3O63A

Crystal structure of thiamin phosphate synthase from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
222
structure length
214
Chain Sequence
HMHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPVNVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTAPGLGLVRVAAELDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thiamine-phosphate pyrophosphorylase
publication title Crystal Structure and Identification of Potential Inhibitor Compounds for Mycobacterium tuberculosis Thiamin Phosphate Synthase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 214
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o63A00
1FY6A 4N9DA 2X30A 2FLIA 3BGJA 2FDSA 3W87A 5LSMA 5EL1A 3BG9A 1DOSA 1WV2A 3ATYA 4UTTC 3UY8A 3WJXA 2C18A 3A22A 3B0PA 4LOCA 1QCWA 2ZZ5A 1TPC1 3H53A 4A29A 1FCVA 1TYGA 3GXPA 1ONRA 5K4XA 2V2DA 3TIMA 1SUXA 3W07A 5F4SA 3KVJA 3UXDA 1A53A 4FB7A 5C6MA 2QCLA 1M7PA 3E96A 2EKCA 4LS2A 5G1TA 2E68A 5IBXC 4GJ1A 3QRHA 4RV8A 3IRDA 3TQVA 3DGRA 3NQ6A 2E5CA 1FDZA 4O12A 1F2JA 3HG4A 4NXKA 1YYAA 4O57A 3G1HA 1OX5A 3I7SA 3LLDA 3NDOA 2D73A 5AHFA 4A21A 2BTMA 3S8HA 1A5AA 1ML1A 3PSVA 3W75A 3GKAA 4O11A 3W7GA 3PBUA 1F5ZA 3TQ0A 1EUNA 1M5WA 1ZAJA 4K37A 1RPXA 4P2VA 5D2WA 5HJLA 1EA0A 2GJNA 1XL9A 3G8EA 3M9YA 3LBCA 4CNOA 2YFNA 4KFNA 4Z0JA 4QM1A 3EWYA 3O06A 1J2WA 3GIYA 2BX7A 5HMSA 4YCOA 2NXIA 5CPNA 4S1FA 1KM3A 4ADTA 5F2LA 3BW3A 2DZPA 3G0UA 2E6YA 4UFLA 3TFCA 2R91A 3QYQA 3W1TA 1F74A 1ADOA 3LHVA 4OV4A 2ISSA 2C6QA 4LV4A 2C13A 2V0TA 1FWTA 3IGUA 2F84A 3L65A 1G69A 4FIRA 1BKSA 3O6YX 3LHWA 5D37A 4UTLA 4LRTA 5IM51 1ZNNA 1ZCOA 5FEWA 3SGZA 2GOUA 3W76A 1VPXA 4OU1A 1M7OA 1D3GA 4CCCA 1AK5A 2VEPA 3R5EA 5I3KA 4K7VA 2PC4A 5D04C 1VCVA 5MHBA 4ML9A 1FCBA 5HINA 1A50A 1OFQA 2R8WA 3JS3A 3TQKA 4E2BA 3MHGA 2J9ZA 4DF0A 1UBSA 2VEKA 4E0CA 1LTDA 4AXKA 1TTPA 5D2VA 2CLIA 4UTKA 1GOXA 1GTEA 2C3ZA 3GKFA 3W7KA 4DBDA 3B05A 1L9WA 3DENA 3H54A 3K30A 3NQVA 4I7UA 1H7OA 3LHTA 3T7VA 1R47A 4JX5A 5D03A 2NX9A 3G1YA 3RLVA 1MEHA 4GWEA 3BVJA 5HUOA 1OABA 3FKRA 4JY8A 2PURA 5DCDA 4AB4A 3DKLA 5CSRA 2A0NA 1CX9A 4ZZ9A 2VC6A 5BW6A 3G8RA 3S0CA 4UFMA 2FTPA 3WJWA 4QNEA 4RR4A 4NJKA 4OBTA 4PC8A 3MO7A 4AWSA 4A3UA 4GUFA 5GVJA 2PRLA 1LORA 2VFHA 3HG3A 1DJQA 5DBUA 5DELA 2ZRZA 3TMQA 3CEPA 1VQTA 1ZY9A 4WOZA 1KFEA 3L21A 3DZ1A 3OHIA 4N4PA 4R7JA 1LBMA 1C8VA 1SZNA 3MJYA 3LRKA 1QFEA 4IPIA 3M47A 4Y96A 2GQ9A 1D9EA 1TV7A 3N9RA 1QO5A 1SO6A 3GAYA 4RXGA 1SFLA 3O63A 2A85A 1AL8A 1IXNA 3I7QA 5E1QA 2WNQA 3RU6A 4IQLA 4P61A 4XQ6A 5FI8A 4H4IA 4HT3A 4JX6A 4QQ3A 3MWAA 1YDOA 4LUIA 1RD5A 4TX9A 5KTLA 1QNVA 3UWWA 5G1YA 2ZRYA 1H1YA 3EB2A 4Q33A 3E9AA 1FDYA 4JD4A 1PIIA 1W56A 1LOSA 2CFFA 4YWIA 1ZHAA 4EOUA 2ZDRA 3W2LA 5CGQA 4JTSA 4JDBA 3G0XA 4O0ZA 1SW7A 3EKZA 2FPVA 3NVTA 4WD0A 1I2QA 4FX7A 4BI6A 3EXTA 3C2RA 1LZOA 4KWVA 3O6DA 1NF7A 2BLEA 4JTHA 2OT0A 5HR7A 4R34A 4RX0A 5K9DA 3GDKA 3DFNA 3HG5A 2V81A 1L6YA 4AVFA 1EWEA 4Q4KA 4RJEA 1Z44A 4IX0A 2BXVA 1WA3A 3W2UA 4MYXA 1NSJA 3TDFA 1KM1A 3EKLA 3VKJA 4DO5A 2QAPA 1R2RA 4TMBA 1JQXA 2ZRUA 1A5CA 4H3DA 3L0KA 4JICA 3SIZA 4MYAA 4JTGA 5LKYA 3IIXA 1IXOA 4FIQA 1FX6A 5J5RA 1Q6QA 2VXNA 3N19B 1HUVA 3W7MA 3B8DA 4JX4A 3N2XA 1GTHA 3RNDA 4X3ZA 3T78A 3NQFA 4NX5A 1R2SA 2FPYA 3EX2A 2YPIA 4IJBA 1KV8A 2X1SA 4N9CA 4O10A 4GNJA 2Y7DA 3LCLA 4BR1A 4N9BA 3P74A 3SFKA 3NPWA 3EWZA 1AW1A 4XWUA 4TIMA 1HG3A 4YMZA 3N2MA 1W3TA 3TKFA 1FCQA 7TIMA 4GUIA 5D33A 4NNAA 4ZQPA 1F7BA 6TIMA 4QIUA 3DAQA 1I2PA 1Y0EA 1LBLA 4LVBA 4UCGA 1JRCA 2NX1A 4ZQCA 2FQIA 3S1WA 3CQ0A 3DXIA 1FWNA 4H6KA 1OFBA 4O28A 5EY5A 2J9XA 3TA6A 2B7PA 5BRBA 4JYDA 1Q45A 2A4AA 3S6DA 5AC7A 1T0OA 3LTSA 2Y7EA 3PVFA 3LTPA 2I1OA 3ELFA 3BG3A 1OFPA 1I8JA 1U83A 3P60A 3W1XA 4X9SA 3JRKA 3MUXA 2FB2A 2A2IA 1QO2A 1PVNA 5D2YA 5LHEA 1OX6A 5LNSA 1OHLA 4HSOA 1SO5A 2X1TA 1FWWA 4K36A 3GXTA 3ABSA 4XKYA 5F1VA 1I2OA 2DZVA 2TYSA 3NL6A 4TU1A 3BLFA 2I9EA 3KRSA 2X2GA 1MZHA 1RVGA 1WOAA 3P8JA 1OYBA 1W0MA 4WY0A 5C5YA 3HF3A 4O52A 1Q6LA 5I3FA 2W79A 4PCFA 1KFKA 4PH6A 2A1YA 1YXCA 3TAKA 2HSAA 3W7QA 3HOJA 3NL3A 3LCIA 3LDVA 4JY9A 1GJPA 1I2RA 1OFEA 1WDWA 2F7FA 4PTNA 3ZR4A 2VKZG 5FF4A 4AF0A 1TPH1 1D3HA 1KTCA 2Y61A 4GUGA 4MY8A 2CWNA 2NUXA 3NG3A 2ABAA 3LCXA 3TUUA 4JTJA 3PBVA 2OMAA 2QUUA 3W74A 3W7HA 3PR2A 1TPUA 4MVAA 1OVDA 1OYCA 4K8HA 4UFHA 3TE9A 3CU2A 2Q3RA 4MFDA 4JS3A 4RZ4A 3L68A 4UTTA 4UFJA 3BW2A 2Y63A 3ABQA 4NX0A 4CQ9A 3UWUA 1THFD 1BEUA 1GVRA 2PRMA 2G5WA 4IPJA 2ZZ2A 3U6WA 1MSSA 2XN2A 3SECA 1DQXA 1UCWA 1F73A 2HMCA 1TB3A 2ZBTA 3NQ2A 2NXHA 2QCDA 3W1AA 4LS0A 1O4UA 1T96A 3W7RA 2PCQA 1KM6A 3NM3A 1YPIA 3TCEA 2E6DA 4LV9A 4M19A 5IBXA 1HO4A 1B3OA 2E5BA 3JR2A 1LP6A 4FX6M 4N6EA 2GVLA 5D09A 2ZRWA 1YXDA 1JUBA 1TO3A 4RK8A 1H5YA 2VELA 5A8GA 2QF7A 3PC0A 2EHHA 4MOZA 5I3JA 3CB8A 2ZA1A 4JTLA 2PE4A 4RLIA 4HN4A 1W3NA 4BF9A 3MI3A 3NZ1A 1S3HA 1EPXA 2ZQ0A 1ICPA 1O5XA 5AYXA 3CWNA 2V5LA 1TPFA 1H60A 3Q37A 1YDNA 3EWWA 5FEZA 3LCGA 3CIWA 3N3MA 4J9JA 5I3HA 3NQGA 2Z1BA 4K6AA 2ZCGA 3A9IA 1DKWA 1T8XA 3PUOA 1OFOA 3TXVA 3PUDA 1GYLA 4LVFA 1WX0A 2JGYA 5LNVA 3ABRA 3STCA 2ATSA 3QW4B 4LS1A 4LY8A 2Q8LA 1OF6A 2FFCA 5HWMA 1LRTA 3WJZA 3VE9A 3LCHA 2V82A 4IXXA 1LLWA 5F1UA 2B7OA 3LBMA 3LV5A 2H3DA 3PWAA 4NT0A 3RLUA 3TSBA 2W0UA 3OA3A 4WQ6A 3DFQA 1DL3A 3GR7A 3KXQA 1XBZA 5T26A 4E2DA 3E0IA 4RCXA 1I45A 2QCCA 3W3OA 3T4CA 3N73A 5D02A 3KVKA 1T99A 1XDMA 4TO8A 4FNTA 5AHEA 2C16A 5DLCA 3QSTA 2RFGA 3W72A 4FHAA 2ALDA 4FX8A 3L66A 2VENA 1C29A 1XDLA 2J24A 3THAA 2EGZA 4JIPA 2WPBA 4POCA 4ZQNA 2H3BA 1MEIA 2ZFAA 1GYNA 3NA8A 5AHNA 3HB9A 2XN1A 3KVLA 3STGA 1ZAHA 3EXRA 5FF3A 3P5ZA 1RV8A 1OF8A 1ZENA 4N2YA 3LRMA 3S1VA 1EIXA 4WOQA 4LVAA 2CZEA 4UMAA 3S5ZA 3PSWA 2YCEA 3B4UA 2X1RA 4HPJA 3UQNA 5J5DA 5AOUA 1KW1A 3W1MA 5FF7A 3DFOA 3TSMA 4O18A 1FQ0A 1TJRA 2ISWA 5G2IA 1G4EA 3W88A 3C6CA 5FF0A 5FEPA 2PRHA 4L4LA 1HFBA 1VCGA 1IXPA 2HTMA 1AW5A 1XUZA 2NWSA 5D30A 5HUPA 5FEXA 3USBA 3N9SA 4A2SA 4BFAA 3G3MA 2FB3A 2WSYA 2Q8ZA 1TRIA 3G1DA 4RKAA 1WOBA 1UASA 2BWGA 3GX9A 3VFLA 1YDVA 3NQMA 3WK0A 5AFDA 4N4QA 3PBYA 4OWGA 1KBJA 1N8FA 3V75A 3VCRA 1O95A 1H7RA 4A22A 3LI0A 1B4KA 3DKJA 1ZFJA 2YSWA 4K39A 1KM0A 5H2ZA 4BK9A 5AHIA 3W2JA 3STEA 3NXFA 2V5BA 3QQ1A 2H90A 2ZA3A 4XBKA 1OK4A 3WJSA 1JCLA 4Y6GA 3TW6A 4ZQOA 1GZGA 1YPFA 4HHPA 5I3IA 4BI7A 3TC6A 2ZYFA 2DZTA 4NVTA 1W5QA 4AWUA 1YADA 3O6CA 4MY1A 2TRSA 2YGYA 2C1HA 2G97A 2OZ0A 3PF3A 1IIGA 5AB3A 3LOTA 2GQAA 5LGZA 1TQJA 1G7VA 3P67A 3UD6A 2QAFA 3E02A 1JUEA 2QUTA 2C19A 4NJIA 3GLCA 3V1PA 1KA9F 3KOFA 1TTIA 1VCFA 2NUYA 3TX9A 4MZYA 3CC1A 1UUOA 2DU2A 4IGHA 8TIMA 3HMJG 3S1UA 3EX3A 5DY3A 1SU5A 2BZNA 2QEZA 3W7JA 1F05A 1OJXA 2NLIA 2Z2UA 2YYTA 3S5NA 3M41A 2CLLA 3LXCA 1JRBA 1RR2A 1QPNA 2B0MA 2WO5A 4K7YA 5D38A 4UTIA 3TSDA 4BWLC 1P4CA 3THQA 3GB6A 4CLMA 1NAL1 2J6XA 3BGGA 1DJNA 2TSYA 4ORIA 5BNKA 2QJHA 3O15A 1K03A 5DCEA 5AC8A 4O1AA 3OEXA 1P0KA 4YXGA 5AYZA 2DZXA 2B7QA 1TSIA 3QF0A 2A21A 1H51A 2AAMA 1LM1A 3G1XA 4IOTA 1HO1A 4NJJA 2ZZ3A 3Q94A 4OT7A 3HGSA 1QOPA 4UTWA 4OV9A 1G4PA 3QMTA 4CNPA 3GDRA 3FS2A 4KFOA 3O8AA 1CI1A 1ICSA 1IF2A 5DCBA 4DF2A 2DZWA 1JR1A 3BPWA 3TC7A 3L0NA 3A23A 2Z6IA 3CT7A 3WJYA 1EB3A 1MO0A 2P10A 4HIBA 1KLZA 5K3VA 1GT8A 4GE8A 2EAWA 1YXYA 1OFDA 3G24A 5L6UA 2OX1A 1K8YA 1F76A 3EWUA 4UXDA 2GJLA 1ICQA 2E6FA 1KV5A 4XBSA 4DBEA 3W84A 3NPUA 2VOMA 4W9TA 1PHQA 1UUMA 3MHFA 5EKYA 4JNMA 1Z48A 3L5LA 1LBFA 3IGXA 1PS9A 3W22A 2J9YA 1C9DA 3VNDA 1EP2A 4O1DA 5F2GA 2V9DA 2CLMA 4UR7A 3TU9A 3W7LA 2TMDA 2YX0A 2LLEA 3G18A 3M16A 2QDHA 1GQNA 3NEVA 4M6VA 4ZL1A 1SFJA 4Z0SA 1QOQA 4I7WA 3DFSA 4GUHA 4UTWC 4Q32A 3FJLA 3NM1A 1UJPA 4KKXA 3LCFA 4RZ6A 3HGRA 2GPTA 4YLWA 1Q6OA 4DF1A 2E1DA 3EWBX 1JUKA 1XBXA 2DORA 3W9ZA 4MPQA 1QAPA 1QMLA 4JIQA 5D32A 3SZ8A 3P7YA 2XN0A 1OX4A 3LERA 4U4MA 4AWTA 4JTKA 3W23A 2VFGA 4Z1AA 5G2WA 3UZJA 3KAOA 3QC3A 2E77A 3C52A 4MLJA 2ZTKA 4NNBA 2ATMA 4EF9A 1W3IA 5TBOA 4X22A 5SWUA 2DZUA 4IWWA 5AC6A 1IIHA 4LC8A 3TV8A 4C1LA 1OFAA 3LHZA 3RFAA 2ISVA 1B57A 1QPRA 2I14A 2AGKA 1CW2A 4JEQA 1GVQA 1MXSA 1X7FA 3M0ZA 3M5VA 4PODA 5CZJA 3T55A 2QKFA 4NJGA 2A6NA 1PCKA 1S5WA 4UTMA 4M6QA 4B5NA 1BWKA 3M1ZA 5DY2A 3ATZA 2QCGA 2YYUA 2OT1A 3W7NA 4AHPA 2JBMA 3W73A 5CPLA 4FNRA 3L67A 2GUUA 2YXGA 3LRLA 1TREA 1GG0A 3QQ0A 3UNDA 1X8FA 2ABBA 1BTMA 5CSSA 2JKPA 3KRZA 1K7EA 4GFSA 3MP5A 2TPSA 3F1QA 1VYSX 1IXQA 2WNNA 3HGJA 2G96A 1GPWA 4FO4A 5G4WA 2ZZ1A 4O1CA 1FWSA 2OCZA 1UB3A 2QCEA 1AW2A 3FEMA 3GK0A 2QDGA 2YZRA 3ABOA 3L2IA 1F6KA 1JCJA 4Z08A 1K7FA 2NXGA 4IX2A 4UC5A 3SR7A 2QUVA 1XUUA 3F4NA 3MHUA 4HSNA 1GVFA 3C3NA 2RH9A 4GBUA 2QCHA 5G2HA 3QM3A 3W70A 2ZRXA 3HPSA 3MYOA 1PV8A 1W8SA 1VYRA 4YCPA 1S5TA 3DH7A 2Y88A 4O4WA 1BWLA 1H7WA 3B06A 5KZDA 4NJHA 3CHVA 4N6FA 2ZZ7A 3TK7A 2A7PA 2ZZ6A 1P5BA 4LUJA 3W1PA 4WJEA 2QCDB 5EBUA 3GYEA 3SI9A 1LOLA 1FWRA 3W86A 3PM6A 4PL2A 4UIOA 3TH6A 3UZ5A 5LNUA 2R94A 3UPBA 2WSQA 4UNLA 2UV8G 4UFIA 4Y90A 4FXRA 4HPXA 3IIPA 3IVSA 4O54A 4PA8A 3L9CA 1VYPX 1DVJA 3QMSA 4UFKA 1JCNA 1Z41A 3M5ZA 1HTIA 3GZ3A 4DELA 3HQ1A 5CZTA 2W6RA 4U28A 4BI5A 4IXHA 2VEIA 3PB0A 1H1ZA 2IQTA 3C8FA 3GDMA 4K8EA 5DBTA 1TQXA 4O8RA 3BLIA 5CZSA 3W83A 1N7KA 1FUYA 5K2ZA 4UTUA 4A2RA 3IV3A 1QWGA 1WQ5A 2QCMA 3G0SA 4FEZA 1KTNA 3A24A 3U8GA 3HG2A 5LNRA 1ALDA 3M44A 4FXSA 3SSJA 4HKPA 4WUIA 4JGDA 4CCDA 3O1NA 5EYWA 4TMCA 5KINA 3HJZA 4QNWA 3FYPA 3LB0A 1H7PA 3BV4A 4O53A 4X2RA 4E38A 5L9FA 2CW6A 4GRSA 3P81A 5EPDA 3B0VC 4K38A 5LZLA 4MJZA 4DQWA 4NZFA 4AAJA 5BMXA 3QH2A 4Z1CA 1JCXA 2V2CA 2Y85A 4UUIA 3VI2A 3W1NA 2V8ZA 1O94A 1K02A 4FF7A 5E93A 5HWNA 2GVGA 3WK2A 4HNTA 3KRUA 2WKJA 3LXBA 4PL1A 3C56A 3NOEA 3ZWTA 4PFMA 1XM3A 1W5OA 2HS6A 3P84A 1DQWA 4OGZA 2KZHA 3INPA 3WK1A 3ZS4A 4QSHA 4O0KA 3Q2DA 1SZGA 3GR8A 4DO4A 5AYYA 3W7IA 2WNZA 3DU0A 1NEYA 4EF8A 2P0OA 3KX6A 5HR6A 3P8IA 2A7RA 3UYCA 1XXXA 1YTEA 2VFEA 2WSRA 1X6UA 4ALDA 4IMDA 4NXSA 1A5SA 3P61A 3OVQA 1SW3A 3PG8A 3PY2A 3G1SA 2RDUA 5U7SA 3G1AA 4XZ9A 4CQ8A 3W1RA 1VLWA 3DHDA 5K9XA 3A21A 1OFRA 2WOQA 2CLHA 3MYPA 3W1QA 1MEWA 1YTDA 1K7XA 1VHNA 2X16A 6ALDA 1W5PA 4UTJA 1TJPA 2JK2A 2QCFA 3Q58A 1J4EA 1OYAA 3B0UX 1SR9A 4MZ1A 3CPRA 3C2OA 3LTYA 1G67A 4MKNA 3A5FA 2YDAA 4JTEA 3EXSA 2FIQA 3IVUA 4I7VA 5CPMA 5F2IA 3W85A 2C14A 3FLUA 4N9EA 1RQHA 1VGAA 3QFEA 2CU0A 2O7QA 1XCFA 1PL9A 3LI1A 3IIZA 4G1KA 1QPQA 5EMUA 4AHQA 1L6SA 2BSLA 1RZMA 2DZSA 3NAVA 3QJAA 3CEUA 1LROA 2QJIA 1TPDA 3BW4A 3LHYA 4ADUA 4IMEA 4M5PA 1VS1A 4OQVA 4QAIA 1O60A 5K9CA 2RDTA 1R30A 1KM5A 3I68A 3NQCA 3QPYA 4LRSA 1N55A 4ZQRA 3ZWSA 1QR7A 3OG3A 1KFJA 1K8XA 4FNSA 3T44A 3NO5A 2G95A 1GG1A 4BWLA 3HPZA 3SW6A 1TPWA 4NU7A 3HO8A 3P62A 4HNUA 1KM2A 3HGOA 1SZFA 3KHJA 3F03K 4M7SA 3S1XA 4Y9AA 2WQPA 5HULA 1W54A 4R33A 3CM4A 1SO4A 1SPQA 3QSRA 3NR0A 1QPOA 3UWYA 3FOKA 1G4TA 1LOQA 5G5IA 3R13A 4UTHA 3CLMA 4JTIA 2JGQA 3L5AA 1FBAA 3T40A 1H7XA 2FPTA 2CZFA 4O19A 3S5YA 3G22A 3W6YA 1X1ZA 4LW7A 4NQ1A 3NZRA 4O14A 3LLFA 3TMLA 4XTIA 3CWOX 3P80A 2VFIA 1Q6RA 1DV7A 1JJKA 2Y62A 3W7CA 4S2CA 1S5VA 2NX3A 3O07A 5FF2A 4ADSA 3C2EA 4NZJA 1SW0A 3EWXA 4MY9A 5DXXA 4M6PA 3STFA 4LTSA 3S5OA 4RZ5A 5LHFA 3UPWA 5BMWA 2A7NA 3W7OA 5HQEA 3NGJA 4AMAA 4HNVA 1XBYA 1XC4A 4UNKA 4LWWA 1L2UA 4KWWA 1ME7A 3PB2A 1V7YA 1WBJA 3DHFA 5CKSA 1SQ7A 1FXPA 3FFSA 3UWZA 3C2VA 1OG0A 5FESA 3GDTA 3GNDA 3CIXA 1VZWA 3M6YA 3LGEA 4ONVA 3BLEA 4S2BA 4EWND 4FNQA 4QJ1A 3C4UA 3NPXA 1M6JA 1PCWA 4QISA 2CLEA 2Y6ZA 3QW3A 3TFXA 2R14A 3SJ3A 2ZRVA 1A5BA 3LCWA 2QCNA 2YW4A 4GXMA 2VFDA 4XUGA 2Y89A 3HBLA 1P0NA 4UMCA 3S9YA 5K7JA 3N14A 1W31A 3R89A 2C15A 4UR8A 3OIXA 4JTTA 3UXAA 1G6CA 3AO0A 3DFTA 4LC6A 5HWJA 4WXZA 1YLVA 3QMRA 4AEOA 3BO9A 5D05A 1AL7A 3LHUA 2RDWA 1TPB1 3EX4A 3HPXA 1JVNA 1VHCA 4WY0F 1NFBA 2E5DA 1HL2A 5EA9A 2A5HA 3HIJA 3IEBA 3FIGA 4LNYA 4UMBA 3DFPA 3O16A 1TMHA 1ZALA 1QDSA 1KM4A 1YTKA 3W2NA 3EX1A 4NNCA 1FCUA 1OX4B 2WV8A 4JDYA 3RMJA 3C0JA 1SZEA 2FJKA 3W2KA 1TRDA 3OVRA 1LRQA 1AMKA 1Q3NA 5TQLA 5KMYA 4MFEA 1NF0A 3M5YA 4I9AA 4EIVA 3G1FA 3IGSA 4AHOA 3N34A 4FNUA 1EWDA 1SSGA 1RQEA 4LVGA 4QITA 3WK3A 4MZ8A 2Z6JA 3B04A 4IMFA 4O15A 3W7PA 4CNNA 5KSWA 5KITA 1XKYA 4HNNA 3C61A 3P82A 4C1KA 1G7UA 3NYZA 3TROA 1SSDA 3IIVA 2NV2A 2V2HA 1I2NA 2CLOA 1JQVA 2Q3OA 3TNOA 1WYIA 1WAUA 3MMTA 3UWVA 3FJ6A 4Z1BA 3QEZA 4XTDA 5K4ZA 3MP3A 1AG1O 4N02A 3YPIA 5KZEA 1LDCA 5C54A 2RHGA 1ME9A 1G4SA 2B4GA 3NQDA 4IMCA 4OE7A 3ZFHA 1FDJA 4PEKA 5F4XA 1I4NA 1EP1A 1JULA 4ZMGA 1KFBA 3NQ7A 4KFPA 1H63A 3C2FA 1ZJIA 4O17A 1R2TA 2C0AA 4IUOA 1H50A 2DJXA 2JKEA 2B7NA 1K8ZA 1R46A 3PS7A 1TCDA 1EX5A 3IVTA 4JYFA 2H8XA 2V30A 2NZLA 3PG9A 2A6LA 4MIMA 3WFAA 1XI3A 3RK8A 3FKKA 1EP3A 3W7EA 1ZAIA 1FXQA 4RXFA 3NL5A 3VE7A 2Y7FA 4JYEA 3M7WA 3QZEA 4JXCA 4MJMA 4GUJA 1TPEA 4CCEA 2YFOA 2J88A 4XKYB 3TR2A 1TIMA 2DJLA 3U2OA 1E51A 1VRDA 2Y7GA 1GWJA 3NQAA 3G1VA 4ICNA 1LCOA 4Z1DA 4CQAA 3IIOA 3EEGA 5HNRA 1W1ZA 3I6RA 1TTQA 3AJXA 4WY0B 2EF9A 5ABTA 2E6AA 5DN1A 3R12A 5D2XA 4LU0A 3SY5A 4L4MA 1V5XA 3GAKA 5F4WA 2NWRA 1PHWA 3BG5A 4OHQA 3W1UA 3BARA 4DPPA 1TPVA 3PULA 4EVZA 5I3GA 2GQ8A 5LGXA 1K3UA 1LYXA 4D2JA 1XFBA 3EX6A 4GC4A 3S42A 4AF0B 3TJXA 2XFWA 3TJLA 2YW3A 3LV6A 4O4VA 4O16A 1WBHA 2DP3A 5G4EA 5C55A 5AHMA 3TW7A 2X1UA 1VH7A 3PAJA 4TR9A 3PUEA 3UY7A 3R2GA 3KVMA 3DBPA 3D0CA 5BOOA 4R53A 5F2MA 1DORA 2QR6A 1P1XA 1KTBA 1Z42A 1U5JA 3FA5A 1F6PA 3TXZA 3LXAA 5D2TA 5A5WA 1VR6A 5CG7A 3OVPA 1H61A 3GNNA 4JTUA 1SO3A 3A5VA 2CZDA 1VLIA 3W7DA 3E49A 3E12A 1IGSA 4DPQA 3R8RA 4WZHA 1W5NA 2VFFA 4O13A 1XBVA 3O05A 1TV5A 2OJPA 3BK0A 3L5MA 1LLZA 2NV1A 3P5YA 5LNWA 2Y70A 4FNPA 3SGUA 4O1BA 5CZ0A 1H7NA 5AN7A 3FYOA 1DHPA 3I7RA 4ORMA 4WXYA 3MI6A 1NVMA 2JKAA 1X1OA 5DXYA 1PE1A 1EEPA 1GEQA 3DI0A 3W71A 2O7SA 4M7TA 5KZMA 1H62A 3MI2A 1O5KA 1W5MA 5AHLA 2QJGA 4WX2A 5H91A 3B03A 3NNTA 3G3DA 1TTJA 1KFLA 4LVDA 1ME8A 3I65A 3NL2A 1VC4A 3NQEA 4YL2A 2P1FA 4ZVJA 2ZA2A 2NUWA 3M43A 2GVJA 1JCMP 2CLKA 3CTLA 3DI1A 3GDLA 3KFTA 1KFCA 2WJZA 3MBFA 1DBTA 2EPHA 4JR5A 4IMGA 5TIMA 1KBIA 1RQBA 3LM7A 1TV8A 3PBWA 1LRNA 1L6WA 3W2MA 3L0GA 3UWQA 4DXVA 4ZQMA 1B9BA 1KLYA 2H8ZA 3W1LA 3MW7A 1W37A 2Z0IA 3H55A 4LT9A 4DO6A 3TAOA 2ZTJA 5E0KA 2RKXA 3LX9A 4JN6A 5C2XA 2ZZ4A 1JCYA 2YR1A 3GVGA 3RF9A 1B4EA 2H6RA 3OBKA 2E09A 2CZ5A 3M5XA 4MUZA 3MP4A 4Y8FA 3ANYA 1VJIA 3NQ8A 4AH7A 1GVSA 3GXNA 5CPOA 5U4NA 3MBDA 4O50A 3NPVA 1WXJA 2CLFA 4JTFA 3F4WA 1OK6A 4DEFA 1J5TA 2HS8A 1GVOA 2AQWA 3QPZA 2J27A 2VEMA 4NUWA 4MLRA 1EUAA
chains in the Genus database with same CATH superfamily
2X42A 2FLIA 2UY4A 5A8PA 1JDFA 5EL1A 2WVUA 1XG3A 4IP7A 4UTTC 3UY8A 2C18A 3B0PA 3LENA 3GXMA 2GJXA 1HN1A 4KEUA 1CPUA 4DM2A 2ZZ5A 1DYSA 1BYAA 4GZJA 3TC3A 1TYGA 4H01A 3GUWA 4PUKA 3TQPA 3WF4A 3W07A 2PDJA 5BRPA 3UXDA 3AS2A 3AROA 4GIYA 4DBSA 4FB7A 3WH5A 4J2PA 3E96A 4CD7A 3VMOA 6XIAA 4GJ1A 4ZO7A 4ATLA 2WM1A 1LWJA 2E5CA 1U2YA 3HG4A 4NXKA 3N29A 3G1HA 1OX5A 3I7SA 3LLDA 3G6MA 3B0XA 4NYUA 1NQ6A 5AHFA 2IPGA 4I6KA 4AD3A 3QZ6A 3ZT7A 3R43A 3PSVA 3TQ0A 1EUNA 1SGJA 1ZAJA 5LIXX 3N13A 4KGJA 2XSXA 3D5HA 1XL9A 1CB2A 2Z1WA 3M0MA 1CGXA 4AIEA 4D1IA 2NXIA 1UPPA 5CPNA 3QGKC 3S5SA 3NVDA 3G0UA 3TFCA 3CHDA 3GHRA 2F2HA 4HZMA 1V08A 4OV4A 1FWTA 3IGUA 4FIRA 1YNPA 1YNYA 1DIDA 3GU1A 1XGZA 4RL3A 1ZP4A 1KKRA 3THUA 5D04C 1HJSA 1VCVA 1MW1A 5HINA 1ISWA 3MDUA 4LYQA 4E2BA 5CCZA 3CNYA 1UBSA 2VEKA 1BXBA 1KRBC 1LTDA 4DYJA 2VT0A 4AXKA 4J3XA 4KCUA 4KMQA 1DXEA 4UTKA 4DBDA 1RY8A 2D2JA 4TVDA 3P6LA 7XIMA 2WZIA 2EPMX 1IT7A 3NQVA 2EPLX 3IJIA 4KRUA 4MTVA 1EC7A 3G1YA 3ANVA 4IH3A 4P7QA 4LAUA 2VMFA 3DKLA 1CX9A 4ZZ9A 2CBVA 1PDYA 2GDVA 3S0CA 1ECQA 2GVEA 3BAYA 4IP4A 4QNEA 4RR4A 2WMIB 2I9UA 3BC9A 2Z25A 1DTNA 1DJQA 2YL6A 5DELA 3ARTA 3TMQA 1A47A 3ZJ6A 1XD0A 3DFHA 3RM9A 2I7GA 3OHIA 2E40A 2CETA 1B31A 1C8VA 3MJYA 2J78A 3OB8A 1D9EA 1QO5A 1SO6A 1SFLA 4HA4A 4C5YA 1AL8A 1IXNA 2C91A 4LEFA 5E1QA 3RU6A 3B9DA 3CXOA 3BJFA 4MNKA 4XQ6A 4MKVA 4JX6A 3GZAA 4C65A 3V16A 4HCHA 4PB3A 3VD5A 2ZRYA 1XIDA 2JF6A 3E9AA 3LUTA 3R25A 5T91A 2CFFA 4YWIA 4EOUA 2DVXA 2ZDRA 5CGQA 4P5UA 3BAXA 1O68A 4OUIA 1I2QA 4BI6A 3RM4A 4NI8A 4LNCA 4QAWA 4J27A 1NF7A 4FSAA 2ZX6A 2OT0A 1TR9A 1C92A 3EA2A 4HD5A 4RX0A 3AMDA 3SUUA 5J8LA 1EWEA 9RUBA 5LA0A 2ZC8A 5IDIA 4S3KA 2BXVA 1MI3A 1WA3A 4DZHA 1ZB5A 3TYZA 3TDFA 3SADA 1KM1A 3VKJA 4WLCA 4TMBA 2WW5A 3WLTA 2ZRUA 1A5CA 2BOFX 5C9ZA 3VDGA 1K9EA 3GTHA 4ZOEA 1FX6A 1S2TA 3LPFA 4FOUA 2VR4A 3GW3A 3QTPA 1TE1A 1GTHA 4PMXA 1E70M 4X3ZA 2XIJA 1PEZA 1M7JA 3PBMA 2GGGA 1IE7C 3H12A 4L6OA 2FPYA 2YPIA 3TW9A 2X1SA 2D2HA 3UWEA 4GX9A 1XPGA 4BR1A 3GU2A 1LT7A 5C9WA 3P74A 5C2GA 1W2PA 1POJA 2WLZA 3SFKA 3NPWA 4XWUA 1L6GA 1F9CA 2V3FA 1W3TA 1E4LA 1FCQA 7TIMA 4GUIA 5D33A 8XIAA 1JYVA 4ZQPA 1F7BA 1LBLA 4HTBA 3ZJ8A 3UJSA 4KF1A 3SCSA 3CQ0A 3SM0A 7REQA 4JYDA 2A4AA 5AC7A 3LTSA 2Y7EA 2I1OA 3MUZ1 3BG3A 3OGSA 1OFPA 2IXVA 1ONXA 2HPMA 3S47A 1J0JA 1R9XA 4PE8A 4X9SA 3JRKA 2W4XA 1A4MA 5HBFA 4U3AA 3T08A 1QO2A 4LCQA 4HZ8A 2RJHA 5LNSA 1FWWA 4D6FA 4PMQA 1RK5A 4XKYA 2DZVA 2TYSA 2PDLA 1JAKA 2XTKA 4TU1A 4M8UA 3BLFA 4C6JA 1KCXA 1QW7A 4KT2A 1RVGA 1WOAA 3P8JA 1A0DA 4Q4SA 1W0MA 2W91A 1Q6LA 4IFRA 3WQOA 4QRNA 4A8LA 4DN1A 3BSGA 3W7QA 1FWHC 3QVQA 4FS9A 4HVXA 5FL1A 3IUDA 3LCIA 4B9ZA 2JEPA 4KCWA 5H8MA 4PMVA 2F7FA 2DT3A 4PTNA 1PZ0A 5FF4A 2ACRA 3W37A 1EEXA 2OGJA 3WUBA 1Z3NA 3NG3A 1GQKA 4WGXA 2QUUA 4O1FA 3N4AA 1P0BA 1V4YA 1F4AA 4K8HA 4F4RA 5IRPA 3OODA 4JS3A 4RZ4A 2IPJA 3HQPA 4UFJA 3V4BA 1BXNA 1THFD 1BEUA 1EOMA 1GVRA 4GIAA 2BY1A 2ZZ2A 1WXYA 3WBEA 3UF9A 1GHRA 1DQXA 3RMEA 3AYVA 2QV5A 5GNYA 3WQPA 4XISA 2PCQA 1MRQA 3NM3A 1S5MA 3TCEA 1PZ2A 2E6DA 4M19A 5IBXA 1HO4A 3WIJA 3RYSA 1O6IA 3JR2A 1LP6A 2GVLA 5D09A 5AYBA 1YXDA 1GJWA 2VELA 4EANA 5ECVA 5I3JA 1U1UA 2PE4A 4W88A 1QNQA 2WANA 4GGHA 1W3NA 1S3HA 1EPXA 2HEJA 4ACZA 4Z2IA 3RDKA 1XYMA 4I8DA 4KETA 1YDNA 3KWSA 1FH9A 4K6AA 2WQDA 1DKWA 1OFOA 2WZHA 3MQTA 2A3HA 2ZWYA 3WH9A 1WX0A 2JGYA 3U5YA 4LS1A 4LY8A 4EPDC 4ZA0A 1LRTA 1UKTA 3LNMA 3MT1A 2DZBA 2V3EA 3HTWA 4DJDD 3E0IA 2A3CA 3N73A 3PZIA 2ZUSA 5D02A 3B8SA 2C16A 1TWZA 3I6EA 4RE3A 1XDLA 1BGAA 4JIPA 5CJNA 4POCA 2ZFAA 3ZT6A 5DRCA 1LUCA 2QNEA 2W3ZA 3STGA 1ZAHA 3LA4A 2Y8UA 5A1AA 2P8BA 4AD4A 1ZENA 1UBPC 3LRMA 3S1VA 4LVAA 5HNNA 5FACA 1EFZA 4UMAA 3S5ZA 4Q22A 5A69A 2X1RA 5J5DA 3APGA 4A3QA 4AIUA 4BCEA 2Q09A 3TSMA 1E6PA 3DYPA 1HXJA 3V3WA 1V6UA 4KEVA 4XSMA 1UZ1A 3O6AA 3H2NA 1UOKA 1AW5A 5HQMA 3USBA 4MADA 1UWSA 4BFAA 1TMLA 3N6JA 3K4DA 2YDRA 3G3MA 1I60A 3M0JA 5A6TC 2P5NA 4IGNA 3K13A 5ABGA 3E2QA 3F4CA 2OG9A 4S23A 4W93A 4GNKB 2GK1B 3NQMA 4N4QA 3PBYA 2PGFA 5CXPA 1N8FA 3V75A 4B5UA 3LI0A 3BXWA 4REQA 5H2ZA 4H04A 1OINA 3KWXA 1WUEA 3QGVA 3QQ1A 4MWAE 1RCQA 3EA3A 3WJSA 3NQBA 2XH7A 1EPVA 5E70A 4HHPA 3D3AA 2HWGA 2ZYFA 4AWUA 2QPSA 1YADA 1DE6A 1E4IA 4OIFA 3WQ8A 1QHPA 4CD8A 2QMJA 3A6OA 3THCA 1TA3B 1HJQA 4WF7A 4UR9A 3GXIA 3E02A 2C19A 2FDMA 3KOFA 1VCFA 3MZ2A 4IHCA 1D7KA 2DU2A 4IGHA 2FKPA 8TIMA 4M3PA 4Q4MA 3BWWA 5DY3A 3WF2A 1KBBA 3H24A 1PJ9A 3O7UA 4K7YA 1RR2A 5D38A 2DSZA 3GNXA 1XRSA 4DJED 4ORIA 3ALGA 3UA4A 4L1GA 3K2GA 3O15A 3F5LA 1UR9A 1XPYA 5AC8A 4O1AA 1FA2A 4LANA 4ZO6A 1P0KA 4H8NA 2DIKA 3MUY1 4G9PA 3QOMA 5AYZA 4MDPA 3UERA 3URQA 2F61A 3R1ZA 1OG6A 4HJWA 2AAMA 1LM1A 3G1XA 1AJ2A 3OIHA 3EDDA 4KCVA 3MUAA 4NJJA 2D1ZA 3Q94A 2PMQA 5IFTA 5D8WA 1QOPA 4UTWA 5HJXA 1G4PA 3RXZA 1J8VA 4F0KA 5BXRA 1LL4A 4C6FA 1U1HA 2QPUA 5DCBA 4DF2A 1JR1A 3BPWA 1C7SA 3TC7A 4AMCA 1BQGA 4YS1A 2PC8A 3QLLA 1GKPA 5I5RA 2Z6IA 2WB5A 3WQ6A 3QV8A 2P10A 2WMIA 3MDWA 4L64A 5C7HA 1IZCA 3I3DA 4GE8A 4FLQA 3UCQA 1YXYA 2J74A 5L6UA 1JPIA 1K8YA 3EWUA 4UXDA 3QQWA 1J6PA 3S2JA 2E6FA 4XBSA 3ITVA 3NPUA 4W9TA 1UUMA 4NZ5A 2NLYA 5XIAA 1H5VA 5EKYA 4QGCA 1YHTA 1OCJA 2HBVA 3W22A 1PBGA 5AECA 3VNDA 4MG4A 3TU9A 3W7LA 2OLAA 3G18A 3ME3A 1GQNA 4M6VA 4ZL1A 4U33A 4Z0SA 1QOQA 4EPKA 3OLGA 1EQPA 2GFTA 2G3IA 4H1ZA 3GD6A 4W8BA 1FHDA 4Y8EA 1MNSA 4UCFA 3HGRA 3EBVA 3BSMA 1CGTA 3WD1A 4DF1A 1V6TA 3EWBX 1E5JA 1NH6A 1WZMA 1XBXA 3W9ZA 1QAPA 3GHUA 3CQHA 2OQYA 3P7YA 1OX4A 4U4MA 1BG4A 4JTKA 3VNIA 1HGWA 1T41A 4AD5A 5MKGB 4XUYA 4JN8A 3MANA 3C52A 4MLJA 4MNMA 4NNBA 1W6TA 3FHQA 1W3IA 5TBOA 3BANA 3SUVA 1WDPA 4PMYA 1L6FA 2RAGA 5AC6A 3CLWA 1W1PA 2VCBA 4JEJA 3ZVHA 2VZVA 4YTUA 3GXFA 1CW2A 4PODA 3T55A 1IWPA 4NJGA 2VUNA 3QR1A 1S5WA 1I0DA 4JQ2A 5HOSA 3LLXA 4GVHA 3ATZA 2QCGA 1PKNA 1FWGC 3SRFA 4EACA 4AHPA 3WQ5A 2Z26A 4I8YA 3W73A 1TG7A 3UG5A 3L67A 3NDZA 2D69A 2BHUA 1V3MA 4QR6A 1TREA 2YBUA 3ZQ9A 2CCRA 1X8FA 1BTMA 1GNXA 2JKPA 3KRZA 3MP5A 4RDZA 3VM5A 3T0TA 1IXQA 4JN7A 3KBWA 4YHEA 2W62A 3TZFA 1WZAA 4FO4A 2V69A 2ZZ1A 2XFRA 1AW2A 4GIEA 4FLOA 1XS2A 5IHSA 2QF8A 2GJPA 1S2UA 4UC5A 2P3EA 1CCWB 1XUUA 2VEGA 3R0DA 2ASHA 2ZDSA 4HSNA 4S3GA 4LXFA 4JTAA 3MYOA 1PV8A 3S6OA 3AXKA 3G77A 3DG3A 3T2OA 1EBGA 3VZZA 1YKWA 2WBGA 1ISXA 4AW7A 3W1PA 2QCDB 5DX7A 3FNDA 2XVKA 1LOLA 4KEZA 3SY8A 6REQB 1FWBC 3W86A 3LU2A 4PL2A 1FWCC 4GABA 1QK2A 4X9YA 2XZ7A 3E74A 4JIRA 2OWWA 1E3ZA 5FJUA 2VEFA 2CEQA 4O54A 3L9CA 1VYPX 1DVJA 2ZXDA 1CWYA 1G94A 2ADAA 1XINA 3M0LA 4F9JA 1K1DA 3VGGA 2I56A 2VC9A 4X60A 1U22A 4PUJA 3N11A 5DBTA 2BGSA 3AFBA 3W83A 4F0HA 1ITUA 5K2ZA 4UTUA 1EXBA 3IV3A 1QWGA 3VX1A 7A3HA 1WQ5A 2AKMA 3G0SA 3A24A 3U8GA 3HG2A 3U4AA 4U2ZA 3PZNA 5KINA 2P88A 4KRZA 3HJZA 2WZEA 1Q4WA 4PMJA 1I1WA 3BV4A 4O53A 1O1ZA 1XV8A 4E38A 3SCUA 3AI0A 2CW6A 3K1GA 1TWWA 1A3WA 3QH2A 3BOFA 1N8IA 3TNBA 5CZKA 1J0ZA 2Y85A 1DIKA 1FHVA 2V8ZA 1O94A 5HWNA 2GVGA 1QI4A 2WKJA 2JFEX 3NJ3A 2EBNA 4WR3A 2OYMA 4QS6A 3T9PA 4J5NA 1E1FA 1F3TA 3LPOA 1O5RA 2PZNA 2O4MA 1XJBA 1BGGA 3HN3A 3IK4A 3INPA 4O0KA 4DO4A 3W28A 2VNCA 4EF8A 2P0OA 3P8IA 7PTDA 2BVDA 1XXXA 2VFEA 4F3HA 1A5UA 2VZUA 4JBRA 3P61A 3OVQA 2RDUA 1LF1A 3VKBA 4C5ZA 4W85A 1ITCA 3E2SA 1R7OA 1OFRA 5JQ9A 2WOQA 2VO5A 3NYDA 4B5TA 1MEWA 2YA0A 1YTDA 2ZVIA 1K7XA 2AAAA 4B3LA 3AIUA 2X16A 1ENUA 3VGBA 3VIHA 1W5PA 4I9MA 3UP8A 5I6SA 3IPWA 1HGYA 4IPNB 4GI6A 3ZLGA 1NOUA 3UFYA 1GGOA 1QOXA 1SR9A 1TJ1A 5D9MA 4MZ1A 2YZ5A 3CPRA 4GMEA 1O1HA 4MKNA 3POCA 3LGGA 2PLCA 3A5FA 1E1CB 3EXSA 1FRBA 3WUGA 4I7VA 5CPMA 4U5KA 4N9EA 1PL9A 1E1EA 3PZTA 2DY3A 1YNQA 1SZRA 2DVUA 4G1KA 3QKZA 4GI8A 1L8PA 3IAQA 5HMDA 4FLRA 1NIUA 4JTQA 4PUNA 4R7OA 4NAEB 3DX5A 1UWIA 1LROA 4JQ3A 2KAUC 4ADUA 2EG8A 4KPLA 4GD0A 4CQCA 1O60A 2XIOA 5K9CA 1RCXB 1PYMA 2RDTA 2VRQA 3OQEA 4CD6A 4XZWA 6XIMA 1RP8A 3AYSA 2G95A 3AHTA 1GYMA 1H4PA 2DIJA 3IUIA 2VZSA 1JD7A 3P62A 2X2YA 3KHJA 3HGOA 1JPHA 3N6QA 3F03K 4OOUA 3H2OA 4Y9AA 2QGHA 2WQPA 4HMEA 2W66A 4R33A 3UVIA 3CM4A 1SO4A 4GXWA 2DV0A 4J4KA 3UU0A 2J6VA 1JI1A 1S39A 3UWYA 2J8GA 3R13A 2PD5A 4FXFA 4FXJA 3N4EA 2CZFA 2G8ZA 4O19A 3GTFA 3RX2A 5CC5A 2PDUA 3N2TA 3W6YA 4KWUA 5KZ6A 2QDEA 2RGLA 2VR5A 3CWOX 3KE0A 3PZVA 2XIMA 1IEQA 1AFSA 3P80A 1DV7A 1JJKA 2QW5A 3CL8A 1S5VA 3WQCA 3ZXWA 4ADSA 3ZM8A 5DXXA 4M6PA 4RZ5A 4XZNX 3UPWA 1E0VA 5T8GA 5BMWA 2A7NA 3W7OA 3NGJA 4HNVA 1QNRA 4LWWA 4UNKA 3CAQA 4KWWA 1ME7A 3PB2A 1V7YA 4LX4A 5DRIA 1WBJA 1UROA 2ZUVA 1R3RA 1O12A 3R7MA 1SQ7A 3OU8A 3FFSA 4DXKA 5FESA 1GOQA 4I9JA 3LGEA 3BLEA 4FNQA 3RRXA 4S3CA 5HXMA 3OGVA 4QISA 4QLLA 4AY8A 1P6WA 3SJ3A 1HP5A 2ZRVA 1TA3A 2PLKA 2QT3A 4GI4A 3DC8A 3LCWA 2CLPA 3DGBA 3P0XA 3S9YA 1Y8BA 2KX9A 4DWSD 3UCDA 3MJMA 2DZAA 1V0KA 5A8OA 4J1OA 2NT1A 3EDKA 2C15A 2VRKA 3MKVA 1EJTC 3OIXA 4YVXA 9XIAA 1YLVA 5D05A 3LHUA 4MNJA 4IISA 3EX4A 2EXOA 1JVNA 2E28A 3HZ3A 5DMNA 5A6BD 2VWSA 1ADSA 1KGWA 3APYA 1QDSA 1KM4A 3W2NA 4Z2GA 3EX1A 3NZQA 3W2KA 1AMKA 1Q3NA 4HU8A 1TX0A 4G8TA 1NF0A 3M5YA 3O9NA 2WLYA 5FJOA 2INZA 3IGSA 1LG2A 2J25A 1E9YB 4N7QA 2AKZA 4FNUA 2X8RA 1VB9A 1EWDA 2ZADA 5ABEA 4TXEA 3F4VA 1UD2A 3VKKA 4AU0A 5DF0A 3V1HA 4RE4A 6TAAA 5KSWA 1XKYA 3P82A 3UJFA 3H23A 3IIVA 2NV2A 2V2HA 1EJ7L 2X7WA 1WYIA 4HNLA 3DECA 2O92A 2DW6A 4Y9MA 3UWVA 4NKCA 4GNVA 2YKKA 3PNUA 4G6CA 1U1JA 4N02A 4M6UA 5C54A 1OSEA 1G4SA 2B4GA 5H1WA 4PEKA 1Q85A 3GXDA 1E6QM 1EKOA 3PZGA 1UUQA 4U3CA 3WNLA 3PPCA 4PB4A 2PEVA 2X0YA 3PS7A 1EX5A 3IVTA 2H8XA 1UWRA 2V30A 1PTAA 2A6LA 1LLOA 3RK8A 3L4WA 4RV3A 1EP3A 3W7EA 3TWBA 4X0NA 1HZYA 3VE7A 4JYEA 3WD3A 3QZEA 1RD6A 1W17A 3ABXA 3TR2A 4JHMA 4TVUA 3CZJA 1AUSL 4AD0A 2Y7GA 4H00A 1QU4A 3KDNA 3SIMA 3NQAA 3G1VA 4GACA 3M0IA 3D3FA 4ICNA 5FA5A 4CQAA 4C1NB 3IIOA 5HNRA 4A4AA 3AJXA 1XYLA 4MUPA 1E56A 4GI9A 1J0IA 1V5XA 3UJEA 4XKMA 2NWRA 4ZXLA 2VOTA 1XLKA 3NEHA 3W1UA 4L7ZA 5I3GA 4EVZA 2GQ8A 3WF1A 5MKGA 1JNEA 5CAKA 1KKOA 1EXPA 4AF0B 1S3TC 1XW8A 4O4VA 2VTFA 1C3FA 3WYZA 1Z6KA 2QDDA 1VBHA 2Q6ZA 3A47A 5C55A 1Q63A 3TW7A 3REQB 4KERA 1VH7A 1ZBKA 3OYXA 1SVDA 2YOCA 3BQ5A 4HU3A 3SAZA 4LBRA 1J11A 2QR6A 3VOHA 4P8XA 1KTBA 2WMGA 4L61A 2PTZA 1US2A 4QJ5B 4MSSA 1KCZA 1E6NA 2WMJA 1CZ1A 3H2MA 1SO3A 3O2LA 4WVXA 4S3JA 2IUZA 3FK4A 4XSLA 3E12A 1IGSA 4PCTA 1BG9A 2HCVA 1KGUA 1XBVA 4LAMA 2OJPA 3BK0A 1EYEA 1LLZA 2NV1A 5LNWA 5FJPA 3HA1A 4FNPA 4IICA 3SGUA 4GCAA 1FKXA 2ICSA 5CZ0A 1H7NA 4H8VA 3I7RA 3UEQA 3HMCA 1DJWA 4ZEPA 2HXUA 2NQJA 1S38A 5D8ZA 1X1OA 3NGFA 3C2YA 1TCMA 3DI0A 4M7TA 5KZMA 4HNOA 1H62A 1V6XA 3PBGA 2G3NA 3U3HA 1UWQA 3MUCA 2V6AA 3OGRA 3GIPA 4HGXA 2Y8VA 3QHOA 4YTTA 3CTLA 1KFCA 4DX3A 3MBFA 5A94A 4UQ9A 4IIDA 4UNIA 4EPEC 2IKHA 3BICA 3ZSTA 4AEFA 3U2ZA 3UWQA 1B9BA 1KLYA 4QBXA 2H8ZA 6REQA 2Z0IA 2VDHA 3H55A 2QGYA 3TAOA 3LX9A 4JN6A 1JCYA 1ODZA 3GVGA 4Q3MA 3DYOA 2OOFA 3TN5A 2FZ9A 3IACA 3SCNA 2CZ5A 1OIMA 2G50A 4Y8FA 3W01A 3W53A 3ANYA 1GVSA 1F61A 3GXNA 1DWFM 4PTXA 1UKOA 1WXJA 3F4WA 1OK6A 2OXNA 3ARZA 1O5QA 2D3NA 1GVOA 3QPZA 2J27A 3VIGA 4NUWA 3WNNA 3HFYA 4Y9NA 5REQB 3CPGA 3UCCA 4YN5A 5A6JA 3VOFA 3A22A 4Q8QA 4M81A 3T81A 3LSCA 1TUXA 1FCVA 3GS6A 2G0WA 4RNIA 5GJPA 1TIWA 4F40A 4GQGA 1AJZA 1EHNA 1TV3A 5M1TA 2PWDA 3AICA 2QCLA 5C2CA 4LUTB 4BF5A 2E68A 1UKQA 5IBXC 3VPLA 3DGRA 4GKLA 4O12A 3RGTA 5E9XA 5FJRA 1Z32X 4I9TA 3PPGA 1K9FA 1EF2A 2BTMA 1PSCA 3S8HA 3FV9A 3R4IA 1ML1A 4QTGA 3GKAA 4WSHA 2VURA 1TUFA 1M5WA 1NFPA 2XYLA 1RPXA 3WLOA 1B30A 4WDTA 4P2VA 1OEPA 2UY5A 3ZMRA 5D2WA 3LD5A 3G8EA 3M9YA 2YFNA 4L1WA 4ERGA 1PB0A 2G3FA 1ZL1A 4DI9A 3WMBA 1J2WA 1TV4A 3GIYA 2YIHA 3M0XA 4YCOA 3AS3A 5LIKX 1KM3A 4PMZA 5FAJA 5F2LA 4ADTA 2XIQA 4GQ0A 2R91A 2PDKA 4NIRA 3W1TA 3T0DA 4PTVA 3TTYA 3WSUA 4LV4A 1V3HA 5BU6A 3KM8A 3O0KA 1WDDA 1G69A 4GQBA 3LHWA 3T8QA 1KB3A 1ZNNA 3SRKA 3SDOA 3SGZA 2GOUA 1VPXA 1E1CA 3VTRA 1M7OA 1D8CA 1D3GA 1T8QA 3N3TA 2VEPA 2XWDA 1MXDA 5I3KA 3CQIA 3B8TA 3IUHA 1V8EA 3ZLFA 5LA1A 4ML9A 1FCBA 1R8LA 4FR6A 1A50A 2R8WA 4AX6A 4ZTXA 2TODA 3UR8A 4NAEA 4WKHA 5M2FX 3N1AA 2J7HA 1B0IA 2C3ZA 3W7KA 4JZ5A 2OO6A 4NZ1A 2INEA 3B8WA 1EGVA 4JFWA 1XCXA 4KIRA 4MWAD 1W8GA 4TTUA 3MVIA 1L9WA 4AG0A 4GXPA 3WD4A 1H7OA 1Y7VA 3LHTA 3T7VA 3WMLA 4WDUA 1F3WA 1MEHA 1V3IA 4W7VA 3BVJA 4TUFA 4HSHA 3TONA 4P8WA 2IPFA 2PURA 1FWEC 5BOFA 2VC6A 4KWOA 1UZDA 3SQMA 5BW6A 2PLMA 3H26A 5LIWX 1NP0A 5A8MA 2WC3A 1K8CA 2WCAA 5H8PA 4AZ6A 4OBTA 1XLBA 4AWSA 4GUFA 3AISA 2VFHA 1YQ2A 1TWIA 4XZMX 2ACQA 1SR0A 3DZ1A 1XR2A 1JPKA 4N4PA 5B80A 2ZC1A 4OUEA 4GY7A 1SZNA 5BYWA 2D0HA 3CGTA 3FX4A 4Y96A 3PPHA 4KIEA 4AZGA 2NSOA 4DYEA 4ZODA 1E9ZB 3Q45A 2NW0A 4UB9A 1R3QA 2A85A 3RN6A 2V3GA 2OR2A 2WNQA 1Q66A 4L1XA 4D8LA 1UD8A 5HAOA 1HVQA 4KQNA 4LUIA 1E6RA 1RD5A 4TX9A 1XQKA 1QNVA 3MSRA 3UWWA 2ZUNA 5G1YA 1H1YA 3DYMA 2J13A 1QRQA 3GFXA 1PIIA 2E8ZA 3LMZA 3V0TA 1P48A 1QWKA 1V0MA 1JG9A 3FN9A 2O56A 3KDOA 1DJXA 2GLKA 4CN6A 4FX7A 4LYPA 4MB5A 3EXTA 1C7TA 5C9XA 2BXZA 4JTHA 1CGYA 1E55A 4R34A 4HOXA 3UR7A 4TX8A 3HG5A 5DT5A 3LMYA 4AVFA 2XJ7A 4C90A 1Z44A 4IMAA 1XLJA 3GG1A 4MYXA 4RW5A 5JBEA 4L5ZA 3AS1A 1BF6A 4ML4A 3VIFA 3L0KA 4ICCX 4DLFA 1O7AA 4F0RA 4F0MA 3N19B 1HUVA 2D22A 4B5XA 3B8DA 3CWHA 4OJYA 3N2XA 3W6LA 4Q4QA 1XWYA 4IJBA 5C71A 2BHYA 3BAKA 1RSCA 3WX7A 4G2DA 3LCLA 3IRSA 3DN5A 3WQFA 2W63A 1E5NA 2VX5A 4YMZA 3TKFA 1XIEA 2XM2A 4Z42C 6TIMA 3AU6A 4QIUA 3DAQA 1I2PA 1JRCA 3U4FA 4S3EA 2IKGA 3DXIA 3VNMA 1E0XA 1FWNA 3MKKA 1GONA 3KCLA 5EY5A 4H9ZA 4BEQA 2J9XA 2B7PA 2IKIA 1JZ5A 1Q45A 3AYTA 4E2VA 3S6DA 3SUWA 3WD2A 3KBVA 4MMWA 3VD3A 2OX4A 5KEZA 4B91A 4F8XA 3HJEA 3WN6A 1U83A 3W1XA 3VIMA 3IGHX 3P14A 2FH8A 2FB2A 3L2LA 4IIGA 4YNGA 2G4FA 2PTXA 5D2YA 4AC1X 1OX6A 4PUEA 3WKZA 2F8QA 4D6IA 4HSOA 5F1VA 4BQ2A 2BVYA 3VOJA 1OM0A 3NL6A 2Z2BA 3MU7A 2I9EA 3GHSA 1PZ1A 3KRSA 1EDGA 1EGMA 4C1NA 1XHGA 1OYBA 1CXIA 4JFTA 1VIWA 3HF3A 2EO7A 2W79A 4PCFA 4A8RA 1F4HA 3PZQA 4ENLA 1G5AA 4X61A 3NL3A 3FY1A 3F4DA 7TAAA 3CT2A 4AF0A 1TPH1 1D3HA 1KTCA 4HHHA 2HQAA 1QW8A 4LEQA 1MUCA 2CWNA 3REQA 4GVIA 4M56A 3RR4A 2NV9A 4G7EB 4MVAA 1OYCA 5C0QA 4W8LA 3E3HA 3ABQA 3SN4A 2Z7GA 4C6DA 2PRMA 3F2DA 5CEWA 5EBAA 4GC3A 1F73A 3JVAA 1ISYA 4Q4OA 3NQ2A 1ZS2A 1ZBVA 1HJUA 1X98A 4BF7A 1O4UA 1NU5A 2PCEA 1YPIA 1EGZA 1KQZA 2DFAA 1XLIA 2VZTA 4P7NA 3S1GA 2E5BA 1MW2A 3GC2A 1Z89A 4KS0A 1Q7ZA 1HVXA 1OD8A 1WUFA 4MOZA 4ATDA 4LBUA 2HBXA 3LM3A 2E67A 4BF9A 3B8VA 3V0UA 3NZ1A 1NOWA 1XP3A 5AYXA 1O5XA 1PPIA 1ONWA 4H6EA 2ZXAA 1XF0A 1YE4A 3N3MA 1K6AA 3NQGA 4K1GA 2ZCGA 1GYLA 1JAEA 5LNVA 4GIRA 3AZTA 2WK2A 1E0TA 2F2KA 1EH9A 1OF6A 2FFCA 3VE9A 2GQ3A 3LCHA 2V82A 2WSPA 1XIFA 2B7OA 5F1UA 1KBKA 4LYKA 2XGBA 4XV0A 2W0UA 3KL3A 4WQ6A 1DIEA 3DFQA 3SN0A 2OLSA 4LAZA 4XVDA 3WDIA 3FYYA 4PRWA 5T26A 5I23A 5EFFA 3CUGA 3VC6A 4RCXA 2QCCA 3FA3A 3PHAA 3N17A 1AVAA 3T4CA 4IFKB 1VFSA 2BS9A 4YYCA 1XDMA 4TO8A 4FNTA 1A5KC 5AHEA 2WNWA 5A6SA 4X2PA 3W72A 1M03A 2ALDA 2XWEA 4FX8A 3WQGA 2VENA 3TZNA 5GNZA 3JUGA 4D9PA 4H7ZA 5M3WA 2EGZA 3TYBA 1GYNA 2YDQA 1V0LA 3HB9A 2XN1A 2WWDA 3B9AA 5FF3A 4HMDA 5REQA 4N2YA 4L4PA 2PLJA 3W81A 3PSWA 2YCEA 3URBA 4HPJA 3UQNA 5AOUA 4NI3A 3AALA 3W1MA 3DFOA 1DXFA 4G56A 5XINA 3QBUA 5EMJA 1FH8A 2D0GA 2QV4A 5DMLA 3NZPA 3C6CA 4FOKA 2PRHA 3UXIA 3QV7A 1IXPA 3AIRA 2NWSA 5HUPA 3N9SA 4LUTA 3LNPA 3PJTA 2Q8ZA 1TRIA 3AZRA 2PGRA 4RKAA 3CUHA 1CLVA 1KBJA 1UR3M 4MDOA 4E8GA 1H7RA 4DUOA 2I5IA 3W0KA 2J7DA 1G0CA 4BK9A 5I0DA 1RH9A 4DO7A 1XIHA 4XBKA 1OK4A 1Y65A 2C7FA 3VNLA 1DWGM 5I3IA 3P3BA 4BI7A 2D2GA 3TC6A 4LUSB 3N6HA 5BROA 4MY1A 2OZ0A 3PF3A 4WSKA 1M9HA 5JBFA 2FHBA 5LGZA 3K1DA 4CUCA 5A95A 3P67A 1BRLB 1HL8A 3KP0A 4GZEA 4HOWA 1KA9F 4MZYA 2FJUB 3VK5A 1Q2SA 3FA4A 3UG8A 2CWXA 1OQFA 3AOFA 3FAWA 3S1UA 2BZNA 5AVNA 3A4XA 2Z2UA 2YYTA 3S5NA 2JF7A 3LXCA 1JRBA 2B0MA 1QPNA 4DYKA 4TQTA 2VP8A 3NUKA 4UTIA 1AH0A 4DJFA 3THQA 1BYCA 3WLRA 1NAL1 2J6XA 1DJNA 5BNKA 3O0FA 5DCEA 3R8HA 4ZENA 3OEXA 2ZUMA 2QUMA 2FHCA 2UY3A 1QI5A 3LYEA 1QBBA 4E4PA 2A21A 1W1IE 3A3XA 3TJIA 1HO1A 1CT5A 3TVAA 1QJWA 3VOIA 1DJZA 1LL6A 3CL6A 4I90A 2P53A 1UWUA 3FS2A 1Z8AA 3QR0A 1SMAA 1ICSA 3RLGA 1PYFA 5E0FA 5A6MA 1BTCA 1RBOB 2CERA 3WL0A 5K3VA 3QV9A 2IKJA 4RNJA 3UZWA 3C0LA 2D0FA 3B9NA 3FJNA 2OX1A 1NM9A 1F76A 3T6CA 4R27A 3S9ZA 3UZXA 2VOMA 2VZOA 3CMGA 5FIPA 3BJTA 3SRDA 1LBFA 3R10A 4FZIA 2IQ0A 3CL7A 1PS9A 4JTDA 3WEOA 4WRHA 4O1DA 2V9DA 4RZBA 2CLMA 4PSPA 1MVYA 4C6PA 3KCOA 1WKDA 1SFJA 2NVAA 3BZGA 3RIKA 3DFSA 5LXEA 2BVWA 4GUHA 2ZWZA 4Q32A 4JFVA 5AC4A 3LCFA 3DERA 3LG3A 4AVNA 3TOPA 1KBLA 4M1RA 1JUKA 2DORA 1R86A 5D32A 3E1F1 2DT1A 1NWUA 2VUYA 2GGHA 7REQB 1XRFA 3KAOA 3QC3A 4C6CA 1F8IA 1PTDA 2ATMA 1EA9C 4PTDA 3R94A 4GPNA 3ID7A 4AZCA 4UTFA 4O1EA 2VRJA 2NVCA 3S2NA 2PTDA 4WEVX 4P8UA 1DJHA 4IWWA 2I57A 3B0YA 2VD9A 3G5EA 1WDQA 3KLLA 1GCYA 2ISVA 1B57A 1F07A 2I14A 4ZOBA 5BXTA 4FP1A 1GVQA 1MXSA 3M0ZA 1DWIM 5DEZA 1XIBA 3GG8A 1Z9AA 4IPPA 4CQBA 4B5NA 1PTGA 5DY2A 4DBUA 2YYUA 1P0EA 3TYEA 2PDHA 2YXGA 1GG0A 3QQ0A 3BMVA 2ON3A 1E73M 2PB1A 5CSSA 1E43A 3GUGA 4LCRA 4QG9A 1WNOA 1VYSX 4IGMA 3HGJA 1GPWA 3QC0A 4GVGA 1GQLA 2ODOA 1AH4A 3RJYA 5G4WA 1BSLA 1UB3A 4UOJA 3GK0A 5I79A 4IL0A 1QNOA 2DH3A 3ABOA 1F6KA 1JCJA 5FKYA 1K7FA 4HPNA 1QNSA 2PDWA 3F4NA 4H6QA 1GVFA 3ZVIA 4ZBCA 5CC6A 1JYWA 2P50A 3QM3A 3GG7A 1VYRA 1UHVA 3NIYA 1OT1A 1WPCA 4US5D 4RNFA 1W9XA 4O4WA 2OKOA 1CBGA 1H7WA 1KQYA 5KZDA 3WUEA 4NJHA 3CHVA 1ITQA 2WM0A 2P8CA 3TN4A 5LIYX 2ZZ6A 1A5OC 2PS2A 5CQ1A 2CXEA 3W82A 5EBUA 4KBXA 1ZP3A 4EKJA 1FWRA 4NAFB 3B4YA 3VCCA 5GQBA 8A3HA 2WSQA 4YJ5A 2UV8G 1YMYA 4UFIA 4FXRA 1UD3A 4PA8A 1C9WA 4F0LA 1JCNA 3CZKA 1R9YA 1HJXA 1A3HA 2UBPC 4QJ4B 3SURA 2W6RA 3OA5A 3CB3A 2YLAA 2VEIA 3C8FA 1TQXA 4O8RA 1V02E 3SCRA 5CZSA 3HV9A 1GPFA 5CC7A 2X40A 3V5CA 1FUYA 1J0HA 1MNZA 1J10A 2J66A 3VIOA 4YTRA 4FEZA 1HW6A 3AAMA 3SO7A 3M44A 5LNRA 4HKPA 4WUIA 5IXEA 4JGDA 4QQUA 4TMCA 1QXLA 4GYPA 5A3HA 1EHAA 4QNWA 3LB0A 3RCMA 5L9FA 2FFIA 1SJDA 2PZ0A 4MJZA 4PULA 2WKGA 1BYBA 1PDZA 2V2CA 3PTDA 4GISA 3PANA 4G7EA 4UUIA 1NDVA 4FF7A 2BY0A 4QS5A 2WXDM 3KRUA 3C56A 4DRSA 1BQCA 4DXXA 3ZWTA 1XM3A 4Z17A 3BMXA 5I02A 3P84A 3UW6A 1DQWA 2KZHA 1FOBA 4QSHA 2XIIA 4E4UA 2CHOA 2WNZA 3DU0A 5HR6A 2VQTA 3IAPA 1CDGA 2A7RA 1LL7A 3UYCA 4EXBA 4A8IA 1CXFA 3CK5A 1SW3A 5U7SA 3PY2A 4QEEA 3ZR5A 3G1AA 4XZ9A 3W1RA 3P2VA 4PUWA 3A21A 4MJ4A 2QPXA 3MYPA 1QI2A 4H9XA 2BDQA 4QJ3B 3B9EA 3VIPA 4WHBA 3H70A 2PU0A 4Q8PA 1ZJBA 3IJ8A 3XISA 3Q58A 1OYAA 2O55A 3C2OA 4PN2A 2VGGA 3IVUA 1UA3A 5F2IA 3BTNA 3W85A 2C14A 3S6TA 2CU0A 1OADA 1XCFA 4REQB 3AUOA 4EXAA 3EWCA 3LI1A 4W8AA 1V3KA 3IIZA 2NQHA 1QPQA 1JGMA 3CMJA 4AHQA 1JZ8A 1L6SA 1IGWA 3HV8A 4ZE5A 1HKIA 3L4ZA 3QJAA 1XLMA 2B31A 3CEUA 2VC5A 2D3LA 3N12A 3LHYA 2WVTA 4HK6A 9XIMA 3MKCA 4M5PA 2HXTA 1VS1A 4IFKA 3GIQA 4QAIA 4R9XA 2P76A 1R30A 3I68A 3NQCA 4B2DA 5CAHA 2CNCA 3P93A 1Q6EA 4LSBA 1E71M 3AHYA 1K8XA 4FNSA 3EKGA 3T44A 4U5IA 5GPRA 1GG1A 1X39A 2VGIA 6A3HA 3SCOA 2G37A 4BWLA 1TPWA 3ICJA 3HO8A 1X8CA 2F6XA 3UG3A 2HK1A 2Z27A 1KM2A 1LG1A 2JE8A 4Z2KA 3TP4A 2GZXA 3RO8A 2YB1A 3ARYA 4XZLX 2AL2A 1LOQA 1UJQA 3ITYA 3CLMA 4JTIA 2JGQA 2BV9A 4GY1A 2RDXA 1R3YA 3L5AA 1PKLA 1H7XA 3U5UA 4OOZA 3S5YA 1P0DA 4GY0A 4IGSA 3CUFA 4Q6JA 3NZRA 1TZZA 3TMLA 4WDXA 1JIBA 3ARXA 4HZ6A 1PX8A 2Y62A 3MCOA 4S2CA 2WVVA 2NX3A 5FF2A 1VEPA 1SW0A 4G5DA 4LTSA 3STFA 4LY4A 5EU9A 1FKWA 3CZ8A 2V5DA 5HQEA 3W6MA 4AMAA 1E0UA 3VNKA 4UQDA 2XINA 2OKTA 4AISA 3DHFA 1A0CA 5CKSA 4Q7BA 1FXPA 2WHLA 3II1A 1SFTA 2P0IA 3KEHA 3GDBA 4ONVA 4S2BA 3UESA 1JDAA 1BF2A 3GC4A 4LUSA 3ZJ7A 4QJ1A 3C4UA 1PCWA 1QBAA 2CLEA 4C7FA 3UR5A 2PTWA 4XZBA 4MB1A 1BRLA 3PZ9A 4XUGA 1P0NA 4PRTA 4WK9A 4EP8C 1V93A 2C1IA 3AO0A 2CIPA 4LC6A 1UIPA 1CENA 4PMDA 3BO9A 1A80A 1AL7A 3VOGA 1FWIC 4WY0F 4JIIX 5BXPA 1B5TA 3V18A 4H8HA 7ENLA 4Q8NA 3HIJA 4UMBA 3RLHA 1OX4B 3RMJA 3C0JA 4GLEA 4HN8A 1TRDA 1LRQA 3WDPP 3KHDA 4MFEA 2L5HA 3G1FA 4GZ7A 1UP0A 1WKYA 3NSNA 3OO2A 1SSGA 2CITA 1XSKA 4LVGA 4QITA 3WK3A 1NOFA 2Z6JA 3O3RA 3VDCA 3NFUA 1KWKA 2GGEA 4CNNA 4C6BA 2WCGA 4XD5A 3ZVHB 2OU4A 3EMQA 3K46A 4C1KA 2UZ9A 1UH4A 3B9OA 1SSDA 2CLOA 3TNOA 1YEYA 2YCLB 1CLKA 3UJ2A 3FJ6A 3QEZA 4F48A 2XDFA 5DMYA 1XYAA 3BAIA 2CXGA 3WO8A 3NQDA 4IMCA 4OE7A 3ZFHA 5GJMA 1V51A 1JULA 4H2HA 4H9UA 4ZMGA 3R0KA 5EMYA 3GHTA 1R2TA 2C0AA 4IUOA 4D71A 4R85A 2DJXA 3WH8A 5I77A 3ES7A 2B7NA 3L12A 3EEZA 1K8ZA 1TCDA 4JYFA 4GA8A 1WDSA 3PG9A 4H6RA 5E6ZA 3SB0A 3WFAA 1XI3A 4JNYA 1J9YA 1ZAIA 3NL5A 1AQFA 3WBYA 4JXCA 3SSZA 2I5GA 3GVRA 8CGTA 4URIA 1TPEA 3SN1A 2FGZA 4CCEA 3U2OA 3K8KA 1VRDA 1GQJA 4JHZA 1K6WA 2BOGX 1TJ0A 1LCOA 1U33A 3EEGA 2OFJA 1TWDA 4F9DA 5ABTA 5DN1A 1FWAC 4LU0A 1HKWA 4GFIA 3SY5A 4LYRA 1AQ0A 4L4MA 3N4FA 3LBOA 1PHWA 3CMFA 4DPPA 2ZE0A 2WHKA 3LQGA 3WDQA 3PZMA 4D2JA 1XFBA 2BASA 2DVTA 2QS8A 3KZSA 2YW3A 4QE4A 1GZ1A 3THDA 3W24A 4S38A 5G4EA 5AHMA 3SBFA 2X1UA 4TR9A 3PUEA 4QSFA 3UY7A 3DBPA 3D0CA 3ZZ1A 3BQ6A 4R53A 2WVSA 3R11A 2WYSA 3KTSA 1M41A 1F6PA 3LXAA 2GVYA 3UGRA 2PA6A 3GNNA 4JTUA 1JGIA 1VLIA 1UD5A 1Q8JA 3AIWA 4PYSA 1A5NC 3BURA 1TV5A 3L5MA 2Z00A 3EPNA 3KS6A 2IPWA 4O1BA 5AN7A 1DHPA 4B3ZA 1KXTA 4ORMA 4XO6A 3HU7A 3VIJA 2DT0A 1Q6DA 4GINA 4TOQA 3I10A 1PE1A 4WJXA 3VKAA 3W71A 1M68A 1VBRA 2GDQA 1GKRA 3CJPA 2QJGA 5G1MA 3B03A 1FTXA 1KFLA 1MWOA 3NTYA 3I4KA 1VC4A 1ZGDA 3NQEA 2DPEA 1KR1A 1US3A 4MPKA 1ADDA 2P1FA 3WMSA 4MM1A 2ZA2A 2PDYA 4E8DA 5JUVA 1TV2A 2CLKA 3DI1A 2NQZA 2WJZA 1XYCA 5ENLA 2EPHA 5TIMA 3M64A 2XHYA 5E09A 2CBIA 1RVKA 3LM7A 1OWQA 2PTYA 4CN1A 2R24A 1L6WA 3E0WA 1JF6A 5JIPA 4DXVA 3W1LA 4NAFA 4LT9A 1V3JA 2ZTJA 5E0KA 2ISDA 2GYIA 1PKMA 4I5XA 3IJQA 1XYFA 3DUGA 1PIFA 3M5XA 1DJGA 2O0TA 1YE6A 5BXSA 4I5UA 1R6WA 4O50A 4OVXA 4AZBA 2HS8A 4MLRA 1EUAA 1XLCA 3GR4A 5ECUA 1FY6A 2AMXA 2X30A 4L65A 3BGJA 3W87A 3H2FA 4I5RA 2UY2A 4PZVA 4F2BA 3ATYA 1M65A 1WV2A 3WJXA 1QCWA 3AWOA 2JEQA 2QYGA 2VGFA 1TPC1 1GVYA 3H53A 4A29A 2XM1A 3GXPA 5D9OA 4RW3A 4P7LA 2RUSA 2YXXA 1KXHA 3OZOA 4GH3A 3AS0A 4V1XA 4XX6A 5LXXA 5C6MA 4B4HA 1XG4A 3SCVA 2EKCA 3QRHA 4RV8A 3IRDA 4EAYA 3TQVA 1OC7A 2Z4GA 4XZIA 3QY6A 4O57A 3FSUA 1QVBA 2PGWA 4DWSB 4LF1A 1AH3A 3W75A 2DW7A 1HNYA 1F5ZA 5BWAA 1XSIA 3OBAA 2OVLA 3HURA 3WNPA 1VD6A 1Z7AA 3UT0A 5CGMA 5KETA 2GJNA 4Z0JA 4EE9A 4QM1A 3EWYA 3O06A 4PMUA 1AD4A 5HMSA 2PD9A 2XVGA 4AZHA 3RPTA 2E6YA 4UFLA 4PTWA 4AY1A 2ZUUA 1EBHA 1ADOA 2ISSA 2C6QA 2C13A 2V0TA 1H2JA 3LZ5A 1H1NA 5A6KA 1P7TB 3SGGA 3T0AA 1BKSA 3O6YX 5D37A 4UTLA 4CN4A 5RUBA 1ZCOA 5FEWA 2X1IA 4OU1A 1B3WA 1S2WA 4B15A 1TFVA 3BL3A 3I6TA 1AK5A 4A35A 1VJZA 2Q01A 1XH2A 5LA2A 8XIMA 1E9IA 3JS3A 3TQKA 1S46A 3PTQA 2A3LA 4ASTA 3LY0A 2BB0A 1I1XA 1UW9A 4WGHA 2GOKA 5C7VA 4E0CA 3AIVA 1DEDA 4JQAA 5J04A 3U9IA 2E9MA 3TTSA 2V68A 4WCJA 3B05A 3AZSA 3RHGA 2PSNA 4V2XA 2R1PA 3LGDA 4QE1A 3TR9A 3K30A 1R47A 3JU2A 3FHAA 3RLVA 5AZ1A 4GWEA 1GK8A 4JY8A 2X41A 3WMCA 3QHNA 2J8TA 5CSRA 2A0NA 1DPMA 4C6LA 3W4RA 1JDDA 1M01A 4LPCA 1RPKA 4GHRA 3SEPA 2FTPA 3WJWA 1BVWA 4PC8A 3MO7A 3T2QA 4A3UA 5I24A 2PRLA 2ZVRA 1NELA 1I75A 2DSWA 5DBUA 3EOLA 2E4TA 2ZRZA 3CEPA 3VZXA 1ZY9A 4WOZA 3ZLHA 4S3AA 4R7WA 4DAFA 1LBMA 3RX4A 2I16A 1QFEA 4IIFA 1ZQ5A 1TV7A 3N9RA 1W3LA 1XLFA 3S3GA 4RXGA 3PZUA 3W02A 3UXKA 4W5UA 9CGTA 1WO2A 3I7QA 3WNOA 2VYOA 2XU2A 4HPHA 4HU0A 3UJRA 4P61A 3ZJKA 4HT3A 4QROA 5XIMA 3MWAA 1YDOA 1NARA 4AX7A 4C6NA 3WUFA 4GJJA 2YA1A 4ZOAA 3KCJA 1FDYA 4JD4A 1CIUA 1LOSA 4ZB2A 1I6NA 4FMVA 1VFFA 2V38A 1UR8A 4JDBA 4O0ZA 3L2MA 3WBXA 3EKZA 3NVTA 2PWHA 2PDQA 4DJFC 2E8YA 2O9TA 3C2RA 1GUVA 1IEXA 3O6DA 2BLEA 4PMNA 1GQIA 5HR7A 3DHUA 1NJJA 1PUDA 2CBUA 1XDJA 2V81A 1C8QA 4IX0A 1Q13A 3NXLA 1ZRQA 4ES4A 2QJNA 3W2UA 3EB4A 1NP2A 1NSJA 3GTNA 3QV6A 4IJCA 1ZPTA 4XD3A 3EKLA 3H2AA 3U7VA 4DO5A 2QAPA 1GJUA 1DP0A 1XGEA 4R9OA 2PWEA 4JICA 4BHYA 4MYAA 4JTGA 3OQ8A 1GW1A 1RJPA 3IIXA 2V67A 1JXKA 1W1VA 2OSXA 3EOOA 1LQAA 4CKQA 2VXNA 1CXKA 3W7MA 3WQVA 3WELA 3L4XA 3OG2A 4B5WA 1EO7A 3T78A 3NQFA 5HPOA 1OBAA 1UYQA 1BYDA 3CV7A 1EX1A 4O10A 2BY3A 2BXYA 1DE5A 4N9BA 1RLDA 2VDGA 3AXIA 2OWXA 3CAWA 3EWZA 3F5KA 3EZ4A 4TIMA 4K8GA 1HG3A 4K68A 1X96A 1PXGA 1AODA 3N2MA 1XC6A 3WLSA 2CKRA 2DIEA 1UZHA 4NNAA 4XAFA 1YX1A 4CVUA 2QJJA 1Y0EA 4LVBA 4PBFA 2GWGA 2YCLA 4ZQCA 2QQ6A 2FQIA 3S1WA 4H6KA 2ACSA 2ZOXA 1OFBA 3BLLA 3D6NA 4O28A 4NZ3A 2POZA 4ZSUA 5F7UA 3TA6A 3M7SA 5BRBA 2GGIA 2XSBA 1T0OA 1VFUA 4Y2WA 3ELFA 1B3ZA 1MZRA 1SM9A 1I8JA 3P60A 2AQVA 1DIOA 4XB3A 2A2IA 1PVNA 2E9BA 4C6EA 3WEMA 3GBEA 3M0YA 5LHEA 1P1MA 5FSDC 2R6OA 1OHLA 3C8NA 3IJ7A 4V15A 1EO5A 1IHIA 4FR1A 1XLDA 2X2GA 1MZHA 1A3XA 2Y4SA 2DQWA 2R1LA 5CPTA 5C5YA 3F2CA 4O52A 4ROQA 5I3FA 2XZ9A 3BLPX 4PH6A 4JKLA 2A1YA 4GZIA 1YXCA 3TAKA 2Z1VA 2OZTA 5CPSA 3CIVA 4JY9A 4CGTA 3KBNA 2DSUA 1OFEA 3FXYA 3A13A 5FCZA 3VGDA 1YRRA 2H9AB 1RAKA 2Y61A 1BKHA 4GUGA 4P8VA 3EOUA 3L23A 4MY8A 4XVEA 2NUXA 3MMDA 3LCXA 2J7GA 4GVFA 1W32A 4JTJA 3PBVA 1SMDA 2OMAA 1JYXA 5BRQA 3W74A 3W7HA 3R0UA 4CCZA 3PR2A 2YCJA 1TPUA 1OVDA 1ONEA 2Q3RA 4HHMA 4CU8A 1L0PA 3L68A 4CQ9A 3ENLA 2R1NA 2X09A 3WNMA 4W86A 4IPJA 2ZX7A 1MSSA 2XN2A 2VI0A 2CKSA 5A6LA 1KC7A 1UCWA 2HMCA 3T8LA 1TB3A 1WP6A 2ZBTA 2NXHA 1EC9A 1NDZA 1S5NA 3WBWA 1KM6A 5CJMA 4DUXA 4LV9A 2VM8A 3LN3A 1XFCA 4FX6M 2HVMA 1KRAC 2ZRWA 1GZJA 2Z1KA 4HHLA 1JUBA 2D20A 3K4AA 4RK8A 4OFCA 4PCSA 1UP3A 5A8GA 2QF7A 3PC0A 2EHHA 2XGIA 1VBUA 1MDRA 2QXWA 4JTLA 1JDEA 3OLEA 4IQEA 2WSKA 4AWEA 2FZDA 3MO4A 4ERAA 2ZQ0A 1E72M 3CWNA 3WLKX 1RA5A 2OZ8A 4DNHA 3Q37A 1Q5MA 3EWWA 1GORA 3LCGA 3CIWA 4J9JA 5I3HA 2Z1BA 3A9IA 4L80A 1T8XA 3PUOA 4FOJA 4G7FA 4CD4A 3TXVA 3PUDA 3S83A 2PDMA 4XAPA 1ZZMA 3ABRA 3STCA 2ATSA 1NQKA 3QW4B 1RK6A 4CNSA 1GHSA 3B8UA 4IXXA 4J3TA 3T1GA 1GEHA 3MZNA 4NT0A 4LJ3A 2J7EA 2H3DA 3RLUA 3TSBA 3OA3A 3ALFA 3B97A 3GR7A 1S2AA 2WC4A 4E2DA 1RCOB 1UKPA 3USZA 4KGLA 3W3OA 3UG4A 1RY0A 3K5XA 3KVKA 3ITGA 3VIIA 4ZFMA 3H21A 1RLCL 4GYPC 4YTQA 5DLCA 2AL1A 1X97A 4FHAA 1UD6A 1CXHA 5ABHA 3L66A 4Z2LA 1C29A 3THAA 3VVGA 1CXLA 4PGLA 3A4JA 3NA8A 4C7GA 4ZB0A 3UZZA 3GNRA 3T07A 4K2SA 3P5ZA 5BZAA 1OF8A 1JYNA 1EIXA 4WOQA 2Y24A 4F0SA 5DMMA 1TJ2A 1KW1A 3LPPA 1Q6CA 3JW7A 1X1NA 3ZYZA 1H11A 1ZUAX 1EQCA 2EQDA 1MW3A 4CEXC 1R3WA 1XLEA 3C5QA 5G2IA 3W88A 2QIIA 4L4LA 1IEIA 1HFBA 2FMNA 1T7LA 2QLYA 3BDKA 4EPBC 1NDYA 2HTMA 1XUZA 5D30A 3B40A 4RPPA 3TLLA 3HFTA 5FEXA 2F6UA 4GH1A 4MNLA 2WSYA 2O4QA 1KCKA 3G1RA 3ERPA 2YB4A 1WOBA 4FA3A 1UASA 2BWGA 3GX9A 4NILA 2AQOA 3WK0A 4M80A 3WDHA 5AFDA 2ZICA 4I3GA 4OWGA 4ZO8A 3BGAA 2QUNA 4AC7C 3VCRA 1O95A 3U2EA 4DWSA 4IZGA 1Y5VA 5FJTA 3DKJA 1ZFJA 2YSWA 3CTTA 3E0FA 1EJRC 2HVOA 1CXEA 5AHIA 3W2JA 3NXFA 3VO0A 1XD1A 2V5BA 2H90A 2REQA 4U31A 2ZA3A 3PAOA 2ONEA 3HPAA 3FCPA 4E5TA 1JCLA 2XH4A 4Y6GA 1GZGA 1YPFA 3S9IA 2DZTA 4MAVA 4NVTA 5A6BA 1IZKA 1W5QA 3O6CA 3LZ3A 2TRSA 1J79A 2YGYA 2C1HA 2G97A 2ACUA 1IIGA 4GK8A 5AB3A 6ENLA 1MDLA 2GQAA 4WKAA 2XVPA 5AKQA 1TQJA 1IZJA 3GRIA 1MXGA 3AMLA 4XAZA 3QGAC 1G7VA 1O66A 2WAGA 3UD6A 5CH9A 1JUEA 2XFFA 2QUTA 3GLCA 2GDUA 1MFVA 3WF0A 2B81A 5TNVA 4E6MA 4Y9OA 1W3JA 3CC1A 1UUOA 2OOGA 1P7TA 1KRMA 2DT2A 3ONCA 3N2BA 1SU5A 4LCSA 2ZIDA 5C70A 2NLIA 2PWFA 1GOOA 3M41A 2VHLA 4D6HA 3SUSA 5TF0A 1V79A 4BWLC 4U10A 3E0VA 3GVWA 3H2CA 3OW1A 3BGGA 4FI4A 2TSYA 3GW0A 4US6A 3XINA 2RGMA 2C79A 4GO8A 3DBNA 1VRXA 4B2DD 5HNUA 1JD9A 4NRRA 2WHMA 1EDQA 2ZZ3A 3CHCA 4TTGA 3HGSA 2AMGA 3WQEA 1PWLA 1VPQA 4CNPA 3EDFA 3OLIA 3GO2A 3O8AA 1W91A 3VD4A 2W61A 3C3UA