1LT7A

Oxidized homo sapiens betaine-homocysteine s-methyltransferase in complex with four sm(iii) ions
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
361
structure length
305
Chain Sequence
KGILERLNAGEIVIGDGGFVFALEKRGYHPEAVRQLHREFLRAGSNVMQTFTVNEAAADIARQVADEGDALVAGGVSQTPSYLSAKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMAIGPEGDLHGVPPGEAAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAAQLKAHLMSQPLAYHTPDANKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPRARARKEYWENLRIASGRPYNPSMSKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Betaine-homocysteine methyltransferase: zinc in a distorted barrel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords BETAINE-HOMOCYSTEINE METHYLTRANSFERASE
total genus 108
structure length 305
sequence length 361
chains with identical sequence B
ec nomenclature ec 2.1.1.5: Betaine--homocysteine S-methyltransferase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02574 S-methyl_trans Homocysteine S-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.330 Alpha Beta Alpha-Beta Barrel TIM Barrel Homocysteine-binding-like domain 1lt7A00
1Q85A 5DMMA 1Q8JA 1LT7A 1Q7MA 1LT8A 1Q7QA 5DMNA 4CCZA 3BOLA 1Q8AA 1UMYA 3BOFA 5DMLA 1Q7ZA 4M3PA
chains in the Genus database with same CATH superfamily
3I7SA 2VD8A 3ABZA 3BSMA 1LF1A 3G0XA 1M9HA 4GI8A 5EPDA 1XYAA 3OZOA 2XH4A 4OOZA 1D7FA 1B0IA 4MAZA 4Z2LA 2QIWA 3DHDA 4EPDC 1BKHA 1PBGA 2DT0A 3EB2A 2NSXA 1YE4A 3QY6A 3UQNA 3B97A 1E72M 5I0DA 3TLLA 2YCLB 1GOMA 1G7UA 3USZA 5A6AA 2PE4A 1EUNA 4AY7A 2E1WA 1KBJA 3VDCA 3N2XA 5DMMA 3H6OA 1J6OA 3H4GA 3R25A 4YVXA 3VC6A 4IMCA 4RX0A 2BY3A 1XDJA 5JIWA 4XD4A 3QV7A 1F4AA 4IXHA 3ZZ1A 2A6LA 5GJMA 4C91A 4LUIA 5CGQA 4NNAA 1TQXA 4TQTA 5CH9A 2G4FA 4QNWA 1Z8AA 2V5BA 3LHUA 3N2TA 2WB5A 4LBSA 4UC5A 3ZSSA 1VEOA 1SJDA 2VENA 3MBFA 1RQHA 2OGYA 4O52A 1OSEA 1HKWA 1SZGA 2GJLA 4F3HA 3O8AA 3QY7A 1ESWA 5F1UA 3FAXA 3CHEA 1OG0A 3AS2A 4AZ7A 3PC0A 4FPSA 1HIZA 4K3ZA 1H5YA 2BY1A 4LGXA 4O12A 1VJZA 3WQWA 3AWNA 5BMWA 3R5EA 1BEUA 1S5TA 2YL9A 4X9YA 3ITXA 1WZLA 3CO8A 1EZ2A 4J3UA 5CLWA 4TOQA 4WJEA 1UG6A 3P14A 4PN2A 4H7VA 4H41A 2R1KA 3R4IA 3W87A 3T0AA 1KBKA 3FYYA 1H1NA 4C6JA 2QW5A 1L8PA 4D6JA 1T6MA 4CCDA 1FH8A 3N18A 2CZEA 4Q4RA 3GTFA 2VO5A 3MV01 5M03A 4EF8A 2V6AA 2XIMA 2UY2A 3BARA 3O63A 1DKWA 3W28A 3R11A 4QROA 1JXJA 4G56A 1TE1A 4NZJA 5IFTA 3LGGA 4MZ8A 4GD0A 1UD5A 4JR5A 3LHWA 1EP3A 1BXBA 3W84A 3VFLA 1XF0A 3HM7A 3W37A 3G3DA 1UHVA 2F7FA 4NU7A 1XUZA 3GNRA 3IJQA 4DYKA 3LM7A 2XTKA 1EFZA 1Q6EA 1U83A 3DHUA 2A7NA 1IE7C 1KRBC 3F5KA 2XSBA 1MW0A 4MWAA 4LVAA 1R8LA 4ERGA 6REQA 1DOSA 2BTMA 3WZ0E 4HK6A 4JTAA 4BI5A 3C6CA 4WR3A 4AEFA 1T41A 4R85A 1J11A 3VD5A 1RY0A 2NUXA 4HCDA 3RN6A 3RYSA 1YMYA 3P82A 1W3IA 3GUGA 3FKRA 1GVEA 4OT7A 1WXZA 4U10A 5AHLA 3TR2A 4NAEB 4S3KA 3TFXA 3S5YA 3EDEA 3L23A 3BSGA 1UD6A 1KM2A 4IM4A 5KETA 4PSPA 4L4PA 3T05A 2WSQA 1JPIA 4EE9A 3M0VA 3F7JA 1QW8A 1R9ZA 1JULA 4O0KA 1MMFA 3JR2A 4JAWA 5LXEA 2WZTA 1KTBA 4W8LA 1R9YA 1QBBA 2V5JA 4LNCA 2PDHA 3LCLA 2E5DA 3CUZA 3OYZA 5HBFA 3TA9A 4PMDA 2QS8A 4FSAA 1A5OC 2FTYA 3IPWA 4AWUA 2HTMA 2OT1A 1OGSA 3OZPA 4LAOA 5TD4A 4WY0F 2UV8G 4NJKA 1L6WA 2OQLA 3GU9A 3EYPA 1JPDX 2C71A 2NXHA 4KH2A 3RM4A 4RZBA 2VRJA 3G5EA 3K30A 2I5IA 1VBJA 2GGHA 3P8JA 1S5MA 2GDVA 1V08A 3QPZA 6TIMA 2NT1A 1RV8A 1G0CA 2O9TA 2CNCA 1FWIC 4IJBA 3R8HA 1X98A 4K8HA 5D38A 3SW6A 4KWWA 5B80A 3CK5A 3IUDA 2AGTA 3BLOA 2Q71A 3CT2A 4MFEA 1UMLA 4FNUA 2FHCA 5T91A 2NQJA 1GOWA 1J12A 4NAFA 4P8VA 3QN3A 4JTTA 1R30A 1ADOA 3OQ8A 1O4UA 3TJIA 2MUCA 1MRQA 1BLIA 2A3AA 2Y88A 5A8OA 3R58A 2H9AB 3AUOA 2NWSA 2OYLA 3V75A 2PTWA 3F4DA 1B2YA 3UBPC 4FNTA 4QJ1A 4ZB0A 1UYQA 3QR1A 2WO5A 4W7WA 4IJCA 3UXAA 5BROA 2CCRA 4HU8A 2YCKX 4RCXA 2PTXA 1K4GA 1TV7A 4V1XA 3WQ8A 4E8DA 3UR2A 2BOFX 4D72A 2NSOA 1W2PA 4FNRA 3AIUA 4LTSA 1XH1A 5TF0A 3MZ2A 5I03A 3RRXA 1E5JA 3R2GA 3UETA 4RXGA 3LUTA 5DF0A 1JDEA 3W7HA 1Q7QA 4NILA 1KXHA 1NARA 3HFTA 3AZTA 5A6TC 5HJXA 4KCVA 4A8RA 3DN5A 4PCNA 4JIEA 4M3PA 4EIVA 3U2EA 1MFUA 2VEMA 2YL8A 2PGWA 2AGKA 3AHZA 3IJ6A 1YNPA 2W5FA 1HGWA 5M3WA 1IIGA 4GH3A 1ELSA 2QAPA 3KS5A 4IICA 2OODA 2Y6ZA 1OFBA 3LCGA 2HV5A 1LOQA 3CLMA 2E7FA 4BA0A 1FCBA 4XO6A 3TQPA 4GVHA 2WLYA 2YSWA 4HA4A 4IQEA 1RP8A 2QEZA 3G1YA 3A9BA 1L8NA 4Q8TA 4GO8A 3AOFA 2JKAA 1UWRA 3STPA 1G4SA 2V2HA 4YPJA 4Q8WA 4XISA 4KT2A 7TIMA 5CC6A 5BXRA 1B9ZA 3HTWA 1HVQA 2XM2A 5GNXA 1X7FA 4L6DA 1GUVA 3F03K 4IX2A 3NDYA 3E0WA 1JDAA 4JIQA 4WIWA 1Q2SA 1XDMA 1H61A 4KCUA 5BRQA 5IRPA 3DFQA 4EF9A 4PTNA 1R3TA 2QKFA 2QCHA 3MTWA 1M01A 1D8CA 1JGMA 2D0HA 4E3VA 4JFUA 1E3ZA 1TB3A 4PFHA 3WMSA 5JH1A 3AICA 2DSWA 1H09A 4AZ6A 2EAWA 2FZ8A 3W7MA 4HT3A 1Y8BA 1OHLA 2XGZA 3W2UA 1K7EA 2J8TA 4MWAE 4O57A 4DJEC 1DQUA 1H7RA 3NURA 3LMZA 2GGGA 2XFFA 4BF7A 1O7AA 3MDUA 3OA3A 3NDZA 2C14A 3SJNA 3G22A 4QLLA 5GJNA 3LK6A 1L2QA 3ARQA 2ATSA 3HGSA 4LS2A 3K4DA 1H62A 3FW6A 2J24A 2OT0A 1UKQA 2VC7A 5AYIA 4OV9A 1IXNA 1PXGA 3AFBA 4ATDA 3WG6A 3OLEA 3FJ4A 4QP0A 4B3ZA 4PB3A 3F4NA 4Z2JA 4UNIA 2E1DA 3I7QA 4S2BA 2PDKA 3E0IA 3DAQA 1EYWA 1PWLA 3JZUA 1SUXA 1LRNA 2WZIA 4KFPA 2C1HA 4QTGA 2QCGA 1UR3M 4M82A 1X8FA 2JQXA 3THDA 2ONEA 3AMCA 4B2DD 3FX4A 1XPYA 2Q8ZA 4B4FA 4RNHA 1HL9A 3PJUA 3AYVA 1SSDA 3LXCA 1ZBKA 2NZLA 1GHSA 3QR0A 3AXKA 3DH7A 4Z42C 2ACUA 3ENLA 4NXSA 1TIWA 3NL6A 1PCKA 2JIWA 1XUUA 2A7RA 1ODZA 1WDQA 2DORA 3WD2A 3ZJ8A 1QBAA 4S2CA 2W9MA 3LB0A 3DGRA 2V3EA 2VZUA 5DQPA 4HYRA 4ASTA 3V5CA 4Y9PA 4R7JA 2J62A 4HSNA 3W7RA 3CNYA 4F8XA 1E56A 4S3AA 2GQ9A 4KETA 3H53A 2A3EA 3E02A 4N6FA 4XAYA 1O5RA 1VLWA 2YXGA 3JS3A 4ORMA 4Q8MA 3GHUA 1WDRA 4KWUA 3WK1A 2BGNE 3MO7A 3E0LA 1Q7ZA 1B3WA 2YW4A 1Z42A 4S3JA 2J9XA 4ZOEA 5F4WA 1AK5A 1TELA 1MUCA 3PUGA 4QIUA 1RCQA 4Q7NA 2DIJA 4GXPA 1DBTA 1FUYA 2XVPA 4LUYA 4H3DA 3QHOA 1QW9A 3M0XA 1FWSA 1PV8A 4FOKA 5E0KA 4KGLA 4LVGA 2OX4A 2JK2A 3TEVA 1H51A 5FEXA 2B7PA 4MB3A 3T09A 2BS9A 1MQQA 1O1HA 4H9VA 1JDDA 1H4PA 7XIMA 1T99A 1HP5A 2OEKA 3W83A 4XZHA 2OO6A 1C92A 4K39A 4NG3A 4AEOA 1XRFA 1JR1A 4CVUA 3RM8A 4EANA 3NXLA 4M0XA 1GOOA 2Q8LA 4W85A 4KCWA 3IV8A 4EWJA 4L61A 4GIRA 2VOTA 3VC5A 4AYSA 3R8RA 3T2QA 4ICNA 1AJ0A 3SN1A 4HPJA 2NX1A 2WMIA 1ISXA 4KRZA 2Y7FA 3HF3A 3VABA 3C2VA 5FACA 2BOGX 3KHDA 4HSHA 3O16A 4H4IA 1E51A 4O53A 2HCVA 1HVXA 3RU8X 2XVLA 3KX6A 1CGVA 4BHYA 3BC9A 3GUWA 1Q6LA 2HSAA 3PG8A 3ANUA 3NQDA 3B4UA 1MXGA 2FVMA 1KA9F 2OKOA 2XSAA 1JEZA 2HPMA 3FAWA 2NUWA 3WQCA 4RKAA 2ICSA 4PCPA 4ZO8A 4LXFA 2ZXBA 3RXZA 2J8FA 2ZZ1A 5FL0A 1KM6A 3MCMA 1UR8A 2FB2A 3D47A 1EJVC 3K8MA 4YHGA 1U22A 4LF2A 1WOAA 3N15A 2YA2A 2DW7A 2HVOA 1GT8A 4U2YA 4ZMGA 3PY2A 1WOBA 2ZYFA 4IFRA 3CZLA 3AMDA 1U1JA 3IJ8A 2G8ZA 5EFFA 4D8ZA 3NR0A 4ROPA 2CU0A 3WDPP 7CGTA 1X6NA 2PI6A 3KCJA 3SRHA 3AS3A 5CPMA 3A4WA 3N2MA 1SMDA 3W02A 3ZT6A 1V6YA 3MZNA 3M5XA 4AVOA 1V03A 2ODOA 2X42A 3DESA 1EEPA 2YYUA 3GDBA 3HG5A 3WJZA 2IKIA 3N14A 5CAKA 4C6QA 1U30A 3Q67A 1AVAA 1U5VA 2E3ZA 3NA8A 4RZ6A 1OZQA 1EBHA 1UKPA 1J0IA 1VYSX 4GYKA 3QZEA 3ARZA 4AF0B 1WV2A 4BI6A 3PF3A 3HGOA 5CZKA 2DZPA 2WCAA 1Q3NA 3U5UA 4IP5A 3Q65A 2DZVA 1UIPA 4RLIA 2WKJA 4G9PA 4QX4A 4DHGA 4ROQA 4NZ4A 4MB5A 4PE8A 3PBUA 3MDWA 3VGEA 5KTLA 4IGNA 1I75A 4IUGA 3C61A 1H3GA 2DVTA 4L80A 3OBEA 3LCXA 4NQ1A 3GE7A 3T8LA 4W9TA 3W3OA 4H1ZA 2XSXA 3WL1A 1M68A 1TFVA 1XR2A 1DVJA 3MYPA 4JZ5A 4K1WA 1DORA 3U0HA 4O19A 4C60A 1FFQA 2WW5A 3CV7A 4WHBA 1W32A 2YR1A 3VUPA 3G24A 3R94A 3TJ4A 3VAVA 2LLEA 4YWIA 4YNGA 5CPLA 1UKTA 3DEQA 4B9YA 3GR8A 4I5UA 3U57A 4UR7A 3GU2A 3E0FA 1XRTA 4GXMA 3EWDA 1W31A 4CNPA 4OFCA 5A8GA 2DSVA 1QMLA 3K1GA 3MYOA 1T8XA 4KWVA 2GGEA 2FDMA 2OZ3A 3OZYA 4IT1A 1IEVA 3SUUA 2X1UA 4KKXA 3ICJA 3FYOA 1RPKA 4LVDA 3CC1A 4NI8A 3ANVA 3E2SA 2Y63A 3W01A 4YJ5A 4FF7A 1NVMA 5CJNA 2BHUA 1A3XA 3QYQA 4IP4A 4RV8A 4GLEA 3TR9A 1Q6OA 3UJRA 4Z2HA 1WUFA 4YVPA 1YEYA 1BG9A 5FJTA 1QPRA 1AQMA 1ECEA 3CYJA 4JL2A 2WOQA 5DRCA 4HNUA 1KBLA 4P7OA 3EWCA 4GPNA 5FJIA 5C71A 3GHRA 3WD3A 5CQ1A 4MNJA 3AYSA 2IKGA 1KV5A 4TX9A 4REQB 1GVQA 1A3WA 2ZE0A 4FNPA 1VENA 4L4OA 3C2OA 1UR2A 1Y7VA 3VKAA 1FWBC 1V4YA 2ON3A 3BCFA 3VNKA 1LP6A 2DGAA 2E4TA 3USBA 5L9FA 1S2WA 1JF6A 1QHOA 3SN0A 1ZFJA 4ZFCA 3K1DA 3QZ6A 1XBZA 4E6MA 5E0FA 2W4XA 2WVSA 1EL3A 1V6TA 1HJQA 2G0WA 5KMYA 3QLLA 1XDLA 1XG4A 3NPUA 4DQWA 2HS8A 3ZJKA 2DVXA 3SRFA 2RGMA 4P8WA 5AZ0A 3GXTA 3W24A 1KR1A 3FJNA 3KUMA 3WJYA 4DYEA 4H8HA 3U8GA 1OB0A 2OCZA 4L9ZA 1JAKA 2VDGA 2F61A 3SQSA 5LIWX 3RR4A 2KX9A 3WQPA 5BU9A 1JCMP 2GJXB 3GTIA 4PUKA 1GPWA 5AC8A 4NVTA 3CB8A 4HK5A 4XVEA 3P0XA 1GYLA 1OCNA 3OYXA 5U7SA 1OG6A 4G1KA 1TPB1 2Y8VA 2Z2AA 1PKMA 3UW6A 3VMOA 3KRBA 4EK7A 2ZUVA 4B4HA 1BYAA 1DXEA 4IIEA 2ABBA 2IQDA 4MZYA 1XSKA 3AS0A 3SR7A 3S2CA 3KRUA 2PRMA 3OGRA 2P53A 2ZTKA 4MWAB 1E6ZA 4TO8A 4AHQA 1B4EA 2IKJA 3QMSA 2WMHA 2D22A 3QGVA 5JH2A 1EGVA 4F2TA 1EDQA 5HNNA 3B9DA 1QCWA 4WEVX 1J93A 3WK0A 3MI6A 2RJGA 4O8AA 2JE8A 3OQEA 2EPHA 3VOGA 4UTTC 1JCTA 2I9UA 1YDYA 2P8BA 3U2OA 1IEIA 3W9ZA 3OTRA 2XU2A 4M56A 3M6DA 2X40A 3S9YA 8TIMA 1DIEA 4K7VA 3TQ0A 3SZ8A 2B0MA 3BOLA 3A47A 3E49A 4AQLA 1LBLA 2BXVA 5HQMA 1UIOA 1T0OA 2WK2A 3UCDA 2YDRA 4ERIA 1VFTA 1WDDA 1GVIA 5DLCA 2DUAA 4H04A 1WZAA 4S3DA 4TX8A 1F05A 4NT0A 1UPMB 4ES4A 4B9ZA 3G1FA 4YHEA 4I6KA 1EPXA 4KEMA 2Z25A 3AALA 4DLMA 1B5TA 2D73A 3SCUA 3ABXA 4L64A 4W5ZA 4Y96A 4BEQA 3SFKA 1XM3A 3NIYA 4JTJA 5I3FA 2XFRA 4DBDA 1XXXA 4O4WA 5EB8A 4UFMA 4HHLA 3CL7A 4HPXA 5K9DA 1ONWA 2OVLA 1R3RA 3WCZA 4C6IA 1EXPA 4C6KA 2PP3A 1JPKA 3IIPA 4IMEA 1TMQA 1SSGA 2E6AA 3OA5A 1VCGA 2Z26A 2HK0A 1VRDA 4J3VA 1E6SM 4QGCA 3UPBA 3BLPX 4Y7EA 3P6LA 3TC3A 5CPSA 3N11A 1TJ0A 3BCJA 4RE2A 4O28A 5FI8A 5IFPA 3IWPA 2EJAA 3UR8A 1PCWA 4HPGA 3B40A 5ECUA 1RZMA 1HF6A 1MNSA 1NWSA 4JTKA 4LPCA 2CBVA 3W73A 4GABA 3WH6A 4TMCA 1DJGA 1B57A 3MV11 3TQVA 1YLVA 2FDSA 2PDUA 3B8DA 5C54A 3VNDA 3GNDA 2CIPA 5J5DA 3AMLA 4GVGA 1FBAA 3B8SA 4CNOA 4W86A 4CN4A 4MKVA 4PMJA 4FX6M 4PL1A 3CZKA 1T5AA 4D6DA 3L7RA 4B16A 1UKSA 3M9YA 2Z4GA 1VC4A 1JNDA 4FX8A 3W2MA 1HO1A 3KBWA 3DI0A 5H2ZA 3LHVA 4UR8A 3LENA 1ICQA 4QSHA 1DQXA 1UR1A 2NV2A 2ACRA 2XVKA 2G96A 3W1AA 3AIVA 4BI7A 4O4VA 4XZMX 4CLMA 1QHZA 2OLSA 3UWYA 5CBIA 1EGMA 3BG3A 4BQ4A 1TIMA 4JQ3A 5BNKA 1P6BA 2XZ7A 3M64A 3CPUA 5HK4A 3LNPA 4X0NA 1X1ZA 1YBQA 3GFYA 4XAZA 1TA3B 4C6BA 2BWGA 1EOMA 1PSCA 4A22A 2QUMA 4OQVA 5A6MA 3GRIA 3QW3A 1KTNA 4GYPA 4UFKA 4DPQA 3QM3A 2FJUB 4OIFA 5HMDA 2V5CA 1VFLA 2TAAA 2WMFA 4HOWA 4JQAA 3N17A 3N9RA 2DU2A 2W63A 5H6HA 1W1IE 2G3FA 4OVXA 1UOKA 3WH7A 1Q85A 3LZ5A 3ZR6A 1YADA 1OABA 3R12A 3QC0A 1H49A 4TVCA 4ZE4A 2Z7GA 3W2KA 2C13A 1JCXA 3QPYA 2GVYA 4BCEA 1WKEA 2WQDA 3NQGA 2C8NA 4ZFMA 1DJNA 3S83A 3N6JA 3WLHA 1GPFA 3DHFA 3ZLFA 3BLDA 5CCZA 3RCNA 5EMYA 3KVJA 4IMAA 3WLRA 1HO4A 5FL1A 1QI2A 2VMFA 3DECA 3VINA 1WDSA 3UWEA 3BSHA 4HU3A 4I3GA 1J0YA 3W07A 3W71A 2PEVA 3TMLA 5BRBA 3QEZA 5AY7A 4RE3A 1TCDA 2ZICA 4HMNA 1JYVA 3PTQA 3N1AA 4UR9A 5BW6A 2PWGA 4X60A 2AL2A 1EGZA 3UCQA 3RCMA 4F0RA 3MSYA 3WLIA 7ODCA 2GVJA 1WCGA 1B31A 4J7RA 3UNDA 2OQYA 1BF2A 1VJSA 1R2RA 3IANA 1S46A 1K03A 3TJLA 4INFA 2ZUWA 3POHA 4OHQA 4B5NA 1FHLA 3DXIA 4ACZB 3PB0A 3CM4A 5AC4A 3FJ6A 2R1PA 1VFHA 5C7VA 4A29A 5I3JA 3TYBA 3SB0A 4HA0A 2XZ9A 2E5CA 1V3KA 4MGGA 2BZNA 3STGA 4KIRA 4P8XA 3AAMA 1XSIA 3TNOA 1EIBA 2FMNA 3VNZA 3W86A 4XV0A 3DKLA 3M41A 4L5ZA 1S2CA 1VD6A 4YL2A 1V51A 2G3IA 2YDAA 4X9SA 2FHBA 3ARYA 1H41A 2FZ9A 4FLQA 4ZQCA 1C9DA 2Z1VA 2NX3A 3RO8A 1A47A 1X38A 3BAXA 3VOHA 1P48A 3VKCA 1ZQ5A 3AMGA 4IPLA 4G2DA 4XD3A 3GAKA 3ITLA 5KEZA 4AIUA 2PTZA 1E0WA 1NWRA 4DELA 3FDGA 4FB7A 4PMZA 3TNBA 1CTNA 1RJRA 3PPGA 3AC0A 1SO4A 2IQTA 4S3FA 3UG5A 4TMBA 1C8QA 1FA2A 1UC4A 4KEVA 5D9NA 5A6SA 4NHVA 3ZVIA 4LUSB 1RUSA 4J2MA 1WDPA 4U4MA 2ZUNA 3M44A 1QWGA 1XD1A 3VIHA 2O0TA 3NL3A 4F2BA 4R3UA 2WANA 4KRTA 5AYXA 5LXXA 4UXDA 2E25A 3GU1A 4DM2A 1CENA 1GJUA 1GG0A 2RAGA 3SY5A 2WC7A 1S2VA 5B7ZA 5A3HA 1MW3A 1MO0A 1SZRA 3B8TA 3WNMA 3RITA 2OSXA 2IPJA 1E9IA 2FJKA 1ONXA 4G8TA 1OFRA 2Z1WA 3JRKA 3VKDA 1CYGA 4S3BA 3SY1A 5EA9A 4UZSA 1FFRA 5B7YA 1E40A 3MWAA 3CHVA 3EDKA 3M0ZA 3N04A 3W2LA 1O95A 3OZMA 1UKOA 3ZT7A 1BD0A 3N19B 4CQCA 2ISDA 3W1MA 3VX0A 1FHUA 2E6FA 1JZ8A 1OK4A 1M6JA 2I56A 3ELFA 4IMFA 5XINA 1IF2A 4WDUA 1ECQA 1REQB 1ME7A 4IIFA 3EMQA 3QLDA 3GR7A 5AC5A 4N2YA 2CZDA 5D8WA 4RL3A 1XYCA 3FA3A 4LYKA 4TV6A 5F2IA 1YBQB 3OVPA 1PS9A 1O12A 2WPBA 2PLJA 3BJTA 3OP2A 3HB9A 3WLPA 4CN6A 1TQJA 3NQMA 5I3GA 2OSYA 5ECVA 4WKAA 3ME3A 3AZRA 4IISA 1SFSA 3KBVA 3C52A 2VEIA 1OYCA 1UBSA 3HMCA 3PWAA 1LYXA 3GWQA 2BGQA 1V7YA 4FMVA 4AMCA 2GDUA 2QCNA 4JTFA 1XH0A 3VNIA 1S1RA 2PURA 2OZTA 4NIRA 2ZRZA 1SR0A 1GTEA 3PTDA 2CEQA 1QPNA 5H8UA 2Z24A 3KDOA 1K8XA 1LDCA 1BVWA 2CC0A 1TR9A 4UOJA 2PUZA 4LNYA 5D02A 3C56A 1ZLPA 4RDZA 3AIQA 4L1GA 2ISWA 2QDHA 1RCXB 2VTFA 3PNZA 5HUPA 3VOIA 1W5MA 3KE0A 3ARXA 3LHYA 2D24A 2BVYA 1XGZA 3VD7A 2GPTA 3T9PA 1VEPA 5CKSA 4PGLA 1QNSA 4NAEA 4U5KA 4LY8A 4NUWA 5CGTA 5AHIA 3UEQA 1HJVA 5A6JA 5F2GA 1P0NA 1TO3A 5C55A 2OOGA 3GNNA 3OLGA 1YNYA 3UXLA 4GOAA 4W87A 4QS5A 2HNEA 3VOFA 1PB0A 4AXNA 4O18A 2WMIB 1XKJA 2Y7EA 2HRWA 1IEXA 3F5LA 5I6SA 3AHVA 3T81A 1V79A 1E6XM 4XVDA 1AH3A 2DQXA 4PMRA 4M5PA 4W8BA 1GYNA 4XQ6A 4E2BA 1WPCA 5H91A 3WFZA 3TJXA 3L12A 1WX0A 5G4EA 4AC7C 4PBEA 2AQVA 4CD4A 2WQPA 3GHSA 2WM1A 3S1UA 1D2KA 3URAA 4WD0A 3EOUA 2Z2BA 3LI0A 2VNCA 2EKGA 1V02A 3TDFA 5FJRA 4GKTA 4LS0A 3QQWA 3C4UA 3O15A 3TA6A 3NTYA 4A3HA 4IQDA 3BGJA 2FZMA 1U5JA 2HK1A 3MS8A 4QJ5B 3L4YA 4R88A 4NY2A 4WUIA 3WMBA 5EMKA 3AIWA 5CEWA 3NVDA 1BWVA 3ARWA 3UR7A 4MG4A 2REQB 3T4CA 6XIMA 2PGEA 1I2PA 3GG7A 3TW7A 3W7EA 3WQOA 2NV1A 1F9CA 3LBMA 3VXGA 4GVFA 3R89A 4B5TA 4ZQMA 2CZVA 2F8QA 2ISVA 4XTDA 5I09A 3EOSA 3GVVA 4KESA 1QOXA 2P0OA 3ITYA 3FGCA 3AXMA 4D6CA 1G7VA 5BCAA 3FHQA 1KFEA 4XD6A 4C1NB 3EEZA 4NX5A 3ARPA 3W7KA 2BODX 3WQGA 3C0QA 2VDIA 4JTGA 4LYPA 3EKZA 1ISVA 4BF9A 3P5ZA 1AW1A 2YCIX 1E4NA 1EJUC 4KF1A 1VFFA 3HQ1A 2J7BA 4MUPA 5LKYA 2INEA 1GTHA 3LRMA 3GM8A 2PBGA 1R3SA 3NFUA 3QGKC 4GE8A 5DX7A 4KPLA 3WUFA 2INFA 3E5PA 3D46A 3BCDA 5E0CA 3LPOA 3W2JA 1XISA 3UESA 1O6IA 3SN4A 1NEYA 1JGIA 1Y65A 4AZ5A 1FRBA 2J7FA 3M1ZA 4K37A 2ZC1A 1O1ZA 3N3TA 2ZUUA 4WZHA 1K7FA 3T6CA 1NTHA 1J18A 4DEFA 3V5OA 5HOSA 4DBUA 2FKPA 1EO7A 4HMCA 3QQ0A 3K4WA 1NWTA 1PZ1A 4XZNX 3L5MA 3TW9A 4I8DA 1Q6CA 3EPNA 4JHZA 3KL3A 1V3HA 3GXPA 1DJXA 3RM9A 1MQPA 5ABEA 5I07A 3D0CA 5M17A 1EH9A 2WPGA 1KXQA 3QR3A 5LNRA 3WH5A 3PULA 1C9WA 3P62A 3QBUA 1TG7A 3O9NA 5J5RA 1T96A 4H19A 3UGVA 1A0EA 4HPHA 2CBJA 2GWNA 2ZZ3A 5C9ZA 2FQIA 1J8VA 3POCA 2CLPA 2WHLA 2CERA 3LHZA 3RFAA 4Q7BA 1SW7A 3TH6A 3VUSA 1KD0A 1W5NA 2L5HA 1E9ZB 3STCA 3KWSA 3MCNA 3H2EA 4UQ9A 4F66A 4GY1A 2ISSA 4J40A 1UZ1A 4AWEA 3G1VA 1ZL1A 2OJPA 3D5HA 3QVQA 4LV4A 5GQBA 3OGVA 1JQVA 3QHMA 1GOIA 5DEZA 3V7PA 4GFIA 3NL2A 2ACSA 4QRNA 4GQRA 4C90A 3L4VA 1QW7A 3GG8A 4AZIA 2DW6A 1VRXA 4HPNA 1A5NC 1RALA 3RX2A 4KW2A 4HNTA 2E8ZA 5IBXA 4XZWA 1TTJA 5EKYA 3GDKA 2DDXA 2ZVRA 1PIGA 5K7JA 2VEGA 4AX7A 3VGGA 5AOUA 1HL2A 1E1CB 1FHVA 1YPFA 4LWWA 1ADDA 3AMKA 4EPEC 3MP3A 1C8VA 2XM1A 4X22A 1Q66A 1TX0A 3VNLA 3URNA 1AQ0A 2VT0A 4X2RA 4AC1X 4B15A 3ZJ6A 3QV8A 3GG1A 5AYBA 1HKIA 1M1BA 1Z32X 3O6YX 3H55A 3H4WA 4HCLA 3B0XA 3C8NA 1E4MM 3GHTA 4IIGA 5AECA 1G1YA 4DPPA 3GVQA 2SFPA 5LNWA 4MADA 5I23A 3C0LA 3QFWA 2VGFA 2CLKA 3MJMA 1UMYA 1V3JA 3Q2DA 4WSKA 1L2UA 1KRCC 2V0TA 1TWSA 5FAGA 1TMLA 5LGXA 3EWXA 2G3JA 3NO5A 5ABGA 3APYA 1SZEA 3S2LA 3SY8A 2OFJA 1WKYA 5FA5A 3HOJA 4R5EA 3ZYZA 1OM0A 1NDVA 2CLOA 4P61A 4KQNA 1EQPA 4JCMA 3HQOA 3PZVA 4S38A 9RUBA 5EMMA 4DBSA 1P0BA 1J5TA 1ITUA 1QU4A 1R0MA 4H8VA 3B8UA 1PYMA 4ZOAA 4UBPC 1DIDA 4EXQA 4YIWA 2YB4A 3LOTA 3NQVA 4Z1YA 4PUUA 1BHGA 3B4YA 1G4EA 5HULA 5E5CA 1I2OA 4WJ8A 4M19A 2GLKA 2ZZ6A 2VQTA 4DWSC 3UG4A 5SWUA 3W38A 4ZODA 1EF2A 1P4CA 1AJZA 1EWDA 3I6RA 2BHZA 1NFGA 1IYXA 4YTSA 4MKSA 1I60A 3S9ZA 5D2TA 3CQKA 1B3XA 1CIUA 5DBUA 2ZXAA 4PYSA 3M43A 4UUIA 1D7KA 4H7ZA 4MFDA 1N8IA 3SEPA 1J0ZA 2GUYA 1GJWA 4JD4A 4RNFA 5JBDA 4JN8A 2XHYA 3M0HA 3M46A 1RBLA 3AYRA 4LCSA 4NSBA 1V5XA 1S38A 1G5AA 1VZWA 1W9PA 3BE7A 2OTDA 1IQ8A 3U4FA 1BFNA 2WHKA 4MYXA 4WY0A 3C86A 3HG2A 1ZALA 3CASA 4HZMA 1OIMA 2Y5EA 1VBRA 3B03A 2WSPA 2XIOA 3WDIA 4DB7A 5C2CA 4UQAA 2XFYA 3C2FA 3PSVA 3RMJA 3R79A 4HA3A 1NWUA 3QMRA 3TCEA 4H2CA 1QATA 1W1YA 5TBOA 4UTLA 2B4GA 1JFXA 1KFCA 4OJYA 1JCJA 3VZZA 4DJDC 1UQYA 5IHSA 2VOMA 4JTDA 3B9EA 4PMVA 3FXGA 3WD1A 1MFVA 2NVCA 1CGTA 3EX2A 1TSIA 5HANA 1AMYA 3N3MA 3BV4A 4ZQOA 2RDTA 5A8MA 2PCEA 3EXTA 2ZWYA 1BYCA 1Z89A 3LTSA 4LUTA 4DN1A 1FP9A 1SO5A 3DFTA 4NNBA 1BG4A 1TZ7A 1KKRA 1Q6GA 3PSWA 2WWCA 4DO5A 1FDYA 1N8FA 4JNYA 4M7TA 2QJMA 4DF1A 5HWNA 2E9MA 4PB4A 1XX1A 2BBFA 2ZRXA 3NO3A 5IBXC 1VIWA 3M4HA 1R9XA 2IPGA 4PZVA 3A13A 2OR2A 1TTPA 3KL5A 3CWHA 1CGUA 4JHMA 5DCDA 2D20A 1VS1A 2RFGA 1UCWA 1JDCA 1Z7AA 2FFIA 1BYBA 1GVRA 5K4ZA 1OC5A 1D3CA 4J28A 3CQIA 1OC6A 1GKRA 1KLYA 1V0LA 1VH7A 1XH2A 3Q4DA 1DTUA 4Q8NA 4RW3A 3M07A 1FHDA 4ZSUA 3VIOA 4H00A 3CIXA 4PA8A 4YTQA 4W7UA 3PZGA 2WBGA 3P2VA 4UTTA 1OGBA 2A21A 1FQ0A 4LAUA 2ZWZA 2AQOA 3GXFA 4HOXA 5A5WA 4K8GA 5CPNA 3ISIX 3M0KA 4V33A 1TPUA 1JDFA 1P6WA 3QPEA 1XIIA 3VO0A 1PJ9A 3GIYA 3SCTA 5A6BD 3IUIA 4I7UA 2IXVA 1XJBA 5JBFA 3MKCA 1N7KA 5DMLA 4HMDA 2Y1HA 1MNZA 2NQ5A 3FNDA 2DFAA 3L2IA 3R43A 3LU2A 2NUYA 3GZAA 5EFDA 3CUIA 2JBMA 1PIFA 2Z6JA 1ZS2A 4PMOA 4LFYA 1SFLA 1ZJBA 3U2CA 3KTSA 3FGCB 4F0HA 2VKZG 4ECLA 5F2MA 1RQEA 1UBPC 4MAVA 3ATYA 1Q13A 3P74A 3AIBA 3AYTA 2QCDA 3LBOA 1M7XA 4GY0A 4GNVA 5CC3A 1ZBVA 3H7VA 1F7BA 5FIPA 1IEWA 5AB3A 3HO8A 3F5JA 4GI9A 2HROA 4I9JA 5HNRA 5D4YA 1XCXA 4EPKA 3BW3A 2VWSA 1X6LA 2J7GA 5CZJA 3GTXA 1MUWA 1RA5A 4JN6A 1Z41A 2NXIA 3SM0A 5CGMA 4RE0A 3V0UA 2WMKA 3UWWA 3BWWA 1KGXA 3BVJA 4BQ3A 2FZDA 1BKSA 2QR6A 2WJFA 1G6CA 2WNQA 2OU4A 3I3BA 2ZX6A 3CHDA 2ABAA 4N6EA 3UWQA 4Q6XA 4JXCA 5U4NA 4LH8A 2DZTA 4ADUA 1TKKA 3VOJA 2IQ0A 1M41A 3WUEA 3ZVHB 4XUGA 4MJZA 4N7QA 4CEXC 2Y8KA 1J2WA 3WNKA 1KRMA 5LZLA 2OZ0A 4LF1A 3WBEA 1BTCA 1DWIM 4UNKA 5DBTA 1L6SA 1UOZA 4EXAA 3R0DA 1R3YA 4AIBA 5CJ5A 3CMGA 3GW0A 4M6QA 4CCEA 2YW3A 1XL9A 5CJMA 5FESA 3DX5A 4NZFA 1D3HA 4AWSA 4RNJA 4DXVA 5IM51 4H9ZA 2VZOA 4GRSA 2PDJA 2QAFA 2JIEA 4ZTXA 1K3UA 1OF8A 1B9BA 4M1RA 1ITCA 3OLIA 2J13A 5LIUX 3NVTA 1P7TA 2WXDM 1DTNA 2ATMA 2O9PA 1A3HA 3APGA 4X0VA 3ITTA 4QS6A 1SO3A 1J5SA 2VM8A 1NSJA 3N6HA 5EBAA 4C7GA 1AL8A 3F2BA 3L5LA 4JKMA 4S3CA 4LY4A 2DSUA 5A2CA 3TU9A 3VIFA 4Q8OA 1WO2A 4RW5A 3W7IA 3IUHA 2E40A 3L4XA 3N25A 1E15A 1CX9A 2AMGA 3A3WA 2ADAA 2FB3A 1YW1A 3TIMA 2QJHA 5JBEA 1GHRA 4LUTB 3A22A 3S6OA 3HJEA 3B8IA 1TVPA 3U4AA 4GI4A 1HJUA 3I4EA 3L4ZA 3PWIA 3G1SA 5CSSA 3TXVA 1AH0A 3EGJA 3SQLA 1S2TA 1TRDA 1GG1A 2B31A 2YX0A 3LTPA 3W1LA 4FR6A 1XIBA 3M5VA 1QO2A 3H12A 2CLEA 3UWVA 1HKJA 3IIVA 2EG7A 1JPMA 5DELA 2XGBA 3EOEA 3UWZA 1GGOA 4PTVA 3AU6A 3QXBA 1EJWC 3TOPA 2OWXA 1CBGA 3WNNA 2DZWA 3CTLA 3LRLA 4GH1A 3BJSA 4MNLA 1E6NA 3A4JA 4HHPA 4WKHA 3ZXWA 3B0PA 2BFGA 4AX6A 2ZQ0A 5A6KA 1XRVA 1R6WA 1VYPX 4U3AA 1IIHA 3H22A 1LRQA 3MUCA 2IMRA 4WJXA 2A5HA 2HDJA 3FYPA 2DVUA 2QCEA 1XICA 3URBA 3UFYA 4Y9NA 1Q45A 2G3MA 1UWUA 2CLIA 3MW7A 1SJCA 1S5NA 1BYDA 4DNHA 3VDBA 5E70A 3WBXA 5EMJA 4C6NA 4DWSB 4HOZA 5BZAA 4CD8A 1Z3NA 3VOCA 3ZLHA 3EWZA 1XYMA 4ZO6A 3IGSA 1KWKA 1CEOA 1K8YA 5HWJA 1FWJC 1W8GA 3T1GA 3SGUA 2E67A 1W1TA 5EYWA 3PR2A 4HB7A 1S5VA 1PTGA 4HQVA 1OQFA 1KQZA 4J3TA 2O92A 2F6KA 1AJ2A 3KOZA 3B0UX 3OIHA 3EBVA 1RLCL 3IEBA 4JTUA 3V1PA 1L6FA 3NZ1A 3BPWA 2QF7A 5LNUA 1XI3A 4ZSTA 2P10A 2GVEA 1OFDA 3H7RA 2GSHA 2V63A 3NM1A 1S2AA 4HU0A 1X97A 1M03A 5LSMA 4C5ZA 2NLYA 5FOOA 3H4XA 1LLOA 3HPXA 1ENUA 4ZR8A 3N9SA 2C16A 2X05A 5M2FX 1RA0A 5GPRA 2X1RA 5TAOA 5H8PA 4UCGA 1UWIA 2UY5A 2DZBA 1DXFA 3WQDA 4LOCA 5I7GA 3BOFA 2C15A 3O0FA 2VEPA 2E9BA 4XD5A 2IKHA 4HKPA 4NI3A 1CB2A 4UIOA 1MI3A 4FNSA 3WF3A 3GW3A 3MSGA 4A8NA 3SCSA 3VIIA 1GQLA 3L65A 1K02A 1VEMA 3IJ7A 3KOXA 4PUMA 3VGDA 2J27A 5JMUA 4JIIX 3VU2A 2OYKA 1DEDA 3QV9A 1UQZA 4CQ9A 2AAMA 1EB3A 1FX6A 5J8LA 3P67A 4E4FA 4KS0A 1U33A 3GKFA 3H54A 4OECA 3LPFA 5ENLA 1DPMA 4FXFA 2PDGA 5LYRA 3I65A 2ZZ2A 1DHKA 1DIOA 3PJXA 2R8WA 4F40A 4MPQA 5C9WA 1J01A 2ZVIA 1JRBA 5FAJA 3B9OA 3SJ3A 2PWHA 3MY9A 1QFEA 2G97A 4ICCX 2HMCA 2ZX5A 1E0UA 2BXYA 3NYZA 4ZXLA 1EJXC 3UG3A 4G1NA 3BUVA 4OKDA 3V18A 3VX1A 1JRCA 5A95A 4JTIA 3FDKA 1OYBA 2QCMA 3CHCA 3KDNA 4BEUA 1HKKA 2QGHA 1VB9A 3V4BA 1IXPA 5DO8A 2NW0A 3MP5A 3WQ4A 4DXXA 3COTA 1EHNA 2HBVA 1F3WA 3WH9A 3VCCA 3SURA 3DFHA 5FSDC 4E0CA 3CAKA 2PDMA 3RJXA 3IK4A 3MWCA 1R2TA 4M6VA 4LYRA 1UH4A 4HNVA 4NZ3A 1RD6A 4RE4A 3GS6A 5HXMA 3DKJA 2EPNA 1SW3A 2EO7A 4PTXA 4HZ8A 3A5FA 3N9KA 5T9BG 5FD0A 3WO8A 4HA1A 4LAZA 4XIMA 2YDQA 3NOEA 2Q3RA 1KCZA 4WOZA 1R85A 4MHBA 1ZAIA 4LJ3A 4ZO9A 2JEPA 5LIYX 5HUOA 1F6KA 1GONA 4FAMA 1TZZA 3A4XA 3G0UA 1O60A 1XQKA 1AZ2A 4FLSA 3VDAA 4M1BA 1ZZMA 3W00A 4Y8EA 1E55A 4ERAA 3WLLA 1F5ZA 3FSTA 3S6TA 3W7QA 4C5YA 2RH9A 1C8YA 3S0CA 1DWFM 4IIDA 5FJJA 1ZJAA 3W27A 5D32A 3MSDA 3VGFA 2X1TA 1H63A 4XZ9A 2BGSA 2FLIA 1O5KA 3VCRA 5A94A 4AD5A 2W27A 1XLCA 2QZRA 1S1PA 5M1TA 3V0SA 2CHOA 1KNWA 1DE6A 2Z28A 2PD5A 2YFOA 3SCPA 5H8MA 3GY1A 2QMJA 3NQ6A 2D2JA 4DJDA 2PFHA 1MW1A 1X6UA 3UVIA 2CKRA 1MEIA 3FEQA 4H83A 1SPQA 4W4QA 4J9JA 3UZJA 1BSIA 3W7LA 1XLIA 3G1HA 5AYZA 3R0KA 4TR9A 2J79A 4MSSA 1LL6A 2Y7DA 3WK3A 4N02A 1AG1O 5XIMA 4GJJA 4WXZA 2VCBA 3CZGA 2GVGA 4DO4A 1W9BM 5FF7A 1U5HA 2V30A 5CLTA 4FXRA 3P0WA 2PD9A 4GA8A 1TPEA 1H7PA 3G0SA 3IIOA 2Y5SA 2W62A 4ZENA 2D0GA 3BW4A 3TAOA 1WBJA 3SUSA 3GVGA 1YPIA 5DT7A 1XS2A 4LBRA 1NDZA 1XLJA 1Q7MA 4AIOA 4H6KA 1CCWB 3FCPA 5BWAA 2V3DA 2P5NA 2DJLA 5HNTA 2J7CA 1OEPA 3CIVA 1A5CA 3KCOA 3ABQA 5KINA 2WHJA 4QCEA 3ORWA 3GH5A 1W56A 3L2MA 5EGRA 4UFIA 1PVNA 2VZTA 3CT7A 1FKXA 4H8UA 1P0KA 1ZU8A 4PBGA 4EACA 4GINA 3CTTA 3PAJA 4MNKA 1RHCA 2P3ZA 2AKMA 1EP2A 2QCDB 5CZ0A 2F2KA 1C7TA 4ZZ9A 4Q7IA 3WLJA 1H1YA 1LBMA 4NXKA 4JTEA 3G1RA 3LXAA 3SADA 3W53A 5D8ZA 1FY6A 4KEUA 1FH9A 3BK0A 2OQHA 3U48A 3E2RA 4ONVA 4C6FA 4RPQA 5DY2A 2Y85A 3WF4A 4UB9A 3LI1A 2X7VA 3GVWA 3ZQ9A 2PTYA 1W5OA 2FPTA 3PG9A 4RR4A 3OOQA 1XC6A 1DJIA 4K2SA 3N2OA 3UP8A 3EPMA 3N29A 1CT5A 3C5QA 4JTHA 1PKLA 3NDOA 4FX7A 3W7CA 1UD8A 3WIJA 9CGTA 3A23A 4UCFA 1QI3A 2C3ZA 1WAUA 4JOMA 4L4MA 3CYVA 3TSDA 1XIGA 1SJAA 4Q33A 1KXTA 2XVNA 2CITA 5HPOA 4NZCA 2EXOA 1TYGA 4M7SA 4KGJA 3VTRA 3NQ2A 3MT1A 4MVAA 3MU7A 3N4FA 3DHPA 1JQXA 1WE5A 3JZEA 1J2BA 4XO7A 1XGDA 3W7OA 3QMTA 3EXSA 3SUTA 4L65A 3TE9A 3PPFA 2Y89A 1F07A 1ZTVA 3H24A 4U33A 3TMQA 3C2EA 1W3LA 3IAPA 3N2BA 6CGTA 2YDSA 2GOKA 1GEQA 1UUQA 3ZS4A 2GGIA 3VIMA 1PX8A 1WAWA 4LEQA 1LUCA 1XLEA 1JI2A 4LEFA 1A5AA 2A1YA 1CXHA 1VCVA 3BAJA 3QGAC 1WZKA 2XH2A 1TR1A 5D30A 3L2LA 1C29A 1OK6A 2DT2A 2PC8A 4ZCWA 3OHIA 1ZAHA 1RXOB 4DXKA 1M65A 4HZ7A 1BVZA 3FY1A 4LUSA 1Y5VA 1S3TC 4BZYA 2PWVA 1ODUA 2XH0A 3LN3A 4PODA 3BXWA 3AHXA 4Q4MA 3OHMB 3T0DA 3SECA 3PAOA 3JU2A 4DJDD 3FEMA 4N9BA 3RPDA 4UOQA 3IRDA 4JNZA 3VVGA 5E9AA 2HEJA 4Q8VA 1F76A 3S46A 1I45A 3CL6A 4JL1A 5I2UA 4JHOA 3UJ2A 3W7JA 3E12A 3W1RA 5LA2A 1WKFA 2PMQA 3TKFA 3V1HA 2CYGA 4HJFA 4KFOA 2PDIA 3OVRA 2Y7GA 2DY3A 3LQGA 4HCHA 3MHUA 4ADSA 2J7HA 7PTDA 4DWDA 3WLTA 3GB6A 4AU0A 2J8GA 2XIQA 5E6ZA 2FVLA 1LCOA 1PZ0A 1SMAA 3VZYA 3INPA 4JEJA 2WSRA 3IS4A 1YXYA 4P8UA 4O16A 2V3GA 1TZ9A 1JXKA 3LY0A 3BZGA 1XLMA 1LOLA 5LA1A 2DH3A 4E2VA 4EP8C 1V6UA 2OLAA 5KITA 4LYQA 3IGXA 4PTWA 1GW9A 3WD0A 1W9UA 1Z6KA 1TRIA 1XBVA 1GCYA 3LM3A 4QQ3A 3PZIA 3RX4A 3TN6A 1E71M 3RIKA 4MYAA 4GWEA 2ZIDA 4NZ5A 4JEQA 3DI1A 4Q8UA 1OCJA 3WH8A 1NDYA 4YVVA 5LIXX 1WDWA 4H6QA 4Q4KA 2NQ9A 1MSSA 3W29A 5LHEA 3U5YA 4AZCB 2EPKX 1I4NA 3GC4A 3NXFA 3WQ5A 3E9AA 2J9ZA 3KXQA 4HN8A 1RBOB 1GQKA 2FYMA 2GGJA 4QCFA 2TSYA 3W70A 1JD9A 1KBBA 3LMYA 2PDLA 4QBXA 5JQ9A 4DUXA 2PZ0A 3HV8A 4GFSA 5D33A 2J7DA 1NF0A 2E6YA 4DZAA 3TFCA 4L1XA 4NF7A 4FEZA 3RAOA 3F4CA 3PVFA 3SCQA 3A4AA 2RKXA 3OPSA 3WYZA 1KO0A 3MI2A 2WVUA 4UTHA 3IVSA 1N2VA 3UNTA 1G4TA 2B7OA 1LUCB 2WSKA 3XISA 1UW9A 2ZX9A 4A2SA 2NV9A 4XX6A 3KVLA 1GVOA 3VNJA 1KM5A 1A80A 3ZVHA 3S5ZA 4Y6GA 3OW1A 4KBXA 5DFAA 4ENLA 2ZRWA 4DF2A 2DP3A 1T7LA 4GX9A 4TU1A 4GC4A 2DV0A 4D6IA 4JQ2A 1SW0A 1FP8A 3GVRA 2IS7A 1YNQA 2QVHA 4CU6A 3EX6A 1ITXA 1DJHA 2AQWA 2XJ7A 3GC5A 3LS9A 3XIMA 5LIKX 2VFFA 3CUHA 3WF2A 1OFOA 1RQBA 3UZZA 1Q8AA 3D6NA 3W1PA 2PDXA 3K8KA 3KM8A 3VMPA 1H7OA 4LC6A 3AROA 4C7FA 4EKJA 4UQCA 2EGZA 2J7EA 3ZLGA 2RDWA 3FKKA 2EPLX 2X09A 3UZXA 2OZ8A 2IXUA 3VM7A 2WM0A 1QJWA 3IJIA 3E74A 4GVIA 3G6LA 3C0SA 4Z1AA 1QUMA 5C8BB 4FP1A 5FKYA 1LWHA 4IIHA 3GXNA 3F4WA 1AQFA 2PPGA 3PZ9A 4R27A 3B04A 3VZXA 3F1QA 3MUY1 3QY8A 1MWOA 3NQ7A 4Y8FA 3WUGA 2P1FA 3QOMA 4HIBA 2ZA1A 4DO7A 4ORIA 3P81A 3GIQA 3T08A 5F2LA 1YXCA 3IIZA 1YTKA 3OODA 3UG8A 5D9MA 4ZXOA 1MYRA 4D6HA 1I1XA 1W3TA 2ZZ4A 2W61A 2ZKMX 3AISA 3CUFA 2I16A 3VKKA 2EQDA 1VAHA 3DBPA 1B54A 3GDTA 4P5UA 4AH7A 4UQBA 4UOZA 4JIRA 1NF7A 5AC7A 1IR1A 4D8AA 1EBGA 3SO7A 4IWWA 4W8AA 3T42A 4L7ZA 5FEPA 3G2GA 3GFZA 5ABFB 2QNEA 3BG5A 4MDPA 2EBNA 1C93A 3WELA 3DYMA 1ISYA 1YDVA 3OLDA 1X8CA 4FA3A 2VDHA 4JKLA 5G5IA 1BGAA 3HFYA 3DYOA 3KVMA 4O1DA 5D09A 3IVTA 1V02E 1HJWA 3GR4A 1OINA 5AHNA 1I0DA 3RCYA 4GYFA 3W75A 3UF9A 4YS1A 4CCZA 4GACA 5FSEC 1C7SA 1Q4WA 2GYIA 3RNDA 1WA3A 3O0KA 5I3KA 1QXLA 2VVNA 1H11A 5FF2A 2D23A 3FA4A 1AD4A 4PCTA 2WCGA 2QT3A 1BRLA 1IZKA 1QRQA 5DRIA 2GSEA 2E8YA 4XK2A 2YB1A 1VCFA 4GIEA 3T40A 4RDWA 1SFJA 1LLZA 1F6PA 3PK7A 4IJRA 1XRSA 3GDLA 4N42A 1Q4NX 4JYDA 4B90A 3G8RA 1ONEA 2PA6A 3O3RA 4JTSA 3TN3A 1KM0A 3LPGA 4HNCA 2CFFA 1K4HA 3AUJA 2VFHA 1HW6A 2O9RA 3T2OA 2IPWA 3CZEA 2GJRA 4MTVA 3R10A 3SSJA 2X30A 1W6TA 2BP1A 5KZ6A 5DANA 2PDYA 2OX1A 3THQA 2EHHA 4O0QA 2C19A 3EDFA 1L0PA 5CBBA 1QOPA 2X7WA 4NASA 1XYBA 4GKLA 3LCWA 2WNNA 3MUZ1 3R13A 3P80A 4GQQA 5A2BA 4DJFA 1KCXA 4OU1A 2WMGA 4EX4A 5C2GA 5GJPA 5FEZA 4XSLA 3QFEA 4Z1BA 3ABOA 4EAYA 4Y9OA 1VBHA 2GJPA 3PPCA 2V82A 4D1IA 5CSRA 3HJZA 3IRSA 4UTUA 3MMUA 1TTQA 4J4KA 1VF8A 3WFAA 2BVTA 2XN0A 4FS9A 1A5BA 1H7XA 4MOZA 4IQLA 2G95A 1XPGA 3CHFA 1KM3A 4IOTA 3VI2A 4CVWA 2Y61A 5KSWA 5XIAA 4GQGA 2H3BA 5DY3A 1DJYA 3H2NA 4ZA0A 1I6NA 3BO9A 5CZTA 1KXVA 2Z1BA 3O05A 3UXKA 1GKPA 4UFJA 3KS6A 2VCAA 1R7AA 4GQ0A 5BOFA 5D2WA 3CWOX 1R86A 4OV4A 4YU1A 2GJXA 3HA1A 4JQ1A 3IGHX 2BXZA 3PB2A 3SUVA 3L9CA 4CU8A 4GZIA 3S47A 5CG0A 1P5BA 1HXJA 3UJFA 4GI6A 4ACZA 1A50A 3BDKA 3NNTA 1E70M 5HR7A 1AH4A 4D1JA 2VFDA 4PRWA 4G7EA 1ICSA 1GOXA 1E1CA 3STFA 1XD0A 3C2RA 4D6FA 4ZGYA 1XP3A 1IWBA 5G2HA 1THFD 3S8HA 2WMJA 1GZGA 1H50A 1RK6A 1RJQA 4E4PA 1QI0A 2E77A 2ZADA 3CL8A 4OGZA 4TTUA 3WLNA 1QPQA 3BOXA 6PTDA 1XIJA 1M5WA 4ZO7A 4D71A 3HQNA 2CLLA 5BOEA 3ZM8A 4NJGA 3VFCA 2VFIA 4YWSA 2WLZA 5CSYA 4FALA 5CZSA 4GC3A 2PRHA 2UY4A 3QW4B 1HGYA 2YLLA 1WXYA 4S39A 2W66A 2Z27A 2WZEA 5A8PA 3W1NA 1GYMA 3PN8A 5EU9A 2VP8A 4OUEA 1X7IA 2CXEA 1TV3A 1EHAA 2PBOA 1TPH1 1X1OA 2C0AA 4U2ZA 4Z08A 1ZJIA 4J35A 3YPIA 3VE7A 3CV1A 1LOSA 1XSJA 3W76A 3QQ1A 4HD5A 1W3JA 2A3CA 4ML9A 3VD4A 3C8FA 3AJ7A 1LBFA 2W92A 3MMTA 3A12A 3MQTA 1R3VA 1FWGC 4RK8A 1R5YA 1B3YA 1XINA 3G8EA 1N55A 1BQCA 1U1UA 3WEMA 3KZSA 4FNQA 3OJGA 1YX1A 4O50A 3W1QA 1OFQA 4IX0A 1QOQA 4JY8A 3WJXA 3LYEA 3N12A 1R2SA 2QCLA 3AXXA 2GUUA 3OB8A 5E93A 2RDXA 4Q32A 4B91A 2CZFA 1QI5A 5BXSA 3DZ1A 1ZENA 2HWGA 4R9XA 1BQGA 2HBXA 3LSCA 2ISFA 5CG7A 3GDRA 9XIAA 3QTPA 6A3HA 4ADTA 2CLFA 3CMJA 1BSLA 4EVZA 3KLKA 5HMFA 1KTCA 4PRTA 2VR4A 4DJEA 4DRSA 5F1VA 3SGGA 3KAOA 3G1XA 3AHTA 1CGYA 7A3HA 4QEHA 1AW2A 2BB0A 3UZWA 3EZ4A 1Q5MA 4PC8A 4DZIA 1ISWA 2V2DA 4I6VA 1YDOA 1J96A 4HP5A 4HNLA 3L4WA 2H8XA 1XLBA 2OSWA 3KW3A 1EA9C 4GNJA 5D2YA 1E73M 1UWTA 3EX3A 4RZ5A 5RUBA 3CBWA 4JKKA 4DJFD 2H9AA 2OG9A 3SRDA 3GG0A 4L4LA 4NJHA 3S42A 4A4AA 3LXBA 4QQUA 2V9DA 4AY8A 1EXBA 3BICA 1H0GA 2QPSA 3P84A 1FDZA 4UNLA 2REQA 2JF6A 3GXMA 4WGXA 2PDQA 1DHPA 4B2DA 4MWAD 5F7UA 3B3DA 2QF8A 1XFCA 1HUVA 3V36A 3W2NA 3NZQA 2PS2A 4JICA 4XZLX 1M7JA 4FK9A 3KBSA 2ALRA 4GXWA 2J25A 3LDVA 4J5NA 1QT1A 1EO5A 4J3XA 4UQDA 4H9MA 3WF1A 1J4EA 1TA3A 2WBKA 1CLXA 1RBAA 1ZB5A 2ZXQA 4AFYA 1HX0A 1EIXA 1P0DA 2Q02A 4QJ4B 3OG3A 4JTLA 2GL5A 5I02A 3CAWA 1PKYA 5C70A 4YCPA 4NKCA 5C9UA 1CW2A 2FHFA 2QIIA 1NQ6A 4F48A 1W1B1 3RRAA 4U28A 1GOKA 3KCLA 4IQJA 4O15A 4QG9A 4HYVA 1VBGA 2V38A 3M0JA 1QVBA 4BQ2A 2YXXA 3HGRA 3LLFA 1LROA 2D69A 3BURA 5BWFA 1PZ2A 3O07A 3H2MA 4IXXA 3STEA 2PDBA 3ID7A 1EWEA 3RF9A 4J2PA 3E6EA 2TRSA 4D6EA 4UTIA 5FF4A 4K38A 3HZ3A 2VC9A 2J88A 2QULA 3VD9A 4EWND 2CWNA 1PDZA 2QDDA 1E0VA 1L9WA 2VI0A 5HJYA 1FOBA 5G4WA 4GGBA 4PCFA 3W1TA 4AVNA 1WNOA 4XSMA 3GBEA 4IFKB 1OWQA 3S5SA 2PCQA 5HAOA 5HQEA 2VQUA 3W82A 2PP1A 3GAYA 2WKGA 3CZJA 1LG2A 1UPPA 2WYSA 3G77A 5JVLA 3URQA 2DPEA 3W1XA 3RUBL 1B90A 4GJ1A 4OBRA 4CN1A 3DIPA 2B7NA 1UD2A 4JTCA 3V5FA 1OC7A 4PMYA 3ONCA 1J0HA 4C6DA 6TAAA 3AZSA 4LC8A 2NVAA 3N34A 4TIMA 1KC7A 4IH3A 1P1XA 3IJLA 3BV7A 2ACQA 5I5RA 3WJSA 3CPGA 1QWKA 2H90A 5I79A 5JUVA 4U31A 3SSZA 2GZXA 1O5QA 3HBLA 3K4AA 4PMQA 3N4AA 5KZEA 1CXIA 3MKVA 1JYWA 3LLDA 1CI1A 3TWAA 4QE1A 1FCQA 1W9VA 3HV9A 5BMXA 1US3A 4R7OA 1AQHA 4QE4A 5D04C 4BQ5A 5M5DA 3KWXA 3WKZA 2D2OA 1XCFA 3AU2A 4IPIA 3H26A 3QRHA 3K8LA 2H8ZA 3MPGA 3W7DA 1H5VA 3CH0A 1ISZA 4QITA 4Y9MA 3PNUA 3NZPA 3SDOA 1VHNA 1KCLA 2J47A 2YXOA 1NOWA 5D9PA 3GFXA 3PPHA 3W6MA 1J79A 3LCHA 3QC3A 3PBYA 3KOFA 4KFNA 3GNPA 1JAEA 4XIAA 2X41A 3THUA 2VX4A 5K2ZA 3KHJA 2IPFA 3LBCA 3VYLA 2Y70A 1P0EA 2YOCA 3SAZA 4P7LA 3RG6A 2R1MA 4LB4A 4DZ5A 5AN7A 4LX4A 1JUBA 4BFAA 1Q8JA 1KM4A 1RSCA 3FIGA 1GKQA 2P50A 4QISA 3F2CA 5BU6A 4RNIA 1Z44A 1RR2A 4B3KA 4B5XA 4GZJA 1FCUA 3CJPA 2FGZA 3L4TA 2G4JA 2OOFA 4ZL1A 4PTMA 1QPKA 3W72A 3UERA 1HL8A 3P93A 3ARUA 1A4LA 4C65A 1ZAJA 4JX6A 3GO2A 4YYCA 2QVNA 2C79A 2PC4A 4O1EA 3KBMA 2GQAA 3KLLA 1UWSA 3OVQA 3UPWA 5EBUA 1WUEA 4TUFA 4X63A 3VNYA 1ZPTA 1EKOA 1PYFA 2WVVB 4N4PA 2ZBTA 1NFPA 2FH8A 4UFLA 3R1ZA 2X16A 1F2JA 2O9OA 4JFVA 3QKZA 3PTMA 4UTKA 3GH7A 2G37A 3GX9A 1G67A 4HHHA 3BGGA 3E38A 2OELA 1KQYA 3WF0A 4I8YA 2KZHA 2I7GA 4GO9A 3NQCA 2FGLA 4P2VA 2BG5A 3P60A 4DVOA 3AIRA 1QO5A 2I57A 3B0VC 1VYRA 3OIXA 5IOBA 3EX1A 4PB5A 1R38A 3CXOA 4XTIA 3UYCA 4L56A 3QSTA 1JVNA 2GFTA 2VYOA 2AAAA 4H9TA 3THCA 1L6YA 1MQRA 1IXQA 2O4MA 1U1HA 3S1WA 1QK0A 4MLRA 2OEJA 1PKNA 2HJPA 3KBJA 3LGEA 3DG7A 2YBVA 2I5GA 3CMFA 3THAA 3B06A 3GK0A 4TX6A 3LA4A 1N82A 1Q6FA 4FR1A 1TUXA 1FXQA 1X1NA 1FWHC 2BY0A 3MCOA 1B3VA 3TSMA 1W0MA 3S5OA 1GQNA 3CIWA 5T26A 4WRHA 4EXBA 4O17A 4J3WA 3T2PA 2PSNA 1G94A 4LU0A 3EAUA 1WQ5A 4HHMA 4PMXA 4MUZA 1TREA 1Y5XA 4HGXA 1H2JA 1E1EA 1POJA 2VURA 2RGLA 3ZR5A 1MEWA 4MNMA 3VGBA 4XBJA 4Q4QA 2C1GA 1SZNA 4UWMA 3CGTA 1XC4A 2IW0A 5C0QA 1OFPA 4JPGA 1BWKA 1Q6DA 1IV8A 1UASA 2WC4A 1J0KA 4QSFA 4S3GA 2BASA 1TMHA 3QF0A 3WX7A 3BZJA 1TJ2A 1QI4A 3A9IA 3M6YA 3S6DA 3I3EA 3ZWTA 4G6CA 3LLXA 2XWDA 4A3YA 3UZYA 1HN1A 1DQWA 2ZUTA 3L4UA 1W54A 1VBUA 1JD7A 2Z1KA 3CS2A 1JIBA 2ZZ7A 3R8GA 5I24A 2YCEA 1ZP3A 1IGWA 1NY1A 3B8WA 1XCWA 5G2IA 4AEEA 3RLVA 1FWEC 2J9YA 2E6DA 3G6MA 3PTKA 1OCBA 1RD5A 2GSJA 4NRSA 2GOUA 1DJQA 3W22A 2WZMA 3WLSA 3ARTA 1W5PA 1EJRC 1MXDA 4PL2A 5BXTA 4F0KA 1LT7A 1H1ZA 4Y2WA 1PPIA 3W6YA 2Z6IA 3KFTA 1R3WA 3PBMA 3HQPA 3LV6A 3WDRA 1V7AA 4LCRA 1IWPA 1UZDA 2PGFA 1E6QM 4F2UA 3BGAA 4G5DA 2W67A 2CHRA 4JN7A 5G4HC 4B92A 1LQ0A 1DE5A 1W5QA 2UWFA 4LRSA 3U7BA 1IZCA 2XVGA 2ZTJA 2FGBA 4K8EA 5K9XA 4WDWA 1A53A 4M24A 2EG8A 2G3NA 1K9DA 1UC5A 4KIEA 4KCTA 1JG9A 3BLEA 2CXGA 4DO6A 2Z00A 4A35A 4A6GA 1BAGA 2CETA 4HMEA 2VGGA 3T07A 2F9RA 3UA4A 4UTFA 4A2RA 4XZIA 1UJPA 1EYEA 4V28A 2YIHA 3ZSTA 1B3ZA 3RLUA 3BAYA 4V15A 3WBYA 4WQ6A 3JVAA 5FF3A 2PDCA 3PHAA 3I4KA 1JNEA 3QHNA 1VFMA 4I7WA 3T0BA 2ZDRA 1R46A 5A69A 1AFSA 2ZOXA 1RP9A 1S5WA 4JFSA 5I77A 2PLMA 1K8ZA 5MKGB 3ITVA 3WNOA 2ZXDA 2FPVA 1Q2RA 4PMNA 1B1YA 1BWLA 1EUAA 4F0LA 1ZCCA 1IR2A 3PFMA 1QNQA 1G01A 1C3FA 3TV8A 4AD3A 5REQA 1US2A 4S1FA 1KFKA 5DMNA 2Q8XA 4P7RA 5HQLA 1UP0A 3NL5A 1RJPA 2JEQA 2EJ1A 1P7TB 3Q37A 4XZBA 1D9EA 3VIPA 2V67A 4UQEA 3L5AA 3WQ6A 4XKYB 1QK2A 2C6QA 4C6CA 1UR0A 2X0YA 4LV9A 3RLGA 6ENLA 4GIYA 2R82A 2Y2WA 5C2XA 5EY5A 2J6XA 4V2XA 1ALDA 4ZQPA 4WX2A 2QXWA 1R3QA 2F6UA 3TZFA 2HE5A 4ZQNA 3WDQA 3H2OA 1OX5A 2RDUA 2Z1XA 3EOOA 1QAPA 3EKGA 2HE8A 8CGTA 3MMWA 4IGHA 2V3FA 2BLEA 2FZNA 2NX9A 4A8IA 2GQ3A 3I6EA 3UT0A 2DIEA 2HPIA 3TTEA 3HU7A 4J27A 5A8NA 1FWFC 1XLAA 3CV6A 3O6CA 4AB4A 2Q09A 3CQJA 3KRSA 3Q45A 4ZB2A 4GQBA 2X1SA 1K1DA 3PZOA 4FIRA 3TOYA 1PAMA 2OPJA 3DCPA 2J4GA 1UB3A 3W26A 4RPPA 4OBSA 4JY9A 3LTYA 3NSNA 4AD0A 1OIFA 4YMZA 2VC5A 2HVNA 4S3EA 4JBRA 3PJWA 3TSBA 4X3ZA 1CXLA 4HNOA 4DI9A 4XB3A 3NUKA 1GOQA 1KBIA 3KVKA 4E38A 5HNUA 4WF7A 1UZ4A 1BXCA 5HR6A 3RJYA 1K77A 2X1IA 2YBUA 4UTMA 3MHGA 2WNWA 3OU8A 2C0HA 2FH6A 5AHEA 4US5A 2ZZ5A 1UR4A 3VIGA 3H23A 4M80A 1VFSA 2TPSA 3M0YA 1V3LA 3BJFA 4IMGA 3NAVA 3L0GA 4LSBA 5DCEA 3SFWA 3BQ6A 4F4RA 4NAFB 4QEEA 4CNUA 1VJIA 3ZMRA 3TYCA 3UY8A 1EX1A 4A3QA 1DWJM 1QHPA 3KP1A 2I5QA 3N6QA 4H9XA 1L6GA 2Z0IA 1Z9AA 4H2HA 4PUDA 2V2CA 4M6UA 2E9LA 3OGSA 3I3DA 3IAQA 4M8UA 1KCKA 3DOPA 3A3HA 4GCXA 3QKEA 3BTNA 3OO2A 1ZBCA 4QJ3B 4F9JA 2PTDA 2PWFA 4GCAA 5JIPA 6XIAA 2VELA 3EDJA 1BTMA 4URIA 1TVNA 3IJ9A 4GHRA 3CQHA 2V8ZA 2R24A 1MVYA 4GUIA 3LRKA 3AXIA 3ZOAA 1TJRA 4CNTA 5EL1A 1KWGA 1XLDA 2QYGA 3G1AA 3TZNA 2Y24A 2WVVA 3DERA 1DYSA 1SR9A 2X8RA 1OGGA 2QJIA 2PU0A 1PWMA 1RK5A 3ZIZA 2XN1A 2PF8A 4O1AA 4BY3A 4Z1CA 4I7VA 3ERPA 3N4EA 2X0SA 3PZMA 4JX4A 2VEKA 1F61A 1MZHA 1FWCC 1EDTA 1XQLA 3ITCA 4MJMA 4QHRA 3BLIA 2UZ9A 3H2FA 4H6RA 4DBWA 1PHWA 1TPFA 1QNVA 1LRTA 5FEWA 1F4HA 1K70A 1REQA 3GZ3A 1V93A 1KFWA 1UROA 2BY2A 5A6BA 2VEFA 3MHFA 2DSKA 1K9TA 1PUDA 1UA3A 5BOOA 4Q4SA 1UWQA 2G5WA 1GVFA 4B3LA 3P61A 1FWAC 1EC7A 1RVKA 2ALDA 3O6AA 1EPVA 4DUWA 5H1WA 4D9PA 5KZMA 4M29A 2JKEA 5ABHA 3VNMA 5G1TA 3A3XA 3FLUA 1W1ZA 2HS6A 3DDMA 4IL0A 4QAIA 4B5WA 4PSRA 1QNOA 2WHMA 2E68A 2ZA3A 1DJZA 3BAIA 3WMLA 3FS2A 4IPJA 4TV5A 1NFBA 1KLZA 2RUSA 1CECA 3CU2A 4H9UA 4ZOBA 5AYYA 4AAJA 4Z2IA 3SUWA 5CPQA 1NOUA 1KFJA 1CNVA 3QJAA 1JL8A 1S2UA 1PIIA 3P5YA 1I2NA 1GZJA 1GQJA 4HVXA 2CKSA 1R87A 2WJDA 2HZGA 1O68A 1XLHA 3ALGA 2CHNA 4XKMA 1LLWA 3I68A 4AVFA 4AZGA 1FWWA 1PL9A 2EG6A 3TN5A 2P8CA 1IT8A 4A8LA 3DFYA 4AY1A 3NGJA 4HBKA 2ZA2A 1BVNP 1CB7B 2PRLA 2B7QA 1MEHA 1JUKA 4CCCA 3GXDA 4DM1A 3SIMA 3B9AA 1E6RA 4FHAA 3UJSA 3KOYA 1A5LC 1J6PA 1CDGA 1NQKA 4XBKA 4AZCA 3ABSA 3VD3A 2XWEA 2H6RA 3ZWSA 4W7VA 3BLKA 4UTWA 3H8AA 4Z0SA 4YLWA 2Z1SA 1UP2A 4JQ4A 1FWRA 3RHGA 1OVDA 5LHFA 4B5VA 2EKCA 1B4KA 4CEUC 1HJSA 1J9YA 4J1OA 4ILSA 1JF5A 2QJJA 2DZUA 1XLFA 3N73A 2VFGA 2PP0A 1WB0A 3W1UA 5D9OA 2CBUA 3ARRA 1OX4A 3NO1A 1OY0A 2A0NA 4LANA 3KRZA 1TV5A 3LSBA 3PS7A 4PH6A 2NWRA 4GNKB 4O1CA 5CSUA 2C7FA 2YLAA 1JZ5A 1ONRA 2V69A 4CGTA 3DFNA 3AJXA 1LQAA 1W3KA 3BL3A 4W89A 3SI9A 4PEKA 2W0UA 4RUBA 4CQ8A 5HATA 1O66A 2O55A 4IIBA 3T78A 2JGYA 4I5RA 1A5KC 1DXIA 4H7CA 1S3HA 1YQ2A 2G50A 1IXOA 2TMDA 1K8CA 5CXPA 3FK4A 3TK7A 3MVIA 4YYFA 1V0KA 5I3IA 3W4RA 3WDHA 4MJ2A 3U7VA 4UMAA 2KAUC 1W3NA 3FFSA 3HPZA 5EMLA 3SRKA 4ZEPA 1A0CA 1P1MA 2PDWA 3ONBA 2QGYA 3FJLA 1E0XA 2FPYA 4LB3A 3C2YA 4W93A 2NQHA 3G3MA 4N9CA 1I9CB 2FZBA 1YE6A 2O4QA 1ADSA 2F84A 4FLRA 1FVPA 1TJ1A 2JFEX 4RV3A 1HG3A 4XBSA 1PEZA 1TE6A 3ABRA 4PRRA 3P7YA 3V35A 4HYWA 4NP7A 1TUFA 4ZOCA 3SCRA 1GQIA 1SU5A 4DAIA 5IDIA 3TTOA 1K7XA 3DC8A 1BXNA 5ABFA 2FIQA 4LVFA 4NNCA 1JZ3A 2XH7A 2HXTA 1EC8A 1Q6QA 3PUEA 3V16A 5LNVA 1GW1A 2OB3A 1E4IA 1W9DM 3R0UA 3VCNA 3BMVA 3B8VA 4C6LA 2VGIA 5D03A 4IG2A 2PWDA 3HN3A 3GTNA 4Q22A 1SZFA 2XIBA 4XAFA 4AG0A 3RPMA 1JCNA 1VFUA 3WLKX 3IIXA 4AIEA 1ZJHA 3GQYA 2FTWA 3FHAA 2J6VA 3SCVA 2Z2UA 1EP1A 1JZ4A 3GC2A 1IZJA 3K13A 3DENA 2R94A 5MKGA 1TV8A 1XIEA 1OZMA 5C6MA 1Y0EA 1JI1A 2YZ5A 3T0TA 1EA0A 2FVKA 1PO9A 1AA1B 3VKBA 5IHRA 4C1LA 1WKDA 3I6TA 2D2GA 3DYPA 3NQEA 4MB1A 4ZTYA 4BR1A 2F2HA 2BVDA 3NZRA 2GDQA 4IP7A 1HZYA 2FTPA 5FJUA 4Q4OA 2INZA 1IHIA 1AW5A 4TTGA 1E43A 2Z29A 5DCBA 2BVWA 3KOWA 2VZSA 5TIMA 1MUMA 5E9XA 2QUUA 4JIHA 2P3EA 2YZRA 4IHCA 8A3HA 2XIJA 3NPWA 2EPMX 3MA8A 3CAQA 4CNNA 2C91A 3LEPA 1V6XA 1S39A 2QPUA 3W85A 1OJXA 4LAKA 1VLIA 3NSXA 4S23A 1KGWA 2D3NA 3RX3A 4CUCA 5AHMA 3TW6A 4JCLA 1SYTA 1CGXA 2JKPA 3M0IA 2VZVA 3WN6A 5IXEA 3W81A 1ITQA 4ZB5A 4XWUA 2P76A 1AUSL 3E2VA 3CH9A 4CU7A 2Q01A 1HQTA 2I17A 2Y4SA 2YKKA 1FTXA 3SIZA 3PBGA 2O7QA 3EX4A 4MF4A 3DC0A 1A0DA 1OCQA 4O11A 1DIKA 3PANA 1OFAA 4KWSA 2PLCA 4ACYA 1TPDA 4QXIA 3JUGA 2R1LA 3TROA 2XYLA 2XFWA 3VE9A 5I06A 4GISA 4LRTA 3TN4A 4C6PA 1F8IA 2YJQA 3J7HA 4DF0A 4MIMA 3H2CA 4CKQA 3OBAA 3E3HA 4Q8PA 2OMAA 4V27A 1OT2A 4MY9A 5HMSA 4WK9A 2VXNA 4KEZA 4K68A 3TTQA 5J04A 1DWAM 3REQA 3PP7A 4HNNA 4GK8A 1QTWA 4K6AA 5LGZA 1KV8A 3OG2A 2CWXA 1Z48A 2QJGA 1WZMA 4FI4A 2PF0A 3WNPA 4D6GA 1ZHAA 5AZ1A 4C7DA 4GUGA 7TAAA 4IF2A 3H21A 3JW7A 1U2YA 4DJFC 1J10A 3CWNA 1GK8A 3XINA 4DLFA 4WY0B 4FLOA 1KW1A 1IT0A 4YTTA 1MDLA 2ASHA 3QH2A 2ZRVA 5A2AA 4XAPA 9XIMA 4GX8A 4IGMA 3BANA 1PTAA 5JXQA 1TV2A 2BHYA 3MP4A 3V3WA 1SVDA 4F0MA 1LORA 2VL4A 5AFDA 3KTXA 5TQLA 2Z7KA 4O1FA 4AUBA 3W25A 3GNXA 4DBEA 4GZ7A 3VA8A 4US6A 1XYFA 2D0FA 3VKJA 1NDWA 2BNJA 2WV8A 4OOUA 6REQB 4D2JA 3FV9A 2VD9A 1B3OA 1BPLB 5BRPA 3SQMA 4MB4A 2DEPA 2O56A 2WNZA 4TVDA 1JYXA 1A5MC 2P0IA 3TTSA 1O5XA 4MPKA 4CQBA 1RY8A 2R14A 2GK1B 2W79A 1ZY9A 1ZNNA 1SO6A 2VX5A 3C0JA 3HG3A 1IWAA 5AVHA 3WK2A 1A49A 1W1PA 2PZNA 3G1DA 1M04A 3MSRA 1IT7A 3TC6A 3ZJ7A 4R34A 2O7SA 4AZBA 3DFOA 2ZUSA 5HWMA 4O1BA 4LBUA 1HJXA 3ECQA 1XYLA 3GYEA 5FCZA 2I9EA 2E28A 2PWUA 1RVGA 2VGBA 3CAVA 2DZSA 4JS3A 7REQA 2VCCA 2H3DA 3RK8A 3UXDA 1KFBA 4I90A 1DL3A 3GDMA 5AKQA 3PBWA 3T0CA 2TYSA 1W1A1 3SCNA 3VM5A 3WFLA 1OYAA 3SBFA 2BV9A 1IGSA 3GKAA 5I78A 4JFTA 5A8QA 2ZC8A 4BK9A 4ZQRA 1FXPA 3CB3A 3MANA 2PODA 4UMBA 2J78A 4W84A 3T55A 4H8NA 4A05A 5LA0A 1PZ3A 3LNMA 3LD5A 3EWUA 1FH7A 1LQ2A 5HDRA 3NYDA 4L6HA 1JZ6A 4WCJA 1ICPA 4L1WA 4POCA 1NJJA 3O6DA 5KZDA 1K9FA 3RILA 1HNYA 4JNMA 2P88A 1SFTA 5CPOA 2MANA 5T9CE 3L21A 1TWWA 4B5SA 2VFEA 2VX6A 2AOSA 3L0NA 5T8GA 1OF6A 4GZEA 4UMCA 3HPFA 2XINA 1PE1A 4N0RA 2CPUA 3WEOA 4MMWA 4YTRA 3NJ3A 5FJPA 3CLWA 1EJ7L 4CD5A 3A6OA 3WL0A 1CLKA 4NZ1A 3PUOA 4NYUA 1ZGDA 3CO4A 4IPNB 3BH4A 8XIMA 2VUYA 3ITOA 3S1VA 1TPC1 3QTGA 1OBAA 2PLKA 1BRLB 3RLHA 5GNYA 1TVLA 5D2VA 3KL0A 3PFRA 2YFNA 2BMBA 3L68A 2D3LA 2A4AA 1LM1A 4ZE5A 5F4XA 4HK7A 2E0PA 4PUJA 4AXKA 5E09A 2R91A 5BXPA 1UJQA 3B9NA 4IL2A 1NIUA 3O06A 3TXZA 3KZPA 1UD3A 3V0TA 3VK5A 1E0TA 3VMNA 2JALA 1UP3A 4Z0JA 3UXIA 1HFBA 4IGSA 4TXEA 3LV5A 4XUYA 3W7PA 4IFKA 1V3MA 2VRKA 2ZX7A 1FWTA 1DWGM 3HMJG 1M7OA 2IUZA 4K36A 1X39A 1CXFA 2POTA 3L67A 1VFOA 4HTBA 3EWWA 4GIAA 1VP5A 4WLCA 3GD6A 4IZGA 1V77A 1YPXA 3S4TA 3EB3A 1LT8A 4DY1A 2ZX8A 5HINA 4AD1A 5I00A 3QOKA 2A85A 3DG6A 4WDTA 2GJNA 2R6OA 1LJYA 3EA3A 2A6NA 2PAJA 3DUGA 1CXEA 4LCQA 3RDKA 3CEUA 2V81A 2GQ8A 2WC3A 5C5YA 3H70A 1TX2A 1OX4B 2DH2A 5EMUA 4E8CA 4DX3A 2JF7A 5CC5A 3ZFHA 2QV4A 1LTDA 3AIEA 1W3HA 4HSOA 2VUNA 3EPOA 4MDOA 4LAMA 4TVUA 4D8LA 1E9YB 1RPXA 3TYAA 5G1MA 4UTJA 1ZUAX 5AVNA 1B30A 3HGJA 3IACA 1Q6RA 2RHGA 5E6YA 3WQEA 4P7QA 2V5KA 5K3VA 2OYMA 1Q65A 1W9XA 2J66A 4C6MA 2CESA 3DFSA 2D1ZA 4K1GA 3M16A 4E3TA 3LPPA 1NU5A 2G41A 3P3BA 3S1GA 5FF0A 3WBAA 3RMEA 1YIXA 1EDGA 4PUEA 1HP4A 1ME8A 4QE5A 3T8QA 1Q63A 4HU4A 4PULA 5CBJA 4FOJA 1XHGA 2HXUA 1YYAA 1POKA 1TJPA 1YHTA 5D05A 3PZNA 4A3UA 3W74A 1MW2A 3ARVA 2QUNA 3FSUA 3S3GA 3TYEA 3IK2A 3UR5A 1I0BA 4FXJA 4OUIA 5HPCA 2HVMA 1SQ7A 4OWGA 2XN2A 2UY3A 4WVXA 4REQA 4L6OA 3B0YA 1XIDA 1F3EA 1K9EA 1TPVA 2YGYA 5AC6A 3A5VA 1A5UA 1NELA 1W37A 5HMEA 3FVDA 3EWBX 3IJDA 3PWGA 4QNEA 3AI0A 3SGZA 4AWTA 1PDYA 1O94A 3EOLA 2YPIA 4MJ4A 1MZRA 2WJZA 3UY7A 3DGBA 4MKNA 1XIMA 1NP0A 3A64A 1QPOA 4E8GA 4U5IA 4HZ6A 3WSUA 2Q3OA 1H7NA 3MKKA 1HTIA 3UYIA 4I9AA 3O1NA 4QDPA 3AQUA 3M0MA 4WSJA 1QNRA 4QFUA 4O10A 1K6AA 4XAGA 1ZP4A 2EF9A 4LUJA 3TYDA 2AKZA 4YXGA 3NGFA 1XLGA 1CZ1A 4N9DA 3FOKA 2CW6A 1XKYA 3W0KA 3PZUA 2XISA 1M7PA 4I9TA 2F38A 1I2QA 3NZGA 4EOUA 4GUHA 1XIFA 1GWJA 5K9CA 1FWDC 3M0LA 1DP0A 3UJEA 3B05A 4YTUA 3WDJA 3REQB 3UPMA 2R9RA 2AL2B 1ZCOA 3LCIA 2EPOA 3OEXA 2YYTA 3HIJA 3EWYA 1JYNA 1XLLA 4NJIA 4CD6A 3T44A 3GIPA 2OWWA 1WYIA 2GWGA 1W91A 3PBVA 3M5YA 4PFMA 3D3AA 3K2GA 1EJTC 2BX7A 2NQZA 2QCCA 1JCLA 4Z17A 2X2YA 3M7WA 5L6UA 3TTYA 3QSRA 2WVTA 1AL7A 1KM1A 4OBTA 4GYJA 3WEZA 1JCYA 3GXIA 2VR5A 3SCOA 4AYGA 1E9LA 3S2MA 3WD4A 3GBDA 3TYZA 3WUBA 3GLCA 1HKVA 3ALFA 3ZR4A 1Y5WA 2Y62A 4O14A 3RU6A 1KGUA 4DWSD 5CC7A 2OWCA 1XGEA 2OXNA 3M7SA 1ZBWA 1V6WA 1CGWA 3EB4A 3GTHA 3CPRA 4GY7A 3MJYA 3RR1A 4BWLA 4LT9A 4LS1A 4RDYA 4BKNA 4GBDA 3NM3A 1I8JA 1XBXA 2WKLA 1SGJA 6ALDA 3WQFA 4GMEA 1NH6A 3W7GA 2DZXA 5C9RA 2NVDA 1XW8A 4PBFA 4M6PA 3TVAA 2R1NA 4Q6JA 4H6EA 3TYUA 1OFEA 2ESCA 3TONA 3CUXA 1V0NA 3NQFA 1VPXA 4PMUA 2GVLA 4BF5A 3O7UA 3AWOA 1FDJA 4LW7A 3VDHA 4M81A 3PZQA 1W8SA 2QV5A 3NPVA 4NRRA 4H9YA 1SM9A 1FWNA 4K7YA 3KTCA 3VGHA 5A6LA 1H0IA 4JFWA 4A21A 4OE7A 1JPHA 3CEPA 3UGRA 1YTDA 1G4PA 4QLKA 3BAWA 1FCVA 1VGAA 3WENA 4B5UA 1V6VA 3KBNA 1QASA 2W3ZA 3E5BA 3T7VA 4W5UA 3R7MA 3MBDA 1DJWA 3FN9A 5E1QA 4E2DA 4QAWA 7ENLA 5A1AA 2A3LA 1KKOA 1E6PA 3S9IA 1TPWA 3EMZA 3S2JA 2C18A 4IMDA 1LZOA 1M53A 5GNZA 3N13A 4I5XA 1VR6A 1EQCA 3LZ3A 4JIPA 4UTWC 3LHTA 3LX9A 5MF5A 1E1FA 1CLVA 1LG1A 1F8MA 3H2AA 4XKYA 4AW7A 1XFBA 1VPQA 3S2NA 2VWTA 1G69A 1XWYA 4O13A 1TCMA 2AMXA 2DT3A 3AS1A 2Y8UA 1UR9A 3NCOA 1WP6A 3AXHA 1EOKA 2QMKA 5DXYA 4DI8A 1UUMA 4NJJA 2J74A 4GJIA 3LERA 2I1OA 5HA7A 3C3UA 4ICMA 1VHCA 2OLHA 2F6XA 4HJWA 1XV8A 4Q4PA 2A3BA 3EXRA 4P7NA 2X2GA 2XG9A 1W1VA 3IV3A 3E1F1 1T40A 3MB9A 2ZE3A 3H7UA 3VIKA 2E09A 5DT5A 4GBUA 1AD1A 4GUFA 3EDDA 2BDQA 3RO6A 1V0MA 4LVBA 3NEVA 1YDNA 2V5LA 1UWAA 3W6LA 2Y0FA 1G9HA 4PEEA 4PTDA 3WMCA 1YXDA 2ZRYA 1DV7A 3BLLA 3Q58A 1OADA 3NQAA 3OVGA 4WKFA 2CLHA 3NWRA 3QV6A 3QZAA 2A7PA 4L9YA 4L9XA 1P43A 1Z69A 1GEHA 5GVJA 3P8IA 4DNMA 4IG2B 4Z1DA 1PTDA 2HISA 3RPTA 8XIAA 1WBHA 1V3IA 1A4MA 1YRRA 3NQ8A 2YCLA 4ATLA 1VIZA 4RDVA 5G1YA 3TCSA 2OO0A 5JU6A 2GK1A 4FO4A 3L66A 4AD2A 1ZSXA 3KP0A 3FXYA 3BMWA 3OBKA 4AISA 2ZUMA 1QDSA 1MDRA 3WNLA 4C6OA 1W2VA 5TNVA 2DUXA 1K6WA 4DYJA 3WLOA 2VJXA 4JGDA 1DWHM 3UCCA 3G18A 1UA7A 3U9IA 1AMKA 1PHQA 4XG1A 4UZUA 2QDGA 2ZCGA