1LT7A

Oxidized homo sapiens betaine-homocysteine s-methyltransferase in complex with four sm(iii) ions
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
361
structure length
305
Chain Sequence
KGILERLNAGEIVIGDGGFVFALEKRGYHPEAVRQLHREFLRAGSNVMQTFTVNEAAADIARQVADEGDALVAGGVSQTPSYLSAKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMAIGPEGDLHGVPPGEAAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAAQLKAHLMSQPLAYHTPDANKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPRARARKEYWENLRIASGRPYNPSMSKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords BETAINE-HOMOCYSTEINE METHYLTRANSFERASE
publication title Betaine-homocysteine methyltransferase: zinc in a distorted barrel.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 305
sequence length 361
chains with identical sequence B
ec nomenclature ec 2.1.1.5: Betaine--homocysteine S-methyltransferase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02574 S-methyl_trans Homocysteine S-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.330 Alpha Beta Alpha-Beta Barrel TIM Barrel Homocysteine-binding-like domain 1lt7A00
1Q7ZA 1UMYA 1LT8A 4CCZA 4M3PA 1LT7A 1Q8AA 1Q7MA 5DMNA 5DMLA 5DMMA 3BOLA 1Q8JA 3BOFA 1Q7QA 1Q85A
chains in the Genus database with same CATH superfamily
3GAKA 3F5KA 1PYMA 2E9BA 3CK5A 3AYRA 3BXWA 3WLPA 1FWTA 2B4GA 3WDHA 3GNNA 1N2VA 4LAKA 3H2MA 4GVIA 2G3IA 2ZZ5A 3P0WA 4I7UA 2OVLA 2WB5A 3RFAA 3BSHA 5CSYA 3WK3A 1H09A 4GIRA 3UY7A 3VD9A 2V3GA 1R2RA 1J0KA 1VQTA 3MWCA 5F4SA 3G22A 1JCXA 3MVTA 4GVHA 5JBDA 2IXUA 3HV9A 1TB3A 4G5DA 1UG6A 3GD6A 3W27A 1ZGDA 2WCAA 1EF2A 2VZVA 4JTIA 2CWNA 3M46A 1DTNA 2QVHA 3V5FA 3PPCA 2GQAA 2IMRA 4HU0A 2WLYA 1LM1A 1YADA 4EX4A 2J7FA 1OG0A 3G1HA 1B31A 1GEHA 2EG8A 3BJFA 5HPOA 2ALDA 3MI2A 4D71A 3W22A 1EA9C 3UCQA 5FF4A 4KFOA 1I8JA 5F1VA 2XM1A 2YBTA 4H8UA 1I60A 2R94A 4XD4A 3NQFA 3VMNA 2ZXAA 1BF2A 4IGMA 4HNOA 1VFTA 2D2JA 7ENLA 1N8WA 2QJMA 5I09A 4FLRA 3ITCA 2BY1A 3T07A 3VD7A 3AHVA 5DRIA 1GYLA 1OZMA 2EKGA 3ARSA 1YW1A 1W9DM 1KTNA 2O7SA 1X8FA 3UNTA 4U3AA 1V0KA 4O52A 4DNMA 4HNNA 2GOUA 3GC4A 3MUCA 1QI2A 2YL5A 5FF2A 3I6TA 1W1IE 2RDUA 2WCGA 3FDGA 3WMCA 2P88A 1H0GA 3THCA 3VFCA 2Q71A 4PMOA 4YTSA 2DT0A 3M0HA 4ZB0A 1RR2A 2FVKA 1JGMA 1TQJA 3ARVA 2B7QA 3SN4A 2VEMA 1U33A 3VNZA 5FCZA 4AIOA 5AB3A 3VMOA 1JPMA 2X09A 3THQA 3CTLA 2IPGA 1CWYA 1E43A 3TCSA 4UFJA 5A8GA 4L9ZA 3EWUA 1FWBC 4DJDA 3UESA 2O4MA 4M6VA 1EX1A 1J12A 7REQA 6REQB 1MDLA 1U1HA 3LGGA 3ISIX 4PFHA 3W7JA 2GSHA 2DUAA 1O60A 3MQTA 3LRKA 3KW3A 4QJ1A 3UERA 4IJCA 2V5CA 2RAGA 1QPRA 1TPC1 4Z1CA 1LLWA 3QGAC 4G6CA 3TTQA 2J8TA 3IARA 3KVJA 4PRTA 4CEUC 4MWAB 4LAUA 3G24A 3GQYA 1SJAA 3VIOA 1QASA 1JCTA 3W38A 4R33A 3DBPA 4N9DA 1PV8A 4JTRA 4LS1A 2GDUA 2VCBA 3SO7A 4IFOA 1IYXA 2CU0A 3KL0A 1OGGA 4L9XA 1VJIA 4RPPA 2OQHA 3BV7A 4IP7A 3EB4A 5DCDA 1A80A 4MYXA 3KCLA 3K1DA 2P50A 1OVDA 3CAKA 5GQBA 1FP8A 2V63A 3B0PA 3LX9A 3H4WA 4YTQA 1KFCA 4JNYA 5FJPA 4GABA 4TX6A 1XIEA 1ZJAA 4E6MA 1T7LA 1TR1A 3DGBA 1BQCA 3WF3A 4S3EA 1OG6A 2YR1A 3PAOA 2WMIA 4PCNA 1AUSL 4ZQPA 2WW5A 2BMBA 4AD4A 3S1XA 4XZHA 2FQIA 3G1DA 3VNKA 3Q67A 1D9EA 3PZIA 1RP9A 3UG8A 1V8EA 1FDYA 1KFJA 3H26A 4QNEA 1DHPA 1S46A 1RCQA 1ZBVA 4WY0F 1P0NA 4JX5A 4FXRA 1NFPA 1FWIC 1S38A 1S3HA 2Q8XA 3IAQA 1VEOA 4MLJA 1O1ZA 2V69A 4FS9A 2VFDA 4ML9A 1FBAA 4HHMA 1PKNA 3IS4A 4IH3A 2OU4A 3LPFA 2BHYA 2DZTA 4MUZA 3KOYA 5D37A 4L5ZA 3LBMA 2W91A 1VPYA 3TMLA 4QAWA 3RCNA 4Q4QA 5EGRA 1B30A 2J78A 3CHCA 3SUWA 1TUXA 2VCAA 1KLZA 4S38A 3ABQA 5IHRA 2J9YA 1Z32X 2H90A 2XN1A 2R82A 3AMKA 1TCMA 2B81A 2OB3A 4O13A 3I7SA 1VYPX 3O15A 4PCFA 4CCEA 4GQGA 1BKSA 4ERAA 4I9AA 4E8GA 3TLLA 1MFVA 3BOXA 5KINA 2OJPA 1K4GA 5J5DA 5B80A 3KBMA 4C6BA 4GI4A 4L1GA 4J2PA 2CBVA 1AW5A 3FHQA 1HKWA 1KD0A 2WNQA 4B3KA 3GVVA 2OYMA 2W27A 2Y7FA 4YNGA 2RUSA 2QCNA 4Y7EA 5E5CA 1DJZA 1VFHA 1M03A 5E0KA 5JUVA 3W1QA 1XXXA 3W71A 3EZ4A 3LSBA 3OIXA 3M7WA 4IL0A 2DW7A 4JFWA 3PBVA 1S5VA 4O1EA 3HMCA 4KRZA 5I2UA 2DGAA 2YJQA 1CGVA 1E5NA 4H9YA 4IMEA 3W75A 1SR9A 3TW6A 3BO9A 4E4PA 2FZ8A 3C2YA 1W5MA 4O0KA 2GVJA 1CEOA 1ICQA 2X16A 2QMKA 4ZVJA 1E4LA 1QBAA 4JN8A 5CPLA 3NR0A 3SQSA 2VXNA 1O95A 4JTLA 2WZHA 1BQGA 1F07A 3DKJA 2R6OA 5G2WA 3DGRA 1BF6A 2QUVA 4KEZA 5AC8A 3TCEA 3LCWA 1AH4A 3MY9A 4LS2A 1NTHA 2AL2A 1JUKA 1F7BA 4DXVA 3PB2A 1I2QA 3O07A 3ME3A 2A3EA 5A6LA 1LL6A 4XBSA 3E49A 4FR6A 2V30A 3NYZA 4E0CA 1LCOA 4MZ8A 4F9JA 2BDQA 3NSMA 3M5VA 2CLPA 5AOUA 3HTWA 3L4VA 4X63A 3RITA 3L9CA 3UP8A 1QNQA 3R2GA 3CPUA 3H4GA 3RAOA 2VI0A 1OBAA 4JTCA 1RLCL 2DIEA 2XHYA 4ZOBA 1E9YB 5DCEA 5J8LA 4A4AA 1CENA 5A3HA 2CETA 2WJFA 1AK5A 2GDQA 1JCMP 4KEMA 3OGRA 4DF2A 2WMGA 4NKCA 3C5QA 3QY6A 1VCFA 1XCWA 3TX9A 3O16A 2R9RA 1I1WA 2WLZA 5D2YA 2GK1B 4FMVA 4GUHA 2OEMA 1IT8A 1B5TA 1XV8A 2DORA 1RCXB 1JPDX 1KGUA 1B3XA 1JZ8A 3W6LA 3MKKA 1RSCA 4IFKB 2WBKA 2VDHA 5AHLA 2XU2A 1H3GA 3H7RA 1LL7A 3KOFA 4GHRA 4RK8A 3DERA 2QDDA 4JCLA 1E71M 4MJMA 1BWLA 4GZJA 5LNVA 1VRDA 1IGWA 3N34A 3ORWA 4WJXA 2FZ9A 3S6TA 2G3FA 6TAAA 2X0HA 5EA9A 4AIUA 4BF5A 3OZOA 1X6UA 3BW4A 5HK4A 1TWSA 1HKVA 3GDTA 4CU6A 3OLEA 4AZGA 5LNUA 1PYFA 1KCKA 1V6XA 4DELA 3URAA 3VCNA 3WUEA 5A8QA 1JVNA 4S2BA 5HA7A 3TIMA 2BV9A 2Y85A 4L1WA 4UTWC 1X1ZA 4HK6A 1XC4A 3NNTA 2C71A 1CDGA 3TH6A 5K9DA 3VKCA 2ZVRA 3T7VA 1WDWA 3RR1A 4P7NA 3A5VA 4ZFCA 4C6JA 2Z1BA 3RJXA 1A5AA 3UZYA 4G8TA 2NV1A 4GX9A 1GOQA 5G1YA 2Y8KA 1ISVA 2OYKA 1TWZA 2OX1A 4M6UA 5CBJA 1LOLA 1NQ6A 3LMZA 3BSMA 1YDYA 1KM3A 1OFDA 1JULA 2AOSA 4D8AA 3WLNA 1LG1A 3A13A 3WJXA 5CH9A 2KAUC 1XD1A 4MWAC 5H2ZA 4KEVA 4FOKA 1ADOA 3CEUA 1DL3A 4I7WA 4P61A 4K8GA 3RG6A 5KETA 5BCAA 1QNVA 4ZQRA 9XIMA 4WJ8A 3WYZA 2HWGA 4PMYA 1RUSA 3IIZA 2Q3RA 5D2XA 3BE7A 4XD5A 2WK2A 1LRNA 4B5TA 1KA9F 1T40A 2R14A 1KW1A 3KZPA 1XS2A 4Z1DA 3WJZA 1A49A 3HQNA 2VZUA 3E0LA 1TCDA 2J7HA 2NVCA 3FV9A 1JAKA 1ONXA 4NU7A 3HURA 3WBWA 2XINA 4ZOCA 3UXLA 3WD3A 3N2CA 2YCIX 1M1BA 2GWNA 1J10A 3HFTA 4TVDA 4UMCA 4DWDA 2PC4A 3DOPA 2BVYA 1NWSA 4AZIA 5D8WA 4FX6M 4OGZA 3CH9A 2H8ZA 5EB8A 3GH5A 4E2OA 2Z7GA 4ERGA 5FAGA 3I4EA 4KS0A 3B05A 4JD4A 4CD7A 3M0JA 1V79A 3FGCB 3A4JA 3CPGA 6A3HA 5CJMA 4XV0A 3B0UX 1VEMA 5T91A 1A5UA 2WZEA 1LBMA 3PK7A 1GTHA 4IQDA 4REQB 4IL2A 2DDXA 4IPIA 1OF8A 5TNVA 4O4VA 1Q13A 4JL1A 1TYGA 2QJHA 4FXSA 3WELA 2DU2A 2QJJA 1XIDA 3TW9A 5F2LA 1CZ1A 1QPOA 1HVQA 1SO6A 4OQVA 2BLEA 3WX7A 1NELA 3KX6A 4DF0A 2WXDM 1QJWA 2CPUA 4HOZA 4AEOA 2B0MA 2C8NA 3GYCA 1K6WA 1K8ZA 1RAKA 3HFYA 2H3DA 3QJAA 3T05A 3AMCA 2YBUA 4K8EA 3SCSA 1X39A 1H50A 2Y88A 1Y8BA 4QJ3B 4HPJA 2IPJA 4Z2LA 1JR1A 1L0PA 4PEKA 4WK9A 2PTXA 2Y63A 3ITTA 2D3NA 3ITLA 1AJZA 1XIGA 1KXHA 2HXTA 2VEIA 2QJGA 1QUMA 3SSZA 3DUGA 3TQKA 2PC8A 2ZUNA 4AH7A 1WUEA 1HJVA 3IJ9A 1Q6GA 3WJSA 1B9BA 4DAIA 1UKTA 4NJJA 3BW3A 3OEXA 4AQLA 2PLKA 5FEXA 2G0WA 2OGYA 3AU2A 1Y5VA 3QKEA 3A3HA 1XGZA 1KFLA 1CLKA 1WDRA 2PWGA 1JYXA 5CPQA 4LBUA 3EWCA 5GVJA 3WD2A 4NP7A 3B8SA 5C54A 3C0JA 3RXZA 1Y65A 3BWWA 1OFQA 1M68A 3EDJA 4OOZA 1OJXA 3QW4B 4LAOA 4AC1X 1LWHA 1NM9A 3CGTA 1R7OA 3C4UA 4HMEA 3IVSA 1ZBCA 2RJHA 3UJRA 4QG8A 1X6LA 2YA0A 1J0YA 5ABFB 1EXPA 4PZVA 2C1IA 3O2LA 3I6EA 1XPYA 1HNYA 3LN3A 3IUHA 5ABTA 1BHGA 3VZYA 4O18A 1KV8A 3ZLFA 1TPFA 2O9RA 4O8AA 1F5ZA 4PCTA 4NILA 4IG2A 1EEPA 2WVVA 4JKMA 4Y9AA 4I3GA 1DYSA 3EWWA 3FAXA 5HQLA 1GVSA 5A8MA 1ZENA 4K8HA 2EPHA 2BNJA 4QGCA 4MNMA 3SCOA 3W0KA 3NQDA 2WZTA 4LAMA 4AY7A 4NZ5A 4RDZA 1A5CA 4YTUA 4F4RA 4IUGA 1JXKA 1UR2A 2UY2A 1QTWA 4AMAA 2W3ZA 2ZA1A 4S1FA 4UNKA 4E4UA 1IZCA 2BBFA 4FNSA 5C7HA 3HG5A 4YLWA 1WOAA 3MBFA 2I56A 5FI8A 3MZ2A 1H5VA 5I7GA 2E8YA 5FEPA 4H9MA 3SI9A 1QHOA 5GNXA 1RA0A 4AVOA 1XKYA 1ZB5A 2J47A 3A22A 3URQA 4S3KA 3BMVA 1H63A 2QPXA 1GKRA 4Q7IA 1W5OA 1PHWA 4GPNA 4UTTC 2EJAA 2OWCA 1ZAIA 1IXOA 4GKLA 1CTNA 4YN5A 1V51A 1V93A 2VCCA 4KWUA 4QE1A 1PIGA 1TZ7A 5FJOA 4LANA 3ARUA 2P1FA 1KGWA 3A4WA 2CLEA 3REQB 2PFHA 1VBUA 3V75A 1LWIA 8XIAA 1MZRA 1V4YA 3TOPA 1RVKA 4Z1AA 3UZXA 5EL1A 1WP6A 3HZ3A 4Q8WA 4N9BA 4FXJA 3MUIA 3DG7A 1JYVA 1YRRA 4K7YA 3W07A 4Q8MA 3KVMA 3LB0A 1D3CA 1NQKA 1UBSA 2CZEA 4H7CA 4F0MA 1FWAC 3UA3A 4PCPA 2INFA 4QLJA 1HGYA 4TIMA 5HJYA 1M53A 1WDDA 4K36A 3R1ZA 4HQVA 3MC5A 1VYRA 4N4QA 1LG2A 3AHZA 2HPMA 4O28A 1JZ4A 3C61A 1JZ7A 4KCWA 1W1YA 1MSSA 4UQDA 2C13A 2VGBA 2NSXA 3R8RA 1MQQA 3V35A 3MW7A 3TJLA 4R27A 4WD0A 3CL6A 5A6BD 5CKSA 4V33A 3NJ3A 2FB3A 3M43A 4LVAA 1VAHA 3N25A 1PZ0A 4ACYA 3C3NA 1TV3A 1AODA 4Q4OA 3OBEA 5HMEA 1DXEA 2POZA 4FNPA 1ZJBA 4JTAA 1VIWA 3B0VC 1KM5A 1W1VA 5T9BG 3V1PA 3KS6A 9XIAA 3TV8A 3WNLA 2ZZ3A 1OCBA 1XLGA 4CVUA 3AI0A 3W2JA 3WH6A 1F2JA 3WH8A 2QW5A 3UXKA 3VOIA 1EH9A 3DHPA 2Z1VA 1JCJA 5HNUA 4E2VA 1KFBA 3V0TA 1AA1B 4MAVA 3VNIA 2VO5A 2PLCA 4MZYA 3CB3A 4DZ5A 5D9NA 2DSUA 3LD5A 4IX2A 3LTSA 3P8JA 3SB0A 1J6OA 3F4WA 3U2CA 2Z7KA 1UP3A 4QLKA 4BI6A 3MI3A 3ES7A 1NFGA 3LQLA 5DY2A 1GQKA 4JBRA 2YW4A 2Z2BA 3TLQA 3PUOA 3U2ZA 3P5YA 1XYLA 4ADSA 5K2ZA 5F1UA 1YE4A 4QBXA 2JE8A 3QMTA 4GIAA 1OFBA 2JBMA 4TVUA 1MW2A 5BOOA 3N2BA 1M01A 3D0CA 1RXOB 3OZPA 4K1GA 3UGRA 4C6NA 4GK8A 3UCDA 4LGXA 5CPTA 1P7TA 1KTCA 1W8GA 2F8QA 3OODA 1OX5A 4Q8UA 2YCJA 2QXWA 4W9TA 3TFXA 3UWVA 1TPH1 1F4HA 3M0VA 2G37A 4RNFA 1VLIA 9CGTA 3NDYA 2VM8A 3SJ3A 4W7WA 1TTJA 4GLEA 3ANYA 3U2OA 1XLKA 1FUYA 2VVSA 4PTDA 4PYSA 5C71A 2CITA 4MDPA 1WKDA 1PZ2A 4DUWA 3QQWA 3MJMA 1LOQA 1QW7A 1TWIA 5LGZA 1TX0A 3LCFA 3EWZA 2J27A 3GFYA 3G77A 1MUCA 1XI3A 3LTYA 3EWXA 1QHZA 4HZ7A 4YHGA 4KCTA 4IGNA 4UFLA 4HA3A 2VQTA 3SJNA 4PMRA 4QJ5B 3GXTA 4QITA 2QCLA 3TTOA 1UQYA 3TWBA 2E0PA 4UMAA 4P8WA 1IR1A 5BXRA 4RE4A 3DDMA 3KOXA 1PBGA 1JIBA 1KCZA 1JRBA 4RE2A 1H7WA 3ARYA 5LHEA 1POKA 1PVNA 3QV7A 3GC2A 4KCVA 1X97A 1R5YA 4GE8A 2BXVA 3SY8A 1UD4A 4JKLA 3WLRA 2PURA 4O53A 2OO6A 4WXYA 3L4WA 1L2QA 3I3DA 2OR2A 1QAPA 1TQXA 3UEQA 3WZ0E 3ZT7A 3HG2A 3N19B 4JFVA 1EJ7L 1KGXA 2Y5JA 2I9UA 1QI5A 2J13A 4YJ5A 2RHGA 3W29A 3CO4A 3NQ6A 4KIRA 1KM4A 2QJIA 4Q4RA 2HS8A 4UFKA 1W3LA 2J9ZA 4PB4A 2JF7A 4GC4A 3CHDA 3QMRA 3M44A 3LK6A 3RYSA 1KXVA 2CHOA 1YMYA 4DBUA 2WNZA 3GFXA 3KLLA 4US5D 3VKDA 1GW1A 1IEWA 4UC5A 3PC0A 3MV11 1WXJA 2HS6A 2X0SA 2P3ZA 3M47A 1FY6A 4GOAA 1C7TA 3M9YA 3VK5A 3QHNA 4NZ3A 1S2WA 3BOFA 5I6SA 3HGSA 3WQCA 2BWGA 4PR4A 1G7VA 5BWFA 1WO2A 4EF8A 2X40A 4NIRA 4GYPA 3NQAA 3U0HA 4IHCA 4WZHA 3HGJA 1K02A 1UWIA 2L5HA 1EIXA 2RDTA 4HCHA 2OEJA 4BWLA 3WDJA 3EKZA 1JXJA 4QSHA 3E2RA 3I65A 4MHBA 2VURA 2WC3A 4HBKA 3DFOA 2OT0A 4J3SA 4JTFA 1ZUAX 3KOWA 1YX1A 3VPLA 2C7FA 3GK0A 2BOFX 1R9XA 4B91A 2UY3A 4HSOA 3R0KA 5DXYA 4DNHA 1EP1A 1TVPA 4L6HA 3G2GA 5AYXA 3PNUA 1PSCA 4HK5A 1J4EA 3W7QA 1E0WA 3CZJA 1GG1A 4HZ6A 2BHZA 3U48A 3WY1A 3KBJA 1M7OA 2YDAA 3LBOA 1TJ1A 2WV8A 2XN2A 4CGTA 5AC6A 5FSEC 1E0XA 4Z08A 2YX0A 1S5MA 4S3GA 1R7AA 3AUOA 1GWJA 5CLTA 1SR0A 3WLOA 2HK0A 1K4HA 3WEZA 4E8CA 3GO2A 2PU1A 4UBPC 3IV8A 3EX1A 3L4UA 1VS1A 2DT2A 3S5OA 4AZCB 1D3HA 1S5TA 4XTIA 1UHVA 4H4IA 4QLLA 4UCGA 1DJNA 1O68A 1EJXC 4HT3A 1F4AA 3W7CA 2DZPA 1TMHA 1L6YA 1HP4A 1OC6A 2XSXA 1MUMA 2ZIDA 4WOZA 4LCSA 1XD0A 4JYFA 4DO6A 3PFRA 1R30A 3SCPA 4A3HA 1EGVA 4H00A 1OZQA 1BXBA 4GBUA 3P61A 4Q6JA 4CQCA 1KXTA 1X6NA 3NA8A 3WH7A 3K4WA 4ZEPA 5EKYA 3OBAA 2J7DA 3OB8A 3NQ2A 1TV5A 3WNMA 2V6AA 4QP0A 5LIUX 3HQ1A 3STFA 5CG7A 3FK4A 4JIPA 2VZSA 3UG5A 2INEA 2CKRA 3IUDA 1TA3B 1PX3A 5BXSA 1G4EA 3PZGA 2EHHA 5IDZA 1GQLA 2A1YA 2CBJA 3WFLA 1E55A 4C6FA 1Q6QA 4MY9A 4PMNA 4HA0A 1DHKA 1M7JA 3RHGA 4B15A 3JUGA 2PGEA 1ZY9A 1G6CA 3N2MA 2C6QA 3WDIA 3N3MA 3ZIZA 3GYEA 4KFNA 3NG3A 5M03A 2PDFA 3OVPA 1RLDA 2A7PA 4U28A 3I68A 1XX1A 1DWAM 2G4FA 2DIKA 4N4PA 4C6QA 1L6FA 3L2LA 3GVGA 2YKKA 4M81A 4QE4A 3C2RA 3R7MA 3ZLHA 5AC5A 5LA2A 3UETA 1PX4A 3L12A 3ZQ9A 2Q3OA 4IIBA 1QHPA 3BUVA 1K7XA 4KWOA 3R5EA 2BVTA 3POHA 5FAJA 1E73M 1QPNA 2ACSA 4S2CA 2EF9A 3ELFA 3NM1A 2QT3A 1O94A 2QCHA 4F0HA 3PUDA 4GCXA 3HPFA 2WPBA 2F2HA 5LGXA 2BHUA 5CPNA 4XO7A 1W2PA 3OVQA 2V5KA 3LM3A 2BVWA 4GUJA 5H91A 1F6PA 3C8FA 4BKNA 4Q8PA 4EXQA 3W24A 4ZODA 4FEZA 1F3EA 4WUIA 1KM6A 4EXAA 1EWEA 4QDWA 2FVMA 1ONWA 5FJJA 1FDZA 2AKMA 1DOSA 1FOBA 1BYBA 1E6NA 1DTUA 3O7UA 4BQ3A 5HXMA 2OZ3A 1ONEA 2ZUTA 3AXIA 1E9IA 4LAZA 2CYGA 1G4SA 2ZE3A 2BB0A 1IE7C 3PUGA 3WQ6A 1MXSA 3ZT6A 5LNWA 4FNTA 3W26A 4GZIA 3BC9A 3L7RA 2Z1XA 1G1YA 5FF7A 1LRTA 1LWJA 1E6SM 4W7UA 4DWSA 1OWQA 1SM9A 2TRSA 1NOWA 2JF6A 1TIMA 3NIYA 4CEXC 3PZVA 3CWNA 2ZRYA 2QKFA 2X2YA 1U1UA 4ZSTA 1RY0A 3ECQA 2XGZA 2P53A 1QU4A 3SM0A 2QDEA 3ZR4A 1WYIA 3QQ1A 4LFYA 1C8XA 4RCXA 1OHLA 3GZ3A 5A2CA 5ABHA 1UKQA 4AHOA 2DSKA 4KT2A 3MO4A 4EAYA 1Q2RA 3RIKA 3VABA 3WK1A 3B4UA 3ENLA 1G67A 2Z00A 4FZIA 4NJHA 6TIMA 1W1TA 4IICA 1P0DA 4UFIA 1YQ2A 1Z9AA 2ZICA 4J3VA 2DSWA 4KETA 4J3XA 1ZPTA 1R3RA 3HO8A 2CBIA 3TYAA 1SZEA 3WQEA 4XD6A 1AQHA 3EDEA 2B31A 4PEEA 2WOQA 2PDUA 4MZ1A 4RZ5A 8RUCA 1VZWA 1Z89A 5FF3A 3H23A 5HNTA 5H8MA 3TK7A 4J3ZA 1OGBA 3MYPA 4RX0A 3LLXA 3GUWA 3KZSA 1OX4A 1GVIA 3BW2A 5J04A 3TTYA 2O0TA 4R9OA 1B3ZA 2X1TA 4K2SA 5HUOA 1OFAA 4DZHA 4H9TA 4JYEA 4B90A 3WEOA 4EANA 3ZFHA 3GX9A 5K9CA 1U2YA 4YTTA 3T08A 5I3HA 4Q3MA 2Z26A 1C90A 1HF6A 2C1GA 2YCEA 2BOGX 2FGBA 1WQ5A 4B5WA 2I17A 3E2SA 2JGQA 3LDVA 5K4XA 4QAIA 4AB4A 3PHAA 1XLEA 1DORA 4AIBA 2OGJA 2PB1A 3EA1A 3BQ5A 4GZEA 3E0WA 1A5KC 2FTPA 2VHLA 1OFPA 2BASA 4GYFA 1V0LA 2X05A 3D5HA 5D05A 1F3XA 1A0EA 1DWGM 1I2RA 1XRSA 1WNOA 2TPSA 1EQCA 4WY0B 3V0SA 4HIBA 4G2DA 1XYFA 4DEFA 2VP8A 3AIWA 3R13A 2R91A 3WQ8A 3FJ6A 2PDIA 4Z0JA 4GD0A 2GGJA 4UIOA 5AHMA 2E9MA 3A24A 1UD3A 2YL9A 3WQ4A 2ESCA 1O5RA 4QROA 4HNLA 2YPIA 4P7RA 3RPTA 2TSYA 2PWDA 1R38A 2BG5A 4ZO8A 3VD4A 2E6YA 2I5GA 1W1ZA 4L61A 1QK0A 1YNYA 4FO4A 1NOUA 1QNSA 3IGSA 1PCKA 3KS5A 2Q02A 3B9DA 4R34A 3AC0A 3GAYA 4BZYA 3PANA 1OB0A 2VZTA 2XIOA 5AHEA 5GJNA 3EPNA 4O50A 3AS1A 4GXWA 1AQMA 1RBOB 3C8NA 3L5AA 2QUTA 3VGBA 3ZWTA 4J1OA 3AHYA 4AIEA 3W2UA 3WMBA 2FZNA 1O12A 1T96A 3ANVA 4WF7A 1I75A 3N13A 1DIKA 2OPJA 4LT9A 4C90A 1PKYA 4E8DA 2PDJA 1HGWA 4GYJA 5I3FA 3TQVA 1GVFA 5E0FA 5I3KA 1O5QA 1PL9A 4LY8A 5HQMA 3A23A 4DI9A 4XISA 4NASA 3VM7A 4M56A 3WLSA 1ZCCA 2C91A 3QPEA 2WC4A 3MDWA 4AYSA 1F6YA 2ZC8A 2WMKA 1UZ1A 3DHUA 3QKZA 2V2DA 4GMEA 1JGIA 1GOWA 1R2SA 1AQFA 2GOKA 3U9IA 3ES8A 5U7SA 3TEVA 4TMBA 4IIFA 2H6RA 1FWFC 3W7IA 2CWXA 4GG9A 2NVDA 3VKAA 5DFAA 4NJIA 5D03A 2VZOA 1AG1O 2VFIA 3NVDA 2G95A 2GGGA 1TG7A 1R3VA 1LLZA 4OECA 4HHLA 4KRTA 4CCCA 4S3FA 4ORMA 1LT7A 5MKGA 3BMWA 1C91A 3KM8A 3KHJA 3TYZA 2F61A 1REQB 2NZLA 1AZ1A 4HA1A 4I6VA 4AD3A 1CGXA 3VIKA 1XFBA 3PPGA 4JTQA 2GZXA 3WD1A 3H53A 3UR8A 3TMQA 3PZQA 1QI0A 2E67A 4PMDA 4Q4SA 3PSVA 2WANA 3TYDA 3SCWA 1XICA 4L4OA 1EP3A 4A8IA 1IZKA 2YIHA 3KTCA 3RNDA 1QO5A 1V6YA 4KIEA 3ZR6A 3WCZA 3HIJA 3LBCA 3GXFA 4HNTA 1PIIA 1RPKA 1S39A 2BY2A 1OABA 3MVIA 4XVDA 3OQEA 1HIZA 1R8LA 2NVAA 4PC8A 1WKFA 2HPIA 3RLVA 4TUFA 4RE3A 1FWDC 1EJRC 4RZ4A 5DF0A 1F8MA 3WMLA 1B2YA 5REQB 2G3MA 4HJFA 4ZMGA 3U3HA 2NXIA 1XIIA 3BGAA 3EDFA 1A5NC 3THUA 1F73A 4UTHA 3W2LA 3AYSA 5FF0A 4EWND 3APYA 4WDUA 3LUTA 1UKOA 1HJSA 1SJCA 2F6UA 7XIMA 2A21A 1NJJA 5C8BB 3PNZA 1GVYA 3USZA 5A8PA 3HGRA 3FHAA 1CT5A 2ICSA 3LY0A 3DEQA 3IJQA 4HPXA 1BWVA 3QZEA 5DANA 1LUCB 2ZC1A 3MUXA 1TV7A 2DV0A 3HF3A 2V67A 3MWAA 1UH4A 1HKJA 3NXFA 3R8GA 3W76A 1CLXA 1PXGA 4D6EA 3VUPA 3NZGA 2A3CA 1BG4A 1QFEA 1E6PA 4AU0A 3VGDA 1NSJA 1J01A 1SMDA 1V77A 2FPYA 4XZ9A 5D9MA 1XPGA 4FX7A 5ECUA 3GR4A 4PBEA 4UOJA 2PBOA 5A94A 3KL3A 1M3UA 3U4AA 4LEQA 3VUSA 3BAWA 4BA0A 2CEQA 4O17A 1A0CA 1MVYA 1PZ3A 3F5JA 4FNUA 1ITCA 1DE6A 3SIZA 4UTWA 5E6YA 2QCDB 3KL5A 1GHSA 4QM1A 3UWQA 1KCXA 2PWHA 5HINA 1D8CA 1S2CA 3B9EA 4W5UA 4MTVA 3E96A 1GT8A 1J79A 1RZMA 3T40A 1SW0A 3LHVA 3CLMA 4JTKA 4GJ1A 4S3CA 1MO0A 3N3TA 3FDKA 6REQA 2CCRA 2V82A 1E6RA 3MDUA 3ZO9A 2GYIA 3GXDA 5T8GA 2W67A 3E2QA 3VOGA 8A3HA 1JPHA 3TWAA 4L6OA 4BQ4A 1KM0A 2E28A 4M1RA 2OLSA 3W73A 4B9ZA 4B5XA 3N04A 2WZMA 2PDLA 1R47A 4R3UA 2PDHA 4DJFC 1EXBA 1YNPA 2OFJA 3K4DA 4MWAE 4AHPA 3NQVA 4V27A 3K8KA 4MWAA 1E40A 5LYRA 4LW7A 2OSYA 3W6YA 1XWYA 1MDRA 2D0GA 4URIA 1JQVA 3CAVA 3P60A 3E6EA 4D1IA 5CCZA 3DZ1A 2V81A 4IGHA 4C1LA 1PWLA 4U10A 4XG1A 1EC8A 1OD8A 2ZRWA 3W28A 3MUY1 2Q6ZA 3WG6A 4NJGA 2VDIA 6CGTA 3CIVA 4LU0A 5HUPA 1FH9A 3ZJ6A 3GHUA 3OGSA 4C1NB 2WWDA 4DO4A 3CZKA 4DI8A 3IJ8A 1SSDA 2EPMX 5LHFA 4UFMA 5A5WA 4GBDA 1BXCA 3THDA 3XIMA 3DG6A 4XVEA 2WC7A 2FIQA 2ACRA 5HANA 3P84A 4UTUA 4RDYA 2HVNA 4GXPA 3H2EA 1FWWA 3K5XA 3EOUA 3UZ5A 3ABXA 2DH3A 3UXIA 4GGBA 3WLQA 2NLYA 4JQ1A 4TTUA 2XGIA 4K68A 5EBUA 3QSTA 4DM1A 4DF1A 3UR2A 1GHRA 3OVRA 3GTFA 3NQCA 4NYYA 1QOPA 4XAZA 3UA4A 4AHQA 4IQJA 4JXCA 3NURA 2O56A 1FCVA 1K9EA 5D32A 3UF9A 3FYOA 1YTDA 3L0KA 4EKJA 3NOEA 2EGZA 3KWSA 1ZAJA 3QVQA 1KRCC 1FWEC 2QNEA 3NPXA 1OIFA 2ZUUA 4R88A 4PUWA 1P1XA 4X2PA 2YFNA 1SUXA 4IP5A 1GJWA 3M6DA 3WK2A 3ITXA 1XYMA 3QR0A 2D3LA 2Y2WA 1IEXA 4NXSA 1FWSA 4PL2A 2V0TA 3MB9A 4PRWA 3GU2A 4UTMA 3WQDA 2Y6ZA 5HMDA 2ALRA 3CWOX 4NG3A 4JDBA 3BLKA 5BXPA 1UD8A 1PZ1A 5MHBA 1A3HA 1WDQA 4Y90A 3C0LA 3N4EA 2O55A 1UIPA 3RX2A 3FEQA 4HYVA 3W88A 3VE9A 4KGJA 1TV8A 5HWJA 4AD1A 4QISA 1EBGA 4HPGA 1D2KA 3MMUA 3STGA 2J79A 3S5NA 1KO0A 1AMYA 3XINA 4EE9A 2XSBA 4V2XA 4XZMX 4LPCA 4TVCA 2VFFA 2UBPC 4XTDA 4LF2A 4ADUA 2E4TA 1FTXA 1RALA 5EMJA 4HNUA 1ME9A 1C92A 3CUFA 1TE6A 3PBUA 5JIPA 3T0CA 1ZLPA 3EA3A 2PF8A 3F7JA 1QPKA 1KFKA 2C1HA 3KCJA 3FIGA 3AJ7A 5E93A 2FFCA 1KWGA 1V6WA 3AUJA 3SRDA 4DPQA 5I0DA 1QNOA 4PTVA 2XVLA 5C2GA 1PIFA 5HDRA 1KM1A 4OHQA 4GINA 3FYPA 3K1GA 3HBLA 3UZZA 1Q63A 3VE7A 4QQUA 1GOMA 3C3UA 2DP3A 1Q3NA 1AJ0A 2WHKA 1SQ7A 2EO7A 3NSNA 2CC0A 2ISVA 3W1RA 3V3WA 2HZGA 1MZHA 2Q09A 4V15A 3O8AA 2XZ7A 3WQGA 1JDFA 1MYRA 3VIJA 1VFUA 2GL5A 3FXYA 3GDBA 3I7QA 1F8IA 4WQ6A 3T4WA 2VRKA 5CC6A 1YIXA 3W84A 2A6NA 3TONA 1GQIA 4JIEA 4O1CA 2DW6A 2QGHA 1FDJA 2GK1A 5DCBA 4Q7NA 3K13A 1X8CA 5JH1A 3S1WA 2XWDA 2TMDA 4IWWA 3DI0A 3SEPA 4LOCA 1K1DA 4IFKA 1OK4A 3HN3A 4XQ6A 2D69A 2BGSA 3T1GA 4TO8A 3WLTA 5JBEA 4H8NA 3EB3A 5I5RA 3D46A 4W8BA 3R4IA 1UWSA 3TXZA 2E25A 1MNSA 3UBPC 1XYBA 3CUXA 2PTZA 1E5JA 5CGMA 3IACA 3LENA 3EMCA 3B4YA 1NFBA 4LALA 2I1OA 3LPOA 4MF4A 2FZBA 3INPA 3AWOA 2HQAA 4UTTA 5TF0A 4PL1A 3E38A 2ZBTA 5K7JA 1TMLA 2A3HA 3V4BA 4B9YA 3Q65A 4G7FA 4HYWA 4BY3A 4HU8A 3GTHA 1R86A 3RPMA 4JQ3A 1Q6CA 1ENUA 3EOLA 2Z29A 1KBJA 4IMFA 1H5YA 1OM0A 3U7VA 3W7PA 3MTWA 2ZX5A 1V08A 2YLLA 3MPGA 2PDYA 1AZ2A 2JKEA 3C56A 4HOWA 3DFSA 4IPJA 2GPTA 3L0GA 3PPHA 3QV8A 1G5AA 1AW1A 1VGAA 4MSSA 3FNDA 1W32A 1Z41A 4GXMA 3A64A 4DZAA 3MU7A 4BF7A 2A3AA 1EHAA 3AXXA 3BLDA 1TSIA 4GI8A 4LUIA 4CN1A 1TFVA 1UWTA 2UY4A 4DM2A 4PUEA 3VCRA 2Y7GA 4BF9A 3M7SA 2D2HA 3KP1A 3WUGA 1Q8AA 3GSMA 3NQGA 1G7UA 1Z7AA 2YCKX 1K8XA 3L4YA 4PFMA 3QRHA 2WMJA 4OZOA 1XRFA 2PDCA 2WJDA 3LI0A 1PPIA 3VDBA 1PWMA 2ISFA 5LIYX 1CNVA 2FHBA 5KZMA 5CZTA 4I9JA 2E68A 3W9ZA 4JICA 3LCHA 4ZCWA 2ABBA 2EG7A 3GBEA 1JZ5A 3PZTA 4WJEA 2TYSA 2PS2A 4B2DA 4I5RA 1I2PA 4V28A 3D3AA 4IX0A 4CU8A 3R58A 2VWTA 2IPFA 2E40A 2ZTKA 1XIFA 2EPLX 3LHYA 3CUZA 3EEGA 2RDWA 2NUYA 4KESA 3RRXA 2E8ZA 1Z42A 5F7UA 2G8ZA 4LYKA 2AL1A 3BG3A 2ZX7A 1ZRQA 1H4PA 2P5NA 1EJUC 3BDKA 1RV8A 2YB4A 4AZ6A 4KWVA 1MW0A 3S47A 3CHVA 4A2SA 2ASHA 3M0LA 5L6UA 3ONBA 1RPXA 2PZ0A 1LQ2A 1DEDA 4FIQA 4GQ0A 1T41A 1E0VA 3FGCA 1M7XA 4R7WA 1DV7A 4F3HA 3XISA 2HBVA 3G5EA 5IFTA 2VUYA 4REQA 5DO8A 5HAOA 4H9XA 3UR7A 3L67A 1CGWA 3W53A 4A05A 4RNIA 4NZFA 1VRXA 2WHLA 1N8FA 1G01A 2H9AB 5I07A 4HGXA 4YVVA 4NQ1A 3TE9A 2IUZA 3KFTA 3VIGA 1J9YA 3C6CA 1H51A 3VO0A 4NAFB 1MRQA 4Q8VA 4YHEA 2Y70A 2F6KA 3CUGA 1B9ZA 5M3WA 2QCMA 1XLLA 1PDYA 1H1YA 1T0OA 2G3NA 2Y5SA 3M0ZA 5A6KA 1S1RA 4D9PA 3RX4A 3MSGA 3SFKA 4NNBA 3IANA 4DWSC 1QOQA 4CNTA 3IPWA 1O5KA 3MKCA 2Z2UA 2OOGA 2XSAA 3EXTA 2PI6A 3LV6A 2NV9A 1CXIA 5I79A 5CAHA 1O6IA 2OEKA 1ESWA 1H7OA 4F40A 4JR5A 4ACZB 2WBGA 3M5XA 3QLLA 3ARXA 4GKTA 4C6DA 2GJXB 3QFEA 3RN6A 1Z6KA 4IP4A 3E3HA 4UNLA 2J6XA 1FRBA 2OSXA 3CT7A 4JIHA 1XHGA 1JDAA 4RPQA 3NTYA 2XVNA 1XRTA 1PTDA 1GYMA 4GJIA 4P8UA 3LGDA 3COTA 4F48A 2Z6JA 4JQ2A 4C6EA 2J6VA 3IGUA 2EPKX 1Q7MA 3GUGA 4J35A 4Q8TA 3EWBX 1HZYA 1OX6A 5KZEA 3ICJA 1XCFA 5HR6A 1W1B1 2VEFA 1GVEA 3T0BA 1FWNA 4J3WA 4WRHA 3IJ6A 2QF7A 5JU6A 1CLVA 4ZO9A 3Q37A 5AFDA 2PTDA 3ANUA 1E1CB 1UD2A 4PMVA 3G0UA 1P6BA 1Z48A 5ABFA 1BD0A 3T0TA 1BSIA 3KBSA 3W7EA 3WQVA 4DBEA 2V2HA 1XG4A 4GY0A 3GLCA 4HCLA 4IGSA 4CNUA 4NSBA 4C1KA 1EF3A 2J75A 3QFWA 1DQUA 4DJDD 8XIMA 4M1BA 5I77A 2GVGA 2PDKA 3NO1A 4MPQA 3GR7A 1C8QA 2PGWA 2WSYA 1ICPA 2EXOA 2GVLA 4IXXA 4ATWA 5DMMA 2OX4A 3USBA 3AIRA 5CLWA 5BW6A 3W7RA 1E51A 1WZKA 2W5FA 3AU6A 3C2EA 3H8AA 4TU1A 2V3EA 4JTGA 3L65A 4WGHA 4NX5A 3UPBA 1EGMA 2ANUA 2CLHA 1SZNA 1PTAA 3DFHA 1L8PA 1BYAA 2OO0A 4AZ7A 2WQPA 3UQNA 3VYLA 3CUIA 3TYCA 4OU1A 4GQRA 2CXGA 3CJPA 1Q8JA 4OTKA 1RP8A 3FFSA 5U4NA 2VD8A 4P7LA 4N6FA 4KW2A 3GKAA 1H1NA 1KXQA 2G50A 2Y0FA 3TA6A 3FJLA 5IDIA 1B3YA 4RDVA 2VR2A 4LF1A 3GVQA 2PMQA 4LCQA 1XINA 3EXRA 5HQEA 3MA8A 2DT1A 1J93A 4W7VA 3TSBA 4CCZA 3VKBA 3RJYA 4HNVA 2YCLB 3SR7A 3S2LA 2YFOA 3LCXA 3A4AA 1AL7A 2WPGA 3R43A 4AWSA 4EPEC 3GG0A 1XJBA 3NM3A 1T5AA 5GNYA 4OUIA 4GNKB 1FCQA 5BZAA 3HPSA 1OYCA 3VOJA 3MKVA 2INZA 4ERIA 4A6GA 1IZJA 1W0MA 2GGIA 2DZUA 4UZUA 3TJ4A 2OTDA 4X22A 3VIIA 1FCUA 2YDSA 1RCOB 4INFA 5EMMA 3REQA 3C2FA 1A5MC 4OKDA 1UUMA 4UQEA 2QCFA 1EO5A 2TAAA 1EB3A 4AXKA 2NQHA 4LH8A 1SFSA 3S42A 1SZFA 1OCJA 3FN9A 1W9BM 1BVNP 3W1NA 3AIEA 3F03K 3BTNA 3KBVA 2QEZA 1B57A 2BZNA 4YU1A 2W4XA 3HJEA 3DIPA 1ZNNA 2OELA 1ZHAA 2W79A 3K4AA 3SCRA 1UIOA 4GNJA 1M5WA 4AY8A 4P2VA 3PFMA 4QR6A 2CHRA 2W61A 4Q6XA 2PDPA 4N02A 3N15A 3S46A 3GNRA 2PDQA 3HPZA 4AWTA 3BCDA 1XSKA 3FA4A 3M64A 3PWAA 4RZBA 3RGTA 4Z2KA 1IXNA 4ZXOA 1RQHA 5LXEA 2XFYA 1UH2A 4OWGA 1V3JA 1CB2A 1KKOA 3CPRA 5EMYA 3STEA 1RD6A 2NT0A 1AW2A 2DIJA 3BJTA 1X38A 4PMXA 3S2JA 5I3IA 3AS2A 5C2XA 2NT1A 1QNRA 2OQYA 3B0XA 4RR4A 7TAAA 3TQ0A 3UPMA 1E9ZB 1W8SA 3UZWA 1UMYA 3Q94A 3VXGA 2AGTA 3GFZA 3N2TA 3W2NA 4M24A 3W2KA 1Q6OA 4J3UA 1WDPA 5AZ1A 1VBRA 2BP1A 3QPYA 4V1YA 4IJRA 1M04A 2QS8A 2A79A 3RCYA 8CGTA 5CZKA 1EPVA 4H19A 2HRWA 3S8HA 4TQTA 1DQWA 3TZNA 2G41A 4PN2A 1T6MA 1O7AA 3TP4A 3W83A 1A3WA 2P3EA 3PN8A 1EUNA 4M7TA 6XIMA 1GCYA 4GJJA 4PTXA 3QPZA 3G1AA 1U83A 5JBFA 1R9YA 1SVDA 4W85A 3RLUA 3RO6A 3OG2A 1GOIA 4O8RA 3TTEA 5AC4A 1EC9A 3DHDA 1E6ZA 3BLIA 4O1DA 3LG3A 3WL0A 3G6LA 3URNA 4X60A 7PTDA 4BEUA 1ZTVA 1EL3A 3L4XA 4X3ZA 3WNPA 1L6GA 2YYUA 1UBPC 3QN3A 2FMNA 4OBRA 1FKWA 3GS6A 2FDMA 1AQ0A 4YCOA 1IWBA 3NQ8A 1W3NA 4HSNA 4QHRA 3W37A 2WNNA 3CL7A 1W5NA 4ES4A 3PJXA 1EFZA 2WMFA 1J96A 3P2VA 4MJZA 3T9PA 2DZSA 2PTYA 4N42A 3GH7A 3V5CA 1LL4A 3A21A 3QV6A 1HJWA 4DY1A 1JFXA 3LOTA 2ZUMA 4MB3A 3TR2A 4YWIA 3GDKA 2PWUA 3GTNA 4WSHA 3PWGA 3CAQA 2VOMA 3FA3A 1KB3A 1SJBA 4ORIA 1KWKA 4ENLA 4Y2WA 5CEWA 1UKPA 3IWPA 3TAOA 3I3BA 1QATA 2WHJA 4QCEA 3S3GA 4W4QA 3CZEA 3MUZ1 1RY8A 1V0NA 3IK2A 1J0ZA 2FDSA 4QDMA 3O06A 3KE0A 1H11A 3V36A 1W1PA 1TWDA 3B06A 3GG8A 1V3KA 1Q45A 2X7WA 5IBXC 4D72A 5GJPA 2A3BA 1ML1A 1TVLA 2P0OA 4RLIA 5G1TA 4HYRA 2P76A 5IXEA 2C3ZA 3CB8A 1JJKA 2QAPA 3W7DA 1GG0A 2XYLA 4GRSA 4HZMA 3DYOA 1J0JA 1W17A 5AHFA 5M1TA 1BKHA 1H7RA 1I45A 2BXYA 3GH4A 3TR9A 2DVUA 2WWCA 3NEHA 3BPWA 2A3LA 1EYWA 2ON3A 3CV7A 2OWWA 2ZZ6A 3ZYZA 1LF1A 4EP8C 1IWPA 1QRQA 1GVQA 3EB2A 4RXGA 2OMAA 3UZJA 3VDAA 1E70M 2ZZ1A 1L2UA 2XN0A 3UWWA 3NYDA 3A6OA 4JKKA 1W2VA 2WYSA 5FJIA 5CC3A 1TPDA 1E6QM 5AKQA 3NZPA 2ACUA 1G9HA 2ZDSA 3LRLA 1DXIA 3B8WA 4JTSA 1ZP3A 4YL2A 4DHGA 2A6LA 4LV4A 7ODCA 3B0YA 3QEZA 1HL9A 1FWJC 5EMKA 3W7NA 1EYEA 3LU2A 3WQFA 4BCEA 2E5CA 4MVAA 3ITGA 1R3WA 3APGA 5HBFA 3AOFA 2VC9A 2ACQA 3LGEA 3SUSA 3QYSA 1V02E 3S2NA 3NPUA 1V02A 4ZO6A 4WXZA 2R1KA 4BQ5A 1VF8A 1WXYA 4B5SA 1FHVA 1UJPA 5FL1A 3BSGA 1BYDA 1K3UA 3WFAA 1DJHA 1WZMA 1OINA 5H8PA 1GJUA 4DPPA 2CZ5A 4MYAA 4GH1A 4J2MA 1GTEA 1OC7A 1Y5WA 2V9DA 1V3HA 1OF6A 3GHRA 3IVUA 4Y9MA 2FKPA 4ZSUA 3I10A 4O1BA 4HKPA 1NWRA 2ZX8A 4AC7C 3S9IA 2J7CA 2PSNA 4TOQA 5CPSA 1UR4A 4H8VA 3L4TA 2JQXA 3RU8X 3DG3A 2ABAA 2E6AA 3MYOA 1QNPA 3NEVA 3CV6A 3H55A 4NT0A 3PS7A 3WLLA 5LIXX 1DXFA 1K9TA 1UR8A 1U22A 3S0CA 1KRMA 2VC5A 1UOKA 3EX6A 4Z2IA 4PSPA 4QSFA 1HL8A 1S5NA 1IIHA 3W1MA 4IISA 4AZCA 2WZIA 1WAUA 3H2CA 2F9RA 1QO2A 4PMZA 4AX7A 1QDSA 2NX9A 5C55A 1XH2A 1XL9A 5CC7A 3TN4A 1US3A 3LXAA 1RQEA 2XH2A 2R8WA 5PTDA 4MLRA 4UTKA 1H62A 4Y9NA 4TXEA 4HD5A 3RPDA 3UVIA 3S4TA 4OFCA 1PHQA 5IHSA 1E4MM 2B7PA 3UW6A 1W3IA 3HM7A 3P8IA 3GTXA 3SRKA 4PTMA 2Z28A 3MMWA 4GY1A 3N73A 3M6YA 4RUBA 3M5YA 4O54A 1S2VA 5HPCA 1EJVC 3WENA 1YDVA 1ME8A 3W1LA 4WDTA 4Y8FA 2CBUA 4DO7A 2FGZA 4JTUA 3JW7A 4AD2A 4LUTB 1KR1A 4FHAA 2E1DA 1PB0A 2AGKA 3FY1A 1IIGA 5FD0A 1EO7A 1OK6A 1TA3A 5F2IA 4JZ5A 1TELA 3B9NA 5HULA 5D38A 2IKGA 3G1SA 5CC5A 3HPAA 1I0BA 1KBLA 4BS0A 1TJ0A 1JYWA 2VT0A 4WEVX 1WBJA 4EVZA 2VJXA 3EMZA 2V3DA 3CL8A 1MQPA 3PUEA 1GNXA 1FA2A 2HK1A 4H41A 2VC6A 3NL3A 3CMGA 3U5YA 3M41A 1UASA 1MEIA 1LQ0A 3W85A 4CQ8A 3L2MA 5HNRA 4AUBA 1YPXA 4CVWA 3QGKC 3LLDA 3G3DA 3W7LA 1W1A1 2GJLA 1QXLA 3DAQA 3M1ZA 2Y61A 4I6KA 1EEXA 4WIWA 5CBIA 1PO9A 3L66A 1JPKA 4TR9A 4B4FA 2VNCA 5FA5A 4E38A 1B3VA 1LJYA 2IXVA 4KQNA 4XAYA 4UTIA 2I5IA 4M51A 4YVPA 2BFGA 2PWEA 4KCUA 4RKAA 3WNNA 4FK9A 2LLEA 2QCEA 3CMJA 4H6QA 4L64A 4ZR8A 3TROA 3V18A 1R2TA 2VVNA 4BI5A 3DYMA 1DWIM 4CCDA 4PGLA 1DVJA 4AWEA 1P48A 5A6TC 1JZ2A 4DJEA 1C9WA 5EFFA 4DVOA 2ZRZA 2VQUA 2Y62A 3TZFA 3T0DA 1W37A 4JFTA 3PTDA 3FJNA 1Y0EA 3UWZA 2C0AA 3WQPA 3KDNA 4LUSB 3KBNA 3NPWA 3L5MA 4C6MA 5BROA 1W5PA 3R12A 1VHNA 5DN1A 4D6JA 4QDPA 3AQUA 1IEIA 1L9WA 4L9YA 1QT1A 4AG0A 3VCCA 1DIDA 2PDWA 5DELA 5DT5A 2VRQA 3BGGA 4F0LA 3AMLA 3KOZA 4N0RA 4N9EA 4NXKA 4H7VA 4XD3A 5ECVA 2OZTA 3VU2A 4ICCX 2PTWA 2NQJA 1EZ2A 4RV3A 3FKKA 3RK8A 4US6A 5A6SA 5C70A 3G1VA 1VPXA 4UQBA 3QOMA 1W3JA 4IPLA 3P3BA 1BLIA 3R25A 4WDXA 2YZRA 5C9XA 2X1IA 1YPFA 1SJDA 3UYIA 1GONA 3KVKA 3R0DA 1UUOA 2GUUA 4UWMA 1ZAHA 1OT1A 4WOQA 3HOJA 2X41A 2ZWZA 2YYTA 4D8ZA 3GIQA 4QS6A 3RM8A 5G2HA 4JY9A 1EA0A 3OA3A 2J8FA 3VNMA 3PTMA 4BQ2A 4H7ZA 1CXHA 1BEUA 3FEMA 1OY0A 2NWSA 3KTSA 1E0TA 5FEZA 3LZ5A 3O6AA 1SFTA 5G4HC 4XKMA 2XFRA 5A8OA 4L7ZA 1J0IA 2V5BA 2OZ0A 1UMLA 5LKYA 4NZJA 5LNSA 3G3MA 3GY1A 2UWFA 3B8IA 3HGOA 4EACA 3WN6A 4X9YA 2F84A 1UJQA 1POJA 5CG0A 1UR9A 2W62A 3VNDA 1TO3A 3FVDA 4AX6A 3N2XA 3WF2A 5ABEA 3OIHA 2ZXBA 5K3VA 1AH0A 1TKKA 1RBLA 1HO4A 3THAA 3H70A 3CQKA 4MMWA 4JPGA 3CQ0A 3MCMA 3PZ9A 1QI3A 3NGFA 4LWWA 4DJFD 1Q66A 3FXGA 2ODOA 4DJFA 2CZDA 1B54A 6XIAA 1KBKA 1F6KA 4F0RA 1Q5MA 3II1A 1XQKA 3LNMA 1W9PA 3KXQA 2OODA 1JNDA 1ITXA 4WDWA 4NNAA 1IHIA 3JZUA 4GA8A 1JDEA 3EOOA 3G6MA 1H2JA 3PZOA 1S1PA 3TSMA 3CQJA 1OADA 4PA8A 5RUBA 4BK9A 2QVNA 1W91A 3GG1A 3KEHA 4LYPA 3QSRA 4L4MA 4RJEA 3OLDA 1ZFJA 4HB7A 1H41A 3AMDA 2RGMA 1R6WA 4GQBA 2QPUA 3AIBA 4XAFA 3RLGA 4F2BA 4WY0A 3SUUA 1MUWA 1UZ4A 3P0XA 3RR4A 1NVMA 2E77A 1LP6A 4LYQA 1GYNA 4GVFA 1KBIA 2CKSA 3CHFA 3S6DA 5D30A 1GOXA 1T8XA 1NP0A 1DIEA 1DJGA 2OYLA 5LIWX 3DU0A 4HJWA 3NO5A 4IIGA 1WZLA 4JNMA 1K8YA 4PUMA 5A2BA 4WLCA 4B16A 1V6UA 2PBGA 2VR4A 4YVXA 2EPNA 7A3HA 1HXJA 3KRUA 2FTYA 2DUXA 3HQOA 1NF7A 2CLLA 4YPJA 2CLKA 4KERA 2XGBA 1AMKA 2FH8A 3W00A 3QYQA 2YB1A 2WM0A 1SO3A 3WMSA 2OG9A 2O92A 1ALDA 2REQA 3LMYA 2QV4A 4C65A 3PPFA 1OFEA 2XDFA 4AY1A 4YS1A 3ZXWA 2EPOA 2ZYFA 3OPSA 1P6CA 4EPKA 3A5FA 2HMCA 2J7GA 1XIHA 4FNQA 5C9RA 1UC5A 1SGJA 1PDZA 3SRFA 2ZKMX 2J25A 1UH3A 1FWRA 2P8BA 3LA4A 5D2WA 3DC0A 4UOZA 3CQIA 2QPSA 3OHIA 4FA3A 3WJYA 3E0IA 3NDOA 2RGLA 4POCA 1R0MA 3AXMA 3QH2A 4QS5A 1TPWA 1VBJA 4PB3A 3AAMA 2IPWA 4NX0A 4Y8EA 5LXXA 1A5LC 5KTLA 3ABZA 3P7YA 3A12A 4QE5A 1V7YA 2Q01A 4FNRA 4FB7A 1VBHA 1XFCA 2XG9A 5I3GA 3B97A 3H2NA 3MUAA 3GG7A 3H54A 1EJWC 1OYBA 4KBXA 1FHLA 3MSYA 4CNNA 1XSJA 4UQ9A 5HJXA 1BPLB 4A8LA 2PGFA 4GWEA 2BTMA 2HDJA 2VRJA 2MUCA 3QW3A 3CYVA 3C2VA 5E0CA 3BICA 2PDMA 2ZWYA 1J5TA 2FJUB 1H0IA 2WO5A 3W02A 1E9LA 4AWUA 1KRBC 1DKWA 4OV9A 3S1GA 2ZX6A 1WE5A 1R3YA 3WJWA 4KPLA 1OD0A 1ADDA 1ISZA 4MPKA 4EIVA 4W8AA 2QIIA 3PG9A 1UR1A 4MFEA 4H9ZA 3VA8A 2PP1A 1JUBA 3CT2A 3KHDA 3V16A 1REQA 4XAGA 1W3KA 3P67A 2PP0A 1OIMA 1W5QA 1JUEA 3VNJA 5I24A 3GIYA 1GVRA 4C6KA 4QTGA 1HW6A 3SCUA 2EQDA 4E4FA 2YL8A 2C15A 1WAWA 1NY1A 3IIXA 3NCOA 3VD3A 3ATZA 2QDGA 2VFGA 4ZTYA 1VHCA 1RBAA 3N11A 2OT1A 3T44A 6PTDA 2NQLA 3SY5A 4C7GA 4CQ9A 5AECA 3F5LA 2WHMA 3QC3A 4OIFA 2VYOA 3ZR5A 1Q4WA 4AVNA 4QJ4B 4O16A 3EPMA 3VDHA 4RDWA 3MMTA 3N6JA 3QHMA 1F3WA 2X7VA 3C2OA 3S9ZA 2F6XA 2P8CA 4FIRA 2D2GA 3BURA 5C9ZA 1TR9A 3F4VA 3NAVA 1XH0A 5REQA 1WZAA 1YBQB 4B5VA 3W72A 3VX1A 1Q6DA 3M0XA 3TYBA 3VZXA 4ATLA 2E6FA 1R3QA 4O4WA 1BG9A 3CASA 4XZWA 3L23A 1J2WA 1V5XA 2J8GA 3TNOA 3ABOA 4Q4KA 2YL6A 4TV6A 3UT0A 4D8LA 3N29A 1TRDA 3B04A 4UTLA 3UFYA 5IFPA 4D6GA 5AHIA 4MG4A 1BRLB 1EHNA 1X7IA 4HN4A 4X0VA 3TU9A 2AAMA 4WVXA 4H04A 1JD7A 2VFEA 3CTTA 1Q4NX 1LUCA 2DSVA 3PAJA 4XZNX 4CD8A 2VX5A 2BY3A 3UWYA 2FTWA 3UYCA 2ATMA 3ALFA 2HISA 4NVTA 1XLJA 3W1TA 4ZGYA 2FZDA 3SAZA 1OGSA 2QUMA 4AF0B 1JZ3A 3W6MA 2DZBA 3LRMA 2NX3A 3G1RA 4U5KA 3EKGA 1YE6A 3WH5A 3ARQA 3RRAA 3N2OA 4N6EA 1S2UA 2BVDA 4AZ5A 3KRZA 2Q8ZA 3FA5A 2DZAA 4MADA 4QNWA 4A35A 4DXXA 2GQ3A 1A5BA 1ZJIA 2QCDA 4WSKA 2FB2A 3PBYA 4H6EA 5BXTA 4YMZA 3QZ6A 4O1FA 2ZA2A 4HHPA 3S83A 4IPNB 3SBFA 4PUKA 2PD5A 2DJXA 2I5QA 3HG4A 2CLFA 4GY7A 4GH3A 4ZQOA 4WGXA 1BAGA 1YDOA 4LNYA 5EBAA 3UVAA 2DQWA 3QR3A 1P5BA 4W5ZA 3V0UA 3DECA 4ZQMA 3U57A 2Y7EA 2PDGA 3WO8A 5BOFA 3RUBL 3CWHA 4JX4A 3N9SA 4K3ZA 3GBDA 4H9UA 7TIMA 4JNZA 4C6LA 1I2NA 5IM51 4EWJA 4JIQA 1A3XA 1DP0A 4NI8A 5AVHA 3S5SA 3DN5A 3OGVA 1B4KA 3Q2DA 1XR2A 5AN7A 1Q7ZA 4Q32A 2Z1SA 2V8ZA 4XSLA 2Y24A 3PZNA 5CGTA 4RXFA 4HPNA 3GXNA 3GTIA 3AWNA 1GKQA 1NF0A 1JFHA 3K2GA 1XUUA 3CEPA 3ITOA 1T99A 4IMAA 5EMLA 3UJSA 4LEFA 1XG3A 2YSWA 1QMLA 1LTDA 4J27A 3D6NA 4LV9A 1WV2A 1D8WA 3MCOA 5JIWA 5D9PA 2GUYA 1P0BA 3QY8A 4IT1A 3AS3A 3O6CA 4C1NA 4MKVA 5ABGA 3H2FA 1ISXA 2YOCA 1O66A 1ZP4A 2W66A 1NDYA 3G8EA 4I7VA 2XH0A 1M7PA 4PUDA 1K03A 1TTIA 3A9IA 3G8RA 4LJ3A 4ZL1A 3W70A 4J28A 1LDCA 2FLIA 3STPA 3O1NA 4LRTA 2WKLA 2O9OA 3OZMA 1EDQA 4CNSA 1TVNA 5H1WA 1HVXA 3WNKA 4ZB2A 4EPDC 3WK0A 3W4RA 1FP9A 1OCQA 4W89A 3SGUA 1H7XA 3MP4A 4P8VA 3T4CA 4NAEB 3TOYA 2WAGA 3SCTA 3LERA 2D23A 4UTJA 1XIJA 4FSAA 3OOQA 3WUFA 2XZ9A 3F2BA 3T8LA 3PZUA 4CD5A 4HMNA 3SECA 2A85A 3AJXA 3B8UA 5BMWA 4JL2A 4V1XA 2BY0A 4ILSA 1DE5A 2NLIA 4LXFA 2QGYA 3RILA 3TN5A 3PBWA 1EBHA 1ODZA 3E0VA 2PDBA 1SW7A 5LSMA 3AROA 3KP0A 1TMQA 4FP1A 4CN4A 4JIRA 2Z0IA 4H1ZA 3HJZA 4MUPA 4UUIA 1B3WA 3ZVHB 3VNLA 2DVTA 4IF2A 3CAWA 3R89A 1J18A 4XZIA 4A21A 3JVAA 5FOOA 3NFUA 1AL8A 4NZCA 4QEEA 3W7MA 1DJXA 3BL3A 3WBXA 4NRSA 1UA7A 2R1NA 5D2VA 5G5IA 1KCLA 4DWSD 2VEGA 4MM1A 2A7NA 2QDHA 3BLOA 4DRSA 4HU4A 2P0IA 2Y5EA 1HG3A 3AZRA 3E5BA 4Q22A 2DH2A 2NQZA 1UQZA 1YHTA 3CZLA 2VENA 3DYPA 4JQ4A 4L80A 4ROQA 2IQDA 5CPOA 4FX8A 4IZGA 1V3LA 2PPGA 3LXBA 2CESA 2OLHA 3TKFA 2PCEA 3N9KA 3NVTA 1M9HA 2QIWA 3MSDA 1SYTA 2PDXA 3F2CA 3GM8A 2VX6A 1NDVA 1ZBWA 2PODA 3AIVA 4G56A 4WKAA 2D73A 3WF4A 4CQDA 3NZ1A 4AISA 2C19A 4MJ2A 5A6MA 4BHYA 5FEWA 1NP2A 4QG9A 5EYWA 2D0FA 3DFYA 4HMDA 4Q7BA 4QEHA 2E1WA 4S23A 5CZJA 2FMOA 3GZAA 5GNZA 3OBKA 1B90A 2OSWA 3DBNA 4M0XA 2PLJA 3CLWA 4LTSA 5A2AA 1VR6A 1W6TA 4O19A 4I5XA 4ZA0A 4CN6A 1Q6EA 3QGVA 5A1AA 4PUJA 3H12A 4XKYB 2JIWA 3DESA 1QR7A 2ZX9A 2W6RA 4C7FA 4P7QA 5A6AA 1VCGA 1JCYA 1XBZA 5FSDC 5M5DA 4FXFA 1OFOA 4ZZ9A 4KH2A 1SO5A 2VEPA 5D02A 1C9DA 4O14A 1Y7VA 2C16A 3MI6A 4Z2JA 2XFFA 3VGEA 1IEVA 1EP2A 1VFLA 3OJGA 3GHSA 4HTBA 4IMCA 3AYVA 4XZLX 3TW7A 1VFOA 5E6ZA 3O3RA 3SN1A 3DFTA 1TPUA 3W1XA 3VKJA 3MP3A 3PJUA 1JYNA 4DZIA 4S3BA 1T8QA 3KRSA 3H21A 4PE8A 5FACA 3PM6A 4NZ1A 4LS0A 4X61A 2CLIA 5C7VA 3LCGA 2NSOA 1WXZA 4NF7A 4RZ6A 1W9UA 4G7EB 4YYCA 4MGGA 3UWEA 5XIAA 3TYEA 1DQXA 2C14A 1IXQA 2E6DA 2Y7DA 3AFBA 1AD4A 4MKNA 1X96A 2V68A 3M07A 4AZBA 3IK4A 3W1AA 3AO0A 4RW3A 3NWRA 3TXVA 4I9TA 2V38A 1SO4A 1VC4A 3SN0A 1CCWB 1ISWA 3AS0A 5KITA 2FJKA 1TREA 3KLKA 2WNWA 3GNXA 2D1ZA 4M80A 5HR7A 2Z1KA 4JOMA 5AYYA 1YLVA 2WVSA 1OCNA 1BTCA 1VBGA 4XAPA 5FJRA 2YW3A 4HHHA 4HMCA 5H8UA 2QMJA 4GISA 3UPWA 1BGAA 4AD0A 5TD4A 1K70A 5CSSA 3UJEA 3H7UA 5FJTA 4MB5A 1C93A 3U6WA 3S1UA 1XH1A 3VNYA 4M82A 1UOZA 2I57A 4UFHA 1KQZA 3OW1A 3RF9A 1VH7A 4KWWA 1FWGC 4D6CA 3UG4A 1LROA 2Z25A 4YIWA 4A8RA 3FW6A 3WF0A 3UXAA 3O0KA 4R5EA 3VOFA 1IQ8A 1H1ZA 1P0KA 4ZBCA 1JDDA 1CIUA 1WKYA 1K77A 2GFTA 3FYYA 3BLPX 1YXYA 2ZRUA 1PX8A 3MS8A 4AEEA 4CQBA 3S5YA 4JIIX 1FFQA 3EWDA 3PY2A 5BNKA 3G18A 4M5PA 4A8NA 2W0UA 5DXXA 3IGXA 1FHUA 4JTJA 2CZFA 1XBYA 3T42A 3GVWA 4U2YA 1GQJA 2EEXA 4LY4A 2UZ9A 1VLWA 1B1YA 4IMGA 2IKHA 3VC6A 3QZAA 4GC3A 2BXZA 3SCQA 4CNOA 3ARZA 2ISSA 3LNPA 1CB7B 1EQPA 4BR1A 3LCLA 2XPKA 1CPUA 3K30A 3N4FA 5E1QA 2NUXA 2PDNA 1GUVA 3EKLA 1XLIA 1ME7A 3VMPA 2ZZ2A 1XBVA 4B3LA 3EOEA 2C79A 3ERPA 1ISYA 4X9SA 1FCBA 3CV1A 2HXUA 1KKRA 1THFD 4U5IA 4QCFA 7REQB 4C6IA 2J7EA 5EPDA 4PTNA 3B40A 2VX7A 3L21A 1K6AA 3AIQA 2YDRA 3AIUA 5E09A 3BLLA 3T81A 5TBOA 2J74A 4NRRA 2JGYA 1DIOA 2HTMA 4PRRA 2I14A 4W8LA 3FX4A 1D7FA 4M3PA 4LBRA 1WCGA 3P93A 4OBSA 1C8YA 3SQLA 2QUUA 1F76A 4WKFA 1PE1A 1MRAA 1P43A 1XP3A 2GJNA 1B3OA 5H6HA 2XISA 2C18A 5FL0A 1IT0A 2NUWA 5JQ9A 4G9PA 1GKPA 3F2DA 4XUGA 3PF3A 5FJUA 4RW5A 1D3GA 4A3QA 5J5RA 3VINA 1HX0A 1Q85A 2XH4A 3RM4A 2H9AA 3O6YX 3KUMA 1W3TA 4DJEC 1LBLA 1UZDA 4MNKA 3CU2A 1V03A 4B4HA 2WMIB 1V0MA 2DFAA 4IM4A 4JFSA 1PEZA 1UZHA 2VWSA 4JQAA 3W1PA 1JDCA 4NAFA 2ONEA 3F4CA 3GXPA 3NQMA 3GHTA 4H2CA 1QCWA 3ZMRA 4E2BA 5JVLA 3NL2A 2HBXA 3L5LA 4PB5A 3NXLA 2B7OA 2GSJA 2HEJA 1E72M 5I02A 1XLFA 4ZQNA 4NI3A 1OQFA 3ZWSA 1W56A 3C0QA 3MZNA 2AQVA 4MY1A 1BFNA 3QTGA 3IGHX 1YPIA 4MJ4A 4NZ4A 4WKHA 4ACZA 8TIMA 3L2IA 1AFSA 3Q45A 2QR6A 4LNCA 3ABRA 2NW0A 4IOTA 2GJXA 3DHFA 3MBDA 3VZZA 3PTQA 2ADAA 3EXSA 1OEPA 2QF8A 2BGQA 1HTIA 3VGGA 3L68A 3SRHA 4QRNA 1KM2A 1VENA 3P62A 3LI1A 4IQLA 2CNCA 3GDMA 2CHNA 1HT6A 3P5ZA 1DJWA 3BAJA 4YCPA 1EPXA 4AW7A 4D6HA 1E1FA 1FKXA 4XX6A 3SCVA 5GJMA 1P6WA 1RQBA 3LQGA 3T2OA 2ZXQA 5IBXA 3ONCA 4WX2A 4JN7A 3MV01 3PP7A 6ALDA 5A6BA 1E1CA 3QMSA 3CYJA 1QBBA 1PS9A 2YA1A 3W1UA 2AMXA 1XUZA 2UY5A 3SFWA 2F38A 3BG9A 3TA9A 3WQ5A 1HKIA 3OVGA 5FKYA 3WQWA 1KTBA 4GIYA 3BAKA 3TSDA 4QG6A 5CJNA 4Y6GA 2VMFA 1OT2A 3H22A 2QV5A 1F05A 4NJKA 2GWGA 3I4KA 1VJZA 1AJ2A 1DWHM 2VL4A 3S6OA 4HOXA 3T55A 3NZRA 4K39A 2FHFA 3SURA 4QFUA 3WDPP 3W74A 4OE7A 3NQBA 2PA6A 4KWSA 3R94A 4ASTA 3CUHA 3QXBA 4B5UA 1SZGA 1W54A 1J0HA 1QPQA 1W9VA 1YXCA 3BZJA 2Z24A 1TIWA 1B4EA 3D3FA 2WJZA 1A4LA 1NU5A 4RE0A 4JFUA 2PRMA 1QWGA 2D22A 1LRQA 2OZ8A 2O4QA 4DBSA 4MWAD 2ZZ4A 3AHXA 4ZTXA 4C91A 3A9BA 2AL2B 1LQAA 1JF6A 3TC3A 1XRVA 1U5HA 4AMCA 2F2KA 1YYAA 3QY7A 3WBAA 1VD6A 1XYZA 4IQEA 2X1UA 2E3ZA 2DSZA 3Q58A 1IV8A 3IRSA 3E0FA 3UJFA 2FGLA 2Y4SA 2WKJA 1BWKA 3MT1A 3IJDA 3KVLA 4FPSA 4CUCA 2YCLA 4JTEA 1KC7A 1EDGA 3BQ6A 2WSRA 3N6QA 2O7QA 1JG9A 5TAOA 4XWUA 3A47A 1CXKA 4Q33A 2XVKA 3NL5A 4FLOA 1XIBA 2BX7A 5KMYA 1GOKA 3J7HA 3K8LA 2Z2AA 2G96A 1I9CB 2X2GA 4LYRA 4RV8A 5DBUA 2J4GA 3SIMA 2VDGA 2GSEA 3BH4A 3WKZA 1CGUA 3B8DA 1VIZA 4JHOA 4DB7A 2WQDA 1EIBA 3NOYA 1KFWA 1UKSA 3UR5A 1ZL1A 1J5SA 2JKAA 5CSUA 3BANA 3VIFA 4KKXA 2X30A 1Q6LA 3ID7A 2MNRA 1UROA 2AKZA 1UB3A 1F3TA 4Z2GA 4FR1A 5I06A 3OQ8A 4L4PA 3TN6A 1UWRA 2YGYA 2OOFA 4J3TA 3T8QA 3WFZA 4E3VA 4D1JA 4AAJA 3P82A 3HMJG 1UA3A 2A4AA 3SGZA 2JEPA 2WVUA 3KDOA 5CXPA 2GUBA 4LBSA 1R3SA 1J11A 1QK2A 3R8HA 5M2FX 1E0UA 4QXIA 2V5LA 3QV9A 1MEWA 3PJWA 4Y9OA 1JD9A 1ELSA 3W7OA 3RDKA 4DQWA 2CFFA 1TJRA 3E2VA 3SY1A 3W82A 4DBDA 1EC7A 1CW2A 4GO8A 3WEMA 1LOSA 1RJPA 4XSMA 3TC6A 5BRQA 3GC5A 3DFQA 4O0QA 4HCDA 2D20A 1ADSA 1TV2A 5CAKA 1MXGA 3CNYA 3T09A 4FAMA 3QBUA 4DJDC 2FPTA 4US5A 1IR2A 4Y9PA 1E4IA 4C60A 1V6TA 2YXXA 1D7KA 4LB3A 1XISA 3WLJA 4JAWA 4HZ8A 1JL8A 1E1EA 2VGIA 1G94A 3AISA 4Q4MA 5XIMA 4PBGA 1K9FA 3TNBA 3EEZA 4CQAA 3JR2A 4DO5A 3N18A 1G4PA 3LHTA 3WLHA 4Q8OA 2POTA 4JEQA 4XBKA 4GFSA 3UU0A 4W86A 4DAFA 1VCVA 1EWDA 6ENLA 2ZQ0A 1AVAA 4GI6A 2ZTJA 1DBTA 1BGGA 3GXIA 4UCFA 1FX6A 1NWTA 1HUVA 2WSPA 1HKKA 2DQXA 1WPCA 1F61A 3I3EA 1GGOA 1K8CA 3JU2A 3EAUA 5K9XA 4UR8A 3RLHA 2P10A 3WL1A 4UTFA 3H2AA 1X1NA 4O10A 4UQCA 1TWWA 3WNOA 1JPIA 3EDKA 3NO3A 1A5SA 3BCJA 4DLFA 4AFYA 4CU7A 3S2CA 5IOBA 5I3JA 5B7ZA 3MMDA 1CYGA 1US0A 2A5HA 4LVBA 2QCCA 2ZUWA 4QIUA 4GNVA 3P14A 1FXQA 4EPBC 4TMCA 2ATSA 1HN1A 3D47A 5D4YA 3MHUA 2A7RA 3WH9A 1K7FA 2RKXA 4K1WA 3QM3A 1UWUA 4GUFA 1Y5XA 3JRKA 2DY3A 4NHVA 4GYKA 5F4WA 2ISDA 4G1KA 4HU3A 3VKKA 3IVTA 4XB3A 1XC6A 4WCJA 2JFEX 3BG5A 1V3IA 2ZA3A 3F1QA 3FVMA 3N1AA 5E9XA 4ZOEA 2QCGA 4YXGA 3B8TA 2OXNA 3CHEA 5TIMA 3QHOA 2H8XA 4R7JA 1VJSA 4GX8A 2WM1A 4Z1YA 3NQEA 2RDXA 4U3CA 4DIAA 1UWQA 4EOUA 7CGTA 1G0CA 3NGJA 1RH9A 3GW0A 2PLMA 4XZBA 4R9XA 2X0YA 3RX3A 3FAWA 1Q2SA 2I9EA 4F9DA 1A5OC 3PTKA 3B3DA 1R85A 3ARRA 1ZSXA 3BLEA 3NUKA 5F2GA 3OLGA 1XYCA 1R3TA 1E56A 1VFSA 3BK0A 5JH2A 1XLMA 1QOXA 3UNDA 4W87A 4BI7A 3CXOA 5D8ZA 4MB4A 3ZT5A 1Z8AA 2ZOXA 1QWKA 1RD5A 1Q7QA 2I16A 2Y8VA 2HV5A 4IMDA 1ZJHA 2PZNA 2PRLA 1L6SA 3SDOA 3ARWA 1KLYA 1EX5A 3W23A 3B9OA 1BVWA 2WJEA 4B5NA 1C3FA 1ONRA 4XIMA 2HJPA 3R10A 5D33A 2VFHA 3HQPA 2O9PA 2NWRA 1US2A 4OBTA 3PZMA 3S2MA 5I3DA 1NDWA 2Z27A 1PJ9A 2RFGA 1UR3M 1A47A 3DH7A 1RA5A 3BAYA 3IUIA 3UG3A 4C7DA 3I6RA 4JN6A 3AXKA 2XIQA 1EKOA 3ZJ8A 2CXEA 1JQXA 2J88A 1GZJA 5IRPA 4A22A 1H49A 1YDNA 2OKTA 2XVPA 2HVOA 1WA3A 4Z1BA 1U5JA 1C8VA 4HNCA 1A53A 1HO1A 3TYUA 1XF0A 1ECQA 3UWUA 2W9MA 3VM5A 3LM7A 4J9JA 4B2DD 3QQ0A 4FOUA 3OA5A 5L9FA 3OO2A 3QLDA 3VTRA 3OU8A 4HPHA 1SFLA 5DMNA 2QULA 1JI1A 4JX6A 3WLKX 1GJPA 4O12A 3EGJA 3VOCA 4L4LA 3UGVA 4IG2B 5M17A 3ZVIA 3DC8A 2AMGA 2WVVB 4RNHA 4DYJA 1H61A 2J77A 2DPEA 1FVPA 4ICMA 5DEZA 1DJYA 5HMSA 1M65A 3IRDA 4PMUA 3EDDA 4JCMA 4ECLA 4FLQA 3GNOA 3IIPA 4EAMA 1EZWA 1MMFA 4GIEA 2XTKA 1XLAA 5T9CE 5GPRA 4ZOAA 3IJLA 5AZ0A 3U8GA 4XK2A 4MY8A 2CZVA 2Z6IA 1QW9A 4GCAA 1SMAA 1MW1A 1TE1A 1ZALA 5D09A 2J24A 4S3DA 1TX2A 3VI2A 1TTPA 4H01A 4OT7A 1TUFA 1V7AA 5ENLA 3M0KA 2VD9A 1WBHA 2YXOA 4JTDA 2VGFA 1MEHA 1KNWA 2ZUSA 4I5UA 4UXDA 1L6WA 1ITQA 3GNDA 5BRPA 3VGFA 1ZCOA 3MHGA 1DWFM 5E9AA 3MHFA 1P0EA 4ZB5A 1UCWA 2GQ8A 1G4TA 1KBBA 5I03A 2V2CA 4NUWA 1WDSA 3BOLA 5DQPA 5C5YA 5CGQA 5DMLA 4ML4A 4WR3A 2F7FA 3KWXA 1ZZMA 4K38A 2Y8UA 4GI9A 1AD1A 1NDZA 2FVLA 4GQQA 3TTSA 4LUTA 4C6PA 1RJRA 4N9CA 3SW6A 1C29A 4H83A 4HP5A 3CC1A 4RL3A 1VFMA 1UWAA 2CLMA 2FHCA 5AYBA 4CLMA 4F0KA 1K9DA 2PGRA 3C0SA 5CPMA 2W63A 1ZBKA 4H8HA 4FI4A 4OVXA 2X8RA 1S2AA 1RHCA 1PCWA 3C86A 2ZFAA 3W3OA 2AQOA 2GJPA 1KQYA 2A0NA 4WHBA 2PD9A 1KFEA 1XIMA 4S39A 4CKQA 2NXGA 4LVDA 2JALA 1CBGA 4TX9A 4DN1A 1P1MA 2AAAA 2XIIA 3DCPA 4UB9A 1SU5A 4HK7A 2PU0A 3KTXA 2BGNE 3LPGA 4L6DA 3VGHA 1ECEA 1X98A 3TQPA 5C0QA 3U7BA 1FH8A 4O1AA 3GB6A 4IIDA 3E12A 5A6JA 2QHAA 5EMUA 4IFRA 2EAWA 2PAJA 1J2BA 3OLIA 1GZGA 4ATDA 2XVGA 2ZXDA 3AZTA 5DMYA 1TV4A 3ZS4A 3WF1A 2ZVIA 4H9VA 2R24A 4L56A 5HWMA 3M0YA 5XINA 3ABSA 3PWIA 1HL2A 4CNPA 5HMFA 4PULA 5HNNA 4AVFA 1TJPA 4WSJA 3PG8A 5BMXA 4GACA 3CUJA 3URBA 1JAEA 1I6NA 3G0XA 3VFLA 2EJ1A 3W2MA 4JDYA 4LSBA 3DENA 4F8XA 3EX2A 4G1NA 1TRIA 1O1HA 5C2CA 1R9ZA 1IGSA 5C9UA 1H60A 4YTRA 5KEZA 4LUJA 4LUSA 3MANA 5G4WA 4NNCA 3N4AA 5LA1A 4LC6A 4R85A 2VGGA 3NDZA 4U31A 3UXDA 2BS9A 1XQLA 2YA2A 5DX7A 2GDVA 4UMBA 1LT8A 4LC8A 1FFRA 3SGGA 3YPIA 4IUOA 4K7VA 5A8NA 2B7NA 1XGEA 1W3HA 1MWOA 3E9AA 3ZZ1A 4IIHA 3ITYA 3FJ4A 2H3BA 3OTRA 4PCSA 4DX3A 3E1F1 3V7PA 2REQB 3GNPA 3MCNA 2X1RA 3LXCA 1VP5A 1Q6RA 1WKEA 4UOQA 4C6CA 3BAXA 4IXHA 1NOFA 5BU6A 3VX0A 4HN8A 4NYUA 4ALDA 2E09A 4Q4PA 1BYCA 4GVGA 4LQ1A 3MSRA 2BSLA 4Z42C 2DUZA 1UPMB 4I90A 3VD5A 2ISWA 4KMQA 1UP0A 3T2QA 1JF5A 3TFCA 4HSHA 2DT3A 5A69A 4MOZA 1K7EA 4I8DA 1P7TB 1JNEA 1S5WA 2PEVA 2E7FA 3H6OA 4EK7A 3OZYA 1GEQA 4CD4A 2FYMA 4E2DA 2BOEX 5BOEA 1UC4A 4Z0SA 3C52A 1NIUA 3SZ8A 3R0UA 1DWJM 3AALA 4DUVA 2WVTA 3LHZA 3BARA 4FALA 4I9MA 2E5DA 1GOOA 3TC7A 2D0HA 2X42A 3S5ZA 4D2JA 4ZQCA 5CJ5A 1U5VA 1G69A 3LCIA 3ZM8A 1VKFA 1MNZA 1VFFA 3O05A 2UV8G 3M16A 2DEPA 4IPPA 2Q8LA 1PAMA 3K46A 1JCNA 2QAFA 4YYFA 4D6IA 3A3WA 1PKLA 3AZSA 2G4JA 2A2IA 5JXQA 2Y89A 1YEYA 4PMQA 1OC5A 1J8VA 3HPXA 2XFWA 3IIOA 2PWFA 5AYZA 5BYWA 3G1YA 4J5NA 1EUAA 3GE7A 3GRIA 3LSCA 1UR0A 4EXBA 2YBVA 2O9TA 2E5BA 1OSEA 3KAOA 4MKSA 4MB1A 4PUNA 1E4NA 2GLKA 2PCQA 2PF0A 4LRSA 2HE8A 2AQWA 2QQ6A 3M0MA 4BFAA 3FCPA 1TPVA 3ZOAA 3WD4A 3KCOA 3W7KA 4K6AA 1JRCA 3CBWA 4NY2A 3WBYA 3POCA 4BEQA 1UP2A 2X1SA 3CQHA 3RU6A 3M0IA 4X0NA 3BVJA 1YTEA 2XIBA 1IF2A 3GDLA 3CIXA 4EF9A 3DFNA 1HQTA 1M6JA 4H6KA 1HP5A 1Q6FA 3CZ8A 4F0SA 3IJIA 3W86A 2VEKA 3GW3A 4LB4A 2R1PA 1O4UA 5BWAA 3E02A 1ZU8A 4W84A 2RH9A 3QR1A 5AY7A 5D9OA 2ZE0A 5KZDA 1VYSX 1Z69A 1SPQA 4P8XA 1CECA 3W7HA 5KSWA 3RM9A 3T78A 3STCA 2FPVA 1NH6A 3ARTA 3N14A 1FQ0A 1EGZA 3DX5A 1MI3A 3LHUA 3AICA 2XM2A 4ZXLA 5AC7A 3N17A 3SUTA 4GUIA 4LCRA 5DLCA 3B9AA 3O0FA 3LV5A 2DJLA 2JKPA 1N8IA 2E9LA 3CIWA 4GO9A 3E74A 4IJBA 5I00A 5JMUA 4PH6A 1BTMA 5HATA 2WMHA 4H3DA 5AYIA 3W81A 2J7BA 3NPVA 5CZ0A 4JEJA 2PE4A 3NZQA 2YZ5A 1QW8A 3W7GA 1UW9A 2WSQA 1AH3A 3P6LA 5CBBA 3QF0A 5C9WA 3H24A 3U4FA 4LUYA 1WB0A 2VR5A 2PUZA 2HE5A 1XLCA 2V5JA 1CXFA 2CERA 4KGLA 5HJLA 3LTPA 4HVXA 1H7NA 2XUCA 1EDTA 1TZZA 3MJYA 3SSJA 4A3UA 3VIPA 3ATYA 1MQRA 2FFIA 3WUBA 5DT7A 1PTGA 3PBMA 3VOHA 3VAVA 1NARA 5DY3A 3ZSSA 5TQLA 3BJSA 4Z2HA 1EJSC 3OYZA 5LNRA 2EKCA 4DLMA 2JIEA 3F4NA 1S3TC 4H2HA 1SFJA 3GWQA 2D2OA 4OJYA 4AD5A 5F4XA 1XLBA 1YTKA 1PKMA 3DKLA 2OWXA 9RUBA 3LLFA 2GJRA 4PMJA 3G1FA 1YXDA 4PUUA 2GGEA 3LS9A 2GVEA 3B8VA 5MF5A 3TVAA 3VDGA 3FSUA 1GW9A 1U30A 2NQ9A 4MNJA 3N12A 5D04C 5C6MA 1DPMA 4HTYA 5FESA 3IIVA 3IEBA 3W25A 3B03A 3TDFA 2IQTA 4W88A 1E3ZA 2GVYA 5EU9A 4F79A 1W9XA 1GVOA 4O57A 2Y1HA 4YWSA 2OCZA 5DBTA 4ADTA 3IAPA 1XYAA 3HB9A 5T26A 4Q8NA 2ZUVA 3WQOA 5CZSA 2ZRVA 4TX8A 4IIEA 2YXGA 1F74A 2HCVA 4RNJA 4A3YA 4JTTA 3V5OA 1XDLA 4CD6A 1HFBA 3L4ZA 4GZ7A 1N55A 4XO6A 1SSGA 4ZE4A 2HROA 3T0AA 3NL6A 5G2IA 4A29A 4GGHA 3S9YA 1IT7A 1J6PA 3EA2A 3EWYA 3IV3A 3HA1A 4NL1A 1Q65A 4BJHA 1U1JA 1YBQA 4OOUA 4N2YA 3GR8A 4MFDA 3T6CA 3MO7A 2QLYA 1BSLA 3Q4DA 4QX4A 2IKIA 3VILA 3L0NA 4FLSA 3G0SA 5LIKX 4O15A 1ZQ5A 1UYQA 3WLIA 4LX4A 3TN3A 3OP2A 1BRLA 3N9RA 2OKOA 1V3MA