1LT7A

Oxidized homo sapiens betaine-homocysteine s-methyltransferase in complex with four sm(iii) ions
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
361
structure length
305
Chain Sequence
KGILERLNAGEIVIGDGGFVFALEKRGYHPEAVRQLHREFLRAGSNVMQTFTVNEAAADIARQVADEGDALVAGGVSQTPSYLSAKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMAIGPEGDLHGVPPGEAAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAAQLKAHLMSQPLAYHTPDANKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPRARARKEYWENLRIASGRPYNPSMSKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETAINE-HOMOCYSTEINE METHYLTRANSFERASE
publication title Betaine-homocysteine methyltransferase: zinc in a distorted barrel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 305
sequence length 361
chains with identical sequence B
ec nomenclature ec 2.1.1.5: Betaine--homocysteine S-methyltransferase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02574 S-methyl_trans Homocysteine S-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.330 Alpha Beta Alpha-Beta Barrel TIM Barrel Homocysteine-binding-like domain 1lt7A00
1Q8AA 3BOLA 1LT7A 1UMYA 1Q7QA 5DMNA 1LT8A 1Q7MA 4M3PA 4CCZA 5DMLA 1Q85A 1Q7ZA 1Q8JA 3BOFA 5DMMA
chains in the Genus database with same CATH superfamily
3THDA 3W07A 3NYZA 3TV8A 2F2KA 2ZX7A 5HATA 4QNEA 3W7DA 2NX9A 1JI2A 3O3RA 5AY7A 2J66A 1TPFA 4Q8OA 5C9ZA 3LQLA 4CEXC 1XYLA 1QK0A 1R47A 1UR0A 3BANA 4MNJA 4NL1A 2VCAA 2YDRA 4BQ5A 4HOXA 1XLCA 3BV4A 1VEOA 3RJYA 5I02A 1KV5A 2WCAA 2EO7A 1OEPA 4HPJA 1OFDA 5HQLA 1X7IA 1MFUA 2Q6ZA 4QP0A 3GXTA 1RQHA 1OT1A 4PCTA 1DJGA 4QS6A 4CNOA 3L23A 4HN8A 4GIRA 3CL7A 1ZNNA 1R38A 5AHIA 3ARQA 2ZXDA 4WHBA 5D05A 3VX0A 3DG6A 4PULA 2R1PA 4FX8A 3DFPA 4QS5A 1UZ1A 4F0KA 4DF1A 1KM5A 4JKKA 3BG9A 5I3KA 3EB2A 1XP3A 3ARTA 2Q3OA 1QHPA 3HG4A 3KFTA 2WMGA 1TWDA 3HG3A 3L4VA 3N4FA 1KFLA 1R8LA 4GNJA 2I9UA 4XAPA 1W1VA 4AMCA 3J7HA 1MFVA 2VR5A 2JGQA 4HYVA 3FJNA 1MI3A 1UR4A 2GVGA 1W91A 2OZTA 5HAOA 3CYJA 5I79A 3APGA 3ITYA 4D6DA 1GOIA 2BHUA 3BL3A 1XFBA 1QPOA 3B8VA 4X2PA 1ZTVA 1W5MA 1QR7A 4P8UA 1S2UA 2DSUA 3EKZA 3FYOA 4YHGA 4C6CA 1J6OA 3CUZA 4CD4A 3LNMA 2BSLA 3DHDA 2WAGA 5CZSA 3C2FA 1F3WA 1HP4A 2QHAA 3NCOA 3RO6A 1R3TA 1ZRQA 2BNJA 3N6HA 1Z3NA 4IMEA 1A3WA 4TR9A 4C1NB 4DVOA 4NJKA 1NM9A 1I60A 1A0EA 2OYMA 1PDYA 4ZBCA 1POJA 3WF0A 4FI4A 4ERAA 4EPDC 2VMFA 4KEVA 3W26A 1XXXA 1PV8A 4K37A 4ORIA 1DKWA 5IBXC 1XRSA 1NFPA 3VD7A 3DKJA 3KTSA 3LBCA 4BQ3A 3ENLA 3N34A 3UVAA 4ZMGA 3FA5A 3EA2A 1OYAA 5HULA 3KOFA 3I6TA 1QO2A 3H23A 3NL6A 1WBJA 1KRBC 2PBOA 3BUVA 1V3JA 4QQ3A 3CV7A 3KBNA 5A8PA 3IUHA 5HR6A 1EIBA 1GEQA 3TAOA 5CPTA 3VUPA 2Y6ZA 1XYZA 4ZQPA 1A3HA 1XIMA 2O9OA 3KHJA 2E67A 4DJED 3E5PA 2GVYA 4NILA 2W63A 3EWYA 4D8AA 3UWYA 3AU2A 1XPGA 2V5BA 1OF6A 1NFGA 3L2LA 4R88A 3F2DA 2DUXA 4V15A 1QHZA 2VDGA 4P8VA 1TREA 3CUIA 4ADUA 1W17A 2ZA1A 4ZR8A 1EUAA 1K6WA 1VRXA 2DVXA 1MSSA 2C0AA 3H21A 1XLEA 4O11A 2PE4A 1NFBA 1FWDC 3P74A 1HL9A 4AZ6A 1C3FA 4NAFA 1NSJA 4WKAA 1PIFA 3K2GA 4K3ZA 4QITA 3I6RA 1RHCA 4C6MA 2NQ5A 3UWVA 5GJPA 4EPBC 1R3RA 1B3YA 5AC4A 4XZNX 4LVFA 2Z25A 1J10A 1GT8A 3C0SA 5IRPA 3MP4A 5AYZA 3UCQA 2X41A 3PY2A 3FA3A 2YPIA 2V2HA 4JOMA 2V9DA 4LUSB 3T0CA 3FHAA 1DIOA 2FZ9A 1A53A 4YN5A 1I0BA 1U1JA 4WK9A 1CXFA 1XKYA 2YFOA 1E1EA 3T09A 2AMXA 3CUHA 1D8CA 4D1IA 4LQ1A 1UJQA 4KRTA 4ONVA 5C7VA 4K39A 1NF0A 1O5QA 4PUUA 3RLVA 1UR3M 1J2WA 1L6FA 3O63A 3N2XA 1QNPA 1NQKA 2HROA 2DZUA 4J7RA 1SJBA 2OSYA 3WLLA 2FHBA 1W31A 4JL2A 3PFRA 3VVGA 1DHKA 1QW7A 3FHQA 1HQTA 3W7EA 3EOLA 1EX5A 3WIJA 4M82A 2WBKA 1XIHA 1BGAA 2X2GA 4PH6A 3WJWA 1KGWA 5CC7A 4DI9A 1OX6A 1PKLA 4KH2A 3NO3A 1RPXA 1ICPA 3LENA 4H2HA 1GOWA 3MI2A 2P76A 5CAHA 2DSZA 1LUCA 1I9CB 3VAVA 2PDFA 7XIMA 2JKEA 3AIVA 1M41A 2Y5SA 4A6GA 1POKA 2Z6JA 1ZPTA 1O5KA 3P93A 3WN6A 1WXJA 3C3UA 2ISDA 3HGRA 3WQFA 1LQAA 1P48A 4LAKA 2PA6A 2X09A 3IIOA 3M0ZA 2XSAA 4Z1DA 5AVNA 3W6YA 4POCA 3QLLA 4A3YA 1W2PA 1EX1A 1UZ4A 5D2WA 4N7QA 1CT5A 3PULA 1UHVA 4C65A 3W1QA 3LOTA 5LIXX 3QGKC 2YZ5A 2PDLA 1PWLA 1E6PA 3OO2A 1F3XA 1X6UA 3R12A 3OGSA 3E2VA 4G7EA 4EAYA 3WKZA 2P3EA 3LHWA 1JULA 4O53A 3AWNA 5D33A 4QCEA 3SFWA 2J9YA 4AISA 1CW2A 4UTKA 1J0KA 4EWND 1Q4WA 4Y8EA 1TWSA 1PDZA 4GPNA 4AX7A 2V81A 1E0WA 4LF1A 3H53A 1AW5A 3V18A 2PWGA 5HUOA 1J0HA 3WH8A 3LPPA 1IEQA 1QBBA 5EBUA 3GNRA 1W3NA 5DBTA 5CBBA 2X16A 3FKKA 1QOPA 3TC6A 2E77A 4IPLA 2JE8A 3DBPA 4ZFCA 4LRSA 2J7EA 2QNEA 3CU2A 1XIJA 1PCWA 4LCQA 3S5OA 3BTNA 1VFHA 3UA3A 1RQBA 1RVKA 2XZ7A 5C2GA 5A5WA 5LGZA 2Z1BA 3L12A 2QCGA 1F7BA 5T9BG 3AZRA 4JFTA 5HWJA 4AQLA 4HZMA 4IP5A 1KM3A 4DJFC 3NDOA 1XYBA 3PM6A 3LTSA 1EF3A 1VJZA 5A8QA 3AHXA 3P81A 5ECUA 3O7UA 2VELA 1CLVA 5C55A 4AYSA 2D3NA 1H7OA 4IICA 1K4GA 3VMPA 3S6DA 2JF7A 2OPJA 3W7RA 1XW8A 1C8XA 3W4RA 4W5UA 1QAPA 2CLIA 4RDVA 2O0TA 5HBFA 1P7TA 1O95A 2RHGA 1QRQA 4HGXA 4P7OA 1BTCA 3FVMA 1E55A 5I6SA 3GXIA 4AXKA 3SZ8A 1IQ8A 1ZQ5A 3N17A 1O1HA 3ZT6A 3ABOA 4GLEA 2ZTKA 2VX7A 1V3LA 3K1DA 2E8YA 3CZ8A 3MUY1 4GVHA 1I2OA 3DGRA 2FH6A 2WWCA 5E70A 2W9MA 3NL5A 5C6MA 5HUPA 3SUWA 3LPOA 2BVTA 3GE7A 2QF7A 2OYKA 4O13A 5I3DA 2Z4GA 3NZRA 5CPMA 1PUDA 3N2OA 3PBUA 2WMJA 4DXXA 4WSKA 1R9YA 4GQ0A 2Y61A 3VILA 1JDEA 3QPEA 5A1AA 4W84A 4FLQA 4QFUA 2GSJA 1O4UA 3W2NA 1EP2A 3OA3A 3QVQA 3O0KA 3EB3A 1KB3A 4PUEA 4YL2A 3M0IA 2CZDA 2JALA 3VD4A 2VEFA 1OX4A 2DIKA 4IXXA 1LL6A 4K8EA 1A5OC 2GJNA 1UOKA 4A2RA 1JDDA 1HN1A 3GG8A 4B2DA 4HK7A 2DT1A 5CZKA 1KTNA 1GWJA 5BZAA 2NLIA 3T07A 1VBUA 3QZAA 3ARXA 1BAGA 4O19A 2YLLA 1E9YB 3GTFA 1GPFA 2ESCA 5LNRA 5IFPA 1VAHA 3MANA 1ZBWA 3IUDA 1WX0A 1WB0A 1K9DA 5DXXA 3TSDA 4O15A 3TROA 4WXYA 2DU2A 6REQB 3ABSA 4N6EA 1IZKA 3G8RA 4ORMA 4H04A 4R27A 1J18A 3BAXA 1UWAA 4TXEA 4RDYA 1EWEA 3RILA 4Q3MA 3PBGA 1MNZA 5I09A 1LT7A 1H4PA 5I77A 1B5TA 1KQYA 4QEEA 1REQB 3B8WA 2YL5A 3AIBA 4CU6A 4HNVA 3FYYA 1L8NA 2J9ZA 1R2TA 2O9PA 3IACA 3BG3A 3P2VA 4CVWA 4JN7A 3RX3A 2HXUA 3LLDA 1IT8A 1HL8A 3VZYA 3LBMA 2WJDA 2FB2A 3VE7A 3SGUA 3GW0A 1W9BM 1VFSA 2IQDA 4HCHA 1P43A 1OZQA 1W56A 1YYAA 1ECQA 4HHPA 1W6TA 4RR4A 1OSEA 1H62A 4AY8A 3CAVA 3BV7A 5CJNA 3GO2A 4O54A 1BYDA 4UR7A 1MYRA 4DF0A 5HXMA 3K8MA 2IQTA 1KLZA 4AD4A 1I8JA 1JG9A 3VM7A 1LLOA 3O1NA 3G6MA 1E3XA 2GDVA 4W86A 4DAFA 4LALA 1F4AA 2PZNA 1RCXB 1XYFA 3NWRA 4S3EA 1TPH1 5DRCA 1UZDA 3KWSA 4O1DA 4E2DA 1S46A 3IK4A 3BLDA 3GWQA 1EJUC 2P8BA 1UJPA 4CD7A 3UZXA 5G1TA 1FXPA 2WCGA 1XJBA 4GI6A 1KXHA 1C92A 3WFZA 3QV7A 1E70M 1GNXA 1EC9A 5BXRA 5BOOA 3W25A 3MSYA 1VLIA 2VQUA 3GRIA 4X63A 1WPCA 1UPPA 4IOTA 1VH7A 3NUKA 3MHUA 3NXFA 3S2NA 2VR4A 1KCXA 1PZ3A 1Q6QA 3QTPA 5D2YA 2PEVA 1E4LA 3TMLA 3TLLA 3APTA 4NAFB 1J5SA 1NWRA 4DBWA 3W1UA 1C29A 2YW3A 1VFLA 1F4HA 4JDBA 5F4SA 1US0A 3C4UA 4UIOA 1XKJA 1B3OA 3BZJA 4YTUA 4HJWA 1JUBA 4FSAA 4NG3A 4U28A 3WLQA 1PX8A 4O1BA 2PDKA 2CBVA 4F9JA 5AYIA 1HIZA 3FV9A 4JCLA 1Q5MA 3LB0A 4ZXLA 3KVJA 3IEBA 3GR8A 2VEMA 1L6YA 3T8QA 2YKKA 2VX5A 3TW9A 2D1ZA 3W22A 3WJSA 2RDTA 4TX6A 1QNSA 1DJHA 3IVUA 2H90A 1ONEA 2HNEA 4OOZA 2EPHA 5EU9A 1MEHA 3W7OA 4DJFD 1UUOA 1G7VA 2OGJA 4PRWA 1V4YA 2RDUA 4QDWA 1W1PA 3AJ7A 1QWKA 3L21A 1RPKA 3T4WA 4HD5A 3HO8A 4NAEB 3SRKA 1FWHC 4LYQA 2CLPA 3UJEA 4IQLA 1AH3A 4FK9A 3TNOA 5DX7A 3WNOA 2G3FA 4Q8TA 3QV8A 1FTXA 2W61A 4DUWA 3EX3A 1W3KA 1V3IA 2HPMA 1XC6A 3BOFA 2YCEA 3VIHA 4UQ9A 1OFQA 2PWHA 3W37A 2WM0A 3R0DA 3WQCA 5DXYA 3I10A 3LU2A 4GOAA 3ZWSA 1R85A 3T1GA 3C61A 1LUCB 1M7OA 3W0KA 4FNTA 4XZWA 3LHUA 1GYMA 2HV5A 5AC5A 1CXKA 1U5JA 2DZPA 1UA7A 1DXEA 1H09A 1XV8A 4FNPA 3RDKA 3NL2A 1SFLA 3RRAA 3PZGA 3TOYA 3CHVA 1FWWA 2IXUA 1DWHM 1H5YA 3GH4A 5PTDA 1YHTA 1UP0A 5BROA 2YJQA 1P4CA 2OLHA 3EGJA 1F07A 3BJSA 3VC5A 1VB9A 3AXKA 1ZENA 1EEXA 5BRBA 3EOOA 4X0VA 4CU7A 3DDMA 1CI1A 2EJAA 3AIUA 1W3IA 3JZEA 5CZ0A 3WJYA 1BQCA 7CGTA 1HO1A 4KEZA 4HMNA 4XUYA 2CESA 4E8DA 1LL7A 2OFJA 2ATSA 4AWSA 5I3GA 4PCFA 4PUNA 1J2BA 4WJEA 2QQ6A 4L4MA 4F48A 2OR2A 4AD2A 3NO1A 1NDYA 3N73A 2PC4A 4PSPA 1GGOA 4S3CA 3RR1A 3TYCA 4HOWA 2PC8A 3NPWA 4FHAA 1Z6KA 1LQ0A 3TNBA 3LRLA 1RP8A 4AXNA 4ZOAA 4L80A 4JIIX 5TD4A 2GDQA 3EX6A 1XRFA 3TYEA 1NDWA 2WJEA 3PJTA 4LCSA 4RW3A 2V82A 4DI8A 1EZ2A 2YOCA 4LH8A 2XM1A 1R30A 1F6YA 5XINA 4DJDC 1MZHA 4ML4A 3P84A 4Z2IA 3SCRA 2PPGA 2YFNA 1RBOB 4UOQA 3EEZA 2C1IA 1M9HA 4ZSTA 1RD5A 4E4PA 3EBVA 3M44A 2ZUTA 1I2QA 3NQEA 1AFSA 3VKKA 3DYPA 3MUZ1 3TYAA 1TJPA 1A5UA 5LNWA 5A6BD 1P0EA 1EGVA 2WJFA 3KHDA 5BXSA 2C1HA 2ZA3A 3XIMA 1FVPA 1ZJBA 3E5BA 2W27A 3TC3A 4MY1A 3PTDA 4BK9A 1P7TB 4WIWA 4HA3A 1Q7QA 3K8KA 4ATWA 2IKJA 3CAKA 4UQDA 3GNNA 2E09A 3FW6A 4IISA 3T0DA 4PTXA 1KCLA 4WR3A 3B0VC 4EVZA 1J01A 2WQPA 1AH4A 3LHTA 3WQ5A 3WD0A 3NM1A 3QGAC 2J9XA 3F4CA 1TR1A 4HP5A 3Q37A 4B9YA 8RUCA 3D3FA 3T2OA 3USBA 3ITGA 1B0IA 1UOZA 2HISA 3RM9A 2YB4A 1GOXA 3MUAA 1GKPA 2RAGA 3N6JA 4XZMX 5LNSA 3UR2A 2W4XA 1Y7VA 2QIIA 4WSJA 2OOGA 4JICA 1UKQA 3CQHA 3VGDA 5JUVA 5KSWA 4DF2A 3S3GA 5IFTA 2VYOA 1ECEA 4E2OA 3WH9A 4DWSA 4YVPA 5C9RA 1RY8A 4JTCA 4MB1A 2INEA 4H6RA 4LPCA 3WLJA 5B80A 3A21A 3KP1A 1CNVA 3QV6A 1OYBA 1HJWA 4KRZA 4HJFA 4ICNA 2XVPA 4EF9A 3SRFA 2Y7DA 1DJNA 1E5JA 1YDOA 3W7GA 3IK2A 2Q71A 3QKEA 4WDTA 1GCYA 3CBWA 4DM1A 3DERA 4MZYA 3CH0A 2PF8A 5K2ZA 1RSCA 2TPSA 4LWWA 3CPRA 3FDGA 1M68A 4FXSA 2G3MA 3D46A 1DJYA 4MJ4A 1DE5A 1YPIA 1J96A 5H8MA 1LL4A 4BS0A 1E0VA 3OOQA 3FEMA 4LOCA 1N8IA 3T42A 3KS6A 1WDDA 2GL5A 1E0XA 4AFYA 4KCUA 3GK0A 3QV9A 1CDGA 2YXOA 3OTRA 4AIOA 4JGDA 2F9RA 3MVIA 3P80A 1A5MC 3LCIA 1XBZA 1W3JA 3W76A 3LQGA 5I3IA 1AW1A 2Z00A 1TPUA 3WELA 4U10A 2WSYA 1ZS2A 4WRHA 4HT3A 1Q6CA 1PS9A 3GDTA 1KWKA 4MF4A 3C5QA 2IKHA 1OABA 4RZ6A 2QUVA 4J5NA 2CU0A 2NQ9A 4DUXA 2X1IA 3DUGA 3H2CA 2GUBA 3RMJA 1SSDA 4S2CA 1V93A 2FVMA 4HNUA 4OHQA 4F2TA 5C70A 1L2UA 3U6WA 3HB9A 3WX7A 1TVLA 3G5EA 2NUXA 2R82A 3MKKA 2MANA 4PB5A 3PZOA 2VD8A 1UC4A 4GI4A 4EAMA 1GHRA 3PJUA 3ARVA 1M01A 3ECQA 4GX8A 3A4AA 3T78A 3BMXA 2FTWA 4XISA 2DH3A 4L9YA 2XN0A 1G4PA 3PANA 1VFUA 3W53A 2Z1KA 3DN5A 3RM8A 1TV2A 2DQWA 3GZ3A 1MXDA 5CH9A 2HMCA 2XIQA 3H26A 5JQ9A 3A6OA 5HMFA 1W3HA 2VEPA 3LZ5A 3VZXA 4M6VA 3RLUA 3B9NA 5LA0A 1V7AA 3WEOA 1O12A 1OCBA 1F05A 1H7WA 2HSAA 4DNHA 3RX2A 1YPXA 2GOKA 2P3ZA 4W4QA 2OWCA 5AC7A 3HG5A 3WDJA 1OG0A 2QJNA 5A6KA 3WMBA 3LPGA 4I5XA 3U3HA 3VDGA 4U33A 3O6AA 4G8TA 4FLSA 1S3TC 5DCBA 3TTQA 1WUFA 3NAVA 3SUVA 3E0LA 1CGXA 4A3QA 3VDAA 4H41A 2R1KA 4QSFA 5C54A 4IUOA 3RITA 3SCPA 2PRHA 2HVOA 3AFBA 5EFDA 4NZFA 1OIMA 4DJDD 3CV1A 4GY7A 1GKQA 4FX7A 3KS5A 3LZ3A 1IZJA 5TNVA 4LCRA 3E2SA 3LK6A 1VC4A 3B3DA 4PRRA 1TE6A 2Y7GA 3DHFA 2ZXQA 1XDJA 4J3XA 3UGVA 2ISWA 5C71A 4BQ2A 3VIKA 3LI0A 5C9UA 2ISSA 4JS3A 4JTLA 3N2BA 4CCDA 2EKGA 4JQ2A 3QTGA 3THCA 3RU6A 3UYCA 1UPMB 4XZLX 1DJXA 2INZA 1H7RA 1YBQB 1LOLA 1R9ZA 5FF7A 1KCKA 3SN4A 3GHSA 1B1YA 1E6ZA 4DQWA 1TJRA 3WZ0E 3IVSA 4IJRA 3OGVA 4GD0A 3WF1A 4Q4PA 4I9AA 3QQ0A 3C8NA 3ZT7A 1B9BA 1KBJA 3W7IA 3MCNA 2ADAA 2A5HA 1XLGA 2C6QA 1P1XA 1GVEA 3F03K 3CPUA 5I7GA 2PGRA 3BG5A 2VC6A 3B8TA 4DRSA 3DIPA 3KBMA 2WPBA 2WNZA 1DJIA 1N7KA 4NNCA 4PL1A 2VFEA 1OFPA 2CZ5A 2P5NA 3UNDA 3CK5A 1N55A 2I9EA 3ITXA 1NP2A 1BXCA 5A69A 2CZFA 4A3RA 4Z2HA 4FA3A 1Z41A 3IIPA 1SMDA 2E25A 3TYUA 4MPKA 1E6QM 4LTSA 1MQQA 2XPKA 4HN4A 3RFAA 2YCKX 3E0FA 1R2RA 4DBEA 3HJEA 3IJQA 3MJYA 1A5BA 3DH7A 2YCLA 1AQ0A 4RLIA 3LPFA 4S1FA 4M6QA 1EF2A 3SFKA 2OJPA 1EJTC 2O4QA 2TMDA 1ELSA 1KM1A 3GKAA 3WNKA 1VYRA 2B7OA 1SW3A 5CBJA 3A23A 3ANYA 4C6EA 3B0PA 1U2YA 4ZODA 1LLWA 4JX4A 3UZJA 3LEPA 1V6WA 5K3VA 2GVEA 3MV11 1QPRA 4HZ7A 3HURA 2IS7A 4W8AA 4PBEA 3BC9A 1T8XA 1ADSA 3SCWA 5GJNA 1GORA 1CGVA 4HMDA 5D4YA 3VNZA 1PKNA 4WUIA 3KOWA 2QUUA 5KITA 3EXTA 4H8UA 4WQ6A 3EEGA 4R3UA 2QUNA 3PPGA 2HCVA 4TV5A 4W7WA 4AD0A 4HNTA 1XM3A 3VUSA 3TN5A 1NDZA 4O14A 1XF0A 3DOPA 3TN3A 2EQDA 4I5UA 3A24A 2PU1A 1Q85A 2VFGA 4A21A 1ZP4A 3BLPX 5GNZA 2OMAA 2HBVA 6ALDA 4KWVA 2WZHA 1ODUA 1DL3A 1PO9A 3LHYA 4FXJA 4W8BA 2UZ9A 4U3CA 1FWCC 4XBSA 2G4FA 1M04A 1XLAA 3H2EA 5EMMA 1KCZA 1SO4A 3E12A 1FWBC 1WP6A 4IIGA 1FQ0A 4O1FA 3PTQA 1UROA 2VGIA 5D9MA 4GG9A 5REQA 2YW4A 4DX3A 5DLCA 1W1IE 2BOGX 4HK5A 1D9EA 4UQAA 3MBFA 2E5DA 5HJLA 2Q01A 1ZBKA 3HF3A 1XBXA 4W8LA 3BPWA 4O28A 3K1GA 3NQGA 1UKOA 4EF8A 2FIQA 4GC4A 8CGTA 1GOQA 1MRAA 4HNNA 1EHAA 4Y7EA 5F4XA 4UTHA 2CIPA 3HU7A 3W75A 2BTMA 4DWSB 3VD3A 3UWEA 1A4LA 4H9YA 5LXXA 1AK5A 4IH3A 4LSBA 4C6FA 4BJHA 3VOHA 3G1SA 2DT2A 3BSHA 1OC7A 3GC5A 1HZYA 3WJZA 3AOFA 5DBUA 4MWAB 3W02A 4O0ZA 1AMYA 3BW3A 2XH4A 5CXPA 5U7SA 2P1FA 2XVLA 3BGAA 1PTAA 1DTNA 3W84A 2A2IA 1VFOA 2RDWA 3CHDA 1QATA 6TIMA 2EG6A 4JIEA 3Q58A 3PWIA 1S2CA 1ZL1A 2J7HA 2WMHA 3TTOA 4PMXA 5F2GA 2JKPA 4D2JA 4MB5A 4WD0A 3GAYA 4GCAA 2VFFA 4O8RA 1KBKA 2DJXA 5A8GA 4PFMA 4QE4A 1OINA 2CZVA 2OZ3A 4C90A 3WEZA 1XG3A 3ES8A 1GZJA 2JQXA 5BMWA 5DY2A 3GVGA 1QW8A 3PBYA 1WKYA 4UZUA 1RUSA 2H6RA 2PRLA 4C7GA 2QV4A 5EMJA 1LTDA 3M46A 3WLRA 3DHPA 1PL9A 1F74A 2ABAA 2YYUA 2D0GA 2JIWA 4KWSA 3AICA 1A80A 1JQVA 5AC6A 1S5VA 3ID7A 3R10A 1IWPA 1X8FA 2CLFA 3FOKA 1KRMA 2J7DA 1EDTA 3LCWA 4QJ1A 3MY9A 1ICSA 3IGSA 2ZUMA 3I3EA 5RUBA 2Z6IA 2CZEA 2QW5A 4WKHA 3U7VA 5E5CA 3BSMA 2D22A 2BDQA 1S3HA 4JIQA 2Q8XA 2G3IA 2Q3RA 5E09A 5FJRA 3GKFA 3URQA 2V5DA 5AFDA 1DWFM 2Z1SA 3SGGA 1HVXA 2ZADA 4WDUA 3NEVA 1DV7A 1J0JA 3RJXA 4NX5A 2CLLA 1EXPA 3FCPA 1QT1A 3B8UA 1JCNA 3UZZA 5FKYA 4GACA 3RGTA 3QW3A 5LNVA 1JCTA 1QPNA 1ADOA 3CV6A 5CCZA 3PBMA 2CLMA 3EAUA 3ZS4A 1I2PA 5F7UA 1A49A 4LVBA 4MDOA 3C0QA 4GKLA 4CN6A 1CGUA 3S4TA 4YLWA 1YXCA 2CHNA 3S1WA 1HJUA 3KUMA 4DEFA 3TU9A 1EQPA 3RRXA 3UQNA 1BSIA 2DIJA 5FSDC 4PB3A 2AGKA 1CCWB 5AHNA 2PURA 3AISA 2QEZA 5LIYX 4CCCA 3OVPA 1UD2A 2EHHA 3GTXA 1V6XA 3TCSA 1V02A 4LT9A 3W2LA 4R9XA 3T05A 1W54A 4LUTA 2DDXA 1FWEC 4Z0JA 5TIMA 5JIWA 4HPGA 3EMZA 1HNYA 3VDCA 1O5RA 5D04C 2JK2A 2NX1A 1E5NA 1BEUA 1US2A 1HKIA 3V4BA 4OKDA 1HJVA 3ICJA 3TTYA 1SVDA 3WQ6A 4XZBA 4C5YA 1RCQA 1KD0A 4QX4A 3BAWA 1LZOA 1DOSA 4H7ZA 3SR7A 5T91A 1EH9A 1M3UA 2QCMA 3AS3A 4QE5A 2ODOA 2BHZA 3ZZ1A 4UQBA 4EKJA 4JTGA 3WBAA 3BICA 3W28A 4PZVA 4DELA 5EGRA 2VFIA 3EDEA 1YMYA 2C7FA 2DT3A 2G0WA 5BXTA 2EPOA 2OQYA 1EFZA 1TPC1 3I6EA 5DT5A 4LAOA 4LJ3A 3OBKA 5CJMA 3CUGA 2F6UA 3CQ0A 4BEQA 1C9WA 2ZUVA 3W2MA 3GDMA 4AVNA 2ZZ7A 1F76A 2FZDA 4LY8A 4JL1A 4M24A 1V7YA 2X05A 4FIRA 3VGGA 1CB7B 1VBJA 2YZRA 4LNYA 4DM2A 1G94A 1WO2A 4Y8FA 4BEUA 4DBUA 4ERGA 3DFQA 3QY6A 3LGGA 4XTIA 4OV9A 1DEDA 3W87A 4KWOA 4MNKA 2X40A 3LGEA 1KXVA 3THAA 2VWSA 2H3BA 1T0OA 4WLCA 4M3PA 3PWAA 2TYSA 2DZSA 4J28A 3GU9A 3W1TA 4ZE4A 3WYZA 2FKPA 5FOOA 3ZLHA 3KOZA 3N04A 1F6PA 2D0FA 3ALGA 3RK8A 3IGXA 5FJTA 4H7VA 1MEWA 3W24A 4Q4RA 4HA4A 4MG4A 1FHVA 4ZEPA 3E1F1 1M03A 1Q66A 4QLLA 5T9CE 5LA2A 2PDGA 2YCLB 4NKCA 2FJKA 3NZGA 2ACUA 2ZZ3A 3SCQA 4GH3A 1SFSA 2WK2A 2VVSA 2CKSA 2H3DA 1L0PA 1QMLA 3SN1A 3U2EA 3CZEA 3HFTA 5IOBA 3RLGA 2GQ9A 4D6FA 1XUUA 1UIOA 1HF6A 1EPXA 3W1RA 3ZJ8A 1ME8A 1V0MA 1XYAA 1JYNA 5M17A 3MMDA 1W9XA 4IF2A 4JCMA 2FTYA 2XFYA 2XFRA 2EKCA 4J3VA 4ZA0A 1H60A 5E93A 2VUNA 2XIMA 1BKSA 3NQAA 1K8ZA 2C71A 3ZVIA 2QJHA 1R87A 1QWGA 3WH7A 3UZWA 5KZDA 3M41A 4H8NA 5D2VA 1Z89A 2Y85A 2EPNA 3VGFA 5I03A 2EBNA 4FR6A 3W00A 1CTNA 4DB7A 1BD0A 1D7FA 3ELFA 4FB7A 1JYVA 1LBLA 1XICA 1RAKA 1YNPA 4XWUA 3S5YA 2DZBA 2PDYA 4GGBA 3W1NA 3W7HA 4HB7A 3OODA 1WKEA 1GEHA 3YPIA 1RVGA 3BOLA 4CQ9A 3N3TA 4AY7A 1BG9A 3PJXA 2XIIA 2J47A 4GYJA 2ZYFA 1VFFA 3AS2A 3SSJA 5J04A 4EXAA 2YBUA 4WOQA 4IGSA 4RKAA 4LS0A 1KO0A 5BWFA 1S2AA 3T2PA 1E1FA 5REQB 1UB3A 5M1TA 3OA5A 2R1NA 4AW7A 1FH7A 4IIEA 4C6KA 1GKRA 1IEWA 3RU8X 2QR6A 3ARZA 3L7RA 3G18A 3BGJA 3M5VA 4ZOBA 1OCJA 4CN1A 1FDZA 4FIQA 3KL3A 4XSLA 1HKMA 1KM0A 1PIIA 4NY2A 4O8AA 3H2OA 1E1CB 4BKNA 2ISFA 3IIVA 2Y2WA 1EO7A 3TA9A 1T6MA 4HSNA 3RPTA 4JD4A 3GDRA 3LCFA 3LGDA 3M0JA 4H9UA 1TTPA 3VNDA 1WZAA 2NZLA 2BVDA 1VHCA 4XKYA 1TO3A 4NT0A 1RJRA 3PK7A 3W70A 4MLJA 1BWKA 4AZ5A 4UFHA 1W37A 3HM7A 1BRLA 3CEUA 4MUPA 7TIMA 4K38A 3CLMA 1TE1A 3QZ6A 2RJGA 3F4VA 5CEWA 1UH2A 2WC7A 4UMAA 4ENLA 4UTTA 3R8HA 3PZTA 2R8WA 2WKGA 1EKOA 4H4IA 3KRZA 3NVTA 4ZGYA 2OEJA 1K9TA 1YLVA 3JW7A 5EMKA 4ZQOA 2HVMA 3RF9A 2BS9A 3CWOX 3HPFA 1GJUA 3EWBX 3B04A 1EWDA 2HQAA 3DGBA 4LFYA 4FOJA 1Q6RA 2WLYA 2C13A 3LX9A 3MP5A 2E9LA 1E56A 2O92A 4OQVA 5AECA 3NSNA 1OCNA 2ZZ4A 4B9ZA 2X2YA 3NYDA 1ZBCA 4O4VA 5CC3A 1YADA 2XVKA 3OIHA 1XIIA 3OU8A 3BAYA 3HOJA 1TV8A 2O56A 1JZ8A 4H8VA 3W86A 1KTCA 1CXHA 2QCNA 1UIPA 3SN0A 1W9UA 3QPYA 2B7PA 2P0OA 5LIWX 1HUVA 3LNPA 4WF7A 2GJXB 3CMGA 1F3EA 2IUZA 2PDHA 2D73A 1D3GA 5EFFA 1E6SM 2VZSA 3B40A 2XN2A 3BLOA 3L5LA 3ZR4A 2ALDA 3I3BA 5JBEA 1S5WA 3W72A 2BODX 3R43A 3VXGA 4MWAE 3FGCA 1R2SA 3ITVA 4M80A 5AKQA 2DPEA 4PMJA 5I06A 1BXBA 1RA0A 3ANVA 3DX5A 5AZ1A 3PSVA 2VXNA 4YTQA 1AL7A 3SJNA 1RD6A 5BU9A 4HYRA 4FXRA 3VIGA 2QJMA 4JIRA 1BVWA 3WD4A 1F5ZA 4KIEA 3CB3A 4RNJA 3EA3A 3WLIA 3W1LA 3SIZA 3STEA 1WKFA 1WA3A 3H2AA 2GJLA 2IPGA 4MVAA 2QJIA 1DJWA 3CC1A 3O15A 3EWDA 4OOUA 4XIMA 4S2BA 2VCBA 1XWYA 2J4GA 1ZSXA 4DO7A 4K1GA 3PFMA 5I2UA 3MQTA 1XHGA 5TF0A 2D2GA 1M6JA 3AZSA 3F5KA 3TQVA 5H8PA 4GXWA 3BLEA 4FNRA 3WK3A 3KDOA 2POTA 2NX3A 4P7QA 1WE5A 3PP7A 1MXGA 3VD9A 3IPWA 3OIXA 4RNIA 5H6HA 1PCKA 4CU8A 2NWRA 1QI3A 3EDDA 4F79A 5JU6A 1A5NC 3GXMA 3W82A 1XLBA 3P5YA 4LY4A 4JQ1A 4AX6A 2ZXBA 2BLEA 1WUEA 4QCFA 2PTWA 1LROA 2WVTA 2V5KA 7REQB 5IBXA 3U48A 4L4OA 4V27A 1OF8A 3ARSA 1KFJA 3SQSA 1L6SA 4TX9A 2GUYA 5G1YA 1E0TA 4OBRA 3SCNA 1EO5A 3CV2A 2BHYA 1E43A 1XDLA 3PF3A 3URNA 4ZTYA 2WSKA 1K8CA 3VNIA 2X1SA 3WL1A 3FEQA 4L61A 4K7YA 2W67A 1R0MA 3E38A 3NQ7A 1IWBA 4CD5A 4AC7C 2D24A 2V5CA 3F4NA 1NEYA 5F1VA 1GVRA 4BCEA 5H2ZA 3RM4A 2H9AA 2G37A 3U8GA 1F2JA 1WZKA 2AAMA 3LHVA 3WD2A 1F8IA 1AZ2A 4Q6XA 3HGOA 1N2VA 4H9TA 3VK5A 3SJ3A 3O0FA 4S3KA 5D38A 2GJRA 3TYBA 5LA1A 1RLDA 2IPFA 4L4LA 4H2CA 2FGBA 1FX6A 1MW2A 1WAUA 3FXYA 1ZFJA 3WQPA 2HS6A 4LANA 3KVKA 4E2VA 3KLLA 3D0CA 4IMFA 4OTKA 1Z69A 1UR1A 4Q8QA 3UWWA 3STGA 4L1GA 4XBKA 4REQA 1TJ1A 4TMCA 1EPVA 1U22A 2XJ7A 1M5WA 4HMEA 4HOZA 2WHJA 3KP0A 3O06A 2XHYA 2Z1XA 1WAWA 4NNBA 2OWXA 3NOYA 4ACYA 4HK6A 4XKMA 1H1ZA 4CQBA 2YCIX 3IGUA 4CCEA 3IJ7A 1ITUA 1VBGA 3MO7A 4IM4A 2QJJA 3FS2A 4M81A 4YPJA 2HTMA 2NQHA 1TJ2A 4UTMA 3BSGA 1XIGA 2SFPA 3PUOA 2WWDA 4H9MA 3VKBA 1NQ6A 2DZAA 4QAWA 1B90A 1LT8A 2IKGA 3DC8A 3EA1A 2WSRA 3AIRA 5M5DA 1TMLA 3I7SA 1UUMA 2WZIA 4FNQA 1FOBA 5A6SA 4JN6A 4AUBA 3EWZA 3M4HA 4CGTA 3ZXWA 1WZMA 4QR6A 4YJ5A 5A6LA 3C2RA 4RV3A 5FIPA 3EKLA 4MJZA 2KX9A 1NVMA 3GR4A 4O57A 4B5TA 4B3KA 1W5QA 2ZUWA 5I3JA 4JZ5A 1VCFA 1R3SA 4D8ZA 2X7VA 4MKSA 4RXGA 4XZHA 3AQUA 2OU4A 1Q7MA 1UUQA 4GJJA 4CLMA 4GFIA 1RCOB 3IJIA 1HO4A 1HKKA 1QBAA 1MMFA 1K02A 2GGGA 2ZRWA 1BYAA 1UMYA 5LIKX 2BV9A 2EJ1A 2QDDA 3G1XA 3F4WA 3W29A 4ZQNA 2PP1A 2J88A 3OLDA 4IHCA 1UC5A 3MTWA 3PZMA 2R24A 3E49A 4XVEA 3U0HA 4PRTA 3UYIA 4JTEA 2WSPA 5FAGA 5K9XA 3UG3A 3NVDA 3SUUA 1Y5XA 3SURA 3BWWA 2YR1A 2VOMA 4G56A 3W1XA 4E3TA 1AUSL 5G2IA 1DXIA 1PHQA 1L6GA 2AL2B 2V6AA 4PMVA 4ICMA 1DE6A 1P0BA 3VKJA 2QUMA 2ZRVA 4GUHA 1ODZA 3MB9A 1SJDA 4YXGA 3GUGA 2NXGA 1EIXA 4CVUA 3AI0A 3MUXA 3WDHA 1Y8BA 3VINA 2DJLA 3MBDA 2ZDSA 2OYLA 4LEQA 1SO5A 4GE8A 1YXDA 4KT2A 4Z1CA 4J1OA 1GVYA 3EKGA 4BF7A 2Q8LA 1GOKA 4MNMA 4D72A 1HTIA 1JCJA 4N42A 1Z9AA 4V2XA 1YDVA 4Y9OA 3THUA 1VS1A 4FOUA 2Z2BA 4RPPA 3AIEA 1MDRA 1M53A 4GYKA 3DU0A 4DO5A 1TJ0A 3LG3A 4DXVA 4RE4A 1FA2A 2I16A 4LS1A 4IPNB 4UNKA 4CQAA 2VZUA 3QOKA 1WXYA 2V3FA 5CPLA 5K4ZA 2WKJA 3VIPA 1K6AA 1W5NA 3W27A 4P8WA 4UTTC 3BQ5A 5A8NA 3NDYA 1MW0A 5MKGA 2XH7A 3V5OA 5I23A 1DIEA 5LYRA 3AJXA 4NRRA 1UBSA 1FWRA 2XVNA 4DJFA 2WHLA 4F9DA 2YX0A 4O1CA 4Q4QA 1D2KA 2DW7A 5FSEC 4J2PA 2F2HA 1W1A1 3TR9A 1CXLA 4AH7A 3E9AA 4O50A 1E9IA 3IV3A 4KKXA 2VI0A 3M6YA 2IXVA 2PRMA 1FFRA 1X8CA 3M9YA 4CQ8A 1XIDA 2AL1A 2RKXA 5JH2A 4L56A 1V3KA 4FO4A 1UKSA 2FHFA 2OELA 1KFWA 4N4QA 3H6OA 4O18A 1ZCCA 4HSOA 3WLSA 1VRDA 2WNWA 1G7UA 5FF4A 5BRPA 5ENLA 5ABEA 4Z17A 2ZX6A 2FPTA 3I4KA 4GQQA 1JRBA 4JN8A 1F9CA 2HEJA 4GCXA 2GGHA 4JTQA 4FOKA 3ERPA 1D3CA 4ACZA 4AZBA 2D2JA 2QCDA 3BW4A 1QNVA 3POHA 2VJXA 1IT7A 1H50A 3TAKA 4GY0A 2XSXA 3ZR5A 1P5BA 2F84A 1YDYA 3KL0A 3WD1A 1TWZA 4X3ZA 1EJWC 1TZZA 1XI3A 4L6OA 1KBIA 4GZ7A 3VGEA 3QSTA 3WQOA 3EMQA 3PZQA 5DMLA 5J8LA 4PBFA 1J4EA 1LG1A 1S2WA 3UZ5A 3QC0A 4XIAA 3FYPA 3THQA 4XZIA 2A3AA 1A0CA 1GJPA 4LNCA 3AS1A 2GVJA 2XFFA 4JPGA 1UD8A 5DCEA 4X22A 2A7NA 3OZPA 4WKFA 4MOZA 4PMQA 1WDPA 3KBWA 4PN2A 1SU5A 4YTRA 4NASA 3VFCA 2OKOA 4PB4A 1JEZA 2BGSA 3FGCB 1XD0A 1U1HA 5DELA 2O9TA 3MPGA 3K13A 3POCA 1W2VA 4KERA 4Z1AA 3HPZA 2BBFA 5GNXA 4EK7A 3MC5A 2OT0A 2HZGA 1K4HA 2B7NA 5HK4A 3HN3A 1GYNA 3NQ2A 2RH9A 3M0XA 4L7ZA 2ZFAA 1JD7A 5KZ6A 3W85A 1IE7C 1SZNA 5H91A 3SADA 3BK0A 3AUOA 3QC3A 2XSBA 1NDVA 3LMYA 3N2TA 2O7QA 4Z2LA 3REQA 5JBDA 1CYGA 2J79A 4MADA 4XAFA 3R4IA 3EXSA 4IP7A 3CWNA 1SZGA 1OFBA 4R5EA 3GD6A 5FEPA 5D30A 3L67A 3QMSA 2I7GA 3GQYA 2XN1A 3RMEA 5G2WA 4EANA 1XPYA 2HPIA 3VD5A 3CASA 4PCSA 4F2UA 3ONBA 3ME3A 4L64A 4FNUA 3IAQA 4RZBA 4JHMA 4GWEA 4DZAA 2WXDM 1TPB1 2J7BA 1XX1A 3NFUA 3P8IA 4ES4A 5A6BA 5D03A 5I3FA 2CEQA 1LF1A 3VCNA 3DCPA 3VC6A 1LRQA 3OHMB 4UWMA 4KCWA 1X1NA 5AYBA 4R7OA 3ZSTA 3IUIA 2OQLA 5CC6A 2Z1VA 3ZT5A 2R1MA 3ITTA 2IMRA 4LVAA 3KBVA 1JI1A 5FL0A 4I9JA 1V08A 2AMGA 5CGQA 1TCMA 3T0BA 3CYVA 3GTIA 3ARPA 4UCFA 4TTUA 2X0SA 3K5XA 3NSXA 1NWTA 4DZHA 3W88A 3JRKA 4I8DA 3VOCA 3S9ZA 1GVOA 2VC5A 1VLWA 1JUKA 1VYSX 3TJXA 1OJXA 1RR2A 3MCOA 2F7FA 4ZSUA 3HQNA 2H9AB 4CNNA 4GXMA 2BXYA 2OSXA 1JZ6A 4BR1A 1WQ5A 2QLYA 2DZWA 3CWHA 4CUCA 3C0JA 1GONA 4RJEA 5JIPA 3LCLA 3U5UA 1UP2A 1GJWA 3RPMA 3VCRA 3K4WA 3PSWA 2A4AA 1TV4A 3Q2DA 3C2VA 1SJAA 1BKHA 4F0SA 1KBLA 2YSWA 1HG3A 4IGMA 3PJWA 3B0XA 1AQFA 4JQ3A 1ZJIA 2GWGA 4HHHA 3P3BA 4FP1A 3WMSA 1S5TA 2H8XA 3EX1A 4REQB 3GNPA 3R13A 2VRJA 5IDIA 3ZFHA 2XDFA 2X1RA 1OBAA 2I1OA 3UESA 3V0SA 4UFKA 3WBWA 1V02E 2KAUC 3M1ZA 5D32A 4Q7BA 3ARYA 4ZXOA 3QXBA 4O4WA 3ZMRA 3RNDA 1QI4A 4V1YA 3VIIA 1SGJA 4UCGA 3CHEA 5KZMA 2E6AA 3TXZA 4XSMA 4CNTA 4UXDA 2VZTA 1U5VA 1AQHA 1V79A 1B3XA 1GW9A 1US3A 2E28A 4G2DA 3H12A 3QHOA 5HR7A 1FWNA 5BRQA 1X1ZA 1ESWA 3BCFA 3W2JA 3BCJA 3UPMA 3RIKA 3E6EA 4GUJA 3L66A 4J9JA 4X0NA 1W5OA 4LF2A 3TMQA 3WEMA 3DKLA 1WOBA 3MW7A 4N9EA 4P2VA 1UYQA 3FAWA 4G5DA 5F1UA 3G3DA 5C9WA 3L5MA 2FZMA 1B9ZA 3WD3A 1K3UA 5EB8A 3BMWA 3JU2A 1PVNA 1K9EA 2ZX5A 2QZRA 1RA5A 3Q4DA 4M6UA 4UMBA 1ME7A 1LYXA 1UWUA 3FSTA 4ADTA 1QI0A 1I0DA 1UCWA 1XRVA 3R0UA 5EL1A 3G1AA 2VC7A 5G5IA 5AC8A 4MFEA 3SECA 1H49A 3UXIA 3E96A 3TEVA 5IM51 3HPAA 2XYLA 3WH5A 2ALRA 3HTWA 5A2BA 4QJ5B 4KETA 2PLJA 4IQEA 2UY3A 5AOUA 3CHCA 5L6UA 3IS4A 3G3MA 3VCCA 4XD3A 4LVDA 5HNTA 5G4EA 1UD5A 3CLWA 1KW1A 1UWTA 1AODA 1A5SA 1TG7A 2VZOA 4WSHA 3IJ6A 1EDGA 3OP2A 1B3VA 1H1YA 3C0LA 3EDJA 2WW5A 1FXQA 3LTYA 1WKDA 2WBGA 3ARRA 1XBVA 5BMXA 3MJMA 3SCSA 2DY3A 4IXHA 2CITA 3WL0A 4OE7A 1EBGA 3L9CA 4JTRA 4ML9A 3M0KA 3NL3A 3H7VA 3WDRA 4BQ4A 2ZOXA 4LGXA 3SI9A 2C0HA 1OIFA 4L6DA 2EG7A 4MAVA 4FF5A 1VBRA 3G6LA 5HA7A 4MYAA 2NW0A 8XIAA 4ATDA 4TVDA 3M7SA 4XV0A 5AHLA 2GGEA 1CGYA 5JH1A 4YTTA 4WGHA 4U5KA 4DY1A 1TWWA 3GHRA 4ILSA 4ZZ9A 3PUDA 5ABTA 1A47A 4GQGA 3BLFA 2A7RA 3NA8A 1NELA 1ZJHA 1ZALA 4M56A 1UBPC 2Z28A 1MW3A 3PVFA 3H2NA 3BMVA 1KM2A 3NIYA 4DJDA 1IXOA 5DF0A 1J93A 1UQYA 2AQVA 2PWUA 3AMKA 3HV9A 2YIHA 2NVDA 1OFRA 3KW3A 4PFHA 3W81A 3B4UA 2IPWA 4JTJA 3T9PA 1KC7A 4QSHA 5LGXA 2ACQA 3SDOA 1LWJA 3KRSA 4UTIA 4D6GA 4LYKA 9CGTA 2I5IA 2QAPA 5EKYA 5AHFA 3H70A 1H0IA 4RE0A 4UTFA 3QHNA 1X7FA 4XAZA 1H2JA 2PTYA 1ISZA 3B0UX 1PEZA 3GDBA 1EP3A 4LRTA 1ISXA 3M5XA 1XIBA 3CPGA 4N9CA 1LQ2A 3DFYA 2PLMA 3AYSA 3LV5A 3VE9A 4AD5A 4GUFA 3GAKA 1DJZA 3ONCA 4PCPA 3VGBA 1W3LA 3IRDA 3HFYA 3NQ6A 3T40A 3KLKA 2Y1HA 1F73A 4KGJA 4KWWA 2OZ8A 4HNOA 5FF2A 4J4KA 4W93A 3G1DA 2JFEX 2Q8ZA 2WPGA 4IIHA 2WSQA 1KRCC 1PYFA 1W0MA 1W32A 3UD6A 2UY2A 2J7CA 3W7LA 5EMUA 3GYCA 2FLIA 4A8IA 3Q94A 4US5D 1X38A 4TQTA 3QQ1A 4ACZB 1EJRC 1AD4A 2QCDB 1EJVC 2Z7KA 4LUIA 2VFDA 3G8EA 4QTGA 2ZVRA 4JQ4A 1AD1A 4JQAA 3W1PA 2G8ZA 3AXMA 4XBJA 2Q09A 3IRSA 4R33A 1HX0A 4NQ1A 3WQ8A 4GIYA 1RXOB 3WLOA 4E0CA 3L2IA 2Z2UA 2QUTA 3OG3A 4DPQA 4XUGA 3TYDA 2ZZ6A 3CS2A 3G0XA 4Z2GA 4ZO7A 1N8WA 3KAOA 4I8YA 4OJYA 3PB2A 4GZJA 4OU1A 3M7WA 4F2BA 1WNOA 2XIJA 4AF0A 2V38A 2DSVA 2AKZA 2ZRZA 4IQJA 3L4TA 4A29A 3GBDA 4AY1A 1C90A 2JKAA 4W87A 3N29A 4S39A 2AOSA 1PAMA 1Q4NX 5AB3A 2FQIA 1JPIA 1EB3A 4KEUA 3UWZA 4KIRA 3DG3A 3EDFA 2ZUUA 2PGWA 4XAGA 1UA3A 2PUZA 3ABQA 3HMJG 4N2YA 1J0IA 3KEHA 1Q2RA 3S1GA 2Z27A 3IAPA 3KRBA 3GW3A 2GDUA 1OGGA 5TBOA 1Q65A 4NNAA 5AN7A 2PCEA 1DJQA 1H63A 1FHLA 3REQB 3WH6A 5FEZA 4MDPA 5CGMA 3R79A 4H8HA 4I9TA 1J6PA 3WMLA 1RBLA 1I6NA 4QG6A 2A3CA 3FLUA 1CGWA 2A0NA 6XIMA 5DT7A 1GQNA 1VF8A 4GJ1A 4M0XA 5FL1A 5FJPA 3N14A 1RK6A 2CERA 3N1AA 4GYPC 4AB4A 4CEUC 2A3EA 1QU4A 4IFRA 3S0CA 1JDFA 5J5DA 4A3HA 2XISA 1DYSA 4CCZA 2VFHA 4MZ8A 1DTUA 1G1YA 3UY7A 1YKWA 3GXFA 1YQ2A 1YRRA 2V3EA 4IL2A 3G0SA 5AYYA 3SRDA 1PE1A 1BFNA 3MT1A 5FF3A 5CZJA 3DHUA 1UR2A 4V28A 3CUXA 1YE6A 1SW7A 1XUZA 3AMCA 3VPLA 1ZY9A 3SAZA 4QDMA 1GG1A 3VIFA 1BPLB 3COTA 1JCLA 1R7OA 1VPYA 4MFDA 4PMZA 1QI2A 4PODA 4AC1X 1M1BA 3EPMA 2NVCA 1YXYA 3HG2A 4RZ5A 2HE5A 3R58A 4OBSA 4KS0A 4IMDA 1LBMA 4TO8A 4C6BA 3E74A 3LLFA 2ASHA 1BYCA 3R5EA 4WXZA 4J27A 3R6IA 2C3ZA 1XGZA 2FB3A 3R25A 2VQTA 3V1HA 3WK1A 1IEVA 3DBNA 5B7ZA 3NJ3A 4Q8WA 1MDLA 1JRCA 3S6OA 3S47A 5D9OA 3MWCA 1UH4A 1VPXA 4O52A 4F66A 2VVNA 2Z1WA 4AZCA 2INFA 2ISVA 2WZMA 3ZR6A 4GY1A 3T55A 1GW1A 2I57A 1XH1A 3U4FA 1LORA 4H19A 2ZKMX 1XINA 4B5UA 1Z32X 3VNJA 4MSSA 5E0CA 1Q8JA 3UFYA 3CT2A 5D9NA 1X96A 1TYGA 5HWMA 3WNMA 5HQEA 3TJLA 3B9OA 3RCMA 2QJGA 3VDBA 3MVTA 7ENLA 4AEFA 1JF5A 1OX5A 3GUWA 3O05A 1NIUA 2NUWA 3PZ9A 3ISIX 4JBRA 1O94A 2QCEA 3ORWA 4B91A 4Z1BA 3B8IA 2VR2A 3N25A 3KXQA 1GOMA 1WYIA 3JS3A 1QOQA 4GYFA 4X9SA 4KW2A 4M51A 2HNHA 4Z2JA 3A4XA 4C60A 3MS8A 3W7QA 5CC5A 3W7JA 3KOYA 1KM6A 4C7FA 3URAA 2EPMX 4Q4MA 2FPYA 4JX6A 4EPEC 3MWAA 2G5WA 4FZIA 2VZVA 3MSDA 3BOXA 1CWYA 4G7EB 4GKTA 1E4IA 4INFA 1EL3A 2Y89A 1VEMA 3ZYZA 4KF1A 1ZLPA 1E4NA 1V0NA 1XS2A 3BO9A 4BWLA 4PUDA 2OLAA 2WMFA 3QJAA 1P0DA 3LMZA 1ME9A 3NQVA 1JZ3A 1ITXA 3AXXA 1OM0A 1SFTA 1DBTA 3GLCA 3H4GA 3P60A 1CX9A 1TRDA 5HJYA 3W73A 4LV4A 1MQPA 2DH2A 4ZB2A 1VFTA 3WF3A 3ABRA 2CETA 2NSXA 1JZ4A 1Q8AA 1E9ZB 1VJIA 2VM8A 7TAAA 4AMAA 3L68A 4JTFA 1Q6GA 3C6CA 4DLFA 1HL2A 3WNNA 4TVUA 3B9AA 3QMTA 4WVXA 3SM0A 1G4SA 1EGMA 4M5PA 1XSKA 1XGDA 5EA9A 4XTDA 3SEPA 2NXHA 3AS0A 1MUMA 3I4EA 1Q2SA 1Y5WA 4IMGA 3W9ZA 4OIFA 3L2MA 3NNTA 4JR5A 2J7GA 4HHMA 2XM2A 1OWQA 1Q6FA 4GC3A 2Z7GA 2MUCA 1G01A 2BP1A 2PLKA 1TPWA 3CNYA 4AD1A 2IKIA 5A8MA 4ZQMA 4C6DA 4KBXA 2PU0A 3A5VA 3LYEA 3ITCA 4I6KA 3GH7A 1YW1A 4FS9A 2Y62A 3MO4A 1DVJA 2GK1A 1Q6EA 4I6VA 4Q8MA 1B2YA 4KCTA 3H55A 3L5AA 4A8RA 2HK0A 2J25A 3UXLA 2WOQA 3DC0A 3GZAA 3N9RA 4X61A 4CD8A 4O10A 4IWWA 3CO8A 3C86A 3CUJA 4B5SA 1ZP3A 2V63A 2RUSA 4O0QA 3UG5A 4BF5A 3CXOA 5KETA 7ODCA 4YVXA 2BVYA 3NGFA 1CGTA 2WNNA 3EPOA 3GIPA 4UQEA 3A47A 3H4WA 4O17A 3ALFA 3GNDA 3QGVA 3HBLA 2P10A 1MQRA 3OLEA 3INPA 2J78A 4C6NA 2PGEA 1V5XA 2WVSA 3GIQA 2D69A 7PTDA 1XLMA 2GQAA 1IEXA 4XD4A 3GDKA 1K7FA 2AAAA 2FFIA 4FXFA 3KRUA 3PBVA 2X8RA 1IIHA 3AWOA 3AYRA 3PBWA 2VGFA 3UF9A 1MXSA 3ZWTA 3R89A 1AQMA 5FA5A 1VENA 2WV8A 2WVVA 4R7WA 2CKRA 3Q45A 1RH9A 3I7RA 1XLJA 3P5ZA 5TQLA 4GA8A 3GHUA 1OX4B 4Y6GA 3GFXA 2VRKA 2OCZA 4TU1A 3V7PA 5HINA 2QYGA 3H8AA 4UNIA 1UKTA 3G77A 1UG6A 2ZXAA 1ONWA 1QUMA 1RJQA 3K30A 4EOUA 4DYEA 4Y9MA 3S2MA 3TQKA 2OSWA 3NTYA 4HKPA 5HJXA 3UP8A 4S23A 6REQA 1XL9A 5DEZA 1AVAA 3CT7A 3LA4A 3RX4A 3S46A 2F8QA 1KA9F 1BTMA 3LXCA 5F2IA 5BYWA 5HNNA 4GO8A 3KCLA 2PF0A 1REQA 1VEPA 4A8NA 1KGUA 3QY8A 1TCDA 2Y5JA 3TQ0A 1QDSA 3TSMA 3OVRA 3S2JA 3EOSA 1NF7A 5IDZA 2I17A 3FJ6A 3DFTA 4OECA 5LHFA 4ICCX 4KQNA 2X42A 1QHOA 4AYGA 1MW1A 2QKFA 4E6MA 2Z29A 3UXKA 3N12A 3PR2A 5K9CA 3GXDA 3XISA 3M0VA 4AF0B 2NLYA 3VO0A 1OT2A 3DECA 1JCXA 2PD5A 2Y8VA 2W91A 5KMYA 1KLYA 3V5CA 3WUGA 1H7NA 1FHDA 3OVGA 4I7VA 2Y7EA 3GNOA 4XB3A 3G1VA 4WX2A 4C91A 2PDQA 4L4PA 1ALDA 2E6FA 1AW2A 3CMFA 4M8UA 1RY0A 4IX0A 3ATYA 4N0RA 4YIWA 3DYMA 2QS8A 2Y0FA 4X9YA 2NQJA 1DWIM 4E2BA 1WDQA 3AZTA 3M43A 3VNMA 3KTCA 4BI5A 2BWGA 1UWRA 4LXFA 1WXZA 1NOWA 2QPXA 4NP7A 1K7EA 3EOUA 1FCVA 3F2CA 3L0KA 2WO5A 4GVGA 3MKVA 3OQEA 4GVFA 1GG0A 5FAJA 3SCVA 3LV6A 5IXEA 5D2XA 3OLIA 1JXJA 3F5JA 3TLQA 1IR2A 3CQJA 4NYUA 3CM4A 1OD0A 3CIVA 1ZB5A 3IJDA 4W5ZA 1GK8A 2Z0IA 3U4AA 3ATZA 4EPKA 5BWAA 4RZ4A 3CJPA 3OZYA 1YPFA 3R7MA 2YA0A 6CGTA 3N2MA 5K7JA 4UOZA 1KKRA 3P62A 3NSMA 2OGYA 4HNLA 4CD6A 2FDMA 1JPHA 3T6CA 4O1EA 3WDIA 1NJJA 1LRNA 1VIZA 3G22A 3FSUA 3GH5A 3GU2A 1TB3A 1IEIA 2WHKA 1A4MA 3VIMA 3KWXA 5C2XA 3VKCA 3DFSA 3EWXA 3NQ8A 1V0KA 4D6CA 5LZLA 1G6CA 1N8FA 1C8QA 1P1MA 4C5ZA 3V0TA 1WDWA 1RALA 2REQA 3ZLFA 3MUIA 3N13A 4QEHA 1H5VA 2O55A 2ZUSA 4C1LA 4RNFA 2C79A 4JKLA 4EP8C 3G1HA 1WV2A 5HWNA 2VURA 3K8LA 3W71A 2WNQA 3TCEA 1MUWA 2G95A 1GOOA 2ZC1A 3WUBA 3LS9A 4WOZA 1EHNA 1E4MM 1XLFA 2PDCA 1TA3A 3TC7A 2X0YA 5GPRA 3L4UA 4NAEA 1O5XA 2FMOA 4AHPA 3AO0A 3RXZA 3QZEA 1TZ9A 3B4YA 3IARA 4ROQA 2IQ0A 4Q6JA 3LHZA 4BA0A 5F4WA 1AMKA 3TYZA 2QVNA 1SW0A 2J7FA 1OYCA 4RXFA 2BY1A 4GO9A 2EG8A 1OGBA 3M0YA 2BVWA 4W85A 1R5YA 4FF7A 4XK2A 5I07A 4AZCB 1H51A 1ZBVA 2PS2A 1QNRA 1S1RA 3TN4A 3C2YA 2PBGA 3OZMA 3RYSA 1FP9A 2W3ZA 5G4WA 3KCJA 3DXIA 3W6LA 3VU2A 1V03A 4MAZA 2D23A 4Z1YA 3EX4A 4BWLC 2E5CA 4NF7A 2C19A 1X97A 3VIJA 5A6JA 4NSBA 3XINA 2WANA 2F6KA 4JYEA 1DORA 4KFOA 3OEXA 4QG8A 3U2CA 1BLIA 2IPJA 4IUGA 2XVGA 1F3TA 4TVCA 4P7LA 1PYMA 3W1MA 4Q8UA 2PTDA 3VGHA 4ZQRA 1PIGA 4X2RA 1B31A 3OVQA 3GG1A 4HCLA 3TW7A 2XGIA 4HCDA 2I5GA 4IG2A 3UWQA 4NZ3A 3BURA 1KRAC 3GG0A 1LP6A 2BGQA 2E1DA 3VI2A 2TSYA 2WZEA 1XQLA 2XG9A 2NV9A 3RUBL 5HDRA 1E6RA 5GJMA 1J9YA 1TQJA 2A6NA 1RP9A 2DUZA 1FFQA 1LOSA 2BZNA 2G4JA 5U4NA 3TE9A 4LVGA 4GINA 3UCDA 1VFMA 3T0AA 3HQOA 1XLKA 2X30A 3Q65A 4DAIA 2CLOA 4PTVA 4KESA 1S1PA 3CZGA 1VBHA 2XWDA 4P5UA 2C18A 4NZCA 1XFCA 5A6MA 4S3DA 1SSGA 2BOFX 3V36A 2AKMA 2QPSA 1JGMA 1CECA 1BWLA 3N4EA 4PGLA 4L9XA 4W89A 2GFTA 3G2GA 4J2MA 3O07A 4ECLA 1JR1A 2UBPC 1HVQA 3UA4A 3UT0A 1FUYA 4GIEA 3OYXA 5FEWA 1UMLA 9XIAA 9RUBA 2E9MA 3C52A 4ZTXA 2PWFA 4H7CA 3OG2A 4NIRA 4R34A 1OADA 1QW9A 3STCA 4GVIA 3GTHA 5D37A 1TV3A 1E0UA 1FY6A 2VC9A 3ES7A 4PTMA 1CEOA 2RGMA 4AHQA 3U2OA 5EPDA 4NZ5A 5D8ZA 1IXPA 2VP8A 1DIDA 2POZA 2RDXA 1PB0A 4Q22A 3IJ9A 1LLZA 4NX0A 3A64A 2BFGA 2ZBTA 1XIFA 5D2TA 1NP0A 2VDIA 4GBDA 3U2ZA 5CAKA 2Y7FA 1QI5A 3MP3A 4D6JA 2J77A 1SR0A 1I4NA 4BHYA 5XIAA 3QHMA 3B9DA 1UW9A 3BE7A 2I14A 4JTKA 2GK1B 2AGTA 4C7DA 1KKOA 2DT0A 3PAOA 4H00A 3CHFA 3AUJA 4JFUA 4RE2A 2ZUNA 2CYGA 4I9MA 4B5VA 1P0NA 4ZB0A 1FDYA 3WO8A 5J5RA 3P0WA 3GFYA 3S1XA 4UR9A 2VX4A 3PZNA 4WY0A 3VKAA 3T8LA 1R9XA 5FI8A 1BXNA 1T99A 4E3VA 3HZ3A 4UC5A 1TSIA 1DWAM 4L9ZA 3N4AA 3V35A 3W7CA 4J40A 1FWGC 4K8GA 3KVLA 5DMMA 2OX1A 3A9IA 1XC4A 2WQDA 2CXEA 1KFEA 1TVPA 4XVDA 1ISYA 4V1XA 1ZAHA 1UH3A 2XU2A 1C7TA 4LAMA 4NJIA 2HS8A 1NAL1 1TIMA 2F6XA 1A5AA 5BU6A 4H6QA 3TFXA 2DGAA 2WVVB 1BGGA 3BVJA 3AHYA 2XTKA 3ZLGA 1I45A 2MNRA 5K4XA 2YBTA 4NRSA 4PCNA 3TIMA 1YEYA 1TTIA 3TONA 1TELA 2PDIA 5E1QA 2YL6A 1TQXA 3DG7A 4HU3A 3S1VA 1XLDA 2EF9A 4F40A 3M0HA 4EE9A 2ATMA 3H54A 4B3LA 2CWNA 1GQJA 3D3AA 5D02A 3AHZA 2YA1A 4IIDA 1XDMA 2C8NA 1UD6A 5KTLA 2DSKA 2RJHA 1PKMA 1R3VA 3BH4A 1I2NA 4PUJA 2HDJA 1H1NA 1JCMP 3GR7A 2C1GA 2EPKX 3E3HA 2E4TA 3PUGA 1LDCA 3WLHA 3MSRA 3SY8A 4H01A 3W01A 4PMRA 1EZWA 2CHRA 1U1UA 4C1KA 3B0YA 1SR9A 3QYSA 3O16A 3B03A 3H7UA 4PA8A 4AZ7A 5MHBA 1G67A 3STFA 2NV1A 4PBGA 4A8LA 3QF0A 1U33A 1FRBA 4R7JA 1A5CA 4LB4A 3N9SA 5IHSA 3UU0A 1GYLA 1W8SA 2PB1A 4K7VA 4YMZA 4I5RA 4E4UA 5CGTA 3TXVA 5D9PA 3GTNA 3CZKA 1YNYA 4XD6A 1KXTA 1J79A 4PMNA 1OD8A 5CJ5A 4F3HA 4NI8A 3T81A 2NSOA 1NU5A 3CAQA 2A21A 2O7SA 5DRIA 1RLCL 2V3DA 3L4WA 3AMGA 5I3HA 3VOIA 4M1BA 4YWSA 1WDRA 1K9FA 9XIMA 5E9XA 1CBGA 4HQVA 4P7NA 3MSGA 1BSLA 4IFOA 4KFPA 3WY1A 1NH6A 5HPOA 3WLPA 4EACA 3FNDA 1EXBA 4NJJA 5KINA 1NY1A 4CN4A 2F38A 4UFIA 4A35A 4K2SA 4W88A 2TODA 1BQGA 1SFJA 1KFCA 3S5NA 4C6OA 3SY5A 1KR1A 2V69A 2PP3A 4D1JA 3H24A 1E15A 4O16A 3TDFA 1OVDA 1I1WA 4QIUA 5E0FA 3A9BA 2R1LA 2OZ0A 3EYPA 2PAJA 2E7FA 4YWIA 3FK4A 3U57A 2YXGA 1UWIA 6ENLA 1QNQA 3QH2A 3VTRA 4A05A 1PZ0A 2PDNA 5C5YA 1LG2A 5JXQA 4DXKA 3MMTA 4UTLA 2JEQA 4YVVA 1Q6DA 1SJCA 3DESA 3PPCA 2Y5EA 1GUVA 3UG4A 4BY3A 5A94A 4E5TA 3F4DA 2WMIA 4IZGA 1FCQA 4QXIA 1JAEA 2C14A 2REQB 4K1WA 3QY7A 1IYXA 3WLTA 5ABGA 3LBOA 2VNCA 1QASA 3AXIA 3H4XA 3A22A 4JXCA 3W6MA 3ANUA 1FBAA 3NZQA 1TA3B 4YNGA 4UNLA 1NWUA 3PTKA 3P6LA 4IP4A 1CZ1A 1D8WA 1A50A 1SYTA 1MO0A 3LXBA 1TV5A 4D6IA 5GQBA 4ZCWA 2ZX8A 4GQRA 1C7SA 3LI1A 3N19B 4UUIA 1W1YA 3S1UA 4C6QA 5HMSA 2YL9A 3N11A 2F61A 3O6YX 1OK4A 1YBQA 4RX0A 4L5ZA 3S9IA 1SUXA 3EX2A 4HPNA 2W79A 2GGIA 3DEQA 1U30A 2BX7A 1VD6A 2VO5A 3PNZA 2HVNA 3VX1A 3VMNA 4RNHA 3WENA 2HXTA 3GDLA 4LYPA 3UGRA 5AYXA 2CBUA 1XGEA 4AEOA 2PDMA 1MUCA 1YE4A 4OUIA 3P82A 4GNKB 3W83A 3EWCA 1OB0A 3GIYA 2FGZA 1J11A 1C91A 1UKPA 4YYCA 1VYPX 3OBEA 1L9WA 3L4YA 1W1ZA 4IG2B 2BY2A 3NDZA 4Q8NA 4WDXA 2G97A 3HQPA 1R3YA 5JVLA 3UEQA 4P8XA 5DMYA 3CQIA 4DYKA 1J0ZA 3GBEA 3W7MA 1JZ5A 2HRWA 3AYTA 2XH2A 4NZJA 1M7XA 4W7VA 2EXOA 3IWPA 4RDZA 2FZNA 4MHBA 3KZPA 4HTYA 2JF6A 4XZ9A 4HPHA 1K1DA 3KL5A 4K6AA 2QXWA 2CBJA 5L9FA 2VGBA 4JFWA 2G41A 3AHTA 3GM8A 4H6KA 2GUUA 1AJZA 1V6VA 3SQLA 1QO5A 3ABZA 3QBUA 1IR1A 2DV0A 1UWQA 3NG3A 4NYYA 5DO8A 4S3FA 3KCOA 3VKDA 1XQKA 1QNOA 4HTBA 2XFWA 1SM9A 3PHAA 1J8VA 3MMUA 3KOXA 3VZZA 4U5IA 1KNWA 3IJ8A 3FXGA 1W9VA 1JF6A 1ZCOA 3HIJA 3DZ1A 3LN3A 1XR2A 3E02A 5T8GA 5T26A 2BY3A 2XGBA 2D0HA 4IJCA 3WNPA 1K70A 1ONXA 4CQCA 2P88A 4NVTA 1ITCA 4NJGA 3EOEA 3TKFA 4DYJA 1VP5A 4GZEA 5FACA 1XD1A 1H61A 4BI7A 2P0IA 3JZUA 1JD9A 2D2OA 3N15A 5LSMA 1JGIA 3QLDA 4K68A 4GJIA 5G4HC 1V51A 3UW6A 1B54A 5LXEA 4DZ5A 5BOFA 3DFOA 1KTBA 2J75A 2ZDRA 2FDSA 3O9NA 5CG7A 1ZHAA 4IFKA 2QAFA 1ZJAA 1E40A 3NOEA 4A3UA 3W23A 3H2FA 4D6EA 3QMRA 3LLXA 2QGHA 3WBEA 4KRUA 2WMKA 1EBHA 3SY1A 4TV6A 3LXAA 4ALDA 3MKCA 3QR3A 3ZJKA 4EIVA 1QVBA 4WJXA 3RPDA 2DZTA 1C9DA 3P0XA 1SPQA 4J3SA 5ABHA 4AWEA 3GXNA 2NQLA 3NZ1A 2QGYA 4U4MA 2WZTA 2CFFA 4ATLA 3U9IA 3GVQA 1OZMA 3BAIA 3CGTA 4DO4A 4WY0B 4MJMA 1PZ2A 3DI1A 2YBVA 4JTHA 3KBJA 5FF0A 4XQ6A 2XIBA 1VZWA 4KFNA 2O4MA 4QAIA 3MU7A 5HANA 4ERIA 1AA1B 4US6A 4JTSA 2C16A 1V6YA 4Y9NA 2G3JA 5E6ZA 1LCOA 2WB5A 4LBUA 4QQUA 4RK8A 4L65A 3DENA 1I75A 2CPUA 3TQPA 5GVJA 3PG9A 2QDHA 2DVTA 4MWAA 2ZVIA 5A3HA 4M6PA 4X60A 3HQ1A 3BAKA 1JPMA 2QVHA 2CXGA 1LJYA 4QROA 2OVLA 2EEXA 3ARUA 1UR9A 2I5QA 3EWWA 5CPSA 4YU1A 3O6DA 4F4RA 1JL8A 2EGZA 4H9VA 1YNQA 2BB0A 2PZ0A 5EMLA 4GZIA 2R6OA 1XBYA 3W74A 1PXGA 2ACRA 4HZ6A 3SO7A 1DHPA 1B4EA 1NARA 2ZIDA 4XG1A 1ML1A 4UFLA 5CLTA 1QXLA 4JAWA 3UJRA 3VFLA 1NWSA 3R8RA 3LRKA 2J24A 5G1MA 2ZZ1A 4DO6A 1ZGDA 4GK8A 1LRTA 5C2CA 4F8XA 4Z2KA 3MV01 2ZQ0A 2HK1A 4Y2WA 4ZOEA 1S5NA 1YIXA 3APYA 3R1ZA 2PMQA 1GQKA 4QJ3B 5B7YA 2QT3A 3N6QA 3PWGA 2W92A 1SZRA 4XX6A 1XLHA 1VR6A 3VNLA 5M2FX 4B16A 2OODA 1EJ7L 1U5HA 3MI3A 2R91A 4AEEA 1Q3NA 1Q63A 1K8XA 3W7PA 1KGXA 2X7WA 4XD5A 3HJZA 3AROA 3MYPA 4RV8A 4AIEA 3TWBA 2GZXA 2G3NA 3UR7A 1YX1A 4S3BA 3AALA 1KR0A 3ZO9A 3WF2A 4YCPA 4JHOA 4GX9A 4MM1A 3GY1A 1T5AA 4GUIA 4JEJA 3S42A 4E8CA 3ZM8A 2QULA 1TIWA 1BF6A 4DNMA 1M65A 3F5LA 3RN6A 3EMCA 3TH6A 1CB2A 1G0CA 3N2CA 1GTHA 2DP3A 5AHMA 1XYCA 1H41A 1IHIA 1XISA 1Q6OA 4OGZA 3NO5A 4NXKA 1OK6A 2A1YA 4IGHA 2CLHA 3UJFA 4B4FA 2ZE3A 3PG8A 3MDUA 2XH0A 4Y9PA 1UASA 1GPWA 4GABA 3P67A 4MKNA 5CG0A 3AYVA 1E73M 4FAMA 1ISWA 1GQLA 5KEZA 4CNUA 4F0RA 1UD3A 2VD9A 4MTVA 5K9DA 2A3HA 4UTWA 4MIMA 3P8JA 5D09A 4ZB5A 2VL4A 4DZIA 1HKJA 1EYEA 3CUFA 1AH0A 5CPNA 3EZ4A 3IGHX 4DPPA 2CCRA 4ZVJA 1J5TA 1TV7A 2XIOA 2E6DA 3WLNA 4IPPA 1JYWA 1QCWA 4K8HA 1LWHA 1XG4A 4PUKA 1ICQA 2WMIB 2WM1A 1PTDA 3KM8A 2H8ZA 4O12A 3STPA 5A6TC 8XIMA 1E71M 4UB9A 3V3WA 3UNTA 4LUTB 2X1UA 3CZLA 7A3HA 3AHVA 4G7FA 1Y0EA 1FCBA 2FVLA 4DHGA 4LU0A 1GQIA 2W66A 3M64A 4H3DA 2WC4A 1AG1O 3MCMA 3OB8A 1CLKA 4E38A 6XIAA 2CWXA 3PPFA 2D2HA 1X39A 2NV2A 2HWGA 2AQOA 2XWEA 3CH9A 3SCUA 4LV9A 2P8CA 1C93A 3NURA 5DANA 3WG6A 1G69A 3JR2A 2ACSA 3WFAA 4Z0SA 1KBBA 4Q7IA 3A4WA 1V6TA 3EXRA 1V3HA 4AVFA 4FR1A 1A3XA 4M7SA 2Y88A 1JNEA 4RPQA 3B9EA 1VGAA 1VCGA 1P0KA 4JTIA 3HA1A 3I3DA 4N6FA 2Y8UA 3O8AA 4B2DD 2DVUA 1DP0A 3IIXA 4B3ZA 4FNSA 1JJKA 1IGSA 2WJZA 3T0TA 1JXKA 4UTJA 2V8ZA 4FALA 4US5A 2PI6A 4EXBA 1R86A 4DWDA 2J6VA 2HE8A 3UETA 3WSUA 4NZ1A 1PWMA 1ZZMA 1HFBA 3SSZA 3IJLA 1SO3A 1Z48A 2BOEX 3D5HA 1ZAJA 4ZQCA 2B0MA 2E40A 3SCTA 1I1XA 5I24A 3NQMA 1FWSA 2UWFA 2NXIA 2X1TA 1FP8A 3BW2A 3UR5A 4AZGA 2DEPA 4MMWA 2CNCA 1EDQA 4PTNA 2GLKA 4TX8A 3LERA 4IQDA 3M16A 3WQGA 3PAJA 1FCUA 2X0HA 3W2UA 2PTZA 4ZENA 4HVXA 1XSJA 4S3JA 6A3HA 1X1OA 2ZC8A 3C56A 4IX2A 4U31A 5CPQA 5AVHA 2OQHA 3NPXA 5FJIA 2PWVA 1V6UA 3BCDA 3PNUA 4ZO6A 5CSRA 3GG7A 5KZEA 3I65A 4LBRA 5I00A 2RFGA 3VM5A 1DIKA 3G1FA 4NZ4A 3L4XA 3PN8A 3QRHA 1TR9A 4W9TA 3GS6A 1YTEA 3W7KA 1SO6A 1G5AA 3WQVA 2GWNA 3G0UA 3QR0A 4N9BA 1TPEA 1WZLA 1TPVA 4LUJA 1PHWA 3FJ4A 2DZXA 5DMNA 2YLAA 1WOAA 2V2CA 3T44A 2L5HA 5BOEA 3NQFA 1KV8A 5A95A 1N82A 5BCAA 2OTDA 4UOJA 3BAJA 1MEIA 2YL8A 1GZGA 4JY8A 1EUNA 4AWUA 1XCXA 2NVAA 1IGWA 2PD9A 3D47A 1GTEA 5JBFA 4AZIA 3MZ2A 1UR8A 1ENUA 1BG4A 2GPTA 4XAYA 1ISVA 1DQXA 2HBXA 2C91A 3UJ2A 2VUYA 4JYDA 4L1XA 1IZCA 3PZUA 4IIFA 4B5XA 2NUYA 5DN1A 4IMAA 1Q13A 1FH9A 4JFVA 1ZAIA 1YTDA 3OW1A 5D8WA 3M0MA 3PC0A 4C6PA 1HGYA 3GYEA 3UBPC 2VOTA 4OVXA 4PUWA 1P6BA 1M7JA 2O9RA 1THFD 4GIAA 4TMBA 4IFKB 3JVAA 1W1TA 1K03A 1OGSA 1KFKA 3MDWA 1EP1A 4DWSC 5E6YA 4GBUA 4LUYA 4ROPA 5DFAA 4V33A 1OFAA 4CNSA 4UR8A 1Z42A 3B8DA 1HW6A 4NU7A 4Y9AA 4M29A 3TUUA 4PC8A 3U5YA 3M6DA 2VEIA 4MNLA 4BFAA 2OEMA 1GVIA 3C2EA 2J8GA 3FIGA 3GFZA 3LSBA 4MWAC 2V3GA 3RR4A 3TJIA 3FFSA 3LSCA 2FH8A 4I7WA 4DUVA 1I2RA 4WEVX 5C7HA 1TMHA 5HQMA 1E1CA 3HGSA 4GHRA 5LNUA 4LAUA 2PP0A 2W5FA 4AIBA 1SMAA 2A3BA 1G9HA 3MHFA 2DZVA 3TR2A 3ITLA 3ZQ9A 2VHLA 3CO4A 5CSSA 4N4PA 4HU4A 4LYRA 4YYFA 1XRTA 2GJPA 2CC0A 4QG9A 4Q4OA 4MYXA 3OGRA 3MUCA 3S5ZA 1NOUA 3K46A 2OG9A 1XIEA 4MUZA 1VHNA 1PPIA 3NPVA 4D9PA 2YDAA 3I7QA 4LEFA 3VOJA 3A12A 3DI0A 4AWTA 3K4AA 4FLOA 4XKYB 1M7PA 4QHRA 2IW0A 1BYBA 4PUMA 5SWUA 3KZSA 1HJSA 3KBSA 4QE1A 1BRLB 2DFAA 2ZZ5A 4NUWA 3UR8A 2B4GA 2QIWA 2Z26A 1B4KA 1P6CA 2FGLA 4GXPA 3S2CA 4JYFA 1UWSA 3V1PA 4QLKA 1GVFA 1NTHA 4YS1A 2Y24A 4ASTA 4QLJA 4R53A 3UERA 2ZWZA 2R14A 2G96A 5GNYA 1BF2A 1HJQA 4NJHA 1EOKA 3B05A 2ZRYA 3UY8A 1TRIA 4IMCA 2OB3A 4Q32A 3NR0A 1RZMA 1L8PA 4BZYA 3LUTA 3CQKA 2EAWA 4GUGA 1SQ7A 1HP5A 3FY1A 1UZHA 3R0KA 3H22A 3FJLA 4A22A 1S38A 2QF8A 3WDQA 4KMQA 2GJXA 3QN3A 1RJPA 4C6IA 3MHGA 4ZE5A 3LD5A 5LHEA 5CPOA 2E8ZA 1D3HA 1PJ9A 2W62A 4AIUA 3L0NA 4B5WA 1CXEA 4P61A 3TN6A 1KQZA 3LDVA 2GQ8A 1ITQA 2UY4A 1R6WA 4N02A 3A13A 1QK2A 2DQXA 4PSRA 1EJSC 1OQFA 3UJSA 3WJXA 1K7XA 1JZ7A 2V0TA 3SCOA 1S39A 1V8EA 5I0DA 3FDKA 1V3MA 1CENA 4GMEA 4UTWC 4DN1A 2E9BA 1XSIA 1RK5A 4E4FA 5HOSA 3TVAA 4GI9A 2FYMA 3GNXA 2R9RA 4YHEA 1JUEA 2Z24A 1DXFA 3NPUA 3WLMA 4Z08A 2ONEA 3RO8A 3QYQA 3LTPA 2VDHA 3V16A 1B57A 2CLKA 1LOQA 1LBFA 3HPSA 4WY0F 1TKKA 4LW7A 1H7PA 1E51A 1TTQA 2A7PA 2GYIA 3BJTA 3SUTA 4JNYA 1FHUA 2PDBA 2E0PA 5TAOA 3WBXA 4WGXA 3CTTA 3T7VA 3FA4A 4J35A 4Q8VA 4HMCA 3V5FA 5EYWA 2J74A 1T96A 4DBSA 1XCFA 1JVNA 4ZL1A 1H3GA 5EMYA 1B3ZA 2QV5A 2PDWA 3CEPA 2A3LA 2VENA 3VYLA 4UMCA 1G4TA 1TFVA 5DCDA 2ZZ2A 4S3GA 2J6XA 3VNYA 8A3HA 5CQ1A 1WDSA 3BXWA 3LCHA 2GSHA 1AZ1A 1ADDA 7REQA 1TX2A 4C6JA 4OFCA 2FTPA 5MF5A 1BHGA 4QGCA 4HU8A 3MYOA 3DAQA 4Q4KA 4LBSA 3UPWA 3G1RA 1XLIA 4H9ZA 1H11A 2XINA 3FVDA 3GVRA 3OBAA 3AIQA 3CL8A 1O6IA 4I7UA 2YA2A 1S5MA 2BXVA 1A5KC 4PL2A 3U7BA 3GSMA 4PTWA 1F6KA 4IIBA 1XLLA 2NT0A 4AHOA 2WKLA 3G1YA 4L6HA 2FHCA 3A4JA 1GVSA 1AL8A 2ANUA 4JTAA 2FJUB 4B4HA 2FFCA 2GOUA 3EB4A 5ABFA 4MJ2A 5CZTA 2XGZA 2E6YA 1ZU8A 3FAXA 4UTUA 2BASA 1TTJA 4K36A 2XUCA 3ZJ7A 1T40A 4LAZA 4GYPA 1X6NA 3W2KA 1X6LA 4NI3A 3USZA 3TZNA 1HT6A 1TUXA 1EA0A 2JIEA 4DWSD 2GVLA 3LY0A 4Q4SA 2PCQA 3GHTA 3NXLA 4MY8A 4DIAA 1VKFA 2VKZG 3V75A 1VQTA 1JPKA 4JFSA 3WDPP 3WUEA 4GRSA 3MZNA 2V68A 1W9DM 5AZ0A 3AIWA 1O7AA 1UP3A 2QCLA 4OBTA 2OKTA 4MWAD 3P7YA 4EXQA 2E5BA 2JGYA 1T41A 4OWGA 1OC6A 4B90A 4UFMA 4AG0A 3R8GA 1C8VA 3T4CA 1IWAA 1CIUA 2YYTA 1XH2A 4G1NA 2WYSA 3BARA 2NWSA 3M47A 2VT0A 4C6LA 2ZE0A 4R85A 2PSNA 4JTUA 3ZOAA 5CSYA 4NXSA 4H9XA 1JPDX 4DUOA 1SZFA 3TWAA 4AZHA 2V30A 3P61A 3G24A 1QPKA 4FX6M 3ZSSA 2DORA 3VNKA 3E2QA 1H0GA 3WK0A 5C9XA 3FX4A 4HSHA 3RHGA 1FWFC 5LIUX 3QFEA 3C8FA 4KPLA 3WF4A 1QOXA 1E9LA 5A6AA 1IT0A 3N3MA 1PBGA 1R7AA 2JBMA 2WVUA 5FJOA 2OO6A 1L2QA 4F0HA 1PSCA 4UFJA 4AU0A 4IPIA 3F2BA 3W1AA 1IIGA 3II1A 3D6NA 2J13A 3UWUA 1JDAA 3KDNA 2KZHA 1VPQA 3NGJA 1FKXA 4M1RA 2PDXA 3LRMA 1VJSA 2Y63A 3S5SA 2BG5A 4GGHA 2YDSA 3M5ZA 2VTFA 3UG8A 2ZTJA 1ONRA 3IIZA 3QEZA 2AL2A 4WCJA 4D6HA 2W0UA 1PKYA 5FJJA 1CLXA 3RAOA 3TJ4A 1SZEA 4JTDA 2HJPA 2V2DA 4XO6A 1OY0A 4M7TA 3KE0A 3NEHA 1TZ7A 3A5FA 1Y65A 4DJEA 5EBAA 2D20A 2CBIA 2QMJA 3OZOA 2E3ZA 4JNZA 3L0GA 1YTKA 1BVZA 3ZVHA 4TTGA 4Z42C 4A4AA 2J8TA 1IXNA 2BY0A 3ARWA 3OLGA 2FZ8A 5EY5A 2ABBA 2ZCGA 5F2MA 3TA6A 4TOQA 3C2OA 4U2ZA 4Y90A 3DFHA 4AD3A 1W9PA 4IPJA 1FWIC 4D71A 1TUFA 1JCYA 4J3UA 4JHZA 3ABXA 1U83A 6PTDA 2QDGA 2ZICA 1FKWA 3NZPA 1R3QA 2ZWYA 4RL3A 3TFCA 1CPUA 2QCCA 2YXXA 4W7UA 5E0KA 4M19A 4JKMA 1T8QA 2VRQA 1OFOA 1Q45A 3QOMA 4WZHA 4KWUA 3PUEA 3UZYA 1Q7ZA 5AHEA 3W7NA 2PDPA 2CLEA 3GXPA 5CLWA 3MA8A 4S3AA 2J27A 4MY9A 3M07A 2AQWA 4OZOA 2GGJA 5I5RA 5ECVA 2FMNA 3CIWA 2RGLA 2PWEA 3QSRA 5HNUA 4XO7A 1G4EA 3E0VA 4U3AA 4Q7NA 3UCCA 3B8SA 1W5PA 3WMCA 3VOGA 2VEKA 3R11A 5MKGB 4QJ4B 3VABA 5F2LA 1V77A 2CHOA 2VCCA 3WNLA 1Y5VA 3SIMA 3RG6A 1T7LA 1X98A 4QNWA 1P6WA 3NQCA 4IJBA 4HYWA 4BI6A 3R2GA 4J3WA 4GNVA 4QBXA 1GHSA 2J8FA 2A79A 3PS7A 1IXQA 3LM3A 2JEPA 1R46A 1JIBA 3WBYA 3L65A 4RE3A 4GFSA 2NT1A 3A3WA 4LC8A 5BW6A 3BJFA 4HPXA 1VIWA 4LX4A 3ZIZA 4F0LA 3CZJA 1JZ2A 3DYOA 3P14A 1JQXA 5FD0A 1JAKA 1IV8A 3K4DA 4I3GA 3QR1A 3BLIA 3S6TA 1EC7A 1UQZA 1PX4A 3I68A 3IVTA 4LS2A 2BXZA 3CTLA 4MKVA 1BWVA 4GI8A