3O63A

Crystal structure of thiamin phosphate synthase from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
222
structure length
214
Chain Sequence
HMHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPVNVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTAPGLGLVRVAAELDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable thiamine-phosphate pyrophosphorylase
publication title Crystal Structure and Identification of Potential Inhibitor Compounds for Mycobacterium tuberculosis Thiamin Phosphate Synthase
rcsb
source organism Mycobacterium tuberculosis
total genus 74
structure length 214
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o63A00
4GC4A 1J2WA 5KZDA 3ZFHA 2A6NA 3L68A 3ANYA 1OK6A 3QC3A 3W1LA 2PCQA 1S5WA 2I14A 4MKNA 3I7RA 1ZNNA 3TK7A 4Z08A 2DJXA 1GPWA 4CCEA 4JEQA 1SO4A 3QEZA 3I68A 4TO8A 4MFEA 4A21A 4GBUA 4OWGA 1E51A 3A22A 3FJ6A 1D3GA 5G5IA 2WSQA 4JNMA 1Q6LA 3EEGA 4OGZA 4CNOA 3TDFA 3BVJA 2PURA 3SJ3A 5BRBA 2Z2UA 5CPMA 2H8XA 1UUMA 2JBMA 3QH2A 2CLHA 4M6PA 5DCBA 3OA3A 4D2JA 1VJIA 2HS8A 1KFJA 3G24A 1ADOA 4MY8A 3N9RA 3NG3A 1FBAA 3EWZA 3BO9A 4BI7A 5KZMA 4KWVA 3NQ6A 1Z48A 3G1XA 1R46A 4OHQA 4HNVA 5HULA 1I2PA 1SSGA 3LI1A 4JIPA 1PCWA 1KA9F 1ZJIA 4RX0A 3WJSA 5AHFA 2VOMA 3UD6A 3OBKA 5F2LA 1QWGA 3IV3A 5KINA 3W7IA 1JRBA 2X1TA 5CPOA 4N6EA 2QUVA 4ADUA 3M41A 3OEXA 2ZA3A 2BSLA 3LLFA 4JTGA 3QSTA 4LV9A 4E2BA 1ZAHA 5AC6A 3C3NA 1O60A 4GUHA 3GX9A 3K30A 1J4EA 3LCGA 1FY6A 5I3KA 3GR8A 1ZY9A 3DFOA 3C4UA 3L5LA 1SO6A 2RH9A 2Y6ZA 2E68A 4AWSA 1ICQA 3NQ8A 5FF2A 2XN1A 5EKYA 4O11A 4RZ4A 1OJXA 2Q8ZA 2ABBA 3BG5A 1EIXA 3I7QA 5LNVA 3NL2A 1IXOA 1R2SA 3ZS4A 1EA0A 3DZ1A 3HBLA 2B4GA 1Y0EA 5EPDA 2FPYA 1W3IA 3A24A 4UTWA 4M6VA 3IIZA 4YCPA 4KFNA 4JR5A 3NQDA 4MVAA 1TSIA 3W73A 4OE7A 2Q8LA 3I7SA 2ZBTA 1VCVA 3CEUA 3O6DA 4FO4A 3W7NA 1Q6OA 3IVSA 1SZFA 2RDWA 3DFPA 5HQEA 1OYBA 3KFTA 5TBOA 4O1CA 3G18A 3RNDA 3FYOA 4LRTA 5CZSA 2TSYA 4K7YA 1LOQA 1VH7A 1SZGA 3MWAA 3W87A 1NF7A 1VLIA 4HPJA 2QUUA 4DF2A 5HR7A 3CLMA 1WAUA 4ORIA 5D09A 4N02A 1LBLA 4OV9A 5DXYA 2CFFA 1K02A 2C0AA 4XWUA 1M7OA 2E5CA 4E38A 5CZ0A 4M5PA 3S1WA 4ADTA 1TTPA 4FX8A 1YDVA 1TTJA 3G8EA 3S1VA 3TAOA 4KWWA 4LVDA 3LXCA 2CZDA 3FKRA 4JTUA 2J24A 2V5LA 4G1KA 4GUFA 4N4QA 3F03K 4XTIA 3UZ5A 1GVFA 1X1OA 1LCOA 4Z0JA 4JY9A 2G5WA 2H6RA 4JGDA 2WNZA 7TIMA 1MO0A 1G67A 4OBTA 2Y7DA 1TIMA 4HKPA 2EKCA 1KM2A 2J88A 1DBTA 2X1SA 4FNUA 4NXKA 1H62A 2QCDB 3NL3A 2OCZA 1JQVA 1A5BA 1AL7A 2VENA 3NGJA 1L2UA 1K8XA 1W5MA 2X1RA 3LOTA 1W8SA 5BMXA 3T4CA 1FCVA 1CX9A 3ABQA 2GVLA 4Q32A 1GVSA 2ABAA 5HUOA 1NF0A 3FLUA 3V1PA 2C15A 4HNNA 3PR2A 1VYSX 3TSDA 5DELA 1KM4A 3TSBA 1UASA 1XCFA 2DZTA 4LVFA 1EX5A 3P8JA 3CIWA 4IUOA 4R7JA 3HPSA 4PTNA 3JR2A 5HR6A 3LV5A 4UR7A 3IEBA 5F2IA 1GG0A 1KFKA 3UYCA 3P8IA 2GQ9A 1O5KA 2BTMA 3VE7A 2V30A 4WQ6A 4JTKA 4JTHA 5FEWA 4DBEA 1RQBA 3EWYA 3NQMA 1TV8A 3L0GA 3NQVA 1WDWA 4O13A 3LHZA 4O1BA 2YFOA 3S9YA 3ABOA 2CLKA 3HJZA 4WUIA 3W7HA 2DZPA 3KX6A 4JX4A 1KTNA 3DI1A 4QJ1A 2GUUA 1TPUA 2KZHA 3A5FA 4JX5A 4JTJA 3L21A 5I3GA 3O15A 3PM6A 3W71A 4O28A 1TV5A 3P82A 2W79A 5IBXC 1G7UA 5MHBA 1JCNA 2YR1A 3UWZA 5AFDA 4RZ6A 1ONRA 3MO7A 4JDYA 1TPH1 3W7QA 4AXKA 3EWXA 3SSJA 3LCXA 3TROA 2VXNA 2WQPA 4QM1A 1VCGA 3L5AA 1GTEA 4L4MA 2TMDA 3MJYA 4MJZA 1RPXA 3QMTA 3BGJA 1SPQA 3PWAA 2H3DA 3TQ0A 4TMCA 5U4NA 1X1ZA 3SI9A 1F74A 1TQXA 4K8HA 4ZVJA 4LU0A 4UTJA 4HHPA 3GDMA 1SZNA 3A23A 1KW1A 3GLCA 5A8GA 3TFCA 2OZ0A 4NQ1A 2DORA 3MYPA 3WJZA 3L9CA 3FKKA 4O10A 1HL2A 1FX6A 1SUXA 1Z41A 4EOUA 3QPYA 1H51A 2FJKA 3EXTA 1XDLA 1JCJA 4WD0A 1GVRA 2CZEA 1WXJA 5D2TA 1YXYA 3G0UA 1DOSA 3TNOA 2YYUA 2NUYA 2QDHA 1LP6A 5F2MA 4EWND 3T7VA 5KSWA 1IIHA 2CLLA 4UFHA 1DKWA 2VFHA 3T44A 4BFAA 4IPJA 1A53A 3EXSA 4IMGA 4NNAA 4PCFA 2NZLA 1OFPA 4LNYA 1VR6A 4HT3A 1T8XA 4RZ5A 2J9ZA 3UXDA 4LUIA 4O4WA 2Y62A 2EPHA 1EWDA 1LZOA 1PV8A 4MJMA 4ICNA 5CSSA 5LZLA 2GPTA 4RK8A 1IXNA 3BW4A 4Z0SA 3W1UA 5DN1A 1O5XA 4NJGA 4JTEA 3R12A 3HG2A 1L6SA 2A2IA 3PBWA 1L6WA 2O7SA 3ZWTA 5LNUA 5LNWA 1KLZA 3G1HA 3EKZA 4NT0A 1N55A 1F5ZA 5I3IA 1BWKA 4NZJA 3IGSA 4AWUA 4A2RA 3HB9A 3KOFA 5K4XA 2B7QA 1TPC1 4NXSA 2OJPA 3C2OA 4K37A 2E09A 3STFA 1Q3NA 4A3UA 3W76A 2EAWA 3BG3A 4NZFA 4Y6GA 4BWLA 3TJLA 1IGSA 4HPXA 4PH6A 3MI6A 5AB3A 1OFOA 3FIGA 1ZFJA 1B57A 2FB2A 4NU7A 4CCCA 3LLDA 5AHNA 1TV7A 4FX6M 2FB3A 3CWNA 1I4NA 4H6KA 2A5HA 4JYFA 3R2GA 2AAMA 3W1TA 2QCHA 1W5NA 1EEPA 2P0OA 4XKYA 3LM7A 1XDMA 4RR4A 2Y7EA 1RD5A 4AHOA 4FXSA 3QZEA 1M5WA 4FHAA 1QPRA 4QAIA 1DQWA 1HUVA 2ZA2A 2Y7GA 5LGZA 1W5PA 2JKEA 3ELFA 3IIVA 1W5QA 1SFJA 4AEOA 3PC0A 1R47A 2Y85A 2G96A 1EB3A 5AYYA 3W70A 1YYAA 3LHWA 1OX5A 4IMEA 3DFSA 1TPFA 4IPIA 4ML9A 4H3DA 4LC8A 1WOAA 3HGSA 4NX0A 3STCA 1YDNA 2V2CA 3LERA 4WXYA 3HG4A 3U6WA 1P0KA 2HSAA 2WV8A 2HTMA 3GKAA 4UXDA 4JTSA 2V9DA 1LTDA 2ZRZA 3GYEA 4GNJA 3EXRA 3LTPA 2X2GA 4MUZA 4UFLA 5E1QA 1PE1A 3E0IA 5G2IA 1FCBA 4IMDA 4LW7A 2B7OA 3W75A 5EMUA 3W1MA 3F4NA 4KFOA 3N9SA 4FEZA 1K7XA 1OF6A 2WSYA 3S0CA 3ATYA 3DXIA 5D04C 1UCWA 1YADA 2NWSA 2WNQA 3W7MA 3RLVA 4UTIA 2DZWA 1H1YA 4MLJA 3O6CA 3PY2A 1KLYA 3NL6A 3NDOA 1B4KA 3IRDA 3LRLA 3LCIA 3LCFA 1RQEA 2C18A 5D05A 4BK9A 4JYDA 3TXVA 1FWNA 2DU2A 1I8JA 1ZENA 1Q6QA 1LOLA 1WOBA 3P61A 2E5DA 5LSMA 3HG5A 3TR2A 5AYXA 3TW6A 3C52A 1QPNA 3PULA 1JQXA 2C1HA 4A22A 4Y9AA 4QNEA 1ML1A 1JUEA 2CLEA 1W31A 1YXCA 1FXQA 3IIXA 1OYAA 1QR7A 3MHUA 2QJGA 3P74A 4YXGA 3P67A 3O05A 2Y63A 1H7XA 4FX7A 2QKFA 3CM4A 5CKSA 4IMCA 4UTTC 4UNKA 1H7OA 4S1FA 1MEWA 4M7TA 1WBJA 2FDSA 1IIGA 5FEPA 4LS0A 1B4EA 1FWTA 4GWEA 3PUDA 3W72A 1Q6RA 3DFQA 4GUJA 3LRKA 3VNDA 3BK0A 3W7OA 6ALDA 1TPEA 3DH7A 3G1DA 4JS3A 1LDCA 2RFGA 2QCDA 4EVZA 1MSSA 3NQFA 1VHCA 3GKFA 4XKYB 4NJJA 1YTDA 4C1KA 4PA8A 1WV2A 2X16A 1QDSA 2E6YA 1L6YA 2Q3RA 2A7RA 1I45A 2YSWA 3DKLA 1C9DA 2OMAA 1SU5A 1Q45A 1AW5A 1AG1O 1G6CA 1OX6A 1EUAA 4K36A 1W54A 2QCCA 3TQVA 1F05A 1GTHA 3HMJG 1DV7A 2A7PA 4GJ1A 2C19A 4WOQA 3UWQA 1QO5A 1EUNA 1LORA 1A5SA 2C14A 4W9TA 5CZTA 3QJAA 1SQ7A 4IGHA 3GIYA 3BLIA 4O15A 3HPZA 1BEUA 1TQJA 3G0SA 5DY2A 5FEZA 3CEPA 5EY5A 4LVGA 5CGQA 5EA9A 3B03A 3W2UA 4RKAA 4BF9A 1NEYA 2QEZA 1C29A 3DHDA 4UFKA 4PC8A 1CI1A 2XN2A 3QQ0A 1KV8A 3GDLA 3C56A 3TQKA 1RR2A 3N3MA 3QMSA 3GK0A 1H61A 3PG8A 4I7WA 3WJXA 3UY8A 4RXGA 2CW6A 4XZ9A 4MZ1A 4O18A 2Z6IA 3HG3A 1K7FA 1P4CA 5H2ZA 2O7QA 3HF3A 2VEIA 1AL8A 3HO8A 3W1RA 3FJLA 3KVMA 3TA6A 2AQWA 3M16A 4NJIA 1KFEA 4N9EA 4CLMA 1MXSA 3G3DA 4O1DA 3W2NA 1W3NA 4R33A 3F1QA 4P61A 1UBSA 5D33A 3NL5A 2VEKA 4K6AA 4WOZA 3W2MA 1FWWA 4AMAA 3TV8A 1IF2A 1T96A 4NVTA 4Z1BA 4WY0F 5FF4A 1N8FA 2PRLA 1KM0A 3LB0A 4S2CA 4ADSA 4EF8A 5C6MA 1OYCA 1H63A 1GZGA 1F6PA 4S2BA 1M7PA 2YYTA 2Z0IA 3HQ1A 4FIRA 4JTIA 1NVMA 2GJNA 3P81A 1NFBA 1S3HA 3AO0A 1ME9A 3NVTA 3B04A 4IMFA 4NJKA 4TU1A 3IVTA 3C2VA 1XFBA 1DJQA 4FNTA 4JD4A 4YL2A 2A6LA 3W84A 4HSOA 3R8RA 4X3ZA 2ZCGA 5L6UA 5CPLA 2P10A 4GXMA 5HNRA 5I3HA 3OIXA 3UZJA 2GQ8A 2DZUA 3DHFA 1O4UA 1X6UA 4JTLA 1VQTA 4NJHA 3SGUA 5J5RA 1GWJA 3B4UA 1VS1A 4FNRA 3W7KA 2A21A 3G1AA 1PS9A 1JVNA 1L9WA 1KFLA 2FFCA 1TTIA 1VHNA 4TR9A 4QQ3A 3TIMA 3A5VA 4DBDA 1OABA 1GYNA 2XFWA 5KTLA 1TJRA 3CPRA 4AHPA 3M44A 3W1AA 3PF3A 1XKYA 5G2HA 3DENA 5HINA 1XM3A 1FCQA 1SFLA 4QSHA 5F1UA 3LTSA 4MLRA 4Z1CA 5K4ZA 5K3VA 5EL1A 1LBFA 1PL9A 2ZZ6A 3KRSA 3L66A 1THFD 2DP3A 1LRTA 1SO3A 2ZZ3A 3QW4B 5D30A 3UPBA 3ABSA 4DQWA 2DZXA 4TIMA 4K7VA 2EHHA 3DGRA 4ZL1A 3S5NA 2R94A 4UC5A 1YDOA 2E1DA 3IGUA 1F73A 3MI3A 3S1XA 4O4VA 1OK4A 4RV8A 3H53A 3B05A 3PSVA 2B0MA 3C2EA 1I2NA 2H90A 3WFAA 1N7KA 3M9YA 1TPWA 1DJNA 3Q58A 2CLMA 4O14A 4FIQA 4JTFA 4YMZA 1FCUA 2WKJA 3B0VC 3JRKA 4I7UA 2A1YA 5F1VA 1V5XA 4MYXA 3G0XA 5L9FA 2FPVA 1G69A 4TX9A 2RDUA 2NWRA 3P5ZA 1KV5A 2JKAA 4XUGA 1QO2A 2E6DA 4ALDA 1B3OA 2ZA1A 1B9BA 1TPVA 3L0NA 3LHVA 5AHEA 2C3ZA 1LYXA 1ZAIA 1AK5A 3OG3A 1FXPA 3TW7A 1H7RA 1QAPA 2G95A 2TRSA 5IBXA 1LBMA 3MW7A 4DF1A 3CWOX 3M47A 4NUWA 3QSRA 2VELA 1EP2A 3INPA 4GUGA 5EBUA 1KM6A 1PVNA 3LCLA 1BWLA 1KBJA 4NX5A 1D3HA 3M0ZA 3LBCA 2PRMA 4O52A 3DBPA 4QNWA 5FEXA 5G1TA 3NQ2A 3BG9A 4NNCA 4EF9A 1YPIA 4QISA 1V7YA 4BR1A 1OFBA 1O94A 1HG3A 1KFBA 3CIXA 3TC6A 3MP4A 3BGGA 4KKXA 5C5YA 1G4PA 2CLOA 1WA3A 4P2VA 1U83A 4L4LA 3O1NA 1YPFA 3STEA 2R8WA 3BLFA 4LT9A 5LKYA 2WO5A 3HPXA 3HIJA 4I9AA 4O19A 3TU9A 2X1UA 1JRCA 1Z42A 1O95A 1GT8A 3W2KA 1RZMA 1D9EA 2JGYA 2Y70A 1TO3A 3NNTA 3SY5A 3PBUA 4AB4A 2F84A 4OT7A 3QQ1A 1JUKA 3W23A 3KHJA 3KVJA 3IGXA 3GXPA 4MY9A 2YW4A 5LHEA 2ATSA 3BLEA 3EWUA 2W6RA 3W07A 1H60A 1HO1A 3L0KA 4ORMA 5F4SA 2H8ZA 4JDBA 3VKJA 3P84A 4PODA 3DFNA 2QAPA 3G22A 4X2RA 4O16A 1AW1A 4C1LA 4CNPA 5G4WA 4LC6A 1I2OA 1YLVA 3MUXA 1P5BA 4FXRA 2BXVA 4JYEA 3S42A 2YFNA 3SR7A 1JULA 3NQ7A 4WJEA 3MYOA 1RV8A 1DQXA 4GUIA 3EB2A 4U28A 4MPQA 3WK0A 2I9EA 1FQ0A 1NAL1 4FNQA 4RXFA 8TIMA 3LXBA 2YCEA 1F2JA 1ZALA 3RFAA 1GYLA 2QCMA 4FF7A 2VFGA 1TRIA 1EPXA 3W7CA 4MZ8A 2C6QA 2ZRWA 5DXXA 3V75A 2ZYFA 2ZTJA 4HIBA 1JCLA 2FIQA 2WJZA 3CHVA 4ZQRA 1DL3A 5AC7A 3GDKA 3FFSA 1TMHA 1VGAA 3CTLA 2PE4A 2VEPA 5AHMA 3G8RA 3MHFA 2ZZ4A 3O63A 5HWMA 1LRNA 2HMCA 3UQNA 3LHYA 1G4TA 4CQ8A 1W0MA 3W7DA 3RK8A 1EP3A 4AVFA 4OQVA 2ZZ7A 4AHQA 3GDTA 2E77A 3W83A 5BOOA 2QJHA 4K8EA 1PHQA 3E9AA 4N6FA 1JUBA 5E93A 3W7LA 2ZRYA 1W56A 3CQ0A 5D03A 2PRHA 4UNLA 4DF0A 4PL1A 3W9ZA 4M6QA 1RQHA 2LLEA 4UMAA 3BW2A 2ATMA 2C16A 3QYQA 3LRMA 5KITA 2NX9A 2Y7FA 3OVPA 1K03A 3M7WA 4DXVA 2YZRA 3PG9A 3TMQA 3A21A 3VE9A 1OFQA 3I65A 5AC8A 3NZ1A 1K7EA 3GVGA 4FNSA 3E49A 3G1SA 4ZQOA 3W7RA 5F4WA 4WXZA 2WSRA 3A9IA 2CLFA 3NQEA 5D38A 1EWEA 1OFAA 3RF9A 1XI3A 5G2WA 4Z1AA 4OU1A 3OVQA 5AHLA 3L2IA 5HJLA 3NPWA 1JCMP 2ZRXA 1ME8A 2B7PA 4JIQA 2BLEA 1GG1A 1ZCOA 4N2YA 1H50A 4PL2A 3W1XA 2R14A 2PC4A 1GVOA 4O0KA 3LXAA 3Q94A 3R89A 3C2RA 1ME7A 4UFJA 1S5VA 3CT7A 3NPXA 1DHPA 4ZQCA 1LROA 5K9CA 2J27A 4LWWA 2ISSA 1FUYA 1BKSA 3QM3A 4O0ZA 1OHLA 1LM1A 2CU0A 1TPB1 3ZWSA 3ABRA 3B0PA 5GVJA 2NX1A 1J5TA 3KXQA 3MI2A 3WK2A 1FWRA 2FLIA 3G1FA 5C55A 3C61A 2WNNA 3B8DA 2NX3A 5C54A 3KRZA 1JR1A 3OVRA 4JICA 1X7FA 5J5DA 1H7NA 3S1UA 2QCFA 3W3OA 5D37A 4UR8A 2ZQ0A 2V81A 5CSRA 3GAYA 3TFXA 3LBMA 1T99A 4UTTA 3B0UX 3STGA 4O17A 4X22A 4XBSA 1QCWA 4R34A 4UTUA 2Z1BA 2DZVA 1VYPX 1VC4A 1UJPA 3NO5A 3NQGA 4X9SA 5F4XA 2V5BA 3GB6A 2ZRUA 3E12A 3L65A 3ZR4A 2BWGA 3MP5A 2VKZG 3NR0A 3EX6A 3EWBX 2QCLA 3KAOA 1K8YA 4WY0B 1FDYA 4N9CA 1G7VA 1KM1A 2V82A 4LY8A 1SO5A 3OHIA 4OV4A 2GVJA 5DBTA 4AH7A 5DLCA 3P7YA 2E6FA 2FTPA 3S8HA 5DCDA 1KTCA 3TCEA 3MBDA 4XTDA 5EYWA 2QCGA 3LGEA 3PUEA 4RLIA 3S5YA 4MYAA 5E0KA 3HGOA 4A29A 3M5VA 5FF0A 5K7JA 3PBYA 3HGJA 2W0UA 1XBZA 2EGZA 4J9JA 4Y96A 5A5WA 2JGQA 4DEFA 3P80A 3N2XA 5D2WA 1WYIA 1R2RA 5G4EA 4Z1DA 4UTWC 2GJLA 3FA5A 2CZ5A 4QITA 4H4IA 4EIVA 3AJXA 5HWJA 3HOJA 3UY7A 3THQA 3NQAA 2B7NA 4O53A 1QMLA 3W2JA 1PIIA 1JJKA 4IOTA 4LS1A 2CLIA 2H3BA 1EP1A 4CQAA 3W86A 1JCYA 1H1ZA 4FB7A 1IXQA 2J9XA 1DVJA 3LHUA 4ZQPA 1XXXA 2A85A 6TIMA 1AMKA 5SWUA 3GDRA 5DCEA 2VEMA 4CNNA 2ZRVA 3QPZA 4IWWA 3M1ZA 3F4WA 1A50A 1YXDA 3KVLA 2ZDRA 5H91A 2QUTA 2DZSA 5HMSA 3NYZA 4Y8FA 4MFDA 3FS2A 1LLZA 1MEHA 2WPBA 4K39A 5AHIA 2EF9A 4U4MA 3CB8A 2XN0A 3DU0A 1OX4A 1XL9A 1WQ5A 3TUUA 2TPSA 4HNUA 1SR9A 2NLIA 3LCWA 5T26A 5D32A 2VFIA 3G3MA 1VLWA 3L5MA 1M6JA 2ISWA 1RVGA 3M43A 1CW2A 2ALDA 3LI0A 1DORA 1OFEA 3E02A 3W74A 4IJBA 1G4EA 1GVQA 3GNNA 3TE9A 4JN6A 2Y61A 5C2XA 2CWNA 3W22A 3S5ZA 1XBXA 3NA8A 4AAJA 3Q37A 2QJIA 3SFKA 2I1OA 4DELA 1QFEA 2GVGA 2G97A 3LCHA 3WJWA 1OFRA 2RKXA 3GNDA 3D0CA 4ZMGA 4UFIA 1MEIA 1P1XA 4CQ9A 2RHGA 2YXGA 1SW7A 1PHWA 2V2HA 1P0NA 3T78A 4UMBA 3W1QA 4UIOA 2ZFAA 3HGRA 4M7SA 2VFDA 4WX2A 1LLWA 3IVUA 4O54A 3NPVA 3W2LA 3NOEA 1OFDA 1OF8A 5LHFA 5HWNA 4N9DA 1VRDA 4TMBA 5KMYA 3YPIA 1F7BA 4BI6A 1TREA 3N34A 5DBUA 2QCEA 3UWVA 3CU2A 3O8AA 4LRSA 5AN7A 2ZZ1A 3H54A 3ATZA 3PAJA 4DO4A 1XUZA 3EX4A 1SW3A 4MIMA 1UUOA 4QIUA 4IXHA 2GQAA 2NUXA 4N9BA 3NZRA 3TX9A 1SSDA 3QRHA 4GE8A 4GRSA 4E0CA 2Q3OA 4MZYA 3SECA 4JY8A 5KZEA 2WOQA 1XUUA 5CPNA 2X30A 5HUPA 3CC1A 1F6KA 1MZHA 3NM3A 4O1AA 5D2XA 2YW3A 4DO6A 1TYGA 3W88A 3N19B 5AYZA 5FF7A 3KVKA 3GXTA 5U7SA 5TQLA 2V2DA 3T40A 3W7PA 2QR6A 2ZZ2A 3LX9A 2NXGA 4KFPA 5FF3A 1K8ZA 2IQTA 3W6YA 3EWWA 2NV2A 1QPOA 2QDGA 1U5JA 2ZTKA 4IX0A 3P62A 3U8GA 4IQLA 4AWTA 1TPDA 3NEVA 1ZHAA 3PBVA 4JX6A 3KRUA 2Y89A 3BARA 3H55A 4LS2A 5DY3A 3L67A 3C2FA 1TCDA 2F7FA 1ICPA 3UWYA 4DPPA 3SZ8A 3EX3A 4IX2A 5I3FA 1NSJA 3S6DA 3G1YA 3E96A 4Y90A 3RLUA 1AW2A 3LHTA 2HS6A 1S5TA 2C13A 3GXNA 1X8FA 2A7NA 1OX4B 1XC4A 3LDVA 4R53A 4BI5A 1WBHA 3VI2A 4YCOA 3MP3A 4UFMA 4RCXA 1ALDA 3BPWA 2CZFA 3QFEA 2UV8G 3G1VA 2VFEA 5K9DA 4PFMA 1XBYA 3P60A 3EKLA 4HSNA 4DPQA 3TAKA 3DI0A 1G4SA 2NXHA 1VZWA 1KTBA 1Z44A 3MHGA 3Q2DA 3M6YA 1I2QA 1W1ZA 3M5YA 4LVAA 3W1PA 3W7EA 3IIOA 5TIMA 3RMJA 3NPUA 1IXPA 4HN4A 1SW0A 2V8ZA 4UUIA 4AF0A 1GQNA 3M5XA 4JTTA 2OT1A 3NXFA 2AGKA 3R13A 4FNPA 3SGZA 5AOUA 1UB3A 4O8RA 3O16A 3O07A 1C8VA 1JCXA 3BV4A 5G1YA 4HNTA 3FYPA 4YLWA 3DFTA 3EX1A 1VPXA 2V0TA 1HO4A 1QPQA 1ZAJA 4UTMA 1VYRA 4A2SA 5FESA 1TJPA 2DJLA 4XQ6A 1FDZA 4BWLC 4MOZA 3TSMA 2FPTA 3PSWA 4UTHA 1I2RA 2A0NA 1R2TA 4IXXA 2TYSA 4ZQMA 5ABTA 3THAA 3B06A 2Y88A 5LGXA 3VFLA 3UXAA 3DAQA 4ZQNA 3U2OA 2J9YA 4O12A 1OVDA 4DO5A 1QNVA 3WJYA 5FI8A 2P1FA 1A5AA 3USBA 4LOCA 3RU6A 1GOXA 4UTLA 2RDTA 5LNRA 1TRDA 3WK3A 4UMCA 2GOUA 3W7GA 3GAKA 4RJEA 1F76A 1FDJA 5LNSA 4I7VA 1YTEA 5CZJA 3C8FA 2YPIA 2VC6A 2JKPA 2Z6JA 4B5NA 3UNDA 3DKJA 1W3TA 2E6AA 3W1NA 5BW6A 1H5YA 1K3UA 4LTSA 2NXIA 5IM51 3NM1A 4UCGA 3QW3A 3M5ZA 2R91A 2VFFA 5D2YA 1TB3A 3C0JA 3TJXA 3C6CA 5F2GA 1KBIA 4WY0A 3N14A 5BNKA 4ONVA 3W7JA 3N73A 2FQIA 4POCA 1W37A 3R5EA 2J6XA 2QF7A 3QMRA 3FEMA 2E5BA 3N2MA 3UWWA 2QCNA 3JS3A 1HFBA 1HTIA 4K38A 3MBFA 1KM3A 3NQCA 4PEKA 4LVBA 5K2ZA 3UPWA 1OG0A 3TKFA 2A4AA 4JXCA 3GZ3A 3TMLA 2OT0A 3MMTA 1YTKA 3TC7A 3NAVA 3T55A 4UTKA 1TTQA 3QF0A 3EX2A 3P5YA 5BMWA 1H7PA 4LUJA 5D2VA 3FOKA 4CCDA 2OX1A 3GR7A 2ZZ5A 2D73A 4E2DA 3TXZA 3O06A 4Q4KA 3IIPA 3TH6A 4AF0B 1BTMA 2NUWA 4N4PA 3WK1A 3VCRA 1KFCA 4MY1A 1PCKA 2YGYA 2YX0A 3PVFA 1H7WA 5I3JA 3S5OA 1GEQA 4YWIA 3I6RA 3BW3A 3SIZA 4GFSA 4O57A 5D02A 5K9XA 1XBVA 2QAFA 1WX0A 1R30A 3PUOA 2ISVA 2JK2A 2BZNA 3SW6A 1T0OA 1GJPA 1LRQA 4Q33A 4ZZ9A 1KM5A 4WZHA 1QOPA 1W5OA 2YDAA 3LTYA 1QOQA 4M19A 1ICSA 3O6YX 4XBKA 1VCFA 3PB0A 5CG7A 2BX7A 1FWSA 3PB2A 4O50A 2NV1A 3UWUA 3LV6A 1LOSA 4NNBA 1SZEA 3W85A 1A5CA 3PS7A 4LV4A
chains in the Genus database with same CATH superfamily
2V63A 2A6NA 2R1NA 1CGTA 4Q7BA 3ZR5A 4C6CA 2VX5A 2CBJA 2E8ZA 2YDSA 1BYCA 1FP9A 1O66A 1SVDA 2VCAA 3NQBA 1NELA 1JG9A 4MFEA 4A21A 4GBUA 4JFSA 1VBGA 3SCOA 5G5IA 3A12A 1ITCA 1Q6LA 2VCCA 3BVJA 5BRBA 5A8QA 4IGMA 2JBMA 3UJFA 1ZBVA 1XLJA 4M6PA 3MS8A 2WBGA 1VJIA 1JAEA 2J62A 2WM0A 3N9RA 3HFYA 3EWZA 1W3LA 5H8PA 4KWVA 1Z48A 3G1XA 4A8RA 1F4HA 3GQYA 4AZ5A 1SSGA 3VOHA 1PCWA 1ZJIA 3WJSA 3PPFA 2BODX 3OBKA 2BVDA 5KINA 3W7IA 1TV4A 1KGXA 2PDNA 1UKPA 1KGWA 3R25A 2ZA3A 3LLFA 1GHRA 4JTGA 4E6MA 3C3NA 4H00A 3IANA 1QNQA 2WLYA 2UY3A 3DFOA 1K9TA 3M0JA 2YXXA 3V5FA 3WLQA 2ZE3A 5FF2A 2XN1A 1W9UA 1XGEA 2ABBA 3PZMA 2ISDA 3S2CA 3NL2A 3PWIA 1H1NA 3VOGA 3UT0A 1OWQA 4L1XA 3A24A 3DYOA 3B8WA 4BF7A 4MVAA 4M24A 1W3HA 2WWDA 3I7SA 1UOKA 3CEUA 3F2BA 4EPBC 4WDTA 2YCLA 2OLSA 2X7VA 5HQEA 4O1CA 4LBUA 3GG7A 3G18A 1ECEA 3FYOA 4LRTA 2TSYA 2HV5A 4K7YA 3MWAA 3MCOA 4WSHA 4DF2A 5HR7A 3CLMA 3HQOA 1W1VA 1WAUA 3W0KA 1LBLA 4OV9A 1VFSA 3RAOA 3APGA 4CNSA 3ITCA 2C0AA 1UUQA 2D2JA 2A3EA 4IJRA 1M7OA 3BOXA 2BGNE 1YDVA 3PBMA 4DZ5A 3WKZA 4WR3A 3RPTA 4CEXC 3NDYA 4GVIA 4LVDA 2GUYA 1PBGA 3FKRA 1UR2A 3KOXA 4JTUA 4RPPA 3ZLHA 4CUCA 1JCTA 1TV3A 1FRBA 2WMIB 4N4QA 3S9IA 5IHSA 3F03K 2VHLA 1PWLA 3BSHA 4JGDA 7TIMA 4BQ4A 1MO0A 2EKCA 5XINA 4ZODA 4B90A 3CYVA 2X1SA 4FNUA 1WCGA 4D1JA 4IFRA 1QHOA 2OCZA 4G5DA 4NIRA 1O6IA 1JQVA 1UKTA 4J2MA 1REQB 2DVUA 3P2VA 1W8SA 1YEYA 3Q4DA 2QYGA 1W9XA 3T4CA 1XLIA 4H7ZA 2ABAA 3V1PA 5BOFA 2C15A 4M29A 1QPKA 1KM4A 4DVOA 4Y2WA 3GXDA 3W53A 4AU0A 2DZTA 1A3WA 4LVFA 2IPJA 1EX5A 1XLDA 4IUOA 4PTNA 2C7FA 3QXBA 1VFOA 4Y9PA 1U5VA 1UYQA 1S2TA 1O5KA 3R0UA 2PWEA 4JTKA 8A3HA 1UD8A 2A79A 3WLNA 1Q66A 4LPCA 4QGCA 1Y5XA 3VD3A 4K8GA 1S1PA 4O1BA 3FDKA 3HJZA 1JZ5A 2VC7A 3UPMA 1KC7A 3ANVA 3CBWA 8XIMA 4W84A 4YTSA 2KZHA 3A5FA 4DAIA 3L21A 3O15A 3WLMA 1TV5A 1XLHA 1G7UA 4Q4MA 5MHBA 1PTGA 4XSLA 5AFDA 1UR3M 4C1NA 4DUWA 2YKKA 1VCGA 1GTEA 2IKHA 4PMVA 4NAFA 4C65A 1RPXA 3QVQA 2W61A 3QMTA 4TMCA 5U4NA 5C2CA 3SI9A 2ALRA 2G3JA 3VNMA 4UTJA 2FGBA 4BEUA 2WPGA 1SZNA 3A23A 3TFCA 5A8GA 3TR9A 2OZ0A 2DORA 3L9CA 2G4JA 3S83A 3QTGA 1V4YA 2G41A 2FJKA 3EXTA 1A4MA 5ABFB 2WQDA 3HTWA 1JCJA 1MW3A 4ZSTA 4WD0A 2CZEA 3VNZA 1WXJA 3G0UA 3PJWA 2OU4A 2NUYA 3T7VA 3USZA 1IIHA 4M51A 4UFHA 4OBRA 1GORA 1LF1A 3EXSA 4NNAA 2NZLA 4H19A 4LNYA 4I9JA 4Q8NA 3UXDA 4UOZA 4PRTA 1JF5A 4M56A 1PV8A 2VTFA 4ICNA 4EXBA 4B4HA 1IXNA 4HMEA 1VAHA 3LPFA 2VZUA 1FWDC 3AJ7A 5DN1A 2IQDA 5IFPA 3HG2A 3U2ZA 4PCTA 3AIRA 1JGMA 1DE6A 1UD3A 2PEVA 5LNUA 3G1HA 4NT0A 4W85A 3W29A 4CVWA 2V38A 4A2RA 1DJXA 1DEDA 2DSZA 3KOFA 2B7QA 1EGVA 4WLCA 3P14A 1BD0A 3H7UA 2E09A 4A3UA 4GVGA 2O9TA 4L1GA 3H70A 4BWLA 2PAJA 3GHTA 1CLXA 1EHAA 3EYPA 1XHGA 4CN1A 4A3RA 3FIGA 3UXKA 4H9MA 5EB8A 4ATDA 4C6MA 3WBYA 1HKMA 2JF6A 1NIUA 1K6WA 1PKNA 4D6GA 4JYFA 3R2GA 4HHLA 4H04A 3BLKA 3GIQA 1W5NA 4CU8A 3BAXA 3LM7A 1JNEA 4RR4A 1AVAA 1RD5A 2Y7EA 1M5WA 4QHRA 1QPRA 4C1NB 1DQWA 2XSXA 2ZA2A 1XJBA 2VURA 2Y7GA 5ECUA 1UWUA 3ELFA 4F9JA 3CL8A 4NRSA 3WQ8A 1NY1A 2XVGA 4IP4A 3LHWA 4IMEA 4NAFB 3GG1A 1WOAA 3HGSA 3PJXA 3DUGA 1YDNA 3LERA 4WXYA 1E4MM 2CIPA 2HSAA 5M5DA 2HTMA 2HEJA 1WZAA 2OWXA 1XQLA 3WD3A 4XZBA 4X9YA 3ERPA 3FGCA 3BC9A 1W17A 3OZPA 1LG2A 4GNJA 4IIBA 4DJEA 3LTPA 4NASA 2DUAA 4MNKA 2PLJA 1PE1A 1XIGA 1XIJA 2XIJA 5G2IA 1JYXA 5EMUA 2GSHA 4B5XA 3RPMA 3N9SA 1A5KC 2WSYA 2DEPA 3LM3A 3QZAA 2CLPA 3ATYA 1KRAC 3IK4A 4LUSB 1GKQA 3DXIA 1SM9A 4J4KA 3AWNA 3V5OA 1UCWA 4EAYA 2WNQA 3RLVA 3CPGA 1CGWA 1KLYA 2GYIA 5HJYA 3LCFA 1MVYA 4IFKB 1O7AA 4BK9A 3AIWA 5A2BA 4JBRA 1HZYA 1ZJAA 1ODUA 3R94A 2A3LA 3FSUA 4BJHA 4M1BA 4CNTA 1POJA 1Q6QA 1L6FA 2QPSA 2O9RA 3RM4A 1WOBA 3RN6A 5LSMA 5HNTA 4F2BA 3TW6A 3RO8A 4S3DA 3H22A 4A22A 1TCMA 2DSKA 4QNEA 3CK5A 1E15A 2WZEA 2D1ZA 1CBGA 2ASHA 2CLEA 1CXKA 1KFWA 3WDQA 1BGAA 3NO1A 1E0WA 1H7OA 3WDRA 3TP4A 1SR0A 1WZLA 2VR5A 2FDSA 3BV7A 4H01A 1TVPA 2FVKA 3E2VA 1JDEA 4C6JA 2BY2A 4Q8QA 3ZJ8A 3W72A 1RLDA 1Q6RA 3DFQA 4GQGA 2OQYA 2MANA 5E0FA 5JVLA 3VNDA 3A4XA 1LDCA 1VHCA 1C9WA 4Q8WA 4YTQA 4NJJA 1YTDA 2J77A 4PA8A 1Q6EA 3SY8A 3UZWA 1I45A 2WLZA 3ABZA 4WJXA 1SU5A 3M46A 5A6SA 1Q45A 1AW5A 1P1MA 3V36A 5C9RA 5H8MA 1G6CA 1OX6A 3N2BA 2QJJA 1XCXA 1EDGA 2R9RA 3GY1A 2ZWZA 4D1IA 1DWHM 2Z28A 4GJ1A 4HK7A 2ZICA 1QO5A 3T2OA 3FA4A 2INEA 2VRJA 4ZO6A 4MMWA 1BEUA 1TQJA 4L65A 2VC9A 3SDOA 1CLKA 3KRBA 3W2UA 1ZSXA 4ZR8A 1C29A 2XN2A 4OTKA 1EJVC 1XIHA 4HTYA 3ITXA 4XAFA 2RDXA 2QS8A 5JMUA 3WJXA 4AD4A 1PKLA 4RXGA 4Q4SA 3OZMA 2ZUUA 1K7FA 1V8EA 4PGLA 5H2ZA 2VGIA 3TEVA 1UKSA 3HF3A 2QVNA 3W1RA 1I0BA 5D9NA 1ZJHA 4KIEA 2VZSA 1US3A 3EWDA 1XSIA 1QJWA 2EG6A 2P8BA 4Q8VA 3B0YA 3GU2A 3TZFA 4O1DA 3NGFA 3F1QA 1Q2SA 2WJFA 3JZUA 3NL5A 2VEKA 3W2MA 1XYBA 1FWWA 3G6MA 2WM1A 2EG8A 2CBIA 3PFMA 4QR6A 2G0WA 2NW0A 4WY0F 3UJ2A 2PRLA 1KM0A 1NWSA 2YL5A 4ADSA 1S38A 3TN4A 1IEIA 1H63A 7PTDA 1GZGA 3B9OA 1RA0A 1F6PA 2DT1A 1M7PA 4QQUA 1OSEA 4C6IA 2XH0A 3IJ6A 3L23A 2BHUA 1ME9A 3NVTA 4MB1A 4NJKA 4TU1A 3IVTA 1XFBA 2ZUTA 2HK0A 4EWJA 3W84A 1J79A 4X3ZA 1DXFA 5CPLA 2HISA 2P10A 2BY1A 4MWAE 4WGXA 4B92A 4JHMA 3P6LA 5I3HA 3OIXA 2XGIA 2UY5A 4W7VA 1O12A 2OYKA 3WLLA 1R3SA 3CO8A 3SGUA 3W7KA 2A21A 1JVNA 3F2CA 2W5FA 1KFLA 2FFCA 3VD4A 4XAGA 1XIDA 4QQ3A 5HMEA 4RE0A 3O0KA 5A8MA 1KXTA 2XFWA 1GYNA 3CPRA 3E5PA 1EC7A 4QLKA 2HVOA 4M6UA 5I00A 6CGTA 1VP5A 4DBSA 1SFLA 4QSHA 5HXMA 4D6CA 1PL9A 1A0EA 1EGMA 2E40A 2RGMA 3KRSA 3L66A 1TJ2A 5DMYA 1WKDA 4JNYA 3GG8A 1LRTA 3KS6A 5D30A 1IWAA 4DQWA 1F3TA 4DNHA 4TIMA 3E6EA 4K7VA 3RRXA 6A3HA 3CQJA 4XV0A 3S5NA 4UC5A 1V03A 3K8MA 1YDOA 4JIEA 1F73A 5HPOA 3TTEA 4RV8A 3B05A 3PSVA 4AZGA 3O9NA 4Q4QA 2BXZA 3WFAA 4ZA0A 1N7KA 2DZAA 3M9YA 3EMQA 4S23A 3Q58A 4O14A 5M2FX 1OCJA 4FIQA 1IT8A 5LXXA 1FCUA 5BXSA 2RJGA 3JRKA 4I7UA 3VGFA 3STPA 4MYXA 4KCUA 2V69A 1GVYA 4UTFA 4QE4A 4XX6A 3FW6A 3H21A 1E1CA 4JTQA 2CC0A 4JOMA 1NARA 3P5ZA 1C93A 1P6CA 2JKAA 4XUGA 4HJFA 1B3OA 1XSKA 2ZA1A 1B9BA 3DFHA 3L0NA 1JAKA 3LHVA 3E0WA 1ZAIA 4RE2A 4G56A 1Q6GA 1FXPA 3CAKA 1H7RA 3K8KA 3SGGA 1QAPA 2TRSA 1X39A 3AISA 2F6XA 3MW7A 3GVVA 3EA3A 3CWOX 4NUWA 3LUTA 5ENLA 3B3DA 4B5TA 1R86A 5EBUA 1CXHA 3QQWA 3LCLA 3HJEA 2G50A 3LPOA 5FEXA 2YA1A 1VFFA 3AXXA 4BR1A 2ISFA 3D46A 1XYAA 1WUFA 2X0YA 3CIXA 5G4HC 1E71M 3MP4A 4KKXA 3PZUA 2PDPA 2BNJA 3D3FA 1YPFA 2R8WA 5LKYA 3HPXA 3HIJA 4GYPC 4O19A 3TU9A 4FP1A 2X1UA 1JRCA 3ZQ9A 1Z42A 1F6YA 1O95A 1UKQA 1J11A 4S3GA 5HMDA 1D9EA 1QVBA 4AB4A 4UOQA 2VOTA 4IGSA 4MWAC 3KHJA 3GXIA 3TJIA 4JQ1A 3H4XA 3URQA 4MY9A 4DUOA 5KZ6A 5LA0A 2W6RA 3CHCA 4HYWA 4J5NA 1H60A 4EKJA 3DC0A 4XO6A 5F4SA 4L9YA 5A8OA 1MUCA 3VKJA 3WDIA 4P7NA 3QLDA 3IUDA 5JUVA 1FWBC 1RA5A 3DHUA 3R7MA 4PRWA 4UZSA 4LC6A 1I2OA 1YLVA 2PLMA 3NCOA 1P5BA 4FXRA 4LNCA 2Y5EA 3N11A 1F61A 1JULA 2Z29A 3PTMA 3VTRA 1RV8A 5F7UA 3VDCA 3EB2A 3FDGA 3WK0A 1DXEA 2I9UA 3WF4A 2B81A 4AD2A 1C8QA 4M81A 3RFAA 4FF7A 4F40A 4UZUA 1UWQA 2NQJA 4MZ8A 2C6QA 1E1CB 3V75A 4FXFA 4X2PA 3ARYA 5DO8A 3GDKA 1TMHA 3NSNA 3FJNA 3EMZA 2OLHA 2VEPA 2G37A 5A6BA 3AS3A 4GIYA 4AD1A 1R3QA 3I10A 1YRRA 2FZNA 4RDVA 3ARSA 4PR4A 2OEKA 3LHYA 1UZHA 3C86A 1W0MA 3W7DA 3RK8A 1EP3A 4AVFA 2ZZ7A 1SJAA 3W83A 3ISIX 1TE6A 5E93A 1W56A 5D03A 2PTXA 3WLJA 1AD1A 2J7FA 3N29A 3AROA 4L1WA 3MUZ1 2I5IA 4M6QA 4F0MA 4XD3A 4HYVA 5I24A 2DFAA 3QYQA 3LRMA 2NX9A 3XISA 2V68A 4M8UA 3TMQA 3E3HA 4ZB2A 3F7JA 4GNKB 4Q8UA 3G1SA 4ZQOA 4GIAA 3W7RA 5F4WA 5GPRA 1V6YA 2J78A 4GFIA 3RF9A 4JNZA 3MANA 1YNYA 4OU1A 3OVQA 5AHLA 1LWJA 2B7PA 2YZ5A 4JIQA 2QQ6A 4AY1A 4YU1A 2R14A 2PC4A 3TW9A 1W8GA 4KWUA 5CCZA 3Q94A 3AS1A 3EPNA 1EBHA 4AZHA 2ACSA 1DJWA 3K1DA 3H7RA 4H9UA 4O0ZA 1H41A 1OHLA 1CB2A 3ABRA 3CB3A 3KZSA 3AMLA 3MI2A 3WK2A 2ZX6A 1FWRA 3G1FA 5DMNA 5C55A 2WCGA 4JICA 3DFYA 4HCHA 3OZYA 2FDMA 2FGLA 3S1UA 3W3OA 5D37A 4UR8A 1DJIA 2ZQ0A 3RM8A 5GJPA 1J0IA 2ZDSA 4J3SA 1Q85A 3GAYA 3P93A 3LBMA 2DH3A 2R1PA 3GVRA 1XV8A 1UHVA 4XBSA 1GK8A 1GPFA 4QJ4B 2AQVA 3D5HA 1JEZA 4X9SA 4AC7C 3GB6A 4RV3A 1GQKA 2ZRUA 4UBPC 3NR0A 3EX6A 3T2QA 3N13A 4WY0B 2OB3A 1KM1A 4PMDA 3OHIA 5DBTA 2FJUB 3P7YA 2H9AA 3TCEA 3TWAA 5FD0A 3GNXA 1UMYA 4ERGA 4LAKA 5E0KA 3HGOA 4A29A 2CHNA 5FF0A 3HGJA 4XAYA 2Z25A 2W0UA 2VJXA 2ZXQA 4Y96A 3N2XA 1WYIA 3QTPA 4Z1DA 2CZ5A 3TLQA 1ZTVA 4H4IA 1NM9A 3GNPA 3GRIA 3AJXA 2OEMA 2XVPA 4HTBA 2E9MA 3A3XA 1WUEA 2W27A 3B9AA 4WVXA 2J7CA 1JJKA 4IOTA 4LS1A 2FFIA 2H3BA 1GYMA 3U4AA 4MB4A 1DVJA 3PFRA 4OIFA 6XIAA 3ES7A 5SWUA 1QOXA 4LCRA 2VEMA 2ZRVA 4Q22A 4IWWA 3F4WA 1A50A 1TR9A 3AHTA 4NP7A 5EFFA 5HMSA 3NYZA 1XYMA 2VGBA 1W1A1 1WDQA 1RCXB 1S1RA 2P0IA 1J2BA 4W93A 3CB8A 5A8NA 2XN0A 4G9PA 2XDFA 1TWIA 2TPSA 3KDOA 3E2QA 4PCNA 5T26A 5D32A 4KRUA 4RZBA 3VNKA 3M43A 2HBVA 3TE9A 4XAZA 4Q6JA 2CWNA 1J93A 1O5QA 5XIMA 3WQPA 1BSIA 4XG1A 1RD6A 2GVGA 3H2MA 3QV7A 4PMUA 4JFWA 2QV4A 3VILA 1WNOA 3DX5A 4NZCA 1R38A 3MUIA 4ZMGA 4DI9A 3K5XA 3PJTA 2RHGA 2V2HA 2X09A 2VFDA 4O54A 1A47A 1E1EA 1OFDA 1X8CA 1OF8A 5LHFA 5A2CA 5HWNA 5G1MA 4MDOA 2GJRA 4TMBA 2GUBA 1ISYA 3SRFA 4Q8MA 1ZL1A 3N34A 1PPIA 4UQAA 2VZVA 3SAZA 4BEQA 1DJYA 2ZZ1A 2DPEA 3MMWA 1XSJA 3EA2A 6XIMA 2H9AB 4PB5A 1UUOA 5JQ9A 4AG0A 4W88A 1HX0A 1VIZA 3NZRA 2QZRA 3QRHA 2NVCA 4BQ3A 3UNTA 3SECA 2WOQA 3SJNA 3CC1A 4H7CA 1DIKA 3A47A 1IV8A 3DERA 1B0IA 3ARUA 4CQBA 1TX0A 1HJVA 2PP3A 3GXTA 1XISA 2GGJA 3C0LA 3UCQA 2V2DA 3W7PA 1Q7MA 5A2AA 4L5ZA 2AKZA 3ITOA 3HURA 2IQTA 3ICJA 3SB0A 3VOFA 2PS2A 1TE1A 4IT1A 1QPOA 4W89A 4DXKA 3H8AA 1U5JA 3L4ZA 3VIKA 4OUEA 3N2TA 1ZHAA 3PBVA 5EMJA 3WLHA 4A35A 3S2MA 1TCDA 3UWYA 5I77A 4DPPA 4GY0A 3K4AA 3G1YA 3E96A 3T0BA 1J01A 4IL0A 1V02E 2C13A 3M0MA 1WBHA 4HHHA 3MP3A 4ZTXA 4UFMA 3TTQA 4H9VA 1Z32X 2CZFA 4GI9A 4FALA 2UV8G 4LAUA 2HNEA 5K9DA 2PWDA 1XBYA 3P60A 2GGGA 3EKLA 1YE4A 3WLIA 4FPSA 4PTWA 4LGXA 1I2QA 3M6YA 3SIMA 2WJDA 3IJLA 2HE5A 3RMJA 4HMDA 1IXPA 5I07A 2HXTA 2PWUA 1FFQA 3NZPA 4MG4A 4F9DA 2DSUA 4JTTA 2OT1A 4B2DA 4ZOCA 4FNPA 4LEFA 1UB3A 5FAGA 3O16A 1JCXA 1UA7A 2YCKX 4GXPA 4HQVA 3KOWA 3UGVA 1KR0A 1ZAJA 1VYRA 3UW6A 2ZC8A 3POHA 3WD4A 5I78A 4IQEA 2A3HA 4CN6A 3PSWA 2E7FA 2GFTA 4UTHA 4IGNA 1EBGA 1R2TA 2TYSA 1VBRA 2Y88A 4MWAA 3TWBA 3GBDA 2ACUA 3DAQA 2KX9A 2Q02A 4ZQNA 1IWBA 3RX2A 2J9YA 4DO5A 1QNVA 3WEZA 4WSKA 4RNFA 3GIPA 1TRDA 3WK3A 4UMCA 4F0HA 5AC5A 1WXZA 2PZ0A 1DWGM 1RCQA 3GU1A 4PUEA 3WH7A 3MVTA 1TELA 3C8FA 4L61A 3KP0A 4B5NA 4GQRA 3MV11 1M7XA 1B31A 3NM1A 1TB3A 3PHAA 4P8WA 2PWGA 3RYSA 1KBIA 5BNKA 1HKWA 4TOQA 3W7JA 1UQZA 3KUMA 3N9KA 3FEMA 3F4DA 3N2MA 4G8TA 2QCNA 3UWWA 3JS3A 4KESA 1CZ1A 4QG8A 1HKVA 3WNMA 3EWCA 4PEKA 1OG0A 1JDFA 1P7TB 3GZ3A 3MMTA 3TC7A 3V0SA 4IPLA 4Y9NA 3UR2A 1ZU8A 1T5AA 1H7PA 3AXMA 4JL2A 2OX1A 1E6PA 3AYRA 4E2DA 3TXZA 3GC5A 1E70M 3IIPA 1B2YA 4N4PA 1NTHA 1RPKA 2J7EA 4MSSA 1KFCA 1HQTA 4IIDA 4MY1A 2YGYA 5BOEA 2YX0A 3PVFA 4XZWA 3S5OA 3I6RA 3BW3A 3WDPP 4QROA 4O57A 3FY1A 4GO9A 5C0QA 5K9XA 1R30A 2ISVA 2AKMA 3SW6A 1JYNA 2QVHA 1KM5A 1W5OA 2YDAA 3U4FA 3ALFA 4S3BA 4JHOA 3PB2A 4O50A 3C3UA 4XD6A 2IPGA 3QY8A 4Q7IA 1RCOB 4MWAB 5IHRA 1R3TA 3R8GA 4A3HA 4LV4A 3H26A 1J2WA 5FJUA 2PTWA 1V51A 3ANYA 4N42A 4XK2A 4Z17A 3T9PA 3W1LA 3DBNA 3EKGA 1ZNNA 2Q01A 3ECQA 3SQMA 4JEQA 1EZWA 5T9BG 1SO4A 3QEZA 3I68A 3RHGA 4GG9A 1EDQA 2IQ0A 4JQ3A 3OP2A 1ADDA 4RDYA 4UQBA 3WBWA 4GQ0A 3WQGA 1EQPA 5AZ0A 2H8XA 1Q63A 1EJRC 3LS9A 3THUA 2CLHA 1SMDA 1JI1A 3FHQA 3OA3A 4J28A 5DCBA 2HS8A 3G24A 4D2JA 4ERIA 1R0MA 4MY8A 4B5VA 3S5SA 4BI7A 3BO9A 1ZQ5A 5A6MA 2BY3A 4JIPA 1KA9F 3OJGA 1BSLA 2VOMA 4C6QA 2W66A 1JRBA 1V3JA 2X1TA 5CPOA 4N6EA 3VX1A 4LV9A 4E3VA 1CIUA 5AC6A 1AQMA 4GUHA 1RUSA 3LCGA 3WD0A 4HA1A 5I3KA 3GR8A 4JCMA 3L5LA 2RH9A 3AS0A 4DZHA 4H2CA 1V0LA 1ICQA 3F5JA 3PANA 5LIXX 4GJIA 1OJXA 3GW3A 1BRLA 3BG5A 3D3AA 1FH9A 1R2SA 2KAUC 4W5ZA 2CETA 3ZS4A 3CV2A 3DZ1A 3HBLA 4PB4A 4KBXA 2B4GA 1Y0EA 4HN8A 5EPDA 1KBBA 2F38A 4W4QA 3NQDA 4QE1A 1F3WA 3W24A 1LQ0A 4OE7A 1J0ZA 3FNDA 1VCVA 2WZMA 3O6DA 1OGSA 4FO4A 3AIQA 1JZ6A 5TBOA 2CITA 1HKIA 4H83A 2R1MA 1LOQA 4DX3A 3OGSA 5FL0A 2PD9A 4HPJA 4TTUA 1YMYA 3WSUA 3WX7A 4N02A 3KOYA 3T0AA 3RCYA 3QY7A 3PTDA 2E5CA 4M5PA 3S1WA 3FXGA 1MFVA 1TJ0A 2DT3A 4GO8A 4RW5A 4IZGA 5DRIA 1QW9A 1V3LA 2V5LA 5HMFA 4JTAA 4GUFA 4LB3A 3UZ5A 2XU2A 4YYCA 4JY9A 2G5WA 1JYWA 4OBTA 2O4QA 1TIMA 4WEVX 1KXVA 1KM2A 5I5RA 8XIAA 4RNHA 2Z1XA 3NTYA 1DBTA 1UIOA 1W9PA 2PD5A 1G94A 3ARXA 1A5BA 4J3WA 3KWSA 4GC3A 2HZGA 1XRSA 1K8XA 1OM0A 1TZ9A 3LGDA 4MAZA 5JU6A 3P0WA 4GCAA 5LXEA 1OB0A 4C6FA 3APYA 1TWDA 2GVEA 1CX9A 3ABQA 1G0CA 2DY3A 4Q32A 2CHRA 4DM2A 1ISVA 4HNNA 3PR2A 1OD0A 5MF5A 4C91A 1XCFA 3XINA 1S2WA 2XIOA 2BP1A 1I1XA 1VBUA 1Q6CA 1GG0A 4Q8PA 1KFKA 3P8IA 2GQ9A 4GLEA 1D7KA 3VE7A 2V30A 3QGAC 3TN3A 4WQ6A 2WK2A 5FEWA 1BGGA 1BRLB 3QHOA 1O5RA 3MZ2A 3G1RA 3Q67A 3NQMA 5CC5A 3U5UA 3L0GA 3LHZA 1OADA 1LT8A 1X6NA 2Z1VA 2W62A 3W7HA 2CEQA 2DZPA 2NQZA 3KX6A 1KTNA 1QXLA 2GUUA 2VEFA 4JX5A 4JTJA 5I3GA 3PM6A 4B4FA 3P82A 1CEOA 2W79A 1ZRQA 1R5YA 1JCNA 1VFTA 2YR1A 3NSXA 3MO7A 3KBNA 2D24A 4MGGA 3SUVA 4U31A 4AXKA 4Q6XA 1WAWA 3OTRA 1FHVA 2VXNA 3O2LA 4QM1A 3L5AA 3KTCA 2ZXBA 1UZ4A 4YS1A 3CH0A 4MJZA 3SCNA 3EBVA 2WCSA 3PWAA 3VAVA 3TQ0A 3NZQA 1X1ZA 1TQXA 3V7PA 4H8NA 1M53A 1KGUA 4QP0A 4HHPA 1KW1A 3GLCA 7CGTA 3RPDA 2XH4A 1E6RA 5BWFA 3EEZA 3AYVA 3LLXA 4KGJA 4NKCA 2Z26A 1XDLA 4FI4A 4HU3A 1VPQA 3VIIA 4FSAA 4OJYA 1JPMA 4YJ5A 5DRCA 5D2TA 2YIHA 4EWND 1Z69A 2OZTA 5KSWA 1UD5A 1N8IA 4BFAA 4IPJA 1WDRA 4IMGA 4PCFA 1ZB5A 3VZXA 2J9ZA 4IQDA 2EPHA 3V3WA 1MNZA 5M17A 5LZLA 4B3LA 4F2TA 1X38A 4Z0SA 3MWCA 1WZMA 4DXXA 1O5XA 4NJGA 3WMBA 4QXIA 3DOPA 2CZVA 2O7SA 4YNGA 4P7QA 1XKJA 1KLZA 5LNWA 3EOLA 1R7AA 5I3IA 1F5ZA 1PUDA 1XLGA 4PTVA 3UJSA 3M0VA 3UCCA 5J04A 1PX3A 4O1FA 1TPC1 2OJPA 1PDYA 3GM8A 2A3AA 4V2XA 2O9OA 3STFA 2BS9A 3PZOA 4JIIX 3TJLA 1IGSA 3I4EA 2XVKA 1FFRA 2CXEA 2DW7A 3MU7A 1A5MC 5AB3A 4RNIA 2FB3A 4H6KA 3UZZA 4ATWA 4PUJA 1ISZA 4PUNA 4DRSA 4EPKA 5FSDC 1MDRA 3B9NA 1NWTA 3REQA 1XG3A 2ZIDA 1N8WA 3THDA 2DIEA 2RUSA 3QZEA 4JQAA 1YNQA 4FHAA 3B9EA 4QAIA 4FR1A 1HUVA 1AQHA 1E4NA 3KS5A 5I3DA 2JKEA 5BZAA 2XWDA 1SFJA 2X8RA 4AEOA 3PC0A 2FKPA 2G96A 3AIBA 1G01A 1KNWA 1OX5A 3DFSA 2BB0A 4ML9A 3MPGA 2YJQA 4MB5A 3O7UA 3K46A 4W8LA 2FMOA 4QE5A 2P8CA 5IDIA 5E6YA 1BYBA 4UXDA 4JEJA 2OVLA 2V9DA 1LTDA 1UP3A 2ZRZA 3SCQA 3UA4A 4ZOBA 3GVWA 4HA4A 3EXRA 2X2GA 4MUZA 4PUDA 4UFLA 5E1QA 4LW7A 3HPFA 3W75A 1MMFA 4GNVA 1K7XA 3S0CA 5JBFA 2W9MA 3WCZA 3UR5A 7XIMA 5AYBA 4O1EA 3KL5A 2C1IA 3SCTA 3OA5A 5GNYA 4A3YA 1G5AA 1FWIC 2DZWA 1H1YA 4MLJA 3O6CA 3NL6A 1V02A 1Z9AA 3LCIA 3V35A 3V4BA 2HK1A 2D2OA 4JYDA 2PF0A 3TXVA 2X1IA 3W38A 1I8JA 2C8NA 1FOBA 1S3TC 4IQJA 3BH4A 1F3EA 4G7EA 5DQPA 4IPNB 3TR2A 3OPSA 1RLCL 4PN2A 4QDWA 5AYXA 4XD4A 4R9XA 5LIUX 3PULA 2C1HA 3OQ8A 4Y9AA 3ONBA 2PDMA 1UH2A 2YLLA 3E2RA 2BHYA 4HNLA 1B3XA 1QBAA 3IIXA 4YWSA 1OYAA 4QLLA 4I6VA 2QKFA 3CM4A 1W6TA 4BQ2A 4JFUA 5JH1A 2BVWA 4M7TA 1WBJA 3IJ9A 1CT5A 2D20A 2IKGA 4S38A 3OOQA 4E4PA 1FWTA 1R6WA 1WDDA 1PO9A 1J8VA 4QG6A 2GVYA 3EDDA 4LBRA 3OG2A 3TYDA 4GUJA 3LRKA 4M82A 1JDDA 4BF5A 3DECA 3H2NA 2QCDA 2GL5A 2RJHA 4XISA 1EIBA 3NQFA 1XIBA 3OBEA 2GWNA 3GKFA 3U2CA 2ZUVA 4BZYA 3KLKA 2Z27A 4C1KA 1WV2A 2X16A 5E9XA 2Q3RA 3S2NA 3ZM8A 1UZ1A 4MDPA 4FOKA 4D6IA 4XO7A 1W54A 1SJDA 1ZBKA 1GTHA 4AZCA 1HJWA 4WOQA 2GGEA 3ZR6A 1J0JA 1A5SA 2C14A 3EDJA 3QV6A 4Q3MA 2XUCA 1SQ7A 1XLMA 3BQ6A 4PULA 2JIEA 4UQ9A 4C6KA 4MJ4A 4LVGA 2PDJA 3ZJ7A 3WQWA 1J9YA 2VX4A 4BF9A 3MCMA 1NEYA 2PU0A 4L4OA 4AFYA 1XH0A 3DHDA 4UFKA 4PC8A 1KV8A 3GDLA 3C56A 4LCQA 1H61A 1BQGA 2YXOA 4ROPA 3UY8A 2CW6A 4XZ9A 1B3VA 3PZGA 4PCPA 3FYYA 3DHPA 3HA1A 4NRRA 2Z6IA 3HG3A 2P53A 2O7QA 3N6HA 2VEIA 1AL8A 3N2OA 3FJLA 4MUPA 4R9OA 3M16A 3WLSA 1KFEA 3BLDA 4N9EA 3KBWA 3G3DA 1PZ0A 4P61A 1UBSA 3TN5A 3MUY1 3GUGA 4K6AA 5HQMA 3MA8A 4G7EB 3B8VA 3TV8A 1VENA 1T96A 4KRZA 4Z1BA 5FF4A 1N8FA 5D9MA 1GOOA 5I02A 3UJRA 1OBAA 4AZIA 4EF8A 2J74A 2PODA 3KBVA 4OZOA 2XINA 5AY7A 4S2BA 2Z0IA 4FIRA 3SRDA 3AMGA 5FJJA 2GJNA 3P81A 3E0LA 1S3HA 5CC7A 2QIIA 3ID7A 3CQKA 3C2VA 2BV9A 3CMFA 4JD4A 1TX2A 4PMZA 3R8RA 5IRPA 2ZCGA 1O1ZA 3PZ9A 1MUMA 2CBVA 1EOKA 2IPFA 2J79A 5HNRA 1HL8A 4EPEC 1VFLA 3UZJA 1XH2A 2GQ8A 4URIA 3DHFA 1O4UA 2Y8UA 4NJHA 4ZO7A 2GSJA 5AECA 1GWJA 2W67A 3G1AA 1PS9A 2AAAA 4K1GA 3MTWA 4EACA 1QK2A 1GOIA 4ZTYA 4TR9A 2WC3A 5GNXA 3A5VA 4J35A 4DBDA 1OABA 5KTLA 3M44A 4S39A 4NAEA 1E5JA 3W1AA 4HPGA 1X97A 5HINA 1E4LA 3KLLA 1XM3A 4AZCB 4Z1CA 8CGTA 3GHUA 1LBFA 2ZZ6A 5EL1A 1WO2A 3G6LA 3OBAA 4EANA 1THFD 2DP3A 1SO3A 2GJPA 3UPBA 2QDDA 2HPIA 2DZXA 2EHHA 4ZL1A 4ACZA 3IGUA 1TMLA 4O4VA 1F8MA 1OK4A 3K4WA 1TVNA 3KZPA 1BVNP 3CL6A 3S2LA 4IM4A 3C2EA 4JKKA 2WZTA 4FLRA 5C71A 1E4IA 2CLMA 3AIUA 4JTFA 4YMZA 2WKJA 3B0VC 1XRFA 1AUSL 3G0XA 1Z89A 4GVHA 1TKKA 2UBPC 1ECQA 2Y2WA 3VGBA 3WLOA 3DG6A 1J5SA 1DWJM 3QHMA 4F48A 1Z8AA 3S6TA 4ALDA 3BCFA 4L56A 1EZ2A 2C3ZA 3SN1A 1LYXA 1EYEA 1AK5A 3OG3A 1H11A 2HNHA 3W01A 2OGYA 4X61A 2A3BA 4E8GA 1V3HA 5C9UA 3RCNA 3GFXA 1LBMA 3M0KA 4DF1A 5T91A 1EP2A 2PC8A 3INPA 4GUGA 1KM6A 4I9MA 4JZ5A 1GKPA 2BMBA 3M0ZA 4H8UA 4LBSA 1A80A 1CENA 4GXWA 1BHGA 5D9PA 4ROQA 1HG3A 3PJUA 2NT0A 3M6DA 3WQEA 1PB0A 1U83A 1W91A 4F3HA 4LT9A 4PUWA 4WCJA 2GOKA 1S5MA 1BPLB 2BOEX 1DTUA 3VGDA 4YVPA 4JQ2A 3MMUA 2UZ9A 1RZMA 3WUGA 1H5VA 1TO3A 3SY5A 3PBUA 3QQ1A 1ONWA 3GDBA 4FLOA 3OVGA 3GXPA 2ZWYA 3KTSA 1MYRA 3SRHA 1I6NA 4ORMA 3HFTA 1OCNA 1CNVA 1US2A 4DYKA 1VFMA 2QGYA 1YIXA 1HP5A 4PODA 3DFNA 1BFNA 3WFLA 1AW1A 2BY0A 3A4JA 4C1LA 3NDZA 1MQPA 3RG6A 5HPCA 3GNRA 1HVXA 3A64A 3MUXA 2BXVA 1UWIA 4PMJA 3RR4A 3ZMRA 1EYWA 4WJEA 3MYOA 4GUIA 2XZ7A 1JPKA 1OINA 3PZTA 4MKVA 2I9EA 5CG0A 1NAL1 3BMXA 4FNQA 1UWTA 2W3ZA 8TIMA 3LXBA 2V67A 3ZXWA 1GYLA 2QCMA 4AQLA 1QNOA 1BLIA 3L4XA 3MO4A 4TX8A 2QPXA 1BWVA 2ZYFA 5DXXA 1TR1A 2ZTJA 2ONEA 4HIBA 2WJZA 3SN4A 3BQ5A 2YLAA 4HHMA 5AC7A 2EO7A 3IGHX 3PPHA 4DUVA 2PE4A 2VP8A 1VEPA 4PB3A 3G8RA 3MHFA 2R1KA 3B97A 2ZZ4A 1ZP4A 5DMLA 1V6TA 4DY1A 5REQA 4Z2GA 1SMAA 2HMCA 2WHMA 4TQTA 2FHBA 3VIMA 1Y5WA 1JZ4A 5ABHA 1YBQA 2PGRA 4R5EA 4AHQA 2WVUA 3EOOA 3GBEA 5BOOA 4K8EA 1PHQA 1JUBA 1P6BA 4W86A 1IEQA 2ZX7A 4DWSA 3FV9A 4XBJA 3WBXA 4HP5A 1RQHA 2ATMA 4GD0A 5CJMA 1MW0A 4NZ4A 3SEPA 5KITA 3OVPA 1K03A 4H9ZA 4L9ZA 1JZ2A 1OFQA 1UOZA 1VF8A 3QGVA 1KXQA 4FNSA 4WXZA 2WSRA 3A9IA 3WNLA 5D38A 4L6DA 1W2VA 1WXYA 1BVWA 1T41A 5EFDA 1JDAA 4CD7A 1XI3A 4QS6A 7REQB 3NPWA 5JIWA 3N2CA 1EF3A 2O92A 2DQXA 4N2YA 1GG1A 1ZCOA 2PGFA 3U5YA 1W2PA 3PK7A 3W1XA 4ZCWA 4AC1X 1FKXA 3NJ3A 3UG3A 1D8CA 3K13A 3DYMA 3R89A 1UD6A 3WF1A 4UFJA 1E5NA 1DHPA 4JN8A 4ZQCA 4LQ1A 2FZMA 3K8LA 4XAPA 3UG5A 2CU0A 3B0PA 4DZIA 2OOFA 3GU9A 1S2VA 3QPEA 3BOFA 5AZ1A 3AOFA 3C61A 2NX3A 1EH9A 1JR1A 5J5DA 1CCWB 1UPPA 4HOXA 5CSRA 2FZBA 3T2PA 1T99A 4AW7A 4X22A 4US5A 4Q4RA 1QCWA 3WNPA 4R34A 4WKAA 5I23A 1UJPA 4IHCA 4HMNA 2DIKA 5F4XA 1M65A 3OYZA 3MP5A 1ENUA 2OGJA 1R3WA 4JIRA 2PDBA 1BG9A 3CAWA 3IUIA 3WYZA 2EPKX 3VKKA 2V82A 4LY8A 4GA8A 4OV4A 4LX4A 3ITVA 5REQB 4PTXA 1SGJA 3WZ0E 2HROA 3LGEA 3TTOA 1E6QM 4RLIA 3W82A 5K7JA 3PPCA 3TONA 5JXQA 1H2JA 4DEFA 3P80A 4UTWC 4Q8TA 4YYFA 5HWJA 4GINA 5DANA 4KCVA 3A6OA 1DE5A 3THQA 5FJPA 3NQAA 1NWRA 4O53A 3TJ4A 1FVPA 3LYEA 4CQAA 1EP1A 4FB7A 1JCYA 1IXQA 2J8TA 3AQUA 3LHUA 3TLLA 4ZQPA 2A85A 4P7OA 3S46A 1HP4A 4LJ3A 4C6PA 3GDRA 1FTXA 1FHUA 1A5NC 3MDUA 2OODA 5HNNA 3EOUA 3NFUA 1YXDA 5AVNA 4FK9A 4O8AA 4US6A 1LLZA 1MEHA 3BAWA 4MB3A 1YE6A 2BVYA 5AHIA 3FAXA 3VD7A 4AIEA 3AHZA 3LSCA 3TUUA 1SR9A 4A4AA 1RALA 2DGAA 1BVZA 4HK6A 3L5MA 3SCSA 1CGUA 1VFUA 3PUGA 1CW2A 3LI0A 1G4EA 1UR1A 2Y61A 2IPWA 4TV5A 3N1AA 3W22A 3S5ZA 1AZ1A 4WGHA 3NA8A 2QJIA 2I1OA 3VMPA 3GNDA 3D0CA 3QYSA 1QUMA 1P1XA 4X60A 4I8DA 3UERA 3W1QA 3MMDA 4UIOA 3HGRA 4M7SA 2YBUA 3CQIA 3W2LA 3IRSA 3NOEA 4Y8EA 1PX4A 2DVXA 4IICA 1VRDA 1QU4A 1I1WA 1X6LA 3VVGA 1F7BA 4FF5A 2D3NA 3O8AA 3BAYA 4LRSA 4QJ3B 3H54A 1XUZA 3CV6A 4HJWA 3MSRA 3ARVA 3WL0A 4MIMA 2GQAA 1DJGA 2J7GA 3T8LA 1QNPA 4KRTA 1KCZA 4XKMA 5C9XA 4GE8A 4E0CA 2Q3OA 4PRRA 3OZOA 2VRQA 4X0VA 1JPHA 4LAOA 1CGXA 3E1F1 1MZHA 2IXVA 2YW3A 3O0FA 4HMCA 4DO6A 1TYGA 1VJSA 3W88A 3LNPA 5FF7A 3KVKA 5H8UA 2PUZA 2REQA 3V5CA 2BG5A 5TQLA 2CYGA 2V3EA 4NG3A 2QV5A 5FF3A 1K8ZA 4PMYA 2ZTKA 2XH7A 3EOEA 4L7ZA 3U8GA 1Q6FA 3GHSA 4IQLA 2VDIA 5HATA 3KRUA 4LS2A 3DC8A 2YCLB 2DQWA 1R9XA 1L8PA 1XYCA 2HQAA 4HU0A 1EFZA 3SZ8A 2WZHA 5I3FA 1NSJA 1QNRA 5FJOA 3VIJA 4Y90A 1K77A 4NSBA 2HS6A 3F4CA 1QT1A 4K2SA 3EOSA 1ELSA 2A7NA 3LDVA 4BI5A 3UFYA 2ZX5A 4YCOA 3B8IA 4CVUA 2JE8A 4K68A 4JTRA 1VEOA 4XZLX 1E56A 3BPWA 3G1VA 3ALGA 1TWZA 5EU9A 2VR2A 3CZGA 1GZ1A 5CBIA 3L7RA 3DI0A 1G4SA 1SZRA 2V3DA 1VZWA 3W7EA 1QBBA 3I3DA 5HOSA 2RAGA 4HN4A 1KKRA 3TC3A 4AF0A 3IJQA 4QDPA 3VIFA 1TA3A 3VIOA 4KERA 1V79A 3NXFA 3BJTA 2OZ8A 2MNRA 3WMCA 4DJED 4GJJA 4D6HA 4HNTA 3FYPA 1V6WA 3DFTA 4GQBA 3T81A 1UD4A 4ZENA 1HO4A 1RH9A 3H6OA 3UYIA 3A4WA 5FESA 1TJPA 2DJLA 4XQ6A 1FDZA 1AD4A 4MOZA 3TVAA 1RBOB 5BXPA 1Q5MA 3THAA 3R6IA 1IQ8A 1VKFA 3PTQA 5LGXA 2X7WA 4WSJA 3CV1A 2VDHA 3PNZA 4O12A 1KO0A 1E9YB 2WYSA 3USBA 4LOCA 1TVLA 1XLFA 2REQB 3MDWA 4JQ4A 4PMQA 4YTRA 3UG4A 3GAKA 4RJEA 1KCLA 1M3UA 1O1HA 1UH3A 5GNZA 3URBA 2IMRA 4QAWA 4DNMA 1ONEA 3LK6A 1JXKA 1YTEA 5ABGA 1SFSA 2ON3A 4V15A 2E6AA 4LTSA 2NXIA 1XWYA 3M5ZA 5D2YA 3C0JA 4A8IA 3MSDA 1JD7A 3C6CA 3WG6A 4QCFA 4CKQA 3ZVHA 4H6RA 3V18A 1W37A 3R5EA 1SJBA 3BCJA 5D4YA 1HTIA 3LZ5A 1KM3A 1U1JA 1J6PA 3QOMA 5K2ZA 3UPWA 4RDWA 3R10A 1MI3A 3QN3A 4NI8A 3WLPA 1PWMA 3U9IA 5H6HA 3GSMA 1JF6A 3QF0A 3OIHA 3WH9A 5BMWA 5D2VA 4R85A 2OO6A 3GR7A 3WNOA 2HXUA 3KCLA 3AFBA 3LEPA 3ARRA 1IT7A 5GQBA 2AMGA 3FAWA 4NI3A 1BTMA 2NUWA 3WK1A 4AF0B 4F8XA 1Q6DA 2XZ9A 3GH4A 1FWJC 4E4FA 4YWIA 1CXFA 1JPIA 2I16A 1C7SA 4R7OA 4GHRA 4ZGYA 2BZNA 1BXCA 4Q33A 1JI2A 4QDMA 3WL1A 4ZZ9A 3VCNA 4HK5A 3ZT5A 1ICSA 4XBKA 1VCFA 4IIEA 3GTFA 2BX7A 4XIAA 5BXTA 2J7BA 3LV6A 3WMSA 1RSCA 3DN5A 3NO3A 1J18A 1LOSA 3WDJA 1A5CA 1NOFA 5TF0A 1OGGA 3ZFHA 1OK6A 5LIYX 4HD5A 3T4WA 2PCQA 1S5WA 2I14A 3I7RA 3W81A 4Z08A 1GPWA 3CHFA 4CCEA 3HZ3A 2FYMA 4TO8A 2DVTA 4YHEA 1UQYA 2PWHA 5C9ZA 2XSBA 3FJ6A 4CU7A 5JBEA 2DT0A 3WQCA 1D3GA 2WSQA 3EEGA 4AZ6A 1BYAA 4OGZA 3TDFA 4CNOA 2PURA 3ITLA 3SJ3A 4D8LA 4TUFA 2Z2UA 3M64A 1UUMA 4H1ZA 5CJ5A 3CZLA 3LSBA 3M7SA 1E3XA 1R85A 4WDXA 5A6KA 3NG3A 1FBAA 2NSXA 2XIMA 3N3TA 3NQ6A 5HBFA 1POKA 1R46A 3WQFA 4OHQA 4HNVA 2WVVA 3LI1A 4RX0A 2XVNA 5EGRA 5F2LA 1QWGA 4GOAA 3RLHA 1XIFA 1KRBC 4WIWA 4QJ5B 2QUVA 4ADUA 5HNUA 3OEXA 4AZBA 3QSTA 1O60A 5GJNA 4GK8A 2C0HA 1CXIA 3K30A 1J4EA 7ENLA 1FY6A 4H7VA 3FGCB 2Y6ZA 2PI6A 2E68A 3C8NA 3NQ8A 1Z7AA 3L4TA 2Q8ZA 4M1RA 1EIXA 1S2UA 5LNVA 3ME3A 2AL2A 1IXOA 4JFVA 4ZO8A 1J96A 1IR2A 3RDKA 4LXFA 3IJIA 2FPYA 4UTWA 1EPVA 1GQLA 4YCPA 4KFNA 1LUCA 4JR5A 1B90A 3CHEA 3W73A 3T08A 1KB3A 2ZBTA 2AMXA 1H3GA 3GXFA 4PUMA 2WHLA 1F07A 3IVSA 1SZFA 3E2SA 3KFTA 3M4HA 4CQCA 2JEQA 3HN3A 3LGGA 5CZSA 3H24A 3N4AA 1VH7A 2XTKA 3FSTA 1Q13A 2E8YA 3UG8A 3DDMA 5BU6A 3LMZA 5DXYA 4IG2A 1XYLA 2CFFA 2VQUA 1JZ8A 1K02A 4XWUA 1FWHC 1T7LA 5CZ0A 4E38A 4ADTA 4Q8OA 4FX8A 1E43A 1TTJA 3G8EA 4EK7A 1QI2A 3S1VA 3TAOA 3SN0A 3KDNA 4KWWA 2V3GA 3LXCA 5I6SA 2CZDA 3ZO9A 3NVDA 2J24A 3E0VA 3QY6A 1JIBA 3R11A 4G1KA 3CZ8A 4XTIA 3RIKA 2VVNA 4AIUA 4JCLA 4PFHA 2H6RA 4REQA 2EG7A 2Y7DA 4D8ZA 4HKPA 2R6OA 1WDPA 3N04A 3ZJ6A 3ZSTA 2J88A 2IKIA 3IPWA 5DF0A 2HDJA 4NXKA 1H62A 3NL3A 5CAKA 1V3KA 2VENA 4JFTA 3NGJA 1L2UA 1E72M 2X1RA 3MUAA 3MZNA 3LOTA 1VBHA 5ABEA 1FCVA 2WVVB 4J2PA 2GVLA 1GVSA 1NF0A 1VYSX 5DELA 3M0XA 3TSBA 3PZNA 3CZEA 1J6OA 4R7JA 1IEWA 3HPSA 3T0CA 3JR2A 5HR6A 1YW1A 2PTZA 1CTNA 2BTMA 2VUNA 1E1FA 5I7GA 4LB4A 4GBDA 4JTHA 1FWAC 1HL9A 2QMKA 1Q7ZA 1RQBA 4ERAA 1EJ7L 3EPMA 4AIOA 1C90A 3EWYA 4AYGA 4O13A 2CERA 2PDQA 2YFOA 4B16A 2D0FA 5CSYA 4QJ1A 1OC5A 1TPUA 1XYFA 2ZVRA 3VPLA 4O28A 3ZYZA 2D0GA 5IBXC 2Q8XA 1ONRA 1HJSA 4JDYA 1RJPA 5DFAA 1NOUA 1HGWA 4ZE5A 4HNCA 3VDBA 5C8BB 3SSJA 1GW1A 4IJCA 3TROA 4JPGA 1EXBA 3BOLA 4KCWA 4L4MA 2Z1KA 5I09A 1RP9A 4IG2B 4J1OA 4GACA 1UWAA 3BGJA 1DPMA 2H3DA 4A8NA 1F74A 4K8HA 2OSYA 4ZVJA 2V5KA 1QHZA 3FVMA 1H09A 4LU0A 3W00A 1US0A 5FACA 3GDMA 2X40A 1K9EA 2J25A 1HN1A 5CLWA 3RX4A 1E9IA 3MYPA 3WJZA 4PMRA 3FKKA 4DZAA 1HL2A 1FX6A 2DSVA 3URAA 5A6BD 2WC7A 4GIEA 4AD0A 1YXYA 3EPOA 3TNOA 2YYUA 2QDHA 1LP6A 5F2MA 2F9RA 4Z42C 1DKWA 2VFHA 1UR9A 3T44A 3SY1A 2YL6A 3GHRA 4H9YA 4P8VA 4CQDA 4E8CA 3J7HA 4J3ZA 4HT3A 5A1AA 1T8XA 3W6LA 3LNMA 1P48A 4LUIA 2Y62A 1QASA 3SQSA 5CSSA 2GPTA 2WMGA 3XIMA 2PGWA 2FZ9A 5MKGA 1XICA 4JTEA 1L6SA 2A2IA 3PBWA 5A95A 3UETA 2E67A 2E25A 3EKZA 3WBAA 3TYEA 4DLMA 1PEZA 3IGSA 4D71A 1V6UA 3HB9A 5K4XA 2GDQA 2XFFA 3NURA 1PZ2A 3IAQA 1Q3NA 2XISA 1DWIM 3W76A 2EAWA 3BG3A 5C9WA 4Y6GA 1Y5VA 4JTDA 4HPXA 4ZB5A 4PH6A 2Z2BA 3MI6A 1XRVA 1OFOA 1B57A 2FB2A 4NU7A 3VOIA 4CCCA 6PTDA 3G2GA 5FSEC 1EC8A 4FX6M 3CWNA 4HBKA 3TYCA 2YCIX 2AAMA 1OY0A 5HANA 3BGAA 3OLIA 1EEPA 4DBWA 2P0OA 2Z1SA 4B3KA 4AHOA 4FXSA 4I90A 4OOUA 5HQLA 4PSRA 1K4GA 5LGZA 9CGTA 4CEUC 1NOWA 2QT3A 3QV8A 3VM5A 1HJUA 4DI8A 2ACQA 2Y85A 4OFCA 1EB3A 4C6LA 1XRTA 5AVHA 5AYYA 3W70A 4AD5A 1TPFA 3DESA 4NX0A 4H3DA 4LC8A 3STCA 4DJFA 2V2CA 3ARWA 3U6WA 2O4MA 2WV8A 4C6OA 3GKAA 3FJ4A 1VBJA 3AICA 4JTSA 2D3LA 1W1YA 1YQ2A 4LUYA 3EB4A 3RGTA 3T05A 3GYEA 4B3ZA 3GO2A 4W8AA 3ANUA 3F5LA 4XVEA 4Y7EA 3E0IA 5DMMA 2PZNA 4I3GA 2EEXA 3W1MA 4KFOA 4L6HA 3WF0A 1OF6A 5E09A 2L5HA 2FH6A 3VNLA 4GI4A 4D6EA 5D04C 4GMEA 1J0YA 5C7HA 1YADA 2NWSA 1XW8A 1PXGA 1GHSA 4ML4A 1W1TA 3PY2A 2XIQA 1W1PA 3NDOA 1B4KA 1VPYA 3ARPA 3V16A 3LRLA 3GG0A 2J47A 1H0IA 1UD2A 1RQEA 4UQEA 4AISA 3AZTA 1EF2A 2XJ7A 3AWOA 3T07A 3AC0A 1JFHA 1FWNA 2ZUSA 2DU2A 1ZENA 4ES4A 4JHZA 1B3WA 3AZSA 1LOLA 2E5DA 1ZBWA 3THCA 3BUVA 4QCEA 4KMQA 4W5UA 2HVNA 1XLBA 4DBUA 3VD5A 1XLKA 3WEMA 1ML1A 1JUEA 2XG9A 4MJ2A 1W31A 1PIGA 1XINA 1YXCA 1FXQA 3MHUA 3P74A 4MHBA 3P67A 2Y63A 4MADA 3UCDA 1FH8A 1NWUA 1IIGA 2WMIA 3E38A 3DEQA 3BSMA 1B4EA 4DAFA 2V6AA 4HZ7A 3QV9A 3OLGA 4B9ZA 2W91A 3BK0A 1FP8A 3SM0A 3W7OA 6ALDA 1V93A 1UR4A 3G1DA 4JS3A 1LG1A 4ATLA 4K1WA 2OX4A 1EOMA 3RJXA 4EXQA 4AD3A 1REQA 3VZYA 1QDSA 2E6YA 4DJDA 2A7RA 3VZZA 2A3CA 2YSWA 1TFVA 3DKLA 1C9DA 2J7DA 1AG1O 3R43A 3FN9A 4K36A 2INZA 4C7FA 2QCCA 3I4KA 3LQLA 3HMJG 1DV7A 2WB5A 2D2HA 3GC4A 3UWQA 3QKZA 1LORA 1OCBA 5CPQA 4W9TA 5CZTA 4LFYA 3AAMA 2WMHA 4DN1A 3R79A 3BLIA 1XIIA 4Y9MA 3WY1A 4CD6A 3HPZA 4INFA 5DY2A 5FEZA 5FJTA 3W28A 1Q8AA 4IIFA 1TWSA 5CGQA 5EA9A 3B03A 2PTYA 4RKAA 3OQEA 1KKOA 1K6AA 2BFGA 3H4GA 1FKWA 4QFUA 1CI1A 1XC6A 3QQ0A 4MNMA 1KR1A 2I5GA 3TQKA 4S3KA 3VDGA 4P5UA 3GK0A 3VGGA 4I7WA 3VO0A 3L2MA 4R88A 3BL3A 4LYQA 4QEHA 1M41A 4MZ1A 2GK1A 2WAGA 3RR1A 1P4CA 3CASA 4KF1A 4QS5A 4G6CA 1ZJBA 4PMXA 3KVMA 1CGYA 2E3ZA 2ZC1A 3TN6A 5FOOA 4CLMA 1MXSA 2VZTA 4R33A 1B5TA 1T8QA 5D33A 2C1GA 3LPGA 2SFPA 4ZEPA 3EB3A 1IF2A 4NVTA 3TCSA 1TJ1A 4L64A 3BXWA 3U7VA 4ECLA 4S2CA 1D2KA 5C6MA 1PIFA 1UWSA 4H2HA 3HQ1A 4JTIA 2G4FA 1NVMA 5LIKX 1NFBA 4L9XA 4XZMX 3WQDA 2CKSA 3TYZA 3B04A 4IMFA 2BGQA 2A6LA 2VZOA 4ZOEA 4QX4A 4MPKA 2XVLA 4V1XA 5ABFA 3CHDA 4PMNA 2DZUA 4U2ZA 7TAAA 2AOSA 4JTLA 2WSKA 3QZ6A 1VS1A 4FNRA 3VABA 1L9WA 4KEUA 4OECA 3M0IA 4U2YA 4QG9A 4C90A 1UA3A 1V0KA 4E2OA 3TIMA 3CPUA 1TJRA 2EQDA 2YB4A 4QLJA 3M07A 4AHPA 1P0DA 3PF3A 1B1YA 1XKYA 2UY2A 4OUIA 3CXOA 1FCQA 3UVIA 5F1UA 3LTSA