2GK1B

X-ray crystal structure of ngt-bound hexa
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
54
structure length
54
Chain Sequence
PALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-hexosaminidase subunit alpha
publication title Crystallographic Structure of Human beta-Hexosaminidase A: Interpretation of Tay-Sachs Mutations and Loss of G(M2) Ganglioside Hydrolysis.
pubmed doi rcsb
total genus 5
structure length 54
sequence length 54
chains with identical sequence D, F, H
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gk1B02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 2gk1B01
1AVAA 4HMDA 1J0IA 3PHAA 2DT0A 4D1IA 1KXHA 4ATLA 4Z2HA 2WZEA 2DPEA 4ZXLA 3VD7A 1TMQA 2E40A 2VX4A 3BLKA 5A8OA 1GOIA 1CGYA 4A4AA 4RE3A 4HOXA 2OSXA 2WVVA 1TR1A 4UQDA 1CXIA 4HZ6A 1B3YA 2D3NA 3AJ7A 4W88A 1BFNA 1CECA 1M03A 1NQ6A 1YHTA 2QMKA 3QOMA 1XD1A 4U31A 4V2XA 4AD0A 2DDXA 2WW5A 1E73M 4P7QA 3VGEA 4PTWA 3K8MA 4J27A 1HL9A 1JZ6A 4AISA 1D7FA 3UERA 2PBOA 1XRVA 3UG5A 3KL0A 1GVIA 4RE4A 4IPLA 2V38A 4KMQA 3WF0A 1KQZA 5CGMA 1E40A 4MNJA 3VDAA 2BXYA 1UKTA 1JZ5A 2WMIB 3AXHA 5ECUA 4W7WA 3CPUA 1GHSA 2VR4A 3AOFA 4CU7A 2BY3A 4HU0A 2Z1KA 1OT2A 2W67A 2GJXA 4C7FA 4PSRA 3WL1A 4HMCA 2WWCA 1KR1A 3WMSA 2J7EA 1E6XM 1YQ2A 2E8ZA 3F5LA 3OGSA 4FF5A 3VD9A 3VIHA 4UOQA 3RDKA 3UCQA 1UQYA 4BF7A 3WELA 1BSIA 1EGZA 2VOTA 3WNKA 3ZM8A 4HA3A 1NM9A 1V6VA 4XZBA 2NW0A 3WH8A 2BY2A 2G3NA 3GDBA 3WDHA 4M24A 3WF3A 4TX6A 2Y4SA 2MANA 5DFAA 3AISA 3MUY1 3ZIZA 3GNPA 1UWSA 1E6QM 2FHFA 2DIEA 2DH3A 1EXPA 1JZ3A 4UFJA 5A6JA 1EQPA 1UH2A 4CD5A 3L4ZA 3RM9A 2XFYA 1UKPA 1G94A 1KXVA 3B9EA 3WQVA 2DGAA 4W87A 5I3DA 4F66A 2WLYA 4D71A 2WMKA 1G5AA 3ARRA 1WE5A 1C90A 4GO9A 3BXWA 4JCMA 5BRPA 3WF4A 1FOBA 2X0HA 3D3AA 1WDSA 2BV9A 3CUIA 3AMGA 1UYQA 4LYQA 1QPKA 3L4VA 2CPUA 4PMQA 4U33A 4IM4A 1HJUA 1J0KA 3RMEA 3VMPA 1HKIA 1V3KA 2XUCA 3BGAA 4EKJA 5CSUA 2X1IA 2A3EA 5CGTA 3K4AA 2JEPA 1K9FA 5D9NA 5C71A 1FP8A 3SCRA 5HDRA 1R7OA 1DHKA 3ARPA 4LYPA 3ARSA 2VMFA 1Q6EA 3WUFA 1NWUA 5A3HA 1W9BM 2DIJA 2GDUA 3SUWA 1H41A 2A3AA 3TP4A 3GH7A 2F2HA 1NARA 4N0RA 1UD5A 3WD2A 2PI6A 1KBBA 1OB0A 1MFUA 3CTTA 4LQ1A 2JE8A 3WKZA 1FA2A 2CIPA 1VEPA 1UG6A 1E6PA 2DSUA 1BQCA 3AFBA 5I6SA 3I3EA 6A3HA 1Q6CA 2PC8A 2ZE0A 3T08A 5C8BB 1XSJA 1QNOA 4UZSA 3ZJ8A 2J74A 1V08A 1ZBVA 4D6DA 2DH2A 1KGXA 1QHZA 2QMJA 5E0CA 3NDZA 4OOZA 4OBSA 3VIFA 4S3JA 1UWUA 2XWEA 4LYRA 1H3GA 4YHEA 3VD3A 3LPFA 3OZPA 2EO7A 2V3GA 4H41A 4OZOA 3EDFA 1WZKA 1MXDA 4UZUA 1E1FA 1E5JA 4S3KA 4MPKA 3PZTA 4AMCA 1ESWA 1VB9A 2D23A 3CZKA 4EANA 1JYNA 1P6WA 3W26A 3M07A 1QBBA 1E4IA 5F7UA 2C0HA 4QLJA 4MB3A 4AD1A 1B30A 1CLXA 1CYGA 1E72M 1V0LA 5LA1A 1E43A 4FLQA 2JF7A 3U5YA 1ISXA 4BQ5A 2WMGA 1W3LA 2PWEA 2VX5A 3VX1A 5A6BD 4YHGA 1KR0A 3OBAA 3MSGA 2VR5A 1JXJA 2CEQA 4J3UA 2J78A 2WVTA 2PWHA 2AMGA 2XIIA 2VL4A 3VM5A 3L2MA 1EDGA 4TXEA 2UY5A 1EH9A 3D5HA 4NZCA 2CESA 3MANA 1GPFA 2A3BA 4URIA 2VTFA 3SUVA 4HPHA 5AYBA 3CIVA 1DWGM 2XVPA 4HA1A 3W6MA 3CZJA 2CBVA 2W5FA 2J62A 4TTGA 4AY1A 2ZX9A 1XSKA 1NOFA 1TZ7A 3BMVA 1EO7A 1ISVA 3II1A 3ARVA 5A8PA 2DT2A 4MJ2A 3VKKA 2WMHA 1UR2A 1VF8A 1AMYA 5FOOA 2HVMA 1V0KA 3VGDA 1FHDA 2O9TA 1VJZA 5A2AA 1UA3A 1UWRA 1GQKA 3T0AA 4BA0A 4WLCA 2ZUWA 2V3EA 3VDHA 1ISZA 2QPSA 2DT3A 1TVNA 1SMDA 4GI8A 3WUEA 3CUGA 4M56A 2E8YA 4MNLA 3PZNA 3CH9A 4WF7A 5A8NA 3FNDA 2YL9A 2NSXA 4AZ6A 4XB3A 5A8MA 2JFEX 4P7LA 1WCGA 4AD5A 1PZ3A 3ARZA 4PMDA 1JFHA 2XPKA 2JEQA 2VRQA 3VPLA 1PEZA 3AIWA 3FW6A 1IZKA 4U3AA 3FN9A 3WH5A 1RP8A 1MWOA 3WNMA 5HBFA 1W9VA 2X2YA 3WQ8A 2CKSA 1V03A 3AI0A 4D6JA 1BVZA 4JFUA 3ZOAA 4UOZA 3ARTA 3AICA 1M01A 5M17A 3M6DA 1CTNA 4GQQA 3M7SA 3WEZA 4WKAA 2VCCA 3U7BA 1GJUA 1E3ZA 2E4TA 3WEOA 2F8QA 1K6AA 4AYSA 2ZX5A 1QI5A 3VINA 5GQBA 1XHGA 3QGVA 1UWIA 4GQRA 1EOMA 3PZGA 3SUSA 3ZT6A 4LGXA 4ACZB 3W29A 4HA4A 1UH4A 3EBVA 4PYSA 1CGUA 3PTKA 3NDYA 2WBGA 1W1YA 5DMYA 4H8VA 2FH8A 4TVDA 4W7UA 1JL8A 1LL6A 3LMYA 4AZGA 2GJRA 1KQYA 1QOXA 2JIEA 5EFFA 2WC3A 3IJ9A 2XG9A 4HMEA 4M29A 1CGTA 3VIGA 5I77A 4CN4A 5I24A 3IAQA 2WVVB 1HP4A 4D72A 1J9YA 4H2CA 3UR7A 4HP5A 1XCXA 1VFOA 1EA9C 4MB5A 1XH0A 1OD8A 2BVDA 3IJ8A 3BAIA 4P7RA 2CYGA 5C70A 1L8NA 4WKHA 1QNPA 1D2KA 3BCDA 4HPGA 3VIIA 4XZWA 1WP6A 3OA5A 1WNOA 3BLPX 3NCOA 4ML4A 3VIKA 2QPUA 4RE2A 3DYOA 4M8UA 3WD1A 3AHXA 4KH2A 4W7VA 3VNYA 1ITXA 2ZXAA 1UD3A 2WLZA 5TD4A 1C8YA 2YL8A 4W85A 4RL3A 3MMDA 1MYRA 1US2A 1QHPA 2YIHA 4WSJA 4MB4A 3KE0A 3T2QA 2XM1A 3GM8A 2PF0A 3QHMA 1OINA 4PMZA 1GCYA 1MVYA 2EBNA 1NWSA 2GJXB 3VIJA 4YN5A 2CCRA 5M3WA 4UNIA 1S46A 4NRRA 3L2LA 3FHAA 4FK9A 3ZJKA 3WENA 2VI0A 3T2OA 1C7TA 4B9ZA 3PTMA 1ZJAA 3SCNA 1BAGA 3PZIA 4C7DA 1CXKA 1KGUA 1ODUA 1R86A 4W86A 1KWKA 1EIBA 1E5NA 5BXTA 4ATWA 1CPUA 1CIUA 4K68A 4H7VA 4HTYA 4B15A 3UEQA 4H04A 5ABFA 3ZMRA 4YPJA 4MDPA 2XSAA 4AIOA 2VRJA 4BCEA 2D22A 4J7RA 1W2VA 2JF6A 1TA3A 1VJSA 1C8QA 3WH9A 3HN3A 2V5CA 1G9HA 3KZSA 4JKKA 4LX4A 2VZSA 3SCVA 3ZO9A 4HOZA 1FH7A 3WDIA 1NH6A 1K9EA 3W38A 1FFRA 2PB1A 1MW3A 1TCMA 2YOCA 2W66A 3WBAA 2WC7A 4U5KA 3NUKA 3RILA 1CXHA 2YA2A 1W91A 1VBRA 3M46A 1CENA 4J3VA 1GORA 1GVYA 3MO4A 4PSPA 1ZB5A 2EPLX 3MV01 1X1NA 4P7OA 4PMRA 1H0IA 3GXDA 4J3TA 5E6ZA 1ZBKA 4AIEA 1BHGA 4UCFA 1LG1A 1QI0A 3BC9A 3OGRA 1KBKA 1W1PA 4TOQA 1W3JA 1H0GA 1W3KA 3UG3A 5BWFA 1UR8A 2J79A 2DSVA 3TTYA 4M82A 3QHOA 3W4RA 4DWSB 1JZ2A 2D20A 4F9DA 3WNOA 3CZLA 3VDCA 1WZMA 3AYRA 4CD8A 4UQCA 4EE9A 2IXVA 2ZXBA 1E4MM 5CPTA 5BYWA 1CDGA 3HJEA 1WDPA 1CGXA 2FHCA 4BQ2A 2JALA 1AQ0A 1OSEA 2BHZA 3DECA 1MW1A 3MV11 1MW2A 4GO8A 4A3HA 1H5VA 2D0HA 4KRUA 3W28A 5I5RA 1FFQA 2ZUNA 3A3HA 1JYVA 3W25A 3W53A 1NOWA 3MMWA 1HL8A 3AMDA 1DWFM 1JAEA 1ISWA 5GNZA 4AZ5A 5I78A 2XM2A 4E2OA 2C7FA 3GNRA 3DHUA 1BGGA 1VIWA 3AZTA 5IFTA 5CZKA 4TTUA 3AXXA 1PIGA 3EDJA 1UZ1A 3WEMA 2AOSA 1UHVA 3ZQ9A 1V02E 3AQUA 4UR9A 1RD6A 3WD4A 3GNOA 2J7DA 3VM7A 1GOOA 3AHZA 2ZUMA 4L4PA 3VIOA 2WMJA 2G3MA 2VVSA 2YJQA 3TOPA 2Z1SA 1E6NA 1GUVA 4W8BA 3L4TA 1C91A 1UZ4A 2VCBA 1HVQA 5GNYA 5KEZA 1TVPA 3NSNA 2VVNA 1DWIM 3MUIA 2ZX8A 3WQWA 4B16A 1RPKA 4DUVA 1E6SM 2BY1A 1M7XA 3MU7A 1J0JA 4H8UA 5A6KA 1TE1A 2W91A 4MAZA 2O9PA 3AXIA 5DEZA 4W89A 1V3JA 1JDCA 5BXSA 2XGIA 3T09A 4PN2A 4AZHA 4AZBA 1TFVA 4UFLA 2GJPA 2YL5A 2WVSA 1CXEA 4WSKA 3N13A 1WZAA 4P8UA 1V3LA 1ISYA 5GPRA 3VGHA 1JNDA 1DP0A 2PWFA 3AIQA 3WL0A 3WY1A 8CGTA 5BROA 2XFFA 3BAJA 5HXMA 1LL4A 3UR8A 5BCAA 1OGGA 4GZEA 4W8AA 2CHOA 2X8RA 1GHRA 5CQ1A 4Y7EA 3UG4A 3WF1A 3A4XA 3OB8A 3SCPA 2BFGA 1BG9A 4KGLA 4C91A 2FDMA 1DEDA 3VDBA 6TAAA 2G3IA 4DWSA 5E6YA 4M80A 4QCEA 3LPOA 4BS0A 1BYBA 1XGZA 1VBUA 1GW1A 1XH2A 4ZE5A 2WWDA 3VGFA 2GFTA 3AS1A 4PMNA 3SCWA 4QCFA 3ARQA 2DT1A 3VVGA 3PZ9A 5IHSA 3B9DA 4HOWA 3ZT7A 4PMXA 1JYXA 1JF6A 2AAAA 2DEPA 1N82A 4GXPA 2D24A 1E0XA 1JFXA 2D3LA 2WSPA 4PRWA 4PCSA 4M1RA 2OSYA 4F9JA 2YDSA 4JFTA 5CJ5A 3WDQA 4JIEA 4DUWA 4CUCA 2XSBA 2IUZA 1J10A 1EDQA 4KWUA 3OIHA 2D1ZA 2W4XA 1E0WA 2GDVA 1R87A 3IJ7A 1GJWA 3HMCA 3ZJ7A 1IZJA 1QW8A 3MUAA 3ZJ6A 4CKQA 1W32A 1Q6GA 2EXOA 3WMBA 5EFDA 1JD7A 1R85A 5KZ6A 2FH6A 4EK7A 1CLVA 5A6MA 1E9LA 4UFMA 2VZTA 4AZCA 1V0MA 4EAMA 1TUXA 1V0NA 1BYCA 5HOSA 1PX8A 5JBDA 3OLIA 3MMUA 1K9DA 3WQ5A 1R7AA 4JKLA 3AIUA 3CHEA 1R8LA 5D8ZA 1J0YA 5DT5A 4AIUA 1VRXA 4CD6A 1JIBA 1HNYA 4E4PA 1KB3A 1KXQA 2VO5A 2WVUA 4OKDA 3CHFA 1ECEA 3W81A 3CMJA 4DWSC 4CCDA 1U30A 4D6GA 1FHLA 1OM0A 2RGMA 2XFRA 1V6UA 4JHZA 2J7GA 2XHYA 4CD4A 2VJXA 1OWQA 1UKOA 4J3XA 2CKRA 1OGBA 4X9YA 3K1DA 2XJ7A 3WH6A 4UQEA 1RP9A 3QHNA 1E6ZA 1ZU8A 3LPPA 1QW9A 2HISA 5AC5A 2D2OA 1WPCA 1EHNA 1JDAA 4BZYA 1E71M 4R5EA 1GZJA 1XSIA 3WFLA 1J11A 3T0DA 5I79A 1BVNP 1VFUA 2WYSA 3W24A 4UFKA 1H09A 2XVGA 1HKMA 2G4FA 2UY2A 2ZX7A 4P8XA 1HVXA 1QI2A 1V3IA 1CNVA 2VT0A 3EDKA 3G6MA 1BGAA 3GXMA 3PZUA 5E0FA 4U2YA 4KRTA 3RIKA 5E70A 4J3SA 1C8XA 2WK2A 3W37A 3VD5A 5ABGA 5ABFB 5GNXA 3ARXA 2ZUVA 3N11A 2VZVA 3WBEA 2GSJA 2ZWZA 4AD4A 2WM0A 4D6IA 3ARWA 5D9PA 1BYDA 1E6RA 1HXJA 3GBDA 3WSUA 2BHUA 2QV4A 4PMOA 5AC4A 1FP9A 2Y5EA 2E9MA 4JCLA 2EPOA 1TA3B 2O92A 1H2JA 1OT1A 3IK2A 3L4YA 2G8ZA 2WHLA 1BG4A 1NWRA 4QLLA 2Y24A 2XYLA 5E09A 1IV8A 4CVUA 3PZVA 3VU2A 8A3HA 3RM8A 4ZEPA 3E1F1 1EQCA 4DM2A 3KEHA 4QDMA 4IISA 4MADA 2V5DA 1OBAA 3ZR5A 1CEOA 3QR3A 3ZSSA 1UA7A 5A6SA 1Q6FA 2WSKA 1MFVA 3AS3A 1XV8A 1FH9A 3A6OA 3WUBA 1ITCA 4U3CA 2QLYA 2WKLA 3S2CA 2A3CA 2OWXA 4AD2A 5A95A 3TTQA 3VOCA 4PUDA 2VCAA 3WN6A 4D6CA 4N42A 5A6LA 1U33A 1OIMA 1CZ1A 4QP0A 1O7AA 5ABHA 2X0YA 3AMLA 4C7GA 1JYWA 3GZAA 2XIBA 2WKGA 4PBGA 1HJSA 2BHYA 5A6BA 2YBUA 1E70M 1I75A 2OLHA 4H8HA 2PBGA 5CSYA 4CU8A 1J01A 1BLIA 1BTCA 2Q8XA 5HPCA 4D1JA 1F4HA 4WK9A 4Z2IA 2E3ZA 2YDRA 3BAWA 4PCTA 2YLAA 4C90A 1G01A 1CXFA 4OOUA 1BF2A 2WBKA 3GTNA 2CNCA 1QHOA 1UKQA 1CBGA 2RGLA 1AQHA 2PWDA 5A6AA 2ZXQA 4MDOA 2VQTA 1B3XA 3CO4A 9CGTA 1A3HA 4W93A 5JBEA 2C8NA 3APGA 1V6YA 1W3HA 2XTKA 2Y8KA 1CWYA 3CHCA 1OD0A 3IAPA 2DSWA 1C3FA 3W27A 1NWTA 3PZMA 4WKFA 4IPNB 2PWGA 2BVYA 3QOKA 4CVWA 4Z2KA 1W9PA 2YA0A 2OWWA 3ALFA 5AY7A 1ZL1A 4X0VA 1HJWA 3NIYA 3N15A 4AXNA 2EPKX 3TTOA 4UTFA 3EDDA 3AHYA 3N12A 2UY3A 3B9AA 3OLGA 3K8KA 1HF6A 2YL6A 3BSHA 4NI3A 4B3KA 3BCFA 2D0FA 2YBTA 1Y7VA 3WQ6A 3DYMA 2EJ1A 2J77A 2NT1A 2V3FA 3OG2A 3ALGA 1V6WA 2ZOXA 2VNCA 4CCCA 3CLWA 1ZS2A 4AEEA 3WIJA 1F4AA 3WDRA 2VUYA 5IXEA 1NOUA 1B90A 2GK1B 4KGJA 1GOMA 1G1YA 2WHJA 1VENA 2O9RA 3MKKA 3MS8A 3VMOA 1LL7A 5BXRA 3SCSA 4Z2LA 2TAAA 1KCLA 2WZIA 3PZOA 3BAXA 2J7BA 2EQDA 3CUHA 2WB5A 5BXPA 2J75A 1QNRA 1SMAA 3FAWA 4ZFMA 4M81A 1DTUA 1OIFA 2CETA 3EDEA 1EOKA 1B2YA 1LG2A 4E8DA 1PIFA 2QF8A 5LA0A 4DWSD 1EO5A 4CGTA 4PTMA 4ZE4A 4TX8A 2VX7A 1B3ZA 4LPCA 5E9AA 1XH1A 3GH5A 3ZT5A 1M53A 1K9TA 1PBGA 4JKMA 4BQ4A 4JL1A 5CG0A 1GONA 1JI2A 2X05A 2IXUA 4OIFA 1GQIA 3SUUA 3WDPP 1J12A 5JIPA 3GXIA 1JDDA 3BH4A 1QBAA 4JAWA 1LLOA 3AIVA 4PUEA 4TVCA 3U5UA 1UKSA 3WUGA 3BAYA 2DSZA 1W9XA 2ZX6A 3WNLA 4AWEA 1HX0A 3EYPA 1H11A 3AIEA 1E0VA 4ZXOA 4D6HA 4CD7A 5A1AA 5FCZA 1A47A 2J8GA 2WC4A 1UOKA 1HT6A 2WHKA 1OGSA 1JF5A 3GXFA 4FLSA 3THCA 3W82A 1CGVA 1AQMA 2J7FA 3SCOA 4QFUA 3T2PA 1QVBA 3NSXA 4P8WA 2WCSA 5IFPA 1NP2A 4J28A 1GNXA 2UWFA 3WMCA 3AIRA 1W9UA 5I23A 4AZIA 3CGTA 3RM4A 4GZIA 5D9MA 1C92A 2CBJA 1E3XA 4UFHA 1E15A 2VURA 1EHAA 1W2PA 1B0IA 2WXDM 2BVTA 1UD4A 3GBEA 4AZCB 2FHBA 2J7CA 1V3MA 4MNMA 4Q22A 2GK1A 4W84A 2J7HA 7CGTA 3KL5A 3SCUA 3VMNA 4MTVA 3GH4A 1L0PA 1JD9A 1BYAA 2UY4A 1PJ9A 3VIPA 2VX6A 2OYMA 3CZGA 4MNKA 1SFSA 2G3JA 1VFFA 3KL3A 3CZ8A 3WFZA 3WDJA 1JZ7A 3VTRA 1HKKA 1WZLA 1LWJA 2NT0A 4W8LA 4IUGA 5CLWA 2ZXDA 4U2ZA 3VGGA 3VD4A 1RH9A 4UOJA 1Q4NX 1G0CA 1H49A 1UR4A 3F5KA 3N9KA 1V6XA 4Z2GA 3IANA 3OLDA 4PEEA 4L4OA 1U2YA 3MSDA 3LPGA 2VC9A 1PAMA 4UQ9A 5LYRA 2YKKA 4GI9A 5IHRA 2ZUUA 3OLEA 2BNJA 3SCQA 1DWJM 4ZENA 3MUZ1 2WMIA 2Y8VA 1I1XA 5ABEA 1E1EA 4AEFA 2YDQA 3AMKA 3SIMA 4Q7NA 3A4WA 1UR9A 3NSMA 4GKLA 1H1NA 4AW7A 5I0DA 3AROA 1MXGA 2ZICA 2W61A 1CGWA 2FGLA 3VUPA 2X09A 3TTSA 3U7VA 1HIZA 1SR0A 2EPMX 5FKYA 5FL0A 2WANA 5CXPA 1V3HA 4NF7A 1E4NA 5M03A 1EDTA 2CXGA 4OUEA 1XD0A 4GI6A 3DHPA 1B3WA 3JUGA 2J4GA 2OYLA 1MQPA 3CZEA 4JHOA 2WCAA 2CITA 4CCEA 1B9ZA 4W5UA 3B8SA 4WIWA 4DM1A 3WNNA 2F61A 1W9DM 1WKYA 3HU7A 2EPNA 1XC6A 4UFIA 4MB1A 1W1TA 3VX0A 3O6AA 2EEXA 5EBAA 4D6EA 1VFMA 2XVKA 3K8LA 1HJQA 3AZRA 3AYSA 1QI4A 1KGWA 4V28A 5LA2A 1HJVA 3ZR6A 4B9YA 2DSKA 5A2BA 3NJ3A 5JUVA 4QAWA 3CUJA 3FXYA 1X6NA 4D6FA 4GPNA 4NSBA 1GOWA 2ZWYA 3O9NA 2B31A 1UWQA 1WB0A 4JZ5A 1TG7A 2G41A 2WNWA 5EMYA 1KWGA 1E56A 4V27A 3EMCA 3ARYA 2ESCA 1FH8A 3VNZA 2XGBA 3RJYA 1LQ0A 6CGTA 4JFSA 4CN6A 1BPLB 3RPMA 5CLTA 3ZSTA 1M04A 1QI3A 7TAAA 1NP0A 2J25A 1VAHA 3ECQA 3N1AA 2VRKA 4F8XA 4OBRA 3FHQA 3VO0A 3L4UA 1GQLA 1PX3A 2BS9A 3SURA 3OGVA 3L4XA 3POCA 2CHNA 3L4WA 3PTQA 3SCTA 1JZ4A 1UR1A 2ZUTA 1C93A 2ZUSA 4JFWA 2XWDA 1WDRA 2V3DA 2WPGA 4BQ3A 4X0NA 4F79A 1B1YA 3VILA 4QLKA 1KCKA 3AZSA 3K4DA 3NYDA 1PX4A 4MJ4A 4FLOA 3CHDA 2XVLA 1JXKA 3CMGA 5A69A 3PN8A 3SEPA 4W5ZA 1JZ8A 2ZIDA 3A4AA 4UQBA 1XYFA 3F4VA 1MW0A 1HKJA 5I2UA 5JIWA 1VEMA 3DYPA 2VZUA 3POHA 1MQQA 1X6LA 3AHTA 1LWHA 5AYIA 5CPSA 3ARUA 1GQJA 2OWCA 1UQZA 4FLRA 1UR0A 3F5JA 1XCWA 2WHMA 3SUTA 1I1WA 3I3DA 3N04A 1Z32X 4AD3A 1UD8A 5DF0A 1VEOA 5JBFA 4PTXA 2Y2WA 3O2LA 4ATDA 4J3WA 2E9BA 2GUYA 1ZBWA 2BY0A 4LXFA 3BAKA 3WQ4A 2XVNA 1HJXA 4PMUA 3N17A 7A3HA 2QHAA 3U57A 3WD3A 2W62A 1JG9A 3KWXA 4AC1X 1V02A 2YLLA 1J0ZA 3EMZA 4E8CA 5EB8A 4NRSA 2JIWA 5FL1A 2W63A 1D3CA 3WD0A 2BXZA 3FAXA 3VGBA 3DC0A 1O6IA 1MQRA 4PMYA 2E0PA 4CU6A 2WCGA 1GOKA 3EMQA 4MAVA 3WF2A 5A94A 4HU8A 1GOQA 5A8QA 1SYTA 1KFWA 3N18A 1JAKA 3W6LA 3AMCA 2WAGA 4TVUA 4A3YA 5A2CA 1E4LA 1US3A 3A47A 2VQUA 1LF1A 2CBIA 1KXTA 1UD6A 3W0KA 2A3HA 3J7HA 2O9OA 3THDA 4DUXA 4XUYA 1UH3A 2D0GA 3G6LA 1XYZA 5BRQA 3TA9A 2FGZA 3K46A 1HP5A 1H4PA 4HZ7A 4GZJA 3RO8A 2J8FA 5HPOA 5DO8A 3AIBA 5D8WA 1B3VA 3I3BA 3RCNA 4PTVA 3RJXA 4FMVA 3BSGA 1IT0A 1ZBCA 4R27A 3PZQA 2YA1A 5FIPA 3FY1A 4PMVA 2J47A 3WH7A 3CUFA 5DT7A 3T0BA 2OSWA 2W92A 1ODZA 4P7NA 5CPQA 2OYKA 4GIAA 3UETA 1CXLA 1C7SA 3GYCA 4Z2JA 1J18A 4HZ8A 4WJXA 1B31A 3WNPA 1PZ2A 1JNEA 2WMFA 1WDQA 3BMWA 4TUFA 4AZ7A 3AS0A 1QNSA 5D9OA 3AS2A 1W1VA 1PPIA 2GVYA 4UQAA 1UD2A 1J0HA 5FD0A 1LJYA 1ZJBA 3PBGA 3UESA 3TONA 4P8VA 1DWAM 1UWTA 2CERA 5HNNA 4OJYA 1JI1A 2VZOA 1WO2A 2DQXA 1DWHM 4JL2A 4XX6A 4U5IA 1WAWA 1UUQA 2WZHA 3VIMA 4CN1A 4GINA 4JFVA 1HN1A 4XV0A 5D4YA 5M5DA 3S6TA 4ACZA 2E9LA 3OZOA 5IDIA 1JGIA 3AHVA 1QNQA 2CBUA 1E55A 4ACYA 4B3LA 1Q6DA 1OCQA 3CBWA
chains in the Genus database with same CATH superfamily
4HMDA 1GG1A 1TO3A 3MSYA 1KXHA 1QR7A 4ATLA 3UWUA 4Z2HA 4Z17A 3MPGA 1O60A 3P5ZA 4Q8QA 3PULA 3VD7A 2E40A 3BLKA 5A8OA 1GOIA 4RE3A 2OSXA 1TR1A 4JIRA 1B3YA 3AJ7A 3BSMA 4AX7A 3SQLA 1GTHA 4JTKA 4CCZA 4MZ8A 1QNVA 1YHTA 1XD1A 3RPDA 2DDXA 2WW5A 2UBPC 4P7QA 1O5XA 2GQ3A 4AISA 3UERA 3NXLA 4ZOAA 3CU2A 1MUCA 1GVIA 3K1GA 3WF0A 1KQZA 1E40A 3QV9A 5BOEA 3LHZA 2BXYA 1KBJA 1UASA 4OTKA 1XIMA 2OMAA 3CWHA 1TJRA 3B9OA 3RCYA 4I3GA 3F1QA 3Q58A 4QISA 3GDTA 3ZYZA 4NU7A 3SECA 4C7FA 2GGEA 3WL1A 5IDZA 2E8ZA 3BUVA 3F5LA 3WLLA 1OVDA 1ZCCA 4ZQMA 3VIHA 4YNGA 2A4AA 3MBFA 5AHNA 4MWAC 4M51A 4PUUA 5RUBA 1O5KA 2ALRA 4HZMA 2NW0A 3WH8A 1KM2A 3QSTA 1FWJC 3T0TA 3H53A 3GDBA 3WDHA 3WF3A 3PUDA 2QJIA 1SO4A 2OPJA 3C56A 2POZA 3AISA 1LTDA 5CC3A 4L6DA 4G5DA 1EXPA 2Z4GA 1SSGA 1Z48A 2HCVA 5E93A 3R94A 4L1XA 3HG5A 4FO4A 4K1WA 4LCQA 1UKPA 3N4AA 1KFJA 3WQVA 1OK6A 3RK8A 5I3DA 5EMJA 2WMKA 3ARRA 1X98A 1C90A 1W3TA 4GO9A 3BXWA 3H70A 4AY7A 2X0HA 3D3AA 4A3UA 3PPGA 3UNTA 2V68A 1ITQA 3AMGA 1UYQA 3EKZA 4WY0A 3B03A 2GGGA 3DX5A 4U33A 3LERA 1EIXA 1HJUA 3C0QA 1BVWA 3VMPA 1R0MA 1GKPA 1V3KA 3BTNA 3O7UA 4EKJA 1FBAA 5FEXA 4KETA 3RF9A 5K4ZA 3S2LA 5HDRA 1R7OA 4A3QA 3ARPA 5C0QA 1FXPA 4PBFA 1RSCA 4FI4A 4N9DA 5DY3A 2DV0A 3ARSA 2JGQA 1Q6EA 1VYSX 1W9BM 3UGRA 4GCXA 3SUWA 1BSLA 3ITOA 3IK4A 3GH7A 1EX5A 1VJIA 1K6WA 1OB0A 3E49A 2OGYA 1MFUA 3CTTA 3SFKA 3GAYA 4P61A 3WKZA 1P1MA 3S6OA 4LVDA 3MUCA 3ZLFA 4JTJA 3UNDA 4O8RA 3M0YA 1BQCA 2VUNA 2GOKA 2W6RA 3UT0A 5LNRA 2P3ZA 2PC8A 2ZE0A 3LYEA 2XSXA 1XSJA 4UZSA 4DBSA 1NU5A 2DH2A 5CZSA 2OOFA 1QHZA 2QMJA 5E0CA 4PCNA 4LYRA 3W75A 3VD3A 3HF3A 5EBUA 2F6UA 3EDFA 3DFSA 3C8FA 1E5JA 1F8IA 2NVAA 3CZKA 4Y8EA 4DUOA 2PLMA 1V93A 5DMLA 3TLQA 1P6WA 1R3VA 3IJQA 5AHMA 4CNTA 2C0HA 1B30A 2Z25A 1ZALA 1UBPC 3D46A 2WMGA 1IR1A 2PWEA 2VX5A 3R8GA 2A21A 4YHGA 3TROA 3OP2A 3PJUA 2VR5A 4ECLA 1JXJA 2WVTA 2XIIA 1BKHA 2VL4A 4RKAA 3L2MA 2EHHA 2HTMA 3NZGA 1U1UA 1EH9A 4URIA 3SDOA 3W6MA 4TTGA 2VC6A 1P0BA 1A5SA 3GG8A 3QVQA 3BMVA 3II1A 5A8PA 5LNSA 2DT2A 1WKEA 4MJ2A 3VKKA 3TYZA 4EWJA 1XIEA 3OEXA 5FOOA 4AX6A 4LUTB 1TPFA 4XAGA 2I57A 4K38A 1VJZA 1QOQA 3TU9A 2GQ9A 3T0AA 1PO9A 4LF2A 1ISZA 2DT3A 1TVNA 1UCWA 3NO3A 2AMXA 4D2JA 1JUKA 2J6VA 3USZA 3PZNA 5BU6A 4WF7A 1D8WA 1SJAA 5A8NA 4K37A 3T1GA 3Q45A 3B04A 3KWSA 5A8MA 1OX6A 4F0RA 4AY8A 4ERAA 1PZ3A 4REQB 4G9PA 3G1YA 2XPKA 3P7YA 5H6HA 3AIWA 3FW6A 4U3AA 1ZY9A 3WNMA 5HBFA 4O11A 3WQ8A 1V03A 3RX3A 3L67A 1XC4A 5AHFA 1M01A 3M6DA 3NXFA 1RXOB 1B4EA 2YCKX 2ZKMX 5FF0A 4Q4QA 3BK0A 3CWOX 1J6PA 4HK6A 4XAFA 3VZXA 2TODA 1XW8A 4WHBA 2ZX5A 4XVEA 1LUCA 1EOMA 4KWOA 3SUSA 4ACZB 3W29A 4XVDA 3NDYA 4X63A 2FH8A 1JL8A 1K03A 4DB7A 3PPFA 2F6XA 1SZRA 2PD5A 3G2GA 2V2CA 4X60A 2JIEA 4ES4A 1F6PA 4Q6XA 2W9MA 1VCGA 2XG9A 4HMEA 4IFKA 3S0CA 3MHUA 1IEXA 3UJSA 3G0UA 1HP4A 1JRCA 4EOUA 4C1NB 1Q6LA 4IPIA 1E1CA 3TYBA 3O0FA 1JCJA 3URAA 5C70A 4WKHA 3VKBA 3BCDA 3AUOA 3JS3A 3OA5A 1JCNA 3NCOA 2PC4A 3DFOA 4XZLX 3DYOA 1V7AA 3C6CA 3WD1A 3N4FA 4MSSA 3WYZA 4W85A 2QIIA 3N6JA 1MYRA 1LOQA 1QHPA 3HGRA 4GVHA 4IF2A 4LF1A 3KE0A 5CBJA 1AW5A 5J8LA 3AU2A 3M5XA 1E51A 3VIJA 2GJXB 4YN5A 4I8YA 1GWJA 3FIGA 1FWSA 3E12A 2OX1A 4FK9A 2VI0A 3T2OA 2QS8A 3BCJA 1C7TA 1TPH1 4BK9A 3PTMA 4F3HA 2QUNA 1R86A 3JZUA 1RCXB 1KC7A 2XH4A 3EWCA 1E5NA 1WX0A 2QCMA 3CPRA 1FCVA 4H7VA 4HTYA 4B15A 3UEQA 3RNDA 2IPWA 5ABFA 4O1BA 2RHGA 3IJ6A 3ENLA 1RA0A 1L6WA 2A7PA 2XSAA 4J7RA 4MHBA 1W2VA 1ZGDA 2JF6A 3LTPA 5D2VA 1E0TA 1Z7AA 1B4KA 2NX9A 3KZSA 3SCVA 4DPPA 3ZO9A 5REQB 1NDWA 4YL2A 1EZ2A 1NH6A 3W7HA 3NFUA 4L64A 3W38A 1HUVA 4KS0A 2P88A 4WGHA 2PB1A 1LYXA 4U28A 1RQBA 1TCMA 3E02A 2W66A 4JIQA 4LALA 3W1UA 2YCJA 4U5KA 4ZO8A 3QXBA 2OCZA 4QG6A 4P5UA 2YA2A 1W91A 3GB6A 1CENA 5AECA 1U83A 4HB7A 4IIFA 1LOLA 3GHRA 2EPLX 3ZLHA 3DERA 5E6ZA 2TYSA 3V0TA 4AIEA 4MLJA 1XIIA 1A0DA 4UCFA 3OHIA 4GY0A 1QI0A 3OGRA 2YW4A 2V6AA 3WK1A 3IGXA 2NUWA 2YYTA 5TBOA 3RU6A 2VEPA 1ZP3A 3KVLA 4PE8A 1EPXA 5CC5A 1FCBA 4QM1A 1HKWA 3VDCA 3P84A 1UBSA 1V77A 1X1OA 2XDFA 3M1ZA 4UQCA 2ZXBA 5CPTA 3GDMA 1E0UA 5LIXX 1C29A 5BOFA 4IIEA 4FP1A 1P4CA 4DXXA 4E2DA 1AQ0A 1IR2A 1MW1A 1DXIA 1MW2A 1ZENA 4GO8A 1ZPTA 2D0HA 3A3HA 2X1RA 3W25A 4ALDA 5C6MA 3W53A 4JQ4A 5D09A 3GC5A 1H62A 5D04C 1VFHA 1VC4A 2XM2A 3GNRA 2C16A 3N3MA 6XIMA 3S83A 1S38A 1QFEA 4NNAA 4TTUA 3AXXA 3NGJA 3UVIA 2YR1A 4L7ZA 1V7YA 4R85A 4O1FA 5KZEA 4FNSA 3VM7A 4FR1A 3RCMA 1QTWA 1LQAA 2XH7A 2G3MA 3U9IA 1KM5A 4L61A 2YB4A 3TOPA 2PDWA 4HCHA 3MI2A 1GUVA 2GL5A 8XIAA 1UZ4A 3P81A 1MNZA 1YDYA 4E8GA 2VVNA 3DGBA 3M0XA 2ZX8A 3H7VA 5B7ZA 1ONRA 3OVGA 4UTUA 1E6SM 1EJRC 2C0AA 4MAZA 1OX4B 4W89A 3VNDA 2QGHA 4HPJA 4LUJA 4AZHA 2Z1WA 4LAZA 3PM6A 2GJPA 2X2GA 4WSKA 1A5MC 1MDLA 2FYMA 3XINA 3AIQA 3WY1A 8CGTA 3IIPA 4UTHA 4LVBA 3TJXA 4DAFA 2NV2A 1MDRA 4AF0A 4W8AA 2CHOA 5T9BG 2X8RA 5AVNA 3UG4A 1GT8A 1Y5XA 1J2WA 1DEDA 4Q7BA 6TAAA 2G3IA 1YPIA 1K77A 4XZNX 5HWJA 4BS0A 1VBUA 1GW1A 3A5FA 2WWDA 3TX9A 4E38A 4RR4A 2QJMA 3GWQA 3SCWA 3VKCA 1XIHA 3O16A 4XK2A 1C8VA 2WM1A 2DT1A 4JTRA 3B9DA 1RHCA 3P5YA 1JF6A 1JYXA 4JQAA 4AYGA 3RR1A 3MWCA 1XISA 3HV9A 1AZ1A 4UTWA 4LC6A 2HS6A 1M41A 3LM3A 2QCLA 2FMNA 5G1MA 4EVZA 3GTFA 5C55A 1BTMA 2XIMA 4IXHA 2EGZA 1GVRA 2B7QA 3L7RA 3WDQA 4JIEA 3BG3A 4KQNA 4XO7A 3CASA 2XSBA 4CUCA 2DJLA 4HSHA 4F2TA 4K8HA 3FYYA 2QNEA 1E0WA 1R87A 2P3EA 3IJ7A 4WQ6A 2P8BA 4HN4A 1SM9A 1Z6KA 1U22A 3KBJA 3HQOA 1IQ8A 4JY9A 5EFDA 3NNTA 3I7SA 4R34A 4DIAA 4LCRA 3CMFA 2NQJA 3A21A 9RUBA 3KTSA 1E9LA 4IMGA 4G7FA 3AXMA 3LQGA 3ZVHB 1BYCA 5C7HA 1PX8A 3PF3A 1QWGA 2Q6ZA 1KV8A 3VNLA 4DI9A 1LBMA 1R8LA 2PGRA 1J0YA 4A05A 1VRXA 4H7CA 1JIBA 3MP3A 3M0HA 1G7VA 1XBXA 1YLVA 1HGWA 4I9TA 3MW7A 3W73A 2W0UA 4AC7C 3W7OA 4XUGA 2RGMA 2XFRA 3O1NA 2J7GA 3DFTA 3PVFA 3IWPA 3TK7A 5CC7A 3R58A 5J5RA 3ABSA 4EPEC 3YPIA 1I0BA 1EB3A 3GNNA 4OU1A 4AIBA 4UTWC 2NLIA 1OC7A 4AVNA 1TTJA 3F7JA 5G1TA 1DV7A 1RP9A 2QJGA 5AHIA 1QW9A 2HISA 4J40A 5ABTA 1EHNA 1AJ0A 3UP8A 3SGGA 3RR4A 2V5LA 1BWVA 1BVNP 1VFUA 3NPWA 3W24A 4YYCA 3E0IA 2X40A 1RJPA 4LBRA 5I3GA 2G4FA 1EJXC 3BW3A 5FF4A 3GU9A 3PK7A 1XLGA 1DTNA 2BGNE 2FJUB 3EB4A 5E0FA 4ZO7A 3NQ8A 4KRTA 1AZ2A 3H2CA 1PKNA 3ID7A 3AYVA 5GNXA 2ZUVA 4JNYA 2VZVA 4UR7A 2YCLB 3WBEA 2GSJA 2WM0A 4D6IA 3ARWA 1Q8AA 5D9PA 1WA3A 4P2VA 5CZTA 3ITGA 2WSRA 2Y5EA 2WNZA 1EJ7L 3R79A 4JCLA 5FF3A 2EPOA 3WLNA 4XKYA 4M6QA 1H2JA 1R2RA 3EWWA 3IK2A 3MBDA 2G8ZA 3MT1A 1NWRA 4QLLA 5E09A 4N6EA 4CVUA 8A3HA 3GDLA 3RM8A 1BF6A 1EQCA 3TAKA 3LGDA 1UIPA 3GVWA 4IISA 1OYCA 1TREA 3DU0A 5D30A 3DIPA 2YFNA 1TPVA 2A79A 4KBXA 1ONXA 5A6SA 3TZFA 2WSKA 3U0HA 1XLHA 3VE9A 4BWLA 3CEUA 4HYVA 3HOJA 2OWXA 1MRQA 2WJDA 3VOCA 4Q8UA 4CEUC 2VCAA 4I9JA 5LXXA 3IJIA 4YVVA 2E5CA 3A23A 4TR9A 2BOEX 4RDYA 4XBKA 2X0YA 3N2MA 2ZZ7A 3GQYA 3CIXA 3GZAA 2BHYA 5HNRA 4GABA 3TR9A 4M6UA 1E70M 1Z42A 1I75A 2OLHA 3NZRA 1LZOA 1J01A 1LROA 3F4CA 1H1ZA 2Q8XA 4F0SA 3P93A 4KERA 3LNPA 1XYAA 1F4HA 2Y85A 4J3ZA 4NX5A 1MUWA 1R3QA 3BAWA 4MY9A 2YLAA 5LHFA 3F2BA 4NQ1A 1BF2A 3UR2A 1RA5A 2RGLA 2I5IA 4B5NA 4QNWA 2VC5A 4IP7A 4QSHA 4MDOA 3CO4A 3QMRA 1A3HA 2C8NA 1CLKA 3QF0A 2ZCGA 3SY5A 2Y8KA 1CWYA 3CHCA 3IAPA 2DSWA 1C3FA 5AC7A 3NQAA 1DQWA 3CL6A 3PZMA 3GC4A 2CXEA 3QOKA 4Z1CA 4Z2KA 2YA0A 5EMKA 5AY7A 5H8MA 4UIOA 2PDCA 3NIYA 4H6RA 6ALDA 3CAVA 4NJKA 2G97A 4UTFA 3DDMA 3RRXA 3AHYA 1XP3A 3OLGA 2OO6A 3BSHA 4B3KA 4JDYA 3WQ6A 3DYMA 1Z41A 1SW0A 4IT1A 2EJ1A 3SJ3A 4BWLC 3QYSA 1EWDA 5FEPA 3ALGA 1V6WA 1SR9A 2ZOXA 4X9SA 1P1XA 2PDXA 3CQKA 1EUAA 2E77A 2X30A 4L5ZA 2VUYA 1EWEA 1G4PA 3EX3A 4N2YA 1IT8A 2Y89A 3VMOA 4IZGA 1KCLA 5M2FX 3S5ZA 2J7BA 3LOTA 2WB5A 4FX7A 3QEZA 3RLVA 1QNRA 2CLKA 3CTLA 4IMAA 4DF1A 4M81A 1DTUA 2CETA 1EOKA 1B2YA 1FCQA 2QUVA 3SRKA 2Z2AA 3WLMA 1PIFA 2QF8A 4AEOA 4DWSD 3FOKA 4LC8A 4GQGA 3GR7A 1DYSA 4IG2B 1FWCC 3L0KA 2ANUA 2O7SA 3R0UA 2CLFA 1FWDC 3ZT5A 5CBIA 1GPWA 3ITCA 4FX6M 1EF3A 1NDZA 2FDSA 3L23A 1VFTA 4UC5A 5JIPA 1JDDA 1F76A 3BH4A 1WAUA 4MZ1A 3BAYA 1F61A 3CUXA 1R2SA 3IPWA 4JQ2A 4AWEA 2QKFA 1HX0A 3LBOA 3MC5A 4O1AA 1DE6A 1E0VA 3TIMA 4GX8A 4E3VA 2HDJA 1HT6A 2WHKA 1OGSA 2Y5SA 3GXFA 4JGDA 4O0QA 4QFUA 3T2PA 4C6FA 1XLEA 1QVBA 5AC8A 4DYEA 1L2QA 5HATA 3HTWA 3QY6A 1BWKA 1ZCOA 3ORWA 2PCQA 3T4CA 5I23A 2ACQA 4YTQA 3MKCA 4GZIA 5D9MA 1L6GA 4XO6A 2GPTA 1E15A 4XQ6A 3RLUA 3ABXA 5LIKX 3GBEA 3MI3A 5F4XA 4FNPA 2PGEA 1V3MA 2PDPA 2FJKA 3FA3A 4Q22A 2OR2A 2PCEA 2J7HA 1QWKA 5FJTA 3SCUA 4QRNA 3PFRA 2Q09A 1DXEA 2E25A 1RY0A 1LT8A 1LRTA 5BMXA 4C6MA 1SJBA 3MHGA 2VX6A 1B3OA 5CSSA 3ATZA 3WG6A 1LDCA 1S5NA 1KM1A 3GFXA 1VFFA 1J96A 2VDIA 4KEZA 1KFEA 3VOIA 3VTRA 1HKKA 1WZLA 2Z28A 3N2OA 3QV8A 4W8LA 2FZMA 2ZXDA 4U2ZA 3FA4A 1RH9A 3C86A 1UR4A 3T8QA 2OELA 2E5BA 1JUBA 1D3GA 3N9KA 4QJ4B 3TV8A 1V6XA 3TMQA 4Z2GA 4ZQNA 1UIOA 3TNOA 1LM1A 3V7PA 3T0CA 4UQ9A 3V35A 2FMOA 2YKKA 4GI9A 5IHRA 2BNJA 2INEA 3LUTA 2PUZA 3RUBL 3WQGA 3QMSA 2WMIA 2Y8VA 1I1XA 4HVXA 4A29A 5ABEA 2P10A 2NX1A 1FWFC 3A4WA 5MKGB 3NSMA 2XIOA 3U2OA 4ZSTA 5KSWA 1MMFA 1MXGA 4LWWA 2CLLA 3VUPA 2X09A 1TTPA 1QO5A 1SR0A 4R7JA 5FL0A 2Q3OA 5CXPA 1V3HA 4IUOA 2Z0IA 2QPXA 1SZNA 1E4NA 4GYPA 4N9BA 1Q2RA 2BP1A 4OUEA 3TW9A 2OLSA 4I6VA 3HG3A 4HHMA 3SGUA 2BASA 3P80A 4JHOA 2WCAA 2CITA 1KM0A 1B9ZA 4W5UA 3LHWA 4GBDA 3B8SA 5FA5A 3U4FA 4IMDA 4F0LA 2QDGA 4RDZA 3UJEA 1W5MA 2EPNA 1FUYA 2DIKA 4G1NA 4DRSA 4MB1A 4JIHA 3O6AA 5EBAA 2R9RA 2Z6JA 3EEZA 3W86A 1IYXA 3AZRA 3AYSA 1QI4A 1KGWA 1HJVA 1S2VA 5F4SA 4FNTA 4GNVA 2B31A 1UW9A 4IL2A 3KX6A 4DI8A 2WNWA 1K4HA 1KWGA 4V27A 2PLCA 3VNZA 4GK8A 3W7MA 5IBXA 5D38A 3E6EA 2C15A 3TSBA 3ZSTA 1GZGA 3NZPA 4M19A 3ZS4A 5HR6A 3LI1A 2G0WA 1CB2A 4E0CA 3N1AA 2VRKA 3WZ0E 4OBRA 3FHQA 4AQLA 3NPUA 1PX3A 3SURA 3OGVA 4IFOA 3POCA 4I7WA 4FAMA 3WK3A 1JZ4A 4NG3A 4QGCA 5K3VA 3TKFA 1RBAA 3KW3A 3UWEA 2WPGA 3LRKA 4F79A 3VILA 1IXOA 4QLKA 1A0EA 1KCKA 3AZSA 2FB2A 5JH1A 1PX4A 4C6IA 4MJ4A 1XXXA 2FZ8A 2HBXA 4HG6B 3E74A 1VHCA 3PN8A 4W5ZA 5G2HA 1WV2A 1H7WA 3CO8A 4EX4A 1S5TA 2A5HA 4YS1A 1RLDA 5JIWA 3E38A 1UROA 4ROQA 4GZ7A 2DZAA 3OQEA 1L6YA 3I68A 4IMCA 1MQQA 3QKEA 3P0WA 5AYIA 1Y5VA 1GQJA 4H7ZA 3DAQA 3F5JA 3UWWA 1TTIA 4HU4A 1J6OA 2QUMA 1I1WA 1VEOA 2VENA 4PTXA 1EEPA 2E9BA 1W54A 5IBXC 4LXFA 2AL2A 4DNMA 3FCPA 3I10A 3W84A 2IQTA 3EWXA 4WGXA 2QHAA 1W1IE 1JEZA 2W62A 4AC1X 1YDVA 5F2IA 1EJTC 2FTWA 3TVAA 4LJ3A 2BXZA 4O8AA 4WXYA 2V69A 1FCUA 2Q8LA 2WCGA 3BMXA 5EYWA 1T8XA 1GOQA 5A8QA 3N4EA 1KFWA 5FJUA 4CQAA 1JAKA 1GGOA 3AMCA 3TQVA 1U5JA 3MVIA 4DJED 3WJYA 1BXNA 3TYUA 1US3A 3LCWA 3A47A 1A5UA 2SFPA 1LF1A 4POCA 3LG3A 5C2CA 4R33A 1KV5A 3EXRA 4XIAA 2O9OA 2QXWA 3ZXWA 1J79A 3TQKA 1VIZA 3MCNA 1WQ5A 2JQXA 4ZQPA 1HP5A 1IEVA 3HFTA 2IPJA 2J8FA 5DY2A 5DO8A 3TN5A 3LHVA 4FMVA 4OV9A 3IV8A 5J04A 3NQ6A 3BSGA 1XRSA 3RO6A 3BQ5A 4LYKA 4R27A 1P7TA 3I6EA 3BGJA 2YA1A 4F0MA 3JVAA 3CUFA 1NF0A 1R47A 1S2AA 3W2NA 3ABQA 4WEVX 4LVAA 4GIAA 4NI8A 4S38A 1J18A 3TMLA 3W7EA 4PRTA 4LUSB 3WFAA 5C54A 3BMWA 1DPMA 2V8ZA 3MO7A 4AZ7A 2J13A 4B90A 1ZP4A 2PU0A 3AS2A 3TNBA 1V5XA 1W1VA 1PPIA 2GVYA 4UQAA 1DBTA 3QGKC 3OZYA 3RXZA 1J0HA 1JCTA 5T91A 1UWTA 3M16A 5HNNA 1T41A 2O4MA 2QDHA 2VZOA 4QTGA 3OVPA 4JL2A 4XX6A 2QJHA 1WAWA 3OJGA 3VIMA 2PE4A 4GINA 1HN1A 5M5DA 3S6TA 2E9LA 3ZVIA 3EPOA 2R82A 4QDPA 3F2DA 4B3LA 4EXBA 4ADUA 1AVAA 3O15A 3BDKA 3RX2A 5IM51 4FALA 4K6AA 1WXZA 2WZEA 3VZYA 2PGWA 3SRFA 1TMQA 4ZB5A 4Y9PA 2QDDA 3DN5A 1B5TA 3BWWA 5TF0A 2D3NA 2QCDB 1BFNA 3P6LA 1CECA 4IICA 3WJZA 3QOMA 4V2XA 3WLQA 1EBGA 4IX2A 3FLUA 4PTWA 4NJIA 1ME8A 1AH0A 1Y8BA 1IGWA 2PTWA 4Q8NA 4RE4A 3SN4A 4IPLA 4KMQA 1VBJA 2R1PA 3VFCA 3VDAA 3ANVA 3AXHA 2C19A 1XI3A 1SJDA 2QCGA 2YBVA 4GJJA 1GHSA 2VR4A 3AOFA 3AWNA 3MHFA 2Z7KA 2VELA 2J24A 5FF7A 2OJPA 3I4KA 3QPEA 3UYIA 1AW2A 2WWCA 3L65A 2F38A 3WMSA 1LRNA 1E6XM 1YQ2A 2DZBA 2J7EA 3OGSA 4LTSA 6TIMA 4FF5A 2R91A 4UOQA 1TKKA 3RDKA 1K7XA 2WZTA 5C2GA 4JTQA 1JRBA 4WX2A 4BF7A 3W1TA 3WELA 3WNKA 3NQFA 1NM9A 4GVIA 4CNSA 1BRLA 3G5EA 1QO2A 4M24A 4MY1A 3WQPA 2Y4SA 4QE4A 2MANA 3ITLA 1ZRQA 1OK4A 1TV3A 2FHFA 2DIEA 1I2QA 2DH3A 4LB4A 1DJNA 1JZ3A 3VOJA 4Q4MA 5A6JA 3JRKA 2XFYA 1G94A 3KUMA 3B9EA 3GY1A 5T26A 4IGSA 3VCNA 4F66A 3KCLA 3KFTA 5LGZA 3OVRA 1WE5A 4UTJA 1YRRA 4XZHA 5BRPA 4C6JA 1ME7A 1FOBA 3O63A 3E0VA 1T7LA 4HNCA 3O07A 3CUIA 3B8VA 4JEJA 4JTSA 3PBYA 3T9PA 1BD0A 1JPKA 3REQA 3GNDA 4WDUA 4IPPA 1J0KA 2DZPA 2EJAA 3ZWSA 1AUSL 2XUCA 3N2TA 2GJNA 4WOQA 1XDLA 5CGTA 2A3EA 2VWSA 4N7QA 1K9FA 5KTLA 3SCRA 2BOGX 4KCTA 4QDWA 4L1WA 1GVEA 2RDTA 4LYPA 3BV7A 2VMFA 3QN3A 3WUFA 5A3HA 5CGQA 1W8GA 1US0A 1KBLA 3M6YA 2GDUA 3TP4A 3GVVA 3VI2A 3TYAA 4JYFA 2ATMA 3WD2A 2PI6A 1KBBA 3R0DA 1XRTA 4LQ1A 2Z2UA 2CIPA 1E6PA 1GVSA 4UMBA 2PTYA 5I6SA 3HMJG 3H2MA 1Q6CA 3H4WA 4U10A 1KKOA 5C8BB 1QNOA 3ZJ8A 4GY1A 1KGXA 3NDZA 4OBSA 1O5QA 3UA4A 1G4EA 4S3JA 2XWEA 3TAOA 3R25A 5D02A 4Q3MA 1H3GA 1PTAA 3LPFA 4H41A 4MPKA 3PZTA 3LGGA 1GKRA 3MP5A 4I8DA 4M0XA 1BXBA 1O66A 1EBHA 3W26A 1QBBA 1YNYA 3IV3A 4MB3A 2NX3A 1CYGA 3NOEA 3KXQA 5JXQA 4FLQA 2JF7A 1GW9A 1IWPA 3U5YA 1ISXA 3CV6A 1R3TA 5D2XA 5TNVA 4BQ5A 2TPSA 1W3LA 3VX1A 3TOYA 4PFMA 3OBAA 3MSGA 2CEQA 1MNSA 2GQAA 1EDGA 4TXEA 2UY5A 3SZ8A 5U7SA 4EP8C 4L4LA 3D5HA 3DHFA 4GH1A 4NZCA 2CESA 3TE9A 1GPFA 3E0FA 3GXNA 3SUVA 4HPHA 5AYBA 4PUKA 3CIVA 1UUOA 2F2KA 1IEQA 2YXOA 3N29A 2D2HA 1U5HA 3CZJA 3GKAA 4AY1A 9XIAA 1YBQA 1NOFA 1TZ7A 2OZTA 1KLYA 1Q3NA 3K5XA 1SFTA 1YXYA 1ISVA 3S1VA 1PWLA 2WMHA 1UR2A 3ATYA 4GGBA 4K7YA 1UWRA 2PODA 3SI9A 3WK0A 1YXCA 3A3WA 4JHMA 2V3EA 2QPSA 1DIEA 2A2IA 4M56A 5AOUA 1K8XA 2J27A 4MNLA 5HA7A 3T78A 3CH9A 2YL9A 3GTXA 3HQPA 3DESA 2AQVA 1S39A 3URNA 3W88A 4JOMA 4DZAA 4AD5A 3ARZA 2A0NA 4PMDA 4F0HA 3UWYA 1JPIA 1TV8A 3NEVA 3KVMA 1PEZA 3AYTA 1IZKA 1MXSA 1W9VA 2X2YA 5D05A 4DY1A 4AWTA 2C1GA 4DQWA 2ZTJA 3AI0A 4D6JA 4JFUA 3ZOAA 4GUFA 4NZ1A 1J8VA 2XZ7A 5M17A 4H83A 4GQQA 3PFMA 1GK8A 2VCCA 3LXBA 1GJUA 1PZ1A 2E4TA 3WEOA 4PCPA 4Y8FA 2F84A 4A2SA 4AYSA 4GFSA 5CG7A 4A8LA 5GQBA 1AK5A 2X16A 3SJNA 2NQHA 4LGXA 3N6HA 2E09A 4PYSA 3EBVA 4MWAB 1QXLA 4RV8A 3BZGA 3EOOA 2WZMA 3PTKA 2WO5A 2WBGA 1W1YA 4H8VA 3QYQA 4DLFA 4W7UA 3S46A 3EPMA 5F2LA 4WD0A 3LMYA 2GJRA 3N25A 1QOXA 2WC3A 4MKSA 3ZFHA 2E6AA 4M29A 4CN4A 5I24A 1RCQA 2R94A 4H2CA 4JTCA 1G69A 1W6TA 4HP5A 4MB5A 3SB0A 2ZVIA 1XH0A 3IJ8A 4I6KA 2QUUA 4P7RA 4MUZA 3KDOA 3EX1A 2ISSA 2OVLA 2YB1A 4XZWA 4C1KA 1H1YA 4KESA 4A6GA 3BLPX 1MUMA 4LY4A 4S2BA 3C0SA 1M6JA 3AHXA 4W7VA 1PUDA 1ITXA 2PDYA 2WLZA 3G77A 3P62A 4LT9A 5TD4A 1C8YA 3FVMA 1TX0A 4RL3A 1RY8A 2X42A 3S2MA 4CQ8A 4WVXA 3OVQA 3FKKA 4HNTA 1EC9A 1K3UA 4V33A 1N55A 2EBNA 2CCRA 4XD4A 4UNIA 3NQEA 3WENA 4R9XA 1JPDX 4B9ZA 5HWMA 5K2ZA 1BAGA 4C7DA 1KGUA 1ODUA 1KWKA 1DJHA 3UYCA 5BXTA 3FJ6A 3KLKA 2HNHA 5DRCA 3PJXA 1CPUA 1XIDA 4EXAA 1F6YA 3INPA 2PLKA 1LOSA 4S3FA 4MDPA 1JR1A 2VRJA 4KRZA 5EMUA 3C61A 4FNRA 1TA3A 3U2CA 1C8QA 1A5LC 1RLCL 2W3ZA 3N9RA 4HOZA 1YTEA 2R1MA 3RLHA 4MF4A 3BARA 1FH7A 4EACA 5IOBA 4RX0A 1AW1A 4MIMA 1G4TA 4GGHA 3S5OA 1NAL1 3GSMA 1WXJA 4K39A 4QS6A 3RILA 1RVKA 4E6MA 3M46A 4WY0B 1M3UA 4J3VA 1GORA 1PE1A 2PDQA 3MO4A 1ZB5A 4MUPA 3E5PA 4E4UA 4L9YA 3SQMA 1ZBKA 5HUOA 5HWNA 1R9ZA 5C5YA 4FXSA 3SN0A 3CAWA 3SN1A 3AO0A 1JCXA 3S1GA 1LG1A 5AHEA 4TOQA 1H0GA 3ONCA 1W3KA 4UUIA 1W0MA 1F2JA 3QR1A 5BWFA 2J79A 3TTYA 2DSVA 5CJ5A 3KRBA 4HGXA 4Q33A 3QHOA 3CAKA 1MEHA 1BEUA 3T55A 3A24A 1LWIA 5LHEA 4EE9A 4ZO6A 1SZEA 5K9CA 1CDGA 3HJEA 4GE8A 1CGXA 2YCIX 2BHZA 3MDWA 4ZB0A 1DORA 2GWGA 4RNIA 4KRUA 3URBA 1FFQA 2ZUNA 3RFAA 1KRMA 3MMWA 3AMDA 1JAEA 1ISWA 3H8AA 5GNZA 3DEQA 2C7FA 2DUAA 1BGGA 3MA8A 3EDJA 3JW7A 1F07A 4Y9OA 3ZQ9A 1V02E 3AQUA 4UR9A 3GNOA 5I00A 2J7DA 2OZ3A 3AHZA 4L4PA 3W23A 3OODA 2VVSA 4Q4SA 3GDRA 2HWGA 4ZODA 2AQWA 1GEHA 4GACA 4KEMA 2C1HA 4JN6A 3GHUA 2VCBA 1HVQA 5C2XA 5KEZA 3MYOA 4IL0A 1EA0A 4K8GA 3LHTA 4C1LA 3NM3A 4DUVA 1KFKA 3KP1A 2W91A 2ZA3A 1OEPA 2TRSA 2IS7A 5DEZA 1JDCA 1I2NA 3F4WA 3H26A 4ZL1A 3CYJA 4H2HA 3BW4A 5MF5A 1P48A 1UPPA 5HR7A 2Z1XA 1TFVA 3LQLA 4WCJA 3NO1A 3BG5A 5H2ZA 5HMDA 2OKOA 2PWFA 1K7FA 5FESA 1TMHA 3UR8A 5BCAA 1P5BA 3QV7A 4M7TA 3B06A 4GIEA 1PYMA 1I9CB 2OKTA 3A4XA 1JPHA 3UZJA 1GKQA 3VDBA 3KTCA 4B5XA 5DN1A 2AKZA 1KTNA 3G0SA 4M80A 2RAGA 1OCBA 3LPOA 3L12A 1XH2A 3GXTA 2GFTA 3LCFA 2G37A 1PCKA 3ARQA 1KFCA 5E9XA 1NSJA 3ZT7A 2TSYA 1HW6A 5DANA 2DEPA 3GS6A 3BO9A 5CJNA 1TWWA 3IRDA 3UG8A 1P0DA 3TZNA 3TYDA 1HGYA 4JTUA 4K1GA 4MOZA 3UY7A 4M1RA 4AHQA 1XL9A 4JFTA 4ORIA 5CPLA 3PUOA 1TPWA 4H9VA 1EDQA 4EXQA 2W4XA 1XUZA 2GDVA 1SFLA 4MWAE 4WJ8A 1DJZA 4J2PA 3ZJ7A 1IZJA 2OTDA 3N73A 3I7QA 4CKQA 3O3RA 2QJJA 2REQB 1LUCB 1VYPX 3T81A 3PUGA 1XS2A 1YDOA 4EK7A 4QITA 4KW2A 3KVKA 2VZTA 3CM4A 1V0MA 4DVOA 4EAMA 3R0KA 2PTZA 3HZ3A 1TUXA 1TCDA 2G50A 3OLIA 1A5BA 3WQ5A 2IKHA 2QIWA 4AIUA 4BI5A 5JU6A 1NFBA 3ONBA 3QSRA 4OKDA 2WVUA 3NDOA 2C1IA 1ICSA 1TPC1 3CV1A 2YX0A 1U30A 4D6GA 4CQBA 1E1CB 1OM0A 1X6UA 4AWSA 1FY6A 3A13A 2YXXA 4N9CA 3DHDA 1WUFA 1V6UA 2XHYA 2O0TA 3DFQA 2DZUA 3HPFA 2BXVA 3T40A 2DUXA 4Q4PA 3FA5A 2HZGA 2RUSA 3M0JA 4X9YA 5DCBA 2XJ7A 4UQEA 3QHNA 4GD0A 4LFYA 3DG7A 3BG9A 3H12A 1DL3A 1TMLA 3H54A 3IVTA 1GZJA 3NQ7A 2PA6A 1SW3A 4F48A 1J11A 3T0DA 2WYSA 1PL9A 4X61A 4UFKA 4N4PA 5HANA 4IGNA 1HKMA 3B8WA 2UY2A 2ZX7A 1TIWA 1QI2A 4KIRA 2VT0A 2ZRXA 1X97A 3G6MA 2VP8A 3RIKA 4J3SA 3ZR4A 3ITXA 3M4HA 1EC8A 2WK2A 3VD5A 5ABGA 1VH7A 3GUWA 2ZZ3A 2Y1HA 5ABFB 3ARXA 4AD4A 2GUBA 3NO5A 5CJMA 3VK5A 1E6RA 2DU2A 3GBDA 6XIAA 2QV4A 2BSLA 3TLLA 1VHNA 4Z1YA 5AC4A 2FZNA 1I6NA 4E4FA 2E9MA 4I7VA 3HGOA 1SU5A 2O92A 2FVLA 2WHLA 3N6QA 4YCPA 1A3XA 3V18A 4ZEPA 2P76A 3ERPA 4DM2A 4UTIA 2HSAA 2V5DA 1OBAA 1TJ2A 2ZDSA 2YYUA 4IMEA 4A35A 1UA7A 3ANYA 3A9IA 3G1XA 4NNCA 1ZJHA 3FJ4A 1HO4A 4US6A 3SBFA 5H8UA 2QLYA 4RPPA 5DCDA 2ISWA 3E5BA 4AD2A 5A95A 1TQJA 3C4UA 4ICNA 4PUDA 3GX9A 4D6CA 2OT0A 5SWUA 1QK0A 3M7WA 5A6LA 4PH6A 3TQPA 3CS2A 2JKPA 2GSEA 3GTHA 1FHUA 1KA9F 3AMLA 1JYWA 2VGIA 2XIBA 2WKGA 4IGMA 1HJSA 2C14A 4H9MA 1XG4A 1AODA 3W7LA 2YBUA 3R13A 1FWHC 4OWGA 4HQVA 3HGJA 1I0DA 7PTDA 3BANA 3F2CA 2ODOA 1ZZMA 1H63A 3P8IA 3OOQA 1XBYA 1DOSA 4C90A 2WBKA 4NZFA 3GTNA 5D2TA 4Z1BA 1JJKA 3CV2A 4IOTA 4OBTA 2ZXQA 2VQTA 3QMTA 5CEWA 2ACSA 9CGTA 3USBA 4F40A 5H91A 5H8PA 5G2IA 5CAKA 1OD0A 3CT7A 4DHGA 1R3SA 1NWTA 7ODCA 4NYYA 1AA1B 3OQ8A 2OWWA 4XAZA 3ALFA 1ZL1A 1WBJA 2PRMA 4AXNA 2EPKX 1UB3A 3TTOA 4CQCA 1BWLA 3M0LA 1OCJA 2ZBTA 2OODA 3W71A 3BCFA 2YBTA 1Y7VA 3IJLA 3TN4A 3T44A 3TWBA 2G95A 3OG2A 3KS5A 4J35A 1DJYA 3UXKA 5CZJA 4UTLA 4MLRA 1FWWA 1PWMA 3IVSA 4KWSA 3V0SA 3W1QA 3WBWA 4GWEA 1B90A 2GK1B 4JTHA 1ZUAX 1G1YA 3V16A 1F3TA 1VENA 2O9RA 1Q7MA 1PXGA 4HCDA 2QJNA 3OBEA 1LL7A 3SCSA 2HEJA 1XFCA 2TAAA 2WZIA 1S1RA 4S3BA 2EQDA 4ZTXA 1XYMA 4FXJA 2DVXA 4G1KA 4XZIA 4H6KA 1Y65A 1SMAA 3G22A 3WBYA 3SY8A 4JX6A 5PTDA 2MNRA 1OIFA 5FEWA 3B8TA 4O13A 2I9UA 3FJNA 1LG2A 4AB4A 4NZ3A 4GG9A 1EO5A 4CGTA 3LY0A 4AF0B 4L4MA 2XFWA 4FHAA 4LBUA 2VX7A 3LCXA 4LPCA 3BJFA 3GG1A 4FZIA 1WUEA 3P0XA 1M53A 1K9TA 4JKMA 4L65A 3UVAA 1LQ2A 2Z1BA 3P61A 1DJQA 5CG0A 1GONA 1JI2A 1XM3A 3EEGA 1O68A 3QTGA 4IQLA 1J12A 1UC4A 4TVCA 1UKSA 4WRHA 3B0PA 1W9XA 2J9XA 2VEKA 2ABAA 3EYPA 5MHBA 1KW1A 4GBUA 4CD7A 1TWDA 3L0GA 5A1AA 3QM3A 4QSFA 1QAPA 5JMUA 2WC4A 1UOKA 3S2NA 1JF5A 3KAOA 4R9OA 4UTMA 3THCA 1AQMA 2J7FA 3SCOA 4Y2WA 3EKGA 1UMYA 4TIMA 3NSXA 4R7WA 1S3HA 2Y62A 3B0UX 4J28A 1RCOB 3OHMB 3TFCA 2OQHA 3UGVA 1E3XA 1OJXA 4UFHA 5G5IA 3ZWTA 2GGIA 2WXDM 3QW4B 3WJSA 5D03A 2HK0A 1UOZA 4PL2A 5AYYA 1DIKA 4GISA 3LM7A 3FYPA 4ZA0A 7CGTA 3KL5A 4OT7A 1VQTA 3JU2A 3GH4A 1L0PA 1JD9A 3N2BA 1XLMA 1W5NA 2UY4A 3E3HA 3MCMA 1A3WA 2B7OA 3CZGA 3E96A 4GA8A 3UZWA 1KM3A 4PL1A 1Q7QA 4TV6A 3KL3A 4NAFA 4M7SA 3CZ8A 4ENLA 1T8QA 5F1VA 3GHSA 4C6EA 5DBUA 1PIIA 2DFAA 3BLIA 1JQVA 2LLEA 4JTIA 4IUGA 1NDVA 2QAFA 2CZFA 1IIHA 4RLIA 2PFHA 3FGCA 3GK0A 3N2XA 2VM8A 3IUIA 1TWIA 1HTIA 4K7VA 4PEEA 3PSVA 1U2YA 2C13A 3P8JA 2DW7A 2PD9A 2Z7GA 4YWSA 5M1TA 3OLEA 4ZENA 1RJRA 4DF0A 2BMBA 1QDSA 3CAQA 4UCGA 4ZOBA 5FI8A 2HS8A 2I7GA 4Q7NA 1Q45A 2I1OA 1J5TA 3GO2A 4AW7A 3AROA 1OFPA 3KRSA 2NXHA 3BVJA 4HSOA 1I2RA 3IIXA 3CH0A 1EDTA 4DELA 1XD0A 2H6RA 4XKYB 1LORA 4CCEA 4WIWA 4DM1A 4KWWA 2AQOA 2F61A 4GOAA 4D8AA 1DIDA 1YNPA 5BU9A 4XZMX 2ISFA 1R9YA 1Z3NA 3PP7A 4IP5A 1W1TA 3ABOA 4HJFA 1S2CA 3K8LA 5FSEC 3STPA 3WQDA 1QPOA 2ICSA 2WOQA 4V28A 1DVJA 4O10A 3U4AA 3B0VC 4S3EA 2DSKA 2G4JA 2CLOA 3NJ3A 3THQA 3B4YA 4QXIA 1T99A 2QAPA 3UF9A 3O9NA 2YW3A 1WB0A 4H4IA 3MI6A 2BZNA 5EMYA 1E9IA 4GQBA 3EMCA 3ARYA 2ESCA 1FH8A 4ZB2A 3R4IA 5DQPA 3RJYA 3W1LA 1MI3A 4CN6A 1BPLB 3RPMA 5CLTA 1LT7A 1M04A 1QI3A 4FPSA 1AD4A 2RJHA 3LBCA 3PTDA 1PB0A 2QVHA 3VO0A 3L4UA 1GQLA 2BS9A 2PLJA 3L4XA 3VNIA 2B0MA 3PTQA 3HPXA 1UR1A 2A7NA 5C9XA 3W01A 2ABBA 4X0NA 7REQA 1NF7A 3K4DA 3NYDA 4S1FA 1ICPA 2XVLA 5G1YA 2P50A 1JXKA 3TWAA 5A69A 1FKWA 3LX9A 2Z27A 2ZIDA 3DFHA 1XYFA 1EUNA 4B4FA 1HKJA 1E9YB 3DKJA 5I2UA 3URQA 2EG7A 3FS2A 4LSBA 1TWSA 4KCUA 5LNUA 2HNEA 1JQXA 1LBLA 4B5WA 1YEYA 3AHTA 4D8ZA 2CZVA 5CPSA 3ARUA 3WX7A 2D69A 2AL1A 3PPHA 4E2VA 1UR0A 4I5UA 1XCWA 4I5RA 2WHMA 3GC2A 3I3DA 1GQNA 3L9CA 1X1ZA 3A5VA 2CWXA 1TPB1 3O2LA 4ATDA 4B5TA 3V4BA 3KHJA 4GUIA 2FFCA 3CXOA 4GI4A 2CLPA 1PTGA 3BICA 2DW6A 5DELA 3B8DA 2XVNA 3U2EA 3C3UA 3HG2A 1XLAA 5EPDA 3PNZA 4RCXA 1AG1O 2ZTKA 1QUMA 3U57A 4XAYA 5BOOA 3KWXA 4IWWA 1CCWB 4ZTYA 1J0ZA 1N8IA 5EB8A 2JIWA 2W63A 3W02A 4B3ZA 4GYFA 2ZC8A 4UXDA 3E2QA 1O6IA 4JN7A 4CU6A 4C6NA 3EMQA 1DJXA 4WDTA 1F3EA 2BB0A 1XDMA 3MDUA 4HU8A 5E5CA 3N18A 3DUGA 2WAGA 2OQLA 5BMWA 1KNWA 4QX4A 5A2CA 3O8AA 1E4LA 3G1DA 4M3PA 4HK7A 2VQUA 1PDYA 4JTDA 1UD6A 3CL7A 3THDA 1UH3A 2R6OA 3G6LA 5BRQA 3M0IA 3O6CA 3K46A 4ZSUA 4XTIA 1PKMA 4GZJA 3RO8A 5HPOA 2CLHA 2Z29A 3AIBA 5GJMA 5D8WA 1VLWA 3I3BA 2CWNA 1XICA 3ES8A 1ONEA 1XLFA 5LXEA 1ZBCA 1EP3A 3K2GA 3WH7A 3WJWA 1M7OA 1ODZA 1UR3M 4FS9A 4DO7A 3LB0A 1K70A 2IPFA 5A5WA 4GIYA 1C7SA 4JTGA 1TVLA 1B31A 4JEQA 3UCDA 2WMFA 3FKRA 2EF9A 5E0KA 1IEWA 1UD2A 1LJYA 3GAKA 3TONA 8XIMA 1J2BA 5I09A 3VKAA 3KCJA 4DN1A 1JI1A 4ZCWA 1WO2A 1KBIA 2ACRA 2QCNA 1IGSA 3COTA 1T0OA 1R6WA 1R46A 4PA8A 2H3DA 4WY0F 1X8FA 3SM0A 3LHYA 5IDIA 3ABZA 1JGIA 2FQIA 2OEMA 4ACYA 1A53A 4PTMA 3CBWA 4LEQA 2Y7EA 4HMNA 4ZVJA 3PHAA 4D1IA 5D37A 1XIJA 2ADAA 4NL1A 4UNLA 3G3DA 1R3RA 2P0IA 2VX4A 4Q8TA 2V2DA 1CGYA 4A4AA 3PJWA 4HOXA 3CJPA 2WVVA 3W7IA 1H7PA 4HBKA 2PRHA 1CX9A 4HZ6A 3UBPC 3GE7A 2DORA 4ORMA 2D2GA 3EOSA 1M03A 2Y88A 1F5ZA 3QZAA 2VFHA 3SO7A 1E73M 1EGMA 3DH7A 3VGEA 1V79A 1A5AA 3K8MA 1JZ6A 1XYBA 2A7RA 4RZ5A 2JK2A 2PBOA 4KEVA 2KX9A 5AYXA 4YTSA 3KL0A 2RFGA 3NA8A 8TIMA 5CGMA 4K8EA 3RU8X 1YIXA 3PR2A 1UKTA 3W85A 1JZ5A 2WMIB 4GNJA 3TW7A 3IACA 5ECUA 3NQBA 4O52A 1OC6A 5C9UA 3N14A 4KFPA 5H1WA 3OO2A 1Q13A 3WCZA 1XQKA 4CU7A 4HU0A 4AU0A 4M6VA 1OT2A 2W67A 4FOKA 1OZQA 4NNBA 5EMMA 5F1UA 3FK4A 4NZ5A 3VD9A 4LUSA 1WKFA 3UCQA 1UQYA 4Q8VA 1BSIA 1S2TA 3ZM8A 4ZOEA 3BV4A 1V6VA 2P53A 2GSHA 4TX6A 1KCXA 4EPKA 1TIMA 2CU0A 3MUY1 5DFAA 2H8XA 3ZIZA 1UWSA 4KIEA 2QF7A 4LS0A 4UFJA 3VNJA 3B8UA 1EQPA 1UH2A 4KKXA 4CD5A 3L4ZA 2H90A 3S1UA 2A6LA 1X39A 2PTDA 2DGAA 3IUDA 1L8PA 3N3TA 2WLYA 4D71A 3RPTA 3VA8A 3EWYA 2IQ0A 4JCMA 1X38A 4I9MA 3L68A 3WF4A 4Q8PA 3DENA 1WDSA 3UFYA 3K30A 2A6NA 4PB4A 1YADA 4LYQA 1QPKA 4IM4A 4AH7A 3RMEA 1XFBA 2QCDA 3GIYA 2EKGA 1Q6OA 4QJ5B 1GYNA 2I14A 2X1IA 5HUPA 1QW7A 2DUZA 5D9NA 4PFHA 3MWAA 3WLRA 3GZ3A 4LVGA 1A5OC 3H6OA 3UR5A 1NWUA 2X7WA 2DIJA 3WQFA 4A2RA 1H41A 2ZC1A 2A3AA 3H2AA 2PRLA 3M43A 4E5TA 2FTYA 3FYOA 2NUXA 2F2HA 3U2ZA 1UD5A 3WK2A 4C6PA 3LZ5A 4IIHA 2J9ZA 2JE8A 3R7MA 3WO8A 1VEPA 4LNCA 1XF0A 1JVNA 4DYJA 5K4XA 2DSUA 4OV4A 1ZNNA 3AFBA 4AHOA 2XN2A 2VDGA 2PZ0A 5F2MA 6A3HA 3T08A 2HXTA 5HQLA 2J74A 1ZBVA 4D6DA 2VFIA 2PU1A 2KAUC 3A9BA 3VIFA 4Q6JA 3OZMA 4GJ1A 3ES7A 4YHEA 3OZPA 1BXCA 2EO7A 2V3GA 1H7OA 4OZOA 3W1MA 1WZKA 4DXKA 3VOFA 3A4JA 4LEFA 4RZ6A 4UZUA 1D7KA 4AMCA 2YFOA 4YTUA 4ERGA 3V5OA 3FFSA 4Y9MA 1JYNA 3UXDA 3M07A 4JNZA 1E4IA 2NQ9A 5F7UA 4QLJA 1CLXA 1V0LA 5LA1A 2ZZ4A 1QATA 3P2VA 4HHLA 6REQA 7XIMA 3IGSA 5A6BD 1RZMA 4MGGA 3PBWA 5HJLA 2QQ6A 4J3UA 2J78A 2PWHA 2J88A 4LOCA 2IW0A 3G1AA 4IGHA 1ITUA 1OADA 2A3BA 2P8CA 1DWGM 4HA1A 2NWRA 1VS1A 2W5FA 4AG0A 3EA1A 2IPGA 4PZVA 3PJTA 1VGAA 3QRHA 1VF8A 3FDKA 4NIRA 2PSNA 4XD3A 1FHDA 3UQNA 2O9TA 5A2AA 5D2WA 3BZJA 4PUJA 5U4NA 4WLCA 3TN6A 2HK1A 3VDHA 4GI8A 3CUGA 2YXGA 3CHVA 2F9RA 3FNDA 1NFPA 4AZ6A 4BJHA 2PPGA 2XH0A 4XB3A 1OFOA 1XLIA 1EP1A 1JFHA 1ONWA 1D8CA 2VRQA 4H9YA 1SZFA 5I7GA 4LV9A 4LAOA 4ROPA 2VD8A 3FN9A 1MWOA 2L5HA 2CKSA 1BVZA 5AFDA 3QC0A 4BFAA 3SFWA 3AICA 3XIMA 3SQSA 1YDNA 3HPAA 2KZHA 1L9WA 3M7SA 3WEZA 4FNUA 1TRIA 2NZLA 2QCFA 3SGZA 2YZRA 4WZHA 3EAUA 3U7BA 4YU1A 1E3ZA 3WJXA 2F8QA 1F73A 5FEZA 2ZQ0A 3KBNA 1QI5A 3VINA 1XHGA 4TMBA 1SQ7A 4GQRA 3PZGA 3IUHA 5G2WA 4GLEA 1Q7ZA 1UH4A 2H8ZA 1WXYA 3S5SA 4GX9A 4H8NA 3BQ6A 2PP1A 1EPVA 5AC6A 1LL6A 1CW2A 4JD4A 5EFFA 2PAJA 2V63A 3IJ9A 1DE5A 1CGTA 5I77A 4ONVA 3IAQA 3I65A 1W1A1 3AAMA 1XCXA 3VFLA 1VFOA 4HT3A 2O4QA 3CL8A 3VKDA 6PTDA 2BVDA 3BAIA 1EJUC 2CYGA 3VOGA 1L8NA 3PAJA 4G2DA 1D2KA 1UC5A 4HPGA 3STGA 3H7RA 3KZPA 1WP6A 1WNOA 3ITVA 4H3DA 4H00A 4KWVA 2DY3A 4ML4A 3VIKA 3P60A 4QIUA 5D32A 4F2UA 4RE2A 2I5QA 4JXCA 1TTQA 2E1DA 3VNYA 4GVGA 5K7JA 3KOYA 2ZXAA 3ITTA 3RRAA 3U3HA 2PDFA 4ICMA 1US2A 3LD5A 4WSJA 5B7YA 4MB4A 4GH3A 2PF0A 3QHMA 1GCYA 1MVYA 1IXPA 1RBOB 2HE8A 1NWSA 3H2OA 4EPDC 4GCAA 3FHAA 4DO4A 2WQDA 3T7VA 3SCNA 4YCOA 4FEZA 1EIBA 3M44A 2CZEA 5K9XA 2Y7GA 2NQLA 4H04A 1BRLB 3ZMRA 2ALDA 5ECVA 3IGHX 1QOPA 1R5YA 1F9CA 2DZWA 4AIOA 1THFD 3W00A 3QTPA 5D33A 1RPXA 5E1QA 3LHUA 3CV7A 4FXRA 4LU0A 4PC8A 2V5CA 2Y70A 1G9HA 4LX4A 2EPHA 3TC3A 2OZ0A 2QV5A 4QG8A 1XINA 4O12A 2Y6ZA 1FFRA 2HPMA 2ZA2A 3UPWA 4QR6A 4L9XA 1MW3A 2YOCA 2WC7A 3O0KA 2VEFA 2NWSA 3NUKA 1YE6A 1VBRA 3REQB 2GLKA 1X96A 3R11A 3THUA 3MV01 1X1NA 4P7OA 3GXDA 4LAMA 2PDKA 5HMEA 3VNMA 4R3UA 3PY2A 4IIDA 4U4MA 2VOMA 1BHGA 4WR3A 4HYRA 5DCEA 2QVNA 3BE7A 3UY8A 1F6KA 1KBKA 2PMQA 2H9AA 1K8CA 1XLDA 1W1PA 3S9YA 1W3JA 5XIAA 4O15A 4G7EA 2MUCA 3HM7A 3UG3A 3UZZA 4EF9A 1UR8A 4I90A 3W4RA 4DWSB 1JZ2A 2D20A 4FIQA 3WNOA 3CZLA 1RR2A 2FKPA 3AYRA 1YPFA 3UXAA 1Q65A 4CD8A 3QFWA 3GG7A 4HNVA 3KRUA 4C6CA 5I3IA 2JALA 1XQLA 3DECA 4DZHA 5I06A 4A3HA 1I4NA 1KFLA 3W28A 5I5RA 5KETA 4DWDA 1HKVA 4CEXC 3OIXA 1NOWA 3I6RA 4DBWA 3H21A 1DWFM 4HHPA 2TMDA 1U5VA 4N4QA 1EGVA 4AZ5A 1K02A 5I78A 1H51A 3LRMA 2WJFA 2FFIA 5IFTA 3LV5A 2I9EA 1PIGA 3RAOA 3R10A 4I9AA 4DX3A 3WEMA 2AOSA 1UHVA 3NL6A 1RD6A 1Z44A 3B05A 3HQ1A 1I2PA 3WD4A 3W7RA 1GOOA 1M1BA 3EOEA 3VIOA 3UPBA 2WQPA 2YJQA 4BKNA 1PVNA 4AFYA 3DBNA 3CPGA 4JTEA 3L4TA 4GVFA 4C5YA 1C91A 2QDEA 3D47A 5GNYA 4RXFA 5CPNA 3NSNA 2PDJA 4RJEA 3WQWA 3IIVA 1CI1A 3E9AA 1RPKA 2A85A 4KCVA 2BY1A 1M7XA 4H8UA 1TE1A 5I3JA 3AXIA 4R88A 4ZZ9A 2Z6IA 3KDNA 2QUTA 1M7JA 3STEA 1TSIA 3W6YA 3T09A 4HCLA 4J2MA 1V51A 2R1LA 2A1YA 1GG0A 1T5AA 4JTTA 4PR4A 2YL5A 4NXSA 1CXEA 2ASHA 1YBQB 3C2OA 3RYSA 3VGHA 1DP0A 3G18A 3WL0A 4IQJA 5BROA 2XFFA 3BAJA 1LL4A 1AMKA 2GZXA 1IXQA 3W7KA 2Z00A 1OGGA 1FTXA 4JQ1A 2POTA 2HVOA 2I17A 3T4WA 1GHRA 4Y7EA 5HK4A 3W1RA 3M5YA 3DI0A 3SCPA 2BFGA 4KGLA 3TN3A 4NASA 2FDMA 4C91A 2OFJA 1N8WA 2V81A 4QCEA 2YSWA 1XGZA 4ZE5A 2C6QA 3VGFA 2Y5JA 3AS1A 4PMNA 1HFBA 4JBRA 3VVGA 1REQA 1W56A 4PMXA 2VKZG 3LN3A 1WKDA 3UWQA 1MSSA 2D24A 1W3NA 4LBSA 3WQOA 3W2JA 1EJSC 1E0XA 3EGJA 2D3LA 1GJPA 3EPNA 1RJQA 4G6CA 4H6EA 4PCSA 3SY1A 2RDWA 4N6FA 2OSYA 9XIMA 4F9JA 4DUWA 2FLIA 1J10A 1OHLA 4KWUA 5KMYA 1YE4A 4UWMA 2E7FA 4D8LA 2D1ZA 1P6CA 2R14A 4O50A 4Q4KA 2OEJA 1GJWA 4C6LA 1O94A 4JTLA 2VEMA 1TPDA 3FV9A 3MUAA 3ZJ6A 3LCGA 1W32A 1XIGA 1D3HA 4R53A 2EXOA 3QR0A 4QQ3A 3WMBA 5KZ6A 1R85A 2BTMA 5LIUX 4HSNA 2FH6A 3LCIA 1OFDA 1CLVA 1JCMP 4AZCA 4Z1DA 1V0NA 5HOSA 1H60A 1UPMB 4FOJA 4NX0A 1K9DA 3GHTA 1VZWA 1R7AA 1O1ZA 4JKLA 3AIUA 5D8ZA 5DT5A 1TQXA 4LS1A 1KB3A 3F03K 2NSOA 1W8SA 2VO5A 3KBMA 5HJXA 4GY7A 4QG9A 2QULA 1QK2A 3CHFA 1ECEA 1EF2A 3Q4DA 4KFOA 3W81A 3CMJA 2JBMA 4CCDA 1FHLA 3CK5A 3T05A 1F3WA 4Q4OA 1QU4A 4JHZA 2VJXA 2INFA 1UKOA 3PBVA 1N8FA 3B3DA 4FSAA 1Q66A 1X7FA 4J9JA 4MFDA 1OGBA 4OE7A 3P14A 3WH6A 1XLJA 1E6ZA 1ZU8A 2OO0A 3LPPA 1VR6A 1EJWC 2ZFAA 1FQ0A 2D2OA 1JDAA 4BZYA 4ZMGA 1XSIA 3GRIA 3WFLA 1VKFA 5I79A 2V30A 3KRZA