2GK1B

X-ray crystal structure of ngt-bound hexa
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
54
structure length
54
Chain Sequence
PALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-hexosaminidase subunit alpha
publication title Crystallographic Structure of Human beta-Hexosaminidase A: Interpretation of Tay-Sachs Mutations and Loss of G(M2) Ganglioside Hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 5
structure length 54
sequence length 54
chains with identical sequence D, F, H
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gk1B02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 2gk1B01
4CN1A 1W9UA 3F4VA 1WDPA 3LPPA 2CERA 2E9MA 1ISYA 3IAPA 1HVQA 2VZOA 3RM4A 3WQWA 1PJ9A 1SYTA 4X9YA 3AMLA 1JAEA 4ATDA 4C90A 1UWIA 4CD8A 2WPGA 1NH6A 3DECA 5BWFA 2ZWZA 5D9MA 1UWTA 4GKLA 1O6IA 2DIEA 1EHAA 2WMJA 1W3KA 3EMQA 2JIEA 1NWSA 3GTNA 2W66A 1BVNP 4CVWA 2OSYA 5CGTA 3W81A 1BPLB 2G3IA 4PSPA 5GQBA 4JL2A 4LYRA 1ZS2A 1VB9A 4J27A 3VPLA 2OYMA 1QI3A 3CMJA 1W1VA 1WDQA 1BYCA 1XD1A 2WK2A 3NJ3A 5A6SA 4TTGA 2JIWA 1WAWA 2QPSA 3D3AA 3S6TA 1C7TA 2VO5A 4MJ4A 4UQBA 3PZGA 2O9OA 1CGXA 1LQ0A 4DUXA 4AD2A 2ZX6A 2Q8XA 3AYSA 3BLKA 2A3BA 2V5DA 4IPNB 2ZUTA 4PMNA 3ARRA 4GO9A 2QF8A 3WDHA 3AXIA 3CUIA 3FHQA 1EDGA 2PWGA 3VGDA 4H8UA 2BHYA 1QVBA 4F9JA 1E4MM 3GH7A 4JFSA 1GZJA 3BCDA 3HN3A 3MSGA 3ARTA 1KFWA 4TX8A 3WBEA 3WF3A 1XD0A 1QNOA 2D3LA 5A6AA 1VRXA 5A8PA 4B15A 3F5JA 1KGXA 4UQEA 1V3LA 3ALFA 4D6CA 3FHAA 4DWSB 4JFWA 2DEPA 1GNXA 3WNOA 3ZJ6A 4P7LA 4BA0A 1NWTA 1VAHA 1JGIA 4PTVA 1B1YA 3NYDA 2VCCA 4WLCA 1E15A 1B30A 1XSJA 3U5UA 4EKJA 3OB8A 3ZOAA 3W37A 1W2VA 2J62A 1FA2A 1H11A 1BQCA 4JCLA 1UQYA 5FKYA 1ZBVA 1E72M 2EJ1A 3T0DA 2XWEA 4Z2KA 4TTUA 3ZSSA 3WD3A 5ABHA 3WDJA 1VJZA 4CN6A 3S2CA 2WMIA 4UFKA 1R8LA 1JZ8A 4FF5A 2WCSA 2V3FA 2QMJA 2WHLA 2CNCA 4PMDA 2E40A 3MUIA 3ARUA 3N15A 3CLWA 1RD6A 5A6JA 3NIYA 5C71A 4AD5A 3SCOA 3AZTA 1JFHA 3LMYA 3LPOA 2WNWA 1C3FA 3W6MA 2Y5EA 1I1WA 2CESA 1A3HA 1R86A 3WH8A 5EB8A 5I2UA 2RGMA 3ARXA 3WL1A 1W9BM 2XHYA 3AIEA 1AMYA 5CGMA 4JIEA 3EDDA 3UESA 4JCMA 2X1IA 1J10A 1HKMA 1U2YA 2YIHA 2CETA 1KR1A 2W62A 2BFGA 1LG2A 4Z2JA 1IZJA 3SCWA 1QI5A 4ATWA 3BAJA 3KZSA 2FGZA 4OJYA 2DH2A 1WZLA 2G3NA 4J3XA 1KCKA 1CLXA 3MKKA 4TUFA 2VT0A 2WYSA 3EBVA 3UG5A 5D4YA 4UQDA 1QPKA 2G3JA 1FFRA 1KR0A 2OLHA 3MMDA 5GPRA 4P7OA 3NSMA 3OGRA 2XSBA 4MDPA 4MB3A 4LPCA 5ECUA 3AIRA 4KGLA 3W38A 5LA2A 1DHKA 5BRPA 3M6DA 2DGAA 1JYVA 1WDSA 2VZSA 4H41A 2D1ZA 2V5CA 1HJSA 1RH9A 4LYPA 5IFPA 4U2YA 5CLWA 5F7UA 3AMGA 3A4AA 2VL4A 2QPUA 2WZIA 1E5NA 4GZJA 2GFTA 1XHGA 1GVIA 2A3EA 4MPKA 3W24A 3W0KA 1E40A 1V0KA 2W92A 2DQXA 3WF0A 1MYRA 5D9PA 5FL0A 3ZJKA 1JF6A 2O9PA 4M1RA 1V0LA 4UNIA 4DUVA 5ABFB 3ARYA 1UD4A 2WSPA 1OGGA 1V0NA 3F5KA 3W27A 2ZXDA 4UCFA 1ZJAA 2V3DA 4BQ5A 3BAIA 1M53A 2BY2A 3W25A 4PEEA 1W2PA 1DWAM 3TP4A 3OZPA 2ZOXA 2YLAA 4PMVA 1C8YA 1B3ZA 3DC0A 3QGVA 1XH1A 4HA4A 3VIJA 2DT1A 4PMZA 1H4PA 1KQYA 4EE9A 3TTSA 4FK9A 2WW5A 2BS9A 2Y8VA 4X0NA 1PX4A 1HJWA 4UQAA 3EDJA 4QLJA 3AZRA 4WJXA 1LWJA 2X8RA 3A6OA 1BF2A 2D22A 3VO0A 4BQ4A 2YA1A 4OBRA 4X0VA 4HZ7A 3AHTA 2XJ7A 4FLQA 4W93A 4AIEA 3QOMA 1KCLA 1CENA 1TCMA 5LYRA 3BGAA 4H7VA 4GZEA 2Y2WA 3W53A 4D1IA 4QAWA 3I3DA 1C92A 3KL3A 2BXYA 5M03A 1FH8A 3WH6A 1M04A 4FLOA 1J0KA 2CKSA 3AMDA 1WO2A 3BCFA 1JYXA 3SCUA 2AMGA 1OGSA 1MXDA 5E6YA 3NSNA 1OBAA 3AQUA 4URIA 1CWYA 3SIMA 3AIWA 4Z2HA 2EBNA 1JZ7A 2J7HA 1J0ZA 5BRQA 1GJWA 4JFTA 5JBEA 2XTKA 1VEMA 3O9NA 3CZJA 4UZUA 1MWOA 1GONA 2WC7A 2ZUMA 3A3HA 1HKIA 1M03A 3HMCA 4ACZA 4JFVA 1BYAA 1UR4A 3BC9A 2D3NA 1UA7A 4U5KA 4CGTA 3WUBA 1Q6GA 2B31A 1W1YA 3BSHA 1KXHA 2OWXA 4MB1A 3VIPA 3RCNA 2EPMX 7CGTA 3NDZA 1G5AA 1R85A 5JBFA 4JKKA 4S3KA 4OBSA 3O2LA 1RP8A 5C8BB 3AYRA 2CBUA 4MTVA 4F79A 1BSIA 1F4HA 2FH6A 4EANA 3PZIA 1B90A 4V27A 1CZ1A 4QCFA 3PTQA 4R5EA 3VMPA 2VJXA 5KEZA 3SUVA 3WENA 3AXXA 1HX0A 2AAAA 4HPHA 1FH7A 1TFVA 2ZE0A 3VGFA 2ZUUA 1UKSA 4CVUA 1VIWA 1D7FA 2GJXB 2JALA 5DMYA 1E56A 3WSUA 3MANA 1KQZA 4OIFA 4UTFA 3AIQA 1DWFM 1UWSA 4AIUA 5A69A 2GK1B 3MUZ1 1NP2A 1CXFA 3EDEA 3PBGA 4PMXA 1HL9A 4B9ZA 8CGTA 3CTTA 3AXHA 5CPSA 1NARA 1JF5A 1M01A 3AJ7A 4W8AA 1ISZA 2XGIA 4CU8A 4QCEA 5A2CA 1SFSA 4YHEA 5C70A 1QHPA 4AXNA 3PTMA 3FNDA 1W9VA 1J01A 2FGLA 3ZMRA 1JI1A 2YDRA 1NOFA 4D72A 4MNKA 1X1NA 4J3VA 1B3YA 3QHMA 1B2YA 2O9TA 2FHFA 4NF7A 1HIZA 3D5HA 2YDQA 4E8DA 1ITCA 1BG9A 3W6LA 2WSKA 4GI6A 2AOSA 4H8HA 3TTYA 2VOTA 4J3TA 1YHTA 2YA2A 3A4XA 1WCGA 5EFDA 3QR3A 1CXKA 5I3DA 3SCSA 1E0WA 2W5FA 3BH4A 1E70M 4TVUA 4HA3A 2Z1KA 3AMCA 2XYLA 2PB1A 3WDIA 4AEEA 1UD5A 4AZCA 4QFUA 3OGVA 4AZBA 4D1JA 2CEQA 3JUGA 3VINA 2CHNA 4D6JA 1WZMA 3AHYA 1UWRA 2DSWA 3OLGA 4HZ8A 3KL0A 1L8NA 3WNMA 5GNXA 1HJXA 1W9XA 2ZUSA 3CGTA 1GOKA 4PTMA 1JI2A 3TTOA 4AW7A 3WUGA 3B9DA 1JG9A 1V08A 4A3HA 4CCCA 1Q6DA 4MNLA 1MQPA 1G94A 1X6LA 3TA9A 3WMBA 3UCQA 4CU7A 1MW0A 5FL1A 1LL4A 2PWHA 3WNNA 1QI0A 2VX6A 2D24A 5E09A 4AIOA 3FY1A 2YL6A 2Z1SA 1HF6A 1E55A 2D0HA 2BY1A 5FIPA 3WF1A 1CECA 1HJVA 1QI2A 4UR9A 5A6KA 1DWGM 3U57A 3BAWA 3QOKA 4TVDA 3ARSA 1V6VA 3WMCA 1Y7VA 4Y7EA 1RPKA 3K4DA 2GSJA 1OGBA 2EQDA 1XCXA 4UOJA 2Y8KA 2PWEA 4WK9A 4W86A 4GZIA 2ESCA 1J0IA 2XVPA 4D6EA 5A1AA 4W85A 5D9OA 1QNSA 1HJQA 4Q22A 4NRSA 4AD4A 1FFQA 1EH9A 2BVTA 1W3LA 1ZU8A 3VX0A 3CH9A 1HKKA 2XGBA 1TG7A 3ARZA 4AC1X 2DT2A 3WEOA 1JAKA 3RDKA 3LPFA 3RJXA 3VGHA 4XX6A 3GYCA 3TTQA 1H49A 3DYPA 7A3HA 1GOMA 3ZT7A 3ZJ7A 2JF7A 2WAGA 1B3WA 1XC6A 1UH2A 4PUEA 3GXIA 2VVSA 2G8ZA 3AZSA 4A4AA 2FH8A 2J77A 3CPUA 2A3HA 2J75A 1XSKA 4R27A 3CHFA 3ZSTA 1GORA 3T0AA 1K6AA 3WH5A 2DT0A 4QLKA 4UFJA 3CZGA 1TUXA 1MW1A 1GHSA 3CUFA 4QLLA 2E9LA 4L4OA 2VR5A 1XGZA 1PBGA 2OSXA 4RL3A 3NUKA 4CD7A 1JZ4A 1LL7A 2CPUA 3GZAA 3WH7A 1R87A 3RM9A 3WUFA 1LWHA 3WL0A 3UR7A 2WB5A 4PMRA 3VTRA 5BXPA 3VVGA 1D2KA 1EGZA 5GNYA 3VKKA 3AIUA 4KGJA 3PTKA 4J28A 2YL5A 2V3EA 4PUDA 1JIBA 1JZ2A 3W26A 3GH4A 2WC4A 4F9DA 1WNOA 2BNJA 3MO4A 5HXMA 1H0GA 1JYWA 2VTFA 2XVKA 1UKPA 4PMYA 2DSUA 3W82A 3WFZA 2J7FA 5BXTA 5GNZA 4BS0A 3N13A 2NT1A 4FLSA 4AZ5A 1CGYA 3RPMA 1US2A 1V02E 4L4PA 4M82A 1SMAA 3NSXA 4N0RA 5EFFA 1NOUA 3K46A 1P6WA 2GJPA 1GJUA 5I78A 1W91A 4DWSA 5IHSA 3RM8A 1I1XA 3DYOA 1GOIA 4N42A 1UOKA 1TZ7A 1CGUA 4PSRA 1PZ3A 3AI0A 3II1A 1C8QA 4WIWA 1ZJBA 3OBAA 3HU7A 1UZ1A 2CXGA 4HP5A 1IV8A 2ZUNA 2WMKA 2ZX9A 2CKRA 4JL1A 2WWDA 2FHBA 4WF7A 5CJ5A 3OIHA 2G3MA 3PZMA 3QHOA 3N04A 1F4AA 4AZIA 2J25A 3AICA 3HJEA 1PZ2A 1ZB5A 5HOSA 2F8QA 2Y4SA 1EOKA 2UY2A 2HVMA 2NW0A 4GI8A 1WZKA 3CZ8A 1H09A 2IXVA 1CBGA 2Y24A 5EBAA 1HXJA 1VEPA 1J12A 1BTCA 2E0PA 1VFFA 1BGAA 1V6WA 1JZ3A 4IPLA 4W5UA 3L2LA 1UR0A 2CBIA 2ZICA 1X6NA 2XUCA 5JBDA 4M24A 2DH3A 5E0CA 3EDKA 5I6SA 4D71A 2WBGA 2O9RA 4BCEA 2XSAA 4LYQA 1H1NA 3IJ7A 4DWSD 1DP0A 3CUGA 4JAWA 4DWSC 1QOXA 2BV9A 1CEOA 2BXZA 1GOOA 1E6SM 1Q6FA 3AIVA 1EO5A 4F8XA 2XWDA 1EIBA 3WH9A 4ZENA 3ZR5A 4TOQA 2ZWYA 3SCPA 1J18A 2VC9A 2CBVA 3WEMA 3FW6A 1W32A 2VZUA 2J78A 4JFUA 3ALGA 1BFNA 5CG0A 1JD7A 4ZFMA 1UD6A 1B3VA 2QV4A 4PMOA 2VURA 3WD0A 4W8BA 4AWEA 1E0VA 3A4WA 1DWJM 5A6MA 1JL8A 3WKZA 2WVSA 1EOMA 3A47A 5KZ6A 4GINA 1UUQA 2NT0A 2WCAA 4ACYA 2D2OA 4U5IA 1E3XA 4AD0A 2J7GA 3SCRA 3U5YA 2DIJA 2YDSA 2VVNA 1XYFA 1WB0A 1V6YA 1JD9A 4D6IA 3CHEA 2X0YA 3M46A 1NM9A 3ZR6A 4MNJA 1I75A 1V6XA 1GQJA 2EPOA 1BVZA 1CDGA 1L0PA 1UD2A 2JEQA 3BAYA 3THDA 2IXUA 6A3HA 4MB4A 3CHCA 1QNRA 2WVVB 1V3HA 4PYSA 4LXFA 3K8MA 1MW2A 1JDAA 3ZM8A 2EEXA 1VFOA 3AMKA 3BXWA 4UQ9A 4MB5A 2JEPA 1WKYA 1VBRA 4D6GA 1HT6A 4JKLA 3CUJA 4F66A 1HKJA 1BAGA 2VX5A 3VD7A 1J0YA 1RP9A 2OYLA 4W7VA 2WHKA 1G1YA 3EDFA 2XIIA 3VDAA 1FOBA 4ZE4A 5DO8A 3POCA 1TVNA 2D0GA 4HMCA 1OT1A 4HMDA 3T0BA 3VM7A 3FAWA 2WXDM 2EXOA 4EAMA 1Q6CA 2PWDA 3O6AA 1V0MA 2C7FA 1OSEA 1WP6A 5A8NA 2J7BA 3SEPA 3WY1A 2WHMA 1KBBA 1K9TA 4OZOA 4YHGA 1E4IA 3L4UA 4HA1A 2XPKA 1TE1A 1XH0A 4WKHA 2PC8A 2GUYA 2J4GA 3CIVA 4CCDA 2XVNA 2G4FA 5IFTA 1EQPA 4ZXLA 5A3HA 1VENA 1QBAA 3BLPX 1R7OA 3ZJ8A 1NWUA 2EO7A 3ARPA 2UY3A 2NSXA 3ZT5A 1D3CA 5ABEA 3VNZA 4GPNA 2VR4A 2VRQA 1E43A 3WQ8A 3TONA 5HNNA 3GNPA 3WQ6A 4AISA 1WPCA 3SUSA 3ZIZA 1KBKA 3SCQA 1TA3B 3WQ5A 4D6DA 1UR9A 3GXMA 4OOZA 2ZX8A 4ZXOA 2VCAA 4GXPA 2OSWA 3FN9A 3OLDA 1EA9C 3W4RA 4PTXA 3WUEA 1UD3A 3PHAA 1J11A 4P8UA 2GVYA 5CPTA 3M07A 3VNYA 3VIGA 3GM8A 4UZSA 2UY4A 4Z2LA 3WDPP 4JZ5A 2ZUWA 1C8XA 4AY1A 2A3CA 3NCOA 1GPFA 1GOQA 4CCEA 2WLZA 2J79A 3E1F1 1PAMA 1KXVA 2J7EA 2YL8A 4XV0A 4P8WA 1ODUA 1MW3A 4JHZA 1UKTA 4JHOA 4BQ2A 4MAZA 3WDRA 5A6BA 1HJUA 1DWIM 4U31A 5CXPA 2GJXA 1ZBKA 4P8XA 1Q4NX 1NQ6A 1VFUA 5A2BA 3SUUA 1J0JA 4QDMA 2BY0A 4M80A 1DEDA 1V3KA 4WSJA 4OKDA 5LA0A 1XSIA 3AOFA 2WM0A 4UQCA 5FCZA 5DFAA 1XYZA 1LG1A 1BLIA 2VQUA 1QI4A 3POHA 4W84A 5DF0A 5HBFA 3AS2A 3TOPA 1AQHA 1JYNA 1BGGA 3AIBA 5AC5A 4FMVA 3IANA 4MADA 1E9LA 1V6UA 3VD9A 3L2MA 3CBWA 1FP8A 3AS0A 4AYSA 1PX8A 2XM1A 5HPCA 5D8ZA 1PPIA 5A8OA 1JNDA 1K9FA 1E1EA 1W3HA 2PBOA 1BYDA 4LQ1A 2X2YA 1CLVA 1G01A 3VOCA 3T2QA 5JIPA 5A6BD 3VD5A 4KMQA 4P8VA 5E70A 4AZGA 5A95A 3PZQA 5AC4A 1U33A 1TR1A 1IZKA 2VUYA 2WANA 1EXPA 3RIKA 5M3WA 1AQMA 2VCBA 4UFIA 3W29A 3GNOA 4CU6A 3OGSA 1CXEA 1UD8A 4PBGA 4IM4A 2CCRA 1E5JA 1NWRA 2VMFA 3G6LA 1BHGA 3GDBA 1WE5A 3PZNA 2OYKA 4D6FA 3WDQA 4HOXA 3KE0A 1BG4A 2J8FA 4YN5A 4BQ3A 2CYGA 4U3AA 3WFLA 1UKQA 4HU8A 1ZL1A 1E0XA 4W88A 1CTNA 2XVLA 1PIGA 2YL9A 4W89A 2XM2A 4YPJA 3AROA 2WMFA 1LLOA 1QNPA 3WEZA 3GBDA 4TX6A 5HDRA 2XVGA 4OUEA 3B9EA 3CZKA 3MV01 9CGTA 1OB0A 3EMCA 5BXRA 1KGUA 4J3UA 3K8KA 3PZTA 5CQ1A 2F2HA 5ABGA 4HU0A 1V03A 4E8CA 2VRKA 3UG4A 4MAVA 2W61A 1H5VA 5BYWA 4AZHA 4KRUA 3ZO9A 4M8UA 1W9DM 4WKAA 2FHCA 3VGEA 1UA3A 2ZXBA 2A3AA 2HISA 3PZ9A 3N11A 3CZEA 1ZBWA 4PCTA 2CHOA 1EDTA 5CPQA 2E9BA 1UR2A 2ZXQA 2J7DA 2BHUA 1ODZA 2ZXAA 4C7GA 4V28A 2BVDA 1B3XA 5A8MA 1WZAA 1IT0A 2RGLA 3PZVA 1E6PA 1E1FA 2XFYA 4LX4A 1JDCA 3VIFA 3DHUA 1FP9A 1QHOA 4NSBA 2IUZA 3I3BA 3B8SA 1GQKA 1C93A 4OOUA 4Z2IA 1E4LA 4UFMA 5JUVA 4W87A 2WMIB 3EMZA 1ECEA 3WIJA 1FHLA 5AY7A 4TXEA 1KWGA 4M56A 5E6ZA 4A3YA 1UHVA 4ML4A 4PRWA 3UETA 1E6ZA 2DPEA 4M81A 2DSZA 4KH2A 2GDUA 4C7FA 1LJYA 2WMHA 2CITA 3L4ZA 4RE4A 4C7DA 3DYMA 3OZOA 3U7VA 2F61A 2J8GA 2YBTA 3L4TA 1ZBCA 3AHZA 4JKMA 4FLRA 4PN2A 1HNYA 4J7RA 3AFBA 3AISA 5M5DA 4GIAA 2J74A 2O92A 5A6LA 3N17A 4HOZA 3CUHA 5IXEA 4NZCA 2D23A 5D9NA 4UFLA 3T08A 1MFUA 1VF8A 1OD0A 1MQRA 3J7HA 4GO8A 2DSKA 3SCTA 2EPLX 3PZUA 1W1PA 3VX1A 1H41A 2YOCA 3VMOA 4K68A 1GHRA 4B3LA 1MFVA 4NI3A 2VX4A 1V3MA 5A2AA 1PEZA 3WF4A 2WWCA 4AD3A 3WNPA 5I77A 3WD1A 4ZE5A 4B9YA 2WVUA 2WKLA 3K1DA 3N1AA 5LA1A 4AZ6A 4CN4A 1J0HA 2CBJA 4J3WA 3VIKA 2E8ZA 1QW9A 1E6RA 1GW1A 1MXGA 4U2ZA 5I79A 2WLYA 3VIIA 4CUCA 1UH4A 1HP5A 4PMUA 3NDYA 1YQ2A 1E6XM 5FD0A 1HP4A 2WHJA 3SCVA 3SCNA 1O7AA 1K9DA 2CIPA 2DDXA 1AQ0A 1N82A 3RO8A 4IUGA 4AD1A 1JDDA 1EDQA 3MUY1 3MV11 1V02A 1KXQA 5I0DA 1H0IA 2XG9A 3SURA 5EMYA 2QMKA 2WVTA 1B9ZA 1CIUA 3VIHA 4KRTA 4BF7A 2PWFA 5JIWA 1C90A 4W5ZA 3WQ4A 4XUYA 2WZHA 3ARWA 3VD4A 2QHAA 4CD6A 3MUAA 4HZ6A 3GBEA 5FOOA 3KL5A 3MU7A 1V3IA 3BMWA 1GVYA 2YKKA 5IHRA 1OIMA 4U3CA 3VU2A 3CMGA 4AEFA 4E4PA 3I3EA 4P7QA 4EK7A 3GNRA 3MMUA 2X05A 1XV8A 3WMSA 1MVYA 1UG6A 3RJYA 1DTUA 1G0CA 1KXTA 1PX3A 2BHZA 2VZVA 2OWCA 1E73M 3BSGA 4ATLA 2YBUA 4MJ2A 3PZOA 1KGWA 1C7SA 1CYGA 5BCAA 2UY5A 1E6QM 2VRJA 3FXYA 3K4AA 4DM2A 1W3JA 2WC3A 1QW8A 4PCSA 1UWQA 4XZWA 3BAKA 1SR0A 4GQRA 1FH9A 1WDRA 2WZEA 2ZX5A 1CGWA 3T09A 4PMQA 3WNKA 2E4TA 3LPGA 3VMNA 1S46A 3M7SA 3L4XA 4HPGA 4WKFA 4W8LA 4S3JA 5CZKA 1E4NA 1OIFA 2XFFA 2E3ZA 3PN8A 1CPUA 1MQQA 2EPKX 3OA5A 4DM1A 4QP0A 3AHXA 4H2CA 5CSUA 1HN1A 2W67A 4Q7NA 5ABFA 2FDMA 5DEZA 1C91A 2BY3A 3IAQA 3KWXA 4XZBA 8A3HA 2TAAA 3N18A 3VDBA 4HMEA 4H8VA 3F5LA 3IK2A 4ACZB 2MANA 3AHVA 4TVCA 1ESWA 5M17A 4V2XA 4C91A 1R7AA 2X0HA 2VNCA 3MSDA 3N12A 6TAAA 3VUPA 2WCGA 1W1TA 1UWUA 4BZYA 2C0HA 2YJQA 3N9KA 1UZ4A 4XB3A 5E9AA 3UG3A 5IDIA 5I5RA 4MNMA 3OG2A 1LF1A 1J9YA 3SUTA 1CXHA 1GCYA 1JZ6A 2JFEX 1CGTA 1XRVA 3BMVA 3G6MA 3OLIA 5DT5A 1B0IA 1JNEA 2BVYA 1US3A 2WVVA 3VDHA 4LGXA 1GOWA 3FAXA 1HVXA 3ARVA 3WN6A 5I23A 2G41A 1NP0A 3MS8A 3WQVA 3KEHA 3T2PA 1E3ZA 3MMWA 2VX7A 4CD5A 1H2JA 1JZ5A 4UFHA 1LL6A 1ISVA 2VQTA 1KB3A 1EHNA 3GXFA 5BROA 2ZUVA 2XIBA 6CGTA 1XH2A 2XFRA 1HL8A 5A94A 4M29A 2V38A 3UR8A 1E6NA 2VZTA 2J7CA 3CO4A 1OWQA 4Z2GA 5AYIA 1ISWA 3L4WA 1VJSA 4P7RA 3VD3A 4B16A 3ARQA 3L4YA 4AZ7A 4CD4A 1OM0A 5D8WA 3SUWA 1U30A 3VGBA 4W7WA 1QHZA 1E71M 2D0FA 3VILA 4UOZA 3VDCA 2YA0A 2C8NA 1TMQA 4DUWA 3THCA 2J47A 1EQCA 2JE8A 3GH5A 3AS3A 1QNQA 2UWFA 1ISXA 1K9EA 4HOWA 4P7NA 5CSYA 4ZEPA 2PI6A 1UYQA 2YLLA 1Q6EA 3WELA 3U7BA 4UOQA 4AZCB 4RE3A 2D20A 4H04A 4KWUA 2PBGA 1ITXA 1UH3A 1XCWA 2V3GA 1G9HA 2QLYA 2OWWA 2VI0A 1AVAA 3GXDA 1UKOA 3WNLA 1TA3A 1GUVA 5TD4A 2X09A 2WKGA 2W91A 7TAAA 2DSVA 1V3JA 1OD8A 1CXLA 2GK1A 4W7UA 4RE2A 4D6HA 5DT7A 4NRRA 3L4VA 1M7XA 1JXJA 3CZLA 3VIOA 2ZIDA 3DHPA 5I24A 1KWKA 3IJ8A 1OINA 2W63A 1UR1A 1BYBA 3ECQA 1TVPA 3UERA 3WD2A 1EO7A 1CGVA 1VEOA 1A47A 1JXKA 1PIFA 1SMDA 1Z32X 4E2OA 4J3SA 3RMEA 3B9AA 1VBUA 3WBAA 3IJ9A 2WBKA 3EYPA 3T2OA 1NOWA 2W4XA 4GI9A 4CKQA 2PF0A 3VIMA 1JFXA 3APGA 1CXIA 5A8QA 1UR8A 3QHNA 1GQIA 2GJRA 3BAXA 3WF2A 3WD4A 3VM5A 1GQLA 1OCQA 1UQZA 3AS1A 3K8LA 2WMGA 3W28A 1W9PA 4B3KA 1VFMA 4GQQA 3CHDA 4WSKA 5E0FA 4IISA 4PTWA 1FHDA 1H3GA 1DWHM 4MDOA 2ZX7A 3VGGA 3UEQA 5HPOA 3ZQ9A 2EPNA 1OT2A 3ZT6A 1B31A 3OLEA 1CNVA 2JF6A 4U33A 5AYBA 4AMCA 4HTYA 5BXSA 2DT3A 2GDVA 5CLTA 2E8YA 3RILA 1QBBA
chains in the Genus database with same CATH superfamily
1S2CA 3FYPA 2PLJA 4CN1A 1W9UA 3F4VA 4RW5A 2A1YA 3R94A 1ISYA 3NQ2A 1HVQA 3WQWA 1PWMA 1F74A 3H4XA 4W4QA 5HANA 3UWZA 4ATDA 5HUPA 1U1JA 2I17A 1W5OA 2OU4A 5D37A 3M0HA 1QTWA 5BWFA 5D9MA 3FJLA 3ZS4A 2OZ8A 4ERIA 2XH7A 4OWGA 1TTJA 2DIEA 4DO4A 4KQNA 2JIEA 1ZJHA 2DV0A 1T5AA 1YTDA 3KFTA 5CGTA 1BPLB 5GQBA 3BO9A 4BI7A 1VB9A 3VPLA 3U3HA 3M5ZA 2OYMA 1FY6A 1W1VA 2PDFA 2JIWA 1WAWA 3D3AA 5GJNA 1G7UA 1PIIA 3NO5A 4LC6A 1J96A 2AGTA 2GGHA 3PZGA 3LCHA 1CGXA 2A79A 3FYYA 4GVIA 4GY1A 3RX3A 4HTBA 3GX9A 3WDHA 3MQTA 3EOEA 1EDGA 4J35A 3VGDA 1R9YA 2BHYA 5EJZB 3MCMA 1E4MM 4JFSA 1LZOA 1TPEA 3MSGA 3HN3A 1SFTA 1QNOA 4N9BA 1VRXA 4LTSA 4DYKA 1ME7A 3W7IA 1WXZA 1DYSA 5DELA 3C52A 4IIHA 3ALFA 1P43A 3FHAA 4DWSB 2F6UA 1UBSA 2DEPA 2Z1WA 2XSXA 3WNOA 4P7LA 5AC7A 4O0QA 4Y8EA 1VAHA 4PTVA 3W1PA 1XSJA 4KCWA 4EKJA 4JPGA 3OB8A 3VCRA 4DBWA 1DXFA 3FX4A 1ELSA 1Q63A 1W2VA 4DXVA 1H11A 1UQYA 2HE8A 1ZBVA 1E72M 1JCTA 3T0DA 3BWWA 4Z2KA 2HDJA 2X41A 1VJZA 3TQVA 3WDJA 4GK8A 3NZ1A 4UFKA 4EXAA 2CC0A 2QMJA 3WLPA 1LYXA 4Q8PA 5DCEA 1LLZA 5A6JA 3STEA 3NIYA 5C71A 3SCOA 2CESA 3IIVA 1A3HA 5I2UA 3VNKA 2RGMA 3ARXA 1S38A 3EDDA 1KRAC 3UESA 2B7OA 4C6IA 1RJPA 4KKXA 3BZGA 1EBGA 2BFGA 2GOKA 5HUOA 1QCWA 1QI5A 2XH2A 3KZSA 4F0HA 2DH2A 2C16A 2WYSA 1V7YA 3B0VC 2L5HA 2Z4GA 3V4BA 8XIMA 2OLHA 1WQ5A 1IXPA 4P7OA 1IEWA 4BF9A 2XSBA 4NX5A 3MO7A 3PBWA 3C86A 4LUTA 3H21A 4FXJA 2E6FA 2BGNE 5BRPA 4HSHA 1WDSA 2D1ZA 2V5CA 5IFPA 2IS7A 4J5NA 4U2YA 4HMNA 2WZIA 3UA4A 1XHGA 5K3VA 4Z0SA 1H7NA 3EOLA 5D9PA 2QZRA 4UMAA 1V0LA 4UNIA 3M6YA 2PDUA 3QR1A 2ZZ7A 3WBXA 1UD4A 1TWIA 1V0NA 4BQ5A 3BAIA 2Z1BA 4JQ3A 3W25A 2RDXA 1DWAM 1R9ZA 2DW6A 3VFCA 1RR2A 2ZOXA 3PFRA 3S1WA 5HNRA 4PMVA 1B3ZA 1VLWA 3QGVA 5XINA 1XH1A 3HGRA 3VIJA 2BZNA 1KQYA 4MZYA 4UQAA 3KRZA 2ZRUA 4QLJA 3H55A 4Q8OA 5E9XA 1TTPA 2X8RA 3A6OA 1BF2A 2D22A 3NZRA 1I2NA 2YA1A 3LZ3A 2R94A 1UC5A 4W93A 5I7GA 2G95A 5F4SA 4PODA 4AIEA 3QOMA 4M6VA 4BY3A 3F2CA 5LYRA 3TLQA 3TR2A 4H7VA 4NVTA 3E0VA 4XISA 3C2FA 5K4ZA 3RFAA 2J6XA 3HV8A 3GFYA 3DBNA 6REQB 3GXTA 4FLOA 3BCFA 1JYXA 1WKDA 2OKTA 1RVGA 1S5NA 1OGSA 2I5IA 5E6YA 3NSNA 3OQ8A 5CC5A 3ZFHA 1QO2A 2ALDA 3BJFA 3R12A 4XSLA 4Z2HA 1JZ7A 1XLLA 2PDGA 2X2GA 1VEMA 4CQBA 1HKIA 1BYAA 1UA7A 3XINA 1W1YA 3SQSA 3DFYA 3IS4A 5T8GA 1JPDX 3OHIA 3CTLA 7CGTA 3UYIA 2VENA 1MRAA 1XYMA 1R85A 4A21A 4DO6A 1CB7B 4H9YA 1RP8A 1LQ2A 2X1RA 3TN3A 3AYRA 1DJIA 4UR7A 3A22A 1F4HA 2FH6A 2DZXA 3PZIA 3V5OA 3HQ1A 1CZ1A 3LUTA 3PTQA 4ZB5A 3E38A 1IHIA 1HX0A 3QPYA 1J4EA 4JYFA 3TZNA 3SJ3A 1XIDA 3AJXA 4C5YA 3GVRA 3L2IA 3COTA 3P0XA 4XAZA 1GVSA 1XIIA 1YLVA 1E56A 2YYTA 3LXBA 3WSUA 4MUPA 3HQNA 5H8PA 1WAUA 1KQZA 2XIOA 2QVNA 3PR2A 4QX4A 2Y7GA 1NP2A 1FVPA 4QG9A 5DX7A 4PA8A 1NARA 3ABSA 1H7RA 3SB0A 2XGIA 4QCEA 4JX4A 2GGEA 4YHEA 3FA4A 1QPRA 1J01A 2FGLA 3ZMRA 3URQA 3TZFA 1Q6RA 1B3YA 4MVAA 2Y8UA 3OBEA 3QC3A 2YDQA 1S5VA 1UZDA 1BG9A 3NL5A 2I9EA 3U4FA 2YA2A 3S0CA 4PUKA 5EFDA 3WBYA 5I3DA 2PDJA 1TMHA 3GIQA 2RFGA 2W5FA 2XN2A 2CW6A 1OFBA 1XKJA 2Z1KA 2EJAA 2XYLA 4HK5A 4P5UA 3GG7A 4AZCA 1JUEA 3UW6A 1Y5VA 1XL9A 3AHYA 3LLDA 3BURA 4HZ8A 5MF5A 2TODA 1GTEA 1L8NA 3E0FA 3WNMA 2AL2A 4H8NA 1GOKA 2C79A 4KWOA 4PTMA 3TYAA 3TCSA 4MWAC 2Y70A 4C6DA 3E0LA 4MNLA 1MQPA 3MYOA 3R4IA 1LM1A 1I2RA 3TA9A 4EIVA 3UCQA 4YCPA 2WM1A 5FL1A 1YE4A 2FJUB 2VX6A 4AIOA 1MZRA 1TWDA 4M51A 2YL6A 2IQTA 1BSLA 3O16A 3NPVA 5ECVA 2D0HA 3QTPA 1REQB 1HJVA 1QI2A 4UR9A 5A6KA 1DWGM 3BAWA 1K1DA 4OU1A 2ZC1A 3ARSA 5DANA 1V6VA 2XU2A 3FIGA 1TJRA 2EG7A 4Y7EA 1RPKA 3BGGA 4ILSA 3ICJA 3LS9A 1XCXA 4UOJA 3DGRA 4JYDA 2Y8KA 1GZ1A 2NLYA 3EPMA 1YPIA 4V33A 2ESCA 3NQEA 1J0IA 4UMBA 2G96A 3ONCA 1QNSA 1W5PA 2WO5A 3WLLA 4AWTA 4NRSA 4RDZA 3R13A 4AD4A 1IGWA 2BVTA 1OHLA 3VNDA 3QZ6A 3VX0A 2HVOA 4AC1X 4Q33A 4GUGA 1EC9A 4H7ZA 2DT2A 3WEOA 4S2BA 4HCDA 1W1ZA 3DYPA 7A3HA 3ZT7A 2I7GA 2JF7A 2WAGA 1UH2A 3UWYA 1F9CA 3O6DA 3UJ2A 1TWWA 3HURA 3KDOA 3T0AA 5G4EA 4DI9A 3UWEA 6PTDA 1K6AA 3QGKC 4FOUA 1TUXA 4MYXA 1GHSA 1P1XA 2E9LA 2PLMA 3UG8A 4CD7A 1LL7A 2CPUA 3RG6A 5C0QA 1EP1A 3WH7A 3ENLA 3R43A 3WUFA 1OC6A 4LCSA 4EOUA 1BKSA 3UF9A 4EXBA 3ME3A 2AMXA 5D30A 1M68A 3G1DA 1RA5A 3CASA 4KETA 1KRMA 3ITVA 3LYEA 2YL5A 1TPB1 4YTTA 7REQA 4XQ6A 2WSRA 4RCXA 1Z8AA 1JZ2A 5DCDA 4QE5A 1S1RA 4LT9A 1HGWA 3C2YA 4B3ZA 1JYWA 4DXKA 4UXDA 3G1HA 4RXFA 1FQ0A 1YBQB 4PMYA 3B0UX 3FS2A 1R3VA 5BXTA 4IMAA 1IYXA 3CWHA 3GNXA 1I2OA 3TTEA 3FSUA 4RUBA 1LBLA 4FLSA 3NOYA 2EF9A 1US2A 1ZPTA 1V02E 3TK7A 4M82A 5IDZA 5AHFA 3TXZA 5EFFA 2PPGA 5F1UA 1W91A 2P8CA 1UMLA 1I1XA 3LXAA 3OTRA 2OGYA 3M5VA 1CGUA 4PSRA 1PZ3A 1C8QA 3CYVA 4LVBA 2HZGA 2CXGA 4IQLA 2ZUNA 2WMKA 3RRXA 6ENLA 2CKRA 3A12A 4DPPA 3N3TA 3OIHA 3IVSA 4IWWA 4QTGA 3QHOA 5AHLA 2RDTA 1PZ2A 5HOSA 4YYCA 2Y4SA 2HVMA 4F2BA 2NW0A 4YYFA 4NAFA 5EBAA 1BTCA 1VFFA 1JZ3A 4IPLA 4W5UA 3WLOA 1UR0A 2CBIA 3W23A 1TWZA 3GXPA 4TR9A 2IKHA 2BMBA 5E0CA 4F3HA 4GYPA 3LSCA 3R8HA 1FX6A 2HS8A 1M3UA 3EA3A 4DWSC 1QOXA 3LHTA 2A2IA 3NQ8A 1K70A 1E6SM 1EO5A 2OO0A 1EIBA 3WH9A 3ZR5A 4M6QA 4TOQA 3TFCA 3HPSA 1J18A 2XZ9A 4AY8A 1ADOA 3I4EA 2CBVA 2J78A 1A0EA 1Z48A 1JD7A 2QJHA 3GC4A 1OCNA 4RPQA 2QV4A 3F4CA 3MWCA 4PMOA 1XP3A 5F2MA 1DWJM 3ABOA 3WKZA 2WVSA 3LBOA 4GG9A 1D9EA 2IPWA 3P60A 1ZSXA 2VDGA 1E3XA 4AD0A 2J7GA 2B4GA 2PGFA 1OFEA 3B03A 2YDSA 4C6MA 1XYFA 4OGZA 2Y89A 4NZFA 5T9BG 5CEWA 2JK2A 2GDQA 4F0KA 4KT2A 4AIBA 1UD2A 1Q2SA 4WDWA 4ASTA 6A3HA 4LFYA 4O17A 3KZPA 2Y7DA 1XIBA 4PYSA 1EL3A 1MW2A 4MLJA 1NTHA 1WOBA 2OFJA 3PVFA 1GKRA 4MKSA 1DIOA 2DZTA 4GX9A 3B05A 1HKJA 3KBJA 4JD4A 2F7FA 4L64A 2RDWA 2VX5A 2HBXA 4AF0A 5A5WA 1AJZA 2WHKA 1G1YA 3VE7A 2V9DA 3EEZA 1FOBA 2P88A 4HMDA 1IIGA 1NFPA 4XK2A 1AW2A 3VM7A 1TPWA 2OKOA 3LENA 1Q6CA 9XIAA 4R7OA 3TNBA 3BDKA 2J7BA 3WY1A 1L6GA 1Y5XA 2XN1A 4O16A 1K9TA 3W84A 2Z24A 2Z7GA 4YHGA 4JNMA 3L4UA 4HA1A 1SFLA 1TE1A 2PE4A 2PC8A 2GUYA 4KFNA 3GFXA 2VR2A 2B0MA 2Z0IA 5IFTA 3B0XA 2TRSA 1JULA 3HIJA 2UY3A 3W7OA 5ABEA 2V69A 4GPNA 3EOSA 1POKA 3NZPA 4L4LA 3GNPA 4AISA 3U2CA 5KZMA 3SUSA 1DQWA 3ZIZA 1KBKA 3WQ5A 4D6DA 1FUYA 1X97A 4GXPA 3I65A 2OSWA 3E3HA 5AFDA 1KFKA 3NPWA 4PTXA 5HWJA 4ORMA 1F5ZA 3E5BA 1UZHA 3SW6A 4P8UA 5D05A 3SDOA 3M16A 3GM8A 2UY4A 4JX5A 1C8XA 4IX0A 4YVVA 3P14A 3NCOA 1F3TA 5HQEA 1GOQA 2J9XA 3LK6A 4JTQA 2WLZA 4H9VA 4UTWC 1IWBA 1HGYA 2J7EA 3W7KA 1L6FA 3HGSA 1ZENA 4LV9A 3B8IA 1DWIM 1YRRA 4P8XA 4JTAA 3PBVA 1CX9A 1VFUA 1YTEA 2OT0A 5KETA 4NJKA 5FSDC 1FWSA 1MEHA 4FA3A 1QASA 2ISDA 2DZPA 5FCZA 3ABZA 3CO8A 5DFAA 2R1LA 1XYAA 1N8FA 1BLIA 1U5HA 3POHA 2BDQA 1SJDA 4W84A 3AS2A 4ADSA 4FMVA 3CBWA 5CZTA 3THQA 2GSHA 1BQGA 1RBAA 3W7HA 2XM1A 1TV2A 4CNNA 5CZSA 2G97A 3KHJA 1PPIA 4WUIA 3NWRA 3BW3A 4IPIA 2OX4A 1HZYA 1W5MA 5JIPA 2PLCA 5A6BD 3CIXA 3WJSA 1JR1A 1PKMA 3W1XA 1EXPA 3SY5A 1AQMA 1RVKA 2VCBA 4UFIA 3MDWA 1XINA 3OGSA 1UD8A 4IM4A 1TSIA 1E5JA 2FMNA 2VMFA 3MBFA 3G6LA 3CQIA 3IVUA 1BHGA 2Z2UA 1XJBA 3PZNA 4PEKA 4FS9A 3WLMA 5D04C 1O5QA 1GYLA 5DQPA 3NURA 4LRTA 2IQDA 4XO6A 4KPLA 2DVTA 1E0XA 1TMLA 1P6CA 4W88A 1ME9A 4ZOCA 2XVLA 1PIGA 3SRKA 1W1B1 1WOAA 2A85A 4LS1A 2HCVA 3ZLGA 2XM2A 4I7UA 4PL2A 4YPJA 3AROA 3QN3A 1KKOA 4L61A 2R6OA 4B2DD 2ADAA 3DFQA 5AZ1A 1QNPA 4JTHA 5HDRA 4RV3A 3WJWA 4IIFA 3VAVA 2ZRYA 3BTNA 3TC7A 1B4KA 4S38A 2X0SA 4QJ4B 1PCKA 4NZ3A 6ALDA 2X1TA 4E8CA 3CHVA 3W85A 3FA5A 2VRKA 3KOWA 2W61A 1FKWA 3GDMA 5G4HC 4AZHA 4KRUA 3W3OA 1W3IA 2QAPA 1G4PA 4AMAA 1OYCA 2W79A 4WKAA 2C0AA 3FDKA 4KF1A 2A3AA 3PZ9A 3CZEA 2OQHA 5CBBA 4PCTA 1UR2A 1RCQA 3HA1A 5D33A 4V28A 1HO4A 3VZZA 2BVDA 3PZVA 2Y5JA 3KTCA 2XFYA 2VKZG 3PFMA 1SU5A 4RJEA 4UTLA 1GG1A 3PS7A 3DHUA 1XLJA 3OVPA 1ZFJA 1CLKA 2ZVRA 3I3BA 3S1UA 1GQKA 2YZRA 3CB8A 3H12A 4JX6A 1BWVA 5IBXA 1AA1B 4PE8A 3W1NA 1FHLA 4QAIA 3LLXA 4M56A 2EPHA 2WV8A 4ML4A 4AHPA 4PRWA 2QVHA 1OC7A 4XO7A 2HXTA 3ES8A 4C7FA 1LJYA 4PUJA 3WCZA 3U7VA 1XBVA 3L4TA 1ZBCA 2GGIA 4P2VA 3AHZA 1K7FA 2Z6IA 3GKAA 5M5DA 1F8MA 2O92A 4L9YA 4HOZA 3WBWA 1ZHAA 3DAQA 5D9NA 2ACQA 4UFLA 1OD0A 1ZRQA 2DSKA 3SCTA 2EPLX 3PZUA 5H8UA 1H41A 4K68A 4B3LA 3G22A 1V3MA 5A2AA 1TYGA 3WF4A 2OEJA 3K2GA 4R33A 3A3WA 3WNPA 2CZDA 1TPDA 5FJUA 4S3CA 3WD1A 1IR2A 1EUAA 3PWIA 4FIQA 1DJZA 5FF7A 2WKLA 1GT8A 4AZ6A 1J0HA 5K4XA 1AODA 4J3WA 3PB2A 4IH3A 1X98A 4LUTB 4WGHA 1E6RA 1MXGA 5I79A 1UH4A 3TJLA 1A5LC 3NDYA 2GVJA 1YQ2A 1E6XM 5FD0A 3Q37A 3GW3A 1SR9A 3ITXA 4G56A 3SCNA 4N7QA 5HAOA 3LBCA 1SZRA 3RO8A 4UTHA 3EKLA 4XD4A 3VOJA 2PTXA 2PDNA 3MC5A 2X1UA 1H0IA 4G6CA 3R8GA 2WVTA 2GVLA 8XIAA 2PWFA 5H6HA 5JIWA 3T8LA 3EB4A 4W5ZA 5AC8A 3G5EA 1LTDA 1EJUC 1DQUA 2WZHA 4MFDA 1O60A 1KM6A 2QHAA 3R79A 4H00A 4WSHA 4CD6A 1NQKA 4HZ6A 3GBEA 3NYZA 2WKJA 3KL5A 5FOOA 4OHQA 2BVWA 3BMWA 1GVYA 1OIMA 4U3CA 2VFFA 4E4PA 4GCXA 4UTJA 1GQNA 4QS6A 3WMSA 4I6KA 1UG6A 3STCA 3EZ4A 4I7WA 3TDFA 4LEFA 2QV5A 3W86A 3N2MA 1W17A 2VZVA 2OWCA 2OLAA 4MJ2A 3PZOA 1F6PA 4M7TA 5J5DA 3QV9A 5BCAA 4I9MA 3MSYA 4DM2A 5I07A 1TJPA 4NHVA 3NVTA 1UP3A 2BGSA 4PCSA 4C1KA 3JR2A 2X7WA 3DG3A 3QKEA 1CGWA 2XDFA 1XIHA 1R38A 3THAA 1S46A 3M7SA 2C1IA 5D2YA 1JCMP 4B90A 5CZKA 4S1FA 3RK8A 4GISA 4DM1A 1EJRC 4C6CA 1O5KA 4S3FA 4LNCA 1PVNA 5EGRA 1F3XA 4DN1A 2ZZ3A 5DEZA 3O6CA 3WLRA 4XZBA 1SPQA 3TSMA 2INFA 3VFLA 2A0NA 3IIPA 4MFEA 2JKPA 5CKSA 2TAAA 5C9WA 4H8VA 4WGXA 3O0FA 3IK2A 4TVCA 1JQXA 3LHVA 3QVQA 3N6QA 1QRQA 1TPH1 3KBMA 3MSDA 3ZLFA 1XX1A 3VNLA 1UWUA 3T40A 3N2TA 4DLFA 2XISA 1BXCA 2PTWA 3UG3A 1LF1A 2CLHA 1CXHA 1GCYA 1JZ6A 2FPTA 3QYQA 1QFEA 5DT5A 1SO4A 4X3ZA 1JNEA 4GABA 4IQDA 1US3A 1JJKA 1SSGA 2NVDA 2IKGA 3PPGA 4ZTYA 5D02A 2QUUA 5HMFA 3F2DA 2QYGA 4FIRA 1NP0A 1TPFA 3WQVA 3QLLA 3IEBA 3H24A 5E0KA 1J6OA 1ISVA 2VQTA 1AH3A 1LDCA 3GLCA 4AUBA 4RDVA 3GAKA 1Y65A 2PZ0A 1O5RA 9RUBA 1HL8A 2A7PA 4O1CA 3SQMA 1NELA 2V38A 2J7CA 3ELFA 1ISWA 4P7RA 5HMDA 4Q7BA 4ROPA 1IZCA 4B16A 3ARQA 4JIHA 3ABQA 4E0CA 2VD8A 1YMYA 3N4EA 5I3FA 1O95A 1XYCA 2D0FA 4FSAA 4O54A 3W1QA 4Q8TA 4MLRA 2J47A 3AS3A 3TX9A 4HOWA 4GH1A 4P7NA 4ZEPA 5I06A 2PI6A 4AZCB 3TSDA 4MJMA 2FYMA 3SADA 2R8WA 1VYPX 1XCWA 1LT8A 2P1FA 1V93A 2V63A 1G9HA 3A64A 3TWAA 1XLKA 2NQLA 1ZZMA 1UKOA 4YNGA 1GG0A 2AL2B 4QDPA 1KTBA 5TD4A 2DSVA 1EGMA 1V3JA 1ZCCA 2GK1A 4W7UA 1A5MC 4NU7A 3QY6A 1XW8A 1M7XA 3RLGA 2J8TA 1JDEA 4Z1AA 3M1ZA 2ISVA 2ZIDA 3DHPA 3M0YA 1OINA 3WD2A 3UERA 4HHLA 3FJNA 5I3JA 3UNTA 1LT7A 1VEOA 3GG1A 1A47A 4ZSUA 5LIXX 2C1GA 4BJHA 2W9MA 2I16A 5AHMA 5SWUA 2BSLA 3H22A 1R3QA 4E2OA 1EUNA 5D2TA 1A5KC 2ZC8A 2YCEA 4B2DA 3PNZA 3QQ1A 4MY9A 2W4XA 4CKQA 4ADUA 3FK4A 3APGA 1CXIA 1KV8A 3PSWA 5A8QA 1UR8A 4HNTA 2I5QA 1GQIA 3ZR4A 5CGQA 3WF2A 1AW1A 4MHBA 3WD4A 4DJED 4WVXA 1V5XA 3KBSA 4N02A 2CZEA 1Y5WA 1OCQA 3K8LA 4ENLA 3P84A 3C3UA 4RK8A 1VFMA 4GQQA 5TF0A 4GBDA 2FZNA 2PZNA 1OVDA 2HK1A 4OT7A 4PBEA 1FHDA 1XRFA 3S2LA 1AG1O 3BLFA 4GIRA 1JUBA 4C6LA 1BRLA 1A80A 1FWHC 4AH7A 1F05A 2ACRA 1KC7A 1W3TA 1Z3NA 1OT2A 3ZT6A 1EJWC 1ZNNA 2JF6A 3PAOA 1DL3A 3RLUA 3NA8A 3I10A 3TVAA 5EMUA 2GDVA 2E8YA 4DF2A 3WQFA 4H9UA 3CWNA 4AFYA 1U1UA 3L0KA 3RN6A 5C9ZA 2PMQA 4QXIA 1GVEA 2CERA 2E9MA 4C5ZA 3ITTA 3GXNA 3SN4A 3T78A 4X9YA 3KOXA 3C8NA 5LIWX 1JAEA 1RXOB 2MNRA 2CLMA 1NH6A 1HQTA 2BOFX 2ZWZA 2CLOA 4GKLA 1OG0A 3NQ6A 4F48A 4N2YA 2WMJA 1W3KA 2GL5A 3UWWA 3GTNA 1BVNP 3RAOA 2DJXA 3G0XA 1R3WA 2OSYA 3W81A 5EMKA 4LYRA 1OCBA 2H90A 1H1YA 4K8GA 3CMJA 1QXLA 4Y6GA 3W1MA 2CWNA 4TTGA 3WLKX 1IEQA 3GE7A 7REQB 1P0BA 4D8LA 3Q45A 4MJ4A 3N14A 4UQBA 2UBPC 2ZA2A 3ES7A 3H8AA 4DUXA 1R9XA 4KEMA 4JYEA 3AYSA 4FOJA 2V5DA 4US5D 2ZUTA 2GJNA 4A8LA 3KCJA 3GK0A 5HMEA 2NV2A 3CIWA 4F9JA 3UJRA 1GZJA 3BCDA 4H9XA 3CS2A 4MJZA 3H23A 2D3LA 3F5JA 4UQEA 1RSCA 5C6MA 1MMFA 1TB3A 2PEVA 4KIRA 3BQ5A 1NWTA 4PR4A 3R0KA 1B1YA 3VKAA 4WLCA 3GUGA 3LHUA 1UROA 1EZWA 5FKYA 1OF8A 2XWEA 3IVTA 3WD3A 1L6SA 5ABHA 3GB6A 2E1WA 2CLIA 3P82A 4LAOA 4BWLA 5LGXA 4MMWA 1JZ8A 2WCSA 4X60A 2POTA 2V3FA 4LF1A 3UXDA 4QGCA 2CNCA 1EGVA 4PMDA 3MPGA 1EXBA 5G2WA 3N15A 1MEWA 3UPWA 3G8RA 2J88A 1RD6A 1K6WA 1WDWA 4FO4A 4NAFB 4NJIA 3S1VA 3JVAA 2PU1A 4OE7A 3RR1A 2Y5EA 2YYUA 3VNJA 2Z7KA 3BLOA 5EB8A 1PXGA 4NUWA 1X1OA 1W9BM 2XHYA 4LUYA 4PC8A 2E28A 1IE7C 5CGMA 1M1BA 3PUDA 1PCWA 4XKMA 1E0TA 2CETA 2DUXA 1XR2A 1GZGA 4G7EA 5EMMA 1LG2A 3L5AA 3SCWA 1Q7MA 2FGZA 4OJYA 1WZLA 1XUZA 5AYXA 1KCKA 1VHNA 3PG8A 3NQMA 4TUFA 2VT0A 3UG5A 1S2AA 4N9EA 4WR3A 1QPKA 1FFRA 2DZUA 4MDPA 4LPCA 2YFOA 1VFTA 3ORWA 3M6DA 3VZYA 3IRDA 1A5OC 2VZSA 4C6PA 2OELA 1LORA 4N9CA 1U1HA 5F7UA 3AMGA 4ZO8A 2VL4A 1FWJC 5DY2A 2QDDA 4JDYA 2GFTA 2XFWA 2A3EA 4MPKA 3W24A 3W0KA 5LZLA 1E40A 1VCFA 4AQLA 5FJOA 5CBJA 2DQXA 3A23A 3WF0A 4S2CA 5TQLA 1S2VA 5FL0A 3ZJKA 3UPBA 2I1OA 2REQA 4BEUA 3ARYA 3GHUA 3BLEA 3F5KA 2ZXDA 4UCFA 1ZJAA 1QOPA 1YXYA 4QNEA 3WLSA 2P0IA 4HN4A 4QG8A 1I4NA 3SY1A 3G1SA 3NL6A 1KA9F 1JEZA 3W2NA 2QCMA 5AYYA 3OZPA 3WG6A 1C8YA 2CWXA 4HB7A 1UUOA 3CV1A 4HA4A 3S9IA 2F9RA 3WQOA 1H4PA 2I56A 3UXKA 1O68A 2BS9A 4B5NA 2H8XA 1MDRA 1PS9A 3EDJA 1GGOA 3GC2A 1TJ1A 1B3OA 1OG6A 3AZRA 3DFHA 4WJXA 5KTLA 4Y2WA 1Q85A 2ZA1A 1P5BA 4LAUA 5BWAA 1UC4A 1GVFA 2QS8A 7XIMA 1D7KA 4OBRA 3HFTA 2BG5A 4FLQA 4QROA 3LTPA 4O12A 1EPVA 1TCMA 3AXMA 3NGFA 2WNNA 4OQVA 2PDLA 2PDKA 5BMXA 3NEHA 2NQJA 1FWAC 1OFDA 4IP4A 4QAWA 1VYRA 3M7WA 3C8FA 4ZODA 4E2BA 2BXYA 3MHGA 3LI1A 5M03A 2PDWA 1M04A 1DORA 4IIBA 1PV8A 4H6KA 3W02A 3H4GA 2X40A 4GBUA 3NL2A 3W9ZA 2DP3A 5FJJA 1OADA 1MXDA 4A6GA 1OX6A 3LEPA 3UR5A 1J0ZA 1GJWA 5JBEA 2XTKA 1H51A 3GY1A 6XIAA 1GONA 4ZQOA 1LRQA 1VIZA 2V82A 3CPRA 1HKVA 4LALA 4IP5A 1UR4A 1FKXA 2D3NA 4CGTA 1Q6GA 1AL7A 1SJCA 3HB9A 3BSHA 4MB1A 4JDBA 3OU8A 3RCNA 2EPMX 3DESA 3S2NA 3BOFA 2EHHA 1G5AA 4A35A 1F61A 3W73A 5I00A 2CZFA 3LGEA 2O0TA 1DJYA 3Q65A 1RK6A 5FF4A 2PTDA 1BSIA 3JZEA 4EANA 1MEIA 1VQTA 4R5EA 3EWCA 5KEZA 3SN0A 4PRRA 3HBLA 1TFVA 2ZUUA 4CVUA 3SRFA 4HD5A 4H6RA 1VIWA 2JALA 2KX9A 5DMYA 3S2MA 3VDGA 3AIQA 4Z17A 3H2MA 1QPOA 1UWSA 3VNMA 3MUZ1 3APYA 1TUFA 3EDEA 3PBGA 2NQ5A 1HL9A 4JGDA 2VOMA 1EP2A 4UIOA 2IPJA 4DNHA 3QMSA 3QPZA 5CPSA 1HG3A 1JCNA 1QMLA 3BOXA 1MNSA 5FAGA 4RDWA 4ZA0A 1XBZA 2OQLA 3UYCA 1UCWA 3PTMA 4DZIA 3CEPA 1NOFA 3HG4A 3DH7A 3AUOA 2ZZ6A 1RLCL 4MNKA 2ICSA 1X1NA 3AWNA 2O9TA 3B4UA 2H3BA 1ITCA 5EIYB 2WSKA 3PJUA 4H8HA 3TTYA 2G50A 4J3TA 1YHTA 3M5YA 5TBOA 3UY8A 1KFJA 1WCGA 1CXKA 3HOJA 3GDTA 4LUSA 3JW7A 4TVUA 4NILA 4HA3A 2CU0A 4AEEA 7ODCA 1UD5A 1LOSA 4CNUA 2ZADA 4MZ1A 3JUGA 3VINA 2H6RA 4D6JA 3N73A 3OLGA 1O94A 4G8TA 3KL0A 2NX1A 4LBUA 4ERAA 1W8GA 5GNXA 4IQJA 1HJXA 2W6RA 2IKJA 3TTOA 4AW7A 3ZYZA 1JG9A 3A5VA 1S39A 3T6CA 1EX1A 3A4JA 1GYMA 2QCFA 3QFEA 2KAUC 3MT1A 4HNUA 3O1NA 4MPQA 4F2UA 3QW4B 3WMLA 1X6LA 2WJDA 1A3WA 3TNOA 3HZ3A 3IUIA 5EMLA 2V2CA 2C19A 2HK0A 3C2OA 3E02A 2PP0A 4GJIA 1EIXA 5HA7A 5FIPA 2BY1A 4C6NA 1CECA 3R1ZA 3E2QA 2E09A 3B9NA 3TW6A 3TROA 3QOKA 1S2UA 2Z6JA 4FAMA 3CV2A 5EMJA 1RK5A 3W7DA 3BV4A 3R8RA 2PWEA 4W86A 2INZA 3QF0A 4W85A 5D9OA 1HJQA 4Q22A 3VOHA 2B7NA 2J6VA 1VH7A 4HU4A 3P8JA 3CH9A 1TG7A 5EY5A 4WJEA 1I2QA 1P48A 3LM3A 3GTHA 1JAKA 1JPMA 4XX6A 1JRBA 3C61A 3GYCA 3VGHA 3TTQA 1GOMA 2FPVA 4Q8UA 4DXXA 4ML9A 1B3WA 2A7RA 4KEVA 1XC6A 3GXIA 3OBKA 4A4AA 3KBNA 2J77A 4Q8VA 3CPUA 3ZSTA 1US0A 3OP2A 2HQAA 3WFAA 3RCMA 4OUIA 2DT0A 3CWOX 3CZGA 3AYTA 5EBUA 4JTLA 4IFRA 4GVHA 3LXCA 1XGZA 1OY0A 1PBGA 2OSXA 3K30A 3SRDA 4CNPA 2FZMA 4LV4A 3R89A 3M0VA 3RX2A 3S1XA 4AEOA 3RM9A 4JOMA 2XIQA 2WB5A 3PP7A 1F7BA 3E2VA 1D2KA 4A3UA 3W7GA 3DG7A 1GEQA 2NWRA 1LQAA 2V3EA 4EPBC 2GQ3A 2PGWA 3W26A 3GH4A 4F9DA 3LZ5A 1WNOA 5BZAA 2BNJA 3MO4A 5LSMA 1FWNA 2FTWA 3BG3A 3W88A 5A8GA 2NWSA 3W01A 3OW1A 2J7FA 4BS0A 3M9YA 3P67A 2AKZA 4GE8A 5JH1A 4C1NA 4AZ5A 4B5WA 3LQGA 4ZFCA 4L4PA 3NFUA 1SMAA 5J04A 3ZVIA 3NSXA 1PYFA 1NOUA 1FCVA 4RE0A 4EPEC 3O8AA 1OK4A 3MI2A 1TKKA 3STFA 3DYOA 4A3RA 5PTDA 1FWGC 1ITQA 5B7ZA 2FMOA 4N42A 4GUFA 2X1SA 2DZWA 1OZQA 3HU7A 5DMLA 4UTTA 5FJIA 2VC7A 2QF7A 2FHBA 2G3MA 1ML1A 5F2GA 1QR7A 3AICA 4FPSA 4KWVA 1SW0A 2X30A 2F8QA 1EOKA 2UY2A 3CYJA 1XLDA 3G2GA 3FGCA 1WZKA 4L7ZA 4TQTA 3CB3A 1W31A 6TIMA 2INEA 5J5RA 3R0DA 2ZICA 4GQ0A 1XLCA 4QRNA 1X6NA 5JBDA 2ZDRA 4M24A 3E2SA 4I9AA 5D2VA 3ZVHA 2DH3A 3WO8A 4I8DA 5IRPA 2O9RA 4BCEA 2OODA 2QDEA 2O4QA 1H1NA 5FESA 4DWSD 3LDVA 4YTUA 3CUGA 1OJXA 3QV7A 1LP6A 1EPXA 4XBKA 1CEOA 4V15A 2BXZA 1OABA 3UCDA 1GOOA 1H7PA 3GU9A 3AWOA 1OK6A 2XWDA 2D69A 3TQKA 3CV7A 4HPNA 3S8HA 2OOGA 2DUZA 2VC9A 3LSBA 4Y90A 2Y85A 1BFNA 4AAJA 2Q6ZA 3BANA 4JIIX 2AL1A 1K8CA 4AWEA 2GWNA 5C9XA 1JL8A 4D8AA 1ICSA 2YFNA 4QE1A 2FFIA 4LAMA 1E9YB 4EPDC 2D2OA 4XKYA 1UWAA 2DIJA 4IGNA 1JD9A 1OYAA 2CFFA 1NM9A 4F0MA 2G0WA 2YX0A 4MNJA 1DV7A 5C7VA 3WYZA 1GQJA 1CDGA 3BAYA 3BW4A 4FNQA 2IXUA 3UXAA 5F4WA 2J9ZA 4GYPC 1NVMA 3D0CA 2H3DA 1JDAA 3ZM8A 3P6LA 3RU8X 1P1MA 3GDLA 1FTXA 4DY1A 1EC8A 3N9SA 4AB4A 2PAJA 1XIEA 3VNIA 4KERA 2Y0FA 2DVXA 1AW5A 2OYLA 4DNMA 3EDFA 4GNJA 1ALDA 4ZE4A 3DCPA 5DO8A 4CEUC 4US6A 1O66A 2WXDM 2VP8A 3O6AA 4L1GA 1OSEA 3W2UA 2RUSA 5LNUA 1NDZA 2JKEA 1Q6OA 1QNVA 5LIKX 1R6WA 4I8YA 2Z25A 3MBDA 1E4IA 1VD6A 4NJJA 3IJDA 4DYJA 1YYAA 1I0BA 2XZ7A 4CCDA 4EX4A 1AH0A 1FWTA 8TIMA 1EQPA 2PGRA 4ZXLA 1VENA 4CLMA 3N9RA 1TX2A 3BLPX 4E38A 3ZJ8A 1NWUA 4IPPA 3NQBA 4MF4A 2NSXA 3Q4DA 1R2SA 3ZT5A 2PURA 1QPNA 4HJWA 1PDYA 2RHGA 2VR4A 3WQ8A 4ZOEA 4XZIA 5HNNA 3W75A 2R24A 3V3WA 4F2TA 1WPCA 3H7RA 4RNJA 3TFXA 1ICPA 4XZMX 1Q7ZA 2POZA 3GXMA 4S3BA 1JCLA 3U0HA 4ADTA 1VKFA 3WUEA 1K4GA 3PHAA 1J11A 3A9BA 5CPTA 1WUFA 3GSMA 3T7VA 3VNYA 4K1GA 1JPIA 1GPFA 3A3XA 3SECA 4F0RA 4I5XA 2VGBA 1K7EA 3MCNA 2VEMA 1KXVA 4XV0A 4YXGA 4JTJA 2HROA 4P8WA 4CQ8A 3GR7A 1MW3A 1UIPA 3DHFA 4BQ2A 3WDRA 4HYVA 5CXPA 3SFKA 2GJXA 1Q4NX 3TJIA 5A2BA 3SUUA 4O1DA 4B91A 2BY0A 3QMRA 1X7FA 1XLGA 4WSJA 3EWXA 4N6EA 4CQ9A 5LA0A 2C71A 2BOEX 3DC8A 5DF0A 1KTNA 3N2CA 1GKQA 1AQHA 1BGGA 3AIBA 5AC5A 4GFSA 3IANA 3L2MA 1FP8A 3AS0A 4AYSA 3OJGA 3LCLA 4E2DA 3P62A 4H7CA 1TCDA 1JNDA 2ZTJA 1O1ZA 2O55A 1BYDA 4LQ1A 4I3GA 3EOOA 4LH8A 1TJ2A 3UY7A 4P8VA 3R7MA 3EWYA 1U33A 3T9PA 2NQHA 1XGEA 2A5HA 4DB7A 4QHRA 3NQ7A 1A5UA 1XIFA 4CU6A 1CXEA 2Z28A 4IMGA 1O5XA 2QPXA 3UZXA 1KTCA 2Z1XA 3GDBA 3W7CA 1Q6QA 4D6FA 2Q09A 3WDQA 2QKFA 4HOXA 2AQOA 4YN5A 1DIDA 3WFLA 2G4JA 3S42A 1VBGA 3U4AA 1QJWA 2EGZA 3GO2A 3OOQA 1XRTA 2DJLA 4HK7A 2YL9A 1TV7A 2WMFA 1LLOA 4ZCWA 2XVGA 3MV01 2VEGA 4RZBA 4TMCA 3EMCA 5BXRA 1KRBC 3NDOA 2F2HA 3H26A 5ABGA 1V03A 2IMRA 2XIJA 1GVRA 3S4TA 3UG4A 4MAVA 5HATA 1OCJA 3URAA 1GJPA 3DI1A 2QJGA 1H5VA 4KCUA 3ITOA 4KBXA 1PKYA 2R1PA 3ZO9A 4M8UA 1SW7A 5GJMA 3VGEA 1G6CA 1XYLA 3N11A 3VXGA 1KBLA 3V1HA 3GHRA 1FWBC 4GUIA 2E77A 2ZTKA 3M0ZA 3A21A 2TSYA 1H1ZA 2ZXAA 5K9CA 4TV6A 4AVFA 1B3XA 4K3ZA 1VCVA 3AO0A 1WZAA 2RGLA 2QCLA 2QUVA 3DX5A 1DIEA 4NXSA 3N3MA 4FI4A 3TMQA 3ITCA 2VWSA 2R9RA 3I6RA 3B8TA 2V81A 4UFMA 5BMWA 1UUMA 2NSOA 3EMZA 4DBEA 3AALA 2UZ9A 3HFYA 5AKQA 1YX1A 5E6ZA 1UHVA 3PWGA 1E6ZA 4M81A 1WXJA 3LV6A 2GDUA 2CITA 3DYMA 2PP3A 2GQ8A 3HM7A 3BUVA 4IMDA 1XFBA 1FDYA 4FLRA 4PN2A 3W7EA 3AISA 3C2EA 4LS2A 5A6LA 3RNDA 3B3DA 4NZCA 3I68A 3KRUA 3KLKA 3HGOA 1G7VA 1MFUA 1VF8A 1MQRA 1M65A 3J7HA 1Q6LA 3GAYA 3VX1A 3VMOA 3IK4A 4G7EB 4PFMA 1PEZA 3DUGA 2WWCA 1I8JA 1K8ZA 1XBYA 1LROA 1SZFA 4GWEA 2RH9A 2WOQA 1GEHA 2O56A 3UXIA 3N1AA 3ATZA 1XPYA 4XIAA 3OA3A 2E7FA 1RV8A 2AQVA 4L5ZA 1XQKA 2E6DA 5IBXC 3URBA 1QW9A 4OTKA 3LQLA 1KCZA 3W76A 1TELA 2PWUA 4GUJA 2Z27A 4CUCA 3V75A 1HP5A 4DF1A 1DTNA 1MI3A 4A2SA 3GD6A 1HP4A 2WHJA 3SCVA 2BGQA 4JY8A 2CIPA 2V5JA 1SO6A 3LTSA 4Y9AA 4LS0A 4YIWA 1AL8A 1EDQA 3P93A 4LAKA 2BXVA 4G7FA 4R9OA 3UWVA 1DJGA 4M0XA 3AU6A 3MCOA 1PYMA 3SURA 4XVEA 2REQB 1C90A 4Q4MA 3VOGA 3C2VA 3LRMA 3T4WA 4XUYA 1XISA 3MUAA 4P00B 3KLLA 3KRSA 3SAZA 3VU2A 5IHRA 3KUMA 4AEFA 3MMUA 2YSWA 2X05A 1XV8A 2JQXA 3PPHA 1MVYA 3GTXA 4Z1DA 4JIRA 3IGXA 1P6BA 1G0CA 3QXBA 4DJFA 1PX3A 2BHZA 2Z2AA 5C9RA 1TIWA 1R5YA 3TW9A 4DJDA 1KGWA 1XLIA 1CYGA 4K7VA 1ECQA 1TX0A 2GOUA 4FXSA 3MI3A 1Z42A 5CPOA 3G24A 4YU1A 1W3JA 2WC3A 4O14A 4Z42C 4ZQPA 1ADDA 3V18A 4GC3A 3SQLA 2ZX5A 3GTIA 3UU0A 1W8SA 3T09A 1B4EA 2BWGA 5JMUA 2VEFA 3V0TA 3EAUA 1K8YA 4DELA 1EB3A 4WKFA 1PTDA 2EAWA 1OIFA 1D8CA 2E3ZA 3PN8A 5EU9A 1CPUA 3C0JA 3N6HA 5CSUA 4Q7NA 1RBOB 3TLLA 2FDMA 1A0DA 1C91A 1DXEA 1H61A 3G77A 1U5VA 3GVWA 4HNOA 5MKGA 2NLIA 3XIMA 3VDBA 3F5LA 3M4HA 4FNRA 3RUBL 2RKXA 4V2XA 1XXXA 1Q7QA 4XAPA 4CQAA 4A29A 1UZ4A 1AUSL 5E9AA 4A05A 3CL8A 5I5RA 4MNMA 3OG2A 2OB3A 3SUTA 5FSEC 5FF0A 1TZ9A 1CGTA 2JFEX 3BMVA 3G6MA 3MP4A 4F0LA 1B0IA 2BVYA 1W37A 3EXTA 2WVVA 4QM1A 2NXHA 3SR7A 4A8IA 4LGXA 3R5EA 4UTWA 3ARVA 1QU4A 4Z0JA 2YW3A 3MS8A 5HJYA 3KEHA 2ZBTA 3T2PA 1VBJA 6REQA 1L6WA 4Z08A 1H2JA 1U22A 1YKWA 2VWTA 3R25A 3P80A 4J1OA 3UZYA 4WZHA 3GXFA 2TYSA 1ITUA 1XH2A 3KTXA 4M29A 4K37A 3ID7A 2P8BA 5LHFA 3UR8A 4KESA 4ES4A 2OO6A 2Y5SA 3LY0A 1KFEA 1OWQA 2KZHA 1VJSA 1A3XA 1T8QA 4L4MA 4X9SA 4KIEA 3L4YA 4ECLA 4IQEA 2VD9A 4AZ7A 5D8WA 3N34A 3SUWA 4W7WA 4RXGA 5AHEA 1Q5MA 4UOZA 2CLKA 4DUWA 3M44A 3THCA 1EQCA 1VR6A 3TN6A 2VYOA 3P0WA 3E9AA 3EX2A 2UWFA 2ZCGA 2QUMA 3MJYA 4LUSB 5CSYA 1UYQA 4IPJA 2OXNA 2Y7FA 4H83A 4IIDA 4NP7A 1UP0A 3L23A 4BFAA 4Q4RA 2QLYA 2VI0A 4Q6XA 4FNUA 4HN8A 3PAJA 3P61A 1P0KA 4LVFA 3WNLA 1TA3A 4R85A 2X09A 2W91A 5FEZA 1OD8A 2QDGA 4RE2A 3BE7A 2DU2A 3EWZA 4D6HA 5HMSA 4NRRA 2Y6ZA 3V35A 3CZLA 3GVVA 3RCYA 3VIOA 1PTAA 2IPGA 4UC5A 2W63A 1BYBA 1Q13A 1IQ8A 1EO7A 3QQ0A 1BXNA 4GRSA 2YXOA 2XGZA 3ITLA 1SMDA 3C6CA 1N55A 1RQEA 1MNZA 5J8LA 1PL9A 3B9AA 1VBUA 2WBKA 4LUJA 1J2BA 1R2TA 1NOWA 5FF2A 2ZRVA 1IWPA 2W27A 4F40A 3D47A 3W7NA 4TIMA 5AZ0A 1W0MA 2GZXA 3NO1A 3CAKA 3S9ZA 1TV4A 3HV9A 4MGGA 1UW9A 1UPMB 3CNYA 4DEFA 1SSDA 4G2DA 4XAFA 3W28A 3ANYA 3FDGA 3GHTA 4B3KA 3TA6A 4AVOA 3T07A 3DERA 1WBJA 5E0FA 3MKVA 1K8XA 1V77A 3QEZA 3E96A 2DZBA 3E49A 4MDOA 1TREA 2VFGA 3UEQA 3QTGA 4K38A 3N25A 1ZAIA 3MJMA 4HHHA 2EPNA 5AYBA 2ZYFA 4AMCA 4HTYA 2FB3A 1XLFA 1D3GA 1GVQA 3N19B 3O3RA 3UJSA 1SZEA 1WDPA 1VPYA 4DHGA 3BGJA 1GPWA 5I3KA 2VZOA 4K2SA 1SYTA 3BG5A 5I09A 1UWIA 7PTDA 3B0YA 4CD8A 5JVLA 3BLDA 2FLIA 2X7VA 5HNTA 1TZZA 1UWTA 1O6IA 3GVGA 2NX9A 1EHAA 1HL2A 1XIGA 3HF3A 3WLIA 3EMQA 1ZP4A 1NWSA 2W66A 3H2NA 1TR9A 3IV3A 4JTKA 3R11A 3KOFA 2PLKA 1VPXA 1ZS2A 1RA0A 4JL2A 2OEKA 1T99A 3MTWA 2Y88A 5AC6A 1QI3A 2WK2A 1XD1A 5A6SA 2YGYA 3SN1A 2BOGX 2A6LA 4WDXA 5KINA 1C7TA 2VO5A 4I90A 1K7XA 2FVMA 1FRBA 4GOAA 4ZO6A 4DZAA 1R46A 2ANUA 4IPNB 1W5NA 4XVDA 3ARRA 4GO9A 5CAKA 1ICQA 1YPXA 2PWGA 1DJQA 3V0UA 4PBFA 5E93A 1LBFA 3IARA 2RJGA 2XN0A 4H8UA 1JDFA 1PHQA 4ZMGA 3CT7A 1CI1A 3WBEA 1KFWA 3WF3A 4C1NB 1XD0A 1J2WA 4B15A 5JQ9A 1R3RA 2Z00A 4NNCA 1RPXA 1KGXA 1RQBA 3TAOA 4RKAA 4JTFA 1V3LA 3E5PA 1GW9A 4JFWA 4FP1A 1AD1A 1FWWA 4BA0A 2OR2A 4RX0A 1SJAA 1JGIA 2VCCA 1E15A 3U5UA 3ZOAA 3MUCA 2J62A 1FA2A 1BQCA 3DG6A 4JCLA 3T0TA 2EJ1A 4JTDA 1AK5A 3ZSSA 1EJSC 1EBHA 2QJIA 3RLHA 5H2ZA 2ZRZA 4CN6A 2QNEA 1DJWA 3R10A 2WMIA 3S2CA 4HQVA 4LY4A 2YDAA 4FF5A 4Q4QA 4L9XA 3EB3A 3TAKA 5C9UA 3NG3A 2A6NA 4GXMA 3FGCB 3LGDA 3VKBA 1V8EA 3AZTA 2WNWA 3W6MA 1I1WA 4MM1A 1R86A 1S5MA 3FSTA 3WL1A 1SFJA 4NYUA 4RZ5A 1AMYA 4NIRA 3ZVHB 1G69A 4GUHA 3VYLA 3SSJA 1J10A 1U2YA 4LAZA 3LD5A 1KR1A 2W62A 3KOYA 4Z2JA 1IZJA 4LANA 3BMXA 2UV8G 1R2RA 1IT8A 4WD0A 3NXLA 2ON3A 3O15A 1KNWA 4EVZA 3MKKA 3EBVA 1XLAA 5D4YA 1KR0A 5I02A 1TV5A 3EGJA 3NSMA 3OGRA 4MB3A 4BWLC 3QZAA 3EA2A 1VFSA 5B7YA 1C9WA 4LB3A 5BOOA 2ASHA 1JYVA 4H41A 3SM0A 2QUTA 1HJSA 2NQZA 4LYPA 2P53A 3A4AA 1S5WA 2VFEA 4XKYB 2QPUA 1LRNA 4REQA 4O10A 5FI8A 4UMCA 4GZJA 5G5IA 1G4SA 1UASA 1G4EA 1V0KA 2W92A 3W70A 3WLNA 3DI0A 1T41A 4OFCA 3TIMA 2WQDA 3CU2A 1JF6A 2O9PA 3IJ6A 4DUVA 5ABFB 7ENLA 2B81A 2WSPA 3TC6A 4UNLA 2R91A 4ZOAA 2V3DA 1M53A 2BY2A 1VPQA 3KS6A 1DJHA 3TH6A 4PEEA 4LW7A 3TP4A 4NY2A 2YLAA 3SJNA 4L9ZA 1QW7A 3DC0A 4EP8C 2NUWA 4KEUA 3OHMB 4EE9A 1K02A 2Q01A 2WW5A 4X0NA 4NZ4A 1HJWA 3TYUA 3QRHA 1LOLA 4IUOA 4HHPA 1LWJA 3JU2A 4BQ4A 4UR8A 5AOUA 3M5XA 4HZ7A 1RUSA 3AHTA 4HG6B 2NUXA 3QPEA 4GMEA 1KCLA 1CENA 1TO3A 3BGAA 4HSNA 5LNVA 4GZEA 1NIUA 2Y2WA 3B04A 3CUXA 3W53A 3OYXA 3I3DA 1C92A 1RY0A 4GXWA 1T96A 3S2JA 2VGFA 1KO0A 4ZR8A 1IEVA 3RXZA 3SCUA 3L67A 4JN6A 1EFZA 3P3BA 3T0CA 1OBAA 3FFSA 1CWYA 1NSJA 5CC6A 2EBNA 1EJXC 4GX8A 5BRQA 4JFTA 4FEZA 3O9NA 1MWOA 2F2KA 2WC7A 3A3HA 3GNDA 2WJEA 3BC9A 3DENA 1MXSA 4U5KA 1P7TA 1KXHA 2OWXA 1DKWA 2QCNA 3VIPA 2OOFA 4W9TA 3OVRA 4MZ8A 3NDZA 5CJMA 3MZNA 4J2MA 4S3KA 4OBSA 3KW3A 4XZNX 4KWWA 3UNDA 4S3AA 2CBUA 4IMFA 3LA4A 4MTVA 1MUMA 4F79A 4B4FA 1B90A 4QCFA 2PUZA 3L0NA 2ISFA 4K8HA 3WENA 3AXXA 3NQFA 2VEPA 4HPHA 3TUUA 1FH7A 4LCQA 4AU0A 3VGFA 1XIJA 1ZJIA 2VDHA 1UKSA 1K77A 1D7FA 2GJXB 1C8VA 3MANA 1NDWA 3PY2A 3IRSA 1MDLA 1DWFM 3IPWA 4Y8FA 4ICMA 4AIUA 4N6FA 1W1A1 4DAIA 2BODX 4B9ZA 8CGTA 2DW7A 3CTTA 1GK8A 3ABRA 3AXHA 4R53A 1JF5A 3HQOA 1ZQ5A 3KP1A 5DBTA 2EG8A 4R7JA 4W8AA 1ISZA 3UWUA 4CU8A 4ORIA 3AYVA 1SFSA 4IFKB 1QHPA 5C70A 4XZLX 3FNDA 1L8PA 1JI1A 2YDRA 1NF7A 1A4MA 3P7YA 3FKKA 5KZDA 3QHMA 4DBDA 1VBHA 4DO7A 1HIZA 1YPFA 3D5HA 4A3QA 1IWAA 3TWBA 3LCFA 3W6LA 2CZ5A 3GG0A 2AOSA 3I4KA 2PDMA 4NZJA 3QR3A 4NL1A 4HGXA 3CQKA 4L1XA 3SCSA 2C18A 1HO1A 3MWAA 1E70M 3LM7A 1RALA 3IJIA 4TO8A 2PB1A 3WDIA 2BASA 2XH0A 3M0IA 4QFUA 1PZ1A 2DORA 4D1JA 5G1YA 4AZBA 3DOPA 4HZMA 3UZ5A 4PCFA 2DSWA 4E4UA 2YB1A 5EA9A 1JVNA 2PDYA 1S5TA 1JI2A 1GVOA 2QCEA 3WUGA 3I7SA 4C1LA 3B9DA 2NV1A 1FWEC 5DCBA 3EWBX 1L9WA 4XD6A 4CCCA 4Q7IA 4FXRA 3W87A 4CEXC 3IACA 1G94A 3TC3A 3B0PA 2BLEA 4PTNA 3DFPA 3TSBA 3WMBA 3CH0A 1MW0A 3EWWA 4KRZA 4IOTA 2NUYA 1LL4A 1H62A 1F2JA 2D24A 2PDXA 4XAYA 3BPWA 4O4VA 5AVNA 3FY1A 3LBMA 3UJFA 4JTTA 1HF6A 3TQPA 1E55A 4C60A 3UA3A 1QAPA 1K3UA 2GGJA 4D2JA 4LF2A 2J9YA 3GRIA 1Y7VA 3NM3A 2QCCA 1XPGA 2EQDA 2PC4A 4C6BA 1OFPA 4GZIA 1RHCA 4RW3A 4ZTXA 4WY0A 3ABXA 3TYBA 3NEVA 2XVPA 2TMDA 4JN7A 1SUXA 4F0SA 4B5TA 4D6EA 2VC5A 3CC1A 3QC0A 1ZUAX 3OEXA 1EH9A 2ZRWA 4DX3A 4XAGA 2I57A 1W3LA 1RY8A 2J27A 4D8ZA 3ARZA 4HK6A 2GGGA 3W72A 1YXDA 1M6JA 3RDKA 3RJXA 3NTYA 1KD0A 4M3PA 5AHIA 1H49A 4QE4A 3MDUA 4LB4A 3EKZA 2QCHA 3VC5A 3EX3A 3HPFA 4PUEA 2YCIX 2G8ZA 3AZSA 1H5YA 4O57A 4OV4A 2A3HA 2J75A 4RLIA 4R27A 4HCHA 3TYDA 4XG1A 3WLHA 1GORA 1J8VA 4GYKA 3WH5A 4QLKA 2O7QA 2VGIA 1EF2A 3EPOA 1MW1A 3CUFA 4QLLA 2VR5A 1SJBA 2P5NA 3HO8A 3QZEA 1JZ4A 4IMEA 3QM3A 2W3ZA 3GZAA 2QULA 4LBRA 4YWSA 4DRSA 4GZ7A 1LWHA 3WL0A 4MG4A 3AAMA 3UR7A 2QR6A 3GVQA 5CH9A 2V0TA 4NG3A 4NX0A 4QJ5B 1FXPA 5BXPA 5GNYA 3AIUA 1AD4A 1ME8A 4Q6JA 4J28A 2ZVIA 3DIPA 4O1FA 2Q71A 1ONEA 2R1NA 4PUDA 1WYIA 1TIMA 1Q45A 1RQHA 1LRTA 3QY7A 3H53A 4YCOA 2R1MA 4IHCA 5HXMA 2VTFA 4JTGA 4FNSA 4RNFA 4X61A 2DZVA 1UKPA 3ERPA 2PSNA 3L5MA 3W82A 5M1TA 1KBIA 3WFZA 3L7RA 1H7OA 3P74A 5GNZA 3EX1A 9XIMA 2WQPA 3M64A 5GVJA 4NJGA 3M0KA 4LCRA 4BK9A 3N2BA 1RD5A 3RPMA 5ENLA 4BI6A 4YL2A 4MYAA 2PFHA 3S9YA 3AXKA 3FEMA 4QG6A 1LCOA 1P6WA 2GJPA 1GJUA 5I78A 1OFAA 1M9HA 4L6HA 3M0MA 3C3NA 4Q4PA 1NFBA 3DFSA 3AI0A 3II1A 4YTQA 3OBAA 1KV5A 4H6EA 4HP5A 1U5JA 4Q8NA 2H8ZA 1JGMA 4K1WA 4JL1A 2VGGA 4FNPA 3STPA 4GGHA 4PTDA 4WF7A 5CJ5A 4FOKA 1THFD 3PZMA 2YB4A 3I7RA 3N04A 4AZIA 4IGMA 2J25A 4RPPA 2BX7A 2GUBA 1AZ1A 3LLFA 3LCIA 2F38A 4WEVX 1ENUA 5AB3A 4GI8A 3CZ8A 1KFCA 2IXVA 1CBGA 2Y24A 1UPPA 3RRAA 1HXJA 1VEPA 1J12A 2E0PA 1XBXA 4NAEA 4X63A 3L2LA 1Z89A 3NR0A 4YTSA 2OZ3A 4QQUA 3GUWA 2OZTA 4LJ3A 4QITA 4D71A 2PDBA 2XSAA 4LYQA 4J9JA 2P76A 4JAWA 3ANUA 2BV9A 2P10A 5LXXA 4O15A 5FF3A 3PPFA 4ROQA 1Q6FA 4RV8A 3AIVA 4F8XA 4UTTC 2FZ8A 3WEMA 3FW6A 5MKGB 5BRBA 1JCJA 3FLUA 2GYIA 2VZUA 3UWQA 1WXYA 2GUUA 3T8QA 3ALGA 5CG0A 1UD6A 2EKGA 1ONWA 1JCXA 4PCNA 4FX7A 4W8BA 3WD0A 4LNYA 1P0DA 1E0VA 3A4WA 5A6MA 5I3HA 4AXKA 5T26A 3A47A 3IGSA 3LV5A 1UUQA 2PS2A 3WX7A 2NT0A 4ACYA 1YTKA 3SCRA 3U5YA 2C14A 4LVAA 4H9MA 3HTWA 4YS1A 1R47A 1DXIA 1F6KA 4EACA 1WB0A 2OG9A 3PSVA 3CHEA 4UUIA 3S5SA 3KVLA 3ZR6A 4GC4A 4Z1CA 1I75A 3BJTA 4XBJA 1BVZA 1KFLA 1L0PA 2JEQA 3W1RA 3THDA 1QNRA 2WVVB 1V3HA 4QIUA 1XLHA 4QSHA 3K8MA 4Z1YA 5U4NA 1DE5A 3AMKA 1VFOA 3BXWA 1HFBA 3EKGA 3H2EA 2JEPA 3C56A 3TJ4A 1VBRA 4D6GA 2JGQA 1HT6A 3W6YA 5LNWA 1CB2A 1MUCA 4DYEA 1EWDA 2CLPA 1BAGA 5L9FA 2OMAA 2PODA 4IGSA 3P5YA 4W7VA 4LSBA 1ZGDA 1EYWA 2V5KA 1PSCA 3VDAA 3PG9A 3M0XA 2CLEA 2D0GA 3GR4A 3POCA 4HMCA 1OT1A 3T0BA 1ZAHA 3REQA 3CXOA 3FAWA 3CPGA 1KM3A 1Q8JA 2SFPA 4GKTA 4DVOA 5A8NA