2GK1B

X-ray crystal structure of ngt-bound hexa
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
54
structure length
54
Chain Sequence
PALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic Structure of Human beta-Hexosaminidase A: Interpretation of Tay-Sachs Mutations and Loss of G(M2) Ganglioside Hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase subunit alpha
total genus 5
structure length 54
sequence length 54
chains with identical sequence D, F, H
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gk1B02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 2gk1B01
1V08A 3OZOA 4BQ3A 3OBAA 4XV0A 2XSAA 1MXGA 1TMQA 1MQPA 4DWSC 1C7TA 3RM8A 9CGTA 2E8ZA 5A6BA 2GJPA 2J7BA 2WANA 4MDPA 3W29A 2GJRA 4PEEA 4KGJA 5M3WA 4U2YA 3VNZA 1UWIA 3AS2A 2FHFA 4R27A 3W81A 4U3CA 3TTOA 1JD9A 3NDYA 4Y7EA 1TA3B 2YIHA 3MO4A 1WDSA 1X6NA 3VM7A 1E1FA 1JZ6A 3FW6A 2J7DA 3SIMA 2CBVA 4AD3A 1WZKA 4AZ7A 1U30A 2BY1A 1W32A 3CLWA 4CU6A 3HJEA 2XIIA 1LG1A 4GO8A 3QOMA 4HU8A 3ALGA 1TZ7A 1QNPA 2W92A 3THDA 3MMUA 3AROA 2UY2A 1ZBWA 4LYPA 1CXLA 1WZAA 1WB0A 2VX4A 4Q7NA 3CHDA 4M81A 4LXFA 1IZKA 3BAKA 3WMBA 4EKJA 5FD0A 1FH9A 1EA9C 1R7AA 1ISVA 1KCKA 1KQYA 3VIIA 2UY5A 4M82A 3WELA 4NRSA 4HA1A 4H8UA 3N13A 4HU0A 1B1YA 4D71A 4OJYA 1DHKA 1EO7A 4JL1A 1NP2A 4UQAA 1C92A 4ZXOA 3AISA 4JKLA 4IPNB 3PZUA 4J3TA 3CBWA 4BQ2A 2JEPA 5D4YA 4GPNA 2FDMA 1XRVA 3ZT7A 1B90A 4AZIA 6TAAA 3VIPA 1JI2A 1QVBA 3PZGA 3SCSA 1CGYA 4CKQA 2XM1A 3WD2A 1PIFA 2VCCA 1D3CA 4V28A 3WQ4A 5ABHA 4UOJA 1GQIA 2XUCA 1QHPA 3I3EA 4GXPA 4UFHA 1GHRA 1GVYA 2PC8A 1UH3A 1HN1A 1TVNA 3RMEA 1HP5A 1CXEA 2XVGA 1BVZA 3VDCA 2V38A 2ZUWA 1GORA 4J7RA 1GQKA 1JF6A 2WC3A 2Y5EA 1GUVA 3L4YA 3K8LA 2A3CA 1JGIA 4UZUA 2J79A 3RPMA 5AC5A 2NSXA 1PEZA 4M80A 1ZBKA 1KXVA 1JFXA 4CCEA 3VIGA 5D8WA 4ATDA 1VFOA 1TA3A 3CGTA 3WH8A 4J3UA 5A8PA 4HMCA 1LG2A 1EDQA 1JXKA 4OIFA 4KMQA 1OM0A 1E5JA 1HIZA 1W3JA 2CIPA 3MMDA 1GW1A 1M03A 5BXSA 4CGTA 1KFWA 1V6VA 2XVLA 1DTUA 4JIEA 3L4ZA 1SFSA 1XCXA 4TXEA 1N82A 2OSWA 4GI6A 1ISWA 4RE2A 1CGUA 3BCDA 5I77A 3WNOA 3VGDA 1CLXA 2BS9A 4MNKA 2XVKA 4NRRA 1C90A 4GKLA 5ABFA 8A3HA 5I0DA 4P8VA 1BHGA 4U5KA 5A6LA 3IJ8A 4CUCA 1GQJA 1W9XA 4CN1A 4Z2KA 1R86A 1HVXA 5D9MA 2DSZA 3F5KA 2AOSA 1HJSA 2X2YA 2TAAA 3SURA 1QNQA 4AXNA 3W6LA 2NW0A 1H0IA 1BQCA 3B9DA 1XD1A 3WNMA 1KXTA 1EIBA 3WD1A 5CGMA 1BFNA 5FIPA 4HTYA 2CBJA 3ARUA 4UOQA 3I3DA 1KB3A 4J27A 4PMNA 3E1F1 1UUQA 1Q4NX 3CHCA 5CXPA 1UD3A 3U7VA 3L4UA 4X0NA 4F9JA 1CGVA 3NCOA 1QW8A 1CLVA 5CSUA 3PZOA 1NM9A 2OLHA 1VB9A 7TAAA 1R87A 2PB1A 2YL8A 2DH2A 1CGWA 3MV01 4PMYA 1J01A 3WH7A 2VURA 2J7CA 2VCAA 3WN6A 2CBIA 4RE4A 4E2OA 1FFRA 3ARZA 2Y4SA 1BGGA 3AIWA 4H41A 3CZ8A 3JUGA 3VGGA 2WW5A 1SMDA 2J78A 4H8VA 2FHBA 1E40A 1GOIA 4AIEA 4B9YA 3ZJ8A 2QF8A 4CU7A 1RPKA 1WCGA 2VX5A 4FLQA 2PWFA 1QHZA 5LA1A 5FL0A 1E5NA 4WKAA 3QHOA 3RJYA 4AC1X 3OGRA 4WIWA 1MFVA 1YHTA 4ACZB 1VRXA 4UFMA 2WMFA 4W7VA 2GK1B 1K9FA 4OOUA 3AZRA 1UD4A 1M04A 1CGXA 2EXOA 1WDQA 5A6BD 2BY3A 4D6IA 1R7OA 3SEPA 1ZJAA 4HOZA 2E9MA 4WSKA 1W1YA 1KCLA 5C71A 3UETA 1B2YA 1F4AA 1MWOA 3GTNA 2QLYA 1M7XA 5EFDA 5A6JA 5JBFA 3VDHA 2JF7A 5FCZA 3SCQA 3VIOA 1E3ZA 4FMVA 1CXKA 1B31A 2AAAA 1H49A 2CNCA 3SCWA 3VDBA 3KL3A 3AICA 4F8XA 2GUYA 2X0HA 1QI5A 3VTRA 1V0KA 1AQHA 3D5HA 3WSUA 2CHNA 3K4AA 4V2XA 4IISA 4WLCA 1M01A 4J3XA 3W24A 2WKGA 3AHVA 2JALA 4AW7A 3GDBA 2DDXA 3AQUA 3AIRA 4E4PA 2CYGA 1W2PA 4W86A 1KGUA 3CTTA 1LWJA 2YOCA 3BAIA 4EAMA 3BAXA 2VRKA 4WF7A 1E6QM 1TVPA 4ZE4A 4ZENA 3DECA 5DO8A 3UG4A 2GFTA 5FOOA 1ESWA 1CNVA 1XCWA 1EQPA 5FL1A 4KWUA 4R5EA 4NF7A 3WQWA 4GO9A 3VIKA 3S6TA 2G3IA 2DEPA 4PMRA 5DMYA 4AEFA 1E70M 4DWSB 3WD3A 3VUPA 4GZIA 2FGZA 3FNDA 3AZSA 1ZB5A 4AEEA 5IHRA 3ARRA 5AYIA 3II1A 2ZX7A 1V6YA 5HDRA 2YA1A 4IPLA 2VT0A 4TVUA 1UR2A 1V3HA 1HJVA 2O9TA 3WF0A 4W84A 4Z2GA 2WC4A 4PCSA 1KR1A 3ARXA 5IFTA 3WNNA 3ALFA 3ARPA 5KEZA 3PBGA 4GQQA 5F7UA 2WKLA 3NSNA 4UFLA 5ABFB 1HKKA 3W26A 1WDRA 1UG6A 1W1TA 2NT1A 4DWSA 5TD4A 3DYOA 1JZ4A 2XWDA 2GJXB 4U3AA 1MXDA 2PWHA 3MU7A 3WF3A 1JFHA 1ITCA 4DUVA 4PYSA 3MUZ1 3MMWA 3F4VA 4QDMA 3GYCA 1OINA 5A94A 1NWRA 1UD5A 4PTMA 5E09A 1E15A 3VMPA 1ZBCA 2EBNA 4DWSD 2ZX6A 1TFVA 2Z1KA 1K9EA 2WM0A 1E3XA 3TOPA 1EH9A 1UOKA 3WKZA 3OLEA 3CUJA 4S3KA 3WDQA 1E6ZA 3SUUA 2J8FA 1V3KA 4BCEA 5M5DA 1G0CA 2QPSA 3FHQA 2ZXQA 3QHMA 3MKKA 2DQXA 1W9DM 3DYMA 4JL2A 2FH6A 2JIWA 3OGVA 2HISA 1AVAA 1K9TA 4JHZA 2W5FA 3AMGA 2XIBA 3VKKA 3B9EA 3EBVA 3N04A 3RM4A 1J0YA 5GNXA 4ACZA 1TR1A 4U33A 2W4XA 1CXHA 2WYSA 2GVYA 3HMCA 4S3JA 4WJXA 3KEHA 1UD6A 1US3A 1J9YA 3BLKA 2FH8A 1EDTA 3TTQA 2X05A 1J10A 2YDSA 1HKJA 5A6KA 1ITXA 1EXPA 1V02A 4LYRA 4QCEA 1PAMA 2CITA 1CWYA 1WDPA 5JUVA 3W38A 5A6MA 4AD2A 4HMDA 3ZM8A 3WNPA 1HVQA 1OGBA 1C8YA 3DYPA 5E6YA 4ACYA 2EPNA 1KQZA 2WMHA 2XVPA 3AIUA 2J4GA 1GOMA 4ATLA 4ZE5A 3FXYA 3RJXA 1BYDA 3AZTA 2XFFA 2O9OA 2EJ1A 2GSJA 2DT2A 3PZIA 5EBAA 1NQ6A 2GDVA 3ARSA 1CTNA 4AISA 4P7RA 1K6AA 4PSRA 6CGTA 3PTKA 2Y2WA 4W7WA 2JFEX 3CUGA 5LA0A 3VD3A 2BXYA 4PMOA 1W3LA 3WBAA 4QAWA 3AXHA 2J25A 4XB3A 5A2BA 2ZUNA 2D22A 3PZTA 1VEOA 1JZ2A 1XYFA 4M1RA 5E70A 1XH1A 5BXPA 2D3NA 4W8LA 4WKFA 3GH7A 4GZJA 3WH6A 3AJ7A 5GNZA 5HPOA 1UA3A 5A8OA 3T0AA 1VBUA 4JFVA 1KGWA 4W7UA 1E6PA 2EO7A 3AIEA 2CCRA 1Z32X 5LA2A 2YL6A 1LL7A 1CECA 3TTYA 1AQ0A 1Q6DA 4HZ8A 4TX8A 2GK1A 3WNKA 1KGXA 2YDQA 1OWQA 3FY1A 3GZAA 2ZUTA 3W27A 4AZ5A 1CPUA 3NUKA 5DEZA 2VX6A 3N11A 1JZ7A 2DGAA 4LPCA 2WVUA 4J3VA 4NSBA 3VGFA 3VM5A 2XFRA 2WBGA 3CZEA 1KWKA 2WK2A 1QI0A 4J3SA 2G3JA 4GIAA 4FLRA 2J8GA 2J7EA 2VR5A 3WDIA 1W9PA 4D72A 1UWRA 1DWHM 2FGLA 3APGA 1S46A 3AOFA 1H41A 1FOBA 4UQEA 1MW1A 5I2UA 2W61A 4LYQA 7CGTA 3N1AA 4P7QA 3CMJA 1J18A 2WMGA 2G41A 1QNRA 4ZEPA 4C91A 1KBBA 1PZ2A 3WFLA 2G4FA 1XSKA 3L2MA 1U33A 1UR1A 3EDDA 1V3LA 1LF1A 4V27A 3PZMA 2WZEA 1NOWA 3WFZA 1BGAA 4GQRA 1VEPA 2NT0A 3GH4A 1WZMA 2BNJA 2JE8A 1XH2A 3WDHA 4C7FA 3POCA 5A3HA 5EFFA 2BVTA 4X0VA 2JF6A 2VZTA 1LQ0A 3KE0A 1B3VA 1W3KA 5JIWA 4UTFA 1QW9A 1UA7A 3HU7A 5CPTA 1G5AA 4QP0A 2WVVB 4W8AA 1CENA 1WP6A 3KL5A 4N42A 2RGLA 1J12A 3WF1A 3AS0A 4UFIA 4UFJA 1UD8A 1JZ3A 1FFQA 3CO4A 4P8WA 1NH6A 1V3JA 1J0JA 2JIEA 1BYBA 3CUFA 4PMDA 2B31A 3A6OA 2XYLA 1V0MA 2OYLA 1MW0A 3A3HA 3DHUA 3M07A 1HJUA 1GPFA 1GQLA 1UR9A 1E6SM 1WAWA 4M8UA 4MAZA 1JYWA 3WUGA 1WZLA 4YN5A 1UD2A 1QBBA 2YJQA 2OWCA 4ML4A 5A69A 4UQBA 3QR3A 5E9AA 3AMDA 1ZL1A 4W87A 1BG4A 2ZUSA 3CMGA 2J7HA 1Q6CA 1QI3A 1GNXA 1Q6GA 3BSHA 1LLOA 3M7SA 2JEQA 4UFKA 2VQTA 4KRTA 1KXQA 3BAJA 1G01A 4OKDA 4AD4A 1TE1A 1WO2A 3AIBA 3VD4A 1C91A 2BVYA 1UR4A 4E8CA 1XC6A 2WWCA 3AS1A 2ZXAA 4PBGA 5BROA 1XD0A 3N12A 1H11A 1W91A 2EEXA 5A2AA 2OSXA 3CZJA 4QFUA 7A3HA 3VOCA 5A1AA 3WMSA 5BCAA 4PMQA 2BY2A 4UCFA 2BHZA 2HVMA 1GJUA 3ARWA 3MSGA 1UYQA 5LYRA 2UWFA 1V6XA 1WPCA 2VCBA 1HKIA 3U5UA 2YL5A 4JKMA 1RH9A 2Y8KA 2VRQA 1V6WA 1DEDA 4D6GA 3FAXA 1U2YA 2V3DA 5EMYA 4QLJA 5JBDA 1I75A 2D1ZA 2EQDA 3SCUA 3WQVA 1W9VA 5GNYA 2C0HA 4MJ2A 2DSVA 1O6IA 5D9NA 1GOWA 3N17A 3UR7A 3EMQA 1XGZA 2ZOXA 5BRPA 1VJSA 2CKSA 2CBUA 3K8KA 5IFPA 1QNOA 3IANA 4BS0A 3K1DA 3VMOA 4XZWA 2D2OA 2V3EA 3N15A 2FHCA 2WHJA 3GXFA 1UKQA 1H5VA 1GVIA 1UHVA 2BXZA 3N9KA 2WLZA 3SCOA 2DIJA 2WAGA 1B30A 4W89A 1B3XA 3CH9A 2ZWZA 1FP8A 2A3AA 4CD4A 4MADA 3SCTA 3WENA 3VIJA 3TONA 4NI3A 1QBAA 1JZ8A 3NSMA 4OUEA 1JYNA 1EQCA 4L4PA 5CLWA 4B16A 4JCMA 1VFMA 4X9YA 5CZKA 4MDOA 3UEQA 3NJ3A 4P8XA 5AC4A 3CZLA 1PX4A 4LGXA 3VD7A 1SMAA 2D24A 4IM4A 3MUAA 3ARYA 4D6JA 1UWTA 2VUYA 1A3HA 1L8NA 1V02E 1E6NA 4JZ5A 1GCYA 4D1JA 1Q6FA 3VINA 4M24A 4HOWA 3AXXA 3ZT6A 5HNNA 4Z2LA 1RD6A 3U7BA 3L4VA 2F2HA 3QHNA 4GI8A 1JYXA 3WDPP 2VJXA 2YLAA 1GZJA 3PTMA 2GDUA 1OT2A 1HJWA 2W67A 3VGHA 1H1NA 1OB0A 4CD6A 3QGVA 4H8HA 1EHNA 1K9DA 3IK2A 3GXDA 3DC0A 2D0GA 3F5JA 3L4TA 2J74A 2XPKA 2Q8XA 6A3HA 3AHTA 4AZCA 1UQZA 2XTKA 1CZ1A 5CQ1A 3LPOA 3UG3A 3I3BA 3VGEA 3O9NA 3K4DA 2D3LA 3QOKA 4MB3A 2DPEA 5I78A 5KZ6A 4D1IA 1YQ2A 1MFUA 8CGTA 1JZ5A 2J75A 5I6SA 1E55A 5E0FA 4EANA 2YLLA 3ZMRA 1E0XA 3RCNA 3MSDA 3SCRA 3ZR5A 1WE5A 1EOKA 1CYGA 4OBRA 1H09A 1QHOA 1US2A 2O92A 1PIGA 4Z2JA 2E9LA 2OSYA 2VZOA 4HOXA 4N0RA 5AYBA 4B9ZA 2X09A 1LWHA 4GI9A 3VX1A 1TG7A 5DT7A 1E43A 4EE9A 2D20A 4OBSA 1PX3A 1C3FA 1EGZA 2CHOA 1MYRA 3L4XA 4HP5A 5CJ5A 2E3ZA 2WVTA 1E0VA 2VOTA 2YL9A 2WZHA 5D8ZA 1W1VA 1E4IA 4AD5A 4D6CA 4U2ZA 2PBOA 1DWJM 4HZ6A 2BY0A 3RO8A 1BAGA 2BV9A 1OGSA 4UQ9A 3PZNA 5D9OA 3GM8A 4FF5A 3D3AA 1VENA 4ZXLA 2UY4A 3GBEA 1BF2A 4MAVA 3SUTA 3ARQA 4P7LA 2VR4A 3THCA 4TTGA 3NSXA 3BLPX 1TUXA 3EDFA 3WQ6A 2ZX5A 3T09A 3WDJA 4AD0A 2D0FA 2VZSA 1UH2A 1IV8A 2OWXA 2XM2A 5A6SA 4PUDA 5D9PA 2WSPA 1OCQA 3AYRA 1R8LA 1MQRA 2WMIB 4TVCA 1JF5A 3KL0A 5ABEA 4UOZA 1JNDA 1WNOA 1ECEA 1V3IA 2VO5A 3K46A 5IXEA 1ISYA 4FLOA 4AZCB 1EDGA 3BSGA 4B3KA 3O2LA 1ISXA 4JCLA 3IJ7A 4PMXA 3MS8A 1KBKA 3LPPA 3WH9A 3WNLA 4BA0A 2WHKA 2ZX8A 3WL1A 1LJYA 1JDAA 2WVVA 4AYSA 1NOUA 3VO0A 3BGAA 4PTVA 2C7FA 3POHA 3AHZA 1NWSA 4P8UA 1W9UA 3ZJ6A 2DSUA 1E72M 2WBKA 4PMVA 4GINA 3SUSA 1ODZA 3AFBA 3SCPA 5I23A 3M6DA 5FKYA 1UQYA 3U57A 1PJ9A 2V3FA 5GQBA 2XHYA 2ZE0A 1F4HA 2WB5A 5E6ZA 1DWFM 3KZSA 3J7HA 2X0YA 1PX8A 3IAQA 2Y24A 1E73M 2EPMX 2VVNA 4C7DA 1J0HA 4H7VA 5BXTA 1EOMA 2VC9A 1EO5A 5CLTA 1CEOA 4C7GA 2WCGA 1C8QA 4HMEA 4HA4A 1G9HA 4CVWA 1XH0A 3PN8A 3DHPA 1HXJA 5CPQA 2Y8VA 1G94A 4QLLA 3OLGA 3T0BA 2ZIDA 2ZXDA 4YPJA 2IUZA 4H2CA 3TP4A 1J0ZA 1OD8A 5IHSA 5A2CA 1QOXA 4W85A 2VZUA 1VFUA 4MNLA 4OOZA 4P7NA 3WUFA 1BYAA 3UR8A 3B8SA 1R85A 3BMVA 3OGSA 3A4AA 3MUY1 3W53A 2D23A 2XSBA 3BMWA 4Q22A 1BTCA 2DIEA 4TVDA 5A8NA 3CHFA 3ZR6A 2X1IA 3T2QA 4XUYA 4ATWA 3NIYA 1CGTA 3RM9A 1X1NA 3VDAA 1XYZA 2WHLA 2UY3A 3ARTA 3ZSSA 3ZJ7A 3SCVA 2VRJA 4BQ4A 2A3BA 1WKYA 3EDKA 5A8QA 3GNOA 1JXJA 1B3WA 4LX4A 2EPLX 2E9BA 2G8ZA 1MW3A 2A3HA 4KH2A 2PF0A 2YBTA 4W5UA 2VTFA 3ZJKA 2C8NA 3VVGA 5IDIA 2PWDA 3WEZA 2WWDA 2PWGA 2J62A 5DFAA 3OG2A 1VEMA 1V0LA 4W5ZA 5BRQA 4A4AA 4WK9A 2VX7A 2EPOA 2IXVA 1E6RA 5M03A 3PTQA 1JAKA 4PUEA 1HP4A 4PTWA 3OA5A 1QNSA 4XZBA 3OZPA 2WNWA 2V3GA 3G6LA 4AMCA 2XJ7A 3EDJA 4HA3A 1JYVA 3T08A 3AHXA 4URIA 3BH4A 1V6UA 3ZIZA 1VF8A 4MTVA 2O9PA 3MUIA 4QLKA 2VI0A 5HOSA 4WSJA 1BG9A 2ZUVA 5BXRA 1GOKA 1IZJA 1W9BM 3VPLA 4KRUA 1DWGM 1MW2A 2CKRA 4AIOA 5I3DA 4D6DA 4CD8A 4PMUA 3TA9A 3S2CA 1BLIA 2WMIA 1DP0A 1UR8A 1UKTA 1XSIA 2QMJA 1MVYA 4L4OA 2VVSA 5HXMA 3CZGA 3O6AA 4W8BA 2BVDA 4FK9A 4MPKA 3GNRA 4D6FA 2YKKA 2IXUA 1PBGA 5I5RA 1JNEA 5I24A 3W37A 2VNCA 3FHAA 3GNPA 1ZBVA 3WEOA 4W93A 1E9LA 4DUXA 2G3NA 1OBAA 3AYSA 3ZO9A 2ZXBA 3VIMA 3VGBA 1QI2A 3K8MA 4PCTA 1E6XM 4RL3A 1JG9A 4MB1A 1NARA 4AZGA 1HL8A 1GONA 1J0IA 4J3WA 4LQ1A 3T0DA 2J7FA 3BAYA 4AZHA 1FHLA 2WCSA 5A95A 4HZ7A 3ZQ9A 4MB5A 3A47A 3U5YA 1XSJA 1VJZA 5HPCA 3W0KA 2WMJA 4K68A 3AXIA 4Z2HA 4BZYA 4MNMA 5E0CA 1HT6A 2YA2A 5A8MA 5ECUA 4MNJA 1H4PA 3IAPA 3ZSTA 2E0PA 1UWUA 4IUGA 2VZVA 1W1PA 4YHGA 2DT0A 3VD9A 3A4WA 3VMNA 3HN3A 3MANA 4U5IA 2WXDM 5BWFA 4J28A 4PN2A 1L0PA 4JKKA 2VL4A 3PHAA 3N18A 1ZU8A 1NWUA 1SYTA 4UQCA 3WUEA 5DF0A 1JDDA 4UNIA 5CGTA 2WLYA 2CPUA 2Z1SA 3NYDA 3WQ8A 2ZICA 3WY1A 1BSIA 3WQ5A 1OSEA 2ZUMA 4DM2A 4HPHA 4E8DA 2CETA 1AQMA 2BFGA 3W25A 3ECQA 1IT0A 2CERA 1W2VA 5AY7A 2BHYA 4JAWA 4JFTA 3CUHA 4NZCA 3RILA 3VNYA 3WH5A 1V03A 1B0IA 1XHGA 1V3MA 4CD5A 3CPUA 2DSWA 5BYWA 1DWAM 2XVNA 3OB8A 2OYKA 2O9RA 3UG5A 4PSPA 3VILA 4M29A 3VU2A 1D2KA 5I79A 3NDZA 2V5CA 1I1WA 1KR0A 5M17A 3T2PA 2DT3A 2DH3A 4P7OA 5ABGA 5C70A 3UESA 1UZ4A 2EPKX 2W91A 3LMYA 4WKHA 2V5DA 2E4TA 1NP0A 4UQDA 3VIHA 1VAHA 1G1YA 4AD1A 2CXGA 4H04A 1UKSA 1OT1A 3FN9A 1ZS2A 2RGMA 1GOQA 3EMCA 3WUBA 1E4NA 3SCNA 5JBEA 4CVUA 1KWGA 4F9DA 3AMCA 2E8YA 4JFUA 1MQQA 3PZ9A 3AMKA 3EMZA 4RE3A 1HKMA 5GPRA 2PWEA 4A3HA 3VD5A 5CSYA 3IJ9A 1FHDA 1E71M 3ZOAA 2E40A 4KGLA 1E0WA 1C8XA 1I1XA 3TTSA 1E56A 5EB8A 3VX0A 2ZUUA 2W66A 3L4WA 2DT1A 2PBGA 1JD7A 4AY1A 2YBUA 5CPSA 3EDEA 4CCCA 3WEMA 1J0KA 1B9ZA 1E4LA 2QV4A 1FH8A 1UZ1A 2MANA 3SUWA 3W4RA 3W28A 5JIPA 4PRWA 3CZKA 4AZ6A 4ZFMA 2YDRA 1NOFA 2F8QA 3WBEA 4F79A 3VIFA 3BCFA 2ZWYA 3GBDA 2AMGA 4AIUA 4OZOA 1E4MM 1JAEA 1UKPA 4C90A 3LPFA 1CBGA 2GJXA 3T2OA 1CXIA 1Y7VA 4PMZA 1X6LA 4TX6A 4XX6A 3G6MA 1V0NA 3A4XA 3OIHA 4JFSA 2WHMA 1VIWA 1LL4A 4CN4A 1HNYA 4BF7A 1ODUA 1JL8A 4TTUA 1UR0A 1HF6A 3AS3A 1QPKA 3WF2A 1KXHA 3RDKA 1BYCA 2XG9A 2QMKA 4YHEA 1CDGA 3AMLA 3GH5A 3PZQA 2WPGA 4DUWA 4U31A 1ZJBA 2WZIA 4MJ4A 4M56A 4TOQA 4CCDA 3WL0A 1JIBA 3L2LA 1OD0A 1JDCA 3BAWA 4JFWA 1NWTA 2XWEA 3KWXA 4CU8A 3GXIA 3WDRA 1UH4A 1W3HA 2DSKA 2WCAA 3OLIA 3AIVA 1C7SA 1FA2A 4A3YA 1XV8A 3PZVA 1M53A 3WMCA 2J7GA 5CG0A 3AIQA 1CXFA 4D6EA 3W6MA 1UWQA 1OGGA 4EK7A 4B3LA 4D6HA 1C93A 1ISZA 2G3MA 3CHEA 5C8BB 1HL9A 4B15A 3GXMA 1BPLB 3UCQA 2W63A 3OLDA 1UWSA 4FLSA 1GOOA 4UZSA 2WSKA 1QI4A 3WIJA 1H2JA 4JHOA 4Z2IA 2PI6A 3WD4A 3BC9A 1BVNP 3M46A 4MB4A 3LPGA 1LL6A 2D0HA 2W62A 3ARVA 1H3GA 3UERA 4UR9A 1CIUA 1GHSA 2XGBA 3B9AA 5A6AA 1PZ3A 3MV11 3W82A 1B3ZA 1JI1A 2ESCA 4PTXA 2OYMA 2F61A 2XGIA 4DM1A 1HX0A 4HPGA 1SR0A 2YA0A 3RIKA 1GJWA 1E1EA 2QHAA 5DT5A 3EYPA 1J11A 4QCFA 4TUFA 3WF4A 1HJXA 2BHUA 2ZX9A 1TCMA 4CN6A 3AHYA 2VQUA 1OIFA 2WC7A 1OIMA 1Q6EA 2CESA 1VFFA 4GZEA 2XFYA 4BQ5A 1P6WA 3ZT5A 1DWIM 3CUIA 4AZBA 2WMKA 1H0GA 1FP9A 1O7AA 3SUVA 3WD0A 1FH7A 4F66A 4AWEA 1AMYA 1RP9A 1D7FA 2J77A 2CEQA 3FAWA 1B3YA 1RP8A 2J47A 2QPUA 2A3EA 3CIVA 2X8RA 1HJQA 4CD7A 1VBRA 2WVSA 4W88A 1EHAA 2VMFA 1A47A 2OWWA 1PPIA 3BXWA 3F5LA 5HBFA 1UKOA 3AI0A
chains in the Genus database with same CATH superfamily
1V08A 2P5NA 3OZOA 2I16A 4ZQPA 3SSJA 3TU9A 5D02A 4DWSC 9CGTA 3H21A 2J7BA 1IF2A 3A5VA 4MDPA 2QULA 1FVPA 2GJRA 3W29A 2CZDA 5M3WA 1RV8A 3CB8A 1DKWA 5EJZB 1OK4A 3QTGA 3UJSA 1OFAA 3GAKA 4WXYA 1M41A 3IJDA 4GYFA 3KVJA 1I0DA 1SFTA 2PTXA 3A24A 4Y7EA 4ERAA 1E1FA 1JZ6A 2J7DA 3SY1A 4LAUA 4AZ7A 3APYA 2XIIA 3E0LA 3SJ3A 1RA0A 3VOGA 4K3ZA 4HU8A 3O0KA 2GJLA 3HBLA 1JPKA 3MMUA 1ZBWA 4XD6A 4LYPA 3AWNA 4QSHA 4A21A 1Z9AA 2Q6ZA 3UPMA 2VX4A 4Q7NA 5K7JA 4DZIA 4LXFA 4GVFA 5J8LA 2GGHA 1OC6A 1ISVA 1KQYA 1VYRA 3THAA 2V63A 4I3GA 3S9YA 5DCDA 1W8SA 3LM3A 4NRSA 1R30A 4Z1DA 4H8UA 2PODA 4HU0A 1FWNA 3TFXA 3DI1A 1NP2A 3W9ZA 3CV1A 4YJ5A 2A7RA 3DAQA 3TCEA 4ZXOA 1H50A 2VGGA 3AISA 3EWCA 4J3TA 4NJGA 4HB7A 5D4YA 3WK2A 4XAZA 4GNKB 4J40A 3UU0A 2G97A 1JI2A 3SCSA 3O05A 1CGYA 1T40A 4LALA 1V4YA 3WQ4A 3H4XA 4GYPA 5C0QA 3OA3A 2XUCA 2OEKA 3QZEA 3M0VA 2PC8A 2Y61A 1HP5A 2V6AA 4BF9A 4XIAA 2HBXA 1GQKA 1JF6A 1G4TA 2WC3A 3ICJA 3EX4A 4MOZA 3L4YA 2A3CA 4WY0B 5AC5A 1PEZA 4M80A 3SADA 1ZBKA 3GYEA 5HATA 2EPHA 4BI5A 2OQHA 1TA3A 3UYCA 3DOPA 5C7HA 3A4JA 1YDOA 4US5A 2OJPA 2CIPA 2QR6A 4NAFA 4E3TA 5BXSA 2QIIA 2VFFA 1FWIC 3QTPA 4QRNA 1IXNA 1S2CA 2FB3A 3BCDA 3WNOA 2BS9A 3ZWTA 2PRHA 5G1TA 3QY7A 3WLOA 1K1DA 4NRRA 1X8CA 3IARA 3L68A 4GKLA 4J9JA 8A3HA 4P8VA 5A6LA 3IJ8A 4CUCA 4PA8A 2Z7KA 3LOTA 4Z2KA 1R86A 2DSZA 2X2YA 3SGGA 2AQWA 3EOSA 2J24A 3W6LA 2NW0A 3TA6A 1H0IA 1BQCA 3B9DA 3MZNA 1EP1A 3DHFA 1EC8A 4DO5A 1TJ2A 4HTYA 4XO6A 2CBJA 4XSLA 2P10A 3TJ4A 1UUQA 3CHCA 4JIIX 4GMEA 2YSWA 3O7UA 3L4UA 4X0NA 1VRDA 1QW8A 1CLVA 3A9IA 3G1DA 1SZNA 4IJRA 2PB1A 3WQPA 1A0DA 3WH7A 1BKSA 4JIPA 3ARZA 4LVBA 1UASA 3E0IA 4H41A 3P82A 2WW5A 1KD0A 3VCRA 2RJHA 4AIEA 1W1IE 3ZJ8A 1TYGA 4CU7A 1WCGA 1OYBA 5HMFA 2PWFA 3UP8A 3ZVIA 1EWDA 3FIGA 4WKAA 5HNUA 3QHOA 4WR3A 4AC1X 4Y8FA 3MTWA 2HPIA 3WLIA 1VRXA 1Q6RA 1Q5MA 3NOEA 3IRSA 2GK1B 5C9RA 5HQLA 5BWAA 3NQ7A 3HFTA 5A6BD 2OOGA 1WUEA 5F2MA 2Q3OA 3GDKA 3REQA 3APTA 4M5PA 2E9MA 3RG6A 1W1YA 2B0MA 5AHIA 3UETA 1B2YA 2D2GA 2QLYA 4K6AA 4GBUA 3SCQA 1W1ZA 4DF0A 1RSCA 3V5CA 1H1ZA 1KTCA 4LT9A 3W1UA 1B31A 1KFKA 3OZYA 2WOQA 4QX4A 2AAAA 1H49A 2CNCA 1RAKA 1UPPA 3DESA 2OGJA 2GUYA 3CH0A 3D5HA 1OCJA 1P0KA 2CHNA 1Y8BA 4IISA 3R1ZA 4H19A 3W24A 4MG4A 4O0KA 2DDXA 1X97A 3AIRA 2CYGA 5REQB 1KGUA 3CTTA 4XK2A 3GK0A 3BAIA 4JDBA 2CU0A 3TC7A 5DMLA 3OZMA 1Q45A 1Y65A 3LM7A 1OYAA 4ZENA 3DH7A 1TPFA 5FOOA 1GW9A 4X3ZA 1CNVA 3RUBL 1XCWA 1EQPA 1YBQB 3V1PA 4R5EA 1RPXA 4KEUA 3PTDA 3WQWA 4K38A 3VIKA 2AL1A 3AU2A 3O06A 4POCA 3S6TA 2G3IA 4PMRA 3PG8A 5HMSA 4YL2A 1Z6KA 4ZBCA 3AZSA 2GSHA 3I7SA 4LJ3A 4C6EA 1DXIA 4HHPA 5AYIA 3II1A 4IFKA 3E3HA 4HYVA 4K39A 1YPIA 4IPLA 4W4QA 1HQTA 3W2UA 1F3WA 4IPJA 3P62A 5DQPA 1UR2A 1V77A 2O9TA 3C4UA 1KR1A 3ARXA 3WNNA 3NGJA 3PBGA 2HXTA 4WDUA 3T4CA 1PSCA 3NA8A 4RX0A 4FSAA 2NT1A 4HBKA 1JDFA 3OVGA 3IRDA 4U3AA 3RCYA 4QJ4B 3DGBA 4DJDD 3MU7A 3WF3A 5TIMA 2F84A 5G2HA 3ZLGA 3MUZ1 4FZIA 3DU0A 3HURA 3N3TA 1TPVA 2GZXA 4UR8A 3N4EA 2NQLA 1H7RA 4YCPA 1ZBCA 3WJWA 2A3LA 4HZMA 1WBHA 1B5TA 4TMBA 5JVLA 1FTXA 3STGA 3RX3A 3UG8A 4QDPA 4BCEA 1P6CA 3WQCA 1G0CA 2QPSA 4RNJA 3S5ZA 4UWMA 2RUSA 1W9DM 3ABOA 2GQAA 2JIWA 3W76A 3OGVA 2HISA 4GKTA 2D2JA 4D8LA 3AMGA 1RBLA 3V7PA 3RM4A 1QT1A 3C8NA 3L5LA 2WYSA 3HMCA 4S3JA 3W70A 5BZAA 1QR7A 1OF6A 2FH8A 3BLKA 3TTQA 2X30A 1QASA 3M64A 4DBSA 2TMDA 5LNWA 1EXPA 1V5XA 1PAMA 1WDPA 4A29A 5JUVA 5A6MA 1OC7A 4HMDA 4NYUA 2FB2A 3OU8A 5E6YA 1OEPA 3DI0A 7TIMA 1TPH1 1XL9A 1M1BA 4QE1A 3AIUA 4ATLA 1GOMA 3Q45A 3OPSA 3LG3A 3H4WA 2XFFA 4EACA 3AXKA 2DW7A 4B4FA 5EY5A 5KZMA 4PSRA 2JFEX 1JGMA 4PMOA 3N2OA 1C29A 5AN7A 3WBAA 2ZUNA 2D22A 3A5FA 3PZTA 3FCPA 3T1GA 1DVJA 2IPGA 3QC0A 1JZ2A 2R9RA 4L9ZA 1V7AA 2FZMA 3PBYA 1I9CB 1KM2A 4RNFA 2XGZA 3GH7A 1U1UA 3WH6A 1UA3A 5A8OA 3MVIA 4Q6XA 1VBUA 2REQA 3I7QA 2DUAA 4ONVA 3WLRA 1K8YA 4MFDA 1KV5A 2XU2A 3C8FA 4R7JA 2CXEA 2GVEA 1AD4A 1RK5A 2ZZ4A 3G1HA 1OWQA 3GR4A 4MVAA 3LBOA 1YXCA 4AZ5A 3NUKA 5DEZA 3ZXWA 3B8WA 3N11A 1JZ7A 2DGAA 3CT7A 1FWFC 4Y9AA 3V5FA 3VGFA 3W01A 3SRFA 4PL1A 4CNPA 4JN8A 1LRNA 2WBGA 3BJSA 4J3SA 1H62A 1I2RA 1MSSA 3W2KA 2J7EA 2VR5A 1W9PA 1UWRA 1DWHM 4UQEA 1JCXA 4K37A 3EWZA 4BKNA 2W61A 3HTWA 5LZLA 4NG3A 5H91A 3N1AA 1J18A 2RKXA 2WMGA 5GJPA 2ALRA 1KBBA 3PNUA 5JU6A 1U33A 3VFLA 1Y5WA 1R3WA 4LUIA 5KINA 3WFZA 4DB7A 2C1HA 3TAKA 1J96A 3SZ8A 1G6CA 1ZP3A 1HO1A 3CQHA 3TVAA 3RHGA 1XH2A 2BVTA 3GTXA 4Q8WA 1FWDC 1UIPA 4NNAA 4FOJA 3QW3A 1EC9A 1X6UA 1B3VA 3EX1A 1D8CA 2OOFA 3TW7A 4C6PA 4QP0A 1H60A 1DXFA 3DENA 4MKNA 1J12A 2CLOA 1D9EA 3VCNA 4O53A 3D47A 4XBKA 2OPJA 2R1MA 5BOEA 3VOJA 3AC0A 1V3JA 1PYMA 3CUFA 4PMDA 3A6OA 4K1GA 2OYLA 3PB2A 9RUBA 1X7IA 4N9CA 3NM1A 8XIMA 3ZLFA 1YIXA 4XD4A 4IX2A 1JYWA 5HMEA 4QQUA 4R3UA 1WZLA 5HR7A 1QBBA 3GXPA 2VEGA 4UQBA 4Y8EA 4N9EA 1ZL1A 4ZZ9A 1BG4A 2ZUSA 3CMGA 3B0YA 3CC1A 3QJAA 5AHFA 4K7VA 1GNXA 4WOQA 4YTQA 5F4XA 3UNTA 3VKDA 4BF5A 2JEQA 4UFKA 2VQTA 3KWSA 1P48A 3BAJA 3AXMA 1W5NA 3GE7A 2QDEA 3TLLA 2A7NA 2BVYA 3QSRA 3DIPA 4S1FA 3N12A 3RLHA 2ZRYA 1A5NC 2VFHA 4WDXA 1H11A 1W91A 2EEXA 4ZB0A 2HTMA 3E2VA 4NQ1A 4HNCA 3QYSA 1EZ2A 5A1AA 2BY2A 4RXFA 1DQUA 4ASTA 3EPMA 4GACA 1JCYA 1V6XA 3PWGA 4NNCA 2YL5A 1RH9A 3GDMA 1RCXB 1V6WA 3EAUA 2VD8A 4D6GA 1ZFJA 4KFPA 1U2YA 3DKLA 5EMYA 1I75A 1FWHC 4FNRA 4ILSA 3SCUA 3WQVA 3PWIA 4BI7A 4MJ2A 2OO0A 5DANA 3G0XA 3MCOA 2CKSA 3K8KA 4WY0F 3FVDA 3U4AA 2ALDA 4G56A 4L64A 3W2JA 4XZWA 3W73A 3LQLA 4M3PA 2D2OA 4CLMA 5KZDA 4WQ6A 5IDZA 1GVIA 3N29A 5C2CA 3MKCA 2GUBA 1YPXA 3EB4A 5IRPA 1DPMA 3W6YA 1KBIA 4AMAA 1OFPA 1MEWA 1JUEA 1FP8A 4G7FA 2B81A 2GPTA 3VIJA 4AG0A 4NI3A 2Z7GA 4G9PA 1JZ8A 3PM6A 2WKJA 3MDWA 4ERGA 1VFMA 5CZKA 1RJRA 5CBIA 3E5BA 3NJ3A 1KM6A 4P8XA 3M0YA 4LGXA 1SMAA 3LHZA 3TQKA 4LS2A 4IM4A 5EL1A 4GXMA 1E6NA 4RCXA 4XO7A 1TTPA 2VHLA 3AXXA 3ZT6A 4L9YA 1DBTA 1WXJA 4Z2LA 3E6EA 4DPPA 2ONEA 1FCVA 2F2HA 2C6QA 1JYXA 3R7MA 3WDPP 4L9XA 4LNCA 1OT2A 3ES7A 1KTNA 3UPWA 1EXBA 3VGHA 1EEXA 3QGVA 3GZ3A 3M47A 3IK2A 3GXDA 1ME8A 3H12A 2HROA 2XPKA 1XISA 1XYCA 1UQZA 4Z1BA 3LY0A 2P53A 3T0CA 3LU2A 3UG3A 4GYJA 3TCSA 1ICSA 3IS4A 3Q37A 2IKHA 4JXCA 3QN3A 2D3LA 4MB3A 4D1IA 8CGTA 1JZ5A 5EMUA 1AK5A 2NV1A 2KX9A 3EKGA 2PDFA 4RZ6A 1E55A 3M5ZA 2Y7EA 5AOUA 2G96A 5E0FA 4O52A 2YLLA 3ZMRA 1QW7A 1E0XA 2PE4A 2PTWA 4TO8A 1WOAA 2ISFA 1QHOA 4ENLA 2D73A 2I7GA 3STEA 2HPMA 4Z2JA 2OSYA 4N0RA 4B9ZA 2X09A 3VX1A 3HG2A 2A2IA 2GJNA 2PRMA 5DT7A 4PB4A 1MUCA 3QMRA 3NZQA 4HK6A 5LNUA 3IGXA 4IT1A 3N4FA 3FJ4A 4NYYA 1TV7A 1F8MA 4XAFA 2YL9A 2VOTA 3VNLA 1B9BA 2WZHA 4C1KA 2QCGA 1E4IA 2PUZA 4HZ6A 3EPNA 2BY0A 4DYKA 3WX7A 4B4HA 5D9OA 3PK7A 4QEHA 1VENA 3RCMA 4ZXLA 3VFCA 4R34A 4C6JA 3EWUA 3NQFA 4RW3A 3THCA 4TTGA 4EAYA 3PFRA 4QISA 2ZX5A 3LGDA 4AD0A 3E74A 2Z2AA 1UH2A 3QGKC 3NQEA 1US0A 3QY8A 1VYSX 1ZY9A 1R8LA 4PUJA 3AU6A 1EF3A 1JF5A 3KL0A 3CQKA 3F4CA 1ECEA 2NVDA 8RUCA 2QCDA 2VO5A 1ISYA 1U5HA 5F2LA 5H1WA 1GTHA 3MP4A 4HT3A 2QUVA 3MUXA 4O28A 4XKYA 1ISXA 4NUWA 2RFGA 1K4GA 2IKIA 4JCLA 5M2FX 1V93A 3MS8A 4IL2A 1R6WA 1XIEA 4BA0A 2QUMA 2C7FA 4R85A 4ROQA 3MY9A 3S6DA 3B97A 1W9UA 2ZVRA 1IWPA 3GIPA 2ON3A 4NJHA 1LDCA 2DSUA 4PMVA 3SUSA 4ADTA 3M6DA 3USBA 2PC4A 3B06A 2DFAA 3P7YA 1J6PA 3U6WA 4E4FA 2P8BA 2GWNA 4O1EA 1YTKA 4JTGA 3KZSA 3J7HA 4QG6A 2Y24A 4HG6B 3NQVA 4NZFA 5BXTA 1EO5A 2ZRUA 2P1FA 3OYXA 1UMLA 4BY3A 2OGYA 1N8FA 3B8DA 3DHPA 5CPQA 1J4EA 2ZIDA 4K7YA 1W1A1 1P7TA 3NVDA 3NEHA 4OOZA 5EPDA 1BYAA 1QPNA 1K4HA 3B8SA 1R85A 3O0FA 3WQOA 2OX1A 2XSBA 3BMWA 1EGMA 1RBAA 4TVDA 4K8GA 4OECA 3NO1A 3ZR6A 3STPA 3T2QA 4XUYA 1KFJA 1CGTA 3LRLA 2PS2A 4B92A 2VWTA 3DEQA 3C2OA 3E2RA 3SCVA 1XLHA 2BBFA 3LTSA 3GNOA 3CS2A 3MB9A 1B3WA 3PULA 4JY8A 4Q8TA 2PD5A 3PF3A 1JQXA 2A3HA 4JIHA 4IGHA 5KETA 3WEZA 1HKWA 3O15A 2C79A 2PWGA 1G67A 1UCWA 2C14A 4NIRA 3DZ1A 1OCBA 1JAKA 1HP4A 3GW0A 3EWDA 3GS6A 3QPEA 3EDJA 4HA3A 1EGVA 3M0HA 3AHXA 3MDUA 3QEZA 4H6KA 3VDGA 1K6WA 3TYBA 3S1VA 3C0SA 5BXRA 4P00B 3VPLA 2HJPA 5DRIA 1WA3A 4AIOA 4D6DA 5CZJA 3U0HA 1FY6A 3P84A 2PDBA 1UR8A 1UKTA 2QMJA 2PMQA 4FR1A 2HDJA 2VVSA 3LEPA 4YTRA 3CZGA 4C6OA 3O6AA 2BVDA 1F3XA 2IXUA 1XDJA 4E2BA 5I5RA 1ONEA 1XP3A 1N8IA 3GFXA 1VCGA 5RUBA 3U9IA 2A79A 3EOOA 4WHBA 2PDNA 4DUXA 1QU4A 3O6DA 3PUGA 2G3NA 4IIHA 3K8MA 5FF3A 1NARA 2X1UA 1GONA 2QYGA 4J3WA 3CMFA 4HNOA 5CC7A 3W7JA 5JH1A 4MY8A 2GVJA 3VNDA 3BAYA 1EC7A 2ZZ1A 4NZ1A 2FKPA 4DXVA 4HHLA 2C18A 3A47A 5JXQA 4ZSTA 3U5YA 4XBJA 2FVKA 4CCZA 5HPCA 3W0KA 2WMJA 4K68A 3W7IA 4Z2HA 4BZYA 1ZAIA 2YA2A 5A8MA 3SQLA 5ECUA 1M3UA 2H6RA 5H6HA 3UWYA 2E0PA 2R1PA 3OODA 5D30A 1K77A 5GJNA 2DT0A 3OOQA 1BWLA 4LUSA 4A3QA 4HCLA 1UIOA 3S1GA 1XLMA 3BK0A 4GQ0A 5BWFA 5KZEA 1VP5A 4J28A 2OZTA 4PN2A 3W00A 1L0PA 3N18A 1B57A 1NWUA 4UQCA 3WUEA 5DF0A 4BWLC 1JDDA 2Z1SA 1ZENA 5AECA 2ZUMA 4IIEA 1KM1A 3TN6A 4HPHA 2CETA 4QAIA 1AQMA 2BFGA 3SBFA 3W25A 3BDKA 3ATYA 1W2VA 2DW6A 3GQYA 3R0KA 1T6MA 4JFTA 3CUHA 3PBMA 1EJRC 2B7NA 1V3MA 1OG0A 4FXSA 1TWZA 3BLLA 3LERA 3HG5A 2XVNA 3HV8A 2GVLA 4ZA0A 2OYKA 4OT7A 3TN4A 3PP7A 3UG5A 2QW5A 3GDLA 1I1WA 1GYMA 3T2PA 1ZHAA 2DT3A 2NXIA 1P43A 1ZGDA 5DXYA 4XSMA 3L9CA 2V5DA 4IMFA 3WBYA 3JZUA 3STCA 1MO0A 4H04A 1OT1A 2BMBA 4UXDA 4QTGA 3RPDA 3BG3A 5H8MA 3MCMA 1G7UA 4FPSA 3SCNA 1O68A 3VA8A 4CVUA 5LIYX 4LRSA 2HK0A 4A3RA 1W3NA 3SN0A 3S83A 2W3ZA 2CZEA 3GIYA 2F9RA 5D03A 3UY8A 4AX6A 3GD6A 4YYCA 3VX0A 1NTHA 3BMXA 2I56A 2ZUUA 1O94A 1JD7A 4C60A 1OX6A 2QVNA 3WEMA 5G4EA 4BR1A 4I90A 4MMWA 5D37A 5MF5A 3AUOA 4ZB2A 4F2TA 5H2ZA 1IZCA 1DJQA 3CZKA 4AZ6A 1NOFA 4O18A 3S8HA 4D9PA 2F8QA 3LLXA 5AVNA 4OHQA 4EPKA 3BG5A 2PP0A 3BTNA 5FF7A 3DG7A 1UKPA 3ZZ1A 4C90A 1OFDA 5IM51 3ONBA 3G8RA 4PMZA 2RDXA 3E0VA 3B40A 1O5XA 4TX6A 3A4XA 2IPFA 2WHMA 3WG6A 3VC6A 4H7CA 4GUJA 2WQPA 1EJXC 1ODUA 3LK6A 1UR0A 1S38A 4AWTA 4DZAA 4HSHA 2XG9A 4ZQMA 3P14A 1Z8AA 3AAMA 1QXLA 2IQTA 4QBXA 1S5WA 1QJWA 2WZIA 4TOQA 3L2LA 2HS8A 1OD0A 2VDIA 4IMGA 3E5PA 1ML1A 1NWTA 2XWEA 3TQ0A 2Y63A 3S2MA 4MPQA 3NO3A 3WDRA 1UH4A 4ICNA 3GHSA 1C7SA 1FA2A 4K36A 5CH9A 4ZO7A 3PZVA 5LNRA 4A2RA 1M53A 3SGUA 1TMLA 4EOUA 4D6EA 1OGGA 1BWVA 4EK7A 4TV5A 1ISZA 3T8QA 3BQ6A 3UCQA 3EWBX 3FFSA 1H7WA 1IEWA 3M0KA 4HN8A 1J6OA 4JHOA 4Z2IA 2PI6A 4B5XA 4I7WA 1AG1O 2PRLA 3C2EA 4MFEA 3TSDA 3KTXA 2D0HA 1V79A 3N6JA 3ARVA 3UERA 3URQA 3LENA 4UR9A 5C6MA 2Y62A 1CIUA 1SZEA 2Z1BA 1PZ3A 3W86A 1RY0A 4JR5A 4GFSA 2F61A 3KOWA 1EX1A 1FWSA 3G8EA 3RIKA 3QRHA 3DN5A 4L56A 2PD9A 4A22A 1EUAA 3LS9A 4QCFA 3IIPA 3MMTA 1HJXA 4JTQA 3WMLA 2BHUA 4MZ1A 3AHYA 1OIFA 3YPIA 1JCNA 3GDTA 1A0CA 4WY0A 1Q6EA 4GZEA 4BQ5A 4AXKA 3ZT5A 1XW8A 1DWIM 1H0GA 1FP9A 1O7AA 2GDQA 4ZVJA 3I68A 4F2UA 4L1XA 4AWEA 2FQIA 1RP9A 1FUYA 4YTTA 4F0SA 3MUCA 3FAWA 1B3YA 1RP8A 4GYPC 1HJQA 4CD7A 5IBXA 4W88A 2NV2A 1X1ZA 5F4SA 1VH7A 5TBOA 1TR9A 3F5LA 4QGCA 1CGVA 1VPYA 4BQ3A 3OBAA 1GKPA 2FYMA 1MQPA 3U48A 1ADDA 5K9XA 4PEEA 4I9TA 1OX4B 1I0BA 1R46A 3AJXA 5FJPA 2V5LA 3BO9A 3W81A 4JTLA 1XR2A 4NX0A 1W37A 1J2WA 2YIHA 4Q4SA 1OC5A 1X38A 3SIMA 3P0WA 3MSYA 3HOJA 1FXPA 3GG0A 4AD3A 4XD3A 5CC6A 2X1SA 3LBMA 3HJEA 3ABZA 3MPGA 4GK8A 2Z27A 2R82A 3NYZA 3CHVA 3P3BA 4H6EA 1TZ7A 3AROA 2UY2A 2JKAA 1CXLA 1WZAA 4ALDA 4R33A 3HQNA 2BLEA 3S46A 1F3TA 5CZ0A 3CHDA 1F8IA 4DI8A 4M81A 1TPC1 1TCDA 1TPUA 4KWVA 4LH8A 3QY6A 1A5KC 2P76A 1VC4A 2W27A 2VR2A 3BOFA 1KCKA 4ZGYA 1W1B1 3VIIA 2RH9A 1P4CA 2PLKA 5CG7A 3WELA 1Q66A 2MNRA 1DHKA 3EA1A 4JL1A 4UQAA 1K3UA 1DL3A 2XIMA 3NNTA 4JKLA 4H6RA 1ZP4A 2ZQ0A 4TV6A 2YGYA 4YVXA 2JEPA 4GPNA 4DELA 2FDMA 1XRVA 3ZT7A 4QQ3A 3VIPA 4QR6A 4LSBA 3LCHA 1A3WA 2XM1A 1XQKA 2VCCA 1D3CA 1UPMB 3C2RA 1QHPA 2V69A 1GVYA 1OZMA 3BLFA 3VKAA 1CXEA 3P5YA 1PZ0A 3EPOA 3UXDA 2V38A 4CNUA 2BGNE 4HK5A 2O56A 2C71A 2Y5EA 3B04A 1GUVA 1E0UA 3BVJA 3K8LA 1JGIA 4AVNA 2J79A 3NZPA 4M0XA 4CCEA 3G1AA 1XDMA 4NXSA 5D8WA 4ATDA 1TWIA 1BSLA 3CGTA 4J3UA 5A8PA 1A0EA 3V5OA 4JYEA 4HMCA 1VBJA 2X0SA 4OIFA 4KMQA 2XFWA 1W3JA 3IJIA 3BUVA 4DYEA 1M03A 4C6DA 1AL7A 4DJDC 3FXGA 3U3HA 1DTUA 4JIEA 1XCXA 4TXEA 3AUJA 4QJ1A 3ONCA 1SW0A 3VGDA 3WJXA 4UTLA 2XVKA 5D2VA 2X7WA 3NM3A 1C90A 4C1NA 4U5KA 1GQJA 2Z25A 1W9XA 1DYSA 4GJ1A 5D9MA 3GTFA 3T42A 3F5KA 3RFAA 3SURA 1QNQA 1XD1A 3LYEA 3VZZA 3WD1A 2ZE3A 2AGKA 2J9YA 5FIPA 2F6XA 1LQAA 5I02A 1XS2A 4F9JA 5FF4A 4C6CA 1SZGA 2E1WA 4QM1A 5CSUA 1RCOB 1NM9A 3CU2A 3OBEA 4I9AA 4RLIA 2DH2A 2QDGA 3MV01 2VCAA 2CBIA 1Z48A 4E2OA 3CAKA 4O57A 1HL2A 2PU1A 4DRSA 2V2HA 1BGGA 3P0XA 1IHIA 4QS6A 3EOLA 3M0IA 4XWUA 1PTDA 2FJKA 3CK5A 3VGGA 3JU2A 4NZ3A 2J78A 4H8VA 2FHBA 1E40A 3AWOA 9XIAA 2YFNA 4B9YA 1RPKA 4DY1A 4XAPA 5DCBA 5FJTA 3BG9A 3WLPA 1ZCCA 4R9OA 2AMXA 1E5NA 3UBPC 3RJYA 1TWSA 1Z3NA 4HJWA 4WZHA 1MFVA 1U5JA 4UFMA 3P67A 2WMFA 1EFZA 1YW1A 4JTTA 1R3RA 4OOUA 3AZRA 2JK2A 3UJFA 3W85A 4M51A 2EXOA 1NFGA 5J5DA 4D6IA 1W5PA 1MNSA 1R7OA 1Z69A 4LUYA 1P5BA 5C71A 3NL2A 1SGJA 1AQFA 2DZUA 4ES4A 3TYEA 1MWOA 2ZZ5A 4PEKA 5A6JA 2ZTJA 3VDHA 2JF7A 4M7SA 1U1JA 3ITGA 4O11A 3CV7A 4HKPA 3VK5A 3SCWA 1TO3A 3A3WA 1JULA 2PEVA 4F8XA 1AQHA 1QI5A 3VTRA 1V0KA 3CYVA 3WSUA 1EKOA 3B4UA 4MJZA 3OJGA 4WLCA 2JQXA 3M0MA 1KBJA 1JEZA 4I5XA 1FWTA 1W2PA 1Z7AA 4AEOA 1LWJA 1QOQA 3M44A 3BAXA 3S1XA 4IWWA 3W7EA 4DJEC 3QLDA 3UJ2A 2OZ8A 4V33A 5HJYA 3CEUA 3FV9A 3B8IA 3DECA 3UG4A 4LEFA 2PDHA 4QXIA 3GR8A 1QK0A 1XIIA 1F07A 4Q8PA 1IR1A 1KCZA 1JUKA 4GO9A 1AH4A 4DWSB 2PDIA 4GUFA 3FNDA 2I9UA 2H8ZA 4AEEA 2AL2B 1YLVA 3OHMB 1V6YA 3SIZA 4WOZA 4TVUA 1I8JA 3KVKA 3W7QA 3WF0A 5CPNA 1WX0A 3QQ1A 4O10A 4CNSA 4PCSA 3KRZA 3S42A 3EWYA 5HK4A 5KEZA 4MLRA 3EB3A 5F7UA 3NSNA 1GKRA 2VEIA 1WDRA 5FAGA 1GYNA 4C6BA 3DYOA 1C9DA 3KBSA 2XWDA 3PUOA 1MXDA 4JN7A 4A2SA 3R8GA 2WNQA 4LW7A 4DUVA 2H9AB 4PYSA 2DZVA 1UUMA 1ICQA 4DBDA 3LCFA 4GYKA 4QDMA 1OINA 3FA4A 4Y9NA 2CLMA 5E09A 3ERPA 1O4UA 2WM0A 4R88A 1EH9A 1QPRA 1L2UA 3WKZA 3HFYA 3H2MA 2ABAA 1UROA 2A6NA 3NQAA 1E6ZA 4AWSA 4V1XA 3S4TA 5M5DA 5EKYA 3BOXA 1S2AA 3FHQA 2ZXQA 3QHMA 3SR7A 2FH6A 1YTDA 3V0SA 3L12A 5KMYA 3JRKA 2QJIA 2HXUA 1AVAA 1K9TA 4Q32A 4JYDA 3WJSA 1K8CA 5G1MA 3N04A 1V51A 4WGXA 1J0YA 4MUPA 1F6KA 1NSJA 2W4XA 1CXHA 4TIMA 2VEMA 1LOQA 1J9YA 1US3A 4MY1A 3PANA 1EDTA 1J10A 1KRBC 5A6KA 4XZMX 1EP2A 1ITXA 3GVWA 1JJKA 4QCEA 1CWYA 3A3XA 5HWNA 2XINA 3WNPA 5J04A 1JQVA 2XN0A 4X63A 2WMHA 2J4GA 4ZE5A 3LI1A 3B9OA 2O9OA 4EWJA 3LRKA 1TTJA 2EJ1A 2DT2A 5EBAA 3O16A 1RCQA 3LB0A 1OFEA 3ARSA 1CTNA 4GH3A 6CGTA 4I7UA 3PTKA 2Y2WA 4L4LA 3R79A 1M7JA 3LMZA 4W7WA 1K8ZA 3CUGA 3VD3A 4YU1A 1W3LA 5AHMA 4XB3A 2E67A 4US5D 1ADSA 1XYFA 3JS3A 4M1RA 4GI4A 5E70A 1XH1A 1XPYA 3PAOA 1CT5A 1YDNA 3AJ7A 5GNZA 4LBUA 2YR1A 3S2NA 4XAGA 2PDLA 3M43A 5CCZA 3VUSA 8TIMA 3KZPA 1W31A 2X1TA 4ZOCA 2POTA 4W7UA 1E6PA 3T07A 4MY9A 3H70A 4RW5A 4ADUA 3LQGA 3RX2A 1NDVA 5G2WA 4KPLA 1CECA 4KCUA 3TTYA 1AQ0A 1Q6DA 4TX8A 1FBAA 2I17A 3WNKA 1XI3A 4U4MA 3PJWA 3SN1A 2WZMA 3WYZA 3V0TA 3BV4A 1XUZA 4NAEB 2NVCA 3M6YA 4EXQA 4ORMA 4UCGA 4J3VA 3VM5A 3N6HA 3OVQA 3CZEA 2I57A 1QI0A 2OX4A 4FLRA 4IFRA 4BK9A 4Q33A 3WDIA 1NJJA 3RK8A 1H41A 1FOBA 3OYZA 1MW1A 3KX6A 4LYQA 3CMJA 4JTJA 3WLLA 3B0UX 1QNRA 4HPNA 4ZEPA 3PPCA 1GVEA 1PZ2A 3WFLA 3I4EA 1PWMA 1V3LA 4GA8A 3UJEA 3PZMA 2WZEA 4I9JA 1NOWA 3UVIA 1BGAA 3EX6A 4GQRA 1VEPA 3OO2A 3GH4A 2I5QA 2BNJA 3POCA 3G1XA 5EFFA 2I1OA 4FOUA 3N6QA 3GG8A 4EPBC 2GYIA 3C3NA 4OUIA 1PTAA 3R25A 4GCXA 5JIWA 1RD5A 4JY9A 5BMWA 4LYKA 1QW9A 3M0LA 3FA5A 3MKVA 1G5AA 5XIMA 4W8AA 1CENA 4QROA 4N42A 4UFIA 4UFJA 1TTIA 2CZVA 4LBRA 1YX1A 1LZOA 4A8RA 1BYBA 4ZL1A 1SW3A 5CJNA 2B31A 4TQTA 2PP3A 1MI3A 1D3GA 1GQLA 1E6SM 1QPQA 2QKFA 4MAZA 4DHGA 3V36A 3WUGA 2LLEA 3DERA 3O07A 4H9VA 1KC7A 4LAOA 1S1RA 3C61A 2OWCA 3BW3A 5E9AA 3AMDA 3W1AA 5DY2A 4WJEA 1TIWA 2E1DA 1Q6CA 1XCFA 1QRQA 2OZ0A 2X40A 4LS0A 5JH2A 1Q6GA 3I6TA 3M5YA 4KCVA 3ITOA 4KRTA 1E51A 4OKDA 4CQ8A 1TE1A 3AIBA 8XIAA 3KAOA 5CC3A 4LC6A 4U28A 3L0KA 4E8CA 2WWCA 3UFYA 2ZXAA 2J66A 4JTAA 5L6UA 3T05A 4GABA 4AY7A 1L6GA 4F3HA 1R9YA 2EJAA 1PCWA 5A2AA 2EKGA 4RDVA 4W9TA 3CZJA 3ANUA 4DAFA 4FNSA 4EVZA 2DQWA 3FKKA 1XIHA 3UWZA 3ARWA 1SQ7A 1X96A 4XD5A 5LYRA 2UWFA 1HKIA 3NO5A 3Q65A 3RN6A 4JX6A 4GCAA 1KM0A 3P61A 3FAXA 1JPHA 1K70A 4XTIA 1UP0A 2CLFA 4QLJA 3E9AA 2D1ZA 1RR2A 1QUMA 2C0HA 5D9NA 1GOWA 1AFSA 3EWXA 1HO4A 4LUTA 2ZOXA 5IFPA 1QNOA 1FWRA 1VR6A 4E4UA 2V3EA 3N15A 2P0OA 3W1LA 1DORA 3SCOA 3G1FA 5LGZA 1B30A 1OQFA 4W89A 1EYEA 3CH9A 2ZWZA 3ABQA 3FJLA 2A3AA 4RJEA 2QVHA 4ZOEA 3W7GA 2WSQA 1GVOA 4S3EA 2ISSA 4QHRA 4L4PA 4B16A 4JCMA 4X9YA 1RBOB 3ITYA 3UEQA 5BU9A 1KW1A 2OQLA 3V35A 4A8IA 2YB4A 3VD7A 1JRCA 4GGHA 2G4JA 2XN1A 4HQVA 3FYOA 3ARYA 4ML9A 1BRLA 1L8NA 3QR1A 4Z1AA 4PODA 3CASA 1W3IA 4XAYA 5HUOA 2YXGA 5HINA 4B2DA 2Y85A 4S3GA 3G1VA 1NIUA 1SVDA 2BZNA 3U7BA 5HNRA 3PJUA 4JDYA 2GDUA 1HJWA 2ZA1A 1EHNA 3H23A 3WZ0E 1A5UA 3DC0A 3UGVA 2D0GA 3L4TA 3LZ3A 2Q8XA 3N2BA 4ZQCA 3FKRA 3PY2A 1E1CB 2NV9A 3VAVA 4NJKA 4GVHA 4GNVA 4DZ5A 3VGEA 4WUIA 1XXXA 3QOKA 3CAWA 1YQ2A 3FOKA 3S47A 1PIIA 2Q8LA 2ZC8A 5I6SA 1IGSA 1LTDA 1GPWA 1W3TA 3LDVA 1H09A 4G1KA 4UUIA 5E0KA 1Q7MA 1XIGA 1PIGA 4MIMA 2E9LA 4JEJA 5FA5A 3VI2A 1O95A 4GI9A 1XLKA 1E43A 4A6GA 1RXOB 3R0DA 4PUMA 2JGQA 4OBSA 1C3FA 1S5MA 4HP5A 4LAKA 2OTDA 2WVTA 1E0VA 2QCLA 4IHCA 4AD5A 2Z24A 1Q7ZA 5LXXA 1Y5VA 1EJTC 5GJMA 3D3AA 4NT0A 2V30A 1PKYA 4GIEA 1DJGA 2CLLA 4PZVA 3VOIA 3ARQA 4P7LA 1A5BA 3RU8X 1IGWA 3EDFA 2QXWA 3PNZA 3WLNA 3T09A 3W7NA 3WDJA 4CNNA 4IFKB 2D0FA 2VZSA 3JVAA 4IMDA 1IV8A 3QFEA 3KBJA 5ENLA 5A6SA 4PUDA 5D9PA 4M1BA 4M19A 2DVXA 5ABTA 3P74A 5C55A 1TJRA 5AB3A 4TVCA 1DXEA 1JNDA 1WNOA 2IQDA 1V3IA 3CL6A 5CZSA 4E2DA 3K46A 5IXEA 4PB5A 4AZCB 2HV5A 2VYOA 1HFBA 2ZRXA 1GGOA 4RZ5A 3LPPA 4FNPA 3WH9A 3WNLA 5EMJA 5XINA 4AYSA 3VO0A 1JCTA 3BGAA 1ZLPA 3AHZA 1K7XA 4P8UA 3WK0A 5LHFA 3ZJ6A 2POZA 3BICA 4Y90A 3AFBA 5I23A 4EF9A 1PJ9A 2V3FA 3RR4A 5GQBA 2XHYA 4M6VA 2WB5A 1CLKA 2DIKA 5I06A 4X9SA 2A1YA 3BCJA 2X0YA 4CNOA 3IPWA 2DORA 1FWJC 4QIUA 2VVNA 2OQYA 1XIFA 2A5HA 2QUUA 2V9DA 3T40A 5CLTA 1CEOA 4C7GA 5LNSA 2WCGA 4LRTA 4HMEA 4HA4A 2GGGA 4CVWA 3L5MA 2Y8VA 1G94A 4FHAA 3FJNA 2ZXDA 4Y6GA 2IUZA 3TP4A 3R94A 2EAWA 5IHSA 1FCQA 1QOXA 4W85A 4PR4A 3RRXA 3RNDA 1EJSC 4O4WA 3A4AA 4GY0A 1P0NA 4LUTB 4Q22A 5U7SA 3FSTA 2DIEA 3NTYA 4BI6A 4NAFB 3M0ZA 3N25A 5DN1A 4ATWA 3NIYA 3W7DA 4Q7BA 3VDAA 3NQ6A 3A21A 5SWUA 2V5KA 3ZSSA 3LUTA 1PHQA 2A3BA 1WKYA 2CHRA 3HPSA 1OYCA 3G1SA 1JXJA 2ODOA 4JX5A 3UXIA 4C6MA 4WX2A 3BJFA 4ECLA 1UZDA 2PF0A 3KBNA 4W5UA 3ZJKA 4MYXA 3VVGA 3IIZA 1WQ5A 5IDIA 4KW2A 5XIAA 5BOFA 5DFAA 3OG2A 2UV8G 1V0LA 2RHGA 5BRQA 1A49A 1KFBA 5TQLA 3S6OA 1QNVA 4IP7A 1UC5A 5DMNA 3VKCA 3SRDA 4EPDC 3S3GA 5LIWX 4XZBA 2WNWA 4FX7A 4MUZA 3G6LA 3V1HA 1XIMA 3T08A 2J88A 4URIA 4GUHA 1RY8A 3ZIZA 1VF8A 3IUDA 4DBUA 3UWEA 1HKVA 1BG9A 2ZUVA 4F0HA 1IZJA 1OX5A 1W9BM 4KIRA 4DZHA 1EJWC 3W2MA 2OR2A 2PCQA 4DX3A 3ENLA 3LV5A 3QGAC 3SRHA 4HU3A 3NGFA 3R4IA 5A6TC 5EIYB 1MVYA 3W1XA 3KS6A 5HXMA 2ISDA 4DWDA 4KKXA 2INZA 3GNRA 4D6FA 2YKKA 4C1NB 2HE5A 2R6OA 3L0GA 4PUKA 3W37A 3O8AA 4AFYA 3GNPA 2Y6ZA 1IXOA 1OBAA 5L9FA 3VIMA 1QI2A 3NL3A 4XZNX 1XICA 4PCTA 3TYZA 1TV4A 4P2VA 4AZGA 1HL8A 4A8LA 2A7PA 5CAKA 3T0DA 2AQVA 2J7FA 1IWBA 3UCCA 1GYLA 3GC4A 1FHLA 3NOYA 2WCSA 1W5OA 3FYPA 5EMKA 4XZ9A 1RLCL 5T8GA 3TWAA 3E0FA 2X42A 1BXCA 2ZDSA 2ZZ7A 1HT6A 1SO6A 2PDKA 4XBSA 3B0XA 2DV0A 2OFJA 2Y88A 3GFYA 2GVGA 5BMXA 3LLFA 1IIHA 2G95A 3UY7A 4JTHA 4NZ4A 4ZQRA 1WKFA 3A4WA 3NQBA 3VMNA 6PTDA 3HN3A 3UR2A 3B0VC 1ONWA 4U5IA 3QBUA 1TVLA 4YIWA 1CCWB 1K03A 1AW1A 3QF0A 5CGTA 4FXFA 4HK7A 1PO9A 1V6TA 3WY1A 2OMAA 3RAOA 3CWHA 4DM2A 3ECQA 3PBWA 5AY7A 2BHYA 1FKWA 5A5WA 3H2EA 5BU6A 3VNYA 1U83A 1KO0A 1V03A 2GQ8A 3C86A 3G1YA 2F2KA 3LRMA 3WK1A 1N8WA 3TK7A 4AHOA 1GG0A 3MA8A 3ITLA 1UR3M 3UZYA 7REQA 4JTCA 4J1OA 4PSPA 3VILA 2HRWA 3ANVA 3NDZA 3SQMA 2V5CA 1TE6A 3TQPA 2NX1A 4Y9MA 3GXTA 4QITA 2XH0A 5M17A 2DH3A 4P7OA 4RXGA 3P5ZA 3UESA 3W1NA 3LMYA 2IKJA 1VAHA 3RYSA 4Q4MA 4AD1A 1T8QA 1EJVC 3W23A 1BTMA 2YCIX 1UKSA 4JQ4A 2VEPA 3IEBA 1ZS2A 2RGMA 4NAEA 3PBUA 1KWGA 4GQBA 1VGAA 1P0EA 1UUOA 1XBXA 2PTYA 4AIBA 2VEFA 4AC7C 3W1QA 3AMKA 4RE3A 4YS1A 1REQA 1NF0A 4A3HA 3VD5A 3C2YA 3LXAA 3ZOAA 1FHDA 1E71M 3LD5A 3SQSA 1SW7A 3INPA 4FNUA 2DU2A 1BQGA 1I1XA 3TTSA 1QK2A 1E56A 5EB8A 4BEQA 2VC7A 3BURA 1W6TA 2DT1A 4HNVA 3TQVA 3ZR4A 1F73A 2Y0FA 3LCGA 2YBUA 5CPSA 2Y7GA 3THUA 2H8XA 1FH8A 2VP8A 1OHLA 1SUXA 4G2DA 4KCTA 1Q63A 1LUCB 4ZFMA 3UD6A 3QVQA 3WBEA 4F79A 3GU1A 2ZWYA 4UTKA 3T6CA 3HM7A 2AMGA 4AIUA 3MT1A 4JOMA 3GRIA 4OZOA 1JAEA 4JGDA 3XISA 3LPFA 3R0UA 2GJXA 3T2OA 4DXKA 4PTNA 1B4KA 3H54A 1F05A 1HW6A 3DBPA 2VELA 2PTDA 5PTDA 4XX6A 5CZTA 1V0NA 3XINA 2ASHA 1VS1A 3RX4A 1LL4A 3ZWSA 4CN4A 1F3EA 3GVGA 3LHYA 4IL0A 1MZRA 3V16A 4TTUA 4RV3A 1DIDA 1TUFA 1HF6A 3WF2A 1WKEA 4A8NA 1BYCA 2QMKA 4YHEA 4ZOAA 3U8GA 4HHHA 1P6BA 1ZJBA 5FJJA 3L7RA 1F6PA 2QGYA 4UTTC 5C54A 4Q8OA 3BAWA 3TN5A 2V0TA 3CPRA 1EL3A 4FX8A 4P5UA 4DJFA 2WCAA 3EOUA 3AIVA 3CAQA 5C9UA 1Q13A 1XV8A 1T0OA 1GVSA 3STFA 3H7RA 5FEWA 3HGRA 1R9XA 4F0MA 2Z26A 3R8HA 4NU7A 2Q09A 2R8WA 3AIQA 1AJ0A 4EPEC 3CLMA 1UMYA 3MBDA 4XIMA 4D6HA 1GEQA 3TFCA 1C93A 4MWAA 1I2OA 3CHEA 1HL9A 3TXZA 4H9TA 4B15A 3ZS4A 4FLSA 1D7KA 2YB1A 3WIJA 1H2JA 3WD4A 1BVNP 4F4RA 3BLDA 4WJ8A 3M46A 2VD9A 3LPGA 3OHIA 2W62A 1H3GA 4MZYA 4IP5A 4UTJA 3UNDA 3N9RA 3B9AA 5HMDA 5HANA 3NDOA 1B3ZA 1JI1A 2GL5A 2PZ0A 3WLJA 1NDYA 2ESCA 3A22A 4DM1A 4KRZA 5DY3A 2I9EA 2YA0A 3LTYA 1GJWA 3KBMA 4ZFCA 2FZDA 1WV2A 3DFHA 4I9MA 5D2TA 4ZMGA 4TU1A 1X98A 1EBHA 1YDYA 4RNHA 3N2MA 3UT0A 5HQEA 2WC7A 1OIMA 1VFFA 1UW9A 3UQNA 4AZBA 1PL9A 2WMKA 1V8EA 3SUVA 1FH7A 4F66A 3OQ8A 1J8VA 4F2BA 1F7BA 3QW4B 4RPQA 4WD0A 1NDWA 1J5TA 3WLKX 2J77A 4Q8VA 3M1ZA 3H2NA 2A3EA 3RLVA 3TYDA 2REQB 1ZPTA 2WVSA 2HEJA 3ITXA 2AAMA 3F1QA 5LNVA 1N55A 3UWVA 4AX7A 3GW3A 4HU4A 1XLGA 1PPIA 3S5SA 4XG1A 1UKOA 3NQGA 3WLSA 4AVFA 3R5EA 3L66A 1TMQA 1ZUAX 2QCFA 1C7TA 4LF1A 5A6BA 2C15A 2FIQA 3IIVA 1XLIA 4U2YA 3VNZA 4JS3A 1EJ7L 1UWIA 2FVLA 4R27A 5FACA 1TZ9A 3TTOA 3TNOA 2PZNA 4H9ZA 1JD9A 2V8ZA 4QS5A 3ANYA 2R24A 3NDYA 1TA3B 1WDSA 4NXKA 4ZOBA 2OCZA 3FW6A 2CBVA 1WZKA 5CPOA 3HA1A 2BY1A 1W32A 1L6SA 4JTIA 4CU6A 1DIEA 1XG4A 4JQ2A 3C56A 1IT7A 4GO8A 4WRHA 4UTMA 2PLJA 3I6RA 3B0PA 3ALGA 1S5NA 3TLQA 4ZO9A 2MUCA 4MWAE 4KF1A 2QT3A 5MKGA 3N34A 3KRUA 5LIXX 2IW0A 1FWCC 4LC8A 3AYTA 5CJMA 2PA6A 4Y9OA 3WMBA 4EKJA 2DZTA 4IIBA 1R7AA 4RNIA 4XKYB 3TROA 2BP1A 2G5WA 4K8HA 3CQJA 3LA4A 3N13A 2EKCA 4D71A 5I3FA 1EO7A 4MJMA 5T91A 3MQTA 4FAMA 1NU5A 1VFSA 3M0XA 5LGXA 1FDZA 2E7FA 2WQDA 2Z1VA 3PZUA 1OK6A 4WCJA 5LIUX 3EXTA 1B90A 4AZIA 1EF2A 3G24A 2V2CA 1QVBA 4ZO8A 5LHEA 4CKQA 4IQDA 2O4MA 3WD2A 3W22A 2R14A 3GTIA 1VCVA 4LANA 2UZ9A 2ZZ6A 1TB3A 4GXPA 4LCSA 4M6PA 2CWNA 1F5ZA 3TYAA 3QPZA 3W7KA 4UR7A 3LZ5A 3RMEA 3MVTA 2ZUWA 3V3WA 1GORA 5AZ1A 3SRKA 3DKJA 5FESA 1MMFA 4QE4A 4J2MA 3KDNA 4H9XA 4UZUA 3TC3A 3RPMA 1XLBA 2NSXA 4KIEA 1WYIA 1KXVA 1JFXA 3WO8A 4XTDA 3WH8A 4Q3MA 1X39A 1XYBA 1LG2A 3EB2A 3S5NA 1O60A 3W7HA 2BG5A 3MMDA 3W1MA 3NG3A 3U2EA 3H2CA 1X8FA 2NQZA 5CKSA 1V6VA 3NPVA 2XVLA 3L4ZA 3N2TA 1N82A 2VM8A 1ISWA 4GI6A 5I77A 5FJIA 1CLXA 3MI2A 1Q4WA 4O15A 3FEQA 1ITQA 2RDUA 5I0DA 3KVLA 4PB3A 1R3QA 1BHGA 3CM4A 1EP3A 1DJIA 4O8AA 3RRAA 2TAAA 3H2AA 5HUPA 1MUWA 3B8UA 1YE6A 2A4AA 3FEMA 4DXXA 2Z2UA 3OP2A 1CB2A 4L1WA 1AMKA 1BFNA 4C6KA 4LVDA 3L65A 3ARUA 4UOQA 2FVMA 4C6NA 4LBSA 1KB3A 2W79A 4J27A 1MDRA 4PMNA 1XRSA 1UD3A 3U7VA 5I09A 4PE8A 3NCOA 1M65A 4ICCX 3URAA 2OLHA 1L6WA 1VB9A 7TAAA 3A9BA 1R87A 1F76A 5IOBA 3R11A 3GC2A 3FVMA 3TMLA 4PMYA 1E0TA 2VURA 3G2GA 1FFRA 1TX0A 3VNIA 2Y4SA 2VFIA 3AIWA 1Z44A 1UJQA 4HPJA 1WDDA 1GOIA 4O19A 3TJIA 1VBGA 3KP0A 1F9CA 1WKDA 1XIBA 1UOZA 5FJUA 3OGRA 1YHTA 4ZB5A 4YTSA 4X61A 4W7VA 1YNPA 1T8XA 4PULA 2ACRA 2R1LA 4I5RA 5FAJA 1WDQA 1ECQA 3KDOA 1MRAA 1ZJAA 4HOZA 3S5YA 4NILA 1KLYA 1K8XA 1S1PA 3QZAA 3GLCA 1M7XA 3GC5A 1WAUA 5JBFA 1H1YA 2Q71A 4LB3A 1TX2A 2DZBA 1E3ZA 4FMVA 2J9XA 2Q8ZA 1CXKA 3VE9A 4DJED 3KL3A 3V75A 1O66A 4GUGA 1SO4A 3QMTA 4J3ZA 3F2BA 2O7QA 2E28A 4MKSA 1ONRA 3K4AA 4V2XA 1NQKA 1TPEA 1M01A 4J3XA 4ROPA 2FPYA 2WKGA 3AHVA 4L6DA 5I3GA 2D69A 3GB6A 2YOCA 1G4EA 3NXFA 4V1YA 3WK3A 1VPXA 4WF7A 4OU1A 1TVPA 3C0JA 3IJLA 2ACSA 2PDGA 2PGFA 2GFTA 4BJHA 6ALDA 1ESWA 2CLKA 5JQ9A 2RDWA 1JCLA 3TUUA 3LV6A 1QTWA 1GEHA 4OVXA 3HPXA 2DEPA 4IIFA 1L6FA 3ATZA 5B7YA 2NX9A 2FGZA 4FNTA 1ZB5A 3T81A 3ARRA 2NZLA 2FTYA 4PBFA 5HDRA 2YA1A 3SAZA 1W54A 2DUZA 5DLCA 4G1NA 4JN6A 2AKZA 1V3HA 1HJVA 3GUGA 1I2PA 3U2CA 2VFGA 1SZRA 1A5CA 4Z2GA 1CB7B 2WC4A 1UP2A 1XDLA 3ALFA 1Q6OA 2ZRWA 3ARPA 4GQQA 3I10A 4UFLA 1HKKA 3R8RA 3W26A 1BXNA 1W1TA 4DWSA 2PGEA 5TD4A 1V7YA 4N4PA 2GJXB 2D2HA 5D2WA 1REQB 1PHWA 1AZ1A 3MMWA 4EXAA 3DFPA 3PAJA 5A94A 1UD5A 2O7SA 1LOLA 3VMPA 2EBNA 4DWSD 2ZX6A 4PCFA 1TFVA 2Z1KA 3S1UA 2V82A 4AH7A 3LLDA 2FPTA 3TOPA 7REQB 2OODA 1L9WA 1B54A 3OLEA 1VBHA 1ZNNA 4REQA 3CUJA 2YXXA 3SUUA 1V3KA 4O0ZA 2DP3A 2PF8A 4UMCA 3MKKA 3H7UA 2DQXA 3TC6A 3WFAA 3DYMA 4DJEA 1G4PA 3KLLA 1VLWA 4OBTA 3B9EA 1EPVA 2DZSA 4RDZA 4FR6A 5GNXA 4ACZA 3I6EA 2WSRA 3VKBA 2YZRA 3KEHA 4NY2A 2OB3A 4H83A 2X05A 2YDSA 1V02A 4LYRA 1YTEA 1VJIA 2CITA 3GVVA 4GX8A 1EUNA 3GAYA 3LI0A 1HVQA 1SO3A 3DYPA 2FMOA 4ACYA 1U22A 4I8YA 3LHTA 3GTHA 1KQZA 5T26A 1LLWA 4GE8A 4X2PA 5CPLA 3A23A 2TRSA 3JW7A 2GSJA 3TMQA 4AISA 3W83A 4P7RA 1K6AA 2CC0A 3VNJA 4B5SA 4IIGA 1O12A 3NFUA 5LA0A 1P1XA 1XLCA 4QAWA 2J25A 5A2BA 3KW3A 1XG3A 2QGHA 5E5CA 3JZEA 4DN1A 3B03A 3C2VA 3THQA 4DJFC 2CLHA 2FZBA 5BXPA 2D3NA 1AJ2A 5C9XA 1TJPA 4W8LA 3ISIX 4O54A 1E9ZB 4CQ9A 4PFHA 2GLKA 4Q8QA 4H9MA 2EO7A 1IXQA 4YCOA 1XLAA 4JQ1A 2EG6A 2YL6A 3SGZA 2V67A 4IJCA 3N9SA 1KGXA 3IIXA 3BZGA 3FY1A 4C5YA 4IQLA 1POKA 2ZUTA 1TMHA 3WLHA 3W27A 3NZ1A 4GY1A 1FXQA 2VX6A 4P61A 4WVXA 4LPCA 2IKGA 2WVUA 4NSBA 4DIAA 4O1CA 1S3TC 2XFRA 1GOXA 3GU9A 2WK2A 2IMRA 4OGZA 2G3JA 2OXNA 1R9ZA 2J8GA 4D72A 4S3CA 4S3BA 3TW6A 2FGLA 1VZWA 2VDGA 2GUUA 2VEKA 1SR9A 1LWIA 1GG1A 7CGTA 1UJPA 3GHTA 4P7QA 4F40A 4EX4A 3PC0A 5EA9A 1O5RA 4A35A 2G41A 3D3FA 3W1TA 3TW9A 2H3BA 3EOEA 1XSKA 4JNMA 3BL3A 5MHBA 3EDDA 4KETA 4PFMA 1GQNA 3R43A 2PU0A 3JR2A 2Z0IA 1WZMA 4FX6M 3WDHA 4C7FA 5A3HA 2DZAA 4X0VA 4HGXA 5E93A 2JF6A 2VZTA 1LQ0A 3DFYA 3F4WA 4YWIA 3I7RA 3R58A 1BEUA 3D46A 1M9HA 2I5IA 4UTFA 5CPTA 1TIMA 2TYSA 3NEVA 2G37A 2WVVB 4D8ZA 3KL5A 2RGLA 3CUZA 4XZHA 2FMNA 1A80A 2IQ0A 3N19B 1FRBA 4X60A 4RUBA 1UB3A 1XYLA 1LM1A 1EBGA 3GO2A 3W75A 1V0MA 1W17A 1MW0A 2QZRA 5HNTA 3DHUA 3M07A 4WGHA 2ACUA 1UR9A 1JUBA 1WAWA 4IOTA 2PSNA 4GVGA 4YN5A 2EG8A 4ZCWA 3TWBA 2YJQA 1ZSXA 3QQ0A 4ML4A 5A69A 3QR3A 3GKFA 2ZA2A 1P1MA 4IGNA 3QV7A 3LHVA 3LCIA 1XPGA 2OEJA 1QI3A 3QMSA 3LXCA 3BSHA 2J6VA 3QFWA 1ZJHA 1DOSA 1KXQA 1G01A 5DRCA 4AD4A 3DC8A 3VD4A 1C91A 2X41A 3MWCA 4OV4A 4OV9A 3CPGA 5CEWA 3CQ0A 5BROA 5H8UA 2QDDA 1XD0A 4IGSA 4NJIA 1DQWA 2XIOA 1HG3A 2NWSA 4U10A 2OSXA 1TPDA 3KFTA 4QFUA 1F2JA 2C19A 3M5VA 3WMSA 3S1WA 2P88A 5BCAA 4PMQA 4UCFA 2BHZA 2HVMA 2PPGA 4FIRA 1S39A 1GJUA 1L6YA 2PDMA 3U5UA 3GY1A 4JKMA 2Y8KA 4E38A 1P7TB 1DEDA 5H8PA 2WJFA 3VZYA 3UZ5A 2V3DA 2E09A 3GU2A 5JBDA 4UNKA 1XRTA 4LY8A 1W9VA 5GNYA 4B5TA 1O6IA 3N17A 1CI1A 3UR7A 4INFA 3EMQA 1XGZA 1BWKA 2J13A 4BS0A 4JQAA 3VMOA 2PLMA 3H55A 2WHJA 5F2IA 3RMJA 5FF2A 3GVRA 1UHVA 4JNYA 2BXZA 3N9KA 1YBQA 4O1DA 2DIJA 4ZSUA 2WAGA 4CEUC 4D8AA 1GZ1A 3C6CA 4NHVA 1OJXA 4KBXA 3NURA 4H2HA 4UBPC 2PDPA 3SCTA 1YEYA 3TONA 3NSMA 4OUEA 1JYNA 3KBVA 1EQCA 5CLWA 3WQEA 4KFNA 4G8TA 3TXVA 5AC4A 2E6DA 1PX4A 4ZTYA 2Z00A 1OX4A 3KUMA 3MUAA 1IIGA 3VOHA 2DZXA 4D1JA 3VINA 1CW2A 3KHDA 4P02B 4YXGA 3TAOA 1J79A 4FALA 1RD6A 4UTHA 3SO7A 3L4VA 5FSDC 4GI8A 4UB9A 4JTRA 4JTSA 4WEVX 2YLAA 1GVQA 3PTMA 3WLMA 3IWPA 5AYYA 1H1NA 1OB0A 3IVSA 4H8HA 1ZQ5A 4RZ4A 5I3JA 4GH1A 3DX5A 2Y7FA 1Q8JA 3PPGA 7ODCA 2EHHA 3F5JA 2P3EA 3OEXA 2J74A 1ITUA 3V0UA 1QFEA 4L6HA 2DVTA 4AZCA 1OVDA 3ITTA 2HCVA 1CZ1A 4KCWA 3MYOA 4KESA 3GHUA 3MC5A 3I3BA 3PUDA 3KOYA 1LRTA 1R3YA 1S5VA 3B8VA 3K4DA 4LY4A 4S39A 2DPEA 5KZ6A 1R3VA 4L61A 1EJUC 1MFUA 3HG4A 4GBDA 1YNYA 1EOKA 2CLIA 1CYGA 2WPBA 4EXBA 2O92A 1KFEA 4FIQA 4HOXA 5AYBA 4GWEA 4HVXA 3VE7A 4JHMA 2AGTA 2VGIA 1I2QA 3W7LA 4EE9A 4LEQA 2QJMA 1PX3A 2CHOA 3BW2A 2GGIA 5K3VA 4HYWA 5D8ZA 3W02A 1NF7A 2QDHA 2AQOA 5KITA 4D6CA 4U2ZA 1DWJM 3QKZA 3FLUA<