62A 3SR7A 1OFPA 3I7QA 4FX7A 2ZRYA 1LRTA 1R2SA 3LTSA 2X1TA 1XBYA 4XTIA 1PL9A 3WK0A 2CLMA 3IEBA 1Y0EA 3MI3A 1WBHA 1KM2A 2ABBA 3BVJA 2ZZ2A 1OFAA 2RDTA 1NF7A 5BW6A 5K7JA 3OA3A 3CU2A 5C6MA 4KFPA 1JCMP 4ZQOA 1WV2A 1KLZA 5BMXA 4I9AA 2KZHA 4NJKA 3STFA 2WSYA 3LBMA 1YXYA 2ISVA 3AO0A 4XBKA 4DQWA 4N9CA 2TRSA 3G1XA 3F4NA 3HOJA 3R8RA 5FEPA 2NWRA 3NGJA 5F2GA 2Z0IA 2BWGA 3H54A 1X7FA 4JS3A 4WUIA 2YYTA 5G2WA 3W9ZA 2BXVA 1W54A 3MI2A 4BR1A 4O11A 3QSTA 1QO2A 5E93A 3W1QA 4E0CA 1O4UA 5CSSA 8TIMA 1KFCA 4LVFA 4BWLA 4MJZA 2WPBA 3VFLA 1QMLA 2GVGA 3OVRA 4QITA 3W75A 4NJIA 2Z6JA 3G3MA 2C6QA 3GNNA 1F05A 1ZNNA 2CZDA 1YPFA 1XKYA 1AMKA 1D9EA 1W3IA 1DORA 3U6WA 2OX1A 1KTNA 4H6KA 1VYRA 3INPA 1H51A 3NO5A 1GWJA 3HIJA 4UFIA 4QNEA 1GEQA 2NX3A 4X22A 1GJPA 3STGA 2RDWA 4LVDA 4FO4A 5D2TA 4DO4A 4TR9A 1W3NA 3OIXA 3K30A 1A5BA 1X1OA 4DBDA 1FDYA 5FF7A 1OFQA 1GOXA 3IGSA 1XUZA 2DJXA 3W2KA 3NVTA 3G24A 4GUHA 2GQAA 1KFBA 3FFSA 4O4WA 1F7BA 3DU0A 3PB2A 2HTMA 2A0NA 2QUTA 3C8FA 4IXXA 3P84A 1YTKA 5K9CA 3TJLA 4IX0A 5D2XA 4HNNA 4LNYA 3S1WA 4UTIA 1TQXA 4UTTC 1FBAA 4UR8A 3TU9A 4JTSA 1PIIA 1KLYA 4E2DA 2JKAA 3PG8A 5C55A 3KFTA 2YW4A 2QCEA 3W7OA 1KM6A 1ONRA 4FNUA 3EX6A 4CNNA 1G4SA 3MWAA 5HR7A 3IVSA 3WK2A 3UXDA 3IVUA 1KM3A 1SO6A 4JTLA 3TW6A 5DCEA 4WXZA 4A3UA 3L68A 2X2GA 3C4UA 3BV4A 1WX0A 3TE9A 2R8WA 3PBWA 2CFFA 3FYPA 3QMTA 4UTLA 4HSOA 3LOTA 1KFLA 1SZFA 4O0KA 5FF0A 1KFEA 3DFQA 4A2RA 2C0AA 2H8XA 3GAKA 2AAMA 3NQVA 1I45A 4O19A 4HNUA 3TH6A 5DBTA 3T7VA 2R14A 3NA8A 3TAKA 3C61A 3O6YX 2ZZ6A 4QJ1A 1KTBA 3USBA 3ZR4A 1Z44A 2FTPA 3NG3A 1H1YA 2HS6A 5AC8A 1Q6LA 1OYCA 5FF4A 5LNVA 1IXOA 2NUXA 3SGZA 2OMAA 2QJIA 2OT0A 5EKYA 1TV5A 3S9YA 3W74A 3G8RA 6TIMA 4XKYA 1YLVA 3G0UA 1M6JA 4CQ9A 5LGXA 3EX1A 4RLIA 3STCA 1K3UA 2WOQA 1QOPA 1AG1O 1GVQA 2ALDA 5KZDA 1H7WA 3HBLA 3OVPA 4MKNA 4R34A 5HJLA 1FX6A 2H3BA 4OHQA 5EBUA 3P81A 5LKYA 4GC4A 3DZ1A 3EKLA 2WQPA 5HINA 2ZCGA 3QM3A 3LHTA 5HUPA 2JBMA 2F84A 5DY2A 3QQ0A 3TAOA 3TC7A 1OVDA 3O6DA 1P4CA 3G18A 2ZQ0A 1RVGA 1SSDA 3NQCA 3UXAA 3WJSA 3HQ1A 4Y6GA 3O06A 2QCCA 2V2CA 4W9TA 3E96A 2DZWA 2ZZ3A 4PL1A 1TREA 3UWVA 2E77A 2X1RA 1PE1A 2B7OA 4PFMA 1M5WA 3PC0A 3PF3A 1JCLA 3NQGA 1TPEA 3Q58A 2VFGA 3HMJG 3SSJA 2J24A 2E6AA 4K8EA 3RNDA 3VKJA 2OZ0A 3WFAA 1W5PA 2DZSA 2C19A 4UFHA 3MW7A 4UTKA 3GLCA 3TV8A 1QNVA 1GG0A 1P1XA 4AWSA 4JN6A 3ELFA 1WOAA 2Z2UA 3W07A 3W7EA 5E1QA 4DPPA 1RQEA 3TSDA 3PBYA 2OCZA 2E5BA 4PODA 3NPUA 4JY9A 4O13A 3NDOA 3LRLA 3T78A 1TV7A 1ALDA 2Z6IA 4A21A 3DH7A 1OK6A 3GB6A 4UFKA 3LHZA 3LGEA 3N14A 1TTIA 4MYXA 3W83A 2YSWA 3ATZA 3EEGA 4BK9A 2YW3A 5A5WA 5H2ZA 1H7PA 1DKWA 5BOOA 1EPXA 3M41A 2J6XA 2QR6A 4LUJA 6ALDA 3PS7A 3W7MA 1R30A 3EX3A 4MZ8A 1DBTA 5CSRA 3LX9A 1K8XA 1JQVA 4PA8A 2NV2A 5EA9A 5D09A 3TMLA 3NL2A 4N4QA 3I6RA 3P82A 1U83A 2CLEA 1ZY9A 4WZHA 1AW2A 4UUIA 3U2OA 4JX5A 5EY5A 3CC1A 5HWMA 1QWGA 2B0MA 5KZEA 1VLIA 3PUOA 4O1CA 1GVRA 4OV9A 5D04C 4WXYA 1B57A 4Y90A 4FF7A 1H50A 3B0UX 3LI1A 3M5ZA 1HUVA 3B0VC 1TMHA 2Q8LA 1VLWA 4TMBA 4MUZA 1B3OA 3EXSA 2NX1A 5CGQA 3CLMA 2O7QA 2J88A 3C6CA 2TMDA 2UV8G 4GFSA 4LTSA 3MP5A 4YCOA 1KFJA 4MIMA 5D2YA 5LHFA 1W0MA 2ZFAA 4MY1A 3V75A 5CKSA 5AOUA 3I7SA 1FXQA 2A6NA 1LLZA 1FDZA 4O14A 5CPOA 4Q33A 4ZQNA 3CIWA 3N9RA 4O8RA 2YX0A 2A7PA 5I3JA 2NV1A 3NXFA 1XL9A 1LLWA 3FOKA 4KFNA 3EX4A 1K8ZA 1VRDA 4OQVA 1UBSA 3HO8A 3DBPA 2RH9A 2EPHA 2NXGA 3M6YA 2QDHA 3SECA 4XUGA 4AF0B 3W1MA 4AHPA 3NQ6A 2I9EA 3VE9A 1OX6A 1MEHA 4UIOA 4O1AA 2ZDRA 3H53A 1AL7A 5I3KA 1JCJA 1EEPA 4GUIA 2PRMA 3GXTA 4KKXA 2Y89A 1TPWA 5BRBA 3E12A 3MHGA 4HPXA 4ALDA 1H7RA 3UPBA 4MY8A 1SW7A 2WO5A 1P0NA 1GVOA 3QSRA 3WJWA 4K7YA 1P5BA 4O0ZA 5FEWA 4DXVA 4DEFA 1LRNA 3P67A 4LVAA 2V9DA 3E9AA 3T55A 1TPVA 3M5VA 4TMCA 1W3TA 2QCMA 3MHFA 3PR2A 4NJJA 1K7XA 1PV8A 4AF0A 1K7EA 4A29A 4IUOA 1DL3A 1SZNA 1UUMA 1HTIA 4RXFA 4NZFA 1TPC1 3N2MA 5E0KA 4Y96A 4DO5A 3QPZA 3DHDA 1EA0A 3C2RA 2DZTA 3NNTA 4M5PA 3EB2A 2QCDB 1RPXA 1I2NA 5D37A 4FEZA 2QCLA 4UCGA 3QPYA 3W76A 5L6UA 1XM3A 1MXSA 4CCCA 4IXHA 3C0JA 5HQEA 1V5XA 5J5RA 4L4MA 1LYXA 3QFEA 2GJLA 5DELA 3Q2DA 1G4PA 1UJPA 2QCGA 4M7TA 3M44A 1W5MA 2ISSA 2CU0A 3TJXA 4RJEA 1JULA 1QPRA 5IBXA 3UWUA 1N8FA 2ZRVA 3RF9A 2QKFA 4JNMA 4DF0A 1F76A 3O6CA 4UR7A 5AYXA 1CI1A 2QEZA 4NZJA 4ZQMA 2ABAA 1T0OA 3GYEA 4NJGA 2RHGA 4B5NA 2CLOA 4NJHA 5FF2A 1H60A 1PVNA 3PWAA 4GUFA 3CM4A 4XWUA 4DELA 3CIXA 1Z42A 2R91A 2Y63A 3LXAA 3TW7A 3W85A 4DF1A 1JCYA 3A23A 3BG3A 1R2RA 4Q32A 1VCGA 3LCGA 1TSIA 2Y7EA 4LVBA 2A5HA 4NXSA 3A9IA 4EF9A 1A5SA 5LHEA 1HG3A 1EB3A 3ANYA 3W7IA 3L5LA 1ME8A 3GXPA 3W1AA 2WNNA 3GDMA 3EXTA 5K4ZA 2RKXA 2H90A 5T26A 1FCVA 3QEZA 4MZ1A 4LS1A 2YYUA 4K6AA 1EP2A 4PL2A 1Q45A 2W0UA 2E6FA 1GG1A 4UFMA 4O16A 1GVSA 3GZ3A 4U28A 1G7VA 3W7RA 3QQ1A 2GPTA 1F74A 3TSBA 3PBUA 2A85A 1DJQA 2J27A 5D38A 2VXNA 3R89A 3NQAA 2C1HA 5HR6A 4O17A 1LOSA 3F4WA 2VFHA 2Y61A 4R33A 3PBVA 1JUEA 3CT7A 4WX2A 3M47A 4G1KA 4UC5A 1I2QA 3UNDA 3W1XA 2PC4A 1AL8A 4UFLA 4BWLC 1NSJA 3G8EA 3N73A 3TCEA 3LLDA 2ZRWA 4P61A 3G1HA 3GDRA 3QZEA 1FWTA 5K3VA 3HG5A 3LRKA 3S5ZA 4OU1A 4QSHA 2YR1A 3UYCA 1ML1A 1PS9A 3EWWA 2BSLA 2V2DA 5HMSA 3THAA 2YGYA 3LRMA 2QCNA 1K7FA 1VQTA 3GDLA 4NVTA 5KITA 3TC6A 4GE8A 4JX4A 3S5YA 1OYAA 5K9XA 2ZA1A 1ZAHA 3G1VA 1GPWA 3N9SA 3B04A 3DHFA 3O07A 5CZJA 3MP3A 1B4KA 1D3GA 4MJMA 4JTFA 5I3GA 4BFAA 5K9DA 5HULA 4FNQA 2GOUA 1H7XA 4N6FA 1M7OA 3GR7A 2NXHA 3UZJA 4UTJA 3C3NA 2A7NA 3ATYA 1JJKA 4ICNA 4WD0A 5D30A 3N3MA 3FKRA 3KOFA 1F73A 1MO0A 3GXNA 2ZRZA 1ZENA 2C15A 1GQNA 1J4EA 2H8ZA 3EXRA 1KFKA 4RZ4A 3W2NA 2NUYA 3UY7A 2FB2A 3A24A 3Q37A 1W5OA 1QCWA 1RQHA 1DQWA 2GUUA 3IIVA 3LERA 3JR2A 1LDCA 3EX2A 3O1NA 3W1RA 4NU7A 1MEIA 2VEIA 3M0ZA 3VCRA 3NZRA 3W1NA 2QUUA 1L6WA 4AH7A 4HKPA 3SJ3A 3L0NA 1XBVA 3B06A 4LY8A 2ZBTA 1SW0A 2J9ZA 4R53A 3RFAA 2B7QA 3FYOA 3L67A 3BK0A 2ZA3A 4ZQPA 1EWEA 5C5YA 3WK3A 3M5YA 1X1ZA 5DCBA 4IOTA 1NF0A 2X16A 2DZVA 2WNZA 4FX8A 3DI1A 1YYAA 2QCHA 4RX0A 3UY8A 4N2YA 4JTJA 3RLUA 5G5IA 4AHOA 3D0CA 4L4LA 5D02A 2D73A 2YPIA 3S1UA 1A53A 2DZPA 3S1VA 1C8VA 4LU0A 4TX9A 5CPNA 4GXMA 1KV5A 3B05A 4WY0F 4A22A 5ABTA 4NNAA 4YLWA 2GJNA 4RCXA 1RV8A 3NL6A 1PCWA 3HJZA 1UUOA 3W73A 1VZWA 2EF9A 4M6PA 2FPYA 3LDVA 1MSSA 4P2VA 2FLIA 3SI9A 3EWXA 5TQLA 3ZFHA 3MHUA 5FEZA 1F2JA 2DORA 4Z1BA 1VCFA 3WJXA 3LI0A 5DXYA 3W7LA 4I7UA 1KA9F 3P61A 1QAPA 3LHUA 5I3FA 2A4AA 5F2MA 1B4EA 4C1LA 4MLRA 2Y85A 4QIUA 1YTDA 4S2BA 3A22A 4FIQA 4KFOA 1OF6A 4O53A 3W86A 4RV8A 2WSQA 4LW7A 1TV8A 1OYBA 3O05A 1EIXA 1SPQA 4N9EA 3H55A 3A21A 4AWUA 4EOUA 3KHJA 1MEWA 1S5TA 2I14A 4HIBA 1WBJA 4IMEA 3LCWA 3LCLA 3ABSA 3CTLA 2QJGA 5D2WA 1G7UA 1HO4A 3MYPA 4AAJA 3KXQA 3GIYA 3KAOA 1ICQA 3PUDA 4YCPA 2ZTJA 1QPOA 1GTEA 1OX4B 3MYOA 3AJXA 2NLIA 2ZRXA 5AYYA 1IF2A 4BI6A 3NYZA 4O50A 3W7JA 4WOZA 2Y62A 5BNKA 2NXIA 4WJEA 3NL5A 1AW1A 4GJ1A 1ZAIA 1LCOA 4IMFA 4UNKA 5CZSA 3P5YA 1RQBA 4LC8A 3ZS4A 4X2RA 1GVFA 1THFD 3UWYA 3UWWA 5LNUA 4FNPA 3NPVA 1O5XA 3GX9A 1SU5A 2BLEA 5LZLA 4QISA 2CZEA 3S5NA 2CLKA 3R13A 1O95A 1YXDA 4ONVA 1VPXA 2P0OA 5LNWA 1ADOA 4DPQA 3I68A 4ZZ9A 1OX4A 1G4TA 1WXJA 4LS0A 4ORIA 4LRTA 4EWND 4JICA 3KVMA 4MYAA 3FKKA 3B03A 1IXQA 2G96A 3PY2A 4OBTA 1ZHAA 5C2XA 4YL2A 3LTPA 4BI5A 5I3IA 4LT9A 5L9FA 4JTTA 4QNWA 4U4MA 4N9DA 1X6UA 2VFFA 5G1YA 5LSMA 1W56A 3NQ2A 1WAUA 2FB3A 1OFOA 3BW3A 2B4GA 3SY5A 1H7NA 1SW3A 4GBUA 1Q6OA 4JY8A 3VNDA 4WQ6A 3QYQA 3WJZA 2VC6A 3QF0A 3W7PA 4C1KA 3W23A 1DHPA 1BEUA 1G4EA 3RU6A 1W8SA 3IGUA 4JDYA 1LOLA 2WNQA 1NVMA 2VEKA 4WY0B 1KM4A 1LBMA 2E6YA 4MLJA 5FESA 5LNSA 1SO5A 4JTEA 4EF8A 3SZ8A 4O1BA 4FNRA 4NNBA 3LB0A 2Y7FA 1E51A 4Z0JA 1DVJA 3PB0A 3TIMA 2AGKA 3B4UA 1SO4A 3W1PA 1WA3A 1K8YA 5EL1A 3ABRA 4Z1DA 1XBZA 3FLUA 2YFOA 3W2UA 1A5CA 5AHEA 2XN2A 3G0XA 2A21A 3W2MA 2DZUA 1DV7A 2HSAA 4I7VA 3G1SA 3G1YA 4UTHA 4GNJA 1H1ZA 1ZCOA 1XDLA 5CZ0A 2E5CA 4RK8A 4OGZA 1ZALA 2DZXA 4OWGA 1G67A 1YTEA 3LHWA 1VCVA 1SZEA 4WY0A 2C14A 1JR1A 3G1DA 3P62A 4FNSA 4M6QA 1OK4A 3LXBA 5A8GA 3EWUA 2Y88A 3IIZA 3S42A 5GVJA 4R7JA 3W1TA 1TQJA 3LM7A 2YXGA 3UQNA 1KBIA 1TO3A 1C29A 1H61A 1XUUA 2TYSA 4FNTA 4QQ3A 3LV6A 4IGHA 4PTNA 3MBFA 3P7YA 3DFPA 3PG9A 3EWBX 1TB3A 5C54A 5F4WA 5SWUA 4DBEA 1EP1A 1N55A 2Y7GA 3TQKA 4JTIA 3MBDA 3C56A 4MOZA 3HPSA 3UPWA 4OE7A 1D3HA 1OHLA 3W1UA 3W84A 4RR4A 1S5WA 3LXCA 5FI8A 1TPFA 1O5KA 3NOEA 3PAJA 3W72A 2C18A 3DKJA 2FJKA 3G3DA 2E6DA 3C2FA 1IIHA 5AC6A 4WOQA 5F4SA 3SGUA 3F03K 3RMJA 3UWQA 2HMCA 3PSVA 1BTMA 2E1DA 2FDSA 3W7QA 4RXGA 5HWNA 2PURA 3IGXA 2QAPA 3MJYA 2FPTA 4FXRA 4UMCA 1P0KA 3TX9A 2R94A 4NUWA 4H4IA 4PCFA 1TTPA 2GQ9A 1EUNA 1IGSA 1H7OA 2XFWA 3CWOX 1DJNA 4M6VA 3U8GA 3HF3A 5LNRA 2RDUA 4FB7A 3MP4A 5IBXC 2I1OA 3LCIA 1WYIA 3SFKA 2Q3OA 1HFBA 1HL2A 4GWEA 2PRHA 2P1FA 3DFOA 1N7KA 2DJLA 2QCDA 5K2ZA 4CNOA 1AK5A 1S3HA 3F1QA 1AW5A 3QMSA 2ZZ7A 1YDNA 1CW2A 1WOBA 3NM1A 3P5ZA 5D33A 2Z1BA 4E38A 2GQ8A 3OBKA 4UTUA 3TA6A 4K39A 4JX6A 2CWNA 3L2IA 4HN4A 3CB8A 3NM3A 4NT0A 1GT8A 1T8XA 5AHNA 1O60A 3FS2A 3NR0A 3ABQA 2BTMA 1OFEA 3VE7A 2EHHA 4IPJA 4Z08A 2VFIA 2AQWA 3R5EA 1SFLA 3T4CA 2VEMA 4PC8A 3TQ0A 3PSWA 5KMYA 3QC3A 4LOCA 4O18A 4OV4A 5G4EA 3W2LA 3BLIA 1SUXA 4GUGA 2C13A 1FQ0A 3DXIA 1HO1A 3HGJA 5EYWA 3HGSA 4Y8FA 3IIPA 3L0KA 3W7CA 1W5QA 2DU2A 4UMBA 3KVLA 1VC4A 3DGRA 1KV8A 4ADTA 2EAWA 4ZVJA 1A50A 3BGGA 2P10A 1EX5A 3TXVA 4MZYA 1OG0A 2ZYFA 3S5OA 1TPUA 4JTHA 1UB3A 1TTQA 2J9YA 2A2IA 3BO9A 5DLCA 1WDWA 4JR5A 3ZWTA 2FQIA 4JEQA 1F6PA 4ZQCA 4KWWA 4RZ5A 1L6YA 3P80A 1LP6A 4UTWA 3UWZA 4UTWC 1IXNA 5KINA 4MVAA 2A7RA 3N19B 3OEXA 4IMDA 4CNPA 1LZOA 3L21A 4AMAA 1NFBA 3L5AA 5EPDA 3LV5A 2G97A 3GKAA 1TRDA 3DI0A 1VR6A 3GNDA 4Z0SA 1BWLA 3TSMA 3LHYA 5U7SA 3KVJA 1I2OA 1VYSX 1OFBA 3HB9A 1XCFA 1L9WA 4M7SA 5CPLA 4HSNA 2GVLA 1TTJA 3FA5A 2V5BA 3MO7A 2VOMA 4J9JA 5D32A 2QCFA 3CHVA 1GYNA 4JD4A 4JTKA 1RD5A 4MY9A 1W37A 4JXCA 2ZTKA 4CCDA 3TNOA 1DOSA 2ZZ5A 4K37A 3KRZA 3C52A 1ICSA 3NQEA 1J5TA 3L5MA 3BW4A 1H5YA 5F1VA 1XBXA 3NEVA 5CZTA 1H63A 1Q6QA 1W5NA 3W88A 3B0PA 4CLMA 3HG4A 2NZLA 4O1DA 3PUEA 2QJHA 1KM1A 2QF7A 4JGDA 2QUVA 4LUIA 4A2SA 3A5VA 2XN1A 5EMUA 2OJPA 3KVKA 3L65A 3SW6A 5FF3A 3TR2A 5CPMA 4LC6A 2CLHA 3HPXA 1TPB1 1SSGA 1TYGA 3HGRA 4TU1A 2ZRUA 4XTDA 5D05A 1ME9A 2G95A 2NUWA 1FCQA 5DBUA 1YADA 4UTTA 3THQA 2FPVA 1SZGA 3N2XA 4MPQA 3E0IA 3GDKA 3M5XA 3N34A 4JIPA 5KSWA 4K8HA 2G5WA 3W7NA 1G6CA 2Y70A 3NPWA 3P74A 3BPWA 3M7WA 3STEA 2E5DA 5AHIA 5D2VA 1XFBA 1OFDA 3W7HA 3BARA 3NZ1A 5KZMA 3W1LA 4CQAA 5K4XA 5LGZA 1BWKA 1U5JA 4CCEA 1A5AA 4XKYB 3S6DA 4JDBA 3BW2A 1O94A 1OABA 2TPSA 4HPJA 3TUUA 3BGJA 4AVFA 3O16A 1LROA 3PULA 3LCFA 2WKJA 4JYFA 1B9BA 4AWTA 1QO5A 2CW6A 2JK2A 1JCNA 1QPNA 2W6RA 3PVFA 2EKCA 1KW1A 3O8AA 1RR2A 1TJRA 4N9BA 1LTDA 3QRHA 2X1SA 2XN0A 3W3OA 3G1AA 1CX9A 2IQTA 4HHPA 3DKLA 1F6KA 3MMTA 4O15A 2V5LA 1S5VA 3FJLA 2VELA 3IIOA 1OJXA 3W2JA 3BG5A 2JGYA 2ATMA 1QPQA 1PHQA 4NQ1A 2JKPA 3P60A 1EUAA 3R2GA 5DN1A 4FX6M 3VI2A 2B7NA 2X30A 5G2HA 4O57A 4YXGA 4UFJA 1KM5A 1X8FA 4RKAA 1JRCA 1FWWA 3P8IA 2QAFA 4ORMA 1YXCA 3PM6A 2F7FA 4BF9A 3DAQA 4GRSA 3NQ7A 1GZGA 1FXPA 1I2RA 1KBJA 2E68A 5HUOA 1UASA 1QFEA 3W6YA 3E02A 3EKZA 4BI7A 4DO6A 4O12A 2YCEA 5AHLA 5AYZA 3TFXA 3LCXA 1L2UA 3IRDA 5KTLA 4N4PA 1Z41A 4CQ8A 2EGZA 4HNVA 3CEUA 2YDAA 3W22A 3WJYA 1YDOA 2Q3RA 1LM1A 4JTGA 4NNCA 4M19A 4EVZA 2GVJA 2FIQA 1FWRA 3C2VA 3V1PA 1KM0A 3NQFA 3MI6A 3GKFA 1YPIA 1OX5A 4IX2A 2WV8A 3W7GA 4NXKA 5G1TA 4JTUA 3KRUA 3SIZA 2Y7DA 1T99A 3OG3A 3QW4B 3JRKA 1W1ZA 1LOQA 2Y6ZA 3LCHA 3DFNA 4FXSA 1FDJA 4D2JA 2OT1A 3MUXA 5H91A 1JQXA 5U4NA 4E2BA 3L9CA 2V81A 3LTYA 5F4XA 1Q3NA 3CQ0A
chains in the Genus database with same CATH superfamily
2QMKA 5ABFB 3PWGA 3WUFA 3GWQA 4H7ZA 1Q8JA 3M1ZA 3IGHX 4Z1CA 1TJPA 1UCWA 3GC5A 2V3GA 2F38A 2Y2WA 4GQRA 2RGLA 2PGRA 2VFDA 3M0YA 4LUYA 4LCSA 3L0GA 2TSYA 3L66A 2PLJA 4NZ4A 1XRFA 2PLMA 1W9UA 3BQ6A 1K4HA 1BKSA 8RUCA 1LRQA 1FCUA 4TVCA 2VEPA 3NO3A 4ZQRA 1NEYA 3LHVA 2FDMA 1V6XA 2DP3A 1FWCC 4JQAA 1VS1A 2ZZ1A 1E0UA 1GYLA 1VRXA 4AU0A 3RRXA 2NQ5A 4YN5A 4DXKA 3SQSA 5AFDA 1ITCA 3WDRA 1CYGA 1OC6A 3GIQA 3VM5A 4WK9A 4YVPA 3BG9A 1JZ8A 1NDZA 1VJIA 3GAYA 1DQXA 2QNEA 3NQDA 3RHGA 3U2ZA 4CD6A 1IWBA 4BEUA 4AIUA 3A5FA 1JCXA 3QMRA 4ZFMA 3B3DA 3EMQA 3RU8X 3HQNA 2QULA 2YZRA 1V3HA 2AMXA 1YE6A 3BICA 4V33A 1QDSA 4DF2A 1T96A 1BPLB 1M7PA 4DWSC 2W61A 2Q01A 2XIIA 3WLHA 3DIPA 3UD6A 2J9XA 4K36A 3CWNA 4HNTA 2GQ3A 1NDYA 3DENA 1FA2A 4IQJA 2DQXA 4RPPA 3QOKA 1Y8BA 3RPTA 3BLFA 4EACA 4PCNA 4GXWA 4FHAA 2WYSA 1ELSA 3NQ8A 2H3DA 1QR7A 3AIEA 3QJAA 4XQ6A 2HZGA 3VNZA 4EANA 1XLKA 3RLVA 3RX3A 2PDMA 4PH6A 3GHUA 4LV9A 1N8WA 1QJWA 1OGBA 1ZFJA 4N02A 2G50A 2PRLA 2WHKA 3V3WA 4MHBA 1EO5A 1MZRA 2PP3A 4CD8A 1TJ2A 3C2EA 3GVQA 1I2PA 2NV9A 2H6RA 4AXKA 5CSYA 3W24A 5C9XA 2PE4A 2VENA 4QS6A 2BX7A 5C2GA 5BXPA 2Q8ZA 3K1DA 1JFHA 4UXDA 5J5DA 2Y5SA 3W7DA 4L9ZA 1O66A 3HV9A 4AXNA 3R4IA 5IM51 3GVVA 3UPMA 1HJQA 4F2BA 2VR2A 2R1KA 3WFLA 4X3ZA 1CCWB 4EP8C 4Q4KA 4O54A 2JKEA 2I57A 3WNLA 4A3HA 2C7FA 2CIPA 4KIEA 1FUYA 2X7VA 1TPH1 4KEMA 1XIBA 1QNOA 3OHIA 1YDVA 3S1XA 3O6AA 4AIOA 2NWSA 3FCPA 1VBRA 3EDEA 3G22A 3ITCA 4Q4MA 5A6BD 1VH7A 2PDLA 2BFGA 3IIXA 2ZWYA 3W71A 2JALA 2ZA2A 3NPXA 3FEMA 3MTWA 5DMNA 3GTIA 3V16A 4UTMA 1ADDA 2DUXA 1Z9AA 1QHPA 1CGUA 4ICMA 2X1TA 2QQ6A 3ARQA 3MDUA 2IKJA 1JDAA 3MI3A 1VFFA 3BVJA 2CBJA 1OFAA 2XIMA 2WHJA 5K7JA 4AZCB 1XWYA 4ZQOA 2OG9A 5BMXA 2VCCA 4I9AA 3HMCA 3STFA 3LBMA 1YXYA 2WK2A 3B9AA 3QZ6A 3AO0A 4XBKA 1HL9A 3G1XA 1QNSA 2WLZA 2Z0IA 1K6WA 3VOCA 1GCYA 1CXIA 3APGA 4O11A 1XSJA 4CUCA 1QO2A 2EG8A 4I6KA 4Z2IA 5C70A 2NQZA 1SYTA 1E9IA 1KFCA 1ONXA 1PKYA 2I5QA 4MWAC 3EPMA 3OVRA 2Z6JA 2ANUA 2CZDA 1J0ZA 4UCFA 2OSYA 1R3RA 1AMKA 3PZIA 1DXFA 4R5EA 3INPA 3T0BA 2GDQA 4H9TA 2YB1A 3HIJA 2HE5A 3NJ3A 3TP4A 1W9XA 2NX3A 1GQIA 4GLEA 1GJPA 3UA4A 5ECVA 4C6FA 3S9ZA 3TWAA 5D2TA 2JIEA 4IQEA 1W3NA 3QV8A 2VZOA 4CQDA 3U7VA 1Y65A 3BLKA 3W2KA 3PNZA 3D3AA 3C5QA 1HJWA 2QUTA 2QIIA 1EH9A 3RDKA 3TYCA 5EMLA 5D2XA 4HNNA 4B9ZA 3CMJA 2QJNA 1FBAA 1K9EA 3TU9A 1KBBA 4JTSA 3SY8A 3TLLA 4CU6A 4E2DA 2JKAA 3BTNA 1GORA 4O8AA 3ZJ8A 2J8TA 3KFTA 2VL4A 2QCEA 1XYBA 1RBOB 1G4SA 3SM0A 2XM1A 5HR7A 2ICSA 3ISIX 1SO6A 4JTLA 3FEQA 3JZEA 4Q7IA 2X2GA 1WX0A 2R8WA 4JAWA 5LIUX 2CFFA 3QMTA 2QJJA 5FF0A 3FHQA 5LIKX 4N7QA 3LGDA 4HCDA 1REQA 2R14A 4Z42C 3NA8A 2ZZ6A 1KTBA 4H8VA 2WC7A 5LNVA 2WMFA 2NQLA 1TV5A 2OZ8A 5FSDC 3W74A 3UW6A 4WJ8A 1D2KA 1B2YA 4U3AA 3WF1A 3KWSA 4INFA 3C8NA 2PD5A 3H21A 1FHUA 4IFOA 4Z2LA 3OVPA 4MKNA 3WIJA 4DZ5A 4OHQA 1M68A 5EBUA 4ZXLA 3PUGA 4XBJA 4TV6A 4C6OA 3DZ1A 5HUPA 5DMLA 4RW5A 2JBMA 1WPCA 5DY2A 3TC7A 4ILSA 4XX6A 1OVDA 3AJ7A 3GS6A 3NQCA 1RP8A 3BSHA 3F2BA 1NOUA 2REQB 3PJTA 3O06A 4Y6GA 2QCCA 4US6A 5A6BA 4PL1A 5XIMA 2E77A 2X1RA 1E4LA 1DWAM 4HMCA 4RDZA 1XQKA 1E4NA 1TPEA 2VFGA 2YDSA 2J24A 1H3GA 1GONA 2OTDA 4K8EA 3VKJA 1JPKA 4NILA 2DZSA 3S9IA 2C19A 4UFHA 5FJJA 4UTKA 3GLCA 1UIPA 1GG0A 3VINA 3WQCA 4DY1A 2BOEX 5CJNA 4IL2A 3W7EA 3DUGA 5CAHA 3TZNA 3TSDA 4MUPA 4LX4A 4C6MA 4L1GA 2E8ZA 2P3EA 3T78A 3A4AA 3B8TA 3N25A 4CD7A 3LGEA 4PMVA 2PPGA 3ATZA 3EEGA 5AYIA 1JD9A 1XG3A 2WANA 1DKWA 1A5NC 3TN4A 3L4UA 4IP4A 3W7MA 1EJSC 3LPFA 4Q22A 3EDFA 3ARYA 5CSRA 2PFHA 3LX9A 4PA8A 2NV2A 2OWWA 4N4QA 5E9AA 3TTQA 2EXOA 4EPBC 4QRNA 3CC1A 5HWMA 1QWGA 2B0MA 5KZEA 1OQFA 3PUOA 2CKSA 4A6GA 5D04C 1B57A 4FF7A 1H50A 6XIAA 4PMOA 1E73M 4C6IA 2DSWA 1P48A 4Q8WA 1HUVA 3OYXA 4TMBA 3E0VA 1MRQA 2D2OA 4LB3A 2UV8G 3CUHA 4MIMA 2YL9A 2ZFAA 3V75A 4QLLA 5CKSA 4KIRA 1E6ZA 3CHEA 1LLZA 1FDZA 4O14A 5CPOA 2DZAA 4FS9A 1CECA 4DAIA 1CB2A 3VKAA 3PPCA 3N9RA 4JFTA 1B54A 4GVGA 1KCKA 5I3JA 1U5VA 1DIOA 4GVIA 2RJGA 1BG4A 1LLWA 3FOKA 2XSXA 1HT6A 3MVTA 3D5HA 3RM9A 3DBPA 1Z8AA 1N8IA 2NXGA 2OEKA 3ZQ9A 4XUGA 1TMLA 3VDBA 1Q6EA 4AHPA 1K77A 1PDZA 3S3GA 4UIOA 4F48A 5I3KA 1EEPA 4KBXA 1E6SM 2XG9A 3GXTA 1WNOA 3S46A 3UJ2A 3HA1A 3W00A 4Y9NA 1H7RA 4ZB2A 3RRAA 1SW7A 2WO5A 3A6OA 3WJWA 2E9LA 2VI0A 1P5BA 3TTEA 4CN6A 5KETA 5C9RA 1QW7A 2BGSA 2JQXA 3CO8A 4DEFA 3VFCA 3P67A 1O12A 3BMVA 1JF5A 1W3TA 3T8QA 2ZX5A 4OKDA 2XTKA 3PR2A 1JZ5A 2DVTA 4AF0A 1DL3A 1PZ2A 3IRSA 3AXKA 3ZJ7A 4NZFA 1S5NA 2WMJA 3GRIA 1TPC1 5AECA 1HNYA 4ZA0A 3C2RA 2O9TA 2DZTA 3ES8A 2CBVA 1RPXA 5HDRA 4PB5A 1XD1A 3W76A 4CCCA 4FOJA 3ARTA 3B40A 3UU0A 3SCWA 1V5XA 4IIDA 1O68A 1UA7A 4PMJA 3KOXA 3KOWA 4WKFA 5CZKA 1SFTA 4B16A 4H9XA 4JNMA 1F76A 5JBEA 1EF3A 4ZQMA 1EC7A 2ABAA 2OQHA 4NJGA 5FA5A 1H60A 3H2EA 3CM4A 3MC5A 2WJDA 3RUBL 5DRIA 2VEGA 3P0XA 1BTCA 1C9WA 1XSKA 1JCYA 3OZMA 3A23A 1BRLB 3W6LA 1DWHM 4JTCA 1PZ0A 1FTXA 2Y7EA 3LSBA 3A9IA 5LHEA 4GNVA 1BGGA 1JYNA 3A64A 2WC3A 4DYJA 1E3ZA 4CU8A 3L5LA 4GC3A 4LYRA 3W1AA 1V8EA 4MNJA 3EXTA 1OB0A 1QI5A 1EJRC 4X0NA 3WX7A 2POZA 3NZQA 2XVLA 2Z25A 4PL2A 2W0UA 2E6FA 4O16A 4I90A 3ZT7A 1G7VA 1FHLA 1F74A 4HU3A 3TSBA 5JVLA 2A85A 3KHDA 3W26A 2VXNA 3QLLA 1LOSA 3F4WA 5FJRA 2OKTA 4Q4QA 3GHTA 4JTQA 2UZ9A 3W1XA 1E5NA 2PC4A 5FCZA 4JZ5A 1NP2A 2FFIA 4UFLA 1XRTA 4CU7A 4U2YA 1EGMA 1OZQA 4UQBA 5GPRA 4JTRA 1UKPA 1ZLPA 2QT3A 4QSHA 2YZ5A 3BSMA 4QAWA 1NY1A 2V2DA 3LRMA 3II1A 2QCNA 3VOGA 3OGSA 1K7FA 1QW8A 4TQTA 3PANA 4JX4A 2Y4SA 1PDYA 4FOUA 4HMEA 4JCLA 5JMUA 3GTHA 1BQCA 3MP3A 1B4KA 3MUIA 4LBSA 2P88A 2EBNA 1AH3A 1QTWA 5K9DA 3VCCA 3VNYA 4R3UA 1M7OA 5AKQA 2XH4A 3GR7A 4HP5A 2D23A 3C3NA 3ATYA 3RLHA 1NDVA 3FKRA 2V3DA 4YTTA 1MO0A 1HJXA 1GQNA 2PDUA 1KFKA 4PULA 4HTBA 4GQQA 1P0EA 3UY7A 4BCEA 3WLQA 1UWUA 3LERA 2AKMA 3JR2A 2PA6A 3EX2A 3W1RA 3DC0A 1JDCA 1EOKA 1AH4A 2DY3A 2VEIA 3VCRA 5C7VA 3NZRA 1IEVA 1FFRA 1H49A 3W1NA 2QUUA 4HKPA 3B06A 3GU2A 3QV9A 2ZBTA 4DJEC 1SW0A 4DNHA 3E0LA 3VGHA 1YKWA 3RFAA 3BLPX 3AWOA 3FYOA 1B3VA 2WMKA 3FXYA 1H11A 3ZLFA 4D1IA 4G6CA 5LA0A 6TAAA 5REQB 2QCHA 2EPLX 3IUHA 3G6MA 3C86A 2EEXA 1HN1A 5FJPA 2YPIA 3S1UA 1A53A 1C8VA 1KRAC 4HNCA 5XIAA 1BYAA 3GXFA 3GG8A 3GUGA 4MTVA 3TYAA 4K68A 4CVUA 2FZNA 1LL7A 2E0PA 1GEHA 4A22A 3CHFA 4NNAA 2XVNA 1HKIA 3OODA 2ZKMX 3FN9A 1PCWA 4WDWA 1UUOA 4IL0A 3W73A 1VFMA 3I3EA 1FWJC 2FPYA 3LDVA 1MSSA 2FLIA 4NI8A 5DMMA 4E4UA 4Y8EA 3EWXA 5TQLA 3ZFHA 1US3A 2DORA 2HK1A 4HTYA 1VCFA 3W7LA 2GGJA 4I7UA 2F61A 1YBQB 4LUSB 3GDBA 1U2YA 3LHUA 4YHGA 3LSCA 1UQYA 3I10A 5F2MA 1B4EA 2POTA 3UGRA 1GQKA 2HDJA 3A22A 3IARA 1OF6A 2XFYA 4RV8A 4B90A 2BGQA 5TF0A 3CK5A 3VIMA 1GUVA 1FWDC 3O05A 1SPQA 4RUBA 3F4DA 1A3XA 4N9EA 1XP3A 3OZYA 3A21A 3FAXA 1GOQA 4AWUA 3W28A 4LAKA 3KHJA 4Y9PA 4AYSA 1ZBKA 4HIBA 4IMEA 2EG7A 2RJHA 2QJGA 1G7UA 3ITYA 3G5EA 3PUDA 3IS4A 1JCTA 2WVUA 4IP5A 1QPOA 1V3LA 3MYOA 3OTRA 2OX4A 4JL1A 5I06A 1R3VA 4BI6A 3W7JA 2YBVA 2Y62A 2NXIA 3H24A 4GBDA 4WJEA 4HHLA 3AIWA 2REQA 5CZSA 4NYUA 4UNKA 3ZS4A 3BZJA 4X2RA 4GYKA 4TXEA 4WRHA 1Q6CA 4M82A 2WW5A 3IJ9A 3NPVA 4GJIA 5E5CA 4QISA 4PUJA 4Z2KA 1O95A 4FR1A 1LG1A 5IDZA 1P0BA 4DPQA 4GY1A 2OGYA 4ZZ9A 4IQDA 1G4TA 4LS0A 4WSHA 1B9ZA 1XYMA 4LRTA 3M0VA 3PZMA 4AZGA 4EWND 1FWAC 1CBGA 1Q66A 4Q8VA 2NVCA 5ECUA 4GCXA 3SUVA 2ZUSA 4LT9A 4FAMA 2GDVA 4FLRA 3KW3A 2VFFA 5LSMA 1W56A 1WAUA 2FB3A 4HZ7A 3W81A 4CQCA 1H7NA 1UWSA 5BRPA 1WDDA 4GBUA 3AXIA 4WQ6A 4M6UA 1H41A 2Z29A 2VC6A 3W7PA 4C1KA 3W23A 1ZBWA 3FDGA 4C7GA 4K8GA 2VX7A 1DWJM 2WMGA 2INZA 5EB8A 4Q8PA 1LOLA 4AFYA 3WLSA 4MLJA 1TJ0A 5FESA 1TZZA 4EF8A 4O1BA 4FNRA 2J78A 2AMGA 3RITA 3GZAA 2DW7A 5DRCA 5CG0A 3FAWA 1KRMA 4MKVA 3W0KA 1DVJA 3N12A 3B4UA 1IT7A 3ARUA 1K8YA 4Z1DA 2OSWA 2A21A 3AICA 3DEQA 2HSAA 1Q6DA 1DTUA 4UTHA 3JZUA 1UR1A 1IR2A 4DWSA 2J74A 1AQHA 1F4HA 1JR1A 3G1DA 3AS3A 2HJPA 2FGLA 5BWFA 2A79A 3OHMB 5I0DA 5GVJA 1US0A 4FALA 1OIFA 3W1TA 1TQJA 2GGEA 4DI9A 2XWEA 1TO3A 1C29A 1H61A 4HNOA 1RA5A 3LV6A 4ZBCA 3MBFA 3L2MA 3P7YA 5AVNA 3EWBX 5IFTA 3ITGA 5C54A 3MV01 4DBEA 1VJZA 4JTIA 3MBDA 1ZB5A 3AIRA 1XH0A 4OE7A 1Y5XA 3TYZA 3DC8A 4RR4A 3N9KA 1S5WA 2VHLA 4AZBA 3N2TA 5EFFA 3N2CA 4PMRA 3M0KA 2E6DA 4C6PA 3C2FA 1Z3NA 1GQLA 2GUYA 4DZAA 2HRWA 1ZS2A 5CPTA 2GJRA 4NYYA 4U31A 2FDSA 3W7QA 4RXGA 5HWNA 2PURA 3EB4A 5D4YA 2QAPA 4FXRA 4UMCA 4EWJA 1MW2A 4GIRA 2WCSA 2WJFA 4IH3A 3WDPP 2VDIA 5DO8A 1QNPA 3GFZA 4M6VA 4A8LA 4RE0A 3MP4A 3LCIA 1QNQA 2AQVA 1HFBA 2WBGA 4GWEA 2PRHA 3DFOA 1O5QA 3H7RA 3N18A 1AK5A 5AYBA 3W27A 2HPMA 4XG1A 4PE8A 2Z1BA 3VZZA 3OBKA 4UTUA 1MUMA 3TA6A 3CLWA 3S4TA 4K39A 1CENA 4JX6A 3TJIA 2CWNA 3BUVA 3OB8A 3U9IA 3W82A 1O60A 3FS2A 3NR0A 5LA2A 1S5MA 3XIMA 3MUAA 1OD0A 1DIEA 1LWHA 3UR2A 1TFVA 5PTDA 3PZ9A 4IPJA 4KGJA 3EOEA 2VFIA 4GINA 2AQWA 1FH7A 4KQNA 1ECQA 1UBPC 1QW9A 1QNRA 4LOCA 4QXIA 1S2WA 3U0HA 3W2LA 2NSOA 1J9YA 1F3TA 3SUTA 1SUXA 3IAQA 1HO1A 3WLLA 1E6XM 2VC5A 5RUBA 5EYWA 2J7CA 4B4FA 3L0KA 2DU2A 3KVLA 1VC4A 2EAWA 4XK2A 1VPYA 5C9WA 1EX5A 3AU2A 3BURA 5FJOA 4UQDA 4AZHA 3CH9A 3N4FA 4HZ8A 2A2IA 1XPYA 1F6PA 4YTQA 4U33A 1TCMA 4JTAA 4HCHA 3GYCA 1R6WA 3LPPA 4UTWA 4DUVA 3H6OA 4CNPA 3OEXA 4GI9A 1HGYA 1SR0A 2MNRA 3WQ4A 4H00A 3QFWA 1PBGA 2G97A 4MWAA 3GKAA 4IIFA 3LHYA 4ZR8A 1H4PA 1I2OA 1L9WA 3L4VA 4M7SA 4Q8OA 2XZ9A 3AIQA 4WR3A 4TTGA 1CLKA 2QCFA 3CHVA 5M03A 2VC7A 1BGAA 1JZ2A 1W37A 2O55A 4K37A 1V51A 1YNPA 4EE9A 2Z27A 3NXLA 2PLCA 1XYZA 3U48A 3FGCA 4HNLA 1UHVA 1SM9A 3K5XA 1H63A 1Q6QA 3ZT6A 1DJHA 2NZLA 4O1DA 4M56A 5LIWX 2GJXA 1D7FA 1KM1A 2BHUA 4YTUA 4A2SA 2VWTA 4G7FA 3M07A 3V4BA 1UOKA 3KVKA 3VIGA 3ZSTA 2DT2A 4LC6A 4YWSA 2NQ9A 1PTAA 1TPB1 4A8NA 1TYGA 3HGRA 4PMYA 2ESCA 2PDKA 4ZB0A 1FOBA 3KZSA 4IM4A 1V3KA 1GQJA 4LEQA 3GHRA 3N2XA 1PX8A 4OFCA 3ERPA 3UFYA 2G5WA 1VENA 3CASA 2DIEA 3NPWA 3BPWA 3U5UA 2E5DA 3WUEA 1TV2A 4JN7A 3CJPA 4H01A 1XFBA 3UR5A 1PX4A 1OFDA 3S6OA 3E38A 3D47A 2EPNA 5KZMA 2Y1HA 3ZR5A 1XGEA 3AYVA 5K4XA 1TX2A 5LGZA 1OCBA 2O92A 1M65A 4D71A 3BW2A 4B5UA 4C6QA 1OABA 4JHZA 2TPSA 4I5RA 5I07A 4JQ4A 3FDKA 2QDEA 1JF6A 3DBNA 1QO5A 1QPNA 1Q2RA 3WNKA 3WUBA 1FWIC 5AVHA 3BAXA 1RR2A 3QRHA 3NSNA 1UH2A 2D2HA 1CX9A 2IQTA 4HHPA 1XYLA 1UWAA 3PHAA 4I9MA 2AKZA 2A3CA 1OJXA 4YYCA 2HNEA 5REQA 3BG5A 1J6OA 1EGZA 3CYJA 4M51A 3P60A 3R2GA 3VI2A 1A0CA 2VX6A 1JAEA 4LCQA 4RKAA 5HPCA 2CEQA 4NAFA 4BF9A 3DAQA 4DBSA 1F8IA 3V0TA 5CC7A 5GQBA 1TUXA 1RHCA 3H26A 2G41A 4BI7A 4O12A 2YCEA 4LQ1A 1SMAA 1HKWA 1QI3A 1VBGA 3LCXA 1L2UA 3IRDA 4XAFA 1O1ZA 3PZOA 4N4PA 2EGZA 4AY8A 2J7BA 4F8XA 1YBQA 4AD0A 5A3HA 4XD3A 3WJYA 1YDOA 1LM1A 3CUFA 4HJFA 4B3KA 3URQA 1AJZA 3ABZA 2PU0A 3AS2A 3NQFA 3USZA 1OX5A 2WV8A 5HMEA 3MS8A 3W7GA 1YRRA 4L9XA 4JTUA 2HROA 1T99A 1LL4A 3QW4B 4H41A 5BRQA 3LCHA 3R0UA 2D69A 4O1FA 2WZIA 1EKOA 5FJIA 1KBLA 4E2BA 1R9ZA 3GW0A 1KQYA 3QGAC 3LTYA 5DMYA 1U1UA 1UH3A 3ABOA 3IJ8A 3PBMA 5MHBA 4G8TA 3GK0A 3MQTA 2G4JA 4FP1A 1MFVA 4GVFA 1I4NA 1SQ7A 4FF5A 3WD4A 1G69A 4WVXA 1E9LA 4POCA 3WEOA 5F1UA 4MFEA 2D0HA 4XBSA 4C6DA 1GVEA 3YPIA 3TK7A 4MNMA 1XIFA 1ISVA 4XZ9A 3DG3A 4ADUA 3T4WA 4UB9A 1FY6A 3FVDA 1SO3A 2Y8KA 4HT3A 5B80A 1C9DA 1IIGA 1VB9A 1XV8A 3HGOA 2E9BA 1LORA 1OCNA 1W1YA 4RZ6A 3TXZA 3DFTA 2WMIA 4EIVA 1TCDA 5GNYA 2OKOA 4RPQA 4JYEA 1EWDA 4MGGA 4AG0A 1FP8A 1MDRA 4D8ZA 1W1VA 3ORWA 3TMQA 4H1ZA 4IFKA 1R47A 2HPIA 1NOWA 5FEXA 2R1MA 4IPIA 3MKKA 3P14A 3E2VA 2CLIA 2OLAA 4NX5A 1HF6A 3E1F1 3Q94A 2WMHA 2IPFA 5AZ0A 2R1LA 1KTCA 2QV4A 1Z69A 2I16A 5G4WA 3SAZA 1JUBA 1QWKA 3TDFA 1GZ1A 3XISA 4XAPA 4L7ZA 3QW3A 3M9YA 3GR8A 1WDRA 2FHBA 5A6KA 1XDMA 5H8PA 1EP3A 1A0DA 4EPEC 3M0MA 4IMGA 3WDQA 4S38A 3P8JA 5CXPA 5HBFA 3ZJKA 4GUJA 2VM8A 4MJ2A 3TQVA 3NSXA 4GVHA 3NL3A 1UR4A 5JBFA 1XRSA 1RP9A 3CXOA 1WO2A 4KWVA 3T07A 1PCKA 2ZDSA 3UERA 4R88A 1J2WA 1ADSA 4N0RA 3WELA 3MCOA 4O52A 2RFGA 4DB7A 2DH3A 3DGBA 1JUKA 2W5FA 1KCXA 4NZ1A 4I5XA 3KRSA 1RZMA 4JBRA 4GI8A 4DJFD 4J3XA 4TIMA 3JS3A 4RNFA 3DFSA 4PEKA 1OF8A 3T44A 3OPSA 4LS2A 4C60A 4KH2A 2DDXA 2NX9A 1CTNA 3BJTA 3RCYA 3WN6A 1MUWA 3UZ5A 7TIMA 3G0SA 4IG2B 3O15A 4W89A 1JYWA 5CG7A 3VPLA 1VHNA 1R46A 1X7IA 1OADA 1VHCA 1VYPX 4YWIA 4H7VA 4Y9AA 1HVQA 3W7KA 3ZLHA 4P8XA 2IS7A 4I7WA 4P7LA 3UA3A 4NX0A 3B8DA 1LWIA 1R87A 3A3HA 2QUMA 1DJGA 1OGSA 1IE7C 3CPGA 1PKMA 4CN1A 2INFA 3L4TA 4OT7A 5G2IA 4AD4A 3BCJA 5JH1A 3GVGA 2CITA 3AIVA 1ICPA 2PI6A 4WDXA 1QUMA 1R38A 4J2MA 1UR8A 4TX6A 2PTYA 2ZX6A 2GOKA 3AALA 3EWYA 4Z2HA 1SFJA 3HFTA 1HJUA 3AOFA 3RXZA 2ZC8A 2YL8A 1UZHA 1GW9A 3BOFA 3AMCA 1NAL1 4ZL1A 3KX6A 2PDCA 3WBYA 4HU0A 3VKDA 5KEZA 4RV3A 2D2JA 4V2XA 2CZFA 4PZVA 2VWSA 5LXEA 2FFCA 2VTFA 5H8MA 3WD1A 2BODX 1RD6A 1JG9A 3TROA 1IWPA 3PBGA 1H62A 3K46A 4FX7A 2Q71A 1NIUA 3LBOA 3LTSA 3K2GA 3R7MA 1PUDA 1RLDA 3OA3A 4E8CA 4DLMA 2PB1A 2KZHA 4DI8A 1J01A 2WSYA 1E4MM 2ISVA 4XV0A 3D6NA 3IJ6A 4DQWA 4N9CA 2TRSA 1WKFA 2HBXA 3ABXA 2NWRA 2Z1SA 3NGJA 5F2GA 2BWGA 1DQUA 3WBEA 4JS3A 3SCVA 2YYTA 5A8PA 3W9ZA 1W54A 1M03A 4GG9A 4MB1A 3W38A 1R5YA 3MI2A 4BR1A 5DT5A 3QSTA 5E93A 3W1QA 1GOMA 4S23A 3C3UA 2JEQA 4AY1A 3QHMA 8XIAA 3UETA 2XINA 4AX6A 3RN6A 4US5D 2GVGA 5D9MA 4FLSA 3MSYA 4HYWA 1D7KA 3G3MA 2C6QA 3T1GA 1ZNNA 1F05A 2F2KA 4LH8A 1PKNA 3LMZA 1DORA 2OX1A 4H9YA 4LGXA 3SADA 1H51A 1DWIM 2XSAA 3NO5A 4GYFA 3Q45A 2DUZA 5C2CA 3B9DA 4LNCA 4QNEA 1GEQA 5AC4A 4KT2A 1MVYA 2FJUB 2Z1WA 4UNIA 4LVDA 4W93A 4FO4A 4DO4A 4P8UA 3EWDA 4REQA 1QI0A 2YLLA 4MNKA 1XPGA 3HPFA 1AQMA 2Z1XA 5I00A 4EPKA 2E3ZA 5FF7A 1DJYA 5BZAA 2DJXA 5FAGA 2BOGX 3NVTA 2WVTA 3UXKA 3CUJA 3DHPA 1F7BA 3DU0A 4QX4A 1I0BA 4L61A 3MCNA 1YTKA 4YYFA 3OVGA 3TJLA 5IHRA 2E8YA 4WKAA 4MB3A 3GVWA 2IKHA 4IX0A 4LNYA 1JZ7A 4LAOA 4ENLA 5BOEA 1V6YA 3Q65A 1IR1A 1KM6A 1X98A 1TVLA 3VMOA 2BG5A 4GD0A 3UXDA 3IVUA 2P0IA 3K1GA 4WXZA 4A3UA 4F0RA 3IJQA 4ASTA 2V5KA 3FYPA 3WNPA 1UIOA 4X61A 2C0HA 4HA4A 4HSOA 1KFLA 1US2A 3DFQA 3GFXA 3NQVA 3LD5A 1WKEA 4DJFA 4HNUA 1ISWA 3TH6A 2YOCA 1RAKA 4NY2A 2XU2A 1P7TA 3ZR4A 4QJ1A 1PXGA 4E3TA 3VIHA 5I02A 4MM1A 2X0YA 3EDKA 1H1YA 2DGAA 3T09A 3I4EA 2NUXA 1TIWA 5IDIA 5I77A 3LNMA 2VRJA 4F2TA 3G8RA 1I1XA 4JFUA 5MKGB 3MT1A 1M6JA 3WH9A 4ATLA 3RO8A 3STCA 4DM2A 4XD6A 3G1RA 3M4HA 2WOQA 4DUOA 1QOPA 1GVQA 1SFSA 3HBLA 1A5LC 2BXZA 3AFBA 3MSGA 3I3BA 2OU4A 4GC4A 1UH4A 4D1JA 3EKLA 1P6CA 3QM3A 3GNXA 1AUSL 2F84A 1TWWA 1XRVA 3O6DA 1XLFA 3WLJA 3ZOAA 1Q6FA 2ZQ0A 5IRPA 4HJWA 3EA3A 3WJSA 2PD9A 4B3LA 1J96A 4Q8TA 5HANA 4HD5A 2BOFX 5CJMA 2B7OA 3L12A 4P5UA 3KBWA 2VX5A 3PF3A 4GKLA 1EZ2A 3WQ5A 4HHHA 2OZ0A 1XH1A 4W7UA 3EMZA 3WFAA 2G8ZA 3WO8A 2G3NA 4ZO7A 1P1XA 4AWSA 3WH5A 3WBAA 3ELFA 3H2MA 1OG6A 3R43A 3W07A 1E0WA 3PAOA 3CUXA 5E1QA 3ICJA 1RQEA 2FGBA 2OXNA 3QC0A 2E25A 3F5JA 4OIFA 3APTA 3S2LA 2WSKA 2Z6IA 1OK6A 4PCPA 4UFKA 2GJPA 2PBGA 1R9XA 4PBEA 1RK6A 1EPXA 1VFSA 3PJUA 4G5DA 5JH2A 2R1NA 3GH7A 2A3AA 5EA9A 5D09A 4QSFA 3AIUA 3T42A 3I6RA 3WQDA 1ZY9A 2YCLB 4WZHA 1E6QM 4UUIA 3U2OA 4JX5A 2QJMA 3OLDA 3WLKX 3GTFA 5CC3A 1XLLA 1GVRA 1JL8A 4MAVA 4Y90A 3KBNA 1MQRA 2PSNA 3LI1A 3MV11 3B0VC 1VLWA 1SGJA 1X6LA 4HK6A 2J88A 5CPSA 4GFSA 3MP5A 1XIIA 5LHFA 1J93A 3B8VA 4D6EA 3R0KA 4QDWA 4Q33A 4ZQNA 4EAYA 3CIWA 1YE4A 3IK2A 4AWEA 3VIKA 4O8RA 1EFZA 2YX0A 2A7PA 1QI2A 2HWGA 2XH2A 4KFNA 3EX4A 1K8ZA 2BV9A 1UBSA 3IWPA 2EPHA 3NQ6A 2I9EA 3VE9A 1OX6A 1MEHA 1TZ7A 1Z89A 1JCJA 4GUIA 2XFRA 4NAEB 2Y89A 5CC5A 1MUCA 3BMWA 3E12A 3MHGA 3S2JA 1VPQA 1FRBA 5D9NA 4ALDA 2E9MA 4LAUA 7A3HA 1A0EA 3VGGA 5FEWA 4P8VA 2V9DA 3LNPA 4QEEA 3T55A 1TPVA 4TMCA 4OVXA 1I60A 4MWAE 3UR8A 2UWFA 1K7XA 3BSGA 1K7EA 3B8SA 3MY9A 1E0TA 1UUMA 3N4EA 4QEHA 4XIAA 4W5ZA 3N2MA 1FWEC 3DOPA 3DHDA 4HPGA 4MJ4A 2VR5A 2QCDB 4E6MA 3M0JA 5D37A 2WZTA 4FEZA 3L4WA 3N17A 1IZCA 1VIZA 1KQZA 4UCGA 3SCSA 2I17A 4W87A 5L6UA 3ZVIA 4S3BA 4UOZA 4IXHA 1UD3A 3NYDA 5HQEA 4PMNA 1W1B1 5J5RA 4L4MA 1LYXA 1VFTA 2QW5A 5DELA 1XX1A 2W62A 4D6FA 1UJPA 3M44A 4GGBA 2ISSA 3ZVHB 2CU0A 4QQUA 1JULA 2OPJA 2Y24A 1N8FA 3WDIA 2ZRVA 1VBJA 4XO7A 2NQJA 4GGHA 2QKFA 4PEEA 4DF0A 1O5RA 2BNJA 4UR7A 5AYXA 1V6WA 1J10A 2AL2A 3GYEA 2RHGA 4NZCA 2E7FA 2OWCA 3WQEA 3QYSA 4F0KA 4DELA 4LF1A 4RNIA 1E71M 2IUZA 5E0CA 1Z42A 1Q7MA 1MWOA 3W85A 1ITXA 5CSUA 1HIZA 4IJCA 3BG3A 1VCGA 3LCGA 1EZWA 2WZMA 1PIFA 4L5ZA 4H2HA 4U5IA 4E8DA 2CPUA 3KDOA 3GXPA 3GDMA 5T26A 2DQWA 1GOKA 1WZAA 3WEMA 2YYUA 4ZO8A 2YL6A 3RJXA 4K6AA 4PUUA 1EP2A 1K70A 1NFPA 1A5MC 4JIHA 4UFMA 1GVSA 3SQLA 3GZ3A 3N6QA 3NUKA 3W7RA 3QQ1A 3IV8A 3GG0A 4PTMA 3EGJA 1DJQA 5D38A 3EDJA 4A3YA 3AHXA 4KEUA 4OECA 3U4FA 2JF6A 3SO7A 4NF7A 2Y61A 3PZVA 7CGTA 2BP1A 5I09A 1I2QA 3EMCA 1EL3A 2D22A 1N82A 1NSJA 2FVMA 1UD2A 2CHOA 4P61A 3GDRA 5K3VA 3LRKA 3S5ZA 4D6IA 5HK4A 2YR1A 3BLOA 3OGRA 1PS9A 1KB3A 4ZOEA 4XSLA 2QPUA 4J3UA 3W53A 2FHFA 5BXTA 5HMSA 3THAA 3WKZA 2O4QA 9XIMA 3NIYA 2C1IA 4NVTA 4GABA 1AZ2A 1AODA 2ZA1A 3VNKA 2X40A 1M41A 1ZAHA 3GH4A 3G1VA 3N9SA 3HJEA 3B04A 9XIAA 3H23A 3O07A 5I7GA 3H8AA 4MJMA 1C3FA 1VF8A 4JTFA 3NQBA 1TX0A 5HULA 2VDHA 4FNQA 3WF3A 1H7XA 3BCFA 2CBUA 1OC5A 1E0XA 3ME3A 1QATA 5HOSA 3VOFA 5D30A 3TQPA 3KOFA 1J0YA 5HJXA 1ZENA 2C15A 1J4EA 3EXRA 2NUYA 2WHMA 3A24A 1UPPA 4TVUA 4TTUA 4YS1A 1AFSA 5AZ1A 4GISA 1QCWA 4Y2WA 1DQWA 1RBLA 3KTXA 1LDCA 3O1NA 4KW2A 3NZPA 3O0FA 2DIJA 3PPFA 1L8NA 3O2LA 2Y0FA 1L6WA 3SJ3A 4ATDA 4BQ4A 4LY8A 1XCXA 2J9ZA 4LANA 1JIBA 1UP3A 2B7QA 3CNYA 1KWGA 3WL0A 2ZA3A 1XS2A 3A12A 3M5YA 4GQBA 1X1ZA 5DCBA 1J0IA 3KBMA 4IOTA 2DZVA 2HCVA 1TR9A 4FX8A 3DI1A 3QKEA 3UY8A 5G5IA 4AHOA 2G3MA 3D0CA 5ABGA 4D72A 1TV3A 5D02A 4JTDA 2DZPA 4S3JA 4TX9A 5E0FA 5FOOA 3AYTA 2VRKA 1WZMA 4WY0F 3AZRA 5ABTA 2IXVA 3HJZA 3T0TA 3GBEA 4IT1A 1RJRA 1QBAA 3ENLA 3MHUA 5FEZA 3EAUA 4Z1BA 2GSJA 3LI0A 1CGYA 1KA9F 2G3JA 3P61A 1T7LA 3ARPA 1SZRA 3GHSA 3RILA 2Y85A 1YTDA 3E74A 4O53A 3W86A 3H7UA 4LUTB 4GYPA 3NDZA 1F3WA 4DUXA 4ZGYA 3WNMA 4C1NB 1FFQA 3TW9A 3HPAA 4HMNA 2WCAA 1S5TA 2I14A 4B5WA 1YW1A 1I1WA 1ESWA 4F9DA 3LCLA 1IQ8A 2ZIDA 1H1NA 3GIYA 3KAOA 1F4AA 3WQVA 3SFWA 4YCPA 3SCNA 2ZTJA 1SVDA 6REQB 3BZGA 1F07A 1V03A 7TAAA 4PB3A 2NLIA 1ENUA 2XDFA 3NYZA 1BSIA 4WOZA 3URAA 3T6CA 1LCOA 1RQBA 2TAAA 1PPIA 1TE1A 5LZLA 5T9CE 1U22A 1A5OC 2CLKA 3ITOA 3R13A 4JL2A 5HATA 1YXDA 2P0OA 5LNWA 1ADOA 1Q7ZA 1XLAA 1OX4A 1W1IE 4ORIA 4HK5A 1XSIA 4MDOA 3KVMA 4ERIA 4MYAA 3S2NA 4OBTA 4DX3A 5IHSA 5C2XA 5I2UA 2PDJA 3LTPA 4FR6A 3QY7A 4DHGA 3FHAA 1PZ3A 3L7RA 5A1AA 1PYMA 3NQ2A 3PZQA 1OFOA 2VZUA 4I6VA 3BW3A 1QRQA 1HKJA 2A3HA 3ES7A 1TELA 4ZENA 1A80A 3CZLA 2WJEA 1ZP4A 1B90A 3QYQA 1EJUC 5FIPA 3ARVA 4LFYA 2R6OA 3AYSA 3RU6A 1W8SA 2OEMA 3IGUA 2D3LA 4ZB5A 6XIMA 2GSEA 4WY0B 3E2QA 2CNCA 5I5RA 3LU2A 1C8YA 1SO5A 3XINA 3REQB 4M80A 4NNBA 1R85A 3ITXA 3H4GA 5A94A 1JDDA 4Z0JA 2EJAA 2XSBA 2J47A 1CXFA 2AGKA 4V1XA 3FJ4A 5EL1A 3MCMA 4L1XA 1XINA 3WQOA 1KBKA 3W2MA 1DV7A 5MF5A 4I7VA 1V7AA 3C0QA 2VD9A 3G1SA 2J25A 1ODZA 3PK7A 4RK8A 1ZALA 4BZYA 1G67A 1YTEA 4Q6JA 3MB9A 5T9BG 1GZJA 4FNSA 5A8GA 3EWUA 1CNVA 2Y88A 5BXRA 1XICA 3N3TA 3B0YA 4FNTA 1UYQA 4IGHA 4PTNA 3DFPA 3PG9A 1HL8A 2ZADA 2Z7GA 1N55A 3BLLA 2XPKA 2YCKX 3C56A 2HV5A 4MOZA 3WD0A 3OOQA 2OFJA 2H9AA 1BLIA 1XIHA 1W9DM 3UF9A 3LXCA 5CLTA 5FI8A 1TPFA 3W72A 2C18A 4IFRA 1AMYA 1AQ0A 5FAJA 4ACZB 5F4SA 3SGUA 2VJXA 3F03K 3RMJA 1RK5A 2BVTA 2J8GA 3LMYA 5JIPA 5CPQA 3EOSA 2PDIA 2ZXAA 4DJDD 4K2SA 4MNLA 3IGXA 5A6MA 3G6LA 3TOPA 3MJYA 1P0KA 4X2PA 3SY1A 1OBAA 2F6UA 4ERAA 1M3UA 3CQIA 3UJRA 4PTDA 1H7OA 1F3EA 3TOYA 1DJNA 1RA0A 2RDUA 1B3ZA 4CNUA 5IBXC 3FYYA 4CCZA 1AA1B 4BQ3A 2QCDA 1J11A 4XZWA 4QLJA 1XFCA 3UJFA 1JFXA 3VOIA 3QMSA 4IHCA 2HQAA 4ES4A 1YNQA 1YDNA 1CW2A 3P5ZA 3UR7A 2GQ8A 4OBSA 1H0IA 5A6TC 3H2FA 3CB8A 1DEDA 1HKKA 1GT8A 3CTTA 4UZUA 2D24A 2WVVA 2DPEA 1G5AA 4GPNA 1EQPA 4L6DA 4AUBA 1OFEA 4R7WA 2EHHA 2DH2A 4Z08A 4ACYA 2ACRA 4PMUA 1X1NA 4GZ7A 3CZGA 3S83A 3V35A 2PZNA 4S3FA 3T4CA 4IUGA 1UKTA 2VGGA 3PSWA 3UZWA 3BQ5A 4O18A 4KCVA 3NGFA 3BLIA 3DXIA 2GL5A 3HGJA 4RZBA 4FA3A 5I23A 4UOQA 2GYIA 4HOWA 3DGRA 4QS5A 4ZVJA 3ANUA 4A3RA 1KXHA 1X8CA 2VT0A 3UYIA 1OM0A 4JTHA 2V3FA 3RIKA 1UB3A 4G56A 1TTQA 4B91A 5JXQA 2PTXA 1E6RA 4UZSA 4JR5A 3ZWTA 4H9ZA 5HQLA 3E5BA 2WBKA 4LAZA 4JEQA 5DX7A 3KCJA 5I03A 3AHYA 1L6YA 3P80A 4J40A 5A6AA 1K4GA 3UWZA 4UTWC 1IXNA 5KINA 4MVAA 4JKLA 1BYBA 4AMAA 1POJA 5EPDA 1DTNA 3GNDA 3TSMA 1VR6A 4Z0SA 1BWLA 1EJWC 3AU6A 2A3BA 4IZGA 3OLGA 1OCJA 3V36A 1XCFA 1ZJBA 4HSNA 3FW6A 4GYJA 1RD5A 2FKPA 4H9UA 4MY9A 1SJCA 2G4FA 1KGWA 2ZTKA 3S2CA 1VFUA 1PEZA 1DOSA 1QHZA 4UOJA 1ICSA 3DG6A 3WLRA 4HZMA 1X39A 4TOQA 2Z1VA 2XVPA 4QP0A 1XW8A 2OB3A 4XZMX 3VC6A 3NEVA 4HMDA 5CZTA 4Q7BA 1W5NA 3W88A 1E4IA 4LY4A 3MWCA 3PUEA 2QJHA 3GH5A 4LUIA 3DYMA 2J7GA 5CGMA 5FF3A 4HZ6A 3TR2A 1RY0A 3IANA 4XZHA 4XKMA 5HA7A 2CLHA 3HPXA 2ODOA 4NKCA 4TU1A 4XTDA 1CXLA 1OC7A 2DSKA 1YADA 2J8FA 5JQ9A 3F5KA 2FPVA 2GDUA 4Q4PA 2YXXA 3E0IA 3KS5A 3M5XA 4JIPA 2QIWA 4K8HA 4MG4A 1BSLA 4H83A 4Z2JA 1J0KA 2WPGA 1UOZA 1BAGA 3P74A 5T8GA 1KCZA 1UR2A 3STEA 5AHIA 2D3NA 4NRSA 3RPDA 2ISFA 3BARA 3NZ1A 4IIHA 3THCA 4DYEA 3W1LA 3UG4A 4F4RA 4WSJA 1ISZA 1EDQA 1O6IA 1TR1A 1A5AA 1KGXA 3PFMA 1K9FA 3V7PA 4JNZA 1M04A 1TWZA 3TUUA 4DO7A 3O16A 1LROA 3GBDA 1J0JA 3LCFA 4JYFA 1JPHA 7REQA 4PRWA 4W85A 2V68A 1JCNA 2OOGA 3ALFA 2VR4A 1RCQA 4BHYA 2XN0A 4H6EA 4CN4A 1F6KA 3V0SA 1BQGA 4WSKA 3FJLA 2VELA 2WLYA 3IIOA 4OJYA 3UXLA 2C8NA 1E9YB 2JGYA 2ATMA 2VC9A 3GY1A 1P6WA 1QPQA 1BVNP 2R9RA 1B30A 2GUBA 4JCMA 2XVGA 1GKPA 3KS6A 4C65A 1NELA 3CAKA 2WWCA 1EUAA 4KPLA 2VQTA 2B7NA 2X30A 3CUZA 4HYVA 4S3EA 3P8IA 4CEUC 4ORMA 1YXCA 5HPOA 2RAGA 3PNUA 3V5FA 1E1CA 3NQ7A 2Z4GA 1KBJA 5HUOA 1UASA 4Z1YA 1QFEA 1R3QA 3WFZA 3UG3A 5AHLA 1I6NA 1W2PA 3BDKA 2V3EA 3WENA 3N15A 3V5OA 1C8XA 1M01A 4AVOA 4HNVA 3CEUA 1BFNA 2YDAA 3W22A 1EXPA 1JNEA 2Q3RA 6CGTA 5C9ZA 2FZBA 3D46A 2GVJA 3KEHA 1FWRA 4H6QA 3L2LA 1UWIA 2W3ZA 1XLDA 2VDGA 3WMSA 3NVDA 1V77A 4PUKA 4LUTA 1TWSA 1YPIA 3VIPA 1MI3A 3I6TA 3SIZA 3JRKA 3SRHA 2Y6ZA 3DFNA 4FXSA 4QDMA 2OT1A 2P8CA 1V08A 1FH9A 2OELA 2V81A 4RW3A 4Q7NA 3RK8A 2BBFA 1LUCB 2VUNA 1W3LA 1V93A 4IPPA 5E6YA 3S8HA 4ZMGA 4X9SA 1TIMA 3S6TA 1K02A 2WM1A 2V82A 1QBBA 1FWSA 4HPHA 1MDLA 2ISWA 2DSUA 5FL0A 4MDPA 4C6LA 4HA3A 4WCJA 1E3XA 2W63A 2XYLA 1SR9A 3OQ8A 1A49A 5BMWA 4AZ6A 5AY7A 3LK6A 1WQ5A 5F2IA 1FP9A 1MZHA 2F2HA 4JIQA 2CLLA 1IXPA 1ISXA 4S1FA 3R10A 5ABFA 4LRSA 2EQDA 1OD8A 1JVNA 4YTRA 3WLIA 1DIKA 1VFOA 2C79A 2A3EA 3MZ2A 1ZQ5A 4JYDA 3BAKA 4IQLA 3VIJA 1ZJIA 4RE2A 1UZDA 3QH2A 4UQEA 3T9PA 1W31A 4IWWA 3S0CA 1XR2A 1ZJAA 3TKFA 1TPDA 1UC4A 5FJTA 2PMQA 5I78A 2QGYA 4GOAA 1NOFA 2XH0A 4Y7EA 3OVQA 1V7YA 3VD4A 4C91A 5HMFA 4DVOA 2C16A 3UCQA 5I3DA 4K38A 2ZZ4A 3QOMA 1GKQA 3IV3A 3PTKA 4LWWA 4XISA 3S1GA 5DCDA 3CPUA 3REQA 2W79A 3MJMA 1IT0A 3A3XA 3VOJA 1XLEA 1IHIA 4HCLA 1WUFA 2ATSA 1J5SA 3CZEA 2WVSA 4D6HA 3OJGA 2J4GA 2XIJA 3KDNA 5D03A 1XLCA 2PCQA 3ZWSA 2VGIA 1XI3A 4ROQA 3MU7A 3VIIA 1C7TA 2VFEA 3FJ6A 4MADA 3KBJA 2DZBA 2V6AA 1W2VA 3W02A 3ZR6A 1QPKA 4YMZA 4HU4A 4FOKA 1HP4A 4GNKB 2GWGA 3NAVA 3VA8A 4W5UA 3VOHA 4R27A 1ZJHA 4GJJA 5TBOA 4GIEA 3TN6A 3ITTA 5A8OA 2CZ5A 1I8JA 2PGFA 4N6EA 2X05A 3FA3A 4QBXA 4ADSA 4JKMA 1CZ1A 5F2LA 4BEQA 4UMAA 4QCEA 4HQVA 4AB4A 3RPMA 4GY0A 4CD5A 1TRIA 3BLEA 4B5SA 3W87A 3HG3A 1R3WA 1B0IA 4EK7A 3AROA 3H2OA 3E49A 2YBTA 1UPMB 4ACZA 2WSRA 1PHWA 2ZUMA 2BMBA 3RYSA 1A5KC 3CT2A 3KWXA 2CWXA 1HJSA 3HG2A 4UNLA 3WL1A 3CZJA 3SSZA 4XIMA 5C8BB 2Z2AA 5AC7A 2W92A 3N6JA 3C2OA 1IGWA 4JIIX 2YCJA 1Q65A 3KBSA 2YFNA 4AEOA 5AB3A 4FIRA 1VGAA 3KCOA 3LQGA 5IOBA 2JGQA 4J3TA 4DLFA 2GLKA 4D6CA 1XC4A 1PWMA 1D8CA 2QZRA 2E09A 3VXGA 4J5NA 3SR7A 1OFPA 1WXYA 2VGFA 3THDA 1XBYA 1EC8A 3WK0A 3IEBA 2XGZA 1KM2A 2ABBA 3KBVA 5BW6A 4R7OA 5C6MA 4KFPA 1JCMP 5CEWA 5HQMA 3ZLGA 1KLZA 1J8VA 4NJKA 3OBAA 2QF8A 4AISA 3WUGA 1F8MA 3F4NA 3R8RA 2QGHA 1PX3A 1FHDA 1X7FA 4WUIA 3AI0A 5G2WA 2BXVA 3POHA 2ACSA 3LEPA 3V5CA 1VP5A 2PBOA 4E0CA 1O4UA 5CSSA 2FVKA 8TIMA 4LVFA 1MMFA 1P43A 2AQOA 3GC4A 2WPBA 4Q3MA 5DQPA 4WLCA 1ZTVA 4AZCA 1KCLA 1NWSA 4PR4A 1V3MA 1JDFA 3W75A 5DEZA 4XSMA 3GNNA 4MB5A 1NWRA 1YPFA 3F2CA 1XKYA 4NZ3A 2X2YA 1KXQA 1DE5A 1VYRA 2VYOA 4M1BA 2B81A 3SUUA 1GWJA 1UR3M 1XLGA 4ATWA 3UNTA 2IKGA 4UFIA 4F0HA 4X22A 3LPOA 3AUOA 1Q4NX 1VIWA 4GKTA 3OIXA 3K30A 1EGVA 1A5BA 4CVWA 4L1WA 1X1OA 4FXFA 4DBDA 1OFQA 1GOXA 1XUZA 2YA1A 3G24A 3ID7A 4O4WA 2XH7A 3PB2A 3C8FA 4IXXA 2VD8A 3P84A 3GG7A 5K9CA 1MFUA 3I3DA 3DHUA 3S1WA 3GC2A 2QUNA 4UTIA 1TQXA 4UTTC 2QPXA 1A3WA 4UR8A 8A3HA 3BANA 3GSMA 9CGTA 1REQB 5J8LA 5A6JA 4V15A 1T5AA 3CIVA 1KLYA 1C91A 2YA0A 4J3SA 1VAHA 1W8GA 3T05A 3PG8A 4DRSA 4AIBA 2VMFA 4B92A 1V6TA 9RUBA 2YW4A 4PCTA 7XIMA 4FNUA 2HE8A 3EX6A 4AZIA 1PWLA 3G77A 2ACUA 2WKGA 3MWAA 3IVSA 1Z7AA 1RCXB 3BOXA 2HNHA 1KM3A 3QHNA 5TAOA 3TW6A 3BE7A 5DCEA 2WZEA 3LZ3A 3L68A 3WNNA 4CQBA 5HJYA 3BV4A 1Z32X 1ZU8A 1LL6A 1W1A1 2J7FA 4UTLA 5C0QA 4O0KA 1KFEA 2PWGA 3EPNA 1L8PA 4A2RA 1MW3A 2IPJA 3GAKA 2AAMA 4O19A 1WZKA 4DJFC 1BVZA 3GVRA 5DBTA 4ZE4A 3QR0A 3TCSA 3TAKA 1J79A 1IEXA 2OYKA 3VDCA 3A13A 3NG3A 5AC8A 1Q6LA 3VD7A 3T0DA 4KMQA 2OMAA 2QJIA 5CCZA 4ZTXA 1LJYA 5EKYA 2OOFA 6TIMA 1HQTA 3G0UA 4CQ9A 3EX1A 3EOOA 4QLKA 4RLIA 1K3UA 3N29A 4DXXA 2ZICA 3R6IA 2ALDA 2P5NA 1BD0A 2FZ8A 3MSDA 4MSSA 1H7WA 3K4WA 2QS8A 1FX6A 3ONBA 4IIGA 1RBAA 1UD6A 1XDJA 5HINA 1G0CA 1PTDA 3P6LA 3WBWA 3TAOA 3RMEA 1P4CA 2XIBA 4C6JA 5BROA 4W88A 3G18A 3E2RA 1RVGA 1SSDA 4LBUA 1CXHA 2ONEA 3QBUA 4W9TA 2ZZ3A 4G1NA 1TREA 1NU5A 4XAGA 1PE1A 3LQLA 4PFMA 1M5WA 2PWDA 1DXIA 1JCLA 3L4YA 3MANA 3M64A 3Q58A 3HMJG 3SSJA 3TN5A 2E6AA 1TG7A 4NASA 1XCWA 2OVLA 2DUAA 3UEQA 2UY2A 1XYCA 3RGTA 3TV8A 2D0GA 2YKKA 3BAJA 1TZ9A 1U33A 1F61A 4QROA 4JN6A 1WOAA 3VU2A 4DPPA 4IP7A 3QGVA 3PBYA 2NVAA 4I8YA 4O13A 3S2MA 3NDOA 3LRLA 4W8BA 4KEZA 1ALDA 2BY0A 4A21A 2QVNA 3V18A 4AEEA 3DESA 1UD4A 4ZFCA 4KEVA 1PKLA 3LHZA 4PTWA 2C91A 4WIWA 1KRCC 4X63A 1WUEA 2PCEA 2PF8A 2YSWA 1E0VA 2J75A 1EHAA 5A5WA 3WMLA 4BK9A 3UBPC 5H2ZA 5BOOA 3M41A 3SCOA 2J6XA 2QR6A 4LUJA 6ALDA 3PS7A 4L6OA 3TEVA 4HOXA 4MZ8A 4J3WA 1JQVA 3CL6A 3ONCA 4OBRA 1U83A 1LUCA 4PMXA 1E6PA 1EJVC 1UZ4A 1AW2A 5EY5A 4GO9A 4J3VA 1VLIA 4MMWA 4NP7A 1BXCA 4WXYA 5ENLA 1RY8A 1Q63A 2IQDA 1D8WA 3R79A 1YIXA 3B0UX 3E0WA 3M5ZA 5G1MA 3SJNA 2ZE3A 1B3OA 1K6AA 5ABEA 5CGQA 2XHYA 4FMVA 3C6CA 2O9RA 2AL1A 4YCOA 1W0MA 1X6NA 3A4XA 4MY1A 5AOUA 3I7SA 4MB4A 3QLDA 4AQLA 3MUY1 4H04A 1IV8A 3PTQA 4NRRA 2QPSA 3GM8A 4GCAA 2HK0A 2PP1A 4AD1A 2NV1A 3NXFA 1GJUA 3WZ0E 3FY1A 1Q5MA 4TUFA 1VRDA 4OQVA 1LLOA 2RH9A 2QDHA 3SECA 4AF0B 3ZM8A 3GUWA 3E2SA 3H70A 1P1MA 4H8HA 2PRMA 3QGKC 4GX8A 5BRBA 3EB3A 4L80A 3CHCA 3VVGA 1P0NA 2VGBA 4BKNA 3QSRA 1TA3B 1ZSXA 1LRNA 3LZ5A 4LVAA 3E9AA 3T81A 4NJJA 1HP5A 3VM7A 4A29A 4IUOA 4J28A 4KWOA 3SGGA 1SZNA 4RXFA 5E0KA 4Y96A 4E4FA 1MW0A 4TX8A 3UVAA 3NNTA 4ZXOA 3QY8A 3EB2A 1I2NA 2PDWA 4JFSA 4FLOA 1ONWA 2Q09A 1D3CA 4D8LA 1IEIA 2DVUA 3B9OA 4AIEA 4E3VA 1GHRA 4C6NA 2QCGA 2XJ7A 4M7TA 1TE6A 1VKFA 3TJXA 1OCQA 3AXMA 2Q02A 3B0XA 5IBXA 1YPXA 1OWQA 1UZ1A 1OINA 2Z7KA 4HU8A 3RF9A 1EBGA 2YLAA 1CI1A 1T0OA 4NJHA 2WXDM 3WLPA 4GUFA 1BXBA 5A2AA 4JEJA 3CIXA 2F8QA 1XJBA 1LT8A 2CXGA 2R91A 4M8UA 6ENLA 2Y63A 3LXAA 1W9PA 1TSIA 2O9OA 1IZKA 1Y5WA 4NXSA 4F66A 1A5SA 1JXJA 1HG3A 1NARA 1EB3A 1N2VA 3WLMA 1ZBVA 2P8BA 1ZCCA 2WNNA 2BDQA 1EJ7L 5K4ZA 2RKXA 3CHDA 1JNDA 1Y5VA 3BGAA 4V1YA 3KL0A 3U2EA 4J35A 3R8GA 4MZ1A