2GK1B

X-ray crystal structure of ngt-bound hexa
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
54
structure length
54
Chain Sequence
PALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-hexosaminidase subunit alpha
publication title Crystallographic Structure of Human beta-Hexosaminidase A: Interpretation of Tay-Sachs Mutations and Loss of G(M2) Ganglioside Hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 5
structure length 54
sequence length 54
chains with identical sequence D, F, H
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gk1B02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 2gk1B01
3ZJ7A 3SURA 4RL3A 1XGZA 3VDCA 3W26A 4QAWA 1UHVA 4QLLA 2XWDA 2Y5EA 3MMWA 2D1ZA 5A1AA 1QHZA 4CCCA 4C91A 3VGFA 4DM2A 4QLKA 1MXDA 3BC9A 3L4VA 2EJ1A 3K46A 4PMNA 2X0YA 1B3WA 1EO7A 4HU0A 1J9YA 4W86A 1GOKA 4OOZA 5CJ5A 2J8GA 1W9XA 4URIA 1C92A 1KQYA 4HPHA 1V02A 2CIPA 5IDIA 3QGVA 4JL1A 1NWRA 3PZMA 4WKFA 1HJVA 2A3CA 1GHRA 3WH5A 2WMJA 2ZX8A 1CBGA 1GJUA 3HN3A 3N13A 1XD1A 3SCOA 2X8RA 1VEMA 1UD8A 3W6LA 1CLXA 1RP9A 1J0ZA 1W9PA 1I75A 1C3FA 3VGGA 4P7NA 1HJUA 1E4NA 4IM4A 1HJWA 3VDAA 5M3WA 1NM9A 1ZB5A 1QI4A 3OBAA 4U3CA 2A3EA 3GM8A 1XHGA 3WEOA 3VIOA 4KWUA 4FMVA 3WNNA 4E8CA 3W25A 4CU6A 3TTYA 5I24A 4TX8A 3WBEA 1CGWA 4J3UA 3VIMA 2WC3A 2VZUA 4MB1A 1H49A 2YDQA 3EDKA 4B3KA 4MPKA 4WKAA 3DHUA 1XSJA 2ZXDA 4MJ4A 4TVCA 3AIBA 1W1TA 1CEOA 5E9AA 5AC5A 4DUXA 1B9ZA 4EK7A 2UWFA 4M24A 1ISWA 1GPFA 1R7OA 4QP0A 1DP0A 2XPKA 2EPNA 2ZWZA 1WPCA 4D6FA 2WVSA 4MAVA 2GK1A 2BHZA 4LYQA 1M04A 3NJ3A 2WCGA 4W8AA 2BVDA 3PZQA 2C8NA 3T0AA 4RE4A 4RE2A 3OGRA 2GJXA 3WIJA 1OGSA 1EOKA 4TTGA 3VOCA 5JBFA 5BWFA 4CD6A 4PMQA 3BGAA 2VMFA 3T2QA 2XVPA 4GZEA 2G3IA 1V0LA 1GCYA 2OYMA 3VM7A 2XVKA 3K8LA 1QW8A 3EBVA 2W4XA 4BZYA 3U57A 2XTKA 5CPQA 4E4PA 2V3DA 2V3EA 3ARTA 2D20A 1G0CA 1PIGA 1J0YA 3THCA 1G9HA 5D9MA 5A3HA 3VIPA 3VD3A 3POCA 1U2YA 2X05A 4EKJA 3UESA 3SCRA 3UG5A 4D6CA 2EPOA 4OIFA 2OSWA 2V5CA 3AZTA 2G3JA 1L0PA 1AQHA 3CO4A 2J4GA 3AHTA 1NP2A 1UR4A 5TD4A 3WQ4A 3BMWA 1C91A 1S46A 3F4VA 2BY1A 3AICA 4KRUA 3WFLA 4M82A 4W88A 4AZ5A 1V3IA 5DT5A 4HOZA 3WDIA 1MQQA 4HZ6A 2FDMA 4MADA 1N82A 4JCMA 1KXHA 1J0KA 4AZHA 1QHPA 2D22A 2WMHA 4PEEA 4BQ5A 5CXPA 1W1VA 4D6IA 2WCSA 4PBGA 3GNPA 5FKYA 5BXPA 1JD9A 4JFVA 4AD3A 1DWFM 5A6AA 1J10A 4MNKA 3EMZA 1V08A 1JZ2A 1FH7A 2OWWA 1MWOA 2E8YA 1JXJA 1MQRA 4HU8A 5A6BA 4UOQA 4HMDA 1BYAA 1NARA 4H04A 3WNOA 4W7VA 2E0PA 4DWSD 1UKSA 2B31A 2VRJA 2CBVA 2Y8VA 1LWHA 5AYBA 1UWRA 3ZM8A 1V6WA 2GK1B 3UEQA 2VTFA 1VJZA 3I3DA 1KFWA 5GQBA 3T2PA 4CU8A 2X09A 1W3KA 2EPLX 3WL1A 2J47A 2FH8A 1QNPA 2GJXB 3MMDA 1CGXA 1E6SM 1MFUA 4GO9A 1Z32X 4V2XA 1HL8A 1Q6FA 4U5KA 1E5JA 4M1RA 4XZBA 1J12A 1QNRA 2EBNA 1CLVA 7A3HA 1CXIA 4PUDA 3QHNA 5BRPA 1UD5A 4D1IA 1EXPA 3E1F1 3SEPA 3QHOA 1J01A 1EHNA 3AFBA 3FN9A 2CHOA 4JKKA 3NCOA 4ATLA 3BMVA 1HXJA 1ESWA 5CSYA 1MW2A 5LYRA 1BYCA 2VRKA 4H41A 4EE9A 1JD7A 4D71A 2O9TA 2XSBA 2WZEA 1JDCA 2WYSA 1DWHM 3BH4A 3EMQA 3PZGA 4ML4A 3ARXA 3W24A 4MNMA 1ISZA 1UYQA 3O2LA 1CDGA 2RGMA 3WENA 1V3LA 4U2ZA 2VI0A 2WHKA 1K9DA 2E9BA 5HPCA 3AQUA 2XVLA 1WP6A 4PTMA 2J7HA 1OGBA 3WF2A 3WMCA 3VX0A 3RCNA 5BXRA 4AZBA 3ARUA 2VC9A 3EDEA 5C70A 1BLIA 1G01A 3G6MA 3W53A 5A6KA 5CPSA 1RPKA 2CYGA 4WLCA 4UFHA 1CXEA 1XH0A 2GFTA 1W32A 1E4MM 4JHOA 2J7EA 1RP8A 2J7GA 3OA5A 3MV01 3N1AA 3CUGA 1QI2A 5E0CA 1UH2A 4KGLA 3VGEA 3QOMA 4YHEA 5A6BD 2VUYA 3BAKA 3ARVA 3HJEA 4WKHA 4A4AA 1DTUA 1US2A 1NOFA 4J3TA 2JEQA 4XUYA 1H11A 4AD0A 4ZE5A 3WD0A 2YBUA 3RMEA 1XSKA 3TTSA 1E6RA 4JIEA 3SCSA 4Q7NA 2VQTA 4NZCA 2VR5A 1O6IA 4PSPA 1J0HA 3NDZA 4JFSA 1OSEA 4HPGA 1AMYA 2EPKX 1B3XA 4MB3A 3PZUA 3AYRA 4GI8A 1C7TA 3K8MA 3VGHA 4UFIA 2WLYA 3ZJ8A 1U30A 1W2PA 1H4PA 3NSMA 1KCKA 1E1FA 1US3A 4NSBA 1R86A 1TMQA 2D0FA 1MVYA 2W91A 4HA3A 5CGTA 3WH9A 2WC7A 1W3JA 4DM1A 3ZT5A 4J3VA 1SFSA 1UQZA 3GXDA 1BGGA 3DYMA 4AZGA 4J3XA 1PX4A 4JCLA 4EAMA 4Q22A 3UG4A 4UFKA 2EQDA 1UR2A 2BNJA 1V0NA 4TX6A 3WEZA 3WQWA 1BG4A 4W5ZA 4TUFA 1E43A 1UKTA 3VGBA 2YLAA 3UERA 3WY1A 2WPGA 4IPNB 1WDRA 2J7DA 1EDGA 4B16A 4AXNA 1UH3A 2PWHA 5C8BB 1UWSA 1VF8A 3AMGA 1IV8A 3VVGA 1LG1A 1JZ5A 4BCEA 1EIBA 2VX5A 3OZPA 1JI1A 1M03A 4FLOA 3AISA 3AS1A 1E3XA 3SUUA 3WNLA 2JALA 1GONA 2QMKA 1PPIA 1JF6A 1V3KA 3CMJA 3WD1A 3WH7A 5I5RA 1HNYA 4NRSA 3BAWA 2A3AA 1GQIA 1QPKA 1UA7A 2DT2A 5D4YA 1W9BM 2XIIA 1SMDA 3CUFA 4N42A 3QHMA 1PZ2A 2BVTA 5GNXA 3D5HA 3CUIA 3WKZA 4MAZA 1HVQA 2VRQA 2WHJA 2CKSA 4F66A 1JYWA 1GOIA 3TTQA 2WBKA 2WZIA 3VDHA 4J27A 1JYVA 4KGJA 2WAGA 2FH6A 3KWXA 4AMCA 5AYIA 2WCAA 5F7UA 3KEHA 3VIHA 1R85A 1PIFA 1BAGA 5I3DA 2RGLA 1LLOA 2VCAA 3CTTA 4Z2IA 1XCXA 1ZBWA 5A8PA 3AHYA 3VGDA 1HKKA 5CQ1A 3AZRA 3VKKA 2QPSA 3VIIA 2OWCA 3WEMA 1LQ0A 4D6EA 3U7VA 4HZ7A 4AEFA 4U31A 4ATDA 2OYKA 3WMBA 1OT2A 3BLKA 3BLPX 3ZO9A 1QNQA 1VJSA 3T2OA 1U33A 1JYXA 1E70M 3GH4A 5EMYA 2F61A 4HP5A 3N04A 2WVVA 3L4XA 2YOCA 2D0HA 5I2UA 4JL2A 2XFFA 3APGA 3MO4A 4GI6A 5M03A 1AQ0A 1C8XA 3GYCA 1QI0A 3OGVA 1UWUA 3VX1A 3ECQA 3VD9A 4YN5A 1UR0A 3WSUA 1UD3A 1W91A 3GXIA 4FLSA 3IK2A 4BQ3A 2W61A 3WDHA 2VX7A 1E6QM 3CH9A 1J0IA 3AIRA 4W84A 5FD0A 2YA1A 3QR3A 4OUEA 1JZ4A 1ZU8A 1V6VA 1SYTA 2DIEA 4P8WA 3ARQA 1NOWA 1PZ3A 3W81A 2XYLA 1YQ2A 1JL8A 2PI6A 4PMOA 3GBEA 2DEPA 5JUVA 4W8BA 4GO8A 1VFOA 3AYSA 2O9RA 1KXTA 1SR0A 2WSPA 4PTWA 4K68A 3WDJA 1JAEA 1OM0A 4D6GA 3ZOAA 1FFQA 1MW3A 3ARZA 4ACYA 2QMJA 1TVNA 4H8UA 1UA3A 1WDQA 3PN8A 4N0RA 3RJYA 9CGTA 3T0DA 2D3NA 4NF7A 2OSXA 1YHTA 3AIUA 1WZKA 5BYWA 1E55A 2VCBA 3VINA 3AHZA 4P7LA 5LA0A 4ZENA 1ISXA 3ZIZA 4TTUA 1GOQA 1E1EA 3CZKA 2GJRA 2VZVA 4UZSA 4DWSA 4PMRA 1BG9A 3MSDA 4L4OA 1UZ4A 1UWTA 4P8XA 4XB3A 1E9LA 3MV11 1CENA 3L4UA 1GOWA 1ISVA 1KB3A 3NSNA 2NSXA 2Z1KA 1VFMA 3RDKA 2WZHA 4PTXA 4LXFA 3AMDA 4M81A 1R8LA 4PMDA 2XM2A 4LPCA 4Z2KA 1XRVA 2J74A 1UKPA 1HN1A 2VL4A 3ZMRA 4GIAA 2ZX5A 4WK9A 1QNSA 4MJ2A 2W66A 3OGSA 2WVVB 3A4AA 4UFJA 4KRTA 1OIMA 2XUCA 1HJSA 1TA3A 2E8ZA 4ZXLA 3UETA 1SMAA 1V6YA 1M01A 3M46A 1JI2A 4OOUA 5D9NA 4AC1X 2WBGA 4R5EA 1XC6A 2BHYA 4UQBA 1EO5A 4H8VA 5CLWA 2VR4A 5JBDA 1PAMA 4D1JA 1VFUA 2HISA 1V6UA 2DDXA 2WWCA 4AZ6A 1GQLA 5A8MA 4H2CA 2E4TA 3FAXA 2UY4A 1V02E 3OG2A 5DO8A 2ZIDA 4PCSA 4GZJA 1GHSA 5EB8A 2CITA 1QOXA 3VD5A 2XG9A 1PX3A 2Y8KA 1JF5A 4C7FA 4PMYA 4X0NA 3RM8A 4P7QA 2BS9A 1J18A 2VZTA 3VD7A 4AW7A 1UWQA 1Q6GA 2G4FA 2WMFA 1X6NA 3ARPA 1JIBA 3TOPA 2WNWA 2BY2A 1UR9A 2JE8A 1NQ6A 1GOMA 2DSUA 3N17A 4QDMA 3J7HA 1JDAA 4XX6A 2YDRA 1MXGA 3WELA 5A6JA 3U7BA 1C7SA 5BXSA 5CGMA 2DQXA 2CERA 3WQVA 2J75A 4IPLA 4AWEA 3LPGA 2O92A 4ZE4A 1DEDA 1ZJAA 3CLWA 4YHGA 2A3BA 1MW0A 4UQAA 4NI3A 3MU7A 1E73M 4DWSB 1UD6A 3AMLA 2BXZA 1LL6A 1QI5A 4CU7A 1VEPA 2X0HA 3B9DA 2CCRA 4UFLA 1H0GA 1E0WA 1BTCA 4WSJA 4Z2LA 1BSIA 5A8NA 2NT0A 2QHAA 4IISA 2DT0A 4CCEA 5A69A 4S3JA 1KGXA 1KXQA 1BQCA 3ARWA 3SUVA 1BVZA 5A6SA 2PWEA 3BAJA 2ZUTA 1B3ZA 1XD0A 5E6ZA 2YLLA 1NWSA 3A47A 2VT0A 4OZOA 3RM9A 3PTMA 2XJ7A 5EFDA 1C8QA 4AZCA 3EDFA 3WQ5A 5FOOA 4JKMA 2WW5A 2CBUA 2D24A 2VO5A 3HMCA 2JFEX 3CIVA 3CHDA 2DPEA 3AXIA 1B90A 4WIWA 1NOUA 1GZJA 2AOSA 5HXMA 5I78A 1HJXA 4H8HA 1RH9A 1W2VA 4GXPA 5FCZA 1R7AA 4QFUA 1MW1A 3FW6A 2WWDA 3KL5A 1A3HA 4GZIA 3FY1A 4JFTA 3MUIA 1E0VA 3L4WA 2PF0A 1ITCA 5A8OA 2YJQA 3VMPA 3BSHA 2WKGA 1WDSA 3CGTA 4PN2A 5BXTA 4QLJA 1UZ1A 1EQCA 1HKIA 1CZ1A 1KXVA 2PBOA 5DFAA 2WC4A 1J11A 1HL9A 3FXYA 2VNCA 3AZSA 4X0VA 1E6PA 3WMSA 1JZ3A 2ZXQA 3ZR6A 4Y7EA 1UR1A 3RILA 1CIUA 1VFFA 3GXFA 4ZEPA 5D9PA 3JUGA 1JZ8A 2EEXA 3WH8A 2WVTA 4U33A 1KR1A 5I77A 1P6WA 5AY7A 5ABFA 1B3YA 2VOTA 2WXDM 1BYBA 4W7WA 3W82A 1E56A 1PEZA 3PZOA 1HP4A 2DGAA 2VVSA 3F5LA 5A2CA 2WK2A 6A3HA 4WSKA 4M8UA 1WZMA 2VX4A 3AHVA 3CZ8A 3S2CA 4D6HA 2D2OA 1XH1A 3POHA 4MB4A 3MSGA 2J25A 2G3NA 4HZ8A 1H0IA 1C8YA 2J62A 2WLZA 3VIGA 4UZUA 1JZ7A 1WZAA 4MDPA 1V03A 4PMVA 1G1YA 1LL4A 4CCDA 4D6DA 1H41A 3EYPA 3U5UA 3ARYA 3CHCA 1DWJM 1KBKA 1EHAA 3PZTA 3N12A 2O9PA 1TVPA 3ZT7A 2DT1A 4Z2GA 1PBGA 4AZCB 2FGZA 1XV8A 3KL3A 1M53A 2DIJA 2EO7A 1QI3A 3N15A 4D6JA 3SCWA 4C7GA 1AVAA 3II1A 2XHYA 3VD4A 4OBSA 4EANA 2IUZA 1V3JA 5BCAA 3SCVA 4PSRA 1K9EA 2YKKA 3THDA 3A3HA 1J0JA 2WMIA 1Y7VA 2W92A 4UR9A 1UG6A 3W37A 2ZXAA 3SCQA 4CD7A 1E4LA 2Q8XA 2ZWYA 1GOOA 5HNNA 3AS2A 4L4PA 3NDYA 4BF7A 1VENA 3AOFA 1BF2A 4WJXA 4UQCA 1W3HA 4U5IA 5CZKA 1VRXA 1KQZA 2PC8A 4ATWA 5I6SA 2PBGA 3N18A 3OLEA 1O7AA 2CBJA 1IT0A 1IZJA 3WF4A 4M29A 2IXUA 4V28A 3T09A 1G94A 1EH9A 2J78A 3VTRA 4CN6A 5DF0A 3B8SA 2WHMA 1JFHA 1UWIA 2PWGA 3PHAA 1K6AA 3ZT6A 4W5UA 3NIYA 4E2OA 1CECA 3S6TA 2JF7A 2JF6A 1FFRA 1WZLA 4PCTA 1FHLA 2AAAA 2E40A 1QBAA 1WAWA 5BROA 4FLQA 4CKQA 5FL1A 2OWXA 2CPUA 2X1IA 4CGTA 2GDUA 3AS0A 4W93A 2QPUA 4MDOA 1WO2A 2EXOA 3ZQ9A 3GBDA 3A4XA 5CSUA 4FLRA 1E6NA 1OCQA 1ZBCA 3AI0A 5AC4A 1G5AA 1OD8A 4UOZA 1H1NA 1UD2A 5A8QA 4D72A 1V6XA 1W9DM 1CXHA 1CNVA 2VZOA 5M17A 1JG9A 1OWQA 4QCEA 3WF1A 4F9DA 4HOWA 3VNYA 4QCFA 1WCGA 2CEQA 3ZJKA 4ACZA 1HF6A 1X1NA 8CGTA 5GPRA 4GKLA 3BCDA 3A6OA 1Q6EA 2D3LA 3M07A 3WDRA 2QF8A 4CN4A 1K9TA 1WKYA 3HU7A 4OBRA 4CUCA 3WL0A 1VB9A 3OLGA 1BYDA 3L4ZA 1V3HA 2BV9A 3AIVA 2WMIB 4W85A 3WFZA 3N11A 2V3GA 3BCFA 3VPLA 1CXFA 1CGUA 5HPOA 3VNZA 3IJ8A 3ZSSA 1KWGA 4AIEA 3ZJ6A 1WNOA 2FHFA 1V0KA 3VIJA 3FAWA 5C71A 1UKQA 2XIBA 4PMZA 2W63A 3GTNA 2VCCA 4B9ZA 3DECA 1HIZA 2FHCA 4FK9A 3ARRA 1VEOA 2Y2WA 1XYFA 4KMQA 1CXLA 1PJ9A 1KBBA 4TVUA 1BHGA 5CPTA 4M80A 3GZAA 5ABHA 4J3SA 3DHPA 3L4TA 1QHOA 5EBAA 5E0FA 4LX4A 1WE5A 1K9FA 2O9OA 2ZE0A 1E0XA 2YBTA 1GNXA 4P7OA 1H5VA 3SCTA 2F8QA 3CBWA 1M7XA 3OIHA 1UUQA 2OLHA 2NW0A 3OZOA 2WSKA 2BHUA 3K1DA 3MUAA 3DYOA 2DSZA 3VDBA 1HX0A 1LG2A 5A6MA 5DMYA 3AXHA 3WF3A 5E6YA 1B30A 1UH4A 1QVBA 3WNMA 1UR8A 4PYSA 1VBUA 2ZX7A 2FGLA 3W0KA 4DWSC 1BPLB 1B31A 1NP0A 4WF7A 2UY3A 3L2LA 3GH5A 4AIOA 3FHAA 4AISA 1E15A 1E3ZA 3PTKA 2XWEA 3UR8A 8A3HA 2DH2A 1Q6DA 5IHRA 4PRWA 4LYPA 1MYRA 3QOKA 4A3HA 4W7UA 3CZEA 4PMUA 3CHEA 2C7FA 2ZX6A 3CPUA 2WB5A 4UQDA 4ACZB 2UY5A 1VAHA 3D3AA 3AS3A 2VX6A 3BAXA 2JEPA 2WVUA 1ZS2A 3GNRA 3MUY1 4U2YA 1FP8A 3NUKA 2G8ZA 1B0IA 4XV0A 1JGIA 4R27A 1HP5A 1FOBA 3F5JA 3K4AA 2YA2A 3FNDA 4GI9A 7CGTA 1VBRA 3SUSA 2ZOXA 4CD8A 1C93A 1FH9A 2E9MA 3WH6A 5I0DA 1L8NA 5D9OA 2BFGA 2Y4SA 3BAYA 3B9EA 4U3AA 2XVGA 1OD0A 1LWJA 5D8ZA 4FF5A 3T08A 3WD4A 2DT3A 5A2BA 2EPMX 4F79A 2BXYA 4AEEA 3K8KA 3CZJA 4ZFMA 3ARSA 5KEZA 3KE0A 1RD6A 5A2AA 1AQMA 1R87A 5EFFA 3SCPA 1GW1A 2GVYA 1KGWA 3G6LA 2YL8A 5ABEA 1CWYA 3WN6A 2WKLA 3VUPA 1B1YA 4GQRA 5IHSA 1TG7A 2WM0A 4IUGA 1EGZA 3TTOA 1X6LA 3SIMA 3DYPA 3U5YA 3PBGA 5HBFA 4S3KA 1BFNA 4UFMA 1E4IA 3OLIA 2J7FA 4DUWA 3IJ7A 1B3VA 2MANA 1CGTA 3BXWA 1OGGA 1VIWA 4CVUA 5BRQA 1A47A 1JXKA 3O6AA 2XSAA 3W38A 2ZUWA 4JKLA 5E70A 4H7VA 2W62A 1JYNA 2UY2A 4J7RA 3AMKA 2JIWA 2ZUMA 3LPPA 1GVIA 1OBAA 1CGVA 2YL9A 5IFTA 5GNZA 1JAKA 5HDRA 1NH6A 3GH7A 3ZR5A 1E40A 2CKRA 4UTFA 3GDBA 1GVYA 4YPJA 3OB8A 4CD5A 5M5DA 2Y24A 5JBEA 1JNEA 3AROA 3CUHA 5IFPA 1XH2A 6TAAA 3EDJA 3VM5A 4CD4A 1ZBKA 3RO8A 1JNDA 2CHNA 3WF0A 4JFWA 2GSJA 1MQPA 4BA0A 2X2YA 1I1WA 4W89A 3NYDA 3VO0A 3W27A 3WUBA 2XGBA 2PWDA 3ALGA 4BQ4A 3MANA 4HA1A 3PZ9A 3WUGA 1OB0A 4TOQA 3MS8A 4Z2JA 5FIPA 1IZKA 1ODUA 4LQ1A 5LA2A 3W6MA 4F8XA 2XGIA 1ZL1A 1E6ZA 2OSYA 3WD3A 1LL7A 2ZX9A 3A4WA 4UOJA 1WDPA 4E8DA 1TA3B 3L2MA 3RPMA 1XCWA 1DHKA 2NT1A 2VVNA 3WNKA 3GXMA 2YA0A 3WD2A 4W87A 5A6LA 5I23A 1D7FA 1GQJA 1KWKA 1TCMA 1Q6CA 2J77A 3TP4A 5KZ6A 3IJ9A 4M56A 2QLYA 3EMCA 4LYRA 4P8UA 2D0GA 4UQEA 1NWUA 1CPUA 4GQQA 1JFXA 1HT6A 3WBAA 1ODZA 2VURA 2V3FA 1F4HA 2BVYA 2V38A 1TE1A 2BY0A 1FHDA 7TAAA 5A94A 2GDVA 1CYGA 3SCUA 3MKKA 3UR7A 2F2HA 2J79A 3TA9A 4HMEA 2PWFA 2ESCA 2WANA 1HKJA 1OINA 1TR1A 4B15A 5ECUA 5I79A 1B2YA 4C90A 4HMCA 5GNYA 4OKDA 1TUXA 2W5FA 3BSGA 1QBBA 1V0MA 3GNOA 3VMOA 3BAIA 3CMGA 3WQ8A 2YIHA 3AIWA 3PZVA 2CXGA 5D8WA 4AZIA 1KGUA 1ZJBA 1W9UA 4J28A 3B9AA 1ZBVA 3CZLA 1E5NA 2DSWA 1E72M 4F9JA 4BQ2A 1MFVA 1ITXA 5DT7A 3EDDA 2YL5A 2ZUSA 3L4YA 4AIUA 2ZICA 3PZIA 4LGXA 3PTQA 3M7SA 4P7RA 1H09A 1QNOA 4J3WA 1JDDA 3VILA 3ZSTA 5CG0A 4AD5A 3RIKA 3SUWA 1UQYA 1UD4A 4HTYA 3M6DA 1I1XA 3IAPA 1CGYA 3CHFA 4AD1A 3WUEA 2TAAA 5IXEA 2ZUUA 4JZ5A 5A95A 3AIQA 2J8FA 1E6XM 1W1PA 3MUZ1 2WHLA 3VIFA 2AMGA 2V5DA 4HOXA 1OT1A 4JFUA 1FA2A 2PB1A 3RM4A 2BY3A 3WUFA 5LA1A 1EDTA 1NWTA 2ZUVA 4GPNA 3I3BA 4TVDA 4UQ9A 1CXKA 2VQUA 4UCFA 1V3MA 2E3ZA 4X9YA 3KZSA 4B9YA 5CLTA 4KH2A 4CN1A 1ISYA 1DWGM 1WB0A 2CNCA 1W1YA 1H3GA 2YDSA 3MMUA 3W29A 5JIPA 3O9NA 3VMNA 2J7BA 3WNPA 4GINA 5HOSA 1PX8A 3PZNA 1FP9A 4TXEA 6CGTA 1HJQA 3RJXA 2XM1A 4B3LA 2ZUNA 3WDQA 4MTVA 4RE3A 2E9LA 2Z1SA 2CBIA 2C0HA 3LMYA 3KL0A 4NRRA 4PMXA 4DUVA 4AY1A 1TZ7A 4JHZA 4A3YA 1HKMA 4AYSA 5ABFB 1BGAA 2G3MA 3ALFA 4W8LA 1EOMA 5DEZA 3K4DA 4ZXOA 2YL6A 4OJYA 1KCLA 3UG3A 3IANA 2XFRA 3AMCA 3LPFA 1Q4NX 2XFYA 4V27A 1FH8A 3CZGA 2VZSA 1DWAM 2GUYA 5FL0A 2OYLA 2ZXBA 2WMGA 1W3LA 2VJXA 4JAWA 1ECEA 2CESA 3CUJA 3N9KA 1H2JA 3UCQA 1JZ6A 1XSIA 3NSXA 1D2KA 2IXVA 2G41A 3T0BA 3WQ6A 1EDQA 1KR0A 1TFVA 4MNLA 4UNIA 1QW9A 4AZ7A 3VIKA 1LJYA 2D23A 2W67A 3W4RA 3AJ7A 3F5KA 1GJWA 4AD2A 2JIEA 4PTVA 1XYZA 1EQPA 3W28A 1UKOA 2GJPA 3DC0A 2DH3A 4MNJA 2FHBA 4P8VA 1C90A 3AIEA 2A3HA 5E09A 1BVNP 1UOKA 4HA4A 4MB5A 4CVWA 1HVXA 4XZWA 3I3EA 4AD4A 1CTNA 1LF1A 1W9VA 4C7DA 4PUEA 2CETA 1EA9C 3FHQA 3SUTA 2DSVA 1E71M 4Z2HA 3VU2A 5ABGA 1D3CA 1DWIM 3AXXA 2DSKA 2XVNA 1GORA 3TONA 2J7CA 3OLDA 1OIFA 2WMKA 3AHXA 1GQKA 4BS0A 1GUVA 1F4AA 3SCNA 2HVMA 2QV4A 3IAQA 5JIWA 3WDPP 3LPOA
chains in the Genus database with same CATH superfamily
2E5BA 3MJYA 1EC9A 3RLUA 2QCDA 4H9TA 4TV6A 1UHVA 1FHVA 4PUMA 3LTSA 2XWDA 3IJQA 3GDTA 3QRHA 4LV9A 4YTTA 3VGFA 4QLKA 1ONXA 5JVLA 3L4VA 2EJ1A 3K46A 4NX0A 5EMUA 1EO7A 4HU0A 1B5TA 1QPOA 3D0CA 2J8GA 4EPEC 1KFLA 2PD9A 1V02A 3E02A 4F2TA 3CTLA 1GHRA 3WH5A 1CBGA 2GUUA 2VEGA 1YW1A 5CC6A 1GYNA 3SCOA 1X6UA 3STCA 3M5YA 4JICA 2YYTA 3KRBA 4I6VA 4AHOA 4P2VA 3W74A 1EFZA 1KCZA 3O05A 1EF2A 4IM4A 1HJWA 3B8TA 3VDAA 5M3WA 4XAZA 1ZB5A 3HQOA 4U3CA 3P84A 4B5XA 1JJKA 3CEUA 3NO1A 2RDUA 1VD6A 3TYDA 3NL2A 4HT3A 2PP3A 4J3UA 1DE5A 1UWAA 3TCSA 3S47A 1X97A 3VIMA 4UCGA 4UMBA 3GU1A 2VZUA 2OQYA 4MJ4A 3S0CA 1W1TA 1TQJA 1B9ZA 4EK7A 2C79A 3DFYA 3TFXA 5FACA 1GPFA 4UNKA 5LNWA 2EPNA 1WPCA 2WVSA 5B80A 3VNMA 5H6HA 3QR0A 2V6AA 4LYQA 1YNQA 1SVDA 4W8AA 3PZQA 3W86A 4RE4A 2E1DA 2V68A 4RE2A 3OGRA 5HWMA 2FMOA 1UIPA 4UTWA 3HFYA 4TTGA 3KVKA 3GQYA 4CD6A 5D2WA 1MDRA 3IJ6A 2A3LA 3T2QA 1KM4A 2HPMA 2G3IA 3NG3A 1V0LA 1GCYA 3IJIA 4LBUA 3K8LA 1QW8A 2EJAA 4TV5A 4CNSA 2Z4GA 1O95A 4IL2A 4GQBA 3U57A 3H4WA 4Q4RA 1IXNA 5CPQA 4E4PA 2XZ9A 4C6DA 1R2TA 5A3HA 3VIPA 3VD3A 4GRSA 4EKJA 3LCFA 4KPLA 3UG5A 1TJ2A 5DQPA 1RJRA 2GOKA 4ONVA 2V5CA 3HV9A 2ZZ2A 2CLPA 1NP2A 1WAUA 1C91A 4FNTA 3S1UA 2BY1A 1NELA 1LP6A 4M82A 4W88A 1YE6A 3WDIA 1EA0A 1M41A 3P61A 1ONEA 4DPPA 3M1ZA 2FYMA 1KXHA 1MSSA 3OHMB 2WMHA 2D22A 4PEEA 4BQ5A 5CXPA 5IRPA 2WCSA 4PBGA 5IBXC 5BXPA 1R3SA 3A12A 5DBUA 2CZDA 2DZAA 4LUIA 4TO8A 1I8JA 1F8MA 3SSZA 4S2CA 3UWUA 1DWFM 2I5QA 3MB9A 1J10A 4MNKA 1JZ2A 1FH7A 4N02A 5TF0A 2E8YA 4JTAA 1IIHA 3NTYA 4RDWA 3QZEA 4H04A 1K6WA 3SN1A 2V8ZA 4NNBA 1K4GA 3RRXA 1SO3A 3WNOA 4MGGA 1UKSA 2B31A 1GKPA 2Y8VA 1LWHA 3PUDA 1UWRA 3QMTA 3UEQA 4O15A 4BI7A 1VPYA 2PPGA 3VOFA 4ZGYA 2RJHA 3W1LA 1DORA 3WL1A 2GJXB 3BV7A 1RY0A 1Z32X 1HL8A 1QJWA 1E5JA 4M1RA 1UIOA 3UR5A 1CLVA 4QROA 1CXIA 4WOZA 3SR7A 4IF2A 3S6DA 1YNPA 1ZP4A 3E1F1 3SEPA 4JKKA 4ATLA 2ZDRA 9XIAA 1HXJA 1ESWA 3NXFA 1MW2A 4HYWA 4H41A 1MMFA 1I45A 2ZDSA 4LVFA 4RLIA 1RBLA 4LC8A 2O9TA 3CPRA 1RJPA 3SQLA 3W24A 4MNMA 4S3FA 1ISZA 2RGMA 3PFRA 3WENA 3H23A 1TTQA 3DFNA 3EPOA 1VIZA 1K9DA 4GJIA 2ABAA 3B8DA 4JTCA 2XVLA 1WP6A 4PTMA 3FIGA 1VQTA 2VC9A 5C2GA 1BLIA 3CAVA 4US5A 5HWNA 4ZO7A 3W70A 1UBPC 3JZEA 3PPHA 3ZVHA 3M64A 3VDGA 5H91A 2PP1A 2TSYA 2D2GA 5T91A 4JHOA 2W27A 4A05A 2ACRA 4NILA 2DZVA 4K2SA 3OA5A 3E3HA 3MV01 3N1AA 1TO3A 4RZBA 4A6GA 4IGHA 2JGQA 2YCIX 4XQ6A 1UROA 3WYZA 3RMJA 4YHEA 2REQB 1X38A 5L6UA 1LRTA 2VM8A 4JQ3A 4XAYA 3JZUA 4J3TA 4XUYA 4ZE5A 1KTCA 3W7PA 4OTKA 3H12A 5LIKX 1WQ5A 3HIJA 4C6OA 2DV0A 2NWRA 4JYFA 4QRNA 1DE6A 3KS6A 3SRFA 4ZCWA 3UJEA 1FRBA 1AUSL 1JCJA 4Z1YA 2ZVRA 2FKPA 1P6BA 4GI8A 3VGHA 5CPNA 2WLYA 4O11A 3ZJ8A 3EOUA 1W2PA 2G95A 3NSMA 1EUNA 3FA3A 4JQAA 1R86A 5FF2A 2HSAA 1QAPA 4DM1A 4PFMA 4N6FA 3EB4A 1V77A 3FEQA 2AAMA 4J3XA 3QTGA 2PWVA 3VNJA 3LENA 1PWLA 2NXHA 4JQ4A 3UG4A 4ZB0A 3B4YA 3XISA 4UMAA 1SFJA 2BMBA 1KFBA 4TX6A 2V2DA 4H4IA 3VKCA 4W5ZA 3FYPA 1E43A 3GXTA 2E67A 2NVCA 3UERA 3OIXA 1WDRA 4WDTA 5BWAA 5C8BB 1K02A 1VF8A 1ICQA 1ME9A 4J40A 3PUEA 1W3NA 1EIBA 5I00A 3KW3A 5D30A 3OODA 5FJRA 1JI1A 1KO0A 3E38A 1M7PA 3NL6A 4H7ZA 1SJCA 4FLOA 3SUUA 3UPWA 4DO7A 5CAKA 1P7TA 3EWXA 3QC0A 3WH7A 4S3AA 4IPJA 3S1GA 3PBUA 2A3AA 3REQA 3P7YA 2ANUA 2J24A 3IGSA 3H2OA 2P76A 1HVQA 2FJKA 4BWLC 2CKSA 4RX0A 1GOIA 3TTQA 4KGJA 2WAGA 2FH6A 4YLWA 2WCAA 4HHHA 3KEHA 1PIFA 3G8RA 1BAGA 3EWWA 1R2RA 2RGLA 4JX6A 2VCAA 3BG9A 1O12A 3MYPA 2QF7A 3AZRA 1XUZA 4QE1A 4IQJA 3ID7A 3LXCA 3KRSA 5SWUA 3EA3A 4YVPA 1Z48A 4AEFA 3V0UA 4ATDA 1R3TA 1WYIA 4NJJA 3Q37A 3ZO9A 3HGJA 1UUMA 4YTUA 3EOSA 1REQB 3BL3A 3N04A 4PZVA 4JL2A 2YXGA 3S5YA 5D09A 1F3EA 3BG3A 2NV2A 3LHUA 2PODA 1UWUA 4UBPC 1UR0A 4LAMA 1XG3A 4FLSA 2NQHA 1SJBA 4NZFA 1AW5A 1E0UA 1S5VA 1GJPA 4B3ZA 1XLLA 3CH9A 2DZBA 3QR3A 5D2YA 5HMFA 1XIEA 3CK5A 3RR1A 4K7VA 3EWZA 1P0NA 2ZTKA 3HURA 3GBEA 1RXOB 3R10A 5JUVA 4W8BA 1JDFA 2OG9A 2WSPA 3W1UA 5EIYB 4K68A 3HM7A 1B4KA 3VNKA 4JTJA 3WDJA 1JAEA 3COTA 3ARZA 3S5OA 1PZ0A 3SJNA 1XDMA 1WDQA 3T0DA 2X0SA 1YHTA 4DI9A 3P3BA 4UXDA 4HNOA 3VINA 5LA0A 4P02B 3R5EA 3L0GA 2VZVA 3LD5A 4QQUA 1WBJA 4ECLA 5CPOA 4L4OA 4IGMA 4AXKA 1UWTA 5G4EA 4IGSA 2NXGA 5B7ZA 1GOWA 4GFSA 3DI0A 2NSXA 2HNHA 2Z1KA 2Z6IA 5FJJA 4FXJA 2OT0A 2QVHA 5AHFA 1AG1O 2O4MA 2CXEA 4WX2A 3VE7A 5FJTA 4FNUA 3ITLA 3GG8A 4WQ6A 1UKPA 4F0MA 2VL4A 1XR2A 3ZMRA 4FOUA 1QNSA 5LIXX 1AW2A 4E4UA 4Q4MA 4HTBA 1OIMA 2XUCA 1EP1A 1TJPA 2E8ZA 4IIBA 1SU5A 1H7WA 1LQAA 1M01A 3GVQA 1GYMA 1AW1A 1KTNA 4OOUA 4AC1X 3GVGA 4I3GA 2WBGA 3RNDA 5CLWA 5TBOA 5JBDA 4D1JA 4UB9A 1VFUA 1ZAJA 1J79A 3FJ4A 3N6JA 2E4TA 4O8RA 3UXDA 1FWJC 2V63A 3FKRA 4L80A 3D46A 5DO8A 4PCSA 2ZKMX 4AHQA 3N2TA 3DFSA 4XKMA 4K38A 4NAFB 4HG6B 4X0NA 2FZDA 1ITUA 2VZTA 3VD7A 4NHVA 4O1AA 1EBGA 1Q6GA 2OU4A 4GIRA 1X6NA 3TOPA 1E1CA 1JQXA 2BY2A 1DOSA 5IDZA 1NQ6A 1GOMA 3N17A 4Z1DA 5T26A 1W5PA 2YDRA 3WELA 3U7BA 3GIPA 5BXSA 2J75A 3WLIA 2O92A 1TPB1 1ZJAA 3B0XA 3CLWA 3BDKA 3GG0A 2IMRA 4UQAA 3MU7A 4MZ8A 3PANA 4DWSB 2OX4A 1UD6A 2BXZA 1QI5A 2X0HA 2CCRA 1H0GA 2QW5A 3K30A 2DP3A 3OTRA 4MPQA 1RAKA 2QHAA 2DT0A 5A69A 5PTDA 3W7QA 1LYXA 1LRNA 5A6SA 2PWEA 3BAJA 4S1FA 2KZHA 2YLLA 1NWSA 1LRQA 5FESA 3LTYA 3WJSA 2VT0A 3R0DA 1C8QA 4TIMA 4LS0A 4ZZ9A 4LB4A 2HZGA 4K36A 4JTIA 3W7OA 1SSDA 4WSHA 5AC7A 2JFEX 2DPEA 4XZHA 3H7RA 4JTRA 4WIWA 5HXMA 1GZJA 2AOSA 3NPXA 4S3BA 5LSMA 1WDWA 1PWMA 4QHRA 1W2VA 4PBEA 1DBTA 3E2SA 1R7AA 4QFUA 2HROA 2WWDA 1A3HA 4RZ5A 3C56A 1C8VA 1E0VA 1Z69A 3VMPA 4LRSA 3CV1A 4PN2A 1UZ1A 4NX5A 1T40A 1EQCA 1CZ1A 4XD5A 1J11A 3DIPA 1G67A 4LU0A 1JZ3A 4S3EA 4X2PA 4KS0A 3NQAA 4Z42C 4O0ZA 1SPQA 1F6KA 3EGJA 2EEXA 3WH8A 1L6WA 5AYYA 1FDZA 4JEJA 3EXSA 4HCHA 3P2VA 4G1NA 1DQXA 4QM1A 2I14A 1BYBA 4D2JA 2EGZA 3PG8A 3RRAA 2VVSA 5KZMA 3ABOA 3F5LA 4HYVA 3W9ZA 6A3HA 1SW0A 1U5VA 1WKEA 1BTMA 3AHVA 4XIMA 1S5WA 3BK0A 1J5TA 5XIMA 1Q8JA 4D6HA 3NZRA 4MB4A 4JN6A 1XUUA 5I3JA 2EG7A 2OB3A 4G9PA 1W8SA 4I8YA 3T42A 2WLZA 1JCLA 3KTXA 3XIMA 5I07A 1K77A 3KBWA 3WLOA 2NUWA 3H70A 1WZAA 1DJXA 1G1YA 3LLFA 5I09A 3QH2A 3FVMA 2ZQ0A 2TRSA 3BO9A 3BMXA 3MWAA 3MMTA 1GT8A 1KCXA 2Q3OA 2QDDA 3SIZA 4FOJA 3ZT7A 3HPSA 4Z2GA 2QCLA 1XV8A 4C1LA 4C5YA 3N15A 2QYGA 4D6JA 4LB3A 4IL0A 4XD6A 3RUBL 1F6YA 4JBRA 2ODOA 1PKMA 3SCVA 3KOWA 1K9EA 2YKKA 2J27A 3VABA 4C6QA 3FOKA 9XIMA 3PBYA 1IEIA 4GG9A 3P81A 4FNPA 4L4PA 1BF2A 2PDNA 2WV8A 4YVXA 1V5XA 2Q3RA 2PLKA 4YJ5A 2QVNA 5T8GA 2E1WA 3M0IA 4YCPA 3Q94A 4DO6A 1EF3A 1IZJA 1MEIA 4M29A 4R53A 4PA8A 4V28A 5C9WA 1VYPX 1EH9A 2A1YA 3CT2A 3VTRA 1TZZA 5GJMA 4PB5A 3RU8X 2WHMA 5EY5A 2PWGA 3PHAA 1L6SA 1QMLA 3ZT6A 2JF7A 2AQOA 1FFRA 1XCFA 3M0ZA 3NZGA 2E40A 4YTRA 3BLDA 1QBAA 5HJYA 5BROA 4FLQA 5C6MA 5C9RA 1XKYA 3IIPA 4BHYA 2OWXA 2YPIA 2X1IA 1TTIA 4GCXA 4GI4A 2QIIA 4E2DA 4HYRA 3UNDA 3GBDA 1MUWA 5CSUA 1TPH1 2YCKX 3RITA 1TPEA 2ISFA 1OCQA 1ZBCA 1H50A 4X9SA 3TLQA 2D73A 1VKFA 1G5AA 1Q6OA 4PR4A 4A3RA 4H6EA 4MZ1A 1W9DM 4GY1A 1CNVA 3ABQA 3P62A 1GZGA 3WF1A 4QCEA 4HOWA 4ZTYA 4AF0B 4WJ8A 3QKZA 4D8AA 3G1XA 1HF6A 8CGTA 3A5FA 5GPRA 4B5VA 3A6OA 4HHMA 3M07A 4YTQA 3AWOA 6PTDA 2P50A 3HU7A 4ZFCA 2ISVA 4DLFA 3OLGA 3PFMA 3ICJA 4F48A 3FXGA 2QDEA 4LWWA 2CLLA 4AVNA 1TV3A 3CWNA 3WFZA 4JDBA 1YLVA 4H9XA 3U2EA 3T55A 1QFEA 1CXFA 3FGCA 4ZMGA 3ZSSA 1FVPA 3TDFA 5EJZB 4ZTXA 3RGTA 3DESA 5F2IA 1UKQA 2XIBA 3C0QA 1YDNA 2DZSA 1P4CA 4F2BA 3N34A 3DECA 3NVTA 1EIXA 2Y2WA 4X3ZA 1XYFA 1I2QA 3LK6A 4UTMA 1D8CA 3GZAA 5ABHA 1X8CA 2X41A 3DHPA 2Q09A 3CAWA 4B5NA 4P7OA 4ZOEA 5EGRA 4Q8OA 3S83A 2H9AB 4AX6A 3V5OA 1ZGDA 2HE8A 2FVMA 2QAFA 4FR6A 3OZOA 1AL8A 1IXPA 3FFSA 3URAA 2GVJA 3CWHA 2OQLA 2DSZA 4EF9A 5DMYA 4O19A 5E6YA 1UH4A 4GBDA 2DORA 1UR8A 3SI9A 3PVFA 5AKQA 4LF2A 1NFGA 1OHLA 4WF7A 5LIYX 4DHGA 4DZAA 5CH9A 1F07A 2C91A 3PTKA 3UR8A 3WFAA 1JPDX 2QJHA 2BLEA 4LYPA 3RU6A 3CZEA 3CHEA 5DXYA 1TRIA 2QQ6A 3N4EA 3BAXA 1ZS2A 4AH7A 3TVAA 4U2YA 3NUKA 2G8ZA 4LFYA 3L7RA 1UMLA 2FMNA 1HP5A 4EACA 1W54A 2HNEA 2DFAA 2QCHA 1X98A 3QF0A 1H7PA 4Z17A 3C0LA 4H19A 3B97A 3B9EA 1L2UA 1OD0A 1LWJA 2PRMA 3GVVA 2DT3A 4EPDC 2EPMX 4C6IA 4F79A 1G4PA 3K8KA 3CZJA 4HN4A 1XINA 6REQA 1R87A 4G7EB 1C9DA 3VFCA 3USZA 5K9DA 4IOTA 3IK4A 2BP1A 3STEA 4JYDA 4FAMA 9RUBA 3BLOA 1H7RA 3WLNA 4MWAE 3W2UA 3RLHA 4L56A 1EGZA 3FJLA 3UPBA 4C1NA 1Z3NA 2RDWA 1SO5A 1ALDA 4LEQA 3ZR4A 4S3KA 1BFNA 2OQHA 4UNLA 1E4IA 3GXNA 2FB2A 2ONEA 3OLIA 4DUWA 3IJ7A 3E0FA 3NR0A 2MANA 3LU2A 1VIWA 1IHIA 2NXIA 4CVUA 2G4JA 5BRQA 4DI8A 1M7JA 1UP3A 1YIXA 2XSAA 4QISA 4JKLA 1XS2A 4J7RA 5RUBA 2YL9A 3SY5A 1RR2A 2V9DA 1XGDA 2WJEA 1EC8A 3GH7A 1E40A 3IARA 3H54A 5IBXA 1PKNA 3GDBA 3H2MA 4MLJA 3U0HA 5DMMA 3GFZA 4CD5A 1W3TA 3T4CA 1J2WA 2VENA 2REQA 3LXAA 1UASA 3H8AA 4CD4A 1SR9A 2GSJA 4IPIA 5HUPA 4B91A 3ZLHA 3CQHA 3EZ4A 4BA0A 2I5GA 2QUNA 2Q71A 3VO0A 1Q7MA 4KRZA 1TX0A 4HA1A 4TOQA 3LRLA 5FIPA 1K8ZA 2P1FA 1MEHA 1TMHA 5T9BG 4DXVA 1ME8A 3ZS4A 3L2MA 3WNKA 3HMJG 1S39A 2PEVA 5C2CA 2Z29A 1GQJA 4AMAA 4J4KA 5KZ6A 2Y5SA 4P8UA 3IGXA 1NWUA 1JFXA 1HT6A 2V3FA 1SGJA 4FXSA 3W7KA 4A3QA 4WY0B 3APTA 2BY0A 4KWWA 1QWGA 2Z1VA 4AB4A 4JX4A 5C9UA 2AKZA 2F2HA 2J79A 3MI2A 1EC7A 1LOQA 4QBXA 2WANA 4FZIA 4WEVX 1A4LA 5ECUA 3A22A 2FZBA 4M19A 5GNYA 3LBCA 3KRZA 1V0MA 3VAVA 2QCMA 3BAIA 3CMGA 4C65A 7PTDA 3CNYA 1BQGA 2V81A 1KGUA 3VCCA 3CQIA 2EAWA 4V1YA 1TIMA 3N3MA 1PYFA 2DSWA 3OW1A 1JCXA 3UFYA 2FLIA 4FI4A 1MFVA 5DT7A 4HIBA 1SZFA 4PUKA 2AGTA 3PTQA 1FTXA 3MHGA 3V1PA 3M7SA 4IPPA 2CZVA 3LM3A 1OFPA 4IXXA 1IZCA 1S3TC 3DAQA 5CG0A 4LALA 2QJJA 4HTYA 1OYAA 3EPNA 1RBOB 4GVHA 4L1WA 3CHFA 3WUEA 4OECA 4AUBA 5CC5A 4U4MA 5EPDA 4QQ3A 1W1PA 3MUZ1 4A35A 1FA2A 4QSFA 1S1PA 5L9FA 3EKLA 3M44A 1NWTA 2ZUVA 3W2LA 4WGXA 4PGLA 5LNVA 4TVDA 5I7GA 4UQ9A 2NWSA 4XKYA 1XG4A 4DXXA 2PZNA 2ASHA 4K37A 4IFRA 2IS7A 5CLTA 4H01A 2EPHA 4I5RA 3TMQA 4UIOA 1H3GA 2CZFA 1W31A 3VMNA 5MKGA 1KRBC 3R8HA 3WNPA 1S2CA 4AWTA 5HOSA 1FP9A 3EA2A 4JDYA 1FWIC 5EMKA 3A24A 2QT3A 3KCJA 4H9MA 3RLVA 2Y70A 3OQEA 1KLYA 1HG3A 3UYIA 1XISA 1YBQB 5HJXA 3KL0A 3EWCA 4DUVA 5D02A 4GJJA 1CW2A 1S2UA 4AY1A 1TZ7A 4JQ1A 2OELA 1BGAA 4B5WA 2OJPA 3FSUA 1EOMA 5ABTA 4OJYA 3UJFA 1LLWA 2ALRA 5I3IA 2XFRA 2CFFA 3AMCA 1F76A 3U2OA 3WK3A 3STPA 2DU2A 4N4QA 3SM0A 3BLEA 1F3TA 1ZAIA 4GLEA 5FL0A 1NEYA 2OYLA 2WMGA 5FF4A 1W3LA 2XGZA 4Y9PA 3CUJA 3N9KA 1OJXA 2GGIA 5DCEA 4AVOA 1A5NC 3WJZA 1TIWA 5DY2A 1KR0A 1TFVA 3DG3A 1RQBA 4UNIA 1S2VA 1LJYA 3AJ7A 4EIVA 4RCXA 3IVSA 4PULA 1TVLA 1EQPA 5CPLA 1UKOA 4MNJA 2FHBA 3E0IA 2ZRYA 1XF0A 4P8VA 3W7HA 1C90A 2DVUA 4NJKA 1UOKA 3VXGA 1P1MA 2VFGA 4C7DA 4PUEA 2CETA 1O94A 1IWBA 3FHQA 2POZA 1E71M 4YXGA 4BWLA 4A8RA 1EGMA 3VU2A 1D3CA 4MY1A 2XVNA 1GORA 3UT0A 2PDYA 1OIFA 4KEVA 3LSCA 4M6QA 3MCOA 4GABA 2BB0A 4J3ZA 2QV4A 3VKAA 1U5HA 3LPOA 2HE5A 3U4AA 1JCYA 3PUOA 3SURA 1EJVC 3RF9A 1I60A 1R3YA 1O5RA 3MMWA 3UXAA 3W84A 7REQB 3W7DA 4UUIA 4DYJA 5T9CE 3E74A 5MF5A 3LLDA 3G3DA 4PMNA 2X0YA 1AZ1A 5E9XA 4QTGA 4RNHA 4W86A 1GOKA 5CJ5A 1W9XA 4HPHA 2PSNA 2Z1BA 3V3WA 2CIPA 4FXFA 3QGVA 2GWGA 4JL1A 4WJEA 3U48A 3LNPA 1HJVA 2WMJA 3T78A 2POTA 1FWWA 2QKFA 1XD1A 4MKSA 3MPGA 3W6LA 1XJBA 3OBEA 1RP9A 2JKEA 1DV7A 1HJUA 4NJGA 2RDTA 1XLAA 1DJYA 1NM9A 1QI4A 3OBAA 2A3EA 4QSHA 3WEOA 1EPXA 4KWSA 3FKKA 1F7BA 5CC3A 2D2JA 3VIOA 4X22A 3K2GA 3V75A 3TTYA 4TX8A 6TIMA 1EJSC 2WC3A 3EDKA 2YDQA 2KX9A 4MPKA 1XSJA 1M3UA 3W1TA 2ZXDA 2Z2UA 3LMZA 2YFNA 3QW3A 3AIBA 4ZR8A 5AC5A 1W1B1 1WXZA 5LGXA 1BXBA 3PJTA 1TKKA 1DP0A 2XPKA 1SO6A 2GK1A 1US0A 4I7UA 1M04A 2WCGA 2BVDA 2C8NA 4GH1A 5JU6A 3THAA 1XIMA 2WNQA 1A5LC 5JBFA 3IRDA 3QQWA 4PMQA 1G6CA 2XVPA 3MSRA 4NG3A 2QCFA 5EA9A 3VM7A 3N9SA 4DO5A 3HFTA 2NVDA 3KM8A 2QCDB 3STGA 2XH7A 2HVNA 1F2JA 4JTQA 2V3DA 3S9ZA 1EYWA 3ARTA 2D20A 2PS2A 3A13A 1G7UA 3LSBA 3THCA 4ES4A 1G9HA 2VFHA 5D9MA 3UR2A 2VEFA 1Z6KA 3V7PA 2JK2A 1R9YA 1XBVA 1W5MA 4HD5A 2OSWA 1L0PA 1SW7A 1AQHA 3O63A 1UR4A 3WQ4A 4J2MA 3T40A 3B40A 1S46A 2NX3A 4DX3A 4FP1A 3AICA 1VH7A 3GHUA 4KRUA 3WFLA 1UP2A 3G0UA 4M7SA 2OODA 4EPKA 5DT5A 4HOZA 1MQQA 1RV8A 5HINA 3P5YA 2FZ8A 4ROPA 1WOAA 2P0IA 4X63A 4D6IA 1W1VA 3NQ2A 3GNPA 2V2CA 3AU6A 1DXFA 4ROQA 5FKYA 4MKVA 4LRTA 4AD3A 3FV9A 4HNTA 4HSHA 1RCOB 5A6AA 2YSWA 4AC7C 2R1NA 4ERAA 3BOFA 4MMWA 3R58A 1YTKA 3C2YA 4ADTA 4HU8A 5A6BA 4KEUA 4HMDA 4JTSA 3ATZA 4QJ3B 3GFXA 3P8JA 4HGXA 4H3DA 4JTLA 2VRJA 1ZTVA 4JQ2A 3TEVA 5AYBA 2HXTA 1R2SA 3ZM8A 3QSRA 3N19B 1XFCA 3DI1A 3WX7A 1E9IA 1VJZA 5GQBA 1NIUA 4CU8A 1W3KA 4RW5A 1YX1A 3DU0A 1QOPA 5E0KA 2FH8A 1QNPA 1T0OA 3KDNA 4GO9A 3N14A 3UYCA 1E9YB 2Y7GA 1AD4A 5EMMA 3A3WA 3DKLA 3QHNA 4NUWA 4K8EA 1IGWA 3SN0A 3RX3A 3UWEA 1OFEA 3AFBA 3T7VA 4O14A 3NCOA 2F6XA 3Q2DA 2ZRVA 3FCPA 1A5MC 2VRKA 4EE9A 3NQDA 2XSBA 2G5WA 2WYSA 3BH4A 3BUVA 4R85A 2BZNA 3ARXA 1JPIA 3P8IA 3DERA 4U2ZA 2WHKA 2H8ZA 5F2MA 3QSTA 1IXOA 3L5LA 1JULA 2FPYA 3WF2A 3S9IA 5FEZA 5BXRA 4AZBA 4K7YA 5C70A 4UTKA 3H2EA 1G01A 3G6MA 3W53A 1Z44A 2P10A 3RXZA 4C6BA 4LV4A 1UMYA 1OF8A 5K9CA 5I03A 2CYGA 1LTDA 5F2LA 1OEPA 2XN1A 4BJHA 3VC6A 3WK2A 1W32A 1E4MM 2ADAA 3E5PA 2IPWA 1MRAA 2J7GA 3BW4A 4N6EA 1L6YA 3CUGA 1QI2A 1NDZA 4E4FA 3UP8A 3TW7A 3RK8A 3TYBA 2PP0A 1NDVA 2Q02A 2ALDA 3BAKA 1Q66A 4A4AA 1US2A 1NOFA 4NXKA 2JEQA 1H11A 2Z7GA 4AD0A 2FZ9A 1U1JA 4E6MA 2DW6A 1KM0A 3RX2A 4OHQA 4JIEA 5FEXA 4QJ5B 2VR5A 4GFIA 4PSPA 1J0HA 4UR8A 4HU3A 2PLJA 4LF1A 1PKLA 4LAOA 2EPKX 4AF0A 1B3XA 3VZZA 4MB3A 3AYRA 1C7TA 3DHFA 4OV4A 3IS4A 2VWTA 1RVGA 2OT1A 2VELA 3MCMA 1CT5A 1KCKA 4NSBA 4L4LA 2Z25A 3GUWA 1TMQA 1A5KC 2IKIA 3WH9A 2PDFA 3MDWA 4MJMA 1W1ZA 1TTPA 3T9PA 1SFSA 3GSMA 1UQZA 3GXDA 1BGGA 3DYMA 3PWAA 2YR1A 1PX4A 4Q22A 1EZWA 2QNEA 2VHLA 4LW7A 4DELA 1SZNA 2P88A 2EQDA 3ES8A 1NVMA 5G2HA 4REQA 3NURA 5HMSA 3WQPA 4TUFA 1UKTA 3VGBA 3WY1A 1LT8A 2WPGA 2J7DA 1TV5A 2BG5A 4B16A 1DTNA 3ZVHB 2PWHA 1UWSA 3CB8A 1WX0A 4IP4A 2PLMA 3BARA 3VVGA 1LG1A 1JZ5A 3QY7A 1AA1B 3KP1A 3VZYA 3FA5A 2ZBTA 3OZPA 4G2DA 2LLEA 2FB3A 3AISA 3AS1A 3WNLA 4NAEA 4LAKA 3S46A 2PGWA 2QMKA 3R89A 1PPIA 4O53A 3G0XA 5EL1A 1JF6A 3FK4A 3S9YA 4GWEA 4ILSA 4NRSA 4WCJA 3BAWA 3EX6A 4B5TA 4NZJA 1UA7A 2DT2A 1OFRA 3G1VA 2A6NA 1RCQA 1SMDA 1XIGA 3CUFA 4N42A 1PZ2A 3R0UA 3D5HA 3CUIA 4IG2A 3WKZA 2I17A 1IF2A 2WZIA 3VDHA 5C9XA 4S3DA 1JYVA 3KWXA 4AMCA 1X7IA 3RFAA 4ZQOA 3H55A 2R1PA 3PAOA 3CTTA 1XCXA 3VGDA 1VFTA 1HKKA 1MNSA 1AQFA 1TPDA 5CQ1A 2QPSA 2OWCA 1L2QA 5BOFA 1LQ0A 3BURA 1R0MA 2C1GA 5CC7A 3UGRA 1OT2A 2HQAA 5MHBA 3GZ3A 1XWYA 4ALDA 3R79A 5J5DA 1E70M 3GH4A 2FTPA 5DCDA 1ZFJA 3APYA 4HP5A 2WVVA 2D0HA 3KVJA 5I2UA 2VD9A 4A8IA 3APGA 3MO4A 4G6CA 4WVXA 1AQ0A 4QXIA 2CLHA 4POCA 4L1XA 5CZ0A 4HB7A 4KWVA 2PE4A 4YN5A 3WSUA 1QATA 3IK2A 4BQ3A 2X1SA 2OGJA 1N8WA 3M0LA 3C61A 4C6CA 2VX7A 1KM3A 3W71A 1GEQA 1JZ4A 3A5VA 3GIYA 1SYTA 4Q4PA 1C9WA 4ICCX 4DJEC 3ARQA 1NOWA 2QDHA 4PMOA 5D37A 4O4VA 1R5YA 4GO8A 1TV7A 1M1BA 2W79A 1XPGA 4TX9A 1XM3A 1OM0A 3FEMA 5H8MA 1P7TB 4D6GA 1FFQA 3A4JA 4F0SA 4ACYA 2A2IA 3QPYA 3GW0A 4H8UA 3UXKA 3B3DA 3W7NA 2WJDA 3TN3A 3REQB 1GKQA 3W75A 1W5OA 1EJ7L 2OSXA 3BGGA 1HGWA 4ZENA 3K4WA 3CV7A 3ZIZA 1E1EA 2GJRA 1U1UA 4JIPA 2JGYA 4GXWA 1UZ4A 1S2WA 4MYAA 4A8NA 5M2FX 1RALA 1GTHA 1ZUAX 3ZWSA 1A0CA 4KT2A 1ISVA 5KMYA 3NSNA 2ISWA 2W3ZA 1B4EA 3ZXWA 5AB3A 4GK8A 3M0JA 2B7QA 1JQVA 1R8LA 4PMDA 3SFWA 4LPCA 3UY8A 2DUXA 4Z2KA 1FX6A 1XRVA 2J74A 4ORIA 4WK9A 1XIFA 4L4MA 4MJ2A 3OGSA 4V33A 5D38A 1BKSA 2FPVA 4C6KA 4QS5A 3NWRA 5HAOA 3U2ZA 1SMAA 4O0KA 3E9AA 3KLKA 1MDLA 5D9NA 3ELFA 1AFSA 2NLIA 4WOQA 2WKJA 1Q3NA 2VR4A 3TYUA 3AXMA 2DDXA 4NYYA 3TNOA 2Y61A 2VGFA 3TQVA 4WY0A 4IMFA 2UY4A 1Q6LA 2ZIDA 4QG8A 3S5NA 4B90A 2CITA 1QOXA 2XG9A 3B4UA 1FDJA 3CL6A 3GYEA 3GR4A 2BS9A 3O6DA 4DO4A 4AW7A 1I4NA 1ZENA 2G4FA 2WMFA 3BZGA 4HSOA 2P3EA 3ORWA 1JIBA 2WNWA 4GX8A 1F6PA 3JW7A 4XX6A 2SFPA 1MXGA 5A6JA 1C7SA 2DQXA 2CERA 4IPLA 3LPGA 1XIIA 4YHGA 2E28A 3KVMA 3QM3A 2X7WA 1SZGA 3SRHA 4NU7A 4Z1BA 3AMLA 2ZE3A 2J6XA 1POKA 4CU7A 3BV4A 3TSMA 4UFLA 2X7VA 1FCBA 5FEWA 2B7NA 1J93A 2NT0A 3L0NA 4CCEA 3NQEA 1JR1A 4S3JA 1BQCA 3ARWA 2C3ZA 1AZ2A 1BVZA 2OTDA 4ZA0A 2ZUTA 3BICA 1V6TA 4IICA 5E6ZA 3A47A 4JHMA 1SJDA 1YEYA 1WV2A 3GKAA 1HKWA 1QPNA 3I6RA 3TN4A 1D8WA 3PTMA 2QCEA 2XJ7A 4PUNA 4AZCA 3EDFA 5HNUA 1LDCA 1RVKA 1A49A 3QMRA 4RPPA 3GHSA 3DGBA 3WLKX 2Y62A 2AMXA 3LA4A 4YWIA 2XIJA 5AC6A 1NOUA 3NM3A 4L7ZA 4NKCA 3OA3A 5FCZA 3RLGA 4B92A 1AJ0A 5CJMA 3MY9A 3MUIA 4WGHA 4IMEA 2BASA 2PF0A 2YJQA 2PCEA 3BSHA 4W9TA 3W2JA 5BXTA 2J88A 3O8AA 3VOGA 1R46A 1KXVA 2VNCA 5G2WA 4HMNA 4HK7A 1FWTA 3Q58A 1UR1A 3GXFA 5D9PA 2VD8A 3C0JA 1KR1A 1XLCA 4CQAA 4CQBA 1H7OA 4Q8MA 1K4HA 4RDYA 1E1CB 3WO8A 2DVXA 4E8GA 1PEZA 1RK6A 3PB2A 1FWBC 4EP8C 2DGAA 1KV5A 1VFLA 3CS2A 4M8UA 3E2RA 2FJUB 1Q63A 2G96A 2VX4A 3CZ8A 3TLLA 3ITVA 1U22A 2NLYA 3MSGA 4HZ8A 3N2MA 4LVBA 2J62A 1GW9A 4Y96A 1VHNA 2HBXA 4LCSA 3CUXA 1TPWA 3SGUA 4PMVA 4DYKA 4CNOA 4CCDA 4MY8A 1H41A 1SSGA 2VEMA 5AOUA 2W9MA 3ARYA 1DWJM 3KRUA 1EHAA 3PZTA 4HPXA 1O68A 3N12A 2O9PA 3Q45A 1E0TA 4IT1A 2VXNA 2DIJA 2PMQA 3EWYA 1QI3A 4M3PA 1OCNA 1DIKA 2GJLA 2TMDA 2AGKA 2ZVIA 3T8QA 1AVAA 3VD4A 1TJ0A 4GUIA 2B4GA 3EOEA 1V3JA 8TIMA 2YCLA 1U5JA 4DRSA 1Y5XA 1J0JA 3MBFA 2WMIA 1Y7VA 1XYMA 1ME7A 2Z2BA 3SZ8A 1LOSA 2PU1A 1GOOA 5HNNA 1KC7A 3NDYA 3AOFA 4E3VA 1XI3A 4JTFA 4UQCA 3DUGA 3LHVA 4PB3A 2BVWA 1S5TA 2WJZA 4XZMX 3C4UA 4ATWA 2PBGA 3OLEA 1O7AA 2C19A 4Y8FA 3NL5A 3IVUA 3AC0A 2R82A 1HGYA 4WDWA 4GE8A 4E5TA 4HNVA 1YPXA 5DF0A 3B8SA 4QDPA 3XINA 4O13A 5HQMA 4K1WA 1UWIA 1JRBA 2OXNA 4YL2A 2GGJA 4W5UA 3NIYA 3MKVA 2IPJA 1S2TA 1LBLA 4PCTA 4B2DA 1ZZMA 4LYKA 1WAWA 1VZWA 1Z41A 1CCWB 5FL1A 3MP4A 4RNFA 3TU9A 4LUSA 3WQEA 4Q4SA 2E5CA 5C0QA 4W93A 3AS0A 2HCVA 3O0KA 2QPUA 4MDOA 2PGRA 3P60A 3PY2A 2R91A 2EXOA 3LGEA 3A4XA 1YDYA 4R7WA 4HU4A 3WBXA 1E6NA 3EEZA 5AC4A 4HNNA 2XN2A 3M5ZA 3NOYA 5FF7A 4UOZA 1VJIA 3P67A 4DBSA 1H1NA 1UD2A 4D72A 1V6XA 2WQPA 1XLGA 1JG9A 4Q33A 3PPGA 3VNYA 1K3UA 4QCFA 4JTEA 3QPEA 1FY6A 5HWJA 5BU6A 1YMYA 3DFOA 3AUJA 3KOYA 3ZJKA 3D47A 4ACZA 3MQTA 1DQWA 4H2HA 3UA4A 4GKLA 3PB0A 5CSSA 3BCDA 3EX3A 1Q6EA 2EKGA 4C60A 2D3LA 4Q8NA 3WDRA 1WKYA 3NQ8A 3WL0A 3AYVA 3QYSA 3AIVA 1K8XA 3UGVA 3QLLA 4JTGA 3P82A 3GDKA 3PF3A 5HPOA 4JS3A 4AHPA 2VEKA 1T41A 3H4GA 3TJXA 3DBNA 4MWAC 1V0KA 4QDWA 3V35A 2TYSA 3VIJA 3CO8A 4Q8TA 3CJPA 1R30A 5FAJA 4PMZA 4YU1A 1KM2A 2W63A 3GTNA 2VCCA 5F2GA 1HIZA 4GACA 1M9HA 2QUUA 1VEOA 4KMQA 3UG8A 1PJ9A 3RAOA 3T44A 2BBFA 4M80A 4TU1A 1X7FA 3GG7A 5E0FA 1K9FA 2O9OA 2ACQA 3DENA 5DMNA 1E0XA 2YBTA 1ZY9A 2GWNA 2F8QA 3CBWA 4TMCA 5EYWA 4CNNA 3A64A 3OIHA 3ZZ1A 2V0TA 2WSKA 2BHUA 3R13A 3K1DA 4N9CA 3MUAA 4J1OA 1B30A 1UBSA 4GNVA 1QVBA 1ZAHA 4PYSA 4GVFA 1BPLB 2OVLA 8XIAA 3GXPA 4DF2A 1FKWA 4YYCA 3C2OA 1NP0A 2ZYFA 4AISA 5JH2A 3PJWA 2DUZA 3R12A 8A3HA 2DH2A 4H6RA 2CZ5A 2GUBA 1PIIA 3QOKA 4W7UA 3NDOA 4PMUA 3W7GA 4NZ4A 4HVXA 4Q8QA 1H62A 1JGMA 3C3NA 3DFQA 3P74A 4NZ5A 2VX6A 2JEPA 4MLRA 3MUY1 3VFLA 1FP8A 3MUCA 4C6JA 1JGIA 1C29A 2V30A 4R27A 3F5JA 2IQ0A 2YA2A 1W37A 2E9MA 3F03K 1L8NA 3QMSA 3FGCB 5CZTA 4U3AA 5AC8A 3S1WA 1XYCA 1AODA 3UZXA 4FF5A 5I02A 3T08A 3KBSA 3WLMA 3HPFA 3H2AA 4AEEA 4MUPA 3M43A 3V18A 3R11A 2YL8A 5AYXA 4HHLA 1RUSA 4K39A 2WKLA 1KLZA 4GQRA 4MSSA 4A2RA 3TC6A 3EKZA 3IIVA 3TTOA 2G3FA 1X6LA 3SIMA 1BWKA 2CLOA 3DYPA 2OR2A 3PBGA 1LUCA 1XBZA 5HBFA 6XIMA 3T1GA 5FJUA 4US6A 2Y89A 4L64A 4UFMA 1B3VA 1R3WA 1LCOA 3BXWA 1RJQA 1KFKA 3FLUA 1JXKA 4MZYA 4DJED 5E93A 4O10A 5HMDA 4KQNA 1AL7A 4H7VA 5G1TA 3LPPA 1A4MA 1JAKA 3F4CA 3AU2A 4CQDA 2ZA3A 3G1FA 4UTFA 4XBSA 2HV5A 4I90A 4LC6A 5M5DA 3CUHA 3NQ7A 4DB7A 6TAAA 3E96A 3WLHA 1ZBKA 4AYGA 3RO8A 3B0UX 3ZFHA 1CX9A 2CHNA 4WUIA 2VGGA 5CPMA 4Z08A 1MQPA 2X2YA 1FXQA 3KBNA 2VP8A 4FA3A 1DIEA 2QCGA 2CC0A 3ALGA 4KFOA 3PZ9A 3WUGA 4LEFA 3MS8A 3H4XA 4HPJA 1IZKA 1ODUA 1ONWA 2GZXA 5LA2A 2OMAA 4F8XA 1ZL1A 2ZX9A 3A4WA 1Z42A 2WM1A 3NOEA 4E3TA 1TA3B 1XCWA 1DHKA 1J4EA 4W87A 2BGSA 2E5DA 1Q85A 3UJRA 5A6LA 4MJZA 3HQ1A 3NQGA 1EEPA 1F5ZA 1KWKA 3RG6A 1SZEA 6REQB 1H61A 2QLYA 5AHIA 1I2OA 3EMCA 4OVXA 4LYRA 1RD5A 4UQEA 3MVTA 4GQQA 1QWKA 3WBAA 1XC4A 2VURA 1H1ZA 3TN5A 1F4HA 2BVYA 2PTYA 4K8GA 2KAUC 4O54A 1RK5A 1CYGA 4LOCA 5AECA 1M6JA 4LH8A 4C1NB 2GVLA 4JY9A 2PWFA 3S1VA 1RBAA 2ESCA 5GJNA 3S2JA 3S5ZA 4FNSA 3WMLA 3L12A 1B2YA 5I79A 3GHRA 4OKDA 1QBBA 2GQ8A 1OADA 3GNOA 5D2VA 2O0TA 3AIWA 3N29A 5D8WA 2YCEA 3DOPA 1YXCA 4J28A 4P5UA 1D9EA 4I9AA 3TSBA 1E72M 1V93A 2ON3A 2OX1A 4BQ2A 5CAHA 2YL5A 1IEWA 3L4YA 1YADA 1WA3A 5DBTA 3PZIA 4LY4A 5BMWA 3MBDA 3ABXA 3G5EA 2GL5A 4PCNA 4H00A 5A5WA 4K1GA 4AD5A 3SUWA 3M6DA 2XIOA 2JQXA 3IAPA 4L1GA 1ZPTA 3RYSA 2NUYA 4AD1A 2DZWA 1GPWA 2ZUUA 5C7VA 4R9XA 4HPNA 5A95A 1A5AA 2WHLA 3GU2A 4Z0SA 4HOXA 1X8FA 3W02A 3WUFA 5LA1A 1N2VA 1R9XA 1XBYA 3I3BA 4UCFA 4X9YA 1X96A 3JRKA 1OABA 2HTMA 4PH6A 1TWIA 4KH2A 4CN1A 4JPGA 1ISYA 4XAFA 1PZ1A 3BW3A 4WRHA 5JIPA 3MMUA 3W29A 2A7PA 2J7BA 3UW6A 1DXIA 2BGQA 2PD5A 2QAPA 4GINA 5DCBA 4TXEA 3TR2A 4IFKA 2Y8UA 3UWYA 2ZUNA 1HQTA 1FWSA 1XPYA 3RCYA 3ERPA 3IIZA 3HTWA 3Q4DA 5D05A 4RE3A 3R7MA 2E9LA 3MHUA 4Y9OA 3WLTA 4H6QA 3C8NA 2HDJA 1GQNA 2PUZA 4JHZA 4A3YA 4DJDC 4PC8A 1OG0A 2G3MA 1LWIA 3DC8A 1FXPA 4IMCA 5DEZA 3K4DA 1XIJA 1KCLA 4G7FA 3UNTA 3LPFA 2XFYA 3PPFA 4V27A 2DQWA 2I16A 3CZGA 4XSLA 3BG5A 4FF7A 1DWAM 1W0MA 3WBWA 4P00B 1OFAA 2HXUA 1K7EA 1T5AA 1VCGA 1TJRA 1A5SA 3UCQA 4I5XA 3NSXA 2OO6A 1QW9A 5K3VA 4WXZA 4AZ7A 2W67A 3W4RA 2PDWA 2PDPA 4AD2A 4R3UA 3W28A 2GJPA 1PCKA 2XH0A 1FWGC 4N9BA 4MYXA 5EMJA 3PJUA 1M5WA 4AY7A 4L65A 1BVNP 3E0LA 1Z89A 3I3EA 1CTNA 3BJTA 3GX9A 3GNDA 1GYLA 3C52A 3OEXA 4EOUA 2I9UA 3SUTA 1GG0A 3SFKA 4Z2HA 3K5XA 2R1KA 2DSKA 3OLDA 4XKYB 2PC4A 2VOMA 2WMKA 5J5RA 4I7WA 3WQGA 1JEZA 4BS0A 1GUVA 1QPQA 3LCGA 1YPIA 3GLCA 2YFOA 3CAQA 1JCMP 4IJRA 4C5ZA 3EX1A 3ITCA 1UC4A 5MKGB 2ZRZA 3MKCA 5AVNA 4RL3A 1M7OA 4XUGA 3VDCA 3W26A 8XIMA 4TR9A 3W2NA 3G1SA 4FXRA 2XSXA 5A1AA 1QHZA 4CCCA 4QG9A 4Q4QA 5D32A 4U28A 4C91A 5BZAA 3VNIA 1XIDA 1XRFA 1B3WA 1J9YA 2YW4A 4AWUA 2ABBA 4URIA 5AHMA 1C92A 1KQYA 5IDIA 1DHPA 4I9TA 3WG6A 3HOJA 3BSMA 4MUZA 2ZX8A 4O1EA 2GPTA 3N13A 2CLIA 3W3OA 4IIEA 1VEMA 1ADSA 2P8CA 4M0XA 2ATSA 1CLXA 3VCRA 1W9PA 4DJEA 1C3FA 4P7NA 1XQKA 1E4NA 1VBGA 3LUTA 4O28A 2PDQA 5H8UA 4KWUA 4E8CA 3W25A 4CU6A 3B8UA 4JNZA 5BOEA 3KP0A 5ENLA 3WBEA 1CGWA 4AU0A 3MDUA 3GDMA 4MB1A 4B3KA 4WKAA 3DHUA 4ENLA 2MUCA 4G5DA 4TVCA 4IIGA 1CEOA 5LHEA 5K4XA 2FZMA 1R9ZA 1ISWA 1R7OA 3GFYA 3C6CA 3GY1A 4D6FA 2ZWZA 4AFYA 2E7FA 3TJ4A 3R43A 3QV8A 2BHZA 3NJ3A 1R3QA 4YNGA 1NF7A 3PR2A 3TA6A 3T0AA 2FTWA 2ZRUA 3WIJA 1OGSA 1EOKA 4RE0A 2CHRA 2VMFA 4XD3A 4GUHA 3IRSA 3O7UA 4R9OA 3UZJA 1G0CA 1VC4A 2VDHA 1PIGA 3F4WA 3KVLA 2NVAA 4HN8A 4UTJA 3INPA 1J6PA 3EAUA 5DLCA 1U2YA 3GR8A 2PWUA 2X05A 3UWWA 3UESA 4D6CA 2EPOA 4C6FA 3AZTA 3UXLA 2OOGA 3LB0A 3CO4A 3AHTA 4MWAD 5TD4A 3LEPA 3BMWA 4HJWA 4FALA 3ATYA 3QY6A 1O5KA 4AZ5A 1V3IA 3O6CA 4RXFA 1ADOA 4HZ6A 1PSCA 3R94A 1EJTC 1J0KA 4AZHA 1QHPA 4F40A 1GVSA 2QS8A 2UBPC 1JD9A 4JFVA 1RA0A 3WLRA 5TIMA 2P3ZA 4GYFA 1GG1A 4FHAA 2H6RA 1V08A 3L65A 1DL3A 1JXJA 5KSWA 4DIAA 3W2MA 1MQRA 4FX6M 3NVDA 3OU8A 4UOQA 3NA8A 1NARA 4CEXC 2A21A 4GNKB 1KTBA 1XP3A 1PYMA 4PEKA 2CBVA 2NQJA 2VDIA 2PRHA 1QO5A 4LUYA 2GK1B 1B9BA 2VTFA 1QK2A 3I3DA 1KFWA 3I7RA 3T2PA 3PNZA 2EPLX 3QQ1A 5LGZA 1GK8A 3IACA 4HA0A 1E6SM 1H5YA 3W23A 3B0PA 4V2XA 3WK1A 4U5KA 4ERGA 4JY8A 4XZBA 1J12A 2EBNA 7A3HA 1FCVA 2X16A 5BRPA 4D1IA 3UBPC 1EXPA 2J6VA 4RNIA 3QHOA 1FCUA 1XICA 1J01A 1EHNA 5F4WA 3D6NA 2F2KA 2XN0A 3SECA 5CSYA 2WO5A 5LYRA 3L68A 1BYCA 1NFBA 3I4EA 3OBKA 2V82A 4UTIA 1DXEA 2BXVA 3WZ0E 4D71A 1JDCA 3PZGA 3S4TA 3VYLA 1EJRC 5LNRA 5CZSA 1FDYA 3R8GA 1V3LA 4L9ZA 4OUIA 2E9BA 5HPCA 3ANYA 3AQUA 4E2BA 3RR4A 4IFOA 4FNQA 1TX2A 3CV6A 3WMCA 1V7YA 5KINA 3F2BA 4OGZA 2D2HA 4L6OA 3B8WA 5J8LA 3DZ1A 1RPKA 1VCVA 3KOFA 5C7HA 4PBFA 4WLCA 4INFA 3ENLA 1CXEA 1TUFA 3W07A 1XH0A 3UZ5A 3U2CA 5JXQA 1RP8A 3WJWA 1QXLA 1YXYA 5D2TA 1ZNNA 1RQHA 1JRCA 3MSYA 1O5QA 3VGEA 4LUTA 3QOMA 1L6FA 3ABSA 3LY0A 3N2OA 2VUYA 1R6WA 2WZMA 3LHYA 4GQGA 3BQ5A 3ARVA 3HJEA 4WKHA 3NQCA 1V79A 2QR6A 4HKPA 2YYUA 3GRIA 3EPMA 3B04A 1DJGA 2YBUA 4K6AA 5LKYA 1XSKA 3OVQA 4BF5A 3SCSA 4O17A 4Q7NA 4WHBA 4NZCA 1O6IA 3QVQA 4JFSA 5LIWX 5DELA 2QPXA 4HPGA 4DBDA 3M41A 3AALA 2HPIA 3L66A 5D03A 3OYZA 5HATA 1K8CA 3B8VA 3OO2A 1W56A 1H4PA 2DY3A 1E1FA 3UCCA 3PPCA 3TAOA 4Q7BA 1MVYA 4HA3A 5CGTA 3F7JA 2GLKA 4C1KA 4F3HA 3QC3A 2WC7A 4ZQRA 2EHHA 2GQAA 2XINA 4J3VA 2O55A 2PFHA 4AZGA 4YVVA 4JCLA 5DRCA 3UJ2A 2FGBA 1ENUA 4B5UA 4A2SA 4EAMA 1JDEA 2YXOA 2HVOA 2QZRA 1KV8A 2XH2A 3V16A 3QLDA 4Q7IA 2J8TA 5KETA 1UR2A 4GYPC 3GC2A 1ZLPA 4NZ1A 4AG0A 3TZFA 2XISA 3WQWA 2IQDA 1BG4A 3TQKA 1IWPA 3GNXA 1RPXA 2YLAA 1EPVA 3LG3A 4IPNB 4MM1A 1EDGA 4HJFA 3EB3A 1W5NA 1UH3A 2ZTJA 2C15A 3R25A 1IV8A 3DX5A 3KUMA 1O66A 4BCEA 2R1MA 2VX5A 4QE5A 4GGHA 5TAOA 1VGAA 3W7MA 1E3XA 1IGSA 1PKYA 2JALA 1GONA 1KKOA 1S5NA 3GDRA 3IGUA 1K7XA 5HJLA 1XLBA 3WQCA 3N2XA 3CMJA 5I5RA 2X42A 1HNYA 3ZVIA 5D04C 1QPKA 5D4YA 2XIIA 1JVNA 1F8IA 4F0LA 4MAZA 2VRQA 4F66A 1P43A 2WBKA 1VS1A 5AYIA 5F7UA 1K7FA 3S5SA 3VIHA 2Y0FA 3M0YA 2EKCA 4KFNA 5A8PA 3AHYA 1TWWA 4GUGA 1UB3A 3LDVA 3WEMA 3BOXA 4GBUA 4D6EA 4HZ7A 4KW2A 2IKGA 3RHGA 2D69A 2OYKA 3C8FA 3BLKA 3BLPX 3UD6A 3T2OA 3CWOX 1U33A 3H7VA 1JYXA 2ZC1A 5EMYA 1UCWA 5AYZA 3K13A 3L4XA 4PMJA 1RHCA 3GD6A 1KBJA 4NZ3A 4GI6A 4LTSA 4XSMA 3VX1A 3VD9A 3ECQA 3S2NA 1SFTA 1UD3A 1W91A 2F7FA 4O1CA 4REQB 3GXIA 3NO3A 3DH7A 1Q2RA 4DBEA 5BU9A 1F73A 2W61A 3WDHA 4OT7A 1E6QM 1J0IA 4W84A 6ENLA 2YA1A 4MWAA 3PSWA 3W1PA 3N73A 4WDXA 5FJPA 2PCQA 5CBJA 3W1MA 2XYLA 1XBXA 4IXHA 2C18A 1YQ2A 1JL8A 2PI6A 2DEPA 3CEPA 4JYEA 2A79A 1VFOA 3AYSA 4PCFA 2PDIA 1KXTA 8RUCA 1G4SA 3W7IA 1Q6RA 1GOXA 4NAEB 4DJDD 1Q45A 4Q32A 3ZOAA 4XVDA 5I3GA 2QMJA 1TVNA 3BZJA 4RNJA 3PN8A 3CHVA 3RJYA 9CGTA 3W1RA 1J2BA 4NF7A 1VR6A 1Z9AA 2Y88A 3T8LA 3AIUA 1WZKA 5BYWA 3UVAA 1A3WA 4LCQA 2VCBA 4P7LA 4RUBA 1YPFA 3A21A 3O15A 4IG2B 3QR1A 3GAKA 1CLKA 1BG9A 5E5CA 1O5XA 4LSBA 4P8XA 4FS9A 1CENA 1KW1A 4GXMA 4JD4A 4PODA 1KB3A 3W1AA 2YDAA 5AZ0A 1VFMA 3RDKA 2WZHA 4MY9A 3TYAA 1TREA 4PTXA 5GJPA 4LXFA 3AMDA 4M81A 4UTLA 2CZEA 3G18A 2XM2A 1A5OC 3AWNA 3L67A 1HN1A 3ITTA 1PDYA 4G8TA 3PBVA 4GIAA 4H7CA 1P5BA 1QK0A 2GQ3A 3SB0A 1OYCA 2WVVB 4UFJA 1FWFC 2V5KA 1TA3A 2YZ5A 4MG4A 1N8FA 4H6KA 4ZXLA 3TYCA 3UETA 1V6YA 3M46A 1JI2A 4L61A 4QE4A 4S3CA 4UQBA 4H8VA 2VR2A 3ITOA 1CI1A 1PAMA 4F4RA 3EWDA 5A8MA 4H2CA 3FAXA 2GVGA 4TMBA 1V02E 3GAYA 2A7NA 4GZJA 1GHSA 1VP5A 5CCZA 5EB8A 2ZA1A 3DKJA 2WSQA 2Y8KA 1JF5A 4C7FA 4PMYA 1Q7QA 1TPC1 4EAYA 2IW0A 3W1QA 1H51A 5XINA 3IUDA 4EPBC 4XZLX 3ARPA 2JE8A 4QDMA 1TYGA 5FEPA 1UR3M 4ICMA 2F6UA 3WQVA 4AWEA 3C3UA 4GIYA 3VC5A 1IE7C 1MW0A 4NI3A 1K1DA 3Q65A 4GY0A 3P14A 4O50A 4IH3A 1LORA 5EKYA 2BODX 2VKZG 4PB4A 3B9DA 3V1HA 1Y65A 3LLXA 4WSJA 1BTCA 2VFEA 1BSIA 4CNTA 5FF3A 4DZIA 1K8YA 3V36A 4IISA 3GNNA 3ONBA 3I7QA 1AK5A 1KXQA 4XISA 4UC5A 3NGFA 5DXXA 3SUVA 4CQ9A 1VCFA 3BQ6A 3TXZA 1B3ZA 1XD0A 4OZOA 3RM9A 3OG3A 1E9ZB 2I9EA 3QY8A 3L0KA 3IGHX 4XBJA 5LIUX 3W7EA 2CBUA 3HMCA 3UQNA 2PDMA 4LAUA 3AXIA 1EBHA 5HR6A 1QCWA 4NYUA 5I78A 1EP2A 1HJXA 4H8HA 1RH9A 1P0DA 3S1XA 4DNMA 1YTDA 1I2RA 1POJA 1F9CA 2UV8G 4GZIA 4JFTA 1TJ1A 3I68A 3L4WA 3E2QA 3ITXA 1W5QA 2E25A 2WKGA 1WDSA 3R0KA 3PC0A 2ATMA 5EBUA 2R24A 2PURA 4QLJA 4C6MA 5DFAA 4IX0A 2CLEA 1HL9A 3AZSA 3KTCA 4X0VA 3UY7A 4BFAA 2JKAA 3UZYA 3RILA 1CIUA 3V4BA 4ZEPA 1EYEA 2FDSA 1JZ8A 3H24A 5I77A 2GDQA 4N4PA 2BGNE 1B3YA 1BRLA 1QPRA 2NQLA 3IV8A 1DQUA 2C1IA 3W82A 1I0BA 2Q6ZA 3TXVA 1PDZA 2I7GA 4RPQA 1TE6A 3ABZA 1QT1A 1LZOA 4FO4A 2WK2A 4DEFA 5A2CA 1PV8A 4WSKA 4D8LA 3FVDA 1XLFA 1Z8AA 4L9XA 1UPPA 3S2CA 4AWSA 2D2OA 1XH1A 1KA9F 3POHA 3B0YA 4Q4OA 5JMUA 2J25A 3O07A 3E49A 5H1WA 4BF9A 1H0IA 1Q2SA 3LYEA 4UZUA 1JZ7A 4GX9A 4MDPA 4KEZA 1TV8A 2X1RA 3URQA 3LZ5A 2CWXA 4D6DA 4N7QA 2CLKA 3U5UA 1TSIA 3CHCA 4QITA 4F2UA 1KBKA 2VWSA 3NZQA 5DX7A 2YZRA 1PBGA 4AZCB 2FGZA 4O1DA 2EO7A 2DW7A 1RA5A 3SCWA 3BLIA 1ELSA 1O60A 4EANA 3U9IA 2IUZA 4MKNA 2A7RA 4KFPA 3V0SA 3FJ6A 4PSRA 4D8ZA 1IT7A 1OQFA 3THDA 3A3HA 5HA7A 3IPWA 2W92A 4UR9A 4G1KA 1UG6A 2ZXAA 1XL9A 5AFDA 1GTEA 3P93A 4CD7A 1E4LA 2Q8XA 2ZWYA 2PGEA 4GGBA 4BF7A 4GYJA 2A6LA 5CZKA 3AO0A 3T6CA 5J04A 1PO9A 1KQZA 4O16A