2GK1B

X-ray crystal structure of ngt-bound hexa
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
54
structure length
54
Chain Sequence
b'PALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-hexosaminidase subunit alpha
publication title Crystallographic Structure of Human beta-Hexosaminidase A: Interpretation of Tay-Sachs Mutations and Loss of G(M2) Ganglioside Hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 5
structure length 54
sequence length 54
chains with identical sequence D, F, H
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gk1B02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 2gk1B01
1HVXA 1W32A 2V38A 4W89A 1JD9A 3RIKA 3LPFA 5DF0A 4MJ2A 1NOUA 1HJSA 4GKLA 3VGBA 3JUGA 2ZX8A 3VM5A 1E71M 2DT3A 2BY3A 1J0YA 2D3LA 1NP0A 5HDRA 1WKYA 4AZ5A 3PTQA 3PTKA 1HL9A 4D6HA 1GONA 1V3HA 1CLVA 3CGTA 2ZWYA 4OOUA 4UOZA 1QW9A 3WD4A 1J11A 3PZIA 2QHAA 1CGVA 4BA0A 3MMWA 3GH4A 1H09A 5GQBA 2PWHA 2G3JA 4HOXA 3VIJA 2DT0A 3QHMA 2D0GA 1MW1A 4TXEA 2GUYA 2VQUA 2YL5A 5ECUA 3G6LA 4MNLA 3CHDA 5CPSA 3M6DA 1XCWA 4J3WA 4Q22A 4TTGA 1UH4A 4C7GA 3EDEA 2Y8VA 4DM2A 3ALGA 2CPUA 3AIQA 4B15A 4D1IA 4GZEA 1C93A 3KL3A 1UQZA 5A2AA 4V28A 3EDJA 3A4AA 5I5RA 2YL6A 3CZ8A 1W9VA 1AVAA 4W86A 1O7AA 2J74A 2QPSA 1XC6A 3AXXA 2WC4A 4GO9A 1HKIA 2W91A 1JAEA 1HJVA 5A95A 1B31A 2XVKA 1ZBKA 1JYNA 1GW1A 7A3HA 1I1WA 3WH6A 2V3EA 3AHYA 1JAKA 1E6XM 2OSYA 4FMVA 1EHNA 2J7DA 1E6QM 3PZOA 4HTYA 4GI6A 3BXWA 2XJ7A 1UWRA 2WMIA 1QI4A 1M03A 2CBUA 3T0DA 3GBEA 1QHOA 2WLYA 4UQ9A 1M01A 2E0PA 3T0AA 4AC1X 2CBIA 2YBUA 1E6SM 4M24A 3ZIZA 1HJXA 2J79A 1SFSA 1G94A 4FLSA 4GI8A 4QLJA 2YOCA 1FFQA 3CZLA 1B90A 4ZEPA 1BSIA 3PN8A 1V6VA 4J3VA 4NI3A 2ZUSA 4RL3A 1CGTA 3ZO9A 1DWFM 1ECEA 1V03A 2CYGA 2W66A 5BXPA 3NDZA 5HXMA 4Z2HA 4EK7A 1KR1A 1I1XA 1PIFA 1CNVA 2RGMA 2OLHA 1J0JA 4CVUA 1HJWA 4XZBA 3VDBA 2ZIDA 1GQLA 4D1JA 3WF0A 1JGIA 2JEQA 2VCAA 5E6ZA 3VVGA 2VQTA 3GH5A 4D6GA 3ARYA 1K9FA 1HF6A 4UQBA 5HBFA 1OGGA 2W5FA 3L2LA 1FFRA 4JFVA 5A6AA 1V0KA 1MQQA 1LL4A 1PIGA 1E43A 1NM9A 4TOQA 2G8ZA 4CU8A 1CZ1A 1ITXA 1VFMA 3WD2A 4MNMA 4OUEA 2BVTA 3NYDA 1PZ3A 4X0VA 4DUVA 3F4VA 4ATLA 5LA1A 4JL2A 2WZEA 3KL5A 1JF5A 4MJ4A 5DT7A 3WFZA 3VD7A 1ODUA 3RJXA 3N13A 5JBDA 4NRRA 3IAQA 1GZJA 4TUFA 3CBWA 3MO4A 1ZB5A 4X9YA 2VO5A 3U7BA 2EJ1A 1GOIA 2B31A 4M1RA 3AIVA 3OLEA 2PB1A 3RPMA 4TX6A 2WCGA 4W84A 4XX6A 3T0BA 4U3AA 4JHZA 2XTKA 1V3LA 1GQIA 3IJ9A 1W9PA 2V5DA 1GCYA 3CUFA 2BS9A 4HP5A 3GBDA 5C8BB 3THCA 1QPKA 1CGXA 4GQQA 1HT6A 2GVYA 2CESA 1VIWA 1OCQA 1OSEA 4QLLA 2OWCA 4DUWA 5A6KA 3ZSTA 3WUGA 1BGGA 1FA2A 3AFBA 4MADA 3QOMA 1OB0A 3FXYA 5GNZA 3BC9A 4UQAA 4PCSA 2MANA 3II1A 4HA1A 1CGWA 3OG2A 3AMCA 2WZIA 3FAXA 5D9MA 3CMGA 3GDBA 4UFKA 3W27A 5CLWA 5I23A 1R7AA 2BHZA 2J8GA 2CHNA 1NH6A 2A3EA 2DSWA 2BY1A 4LPCA 2D20A 2ZUMA 3W4RA 2PC8A 2V3FA 2FH6A 3WD0A 4IM4A 4PBGA 1GHSA 1GNXA 3RDKA 1E0XA 5AC5A 1TE1A 5I77A 4H7VA 3SCSA 2J7GA 4Z2KA 1PX4A 2YDRA 1C90A 1UG6A 2XWEA 4CUCA 3SUWA 1C91A 2W4XA 2FHFA 5FCZA 2CBJA 4LYQA 2X05A 1V08A 2XYLA 1OWQA 2V3GA 2WXDM 2NW0A 3VGFA 1H41A 1WZMA 2QPUA 2D22A 1N82A 3FHAA 1QNQA 2JEPA 2V5CA 3VGHA 4TVCA 7TAAA 4XV0A 3NSNA 2VZTA 2J7CA 3BCFA 2WVTA 1BYAA 4HU0A 2XWDA 4JKKA 1CIUA 2ZE0A 4UFJA 4Q7NA 2YA0A 3HMCA 3ZJ7A 1PPIA 4IPLA 4J3TA 1GOOA 5IXEA 3SCUA 3B9EA 5GNXA 3GXIA 1MYRA 1B30A 4MB5A 5BYWA 4EKJA 1W1PA 2GK1B 4HZ7A 2VRKA 3UG5A 3VIMA 2ZUVA 4GZJA 1JF6A 1KBBA 2O92A 5HOSA 1LL6A 2YBTA 6TAAA 2OWWA 3A47A 1CXFA 2XVGA 2YLLA 3CHEA 2DH3A 3AZRA 4ZFMA 4MDPA 4GI9A 2FGZA 5BRPA 4UOJA 1BHGA 5EMYA 1DEDA 1M53A 4YPJA 1B3VA 3L4TA 2PWFA 4CU7A 1C8QA 1KGUA 2PF0A 2A3HA 1XSIA 2VNCA 4D6JA 3SCVA 1UWTA 3WD1A 2A3AA 1B3ZA 1Q4NX 1BVZA 3GXDA 1U2YA 1GQKA 2CETA 5BCAA 4CD5A 1X1NA 3WQ5A 4D6CA 1W9XA 5LA2A 3WQ8A 1V02E 1ODZA 4H04A 1U33A 4XB3A 3MV01 3ZJ6A 3AXHA 4KMQA 2CHOA 3L4ZA 4NRSA 3WNOA 3AHXA 2QMJA 3D3AA 5I79A 6CGTA 3ZT6A 3WQWA 1B3WA 3WUFA 2E4TA 2DPEA 2ZX7A 3SCRA 1H1NA 2GJXB 5I78A 1JD7A 4HMDA 4P8UA 5E6YA 1UD2A 4AXNA 1J01A 1IT0A 1XSJA 2CCRA 3GXFA 1KWGA 2WMFA 5JBFA 1GQJA 1UR9A 2C0HA 2W92A 3WQVA 1US3A 2BFGA 4P8WA 3VMNA 3WMBA 3AISA 3OGVA 2A3CA 5FOOA 4CD4A 1OGBA 2XSBA 4W8LA 4H2CA 4TVUA 1EOKA 1QI2A 4EE9A 3FN9A 4Y7EA 5FKYA 1JI1A 3M7SA 1KBKA 4HZ8A 4UZSA 1WAWA 3K4AA 2Z1SA 1W1VA 4QAWA 3RO8A 1FOBA 3W28A 3K8KA 4UFLA 4W88A 1BYDA 3RMEA 2DT2A 3KE0A 3OZPA 3AMLA 1V6YA 3VGGA 3GNOA 1E1FA 1HJQA 5M3WA 3T2OA 1V02A 4MB4A 1E4LA 3CZGA 1ISXA 2O9PA 5D4YA 2W61A 5D9NA 2VI0A 3WSUA 2FDMA 5A3HA 4GPNA 1BTCA 2XFYA 3RILA 1JNEA 1WZKA 2WM0A 1GJUA 3VGEA 3WD3A 4BQ3A 2WAGA 4A3YA 1GVIA 2Y2WA 2WC7A 1E1EA 3I3DA 5E70A 2PBOA 1CLXA 1FP8A 1GOKA 5HPOA 3BCDA 3RCNA 5E09A 4Z2GA 2PWEA 2BHYA 2XIIA 1NWSA 1VRXA 3W0KA 2WVVB 4W85A 1UH2A 3L4YA 1BYCA 3ARVA 1WP6A 1Q6DA 1S46A 1WO2A 2ZWZA 1VEOA 4BS0A 3ZT7A 1OM0A 4YN5A 4JFWA 4DWSB 3MUZ1 4B9ZA 2IUZA 2WWDA 2CBVA 4CKQA 2GFTA 2WWCA 4JFUA 1EDTA 1UD3A 2VZSA 5A94A 1W3KA 4PMUA 4WLCA 2ZXBA 3BLKA 1CXIA 1E70M 1FHDA 1TA3B 5BRQA 2WMHA 1NWUA 1VENA 1CPUA 2D23A 2VUYA 2DDXA 4PN2A 4U3CA 2WMJA 1TFVA 3IAPA 2WBKA 2O9RA 3VMOA 2VZUA 2OSWA 5CPTA 4UQEA 2VVSA 7CGTA 1CWYA 3VD9A 3MSGA 3WH7A 1JNDA 2OSXA 4MB3A 3O2LA 3BAJA 1OT2A 4V27A 3HJEA 2G4FA 4PSPA 4GZIA 4IUGA 1GORA 1V0MA 2D3NA 9CGTA 5I24A 3GZAA 4M8UA 3WL0A 4HZ6A 3K4DA 1WZLA 3O9NA 1GOWA 2C7FA 2UY3A 4ZE5A 2VCBA 4AD4A 1K9EA 1C8YA 4MNKA 4W7VA 4UQDA 2FHCA 4BQ5A 2G3MA 1B3YA 2J7FA 3W25A 5A6LA 3VUPA 1ZBCA 4M81A 1CDGA 1JYWA 2J47A 1QNRA 4HOWA 3UR8A 1OT1A 5GNYA 4F8XA 4LYRA 2VX5A 3VIGA 3NIYA 1ZS2A 2F61A 1DWAM 4E8DA 3CH9A 2VCCA 1CEOA 4CN4A 4ZE4A 3CUJA 2VRJA 1WE5A 1V6WA 3AIBA 1LG1A 2Z1KA 3VX0A 1HNYA 2EPNA 1KQZA 4RE2A 4AZCA 4OKDA 4UFIA 2XVNA 2FHBA 3MUY1 2DEPA 2J4GA 4WJXA 4PYSA 1E73M 4HA4A 1G5AA 4J27A 3WQ6A 5FL1A 1JI2A 4LGXA 4ACZA 3ARPA 1QVBA 1W3HA 4PCTA 3WENA 1GHRA 1VEMA 3AOFA 1B0IA 1F4HA 3PHAA 1XH0A 4QDMA 3A4WA 3VIPA 5BXRA 5I2UA 4P7OA 1W1YA 5A8OA 1ZJAA 2IXVA 2F8QA 1JIBA 5CSYA 3NSXA 3SCWA 5D9PA 2ZOXA 1Q6FA 3QGVA 3WNNA 3WF3A 2ESCA 4PTXA 1UWIA 3QOKA 3TTSA 1KXHA 1CECA 3MSDA 3SEPA 1W3JA 2BY2A 3DYOA 5IHRA 5ABFB 2JFEX 5CJ5A 1V3MA 4M29A 3GM8A 2E40A 1G0CA 1EA9C 4KRTA 4HPHA 4PMVA 4MAVA 4PMYA 4AIUA 1RD6A 4S3JA 5CGMA 2VZVA 1VBRA 3ZT5A 2EPOA 1ISYA 3WUEA 3W82A 3KZSA 3BAYA 3WMCA 2Y4SA 2OYLA 2ZICA 3VU2A 2DGAA 2WHKA 3QR3A 2GJXA 4PSRA 4H8UA 1EOMA 4NF7A 2XVPA 1QHPA 2CKRA 5JUVA 1EQCA 1B2YA 3APGA 4CCDA 4ML4A 4H8VA 1PAMA 3MMUA 5I0DA 2FH8A 1RP8A 3WNLA 1V6UA 1XRVA 1BG9A 2WK2A 3LMYA 3VNYA 3MU7A 4UR9A 4LQ1A 4RE4A 1H3GA 2E3ZA 3CZJA 1L0PA 1OINA 1B1YA 2VJXA 3OIHA 1E40A 1QNPA 3PZTA 3F5LA 4KRUA 3TTYA 4MDOA 3ZSSA 5D8ZA 1Z32X 2GDVA 4BCEA 3SCPA 3PZ9A 2F2HA 2XM1A 1MXGA 1QHZA 1UWUA 4U2YA 4J3UA 1D7FA 4HU8A 1EQPA 1K9TA 4CD8A 2EPMX 4ATWA 2GDUA 1ESWA 1UR8A 3MMDA 4JKLA 5A2BA 1BFNA 1PX3A 3THDA 1KGXA 1WCGA 1XH1A 4PMQA 1JYVA 5CSUA 3VOCA 1QI5A 4GIAA 3B9DA 1BAGA 4B3LA 3ARTA 4WSJA 1E72M 4HMEA 4M56A 1D2KA 2UY2A 2WW5A 4J7RA 3EDKA 4AW7A 5EB8A 3U7VA 1H0IA 3M46A 2ZUNA 6A3HA 1UQYA 2YKKA 1F4AA 5ABGA 4UNIA 3A4XA 1C7TA 1UUQA 1UKSA 3CTTA 1XSKA 3L4UA 5DT5A 5CQ1A 2ZUUA 3MKKA 1Y7VA 3AIEA 2NT1A 3ARWA 1JZ7A 1QOXA 4AZBA 3ZOAA 4PMRA 3AXIA 4DWSA 4LX4A 4U33A 2GSJA 1E9LA 1J18A 4TTUA 3UEQA 3MANA 1VEPA 2JF6A 2XVLA 2ZXQA 2XGIA 3K46A 4K68A 5GPRA 3KEHA 5E0FA 2PI6A 1QNOA 4Z2LA 1NP2A 1MW3A 5DMYA 4IPNB 4PMOA 1R7OA 4JCLA 4D6FA 1WDPA 3WH8A 1UR2A 4AYSA 3K1DA 3AICA 1VBUA 1BVNP 1DTUA 3T2QA 4EAMA 3PZGA 2VC9A 4W5UA 1LWHA 2FGLA 3WDIA 2WSPA 4JAWA 2X09A 3ARQA 2J7EA 2X1IA 4N42A 3W81A 5E9AA 3L4XA 3L4VA 1KXTA 1C8XA 2JE8A 2XFRA 1KFWA 1PZ2A 3PZUA 1LWJA 4LYPA 1A3HA 2GJRA 4PUDA 1R8LA 1NOFA 2WC3A 4MAZA 1ZBWA 3U57A 3WN6A 1NWTA 4A3HA 4W7WA 5A6SA 3A3HA 4KWUA 4OJYA 4AZHA 3QHNA 4GINA 3NJ3A 1A47A 3DHUA 1TG7A 3MS8A 1SMDA 1V0NA 1DWJM 1FP9A 2DH2A 4D6EA 4F79A 3VPLA 3ZJKA 3BSHA 2W63A 2VX4A 2VOTA 3LPGA 3VKKA 4WSKA 1CXLA 3MUAA 4NSBA 3ZM8A 1NARA 1DHKA 1EO5A 2EO7A 4F9JA 3WY1A 4PMXA 1E5NA 4PMNA 1L8NA 4CCEA 1KB3A 3TP4A 3EDDA 4V2XA 2BXYA 5CG0A 2ZXAA 5ABEA 3VM7A 3IANA 4XUYA 3RM4A 3CPUA 1UWQA 4UQCA 4S3KA 2J78A 3EDFA 1J12A 3AQUA 1M04A 3NUKA 2QV4A 2JF7A 3AIWA 2PWDA 3PZVA 3AI0A 4P7NA 2YL9A 5KZ6A 5HNNA 3AMGA 2D2OA 4D6DA 3GH7A 2YDSA 1AQHA 2VTFA 2X8RA 1G01A 2O9OA 1H11A 2JALA 1WB0A 1LLOA 1MFVA 1KQYA 3UR7A 4D6IA 2JIWA 5D9OA 1UR4A 1JXJA 4LXFA 1HX0A 5CLTA 4IISA 3ZQ9A 1V3IA 4F66A 4N0RA 1SR0A 2AAAA 1MFUA 1TVPA 2XG9A 1E4NA 4UCFA 3AROA 2WZHA 1KR0A 5ABFA 4JL1A 4M82A 1QI0A 4UOQA 4GQRA 4AY1A 1E3XA 4C7FA 2J77A 4W87A 1UH3A 4AZGA 3WBAA 1H4PA 2CKSA 3CHFA 1E0WA 5FD0A 1KCLA 2XHYA 2WPGA 1BQCA 1LF1A 2DSZA 1J0KA 3ZMRA 1XYFA 3UETA 5A1AA 3GTNA 1X6LA 3N18A 3PZNA 1QI3A 2D1ZA 1HL8A 5I3DA 2YLAA 4F9DA 3FHQA 2D0HA 1D3CA 1V3KA 1R87A 3UERA 3ARXA 1C3FA 1OD0A 3VD3A 1UKPA 1CXEA 1XV8A 2D24A 1K6AA 3TONA 1P6WA 2DSUA 4OBSA 2QF8A 1XHGA 4JFTA 4YHGA 2ZUTA 2WCSA 4ZXOA 1JFXA 1JZ6A 1OGSA 1H49A 2EPKX 2WCAA 3N12A 4BF7A 1ITCA 5IDIA 1XYZA 4P8VA 2DIEA 1CGUA 1UA3A 1BGAA 1GPFA 2DIJA 2WHJA 1UKOA 3OLDA 1JZ8A 4UZUA 1RH9A 1JL8A 1BYBA 2WKGA 5C71A 3W6LA 4H41A 2CIPA 4CCCA 3N1AA 1ZJBA 3VIKA 4AISA 2E9BA 4JHOA 1IZKA 1MVYA 4D71A 1HVQA 3RM9A 1J0IA 4E4PA 1LG2A 4C90A 2IXUA 1H2JA 4R27A 3UCQA 5JBEA 4BQ4A 4FLQA 1JDCA 3N15A 1K9DA 1WZAA 5A2CA 5M5DA 2CXGA 1GJWA 4AD3A 1HKMA 5CGTA 3ARRA 4P7QA 4PEEA 3K8LA 2WHLA 1KCKA 4FK9A 1E56A 1WDRA 2Y8KA 1V3JA 1W9DM 1UD6A 2X0YA 1MXDA 1UR0A 2EXOA 2DT1A 4OOZA 3CHCA 1TZ7A 1EO7A 5AYBA 2VL4A 3OA5A 3WEMA 2WKLA 2CITA 8CGTA 3BMWA 4JCMA 3N11A 1DWGM 3WDRA 1FH9A 3AYSA 3NSMA 1CGYA 2VMFA 2PWGA 2W67A 4URIA 1C7SA 3AYRA 5CZKA 1CENA 5IFPA 3WEZA 2OYMA 1KWKA 1UD5A 5DO8A 3WDJA 4ACYA 2WANA 3HU7A 2WYSA 3OGSA 1YHTA 2YA2A 1AMYA 3WBEA 3ARUA 3T09A 2ZX6A 4P7LA 1QNSA 1UR1A 1W9UA 3SCOA 2VT0A 1GOMA 2J75A 3AS1A 3MUIA 2A3BA 5IHSA 3CZEA 4J3XA 4W5ZA 5F7UA 1KXVA 4WK9A 1UKQA 1XD0A 3EMZA 3VIIA 4QLKA 1QBAA 2HISA 4P7RA 5AC4A 2UWFA 4HA3A 1OIFA 2BY0A 4FF5A 3KWXA 1LJYA 2WMGA 3HN3A 3VDHA 1JG9A 2GK1A 4L4OA 3TA9A 5BROA 1X6NA 1W2VA 4D72A 3WELA 2XFFA 1TMQA 5KEZA 3IJ8A 4ZENA 1ISZA 4KGJA 1E5JA 4MNJA 4HPGA 3ARSA 2BVDA 5JIPA 3OB8A 5EFFA 1W1TA 5IFTA 2XSAA 4H8HA 5DFAA 2UY4A 4AZIA 4WKFA 4AZ7A 1SYTA 1HKKA 3AMKA 4GO8A 4JFSA 2YJQA 1GVYA 3WNMA 2J25A 3AMDA 2E8ZA 3TTQA 3VINA 1XD1A 3UG3A 3AS0A 3DHPA 3I3EA 1TR1A 3SURA 4W8BA 4AEFA 1RP9A 4AWEA 3VTRA 1E6PA 4RE3A 4PTVA 1SMAA 3LPOA 4BZYA 5A6MA 3WEOA 4AD5A 1EIBA 2X2YA 3SCTA 2BV9A 4UFHA 3WF1A 3POHA 3AJ7A 3WKZA 3I3BA 4HMCA 1E4MM 1J0HA 3OBAA 4XZWA 1BLIA 3POCA 3AS2A 3VGDA 1JZ3A 2VX6A 2NSXA 4JIEA 1TCMA 3W29A 1NQ6A 1QW8A 2G3NA 1R85A 3EYPA 2WVUA 1UWSA 1LL7A 5LA0A 4J28A 3U5UA 5A6BA 2YIHA 4B16A 4AD0A 5EFDA 3N9KA 1EDQA 1ZBVA 2GJPA 4AMCA 3VDCA 5A8NA 2JIEA 1UKTA 1CTNA 2VR4A 2XPKA 4OZOA 4QP0A 1FHLA 4WKAA 5FIPA 3VMPA 1BF2A 3OZOA 1KGWA 1W91A 1E0VA 3W38A 2BVYA 1J10A 1J0ZA 1EDGA 3S6TA 4Z2JA 2EPLX 3BLPX 1MW2A 3EMCA 3SUUA 4DUXA 3SUTA 3PZMA 3CZKA 3N04A 3AHZA 1E3ZA 3BAIA 5AYIA 3WF4A 2VR5A 2E9LA 4W8AA 1BPLB 2EBNA 3UESA 1HIZA 2ZXDA 3SUSA 3OLGA 2NT0A 3WDHA 4AD2A 1E6ZA 2VRQA 5A8MA 1HP4A 1JDDA 1VAHA 3G6MA 4A4AA 2EQDA 4MB1A 3FNDA 4YHEA 1W2PA 4AIEA 3SUVA 2BHUA 1J9YA 1OD8A 3F5JA 1NWRA 2VX7A 5M03A 1ZL1A 3W6MA 3WDPP 1JXKA 3BGAA 3VNZA 5BXSA 1O6IA 4WF7A 2BXZA 4W7UA 4MTVA 2O9TA 1US2A 3WH9A 1UYQA 4CGTA 3OLIA 1JZ2A 3WQ4A 1EH9A 3SCQA 5I6SA 3TTOA 4PMDA 1WNOA 2PBGA 2WHMA 4CU6A 5BXTA 2G41A 1VFOA 2DSVA 2E9MA 3WMSA 1XH2A 3O6AA 1JZ5A 3DYMA 2XGBA 2AMGA 5DEZA 2CNCA 3BH4A 4X0NA 1QBBA 4M80A 4PMZA 3KL0A 4R5EA 3ALFA 2YL8A 2WVVA 2XM2A 3D5HA 5A6JA 3VD4A 2EEXA 1UHVA 1MQPA 1H5VA 4ATDA 2AOSA 1JYXA 3ZR6A 1JZ4A 3VILA 2V3DA 3CIVA 4PUEA 2G3IA 5EBAA 5AY7A 5HPCA 3EBVA 2WBGA 1HJUA 1DWHM 1UZ1A 1HP5A 2DSKA 2Y24A 4W93A 2VURA 4PRWA 1BG4A 1Q6CA 3W24A 4CD6A 3DECA 1JFHA 2W62A 1WPCA 2ZX9A 4OBRA 4KGLA 1E6RA 1AQ0A 2D0FA 3B9AA 1EXPA 1VF8A 3W53A 4CVWA 4E2OA 5A6BD 1HKJA 2J7BA 4UTFA 3ZJ8A 1TA3A 4L4PA 4FLOA 2X0HA 1FH8A 1OBAA 3NDYA 4FLRA 1GOQA 3CLWA 3AIRA 5C70A 1RPKA 2WLZA 3EMQA 3PTMA 1E55A 1UD4A 1G1YA 1C92A 1CXKA 1MWOA 3VIHA 3IJ7A 3BSGA 1LQ0A 3SCNA 1MQRA 1KXQA 3OGRA 4PTMA 3DC0A 2QLYA 5ABHA 5M17A 2DQXA 1VJSA 1WDSA 1CYGA 4WIWA 3DYPA 1UZ4A 2WMIB 3AZSA 3VX1A 1JDAA 1V6XA 1PBGA 2Q8XA 1UA7A 4AZCB 2YA1A 4B3KA 1UOKA 3VIOA 4CN6A 3WIJA 3RJYA 3U5YA 4J3SA 4ACZB 1CXHA 4EANA 3AZTA 2OYKA 2WMKA 2VZOA 3GNPA 1M7XA 1E15A 5A69A 1IV8A 4MPKA 1VFUA 2ZX5A 4UFMA 2UY5A 3A6OA 1HXJA 1B9ZA 3L4WA 1YQ2A 4NZCA 3FW6A 3CUGA 3RM8A 3M07A 5A8QA 4C7DA 4OIFA 1ZU8A 5TD4A 1TUXA 2RGLA 4JZ5A 1ISVA 1VB9A 4U2ZA 2TAAA 5BWFA 1EGZA 2Y5EA 3FY1A 1DP0A 5D8WA 3ARZA 1VJZA 4QFUA 2C8NA 3LPPA 5A8PA 3ZR5A 3WF2A 2CERA 1R86A 4U31A 2YDQA 1U30A 3BAWA 1E6NA 2E8YA 5CPQA 4AEEA 2WSKA 3ECQA 4CD7A 3PZQA 3GYCA 3UG4A 2QMKA 1XCXA 1Q6GA 4Z2IA 2BNJA 4U5IA 4DWSC 3WNKA 3GXMA 3N17A 3BAXA 4DWSD 1OIMA 3BMVA 3WL1A 1MW0A 1EHAA 3WH5A 4CN1A 3FAWA 3W37A 3AS3A 4DM1A 3AIUA 4KH2A 4U5KA 1I75A 4QCFA 1ISWA 1TVNA 3J7HA 5E0CA 3T08A 1VFFA 3MV11 3CUIA 4JKMA 3IK2A 3VDAA 1XGZA 3T2PA 5CXPA 4E8CA 1WDQA 2HVMA 3K8MA 3S2CA 3WUBA 1HN1A 4C91A 1V0LA 3VD5A 1AQMA 1W9BM 3VO0A 2XIBA 4GXPA 3E1F1 4P8XA 4QCEA 2VVNA 5LYRA 4TVDA 1FH7A 4PTWA 1GUVA 3BAKA 1PX8A 1DWIM 1G9HA 2ZUWA 3NCOA 3WDQA 5FL0A 3AHVA 3CUHA 4AZ6A 3WNPA 3AHTA 3QHOA 3VIFA 3B8SA 3CO4A 3TOPA 1E4IA 3F5KA 2OWXA 4B9YA 1NOWA 8A3HA 1B3XA 3W26A 1IZJA 3WFLA 4BQ2A 1CBGA 2CEQA 5JIWA 4WKHA 3CMJA 4HOZA 3GNRA 4ZXLA 4AIOA 1PJ9A 1Q6EA 2J8FA 1H0GA 4TX8A 1UD8A 2XUCA 3SIMA 2J7HA 2WNWA 4AD1A 2J62A 2WB5A 3PBGA 2WVSA 1PEZA 1W3LA 3L2MA
chains in the Genus database with same CATH superfamily
2OXNA 4W89A 5HJXA 4WDXA 3RIKA 3LPFA 3ZVIA 2I17A 3LA4A 5B80A 4XBJA 3W85A 4LRSA 1YLVA 3ABOA 4C6NA 2ZX8A 3W1UA 4ZODA 3SI9A 3NEHA 2QXWA 4I9JA 3EB2A 4GZ7A 1PO9A 1GONA 1QPQA 3NL2A 3NQ2A 4GCAA 1TYGA 1S5NA 3PZIA 3WD4A 1TELA 1CGVA 4NZ5A 4IIEA 4AIBA 1AH0A 2XN0A 2FPYA 4HOXA 3GG7A 4IX2A 3LCGA 1XDJA 3VIJA 3GDLA 4I9AA 3W1XA 6REQA 4PCFA 4TXEA 4N9EA 4DO4A 4JYDA 3DFNA 3VC6A 3G6LA 4RLIA 5C55A 5CPSA 2PD5A 2Y61A 5JVLA 1OABA 4J3WA 3PJXA 2Z24A 5HK4A 3FJ6A 1UH4A 3B05A 3MVIA 2BP1A 3WLPA 4D1IA 2C19A 5LSMA 3UW6A 1HQTA 5AYYA 1UQZA 3TQKA 2QVNA 3EDJA 2YL6A 3QQ0A 1K3UA 1T5AA 1O7AA 4A3RA 1XC6A 2WC4A 3G3DA 3U2EA 1JAEA 1OADA 5ENLA 1WOBA 4BHYA 1JYNA 1I1WA 3C0QA 4PFHA 4F4RA 2V3EA 2Z0IA 5HATA 1IWBA 1QOPA 2VDHA 4HTYA 1VYSX 2F7FA 3I4EA 3SQMA 1M03A 2ISWA 3U2OA 3T0AA 2CBIA 7REQA 2PRHA 3P2VA 1IT7A 1SFSA 1Q7QA 2YOCA 4XQ6A 2VFHA 2CLMA 2NWRA 4RL3A 1CGTA 3ZO9A 4Y90A 2QCMA 1DWFM 2CYGA 5CC6A 5BXPA 3N6JA 4F0RA 1U1JA 1F05A 2RGMA 2DZSA 1XYCA 1J0JA 2V2DA 1W1IE 3CIXA 4KERA 3L5LA 4MLJA 4FNUA 1EC9A 2JEQA 2VENA 3VVGA 2CZDA 4NJIA 2VQTA 1MSSA 3ARYA 2G96A 1HF6A 4CEXC 4UQBA 3UYIA 1VKFA 2IKHA 1YE4A 4C6QA 4F2UA 4KS0A 4RDYA 3O07A 4ORIA 2HPMA 4H2HA 1PIGA 1NM9A 2TRSA 2JKAA 3C0JA 1ITXA 1W3NA 3MVTA 3MCOA 4JN7A 3DBNA 2FTYA 4GUIA 4HKPA 4XZNX 3EB3A 3N9RA 2RJGA 1GK8A 5G4WA 4MJ4A 1OFOA 4IGHA 4N6EA 4QDPA 3N13A 3W1PA 2PP0A 4WDUA 2G3FA 3S4TA 3IAQA 3EWWA 3CBWA 1O12A 3U7BA 4GFSA 2RHGA 3C3UA 3C2FA 1YMYA 4JEQA 3OLEA 3HM7A 2PB1A 3RPMA 1NFGA 2PU1A 3GKFA 5JMUA 2Z28A 4JHZA 2YW3A 1GQIA 3IJ9A 1WAUA 1EWEA 1CW2A 1GCYA 3CUFA 4JYFA 3GBDA 4JGDA 3IGXA 3MO7A 3NA8A 2CESA 4JIRA 4ZQNA 1OCQA 3LHUA 2Z4GA 4G56A 4UMAA 3AALA 3WUGA 1BGGA 1FA2A 3AFBA 1UP0A 4MADA 3NM1A 1OB0A 5GNZA 5HMEA 4LB3A 2CLLA 3AYVA 3G8RA 3AMCA 4LY8A 4IT1A 3CMGA 3BE7A 3UYCA 3G0XA 5I23A 4YTQA 4WXYA 1P7TA 1F73A 1NH6A 1EIXA 4ZQCA 2ZRZA 5FESA 2D20A 3GDTA 1GNXA 5AC5A 1K7XA 5AHNA 2DZWA 1WXJA 4Z2KA 2NQZA 4FPSA 4GHRA 4D8ZA 4L65A 2W3ZA 2W4XA 3C2VA 5FCZA 2CBJA 3TWAA 5BU9A 3UZWA 1V08A 2ASHA 1S38A 4S3GA 3VYLA 3JR2A 4IWWA 1DYSA 1SSDA 1QNQA 2JEPA 3W01A 3WLSA 2V5CA 2ABAA 3NFUA 4OV9A 1FWFC 1PKMA 5HR7A 3NSNA 1WBHA 2CLKA 3M41A 3BCFA 5KZDA 5KITA 2XWDA 3URBA 1CIUA 4UFJA 5FI8A 3B06A 3HMCA 3WLQA 3XISA 2C3ZA 1HKVA 3SCUA 3MSRA 1R2RA 3B9EA 2Q8ZA 3URNA 3V0UA 3D0CA 5BYWA 4HNOA 3CS2A 1OFDA 2VRKA 3VIMA 4GZJA 1VHCA 3OEXA 2OX4A 4PUKA 4GIYA 2Z2BA 3WJZA 1CXFA 3P93A 2XVGA 2YLLA 2V82A 3DERA 3N4AA 4GI9A 1TIWA 5F2LA 1BHGA 2Y5JA 2WNQA 5D05A 3MZNA 4JYEA 2FZNA 1Z48A 4HHPA 4O0ZA 3ORWA 1S5WA 1XPYA 3PG8A 4IPPA 3B0YA 4D6JA 1A5NC 2A1YA 1DJIA 3VZYA 3U2CA 1BVZA 4DBWA 2PZ0A 2O0TA 4JNZA 3WQ5A 3BOFA 2NQHA 5D30A 1CLKA 1SZNA 5E1QA 1N8IA 3MUCA 4K1WA 4LVFA 5JU6A 3ZJ6A 2NXHA 3AXHA 2CHOA 3AHXA 1YPFA 2QMJA 2BGSA 3WQWA 3O0FA 4Q8TA 3T78A 4KFNA 1IXPA 2ZX7A 3SCRA 3ONBA 2QS8A 4NP7A 5I7GA 3CK5A 4QE5A 1KFLA 4P8UA 3GAYA 3KOYA 3ITYA 1KWGA 2WJFA 5BOOA 3HG4A 2BFGA 2B7QA 5AKQA 2QPXA 5DMNA 4W8LA 3RF9A 1EJSC 4Z1BA 2BBFA 2ICSA 3BURA 3PPGA 1SZEA 4TVUA 1EOKA 4EE9A 3E2SA 4TMBA 3ZS4A 2FZ9A 3BOLA 3Q94A 3XIMA 1WAWA 3VKBA 4UFLA 1BYDA 2DT2A 1V6YA 3VGGA 4DNHA 3IVUA 2PWVA 1Q85A 4JQ1A 2O9PA 3HURA 2W61A 1NF7A 1H1ZA 3N25A 2OQYA 3LTSA 4GPNA 4CQ9A 3GNNA 1FWEC 3QSRA 1BTCA 1JNEA 1UASA 3NYZA 5C7VA 3S5OA 3ITVA 3O16A 1E1EA 4JTEA 2P76A 3I3DA 5E70A 2CLFA 2PBOA 4GUGA 2J66A 1FP8A 4HT3A 5E09A 4ZQRA 3MW7A 1M41A 2BHYA 4ZGYA 2WVVB 4JTUA 4XIAA 3NR0A 2HSAA 1UH2A 1BYCA 5DANA 3ARVA 4MSSA 1FRBA 3C8FA 4B2DA 1WP6A 2QAPA 1S46A 3IIOA 4BS0A 4A2SA 3ZT7A 1OM0A 4NYYA 3MUZ1 4EAYA 5H91A 4LJ3A 3SSZA 4CKQA 1IR2A 4HNUA 1THFD 3TJXA 2Z2AA 4JFUA 1R0MA 4LVDA 2ZXBA 3BLKA 4WD0A 3TROA 2ZE3A 2WMHA 2WMJA 3IAPA 2O9RA 4ZQMA 3S2LA 5DMLA 4UQEA 2VVSA 4UTUA 4R7WA 1CWYA 2IPGA 4A8LA 2A3LA 1TWIA 4MB3A 3R0DA 4V27A 4PSPA 3NWRA 2VC5A 3H2OA 3SRKA 4GZIA 3QLLA 3SECA 4ZB5A 4IICA 1XIDA 5I24A 3GZAA 4HZ6A 3K4DA 1E51A 1OYBA 2C7FA 2UY3A 1SVDA 2VCBA 4AD4A 1DHPA 1C8YA 3K4WA 3L0GA 2G3MA 1B3YA 2P53A 3DGBA 1DORA 4DJFD 1RVGA 2OEMA 1PUDA 3GR8A 4M81A 2Y70A 3IJDA 4RE0A 1FY6A 1KRMA 1KTCA 4WZHA 3LTYA 2F61A 1DWAM 2JK2A 3S3GA 2VCCA 1CEOA 2AKZA 4TV5A 4ERGA 3GVGA 2HE8A 3O1NA 2DORA 4ZCWA 1HNYA 4AX7A 5BOFA 2OG9A 4RE2A 1RQBA 1R47A 3EWBX 2NX9A 1OFRA 3KS6A 2XVNA 3MUY1 4E2BA 4WJXA 1E73M 4HA4A 2QUMA 4S23A 4QS6A 4ACZA 2QKFA 3ANUA 2PDBA 1GHRA 5CBJA 1B0IA 3B9OA 3VIPA 5BXRA 1Q2SA 4P7OA 2QCEA 1KM5A 4HMNA 4IGNA 1VYRA 3OHIA 5EIYB 2F8QA 1I0BA 1NFBA 2FLIA 3C2OA 3FYPA 5D9PA 3CL8A 2PDYA 1Q6FA 1L6YA 3WF3A 1ICQA 3R13A 4IMDA 4QEEA 3RHGA 3ZZ1A 3DYOA 3MTWA 5ABFB 2QCLA 6TIMA 1KV8A 3TC6A 5FEPA 2HVOA 3KOFA 1Q45A 5G4HC 1VCGA 4KBXA 3IJLA 4PMYA 1RD6A 4S3JA 5HR6A 1VBRA 2PGWA 1ISYA 2J24A 3NOEA 4GQ0A 4HNNA 3KZSA 1X98A 4RJEA 5J5RA 3FXGA 4XD5A 1P48A 3MSYA 4M7SA 3ZYZA 3LLDA 4AF0B 1QHPA 3IVTA 4M5PA 2NWSA 5JUVA 1EQCA 1B2YA 4UTLA 1A3XA 1KC7A 4RR4A 4B92A 1RJRA 3MMUA 4HHHA 3CT7A 3H23A 2PFHA 1BG9A 3MU7A 4UR9A 4LQ1A 1QK0A 3W1RA 3KFTA 2HS8A 5LGXA 1E40A 1OHLA 3VNDA 3TTYA 1E9IA 3ZSSA 4CNUA 1Z32X 2GDVA 4G7EA 4PB4A 3HFYA 2F2HA 3EPOA 1YDOA 3H24A 4YL2A 1GVRA 4XG1A 4HPNA 1DIDA 3ENLA 4DJDA 3UJEA 2C91A 4AHOA 2WPBA 4S2BA 2GGHA 4JKLA 2QJMA 1BFNA 3HOJA 3ITLA 1SW7A 1WCGA 1XH1A 2V6AA 3UFYA 3VOCA 1DJYA 1QI5A 4GIAA 5KTLA 1A53A 3B9DA 4OTKA 2YX0A 3G1DA 4LC6A 4WGHA 4WOQA 4WSJA 1E72M 1B4EA 1XP3A 4HMEA 4M56A 1D2KA 2UY2A 3PBVA 4ICMA 3NQVA 5EB8A 3U7VA 1AQFA 3THUA 3GHSA 6A3HA 1F4AA 3W7EA 3FK4A 4G8TA 4LSBA 3ZLFA 1OCJA 3U8GA 2WNNA 1FWAC 4JXCA 3W7LA 4IMCA 1XSKA 3P62A 1MO0A 5CQ1A 4ZOEA 3N4EA 3SQSA 1JZ7A 1JULA 1L2QA 1GYNA 4QE4A 1ECQA 1K7EA 1SU5A 4RK8A 2ZA1A 1JCJA 1RY0A 3B04A 4ZL1A 3MANA 2DZVA 3TZFA 1PCWA 4DLFA 5T9CE 3THAA 3OJGA 3LGDA 3SGUA 1OCBA 1RSCA 3KEHA 5G1TA 4UTTC 5FEZA 3G1AA 1QNOA 3XINA 4Y9AA 1QWKA 1R7OA 1W5OA 2FZBA 2OJPA 5IM51 3GDRA 3K1DA 1TZ9A 3VCRA 1H62A 3N6QA 3PZGA 1NDYA 2VC9A 3ITGA 4W5UA 1LWHA 2DU2A 4LCSA 1NY1A 2R8WA 2X09A 2GL5A 3NVTA 2QF7A 2NV9A 1FX6A 1WDWA 3OIXA 4I6VA 4AH7A 4WJEA 4IP5A 1A3HA 3WJWA 1PYMA 3M43A 3LSBA 4IIGA 1PWLA 4KWUA 2VKZG 4ZMGA 2EF9A 3VAVA 4C6BA 3MS8A 2ALDA 5KSWA 4LS2A 3FEQA 3O6YX 4DJDD 3A4JA 3NZGA 1F6YA 3RUBL 1FP9A 5F4SA 4ZFCA 4A29A 3LXAA 3INPA 4LAUA 1JQXA 1E1CB 2VX4A 5E5CA 3PWGA 1CXLA 3MUAA 4IQDA 1EO5A 1T8XA 4H01A 3GX9A 2PLMA 3WY1A 1L8NA 1KB3A 1S2AA 2Z26A 2BXYA 5ABEA 3CASA 1L6GA 3RFAA 3SFWA 3WK3A 3GQYA 1Z89A 3BZGA 2OZ0A 4DIAA 1UWQA 4UQCA 2BASA 3AQUA 3L7RA 5D2XA 2JF7A 5CAKA 5KZ6A 3PVFA 3P60A 4L9XA 1YYAA 2QCDB 4JTHA 1WB0A 2YCLA 1AJ2A 4D6IA 1NU5A 2FYMA 3SFKA 1XGDA 1XX1A 4XBKA 1UR4A 1JXJA 1IEXA 1IIHA 3UJFA 2BXVA 2REQB 2GQ8A 2PTWA 3HQOA 1E4NA 1V8EA 3LHYA 2FVLA 3VKAA 1KR0A 4FSAA 3VI2A 4UOQA 4GQRA 4LALA 4C7FA 1R2SA 1KKOA 4NUWA 1C9DA 1ONWA 4AZGA 3GKAA 3TMLA 2DZAA 4N9DA 4UR7A 3ITOA 3DC8A 3W7GA 1Q2RA 3STEA 3OTRA 1AD1A 2PDLA 3CEPA 3I6EA 3GK0A 1QI3A 2D1ZA 5M1TA 4F9DA 4GC3A 3FHQA 1D3CA 1C3FA 5IOBA 1YE6A 3VD3A 1CXEA 1R3YA 4XSMA 3V1HA 1K6AA 1LT7A 1P6WA 3ZWSA 3VE7A 1KRBC 4YHGA 4C1NB 1JZ6A 1J6PA 4TU1A 3B8UA 3EWCA 3L2IA 3GS6A 3N12A 1I0DA 3FGCA 2DIEA 3UT0A 3ES7A 3F4NA 6ALDA 1JZ8A 4UZUA 2BB0A 2VEMA 1JL8A 4HD5A 5C71A 2ON3A 3GNDA 4R53A 4CNTA 2ZZ6A 4DQWA 3KOWA 3NPXA 3PBUA 1V51A 3VIKA 4FX7A 2J9ZA 1JRCA 1TV7A 4AISA 2VD8A 3EPMA 4REQA 2QUTA 3AU2A 2QUUA 4I7VA 4H7ZA 4Q4KA 4P5UA 3EZ4A 1K03A 3WQCA 3UCQA 1HTIA 4FLQA 1JDCA 1WZAA 5A2CA 4NI8A 1KM2A 5M5DA 2QAFA 3ES8A 4UC5A 1GJWA 1FTXA 4GIEA 3OQ8A 3LNMA 4PEEA 3W70A 3OBKA 3UGVA 1X6UA 4AWTA 1SGJA 1V3JA 4B4FA 1MXDA 3I7SA 4Q7BA 2DT1A 1LUCA 3UA4A 3OA5A 3WEMA 2WKLA 2POZA 2HCVA 1R3QA 3WDRA 1FH9A 3NSMA 8RUCA 2OZ3A 4UNLA 4LAMA 1F5ZA 2VMFA 4BWLC 5DBUA 4NKCA 3IJ6A 5HQLA 1CENA 1IGWA 2C71A 2O56A 1CCWB 4JTCA 2PWUA 5DO8A 2OPJA 3B03A 3WDJA 2WANA 1VBHA 3WBEA 4GBDA 2ZX6A 3WBWA 3AS1A 1XYMA 2BOEX 2A3BA 5IHSA 4YIWA 4W5ZA 1F7BA 5F7UA 3PJTA 2YDAA 3DI1A 3EMZA 1XD0A 4IQEA 2DVUA 4QLKA 1QBAA 5EMUA 5LHFA 2UWFA 9RUBA 2BY0A 4FF5A 3S83A 2OU4A 3MT1A 3ONCA 2WMGA 2E5CA 3VNIA 3JRKA 3E2RA 1TQJA 4NZ3A 3STFA 4KGJA 3ARSA 2C18A 2YYUA 4QSFA 4DF1A 4ES4A 4I3GA 1HZYA 3KOZA 3HO8A 1FWJC 2YJQA 1GVYA 2J25A 3DCPA 3R2GA 1IXOA 1FXQA 1XD1A 3DHPA 2CLPA 2FTWA 4GYJA 1E6PA 3GUGA 1SMAA 4BZYA 2QIWA 2VC7A 3FX4A 2VFIA 1EIBA 3SCTA 2BV9A 3I7QA 1VPQA 4WY0B 3WF1A 3W7IA 3VOJA 3I3BA 4HMCA 4KCUA 4XZWA 1M7OA 4Q32A 1JZ3A 1TMLA 1TCMA 1FDZA 3TYAA 1QW8A 3E3HA 2VEIA 3GTFA 1A5CA 4I9MA 4X63A 1LL7A 5LA0A 1AZ2A 3TKFA 2IPJA 4J28A 3U5UA 3PM6A 4AD0A 5A8NA 1EDQA 4AMCA 3DHDA 5FF4A 2XPKA 2VR4A 4OZOA 4WY0F 4QP0A 1PSCA 2QCCA 2NUYA 4AHQA 4TO8A 3DFOA 1KGWA 1DE6A 3HJZA 1E0VA 1J10A 4FX8A 1EDGA 4Y8EA 1QFEA 3WK0A 3SUUA 1TPFA 1DQXA 2F6UA 1E3ZA 2VR5A 3WK2A 3KBNA 3R12A 2ZXDA 1LCOA 1IEVA 1RZMA 4Q8NA 3WDHA 1NTHA 1S5MA 1G67A 2VM8A 4KQNA 2LLEA 1QNVA 1A5BA 3IARA 1YXYA 1BXBA 4HK7A 2BHUA 1OD8A 3F5JA 1XBVA 1ZL1A 3W6MA 3QMRA 3WDPP 1JXKA 4IF2A 4FALA 3ZVHA 3PG9A 1YBQA 3JZEA 3SSJA 1TPUA 1IEIA 4TIMA 4YXGA 5D04C 1UYQA 5FF0A 3LTPA 1BSLA 3OLIA 3BJFA 4OVXA 3DX5A 4X3ZA 2WHMA 2G41A 4Z0SA 3TWBA 3WMSA 3O6AA 1RHCA 2WJZA 2XGBA 4NASA 5DEZA 2Z2UA 2EJAA 4PMZA 3KL0A 2YL8A 1TJ1A 3Q58A 6REQB 3JS3A 1EZWA 2PDKA 1VJIA 5A6JA 3KW3A 1MEIA 4S3FA 3A3XA 1FDJA 4O1BA 1XQKA 3R10A 2VDIA 4H9TA 1JZ4A 3SADA 3VILA 1PWMA 3CC1A 1HJUA 4PTNA 1UZ1A 1CB2A 4W93A 5LNUA 3BW4A 4O53A 5J5DA 4CD6A 3DECA 3EXTA 1WPCA 3H2NA 3LQGA 3ME3A 3B9AA 2PLKA 5HNTA 1VF8A 4A8IA 3CV2A 2P0IA 4FLOA 1I2QA 3CLWA 4YJ5A 3NGFA 2WLZA 4ALDA 4BEQA 5LNSA 2Z29A 2OKOA 1G1YA 1C92A 1CXKA 3H70A 1MWOA 4XZ9A 3TEVA 1LQ0A 3SCNA 5EMJA 1MQRA 1KXQA 4E4UA 1O60A 1NEYA 2QLYA 1OC5A 1SUXA 5M17A 3L9CA 1VJSA 1GVOA 1CYGA 4QBXA 3CXOA 1LT8A 1F9CA 4WIWA 3UXAA 4HNTA 3W2JA 3W7RA 3AZSA 1V6XA 2GJLA 5FJJA 4LBRA 2YA1A 5HNRA 3QV7A 1LP6A 3W07A 3WIJA 4YLWA 2OYKA 2XGZA 1N7KA 1Q4WA 3M5ZA 3V3WA 7PTDA 4E2VA 5A69A 3MWAA 3GFXA 2PCEA 3AJXA 1VFUA 4JTAA 4MPKA 1VFHA 1ME7A 4CQAA 1SW3A 3FW6A 1UBSA 3M07A 3PUDA 1RAKA 4K37A 2I9EA 5BWFA 2XZ7A 5EGRA 3WF2A 2OOFA 2CERA 4HU3A 2YDQA 1R9YA 3HPZA 1U30A 3A64A 3BAWA 2E8YA 3UXDA 2WZTA 2J9XA 2WSKA 3M0VA 4JN8A 3M4HA 3GYCA 4MLRA 4DX3A 1IWAA 4Z2IA 3WLKX 4DWSD 1OIMA 1JUEA 1W5PA 4H4IA 3WH5A 3NQEA 3KRBA 2GVLA 2E5BA 4GXWA 4Q4OA 4U5KA 1W0MA 2YCKX 4QCFA 4UTIA 3J7HA 1J5SA 1QMLA 4JKMA 3GRIA 3TJIA 2QZRA 3THQA 5CXPA 2HVMA 4RW3A 4AQLA 3WUBA 1ZY9A 1Q3NA 1HN1A 4WEVX 1XC4A 4O16A 2QVHA 4FOKA 1XLEA 1AQMA 2YB4A 4LNCA 2DW7A 2XIBA 4QCEA 2VVNA 2QJJA 3MMTA 4PTWA 3BAKA 1PCKA 3EGJA 3CPRA 3NCOA 2RDWA 3I4KA 3WJXA 1O4UA 1J4EA 3B8SA 3CO4A 4O4VA 5HINA 1RBAA 1NOWA 3KCLA 3FKKA 1WQ5A 4CNOA 3WFLA 4BQ2A 1RBLA 1QXLA 2QDEA 4JX5A 3BJSA 5JIWA 4GVHA 4J4KA 3GNRA 4ZXLA 2J8FA 2D73A 3EOUA 4C6PA 4RNHA 4QNEA 2BLEA 5TF0A 3W1TA 2J7HA 1R3WA 2J62A 2WB5A 3PBGA 2WVSA 2E1DA 3C4UA 1RLCL 2R1NA 5JQ9A 1VFLA 2O4MA 4JNYA 4MJ2A 5DF0A 1TTQA 2IPWA 3VGBA 3EWDA 1CI1A 2BY3A 2NLYA 1IT8A 1J0YA 4ZOCA 2D3LA 5HDRA 4AZ5A 3KRZA 1HL9A 1JCYA 3BARA 2XDFA 6ENLA 4DPPA 4DLMA 1CLVA 3PJUA 4GY0A 1Q13A 4RX0A 1QW9A 1J11A 4BA0A 2QW5A 3RYSA 5GQBA 2PWHA 3M0XA 1UMYA 3CB3A 3N34A 1O68A 2PS2A 5FF7A 2YFOA 2D0GA 1EF2A 4IFKB 2GUYA 2PMQA 1O94A 1WX0A 5ECUA 4OE7A 1LRQA 4QISA 1XLJA 4Q22A 1XIJA 1YRRA 3BG9A 4TTGA 4C7GA 2Y8VA 4DM2A 1XIGA 3ALGA 3RO6A 4YU1A 1GG0A 3BWWA 3L66A 3GU1A 3CQJA 4O1CA 1YPIA 3NXLA 4R33A 5EJZB 2H8ZA 1W9VA 1AVAA 1XLGA 3C2EA 2J74A 3FA3A 2F9RA 5IBXA 2W91A 3B8TA 3RR4A 5A95A 1QAPA 1B31A 3T4CA 2ZVIA 1LBLA 4GKTA 1XBZA 4Y9OA 2ZC1A 3SBFA 4XK2A 2CZVA 1JAKA 3M9YA 1E6XM 3W7KA 1BTMA 3OYXA 1KTNA 1E9ZB 1E6QM 2DVXA 3K13A 2IQTA 3BXWA 3TYUA 2XJ7A 5KMYA 2WLYA 3LSCA 4DPQA 4Z1DA 3CAKA 4YNGA 2R1MA 3C0SA 3PPHA 3QPZA 4TX9A 2J79A 3V1PA 5AHEA 4FLSA 1FFQA 3BV7A 4QG6A 3PN8A 4KIEA 4U28A 4U4MA 4J3VA 4WRHA 4I7UA 4GCXA 1V03A 3VNKA 4Z1YA 2ZVRA 5HXMA 4O15A 2NVAA 4XAPA 3G22A 2VEGA 1PIFA 5ABTA 1TV8A 1HJWA 4L1WA 4EOUA 2YCEA 1G4SA 3WBYA 1JGIA 4ZO9A 6XIMA 2OEJA 3BDKA 3GH5A 4D6GA 2FFIA 1OGGA 1AJZA 4X2PA 4JFVA 5A6AA 4UBPC 1V0KA 1NDZA 1E43A 4CU8A 4DJEC 1CZ1A 1HO1A 1XIFA 4YCOA 3E5BA 1VFMA 4XD3A 2PGRA 4X0VA 3C61A 4ATLA 5LA1A 4JL2A 1HW6A 3KBJA 1AZ1A 3RLGA 4GJJA 1E0TA 3E0LA 3BLIA 3KL5A 4MFEA 4MJMA 3G24A 5EU9A 1JVNA 4UTTA 1S2CA 1A80A 2X1SA 3NL6A 4GK8A 3RJXA 5JBDA 1HO4A 4W9TA 2YSWA 4X60A 4LV9A 4YCPA 3DFPA 1ZB5A 3TFXA 2VO5A 3IIZA 3PWIA 5AZ1A 2OQLA 2PRMA 4L9ZA 4W84A 4XX6A 1LZOA 2XTKA 2Y88A 1QT1A 3TTEA 3ZFHA 1VFTA 3GG1A 4JICA 3CHVA 3ITTA 5FA5A 1CGXA 4GQQA 3M0HA 1HT6A 4NQ1A 2EG6A 1Q63A 3SRDA 4O12A 4RUBA 3ZSTA 1XQLA 3I65A 3QOMA 4FR6A 4XAFA 3BC9A 1FWRA 3WQFA 3FAXA 1XLMA 3I7RA 3GDBA 3IUIA 5CLWA 2BHZA 1J79A 4DXXA 2CHNA 1PV8A 2VWSA 3QY8A 3W4RA 2V2CA 4HQVA 4GA8A 2V3FA 2XSXA 4CNNA 5EJ1B 3WD0A 3CT2A 1GHSA 3RDKA 4ZOBA 1W1ZA 4GNJA 1TE1A 4F3HA 5I77A 1I4NA 1VLIA 4QQUA 1XLIA 1C90A 3USBA 3G3MA 1C91A 1FKWA 4F0SA 3LBMA 1PTAA 2HS6A 2NW0A 1OF6A 2D22A 3FHAA 2ZA3A 3L12A 4FXJA 5JH2A 3VGHA 4TVCA 4NY2A 3UA3A 4LW7A 2VZTA 4MIMA 4QJ4B 2J7CA 4A3QA 3DBPA 4HU0A 5A8GA 4MYXA 3WLNA 5FJPA 3RITA 1ELSA 2J6VA 5I06A 1R30A 2E1WA 4F0LA 1PKNA 5I3HA 3GXIA 3K2GA 4MB5A 4TMCA 2NV1A 2UV8G 1W1PA 3UG5A 2ZUVA 4ZB0A 1JF6A 5K9XA 4O0QA 4IMGA 1LL6A 3M0IA 3D3FA 4CLMA 2OWWA 1T41A 1TJ0A 2DH3A 5DLCA 1P0NA 3HGOA 3N4FA 3MYPA 2PDJA 3SRHA 3KLLA 1K77A 2FGZA 4XZIA 4XTDA 5FSDC 1DEDA 1M53A 4YPJA 4C6IA 2PWFA 4L80A 5DX7A 3VE9A 1VP5A 1KGUA 3ANYA 4LUSA 4P2VA 2ZZ4A 4FX6M 3WD1A 2ZDRA 1Q4NX 1B3ZA 3GXDA 3TUUA 1U2YA 2CETA 3IK4A 3CV7A 1ZAHA 4Z1CA 4D6CA 3WQEA 1W9XA 4Z17A 1V02E 4MGGA 3KM8A 3P0WA 4UTHA 3S9YA 1SW0A 3RCMA 3TAKA 4MF4A 2Y7DA 4C65A 1OX6A 3MV01 2L5HA 5BU6A 4DNMA 1OYCA 4JQ2A 3HG3A 2NQ5A 4Y96A 3UWZA 5I79A 3TYDA 3TR9A 4AHPA 3TOYA 1KO0A 3O63A 3WUFA 2E4TA 5HA7A 1A5MC 1REQA 1WKEA 1XLKA 1GT8A 4HK5A 4H6KA 2A2IA 4ERIA 5E6YA 1UD2A 1J01A 2HPIA 1JRBA 3PNUA 4H6QA 1UR9A 2I5IA 4DBEA 4J2PA 2GVGA 2C0HA 1TREA 3WMBA 3OGVA 1DXIA 5AOUA 5FOOA 4CD4A 1AL7A 1BRLB 4BWLA 4H2CA 2Q01A 3FFSA 4RNJA 1QI2A 1IHIA 3DOPA 3WYZA 4H9YA 1EJRC 4JY8A 5FKYA 1JCLA 3M7SA 1UC5A 3HQPA 4M6PA 4G7EB 2JQXA 3W28A 3QMSA 3K8KA 4W88A 1F6KA 3RMEA 3OZPA 2CZ5A 3AMLA 3C5QA 1HJQA 3H4XA 3IS4A 4MB4A 4ZA0A 5K2ZA 3CZGA 1ISXA 1EZ2A 4MWAB 5AHLA 3U0HA 3W2NA 1TRIA 2INEA 5D9NA 2V30A 1JCNA 3WSUA 2PRLA 3SDOA 3H4WA 1LQAA 3VGEA 1AJ0A 4POCA 1R9ZA 1A3WA 3QPEA 4ZBCA 1CLXA 5FACA 4IFRA 3NO5A 5HPOA 3RCNA 4IG2A 2PWEA 2XIIA 3W22A 4AAJA 4W85A 4WX2A 3E0IA 4A3UA 1XM3A 3C56A 2PGFA 3VKDA 4K36A 3LYEA 1OFPA 3P74A 2P10A 3ISIX 4H9MA 9XIMA 4FR1A 5BMWA 4E4FA 5C7HA 4JFWA 2FTPA 4FIRA 3BO9A 2WWDA 4ZO6A 5CC3A 1SFLA 3EAUA 3UCDA 3KHDA 3KX6A 2QCFA 5G2IA 1B3OA 2PSNA 4PMUA 4WLCA 3H2AA 1TA3B 4LCRA 1QOQA 1CPUA 2D23A 4U3CA 1AUSL 5AC7A 5GVJA 3VMOA 4NAEA 2ABBA 4M6QA 5REQA 1OK4A 2R24A 3WH7A 4CNSA 1BWVA 2GWNA 3O2LA 1CT5A 3PBMA 1OT2A 3HJEA 3K5XA 3VCNA 2DIKA 4IUGA 4LUTA 1GORA 1V0MA 1XBXA 3COTA 4NILA 1WZLA 3O9NA 4HPJA 1FWWA 5HMSA 4ZE5A 4EXQA 1MEHA 4GY7A 4UQDA 2FHCA 4BQ5A 4U10A 4LVAA 4DJFC 3G1HA 4YTUA 2J7FA 2H3BA 3LOTA 1BF6A 1CDGA 2J47A 1MI3A 1QNRA 5AYZA 1DE5A 4IMAA 2NSOA 3EXRA 3UR8A 5H2ZA 3H12A 4F8XA 3MPGA 2VX5A 3NIYA 3H8AA 4JTRA 3KBSA 1ZS2A 2ACUA 2OGYA 3EXSA 4E8DA 2X1UA 1KRAC 3CUJA 3VOGA 3WQGA 5AC8A 3NOYA 2Z7KA 4C6JA 2PDXA 5L6UA 3AIBA 4NJGA 2X16A 1UP3A 2VDGA 3PNZA 2PDPA 2PA6A 3GXPA 1TV3A 4OKDA 1O5KA 2JKPA 1DKWA 3TW9A 2FHBA 3GD6A 2DEPA 1S1RA 2OODA 4J27A 4UB9A 5FL1A 4MVAA 4LGXA 4WHBA 1UP2A 2DVTA 1V77A 2QIIA 3BLFA 4FHAA 1VEMA 3QZAA 1F4HA 1XH0A 4NZJA 1ZJHA 3A4WA 5HJLA 1DJGA 2YCLB 5I2UA 2Q8LA 5A8OA 5D02A 5MKGB 3B40A 3WLOA 1JIBA 1F61A 1K1DA 4C6EA 3VABA 2ZOXA 2GGJA 4M3PA 4AFYA 3WNNA 1ADDA 2ESCA 4LFYA 1UWIA 3LCWA 3QOKA 3G18A 5DXYA 3TTSA 1Q66A 4H8NA 4P00B 3T8LA 2J6XA 2A5HA 3ITXA 1Q5MA 1Q6RA 2V67A 2I9UA 1WXZA 4IUOA 2TPSA 1V3MA 5C2GA 1G0CA 1XBYA 4JTIA 4AIUA 5CGMA 2ZADA 4AWUA 3S6OA 2PTYA 3ZT5A 4FO4A 1D8CA 1GWJA 2EAWA 3BAYA 3WMCA 2Y4SA 3P3BA 3M0LA 2OYLA 2ZICA 2WHKA 3QR3A 3UCCA 2FQIA 4C1KA 3V7PA 1VD6A 1F2JA 4Q8UA 3IJQA 4NF7A 1VLWA 2XVPA 1GW9A 1OG6A 3I10A 1RK6A 2QJNA 3S2MA 4EIVA 3G1XA 3L21A 1PAMA 3MP3A 3M47A 4AEOA 4XBSA 2OFJA 3UBPC 2WK2A 3LMYA 3OG3A 3VNYA 4RE4A 1B54A 5TAOA 1FXPA 3SN1A 1L0PA 3TE9A 1QNPA 1US0A 1QTWA 4LVBA 2QNEA 4BCEA 4REQB 4PE8A 2XM1A 4YVXA 1QHZA 1UWUA 4M51A 5PTDA 2IKGA 3G77A 4HU8A 1LOLA 4MUPA 2EPMX 3WCZA 4ATWA 2WJDA 1YX1A 1PX3A 3THDA 1EBHA 3UZ5A 3L68A 1JYVA 1XR2A 4JTLA 3O8AA 3PS7A 4IL0A 1KFJA 1JDFA 1LUCB 3FIGA 1AW5A 3HPFA 4QROA 2WW5A 1UIOA 4RZ4A 4AW7A 1H0IA 2R91A 1B9BA 2CXEA 4UTJA 1L9WA 2YKKA 4QHRA 4WVXA 5ABGA 3A4XA 4ZB2A 2HDJA 1C7TA 1UUQA 3SIZA 1QJWA 3T0TA 4ECLA 2YPIA 2OT1A 2CLHA 3L4UA 3R1ZA 1EJUC 3MKKA 1Y7VA 1CX9A 3AIEA 3BLOA 1L6FA 3ARWA 3GU9A 4AVOA 1JDEA 3R94A 2GSJA 1E9LA 1UUMA 4KT2A 4UWMA 4S3EA 4TTUA 1NVMA 4XAYA 2PTDA 3M44A 2PF8A 2XVLA 1WBJA 2ZXQA 4QRNA 4F0MA 4FI4A 4XZHA 3TQ0A 1MZHA 1N8WA 2PI6A 2NX1A 1H50A 3S5YA 4DZAA 4Z2LA 1NP2A 5DMYA 4IPNB 1TPB1 2W79A 1J96A 3H7VA 4PMOA 1TJPA 1BKHA 3PAJA 3CUXA 2PP1A 1VBUA 2B7PA 1BVNP 1V6TA 1DTUA 5LIUX 3PJWA 2Q3OA 4G9PA 3KLKA 3TC7A 1RA5A 3CNYA 4A22A 5E9AA 1OC7A 3GVRA 1M9HA 1UJPA 3L4VA 1KXTA 4WDTA 1UUOA 3BTNA 1KFWA 4BI5A 4DZ5A 5CZ0A 5AECA 4NG3A 4MUZA 4MAZA 3R4IA 5G1MA 3WN6A 3LNPA 3AU6A 4A3HA 4W7WA 2QJIA 4FIQA 1FDYA 5GJMA 4AZHA 1C29A 4GC4A 2AGTA 1TG7A 2R14A 1TPH1 1D8WA 1EGMA 1G4PA 2KX9A 1ZLPA 1DWJM 4F79A 3SGGA 3VPLA 3ZJKA 3BSHA 2W63A 2VOTA 3NQDA 1TKKA 1EPXA 3B0XA 1XYLA 4E38A 1PZ0A 3VKKA 3QY6A 3OPSA 3IPWA 3TNBA 3ZM8A 5XINA 2R6OA 4C6MA 3F4CA 3O05A 1J2BA 4F9JA 4DBDA 4CCEA 5XIAA 5CG0A 2I56A 1FWGC 2F38A 3A9IA 4C6FA 3VM7A 3IANA 4Q8QA 3LGEA 3CPUA 2J27A 3BPWA 3MB9A 1RPXA 4QNWA 3GXTA 1IF2A 2EKCA 2J78A 5FAGA 1J12A 1M04A 3CO8A 4HA0A 3AIWA 2PWDA 3W84A 3PZVA 4P7NA 5HNNA 1Z8AA 1MNSA 3GY1A 3OU8A 3GH7A 4AY7A 4L6DA 2V0TA 2VTFA 2O9OA 3UXKA 1GVQA 1Y65A 3WX7A 1O1ZA 5FF2A 1DQWA 1MFVA 4PL1A 1KQYA 1DVJA 4Q4SA 3URQA 1ZP4A 3EWXA 3KP1A 4LXFA 2ISDA 1KW1A 4KEUA 4GRSA 3WLIA 4Q33A 1SJBA 1V3IA 4F66A 3FSUA 2AAAA 4UCFA 4DZIA 4DO6A 3BQ6A 3LXCA 1A5KC 3EA1A 4HHLA 1LDCA 4JTSA 1E3XA 4W87A 1XWYA 1OFBA 5J04A 2CKSA 4L64A 2XHYA 1GVEA 1BQCA 4LB4A 4MY1A 3WZ0E 2DSZA 3ZMRA 1R5YA 2GGIA 5A1AA 4ERAA 3N18A 1RJPA 1HL8A 1ZAIA 1H7RA 5K7JA 4B3ZA 2YLAA 4NJKA 5C2CA 6XIAA 3EEGA 1OD0A 1UKPA 3RCYA 1GZ1A 1XV8A 1XLHA 1P5BA 2VFEA 2DSUA 4OBSA 3E2QA 4KEVA 1XHGA 4JFTA 2WCSA 4ZXOA 4LEFA 1U83A 3AXKA 2EPKX 1FWIC 3NZPA 4KPLA 1F74A 2FB3A 1BGAA 1UKOA 1OF8A 1RH9A 2B4GA 2WKGA 1WV2A 4FEZA 5HUOA 3R5EA 4H19A 1S5TA 3L67A 1RQEA 1G6CA 5K9CA 1AH3A 5CBBA 4GUFA 2DJLA 5CZJA 3M1ZA 2IXUA 1H2JA 1EX5A 4BQ4A 2H8XA 3CUZA 5IDZA 1OY0A 4HHMA 4F2BA 3W88A 4AD3A 1HKMA 1EGVA 3K8LA 2WHLA 3QKZA 3W71A 3V5CA 2Y8KA 1WDRA 3UQNA 4DI9A 1JPMA 2X0YA 4CNPA 2EGZA 2OQHA 2ZC8A 3HB9A 4OOZA 1TZ7A 4N02A 4O4WA 2VL4A 2CITA 2DZUA 5LXEA 2XFWA 2W67A 1SO6A 5LKYA 1ZUAX 4DJEA 3P84A 4LU0A 2G4JA 3L0KA 3T07A 3U9IA 3WEZA 4M6UA 3BK0A 1DIKA 3D6NA 3Q67A 1V7YA 3OGSA 2B7NA 1YHTA 3ARUA 3T09A 1Z7AA 2RDTA 1E9YB 1QNSA 1Y5WA 1GOMA 2J75A 3UU0A 3EB4A 2OVLA 3IV3A 3MC5A 1PDYA 2A21A 1H7OA 2DZTA 2H3DA 1KXVA 4WK9A 2C1IA 3VIIA 1G7UA 1ONRA 3WLMA 3KCJA 3S0CA 3EOLA 3QPYA 1TWSA 1LJYA 3V75A 3HN3A 4KW2A 3TA9A 3WELA 2XFFA 4DAFA 1RK5A 4PEKA 5EFFA 3UZXA 2O55A 5IFTA 2XSAA 3H2MA 4H8HA 4PH6A 4WOZA 4XAZA 4XO6A 5A5WA 5HWNA 3DFQA 1SYTA 2GQ9A 1HKKA 4JFSA 1ZTVA 3WMLA 2E8ZA 4J35A 4B5SA 3UVAA 3VINA 3UG3A 1S3HA 4W8BA 4AEFA 1RP9A 1NSJA 1VS1A 2JBMA 3PAOA 2AL2B 4AWEA 2NXIA 2VEFA 3LBOA 1S3TC 3E96A 3PTDA 3VNJA 4H9UA 2C1HA 4AD5A 2X2YA 4MYAA 5G4EA 2VELA 5AHFA 1X38A 3B8WA 1R2TA 2WQPA 3PSWA 3E12A 3OBAA 2WSQA 4IPIA 3LLFA 3POCA 4K38A 3VGDA 1ICSA 3LN3A 1LLWA 1NQ6A 4S38A 2G3NA 2DJXA 4L7ZA 2FMOA 4QSHA 1AK5A 2D2GA 2YIHA 3CH0A 3CU2A 1ZBVA 2GJPA 3VDCA 2JIEA 1CTNA 4DJED 4O1AA 1FHLA 3LCLA 1LQ2A 4HU4A 4NNBA 2ZFAA 4K6AA 4WCJA 4Y9MA 2CC0A 4S39A 3W38A 3PPFA 4Y8FA 3EOSA 2GUUA 3MCNA 4Z2JA 2EPLX 4LUYA 3EMCA 4DUXA 5K3VA 2VD9A 2CLOA 2DUZA 3DKLA 3AHZA 3H21A 5FF3A 2I14A 5AYIA 1RALA 4W8AA 2EBNA 4YMZA 3SUSA 2PP3A 3N2MA 1E6ZA 2VRQA 1T99A 2ZRXA 2A6LA 4A4AA 3N2TA 4MB1A 2AAMA 1W2PA 3PP7A 3WO8A 1X7IA 4ZVJA 1YNYA 1J9YA 1KFKA 1YDYA 3WQOA 1J8VA 4Q6XA 1SJCA 3FVMA 1TR9A 3ERPA 3MUXA 2A85A 3UF9A 1WOAA 2E09A 3VNZA 5AB3A 2HBXA 3PUOA 3W00A 3LHZA 1S39A 3B4UA 3QLDA 1JEZA 3NXFA 3SCQA 5I6SA 3TTOA 4PMDA 1WNOA 2TSYA 2PBGA 4CU6A 5BXTA 3M5VA 1DJZA 4L1GA 1V5XA 3O6CA 3TNOA 3QW3A 3DYMA 2DY3A 1Z41A 2AMGA 5LNRA 3BH4A 4X0NA 1AMKA 4CQ8A 4R5EA 3SGZA 3S5ZA 2WVVA 2XM2A 5C9RA 2SFPA 3NO3A 3U6WA 5C9ZA 2RKXA 3ID7A 1H5VA 1PKLA 4IX0A 4ATDA 2AOSA 1JYXA 2MNRA 5HMDA 3RN6A 1S2VA 3CIVA 4PUEA 3EOEA 5EBAA 5AY7A 5HPCA 1H61A 1U1UA 1DWHM 5D38A 4Q3MA 4QJ5B 1GTHA 2ZX9A 1F8MA 3RRAA 1C8VA 2AQVA 1EXPA 4F0KA 2QCGA 5CC5A 4NZFA 1HKJA 4OV4A 2Z1WA 2X0HA 3NDYA 4FLRA 1GOQA 5EL1A 3UWUA 3AIRA 2PLCA 1UBPC 3EMQA 3PTMA 1E55A 7ODCA 5AVHA 1POJA 4HSNA 1G7VA 4YTTA 3VIHA 3IJ7A 2VEKA 1EP2A 3NQ8A 2C6QA 1K4GA 5L9FA 1W5NA 3NQGA 4HB7A 4MKSA 5ABHA 2F6XA 1BWLA 2DQXA 2FIQA 3P82A 3VX1A 1PBGA 1JPHA 1XYAA 4AZCB 1HGYA 3TVAA 3CQ0A 4B3KA 4BF5A 3DG6A 4LNYA 1IZCA 3STPA 1F3XA 4EANA 2NQLA 5CGQA 4C5YA 2BSLA 3R58A 3UY7A 1XRTA 1IV8A 3L5AA 3NQFA 1EXBA 1B9ZA 1RVKA 3L4WA 4NZCA 3CUGA 5A8QA 1X8FA 4OIFA 4L4LA 1C9WA 5CBIA 8XIAA 2RGLA 3JU2A 5DCEA 3TZNA 1VB9A 4S3AA 4LF2A 3TQPA 2Y5EA 3FY1A 4D2JA 5D8WA 1VJZA 2C8NA 1M68A 2Y5SA 5CPQA 3R8RA 4AYGA 3R11A 2Z6IA 4KEZA 3LLXA 5K9DA 3UJ2A 2QGYA 3H26A 4AC7C 2BNJA 2FB2A 4DWSC 3WNKA 4IL2A 4IXHA 2HTMA 4YYCA 3WL1A 4CN1A 1KLYA 2XZ9A 4JQ3A 3AS3A 4DM1A 5T9BG 4EF9A 3LY0A 3AIUA 1I75A 1W5QA 4EWJA 1B4KA 3QM3A 2Z1BA 3P0XA 1JR1A 2W0UA 3CUIA 1TWZA 3LCIA 5LIWX 1WDQA 5HJYA 3K8MA 3BGJA 3S2CA 4C91A 3OP2A 3VD5A 2PDCA 4GYPC 4JX4A 5LXXA 1X1ZA 3E1F1 3PF3A 4MJZA 5LYRA 3UR5A 3MKVA 1GUVA 1KM3A 2OLSA 1DWIM 1G9HA 2ZCGA 5F2IA 4DJFA 5FL0A 3AHVA 3CUHA 3W2MA 5BNKA 3N3TA 3O7UA 3VIFA 2CWNA 3TOPA 3V5OA 4NJHA 1E4IA 1LOQA 2OEKA 3EKLA 3LENA 1OX5A 4JN6A 1IZJA 3IEBA 4GQGA 1L6SA 1M6JA 3DAQA 1DPMA 2CEQA 4R34A 4WKHA 2E25A 1RV8A 3CMJA 4RV8A 4AIOA 4TX8A 5C9XA 3N2CA 2F84A 3G5EA 2BVWA 3C2RA 4IIBA 1UD8A 2XUCA 1S5VA 1JCMP 3SIMA 1SQ7A 3UWVA 5T91A 4R9OA 2V38A 1JD9A 3EWUA 1HJSA 4GKLA 3TK7A 1E71M 1BXCA 2WM1A 2XN2A 1WKYA 5D32A 4OFCA 3ZWTA 1QR7A 3R8HA 4Q4PA 3UP8A 1K8ZA 3R8GA 1SO3A 2W9MA 3CGTA 3EA2A 4OOUA 3LU2A 4B90A 3MMWA 3GH4A 3VZXA 1H09A 1ZQ5A 3T05A 4ENLA 3C3NA 3RX3A 3Q65A 4HNLA 2DT0A 3GTIA 4OBTA 1MW1A 1PL9A 4EPDC 3ITCA 1BWKA 1Z6KA 1XCWA 3KTSA 5FJTA 1TPDA 3MP4A 1LOSA 1KBJA 3LZ5A 1FCVA 3ANVA 3AIQA 4J9JA 1TWDA 3SB0A 2QDHA 2YZRA 4GZEA 5TIMA 3BLDA 1ZZMA 3KL3A 4GVGA 1IXNA 3A22A 5A2AA 1K7FA 4MY9A 3A4AA 5I5RA 2B7OA 2NUXA 3LX9A 3IGSA 4LUSB 5EBUA 4HCHA 3P8JA 2QJHA 3E0FA 2OB3A 1SFTA 7A3HA 3AHYA 4BK9A 4FMVA 2J7DA 3STGA 1ZCCA 4LV4A 3PZOA 4GI6A 1YTEA 2E6DA 3I6TA 5I3KA 1UWRA 2WMIA 3HMJG 1UPPA 2HQAA 2Q02A 4MKVA 1QI4A 4OQVA 5LHEA 3T0DA 1QHOA 4UQ9A 4YWSA 1D9EA 2E0PA 4M24A 4LRTA 4QLJA 4GI8A 1V93A 3CZLA 4X2RA 1BSIA 1XDLA 4O14A 1YADA 2ZUSA 1PYFA 1KA9F 5CEWA 2W66A 3NDZA 2YW4A 1VBJA 1KR1A 1JCTA 1I1XA 4X9SA 1E1CA 3ATZA 3VDBA 2ZIDA 3MWCA 4ZSTA 4D1JA 3WF0A 5E6ZA 3R0UA 4CQDA 2O4QA 2FPVA 4QR6A 3M5YA 5KETA 4W4QA 5FEXA 2W5FA 4NAFA 3L2LA 2ZTKA 1EJ7L 1F3EA 1MQQA 1LL4A 4V33A 3NM3A 3G1FA 5F4XA 1P6BA 4MNMA 1W3TA 3NYDA 1PZ3A 4DUVA 4EX4A 1GYMA 2QCDA 3GHTA 4OUIA 1AA1B 3CWHA 4I9TA 2ZRUA 2DFAA 2WZEA 2WQDA 4US5D 1Z3NA 3WFZA 4BI6A 2V5JA 1FWDC 4NRRA 4LTSA 5C6MA 1GZJA 2REQA 4TUFA 3MO4A 4A35A 1VRDA 3BANA 4LS1A 3PSVA 2EJ1A 2B31A 4FOJA 3KWSA 2CZFA 3NAVA 4IG2B 3HPSA 4GX9A 1W9PA 4GWEA 4O1FA 2E77A 4QM1A 2V5DA 2BS9A 4HP5A 2HXUA 1QPKA 3M0MA 4J2MA 2GVYA 3IVSA 3N6HA 3E74A 1VIWA 2OTDA 2GOKA 1OSEA 4QLLA 2OWCA 1H51A 5A6KA 3E2VA 1F8IA 3A21A 1RCQA 1EEPA 4QGCA 1Z42A 1A0DA 1ADSA 5D9MA 1D3GA 1PKYA 4UFKA 1VFSA 1EJXC 1XLDA 2HMCA 3W27A 3YPIA 3DENA 2EG8A 4WR3A 3BVJA 3A9BA 3DGRA 2DSWA 4Z1AA 4LPCA 2ZUMA 3UJRA 1YW1A 3SY8A 2PC8A 1EFZA 1W1B1 2PDQA 4IM4A 4B5UA 2H90A 3BSMA 5U4NA 4PBGA 4NAEB 1E0XA 5REQB 3ZXWA 3QV9A 1KM1A 4XUGA 4H7VA 4PODA 3SCSA 2J7GA 5CC7A 3FJ4A 1PX4A 2YDRA 5EMLA 4CUCA 1M7JA 3QFEA 1T96A 3BGGA 3W7CA 2X05A 3B8DA 1OWQA 4LUTB 2WXDM 1YPXA 1H41A 3LRKA 3B0UX 2QPUA 1N82A 3ABQA 5TQLA 7TAAA 1ICPA 3B8IA 1V4YA 1T40A 3IIXA 3RU6A 3DZ1A 1RA0A 4HK6A 1QU4A 5HANA 4RXFA 4L5ZA 1XLCA 1UW9A 2WVTA 1DL3A 1BYAA 1EL3A 4E3TA 4JKKA 2ZE0A 4LY4A 4ICNA 3ZJ7A 1G4EA 3SO7A 4AWSA 3N2OA 5IXEA 4EWND 4BI7A 3QC0A 5GNXA 1MYRA 3W7NA 4N6FA 3KVJA 1IXQA 1B30A 1ZGDA 3GW0A 4EKJA 2GK1B 4HZMA 2O92A 3TYZA 1H7XA 1LYXA 5JH1A 3DXIA 1FWSA 4CQCA 2DQWA 6TAAA 5ECVA 3ABXA 3A47A 3CHEA 1LROA 4S1FA 2HROA 3LMZA 3APTA 4BEUA 2PZNA 2D2JA 3AZRA 5BRPA 4UOJA 3EX4A 2VXNA 4MWAC 4L6OA 3MCMA 5GJPA 3L4TA 2Y7FA 2YBVA 3P61A 1GOXA 3NTYA 1QPRA 1C8QA 4ADTA 3UPBA 3KUMA 4GJ1A 5HNUA 2A3HA 3FS2A 1XSIA 4N4QA 3E38A 3NQ7A 1VZWA 2ZA2A 2FJUB 3MHGA 3STCA 2FVMA 5BCAA 1B5TA 4CD5A 1X1NA 4B5NA 4XISA 5LA2A 1ODZA 3TN6A 4H04A 2DZPA 4XB3A 1BQGA 5CAHA 4I8DA 4TQTA 7ENLA 4KESA 2GOUA 4KMQA 1MDRA 3L4ZA 4NRSA 2DUXA 3KVMA 3WNOA 3R0KA 3D3AA 1UC4A 3MBDA 6CGTA 4L4MA 4H6RA 1I45A 3BW2A 3QF0A 4LOCA 1B3WA 4C6CA 1H1NA 4DXVA 5I78A 1H7NA 4HMDA 3SQLA 1XLBA 3URAA 2I5QA 1FWCC 3MJYA 2CCRA 2WMFA 1GQJA 3TX9A 2W92A 4XKMA 1Q7MA 2XH0A 1PE1A 2J8TA 4A05A 1OGBA 8TIMA 1VQTA 2CHRA 1PB0A 3F2DA 1GTEA 4K2SA 1NJJA 3NZ1A 3T1GA 3V35A 1KBKA 4IOTA 2E6AA 3QR1A 2RUSA 1W1VA 4HSHA 2OCZA 4JTDA 4EPBC 3KE0A 5BW6A 1Z44A 3GNOA 1E1FA 5M3WA 3L5MA 3T2OA 1DBTA 1V02A 4RPQA 1E4LA 4JBRA 2F2KA 5D4YA 3HA1A 4WUIA 2VI0A 3I68A 2FDMA 3H4GA 5A3HA 4QXIA 1FKXA 2XFYA 2WM0A 3WLTA 4IIFA 4QS5A 1ZRQA 2VWTA 1GJUA 1XJBA 1B57A 1OZQA 2AQWA 4A3YA 4G7FA 1GVIA 2Y2WA 3DH7A 3GDMA 1OQFA 4JNMA 4Z08A 3G1VA 3BCDA 4Z2GA 3W2LA 4OECA 3RX2A 2POTA 4RV3A 2ZQ0A 1OC6A 3PANA 1XYBA 1Q7ZA 3L4YA 3PK7A 3EWYA 4B5WA 4GISA 3U3HA 5I3JA 1EWDA 4YN5A 1XFCA 2ZDSA 1TJRA 2CBVA 2WWCA 4XVEA 3LBCA 5BZAA 2Z25A 4H1ZA 4KCWA 3EWZA 4LS0A 5DCDA 5A94A 1W3KA 2WZMA 1XKYA 3GWQA 2EG7A 3PFMA 1CXIA 4IH3A 1FHDA 1EYWA 2UBPC 2WJEA 5EY5A 2GLKA 4JY9A 2DDXA 3W1NA 4PN2A 2R94A 3Q37A 4PBFA 2WBKA 2OSWA 3L0NA 3PC0A 2NX3A 3MSGA 5CH9A 1JNDA 1AG1O 2G4FA 2CW6A 3HV8A 3V5FA 5K4ZA 3GIQA 4BJHA 1X7FA 9CGTA 1M1BA 3WL0A 1NAL1 1GOWA 1K9EA 2H6RA 5C9UA 1K6WA 4PUWA 1P0DA 3P6LA 3MHFA 2PDWA 3W25A 2OR2A 4UIOA 3N14A 1JYWA 5C9WA 3S46A 3KHJA 1OT1A 4LYRA 2XN1A 1W8SA 2BWGA 2TODA 3OA3A 5KINA 5TBOA 3E5PA 3CH9A 4GH3A 4MZ8A 4CN4A 4ZE4A 3LM3A 1WE5A 1V6WA 1LG1A 4GY1A 3B8VA 1EA0A 2EPNA 3GB6A 4D9PA 2UZ9A 5RUBA 3RX4A 4PYSA 1EJVC 1LORA 4A8RA 1JI2A 1KBIA 3ARPA 3QR0A 3R7MA 1W3HA 4PCTA 3CWNA 4K39A 3N3MA 2ZZ5A 3WJSA 3AOFA 3PHAA 4IXXA 4YYFA 1NQKA 3TU9A 4QDMA 1T6MA 5CJMA 3BL3A 2IXVA 3SZ8A 3FOKA 3GYEA 1SZRA 3BLEA 3NSXA 4PB3A 3E49A 4PULA 3SCWA 3QGVA 3VFLA 1O5XA 3GG0A 3SEPA 1W3JA 2BZNA 4HNVA 3TLLA 4ZQPA 4NL1A 4H9VA 5IHRA 2GPTA 3W87A 1LRTA 4G2DA 3T6CA 5CJ5A 3T42A 2ONEA 4WJ8A 2BMBA 3GM8A 4KRTA 4HPHA 4PMVA 4DAIA 4FS9A 3W7QA 2VZVA 4EXAA 2EPOA 2FDSA 3WUEA 3W82A 1ENUA 1QUMA 1U1HA 1NF0A 4RW5A 5G1YA 3L65A 4GNVA 3VU2A 2DGAA 4HSOA 4NT0A 2GJXA 5D2YA 3QTPA 4N2YA 4JPGA 3C8NA 3MBFA 3APGA 2YCIX 3PBWA 4ML4A 3BMXA 1DTNA 1BD0A 3MP5A 5I03A 2RDXA 4H00A 5I0DA 5LIXX 1DXEA 1RP8A 1I2NA 2X7WA 3WNLA 3CLMA 3BW3A 3HF3A 1H3GA 2E3ZA 2QQ6A 1I6NA 3QW4B 4O0KA 3CZJA 1B1YA 3PZTA 4FNSA 3F5LA 1W8GA 4MDOA 1ZSXA 2CWXA 3KP0A 3SCPA 3PZ9A 1MXGA 3RLUA 4OU1A 4H83A 3NPVA 1EQPA 1K9TA 4CD8A 1ESWA 1UR8A 5A2BA 4Q8OA 1XINA 2GGGA 1OYAA 4PMQA 1QO5A 5CSUA 1I60A 3TYEA 1ZENA 5AHMA 1BAGA 4B3LA 2QCHA 3MDUA 4YVPA 3A24A 4GGHA 4XSLA 3EDKA 5H8PA 1ADOA 1RUSA 3CEUA 3M46A 1UQYA 2INFA 3VCCA 4UNIA 1O5RA 5T26A 1XF0A 2PODA 1UKSA 3KBVA 5DT5A 4MM1A 1X39A 4DO5A 3KCOA 4PMRA 4Z0JA 4GVIA 3AXIA 1XLLA 4DWSA 1FWTA 3MY9A 2GZXA 3V0TA 1LRNA 3PUEA 3UEQA 1VEPA 2ATSA 5C54A 4M1BA 3K46A 3VKCA 5GPRA 2QGHA 3ELFA 2Y0FA 1FHUA 3QMTA 4RDVA 3AWNA 4LUJA 4XZLX 4G1KA 3S42A 4D6FA 3LGGA 4IFKA 1WDPA 1RQHA 3AICA 3T2QA 4EAMA 7TIMA 4RPPA 4A8NA 4GYPA 2FGLA 1IWPA 1TPEA 2P50A 3HPXA 2WSPA 3ARQA 2X1IA 4N42A 1R9XA 4GABA 4NXSA 4K8HA 5AZ0A 2JE8A 3E6EA 3PZUA 1GGOA 4ZR8A 4LYPA 2GJRA 4PUDA 1NOFA 2WC3A 7REQB 3TSBA 3MA8A 3TXZA 1NWTA 4RZ6A 5A6SA 5DY3A 1QWGA 1ZFJA 3DHUA 1V0NA 1P1MA 2DH2A 4D6EA 3DN5A 1GPWA 4I5UA 4HYRA 1FCBA 1YKWA 4LAZA 2C16A 4H9XA 3WQDA 3LPGA 4G6CA 1JPKA 3QY7A 1NARA 2V5LA 4PMNA 4HCDA 3EX6A 3TP4A 3EDDA 2ZXAA 3V0SA 4XUYA 2QUVA 4S3KA 2HXTA