1AH3A

Aldose reductase complexed with tolrestat inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
314
structure length
314
Chain Sequence
SHLVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKREDLFIVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKDPFPLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYNRNWRVCALMSCASHKDYPFHEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title A 'specificity' pocket inferred from the crystal structures of the complexes of aldose reductase with the pharmaceutically important inhibitors tolrestat and sorbinil.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 100
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ah3A00
2A79A 4YU1A 2BGSA 4JIIX 4LAUA 2FZ8A 4DBWA 2PDCA 1EKOA 2FVLA 4DZ5A 4PUWA 2PD5A 3CAQA 3LN3A 1X98A 1ZUAX 4WDXA 1Z8AA 1ZSXA 1S1RA 3GHSA 3D3FA 4PRTA 5M2FX 1ZQ5A 4PRRA 1FRBA 3UZXA 4XK2A 3P2VA 1S2AA 4FZIA 3R6IA 3EB4A 3WBYA 4H8NA 3O0KA 5LIUX 3R8GA 2PFHA 1RY0A 3C3UA 3H7RA 4R9OA 5AZ1A 4EXBA 3BUVA 3UGRA 2PDBA 3R58A 1ADSA 3LUTA 2IQDA 4YVXA 2PDLA 3F7JA 4GACA 3FX4A 3R7MA 4RPQA 4AUBA 3R94A 1C9WA 2C91A 2FZ9A 3H7UA 3LBOA 3ERPA 4LBSA 2R9RA 3R8HA 3ONBA 3GHTA 4G5DA 1LQAA 2HV5A 1PWLA 2PDUA 4WGHA 3G1RA 4JQ2A 5LIKX 1GVEA 4WDTA 1EXBA 2FGBA 2ACSA 3LNMA 2IKGA 3R43A 1Z89A 3QKZA 4JQAA 4OTKA 1PWMA 4JTDA 4XVDA 4XZMX 3G5EA 4ICCX 4HBKA 3LQLA 2IKIA 3LD5A 4LBRA 3DOPA 2J8TA 3RX3A 4IJCA 5JH2A 4FA3A 1K8CA 4GQGA 3DN5A 2PDIA 2PDHA 2PDMA 2PD9A 4JTAA 4NKCA 2F2KA 1QWKA 3WBXA 1Z9AA 2I17A 3B3DA 1T40A 4XZNX 1XF0A 3WCZA 1PZ0A 3BV7A 1EF3A 3GHRA 4GCAA 1PYFA 1VP5A 2IPJA 4XAPA 4GA8A 2WZTA 2ACQA 3LENA 3UFYA 2HE8A 3FJNA 1RALA 4QXIA 4PMJA 4Q7BA 2IQ0A 2HVNA 3RX4A 4IJRA 3LZ3A 3UYIA 2INZA 2IKHA 4ZFCA 3V0SA 1MRQA 1AH3A 2IPFA 1ZGDA 2HDJA 2PDWA 2PDJA 4JQ4A 1J96A 1RY8A 4WDUA 4JTCA 3CAVA 3RX2A 2BP1A 1QRQA 1M9HA 3S3GA 2PDKA 2R24A 4XZHA 2VDGA 3CMFA 4MHBA 4L1WA 3M64A 5DANA 2DUZA 4XO7A 1HW6A 2AGTA 3UG8A 4YVPA 3ONCA 4JIRA 4XVEA 2IS7A 2PDPA 4XZIA 3UWEA 4IGSA 4ASTA 1LWIA 2BGQA 2PDYA 1R38A 3KRBA 4GIEA 4PUUA 2WZMA 4QX4A 4QBXA 1AH0A 1AZ1A 5HNUA 4YVVA 4L1XA 2DV0A 4JTRA 3UZYA 1UR3M 3LQGA 4JQ1A 4XO6A 1IHIA 4YS1A 5C7HA 1MZRA 3UZZA 1YE6A 2FZBA 3V0UA 3T42A 5KETA 3MC5A 1S1PA 1YNPA 1Q13A 2NVCA 1MI3A 2PDQA 3M4HA 2IKJA 2FZDA 5AZ0A 4DBUA 1T41A 1YNQA 2ACRA 2ALRA 4H7CA 3CASA 4GABA 2PDNA 1SM9A 1S2CA 4GQ0A 2PZNA 3UZWA 2ISFA 3EB3A 4LB4A 3WBWA 3N6QA 2INEA 1Z3NA 4I5XA 4LB3A 2QXWA 2P5NA 1IEIA 1X96A 1EL3A 4WEVX 2CLPA 1X97A 2NVDA 3LEPA 2PDFA 5LIXX 4HMNA 2HVOA 1XJBA 4LAZA 2I16A 5HA7A 3WG6A 1YE4A 3VXGA 3Q67A 4FAMA 2HEJA 4PR4A 2F38A 2PF8A 5LIWX 1XGDA 1AH4A 3Q65A 4QR6A 3V0TA 4F40A 1JEZA 3GHUA 4EXAA 1US0A 3CV6A 3EAUA 3V36A 2IPWA 3CV7A 5JH1A 3U2CA 3M0IA 4XZLX 3NTYA 3O3RA 3V35A 2HE5A 3UP8A 5LIYX 1OG6A 4JTQA 3BCJA 2PDXA 1AFSA 4WDWA 1HQTA 5HNTA 4FALA 3BURA 2IPGA 2ACUA 1VBJA 3LZ5A 4Q3MA 4WRHA 3N2TA 2PEVA 4JQ3A 1AZ2A 2DUXA 1PZ1A 1A80A 3COTA 3GUGA 4JIHA 2PDGA 3MB9A 4DBSA 1Q5MA 3H4GA
chains in the Genus database with same CATH superfamily
3G1DA 2VZSA 3W74A 4AD5A 4LUTA 2VZVA 3LMYA 4J40A 1JCXA 3EX2A 4DZ5A 3GBEA 2WWDA 1ZLPA 4NAEA 1J5TA 4A8LA 1RVGA 1R5YA 4O0QA 1S1RA 4PRTA 2WBGA 3C2YA 3ZJ6A 2HNHA 1XC6A 3EOUA 1XIHA 1YIXA 1S2AA 2DIJA 2P3EA 5BMXA 2VENA 1UKQA 1W8SA 1HGYA 3O9NA 4UOQA 1SMAA 4P7LA 4AXKA 2DT3A 4U28A 1U1UA 1VBUA 5TNVA 2I57A 1OZMA 1OT2A 4FF7A 1AK5A 1KV5A 3GNNA 3T2OA 4W85A 2RJGA 3GR8A 3A3XA 3PBWA 1BKHA 2GGHA 3LY0A 1UPMB 2Z1KA 5EYWA 4RE4A 2PP0A 2P76A 4R85A 1WYIA 3CWNA 1HL2A 4UTHA 1W5QA 4FXJA 3ALFA 4R7OA 1M04A 3AIEA 4B2DA 4DUWA 4MF4A 7REQB 3RDKA 3I7QA 1AW2A 2Z7KA 2W92A 4C5YA 4EAMA 4QG9A 4YWSA 2WK2A 1HFBA 4L80A 4Z2LA 3W1TA 3PY2A 4E4FA 1BKSA 3WJSA 1OK4A 4PCTA 1TWIA 2REQB 3BL3A 1IT7A 3CZKA 4GY7A 1R9XA 3RILA 1XFCA 3MBDA 3AHVA 3PUDA 1L6SA 5TBOA 2ZX8A 3OO2A 4R88A 2OSWA 3M6DA 4IFOA 3FXYA 2PRHA 3WNNA 1GTHA 3DERA 2IMRA 4XTIA 3R13A 1A53A 3W2LA 5D02A 4HVXA 2BOGX 2RDWA 4YTQA 3PZMA 3URNA 5EMYA 3ZIZA 3W26A 2B81A 2PDHA 3LRKA 3GC2A 3VE9A 1QWKA 5I02A 3MKKA 3P80A 7TAAA 5CPTA 1V8EA 3GDLA 3HTWA 2WKJA 1GQLA 2GPTA 4MJZA 3CLMA 2YA2A 1PYFA 2IPJA 4LCSA 3IS4A 1PBGA 1QFEA 4NNBA 3GG8A 2PE4A 3SW6A 4B3KA 1UA7A 2C14A 3FJNA 4UCFA 4RKAA 4NRRA 4IPJA 1JFXA 2FPVA 1RBLA 5AC6A 4EIVA 2V3DA 3CC1A 2INZA 4ZENA 4GJJA 5C9ZA 3ITYA 2E28A 1A5OC 3W2UA 4KWSA 2DZVA 3R25A 1ZGDA 4RDYA 1K9FA 2PDJA 3SN1A 3RGTA 5HUOA 4ROQA 4O50A 2VNCA 3CHVA 5H1WA 1UWAA 4GVGA 4H8VA 2HTMA 3C6CA 1HNYA 4XZHA 1JZ3A 1XLIA 2YCLB 1DE5A 1VH7A 3THUA 2XVGA 1N8FA 1C8QA 3N34A 3T0BA 3GWQA 4OT7A 1TV3A 3NSXA 3W7PA 1FH7A 4KESA 2WVSA 2TRSA 4LBUA 3QGAC 3QR1A 2Z6IA 4GIEA 3KRBA 2BLEA 1GCYA 4QX4A 4O1EA 1MEHA 4IIGA 2HS6A 2J62A 4US6A 3F5LA 2EG8A 3UZYA 4YHEA 4L4MA 5D30A 2HJPA 3E49A 4A22A 1DJNA 2ZZ2A 2PP1A 1XICA 1RUSA 3W7GA 1H5VA 5AYBA 4Q4RA 2PWUA 3AIVA 3MW7A 5KETA 4LY4A 1Y5WA 4DM2A 4ZMGA 3FHQA 1VRXA 1ISZA 1OX4B 2DVXA 1DXIA 3SY1A 4W86A 4MB1A 1GVIA 1KWKA 1KQYA 3BVJA 2EGZA 2YCKX 3EPOA 3AU6A 4B5XA 4J3TA 4NJGA 1GOXA 4HP5A 3W53A 2D20A 1LWJA 4JNZA 5TD4A 1XIMA 1QW8A 1XYMA 3M41A 1E0XA 1XGZA 1ZRQA 2P8BA 4DI9A 1X96A 3S1XA 1Y5XA 5FEZA 1E72M 1U5HA 3E0VA 3WLIA 1S39A 1X97A 3H12A 1UBSA 5C9XA 4C6FA 2Q3OA 3DFSA 3LPGA 5D2TA 4BQ5A 1TPDA 3ITCA 2OEKA 1FWNA 4TX6A 4LF2A 3IIOA 3ZLFA 2XJ7A 3LCWA 2E9BA 1EO5A 7REQA 1IE7C 3PPFA 4LUIA 4IX0A 4QEHA 4BF5A 4HK6A 3ITTA 4AU0A 1BWLA 4DUXA 2OWCA 4L9XA 1J8VA 4GRSA 3BSGA 4A2RA 4NXKA 3NQCA 3S1VA 3VDBA 3BZJA 5FF3A 3CQJA 3NTYA 1TZZA 2REQA 4ZFMA 2Y7EA 3UP8A 1A5KC 5D8WA 1VFSA 1SO6A 1QAPA 4JIEA 1MUMA 5CZJA 1CLVA 4IP5A 1BGAA 4HGXA 5HXMA 4IGNA 3S6DA 3P82A 1ICSA 1Q8JA 2W63A 4JX5A 4O0KA 3IUIA 5HAOA 3NCOA 1UB3A 1SZGA 1AZ2A 3AXHA 1TV7A 4LAKA 2XGZA 1PZ1A 3OBEA 3LHWA 2Y85A 1PX3A 4AC1X 1F73A 3AIBA 3DI0A 4M7TA 5HMSA 2BGSA 4X2PA 3GG7A 1C8YA 4G7EA 4UB9A 4PODA 4DYKA 2R82A 4UQEA 2Q09A 3EWYA 2EPLX 3P14A 2J47A 5EMUA 5I23A 3CHDA 3GY1A 1DHKA 4Q4SA 3QV7A 5HWJA 1E0UA 4AWUA 4PUEA 4H8NA 1MNSA 3L7RA 5FOOA 2J4GA 4K8GA 4A3QA 3C3NA 2X16A 1J79A 4HTYA 1JZ5A 3T2PA 3PAOA 3SCVA 3APTA 4ZB2A 2VJXA 1EOMA 2Y89A 3HN3A 4JTGA 1UWRA 3K1GA 2BXYA 3NOYA 4K7VA 4FPSA 4IXXA 1Q6GA 4W93A 4O0ZA 2YL9A 4ERGA 2FTYA 4GINA 3OQ8A 2GDUA 2BDQA 4PUMA 3BZGA 2EAWA 1GW1A 3TEVA 3CUZA 5D9MA 5AFDA 4M6QA 3EDKA 4A4AA 3CS2A 4PH6A 2OJPA 1TSIA 2R9RA 2FZMA 2PUZA 3KL5A 1OFDA 1ONRA 4IUGA 4CU7A 5HQMA 2V63A 4C1LA 3WDHA 1J2WA 1M7XA 2XU2A 4ZQOA 1DE6A 4DYJA 5D32A 3IK4A 4GE8A 4DX3A 1XV8A 1UH2A 3PSWA 1ZB5A 2AOSA 3WH5A 4GNVA 5IHRA 4EXQA 2QPUA 1ICQA 1OX4A 2D2OA 1O60A 5CC7A 3I7SA 4LF1A 3T55A 3B4YA 3CUJA 3BLDA 1GWJA 3WELA 3H2NA 5JH2A 1JGMA 5B7YA 1C91A 1LT7A 3WFLA 3DN5A 1TR9A 2XH0A 2VX6A 2NWRA 1YDYA 1RBAA 1N82A 2LLEA 3TA6A 4Y7EA 2YW4A 2GVYA 4PBGA 1EBHA 2C1GA 1LBMA 1V6WA 3O6DA 3K13A 1DP0A 1HXJA 1VLIA 1UUMA 2G96A 1J11A 4M29A 1X1ZA 3AIUA 4U3CA 3VOIA 3LCFA 2VQTA 5HMFA 4HNCA 1B31A 2BTMA 1J0HA 4IGMA 4D6EA 1S3TC 5A69A 2DZSA 1KKRA 1S2VA 3UNDA 3R8RA 4W88A 3KLKA 1T0OA 1XHGA 1CEOA 3FW6A 4GIYA 4AHQA 2VX5A 2IPFA 1E5NA 2X05A 3WH9A 5ABEA 4DHGA 4IHCA 1W9XA 4GZEA 5TF0A 4Z1AA 1QRQA 4IX2A 1M01A 5KTLA 3PJTA 2B31A 5CH9A 4X2RA 2C8NA 3ZJ8A 4ZE5A 1QO2A 4GO8A 5EB8A 5A94A 2D0FA 1FWEC 2DSVA 1R9ZA 4ZOAA 2ISSA 5ENLA 2W27A 2YSWA 4KCTA 5CSYA 4KWWA 1R38A 1E0TA 4OKDA 5JU6A 3VTRA 5AHEA 2B7QA 3GFXA 3M0YA 4JTRA 4Q7IA 1O68A 3ZS4A 2CNCA 3R12A 1GGOA 3PB2A 2BASA 4EE9A 2E4TA 3VGEA 1R46A 4IUOA 2CEQA 1E9YB 4KRTA 1CGXA 3SN4A 1HJUA 2WVUA 1K8ZA 5I07A 2X30A 2FZDA 3MS8A 2J9YA 5F7UA 2AAAA 2JKAA 1P5BA 4H7CA 4GABA 1EGMA 2W0UA 1K6WA 2PDNA 5DXXA 4JL1A 4L56A 2RKXA 4AZBA 2QT3A 5EBUA 3W2NA 1ZAHA 3INPA 3QJAA 4JNMA 4NNCA 2NV9A 2OB3A 1Q6RA 1JXJA 2ZRZA 3BGGA 4MPKA 5FF7A 3TXVA 1I8JA 3THDA 3AICA 4XUYA 3WNLA 3LG3A 3GRIA 3ABXA 4GYJA 3F4DA 3CUXA 4F0SA 5LA2A 3HB9A 1O7AA 1XJBA 4OE7A 1SUXA 4GOAA 5E93A 4REQB 2FLIA 2XYLA 2BHYA 3M46A 1V7YA 1I1XA 3UXKA 2XTKA 1ZHAA 1ECEA 4I7UA 1A0EA 3GAKA 4CQCA 1TZ7A 4AC7C 1V3HA 1X7FA 3GIQA 4P7RA 4CQBA 1UP0A 1WV2A 3NQ7A 5FJJA 4N7QA 1SR9A 2X1IA 3CPUA 3WLQA 4RPPA 4UQCA 1LROA 1K9EA 3AIRA 5B7ZA 2UY4A 4GI8A 1HKWA 3G6LA 3G8RA 4HCDA 1JZ8A 2XVPA 3ITLA 3OU8A 1KRMA 3QHMA 3FGCB 1RJRA 2VGFA 2WPGA 3QV8A 1FX6A 3T0CA 2Z2UA 3FJ4A 3SQLA 3B03A 3IJDA 2H90A 5E09A 3N2TA 2PEVA 2QCCA 3MI3A 1ONEA 4AXNA 2DIEA 4XKMA 2YCJA 3TC6A 4GJ1A 3WMSA 3L4WA 3JW7A 4UMCA 1Q8AA 1ZL1A 2GDQA 2Z2BA 1P6WA 1GZGA 1UIOA 2DSKA 1HJXA 2A79A 1KLYA 2X0YA 1U5JA 3NWRA 3NL6A 3PAJA 1RK5A 1E6SM 1EOKA 3FYOA 4EF8A 4R7JA 3D3FA 4PUDA 4HZ8A 5CSSA 3O16A 1LJYA 4U2ZA 4YPJA 4E4UA 4AHPA 2XG9A 3FA4A 1VGAA 3NQBA 3AISA 4WCJA 3H55A 3O6CA 1A3HA 2QCFA 2PFHA 4F48A 1KBIA 2J7DA 4R9OA 3GC4A 3BUVA 4ES4A 1EUNA 1OM0A 3VC5A 3GFYA 4Q4QA 1D2KA 1P0EA 4ONVA 4YVXA 2RJHA 2VCBA 3UR7A 4AY7A 3F7JA 2XH4A 1JZ7A 1EJRC 1EGVA 2QMKA 2DZXA 1ECQA 1U5VA 3AHYA 3FDKA 4EKJA 1YBQB 3CEPA 1C29A 3HGRA 2FZ9A 1TTIA 3FJ6A 3LBOA 4FP1A 4S39A 1NEYA 2ZRVA 3CT7A 4US5D 4QLKA 1B54A 4JS3A 3BCFA 2XH2A 2VZOA 4MM1A 1PWLA 1WOAA 4ZGYA 1NF0A 2A6NA 3IV3A 4QQUA 4DO4A 3FEQA 2ACSA 3WJYA 2NUXA 2ICSA 1EO7A 4KIEA 3S47A 4NZ1A 4AYSA 3FYPA 1S3HA 5CCZA 3N2BA 5A3HA 1V03A 2OT1A 4F2TA 5AC7A 3CZ8A 1Q2SA 1PEZA 3CZJA 1Y7VA 1UH3A 4A6GA 1S5NA 2WXDM 1SSGA 1OCQA 1XL9A 3IJQA 4NI8A 4RL3A 3TC3A 4B5TA 4OOZA 5CAHA 3A12A 1MNZA 1Q4NX 4NP7A 2CPUA 3S2LA 2ZRWA 5TQLA 3KZSA 2OQHA 3LK6A 3NO1A 3WBXA 2XSBA 1Q6QA 2PZ0A 1Y8BA 4JX6A 2RDUA 1N8WA 2O9PA 3OYZA 1XF0A 3TSDA 1FWWA 1V0LA 2XISA 4PL2A 1B9BA 1DIEA 2GSHA 2GOUA 2OYKA 2BBFA 6TIMA 4NG3A 4GBDA 4OIFA 1XR2A 3A64A 4N9CA 3FIGA 4REQA 2AKZA 4W7WA 1VFHA 3QMTA 2WSQA 3NQ6A 4A3HA 3GTNA 5T9CE 1KKOA 4GFSA 3VILA 4LVFA 2VCCA 3KOXA 3WH7A 4C90A 1HJQA 3TXZA 2XSXA 4Q4PA 5A95A 4IQLA 2XH7A 4DJED 2CBUA 2GJPA 4DB7A 4Q8NA 4IPLA 3BG5A 1G7UA 4GGBA 3SI9A 2CXEA 3TR9A 3NPVA 3N9SA 3TTSA 1QW7A 2QS8A 2C16A 3B05A 3STPA 1W37A 3I7RA 2Y4SA 3W85A 3KS6A 3FGCA 2XM2A 4JAWA 5DCBA 1H11A 5JMUA 4CVUA 1UD4A 3MCMA 1XIGA 2CFFA 3GIYA 3TJIA 2OQLA 3E5PA 5A8OA 1MXGA 4NL1A 1WCGA 2QYGA 3PJUA 1J0IA 2PRMA 3BTNA 3NDOA 5A6LA 2QW5A 4S23A 3TNBA 4KGJA 4FNRA 2ISVA 3MSRA 5MKGB 4FOJA 4L1XA 4ZOCA 3SQMA 3AYVA 4MNJA 3PNZA 4I90A 3MO7A 1DEDA 3C4UA 3UZZA 4PUJA 1CX9A 3DYPA 3KTXA 3UJFA 1JDAA 3WY1A 4K6AA 2DSZA 4IMEA 2AL1A 1OFRA 1F3XA 3M0LA 2G97A 1GHSA 1GKPA 1DBTA 1MYRA 1ONWA 5JQ9A 3PBUA 2IW0A 3NPWA 2VZTA 1SM9A 3UPWA 2G8ZA 4MZ8A 4BQ2A 1IV8A 1YPIA 5HPCA 4M19A 2NQLA 4LWWA 2FH6A 2QV5A 1HKVA 3L2MA 3S2CA 2R94A 3EZ4A 4HU4A 1EL3A 4WEVX 4HNNA 5BXSA 3LNPA 2HPMA 1YKWA 3N2XA 3N9RA 4H1ZA 2V2CA 3B8IA 2NVDA 4UR7A 2E09A 4E8CA 4LU0A 4QG8A 2A2IA 3VD3A 1VJIA 1I9CB 1ADOA 1R9YA 2GJXB 1YBQA 1UROA 3VGFA 2V30A 3LHZA 3CTLA 3O7UA 1G4SA 4HIBA 1XGDA 1EPVA 3PK7A 2YGYA 3W7MA 4AZCB 2J8GA 4C6JA 2I7GA 4HMEA 2Q8ZA 3U9IA 4CN6A 1PTGA 1O66A 4E3VA 3DFTA 4PBEA 4TMBA 1OYCA 1MW2A 1US0A 2NXIA 2RDTA 1VJSA 4IL0A 4UQDA 5HULA 3RU6A 3IJ6A 2PC8A 1DJWA 3DGBA 3C52A 3MJMA 3VU2A 4JGDA 5M1TA 2W67A 1M3UA 1XG3A 1BFNA 1V7AA 3JZEA 3AXKA 4K7YA 4ZSTA 3DH7A 2ZCGA 3TN5A 5C9RA 1C92A 5LXXA 1SO4A 1POKA 1Q6CA 2PTXA 4DVOA 4NXSA 1TMLA 1IXOA 4XAGA 3BJSA 4AYGA 4YN5A 1E0WA 2VRJA 1L6FA 2BSLA 3BQ6A 1I6NA 2BY3A 1VYPX 3EDFA 3LI0A 3Q37A 4Y8EA 3MP5A 2DJXA 4JTKA 3SRKA 3CAQA 3LN3A 2WO5A 4CCCA 1Z8AA 2CWXA 1D3CA 4S3KA 1J5SA 3VNZA 3B0PA 3AALA 3EOLA 3LYEA 1J0YA 3AC0A 3O06A 5CPSA 3VKJA 2PWFA 3B0VC 1ZBVA 2QV4A 5I3HA 3WO8A 2PBGA 4WKFA 2UV8G 4PZVA 1FQ0A 5ABGA 2FFCA 2V5LA 4M1RA 4GUIA 2VVSA 1W3LA 3QTGA 1UPPA 1VBHA 2PDBA 1PX4A 4GISA 4DBDA 2CITA 1XKYA 3WH8A 1CB7B 3V1PA 3UNTA 1H0IA 1M7OA 3EKGA 3NQFA 4H6KA 2PGEA 3TYUA 3WD3A 4BI6A 2WZEA 2E7FA 4WK9A 3RM4A 3KEHA 1CECA 3FA3A 1E40A 1ME7A 4DPPA 2D24A 5K9DA 4AISA 4F0HA 1SZNA 1HKMA 4Y90A 3WQWA 3KL3A 3WDPP 3V5CA 4UTIA 1VYRA 3MYOA 2QDEA 1JZ6A 4ICMA 3TCEA 4DUOA 1JAKA 4ACYA 1K3UA 3TP4A 5MKGA 3G1RA 1B3ZA 2NT0A 4GZ7A 1SJDA 2V81A 2ZE3A 1BYDA 5G2WA 3SSZA 2RDXA 1FWAC 3B0XA 4LV4A 1D8CA 2YBTA 4O28A 3KOYA 4UQBA 3U2EA 2RUSA 4J3XA 1JPMA 1PZ2A 3VGDA 1W9BM 1GVFA 2POZA 3QLLA 3GAYA 3AHTA 1NDYA 4ZOEA 5HNRA 5FSDC 1L8NA 4PFMA 4BCEA 4PL1A 5FEPA 4GUGA 3UA3A 3F4CA 5IDZA 4XIMA 3CZLA 3HFTA 3IVTA 1DWFM 1OHLA 2I17A 1OYAA 1EF2A 4XZNX 3NO3A 3VDAA 1I4NA 3QYQA 2FPTA 3QQ1A 1I0DA 3H70A 2CZ5A 1VP5A 3K8KA 4IZGA 3DHPA 3LENA 2QJGA 1IXNA 1OFQA 2PTZA 2GJXA 4WJXA 3HQNA 1NWTA 1GTEA 1OFAA 3RM9A 2RAGA 3O6YX 4AZCA 2VX7A 3KBWA 3DFPA 4C1KA 3OIXA 4S3AA 3NZQA 1VB9A 4D6DA 3MQTA 4N6FA 1OWQA 2H3DA 2E1WA 3BGAA 2CC0A 1RY8A 1BLIA 3L5AA 1P0NA 2W3ZA 4NYUA 3SM0A 1VAHA 3CXOA 4DWSD 5K7JA 2R91A 1E70M 1F8MA 3VAVA 4FX7A 5DRCA 4Q8OA 3NL2A 3RRXA 2PLJA 2MANA 4C91A 1VCVA 1HUVA 3UXIA 3OEXA 4UTKA 1BHGA 1PHWA 1E1CB 2A85A 4BA0A 2ZC8A 4HOWA 3MA8A 3MUCA 3TOYA 4GLEA 4KFPA 1T96A 1GYLA 4FLSA 3RR1A 4PB3A 6TAAA 3PULA 4O1AA 3WLNA 4LYRA 1AZ1A 4YVVA 1EDGA 3U3HA 1ISVA 1MQQA 2WJEA 1DJZA 3TYCA 1L0PA 1EWEA 4A8NA 3MSGA 4M81A 1IT0A 3CH9A 2QKFA 5LGZA 2VX4A 3E02A 4Y9PA 4HKPA 1M7PA 3CH0A 4NJKA 4KEVA 3P8JA 3B4UA 4EPKA 2BX7A 2X2YA 5D9PA 3PUEA 4FO4A 3IAPA 3OOQA 5DXYA 3W23A 3SN0A 3F2DA 4LJ3A 2ISFA 1O95A 2QF8A 3IPWA 1F6KA 2Z24A 4ERIA 3DHFA 4JEQA 1EA9C 3W7DA 4RZ4A 3CPRA 4PMQA 3M6YA 3CIWA 1KM2A 5DO8A 1XQKA 2E40A 3WJXA 3LEPA 3C2RA 3GTFA 4PCSA 4R5EA 5AYZA 4DNMA 4HYVA 2I16A 5J04A 1TX0A 3O05A 3KCOA 3T8LA 5LIWX 4C6CA 1WOBA 3AMGA 1H7NA 3ALGA 4EK7A 2ZBTA 3G0SA 3NPXA 7ENLA 3DBPA 5D37A 1YLVA 4R3UA 4Y6GA 3DGRA 4JTHA 3EMQA 3RMJA 3CV7A 3DHUA 1EX5A 3M5YA 4HHPA 5EMKA 2CZEA 1EJ7L 3EKLA 1PO9A 3J7HA 1OGBA 1KTCA 2GUYA 4JTQA 3RITA 1RQEA 5C7VA 2Y2WA 5G1YA 1TPH1 1TKKA 1XLJA 4CCEA 4DJEC 1VF8A 2R1MA 4M5PA 2XIQA 3YPIA 3PWAA 3QHNA 3EOEA 1RP9A 2G50A 4ATLA 1LOSA 1SSDA 1WBHA 3FAXA 3UPBA 4BEUA 5BW6A 5HWMA 3RIKA 1DYSA 4KT2A 3C0JA 1J01A 3APYA 3MKVA 2QCHA 3EXSA 4FMVA 1F61A 2PWVA 2Z1WA 2VGBA 4DBWA 2PDCA 2YXOA 5LA1A 2VKZG 1WDDA 5I7GA 3A3HA 4WDXA 1ZQ5A 3LV6A 2PA6A 3Q45A 3PG8A 4O1DA 3LOTA 4P8VA 2OGYA 4NZFA 4DWDA 4GIRA 1KXQA 1MRAA 1IR2A 1PKYA 4XD5A 4NHVA 3IEBA 1EQCA 1MEWA 3H7RA 3DFNA 3WLOA 1XH2A 3BOXA 3OBKA 2RFGA 5J5DA 1JCJA 1LUCB 4ZO8A 3VOCA 1AW5A 2GK1A 3M07A 3UWVA 1KTBA 4MJMA 1OIFA 3B0YA 4LYPA 4MOZA 4Z1YA 1HJWA 4JHMA 1OT1A 1UA3A 3MU7A 1FWTA 1E1CA 1TWWA 4RZ5A 3W0KA 4UMBA 3LXCA 1OC6A 4AUBA 1DWGM 2HXUA 3RR4A 1P0DA 2UZ9A 1R2TA 3VA8A 3ANYA 1GVQA 1W3TA 2V69A 2XVLA 4D6IA 1FBAA 4PTVA 3BSMA 1TX2A 3BOFA 4QLLA 3NQ2A 2Z29A 4O19A 4G9PA 2VURA 4CD6A 4UXDA 5FSEC 3NQVA 2J74A 1R0MA 4IG2B 1KO0A 1GQNA 1IXPA 4H9MA 2ADAA 1TMQA 4EWND 2FGLA 4LALA 3MZ2A 5IFTA 1A4MA 3RX3A 2BODX 4H2CA 1CLKA 2CETA 2X41A 9RUBA 4BHYA 5E0CA 4L6HA 3O0FA 4O12A 3BG9A 1KRCC 2DW7A 1UWQA 1LG1A 4NSBA 4BY3A 1I2OA 1FWDC 4ZE4A 4N9BA 4EOUA 3MMDA 3GS6A 3EWXA 5BCAA 4ZL1A 1VCGA 4XIAA 3OW1A 3GXNA 1W56A 1OCNA 2Q6ZA 1E4MM 4M80A 1UR4A 2C79A 3EWBX 3GVGA 1X6UA 3PBVA 1ZCCA 5F2MA 4PUNA 2J6VA 2Y0FA 5FESA 4I6KA 5I09A 8CGTA 3HPXA 2A4AA 3BDKA 3QMSA 4CKQA 4B3ZA 3VMPA 3V7PA 5C71A 1JDFA 3FJLA 3MUY1 3ZVHB 1EJVC 1EP2A 4ZA0A 2NQ9A 3AXXA 3GU9A 2I1OA 1V0KA 2UBPC 5M03A 1H7RA 3C56A 2F6KA 3CYVA 4GHRA 1DKWA 4WX2A 4YNGA 4C6BA 4UFJA 4P8XA 4IIFA 2E8YA 4YVPA 4XVEA 7ODCA 1N55A 4QTGA 4LCQA 4XZBA 2GL5A 4C6EA 1S5MA 4LYQA 2A3LA 3OLGA 1XBYA 1PDYA 1JL8A 4EP8C 1RLCL 2UY2A 4QFUA 1IF2A 3QMRA 5DCEA 4HA0A 3BXWA 4J1OA 4CNUA 5KZEA 3KHDA 4MJ2A 5I3IA 1F8IA 5C8BB 4CNOA 1FUYA 3SUSA 3UJSA 5C6MA 4HB7A 4MFEA 1TUFA 3BMWA 3HG5A 4RCXA 3E1F1 2NUYA 3R0DA 1XD1A 1CENA 3WFZA 1GQJA 1PIGA 3KL0A 1Z32X 3HFYA 2G3NA 5FJOA 4L4OA 3UY7A 1E4NA 1MI3A 2B7OA 3WF3A 3M4HA 3XINA 4F2UA 2QF7A 2G0WA 1J0ZA 4GYKA 4A05A 1NU5A 4JY9A 4IP4A 3PWGA 1FHDA 5HMDA 3CASA 4G1NA 4DJFA 1KFJA 3UG4A 2DT1A 4IFKA 3VVGA 2PGRA 5GNYA 2AL2B 2CLKA 1VIZA 2NQHA 3OHMB 4GUJA 4LB3A 1E0VA 4WUIA 2VWTA 3PZQA 1LUCA 1GKRA 2A3AA 3RU8X 3K1DA 3ATZA 2VC6A 3GM8A 4EPBC 1HZYA 3ZT5A 3WEZA 3BARA 3W2MA 2AQWA 3HGJA 3I68A 1G4PA 3G1FA 3LM3A 4BQ4A 1QXLA 4HQVA 1UMYA 3ARSA 1TPFA 3N2CA 1HX0A 2IQTA 1GEHA 4CNPA 3C8NA 3M0VA 1VBGA 1ADDA 3LI1A 3ENLA 4O16A 4M6UA 3UPMA 5CC3A 1V93A 3TMLA 3HV9A 3BAJA 4JN8A 1QJWA 4AD3A 4HCLA 1GG0A 4QITA 1JDCA 1JUEA 1ME9A 2ZWZA 1ZBWA 3WK0A 4F0RA 4RZBA 3VUSA 4PYSA 3OA5A 3GR7A 4XUGA 1IR1A 3V35A 2WC7A 3HOJA 3PWIA 1D3HA 4O14A 4TX8A 4JYDA 4QP0A 1L6YA 3GDTA 2OTDA 2JALA 4MDPA 5LGXA 2ZZ3A 4IG2A 1ZPTA 3L65A 1KNWA 1ZAIA 3CWHA 2DZBA 4WGXA 1VJZA 3XISA 5HNTA 5DN1A 3TW9A 2ZVRA 4RV3A 1RA5A 1H09A 3T08A 4Q6JA 1RAKA 1S5TA 3KBJA 3MVTA 2QUUA 4DWSC 2GGIA 2NQZA 3PPGA 4LVBA 4D8ZA 3SRHA 4KCUA 2VEKA 1XDLA 2ON3A 2OMAA 3DCPA 4CU6A 5CZKA 5BXTA 1K9DA 2FZ8A 1EKOA 3B9DA 3FFSA 1PAMA 3MMUA 4PUWA 4FLQA 1X98A 1OCBA 1F76A 3N1AA 1D7FA 5IRPA 1DQWA 4OQVA 3LSCA 2GGJA 3KFTA 2R1LA 3R6IA 2XSAA 4K8HA 3TFXA 3AJXA 5AZ1A 3B8TA 3ZVHA 4D71A 4UCGA 1GZ1A 3GG0A 2YA0A 3PPCA 1B4EA 3DG7A 1DTNA 1DJYA 1Z6KA 5FJRA 3V16A 3SQSA 4IICA 1JI2A 1KLZA 4KEZA 1M65A 4J35A 2BY2A 3W73A 4Q33A 3G0UA 3BLEA 5C2XA 3FSTA 1ZP3A 3IRDA 3GK0A 4W7UA 2V68A 2CLMA 4XBKA 3W2KA 3S4TA 1XYCA 5GQBA 4PCNA 1J4EA 3KOFA 3S9ZA 3VGGA 2WNNA 1XLDA 1FCBA 2PDUA 1PHQA 3ZR4A 3PZNA 1RXOB 3IIVA 4OECA 3HQPA 2R8WA 3R11A 3UR2A 4MY1A 3ZR5A 2E9MA 2OOGA 4PMNA 2HMCA 2WCAA 4H6QA 3FN9A 4E2VA 3FNDA 1QPNA 4IH3A 1EYEA 1TO3A 1H5YA 2HXTA 5A2AA 2QJNA 4MZ1A 1F6PA 1WE5A 4U2YA 5T26A 4GYPC 1GOOA 3CMJA 3OIHA 2NX3A 1V3JA 1JQVA 3NIYA 2AL2A 1ITXA 5A6TC 5F2IA 5XINA 5HBFA 4B5NA 1NF7A 5KZMA 2VFHA 1V3IA 3SY5A 1QI4A 3BLIA 1SJCA 3GX9A 4PCFA 2Y5EA 1AL8A 4US5A 5H8UA 2GJLA 4LPCA 1TJ1A 3B8VA 4B90A 4LC6A 8XIMA 5CSUA 3ITXA 3TYBA 5G2IA 3CLWA 2DIKA 1Q66A 3MHUA 3UEQA 1K02A 4N4PA 2WLZA 4JFTA 1KR0A 1Q7MA 5AHFA 3TWAA 4RNIA 2VFGA 3SSJA 5D05A 1RALA 4Q7BA 4QJ1A 4IJRA 3TH6A 1XRVA 5DQPA 3URBA 2WSPA 4FR6A 2F7FA 3AFBA 1XH0A 3VD4A 4UTUA 4LS0A 3GTHA 4O1BA 3N73A 4ATWA 3ATYA 5KMYA 1OD0A 2WHKA 4PMDA 4AIUA 4RK8A 3TX9A 3GE7A 4Y9OA 5CGQA 2XIBA 1F5ZA 2YX0A 4L1GA 3AHXA 3JRKA 3CMFA 4L1WA 4BKNA 1R3WA 5CZSA 2D69A 2D73A 3N3MA 1K7EA 2QJIA 5TIMA 1W1PA 3WJWA 1XIIA 4HNUA 4U5KA 3K46A 4OFCA 2BS9A 1KR1A 2IS7A 3KOZA 2DSUA 2XIOA 2O0TA 1XLGA 5FI8A 4ZQCA 2XVNA 3MCNA 6PTDA 2PAJA 3W7JA 2ZXQA 3T44A 1DHPA 4QRNA 1KBBA 1R2SA 2Y62A 5D04C 2C15A 3SZ8A 4AD0A 5BROA 3F1QA 4DJEA 3SR7A 1OC7A 4MNLA 2WNZA 4X3ZA 4GNKB 1J6PA 2FZBA 3MUAA 1H51A 3HPFA 1R6WA 5IFPA 1Q13A 4NAFB 2B4GA 4Z2KA 4GVFA 4W8BA 3L2LA 3I4KA 1JZ4A 3U7VA 1QOQA 1XIFA 1CI1A 4A8IA 1CXHA 2YYTA 1R3YA 5KINA 1Y0EA 5DT7A 2ZICA 3WBAA 1UUQA 3RLGA 1I2QA 1XPGA 4BS0A 2Y7GA 3DDMA 4K1WA 3CQKA 1C8XA 3ZLGA 1OB0A 2XM1A 3MDWA 3WNKA 1OF6A 4ENLA 1MW0A 2ALDA 3WNPA 1TFVA 1H4PA 2OT0A 5K3VA 2WSYA 3M44A 4Q8PA 2AMXA 5F4XA 4HN4A 1WA3A 1MDRA 3W7EA 4ZVJA 5HUPA 3IWPA 2FHCA 4YLWA 2A7PA 3TTEA 3C2EA 3CTTA 3W6YA 4LAZA 4R27A 4HU8A 2YLLA 3V75A 3G1SA 2BWGA 1U1HA 5AY7A 2OVLA 4QE4A 5HQEA 2F2HA 2PLMA 5EGRA 1JF6A 5E70A 2J79A 4O13A 1OX6A 4A29A 4UUIA 4AG0A 4IMGA 1RZMA 3VYLA 4Q6XA 2R1PA 3MP4A 1UWTA 4DZIA 1UKSA 2J88A 4XAZA 3ZT6A 3GNDA 3O3RA 1UR2A 3BANA 3SCNA 2Y7FA 8A3HA 4MWAE 1HN1A 1QBBA 1BSLA 3VD9A 2UY3A 4DO6A 3PUOA 3HPSA 4U4MA 2C1IA 2EO7A 2WZIA 4Q8TA 3II1A 1XG4A 2WCGA 1XRSA 3MI2A 1Z41A 1Y65A 3C86A 3W7KA 2EPMX 3DECA 1H7PA 5E0FA 4WRHA 1V5XA 3VE7A 1MVYA 4DXXA 3K8LA 1CIUA 1XP3A 3GUGA 3UZ5A 1TUXA 2XIMA 5FAGA 4FI4A 1FHUA 2NLYA 3W7HA 3MB9A 3QW4B 4IMCA 1FWRA 4W9TA 4BF9A 4V15A 1HP5A 1KCKA 1RCOB 4KEUA 1KFBA 4LAUA 2PF0A 2X1UA 3GVRA 1M68A 4NJJA 5BXRA 3OQEA 4MZYA 2AQVA 3P5ZA 4O10A 4DWSB 4GY0A 1QHOA 4D6HA 3ZZ1A 1XYAA 3U2OA 4R34A 2XFRA 3OGVA 3WDJA 1FRBA 2KAUC 4GD0A 1E6NA 4JFSA 2Z1XA 1SW7A 4LFYA 3N25A 5F2LA 1FDJA 1DVJA 1AMYA 4NIRA 4G8TA 4UFMA 3W6MA 3ARTA 1XIBA 4EXBA 3QV9A 2OZ0A 1TG7A 3POHA 1WKYA 4HPGA 3FA5A 1BTCA 2BGNE 3VZYA 1JQXA 2FGZA 4PCPA 1G69A 2WZHA 4HJFA 3QN3A 2ZTKA 3BW3A 3QY8A 2PDLA 5A8QA 4GACA 2W79A 3KVJA 4AWSA 2Z27A 1FFRA 2J13A 4C65A 2F61A 3D5HA 2WJFA 4XZWA 4Q4KA 3WLTA 3VC6A 4I9TA 2DP3A 2BY1A 4I3GA 1NFPA 2GUUA 1P7TB 2VCAA 3F03K 4JKMA 4JKLA 1SZFA 3BAXA 5DLCA 1SFTA 4LBSA 3UU0A 4HZ7A 4WOQA 5EL1A 4UFLA 3HURA 2FMNA 5BU9A 1GVEA 2ZDSA 1EXBA 2ZZ1A 3ELFA 4O54A 3G24A 1C93A 1WDSA 1RLDA 4XSMA 3IGXA 4GI9A 2IKGA 2Z00A 3PF3A 4QHRA 3ZWTA 4DLFA 1YADA 1PWMA 1YPXA 1E71M 2CLIA 3E12A 1GQIA 5DELA 6XIMA 2YL5A 2FKPA 2OEJA 2GFTA 4NAFA 3BG3A 4J5NA 1XCFA 4WVXA 2HRWA 2BFGA 2FVMA 3KE0A 3RUBL 4P8UA 2VOTA 1C7SA 4IP7A 3DYMA 5I3KA 1ZBKA 1AQ0A 1LLZA 3W87A 4F3HA 1EDTA 2GJNA 2ABBA 1G94A 3U8GA 3GNOA 3BK0A 1FCUA 1FOBA 4LT9A 1A5AA 5XIMA 1SVDA 2VO5A 4HK5A 4NF7A 2OWXA 2PU0A 1SMDA 4YTTA 4L64A 3OZMA 4FIRA 1JD7A 4QNEA 3BV7A 1DIKA 1YEYA 4ECLA 3GHRA 1N7KA 4M6VA 4XAPA 8TIMA 3LHUA 4MLRA 4TQTA 3LHVA 3WF2A 2PTDA 3LPPA 1A5LC 2QZRA 4QNWA 3GQYA 2IKHA 2ZRXA 2JGYA 3ISIX 1ESWA 4PMOA 2DH2A 3PTMA 3EWZA 4G56A 4K1GA 1TVLA 3TOPA 1DXEA 2DPEA 4WDUA 4I7VA 3CAVA 1M9HA 1V51A 3M0HA 4I9JA 4JDYA 3SCOA 4X61A 3GDBA 1XLLA 4IM4A 3ZT7A 4WXYA 1MQRA 3W01A 2AGTA 4WJ8A 2ZTJA 3D6NA 1ZAJA 2KX9A 3CB8A 2CLEA 2ZRUA 2GYIA 1W9DM 4B9YA 4UTWC 3KAOA 2JK2A 3QTPA 1ZJIA 1K8YA 2PBOA 2YXGA 1J93A 3TYEA 4WF7A 5ECUA 4E2DA 3TW6A 1JXKA 1KM1A 3WF1A 4JFWA 1X8CA 2B7NA 1L9WA 2OLAA 4UFKA 2NQJA 3BPWA 3HA1A 3BE7A 4N9EA 1UR3M 3O2LA 4B5WA 4XO6A 1V0MA 2WVVA 3EB2A 4H4IA 5CJ5A 1F05A 1NP0A 3LCLA 4B16A 1ZJHA 3ECQA 1MW1A 4UNKA 2JEPA 2QUTA 2YYUA 3BAWA 4DF1A 4DWSA 3A3WA 4XSLA 1YNPA 4HSHA 1B3WA 3E2VA 1RCQA 1AD1A 3AZTA 1GW9A 4B92A 4BQ3A 1S2CA 1JUKA 4S3DA 3S1UA 1BQCA 2CZFA 2ZX7A 4XG1A 3RG6A 1A5SA 4BF7A 4KS0A 3IUDA 1UQYA 3ARVA 1FWIC 1YTKA 4HA3A 1E5JA 1KM0A 2X0HA 4ZZ9A 2V5KA 3R0KA 4J3ZA 4FS9A 5IDIA 3HMCA 2VQUA 2HVOA 1XBVA 2CCRA 4JX4A 1SZEA 4BWLC 1KM6A 4TV5A 1EJWC 3Q67A 1JDDA 4PULA 5I03A 2F38A 5I3JA 1U83A 3BW4A 1P7TA 4HNVA 4L9ZA 3ARUA 4JKKA 2PGWA 3BLPX 4KWUA 1OEPA 5M5DA 1FY6A 3JVAA 1HIZA 4MY9A 1GORA 3CV6A 3TCSA 4CCZA 1KRAC 1RPKA 3V36A 1G4EA 3OVGA 3NZPA 4XZLX 1RQHA 5GJMA 1EJUC 5HJYA 3WUFA 3WIJA 5F2GA 3R2GA 1W1ZA 5CGMA 3SRFA 1UKTA 1V02E 3W72A 3JU2A 3ARWA 3NQMA 2O7SA 5K9XA 2JBMA 5K2ZA 2ZOXA 3VM7A 3SCWA 4LC8A 3CIXA 2F8QA 4C6KA 1H60A 2A7NA 3VABA 4Q3MA 4FNPA 1PVNA 5PTDA 4E5TA 2EXOA 1HKIA 3DKLA 1RJPA 4GYPA 3VFCA 1Q5MA 1RH9A 3DFYA 5LZLA 4TV6A 5EFFA 5L9FA 4JN6A 4AWEA 2WC3A 3KDOA 4F9JA 3ZMRA 4RJEA 4CQ8A 2QJJA 1ZUAX 1CXFA 4Q8UA 3H4WA 3JS3A 3VPLA 2FDSA 1CDGA 1WQ5A 2OCZA 1W1YA 3OODA 5CPNA 1FWCC 9XIMA 3CHEA 4LNYA 1UJQA 4G7EB 4PB4A 2WHLA 1EJSC 2DUAA 2O4MA 3QBUA 3BGJA 3P3BA 5FL0A 3UR5A 1ZZMA 2Y5JA 4KETA 3CZGA 4L65A 1A5UA 1UD8A 1TJ2A 3KWSA 1JPHA 4CEUC 3MHGA 4I8YA 4CCDA 3GZ3A 1W1IE 1NH6A 2X0SA 3UVAA 2EKCA 3P62A 4BI7A 4UZUA 2XDFA 1AJZA 5A8PA 3W3OA 2GLKA 3H4XA 4HYWA 3GW0A 3PJWA 4DY1A 3H54A 3LM7A 4J2MA 1VC4A 4JCMA 4KWVA 3ERPA 4B5SA 3NNTA 2VFDA 4G5DA 4H83A 3CL6A 1IT8A 4MSSA 4PMUA 3ES7A 2FGBA 2ZRYA 3ZJKA 1TV8A 3R43A 4AX6A 4B5UA 3DEQA 2HZGA 4K2SA 4LUSB 4IIDA 5ABHA 4MPQA 3QPZA 1XS2A 5HDRA 4EANA 1C7TA 3LQLA 4MTVA 2BXZA 4WJEA 1JCMP 3BSHA 4H04A 5I77A 2J8TA 4AD2A 1YMYA 3QZEA 3WUGA 2E6DA 2A7RA 2YA1A 1NAL1 4L61A 3V5FA 4AY1A 3AU2A 5HWNA 3RRAA 1NWSA 3WQPA 3BLOA 2ONEA 4AF0A 2WJDA 4NJIA 2W91A 4MIMA 5CC5A 2WM1A 4PFHA 3L4TA 3MI6A 2NX1A 3KCLA 3RLHA 1BTMA 2OX1A 3UFYA 3MVIA 2E68A 1H1NA 4A35A 1HG3A 4FB7A 4UTLA 3JR2A 4ADSA 4CD4A 1B57A 4O57A 3LZ3A 1OFPA 4MKNA 5H2ZA 3SAZA 3ID7A 4BI5A 2CBJA 4AWTA 1HT6A 3EXTA 4JYEA 4PSPA 2DW6A 1QUMA 2WJZA 1RCXB 4X60A 3URAA 3A9IA 4GVHA 2HBVA 3AS0A 4RDVA 2QQ6A 1Q65A 1QU4A 4I9MA 5AYYA 4AMAA 2V38A 1GOIA 2W6RA 4JFUA 4A21A 4R33A 4L4LA 1T5AA 2FJKA 2JFEX 4U10A 1HW6A 2BVYA 3ABSA 3IJLA 5KZ6A 5CAKA 1EH9A 3UG8A 5U7SA 2HWGA 3DBNA 3ONCA 1XW8A 2Q71A 3MWCA 1AQFA 4Z2IA 2JE8A 4WHBA 1GEQA 2C0AA 2H9AB 1KXTA 1R2RA 3KS5A 3L67A 2O9RA 4DNHA 3VZXA 4QISA 3EDDA 5I0DA 4UTFA 4GG9A 4LY8A 2ZUMA 4L7ZA 3VX1A 3D0CA 4YS1A 1MZHA 4KRUA 3WQ5A 3A24A 2DT0A 1LORA 1N2VA 1UC4A 3IAQA 1SPQA 1NDVA 3UWZA 3UT0A 1FDZA 4XBJA 1P6CA 1HTIA 3M16A 2EG7A 3NQ8A 3CUIA 4OHQA 4W4QA 2PDQA 5AZ0A 3W29A 1NVMA 4HZ6A 2QCGA 1ZALA 3T81A 3MV01 4KGLA 5AHLA 4DN1A 3FK4A 2WV8A 2DEPA 4WZHA 5F1UA 1U1JA 3KBNA 5E6YA 3O15A 4PMZA 4AB4A 1I60A 1AMKA 4KW2A 1SJAA 4NJHA 3RN6A 1B3XA 1AQHA 3RAOA 1J18A 2RHGA 2J9XA 4LAOA 4Z42C 2QGHA 3UG3A 1PYMA 3MY9A 3EWCA 4HOXA 2B7PA 1QNVA 1XYLA 1JNDA 2ODOA 1ITCA 3P0WA 4IF2A 4QE1A 2CWNA 3RK8A 3EXRA 1US2A 5E5CA 4D6FA 2C1HA 3NL3A 2QIIA 4H6EA 1YW1A 4FAMA 1HP4A 3M5VA 2Z25A 4QAIA 4JEJA 5SWUA 1V6TA 4PGLA 2FFIA 5CPQA 1CBGA 1AH4A 5BYWA 1EJTC 4HMCA 2VDIA 2HCVA 5FJPA 4C6MA 4J3UA 3EAUA 3G1YA 3TJLA 1ZBCA 3TDFA 4MYXA 1GOMA 2HE5A 3TYZA 4MJ4A 1XWYA 1XLBA 3GXMA 3CB3A 1F3TA 4LUSA 2GSEA 1E56A 1CXKA 3VZZA 2PRLA 4BZYA 3IV8A 2CBIA 3RPTA 2VHLA 4XD6A 4FALA 2CESA 2IPGA 1ALDA 2D22A 3POCA 3NGFA 4LVGA 5F1VA 3E0FA 2VRQA 2NT1A 3S5OA 3M0JA 1I2PA 4H00A 4PE8A 4JIHA 3U7BA 2G3IA 1VFTA 1CGUA 2Z7GA 3DAQA 2PB1A 1VLWA 2D3LA 4LW7A 1S5VA 4LSBA 4ADUA 4UMAA 1M7JA 1UD3A 4QG6A 3C8FA 4OJYA 1G6CA 3H2MA 3LCXA 3NL5A 1Y5VA 1XDMA 3IARA 1MMFA 3QSRA 1BYBA 3W7QA 4ROPA 4C6IA 3ZWSA 1TRDA 1VRDA 4A3YA 4GZIA 1OX5A 4PTDA 2XFFA 1Q6DA 1CYGA 4DXKA 4DAIA 3HG3A 4UQ9A 2V5BA 1TMHA 1EHAA 4QCFA 2VGGA 3TK7A 2H6RA 3PFMA 1CGVA 3MSYA 3B9EA 2J9ZA 5A5WA 5FF4A 1B3OA 1EZ2A 4MUPA 4AIBA 2EEXA 4H7VA 2QPSA 3H21A 4Y9MA 1TE6A 3U2ZA 3BWWA 3S46A 3LA4A 1LYXA 3MJYA 4EPEC 3MUIA 2I9EA 2FH8A 4HTBA 2ZFAA 3R94A 4WSKA 1TELA 2FHFA 2C91A 2YDQA 1PTAA 4WSHA 4GXPA 2H9AA 4PMYA 3GVQA 5LKYA 4Z2HA 4OBRA 3WQGA 2IXUA 3N9KA 4DJFD 4YTRA 1O1ZA 5FL1A 4UTWA 1LQ0A 2EPHA 5C54A 2GVLA 2V82A 2H8ZA 1E51A 4FF5A 3LNMA 3VKCA 3PM6A 2ISWA 4Y9NA 3SY8A 4ZTXA 3GDKA 2A1YA 4OTKA 3W75A 4XZMX 3L4VA 5BWAA 2XFYA 3W1RA 5AVHA 3PFRA 4ZCWA 1BPLB 4RE3A 1V79A 1MUWA 1WBJA 2V9DA 1IEXA 1MO0A 4ICCX 1WNOA 2UY5A 2C7FA 1R3VA 4GO9A 3VNJA 3UJRA 3SUWA 4LBRA 2CW6A 3RFAA 4AZIA 5HMEA 5CQ1A 2GQAA 2J77A 3GU2A 4FA3A 3NZ1A 1K8CA 4JTIA 1SW0A 1NJJA 1H49A 1W54A 3O63A 3TKFA 2PD9A 3UVIA 5BZAA 3NXFA 4XX6A 1UUOA 3GNRA 3ARXA 4X63A 3TWBA 4JL2A 1NDWA 4XD3A 1PV8A 2QVNA 4XQ6A 5I2UA 3S2MA 2ZUSA 4YTSA 2J24A 2GSJA 4QXIA 3S9IA 5D33A 1H2JA 1CGWA 2PC4A 2WKGA 1JPKA 2QVHA 3OYXA 1KW1A 4KQNA 1TTPA 3NZRA 3F4NA 2Y5SA 3U0HA 2QGYA 3W86A 3LGDA 2PDWA 1ICPA 2POTA 2YIHA 2YPIA 5DY2A 4DI8A 2VOMA 4BWLA 1H62A 1TQJA 4JQ4A 4A8RA 4AVOA 1XC4A 4KFOA 2A3HA 3D47A 3NG3A 1DWIM 3LGGA 1XRFA 3A5FA 3K4AA 4GX8A 3ANVA 3M64A 2HISA 2V6AA 1SFJA 3TR2A 3V5OA 1W1A1 1F3EA 3KUMA 1UG6A 2YFNA 1Q7ZA 1CNVA 3KW3A 3QW3A 2Z1BA 4A3RA 2CKRA 4KMQA 2YZ5A 2VP8A 3KCJA 4UNIA 3MDUA 4ASTA 1QPOA 1FP8A 1A3WA 1K1DA 5EKYA 1B30A 1KFWA 1UJPA 4BJHA 3GXDA 4ACZB 2J7GA 5HNUA 4X22A 1EIXA 1W8GA 2OOFA 2VFEA 4LRTA 4KCVA 2V2DA 1E1FA 3BICA 3IJIA 3CMGA 2FPYA 4LTSA 2H3BA 4JXCA 4O18A 2P0OA 3AMDA 3V0UA 1VFOA 3URQA 1UZHA 2YL8A 3LB0A 2V0TA 1ZU8A 1S1PA 4CD8A 4PN2A 2Q8LA 1FWFC 3U4AA 3VIKA 4DBUA 1RJQA 3QOMA 4O11A 1VKFA 5AN7A 3ORWA 4J3WA 4P7OA 3P60A 5GJPA 5J5RA 1KCLA 3B8DA 3OTRA 1UD5A 1P0KA 4PEKA 3QGVA 4ZO6A 5EA9A 3UWYA 3B97A 3SGGA 1XIJA 3AQUA 1Z3NA 2J66A 3W1PA 3WLPA 3SURA 4DPQA 1KWGA 5A6MA 4E3TA 4KCWA 4QGCA 4ZTYA 5CJNA 3IGHX 2CLPA 3M0MA 4ZXLA 2WMJA 2OZ8A 1PCWA 2PDFA 5CLWA 4H3DA 1YQ2A 5GJNA 4LCRA 3NQGA 4R9XA 3VIOA 5M17A 2E77A 3PZGA 3TV8A 1K6AA 3VXGA 3MPGA 2YL6A 2D1ZA 2ZWYA 1QPRA 4OZOA 4H8UA 1BYAA 1REQB 4V2XA 2X09A 1QNSA 3IJ8A 4XV0A 1WXJA 4YHGA 3Q65A 1BG4A 2INFA 1MWOA 1GVSA 3NYDA 1NWRA 3DXIA 4QR6A 4GK8A 3PSVA 2PTWA 4C1NB 1W1B1 1JRCA 2R14A 4S3JA 5ECVA 2HROA 4GMEA 4IQDA 5IM51 2D2GA 2VR4A 2IPWA 1BEUA 1XI3A 3HJZA 4I5RA 4CUCA 3EOSA 2OYLA 3AMKA 1EGZA 1DL3A 3R4IA 3TN3A 2BB0A 4RW3A 3N2MA 3TTOA 3MHFA 4CVWA 3BCJA 1J12A 1AFSA 5C9UA 4WDWA 2YDSA 5LHFA 1SQ7A 1HJSA 3NJ3A 5CSRA 4GWEA 1TIWA 3BURA 1GHRA 1JGIA 2ACUA 3DYOA 4C60A 2VFIA 4MWAD 1CXLA 1W1VA 3QF0A 3VNLA 3CK5A 1WZMA 3COTA 4LANA 5DRIA 2I9UA 3WF4A 3S83A 2YR1A 3CHCA 4DBSA 1OFOA 4RR4A 1LCOA 1A5BA 3ZJ7A 1F7BA 2WANA 5CXPA 3NA8A 2XINA 2J27A 1UZ4A 1YHTA 3EWUA 3R79A 2J7CA 3NVTA 3VINA 2PSNA 3VCRA 2C13A 2D0GA 2HVMA 3QOKA 4LV9A 5C2GA 3RNDA 4P7QA 3GH5A 5HJXA 3K4DA 1UR9A 4HPNA 4WXZA 3ARRA 1WKEA 2VEFA 5LIUX 1LRTA 3R8GA 2DZTA 1TZ9A 4DQWA 1H7XA 1WUEA 3PBYA 3AUJA 3M0ZA 1XRTA 1ADSA 4P8WA 1BF2A 1UD6A 2W66A 3REQB 3T6CA 3NEVA 5LNWA 1W3JA 2NUWA 3NR0A 4MDOA 3W76A 4JTTA 1PKLA 1P48A 4MKVA 1OGSA 4RE0A 2WMKA 2XN1A 3APGA 3HJEA 3S6TA 4QS5A 4WR3A 4WKAA 3FXGA 3SB0A 1EQPA 5H8PA 2E5BA 4F66A 2ZVIA 3A4WA 3QRHA 5CJMA 3KWXA 1WDWA 2DORA 1JDEA 2EF9A 4Y96A 3TUUA 5REQB 3U4FA 4UTMA 4CN4A 1IWPA 3W4RA 4HNOA 3KX6A 3H7UA 1QI0A 4HZMA 3E0WA 4MNMA 4AH7A 3BMVA 2WBKA 4ACZA 4EACA 2XIIA 1DWAM 3CV2A 1LQAA 2HV5A 4M1BA 3TU9A 3ANUA 3PZVA 5LIKX 1SW3A 2YDRA 2WKLA 2Y61A 4L5ZA 4CNNA 1XLAA 3U5YA 4JQAA 3MWAA 3P7YA 2OWWA 4LUYA 1A4LA 5LSMA 2P53A 2PWDA 3BJFA 1TYGA 4OWGA 1G01A 3WQVA 1MFUA 2PPGA 1EC9A 4ADTA 4CQAA 3AMCA 1QNRA 2GQ9A 3OVRA 3KVLA 6ALDA 3CZEA 3STCA 1KM4A 1I0BA 2OG9A 3FKRA 3S1GA 1VEPA 4JR5A 4I9AA 2FHBA 3EMCA 4N9DA 2PDIA 2PGFA 4QIUA 3BAIA 2PDMA 4NKCA 3RCMA 3LTPA 1MFVA 3RJYA 1JRBA 1CT5A 5DMNA 3UWUA 3E0LA 3PTQA 3THCA 1EC8A 3B3DA 2XZ9A 1AQMA 4KIRA 3BJTA 1IZCA 1O1HA 1TR1A 2CKSA 1KFLA 5JVLA 1DQUA 5DMLA 1D9EA 2CLLA 2Y1HA 1NQKA 3S5YA 4DXVA 3EX6A 1P6BA 3WUEA 3LLDA 1TV2A 4QAWA 3FDGA 3FHAA 4Z0JA 2OPJA 3TMQA 1KB3A 1ZJBA 4PC8A 2R1NA 3IGSA 2XZ7A 1JFHA 1XSKA 2E6YA 2ZIDA 3ITGA 3GVWA 3AIWA 3FAWA 2Y24A 3UYIA 3WQ4A 1REQA 3IACA 4LXFA 2YOCA 3AOFA 3L21A 4Q4MA 5EY5A 4AZ6A 3WBEA 4C1NA 5FAJA 2DSWA 2JF6A 2FTWA 3UWQA 4JTCA 4CN1A 4D1IA 4MKSA 3S3GA 1IZKA 2WWCA 2R24A 2BVDA 1MUCA 3N6HA 5BRBA 1I2NA 4MHBA 3W24A 3WH6A 4U33A 2VEGA 1E9LA 1NELA 2OODA 5I06A 4ZQPA 2QDGA 3ZSSA 4JIQA 4UC5A 2AKMA 3F4WA 4K36A 3FCPA 2OLHA 1AJ2A 1CW2A 2BGQA 4N6EA 4P5UA 5D8ZA 2WZMA 1XCWA 3N11A 3HGOA 4IIBA 3PTKA 2BVWA 1AH0A 2TYSA 2BHZA 2O9OA 1HVQA 3L4ZA 3RF9A 1QOXA 3R0UA 3TQKA 2I14A 4WY0B 1JR1A 3L66A 3UJEA 2HBXA 2VC5A 3H2FA 3VD5A 4GUHA 3GUWA 1W3KA 4I5UA 4MGGA 2YZRA 5FJIA 1QCWA 4OOUA 1FCQA 5TAOA 3LV5A 1GVRA 3T42A 1BRLB 3OG3A 2PWEA 1NOWA 2NVCA 4LAMA 1OADA 2EHHA 1MQPA 4NX5A 4FNTA 4FX6M 3SFKA 2Q3RA 1UC5A 3VNKA 3D46A 5LXEA 4DJFC 2EQDA 1IXQA 4DUVA 3TYAA 3GYEA 4P61A 3I65A 1K9TA 3QC3A 1T8QA 2PZNA 1EFZA 1KA9F 5H8MA 3NVDA 2CU0A 4HA1A 3QKEA 3F2CA 3S1WA 1GK8A 2V5CA 2QXWA 4W89A 3REQA 3T4CA 3HQOA 3STEA 1HKJA 3M47A 1FHVA 2P3ZA 1XYZA 3LXAA 1IEWA 4C7FA 1S46A 2ZUNA 1IYXA 4AVFA 1LLWA 1LDCA 4FSAA 3GNPA 1TPB1 1HL9A 3WG6A 1GOQA 4Z2GA 5REQA 4XTDA 2P88A 1CTNA 1A3XA 4QJ3B 1R47A 1XSIA 3SIZA 2OGJA 4RV8A 3GXFA 1WB0A 4Z1CA 3AHZA 1DQXA 6ENLA 4O1CA 1TB3A 3V0TA 1JEZA 2XPKA 6CGTA 2R1KA 1GJPA 2TAAA 1VR6A 3OJGA 1BF6A 1OF8A 3LLFA 5FACA 5EPDA 4GUFA 5BOOA 1UZDA 5C2CA 5EBAA 4JTSA 4GKLA 4J3VA 1HGWA 3VFLA 2GGEA 4AZ7A 1IIHA 4KEMA 1QASA 2HSAA 3W00A 2JF7A 5DF0A 4F2BA 4H9UA 3QXBA 2WMIB 3RCNA 2E1DA 3GKAA 4YTUA 1VBJA 2O92A 1JVNA 4UTJA 1B90A 1KBLA 4AZHA 4GKTA 3AROA 1NY1A 1TCMA 3LDVA 4H6RA 5A8NA 1XIEA 1Z69A 2VR2A 4V28A 3WD2A 4F0MA 5DCDA 2QJHA 4RLIA 1VBRA 3UBPC 1JF5A 4K38A 3QSTA 1V0NA 5A8GA 3N12A 3WK3A 4MADA 2VD9A 7XIMA 1SGJA 1V6UA 1E9IA 1O6IA 1OYBA 1U30A 4RNFA 2X1RA 3DKJA 1GJUA 2ZYFA 4LOCA 3CNYA 3NEHA 1PTDA 3EB4A 3WBYA 2VRKA 3S6OA 5BWFA 4LH8A 3Q4DA 4EF9A 1Z44A 4GZJA 1TTQA 3UGRA 4XZ9A 2Z4GA 3NURA 3CUGA 3WX7A 1AD4A 1JNEA 4ZO7A 2V5JA 3E9AA 2NSXA 4JTUA 1OFBA 2ZUUA 1LF1A 1XH1A 3M7SA 1W17A 2G4FA 4AMCA 3QR3A 4IFRA 6REQB 1EP3A 1VPYA 2GQ3A 4UIOA 1Q45A 5I24A 1S2WA 3EBVA 2V8ZA 3E2RA 4M56A 4QROA 2GK1B 3N4EA 1C9WA 3CHFA 4X0VA 4E6MA 1GYNA 1LLOA 3DC0A 1HL8A 2WPBA 2AMGA 3BQ5A 2P10A 3B9OA 3MYPA 4H41A 4H9ZA 4AEOA 3SADA 1WDPA 3H2AA 4LQ1A 4NQ1A 4S3GA 1B5TA 1UBPC 4WY0A 3FS2A 5D9NA 2ZADA 5A8MA 2OR2A 3GBDA 5AOUA 1UH4A 3IJ7A 4WD0A 4ALDA 1W31A 3UJ2A 3UYCA 2WNWA 9CGTA 3S5SA 3WQDA 5T8GA 3PN8A 5A2CA 1BRLA 1DWHM 4QE5A 1GNXA 1Q2RA 5CG7A 2ESCA 1GVOA 2QDHA 3CM4A 4HBKA 4DLMA 1XFBA 3VIFA 1A5NC 1VFUA 1EIBA 1XXXA 3L0GA 3CIVA 4DYEA 1Q6FA 1PE1A 3B8SA 4YWIA 2F6UA 3HMJG 3VOFA 4GQGA 2ZX6A 1H7WA 2BOFX 2ZZ6A 1FCVA 4G1KA 2NW0A 1D7KA 3UA4A 3TJXA 1W1TA 1YDVA 4QDWA 2E3ZA 3RHGA 1CWYA 3UQNA 1TV4A 6A3HA 1TREA 3WCZA 1A47A 4AX7A 2WZTA 3WNMA 1LRNA 3IANA 2ZDRA 1UWIA 3EGJA 5CPMA 3WNOA 2I5QA 4MWAC 1JULA 2IQ0A 3V1HA 3N4FA 2DZAA 9XIAA 3LCGA 3U48A 1NFGA 2YBVA 4PA8A 4LYKA 2YCLA 3RMEA 3BV4A 4DF0A 1R7AA 1LL6A 1CB2A 1V6YA 1AH3A 2EJ1A 2QR6A 4V1XA 2FB3A 4JCLA 1QI5A 3VDGA 5JXQA 4YMZA 3C0QA 5BRQA 4XWUA 1KXHA 3H24A 3WLLA 2BP1A 3PUGA 1TPWA 3W37A 1R3RA 3RPDA 4W8LA 3N29A 2VDGA 2VI0A 1HJVA 4XO7A 4WY0F 3FYYA 5AHMA 4J9JA 1VPXA 3E2QA 5HANA 4AQLA 2WMIA 1TPUA 4IGSA 4PRWA 3SCTA 1W0MA 4PTMA 2ZZ4A 1R86A 2ZKMX 2PDYA 4PUUA 2YFOA 3TJ4A 3TTQA 4PBFA 3AYTA 1KBJA 1Q6OA 2ZUWA 2QLYA 3F2BA 4RUBA 5D9OA 3B04A 3QH2A 4ZR8A 2B0MA 3LQGA 5D2WA 4HK7A 2DQWA 3M7WA 5F4SA 7A3HA 4PMXA 4LRSA 1CGTA 3WENA 2DVTA 1J0JA 3OGSA 1QI2A 4HJWA 3S0CA 2WCSA 1M41A 1WO2A 4RE2A 1R8LA 3ARQA 1OBAA 1GG1A 3MT1A 4O4VA 1T41A 5CPLA 5CZTA 4YYFA 2J78A 2I56A 3C61A 2J7BA 4GQ0A 1ZNNA 3UZWA 4AIOA 3HG2A 4U5IA 3N6QA 2VD8A 5GNZA 6XIAA 4U31A 1W3IA 2JQXA 1IEIA 4KWOA 5FA5A 3WMBA 4GC4A 3HPAA 2TPSA 2G3MA 4IFKB 1O5RA 3P6LA 1YX1A 1E4LA 1DORA 1PB0A 3BW2A 6REQA 2J7FA 3GYCA 1TPC1 1B3VA 2BV9A 1V08A 4OVXA 1FXQA 1Q7QA 3SEPA 3FY1A 1AVAA 4Q8MA 4NRSA 3LHTA 2F6XA 4GFIA 4DO7A 1E55A 2XGIA 4KH2A 1M6JA 1E6XM 1I1WA 4MVAA 1TV5A 2ZC1A 3QY7A 3UCQA 2WB5A 4A2SA 2PWHA 3LPOA 1UWUA 4J3SA 4D6GA 1H63A 1YRRA 4IIHA 3P61A 4HCHA 3SCQA 2DU2A 3VNDA 3M0IA 2A5HA 5AC4A 3OB8A 3W1XA 1QTWA 4GH3A 1L2UA 8RUCA 1A0DA 3W9ZA 1LZOA 1E73M 3ARYA 2Q01A 4MAZA 3AWNA 3AXIA 3CO8A 2PDXA 5CZ0A 4E0CA 3E0IA 3VKAA 1GQKA 3DENA 5AKQA 4NZ3A 2C0HA 3WL0A 2WQDA 3CAWA 3EPNA 3VI2A 4TO8A 3WK1A 3H53A 1FDYA 3A4AA 1PKMA 4XAFA 3VX0A 1QNOA 2FQIA 5CGTA 2NQ5A 3AZSA 2PDGA 3G3MA 5GPRA 2PTYA 4ZSUA 5D38A 2ATSA 3MV11 3SUVA 1R3TA 5D4YA 3PZIA 2E5CA 3NM3A 2DDXA 1VD6A 4E2OA 3BCDA 1SR0A 3UCCA 5IXEA 2GUBA 1UKPA 1DJXA 3BO9A 3CQIA 3U57A 4FR1A 5HINA 1TVNA 5DT5A 1JPDX 4NZ4A 3W07A 3LS9A 3T78A 5A1AA 4P2VA 3GXTA 1PPIA 2I5GA 3L9CA 2ZX9A 3I6EA 1RY0A 4H01A 4Y8FA 4JZ5A 4D6JA 1YDOA 3OLIA 2X7VA 2O55A 3EX4A 3R58A 2IQDA 5I79A 1FP9A 2QIWA 4TUFA 3DC8A 1TWDA 3S5NA 3N19B 3BH4A 4URIA 1YDNA 3NQAA 3KZPA 4J2PA 1KCZA 1I45A 4CLMA 1PUDA 3MSDA 1MSSA 3NXLA 5IOBA 4UFIA 3TZFA 4N2YA 1YXYA 5A6AA 3GKFA 2ZA2A 4Q22A 4Z1BA 2NSOA 5HPOA 3KBSA 1Z48A 4UR8A 1FWJC 3LBCA 1DV7A 4CNTA 1WKDA 3ITOA 3OZYA 5G2HA 3GXIA 1KCXA 4GQQA 3VUPA 1Z7AA 1WDQA 4MB4A 3LTSA 3EX1A 3WLRA 1KQZA 3W1UA 3GH4A 2DZWA 4HYRA 5LHEA 3AXMA 4QJ5B 4WDTA 2OELA 4FOUA 3GSMA 5F4WA 1WXYA 4AW7A 5T9BG 2ZA1A 2FJUB 1V6VA 3S2JA 1XYFA 4XVDA 4PTWA 3G5EA 3WK2A 1LL4A 5AB3A 1Q63A 3DFOA 4GPNA 1ZENA 2CIPA 1XLHA 2BY0A 4AHOA 4W7VA 3LD5A 1GYMA 5CPOA 3DOPA 4IQJA 5G4EA 4W87A 4GVIA 1X8FA 3TROA 1EC7A 1RSCA 1WPCA 4IMAA 4E4PA 3EA2A 2MNRA 1E3XA 2PCQA 4JTAA 2CHNA 3RCYA 2VM8A 3VGHA 5BRPA 2JEQA 2QULA 2FVKA 2DH3A 3DX5A 5RUBA 2XVKA 1JCTA 3GTXA 1QPKA 2W9MA 1BVNP 1EF3A 3SDOA 3O1NA 4HD5A 4ICNA 1RK6A 3W7NA 4M8UA 4HHMA 3A4JA 4M0XA 3WD1A 3DHDA 3CL8A 4WQ6A 3SJNA 1Q6EA 1E4IA 1JYNA 3LU2A 3A5VA 3T0DA 4RZ6A 3P8IA 1CGYA 4S3CA 4KERA 3DIPA 4D8AA 5ABFB 2QDDA 4MWAB 3QLDA 5C55A 1O12A 3N18A 2VEMA 3WLHA 2WLYA 2I5IA 3RX2A 4AEEA 4Q8VA 5K4XA 1G5AA 1NOFA 4NZJA 4B5VA 4A3UA 2VVNA 1JZ2A 5CG0A 1RQBA 4JTLA 3GB6A 3P67A 4HPHA 2DGAA 3L0KA 3AIQA 5LNRA 3EEZA 4FIQA 1X1OA 1EEXA 5HK4A 1BWKA 2ZUTA 4DRSA 4ZQNA 3W88A 3WMLA 1K77A 3F5JA 5A6BD 1OSEA 1DWJM 1H61A 3HO8A 1O5QA 3TONA 1Z42A 2E6FA 3RYSA 1K8XA 2BOEX 3OPSA 1KTNA 4ZQRA 4JYFA 4DJDD 4XAYA 2DV0A 1GONA 3GTIA 1QO5A 5GVJA 7TIMA 4MAVA 4UR9A 1EB3A 3UGVA 4GXMA 1XLFA 2V3GA 4UQAA 4B15A 3TE9A 4QLJA 3A47A 1JG9A 1VEMA 3QZ6A 4G7FA 4K8EA 4LS1A 3KP1A 3W1MA 5E9AA 1UZ1A 2AAMA 2FMOA 4TOQA 2A6LA 1PKNA 3DU0A 1LOQA 4V1YA 3SECA 3M1ZA 4QS6A 1T7LA 2VT0A 3CUHA 3STFA 1EPXA 2XN2A 1AUSL 4TXEA 3KM8A 4IPNB 2GZXA 3WZ0E 4F0LA 2VWSA 4M6PA 1KXVA 1IWAA 4ML9A 3SGZA 5HJLA 1HKKA 2HK0A 2BHUA 3TZNA 1J9YA 5I3GA 4I6VA 3Q58A 2X42A 4D2JA 1HO1A 1X39A 4S3BA 4F0KA 2GVGA 2WYSA 1XINA 2DJLA 1C90A 3EPMA 4LX4A 1JPIA 1QNPA 1A0CA 1OABA 3L5LA 2X40A 2TODA 2DZUA 4FXRA 4AZ5A 1VS1A 4HA4A 3TSMA 1HVXA 1V3MA 2X1SA 4EXAA 1DJQA 3S5ZA 1EX1A 1F9CA 4UTTC 3SO7A 2ZXAA 4ORMA 3GZAA 3PZUA 1E6RA 2PODA 3S42A 3H26A 5I3DA 5LIYX 3M0XA 1RV8A 3DG3A 4WSJA 5FF2A 3KXQA 4N02A 5JIPA 2D0HA 4RNHA 3L68A 3VIMA 1A49A 3H2EA 2HS8A 3MBFA 3WDQA 3A6OA 3CQHA 1FWHC 5LYRA 3TLLA 1WZAA 1SO3A 3RLVA 3ICJA 3SGUA 1LP6A 4J7RA 2AGKA 4L9YA 3NDZA 5KITA 2EKGA 2ZZ5A 5HATA 3TQ0A 4JIIX 1V77A 3ZQ9A 3LXBA 3H2OA 4QSHA 3TA9A 1DIOA 4CD5A 1CCWB 2DVUA 1ZSXA 1U2YA 1XLMA 1R3QA 3HZ3A 4H2HA 4Q4OA 1UOZA 1OCJA 4BEQA 2JGQA 3AJ7A 3A13A 3W7RA 3NPUA 4FZIA 3TQVA 1XBXA 1F4HA 1KBKA 3W25A 1TJPA 1EA0A 4HHLA 5ABFA 1DJIA 4MWAA 3LERA 4JHZA 2VC7A 2A0NA 3GD6A 3ABOA 4NYYA 4LUJA 4MUZA 3QVQA 1RA0A 1S38A 1E9ZB 1XYBA 2RGLA 3AZRA 4JBRA 1LT8A 1PCKA 1ZFJA 2CZDA 1S2TA 2BG5A 1LQ2A 4XBSA 1YTEA 3IUHA 2EG6A 2Y8KA 4R53A 1VEOA 1ENUA 1G7VA 3PPHA 4KFNA 3JZUA 4MB5A 4Y9AA 2L5HA 1GOWA 1I75A 3R8HA 3CEUA 3GHTA 5FF0A 1H1ZA 2NV1A 2ZA3A 4F8XA 5C0QA 3K2GA 4NU7A 1QHZA 4E2BA 1H0GA 2WQPA 4HHHA 1TA3B 5H6HA 3AYRA 3QKZA 4BR1A 1QHPA 3W28A 2W5FA 2ANUA 1JCLA 2XN0A 3S2NA 2XFWA 2Z1SA 2XHYA 4D6CA 2JKEA 1PS9A 1GT8A 1YPFA 2YJQA 3NUKA 3C2FA 2XIJA 1K7FA 5JIWA 2WMHA 4J28A 1XLCA 5EFDA 3NQEA 3TVAA 1BAGA 4DZHA 4FLOA 5KEZA 5ABTA 1PZ3A 1OZQA 1OVDA 2OEMA 3KLLA 1OFEA 2GOKA 5C70A 4AD4A 1CXIA 4FX8A 1SO5A 3B8UA 1W5MA 1E6PA 1C8VA 4JTJA 3T05A 1GPFA 1RD5A 1C9DA 3QC0A 1NWUA 1A50A 2OX4A 4GCAA 3TN6A 3ITVA 4JY8A 3I3DA 3I3BA 2ACQA 2FTPA 2JKPA 4AFYA 4ZOBA 3THAA 2HE8A 2BVTA 2Y6ZA 4GCXA 3QFEA 3H23A 2HVNA 2TSYA 3L23A 1EDQA 4UFHA 2Y70A 2QPXA 3USBA 3LHYA 2RH9A 3QEZA 3V0SA 3GVVA 5AYIA 2CERA 1QK0A 1ZP4A 4P7NA 4UNLA 4C7DA 1EWDA 3FKKA 2PS2A 3KTCA 1NARA 5E0KA 2NX9A 1B1YA 4JIPA 3N04A 3UD6A 1F07A 1V4YA 3SBFA 1MXSA 3CO4A 1YXDA 3WMCA 2OLSA 2W61A 2Y63A 3CBWA 2DUZA 4BFAA 2ISDA 2A3BA 4KF1A 1W9VA 1V3KA 2GQ8A 4JIRA 4IIEA 2PDPA 2P8CA 4XZIA 3NOEA 1DTUA 5C5YA 3WLJA 3VIPA 1LWIA 1YYAA 3QYSA 3R5EA 3GU1A 3DFQA 3OZPA 3OP2A 4B3LA 4UOZA 4QBXA 3PBGA 3EYPA 2E0PA 3S9YA 4EVZA 3KTSA 1ODUA 2AQOA 2ZUVA 4JQ1A 4CEXC 1VIWA 3VCCA 3UXDA 1LWHA 1H41A 3TAOA 3LMZA 1T99A 2VL4A 4K3ZA 3VK5A 3K30A 3CV1A 2ZZ7A 1QI3A 5E1QA 2WVTA 3VIHA 3CYJA 3I6TA 2Q02A 3IJ9A 3W2JA 3TC7A 1FFQA 1NP2A 1YNQA 3A23A 2WVVB 3EDEA 2ALRA 4LVDA 3W70A 5D03A 2A21A 3N15A 2OO0A 3HM7A 4JOMA 2J7EA 1GUVA 1LG2A 4LB4A 4JFVA 1M03A 3WBWA 3HQ1A 5CLTA 4L6OA 2C3ZA 3W7IA 2YDAA 4LS2A 4IJBA 2VEIA 5AECA 2P5NA 1T8XA 3PNUA 2CLOA 4DF2A 1LOLA 4IMFA 4D1JA 3JUGA 4S2BA 2VUYA 2E5DA 1ZS2A 1PIIA 3VMNA 4CGTA 4F4RA 4Y2WA 3VIIA 3F5KA 4JN7A 3M9YA 3PZTA 1PX8A 5JBEA 3T0TA 3A4XA 4DZAA 2X1TA 1GPWA 3L5MA 3RJXA 1IEQA 3M0KA 1FH8A 4PR4A 2FYMA 5CBJA 1WZKA 1J10A 4RW5A 3BAYA 3CPGA 1AODA 4G2DA 2FZNA 4H9TA 1UYQA 1BQGA 1U33A 1R7OA 4QCEA 1UASA 1TA3A 1XBZA 3G22A 4UBPC 3RLUA 1DJGA 3KHJA 4JHOA 3PBMA 3G8EA 4ZEPA 3VKDA 5A6KA 4RXFA 2V2HA 3EKZA 3CJPA 5I78A 7CGTA 3RO6A 3WEMA 3S8HA 1W3NA 3LZ5A 1QOPA 2DUXA 3H7VA 5DBUA 1A80A 2P50A 1TJRA 2YXXA 3D3AA 1OINA 3DUGA 3W38A 3W82A 4FK9A 1ZY9A 5LNSA 3KBMA 3AYSA 2QAFA 1LBFA 2QMJA 4Z0SA 3OLEA 1ZJAA 3L4XA 3LSBA 1KC7A 3WKZA 2PWGA 4Z08A 2FVLA 2PD5A 2Z2AA 3H2CA 4RDZA 4JD4A 4UWMA 1Q3NA 4B2DD 2J25A 1Q6LA 4Q8QA 1VHCA 2CBVA 4ZQMA 3LTYA 1EBGA 1CXEA 4DJDC 3O0KA 3AAMA 3SCRA 2GWNA 3MUZ1 3SJ3A 1GVYA 2WOQA 3T07A 1V02A 1J2BA 4OV9A 3R10A 2Z28A 4GI6A 3ABQA 1UD2A 3ZOAA 1B4KA 4FNQA 1JD9A 4ORIA 1R87A 1OY0A 2VC9A 5AHNA 4M3PA 4FXFA 4NZ5A 5G4HC 3G1XA 2BXVA 4MLJA 1FKXA 3R7MA 1TRIA 3UERA 3WEOA 1T6MA 4JTEA 4ZB5A 5EMJA 3WQEA 3DG6A 3LGEA 3E2SA 3UR8A 3R89A 1UOKA 4GQBA 3LX9A 5DMYA 1ODZA 4HT3A 4RNJA 3GC5A 3FVDA 2WW5A 5DX7A 3KBVA 3AWOA 4POCA 4ZODA 3TSBA 4S38A 4GY1A 3NZGA 2G3FA 3GW3A 5E9XA 3N3TA 2FDMA 2X2GA 4NX0A 2WNQA 4M82A 2YB1A 3GLCA 3NSMA 1SFLA 3WFAA 3OA3A 3NFUA 3IK2A 1G1YA 4GJIA 4E38A 4AEFA 1K70A 3STGA 1US3A 1D8WA 2IKIA 3RXZA 1J0KA 1FVPA 3TIMA 2FB2A 4D72A 3WL1A 2HPIA 4IJCA 1VCFA 4DAFA 4INFA 3SCPA 2VMFA 4W5UA 3DI1A 3B40A 3PJXA 1ZCOA 2OSYA 4JNYA 3VDHA 3IGUA 3OVQA 5FEXA 1W32A 4KRZA 3TQPA 4YYCA 1T40A 1VYSX 3QGKC 3QY6A 1UP3A 2VUNA 4NI3A 1PZ0A 2MUCA 4NVTA 5HOSA 2CHRA 2EPNA 4LGXA 2PP3A 1F6YA 3AS3A 3TFCA 3VNIA 2ATMA 4AF0B 3H6OA 1NIUA 1O5KA 3LRMA 1NDZA 2OQYA 2YKKA 4HSOA 1N8IA 3WQOA 1E43A 1RBOB 1K03A 2ZX5A 5LA0A 2EBNA 3PVFA 3AO0A 1XKJA 3FVMA 4TU1A 2GDVA 3BMXA 1F4AA 1BYCA 2Z6JA 3VMOA 1UKOA 3VNYA 1TJ0A 4KKXA 1NTHA 2OZ3A 3N14A 4CQ9A 3O6AA 3T8QA 1W2PA 1XGEA 2BNJA 4GX9A 4QDPA 3QQ0A 4NZCA 1FXPA 4GYFA 4NILA 1E1EA 4UTTA 5FJTA 2GGGA 3HGSA 5M3WA 4AY8A 3HU7A 3G6MA 2XWDA 3AS1A 3V3WA 3V4BA 3CT2A 1UMLA 3H22A 1XLKA 3EDJA 1KFKA 4Q7NA 3H8AA 4GH1A 4HSNA 4MB3A 5HR6A 1F3WA 2VZUA 1CPUA 3UZJA 4ERAA 4S3EA 3CAKA 2IUZA 3K5XA 4GGHA 3NO5A 3WQ6A 4H19A 5C7HA 3W81A 4PSRA 1PXGA 3GO2A 2F84A 1P1XA 1A5CA 1G0CA 1VPQA 1M1BA 3MMTA 1SJBA 4ZBCA 3SCUA 3MC5A 1G9HA 1XCXA 3KP0A 4HU0A 2IKJA 4O52A 1X6NA 5G4WA 4DEFA 2C19A 4W84A 1J6OA 3N17A 3P81A 3SUTA 2YCEA 4N42A 1FTXA 1JIBA 5G1MA 3MTWA 3G0XA 1L2QA 3P0XA 1R85A 2INEA 1NQ6A 2RGMA 4AIEA 3GFZA 3VD7A 1TE1A 4MFDA 1KFCA 5K9CA 4S1FA 4CQDA 1KRBC 3T40A 3WD0A 4AD1A 1E6ZA 4Z2JA 3WYZA 5JBFA 1UR8A 4HMNA 4BK9A 1JUBA 1BXBA 2NZLA 1F74A 1IQ8A 1XSJA 4EWJA 3T7VA 3T09A 2V5DA 4UZSA 1WX0A 2R6OA 3ZM8A 4D8LA 1NM9A 2HEJA 3UCDA 1BVWA 2C6QA 3HG4A 3PTDA 4OUIA 3UESA 3E6EA 2J7HA 4LNCA 2CYGA 1QBAA 3W84A 5JBDA 1W9UA 3WLKX 2D2JA 5EMMA 2OYMA 3P74A 3G77A 5BXPA 5HNNA 3AI0A 4S2CA 3HF3A 4RDWA 2D3NA 3N6JA 2QJMA 4JTFA 5JH1A 3U2CA 3BLKA 1ONXA 1BXNA 3EWWA 3P5YA 1LRQA 2YB4A 2HK1A 4EPDC 3OLDA 4EAYA 1E3ZA 3B9NA 3UWWA 3L12A 1F2JA 3W83A 3DFHA 1W2VA 3EMZA 5G5IA 3ZXWA 1HQTA 2C18A 1W9PA 3CWOX 2WM0A 2VTFA 2G5WA 1GKQA 2ZE0A 1KGWA 1MEIA 3LCHA 3T9PA 1K4GA 2XUCA 3PZ9A 4RX0A 3L4YA 4PB5A 2WHMA 2E67A 4E8DA 3VOHA 1YXCA 4H7ZA 3W7CA 2EPOA 3LBMA 1HF6A 1DIDA 5BU6A 4X0NA 2DZPA 1XISA 3C2VA 3ZVIA 4X9SA 4LVAA 3EA1A 4GI4A 1PDZA 1KD0A 4YU1A 3UG5A 1PJ9A 2WMGA 3K4WA 1O94A 3VCNA 1XQLA 2G4JA 3AS2A 3GHSA 5M2FX 1NSJA 1QPQA 1R3SA 1IGWA 4OGZA 3IVUA 2F9RA 4XK2