1AH3A

Aldose reductase complexed with tolrestat inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
314
structure length
314
Chain Sequence
SHLVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKREDLFIVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKDPFPLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYNRNWRVCALMSCASHKDYPFHEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A 'specificity' pocket inferred from the crystal structures of the complexes of aldose reductase with the pharmaceutically important inhibitors tolrestat and sorbinil.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
total genus 100
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ah3A00
3LNMA 4EXBA 2PDJA 4LAZA 4JTCA 3V0TA 1GVEA 5LIYX 2PDFA 1MRQA 3MC5A 3LZ3A 3GHSA 1PZ1A 3R8HA 4OTKA 3BUVA 4GA8A 3GHRA 5HNTA 1US0A 2IQ0A 2BP1A 1ZUAX 4JIRA 1HW6A 3V36A 1S2CA 2PEVA 4MHBA 1VP5A 2PDPA 4JQ4A 1M9HA 2F38A 5AZ0A 1EL3A 4JQ2A 5AZ1A 4FA3A 2FGBA 4LB3A 5HNUA 1ZGDA 2R24A 4ASTA 1IEIA 3UGRA 3LN3A 4DZ5A 4EXAA 1LWIA 3ERPA 2PD9A 3UZWA 4XVDA 4GCAA 2AGTA 4XZHA 2CLPA 3UP8A 3LENA 2FZ9A 4PMJA 3BURA 1AFSA 2IKIA 2I16A 1AZ2A 3B3DA 4JTRA 4FALA 2PDGA 3N2TA 3N6QA 1PYFA 4R9OA 2PDXA 3V0SA 3VXGA 4IJCA 4RPQA 4L1WA 3BCJA 3R8GA 2HDJA 1X97A 3CV7A 2DV0A 2I17A 3UZYA 2HVNA 4ICCX 1Z8AA 3G5EA 3LZ5A 4IGSA 1AH4A 2FZDA 3R6IA 1YE6A 4JTDA 4XO6A 2IS7A 1PWLA 3LEPA 4JTAA 1X98A 2INEA 3RX3A 5JH1A 3ONBA 4PUUA 1FRBA 1A80A 1Z3NA 1IHIA 3WBWA 2IPFA 1XGDA 2IPWA 1S2AA 2PFHA 4JQ3A 4WDUA 4H8NA 4Q3MA 3WBXA 4WDWA 1RY0A 2IKJA 1RY8A 5HA7A 1YNQA 4DBSA 1EKOA 1Z9AA 3WG6A 2ACUA 2HEJA 1X96A 4JTQA 1LQAA 4PUWA 4YS1A 1AH0A 3O0KA 1XF0A 3LD5A 4WDXA 4YVXA 4DBUA 3LBOA 5LIKX 4GABA 4QBXA 4XZMX 2F2KA 2FVLA 4YVPA 1Q5MA 3Q65A 3LQGA 2R9RA 1SM9A 3T42A 4LB4A 3F7JA 4WEVX 2PF8A 3UWEA 3GUGA 2BGSA 2BGQA 1UR3M 1YNPA 4PRRA 2PDUA 3LQLA 4G5DA 4XAPA 2PDQA 1ZQ5A 4LBSA 2VDGA 1T41A 3CAVA 2WZTA 3FX4A 3FJNA 1S1RA 4I5XA 2FZ8A 3M4HA 2ISFA 4H7CA 2PDHA 3H7RA 4ZFCA 3C3UA 4XK2A 4FZIA 2NVCA 3EB4A 3RX4A 4YU1A 2P5NA 1PWMA 3R94A 1S1PA 1MZRA 2IPGA 2FZBA 4WDTA 3H7UA 3GHTA 1OG6A 4AUBA 2QXWA 3D3FA 5LIWX 2IKHA 1QRQA 4JQAA 3M0IA 4GACA 2IPJA 3UZXA 1PZ0A 3COTA 2INZA 3UZZA 4HMNA 5KETA 1VBJA 4GIEA 2NVDA 3UG8A 2A79A 3UYIA 4IJRA 3WCZA 2ACQA 2DUXA 1JEZA 4XVEA 3V0UA 3GHUA 4XZNX 2HE5A 2PDNA 4YVVA 4LBRA 3S3GA 1R38A 3M64A 4NKCA 1EF3A 4XZIA 3R7MA 3ONCA 2PZNA 4XO7A 4JQ1A 2PDIA 3CASA 3Q67A 5LIXX 1C9WA 3DOPA 3H4GA 2HV5A 4QXIA 5LIUX 4HBKA 3O3RA 3NTYA 2ACSA 2ALRA 1K8CA 2WZMA 5C7HA 2HE8A 3EB3A 3R43A 3MB9A 3EAUA 4WGHA 3CV6A 3KRBA 4GQ0A 3V35A 4L1XA 4FAMA 4QR6A 1HQTA 4PRTA 3BV7A 3RX2A 1T40A 4JIIX 1ZSXA 2IQDA 3CMFA 4LAUA 2PDKA 4XZLX 2PDYA 2PDLA 1QWKA 2PDCA 3LUTA 3CAQA 4F40A 1MI3A 1RALA 3DN5A 2HVOA 1Q13A 5DANA 3WBYA 2ACRA 3UFYA 2IKGA 3G1RA 4WRHA 2DUZA 3R58A 2PDBA 3U2CA 1YE4A 4QX4A 4PR4A 5JH2A 4JIHA 1EXBA 3QKZA 4GQGA 2PDMA 2J8TA 4Q7BA 1AH3A 2PD5A 2PDWA 1J96A 1AZ1A 4DBWA 1Z89A 5M2FX 2C91A 1XJBA 1ADSA 3P2VA
chains in the Genus database with same CATH superfamily
4RUBA 1V3JA 4MFEA 3O0FA 3OA5A 1EXPA 5CAKA 1OC5A 1UG6A 2CERA 3MVIA 5ECUA 1MRQA 3RNDA 4QDMA 5E93A 3GHSA 1JCNA 3BPWA 1UD2A 3STCA 3UQNA 2C71A 1EWEA 1AA1B 3IJ9A 1FWFC 3TSBA 1XH1A 3W2UA 4FB7A 4PUDA 1CXHA 1VS1A 2B0MA 1E51A 4P7RA 3UYCA 2BXZA 2DIJA 4PTDA 4WIWA 3ARQA 4KCWA 2DH3A 1OFPA 4ENLA 4PCPA 4ASTA 3TJIA 1LWJA 1JL8A 1PIGA 4JTIA 4PUMA 4F2TA 3L0GA 3BOXA 3ERPA 3BGGA 4ZSUA 4HSOA 5BRBA 1EJWC 4I7VA 1ZAHA 1DHKA 3SQMA 4RZBA 1AZ2A 4J40A 2R91A 3GXFA 3B3DA 1ZBWA 3OZOA 4Q8QA 4AX6A 3UF9A 2QW5A 1KB3A 3N73A 3IJDA 4LV9A 2HS8A 4BQ2A 2ISDA 4Q33A 2WB5A 4J28A 3AHTA 3WQ5A 3WEMA 1KQYA 1ME9A 4YXGA 2Y88A 1VKFA 3G2GA 2DV0A 4GZIA 3TR9A 4GNKB 3CTLA 1EJVC 3K5XA 4M56A 4WY0A 5HOSA 3CQHA 3PC0A 1DWHM 1PO9A 1TPC1 3CYJA 3FVMA 4GBUA 3F4WA 3GSMA 3W7LA 3B4UA 3RRXA 2C0AA 4TOQA 1V0MA 4K68A 1P0DA 3FV9A 2Z27A 2BOFX 2G3MA 3W6LA 2WJEA 1GKRA 3KVJA 2JKEA 2VZUA 4TVUA 1TPDA 1YNQA 4MJZA 3S47A 1KTCA 1W54A 3RPDA 3TTOA 4WQ6A 3LPGA 5KTLA 4CCZA 4ES4A 1T99A 4YS1A 3AQUA 4OIFA 1UR0A 3NAVA 2E77A 3LBOA 4EF9A 1J79A 1BTMA 2GLKA 4YVPA 1WOBA 1GQKA 4ZVJA 1Z44A 3AWOA 4UFJA 4F2BA 3VIKA 4PMOA 3N6HA 4JKMA 4MKSA 4KWVA 4HJWA 2GDUA 4J3WA 1I75A 5EGRA 1OHLA 1U33A 2Z1XA 5DMNA 2XDFA 5LXXA 5CPLA 3P82A 1IE7C 2OSWA 3G0SA 1D9EA 2CZVA 3PANA 1AMYA 3SGZA 3H54A 3GAKA 2MANA 3WLIA 4QIUA 1Z69A 1JZ7A 1UP3A 2VR5A 2G3IA 3WUEA 4N9DA 3NEVA 2GJLA 3I4EA 1E1CB 5ENLA 5AYYA 4MB4A 3DGRA 4KH2A 2EG6A 3R94A 5D9MA 2V5BA 3C2OA 5H6HA 4X63A 1LROA 2ZOXA 4H6KA 4XAFA 2YBTA 3VX0A 2O9TA 1BWKA 3H7UA 3IARA 4R9XA 5DMLA 2DZXA 1FVPA 2FJUB 5BXTA 3D3FA 2DIEA 1G5AA 4FIRA 4Q4QA 4C6QA 4JPGA 4D8ZA 4K7YA 1MO0A 2O9RA 1KFEA 4Q7NA 4EAMA 2Y4SA 4HN4A 3UZZA 3R79A 1GW9A 3DG6A 3B0XA 3MMTA 3TH6A 2Y8KA 3UG8A 2V5KA 5B7ZA 4BQ5A 4JS3A 3MUAA 5BOFA 3GZAA 1KM1A 2HJPA 4DY1A 5CJMA 2PDNA 4YCPA 3WQCA 4JBRA 8XIMA 5D2YA 3T7VA 4GYPA 3U7BA 1NDZA 4R85A 5HMSA 3VKKA 8RUCA 4HIBA 2JIWA 1W5PA 4US5D 4ONVA 2NV1A 4US6A 3N13A 4FF5A 1H50A 1RR2A 4Z2KA 2QV4A 4MNLA 2VDIA 4EANA 3CO4A 5LGZA 4C1NA 5A8GA 1K8XA 5A2AA 2UY4A 4D8LA 2XIBA 3F4VA 3PB2A 4JICA 1L8PA 5MKGB 1Q63A 2VX6A 3A5FA 3F4DA 4XG1A 2AAMA 1V0LA 1QMLA 3PWAA 4UNKA 2TPSA 3PPHA 3Q94A 1R3VA 4NT0A 1RQBA 4DJFD 3AS1A 1SW0A 3VINA 4IWWA 2RDWA 4UNIA 1LL4A 1JPMA 4HCLA 5FEZA 4B15A 4NU7A 4UQBA 3WUFA 4B90A 1JUBA 2FHBA 3MUY1 4G7FA 3SB0A 3RILA 3ZO9A 4LS2A 1QPRA 1Q2RA 1F4HA 2Z7KA 2X1IA 1XS2A 2GSEA 5D2VA 1DXFA 4RKAA 2P10A 1FDYA 1OF8A 3TYAA 4XKYA 5E1QA 4ADSA 1RSCA 4YMZA 2BNJA 2XYLA 5CG7A 4PR4A 1NP0A 4PFHA 2QPSA 2Z1WA 2XVKA 4EX4A 3WH6A 2D20A 3G1FA 3D47A 5KZDA 2CBIA 1LWHA 4NUWA 1RVKA 4QSHA 3N4AA 4OKDA 2GK1B 1NH6A 3KBMA 4WY0F 3W72A 4N9EA 3LHYA 3LA4A 2ZRZA 2R14A 4HA1A 1JDFA 5H1WA 3VDHA 3CLMA 2BHUA 2EPNA 1FH7A 3RN6A 4JTCA 2R94A 3N1AA 1O7AA 4IG2B 3V5CA 2VEKA 1NF7A 3O6DA 2WSQA 4L4MA 1HVXA 3UY8A 3JVAA 1JPHA 2WHJA 3U9IA 2E5DA 4JEJA 4J35A 3TQKA 3VUSA 1US0A 2BP1A 1FCBA 4BK9A 1BVWA 2ZXAA 4IFKA 5F1UA 1UH4A 2I5GA 1O5KA 4QISA 5HULA 1TUXA 4I90A 5BXRA 3CWOX 1I45A 1V08A 4ORMA 5DRCA 5EFDA 4XZBA 2RDXA 5G2IA 3N12A 2Y62A 3W7HA 3MCNA 2OELA 3LN3A 1Z41A 4EXAA 3ZMRA 5A8PA 7TIMA 1S46A 3QPZA 5U7SA 3UCCA 1VF8A 4GCAA 1X1OA 3BLDA 4HA3A 3QV6A 4XZHA 4W7VA 3DESA 1NFBA 1YW1A 3LXAA 2J7HA 1SO3A 2I5QA 2HPIA 3GNOA 5CAHA 4B3KA 1QCWA 1PZ3A 1TRIA 4QJ5B 5HQLA 1VFTA 5LNUA 3W1MA 3TONA 4Q22A 1TB3A 3UR5A 4BQ3A 1IZKA 4IJCA 4O57A 3A47A 4G6CA 3S6OA 1X97A 3FK4A 1ODZA 4PTXA 4NZJA 5IDZA 1P1XA 1AD4A 3TVAA 1FFRA 2CZFA 3R6IA 4I7WA 3T40A 3RYSA 4B16A 2EF9A 2YBUA 2IS7A 1PWLA 4EACA 4DJED 1X98A 4HA0A 1BVZA 3RX3A 4PBEA 1J8VA 3ARPA 3T0BA 2DZSA 2G3NA 1QPKA 2W92A 2OLAA 2INFA 4I6VA 4AVNA 2G0WA 2P76A 4DWDA 4G7EB 2PFHA 1YADA 4UNLA 3NZPA 3AOFA 3L4YA 4IXHA 3IACA 3E0FA 5HJLA 4LYQA 4N4PA 3TIMA 1OIFA 3SADA 4IZGA 4AIOA 1XIHA 2R1LA 2IQTA 3TYEA 1KCLA 1LQAA 2JK2A 2X30A 2FLIA 5G1MA 5KMYA 4Z2IA 3LD5A 3IK2A 3U5UA 4S3KA 2QUTA 3B8UA 4L1GA 1K9DA 1MXDA 1K7XA 1OYCA 1O60A 1SMAA 5HMFA 3DHFA 2ZA3A 4QJ4B 3P0WA 2FQIA 3W7IA 1VD6A 2J7GA 3QLDA 4FNUA 4GZEA 4Q32A 1KTNA 3VM5A 2GSJA 4JCLA 1ZQ5A 1FTXA 2PS2A 1UR4A 2QPUA 4KGLA 5AC5A 2FFCA 3KRZA 2W6RA 4I5XA 2VQTA 4BF5A 4RDZA 3MBDA 3NZQA 5EB8A 3FDKA 1FKWA 2QCEA 5HQMA 1XV8A 2VZOA 2ISFA 4ICMA 1ZTVA 2CLIA 2W91A 2VQUA 4IIDA 3QZEA 4GGHA 2PDHA 2YL8A 4K8GA 3OZYA 1MEIA 1L6GA 1N2VA 1K3UA 5A95A 3WH9A 1EUNA 3USZA 1XC4A 3VX1A 1ZBCA 9RUBA 1A3XA 2WLZA 4ZTXA 1L6YA 5CZ0A 4W5ZA 1BQCA 2P5NA 5LKYA 1PAMA 3EX2A 2GQ8A 3M6DA 5FACA 3T1GA 2QCGA 3UA3A 4D6EA 4HNUA 4LUTB 4XZWA 1U30A 3C0SA 5BMWA 3N3TA 1TV4A 1PUDA 2R1NA 3GU1A 2EQDA 3GNRA 2XZ7A 3TAKA 1X39A 1P7TB 4DF1A 4WR3A 1QJWA 3GYEA 1DWFM 4FR1A 4ZQRA 1QW9A 2J74A 5G2HA 3IJQA 1XQLA 4OQVA 5LGXA 5AHMA 4KFPA 2JKAA 3IIXA 2ZWZA 1Q7MA 4IXXA 5CBBA 4LANA 2Z0IA 3N19B 3V0UA 1DWGM 4UQEA 5B7YA 3AI0A 4ZE5A 4NNBA 7CGTA 4GI9A 4A8NA 1EPVA 3TWAA 2QDEA 5DN1A 2YL9A 1UB3A 3FLUA 1IIGA 3DC8A 1DIKA 3TC3A 3TZNA 3F4NA 1U83A 4QP0A 1H7XA 3THDA 3GVVA 5A3HA 3LI1A 4IHCA 4GFSA 2E1WA 3NZRA 3JW7A 3H4GA 4DJFC 2WKLA 3B8DA 4I8YA 4X2PA 1TFVA 2WZMA 4QNWA 3QYQA 4H2CA 3WBEA 4PMUA 1C29A 2G8ZA 2Y1HA 1W5OA 2BVDA 1E3ZA 2ZUTA 1NM9A 3QTGA 2OYMA 4KMQA 4Z2JA 4PL1A 2YOCA 4IP4A 2NQJA 3ANUA 4XZLX 3QFEA 3LGDA 4PMVA 3VNZA 3W2KA 5D37A 4RV3A 3S8HA 1QWKA 3FA4A 5I02A 4HB7A 5KEZA 2HVOA 3MHUA 1Q4NX 3C61A 3CUIA 4CNTA 3IGSA 1YEYA 3CXOA 2IKGA 3G1RA 4BEQA 4OJYA 2DUZA 3URAA 3HURA 3U2CA 5I7GA 5JIPA 1BAGA 5A2CA 2PRHA 3W75A 2WNZA 3T08A 5AC6A 2H6RA 4X2RA 4DM2A 4XTIA 4A3QA 3E0IA 2EPHA 5DMYA 1IWAA 3CQ0A 3QR3A 1YMYA 1O66A 3W82A 4ZE4A 1TMLA 3WMBA 4NXSA 2OQLA 1QI5A 3SCTA 4GLEA 2PDWA 4C6DA 3KS6A 4N6FA 3R1ZA 2VGGA 3VTRA 5ABGA 4QQUA 4E6MA 2V3FA 3WLRA 1GZGA 2VNCA 1X1ZA 1XL9A 1BXBA 4JY8A 3RFAA 1OEPA 5AYZA 4G1NA 2GGIA 3NQVA 3V4BA 4XKYB 1EDTA 2E09A 3EPMA 3CB3A 2YX0A 1QO5A 2D1ZA 3PB0A 1KO0A 3RLUA 3WSUA 3H7VA 4LH8A 1QHZA 1XLLA 3NVTA 2QQ6A 2IXUA 3ARRA 1CGXA 1L2UA 4DEFA 3K46A 5I77A 4IPJA 3M0YA 3RO6A 4FNTA 3M5XA 4EF8A 4QFUA 1SJBA 1ME7A 1PKMA 4JTHA 1NOWA 2ZDSA 3N34A 1IZJA 3KOZA 5D9NA 4QE1A 4CQDA 1C8XA 3TTSA 3L66A 3LENA 1C93A 3VE7A 4BR1A 4CNNA 2XGZA 1IT8A 5HMEA 2HNHA 4QAWA 4JR5A 5I03A 1AMKA 4LQ1A 1PCKA 3S2LA 3VDBA 2FH8A 4YTRA 2YYTA 2FTPA 4FLQA 1M03A 1QNPA 1PHQA 2C19A 1RVGA 3BDKA 3WNLA 4IIFA 2WKGA 3TYZA 1JYXA 3PJTA 1XI3A 3FEQA 3BLLA 3IUIA 2FDMA 2FZDA 1R47A 1GOKA 1TMHA 3AIRA 5CXPA 5CGTA 2WCSA 1L2QA 3CHVA 4C1KA 4PUUA 1AD1A 4LT9A 5D2WA 3MWAA 1RCQA 4F79A 3ZIZA 1R85A 1MDRA 4WDUA 3PNZA 3GXIA 1RY0A 5FSEC 1EJRC 1QXLA 1S5MA 1UD3A 2CC0A 4KCUA 4RDVA 2YL6A 2V3EA 2QJGA 2DVTA 3UJRA 1PKNA 4J3ZA 1EKOA 1HKJA 5JMUA 5BRPA 2G4JA 3DGBA 2QJJA 1Q45A 1Q6EA 3QPEA 3NM1A 5F2IA 4QAIA 4S38A 2Y85A 5CKSA 3C52A 1XF0A 4ZB5A 1YXCA 1X1NA 3BCFA 5EBAA 3G8EA 4HYRA 1V7YA 2HQAA 1Q5MA 4N42A 1QDSA 1WNOA 1R87A 3W0KA 3NPVA 3KWSA 3RCYA 4ZGYA 1W5MA 3VCCA 3WMLA 3GTNA 3WF4A 5D03A 2ZKMX 1XLHA 2P3EA 1HIZA 2NLIA 1GHRA 2X1TA 1EHAA 5LA2A 1QU4A 1VHCA 1CGWA 1FHLA 4CD7A 3NNTA 4IL2A 2WZHA 4M5PA 1E5JA 3TMLA 3H2FA 1FWWA 4LF2A 4PUKA 3STEA 3VCNA 3EWYA 1O1ZA 4H6RA 5JIWA 4LFYA 3TQ0A 4Q4KA 2W27A 3ZT5A 3ABOA 3TQVA 1CB2A 1KCKA 1MW2A 3GDKA 3WD3A 2NWRA 1SFJA 3SUVA 3ZJKA 3WQEA 4JHOA 4REQA 1Q8AA 3W23A 3SRKA 4CNPA 1DTNA 1UD4A 3F03K 4JTKA 2YGYA 3ZQ9A 4P7LA 3UWQA 3O07A 1HT6A 2NT0A 1MVYA 1SR9A 4TX8A 4C1LA 1SO6A 3SY8A 1NWSA 3NQ8A 1XIDA 4U2YA 3NDZA 4GVGA 3SCQA 1DP0A 1HO4A 2CFFA 4JFSA 3L4WA 2BY2A 3TP4A 1CXLA 3PJWA 2AL1A 4IMAA 4CU7A 2VOTA 5C9RA 3AZSA 2AOSA 2QCLA 3M0ZA 4HN8A 2QGHA 2BY1A 2E7FA 1W9BM 2ANUA 3O16A 4MGGA 4F9JA 3HO8A 3MSDA 1E0WA 3QW4B 1JF6A 1PSCA 2WJFA 3GBDA 3NPUA 1R5YA 3AMLA 4IMFA 1LLZA 3PM6A 1KBBA 3WK0A 4YL2A 4M3PA 3LSBA 3GVQA 4B5NA 2J8GA 2CETA 5BOOA 3R7MA 1PTGA 4HNLA 4GO8A 3UXIA 2XWEA 1T0OA 3U5YA 3CNYA 3WKZA 3TN5A 3BAJA 3G3DA 3AXHA 2P8BA 2OG9A 3KLKA 1CZ1A 2ON3A 4E4UA 3VDAA 3MUXA 5T9BG 1EX5A 2YDRA 3OVPA 2ZVRA 3OB8A 1RD5A 5K3VA 4C90A 4KCVA 4D6HA 4HPGA 2NXIA 3HA1A 4H19A 1W32A 4C7DA 1JF5A 5HJYA 1GK8A 1OZMA 1E55A 3PY2A 1GWJA 3ZXWA 3SI9A 1HJQA 4JYEA 4UOZA 1KLYA 1TJPA 1CGVA 3LRKA 3AJ7A 3WLSA 1OWQA 1U1JA 4D6FA 3S1UA 2QNEA 2YFOA 5E0FA 3PK7A 1EP3A 3EXTA 1HFBA 2PA6A 4UUIA 3GDLA 2Q01A 2GJRA 1HGYA 2DY3A 3QR0A 2I1OA 1AJ0A 2RH9A 2Z1BA 2XVPA 3EDJA 2PU1A 3PZQA 5AVHA 4OUEA 2XSXA 1E0TA 4DZAA 3TV8A 2VEPA 4C91A 3ZFHA 1AH3A 2E0PA 3N04A 1Z89A 3CEUA 4GISA 3LCXA 3KBVA 1K9TA 2X8RA 3JZEA 4IJBA 3WJWA 3P2VA 3MV01 3NQFA 3W38A 1KXQA 3OHMB 1TE1A 4ZB2A 4RZ4A 5LIYX 5I06A 2PDFA 3S2NA 2WBGA 1VFHA 3R8HA 4O10A 3DEQA 3NQAA 4OTKA 4O8RA 2D0GA 2H8XA 2OZ3A 1CIUA 1VB9A 2QUUA 4AY7A 4M19A 4PEKA 4AY1A 1DXEA 3R12A 3TOPA 4DYEA 1DIOA 1A5OC 1S2CA 2PDPA 5DT7A 1KFJA 4OHQA 5CC7A 2A6NA 1P0KA 4GQRA 5E6ZA 4WKFA 1R6WA 1QOXA 1XPGA 1GVSA 3ZLHA 3UXAA 2JF7A 1EPXA 5FEPA 3CS2A 3HV9A 4XWUA 3VIHA 1VFOA 2WMGA 2RFGA 2G41A 4GD0A 1IWPA 2E6DA 1X8CA 2VR4A 3DFSA 5F4WA 2AGTA 3UP8A 5DCBA 1CX9A 2I16A 1GVRA 1IIHA 3N2TA 1TJ1A 1VFFA 3GUWA 1J2WA 1IXPA 3GXMA 1PHWA 3EKLA 1TCDA 4QG8A 3ZS4A 3ARUA 5A6MA 2POZA 4DWSD 2OZ0A 3W00A 4LYPA 3WMCA 4DO4A 1PJ9A 1G01A 4P8XA 1CI1A 3GE7A 4GJ1A 2HVNA 1RCOB 3LZ5A 1WYIA 3EEZA 3UXLA 4CU6A 1TA3A 3WFZA 2EPMX 1WXYA 1CB7B 1H7OA 4NL1A 4AISA 2NXGA 1MNSA 4DNHA 4JQ3A 1XDMA 2ZX9A 1QNVA 4DNMA 1GQIA 4Y8EA 3W22A 4M81A 3VKJA 3G0XA 4DUVA 3QC0A 4NZFA 3NWRA 4GZJA 4X9SA 2BG5A 4RNIA 2NX3A 1X96A 1S2UA 4FXFA 1AH0A 5FA5A 1LOQA 3O0KA 3SEPA 3W86A 2Z2AA 4NZCA 1U1HA 3KBNA 4C5YA 4DZIA 3U48A 3HBLA 3LQGA 4H9ZA 2VGFA 3QC3A 1ISYA 4ZOBA 4NZ3A 3DKLA 2J88A 1GQJA 4I7UA 4GJIA 1C90A 3QXBA 2DZUA 3E9AA 4IPNB 1P48A 2BS9A 4MIMA 3MWCA 1KQZA 3UCDA 1BYDA 2VFHA 2ZRXA 1LUCA 5C2XA 4ZOAA 1TPUA 1XRFA 2BDQA 2OGJA 2O9OA 3ATYA 4A8LA 3M4HA 5DO8A 5FAGA 1F7BA 1WXZA 4MB1A 3G22A 2PTXA 3ZM8A 4A21A 2O56A 3NO5A 3VNDA 3UXDA 5AC7A 4ML9A 1BG9A 4MPKA 5C6MA 3N17A 4IIBA 1XHGA 2X7VA 3HPZA 4X3ZA 1XFBA 4H9MA 1PDZA 2O92A 2QAPA 1PX4A 3EB4A 4D6DA 2PWFA 2BV9A 3V1HA 2UY3A 1FUYA 5CH9A 2VEIA 3VKAA 3VAVA 4O1BA 3IUHA 2OQYA 4D71A 2FZBA 2F6KA 4S23A 2Y6ZA 3UA4A 4QHRA 3TLQA 1SPQA 4ZR8A 3A64A 3PP7A 5EYWA 1XCXA 4JL2A 1L6FA 5DFAA 2VX7A 2BY3A 4D6JA 4K7VA 4LRSA 5SWUA 2GJPA 2DGAA 3WQGA 2HZGA 3CMJA 4JNYA 4Y7EA 9CGTA 2NX9A 2XVLA 4B4HA 3WLLA 1V7AA 2DJLA 4K8EA 2Z2BA 3W7MA 4AF0B 1CXFA 1IEWA 3G3MA 1FWEC 3ABSA 3M5VA 1E40A 5I3DA 3IJIA 3RGTA 4LSBA 1GT8A 5J8LA 2HE5A 4GBDA 2VEMA 2WHMA 1X6NA 1PPIA 1XBVA 3NQ2A 3SECA 1J6PA 1K9EA 5CBJA 3M64A 1XYCA 5A94A 4H2HA 5I79A 4S2CA 3K4AA 4H9XA 3KOFA 1DJHA 1RBAA 3E2QA 5A6SA 5K4XA 4HT3A 1H41A 2AGKA 2DT2A 3XISA 1LL7A 3S6DA 3SCWA 4OFCA 2F8QA 4HVXA 1S38A 1HUVA 3THCA 3VKDA 4FNPA 3BLOA 1J0YA 2ZFAA 1VRXA 4W93A 1TREA 1KGXA 1H7WA 4Z17A 3LV6A 1EB3A 2Z1SA 3JS3A 1KFKA 4JZ5A 4K6AA 1TELA 1KA9F 1XW8A 2WLYA 1BWLA 3H23A 3RX2A 4DWSC 3BAIA 3ITOA 2DZBA 4AWUA 4C6JA 1T96A 2KZHA 3T4CA 4LPCA 4FMVA 2ZXQA 1D3GA 4DM1A 3KM8A 1LG2A 5DANA 1I0DA 1IT0A 4ICNA 4O4WA 3BC9A 3C2VA 4CD6A 1YE4A 4UR8A 4GGBA 2QJHA 3ITYA 3OW1A 2BX7A 1S3HA 1XISA 4IFKB 3M9YA 1E6QM 1SQ7A 2CNCA 2DW6A 4ZXLA 4GQGA 3R2GA 4O8AA 4XSMA 2FPYA 1XIFA 1VHNA 3IS4A 1YTEA 1KNWA 2E28A 1H61A 2V81A 4Q8VA 3OOQA 3MZ2A 2VO5A 2W63A 2WJDA 4AWSA 1ADSA 3BARA 2XIJA 3N9RA 2ZZ4A 3W2NA 3MJMA 4J5NA 4IMGA 3MC5A 2V3DA 1WKYA 1SFLA 1EJTC 4DO7A 3N25A 3TYCA 3MUZ1 1ZAJA 2ZCGA 1W5QA 2PODA 3FFSA 2GJXB 2IQ0A 4LUTA 2HSAA 3MPGA 4QG6A 1HW6A 3OBEA 4F0KA 3OQEA 1E1EA 3I3EA 5AZ0A 1G1YA 2WANA 3LGEA 3VGBA 2NT1A 4O1DA 5CZSA 5M03A 1TIWA 3FYOA 2VX4A 4HHHA 5HNUA 1ZENA 4DQWA 2NSXA 4A8IA 4AZ6A 5I3JA 1NWTA 3UGRA 2OWWA 1JZ2A 4XD6A 4L64A 3F1QA 4NI3A 3AWNA 3UR8A 3LPFA 2OSXA 5D09A 1QI3A 1ECEA 2CWNA 3P7YA 3M1ZA 3ZT7A 4S39A 2J62A 1RK6A 4O15A 1FWDC 1WKDA 2P8CA 4LX4A 4MG4A 4C1NB 3WQ4A 1LM1A 2PGRA 2PWDA 4C6IA 5DXYA 3C2YA 1D3HA 2OWCA 1MYRA 3BCJA 1CTNA 3BOLA 3ANVA 3A9BA 3THAA 3HQOA 3UZYA 2UBPC 2YZ5A 3RAOA 2VP8A 1JR1A 1REQB 3SFWA 1A0DA 3IRSA 4LYKA 1SR0A 4PCTA 2EPOA 3RLHA 4S3FA 4O16A 4XUYA 1A80A 1JZ5A 2IPFA 1R86A 4DWSB 6ENLA 1ZCOA 3W1AA 1B9BA 3GTFA 3OBAA 4Z0SA 5HR7A 1XX1A 1ZJHA 5F7UA 1V0NA 4RR4A 2R1PA 4DJFA 3W7KA 3GNXA 5HWMA 4UMAA 4MYXA 1Q6DA 1C92A 1MW3A 3P61A 1D2KA 2ZE0A 1CWYA 1PKYA 2XN0A 2C1GA 5LIKX 4U5KA 1F61A 5IHSA 2AKZA 2GWNA 3UBPC 4C6OA 5BU6A 1ICQA 4NVTA 1R0MA 1UR1A 4GX8A 2DFAA 1TV7A 4FX8A 3VM7A 3RPTA 2RGLA 1EP1A 4J3VA 2XGIA 1AQFA 3I7QA 1GYNA 4YTSA 1GOXA 2PDQA 3BL3A 1R30A 4R7WA 2HTMA 4B5WA 4DYJA 1RD6A 3KUMA 1HVQA 1S1RA 4LCSA 3CHDA 4J2PA 1OX5A 4DO6A 4EWND 1AQMA 4CQCA 1WDDA 3QMTA 4CVWA 4CQ9A 3PZUA 4O0ZA 2X2GA 1XYFA 4PULA 2E5BA 3HF3A 1ZZMA 1S2WA 1TPWA 3BSHA 2XH4A 3EPOA 2Q8ZA 3BAYA 4PSPA 4OT7A 3CB8A 3AU6A 2Q3RA 1POKA 4IFOA 1WA3A 5FSDC 3GHTA 2VWSA 1MW1A 3WNNA 2OOGA 1AJZA 4W85A 2C1HA 3GC4A 3UERA 3M0IA 1POJA 1R3SA 3PZMA 3NOEA 3CPGA 3LBCA 5HAOA 2OGYA 3M0KA 1ZPTA 3W70A 4XTDA 4JIQA 1BF2A 1J0ZA 5PTDA 3ZOAA 1V51A 1OADA 3VFCA 4LS1A 4Z2HA 3C3NA 3W29A 4AHQA 1JXKA 3LHVA 3IVTA 3N6JA 1A5LC 2WM1A 1DXIA 5HINA 3GHUA 3A6OA 2VFDA 4O1FA 1F6YA 1GKQA 2X16A 1QK0A 5BXPA 2Y0FA 4HK5A 4AX7A 2FMNA 2PZNA 4IIHA 4B5TA 5LHFA 4I5UA 1DIEA 4M1RA 2NLYA 4MTVA 5XINA 1RJRA 4NZ4A 4DO5A 3OBKA 3ANYA 2V5JA 3B9DA 1KWGA 4GK8A 1FP8A 3NTYA 2J9YA 1U2YA 2XFYA 2ZZ5A 3QKEA 2Y5JA 3W7RA 2GGEA 3GR7A 3OZMA 3QH2A 5CSRA 4JHZA 1H49A 1TE6A 3QW3A 4BCEA 3ALGA 3EKGA 1F07A 1F3EA 1SO5A 5GJMA 3TAOA 1A5BA 4MY8A 1JFHA 3OGSA 3LMZA 4ZZ9A 3Q37A 1H1YA 4A05A 3AO0A 4O12A 1W3KA 3C0QA 4URIA 4GUHA 1GVFA 4LC8A 4U2ZA 2CZDA 3G77A 1MI3A 1BQGA 3WBYA 1JPKA 3GTIA 2QIIA 4ROQA 5HNNA 4S3JA 3HTWA 3S1VA 1U22A 4MZ1A 1RLCL 2PDBA 4RNHA 3UVIA 1H11A 1HTIA 4LOCA 1GJUA 2VC5A 2J78A 3F5LA 3URBA 1LUCB 1TZ7A 4JIHA 3IGHX 4L9YA 3PF3A 2A0NA 3LCGA 3DUGA 4KF1A 2PDMA 3IAPA 2PD5A 6A3HA 4CD8A 4D2JA 3TW7A 2VDHA 1TPFA 2YW4A 4LU0A 1A47A 4O28A 1W9UA 1KR1A 1RCXB 3LNMA 3NZ1A 3PZ9A 2PDJA 1G0CA 1TRDA 4H9UA 4AVOA 3GXDA 2V2HA 4DAIA 3LM3A 3HG4A 1RBLA 2YA1A 3I7SA 1C3FA 1JCYA 5TF0A 2Z7GA 2QLYA 1B3VA 3QSTA 1E9LA 4LEFA 1J6OA 5FF4A 3W2MA 4JTJA 4MWAD 3MKKA 3T07A 3P14A 3VYLA 3FJ6A 3KRUA 4OUIA 3SY5A 4XAZA 2F38A 4H41A 4KFOA 1J12A 3WELA 4FXRA 5LNWA 3R13A 4V28A 1MFUA 2V5LA 3NXFA 2R24A 1YTKA 1EZWA 4M6UA 3U8GA 1VFMA 3OVRA 1BEUA 2E1DA 1P4CA 1DWJM 4FNQA 3KVKA 1UR8A 3KRSA 4KESA 1OK6A 3S9ZA 4LVGA 4IGMA 3GB6A 2GOUA 3ZSTA 3BGAA 2CXGA 2E3ZA 2DEPA 2XIIA 3FW6A 2Z00A 1VIWA 1OB0A 3TTYA 3GXPA 1I8JA 3EWWA 3WLQA 4RPQA 3TA6A 1VBRA 2OLSA 2HBXA 1G4TA 2ZYFA 1LT8A 1JZ3A 1WUEA 3DCPA 3RR4A 2I17A 4PB3A 5AC8A 2CLLA 3IK4A 4IGSA 3H2MA 5GNYA 4JFWA 2XPKA 4PC8A 2RGMA 4XX6A 2EHHA 2PP1A 2ZZ2A 3GFYA 4S3DA 3AS0A 4FO4A 4PN2A 1EGMA 1IXQA 3B8VA 4ZTYA 4YJ5A 2Q71A 4ZOCA 1OCBA 3APYA 4AVFA 5BWAA 1WAUA 3FY1A 3WDJA 4XZ9A 2ONEA 3IJ8A 3KFTA 2HVMA 4NNAA 2QDDA 1UP2A 4K1GA 4XV0A 3EA2A 2OODA 3E5PA 3I7RA 2FB3A 4PUWA 3M0VA 4Z1BA 2D2HA 3ME3A 2CHNA 4LWWA 1EHNA 4KERA 5KZMA 4MNKA 1EBHA 3NQMA 1DWIM 3OLDA 3T55A 2R9RA 1W3JA 1VYPX 2DH2A 4BI7A 4CNUA 3VA8A 1ODUA 2BGQA 3Q58A 2DP3A 4X9YA 5FJRA 4M6QA 3GW0A 3GBEA 2XJ7A 3RM9A 1S39A 3H55A 1UWUA 4LBSA 2ZUVA 3UZ5A 2VDGA 2LLEA 3PG9A 4JAWA 1T41A 3LRLA 4WKAA 1H0IA 1KRBC 1V79A 3SCVA 3EDEA 5HDRA 1NARA 1MW0A 3H2EA 4IM4A 3RU8X 2ASHA 4AU0A 1KRCC 1VPXA 2W62A 1UZHA 2AL2A 3W88A 4DHGA 1IXOA 4XKMA 3W71A 1NSJA 1JNEA 3VUPA 2PBGA 3R4IA 3KL3A 3SO7A 3GG1A 1AG1O 4PGLA 4A3YA 1TPB1 3W7GA 1FH9A 1YXYA 4ZQCA 2V8ZA 3LMYA 3PBWA 2PCQA 1EA9C 4C6BA 4UFHA 2JEPA 3CT2A 1UIOA 3RR1A 3W7DA 4NXKA 2QDGA 2WKJA 4V1XA 1JULA 1A53A 2WVTA 3F5KA 3SIZA 5LZLA 1E0VA 1AQHA 2A3EA 4KBXA 1F9CA 2R8WA 4WLCA 2OZ8A 3B03A 1UC5A 1SZRA 3FEMA 4PH6A 1KLZA 4RE2A 3NXLA 2FTYA 4AZHA 1GZ1A 2V2DA 1MQPA 3MUCA 2NZLA 4IX0A 3B8WA 3TFXA 2X0SA 5C0QA 5KITA 3W1QA 1UKTA 3WLNA 3UVAA 2GVJA 3EWDA 3WNPA 2OO6A 4NG3A 4V1YA 3J7HA 1MXSA 1RQEA 2X2YA 3W28A 4U28A 2YJQA 4C6EA 3S3GA 4B3ZA 4DAFA 3DIPA 3K4DA 3TOYA 3GQYA 2WPGA 3EX3A 4L4LA 1LTDA 3OLEA 1BYCA 1V3IA 3QJAA 4GI6A 1FWGC 1TA3B 3HFTA 5C2CA 4C6PA 1BF6A 3NL3A 4GIAA 3INPA 2NWSA 3BG9A 5G4HC 3EEGA 4QS6A 3Q67A 2HPMA 3O3RA 1WUFA 2VCCA 1ZBVA 4C6KA 1EDQA 1ZJAA 2JALA 3V5FA 2QCHA 1AVAA 4JTEA 4LXFA 3T6CA 4E3TA 3LNPA 4WSKA 3QOMA 2IXVA 1V6YA 5LA1A 3MB9A 1HKMA 2YXXA 2E5CA 2ZUUA 4DRSA 5G1YA 1RPXA 3KRBA 2E9BA 1W1VA 2WSRA 1FWTA 3PZVA 1JZ4A 3S2MA 1ZSXA 2XH2A 1O5QA 3CK5A 4K2SA 4F0MA 3CJPA 3PBVA 4YCOA 2VC6A 1DE6A 1SJAA 3GDMA 4FNRA 4AYSA 3MDUA 5D02A 3CWNA 1Q13A 1UA7A 1HL9A 3L0KA 4Z08A 3H4WA 1XLKA 3UY7A 4IT1A 1E15A 3L7RA 3O7UA 2Y24A 2PP3A 1Z32X 1I6NA 1LBMA 5D2XA 1ALDA 3U7VA 4WSHA 3QSRA 4FLRA 3QPYA 3W2LA 3QKZA 3SCRA 1E43A 3CMGA 3ISIX 1XYMA 4JNZA 1V6WA 3PWIA 1JQXA 3G1HA 4PA8A 4FI4A 3WLOA 1ONEA 1MUMA 3GVRA 4HOXA 2ZBTA 2BWGA 4E4PA 1BYAA 1VYSX 3T44A 1D8CA 2PUZA 4CD5A 1WZKA 3LY0A 2ZXBA 4C7GA 5M17A 1HJXA 1DQUA 4IIEA 4KS0A 2ZTJA 3PWGA 1B3YA 1P5BA 4MLRA 3SFKA 3BVJA 7PTDA 3DHDA 4IH3A 3L4UA 1YXDA 2PEVA 3MA8A 1FHUA 5AECA 4EAYA 2TMDA 5AFDA 3VNIA 1S2VA 3F2CA 4MSSA 4S3BA 1J0IA 1PKLA 3VE9A 2V30A 3THUA 1TSIA 3VGHA 1IEIA 2WWDA 4MNJA 3WUBA 1ISVA 1U5VA 1EC9A 1HKWA 4ZSTA 3KL5A 4QDWA 4FNSA 2Z29A 2E9MA 2XFWA 2Q09A 4ECLA 4XBKA 3B9EA 5DMMA 1TWSA 1WDWA 2GVGA 3GR8A 3HB9A 4MWAB 2FZ9A 1CBGA 3BURA 1XDLA 5JXQA 3WZ0E 1UOKA 3N4EA 2XTKA 3TTEA 4S3EA 1MNZA 1E56A 2WO5A 3WH5A 2QF7A 3RM8A 3P0XA 2AQVA 4FR6A 4R9OA 3WO8A 4F0LA 1FHVA 3QHMA 1VJSA 2EKGA 3LK6A 4PEEA 4UOJA 1V03A 2VM8A 2ABAA 3VIJA 3CIXA 3DAQA 3MSYA 3P60A 1B2YA 1Z8AA 4Z1CA 4RNJA 2PRLA 1YE6A 3AUOA 3KEHA 2QJNA 4AD0A 2HBVA 4TQTA 2VJXA 2VRJA 1H7PA 1FQ0A 4K38A 3CUJA 4FS9A 1PBGA 2PWGA 3R0DA 4LVBA 3RK8A 1CW2A 2OKTA 2C15A 2WQPA 5C9XA 1FWSA 3CZGA 2F61A 2OX1A 3TCSA 4Z2LA 3BXWA 2Y7GA 1B4EA 3MP5A 2Z4GA 2X0HA 1PE1A 5I3FA 1VH7A 1OABA 2RKXA 5HA7A 4IQLA 4IQJA 3EXRA 3UWVA 1P7TA 3CM4A 4CQBA 3AYSA 3GDRA 5DELA 3WF0A 4E2BA 1LG1A 1NFPA 5CSYA 1WDRA 3C2FA 3ARTA 4DBUA 4YWSA 2G4FA 4NY2A 1XLDA 2JF6A 2UY2A 4YTUA 4WZHA 3WH7A 3B97A 2YLAA 1T8XA 3W3OA 3MTWA 1O5RA 2DT3A 2PSNA 4UFMA 4PRRA 5T9CE 2WAGA 3QQWA 2YDQA 2XIOA 2Y5EA 4C6NA 3L5LA 1EX1A 1K77A 3IIOA 3VOHA 3L21A 1Y0EA 4IOTA 3F4CA 3SSZA 1EFZA 3W1PA 4ZO9A 1VGAA 2JFEX 2HWGA 4Y8FA 2A6LA 1SJDA 1LQ2A 3BMXA 2XVGA 4KRUA 5EMUA 4REQB 3I68A 1TTPA 1J93A 1LRNA 1Y5VA 3BLPX 3VIIA 1VJZA 1S5VA 1W8GA 4F66A 3APTA 4AQLA 4TVCA 3HGJA 1K70A 2H3DA 2I14A 2IPGA 3ARYA 3VGGA 1AL7A 2VELA 1X6LA 1OFDA 3RMEA 3TWBA 3VNJA 5FJJA 3DH7A 4C6LA 4AUBA 3GNPA 2QXWA 3OA3A 3P62A 4FP1A 2YIHA 4HCHA 5H2ZA 2XU2A 1ZRQA 2CEQA 4FSAA 3TA9A 3AHZA 3COTA 3HPAA 2G50A 1F76A 3GVWA 8XIAA 4HHMA 3WEOA 1EYEA 4OOZA 4TVDA 5TD4A 3L68A 1A0EA 2GUYA 5ABFA 3T4WA 2IW0A 2FDSA 5AHNA 4U3CA 5EFFA 3ITCA 3WDPP 3WDHA 1EF3A 4JTSA 4L9ZA 3NEHA 1JZ6A 4QG9A 1GEHA 2WYSA 4JX6A 4H4IA 1NU5A 3OTRA 2CXEA 4WVXA 3ITTA 5A8NA 3ITGA 2J9ZA 3TJ4A 4ZO7A 3SGGA 1V4YA 5D04C 4RL3A 5HQEA 1V6XA 1VC4A 5TAOA 4CN4A 4EKJA 5D9OA 3N2XA 4PMNA 3PUEA 1DQXA 3C0LA 3P80A 2FB2A 1IT7A 3M0LA 3CV1A 2ODOA 1K03A 1E6PA 1K7EA 1VBUA 1UC4A 5AYXA 5E70A 1NOUA 1CGUA 2A1YA 3UZJA 3ABQA 1A5KC 1I1WA 1GTEA 4QLLA 1GTHA 4U10A 2J77A 2QJIA 5E0CA 2FIQA 1Y7VA 1U1UA 1JCMP 3W1LA 4HHLA 2VRKA 2X09A 4LUSB 1E1FA 1RALA 1RA5A 1N8IA 4MLJA 1X7IA 5LNVA 3HPFA 4GYKA 3ZLFA 1D3CA 4RCXA 3CYVA 1W3HA 1WDQA 3U0HA 4MZ8A 1WKFA 5I09A 3K8LA 1OFRA 1OZQA 3VD5A 1JDDA 2VI0A 4DXVA 2J7EA 5FF7A 1RJPA 4E2DA 2J8TA 3M43A 1OX6A 4CVUA 4OVXA 1AW5A 3NQCA 3GKAA 3O15A 2C7FA 1GHSA 4B2DD 1TV8A 3AHVA 4YTQA 4E8GA 4W7UA 2EG7A 1XLAA 4JNMA 1OFEA 3C5QA 1XGZA 2Y7EA 1MFVA 1O6IA 5AN7A 3S42A 3CL7A 1TKKA 1EJSC 1P0NA 1L9WA 1WDPA 2FPTA 4OV9A 1XG4A 4JN7A 1R3RA 3GHRA 5A6JA 3N2MA 4V33A 1J0HA 3P5ZA 3KBSA 2WXDM 2C8NA 1PYMA 4OOUA 4GG9A 3K2GA 1CLVA 3NR0A 1F4AA 1W1A1 3S5NA 1QW7A 2OLHA 2DVUA 2A3BA 1NVMA 2G3JA 3PS7A 1XLGA 1QW8A 1OJXA 4QRNA 3M0XA 4BQ4A 3QHNA 4C6FA 1XCFA 2CLPA 7TAAA 3F2DA 3FA3A 1XIIA 1XIBA 2IKIA 4LS0A 3ZWSA 1M3UA 1U5HA 3PTDA 1GNXA 1PYFA 2XSBA 3V0SA 5TQLA 1CGTA 3VOGA 3KVLA 1E9IA 1V3HA 3AIEA 4L1WA 2ZRWA 5BROA 3RCNA 5M1TA 1HZYA 1R46A 4XIAA 2WHLA 1OY0A 2JEQA 1VEMA 3OHIA 2QVHA 3C8NA 1EOMA 4EPEC 4AXNA 1V5XA 4JTAA 2OJPA 4Q8OA 3B9AA 1QNOA 2PF0A 4J4KA 3G6LA 1PX3A 3H12A 2VFEA 3WQOA 1RH9A 1ELSA 2P88A 4GCXA 5U4NA 1E6RA 4HZ7A 1XXXA 3ZYZA 1Q85A 1TIMA 2A3HA 3PBUA 4TV5A 1UH2A 1KC7A 4I9TA 2NV2A 1UPPA 2BOEX 3T09A 1OBAA 3WBXA 6REQA 2WV8A 1MRAA 6TAAA 4I9JA 1EYWA 4UIOA 3PTMA 1HJVA 3FGCA 2PGEA 3B40A 2J24A 4DPPA 5H91A 2ABBA 4NNCA 1LL6A 3P6LA 3CO8A 1OFQA 3Q45A 4OBSA 3OP2A 4YVXA 1DWAM 4QBXA 2B7NA 3E12A 4O50A 4M51A 4PMQA 4R3UA 5H8UA 3L4XA 5D9PA 3E2SA 1WCGA 1CYGA 4RDYA 1YQ2A 4WEVX 5HXMA 1FWAC 3DC0A 1TJ2A 3PBYA 2X7WA 1W9XA 3TN4A 1R7AA 3LHTA 1W1B1 1N82A 1O94A 3PZOA 4X60A 2H3BA 1CXKA 1ZCCA 3VD4A 2BXYA 2E8YA 4MWAE 2YCIX 4KETA 3U6WA 3FSTA 1GOIA 3NFUA 1WBHA 4Z1YA 3EWXA 3WQPA 2PLJA 1O1HA 3ARSA 4ZFCA 4BZYA 3EB2A 4KT2A 4LALA 4P7OA 3DI1A 4FPSA 3FAXA 3BLIA 3WLTA 1V02E 1S1PA 4BFAA 1J0KA 1DJYA 3OPSA 3LCHA 4WKHA 2PWEA 3WJXA 4BWLC 2JGYA 3TXVA 5HATA 1HJUA 2FTWA 1HJWA 4IP5A 3H8AA 2WW5A 5JBEA 2YZRA 4UQAA 3DFNA 3HN3A 1W3LA 2PTWA 1NTHA 1KBKA 4GVFA 4UMCA 4Z1AA 1HX0A 4GVIA 4IF2A 3VNKA 3MY9A 1LBLA 5F4XA 1VBJA 5EA9A 2WSKA 1T6MA 2YL5A 2REQB 1WAWA 1DYSA 5DQPA 2DUXA 2YXGA 1K8ZA 3T78A 5FESA 5E6YA 2ATMA 3OEXA 1BD0A 2R1MA 4QEEA 1H09A 4O0KA 1BXCA 4Y9AA 3SRFA 3AISA 1G7UA 3SM0A 3TN6A 3R0UA 1OCQA 3FDGA 1XBXA 1KRAC 1MUWA 3BJSA 1LZOA 4IX2A 2I9UA 3KOYA 3M0HA 3W7EA 3KVMA 5LA0A 3ID7A 5G4WA 3NO3A 4UTKA 2C0HA 4GIYA 5CJ5A 3CUXA 5ABEA 4HBKA 4LV4A 2Z24A 4I9AA 1P6CA 1UWSA 3S5YA 4ZL1A 2PU0A 2SFPA 2BLEA 4DUWA 3IIPA 1HG3A 3VDCA 5HPOA 2ZA2A 3BV4A 3CAKA 2WMIA 2NQLA 6CGTA 4ATDA 4S1FA 3KHJA 3I6TA 4A2SA 5I07A 2ATSA 2I57A 4G9PA 2AMXA 3BH4A 3P3BA 4WCJA 3ZR6A 2C79A 1OX4B 3E0VA 1E70M 2FZMA 1JDEA 1UKOA 3EMZA 5D38A 3N14A 2OSYA 3P67A 2BVYA 2BBFA 2PWUA 4O54A 4ZQOA 4U3AA 4IIGA 6XIAA 3LTSA 4NJHA 5E5CA 3UFYA 4ERGA 4UQ9A 1UMLA 1NEYA 4UZSA 4GC4A 3E74A 4Q7IA 3ZT6A 3W74A 1LLWA 3I6RA 3MV11 3CGTA 2YCEA 3GIYA 1R2RA 3O1NA 4LUIA 2CPUA 3DFPA 4JX5A 1OC7A 4CGTA 2VD9A 2CLKA 1LCOA 4DYKA 1PIFA 5CPSA 2FGLA 3V0TA 3PSWA 2FKPA 3UT0A 3REQA 2QKFA 2CLOA 3CC1A 1ADOA 1B9ZA 4D6IA 1DKWA 2QCMA 1V6VA 4GA8A 3UNTA 4EVZA 1LOLA 3WQWA 4Y9NA 4QE5A 3KBJA 3WD0A 3FNDA 2OFJA 3WK1A 4PUJA 4RJEA 1SW3A 5K9DA 1GORA 4FA3A 2P0OA 1W6TA 1XGEA 1DBTA 2WVVB 1KTBA 4XD4A 2VR2A 1V02A 2GPTA 5FOOA 3B0VC 1KFWA 1ZU8A 3G0UA 3BJTA 3HQNA 4QLKA 1W17A 2AL2B 4RW5A 4CLMA 3DZ1A 1WXJA 1CDGA 5FL0A 2I7GA 2J27A 3QLLA 1CLXA 3S2CA 1VCGA 4PUNA 5I3IA 3V18A 4DN1A 1VBHA 2ZADA 3N6QA 1SUXA 5CQ1A 4QCEA 3LTPA 3C2RA 3WQDA 1F6KA 1OK4A 3Q4DA 4LBUA 2PDXA 3GWQA 2P0IA 3VXGA 3DECA 3NPWA 3KCOA 1NQKA 3TJXA 5C2GA 3O8AA 3LHZA 4FLOA 3HM7A 1ISXA 4FX6M 5LXEA 3HQ1A 5D4YA 2F9RA 3G5EA 1AH4A 2X1RA 2QAFA 2BSLA 1VEOA 1NFGA 3STGA 4XO6A 5A8QA 3LGGA 3SR7A 1H63A 2VFGA 3V1PA 3CUFA 1IHIA 1TX2A 2Y89A 1ESWA 1H4PA 3SQSA 3E49A 1S2AA 2W3ZA 3WJYA 3EPNA 3MANA 5CZKA 4GYFA 4Q3MA 4QM1A 3PUGA 1K4HA 3O2LA 5DEZA 4YWIA 1GONA 3HU7A 3RJXA 3G1YA 3OIHA 1UHVA 1RY8A 5GPRA 3WQ6A 5C70A 1XC6A 1CLKA 4YLWA 4XIMA 1VPQA 3RF9A 3WG6A 4UTUA 2ACUA 3BAXA 1J0JA 1CT5A 3S83A 3BAKA 3BCDA 3NOYA 3UWYA 2QF8A 3PZGA 3STFA 2PC8A 4XZMX 4MJ2A 5C71A 3IGXA 2V63A 1I0BA 3VMPA 4D6CA 1GQLA 2ZA1A 1UUMA 1M6JA 5CSSA 1VLIA 3TUUA 2PF8A 3GUGA 3IJLA 1R8LA 2V82A 3FHAA 4NYYA 3W9ZA 1R9XA 4GH3A 4LVAA 3N29A 1H1NA 4XSLA 1E4MM 1AW1A 4W7WA 3VKBA 1ZNNA 4FOJA 3BW4A 3CQKA 2CKRA 3IJ6A 3FJNA 3MW7A 3H2CA 5HJXA 4FF7A 2NSOA 2CLMA 5G5IA 3A3WA 4A3RA 1KM5A 4AW7A 4K1WA 4MUPA 2DPEA 3NL2A 1VCFA 2XH0A 2VUNA 3I65A 1YKWA 4H6QA 1MZHA 3HG5A 1DL3A 2OXNA 4GFIA 8TIMA 3PPCA 2EG8A 2H9AB 4M82A 3VD3A 4QS5A 4TV6A 1YNYA 2UWFA 1EQCA 1W2PA 3MMUA 3VI2A 3UGVA 1RHCA 3L23A 3VVGA 3WLJA 4Q4MA 4KEUA 5C5YA 2ZE3A 3KZPA 1Z6KA 4DJDA 3GZ3A 5LIWX 3IIVA 3AYVA 2RDUA 1EH9A 4EPKA 5D8WA 4UTWC 2AMGA 3VGEA 4H9VA 2INZA 5JUVA 1F8IA 1I2PA 2G37A 4GWEA 1XUUA 4P2VA 3A9IA 3QR1A 1BRLA 2DQXA 1W56A 4MB5A 2NVDA 7A3HA 4GI8A 3KZSA 1G4PA 3TNOA 3L4ZA 4MADA 4XVEA 2ICSA 3P84A 4G7EA 4W8AA 5CC6A 3W53A 4UTFA 2OYLA 4LBRA 1I60A 3HPSA 3LRMA 3JZUA 3PPFA 4K39A 3UWUA 3QBUA 4CEUC 1F3WA 1CNVA 3LERA 2ISSA 2CITA 3E02A 2CW6A 1K4GA 4GVHA 4O52A 4A6GA 3U3HA 1EZ2A 2ZUNA 4NI8A 1BWVA 3U4FA 5BWFA 3RJYA 1EIBA 3CQJA 1EP2A 3ZR4A 5IBXC 4Z2GA 2ACSA 1Z7AA 4ATWA 1EDGA 3WQFA 1R3YA 3VGDA 1YDYA 2GZXA 4LAMA 6REQB 1ZJBA 4N7QA 1HP5A 4HMDA 3VNYA 4P7QA 4GXWA 5GQBA 1WP6A 4NAFA 5C7VA 1HQTA 3BV7A 1EC8A 2VWTA 4L6OA 4AMAA 3HG3A 4GIRA 4DLMA 3W1UA 5HNRA 2RHGA 3M44A 4DXXA 2WOQA 1XFCA 3NM3A 3W85A 2DIKA 1D8WA 1CPUA 1K8YA 4DJEA 5FF0A 4QITA 4XBJA 3WL0A 1E71M 1YIXA 2NQ5A 5CPQA 4WRHA 3ZSSA 3DX5A 3WQVA 1RUSA 3QVQA 1W9PA 3VOJA 4JIEA 3L2MA 1DIDA 4ADUA 1TWWA 1XLBA 1TTIA 9XIAA 3IEBA 1JD7A 1SJCA 2OT1A 1EXBA 2VT0A 3URQA 5DF0A 1CCWB 3AXIA 5CG0A 5T8GA 5CGQA 4R53A 5I78A 3A4AA 3ORWA 1K7FA 4EP8C 1TQJA 1JJKA 1TPEA 2QUMA 2PTYA 1B90A 4DLFA 3E3HA 1GGOA 3IWPA 4AC1X 4AMCA 4DWSA 4AAJA 1UASA 4JL1A 3EYPA 4GKTA 4C7FA 2RUSA 3HGRA 3L2LA 1PZ1A 3RCMA 5CPMA 3RITA 2VC9A 4IP7A 3E0WA 4HZ8A 3GX9A 1GPFA 1PZ2A 4JIRA 3E2VA 3WK3A 4ZENA 2WVVA 1VP5A 3MI3A 2VEFA 2W5FA 4JQ4A 1M9HA 2V3GA 1X7FA 4UB9A 4ZXOA 3LOTA 4HPHA 1XRSA 1VFLA 3LLFA 2Y8VA 3W84A 3RPMA 2NVAA 2A7RA 1F05A 4O1CA 1IR2A 4LW7A 1NWRA 1Q6OA 3MO7A 4LNYA 3DFQA 4XVDA 2ISVA 2CZ5A 3CLWA 2GGHA 4AIUA 4DB7A 5JBFA 1OGSA 5A6KA 1AFSA 1XSIA 3U2ZA 5A6TC 3RRAA 3SDOA 2NQ9A 5TIMA 2E9LA 1OQFA 1VJIA 5HUOA 5I24A 1JRCA 1R3QA 3CL8A 5LYRA 3LSCA 4ACYA 2W66A 4GXPA 3W1RA 2D23A 3A3XA 4KWWA 3FVDA 1VYRA 2ISWA 1GVOA 1FA2A 3RM4A 1W37A 3UG3A 2B81A 5I23A 1NJJA 2WVSA 2DT0A 2WZEA 3O6YX 4NZ5A 1LP6A 4NRRA 1UYQA 4W89A 2H8ZA 2YA2A 4M8UA 4Q4RA 5TNVA 4HPNA 3QY6A 1XYAA 3UETA 1BSLA 4JGDA 3AIBA 4GI4A 1TR9A 1Q6GA 2PMQA 5F2MA 1US3A 3DBNA 4FOUA 3WLPA 5CC5A 1H2JA 3WDQA 7REQA 3KTSA 3VGFA 4AEOA 3FXGA 2GVYA 1L6SA 4WDWA 5I5RA 1Z48A 3KDNA 1JAKA 1OX4A 2J8FA 5DX7A 1FWIC 2YW3A 3OIXA 2ZUSA 4AD5A 3WUGA 2EXOA 4O4VA 3HGOA 4C60A 1E0UA 2MNRA 3QN3A 1UBSA 4UTLA 3RLGA 2FVLA 3EBVA 3V3WA 3S46A 3Q65A 3OU8A 4AD3A 3EX1A 2BODX 3F7JA 3TFCA 4F9DA 4J7RA 3CV2A 3LLDA 4L7ZA 4RE3A 2WCAA 3UESA 4XBSA 3UG4A 4YIWA 3H2AA 2W67A 2GYIA 3VKCA 1E4IA 2CLHA 1N7KA 1KV5A 1J5SA 1ZY9A 3FX4A 3OJGA 3N2OA 1EGZA 4CU8A 5F1VA 5BW6A 4TR9A 1UWAA 2V67A 3EMCA 1KR0A 1GEQA 3REQB 1SSDA 3AROA 4W84A 1FWRA 3PZIA 1F6PA 3N9KA 4K37A 2DVXA 2WHKA 3CBWA 2I56A 4FZIA 4HKPA 4JDYA 4FIQA 3TSDA 4YU1A 1E4NA 3A4XA 2P1FA 3R10A 2WPBA 4BI5A 3CUZA 3I6EA 4JFTA 4Y9PA 3WBAA 5EL1A 2ZXDA 3AMGA 4O19A 4PMYA 3UJFA 5FL1A 4JTLA 4I9MA 3OGVA 3ITLA 4G1KA 1BKHA 2JKPA 2X05A 3C2EA 1BHGA 3PFMA 1ZP3A 4K8HA 1FWBC 3RG6A 1GYLA 4GOAA 3S0CA 3EXSA 3GH5A 4GX9A 3UPWA 5BZAA 3M07A 1UUQA 1SZNA 3KHDA 1A49A 4E8CA 4P8UA 4F4RA 3VPLA 3W7OA 5KETA 3EOOA 1KKOA 1XD1A 3KLLA 3PAOA 4LVFA 5HPCA 3L9CA 4PTVA 3W7QA 5FJPA 3N15A 1AUSL 2E67A 2OB3A 3KAOA 2R6OA 4NX0A 5LNSA 1ZAIA 3AHYA 1IWBA 2J4GA 1AK5A 3ONCA 1XIEA 3H22A 3WMSA 1WE5A 2TAAA 2VCAA 4L4OA 4WGXA 3L65A 5LIXX 4KWUA 1JYVA 2HV5A 1Q8JA 4B5UA 1UKQA 4OV4A 4CKQA 1DE5A 1V3LA 1ZLPA 1BRLB 4RXFA 3CUHA 3VIFA 3E0LA 6ALDA 2PWVA 3K13A 4PB5A 3ZVHB 1TVLA 3E96A 2BB0A 3CU2A 1KM0A 2R1KA 3SUSA 1QBBA 1TPH1 2W0UA 3F5JA 2OPJA 5H8MA 1XD0A 2GDQA 4QR6A 4KKXA 5FJUA 3LYEA 2UY5A 4QLJA 4H7ZA 1QHOA 4AZCA 4H7VA 4HYVA 3PR2A 3LUTA 2IMRA 4J2MA 1T7LA 3DKJA 1R7OA 3QRHA 4H9TA 4B91A 3BW2A 1JCJA 5LSMA 1HNYA 4XUGA 2VEGA 1AQ0A 3DG7A 2X42A 1Q6FA 5DCEA 4X22A 2GQ9A 4JTUA 2Y63A 4JTFA 3W07A 3FN9A 2VFFA 3AYRA 1S5WA 1H1ZA 3IV3A 5K7JA 3BLKA 4BF7A 3EKZA 4K36A 3V16A 1TWDA 5G1TA 5IRPA 4CCDA 4G56A 3QV7A 3RLVA 2AQWA 3TU9A 2XM2A 2GVLA 2HK0A 3KOWA 3FKKA 4B9YA 4IQEA 1PVNA 5HWJA 2CU0A 1H3GA 3DXIA 1NP2A 4UWMA 3MI2A 1LQ0A 3PN8A 1H62A 2BXVA 1E3XA 5CZTA 5K9CA 1IEXA 1JQVA 1IZCA 3QV8A 5HWNA 3HMJG 3IVSA 4S3AA 5KZ6A 4PYSA 3R0KA 2D2GA 5FJTA 4HZ6A 4TMBA 4F48A 1JPDX 3OO2A 3AUJA 1OSEA 2VX5A 2EKCA 1QO2A 2Q8LA 4O18A 3W7PA 2G97A 2DZPA 1HL8A 1TUFA 4DZHA 4DZ5A 4EWJA 3GY1A 1TWIA 4Q8WA 3AJXA 4DI8A 1JI2A 4TXEA 2PAJA 3EA3A 3LCIA 3B0UX 4GY7A 1PIIA 3N2BA 3O6AA 3FKRA 1UD6A 5JVLA 3VOIA 3H2NA 3OG2A 3I4KA 4LCRA 4QDPA 4S3GA 4JKLA 4BF9A 4MWAA 1ZALA 3OG3A 4CCEA 2X40A 1OG0A 2DZTA 4L6DA 3SCUA 4L5ZA 3VZYA 5A6AA 3SJ3A 3S2JA 3KTCA 3HIJA 3QQ1A 1HF6A 1QR7A 4GUIA 1XM3A 4NJGA 4E8DA 3D6NA 4JTDA 4KEVA 3DFHA 1R3WA 4UQCA 3VMNA 4JTTA 4J3SA 1JDAA 5C54A 4PUEA 3AZTA 3QMRA 1FWCC 1TPVA 2DT1A 2AKMA 2IPWA 5IXEA 1KGUA 4PL2A 4LNCA 3VOFA 1FY6A 3W83A 1ISZA 1YPXA 3B8IA 1KM4A 4BEUA 1TV3A 1K1DA 3C8FA 1GJWA 3IGUA 3TXZA 3N2CA 3WF2A 2E68A 4HHPA 3AIQA 1FOBA 5AHLA 2BTMA 4KFNA 1S3TC 2UZ9A 4IGHA 3BQ5A 4IPIA 1NY1A 4DF0A 4QSFA 4ZQPA 1GPWA 1TYGA 1RV8A 4L9XA 2WSYA 5HUPA 1Y65A 1NDVA 2J7BA 3W7JA 2V0TA 4QCFA 4MYAA 1TWZA 1C9DA 2ZDRA 4XQ6A 3SQLA 3OQ8A 3VC5A 1UR3M 3SBFA 3N3MA 2JBMA 3EWUA 2EJAA 1JG9A 2PDUA 1Y8BA 3QGVA 3II1A 4XAPA 4JXCA 3E38A 4MPQA 2CBJA 1EO7A 4AEEA 3B0YA 1KCZA 1GOOA 1JIBA 1UR2A 2PWHA 1B1YA 3T0DA 1Q2SA 2ZUMA 3EOLA 1HKVA 1SW7A 3NL5A 1EIXA 1EEXA 3VD9A 1V93A 4MM1A 3VIOA 2D0FA 4FOKA 2P53A 1LJYA 2YDAA 3NSNA 1PTAA 2ZRUA 1B30A 2I9EA 4L61A 4KRTA 5EU9A 3CH9A 5MKGA 3A4JA 1DV7A 2VZSA 4HD5A 5A8MA 3FHQA 3SZ8A 3RUBL 4Q8PA 3W6MA 1LORA 3A3HA 1MZRA 4AXKA 2GVEA 1E72M 3STPA 5IHRA 2Y8UA 1K6WA 3JRKA 4GXMA 1WOAA 4WJEA 2GL5A 5I00A 1E6SM 4GUJA 3M16A 1QASA 4JQAA 4JD4A 3QFWA 1YPFA 3LBMA 1R2SA 1XP3A 3NA8A 1GW1A 3VABA 1A50A 3SCNA 4Z0JA 3LI0A 4RW3A 1I1XA 3NIYA 4GIEA 3VIPA 2A79A 1XDJA 2GJNA 3G1SA 5XIMA 1OGGA 4O53A 3C56A 3WH8A 3ECQA 4Z42C 3P8IA 4PCSA 2G96A 5CZJA 2A3LA 1W5NA 4R33A 4NKCA 2GGJA 3TYBA 2FVMA 1W91A 3D5HA 1C91A 4I3GA 3P5YA 4C65A 4JN6A 1ITCA 1JCLA 3K4WA 2XN1A 1A5AA 1OGBA 1W1YA 1C9WA 4Q6JA 1A5MC 4QXIA 2ESCA 1JGIA 3AXKA 2QUNA 4UR9A 5BCAA 2A2IA 3M5YA 5C8BB 4LRTA 3QTPA 2E6FA 2EBNA 1K8CA 3A22A 1BGGA 2CBUA 5DRIA 1Q7QA 2BY0A 3EAUA 3BK0A 4ORIA 3CUGA 3KX6A 2XVNA 1XIJA 3V35A 4L4PA 3RHGA 1Q6LA 3UW6A 4OGZA 1T40A 2G95A 3ZVIA 2QPXA 5RUBA 2QR6A 3OODA 2GK1A 5LHEA 3B0PA 2PDYA 4LCQA 2ALDA 4YTTA 5DY3A 3WX7A 1H0GA 1BKSA 3UJSA 5A6BA 1FWJC 3MDWA 5L9FA 3MHFA 4AWTA 4PBFA 4ML4A 2ZRVA 3SGUA 1RQHA 4US5A 4N9CA 3D0CA 1W1TA 3TW6A 4AF0A 2W4XA 7ODCA 2WBKA 3DDMA 4M29A 5JH2A 3P74A 1U5JA 4N6EA 3MMDA 5GNZA 1LYXA 4A3HA 2OCZA 4DXKA 4KW2A 1J96A 5M2FX 3O6CA 5CBIA 1LT7A 1ECQA 5IM51 3UEQA 3LHUA 3GFXA 1DJGA 5CEWA 2RDTA 3CEPA 1ZL1A 1J4EA 4NRSA 5GNXA 3AICA 1V3KA 4V27A 3IIZA 1QI2A 3UPBA 1MSSA 2H9AA 2VC7A 4MY1A 1JZ8A 4MHBA 5I3KA 3WJZA 4MJMA 1W8SA 4A35A 4L80A 3OYXA 2V5CA 1A3HA 5AZ1A 1WKEA 4TUFA 4ZO8A 2V38A 4LB3A 5CSUA 3BSMA 1XICA 2NUYA 1AW2A 2DSVA 3UR7A 4RXGA 1O95A 5FD0A 1LWIA 1G6CA 2W9MA 3U2EA 2XH7A 4W88A 3WEZA 1WZLA 4NAEB 4N2YA 4PB4A 5K9XA 3GC5A 3R5EA 3RO8A 3VO0A 4PRWA 2XG9A 1QNQA 3GG0A 1OYAA 4ZO6A 4FALA 2PDGA 1T5AA 1A5CA 3EWZA 1QTWA 4ACZB 2OU4A 1UMYA 4YHEA 4DJEC 1TTJA 4C5ZA 1SZEA 1KD0A 3CV7A 1YRRA 3DENA 1HKIA 4E4FA 1BFNA 3FJLA 4ICCX 3OLGA 3LPOA 4GUFA 3AMCA 3GAYA 1VFSA 4PE8A 4MF4A 2PC4A 4I6KA 4AG0A 1MXGA 4DJDD 3GRIA 4PZVA 5F2LA 3DI0A 1UZDA 2TRSA 1WO2A 1XGDA 4AIBA 4R34A 4GNJA 1B54A 2C18A 2ZUWA 4WK9A 3GIPA 1KRMA 1P0BA 5CC3A 1GJPA 1BVNP 2CZEA 1M53A 2OTDA 3L5AA 4IQDA 4E0CA 4B4FA 5CLWA 4RNFA 3C6CA 2V9DA 1FCUA 2DZAA 4LY4A 2PCEA 4YYCA 2WWCA 2E25A 2ZIDA 1AODA 4X61A 3GG7A 3PNUA 1GOWA 4JTQA 3ZZ1A 1H5VA 1MDLA 4WDXA 4Q8MA 5A6LA 4Y2WA 4GYPC 1Q65A 1RAKA 4DPQA 3QMSA 3T42A 3HOJA 3WD1A 1D7FA 1XR2A 4GMEA 1YNPA 1UKPA 4MAZA 3LQLA 4B9ZA 3KP0A 3VD7A 2YCJA 3IUDA 3HJEA 2NQZA 4IPLA 5M3WA 1FH8A 3U2OA 4F2UA 3SAZA 1BXNA 2TYSA 4UTWA 1US2A 5D33A 1JUEA 3AMDA 3G1XA 3B9NA 4H7CA 1H60A 2CHOA 4H8UA 1F5ZA 4NJIA 3GDBA 3NGJA 4XK2A 5D32A 2XIMA 2Z1VA 3KP1A 4BI6A 5REQA 3EWBX 3W76A 4HJFA 2C14A 1UWQA 4M7SA 3W26A 3MJYA 4PFMA 4GY0A 4WDTA 1PS9A 3AC0A 2YKKA 3W01A 2Y61A 3T2QA 4AEFA 2NUXA 1BGAA 1I4NA 1QRQA 4RZ6A 5JQ9A 3GYCA 3XINA 3CPUA 3NO1A 2A85A 3BJFA 2QEZA 1QT1A 2CLFA 3O63A 3UZXA 3G6MA 3PG8A 5AYBA 3LX9A 3G1DA 2PB1A 3FYYA 3WYZA 4MZYA 2YR1A 3MSGA 4UTHA 2VVSA 3B06A 4PCNA 1LBFA 4LEQA 3RIKA 4HOZA 2Q3OA 4O17A 2REQA 3H21A 3WLHA 4OBRA 1N55A 3W02A 4AB4A 5HMDA 4B5XA 4NAFB 4P5UA 3GR4A 3WFLA 2KX9A 2O7SA 3M6YA 3T81A 3KS5A 3NDOA 2VXNA 2WNQA 3AAMA 5JU6A 3S9IA 1XH0A 3B8TA 4JQ1A 3EDFA 3N4FA 2VGIA 1VBGA 2WC4A 4IMDA 3MBFA 2FHCA 2D73A 2IUZA 1ITQA 7ENLA 2XFRA 3TNBA 1P1MA 1B31A 1HKKA 2ZRYA 1H7NA 1LRQA 1HL2A 4J3TA 3A24A 3D46A 7REQB 4AC7C 4LVDA 4H00A 2YA0A 4XB3A 4YYFA 1M65A 2Y70A 1FFQA 1Q4WA 2QUVA 3FCPA 4GJJA 4NP7A 4PRTA 2OOFA 1KFLA 5A8OA 4JIIX 4ERAA 2CESA 3QGAC 2YYUA 3GG8A 3M7SA 5C9UA 1FXQA 2CYGA 1M04A 3BWWA 4CNSA 4XD3A 2J6XA 5FEWA 3L67A 3E5BA 3M7WA 4DUOA 2G3FA 4KRZA 5A6BD 2ACRA 1KKRA 4MWAC 1QK2A 1FP9A 1G69A 2OWXA 4GQBA 1MUCA 3MP3A 3T05A 1XIMA 1FHDA 3W87A 4BS0A 1OYBA 5KINA 1RPKA 1JYWA 3NUKA 3W37A 3PFRA 1KBJA 3A13A 3R8RA 2D2JA 1XBZA 4RLIA 5AVNA 4BHYA 2XGBA 4Q7BA 1F73A 4ZBCA 3B9OA 3M5ZA 5EMLA 2XSAA 1KCXA 2EEXA 1SFTA 4HPXA 3UD6A 2PGWA 1OM0A 3MU7A 1CGYA 2ZZ7A 1GVIA 1IQ8A 1ZBKA 3CH0A 4UTTA 1TTQA 4CEXC 2J25A 3AIWA 5BXSA 1NF0A 4D9PA 3NURA 1X8FA 3LZ3A 4M24A 2UV8G 5FI8A 3BUVA 3PHAA 3WENA 4X0NA 2VVNA 4ROPA 4R7OA 4UXDA 4JKKA 4PMZA 5AHEA 2QV5A 1I2QA 4ZODA 3V36A 4HNVA 2HROA 3EGJA 1Q6CA 5FJIA 2YLLA 1C8YA 4MDOA 1EL3A 5D30A 3LHWA 1XLCA 4QJ3B 2XM1A 3M0MA 5ECVA 4PTNA 3TDFA 5BU9A 3N9SA 4Q8NA 1XG3A 3C0JA 3DERA 5FF2A 3LM7A 3CHFA 2BOGX 1FWNA 5DBTA 2BFGA 3MQTA 3TYUA 2C3ZA 4GH1A 1BYBA 1EJUC 3HMCA 1MQQA 1J18A 1BG4A 1XLMA 4IISA 1YDNA 3BGJA 5EKYA 4ACZA 3ITXA 3D3AA 1CXEA 2JIEA 4A2RA 1X38A 3SCOA 1KM6A 4ILSA 3B4YA 1YPIA 3R8GA 1RLDA 2Z6IA 1JRBA 4DX3A 5FIPA 2O55A 4GRSA 3LU2A 4Y9OA 4D1IA 2PGFA 3AS2A 1YYAA 5GJNA 4EPBC 3AIUA 2P3ZA 3I3DA 3V75A 1E6ZA 3G24A 3VZZA 1DJXA 3HG2A 3GTXA 5BRQA 3ONBA 3LDVA 2GJXA 3L4VA 4TO8A 4GC3A 4Q4PA 3CZEA 4MNMA 4RZ5A 3PTKA 1QAPA 7XIMA 4H8NA 3UU0A 3FGCB 3ZVHA 1W3TA 3UCQA 4HZMA 4HNNA 1W2VA 1J9YA 1CEOA 2Q6ZA 1NAL1 3CT7A 4DBSA 1UWIA 1PV8A 2PE4A 5I3HA 2OEMA 1W0MA 1E9YB 1M7JA 3BOFA 2CLEA 2B31A 2DJXA 1ITXA 1QFEA 2BHZA 4TTGA 2QCDA 4H8VA 4KGJA 1MWOA 2V68A 1NOFA 2GGGA 1JNDA 2VRQA 3VIGA 3S9YA 2F2KA 3GXNA 4GKLA 1OC6A 1K6AA 1VRDA 1GVQA 2C1IA 1SFSA 1TVNA 3H2OA 2HXUA 3ARXA 4HMCA 3SN4A 2BGSA 2YBVA 4A3UA 4AD2A 3GO2A 3W24A 1E73M 3TC6A 4PODA 1WX0A 3WY1A 3SW6A 4P7NA 3TLLA 4B3LA 2KAUC 3L2IA 5E09A 4O11A 1XH2A 4N02A 1VAHA 4TTUA 4WY0B 1JVNA 3ENLA 3W2JA 1E1CA 2QJMA 4B2DA 1UA3A 4RX0A 8A3HA 4NZ1A 3SUWA 2Z1KA 1FXPA 1QVBA 3AYTA 4NASA 3V7PA 3H7RA 1R2TA 3C3UA 4Q4SA 4NAEA 1SVDA 4NQ1A 4G8TA 2NVCA 3RX4A 3PUOA 3EWCA 3JU2A 9XIMA 4M1BA 4CNOA 3M46A 3WF1A 1UW9A 1Y5XA 1TO3A 4YHGA 1VLWA 2XHYA 1AL8A 1FWHC 2QS8A 4X0VA 5D8ZA 3DU0A 1QBAA 2YDSA 2IKHA 4AH7A 2NUWA 4E2OA 2WSPA 1S5TA 4GACA 4R88A 3LLXA 3T8QA 4MVAA 3THQA 4C6MA 1XRTA 1R9ZA 5J5RA 3AIVA 2QIWA 3ABXA 2PURA 3L4TA 1O68A 4E3VA 3MS8A 5G2WA 4M80A 4IICA 3L0NA 2GQAA 5M5DA 1KXVA 1JEZA 2BASA 3R89A 1K02A 2JQXA 4JCMA 3DFTA 4UCFA 3H6OA 4S2BA 1EWDA 3PAJA 4HQVA 3LB0A 4YVVA 2NV9A 1HJSA 4WF7A 3T0CA 4QJ1A 3DFOA 3W4RA 1J01A 3S5SA 5FF3A 1ONXA 2B7QA 4UFLA 3NJ3A 1J11A 2WC7A 1EO5A 4A22A 4QROA 4NJKA 1TR1A 1WZMA 3FS2A 4JX4A 1JUKA 4LC6A 4TX6A 3WLMA 4ZQNA 1MMFA 4D1JA 1GG0A 1GOMA 1XKJA 4IGNA 4H8HA 3DBPA 1HGWA 3BQ6A 2OYKA 4H04A 1FCQA 2X41A 1NQ6A 2JGQA 2PTZA 4K3ZA 5G4EA 4DUXA 4B92A 2J47A 4N0RA 2BVWA 4D72A 3PTQA 4O14A 3R43A 3PJXA 3R25A 4KEZA 3WDRA 1PX8A 4GQ0A 2PZ0A 4U4MA 3MI6A 1C7TA 3QYSA 3VZXA 3QV9A 4I8DA 3CIVA 2VHLA 4CQAA 5DY2A 1IYXA 2IQDA 3NQGA 3TC7A 2PDKA 4KWSA 2VGBA 5K2ZA 3ELFA 4E2VA 1Q66A 2PDLA 4RPPA 1QOQA 2FGZA 3DHUA 3CAQA 1UP0A 3NQ7A 4F40A 1V8EA 2HISA 4J1OA 3SIMA 1WZAA 4HA4A 1V77A 4PTWA 2PLKA 3GH7A 1L0PA 1IGSA 3FIGA 1G94A 2YCLA 1V0KA 4R27A 1JYNA 1J2BA 4IPPA 2A4AA 4HU0A 2XUCA 4MJ4A 1B3XA 4W8BA 5FKYA 1OT2A 4FHAA 4NX5A 1SZGA 2Z26A 1JCTA 4A8RA 3WD2A 2YPIA 4KCTA 1W9DM 4RDWA 2ZX8A 3NYZA 4F0HA 5FJOA 2I5IA 3BO9A 1UD5A 1E4LA 1XSKA 4AD4A 2HMCA 5BMXA 1OCNA 4CN1A 3URNA 3UXKA 2QZRA 2QVNA 1UWRA 2WVUA 1B3WA 4PMRA 4Q4OA 2QULA 3APGA 5C9ZA 3G8RA 1I9CB 4GO9A 4FXSA 3BMVA 1F3XA 4TMCA 3SN1A 1EGVA 1P43A 3G1AA 2XIQA 4LUYA 3GLCA 2VTFA 3GIQA 3RMJA 4EE9A 3SY1A 6XIMA 4Y6GA 4LAKA 5AC4A 2F2HA 4MUZA 3GDTA 4ZB0A 3JUGA 3LCWA 3G1VA 1XRVA 1QPQA 1UROA 2WMFA 3T0TA 3KWXA 3T2OA 1VIZA 1ISWA 2WZIA 2V2CA 1M68A 2PD9A 1KM2A 5B80A 3LCLA 3S1GA 2F6UA 3EOSA 3FOKA 1FCVA 1OINA 4N9BA 1O5XA 4HSHA 4F0SA 3PZNA 2Q8XA 3B04A 4A29A 4HGXA 5AOUA 2ZZ3A 4JTRA 4KQNA 3CL6A 1THFD 3NVDA 5F2GA 1ADDA 2PLCA 3SN0A 3GC2A 1TV5A 4B5VA 2ZZ1A 2E8ZA 3I10A 4AZBA 2HXTA 1UKSA 3KL0A 3VNLA 3IVUA 1UWTA 2RAGA 3L12A 1JGMA 1SO4A 2XN2A 4GY1A 3HZ3A 5EY5A 3GNDA 1GVYA 1KV8A 3AS3A 3I3BA 5BYWA 2GUBA 3TK7A 1R3TA 4S3CA 3H70A 4V15A 3W6YA 3OLIA 4Z1DA 4ADTA 2QCCA 1DPMA 3WK2A 2HS6A 2INEA 4P8WA 2EAWA 4LF1A 1Z3NA 4FLSA 4AD1A 3VFLA 1QI0A 4J3UA 3S5OA 3OYZA 1N8FA 3GU2A 4ZMGA 4JEQA 5JBDA 3ICJA 3DG3A 4AY8A 1KGWA 2IKJA 1XKYA 5L6UA 5AHFA 2Y7DA 3H24A 1DJZA 2OX4A 2D3NA 1XCWA 3U4AA 4ZA0A 2HK1A 3HJZA 2HEJA 3BLFA 4U31A 2D22A 2FJKA 3KE0A 3BE7A 5HBFA 3ZJ7A 1W31A 3NZGA 3A5VA 2TODA 3SUTA 4AHOA 3WQ8A 2GWGA 1XUZA 1EF2A 3QY7A 2DZWA 1EBGA 4CCCA 2PTDA 3WNKA 1CECA 4G5DA 1B5TA 2D3LA 3BSGA 4O13A 1EOKA 4LYRA 5ABTA 1IR1A 1L8NA 2DSZA 4L56A 2WZTA 1KW1A 2J79A 4DBEA 3A4WA 2J13A 4HU3A 1YBQA 2FZ8A 4FXJA 4GINA 3GD6A 4WHBA 4NHVA 2VCBA 1OF6A 4DJDC 1UZ1A 4LY8A 5IFPA 1WPCA 4D6GA 1A5NC 3P93A 3GVGA 4OZOA 1KXHA 2WC3A 1VENA 3NPXA 4GYJA 3UG5A 2J7FA 4FX7A 3EOUA 4ZFMA 2YXOA 3IRDA 1H7RA 1G67A 1SMDA 2J7CA 4HPJA 3MCOA 1ZHAA 3ARWA 2W61A 3K1GA 3QZAA 4QEHA 4HSNA 3O05A 3ALFA 2XINA 1YHTA 1WB0A 1P6WA 2A3CA 1EC7A 1LOSA 1E6NA 3VILA 2BZNA 3WL1A 4P8VA 4JN8A 4H83A 4U33A 1GOQA 1XLJA 3BG5A 3ARZA 5BOEA 1SGJA 3P8JA 4IJRA 4CN6A 3WCZA 3UPMA 3DHPA 1D7KA 3BW3A 3W1TA 2YB1A 1DVJA 1B3OA 4GE8A 2O9PA 4IL0A 4OU1A 4ZEPA 1VQTA 3S1WA 3CAWA 5EMKA 1DJIA 5AKQA 1UPMB 5D2TA 2RJGA 1Q3NA 2CIPA 4XO7A 4R7JA 4HNTA 2Y2WA 1PTDA 2Q02A 2PDIA 1N8WA 3CASA 3MKCA 5MHBA 1A3WA 1TG7A 3GXTA 4ZQMA 3VK5A 3WNMA 4MB3A 2XFFA 3KXQA 4F3HA 2QCFA 5AY7A 2O4QA 5LNRA 2HE8A 1GUVA 3EB3A 5E9XA 5I2UA 2P50A 3U57A 1H51A 3NSXA 4TU1A 1ML1A 2DU2A 2J7DA 3M0JA 3PBGA 1IEQA 4R5EA 1UIPA 3AHXA 4AZGA 4WXZA 4WGHA 5D05A 3DYOA 2TSYA 4ATLA 4FAMA 1K9FA 2CCRA 4KIRA 3W27A 3NQEA 3N18A 2Z2UA 2C13A 3CMFA 4LAUA 4DIAA 3IJ7A 3NSMA 5A1AA 4NILA 1NWUA 3FYPA 1ME8A 1XBYA 4Q8UA 3EZ4A 3HGSA 2E6YA 4AZ5A 3TJLA 3K30A 4F8XA 5CJNA 2DSWA 1OFOA 4HK7A 4MY9A 1B0IA 4WJ8A 3H53A 4O0QA 1E6XM 2NXHA 1ITUA 5BNKA 3W7CA 3K8MA 1NDYA 4QE4A 2Z6JA 1V6TA 3BANA 3H4XA 3G18A 4UFIA 2QCNA 3T2PA 1VEPA 4OE7A 2HRWA 1DOSA 5EMJA 4DELA 1XINA 4B5SA 1FBAA 4EXQA 2A3AA 4JFUA 2C91A 1GKPA 2GUUA 3IAQA 4J9JA 3PJUA 3QEZA 2C16A 1UBPC 1BTCA 4M6VA 3SUUA 4EXBA 3QGKC 3MHGA 3DFYA 4NYUA 3QQ0A 4LAZA 1XLIA 5AYIA 3LTYA 1V3MA 5AHIA 2O7QA 3EA1A 1FX6A 3R11A 1IXNA 2DW7A 3PSVA 1TCMA 4GHRA 5ABFB 1I2RA 2PI6A 3S6TA 1TJRA 2OVLA 3RDKA 1XLEA 3BZJA 4TIMA 5DLCA 3WFAA 2DZVA 2DSUA 4HNCA 3ATZA 2O0TA 1DHPA 1YDOA 1CXIA 4C6CA 1LDCA 1QPNA 2CHRA 2ZC1A 3C4UA 1ZGDA 4KPLA 4O1EA 3NCOA