3O63A

Crystal structure of thiamin phosphate synthase from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
222
structure length
214
Chain Sequence
HMHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPVNVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTAPGLGLVRVAAELDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thiamine-phosphate pyrophosphorylase
publication title Crystal Structure and Identification of Potential Inhibitor Compounds for Mycobacterium tuberculosis Thiamin Phosphate Synthase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 214
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o63A00
1PS9A 3VKJA 1I2QA 4UFMA 3TC7A 3FS2A 3HBLA 3LBMA 4RZ4A 3PBYA 3HOJA 3M9YA 4Y96A 2VEKA 2VKZG 3PS7A 2HTMA 1OYCA 3UYCA 1KLZA 1KTNA 4GRSA 2CW6A 3HG4A 4TR9A 3E96A 3LCWA 4XTDA 3W73A 3LCHA 3B05A 3CEUA 3PUOA 1QWGA 2OT0A 2HS6A 2YDAA 5LNVA 1MXSA 4RZ5A 3TDFA 1ML1A 1CX9A 2ISWA 4M6QA 4MPQA 2QCEA 3ATYA 1ZHAA 4Q32A 3EKZA 4H3DA 1FBAA 5FEPA 4JR5A 1VR6A 4P61A 1L6WA 1J2WA 1PL9A 3HGOA 4O11A 4U4MA 1G7VA 4Y9AA 1SU5A 4GUFA 3TQVA 3C2RA 3TA6A 3PUEA 5LNUA 2QCHA 4DO4A 4PA8A 3NGJA 4O13A 3HGRA 1GG1A 1KFJA 2BZNA 3NM3A 4LRTA 1LCOA 3G1XA 2ZYFA 4QITA 1EEPA 3G0SA 3QC3A 3C0JA 3CQ0A 2VFHA 1LYXA 2Z1BA 4CCDA 3GR7A 2X16A 4QIUA 3EWBX 1FCVA 3DKLA 4JS3A 3WFAA 3TJXA 5E93A 2VEPA 2YYTA 2H8ZA 3C2EA 2A7RA 5A8GA 4O50A 1RPXA 4HNVA 3M1ZA 1B3OA 3G1AA 2WOQA 3INPA 1VC4A 1L2UA 1Q6RA 3NQVA 1Z44A 3PSVA 2WNQA 4UNKA 4FNUA 1H62A 1EUNA 2WSQA 3W1AA 4LT9A 3DFQA 4O0KA 3M5YA 4MYAA 1W0MA 3MHFA 4CQAA 3FOKA 3MJYA 4TIMA 2ZRZA 5AHFA 5F4SA 4HPJA 4OQVA 3UWZA 1EWDA 3LHWA 1F05A 1H7NA 3G0UA 1O60A 2E6DA 2KZHA 2QCFA 5C55A 1Z42A 4NNCA 2CLIA 3KAOA 1M6JA 5D03A 3W2LA 3V1PA 2A0NA 2HSAA 1I4NA 5D2WA 2NUYA 3MI6A 1F76A 1LZOA 3BLEA 1D3GA 1K7XA 1YLVA 3G1FA 5AFDA 1M7PA 4LC8A 4LOCA 5D33A 1W5PA 3W87A 2R91A 4DPPA 4HNNA 3QQ1A 4BFAA 1MEWA 3TXVA 3IGUA 3TQ0A 2CZDA 5D38A 2B7PA 5BMXA 4LS2A 1G67A 1AMKA 3W7RA 4AWSA 1D3HA 1XUZA 1UCWA 2ZQ0A 3CT7A 4ADTA 3UXAA 4O53A 4JEQA 2Z2UA 1SQ7A 1QMLA 3QW3A 4JDBA 4FB7A 2TMDA 4O17A 4O10A 2RHGA 3GZ3A 4JN6A 3NQEA 2V2HA 4YCOA 3C3NA 3CWNA 1Q6LA 3WJZA 1W56A 1WBJA 2NX1A 4FX8A 1THFD 1LOLA 4LVAA 5CZJA 2FJKA 3EKLA 4JTFA 4LTSA 4UTIA 3FYPA 2J6XA 1FY6A 2G97A 2WKJA 2CLMA 1OG0A 3I6RA 4KFPA 4FNTA 3L5MA 5F1VA 3TIMA 4UR7A 5LSMA 1RR2A 2AGKA 2C13A 5LGXA 2AAMA 3IIXA 3D0CA 3W7KA 4YL2A 2XFWA 3W1LA 2V30A 2NV2A 4BI7A 3M7WA 3EX1A 3GLCA 1H50A 2FFCA 4EF8A 4Y8FA 2EF9A 1D9EA 1I2OA 2NUWA 2EAWA 3TSDA 4QSHA 1VCGA 3NQCA 3MYPA 3LB0A 3LXAA 1VYRA 1JVNA 1SO4A 3W76A 3W7LA 4UTUA 3GXNA 3NPUA 1ZCOA 4QNEA 3NM1A 3C2OA 4K8HA 5EA9A 1YYAA 3S5ZA 2FB3A 2ZZ5A 5CZTA 1WOAA 4PC8A 3N73A 1IF2A 2QJIA 2QJGA 1FX6A 3IGSA 1CI1A 3PR2A 4R53A 3ZS4A 3O8AA 3NQFA 2PE4A 5E1QA 1TQJA 5K3VA 5MHBA 3LBCA 3W22A 3PG9A 5T26A 1EX5A 2OT1A 2DZPA 1KM3A 4DF0A 4N9CA 2YW4A 2R14A 4BI6A 2Y70A 2ZRVA 3F4NA 1Z48A 4AHPA 5EY5A 5FF4A 1F2JA 4ADUA 1G6CA 1SW7A 3O63A 3DHFA 3HPXA 1IIHA 3MHGA 1P0NA 3MWAA 1QAPA 2NV1A 3RLUA 2QJHA 3NQ7A 4TMBA 1DV7A 4HNUA 2E68A 4IXXA 5G2WA 1VQTA 2ATSA 4LS0A 3G0XA 4GUIA 4AMAA 4JY9A 3QM3A 4UFKA 1PHQA 1TPC1 5DXXA 5D04C 4XWUA 3QSRA 4GFSA 1Q6QA 3P61A 1LDCA 3QMTA 4LVDA 1GZGA 3LXBA 3L9CA 4PFMA 4K38A 1G4PA 4MFEA 4OE7A 5K9CA 3UY7A 3QW4B 3HB9A 4N4PA 4JNMA 1KM4A 5KITA 4PEKA 3HPSA 5FF2A 3W2JA 2JBMA 1GOXA 1NF7A 4GE8A 3W75A 3W86A 3W6YA 1HTIA 4WJEA 3R5EA 3IVSA 5F1UA 2G5WA 5DBTA 1W37A 2OMAA 1OHLA 1VLIA 1W5QA 5FF3A 1HL2A 1N55A 3WJWA 4FEZA 3IGXA 2YSWA 1SSGA 2C14A 3G8EA 4NXSA 3P8IA 4UTTA 3Q58A 1W31A 3W7MA 3OA3A 3HIJA 1F6KA 5KZDA 1HFBA 3W70A 2J24A 3W88A 1AW1A 1FXQA 4BF9A 1VJIA 5AC8A 3AJXA 2NWRA 1JCYA 4PL1A 5FF0A 2Y7EA 3M16A 4POCA 1OX6A 5AHLA 3DENA 1KBJA 4JYDA 3STCA 4IMGA 3N14A 1DKWA 2XN0A 3W9ZA 3FFSA 2Y63A 1AK5A 4Q4KA 1OK4A 2DZSA 5EMUA 3KRZA 5G4EA 4DEFA 4JTTA 2X2GA 3NXFA 1IIGA 4O14A 1XBVA 4FHAA 3EWYA 3WK0A 1F7BA 4UTTC 2B7OA 4ZQOA 1O5XA 4LRSA 3L5AA 3O6CA 5KMYA 5D2VA 3KVJA 3NVTA 2QKFA 4X22A 3GAKA 1C8VA 4UMAA 2FIQA 1XXXA 3L0NA 5IBXA 1C29A 3DZ1A 3EX6A 4FNPA 1ZENA 3AO0A 1Z41A 5IM51 4OWGA 2FDSA 5KZMA 1FCQA 3MP3A 4Z08A 4NU7A 1TPUA 3A9IA 1RD5A 3LM7A 3P7YA 4FXSA 1OF8A 3DBPA 1OFBA 1GTHA 4O4WA 5DLCA 2CLHA 4JTGA 4CNPA 3H53A 3MW7A 3ABRA 3ABSA 3LLDA 2BX7A 5J5DA 3O6YX 1YADA 5KZEA 3LCFA 3BLIA 3SI9A 5IBXC 1RZMA 4UFLA 4QM1A 1QPQA 4M6VA 1XI3A 1NAL1 5BMWA 3QFEA 3GDRA 1JCJA 1SO6A 3LXCA 1SO5A 4Z0SA 3KOFA 5ABTA 4WY0A 3NQMA 1F6PA 3N9SA 4NX0A 1JQXA 4CCEA 2QR6A 1UJPA 2WPBA 4PCFA 4Y6GA 3LI0A 2GVJA 1W3TA 1FWTA 4ZQNA 2ZRUA 4WUIA 2A7NA 3EXTA 1JULA 2X1TA 2CLEA 1GPWA 3JR2A 4FX6M 1KA9F 1YTDA 2E5BA 4FIRA 1NF0A 6ALDA 4GNJA 3MBFA 3BG3A 1TMHA 3B0PA 3LHUA 4KKXA 3GX9A 1TPEA 2ISVA 4JICA 1DJQA 3QJAA 4DO6A 1TRDA 3BW4A 1SR9A 4UR8A 3M5VA 3FKKA 3G1YA 4NXKA 1F74A 1GVQA 4PH6A 4IJBA 4ZZ9A 1OFPA 1PVNA 5CPOA 2NZLA 3CC1A 3W23A 3DI0A 4WY0B 4BK9A 2EKCA 3MYOA 4K37A 2Y89A 1N8FA 2VC6A 3P80A 3P60A 1JCXA 1KFBA 3OEXA 2CLFA 4LS1A 3TW7A 3EWWA 1PCWA 2V9DA 4ICNA 2ZTJA 1M7OA 4WOZA 1QCWA 5AN7A 1KTCA 2RFGA 3IVUA 5CZSA 4K6AA 4OBTA 1OK6A 3A5VA 1MZHA 3G1VA 4TU1A 3LCLA 2C15A 1A5CA 2GQAA 4O8RA 1VYPX 2Y7DA 1J4EA 3HO8A 2YFOA 4WY0F 4Z1AA 1KM6A 2PURA 1LOQA 3E49A 2HS8A 1VCVA 1BTMA 3PAJA 1ZY9A 5HWMA 4A22A 4S2CA 1LRQA 4FO4A 1JRCA 4MJZA 1G69A 4MOZA 2E6FA 1DVJA 3DH7A 3O15A 4C1KA 3R2GA 3L68A 3QEZA 5TBOA 3W2NA 2DZVA 4FF7A 3W2UA 1BWKA 3BARA 3TU9A 4TX9A 4HHPA 4XZ9A 2O7SA 3G3DA 1JUKA 3T40A 1PE1A 1QOQA 1KBIA 3LRLA 5D2YA 1I45A 1HO1A 3UWUA 4OGZA 4WXYA 2RH9A 3W1RA 1L9WA 1O5KA 1KM5A 3CPRA 3IIOA 1KM2A 3GNDA 2AQWA 4MFDA 4HN4A 4QQ3A 1LM1A 1W5MA 2OZ0A 2C0AA 3GKAA 4IPJA 4O28A 4L4LA 5LHFA 2Y88A 3SSJA 3O06A 3EWUA 3OVPA 3IIVA 1P5BA 3UZJA 5KSWA 1K8YA 2ATMA 4DPQA 1OFRA 2FQIA 1Y0EA 2WSYA 2YR1A 3DI1A 3EEGA 4KFNA 3HG5A 4X9SA 4HIBA 2Q3RA 2ZRXA 3P82A 2R94A 4K7VA 4KWVA 2I14A 2JKPA 1G4SA 3NQGA 3O07A 4TO8A 1S5VA 1V5XA 4DF2A 4LW7A 1JR1A 1H51A 3K30A 4LV9A 3UQNA 4ZQMA 1WBHA 3E9AA 4UFHA 3QYQA 4N6FA 5G1YA 3GAYA 5K7JA 3T78A 1EP3A 3LV6A 4AH7A 1VHNA 4RXFA 1WXJA 3OHIA 1H7XA 4RR4A 3QF0A 3F1QA 1KV8A 3RNDA 2BLEA 2CFFA 2B7QA 4UTHA 1QPOA 2VFDA 3MO7A 2R8WA 3DFPA 3FLUA 4X2RA 5FI8A 3RFAA 3RU6A 3TMQA 2V8ZA 3W1PA 4CLMA 5E0KA 4G1KA 1O94A 5CPLA 1JUEA 5U7SA 4JTJA 2W0UA 3LHTA 3PSWA 5EL1A 1KFCA 4OU1A 2GUUA 4XBSA 1I2PA 3BW2A 2HMCA 1A5SA 3FKRA 5AB3A 5G2HA 4LNYA 1QPNA 4P2VA 3BO9A 2Y7GA 4S1FA 3NL5A 1KTBA 4HSOA 1SUXA 1TPDA 1SZEA 1GEQA 1MEHA 4MZ1A 3L21A 1ME8A 2ALDA 1PCKA 4JTSA 5I3JA 3TW6A 4CQ8A 3TJLA 3BPWA 1EIXA 1LTDA 1G7UA 1XM3A 5HQEA 1ICQA 3OVRA 5K9DA 2VELA 3W84A 4Z1BA 2P10A 3DFNA 2C18A 8TIMA 5HNRA 1PIIA 1ZNNA 1X8FA 3RK8A 3NDOA 2YPIA 1TV7A 3LRMA 1W54A 4PL2A 2PRLA 1YPIA 4M6PA 5FEWA 3W2MA 5LHEA 4UUIA 5AHEA 3DFSA 4UTJA 3ABOA 2QCMA 5CZ0A 3PY2A 5CSSA 4C1LA 3W74A 3W72A 3PUDA 3NZRA 1XFBA 1YXDA 1L6SA 1LBFA 1DL3A 1OVDA 5F2IA 2ZZ4A 5F2GA 5G2IA 1X1OA 3P5ZA 1UASA 1K7FA 4NJHA 2QAPA 3H55A 4UTLA 3MHUA 1MEIA 4YXGA 4FXRA 2GVLA 4O54A 4OV9A 3QPYA 3TSMA 5AYYA 1M5WA 1WDWA 2FPVA 4LVGA 1H7PA 3MMTA 2QF7A 3DFTA 1PHWA 3N34A 3W83A 3L0KA 4N9BA 2UV8G 4IUOA 4UTKA 2NXGA 3DHDA 1QR7A 4N9EA 3BW3A 4YWIA 1P1XA 2WNZA 4O1CA 4UC5A 3WJSA 3UD6A 2VEIA 1OX5A 1B9BA 3DXIA 3OG3A 3KRUA 4Z1DA 4O15A 1ME9A 5LZLA 1R2TA 4O57A 3DAQA 1L6YA 4HNTA 5DXYA 4FX7A 1VPXA 2YX0A 4Y90A 1VRDA 1G4TA 2E1DA 3HGSA 3NL3A 4XQ6A 1FWRA 2X1SA 2JKEA 4JTHA 3PB0A 4YLWA 4CNNA 1BEUA 5HR7A 4R7JA 4JTKA 5GVJA 3L66A 4GJ1A 3S1XA 1K8ZA 2QUVA 4IGHA 4HSNA 1E51A 5HUOA 3KRSA 1IGSA 3THAA 1QFEA 4LC6A 2A5HA 1R2SA 4M19A 4JTEA 1W1ZA 5I3GA 1UUMA 3PWAA 3W2KA 5HR6A 2DORA 3EWZA 2C16A 1IXPA 4UMCA 1ZALA 4XKYA 3EX4A 4AF0A 1WA3A 2ZZ3A 3STGA 4MUZA 1G4EA 2YCEA 4NNAA 1ONRA 1TB3A 3UZ5A 4DELA 1XBYA 1K02A 1X6UA 3IVTA 3UPBA 5J5RA 5CPNA 2ZA3A 3HGJA 3TSBA 3W7JA 2V2CA 4JIQA 4E38A 4JX4A 1VHCA 2C3ZA 4NUWA 1H60A 3QMRA 1DQXA 4TMCA 1B4KA 2ISSA 3STFA 3LERA 1RQBA 1LP6A 3S6DA 1LBMA 3EX3A 4A2SA 4JYFA 1WOBA 2ZZ2A 4ADSA 1SFJA 5EYWA 2F7FA 3HJZA 1DORA 3GDKA 1H61A 1H1YA 4ONVA 1V7YA 3QMSA 2IQTA 4XKYB 3BGGA 2QCDA 4AF0B 1EPXA 1XCFA 3TC6A 1TPH1 2JKAA 3EWXA 5AOUA 1GVFA 4DBDA 1X7FA 4DBEA 1TPFA 4ZQCA 5HMSA 4I7WA 1T99A 3C2VA 1YDVA 2H3BA 2NX9A 4QAIA 3GNNA 1KLYA 3MP5A 3TUUA 1A50A 4GUGA 3S0CA 1LRNA 3W07A 4ZMGA 3C6CA 3N2XA 1QNVA 2Y6ZA 3NAVA 4NJJA 4ORMA 3Q37A 1U83A 1GWJA 4LY8A 3S5YA 1F73A 3M41A 3M6YA 3SW6A 4U28A 3WK3A 3KXQA 4MJMA 5FEZA 2H8XA 2QCCA 5D30A 3KVLA 3V75A 4PTNA 3PF3A 5LNSA 4A29A 2QCDB 3NNTA 4EIVA 1O4UA 4AWTA 1RVGA 1W8SA 3RMJA 3CWOX 1TREA 2E77A 2H3DA 3UWVA 4FNQA 1W5NA 1LORA 1EUAA 3PG8A 1TPB1 3C56A 3P62A 3SGUA 2CLLA 3TAKA 3PULA 5KTLA 3NQ6A 3SZ8A 2E6AA 1FWSA 2J9XA 2NUXA 1RQHA 1AL7A 2H90A 5DY3A 1S5TA 2QDHA 3W7QA 5TQLA 3STEA 3FJLA 4JX5A 3RLVA 2VFFA 3N9RA 2XN1A 4A2RA 5C5YA 1OYAA 3T55A 1OF6A 4GUHA 3LTPA 2E5DA 2TPSA 3M0ZA 3LCGA 3NL2A 3IRDA 4RLIA 4O4VA 2Y62A 5EBUA 3FEMA 4LVFA 4A3UA 2W6RA 4UMBA 2W79A 2VXNA 1HG3A 2PRMA 4E0CA 4WOQA 4Q33A 1ME7A 3PBWA 5AYXA 1OX4A 4MVAA 4GUJA 5H91A 5D37A 1LRTA 1FWNA 2ZZ1A 4O52A 4AXKA 5CSRA 1JCNA 1H63A 3W1MA 3P67A 4KWWA 2BXVA 5G4WA 5LNRA 1VH7A 2CWNA 5LGZA 2WQPA 3W7OA 2X1RA 1GG0A 2Q8ZA 1CW2A 3O16A 2VEMA 1TQXA 3W85A 4Z0JA 2V2DA 3S1VA 1NFBA 4RX0A 1R30A 2YGYA 3A24A 1HO4A 1K7EA 2JGQA 2OCZA 4DO5A 4D2JA 5EKYA 1ALDA 1YXYA 2CLOA 3M44A 4N6EA 4K36A 3W1TA 5D32A 1OFEA 3W7IA 2PRHA 5C2XA 1K8XA 5F4WA 1FCUA 1OX4B 1VCFA 4NQ1A 3P74A 5FEXA 4UTMA 3LV5A 4JGDA 1A53A 1ZAIA 3VCRA 4MY9A 3LTSA 5I3IA 2DJXA 3SFKA 3W1UA 3GDTA 5G1TA 4JTIA 3PB2A 1SFLA 4GWEA 3S8HA 1OJXA 5CGQA 1XBXA 2GJLA 3I7QA 5DCBA 1UB3A 4JY8A 3UNDA 1EA0A 1YTKA 3CEPA 4AEOA 5SWUA 3KHJA 3KX6A 4HT3A 1R47A 3WJXA 4NVTA 4LUIA 2GVGA 1FQ0A 4LV4A 2ZZ6A 1AG1O 3W71A 1U5JA 1W5OA 2QEZA 3QRHA 1JCLA 3LHVA 5BOOA 1XBZA 4N4QA 2Y7FA 2BWGA 1R46A 3C4UA 4MYXA 4O1AA 5TIMA 1LOSA 3W7CA 3GYEA 3E12A 3I65A 4Z1CA 5I3HA 2V81A 2C19A 4IWWA 5FESA 1LLZA 3GIYA 2V82A 2Z6IA 5F2LA 3EB2A 3VE9A 4RK8A 5K4XA 1DOSA 4FNRA 1EWEA 2A1YA 5D09A 1C9DA 3THQA 3TR2A 4UNLA 3QZEA 1BKSA 2NX3A 4B5NA 4RXGA 2VOMA 1LBLA 3N19B 3P84A 5CKSA 2NWSA 4AHOA 1TJPA 3G18A 4N02A 2C1HA 2CLKA 2QCLA 1ICPA 2A7PA 3EXSA 3F4WA 2RDUA 1TTQA 3VNDA 3W1QA 2Z6JA 4E2BA 4RJEA 3TFXA 4BWLA 3B0UX 2B4GA 1H7WA 4JX6A 2WV8A 3SR7A 1I8JA 4MZYA 4JTLA 2ZZ7A 2Z0IA 4AVFA 1JUBA 2ABBA 1TCDA 6TIMA 1SO3A 5KINA 3PC0A 3ELFA 2P1FA 3HG2A 2EPHA 4LVBA 3VI2A 5D02A 4K8EA 1H1ZA 3TE9A 1RV8A 1A5BA 3L2IA 3CTLA 4UFJA 4O12A 3W7HA 2QUUA 3A22A 7TIMA 1ZAHA 1QDSA 4O1DA 3W7DA 2YXGA 5F4XA 1VLWA 3S5NA 3JS3A 4AB4A 4NJIA 3GDMA 2EGZA 1H7RA 1FUYA 1WX0A 5I3FA 3I68A 4BWLC 2LLEA 1YXCA 2ZRWA 3I7RA 5DN1A 2DP3A 3CLMA 1QO2A 3TXZA 1LROA 4UCGA 3TROA 4WQ6A 1IXNA 4X3ZA 2Q3OA 4QNWA 2J9YA 3FJ6A 4GC4A 4QJ1A 4ZQPA 2J9ZA 1EP1A 1TYGA 3DFOA 3A23A 3LHZA 3VE7A 3ZWSA 4O18A 5LNWA 1JQVA 3L65A 4O0ZA 1F5ZA 1XDMA 1OFQA 3NZ1A 5AHNA 3SGZA 1GQNA 4M7TA 4NZFA 4O19A 1Q3NA 3W7PA 1WV2A 3U2OA 3ANYA 2FPYA 2Y61A 1NSJA 1FDJA 3LLFA 3KVMA 1S3HA 3NPXA 1K3UA 3TX9A 3NQ8A 3NQAA 3GXTA 1S5WA 3LOTA 4AAJA 1NEYA 1JRBA 2G96A 2E6YA 2DU2A 4I7VA 3E0IA 1PV8A 1AL8A 3HMJG 3B04A 3TFCA 3SIZA 1R2RA 1GVRA 2VFIA 1LLWA 3TKFA 1ZAJA 5L6UA 3HPZA 3BV4A 3JRKA 2A6NA 4M5PA 4MKNA 4XTIA 2NXIA 1TPVA 4J9JA 3TH6A 2GQ8A 3ZFHA 3BG9A 2QUTA 2B0MA 3MI2A 4RV8A 3O05A 4IQLA 3Q94A 1GYLA 4N2YA 5DY2A 4WD0A 3R89A 3BGJA 4UFIA 3DKJA 5HWJA 4DF1A 3S42A 1XUUA 3NL6A 2J27A 4KFOA 5F2MA 4NJKA 4JXCA 5HUPA 2VFEA 2RKXA 3NPWA 3LDVA 3NO5A 1KV5A 2ZCGA 1HUVA 1SZGA 5EPDA 2I9EA 3NQ2A 5FF7A 5AC6A 1YPFA 4MIMA 4FNSA 2XN2A 5HINA 3M43A 4RZ6A 1I2RA 3S5OA 3T7VA 3TK7A 4EVZA 2ZBTA 3OIXA 5D2TA 2QCGA 1B57A 2ZA1A 3EXRA 3A21A 4ZVJA 3WJYA 1WYIA 2ZFAA 3NG3A 1EP2A 3G1DA 3M47A 5G5IA 2OJPA 4NNBA 4AHQA 4R34A 2I1OA 3CU2A 2TYSA 3S9YA 3P81A 4E2DA 2WO5A 2CZEA 1RQEA 3LCIA 2OX1A 4WZHA 1QO5A 2VFGA 3CM4A 1FXPA 1FWWA 3W7GA 4M7SA 4FIQA 5DELA 5D05A 4JYEA 3OVQA 4ZL1A 4IMCA 1GTEA 1MSSA 1W3NA 2GJNA 5AYZA 4IX2A 3EX2A 3QQ0A 5DBUA 1GYNA 4MLJA 3B0VC 4IMDA 1SSDA 2WJZA 2DJLA 4GXMA 5A5WA 5D2XA 1VS1A 3L5LA 3BLFA 4MZ8A 3ZR4A 3T44A 4O16A 1IXQA 1N7KA 2A6LA 4XUGA 1GVSA 5C54A 5K2ZA 3UWYA 1FCBA 4LWWA 2A4AA 3RF9A 3S1UA 3TMLA 3G3MA 2PC4A 3FA5A 1H7OA 2WSRA 2ZDRA 5L9FA 3IEBA 4EF9A 1TJRA 1TO3A 2DZUA 2NLIA 3Q2DA 2YFNA 1NVMA 3CB8A 4R33A 1H5YA 1KFLA 3U8GA 3UY8A 1AW5A 1GJPA 1YDOA 5H2ZA 3H54A 4IX0A 3NOEA 4ML9A 3B8DA 3R12A 2FPTA 3N2MA 2PCQA 3SECA 2YW3A 4PODA 3W1NA 4NX5A 3LX9A 3WK2A 5DCEA 1J5TA 2GOUA 1QPRA 1P4CA 3GR8A 2X1UA 5BW6A 3HF3A 2A85A 1X1ZA 4IOTA 2ZTKA 2G95A 2DZTA 2P0OA 1KM0A 2A2IA 2FTPA 1XDLA 4CCCA 2JGYA 2DZXA 5HJLA 3W3OA 4IPIA 2FLIA 3KVKA 1WAUA 4GBUA 3LHYA 4DXVA 3PVFA 4EOUA 3L0GA 2VENA 4JIPA 4CQ9A 2X30A 2QDGA 4OV4A 2ZA2A 2ZRYA 2RDTA 1XC4A 4K39A 2QCNA 4UTWA 2NXHA 4S2BA 1SW0A 1KW1A 3QH2A 4I9AA 3T4CA 1Q45A 2CU0A 1A5AA 4HKPA 1WQ5A 4AWUA 5CPMA 3M5XA 1TTJA 3IIPA 3SJ3A 3BG5A 3MUXA 3MI3A 1T8XA 3E02A 1VGAA 1TV5A 4HPXA 1EB3A 3TV8A 3GKFA 1T0OA 3TNOA 1DBTA 2JK2A 4ORIA 1SZNA 5LKYA 3FIGA 1AW2A 3TCEA 1TSIA 1ADOA 4H6KA 1GVOA 1GT8A 1OFDA 1UUOA 4NZJA 3HQ1A 3I7SA 1OFAA 2WNNA 1TIMA 3MBDA 1OFOA 3CHVA 5AC7A 4RCXA 1OABA 3MP4A 3NYZA 3QSTA 2A21A 1P0KA 4UTWC 1TTPA 4MY1A 3UPWA 1W3IA 2C6QA 1ICSA 3FYOA 2BSLA 2D73A 2BTMA 2TRSA 3F03K 5HWNA 3ZWTA 4WX2A 3P5YA 3NA8A 2FB2A 1JJKA 3HG3A 1SPQA 1DQWA 3U6WA 4RKAA 3O1NA 2J88A 3ATZA 4WXZA 2V5BA 4N9DA 5C6MA 2CZFA 3M5ZA 1Q6OA 4BR1A 1JCMP 3N3MA 3UWQA 3USBA 3TAOA 1TV8A 1VZWA 3R13A 2YYUA 5AHMA 3GB6A 3BVJA 1IXOA 1KM1A 4LUJA 2YZRA 4LU0A 4L4MA 5K4ZA 1QOPA 3CIXA 2E5CA 3W7EA 5BNKA 4JTUA 5BRBA 3R8RA 4YCPA 3WK1A 3UXDA 3GVGA 1XKYA 5K9XA 1BWLA 3W1XA 3IIZA 3NQDA 3B4UA 3CIWA 1KFKA 3NR0A 4IXHA 4IMFA 4NJGA 3LTYA 3L67A 5I3KA 3DU0A 4DQWA 3NEVA 4MY8A 3G24A 2E09A 2GPTA 3DGRA 1FDZA 1B4EA 3GXPA 2RDWA 3ABQA 2F84A 3G1SA 4OT7A 4IMEA 1K03A 4H4IA 3A5FA 3C2FA 2Q8LA 2B7NA 3VFLA 3C52A 3G1HA 3QPZA 4I7UA 1XL9A 4NT0A 4OHQA 2ABAA 1MO0A 3C8FA 1OYBA 2V5LA 3LI1A 1DHPA 3BK0A 1TPWA 3G8RA 3NPVA 5U4NA 1ZFJA 3LGEA 2V0TA 2TSYA 4W9TA 1SZFA 3PBUA 4ZQRA 3PM6A 1VYSX 4O1BA 3LCXA 4A21A 3TQKA 3B03A 4BI5A 1YDNA 4EWND 3GDLA 3PBVA 1UBSA 4MLRA 3O6DA 2CZ5A 3LRKA 1FDYA 4UXDA 1I2NA 5AHIA 3UWWA 3S1WA 3YPIA 2O7QA 2Y85A 4JD4A 4YMZA 3KFTA 1DJNA 4JDYA 1YTEA 1TRIA 3G22A 3SY5A 3GK0A 1T96A 4ALDA 5CG7A 3P8JA 2DZWA 1KFEA 3C61A 1SW3A 3OBKA 1TTIA 5HULA 4XBKA 3IV3A 4QISA 5DCDA 2QAFA 1ZJIA 2EHHA 3W7NA 4CNOA 4UIOA 3B06A 2H6RA 1O95A 4K7YA 2GQ9A
chains in the Genus database with same CATH superfamily
5DFAA 4U5IA 3T8QA 4Q3MA 4CNUA 3LBMA 4RZ4A 3CGTA 4QEEA 3SN4A 4Y96A 2VEKA 2HTMA 3H7UA 3TWAA 3LCWA 1W9PA 3FVDA 3CEUA 3PUOA 1V3KA 2OT0A 4PEEA 1VFTA 2PDFA 5D4YA 1J96A 3TDFA 4D6DA 4MPQA 3KBNA 2QCEA 2QXWA 4FXJA 4Q32A 4H3DA 4W88A 5FEPA 1VR6A 4P61A 1P0DA 1J2WA 1J0IA 3ONBA 4GUFA 1VBGA 4ES4A 4C6MA 2MNRA 4EAYA 5D9MA 1A5LC 4GYFA 5LNUA 1XGDA 3T08A 4DO4A 3W81A 4ICCX 1ZUAX 3NGJA 3H23A 3PN8A 3FA3A 5FSEC 5C9RA 1LCOA 3G1XA 4P7OA 2REQA 1IE7C 4Q6XA 1M3UA 2PDBA 3LPGA 2FGBA 5LIKX 3QC3A 3C0JA 3WD0A 4HB7A 2VFHA 4L4OA 3VD9A 3TJXA 1K9FA 4PB3A 2GDVA 1V6WA 2VM8A 5HAOA 3G1AA 4F66A 1H4PA 2WOQA 1V0MA 1VC4A 1RXOB 3QGAC 4E3TA 2W62A 1ISZA 4FNUA 3WD4A 5C7VA 1EUNA 2WSQA 3HPFA 4XISA 1GHRA 1QVBA 3W1AA 4ZOEA 1YNQA 2ZX5A 3VGHA 4O0KA 2GGGA 4MYAA 4Q6JA 3VGEA 3MHFA 3FOKA 1CGWA 1QWKA 2ZRZA 1U1HA 3BMVA 2FZ9A 2PDKA 4K8GA 1EWDA 1NQKA 3LHWA 4HHHA 2I57A 1F05A 2Z25A 3C3UA 3FX4A 4NNCA 2CLIA 3KAOA 1FWFC 4C1NA 1HNYA 4GVHA 5BROA 4WDTA 4BA0A 1WKFA 1ZBCA 3VIFA 1I4NA 2ZX9A 3EWCA 4HA3A 1LZOA 3G1FA 1IHIA 4C6JA 5BXSA 4JIRA 5D33A 2W91A 4Q8PA 1PAMA 5GNYA 3DG3A 4HNNA 2CKSA 4JOMA 4ML4A 3TXVA 3IGUA 1KQZA 4GH1A 5D38A 1G67A 3P2VA 1E0XA 1E9IA 1D3HA 1JEZA 3M0MA 3NFUA 9XIAA 3CT7A 4O53A 2Z2UA 3BZGA 1SQ7A 1QMLA 3QW3A 1DHKA 2PDCA 4O10A 3GZ3A 2EEXA 4JN6A 1EZWA 2V2HA 4YCOA 4XZMX 3IJ9A 3C3NA 3WMLA 3WJZA 2X8RA 4QROA 2D0GA 4WDXA 2HZGA 4LVAA 5CZJA 3EKLA 4UTIA 4G6CA 4JTFA 5BXTA 4KF1A 1BXNA 1FY6A 4X9YA 1OINA 2WKJA 3U5UA 4X63A 2CHOA 2PDUA 3UPMA 2ADAA 4FNTA 7TAAA 1PWLA 1PZ1A 1FWDC 5LSMA 4IFKA 3QOMA 4F2TA 4E5TA 1WDDA 3VO0A 4AX7A 4AZ6A 2VRQA 3E0FA 3QZAA 1ODUA 1I2OA 2EAWA 1HVQA 3TSDA 4QSHA 2D2HA 3SCWA 3LB0A 4QR6A 1JVNA 2NV9A 1PJ9A 4UTUA 4GIAA 3NPUA 4K8HA 2IXUA 3S5ZA 2ZC1A 1WOAA 4JQ4A 3AZRA 1NIUA 1DXEA 2OZTA 3H2NA 1VFUA 3QR3A 5A2CA 3CQJA 3QYSA 5T26A 3FN9A 1CGTA 1XLLA 5BZAA 1KM3A 3AMCA 4BI6A 1LG2A 1Z48A 4AHPA 5EY5A 3AS2A 4ADUA 4QDWA 5DT5A 3O63A 3V36A 2Z00A 1P0NA 1IZCA 3MWAA 2C8NA 4EPBC 2INFA 2PDQA 1XV8A 1VQTA 4JQ3A 4AMAA 4JY9A 1D3CA 4HYRA 4FF5A 4W5UA 4QAWA 4GFSA 5A8PA 1R3RA 2WK2A 4HPNA 5B7YA 4PMVA 1C8QA 2WMFA 3XINA 3UGRA 3L9CA 4K38A 5DMMA 4MFEA 2HVMA 3HB9A 4N4PA 4JNMA 3CYVA 1HZYA 4PEKA 3I6TA 1X7IA 4PCSA 3HPSA 5M5DA 1F07A 4UQBA 1GKQA 1JAEA 2ALRA 1E0VA 1NF7A 4GE8A 3VINA 1A49A 4GACA 1R9XA 2WQDA 1US3A 3CH9A 1F6YA 2GGIA 3RMEA 2FMOA 3WQGA 4W8BA 3ZT6A 1XG4A 4PMOA 3RPDA 5HNTA 1E71M 4FEZA 4OTKA 2PCEA 4DWSC 4DWSB 2WSPA 5I09A 3Q58A 3OA3A 3HIJA 4LYPA 1E1FA 4PMXA 1HFBA 1Q66A 2CYGA 2J24A 3W88A 4BF9A 1VFSA 3WUEA 1TJ0A 2JE8A 2QUNA 2Y7EA 1C8YA 3M16A 4IZGA 1BYDA 4POCA 1OX6A 5AHLA 4MSSA 3GHUA 3VUSA 1KBJA 1ZP3A 1JZ3A 2YLLA 2ODOA 4WKHA 4JYDA 3TTYA 1BRLA 4BEUA 1UP2A 4K3ZA 3KRZA 3WLNA 2Z7GA 1HKKA 1IIGA 4J2MA 4O14A 4J3WA 4CN6A 2ZX7A 3WK0A 2PTZA 5FJPA 1J0HA 1O5XA 2HV5A 3L5AA 3WBYA 3KVJA 1VBRA 4LCSA 4L6OA 1C8VA 1XXXA 3DYMA 2PI6A 3EX6A 3U9IA 1Z41A 2CC0A 3GM8A 3NGFA 4OWGA 1W1YA 1KCZA 2OSWA 3XISA 3A9IA 4LEFA 5A6AA 1XH2A 4IQEA 2ZVIA 4GZIA 4XD3A 3OLIA 3RRXA 2BMBA 5DLCA 3OODA 3WEOA 4XZBA 4CD4A 4KWOA 4CNPA 3MW7A 3ABRA 5HNUA 5REQA 3GH4A 5I78A 3O6YX 3EOLA 3DOPA 5DT7A 1RZMA 3C2YA 4UFLA 4QM1A 4M6VA 1OT1A 1ITUA 1ZJHA 4Z0SA 3WFZA 2GJRA 4Y2WA 1EOKA 3MUZ1 1GORA 1F8IA 4A6GA 2J62A 5ABTA 3PFMA 4XIMA 1JDFA 1EXPA 3NQMA 1F6PA 4NX0A 1JQXA 1UJPA 1XC6A 2BXYA 3RX2A 1XCXA 5G4HC 1FHVA 3M46A 4ZQNA 2ZRUA 4PB4A 1J0KA 3AHZA 4AY8A 1Y5VA 3CTTA 3C5QA 1YTDA 6ALDA 3MBFA 1LF1A 4WIWA 1SMDA 3SCQA 2CIPA 3LHUA 1ZBVA 2NQ5A 4KKXA 1JFHA 1TPEA 2ISVA 2QNEA 5JBDA 1FFRA 3SCPA 5FOOA 3FKKA 2J8GA 3G1YA 4R7WA 4DZHA 3PTMA 1V02A 1XISA 2IPFA 1RK5A 3M0KA 3KZPA 3I10A 4BK9A 3KOXA 3UXLA 4UQEA 3AS3A 3IJ6A 3UCQA 4CGTA 1BF6A 2Z24A 4NIRA 1VRXA 3P60A 3OEXA 4LS1A 3I4EA 1W32A 3EWWA 1U33A 1PCWA 3NZQA 1QNSA 4ZSUA 1PB0A 2ZTJA 1M7OA 2VTFA 3R79A 4OBTA 3A5VA 1MZHA 2PTWA 2C15A 4HTYA 3LU2A 3Q65A 2GQAA 2HWGA 1XGZA 2Y7DA 4HNCA 2YFOA 4BQ3A 1ECEA 2PURA 2QMJA 1LOQA 3E49A 2ZX6A 1BTMA 3GDBA 3PAJA 5CAKA 1TWDA 1FVPA 4FO4A 3GG8A 4AZHA 2AL2A 3WBAA 4MOZA 2E6FA 3O15A 3DIPA 3GTNA 3R2GA 2X09A 3ZLGA 3W2NA 2DZVA 3W2UA 3CHEA 4YPJA 1HL9A 1DJYA 3SEPA 1W9XA 3T40A 1KBIA 2IQDA 5D2YA 2PP3A 1YNPA 1GKRA 4U10A 4W8LA 4UR9A 3UWUA 4OGZA 4WXYA 3W1RA 1C7TA 3IUDA 3IIOA 1FTXA 1R7OA 4F8XA 3C8NA 1LM1A 3MMWA 3QN3A 3GKAA 1O6IA 1QASA 3WYZA 2DDXA 2DVUA 4ZO9A 2JEQA 1EJRC 4TX6A 3OVPA 4LYRA 2PDLA 1OFRA 4LX4A 1Y0EA 2WSYA 7CGTA 4KFNA 4HU3A 4HSHA 3HG5A 4X9SA 3T4WA 5A6JA 2R94A 3HQPA 4K7VA 1G4SA 4DUWA 3O07A 4TO8A 4FZIA 4LW7A 1H51A 4PZVA 2A3AA 1JYXA 3E9AA 4UFHA 2ESCA 4N6FA 5G1YA 5CC5A 3LV6A 2WKLA 4AQLA 1VHNA 4RXFA 4JCLA 1H7XA 1XIEA 2BBFA 3L23A 3F1QA 2BLEA 3M64A 2B7QA 1BG9A 2BVWA 2R8WA 3DFPA 5FACA 4X2RA 3GBEA 3FAWA 1UD4A 3W1PA 4G1KA 1JUEA 1CXLA 2XIQA 3K8LA 1XPYA 2DH2A 4HN8A 4OU1A 4RV3A 4XBSA 3HURA 4HD5A 3VGDA 1A5SA 4EXQA 3FKRA 5G2HA 1EYEA 2OKOA 4ICMA 2YIHA 4Z2GA 1KTBA 4AZBA 1DWGM 3L2MA 1TPDA 1QI4A 2IKIA 1EA9C 4V2XA 1ME8A 3TW6A 3TJLA 2IUZA 3AICA 3P93A 2JF7A 5HQEA 3GTFA 4IG2A 5A6MA 2VVSA 5K9DA 3EMCA 4Z2HA 4Z1BA 4PCNA 8TIMA 1PIIA 4YJ5A 1X8FA 4O8AA 2PDWA 1Z7AA 3E0LA 1TV7A 1US0A 3LRMA 4D71A 5C8BB 4DX3A 4NAFA 2GUYA 4U2YA 4UUIA 3VZYA 1EL3A 1MW1A 2X0HA 4KRZA 4IQDA 3MKVA 3PUDA 3KBWA 3N2TA 1IZJA 3KP0A 3UVIA 1V0LA 1XFBA 1L6SA 3U4AA 3FYYA 3R0UA 1TJ2A 1OVDA 5HXMA 4LSBA 4UOZA 5F2GA 3AYSA 1MFUA 1L6FA 2DSWA 3AXXA 1UASA 3H26A 2XH2A 3H55A 3MHUA 1VBUA 2GVLA 4O54A 3QPYA 5AYYA 2QF8A 1PDZA 2QF7A 1U1JA 3DFTA 1PHWA 3N34A 5D9OA 3WX7A 1BTCA 1W3LA 1EPVA 1QTWA 1S2TA 3V5OA 2PSNA 5KEZA 1RK6A 4YWIA 1QBAA 2WNZA 4KCVA 1DTNA 3ITVA 5HQMA 4W7VA 1TMLA 2RJGA 5H8UA 1W9VA 2G3FA 3IJ7A 3KRUA 1ITXA 4Y9MA 1ME9A 4C91A 2NVAA 3DAQA 1L6YA 4HNTA 1F3EA 4L6DA 4FP1A 1VRDA 7ENLA 1G4TA 3NL3A 4WLCA 3N29A 1PIFA 1UYQA 3W6LA 3H2OA 4JTKA 3SRKA 1K8ZA 1BFNA 4IGHA 3WH9A 1LL4A 4HSNA 2XIIA 3PBGA 1E51A 4US6A 1HX0A 3V3WA 3R4IA 1DWAM 3W27A 3W25A 1R2SA 5T8GA 2W66A 1W1ZA 1HKIA 5I3GA 1CWYA 5HR6A 2Y5EA 3DC0A 4LPCA 4XKYA 3N9KA 4UQ9A 1WA3A 2ZZ3A 3T2QA 4MUZA 1AH3A 2YCEA 4B5WA 3UZ5A 1AODA 1K02A 1GPFA 5J5RA 2XH7A 5CPNA 4R5EA 3KTCA 3W7JA 1XLMA 4JX4A 4H6QA 2C3ZA 1W2PA 1CZ1A 2HXUA 2XVNA 3QMRA 3AHXA 3AUJA 4TMCA 2ISSA 3LERA 1TR1A 2VMFA 3R6IA 4HNOA 1Q2RA 1QATA 3BL3A 1LP6A 2XVLA 1LBMA 3ZMRA 1EDTA 3AMDA 3TONA 1AZ2A 2NSOA 2E40A 3WUFA 1DORA 1V7YA 4Q8WA 4Z2LA 4URIA 5LIUX 2IQTA 1R85A 3PZ9A 2CPUA 3HPAA 2EPOA 3MS8A 5BXPA 1C90A 4DBDA 2PD5A 1JPDX 2ZIDA 1MVYA 4C6LA 1T99A 4YTTA 2H3BA 5H8MA 3T05A 3GNNA 3N3TA 3H4GA 1KLYA 3MP5A 2ON3A 3VDAA 3GXDA 4ZMGA 3N2XA 4L1GA 2HK0A 4AVOA 3R1ZA 3E5BA 3SW6A 4CN4A 4U28A 5FEZA 3OGRA 4PUUA 5GQBA 5D30A 2XZ9A 2WVVA 3V75A 5A8NA 2QCDB 1ZB5A 3RMJA 3CWOX 3UWVA 1XRTA 1LORA 1HKMA 4ZOCA 1GZ1A 2J7DA 3GG0A 1TA3A 2BY2A 4KWUA 1U30A 2EG7A 3TAKA 3CUIA 2E6AA 1FWSA 1W2VA 2NUXA 1RQHA 4XAFA 1VAHA 2R6OA 1AL7A 5CBBA 4QGCA 1EGZA 4RPPA 1O12A 2QDHA 2VNCA 4GH3A 5TQLA 5CPSA 3RLVA 4Y7EA 1ZU8A 3UJFA 1O5QA 2P3EA 4A2RA 3IK4A 3T55A 3WH6A 1E6ZA 2TPSA 3LCGA 2WMIB 4RLIA 1XLHA 5HANA 3THCA 4MB4A 2Y62A 4LVFA 4A3UA 3BAWA 4R88A 1PUDA 1A3XA 2VXNA 4XSMA 3ZT5A 4GMEA 4WOQA 3PBWA 3AZTA 4GUJA 4HPHA 2WC4A 4AXKA 1JCNA 3P67A 2BXVA 3AXIA 3CV6A 3W7OA 1KFWA 4QE1A 3AISA 3GW0A 1TQXA 1NWUA 4IFRA 4RX0A 4C90A 3DESA 4IIFA 1K7EA 4DO5A 4D2JA 2AMGA 1JXJA 1YXYA 4HMEA 4G2DA 2CLOA 2ISFA 3VKCA 4YVXA 2EG8A 3W7IA 1KWGA 4GI4A 1K8XA 1OY0A 2PMQA 3B9DA 1OX4B 1VCFA 4NQ1A 4AIUA 1A53A 1ZAIA 4M24A 1ZSXA 1PKNA 4QLLA 1SJCA 3VPLA 5G1TA 4JTIA 5IXEA 2F38A 1KRBC 5CGQA 1XBXA 5DCBA 1UB3A 2WBKA 2OEKA 3VC6A 2R1LA 3KX6A 1Q6GA 3IJQA 4HT3A 4R7OA 3VD5A 3WNMA 5T9BG 1MUCA 1HGWA 4GYPA 3M0JA 2GVGA 1C92A 3A4XA 4ZSTA 2XSAA 1AG1O 3W71A 1VFMA 3QRHA 1DYSA 1JCLA 1OG6A 1XBZA 2Y7FA 5DMYA 4A8RA 3WENA 1FA2A 4O1AA 5TIMA 1UH3A 1UIOA 3GYEA 2AGTA 2OXNA 3BXWA 5FESA 4AZCB 3CAVA 3EOOA 2HPIA 3KS5A 2FHFA 3EB2A 3VE9A 4GFIA 4RK8A 1E3XA 4ZXOA 1UA7A 2F8QA 4GABA 3TR2A 4UNLA 1VP5A 1QHPA 5GPRA 1BKSA 4B5NA 3BJFA 3ECQA 5EU9A 2VOMA 1LBLA 5CKSA 1BLIA 4N02A 2A7PA 1M7XA 1OEPA 1TTQA 3VNDA 2ZADA 1MW0A 2Z6JA 4E2BA 3A4JA 1J11A 4R9OA 3N2OA 3VFCA 3B0UX 4WHBA 1I8JA 3I3DA 3GVWA 1SO3A 5KINA 3DFYA 2O55A 3U4FA 4RNIA 4M82A 3VI2A 4Q8UA 3L4UA 3VNMA 4K8EA 1H1ZA 3TE9A 1RV8A 3GU2A 3WN6A 3L2IA 4O12A 4C65A 3W7HA 3ANVA 1J9YA 4J3VA 1QDSA 3WMSA 3WQPA 5F4XA 2CXGA 1VLWA 4AB4A 2R1PA 4U3AA 1O1ZA 4JQ1A 3EBVA 1H7RA 4I5UA 5I3FA 3S2LA 3OIHA 3URBA 1H0GA 4UCGA 4WQ6A 4A3YA 4QNWA 1W3HA 3FJ6A 1E6PA 4AD2A 2W92A 3ZWSA 3JVAA 2PWUA 3KCLA 4NZFA 1V79A 1Q3NA 3W7PA 3UXIA 1NSJA 1FDJA 3LLFA 3TCSA 4PMDA 1K3UA 4Z2IA 3NQ8A 4W85A 1U1UA 1XWYA 4JN8A 1DIOA 4P7RA 4L64A 2HK1A 1Q6CA 4WEVX 3K2GA 1GEHA 1EGMA 1XHGA 1UKQA 3SIZA 4S3EA 2Z1WA 1GVRA 4LYKA 1ZAJA 1IEXA 5EB8A 5L6UA 3HPZA 4M5PA 1TELA 1BYAA 1XSIA 3MZNA 1W17A 3TH6A 2V38A 3QHOA 4PRTA 1YDYA 2QUTA 1UWSA 3MI2A 2BNJA 3KBVA 4PUJA 3O05A 4RNJA 3ZO9A 3WLKX 1BPLB 3QY6A 3R89A 4AU0A 2Z29A 3DKJA 3V0TA 5HWJA 4QLJA 2J27A 3WFLA 4KFOA 1SJAA 1Q6DA 2DFAA 5DX7A 4TVDA 1J0ZA 2IMRA 2V3GA 4IFOA 2OVLA 4MJ2A 3ZVHA 2ZCGA 1SZGA 3NSMA 2FHCA 2I9EA 3NQ2A 4FPSA 5EGRA 1E0UA 3NSNA 4MIMA 1ZP4A 5HINA 3AIEA 1I2RA 3AZSA 1TE1A 2D0HA 2ZFAA 2DVXA 3M47A 3FXGA 4LF2A 4DYEA 1EO7A 4MNMA 4E2DA 4F2UA 2CZEA 1DJZA 1Z69A 5T9CE 2OX1A 3LYEA 2VFGA 3CWHA 4GNVA 4AISA 4D6FA 3W7GA 4M7SA 8RUCA 5DELA 3OVQA 2V5KA 4OJYA 1QK2A 1MSSA 3K5XA 5AYZA 5AC5A 3CMFA 1OSEA 1GW9A 3E2RA 3K46A 1SJDA 4HCLA 1JDAA 4F0SA 5A6BD 4DZ5A 1FHUA 4O16A 3DYOA 3EDFA 9CGTA 4GJJA 2J78A 3WZ0E 4LWWA 2A4AA 1RPKA 3T0TA 3RF9A 3TMLA 1DJGA 4CUCA 1OB0A 3NSXA 3T09A 2WMKA 3FA5A 3SSZA 2J79A 2PWEA 3ARVA 4G56A 2CBUA 2DSVA 1TO3A 3OLEA 5AZ0A 4MWAE 2YFNA 1NVMA 3CB8A 1H5YA 3UZXA 5A6KA 1AW5A 1GJPA 2BFGA 2G37A 3SUTA 1BYCA 3VZXA 1PZ2A 4ATDA 3MTWA 2GOUA 5BW6A 1X1ZA 1Y7VA 3A9BA 1S2WA 4M56A 1JYWA 3B8VA 4J3TA 1Q8JA 1H1NA 3WLLA 4GBUA 3LHYA 3PVFA 3L0GA 3O9NA 4MWAD 3U3HA 2HNEA 1VIWA 1NOWA 2O92A 2ZRYA 4P8UA 2ZUUA 4PGLA 1JYNA 1WQ5A 3GFXA 4GKTA 3SJ3A 1PKLA 4H00A 2HRWA 3MI3A 1T8XA 1R87A 6PTDA 4IJCA 1WZKA 1VGAA 1XGEA 3MPGA 5A69A 3TNOA 1DBTA 1PX3A 5LKYA 4PTVA 3EA1A 1AW2A 1J10A 1CGUA 1ADOA 4H6KA 1ISYA 1UUOA 3GXIA 3H24A 1HIZA 2X7VA 1TIMA 2YA0A 1NP0A 3S3GA 3WO8A 1BXCA 4RCXA 1MUWA 3QSTA 4UTWC 3E74A 4MY1A 4KQNA 2SFPA 4Z1YA 2ASHA 4H01A 4KPLA 5CLTA 5M1TA 2C6QA 3FYOA 2VR2A 3LN3A 1PZ3A 2BTMA 5HWNA 4WX2A 3P5YA 2FB2A 1XYCA 2D1ZA 3QGKC 4QQUA 3FGCA 4RKAA 4WDWA 2WM0A 4JKMA 4UB9A 1R3SA 2WHJA 4MWAC 2YXOA 4GY1A 4AD0A 1UH4A 1EH9A 4ZGYA 4E8DA 3ZSTA 3R13A 4MB5A 2YYUA 1TE6A 1ZQ5A 4BKNA 4L4MA 5K4ZA 2QPUA 3ZT7A 1AZ1A 1ESWA 5BNKA 5BRBA 1X38A 1HGYA 3UXDA 3GVGA 1MI3A 1UKOA 2X7WA 3IIZA 3EMQA 1KFKA 3NR0A 3MVIA 5GJNA 3LTYA 3L67A 3R58A 3FJ4A 3NEVA 1O1HA 2GJXA 3W38A 4MY8A 3G24A 4GZ7A 1KRAC 4LCQA 2GPTA 1LUCB 1MXGA 5EMLA 4EWJA 4DO7A 4B2DA 5C2CA 4IIGA 2PDJA 1XD1A 1K03A 5LIYX 3G1HA 3QPZA 4I7UA 4NT0A 5FJIA 2ABAA 3VAVA 1MO0A 3ISIX 4XX6A 4PBFA 3RR4A 2VRKA 4LH8A 5CC3A 2WZTA 3KLLA 2V68A 5XIAA 2YZ5A 3K1DA 4KGJA 3PBUA 4RZBA 7REQB 1KNWA 1DTUA 1VYSX 1YDNA 2YL8A 5JBEA 2ZXQA 3IK2A 4EWND 3GDLA 3TTEA 3F4VA 2CZ5A 4I6VA 3UVAA 3MCMA 4AUBA 4I90A 3EDDA 3KEHA 4ZO8A 1B3XA 4UXDA 2XWDA 4NAEB 4HK7A 3VM5A 3JZUA 2C7FA 3YPIA 4JTDA 4JD4A 3C0LA 2ZICA 1NOFA 4ALDA 3LGDA 3WQ8A 4BF7A 5I79A 4UTFA 3WNOA 2HNHA 4GGBA 5CC6A 3GXMA 1UC4A 5HULA 5DCDA 4NILA 4HOXA 5D8WA 4CNOA 1XIIA 1HN1A 2H6RA 3B8WA 3GC5A 3BAJA 1DE6A 4EE9A 2OEMA 1MQRA 3UEQA 3PS7A 3UYCA 4BEQA 3VIPA 1EYWA 1E1CB 3G77A 4TR9A 4DJDD 3S2MA 3A3WA 3LCHA 4UOQA 1XW8A 1CT5A 2O9PA 3T42A 2EG6A 1ML1A 1CX9A 1RSCA 2ISWA 4CNSA 2CNCA 3GSMA 1P48A 1FBAA 1L6WA 5DO8A 3HGOA 4O11A 1G7VA 1NOUA 1M53A 3TA6A 3PUEA 4AY1A 6ENLA 2ZVRA 4PA8A 1JZ6A 3HGRA 2OO0A 5I3DA 3OQEA 4TX8A 2WZEA 4YU1A 3NM3A 4HPGA 3GFYA 4LRTA 4HZ7A 1GCYA 1YBQB 2ZYFA 4Q8QA 2CXEA 4P8WA 3KWXA 4QITA 1GOMA 4MNKA 8XIMA 3CQ0A 1KC7A 1RALA 1LYXA 1DWIM 3GR7A 2X16A 4QIUA 1FCVA 4W7WA 3WFAA 2YYTA 2A7RA 1RPXA 2CERA 3INPA 4EX4A 1Q6RA 4S3BA 3PSVA 3S46A 4C7GA 3TTQA 1XIHA 2KX9A 1MXDA 2A3CA 3KS6A 2JEPA 1FKXA 3WDQA 1IYXA 4AEFA 4FR6A 3OBAA 4XAYA 3QOKA 1W0MA 1OQFA 4H8UA 3S83A 4H2HA 3MJYA 5AHFA 5F4SA 3RM8A 3P0XA 1Z89A 3T0BA 3WDHA 3G0UA 2KZHA 3GVRA 4J3XA 1CEOA 1M6JA 4F4RA 4H04A 2A0NA 4P8XA 1W1IE 4IIHA 1UR0A 4INFA 5D2WA 2NUYA 3QR1A 1F76A 3BLEA 1YLVA 1K7XA 3O2LA 1G1YA 4LC8A 4LOCA 1W5PA 3W87A 2XGBA 1Z9AA 4QG9A 1AH4A 3WQCA 3MJMA 4BFAA 1XLAA 1DJWA 1F3TA 1AH0A 3NJ3A 2B7PA 4DUXA 4LS2A 3AIBA 3MA8A 4IGMA 1XUZA 1UCWA 5I23A 3H4XA 1L2QA 4MM1A 4JDBA 4O17A 5C9ZA 2RHGA 5A1AA 4J27A 4DLMA 3NQEA 3ZM8A 4ZTYA 1W56A 1CB7B 2NX1A 1THFD 2W63A 1IR1A 3WLIA 3ZYZA 3MZ2A 1JZ4A 3FYPA 4KEMA 3KHDA 2G97A 3LSBA 2CLMA 2Y8UA 1OG0A 2NSXA 1UP0A 4KFPA 5F1VA 2XG9A 4UR7A 2W67A 5I5RA 2C13A 1Q4WA 3ARWA 5LGXA 1EBHA 2PUZA 3W7KA 2AQVA 4ACYA 1W9UA 4YL2A 2XFWA 4JFWA 2V30A 3PUGA 2HEJA 2IS7A 2NV2A 4NASA 4BI7A 2QIWA 1I0DA 1T40A 4EF8A 4WKFA 4GYJA 1OT2A 1X96A 2WB5A 4GGHA 2EF9A 1D9EA 5I7GA 3NQCA 1NU5A 3N25A 3W76A 3OGVA 3W7LA 3GXNA 4QNEA 2OGJA 1D8CA 4PE8A 4KH2A 5CZTA 1UD8A 1ONWA 2QJGA 1P7TB 1CI1A 3ZS4A 1TQJA 2XIBA 5CJ5A 5MHBA 3DHUA 2FDMA 3PG9A 3HQNA 3WQFA 1S2UA 1KCKA 4XAZA 4N9CA 3GO2A 4Y9NA 2YW4A 1AVAA 2VURA 3S9ZA 1UKTA 2ZRVA 3F4NA 1Z32X 3TA9A 3TN5A 1JPKA 1SZRA 4QEHA 1SW7A 3T0AA 1LG1A 3ARSA 3OP2A 1QAPA 3RLUA 1NDYA 4EAMA 4X0NA 2PDHA 4PTDA 3QM3A 4HA1A 4X2PA 4DWSA 2YDSA 4HA0A 1LDCA 1RY8A 2VC5A 4LVDA 3E5PA 3OA5A 4MGGA 2ACUA 4PFMA 1G4PA 3BICA 1QJWA 4R9XA 1QI5A 3QW4B 1KM4A 1IEQA 1XLKA 4QFUA 3PAOA 3MQTA 3RAOA 1FWAC 4XBJA 5FF2A 3W2JA 3W86A 3BAKA 4JEJA 2OMAA 1OHLA 1AD4A 1HL2A 3WJWA 1QNPA 2V5CA 4F48A 3VX1A 1Q63A 3UP8A 1G5AA 3G8EA 4NXSA 3CZKA 5CC7A 1V6UA 1VJIA 3AJXA 2WBGA 5H6HA 1JCYA 5AVHA 4YTSA 5FF0A 2WLZA 1F8MA 2NQZA 3EMZA 4G1NA 2WJEA 1K6WA 3WQ6A 1UR2A 4DVOA 2VQTA 2DQWA 3ZJ8A 2PLMA 3ITOA 5CH9A 2XN0A 4Q7NA 3W9ZA 2V69A 2DZSA 3OLDA 2A3HA 1EJ7L 4LAOA 4JTTA 1OGSA 3NXFA 4GX8A 1FWJC 3UA3A 2DVTA 3J7HA 4Y8EA 3V5CA 1D7FA 1F7BA 3E38A 5DF0A 2VT0A 4UTTC 2B7OA 1UWQA 3O6CA 1ISVA 1GQKA 4KEZA 3NVTA 2QKFA 3EA3A 3Q45A 1R3TA 1C29A 1K77A 4AZGA 1ZENA 3MUAA 3AO0A 3CL6A 4XV0A 5E0CA 5IM51 3HQOA 2FDSA 1B31A 4H83A 3MP3A 2WNWA 1RD5A 1J12A 3VILA 2CBVA 1LL6A 2I56A 3MMUA 2CITA 1J93A 4O4WA 1XLEA 4H41A 3QBUA 4JTGA 2BHZA 4DAFA 5J5DA 2NT1A 5KZEA 1HP5A 3T07A 4TQTA 1SFSA 2XINA 1RJQA 1XI3A 1I9CB 2PFHA 4N7QA 1JCJA 1SO6A 2G8ZA 2I5IA 4ROQA 3FXYA 4AXNA 2PDIA 1UUQA 3F2DA 1UPMB 1XICA 1HQTA 4CCEA 2GVJA 1W3TA 4WUIA 3WD2A 2GSHA 3V16A 1JULA 2X1TA 1I75A 4KCUA 4AYSA 3JR2A 1IEIA 4FX6M 3IGHX 4FIRA 1WZLA 1PTDA 1TMHA 4GQRA 3LM3A 4EACA 2QQ6A 3ZJ7A 3GX9A 1SGJA 1DJQA 3RLGA 2PA6A 1SR9A 1S1RA 3VMPA 3DCPA 2WLYA 3GIPA 4PH6A 4IJBA 4ZZ9A 1BG4A 2NW0A 1OFPA 1PVNA 3CC1A 4G7FA 3DI0A 4WY0B 3KOZA 3LPFA 3MYOA 2QULA 2Y89A 5CJMA 2VC6A 1NP2A 3QC0A 4C7FA 1S39A 1OCBA 2Z1KA 4XVEA 4BF5A 4ACZB 3BANA 3TW7A 1W3JA 3TYCA 1C91A 3WLQA 1RP8A 4JAWA 3K13A 5AN7A 1KTCA 5CZSA 3GIQA 3DGBA 1OK6A 1QXLA 3G1VA 4TU1A 1H2JA 5DEZA 4QS6A 2D20A 3WLOA 1A5MC 3B0XA 4WY0F 3N4EA 4JKKA 1TG7A 1XINA 3NDZA 1VCVA 3II1A 3BOFA 3KTSA 2PDXA 3AIUA 3UFYA 1XIDA 1PTAA 4A22A 3TYDA 4NKCA 4FLOA 3VOIA 2V5JA 1LRQA 5LYRA 3UZZA 2YA2A 2BP1A 3RM9A 1JPMA 4KS0A 3L68A 3QEZA 1L6GA 2G41A 1BWKA 3BARA 3TU9A 4HP5A 5MKGB 1XQLA 2QLYA 1PE1A 1QOQA 4PUWA 1DIEA 2BB0A 2H9AB 3LRLA 4S3FA 2D2GA 4OFCA 4DJEC 1HO1A 3VCCA 1B0IA 1KBKA 1KKOA 3GR4A 4MB1A 3PZVA 1E6SM 3VGFA 3VIJA 2YBUA 1UIPA 4L4LA 1AJ2A 2Y88A 3O06A 1FOBA 4DJFA 5BU6A 4YTUA 3UZJA 4H9TA 1IEWA 1UWAA 2ATMA 3F2BA 1QNOA 2FQIA 3EEGA 4QG8A 5E0FA 3MCNA 4HIBA 2ZRXA 3P82A 3ITCA 2NVCA 3CHFA 3QY7A 2J8TA 3UBPC 3K30A 2UZ9A 3FV9A 3OLGA 3WSUA 3QYQA 3T78A 1EP3A 1DXIA 5HK4A 2Q8XA 1GW1A 1WXJA 1KB3A 3QF0A 9RUBA 3GFZA 1KV8A 4Z2JA 1IT8A 2Y24A 4M80A 1EJWC 2V8ZA 4CLMA 1OCJA 5E0KA 3A64A 3KL3A 1UPPA 3PWGA 3PSWA 1KFCA 1DXFA 1I2PA 3BW2A 1YE6A 1NJJA 2FTYA 5AB3A 4LNYA 1ZBKA 3CPUA 2Y7GA 3RIKA 1SZEA 4NY2A 1WE5A 3L21A 2ALDA 3K8KA 5I3JA 2PAJA 4A3QA 2QYGA 5HJXA 3WBEA 2DGAA 1G7UA 4UCFA 1PX4A 4YVVA 3SFWA 3PBMA 2PDGA 1Q6EA 1MDRA 1S5MA 2GGEA 3NDOA 3LSCA 4L9XA 1W54A 3SY8A 1QI3A 3VNKA 2PRLA 2PODA 5CQ1A 3W2MA 3ANUA 2XIMA 3BOXA 5AHEA 5G1MA 3ABOA 4B9YA 2QCMA 5CZ0A 3PY2A 1BWVA 4C1LA 3PZTA 3UNTA 4N0RA 3W72A 5BYWA 3PWIA 1LBFA 1DL3A 5F2IA 3EB4A 5G2IA 3KL0A 1X1OA 3VNZA 3R0KA 2X0SA 3AU2A 3Q67A 5EBAA 1K7FA 2VX4A 4YXGA 4FK9A 3WH8A 1FH8A 3QY8A 1M5WA 4EP8C 2FPVA 8A3HA 4LVGA 3U2CA 3MMTA 4E6MA 3C86A 3L0KA 1V93A 1BYBA 3C0SA 3OJGA 2UV8G 4IUOA 4UTKA 2XFYA 4LF1A 4N9EA 5XINA 6CGTA 1DJXA 3BW3A 1P1XA 2WC7A 3L7RA 2OZ8A 2VEIA 3I6EA 4RW3A 1B9BA 3OG3A 4JCMA 4O15A 5GJMA 1Q8AA 5LZLA 1R2TA 2ZUVA 4O57A 5CEWA 3DBNA 5IDIA 1J0YA 1VFOA 1UP3A 4Y90A 3W01A 3HGSA 2E1DA 5FKYA 3PB0A 3ZJKA 1BEUA 2CLPA 5J8LA 3L66A 4GJ1A 3H2CA 3S1XA 1MZRA 2QUVA 4FOJA 4AYGA 2R1KA 4WR3A 3AIVA 3KRSA 3A47A 1IGSA 5ABGA 2OWXA 4LC6A 4JTEA 4YTQA 1HP4A 3U2ZA 2GFTA 4BHYA 3V0UA 1MYRA 3FDKA 1MNZA 2C16A 1UD2A 2QV4A 1DQUA 5JH1A 4QSFA 4ZODA 1G4EA 1XH0A 3SCVA 3AIRA 4B5UA 5LIWX 2IPGA 3IVTA 1M68A 3QQWA 2R1MA 2IPJA 3HGJA 3BTNA 3L2LA 4JIQA 4ILSA 2AAAA 2Y0FA 3SRHA 1RLDA 1H60A 3WD1A 2HXTA 2XYLA 4IF2A 1XFCA 1RQBA 3S6DA 4Q4PA 1MQPA 1HJQA 4A2SA 2ONEA 4C6PA 3LQGA 3GC4A 2Z1SA 2EXOA 3HJZA 1AJ0A 3GDKA 1OADA 4AEEA 1KD0A 4RL3A 2DT2A 4CD6A 3BGGA 2QCDA 4AF0B 1XCFA 1TPH1 2JKAA 3WELA 5AOUA 1X7FA 4DBEA 1TPFA 5A6LA 3G6LA 5HMSA 5XIMA 2O9TA 1JDCA 3T0CA 2NX9A 4QAIA 3F7JA 3UG4A 1WXZA 4FA3A 3PPFA 1K4HA 4WSKA 3TUUA 4H9UA 1S2CA 4GUGA 1IT7A 1LRNA 4HK6A 4S3DA 3C6CA 2Y6ZA 3NAVA 4LALA 4NJJA 2GQ3A 3Q37A 3S5YA 4J2PA 4GKLA 3KXQA 2WMIA 2H8XA 2CZVA 4FXFA 4A29A 4HTBA 1O4UA 1RVGA 1YQ2A 3TEVA 2H3DA 4O1FA 2ZUWA 4WKAA 4S3JA 2PGRA 1EUAA 1NM9A 1KO0A 4NF7A 3P62A 3L12A 4YVPA 3NQ6A 3SZ8A 2J9XA 4NRRA 3SM0A 1BRLB 5DY3A 3UG3A 1V51A 3PZUA 2E67A 1Z3NA 4AVNA 2VFFA 4ZEPA 1TUXA 1V3LA 5C5YA 5ABFB 4GUHA 4U33A 4EPEC 2E5DA 3ARQA 3QKEA 1AQHA 3HTWA 3QV6A 1ITCA 4JFVA 2GL5A 4E0CA 3CMGA 4LBSA 3SCUA 1OX4A 4NRSA 1AQ0A 4MVAA 5H91A 1OC7A 1LRTA 2AKZA 2ACSA 3CS2A 2R82A 4F79A 4DWDA 4KWWA 4PBEA 3GC2A 4PUEA 3LY0A 2V67A 4MNLA 1VEMA 1GG0A 2Q8ZA 4M6UA 2VEMA 1CGXA 5C0QA 2OG9A 3VGBA 4V33A 3GNPA 2AOSA 1A0DA 5EKYA 1ALDA 4N6EA 4KRTA 3W1TA 5D32A 2PRHA 5C2XA 1FCUA 1P6BA 1EIBA 1GOWA 5FEXA 7A3HA 2DSKA 4A8IA 4JGDA 3VCRA 4CN1A 4E8CA 1PO9A 1J8VA 2X40A 2VP8A 5BU9A 4KRUA 4AZCA 3QKZA 3AFBA 1SFLA 3GUGA 1A4MA 4RE2A 1OJXA 5FAJA 2GJLA 2VC7A 1EO5A 4AZ5A 1B3WA 2PDYA 1P0EA 3N18A 1MDLA 5SWUA 3KHJA 4REQB 4NVTA 1H11A 3H2MA 2VI0A 1V6YA 4GXPA 3SUWA 2VD9A 2ZZ6A 1POKA 4HYWA 3HM7A 4NZ5A 2QEZA 1TZ7A 5BOOA 5RUBA 1YKWA 1GVYA 1W1PA 3CV2A 2BWGA 1E4NA 4D6EA 5BXRA 3G5EA 4MYXA 3RITA 3FHAA 1LOSA 1TZZA 5I3HA 1OC5A 2V81A 3QV9A 4IWWA 3BUVA 3HV8A 2DIJA 2V82A 2Z6IA 5F2LA 4HZ6A 3BLKA 2A3BA 2A1YA 2PU1A 5D09A 3B9NA 4Q4QA 4Y9PA 1X1NA 3QZEA 2NX3A 3TTOA 1KR0A 4WK9A 1BXBA 1JNDA 3D46A 2NWSA 4AHOA 3TZFA 2C1HA 1ICPA 1QI0A 2GDQA 5A6TC 3W1QA 2GVYA 4JN7A 5CJNA 3TFXA 1V77A 1TX2A 1VFFA 2GUBA 3A12A 4A4AA 4KEVA 2ZZ7A 3PFRA 2GWGA 3RJXA 1F3XA 3ELFA 2YJQA 2EPHA 3NZGA 5D02A 1R0MA 3OW1A 2C0HA 3A22A 4C6DA 3FDGA 1TFVA 4FI4A 2YXGA 2I5QA 3CQIA 4GC3A 1ELSA 3G2GA 1XIGA 1RHCA 3W02A 4I6KA 2I16A 5DN1A 1SMAA 3N2CA 4XAPA 1IXNA 4DB7A 5A95A 1FHLA 4GC4A 1A3HA 3UJEA 5IHSA 4W5ZA 2Y4SA 4TV6A 4ZQPA 1EP1A 3DFOA 3A23A 3LHZA 4O18A 1O5RA 1JQVA 2PBGA 4ASTA 1XDMA 1KXHA 1E1EA 3WF2A 5JXQA 1WV2A 3ANYA 2FPYA 2Y61A 3KVMA 3TJIA 4HNLA 1S3TC 4AG0A 1W8GA 2HJPA 1VB9A 2GDUA 1JRBA 3ITYA 1QT1A 1G94A 4G8TA 3E0IA 5CCZA 1PV8A 1AL8A 4V28A 2CEQA 3FEQA 3B04A 4ZA0A 4J40A 1GOOA 2XWEA 3ONCA 4KIRA 3SURA 1OM0A 1XLBA 3BV4A 2A6NA 4MTVA 2NXIA 3UXKA 3PJUA 2GQ8A 2XVPA 3ZFHA 1U5HA 2B0MA 2OX4A 1SM9A 2O4MA 3WQEA 2OYMA 2Y8VA 1OD0A 4RV8A 3Q94A 4N2YA 3OB8A 4WD0A 2F6UA 2VQUA 2D69A 3M0XA 3QVQA 2DT3A 4B4HA 3CUHA 4JXCA 1LL7A 5HUPA 4Z17A 3NPWA 1PPIA 2WMGA 2PGWA 9XIMA 5FJTA 5I2UA 3DG7A 1YPFA 4FNSA 4LQ1A 1SYTA 4G7EB 1BGGA 4RZ6A 1W91A 2RJHA 1E6RA 1ZBWA 2J4GA 3EB3A 1EXBA 1UMLA 3EXRA 3WJYA 4ZB5A 2FZMA 4HGXA 4Q7BA 2VZSA 2OJPA 3VM7A 3DERA 3S9YA 3P81A 4IM4A 2WO5A 1RQEA 3LCIA 4PUNA 4DUOA 2WCGA 1P6CA 3CM4A 2G3MA 3R8GA 1RJPA 2Q6ZA 3E1F1 3PNUA 4ZL1A 1GTEA 4I5RA 3QQ0A 4W89A 6XIMA 2PTYA 5DBUA 1GYNA 3G1RA 2WJZA 2DJLA 1ZTVA 1MW3A 3W6MA 4GXMA 5D2XA 1VS1A 5HATA 3BLFA 3CV1A 3MDUA 3T44A 4TTGA 5CGTA 2XUCA 1WKDA 4YWSA 2A6LA 3KM8A 2ZE3A 4L56A 1F9CA 4TV5A 3UWYA 2JQXA 1HF6A 3K4AA 3O7UA 3WLRA 4DZAA 3EDKA 3GW3A 1A5OC 2PC4A 3AHTA 3R10A 1TZ9A 2ZDRA 5L9FA 1X39A 1C93A 4NYYA 2NLIA 3CMJA 3Q2DA 4Y9OA 4R33A 5A8QA 1V6XA 1S2VA 4ML9A 3N2MA 2ZUNA 3SECA 2YW3A 1Q5MA 4PODA 3VOCA 4NX5A 1L8PA 3WK2A 1J5TA 1UR4A 3R43A 1QPRA 3GR8A 2X1UA 3RPMA 3B8SA 1FP9A 3UR8A 4IOTA 3T2OA 2ZTKA 2DZTA 4CU6A 4RE0A 1E15A 1XDLA 5HJLA 1Z6KA 3ZLFA 2FLIA 3KVKA 4DXVA 4EOUA 2W4XA 2Z1XA 3L4XA 2X30A 3WDRA 1KGUA 4GX9A 3TQPA 3MV01 1FWHC 2RDTA 1XC4A 4UTWA 1UR9A 2W5FA 4S2BA 3QH2A 3T4CA 1QW9A 1Q45A 1A5AA 3P3BA 4AZIA 4Q8VA 4S3KA 4AWUA 1TTJA 1QU4A 4MUPA 1NARA 4IUGA 3L4VA 2GJPA 3WLTA 1DP0A 3E02A 4HPXA 1EB3A 4LY4A 4NYUA 3Q4DA 2JK2A 3FIGA 4LJ3A 3TCEA 4ZCWA 1GT8A 1MRQA 3GD6A 5BWFA 1QBBA 3TYAA 3I7SA 1OFAA 1CXFA 5BRPA 1OFOA 3CHVA 5AC7A 1JFXA 1XF0A 2A21A 2BDQA 3EOEA 2Z27A 1RBLA 1M04A 1ICSA 2BSLA 3F03K 4J4KA 3N4AA 4CKQA 3NA8A 1JJKA 4BS0A 5FA5A 3E0VA 1DQWA 1Q2SA 1UA3A 2J88A 4KCWA 1ISWA 1LUCA 2V5BA 4CQBA 2PP0A 5C6MA 3M5ZA 1Q6OA 1EEXA 2P0IA 1CDGA 3N3MA 3SCTA 3USBA 1TV8A 4Q8TA 3GB6A 4KESA 3TN3A 1RCQA 4LU0A 3LZ3A 1QOPA 3KBMA 3OYXA 1V0KA 1L8NA 4E2OA 3BLOA 2EJAA 5HDRA 3OZPA 4GO8A 1XLFA 2YDRA 3NTYA 5K9XA 1BWLA 3W1XA 4OKDA 2PLKA 2DUXA 2MUCA 2QPSA 4FLQA 4IXHA 3NIYA 3DU0A 4QJ4B 3WMBA 7REQA 3OU8A 4H9MA 2VEGA 3T1GA 3IRSA 4X60A 1JGMA 4HZMA 3ABQA 2F84A 4OECA 4P7LA 4IMEA 5E9AA 4LGXA 3THUA 4H4IA 3POCA 3A5FA 3WD3A 4NAEA 1NH6A 7PTDA 3MU7A 3C52A 4BQ4A 4OHQA 2PP1A 1XL9A 3KUMA 3RX4A 3EWDA 5I77A 3QHMA 1BF2A 4A3HA 5FL0A 1XPGA 3BK0A 3C0QA 1D7KA 2ZX8A 3ARYA 3F5LA 5U4NA 4LUSB 3ABZA 4XK2A 2V0TA 2TSYA 2ICSA 3BGAA 4W9TA 3ICJA 4WRHA 4ZQRA 2PWFA 3PM6A 4O1BA 4BI5A 2DEPA 2C1GA 1RP9A 3SQSA 2YDQA 1E3ZA 1UBSA 4MLRA 3URAA 3TP4A 3GNXA 1EJUC 1E1CA 3GWQA 2GYIA 2ZXDA 3AHYA 3MCOA 3EKGA 3DFHA 1K9DA 4LB3A 2VYOA 2XTKA 2DQXA 1DJNA 3SY5A 3GK0A 3TR9A 3TOYA 2ZWZA 1E9ZB 1SW3A 1RCXB 2QZRA 3E6EA 5HQLA 4L1XA 3VX0A 4XBKA 2QAFA 4LB4A 1V3HA 3N11A 1PS9A 1I2QA 4P7QA 3TC7A 1WKYA 3AI0A 3HBLA 4RDZA 2EPLX 3BWWA 3PBYA 4QDMA 3HOJA 1C7SA 4GPNA 3D3FA 3ZJ6A 2YL6A 1UOZA 3R8HA 1KLZA 4GRSA 1YBQA 2CW6A 2WHKA 3HG4A 3W73A 5BOFA 1E73M 3B05A 4GYPC 2FTWA 4HOWA 2HS6A 2YDAA 5LNVA 1MXSA 3BZJA 4RZ5A 1LWHA 5AY7A 3ATYA 4MHBA 1ZHAA 4JR5A 4K1WA 1O66A 3N2BA 4Y9AA 5B80A 2XJ7A 1SU5A 3DDMA 3B97A 3C2RA 1EF2A 3VIIA 4TOQA 1UD3A 2RGLA 1GQIA 3GTHA 3REQB 1E6XM 4X0VA 1FRBA 4D8LA 1GG1A 1KFJA 1V3MA 2BZNA 4V1YA 1UWRA 2WYSA 1N82A 1F3WA 3HV9A 2VD8A 3G0SA 4JTQA 2Z1BA 3HFTA 4GZJA 5E93A 1Q85A 2VEPA 4DRSA 2H8ZA 3C2EA 1XS2A 4O50A 2QV5A 4HNVA 2RDXA 1B3OA 3S2JA 3DEQA 1L2UA 4B5SA 1XCWA 4D8AA 1R8LA 1Z44A 4L9ZA 2Y2WA 2E4TA 1K4GA 4OBRA 1VJSA 4EXAA 4LT9A 3DFQA 3SRDA 4FAMA 2GSJA 1UR8A 3M5YA 3RHGA 5IFTA 1IGWA 4TVCA 3SCOA 1B9ZA 5H8PA 1OGBA 1F4HA 1XLCA 1E5NA 5BRQA 1REQB 3H8AA 1X6NA 3LENA 5CXPA 2W61A 3UWZA 1R6WA 1EZ2A 1O60A 2E6DA 2QCFA 5C55A 1Z42A 2HDJA 1JPIA 1CXKA 3W2LA 1P0BA 3V1PA 2CKRA 3KCOA 1UMYA 3MI6A 5C9UA 1QHZA 1D3GA 3R0DA 3CAWA 3TTSA 2VEFA 1T7LA 5IFPA 1TWSA 1JZ7A 3QQ1A 4KCTA 1XLJA 3W28A 1RAKA 4MKSA 1MEWA 3OPSA 4MPKA 3ITTA 2CZDA 2QHAA 1KXTA 3W7RA 4RUBA 4AWSA 4IP7A 5CBJA 3TWBA 1FKWA 3UXAA 1UD6A 4JEQA 1JNEA 3LNPA 4FR1A 5AKQA 3URQA 3MB9A 3CWNA 1Q6LA 4LAMA 1TWWA 4FX8A 2WWDA 2TAAA 3IJDA 4LTSA 5HBFA 4CQCA 3EAUA 4E4FA 2J6XA 2IKJA 5M17A 2FHBA 3VA8A 3RXZA 4NHVA 1P7TA 2WCSA 3L5MA 1RR2A 3GRIA 3VYLA 4JTAA 5FJRA 2AAMA 4C6KA 4C6CA 7ODCA 1XIMA 1M65A 4JFUA 5FJUA 1DIDA 3GLCA 2FFCA 3FSUA 2NUWA 4MDOA 4D6CA 1TIWA 1TVLA 1VCGA 3LXAA 3GG7A 1VYRA 5CPQA 3WY1A 3SGGA 5E6YA 3SAZA 1GOQA 1H49A 5TAOA 1NTHA 4KEUA 1Q7QA 2FB3A 3BLLA 3LPPA 4GK8A 4PC8A 3VDGA 4WJXA 2XH4A 2QJIA 4W86A 1FX6A 3PR2A 4R53A 2EPKX 4IL2A 1GKPA 5E1QA 3BAYA 3QXBA 5IRPA 4EK7A 3LBCA 1AQFA 2OT1A 3QV8A 4DXXA 2DZPA 2VZUA 2AL1A 3HN3A 1DJHA 5GNXA 1PWMA 5FF4A 3R94A 3CV7A 1G6CA 3DHFA 3HPXA 1IIHA 2NV1A 5CG0A 4HNUA 4IXXA 3PPCA 5G2WA 4F2BA 3APTA 3G0XA 4GUIA 4UFKA 1PHQA 1JI2A 3QSRA 1OZQA 1IV8A 1Q6QA 3P61A 1S5NA 4ERIA 1N2VA 4M29A 3QMTA 1CECA 2YKKA 5E6ZA 3CUXA 3P0WA 1HJWA 2D3NA 2NQHA 3CZJA 3UY7A 2GZXA 2PDNA 1M41A 5KITA 2HBVA 2Z26A 3NDYA 3AROA 4GCXA 1ZCCA 2ANUA 3EOUA 2JBMA 2HPMA 3W75A 3W6YA 1HTIA 2WMJA 5F1UA 5HMDA 2G5WA 3WLJA 1W37A 4QS5A 2E9BA 1W5QA 4AC1X 3IGXA 1EJTC 1JI1A 4UTTA 5KZ6A 3FNDA 1W31A 3W7MA 2CBIA 3BDKA 2BY0A 1F6KA 1H41A 1AW1A 1FXQA 1FWGC 3IWPA 3PZGA 4XKMA 5AC8A 5AC4A 4AIBA 2D2JA 2NWRA 4GQQA 3ZVIA 2RAGA 5HNNA 3ITGA 3E3HA 2O9OA 3DENA 2OPJA 2PZNA 4S3AA 4D9PA 3FFSA 4I8YA 1AK5A 4Q4KA 2OLHA 2Z2AA 5EMUA 4GLEA 3CL8A 2OKTA 3N04A 5EMKA 3QPEA 4FHAA 3VDHA 2W3ZA 1PBGA 4LRSA 4X22A 3GAKA 4UMAA 4GY7A 4FOKA 3DZ1A 4FNPA 5DMNA 3ZR6A 3LPOA 1QOXA 3IUIA 4C60A 1UWIA 4PULA 3WNKA 4Z08A 4HVXA 4NU7A 1EJVC 3R7MA 4B2DD 1V6VA 1VENA 2XSXA 1YNYA 3LM7A 2GGHA 4OUIA 3KDOA 3M07A 4DBSA 3GQYA 2VCCA 1OF8A 5FSDC 3KDNA 1OFBA 1GTHA 5FCZA 4IL0A 3UWEA 1BVZA 1JIBA 3H53A 4MAZA 3ABSA 3EDJA 4A8NA 1GNXA 1YADA 1NWSA 3SI9A 5IBXC 3L4ZA 5JIPA 5DRCA 3T2PA 4RNFA 1NAL1 3RR1A 3QFEA 3GDRA 1ZJBA 1SO5A 4O1EA 1C8XA 4JQAA 3HU7A 3EEZA 1RUSA 5JUVA 3DECA 1RA5A 2OFJA 3PZNA 4WY0A 3N9SA 4I9JA 2J13A 2QR6A 4Y6GA 2WPBA 4ACZA 4WSJA 2P8BA 4M1RA 2FKPA 1KA9F 4HU0A 2B31A 3AYRA 3BG3A 3B0PA 3BLDA 1XDJA 4JICA 1EDQA 1CYGA 1CTNA 3TOPA 1TRDA 4UR8A 3M5VA 2NVDA 4F0MA 2WVTA 2VOTA 2PBOA 3MUCA 3BJTA 1CLVA 4LUTB 6XIAA 5CPOA 2NZLA 1KCXA 3KCJA 4JIHA 1S2AA 2EKCA 4IGSA 4K37A 3A3HA 4Q22A 2V3EA 3CL7A 1JCXA 1KFBA 3AYTA 1UWTA 4PUMA 3CH0A 1GQLA 3AIQA 4ICNA 5MKGA 4WOZA 2G50A 5E5CA 2H9AA 3SQLA 1X8CA 4MJ4A 4K6AA 4AD3A 2NQJA 4DJEA 4C6NA 3LCLA 5DMLA 1MW2A 1OGGA 5D9PA 1A5CA 2DV0A 1CXHA 1VYPX 1J4EA 3HO8A 4YN5A 2WPGA 4LFYA 4ROPA 4DHGA 3VDCA 2OQHA 1XIFA 1ZY9A 5HWMA 3GHRA 4DBWA 1KRMA 4NZ4A 1JRCA 1G69A 5JIWA 4NZ1A 3V35A 4M0XA 1DVJA 5HA7A 3BSGA 1S38A 5TBOA 3WNNA 3ALFA 4FF7A 1VIZA 4HHPA 5I6SA 2P76A 2BGNE 4XZ9A 3SUUA 2WZHA 1JUKA 3BCJA 4KWSA 1I45A 2RH9A 2GK1B 1O5KA 3S2NA 3S4TA 3CPRA 1KM2A 4H8HA 4BQ2A 2FGZA 2AQWA 4MFDA 4H9YA 4QQ3A 3PZMA 2C0AA 3GTIA 4H6RA 4IPJA 4O28A 2FVMA 4FLSA 3URNA 4D6HA 3SSJA 3EWUA 4QE4A 1P5BA 1UC5A 3N6JA 1CIUA 3MUY1 1K8YA 4CD8A 2ZUTA 2DW7A 4LYQA 4E3VA 3DI1A 4TTUA 2XHYA 4DLFA 3UGVA 3BQ5A 2I14A 4OBSA 3WIJA 3FSTA 1JR1A 2J7GA 4LV9A 4ZQMA 4IISA 3ARTA 3W53A 4PN2A 4AH7A 3OHIA 1BQCA 2PS2A 3SCRA 2E9LA 1Y5WA 3MSGA 2CFFA 4UTHA 2VFDA 4PMJA 2X41A 4RW5A 3TN4A 2Z7KA 5FI8A 4DIAA 3IV8A 2BY1A 1GYMA 2CETA 3RU6A 3TMQA 4AD4A 3D47A 5U7SA 1KGXA 5I0DA 3LHTA 3XIMA 3MC5A 5EL1A 1GHSA 2GUUA 1J5SA 1M03A 2HMCA 4BZYA 3TYBA 3V0SA 3TVAA 3MDWA 3S47A 3P14A 4P2VA 4HA4A 4S1FA 3NL5A 5C9WA 1GEQA 5ECUA 2J77A 4MZ1A 1IWBA 3VCNA 1PCKA 4IQJA 4YNGA 4CQ8A 3BPWA 1KQYA 1T6MA 1ZGDA 3B0YA 1LTDA 1V03A 1XM3A 5I07A 2QT3A 3OVRA 2YCLB 3SUSA 4UQCA 3W84A 1CPUA 3MVTA 1GJUA 5MF5A 3UF9A 2YPIA 4MAVA 3WL1A 4PL2A 4JKLA 4DY1A 3KTXA 1YPIA 3JW7A 4ZR8A 5LHEA 3H2AA 2F2HA 3IARA 1BKHA 5ECVA 2HVNA 1PYMA 4GINA 3M0IA 1YPXA 3NZRA 3ZOAA 1YXDA 4UWMA 1AUSL 1IZKA 1E9YB 2NLYA 5AYIA 2X05A 3P5ZA 2YXXA