4R9OA

Crystal structure of putative aldo/keto reductase from salmonella enterica
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
MVQRVTIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALTLAPHLREKLQIVTKCGIATTARAENKLGHYITDRRHIILSAEQSLKNLATDYLDMLLIHRPDPLMDADDVAEAFQHLHQSGKVRHFGVSNFTPAQFTLLQSRLPFTLATNQVEISPVHQPLLLDGTLDQLQQLRIRPMAWSCLGGGRLFNDEAYQPLRQELSVIAQELNASSIEQVVYAWILRLPSQPLPIIGSGKIERVRAALEAETLSLTRQQWFRIRKAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative aldo/keto reductase
publication title Crystal Structure of Putative Aldo/Keto Reductase from Salmonella enterica
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 99
structure length 293
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4r9oA00
2PDLA 2ACUA 3LBOA 1PYFA 4XZLX 1RALA 2IPFA 3WCZA 2QXWA 2PDXA 2F38A 3GUGA 4GABA 4XO7A 4JIHA 1ZSXA 3F7JA 4RPQA 2HDJA 3CASA 4LAZA 2FZBA 2PDKA 3FJNA 3H7UA 1X97A 2IQ0A 1QRQA 4GA8A 3D3FA 3R8HA 2I17A 3M64A 1XF0A 4F40A 1PWLA 1R38A 2HVNA 2DUXA 2PDBA 4PMJA 3B3DA 3Q65A 2PDWA 2PDHA 1A80A 4QBXA 4PUWA 4WEVX 1X98A 3LN3A 2PD9A 3BUVA 1AZ1A 5LIKX 2PDPA 3H4GA 1VP5A 1ZQ5A 1EL3A 4GIEA 3EB3A 4JQ1A 3GHTA 3WBWA 4PRTA 4GACA 1AH3A 4GQ0A 5LIYX 5HNUA 4XVEA 3UWEA 4XZNX 1IEIA 4IGSA 1HW6A 2PF8A 1GVEA 5LIWX 4ICCX 3ONBA 4PR4A 1RY0A 2BGQA 4GCAA 2BGSA 3KRBA 2R9RA 3LQGA 3EB4A 1FRBA 3C3UA 3V36A 4LB3A 3UP8A 4PRRA 3UFYA 4MHBA 3RX2A 4DBUA 3M4HA 3V35A 3MC5A 3FX4A 4XZIA 2P5NA 4IJCA 4ZFCA 4IJRA 2PDFA 3UZWA 4WDUA 1PZ1A 3V0SA 2ACRA 4FZIA 1IHIA 4JQ3A 4PUUA 2VDGA 2J8TA 3COTA 4NKCA 2WZMA 1J96A 3LEPA 4YVVA 4EXBA 4GQGA 2PDJA 3R58A 2FZDA 4G5DA 2AGTA 1AH4A 4I5XA 2IS7A 4FALA 1Z3NA 4XAPA 5HNTA 1X96A 4XZHA 2DV0A 2PDGA 4XZMX 3R6IA 3QKZA 1YE4A 5M2FX 1EKOA 2CLPA 3CV7A 3DOPA 2ACSA 4ASTA 3VXGA 2ACQA 3BV7A 4XO6A 1XJBA 4JTDA 3V0UA 4QR6A 1AH0A 1US0A 3UZXA 1ADSA 2PDNA 4JIIX 3O0KA 2FZ9A 3WG6A 1OG6A 2DUZA 1T40A 4OTKA 1T41A 3R94A 4YVPA 5HA7A 2PEVA 5AZ0A 4LB4A 5KETA 5LIXX 1S1RA 4FA3A 5DANA 2WZTA 3M0IA 4AUBA 3MB9A 1Z8AA 1VBJA 4L1XA 3UZYA 3WBXA 4Q7BA 4FAMA 4WDTA 1MZRA 3ERPA 2HVOA 4L1WA 1UR3M 3LD5A 2HV5A 3U2CA 1S1PA 4DZ5A 1MI3A 4JTAA 4WGHA 5JH1A 2C91A 2ALRA 3ONCA 2IPJA 1LQAA 4XVDA 1Z9AA 1ZUAX 4JQ2A 2R24A 4HMNA 3CAVA 4EXAA 2PDQA 2INEA 3R43A 3UYIA 3R8GA 4R9OA 3BURA 4YVXA 3N6QA 3O3RA 1EXBA 2NVCA 2IPWA 4WDWA 1JEZA 2ISFA 1Q13A 2PDIA 1XGDA 3UG8A 2IQDA 5JH2A 3LENA 3Q67A 3T42A 1YNQA 4JTCA 1LWIA 3H7RA 4DBWA 2HE8A 1YE6A 3S3GA 1SM9A 2FVLA 2PZNA 2IPGA 3DN5A 3GHUA 4LBRA 4JQ4A 4LBSA 3CAQA 4Q3MA 1AFSA 3CMFA 3CV6A 4H7CA 1AZ2A 3LUTA 3WBYA 1ZGDA 2IKHA 3P2VA 1MRQA 1PZ0A 3LZ5A 3RX3A 4LAUA 5C7HA 1QWKA 3N2TA 3LQLA 3G5EA 2IKJA 4HBKA 4JTQA 1HQTA 2PDUA 4QX4A 4WRHA 3R7MA 4DBSA 2PD5A 2PDMA 2IKGA 2F2KA 4H8NA 3GHSA 2FZ8A 1M9HA 3LZ3A 3UZZA 4QXIA 3UGRA 2PDYA 1YNPA 1K8CA 5AZ1A 2FGBA 3NTYA 2I16A 1Z89A 1EF3A 2A79A 1PWMA 1RY8A 1S2AA 2INZA 2PDCA 3GHRA 2PFHA 2NVDA 1C9WA 2HE5A 3LNMA 3G1RA 5LIUX 4WDXA 3EAUA 4XK2A 3V0TA 1S2CA 3RX4A 2IKIA 2BP1A 1Q5MA 3BCJA 4JIRA 4JQAA 4YU1A 2HEJA 4JTRA 4YS1A
chains in the Genus database with same CATH superfamily
1A5NC 1OINA 3F1QA 2J7FA 1J10A 3VAVA 1VRDA 2FGLA 1H1ZA 5DY2A 4HT3A 2MNRA 4NZFA 1XLJA 1QBAA 3B8IA 4ZCWA 4RXFA 5EMKA 4C6EA 4B92A 4HHPA 4KQNA 3N1AA 5A6JA 1FKXA 1XCWA 4UNKA 3UXLA 2Q09A 2OODA 1OQFA 5DX7A 5D09A 3QVQA 4Q8PA 3TW7A 3M64A 4YTQA 1MEHA 4QIUA 4F40A 4PMYA 3BSHA 1E70M 5I06A 1HKVA 4KWOA 1REQB 2F6KA 1O5KA 4GI4A 2BLEA 1GONA 3DXIA 3MI3A 2PD9A 4UQDA 3H2AA 1DXIA 1G67A 4GYFA 4LUSB 2PDPA 1M68A 4UMBA 3K1GA 1XLGA 1VENA 1KM2A 1M7JA 1R3VA 4KCVA 2A21A 4GYPA 1RAKA 4QEEA 1XUZA 4JTEA 4Z1BA 1PSCA 4C6JA 5HNUA 2A85A 1MQPA 4S1FA 4CU8A 1KM0A 1NWTA 1DJYA 4J1OA 1ONRA 1KBKA 1W1B1 3JW7A 2V5LA 4FR1A 5G4HC 1KCLA 2CU0A 2ZE0A 1SJDA 4QROA 3NQBA 3K46A 4FXFA 3MQTA 4GG9A 2QCDA 1PKLA 3UJSA 2W79A 1SFLA 2QJJA 3F4WA 2OSWA 3RMJA 4O0QA 1VPXA 2J7GA 1LQ0A 1NFBA 3OG3A 4DUVA 4GQQA 1EO5A 4TMBA 4LOCA 4PB5A 3PNUA 4D6HA 1W1YA 2HNEA 1C8QA 4IJCA 2OTDA 1FWBC 3HPZA 4J3TA 4D1JA 1UKQA 1PZ1A 4I7VA 2ZUSA 2YXGA 3SDOA 4H6RA 4JQ3A 3DC0A 4ENLA 1TSIA 5IBXA 3W7NA 4GYPC 3OA5A 4A3QA 3VGFA 3WLKX 5D04C 3QR3A 4O4VA 2C1GA 4AU0A 4EE9A 3H7VA 4D8ZA 2PC4A 1UZHA 3MUAA 5CAHA 4RDYA 2EO7A 2HK0A 1X96A 2DSZA 4AY1A 4US5D 3JVAA 1XGZA 2O9TA 4CQ9A 3KS6A 1EKOA 1EF2A 1HJWA 4ES4A 3SN4A 4DELA 1UWRA 3QKEA 3RU6A 2QHAA 3BLOA 3QRHA 1E6PA 4Q4PA 4ASTA 1DE6A 4TXEA 3WEMA 3VA8A 1KBIA 3TVAA 3CS2A 5CSYA 2VOTA 2GK1B 3MO7A 5G1MA 3CPRA 4QG8A 4M7SA 3TLQA 2ZZ5A 1I2QA 5A8MA 2CBJA 4L9ZA 2JALA 3M43A 3RF9A 4JL2A 3LHVA 3KBSA 1LL7A 4UB9A 3C5QA 2C79A 1V6YA 1AUSL 4LSBA 4ADSA 2C8NA 2Z6IA 2WC3A 1OFAA 4A3HA 2WZTA 1X7FA 4FOKA 1T0OA 3UYCA 5AVNA 4L6HA 4LNYA 5MKGB 2PP3A 4Q7BA 3EYPA 3H2NA 4HA4A 4OGZA 1DWFM 3DIPA 4QNWA 2PWGA 1MI3A 1LRTA 2ZTKA 4JTAA 3ALGA 4AC1X 4ZXLA 2R1PA 2VFIA 1QNVA 3QGAC 3I6RA 3UWUA 1J4EA 4K36A 4B91A 2PDQA 1ZZMA 2J88A 5I77A 5BYWA 1TWDA 4CCCA 3NXFA 4MB5A 1DJHA 1NWUA 3FDGA 5GNZA 3LOTA 4GIYA 2E1DA 2PZ0A 1GWJA 3P82A 5E1QA 3MKVA 1C8XA 4KEVA 4EPEC 2V5JA 4JHZA 2DUAA 1GTEA 3SO7A 3UVIA 1QATA 4BF5A 2VEMA 5JBFA 1RBOB 2C0AA 3GC2A 3WNNA 3OEXA 1PX4A 1I8JA 1L6SA 1IT8A 3H7RA 3FV9A 3AWOA 1K6WA 3AMKA 1ALDA 3IJIA 1VIZA 4Q3MA 1V77A 4Q8OA 3LM7A 4AEOA 1EPVA 2X16A 3LCFA 3LUTA 4JZ5A 3GZAA 1OVDA 1UR1A 4PBEA 3AIQA 3WLMA 4L56A 5HQLA 3GVWA 3QJAA 1WX0A 3ORWA 1D9EA 5E0CA 2XM2A 3CQIA 4ZL1A 4XKMA 1S2WA 1CBGA 1KCKA 4JTQA 2RKXA 4BKNA 3VD4A 2TYSA 3F4CA 1I9CB 1IIGA 2A3HA 4A4AA 1A53A 1AJZA 1OJXA 1B9BA 2TPSA 3RJXA 3SY1A 4UTMA 5IOBA 5M5DA 4G9PA 4CD8A 3T2PA 4WLCA 1T5AA 4CD4A 4H8NA 4YTUA 3UZZA 4B3LA 3G18A 2BFGA 3PSVA 3WEZA 2QMKA 3DBPA 2PDYA 3P6LA 5GQBA 5CAKA 1N55A 4K38A 1F6KA 3TC6A 5C2GA 3N4AA 1AW2A 1XKJA 3QW3A 1DWIM 4QE4A 1UHVA 2A3AA 3UCQA 1S2AA 2GGHA 3O2LA 2O9RA 3G1XA 3U0HA 1QNPA 4KGJA 3CMJA 4CU7A 1XH2A 4LCQA 3LDVA 2BXYA 4PMXA 2ZUTA 4MM1A 1EPXA 4WY0F 1Y65A 4C6NA 4WGXA 2R1NA 1RQBA 4W89A 3W4RA 4A3RA 5HPCA 1N82A 4PB3A 3EWUA 5CLTA 3R8RA 2ZRWA 3L0KA 2C6QA 5GNXA 3UPWA 1DJXA 2NZLA 2NLIA 4MVAA 4CEUC 4JIHA 3E0VA 4DJED 4UFLA 2RJHA 3OBAA 2I56A 2FZBA 3RUBL 3SGGA 3T09A 4GA8A 3TC7A 1B0IA 5C7VA 4MB4A 3CH9A 3UETA 3AYRA 2XGIA 2WVSA 4X9SA 3TONA 3WNKA 4IP4A 4NRSA 4PODA 4J3ZA 1R38A 4C5ZA 2WQDA 3U4AA 1A4LA 1J6PA 4O1CA 4RCXA 1A80A 1MXSA 3VM7A 3NZ1A 1XS2A 1ZL1A 2OWCA 1W1ZA 4UTUA 4HNUA 1KV5A 3WMCA 1OYAA 3OZMA 4GIEA 4GUGA 4G7EB 5EBUA 3G22A 1UZ4A 3EOSA 1BAGA 3TX9A 4V1XA 2XPKA 3N34A 4PUEA 3VGEA 1B2YA 4GK8A 1BSIA 1XIFA 3CB3A 3VABA 5F2IA 3MP5A 3S5ZA 3BL3A 4A22A 3LLXA 1I1WA 3UR7A 4AZGA 3W2KA 1JGMA 1NQKA 3DI1A 1W8GA 2XU2A 4FX7A 4UNIA 1XIJA 2ZX6A 2R9RA 1KLZA 3LRMA 3TSMA 4CCDA 1LROA 2P50A 3E2SA 3INPA 3ZLFA 4DB7A 5EB8A 1KQZA 2JK2A 2QPUA 3H26A 1CEOA 3RCYA 4EANA 2DZTA 3KTSA 1JPKA 1F07A 5JBDA 3MC5A 1K6AA 3BAJA 4LV4A 3A3WA 4EP8C 1KCZA 1UZDA 4WDUA 1KXQA 3F4VA 4LCSA 5RUBA 4ZSUA 1SMAA 1TPH1 5CZSA 1NVMA 3GR4A 3AISA 4NZJA 4JTIA 1BSLA 3UG5A 2O7SA 4Y7EA 3ZLHA 4WQ6A 4AIBA 1D8CA 2DU2A 3PP7A 4D8AA 1UP2A 5TBOA 2FGZA 3KM8A 4I5XA 1IWPA 4UR9A 3V4BA 5CKSA 3WNLA 3POCA 4DZIA 1QNOA 2TAAA 4YJ5A 1NY1A 2PDGA 3WDRA 3R6IA 3TN6A 5M2FX 1R0MA 3UW6A 9RUBA 1QPOA 5BRBA 5EY5A 3KP1A 3LCHA 3QBUA 3G6MA 1X38A 3NQ2A 3NZQA 8XIAA 3M46A 5E9XA 3H2MA 4KFOA 1S5VA 1JIBA 2F2HA 4RNFA 3FJ4A 4AW7A 2PAJA 4IM4A 3BK0A 3TW9A 3L68A 4IMCA 4P5UA 2FZ9A 3G1YA 2NW0A 3NVDA 1OG6A 4IPIA 3T78A 3TZFA 3UR8A 3NL6A 3V18A 4F0SA 1GVYA 3ZR6A 1Z69A 3GR8A 4MDPA 3WLHA 1PKNA 1ADDA 4JTTA 4MJMA 3T07A 4FA3A 2GYIA 1I2OA 1S5WA 3H22A 5H1WA 3MI6A 1ZBKA 1KD0A 4NL1A 2WB5A 2AOSA 4TTGA 4S23A 2W61A 1M53A 5FF4A 4CNSA 4L9XA 2W9MA 4C6PA 1GG0A 4G2DA 1A5BA 4BJHA 1MUCA 4NXSA 1EWDA 2OQLA 3MSGA 3LMZA 3RHGA 3GNXA 3EWWA 4NNCA 3VE7A 4LUYA 1UWAA 4PTDA 1VFOA 3HTWA 4E38A 2YA2A 4MB1A 1MDLA 2J8GA 2VGIA 2PLCA 2BS9A 2WCAA 3LCLA 4KRTA 4BQ3A 4D6DA 4H9UA 5CC6A 3WMLA 3VTRA 1KRBC 3W7HA 5FF7A 4JPGA 3GVQA 3DDMA 4O15A 4O54A 1ISZA 2Q8XA 5BXTA 2PDIA 2GLKA 3OVGA 2OLAA 4V15A 2NV9A 5JH2A 3GC4A 2XJ7A 2J13A 2ZA2A 3B0PA 1KFJA 1FTXA 3WELA 4JTCA 5FSDC 1SQ7A 5C54A 1TVNA 2L5HA 1EUAA 2C3ZA 3DN5A 1W5NA 4DYJA 5HINA 4JN6A 2XUCA 3NIYA 3BAYA 4LBSA 4Q4SA 1DEDA 3ARTA 3QM3A 1NSJA 4V2XA 3FA5A 4IXXA 1TR1A 2FB3A 4D6EA 4NP7A 3VMPA 3DI0A 5CH9A 3PZ9A 3IJ7A 2YCLB 5C7HA 3LQLA 1OFBA 1HQTA 2WNQA 5AC6A 5I0DA 4IGNA 2G37A 4Y90A 2OPJA 2VFDA 4ORMA 3BARA 1LG1A 2QIIA 1BVNP 4PMVA 2OELA 4FLRA 1O7AA 4O28A 4F0LA 1GVFA 2QUNA 1ITXA 2QJMA 1O66A 1XLFA 2BZNA 5C9ZA 2ODOA 1OZMA 1UR0A 3RR1A 1E0UA 2DZUA 4QGCA 4ACZB 5K7JA 1KM6A 1NELA 3TQKA 2OCZA 6XIMA 2Z00A 3OGRA 3G1RA 3UERA 5EKYA 4N9DA 3A64A 1OD0A 2WOQA 1R8LA 3MA8A 3RM8A 3GSMA 1IYXA 3P8JA 2OU4A 2P8BA 3P3BA 3FFSA 4JS3A 1YW1A 2QKFA 1WXZA 1SW3A 3PAJA 2WHLA 3FAXA 4TUFA 1O6IA 4A35A 1DWGM 2B7OA 3IJQA 3P5ZA 3VNKA 3KP0A 1B3VA 2VFGA 4RPQA 4ZA0A 1SZFA 5REQB 4JBRA 2PDKA 3PTQA 2BNJA 1PAMA 3LY0A 1QRQA 2JEQA 3VOIA 1UD3A 1RK6A 3M07A 2BBFA 4FI4A 3LLDA 3H55A 1ZJAA 4EPBC 2PLMA 3CLWA 2C1IA 1IEVA 1TV3A 4LQ1A 4F9DA 2YOCA 2HVMA 1JDCA 1KGXA 4JHOA 1E72M 3O16A 1QO5A 4CCZA 4DO7A 3T0DA 2XN0A 4CQBA 1ISYA 4GBUA 3CK5A 1EL3A 3U7BA 1E73M 3WBWA 3OLGA 3W86A 2YL6A 1I75A 1ZENA 1FHLA 3MMUA 3HBLA 3EX4A 3GO2A 2VR4A 3J7HA 2HK1A 3TW6A 7PTDA 2ISSA 2CLHA 2FDMA 5EA9A 4Q33A 4IGSA 4W84A 4ROPA 3HGOA 1GVEA 4HNVA 5DRCA 1J01A 1OFQA 4E5TA 1DTUA 1DWHM 2FJUB 3PZQA 5A5WA 1CGYA 4JCLA 3FJ6A 1R85A 1FRBA 3S2CA 5A2BA 4K7VA 1IWAA 1XBYA 3A21A 2WNWA 1XYFA 2NQLA 1SO5A 2CLFA 1XD1A 2CZDA 3ITYA 1FQ0A 2E67A 3E1F1 1IWBA 4OU1A 1QUMA 3VKCA 2EBNA 4E2VA 1RBAA 5A6KA 2CFFA 3CH0A 1R3TA 2OT0A 4WY0B 3QHMA 1GZGA 1DP0A 1IR2A 4HD5A 3RM4A 3GVGA 1AL8A 1XH0A 3BANA 2REQB 3FY1A 1TZ7A 2XIJA 2OR2A 1SFTA 3A5VA 4GI6A 1TWIA 3WH9A 4AHOA 1W3NA 1AMYA 5A6SA 4B5VA 4JNYA 1EGZA 5CBJA 2E77A 3P8IA 2NXGA 3G3MA 3PWIA 3R58A 3W72A 3ZJ7A 2C15A 1AH4A 4P7QA 5TD4A 3QC0A 3IVTA 4QSHA 2FZNA 3G1VA 3I65A 3WFZA 3WUEA 2P1FA 4GFSA 3CL8A 3UXIA 3LK6A 4RV3A 1Q6CA 4ZQRA 3M47A 4ERAA 3CIXA 1L0PA 5XIAA 1L6WA 3ZJ8A 1US0A 1F3XA 1YMYA 1WO2A 3MU7A 4M1BA 1Q7ZA 1QI4A 3QV8A 1ZPTA 3MI2A 5IM51 4ZODA 3E6EA 5CPMA 1OBAA 1UWQA 1GVSA 3ZVHA 4A3UA 1ITUA 2A6LA 3LGDA 4LB4A 5LIXX 1H5VA 3A12A 5GNYA 3T81A 5HWNA 3VILA 4JL1A 5FKYA 4AY7A 1W8SA 1DIKA 1Y8BA 1G4TA 5F4SA 3MS8A 3GS6A 1DIDA 3HURA 2HVOA 1JYXA 3WDHA 2Y63A 3TTQA 1SSDA 3GU2A 4IXHA 2H90A 1FWJC 4TVDA 1AD1A 5IHRA 1WZAA 4D6GA 3P7YA 2Y2WA 2J9YA 3BZGA 3PB2A 4NHVA 1B31A 3S6DA 1E0TA 3HJZA 5A2CA 1H7WA 4HMNA 4C1LA 2HXTA 3V3WA 2INEA 3F5KA 2YDRA 1EA0A 2QUMA 4Q8VA 3NJ3A 3SY5A 3UZJA 1E15A 3FS2A 4AISA 4YVXA 3N6QA 3SUTA 3EA3A 3VGDA 5HULA 1MNZA 5HDRA 2ZWYA 2OZ8A 4JKKA 3F2BA 7TIMA 3TWAA 2NQJA 2DEPA 1H50A 1W9UA 1XRVA 2WMGA 5C8BB 1WXYA 2J7BA 2X1UA 3WENA 5C71A 4RW5A 4FK9A 3BAIA 3RYSA 5JVLA 2EAWA 4J40A 1EUNA 5AB3A 1GOWA 3RO8A 2TRSA 1NDVA 1VCVA 3GH5A 3R0UA 1NH6A 4XD5A 4IH3A 4H9ZA 4G1NA 2DGAA 5A6BA 1C9DA 2ZWZA 2XWEA 3ZWTA 1RA5A 3RITA 3M5XA 4AZCA 3OYXA 1WUFA 2R91A 5AHMA 1XG3A 2NVAA 4LAUA 1ONWA 1QWKA 4IP5A 1E6ZA 3VI2A 3GYCA 3LB0A 3REQA 4QX4A 2XN1A 2BXVA 1DORA 3AZRA 5IDIA 2GDUA 4Q8TA 2VEPA 2J7HA 3NQ6A 1A3XA 3M0YA 3WUFA 2XIOA 3S47A 3NYZA 4UFJA 1W1IE 2CHRA 2FZ8A 3URNA 1R9YA 3NCOA 1TWZA 3UY8A 3W75A 1TTPA 1ZP4A 1K8XA 1Z89A 4PUJA 1MZHA 1IGWA 2NUWA 4LYRA 4U4MA 3MVTA 3WFAA 2QV4A 4GYKA 3ARXA 2DJXA 4PRWA 2PWHA 2V6AA 4YTTA 4NZCA 3E96A 5I2UA 3WBAA 4AG0A 4M6PA 3CUXA 5JIWA 4NNBA 1EP2A 5F2MA 1CECA 3M0XA 4Z1YA 4O18A 3LI0A 1R46A 4JQAA 3SUVA 3APTA 1R87A 3OVRA 3IJLA 3NEVA 4OUEA 4ZMGA 5U7SA 4GGHA 6PTDA 1PYFA 2NV1A 4UTTC 1RALA 2WNZA 4K8HA 3TYCA 4JN8A 4NSBA 4O12A 1BQCA 3RRXA 5T9BG 1RZMA 3SR7A 4F0HA 1ZLPA 4NZ1A 1E1CA 4EWJA 3RM9A 3EGJA 3C0QA 3G8EA 3FYYA 3H7UA 2W67A 3OB8A 2D69A 1WPCA 5MKGA 4LVGA 3R89A 4FLOA 4YPJA 1Q85A 3NSMA 3SIZA 4FOJA 1BD0A 3OYZA 5I79A 3V16A 2RUSA 3TKFA 4QBXA 3T2OA 4PUWA 4Q6JA 4OBTA 4C6BA 1EDTA 3BUVA 2CLEA 1H1NA 3WH8A 3EXSA 3TOPA 4TX8A 3VNIA 2PTDA 1H7NA 1ZQ5A 3QTPA 2BVDA 5A1AA 5CBIA 3OTRA 4JQ1A 3WQPA 2Y88A 2PTYA 3KW3A 2BHUA 3QOMA 4DWSB 4Q8MA 4I9TA 4Y9AA 2PTZA 3H2CA 4GACA 1S5MA 3LHWA 2G3JA 2X7VA 2XZ7A 3VFLA 2WKGA 5AC8A 3E2QA 1BRLB 3W1TA 1X8CA 1VHCA 3PVFA 4W85A 3FDKA 3W1XA 4GLEA 1CPUA 3IIZA 1P7TB 5C5YA 1VFFA 3WZ0E 1L6YA 3BLPX 3QZ6A 4K2SA 3M6DA 1BG4A 1EXPA 3L0GA 1RH9A 4JEQA 4ILSA 1LOQA 2WJZA 1XLDA 3ITGA 4DZHA 4M80A 1H49A 4FNRA 4IICA 2FH8A 3UZWA 2QLYA 3FJLA 3WEOA 1CB7B 2Y7DA 3UNTA 3DESA 1W0MA 2OMAA 5K3VA 1GPWA 2VEFA 4A21A 3AFBA 4NKCA 1Q6FA 2IMRA 8A3HA 3WJWA 3WQFA 4UTLA 3PANA 1AMKA 2HMCA 4WJEA 2PDJA 3OJGA 3M0MA 3T1GA 2V30A 2PGFA 3DCPA 5D30A 2WANA 3C8FA 4O8RA 1CXLA 4XZHA 2EJAA 2WAGA 1QOXA 2AL2B 3DU0A 1EIXA 2WSQA 1TV4A 2ACSA 4U3CA 5EMMA 3OA3A 4MJ2A 4QNEA 5E70A 5F1VA 4CU6A 2YL5A 5TIMA 1FDYA 4H9MA 4LS2A 2E5DA 2Z24A 4JKLA 2XIMA 1EB3A 3R12A 3PJWA 4JAWA 1H4PA 2D24A 5CZTA 1QCWA 2AAAA 2V5DA 4JIEA 1UPMB 1XSJA 1FWRA 1FVPA 5A6AA 4JIIX 1TPUA 2Z2BA 2HBXA 3HU7A 3EXRA 4Q4OA 4LPCA 3UG3A 1JZ7A 2C19A 3ABQA 1VPQA 1JUKA 1S1RA 4XSMA 3N9SA 1OIMA 4DF2A 3CWOX 3QHNA 3MB9A 1XFBA 3OLIA 1UP3A 3W1AA 2Z28A 3BCFA 2W6RA 3TC3A 6A3HA 1QHOA 1SZRA 2V5CA 1NF7A 1J0JA 1QHPA 4DY1A 1EC8A 2E28A 3G0SA 3T0TA 6REQA 1UBPC 1WUEA 1VF8A 4HCHA 3TFCA 3AHTA 2R1KA 5E9AA 3UY7A 2Q8LA 1HO1A 2R24A 4PN2A 4EK7A 5LHFA 2PWVA 1TQXA 2DIEA 3R13A 2OO0A 1AW1A 4ZVJA 4JN7A 3O3RA 1MWOA 2NVCA 1E6SM 4KCUA 1ICQA 3R79A 1OEPA 3STCA 1K3UA 1UBSA 2GJLA 1C92A 4RNJA 1XLKA 5AHLA 4DJFA 1EJWC 3GNNA 3OODA 4EAYA 3IS4A 1UJQA 1OSEA 3EPNA 4HSNA 4AF0B 1L8NA 4LRTA 4S2CA 3SZ8A 4LCRA 2VC7A 3NQCA 2GGJA 3IANA 5TQLA 3K4DA 4V1YA 4AAJA 2IW0A 3A47A 3GXFA 3NGJA 2X7WA 2VCBA 1XX1A 4GOAA 3I7SA 4IIEA 2XFYA 3OQEA 3PWGA 1GYMA 2BVTA 1SO6A 4CLMA 4H7CA 5EFDA 1TUFA 1W2VA 1J2WA 1JL8A 3L23A 1ZGDA 4FNTA 4JTUA 3OBKA 4GNKB 1W54A 1F05A 2O4QA 4Q4KA 2G97A 2B0MA 4DAFA 4AD5A 3V5OA 3KOXA 1XRTA 4LFYA 1GKRA 3BGGA 1JXJA 2ZDRA 4H04A 4N4PA 4AZBA 4JTSA 2JKPA 3S4TA 2YL8A 4H3DA 3R7MA 4DBSA 1F3TA 4JX6A 5HBFA 2BGNE 1FHUA 3OZYA 3S46A 4H6QA 1BYCA 1CW2A 1I4NA 3QF0A 4DJFC 4XG1A 1U83A 4HYWA 5DF0A 3BDKA 2X30A 1A5OC 4C6LA 2CCRA 5JIPA 3FIGA 2YFOA 1BTCA 4A8IA 4MTVA 1EF3A 1WBJA 1GOXA 3H2OA 2F6UA 2PFHA 4JTGA 5A8QA 1UYQA 2ZCGA 2QVHA 3EAUA 2UY4A 4WR3A 3PZTA 4JTKA 4HP5A 3WDJA 3HGRA 3VYLA 2I5IA 5LXEA 4HA3A 4GVFA 3CPUA 1TTIA 3TMQA 1IR1A 4OZOA 3KOWA 3AMCA 3OG2A 4BFAA 4XIMA 4BR1A 5K4XA 1I0DA 3L4YA 4B9YA 3ZJ6A 4J2PA 3CV1A 2PU0A 1UWUA 1ENUA 3EDFA 3CZGA 3DH7A 4J7RA 1V0LA 3UXAA 2UV8G 1A47A 2VFHA 4RLIA 1UKPA 2ZZ4A 5FJUA 3VDGA 5CZJA 4M81A 4GC4A 1CX9A 1RHCA 1XYAA 4MB3A 3CO4A 5KITA 3GXTA 5A8OA 1KTCA 3K30A 3MDUA 1XIEA 4YYCA 3NQAA 2PPGA 1DJNA 2R1LA 3R11A 2QCLA 4QQUA 5HXMA 4ZOCA 5CG7A 4NF7A 4M6QA 1X6LA 3LRLA 3CWNA 1X98A 4H2CA 4D6CA 1G01A 3IIXA 1G4SA 2YPIA 4PL1A 2PCEA 2ZRVA 4FX6M 1C8VA 3IAPA 4RNHA 3SAZA 2FLIA 3UWVA 2PS2A 4RE2A 1A5SA 3IVSA 3HF3A 1GPFA 3KL5A 1GT8A 2V68A 5BWFA 4RE0A 4IFKB 4IG2B 5LNVA 3ZVIA 1CXKA 1H09A 3NR0A 3VNLA 1E3ZA 3C4UA 3L12A 1JDFA 2Z4GA 4UFIA 1DXEA 1NP2A 4MG4A 3C86A 3BMXA 1SMDA 5D2XA 3B04A 2WQPA 3HMJG 3A5FA 4I9JA 4UOZA 3NO3A 4HMEA 1PIFA 2CITA 1AA1B 1AQHA 2IXVA 4O53A 3O6CA 1IQ8A 4L7ZA 1KCXA 2XH2A 3CL6A 5D9OA 3V36A 3DX5A 4DUXA 1UKTA 1BWLA 3VKKA 4GBDA 3L66A 4N6FA 4DBUA 3VX1A 1H7PA 1GUVA 3IV8A 1M65A 2GPTA 5FJPA 2YW4A 3MMTA 4QFUA 3DENA 1I0BA 2P5NA 3QEZA 3UESA 1YEYA 3ITXA 1VYPX 4H9XA 4WHBA 1TQJA 1OYBA 3ABSA 4WOQA 1I45A 2EG8A 2C18A 1K77A 2OO6A 4DEFA 1IF2A 5C6MA 3AMGA 1BF2A 2WPBA 3LEPA 1K9DA 1F2JA 1TZZA 4EXBA 2VZSA 4DBEA 3ZOAA 4DXKA 2HSAA 3SUUA 3WF1A 2FZDA 4IGMA 1KXVA 1Z3NA 3TNOA 2AKZA 4IMEA 2J77A 3GYEA 2DV0A 1GVOA 3P5YA 4ACZA 4KW2A 1FWDC 2I14A 2QCDB 4Y9MA 3QSTA 4HA1A 3CV7A 3TSBA 2FVKA 3DOPA 2WWDA 2JKAA 1W56A 2PTWA 4HOXA 2YLAA 4ECLA 2QCGA 5JMUA 5T26A 2XVPA 3CWHA 4KT2A 3WLTA 3VK5A 2XIBA 1PTDA 1H7XA 5IRPA 4GD0A 3JRKA 4L80A 1T40A 1UH2A 3EPOA 4WD0A 2NV2A 1T41A 5G2WA 4GRSA 4U33A 3TN4A 5HATA 1KA9F 3CO8A 3ECQA 4AQLA 2E9BA 1FH8A 4KCWA 3U6WA 3DHPA 3SY8A 3I3DA 5REQA 3E02A 3AXHA 5D9PA 3AHYA 3B8WA 3JU2A 4J3VA 4DZ5A 1GGOA 2RDWA 1PYMA 3MO4A 3P80A 1MRAA 3PBWA 1KR0A 1W3TA 1V3LA 4RL3A 3EEZA 3OQ8A 3O7UA 2HTMA 1KBJA 1JD7A 2YGYA 1A0DA 2ZUUA 1FP9A 3HQNA 3HG2A 2CETA 1ISWA 2WPGA 3ARSA 2Y5EA 3E0IA 3H53A 1J18A 4MADA 3W07A 3DYMA 4CQAA 3NDOA 4PFHA 2PE4A 4IPPA 1NDWA 2OFJA 1JD9A 4O13A 4NU7A 3UWYA 1W2PA 1Q13A 3UG8A 3PTKA 3P84A 1QK2A 2YJQA 3U4FA 5LA1A 1AL7A 2IQDA 4KS0A 5J04A 1E3XA 3NM3A 3W7RA 4KMQA 4KRUA 3VFCA 2CZEA 2P3EA 1JUBA 1OFPA 2WMFA 3KCJA 5CEWA 1F61A 1XQKA 1DPMA 3O6DA 4LYKA 4TVCA 2YDSA 3IIPA 3PBVA 3OHMB 1BHGA 2WSRA 3KRZA 1Z7AA 3KX6A 3W7OA 1GJWA 2VEIA 2OGYA 2E6FA 3A4AA 1JCLA 4WY0A 3LZ5A 1LBFA 3N2TA 1P4CA 4H9YA 5A8PA 4UR8A 2REQA 3AWNA 3I3EA 1M01A 4WRHA 1EJTC 3VINA 1W31A 3CUJA 1WZLA 1X39A 1J6OA 4Z1CA 2BHZA 2WXDM 1Q6OA 4K6AA 4AC7C 2GJNA 1UMYA 4FIRA 3G0XA 1PV8A 4S3DA 3W7LA 4LEFA 2ZZ1A 1XPYA 3XIMA 3P67A 1V3JA 2YB4A 3AIVA 4H4IA 1GKPA 3BLDA 2E8YA 4DJDA 3GDKA 1EC7A 2G4FA 3E5BA 4GX9A 2J7DA 2R6OA 3ISIX 4M51A 1W9DM 1XCXA 4Z0SA 4MF4A 4YHGA 3GWQA 3TE9A 4IIDA 3GIPA 4MAZA 4BS0A 4N6EA 1Q5MA 2QF7A 2PWEA 1W9XA 1XCFA 1EP1A 2J7EA 5F4XA 2CIPA 4E0CA 1J0HA 4QLJA 1K7EA 3QMSA 5M3WA 1XD0A 4V33A 4AHPA 2RFGA 5J5RA 1P5BA 5BU6A 1R7OA 4QDWA 1EBGA 4R7JA 3MW7A 3W26A 4P7NA 3KOZA 3A3XA 3HJEA 3TFXA 3UXDA 4D72A 3VNJA 2GVYA 4MNMA 4P7OA 3GDMA 4TV5A 1W3IA 3VNZA 5AYXA 1XIMA 3SW6A 3RLGA 3KRSA 4HB7A 1UASA 4KH2A 2Y62A 3M0ZA 1E9ZB 4DJDC 7ODCA 3LM3A 2D2GA 3Q65A 2OT1A 2PDWA 1E5NA 2EHHA 3N73A 1XYCA 5I24A 4ZQPA 5AC7A 2PTXA 3W2NA 1JCYA 2J6XA 3MZ2A 1AJ0A 1WAUA 4S3FA 5IDZA 5FI8A 4DNMA 3WJZA 3HOJA 2WMKA 4RZ4A 1E0WA 1FH7A 2ZOXA 3LPOA 3GHTA 1FX6A 3GC5A 4L4OA 2CBUA 2BOEX 5B7ZA 4ADUA 3QYSA 2OYLA 1E40A 1QT1A 1PX3A 4XZNX 1MDRA 1W3LA 1EZWA 4P8VA 1FWNA 1IEIA 1LZOA 5TF0A 1F73A 4FX8A 4EPKA 1HKIA 5LA2A 2WMIB 5LIWX 3VIPA 3KWXA 3DAQA 1LLZA 3WN6A 3WNMA 1LP6A 2ZRZA 4L61A 1X7IA 3EOOA 1C91A 4MLJA 3RCMA 4MKNA 3VDHA 3S2LA 3RLUA 4MFEA 1JYWA 5FEPA 1U2YA 3ZIZA 3FKKA 2ZTJA 4MHBA 3T0BA 3MUCA 1J0ZA 3VOHA 3NNTA 5BMXA 2PSNA 1ML1A 3BO9A 1N8FA 1R3SA 3DGBA 3WQDA 2OEJA 2WVVB 4XZIA 2C16A 1L2QA 1IIHA 3C8NA 3UT0A 2BB0A 3C0JA 2VC5A 4PBGA 2ZUVA 3ZMRA 5FF0A 3QFWA 2O0TA 2OQHA 3KTXA 1Z41A 5TAOA 3W22A 4NZ5A 1K02A 3EKLA 4TOQA 5HJYA 1J96A 4JIPA 1JFXA 3TUUA 3T05A 4MYXA 4NI3A 4GQGA 4CN4A 3TXZA 1BLIA 3L67A 3P60A 1BEUA 1KKOA 2XGBA 1OFOA 1PEZA 3PPHA 3EWBX 1HL8A 1TUXA 3QKZA 3SQLA 2FTYA 1PPIA 1TWWA 3O06A 5CG0A 2HCVA 1K4HA 4WJ8A 1GHRA 1XLCA 5FJOA 4R5EA 4TIMA 3VXGA 3BV7A 3VMOA 3BJFA 3ITOA 3MP4A 3Q58A 1ITCA 3GXDA 3NSXA 3SSZA 4QR6A 2H8XA 1E4IA 5IHSA 4LH8A 3M16A 2P0OA 3L0NA 2PDNA 3G1HA 3PBYA 4Q32A 2ZA3A 3ZFHA 2Y8KA 1OCNA 3BGJA 2NT1A 3QN3A 3RJYA 1GW1A 2J4GA 3GFYA 4FMVA 4HMDA 5HA7A 3EWCA 2HXUA 5HNRA 1S5TA 2MANA 1QOQA 1R9XA 1TWSA 3E0FA 3S2MA 4EXQA 3P0WA 4D6JA 2W27A 5IXEA 1EX5A 4MAVA 3TLLA 4D1IA 3WBXA 5KMYA 2QS8A 2G4JA 3ZT5A 1W9BM 7XIMA 1UR3M 4WZHA 3SCRA 1DJZA 3AQUA 5ECUA 4G56A 1PTGA 5CPQA 2OVLA 3WSUA 4U2YA 1RCOB 2FZMA 5U4NA 3ARVA 4M6UA 3NPVA 3WH5A 2DZAA 4WGHA 4WIWA 3SRFA 2AKMA 3VD7A 3B8UA 4NIRA 3TAKA 3A23A 1KFKA 4IIBA 4EXAA 3THQA 1VIWA 1CLKA 4HTBA 4PBFA 2IPWA 4DWSA 4LU0A 1OF8A 2WHJA 2GSHA 4EF9A 4H8UA 4LF1A 2CYGA 2GVGA 1BRLA 1V3HA 2OLHA 2VFFA 4B4HA 1D8WA 1YXDA 3F5LA 3OW1A 2V81A 2VI0A 3ID7A 4WVXA 4JY9A 3ZM8A 1P7TA 3HZ3A 2BY1A 1JJKA 2E3ZA 1RR2A 1XUUA 2AMXA 4C7DA 1LQ2A 1TA3B 1ITQA 1K8ZA 3AZTA 3N19B 3CB8A 1YPIA 3MUY1 4G6CA 3CZ8A 2W3ZA 4QE1A 1DIEA 4JTHA 2Y4SA 1CYGA 1MXGA 3GG1A 4HTYA 2WC7A 5D8WA 3HO8A 4XQ6A 3IVUA 3T8QA 1B3ZA 4JTLA 4JNMA 3ATZA 4RPPA 3GTNA 4JEJA 5D2YA 3GM8A 2PDUA 3FA3A 3PBGA 4AWSA 4B3KA 3GG0A 2FB2A 4DWSC 3WQEA 3W7GA 2RGLA 4A8LA 1ICSA 1FY6A 2Z7GA 1R86A 1RP9A 4WK9A 2TMDA 5F2GA 4M3PA 1PKYA 2WVUA 3AS2A 3W7QA 4B5XA 1JZ4A 3NTYA 4I8DA 4I6KA 1K4GA 4J4KA 2VYOA 1MYRA 4MWAE 3TTYA 3VKBA 1PIIA 2BG5A 3CAKA 2CLKA 3BOXA 4E2DA 4F0RA 4I8YA 3FNDA 2CLIA 2OWXA 5M1TA 3EOUA 3U5YA 3VCNA 3LA4A 3HQ1A 4XK2A 3B8DA 3V0TA 3PJUA 3TR2A 3RX4A 1UG6A 2IKIA 3BCJA 1E9LA 1LRNA 1B1YA 3QY7A 2QT3A 3SQMA 1H7OA 4HHHA 2NSOA 4YN5A 3PZUA 4B5WA 4W7WA 4LVDA 2IPFA 7TAAA 4JHMA 5DY3A 4C7GA 2Z1VA 4ML9A 1ICPA 1A5LC 2HS8A 3PTMA 1EJSC 5I3FA 1EGMA 2E6YA 1ZSXA 1G69A 6TAAA 1KFLA 1UD6A 5CSSA 4ONVA 1EH9A 1F9CA 1VLWA 2Z26A 1FWFC 1R7AA 1ZFJA 1S3HA 2QUUA 3M0HA 1MXDA 3LNPA 3UG4A 1L8PA 3NQMA 4C6IA 3T2QA 3BMVA 3WK0A 1TV2A 2R94A 1IZJA 3NQDA 3OZPA 2WBKA 3H4WA 4CNTA 3LBCA 2QGYA 3E0WA 1TMHA 1V5XA 1JYNA 5G5IA 2EJ1A 3W88A 4KIEA 3H12A 1GKQA 3EB3A 3RGTA 3W23A 2Q71A 1EHNA 3HIJA 3BV4A 1I2NA 2E68A 1G94A 4XB3A 5DXXA 2W91A 5G2HA 1H63A 4MFDA 1B54A 3W53A 1BKHA 2G8ZA 1JULA 2PUZA 3STFA 1ZHAA 3OU8A 4LVAA 4LF2A 2VVSA 1T99A 3CQKA 1V6TA 4UTJA 4ZGYA 3FGCA 4YL2A 2YKKA 2RAGA 1BYAA 4H6KA 1D3GA 3VIGA 3D0CA 4AIOA 2J47A 2XN2A 3AIRA 1VFSA 3AXXA 3WJSA 1IXPA 4AVNA 4REQB 2NLYA 4ZSTA 4LB3A 1PCKA 3UP8A 1CT5A 3ZQ9A 4ZBCA 3M5ZA 3DFPA 4R34A 1F4AA 5HMSA 4B2DA 2C7FA 3QQWA 4FF7A 1P0KA 1ISXA 3VIKA 2PDFA 2C1HA 4GKTA 1IHIA 1VFTA 3FEQA 1EGVA 3KAOA 4MWAA 5CZ0A 3DG7A 1HKMA 3PJXA 3N6JA 1E43A 1X1OA 4A29A 5L9FA 1P43A 1SU5A 3MZNA 2HISA 1VLIA 2DFAA 4HJFA 4LS1A 2Z7KA 5AYIA 1TV8A 1VYRA 3VU2A 1YKWA 4AY8A 3ARZA 2I9UA 5C9WA 3EEGA 3PG9A 4RUBA 2D1ZA 3H4XA 1PKMA 2DDXA 3W7IA 4PFMA 5DRIA 2ZC8A 1WYIA 4HSHA 4QM1A 3W2LA 3W2UA 2KX9A 2CWXA 4PZVA 5H6HA 1JZ5A 2ABBA 4XZ9A 3KVKA 3MTWA 4FLSA 5B7YA 4JTDA 3WLIA 1EQCA 2OKOA 3CHCA 4QS6A 3VD9A 3BW4A 3WF2A 3SCQA 4CNUA 1B9ZA 1LDCA 3W1QA 1HUVA 1GORA 5I07A 3SJ3A 3H8AA 1W3HA 2VT0A 2ZX5A 1JF5A 2F7FA 3AZSA 3GXIA 2GSEA 3LHUA 4E2OA 5HR7A 4MWAC 2D0HA 4TV6A 3UJEA 1AD4A 3W82A 4W8BA 4NXKA 2VP8A 3V1PA 2PBGA 4XAGA 3GTFA 5KZMA 1WOBA 1Z8AA 1YX1A 4YTRA 1XIDA 1HNYA 3AXKA 3A13A 3EWXA 4IZGA 3VDBA 1MEIA 3ERPA 4JYDA 3TYEA 4DXXA 5LZLA 3F4DA 3PPFA 4K8GA 1QWGA 3CQ0A 1V7AA 1HJUA 1SO3A 2PU1A 3R1ZA 3QC3A 5A6BD 3CM4A 2C91A 2QCFA 3C2EA 2YYTA 1H41A 1DVJA 4ZOEA 3GTHA 2AAMA 4NAFB 1T6MA 3R8GA 4ZE5A 1UUMA 4Y8FA 3P81A 4GPNA 4FEZA 4XZBA 9CGTA 2QULA 5FL0A 1Q7MA 3SCNA 4AH7A 1KR1A 4QDMA 4IFKA 4F3HA 4IG2A 5BW6A 4WDWA 1Q63A 2X40A 4GI8A 1XIIA 4HVXA 5IFTA 3E5PA 3ZVHB 3BJSA 2Z25A 1XLLA 2GJXA 4GY7A 4GXWA 1UC4A 2G95A 4R53A 3RDKA 2I1OA 5D32A 5EL1A 2Y5JA 1XC4A 3ENLA 2QPSA 1LWIA 3W71A 4A8NA 4FNPA 3WUGA 4UUIA 1YE6A 1VAHA 4Z2IA 3ANVA 3VO0A 3W7KA 3QOKA 1V6VA 4NX0A 4O19A 2A7RA 3CTLA 1PL9A 4NAEA 2QAFA 1LL4A 3DYOA 3MSRA 4BQ2A 1KTNA 4C1NA 4K39A 5AHEA 5DEZA 4PCNA 3P2VA 1IEQA 2ZXBA 3GDRA 4GNJA 1PZ0A 2J74A 1J9YA 3BAXA 4J5NA 1A5AA 2HRWA 4UFHA 2JKEA 1DWJM 3NQ7A 4RJEA 3G6LA 4INFA 3LZ3A 4ZZ9A 2ISVA 1E6RA 5HWMA 3EWZA 4S3KA 2J9ZA 4LTSA 3O9NA 4OECA 3PSWA 2I16A 1UA3A 1RVGA 3UQNA 2A79A 5DBUA 1VBUA 1EQPA 4N42A 3GHRA 2V2HA 3PF3A 1WDDA 2POTA 4WDXA 3IGSA 3QPYA 4JDYA 4L5ZA 1S2CA 1DQXA 3IAQA 1TCMA 4ICNA 3QV7A 2A2IA 4IMFA 3L4UA 2ZZ7A 2OEKA 4KEUA 4HOWA 4WSKA 3KBWA 1HG3A 4AYGA 4WKAA 4K1WA 3W7PA 2XIIA 4M29A 2XVNA 4AZCB 1IGSA 4UTFA 1WOAA 3LBOA 1G5AA 3GXNA 4C90A 3MKKA 3OHIA 2YYUA 4GUHA 4MUPA 3W01A 1TE6A 5J5DA 1LWJA 2VDIA 4HNLA 3REQB 2ISDA 4F48A 1H51A 2W4XA 1PCWA 2F61A 5LNRA 3GW0A 3WMBA 2HNHA 4WKHA 2BOFX 4HCDA 4XZWA 2EPKX 3RXZA 1L9WA 2DZSA 5DMMA 4DF0A 3U57A 1QW8A 4AD3A 3RILA 2E7FA 5I3HA 3W27A 1XIBA 4BWLA 3SRHA 2Y85A 3ZT7A 3B0XA 1UQZA 3B3DA 1A50A 4LVFA 1OABA 1TB3A 5AC5A 1LG2A 1KQYA 1R3WA 3LN3A 3VCCA 5KINA 3O07A 3HV8A 2BY3A 5DO8A 3ME3A 1CI1A 2DQWA 5FF3A 1AQMA 4PRTA 2GDVA 3ZXWA 4LV9A 2CZ5A 2NT0A 4UTWA 1OCJA 3UWEA 4IQJA 4YCPA 5D33A 3NXLA 4F2TA 4IFOA 5CC3A 4U5IA 4HYRA 3RCNA 1E1CB 3VC6A 1YDNA 4DM2A 3CHDA 3BLKA 3A6OA 1EWEA 3PC0A 3CV2A 1SYTA 1W5PA 3GAYA 4GH3A 1LJYA 4MGGA 2BGQA 3ALFA 1ONXA 2VX6A 2Y7FA 2VX5A 3GXPA 1G6CA 1MO0A 1V3MA 2Y61A 4AX6A 3EB4A 3C3UA 1K7XA 2J7CA 3UWQA 1US2A 4HOZA 4BWLC 1W37A 3NM1A 1R6WA 1QW7A 1YLVA 3A22A 1HIZA 3NQ8A 4FXRA 3PBMA 1GOKA 4M82A 3JUGA 2G41A 1KW1A 4RE3A 4ZQMA 2JFEX 3W1PA 4MKSA 5I3KA 4AX7A 1LCOA 2ZFAA 1YQ2A 3U5UA 2B7QA 3TAOA 3N6HA 2OQYA 4CNOA 1T7LA 4Y6GA 4UTWC 1XH1A 4YVVA 3W81A 1O95A 3CUZA 3DFTA 1KWKA 2BXZA 1VPYA 3C0SA 4AB4A 3CJPA 4G5DA 2IS7A 4IPLA 4XAPA 3G1FA 2P0IA 1KXHA 4DYKA 3TCEA 4V27A 4AXKA 4GINA 5A2AA 2ZVIA 3WLJA 4A6GA 9XIMA 4TX6A 2CLPA 3TA9A 3L65A 1BYDA 5AHIA 4R9XA 1UUOA 3TJIA 3KHDA 3TJXA 3N2BA 2VQTA 3SURA 3EPMA 1AODA 2PMQA 3THDA 3PPGA 1JFHA 4IISA 5TNVA 2JBMA 4C1KA 5T91A 4MPQA 3S2NA 4GZEA 3AICA 4V28A 4DJFD 4W8AA 3A3HA 3MMWA 4QLLA 1CCWB 3N25A 4GNVA 3AHVA 1DHPA 4I7WA 1XBVA 1HJSA 5KETA 1JCXA 3HPFA 1UWIA 5DMNA 4CNNA 3S6OA 4QJ3B 4KWWA 1E71M 3S9IA 1O94A 2PLJA 1VBJA 1OC5A 1ZALA 2BHYA 4GVHA 2ZADA 2WCGA 4PTNA 3QW4B 4PMOA 3MHUA 3EDDA 4OT7A 1B90A 1Q6GA 1GZJA 1Z44A 3RPDA 3PZGA 3WUBA 4MLRA 1TVLA 5JH1A 3WNOA 3EA2A 2IPJA 1LQAA 5CLWA 4JQ2A 1OIFA 4Z17A 3XISA 4H7VA 3STGA 3UYIA 2YZ5A 1TKKA 3C2OA 4ZOAA 7REQA 3AIEA 3CMGA 5HUPA 4PSPA 2OLSA 3CYJA 2Q6ZA 1P1MA 1W1A1 3WL1A 4X61A 3BLIA 1AG1O 1XFCA 4DUWA 2V2DA 2NQHA 3S9ZA 1OD8A 3QZAA 2WLZA 4PMQA 2WMIA 1JZ3A 2I9EA 1KGWA 2DSKA 2OYKA 3L5LA 1M7OA 2O4MA 4X63A 1FDZA 3URAA 3N3TA 4OHQA 5KZEA 2I57A 2FVLA 6REQB 2IPGA 4ZR8A 3CAQA 1A0CA 1S3TC 6CGTA 1AFSA 1QI2A 2ZKMX 3VD5A 2AQWA 3RMEA 1A49A 2VOMA 2VTFA 2IKHA 2UY2A 3WQ6A 3F03K 2WVVA 3JZUA 4JFSA 1TTQA 1YDVA 4L4LA 5E93A 4HBKA 4H6EA 4DRSA 1ZAHA 3KVLA 3WD4A 2V0TA 2XDFA 3EBVA 4LGXA 2PD5A 2J79A 5JU6A 5AY7A 1GQKA 3ZWSA 2ZZ3A 2JE8A 5AFDA 1VZWA 3L4XA 3PS7A 4GIAA 3S83A 3C52A 3ARUA 4DNHA 4Z42C 4I7UA 4N9BA 5HOSA 3S1GA 4F2BA 3TQPA 1CB2A 4HHMA 4XBKA 4JTFA 3CBWA 5HANA 1RY8A 4LW7A 4GWEA 1R3YA 3BICA 3PY2A 4WSJA 3PHAA 1Q6LA 1XC6A 1XIGA 3IUDA 4W7UA 4H19A 1IV8A 4S3EA 1QNRA 3LTPA 1UUQA 4O8AA 2GQ8A 2PA6A 3E12A 5HQEA 4K8EA 2BP1A 3W1UA 3FOKA 3B40A 1UPPA 3RO6A 4DVOA 1HTIA 3QQ1A 2XSAA 3WDQA 4PTXA 4HA0A 3UA3A 4W5ZA 1JAEA 4QJ5B 1B3YA 1MW3A 3UPBA 3TSDA 3HFYA 3BTNA 3MHGA 1BG9A 1WNOA 3GUGA 1G4EA 3NL2A 3WLSA 2BY2A 4GABA 5ABEA 2Y5SA 3QLDA 4F8XA 1JNEA 3PG8A 1MFVA 3KRUA 1RD6A 2AGKA 3VC5A 2OGJA 1LUCA 3D3FA 2NXHA 3UWWA 4KGLA 2G3FA 4OJYA 1C7TA 2Z1XA 3W83A 2V38A 5ABGA 3F4NA 2VC6A 1HT6A 3PR2A 1UMLA 2A0NA 1AZ1A 2OEMA 2NWRA 1Y0EA 5DCEA 3TH6A 1TPWA 2EG6A 1K9EA 4KBXA 1JUEA 2WC4A 3T0AA 4DXVA 4IUGA 1BGAA 1P0EA 5CCZA 2AMGA 3N4EA 3V75A 4ML4A 4M1RA 3VGHA 4BI6A 3CEPA 2CLOA 2QNEA 4C6QA 1ME8A 3DFSA 3BWWA 3RFAA 1GOIA 4DYEA 1H1YA 3K8LA 1G0CA 3W7DA 3ONBA 5ECVA 1AQ0A 1A5MC 1HJVA 3KXQA 3NQEA 1H60A 3LS9A 3W70A 1XDLA 3LQGA 3FSTA 3AU2A 2WKJA 2QVNA 4AWUA 4HU8A 2QW5A 5K2ZA 2BWGA 3UFYA 1DYSA 3OGVA 1TFVA 4BF9A 1EEPA 3UD6A 4GC3A 3O8AA 2R1MA 1TA3A 3CLMA 3L4TA 2Z29A 5C2XA 4YWSA 4ZFCA 5H91A 4YXGA 1V6UA 3WQ5A 3B9OA 3AMDA 2GOUA 2EXOA 5C2CA 4O1BA 3ICJA 4YMZA 3S5NA 3COTA 2WZMA 1JCJA 5HR6A 3UEQA 4IF2A 3L4VA 1XLIA 1UJPA 4BK9A 4JD4A 5D37A 3HA1A 2WHKA 4OQVA 5BOFA 2ZYFA 1RBLA 1QPQA 3WK2A 4RKAA 3LSCA 4FB7A 1V4YA 2H3DA 4NVTA 2FYMA 4FALA 3A24A 2WWCA 4AD1A 3VIOA 3TJ4A 4UNLA 2ZZ2A 2VFEA 1XW8A 3GXMA 1QW9A 4PC8A 4J9JA 1EO7A 4KIRA 3VVGA 2Q8ZA 2YIHA 3LXBA 1TYGA 2Y0FA 1OT1A 3G24A 2WO5A 2VZOA 1VFMA 3HPSA 1IEXA 3WLPA 1F76A 3C6CA 4O1EA 1D7FA 3TN5A 2BVYA 1ADSA 4LT9A 3NG3A 3EDJA 2WSPA 5K9CA 3DFOA 1NAL1 1YTDA 3TDFA 4E8CA 3UVAA 5ABHA 1MW0A 2CHOA 3D46A 3PM6A 2G3MA 3NYDA 2VM8A 4CQDA 1VKFA 2X2YA 3QV6A 3RNDA 4B5NA 3IK2A 2I5GA 4GE8A 4UBPC 2VJXA 5D2WA 3SECA 3UZYA 4G7FA 4Y9OA 3P61A 1XM3A 1M03A 3LXAA 4Z1DA 3LD5A 4XWUA 1S1PA 4TX9A 4UZUA 4NYUA 4W9TA 1XLHA 1RK5A 1M6JA 4KRZA 3E3HA 3NVTA 1L2UA 3JZEA 1BXBA 4M56A 2WK2A 2DQXA 2J6VA 2VNCA 4EACA 4XVDA 1Z9AA 3OVPA 4BA0A 1P0BA 3SUWA 3BSMA 5A3HA 1F4HA 3L4ZA 3S6TA 3L2IA 2PWFA 3GDBA 2HROA 3LV6A 3NA8A 4R9OA 4HNCA 5D05A 4BF7A 1GQIA 2QJHA 4LWWA 1YIXA 1XIHA 4US6A 5FIPA 4MDOA 4LUIA 1JEZA 4CD6A 2FIQA 3KCLA 1EC9A 1J2BA 3N3MA 3WO8A 4QE5A 4WX2A 1HKJA 1AQFA 4QP0A 2YCIX 4MJ4A 2CERA 4Y2WA 4C65A 4DJDD 3KCOA 3AJXA 1TJ0A 3R2GA 3ANYA 3UWZA 1XBZA 4DBWA 3EMZA 4EOUA 4FOUA 4FNQA 4N9EA 4LBRA 4F0MA 4XTIA 4REQA 1CIUA 1OY0A 5A6MA 2Z1BA 2YCKX 2YFNA 3NSNA 4MY9A 4Q8QA 4JCMA 4E6MA 4GI9A 2DORA 4PTMA 1K9TA 3SFWA 2NX9A 2P53A 3N04A 3U9IA 4U31A 3RX3A 3GH7A 5HJLA 3NO5A 1U1JA 2QIWA 4H2HA 5DFAA 1E4LA 1Q45A 3SBFA 1Q6RA 1PDZA 1PDYA 4HNOA 3QGVA 1QDSA 1SUXA 4PH6A 3ZJKA 3HN3A 5HMEA 2ABAA 2VO5A 2YCEA 4XIAA 4WOZA 2G3NA 3TP4A 1BVWA 4W5UA 2YDQA 4UQCA 2DH3A 1LOSA 3S5OA 4AD0A 1JPMA 2UWFA 2PWUA 3AIWA 5EGRA 1FDJA 3WLNA 3W24A 4PE8A 2PODA 1H3GA 2R82A 4IMAA 3QHOA 5CSUA 1RPKA 2QCNA 3QGKC 2INZA 3EMQA 1KC7A 3IARA 3S5YA 3THAA 1BKSA 3K4WA 3MWAA 4OBRA 4ZTYA 3IGXA 3FLUA 4AZHA 3S1UA 3URQA 5CPOA 2QDGA 3BCDA 1EA9C 2XIQA 3IGUA 2RGMA 3VDAA 2OXNA 4U28A 1X1ZA 1SFSA 5AHFA 2OZ0A 3DZ1A 1EFZA 1EJ7L 4LNCA 2ZRXA 2YX0A 1WKEA 3TNBA 1M7XA 1GK8A 3PBUA 5FJTA 1B5TA 3HPXA 2DW6A 3CAWA 1DJQA 2DVXA 2UY3A 1A5UA 2E5BA 3E9AA 1G7VA 5C70A 3VKAA 2D2HA 1B30A 1NJJA 3VIHA 2HPMA 3AYTA 3F7JA 2HDJA 2H3BA 2XFWA 3FJNA 4Z2GA 4Y96A 3WDIA 2W63A 2X09A 4ZB2A 4NASA 2CKRA 3A4WA 4N0RA 1EHAA 4JICA 4LRSA 2E5CA 2Q3OA 5C9XA 1KWGA 4KETA 1TPB1 3NZPA 4PMJA 4NYYA 4GFIA 1KRCC 2XVKA 5HNNA 4AEEA 5LIKX 3PNZA 4Z2JA 3H4GA 5FEZA 1RSCA 4ZTXA 2Z2UA 5EU9A 1O60A 1PIGA 4NAFA 4H01A 1W9VA 1E4MM 4J28A 4TO8A 3AU6A 4DIAA 2OWWA 5LIYX 3W7MA 1FCBA 3FKRA 4AZ6A 1H7RA 2X41A 3LHYA 3LSBA 1OFDA 2D3LA 4L64A 1OX5A 3EX1A 3KRBA 3LMYA 2VRKA 4AZIA 3O05A 2VGGA 2W66A 2ZXDA 3DFNA 4X9YA 2WLYA 1M3UA 3RX2A 1UR4A 4G8TA 1LRQA 3V35A 1QNQA 4WXZA 4GVIA 1ZAIA 5M17A 1CDGA 3GB6A 4FHAA 1NTHA 4K68A 3KL0A 2ACRA 1WDSA 5BRPA 2CKSA 5HMDA 1Y5WA 3ITVA 3GU9A 3UR5A 4ALDA 1RJRA 2QV5A 2VX7A 3MUXA 1A5CA 2D0GA 3IRDA 3P62A 3EWDA 2A3LA 1V02A 1P48A 5I23A 4GX8A 3BC9A 1BYBA 2WM1A 3VOGA 3BGAA 4XTDA 4S3JA 4HHLA 4DPPA 1THFD 5DMYA 3T7VA 2CLMA 4GQBA 1NQ6A 2Z27A 4C6MA 3V5CA 2FHFA 3MBDA 1EYWA 3B0UX 3B0YA 3STPA 2JGYA 3TCSA 1XLAA 2DVTA 1FFRA 3U48A 2OZTA 4GHRA 5ABFA 4IHCA 4A8RA 3B0VC 5FAGA 3H21A 3GVRA 4DI8A 3CUGA 1A0EA 2ACQA 2GQAA 2RJGA 4GO8A 3QY8A 2DZXA 5LGXA 3ZT6A 3QXBA 5B80A 2A7NA 1BTMA 3UZXA 4DWSD 1MMFA 3IK4A 2XINA 2AQOA 1MVYA 3UNDA 1DOSA 3WD0A 4UTTA 3U2EA 3WQGA 4ATDA 2Z1SA 2YW3A 1V7YA 3QTGA 4E3VA 3W25A 4ZO8A 3NOYA 1UH4A 1O5QA 3TEVA 4RV8A 3G1SA 4C6CA 4P8WA 3GNPA 3W02A 1IT0A 3MYPA 1QK0A 4XKYA 1LWHA 3UPMA 4QITA 5FAJA 3NGFA 1MZRA 1FUYA 4PSRA 3EMCA 2A3EA 4Q8WA 5E09A 3AALA 3L21A 3KLLA 4ATWA 5CC5A 5ENLA 5EMLA 4C6KA 3KZSA 1DHKA 4H1ZA 1XWYA 4NX5A 4NILA 5DCBA 2H8ZA 2GDQA 3I10A 1XL9A 4MZ8A 3LBMA 1OX4B 4GUFA 4AWTA 2J62A 1SO4A 1EJRC 3MJYA 4D6IA 5DXYA 3L2MA 1GOOA 1J5TA 1TO3A 1A5KC 7CGTA 5F1UA 1VGAA 3BQ5A 2QR6A 1D3CA 5E0FA 2ZZ6A 2H9AA 2PF0A 3V5FA 2J24A 3WMSA 1CLVA 2CXGA 3IGHX 4AHQA 3Q67A 5DT5A 5I3IA 1TPEA 3WF3A 3FCPA 3OGSA 3H6OA 2EPOA 2FFCA 4B3ZA 2FKPA 1TCDA 3S3GA 1V6XA 4EVZA 1OM0A 4YTSA 1FKWA 1NWRA 1J5SA 1JDEA 3DFHA 3WLLA 3B8SA 2IUZA 3CMFA 3R10A 1CZ1A 1E9YB 3SCTA 3DHFA 4OV4A 3IUIA 1BVZA 5DBTA 3WD1A 4C6FA 4DPQA 2J8FA 1VEPA 4BY3A 2XM1A 3G5EA 4YWIA 5IBXC 3VKDA 4HCLA 3TYDA 1RVKA 1XYZA 3LU2A 3WF0A 4MY1A 2EPLX 2Y70A 1W5MA 2GWGA 3IJ8A 5EFFA 4QXIA 2YA1A 2QGHA 3ES8A 1UW9A 2WHMA 3AROA 1VHNA 3WQCA 1P6CA 1XI3A 3GFXA 1Q8JA 1E55A 2MUCA 3G1AA 3SB0A 2HE5A 1UD5A 1PE1A 4I9MA 5XIMA 4UQEA 5GPRA 3GLCA 1RD5A 4TTUA 1W17A 2G96A 3VE9A 4P7LA 3S0CA 2KZHA 3HMCA 3RN6A 4R85A 4JTRA 3H2FA 4DLFA 4F66A 2JF6A 5CQ1A 2NXIA 3M0LA 4Q4RA 5AYYA 3E2RA 1UQYA 1IXNA 4N9CA 4EF8A 2TODA 1O1ZA 4NI8A 4GMEA 1UR2A 3EB2A 3WCZA 2E09A 3PZNA 1E1EA 2QXWA 3ANUA 3N18A 3OIXA 4UTIA 3TZNA 3ARWA 5IFPA 1YHTA 3G3DA 3CASA 1LL6A 4HPJA 1R2RA 2FFIA 1QOPA 3N4FA 4CVWA 3FW6A 3E38A 1E6XM 1KM5A 2GGEA 3M7SA 1P6BA 3NURA 4URIA 2D2OA 2PDBA 4NJGA 1ISVA 3KBMA 4B2DD 5BWAA 2G50A 1VRXA 4PCFA 3SCVA 2VELA 2GZXA 3WQ8A 4WEVX 3EWYA 1Q6DA 3NL5A 3FA4A 4KF1A 4WUIA 4MWAD 5EMUA 4E4FA 2J66A 2VURA 3EX3A 4HZMA 1TTJA 3GX9A 2CPUA 1S38A 2WZHA 3GG8A 3T55A 1J93A 3DG6A 4GQ0A 4J3XA 3CIVA 2A5HA 4W86A 2XG9A 1RUSA 4PCPA 1PBGA 2PF8A 1FA2A 1ME7A 3G1DA 2ZA1A 4K1GA 4ZXOA 3NZGA 5BCAA 1JCTA 4GCAA 2XSBA 1LYXA 3WY1A 3B9EA 4N2YA 4LC8A 1EJUC 4I5UA 4HSOA 1WKDA 3CTTA 3MV01 2D22A 4NQ1A 1CXEA 1SFJA 4KCTA 5MF5A 5K9XA 1WE5A 4XSLA 4P2VA 4MY8A 4RZBA 4Z2HA 4KEZA 3FX4A 3USBA 1FWEC 1VJSA 1XLEA 2ESCA 3GVVA 2HJPA 1W1TA 4JXCA 2DT3A 1NU5A 2XISA 1FCVA 2RHGA 2VDGA 3KDNA 5PTDA 1CGTA 1HXJA 4UOQA 4E8GA 5G1TA 1US3A 2B4GA 4NNAA 3BLFA 3QH2A 4W88A 4DO4A 3FGCB 3PZMA 5A94A 2QPXA 1X8FA 3VIMA 1BXNA 2OJPA 1GEQA 3MSYA 4K3ZA 1T8QA 2DT2A 4XZMX 5CPTA 4TU1A 2DZBA 3TA6A 3UR2A 1P1XA 5DN1A 3HGJA 4IIFA 4LYPA 3WQWA 4I5RA 1O4UA 3TXVA 4JFTA 1XSIA 1VFUA 4DX3A 2Y89A 3V0UA 4MZYA 2ZRUA 1AH0A 4GZJA 1F6YA 1DQUA 2WJFA 1VEMA 3D3AA 4L4PA 4RDVA 3LG3A 3BXWA 3THUA 4UIOA 2O9OA 2B81A 1KNWA 1V0NA 4MWAB 5E0KA 1XLMA 3FK4A 2DZVA 1GHSA 1VFLA 4IP7A 5LKYA 1FH9A 3P0XA 4JFVA 4IGHA 4AZ7A 1NOFA 1HVXA 3EX2A 1B3XA 1GOMA 3LCXA 9XIAA 2HPIA 4UMCA 3U2CA 4OUIA 3ATYA 4IJBA 5I3DA 1VH7A 1W5QA 1DE5A 1OYCA 2DZWA 3T8LA 4XAFA 3W87A 4XX6A 1V6WA 2VR2A 5D2VA 1YPXA 3ZSSA 3CAVA 4JX5A 3R43A 5BMWA 3LGEA 1XYLA 3ELFA 1NEYA 2OX4A 1HVQA 4XD3A 1E0VA 3KEHA 3BLEA 4D71A 1R2TA 3GBEA 1IEWA 1F5ZA 2BASA 5JBEA 4D9PA 5D9MA 2GSJA 3AAMA 4LEQA 1XGDA 4XBJA 1SZNA 3N2CA 2VHLA 4LYQA 1XGEA 3PB0A 1EDGA 4I3GA 4RK8A 5HMFA 1XKYA 2VZTA 5BU9A 3SN1A 4ZO6A 2PCQA 3N14A 2R14A 2YXXA 1EOKA 3SUSA 1G9HA 2J75A 4GVGA 5EMYA 3UF9A 2POZA 4H00A 4QG9A 1JPDX 3C0LA 1U5VA 5AYZA 3BE7A 4GKLA 3V7PA 3C3NA 3IJ9A 2VD8A 4J3WA 1WKFA 3KBVA 1L6GA 4LANA 2GJRA 3LHZA 3SQSA 1KB3A 4XUGA 3WDPP 1Q6EA 1CTNA 1WDPA 3E74A 2ZUWA 4O1DA 4X3ZA 2GJXB 2NWSA 3WJXA 1JPHA 3I6EA 3PZIA 1D7KA 1XRSA 1GNXA 1QTWA 2FPYA 1PX8A 1GOQA 3FYOA 5AZ1A 3N2XA 3ABRA 3UBPC 4NT0A 2NUYA 5H8PA 4QSFA 2W92A 4FP1A 3TYZA 4RDWA 1Q4WA 3KS5A 4J3SA 1YNYA 2P3ZA 3MP3A 3KDOA 1TX0A 2V5KA 3NWRA 4KERA 3F2CA 4NAEB 1AJ2A 3W6LA 3VGBA 4C1NB 3RR4A 3W76A 3W1RA 1KTBA 3YPIA 5FOOA 1B3WA 1MQRA 1HL9A 2X0SA 3SM0A 2WCSA 2J25A 3A9IA 3HG5A 2V3FA 3TROA 3UJFA 2XTKA 5CJ5A 5T9CE 4BQ5A 3W29A 3GU1A 5G4EA 5EMJA 4LUTA 4PUDA 2ANUA 3HM7A 2DT0A 2PDXA 4HZ7A 1U22A 1E4NA 2OG9A 3CHVA 1CGUA 3LGGA 1F6PA 2OSXA 3DECA 1PB0A 4LAZA 4OIFA 4MNKA 2YSWA 3MT1A 1R2SA 4JGDA 4XD6A 1B57A 3CHEA 1DJIA 4XD4A 2QCEA 4KESA 2ZUNA 4QDPA 2QUTA 1GG1A 3RK8A 1CGVA 1IXOA 3AOFA 4HPGA 5LA0A 1Y7VA 4UFKA 4HZ8A 1SZGA 2Y24A 2GL5A 1T96A 3LX9A 3SJNA 1TPC1 4BCEA 5CPLA 1OC7A 1ODZA 4A2RA 2VZUA 3VPLA 3S5SA 2CESA 1I60A 4O10A 3M0KA 4S3BA 2QCHA 2Q01A 1OG0A 1MQQA 1NIUA 3MKCA 5I03A 3G2GA 3DGRA 4WJXA 4NZ4A 2PRMA 2TSYA 5F7UA 1TJ2A 4ORIA 3K4AA 2WVTA 3BVJA 1O5RA 4NJJA 1TPDA 3MBFA 3CQHA 2GUUA 3AJ7A 4IQEA 3CPGA 1XYBA 4PB4A 2ZDSA 3TK7A 2DJLA 1UD2A 3U2OA 2RDUA 4S39A 1V03A 1TMQA 3WH7A 1BQGA 5BOOA 4X0NA 4BEUA 1NF0A 3SEPA 4PRRA 3BQ6A 1FXQA 4NY2A 2EPMX 4ZO7A 3QMRA 2ZRYA 1JXKA 4PMUA 4X22A 5BOEA 3VZZA 1XBXA 3W37A 4HJWA 4IJRA 1GYLA 4HYVA 2EGZA 4FZIA 2DSUA 1A4MA 3WQ4A 3OLDA 4PUUA 5BXRA 2DSWA 2YXOA 4EWND 4MKVA 1DL3A 1J11A 1FWWA 2VRQA 3W9ZA 2PP0A 1XRFA 3KE0A 1RLDA 2F6XA 2JIEA 3UJRA 2FHBA 1GQNA 1GVQA 3GG7A 5CGTA 3IJDA 1LT8A 4DI9A 1QFEA 1EOMA 5HNTA 2CBIA 1Q4NX 1X6UA 5LNUA 3TQ0A 3CU2A 1Y5VA 2R8WA 4GH1A 4CN1A 5FJRA 1YE4A 1VC4A 1JVNA 1OADA 1U5HA 5D8ZA 2CEQA 1ZU8A 2VEKA 1WZKA 6TIMA 3BG5A 3PUEA 4BEQA 2VRJA 1SJAA 4OE7A 4KFPA 1JNDA 3SADA 1JI2A 3WQOA 1PTAA 1W3KA 3PZVA 3UCCA 3AUOA 1XQLA 3KZPA 4DAIA 4R27A 1A3WA 1LBMA 3VZYA 3S1XA 4OTKA 1X1NA 3G8RA 2YB1A 1RQHA 2WJDA 1W91A 2PEVA 5AZ0A 5ABTA 5H2ZA 2OZ3A 5DANA 3W74A 3GQYA 5AOUA 3VZXA 4GJIA 4L1XA 3SRKA 3S1VA 1HFBA 1GJPA 3H70A 4WDTA 3UCDA 1ME9A 2HV5A 3GH4A 4I90A 2P76A 3R0KA 8RUCA 1RJPA 4CVUA 4MOZA 3UXKA 1OGSA 3EZ4A 1RQEA 2V69A 5LGZA 1TMLA 1Q7QA 5FD0A 2DY3A 4ZOBA 4AFYA 3LYEA 2UBPC 3VOJA 3QSRA 4R7OA 4UCFA 3OPSA 4ERIA 1YDYA 4W8LA 1EXBA 2EEXA 1XG4A 4KPLA 4Z08A 4MMWA 1ZBWA 3EX6A 2E40A 4EAMA 3OLEA 4CQ8A 3QR1A 2ZVRA 2X0YA 3AYSA 4RNIA 2QMJA 2DW7A 3HPAA 3LTYA 4ZB0A 4M24A 4WKFA 2QQ6A 2CXEA 3FXYA 3LENA 3LLFA 4OFCA 4HNTA 3ZSTA 1KO0A 2G0WA 4HNNA 1K70A 2A6NA 2V9DA 4C6OA 2PZNA 1KFBA 2VKZG 2I7GA 1GQLA 3PN8A 4PMZA 3GNDA 4FXJA 3STEA 3D6NA 3M1ZA 4L65A 3FYPA 1HN1A 4R3UA 2J78A 2X1SA 1MRQA 1VJZA 1Q65A 5FSEC 4S38A 1C90A 5BROA 4L1GA 4OVXA 2VCCA 2W0UA 4HMCA 1F3WA 1Z32X 2IKJA 7REQB 2QYGA 4HKPA 2VMFA 1RA0A 4UWMA 2PGWA 1WDRA 4DM1A 4P61A 3WD2A 4F2UA 4AD4A 3Q4DA 4O57A 4FNUA 1PHWA 3WKZA 1YNPA 1U33A 2O9PA 3BW3A 4LJ3A 1KFCA 1UR9A 1LLOA 1FP8A 3VOCA 3PTDA 4J2MA 2C0HA 1REQA 3ABOA 2PB1A 2EQDA 4ZQCA 1Q3NA 3WLOA 4FSAA 3BPWA 5BRQA 5A69A 3AS1A 4Z1AA 5LIUX 1WZMA 1S46A 2CC0A 4JYFA 4LUSA 2JQXA 3G0UA 1QI3A 2P10A 3N11A 4F9JA 4YU1A 2E8ZA 2GUBA 1BFNA 4IL2A 3T40A 2GVJA 3CT7A 3L5AA 4PA8A 1O68A 3HB9A 1FWHC 1FCQA 3RPMA 4UFMA 1XDJA 1HKKA 1B3OA 1EX1A 3PFRA 3W6MA 1JZ6A 1ONEA 2DIKA 2PWDA 3R25A 2G5WA 1TE1A 1DTNA 4Q4QA 4IQLA 2QDDA 2I17A 3KHJA 6XIAA 1E6QM 4XUYA 2ASHA 1OFEA 1VB9A 3LRKA 4U10A 3QR0A 2XGZA 1JDDA 2VUNA 2VX4A 4CCEA 3TOYA 2PLKA 4MYAA 1VP5A 4FXSA 1SJBA 2EKGA 2QCCA 2NX3A 5E6ZA 2X0HA 1OX4A 1FFQA 1OCQA 1TJRA 1IT7A 3GNRA 3ZR4A 4LAMA 1OFRA 4MSSA 4GXMA 4HU3A 2I5QA 3MY9A 2VDHA 4L6OA 1OK6A 1UCWA 4D2JA 2P8CA 3FVMA 1EDQA 1M04A 3CHFA 4ICCX 4IMGA 5AN7A 1RY0A 1VQTA 5KZDA 4EPDC 3O0FA 4E3TA 4F4RA 3I7RA 4J27A 4IPJA 1LUCB 2PC8A 2QF8A 2X1RA 1VCGA 2XVGA 4ZQOA 1J0KA 3S42A 4IT1A 2YL9A 3CIWA 2E0PA 3FAWA 3TR9A 2DVUA 2EKCA 2GK1A 1OHLA 1FWTA 4P7RA 1MUMA 2DSVA 3WLRA 4FPSA 3M0JA 2YBUA 3N13A 4MUZA 1C8YA 1NP0A 1CXHA 3ITCA 1HF6A 1H0IA 3SCUA 3M41A 2A1YA 4L4MA 1NDZA 1VBRA 5JQ9A 1UP0A 2QZRA 1OGGA 5D9NA 2VXNA 1JYVA 4EX4A 1O5XA 5FJIA 1H5YA 1UIOA 4YCOA 4Z0JA 4BQ4A 3WK3A 1DWAM 4AIEA 4AVFA 4LX4A 3PZOA 1YBQB 1IZCA 4B4FA 1JI1A 4PUKA 4WCJA 1BPLB 2WSYA 3SCPA 4RW3A 3B8TA 4GCXA 1JG9A 4ATLA 2X05A 1UC5A 1POKA 2YA0A 4JKMA 1QPRA 2GGGA 3DKLA 4YLWA 3W7JA 1R9ZA 4RDZA 1OK4A 1WKYA 3W1NA 3FSUA 1LTDA 4MNJA 1GVRA 2J27A 4UQBA 3V1HA 5FJJA 1XINA 3O0KA 1TV5A 1U30A 4N4QA 1GJUA 1OC6A 5CJMA 5I09A 3BAKA 1ZAJA 3IPWA 1MEWA 3U3HA 3AI0A 4DLMA 2IXUA 4GISA 1VR6A 1JAKA 1MW1A 3M0IA 4W87A 3W84A 3BJTA 5LNWA 1JQVA 4CUCA 3K8MA 3TIMA 1QBBA 1YRRA 2YBTA 2B7NA 1K7FA 2VGFA 4NZ3A 4K7YA 4DWDA 1AW5A 4QEHA 4BZYA 2CHNA 1UR8A 3SRDA 3L5MA 1TZ9A 1E9IA 4US5A 3M0VA 4U3AA 1V3KA 1YPFA 2D3NA 1FOBA 4O17A 4NG3A 8XIMA 1SJCA 1UWSA 3WK1A 2Y6ZA 3AC0A 1TPFA 3W2MA 1CENA 3GKFA 5CPNA 5I6SA 3LCGA 4E4UA 3NDZA 3UGVA 1IZKA 4S2BA 1I6NA 1QMLA 1RCQA 3TN3A 1W9PA 2ISWA 1NFPA 5GJMA 2Z1KA 1J0IA 3DFQA 3LXCA 2V63A 2EPNA 3DBNA 3DERA 2WM0A 4C5YA 3W7EA 4E4PA 3WD3A 2E25A 4GUIA 1ZCCA 4FLQA 1O1HA 3LERA 3AO0A 2O55A 1I1XA 4RZ5A 3EOEA 1X6NA 5F2LA 1CXFA 4DQWA 4GXPA 4X2RA 3CV6A 1NM9A 2C71A 2JGQA 1AZ2A 2FJKA 4HPXA 4PL2A 2FTPA 1K9FA 2HZGA 4XBSA 3GIQA 3XINA 3VNYA 4PEEA 1H61A 3VM5A 3F5JA 3QYQA 4PUMA 2Y8VA 3WF4A 4IFRA 1V8EA 2X1IA 3LI1A 3IV3A 4QAIA 3GZ3A 4CNPA 1N8WA 2IKGA 2NQ5A 4KFNA 3UGRA 1S39A 2FPVA 2O92A 5SWUA 1TELA 1HZYA 1K8CA 3KOFA 4LBUA 4Q8NA 1BXCA 2FGBA 3AHXA 4L6DA 5LYRA 2CWNA 3K5XA 4A05A 2KAUC 2FPTA 3K1DA 4IWWA 3S1WA 3QMTA 4XISA 3IACA 2PDCA 5HK4A 2A7PA 5E6YA 1UZ1A 2FH6A 1H11A 4X0VA 1FWCC 3SCSA 4GJ1A 5I5RA 1MUWA 3QLLA 2XH7A 1B4KA 1EP3A 1QAPA 4QJ1A 4Y8EA 5M03A 1EBHA 5C9UA 1H62A 1QASA 1JDAA 4QCEA 3QQ0A 1WAWA 4G7EA 4PCSA 4XAZA 4JIQA 4PCTA 1WXJA 4JNZA 1KBBA 2FMNA 2PDLA 1ZJBA 3C56A 3PJTA 5FESA 5LNSA 5T8GA 4XZLX 2ZQ0A 4H8VA 4A3YA 1YTKA 4O1FA 2D20A 3KVJA 1HP4A 2A4AA 1ZP3A 4C91A 5KTLA 1ZTVA 4OBSA 5HAOA 1N2VA 5CBBA 2YDAA 4IUOA 1WB0A 4GY1A 3ITTA 3GW3A 2WKLA 2B7PA 1WP6A 4PMNA 5CZKA 1XSKA 3N9RA 3BLLA 4Q7NA 5BXPA 4P8XA 1X97A 3VOFA 2IQ0A 1V51A 2VC9A 4HIBA 4KWVA 3ZLGA 5K9DA 3A4JA 3DUGA 2VGBA 1G1YA 2ZX7A 3IWPA 2H6RA 3D47A 2V8ZA 3CUHA 1OF6A 2F9RA 4GO9A 3THCA 1FWSA 1DIOA 2XZ9A 5AECA 3NPWA 3RLHA 4N7QA 1V93A 3B9NA 3SSJA 3ARQA 3OVQA 4PUNA 5FEWA 3NOEA 1JCMP 2ZIDA 3ZZ1A 1VS1A 2Z6JA 4YYFA 3KWSA 1AH3A 4W4QA 1XISA 1I2RA 2V3DA 3U7VA 1DXFA 1LBLA 3W73A 1Q8AA 3FN9A 1F8IA 4AXNA 4E8DA 3B06A 1XV8A 4PTVA 2Y7EA 4Q7IA 3GR7A 3VIJA 2X8RA 4DJEA 2CBVA 3NAVA 1OZQA 4XV0A 3MJMA 3VDCA 3PFMA 3CC1A 2ZBTA 3ES7A 1OWQA 2RDXA 3NFUA 1LOLA 1ZB5A 4O14A 4OOUA 5GJPA 1NWSA 1Y5XA 3C2YA 1GZ1A 2VWSA 1RCXB 1SR0A 3TTEA 7ENLA 1W1PA 1UB3A 3QY6A 1R5YA 3V0SA 3AXMA 2YR1A 3RRAA 1FWIC 2ATSA 3JS3A 2J8TA 3BMWA 5DCDA 3DHUA 4UXDA 1J0YA 3N15A 1JPIA 3G77A 3GKAA 1C3FA 3L4WA 2UY5A 2DZPA 4JR5A 1Q2SA 2Q02A 1VYSX 3R5EA 3JR2A 1J8VA 5CPSA 2QCMA 4UC5A 4ADTA 1Z48A 1C93A 4LY4A 3VGGA 3SGZA 2LLEA 4WXYA 4H8HA 4DJEC 1ZS2A 2E6AA 2NQ9A 3MMDA 1FBAA 3O1NA 5F4WA 4ZEPA 2YZRA 3CZJA 2XWDA 2J9XA 4YIWA 5XINA 3DFYA 3BSGA 3M9YA 1KM1A 4XO6A 1RP8A 2EPHA 5K4ZA 5I78A 3RIKA 5HWJA 3URBA 3O15A 3IIOA 3M5YA 3DEQA 3QPEA 1UKOA 3W1LA 2O7QA 4DO5A 1E0XA 1BWKA 4GZ7A 2DUZA 4N02A 3MWCA 3W6YA 1W6TA 4YVPA 3MUZ1 5GJNA 1V0MA 1PXGA 4AUBA 3I6TA 1SW0A 3QZEA 2GGIA 2V82A 3TYUA 1UD4A 3KBJA 3I68A 4J3UA 4FAMA 3EDKA 4L1WA 2XFRA 1D3HA 2WJEA 1QI0A 1KRMA 3OIHA 3TYAA 3TTSA 3BG9A 1Q66A 3KLKA 1CNVA 4JDBA 1KXTA 1U5JA 3MCNA 5ABFB 4M6VA 3B9AA 4Q6XA 3B05A 1W3JA 1CGWA 2ALRA 5AYBA 2GQ9A 1K1DA 1C7SA 2ICSA 4O16A 1W5OA 2YBVA 3MV11 1GEHA 3K2GA 2BODX 4O0ZA 2OX1A 4QHRA 3PWAA 3GDLA 4H83A 4JFWA 2YCLA 1EIBA 3I7QA 3LTSA 1U1UA 1V08A 5FL1A 4U5KA 4TMCA 2GUYA 5AC4A 4F79A 5LSMA 3FVDA 3UJ2A 2ISFA 1ADOA 2QUVA 4TR9A 4JY8A 2RH9A 3E0LA 2VCAA 1N8IA 3OP2A 4XKYB 1UD8A 3T42A 4S3GA 1YNQA 3SGUA 2ZX9A 2XYLA 1QJWA 2HE8A 3SN0A 1SM9A 2QAPA 2GVLA 3QV9A 4ZFMA 3BOFA 4D8LA 5A6TC 1JR1A 1V0KA 4AMCA 4ZO9A 8TIMA 2RDTA 3W1MA 2BTMA 2GQ3A 3VUSA 3WBYA 1GQJA 3GD6A 2YCJA 4AYSA 4UTKA 1HX0A 3KBNA 1S2UA 2Z0IA 1MNSA 1F74A 4UR7A 3WNPA 4GGBA 5DELA 3DYPA 4HN8A 1QVBA 3NL3A 1QI5A 3EKGA 2BY0A 2VQUA 4DHGA 5BZAA 3AHZA 3SIMA 2JF7A 3DG3A 4CKQA 5H8UA 1O12A 1VBHA 1LORA 4IX2A 1TX2A 2H9AB 3WYZA 1V79A 2HWGA 4GJJA 5CSRA 1NOWA 2OOGA 1TR9A 3C61A 2HS6A 2OYMA 3PUGA 2X42A 5CGMA 2PP1A 3GDTA 3LNMA 5I7GA 2INFA 3OZOA 2VENA 3EKZA 3ITLA 4GQRA 1PZ3A 1S2TA 3KOYA 4FF5A 1POJA 3L9CA 1BF6A 3C2RA 3P74A 2QJGA 4B16A 5I00A 1M1BA 2HEJA 1E1FA 1PUDA 1ZNNA 5C55A 3B9DA 1AVAA 2ACUA 3T4CA 2WYSA 1R47A 2WSKA 4FNSA 1TREA 4AIUA 3W00A 2C14A 2PRHA 2F38A 3GIYA 2JEPA 4XO7A 4ACYA 2D0FA 1TPVA 4QG6A 3T6CA 3O63A 3PAOA 3Q45A 4AEFA 3ARRA