4R9OA

Crystal structure of putative aldo/keto reductase from salmonella enterica
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
MVQRVTIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALTLAPHLREKLQIVTKCGIATTARAENKLGHYITDRRHIILSAEQSLKNLATDYLDMLLIHRPDPLMDADDVAEAFQHLHQSGKVRHFGVSNFTPAQFTLLQSRLPFTLATNQVEISPVHQPLLLDGTLDQLQQLRIRPMAWSCLGGGRLFNDEAYQPLRQELSVIAQELNASSIEQVVYAWILRLPSQPLPIIGSGKIERVRAALEAETLSLTRQQWFRIRKAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aldo/keto reductase
publication title Crystal Structure of Putative Aldo/Keto Reductase from Salmonella enterica
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
total genus 99
structure length 293
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4r9oA00
3WBXA 3GHRA 4Q3MA 1ZQ5A 1S2CA 4XZIA 3WBYA 4JQ2A 3CASA 3LQLA 2FZBA 4JIRA 4L1XA 4GCAA 1C9WA 2PDMA 1X97A 3LZ5A 3EAUA 4XVEA 5M2FX 1YE4A 4FZIA 4QR6A 4XZHA 3RX2A 2IKGA 2IPWA 4JQ1A 3UG8A 3UZXA 1YNQA 3LBOA 1JEZA 3V0TA 3NTYA 1PWMA 5LIYX 3R7MA 4JTCA 1EF3A 2PD5A 1Z8AA 3G1RA 2IPGA 3WG6A 3LD5A 2F2KA 3LN3A 3T42A 3CAQA 2IKHA 1Z3NA 4JIIX 2PDGA 2I16A 4NKCA 4G5DA 3U2CA 3R43A 2HVNA 1RY8A 2VDGA 2IQ0A 3R8GA 4H7CA 4QX4A 5HA7A 2NVDA 2PZNA 4JQAA 2AGTA 2PDUA 1YNPA 4QBXA 4PMJA 3BV7A 2NVCA 4OTKA 1T41A 4QXIA 4ASTA 3G5EA 4LAZA 3WCZA 3D3FA 2PDPA 3LEPA 1J96A 1QRQA 2IKJA 1MI3A 2PEVA 1Z89A 3EB4A 3R94A 4HBKA 2PDIA 3MC5A 2IS7A 4JTQA 2PDXA 1XGDA 4F40A 3UGRA 4GABA 4XK2A 2J8TA 1UR3M 4FA3A 3BCJA 3H7RA 2I17A 3O0KA 2ACRA 2ACSA 3UFYA 3B3DA 1X98A 3BURA 1AH3A 5HNUA 1RY0A 4XAPA 1GVEA 3GUGA 4WDXA 2PDQA 2FVLA 2ALRA 2PF8A 2HEJA 4JIHA 3LQGA 4GQ0A 4DBWA 2HE5A 3CV6A 4LBRA 4XVDA 4LB3A 1IHIA 5LIKX 5JH2A 4WEVX 1X96A 3CV7A 1R38A 1AH0A 4FALA 4PRTA 1K8CA 1ZUAX 4GA8A 2PDFA 3EB3A 3O3RA 1EXBA 5AZ0A 4LBSA 5HNTA 3LENA 5C7HA 1HW6A 2R24A 3S3GA 1XJBA 5AZ1A 2HVOA 3VXGA 3FX4A 1Z9AA 4JQ3A 3DN5A 1OG6A 4LB4A 2FZDA 2F38A 4GIEA 3GHUA 1AH4A 4DBSA 3H4GA 3LZ3A 3V36A 4AUBA 1AZ2A 4XZMX 1US0A 4R9OA 3Q65A 3ONBA 1SM9A 3FJNA 4JTRA 4L1WA 3ONCA 3M4HA 2IQDA 1YE6A 3MB9A 4IGSA 4JTAA 1A80A 3RX4A 1Q5MA 3RX3A 3GHSA 2PDYA 1M9HA 1LWIA 3R8HA 4LAUA 5DANA 2PDBA 2BGQA 3N6QA 1MZRA 2PDWA 3KRBA 4WDTA 2HV5A 1MRQA 2CLPA 3M0IA 4ICCX 2PDCA 4WRHA 4DBUA 1ZGDA 2PD9A 1S1PA 3GHTA 4ZFCA 1S1RA 2ACUA 2IKIA 2PDJA 1LQAA 1VP5A 3UZZA 2ISFA 2ACQA 2DUZA 4Q7BA 2DV0A 2FZ9A 4EXBA 4PUWA 2WZTA 2PDNA 1QWKA 2DUXA 1FRBA 2BGSA 4GACA 4DZ5A 3LUTA 2WZMA 4FAMA 2IPJA 4IJRA 2BP1A 1PWLA 1AFSA 4MHBA 3V0UA 2PDLA 2IPFA 2FZ8A 1PZ0A 4PUUA 4YU1A 4YVPA 1AZ1A 4PRRA 5LIWX 1S2AA 3F7JA 4PR4A 4GQGA 1PZ1A 3C3UA 1T40A 4WDWA 4IJCA 3M64A 2PDKA 4YVXA 3R58A 3ERPA 5JH1A 1PYFA 1EL3A 3UYIA 1ZSXA 3UWEA 4YVVA 3N2TA 2INZA 4JTDA 4H8NA 2PDHA 5LIUX 3Q67A 3V35A 1VBJA 1EKOA 3WBWA 3UP8A 3V0SA 4XZNX 2QXWA 2A79A 3LNMA 4YS1A 4WGHA 2INEA 3DOPA 3UZYA 2FGBA 1Q13A 1RALA 3UZWA 4XZLX 4WDUA 4XO7A 3H7UA 2HE8A 3R6IA 1ADSA 3COTA 2HDJA 3BUVA 1IEIA 2P5NA 4HMNA 3CMFA 4EXAA 2C91A 5LIXX 1HQTA 3P2VA 2PFHA 1XF0A 4JQ4A 4XO6A 2R9RA 4RPQA 5KETA 3QKZA 3CAVA 4I5XA
chains in the Genus database with same CATH superfamily
5CZJA 3F5KA 4L7ZA 3M0VA 3TTEA 4DM1A 3CZLA 2OZTA 2DSKA 1XDMA 1M65A 4HN8A 4PZVA 4JEJA 2J6XA 1X97A 4FXJA 4JTTA 5CSRA 1RQHA 4I9TA 3OLEA 3CIVA 4XZHA 1VYRA 3VIMA 4AAJA 3NYDA 1DWFM 2XIIA 5HMEA 3D0CA 2PGEA 2IPWA 3UF9A 1M7OA 3Q4DA 4ZODA 3B8SA 3JW7A 3V18A 5CC5A 3QV7A 3QY6A 5I5RA 2YYUA 3LD5A 2FLIA 1JPKA 1H09A 4KBXA 2WWCA 3AXMA 1OC6A 3B0VC 2WJFA 4KFPA 2G3NA 3M43A 3DFPA 1NAL1 3HO8A 3U2CA 1W8GA 2VDGA 4LVFA 2PLKA 1OD0A 2A6LA 1SZNA 3PANA 5DMYA 4FNPA 5C2CA 4CQAA 1J8VA 1BVNP 1YPIA 4IFRA 1OGSA 3L2MA 2QJNA 3A9BA 4TTUA 2HCVA 1Q3NA 4R53A 2PP3A 1KW1A 4LBUA 4QLLA 1DP0A 4UTTC 3TYDA 4ACYA 1GOKA 1EJWC 2GJPA 2X40A 3LGGA 1UWAA 2EKGA 4YPJA 4WKFA 3BMXA 5DCEA 4B3ZA 1PIIA 4BWLC 1WO2A 3AICA 1Q4WA 3D3FA 3CWOX 1VPQA 2FPYA 3K5XA 3QSRA 1EA0A 3VNMA 5C6MA 1T8QA 2NX9A 1DWIM 1MEWA 4UMCA 3R94A 4GH3A 3DI0A 4PN2A 3GK0A 3CEUA 2CCRA 3AYVA 3RU8X 2OT0A 2PGRA 3IVSA 5CPQA 4XB3A 4Q4QA 4FLOA 4FA3A 1EP1A 1WKYA 3VM7A 2ACSA 3T0BA 2I7GA 1H0GA 3GD6A 3BICA 4MDPA 3AHYA 2CZFA 3P8IA 4PTWA 3CMJA 4HZMA 1UKPA 3ARWA 1WYIA 4E8DA 3LTYA 4PBGA 5H8PA 3IGUA 1F6YA 2F8QA 3B0XA 4LBRA 1DJHA 3UXKA 4N9EA 4J1OA 3DG6A 5IFPA 1TPDA 2V30A 1Z7AA 5AY7A 3ZFHA 1TPEA 1OFOA 3OLIA 5U7SA 4FALA 1ZENA 1M6JA 1QOXA 5CBJA 3W1RA 1GVRA 1K8CA 1VBRA 2LLEA 4IP5A 3CO8A 3W23A 1UH3A 5ENLA 2Y4SA 3NJ3A 1J5SA 4KWWA 1HUVA 1TVLA 6A3HA 4K1WA 1MFUA 4C6MA 3VXGA 1AMKA 3DFQA 2GYIA 1X6NA 2PU1A 1OYCA 4BQ3A 4DJDA 3ZSTA 1PKNA 2FB3A 3KLKA 1AJ2A 5XIMA 3RXZA 2NX1A 2ZIDA 2E6AA 3LYEA 2C1IA 1IZKA 3R0DA 3R2GA 2CWXA 3W2LA 4P7RA 3NEVA 3W1MA 5E70A 1H0IA 4MIMA 3HJZA 4GI6A 4INFA 1FQ0A 4JTAA 1NDZA 3RX4A 2FH6A 1K6WA 3LG3A 1LT8A 1V93A 3OHIA 1KC7A 5FF0A 1QNPA 4F9DA 1R6WA 3TSDA 4EIVA 3KRBA 1SO4A 4UTJA 3DGBA 4AD4A 1BRLA 2PDCA 1E43A 4IPNB 5HDRA 1RBLA 2V3DA 1PHQA 4UOZA 1K1DA 4BK9A 2NV2A 1RH9A 1DWJM 1N8WA 1LLZA 4FNUA 1J0ZA 1IZCA 2P3ZA 3N14A 1EGMA 4IH3A 3SO7A 4L1GA 2J27A 2GFTA 4L80A 4DX3A 4Q4SA 1Y5WA 5AB3A 2HTMA 4LV4A 3A47A 3OIXA 4AIBA 3UJRA 5F2IA 2IPJA 3ME3A 1D8WA 3ZJ7A 5I23A 3T78A 2WJDA 4MHBA 4OE7A 5ECVA 2DZXA 3V5OA 2PTYA 3W37A 1S5VA 4NZ3A 2RAGA 2XVLA 4A3HA 4I6VA 5DELA 2X7WA 3F7JA 4JY8A 3THAA 3B4YA 1TCMA 2BG5A 3CHVA 1CGWA 4LVBA 4YVXA 2VC7A 4ICMA 3NGFA 6PTDA 1ODZA 3A21A 3DFYA 3VA8A 4KEZA 2FTPA 3EKZA 2JALA 4QE1A 1JF6A 1UD6A 3NQCA 1XI3A 3DBNA 4WX2A 3EDDA 4M24A 2OTDA 3CHFA 4GBUA 4UTWA 1Q6EA 3WBWA 2EO7A 1OC7A 3XINA 1UJPA 4I7WA 4Q6JA 4EE9A 1FHLA 3CIXA 3WQCA 2V9DA 4JTSA 3IJ9A 5AECA 4AEFA 3RPMA 3CZEA 3TYBA 1B3WA 3TYCA 3MUAA 2ATSA 4JCMA 3L5MA 3Q94A 1J0IA 2ZQ0A 4W93A 4Z08A 4EWND 5LIXX 1HQTA 3QC3A 2J9ZA 2NQZA 4JQ4A 2PTDA 1HVXA 1TMHA 2DORA 1QWGA 3TC7A 4M1BA 3NQ2A 4D2JA 2DPEA 1TELA 3MCMA 3IAPA 4C6IA 4PMNA 1HX0A 3E5BA 1ITCA 3RM9A 1VAHA 1XG4A 2VKZG 3URQA 1ADOA 2XM2A 4G7EA 2VFIA 3EWYA 1S3HA 3IJIA 3NAVA 2VO5A 3LI1A 2C19A 2YLLA 4K7VA 3T55A 3ZLGA 2Y88A 3UXAA 3M41A 3QR1A 1ADDA 3CPGA 4UZUA 3LLXA 4Q8VA 2GLKA 1CNVA 2DFAA 4JQ1A 1PE1A 1QDSA 4HJFA 2VI0A 3O6CA 1TWSA 2JKAA 3HJEA 3CPUA 3URBA 4RCXA 1XBXA 5BWAA 3TYZA 4PODA 1N55A 1E73M 4GI8A 3PZTA 2PD5A 1VFFA 5LGXA 2VQUA 3LRKA 1IXPA 1CDGA 3W1LA 3CAWA 4WSHA 3HGSA 4LANA 1TJ0A 1XYLA 1CI1A 4DAFA 1OBAA 4ZTYA 2QGYA 4C5YA 3TIMA 4FXFA 4XX6A 4MZYA 2NUXA 1ZTVA 1ZP4A 1EGVA 1A3WA 2EBNA 4GX9A 3W53A 2XWEA 2VX7A 2TMDA 1W1ZA 2BY0A 2WSKA 2ISSA 3TYEA 1QW9A 3O1NA 1ZBVA 3SRKA 2NVDA 3O6DA 3EXSA 1W3NA 1OX5A 1YEYA 2YDSA 1T6MA 1L8PA 2VGGA 5CPMA 1DPMA 2J6VA 2VZTA 3GKFA 2FVMA 4PMOA 1S2TA 4LAZA 3HFTA 5FJUA 2J7EA 1CGUA 1EA9C 3CGTA 3TU9A 1VIZA 3VOIA 1FUYA 1XLAA 3A4JA 3FYPA 2ZZ6A 4F48A 3UJSA 4RK8A 4ZOBA 4RNHA 1KBJA 2FHBA 1TMLA 3OW1A 5EMLA 1NARA 3VD4A 4ZXLA 2PWFA 4CVUA 4GABA 4K6AA 4ORMA 1RA0A 4YMZA 3G24A 3NL5A 4KKXA 2EPOA 2GQAA 5HQLA 4LFYA 4GRSA 4XD5A 4OOZA 3GUGA 2C15A 3RPTA 4ECLA 3VIKA 4L6HA 4GIYA 1ITUA 4H6EA 1LZOA 4QITA 1W31A 2PCQA 3PZMA 3GWQA 2VYOA 3HPFA 1L2UA 4DJDC 4UNKA 5F4SA 1KWKA 5C0QA 1VYPX 4LB3A 2ZFAA 2Z25A 3PPHA 2CZDA 2V3GA 2WHJA 5I78A 3DFHA 3WQ8A 3C0LA 3KZSA 1BPLB 4NZJA 3PBUA 4HVXA 3S9YA 4QFUA 3BLPX 2G3IA 3P84A 4IUOA 3M5ZA 3O3RA 5HINA 1GZGA 3TQKA 2VX4A 1B57A 3CUIA 4O0QA 3G1AA 1CXEA 1UQYA 3AIVA 3I68A 1V8EA 4HZ8A 2WCAA 1XICA 3SM0A 1A53A 1V03A 2GSJA 3MP4A 3M0MA 3LXCA 1GVQA 1R3WA 1XRFA 1K4GA 1QNVA 4G1NA 2VGBA 4DBSA 1XIDA 4X0VA 1W9VA 1US0A 3KLLA 4DZHA 3MV01 4JTRA 4J3UA 5H1WA 3U2ZA 1YE6A 2BY2A 5BU9A 3L67A 4UFIA 5GQBA 3FJ6A 1CX9A 1LWIA 5D04C 3PZ9A 4B3LA 3STPA 2YL8A 4DJEC 1W3TA 3DZ1A 4MGGA 1OCQA 3PFRA 3VOFA 3GYEA 3HGOA 3EPNA 3TC6A 3P61A 4A22A 2R8WA 3PPCA 4Z1AA 4PFMA 3QYSA 3T2PA 3T08A 3FW6A 3HU7A 3PR2A 1NFPA 4MPQA 1TQXA 1K8ZA 2ACQA 3MSGA 4V1XA 1AW1A 5JBFA 5EMUA 4FLRA 1VRDA 1RPKA 3HPZA 2ZBTA 3IACA 2AQVA 3AHZA 4AF0A 2UWFA 3WDJA 1UG6A 2V5CA 1J6PA 1SYTA 4CU7A 1KV5A 2WVTA 1FP8A 2Y1HA 2OXNA 2NLYA 4KT2A 3M0JA 3CH9A 3U5YA 4N9CA 2QVNA 1E9ZB 1E3XA 1DJYA 2YFOA 3OA3A 1NU5A 4EXQA 4W8BA 2DT3A 3OTRA 4WOQA 5CGTA 4GQGA 4FF7A 5I3DA 3H2FA 2CLKA 1UWIA 2PDKA 3VDGA 4WSJA 1IF2A 2QCDA 3IV8A 3E2VA 3OHMB 4DAIA 2ZXBA 2RGLA 1UR2A 1YKWA 1ZSXA 2J75A 2QCFA 3ITLA 2INZA 2Y5EA 2VEKA 1RJRA 4UFJA 1VZWA 1VBJA 4LYPA 4YWSA 4JNYA 3H53A 4D6IA 4J3VA 1O5QA 4EPEC 2H90A 4UR7A 3S5ZA 4UTFA 2A3EA 1Y0EA 1C3FA 1I2QA 3IGSA 2ZVRA 5KINA 1LUCB 1Q6RA 4RDWA 1A3HA 5BRPA 1MDLA 2CZEA 2AAMA 4OWGA 4FR6A 1XCFA 2FZNA 5PTDA 2DIEA 4MAZA 2HPMA 1K70A 1NQ6A 1R7AA 1FXPA 3AALA 3T07A 1D7FA 1KV8A 3AXKA 4QS6A 1DJXA 2OELA 1TRIA 2BWGA 1UA7A 2QUNA 3WH9A 5A6LA 4TU1A 2OGJA 2ZUSA 1GQLA 3W6MA 3OBEA 2WAGA 2X2YA 5HUOA 1RZMA 4PYSA 4I5XA 3WBXA 3GU9A 3CTLA 2WWDA 2VENA 4JQ2A 3GTNA 2J74A 3AO0A 4M3PA 4YHEA 3KVKA 4B2DA 4AY8A 1A0CA 2RDWA 3NO5A 3K13A 1U1HA 4U5IA 4LY8A 3HTWA 1W1IE 3RX2A 3BL3A 4YJ5A 2EXOA 4Q4RA 4DUWA 3K1DA 3HQOA 3WD4A 3LBOA 1YADA 3MMDA 1RD6A 3GXIA 2P3EA 3A4AA 1NFBA 1UQZA 4LCRA 1Q7ZA 4YTTA 2VEGA 2OWWA 4FI4A 4RX0A 4MG4A 4K38A 3PBVA 4XZWA 3OGRA 4LTSA 3IIPA 4M8UA 4O11A 3T42A 4MSSA 3CAQA 2C18A 1Z3NA 1E6RA 3GIPA 3CLMA 4MADA 1W5NA 3CZ8A 4MTVA 1UR9A 4NZ4A 3WF1A 4UQAA 1QHPA 3GUWA 4R3UA 2HVNA 4AIOA 5KITA 4QDWA 4O0ZA 1DBTA 2P88A 3T8QA 2BZNA 3VGFA 5HR6A 2D3NA 4CVWA 5DT7A 1EH9A 4UXDA 2FDSA 3CUHA 4JICA 2PZNA 4QS5A 1NP2A 4A2SA 2CLHA 3VNIA 4MY1A 4PSRA 2AGTA 5D2YA 2J66A 3BV7A 5E1QA 2PUZA 2CLEA 2WCGA 3GW0A 3KHJA 3AQUA 5CG0A 2BLEA 3BSHA 3ZJ6A 2VC9A 3RGTA 1J96A 3IVTA 2IKJA 4NNBA 1YBQA 2E5DA 3W7HA 3RYSA 9XIMA 3APGA 4RLIA 4C60A 3WUFA 4HB7A 1PCKA 2RFGA 3U6WA 1EZWA 4PULA 1EO7A 3VMNA 5D8WA 1HTIA 3B4UA 3DC8A 5G1YA 2I57A 1TJ1A 3UWYA 5BMXA 1ZL1A 3C2YA 4NNAA 1MVYA 1FDZA 4GC3A 4ROQA 4DJFC 4PMRA 4DPQA 1KGWA 3I4KA 3QGVA 4OT7A 5TNVA 1A5OC 1TE1A 1VYSX 1JFHA 1GW9A 4I8DA 1W1B1 2QJMA 3A22A 3DFOA 2OLSA 3W4RA 1UKQA 1FP9A 4XTIA 4AXNA 3M5XA 4FLSA 5K9XA 4IMFA 3SCPA 4H6RA 4PMXA 4PUEA 3HPAA 2RUSA 3QSTA 1TZ7A 3KP0A 1R3RA 3C0QA 3W73A 4ZBCA 3VIJA 1KXVA 5AYXA 3RJXA 4JKMA 1EXBA 3SUTA 3LENA 5A2AA 1R0MA 3S3GA 4GJ1A 4HKPA 2XFFA 7ODCA 2HROA 5TAOA 1Z9AA 5KZ6A 1GEQA 3VTRA 3TLQA 1UPMB 3MMTA 2VFEA 3EWBX 4GIEA 4JN8A 1E55A 5CC6A 4S3AA 4AD1A 6XIAA 3NO3A 1TYGA 1GONA 4FXRA 1UZ1A 4MNKA 2H3DA 3GNXA 4LS1A 1NWRA 3SGUA 3M4HA 3N13A 8XIAA 4HNCA 1GOOA 3L21A 4J3WA 4H8HA 3TWBA 2WNQA 1E72M 2WM0A 2G5WA 4MKVA 1H7XA 3MHUA 3N6QA 2DT0A 5T8GA 3NA8A 3EB2A 3SI9A 1DIKA 1PTDA 2QF8A 3UXIA 3MI6A 3WD2A 1KWGA 3GHTA 3UQNA 1F7BA 1OCNA 4KCTA 1JD7A 2J47A 1DXEA 4XAGA 3TAOA 1FH9A 5G4WA 3TR9A 2YA1A 4H7ZA 3N3MA 3DYMA 3M47A 4BS0A 1EOKA 4U2YA 2XU2A 1V3LA 3T0TA 3IJDA 3W74A 3TTOA 1JR1A 3VD7A 4OECA 3KOFA 2A3HA 3NQAA 4AY1A 4WVXA 4IJRA 2OZ8A 3WQGA 4DVOA 1UROA 4Y6GA 2EG6A 2GQ8A 1FCBA 4LX4A 5HMSA 3PWGA 5KSWA 2PDLA 3WLLA 4OVXA 4ILSA 4YU1A 3E0LA 4DUOA 2BHUA 1PTAA 1AZ1A 3TWAA 1M01A 2NUYA 1S2AA 2CLIA 3QVQA 3O8AA 2VX5A 2VDHA 1AMYA 5EKYA 3NR0A 5D30A 3WK1A 2PBGA 3IJQA 2GVGA 4NZCA 4BFAA 1LP6A 1PJ9A 3NXLA 1XS2A 3H21A 4Y7EA 1XLEA 2GL5A 4B5TA 4BI7A 2PTXA 4A35A 4AD0A 5BXPA 5BOEA 3RLVA 1GOQA 2Z7GA 5FCZA 2WVVB 5FSDC 4ADTA 2YCLA 1E3ZA 1DL3A 1PKLA 1AQ0A 3UZYA 1BFNA 4HA3A 3WDIA 4NAFB 4QDMA 3S2LA 1GQJA 2ZCGA 4XUYA 5CXPA 1NH6A 3DENA 1L6YA 2WYSA 1XV8A 4Z1BA 3W7JA 1JRBA 1UD2A 4X3ZA 4Q7NA 3T0CA 1QJWA 5FA5A 3H4WA 3P2VA 1YLVA 4FMVA 3VGDA 3P60A 2V81A 5DRIA 3CU2A 4Z2GA 5BW6A 5E0FA 1HKMA 2Z7KA 4E4UA 3BW4A 3QMTA 4WJEA 2FZMA 3TW7A 3N2MA 3OVRA 2DVUA 2XIJA 1YHTA 1A0DA 3PPFA 5C9ZA 2V82A 3NO1A 2JF6A 3F1QA 3RF9A 4F2BA 4QR6A 3P74A 3MBDA 3RFAA 2X7VA 1UJQA 1T8XA 4RPPA 1OX6A 4ONVA 5ECUA 2Z2UA 2E3ZA 2INFA 5KTLA 1BHGA 1B9ZA 5A6TC 3NDYA 3APTA 4IT1A 4UQCA 1A0EA 1V3HA 4O8RA 1H5VA 2GWNA 3W9ZA 3U57A 1WDPA 2V2DA 1Z69A 3KBNA 3EWXA 4ZR8A 2VEIA 1DJQA 3RRXA 2FVKA 3VGHA 1KM2A 4LYKA 4WOZA 3WBEA 4KS0A 3KOZA 1U30A 2WBGA 4B90A 2I1OA 2IQ0A 2VEMA 3N15A 4QDPA 5DT5A 3IARA 2W63A 4MAVA 3VKKA 3S83A 4E3VA 3F2CA 4DF0A 4B2DD 3ABQA 2QUUA 1MW2A 3FAWA 3RLGA 4OZOA 2L5HA 1XINA 5FAJA 1UA3A 1OK4A 1DJIA 1LCOA 3N12A 4O19A 3UG3A 3RLUA 4CEUC 2W9MA 2QCEA 3ICJA 2R1KA 3LMZA 1OGBA 2ZE0A 5CZSA 1R7OA 3NVDA 2OX1A 3C61A 4US6A 3PWIA 2WMKA 1XGDA 1XP3A 2JQXA 2BBFA 1FTXA 4F40A 4UTHA 1HJSA 3GFYA 1EX1A 3B06A 3C0JA 3N34A 3EOEA 3DHUA 3E02A 1UR3M 3EX1A 1BYBA 4L65A 3NOYA 1G0CA 5LGZA 3UFYA 1W8SA 1RY0A 2XYLA 3W7MA 2G4JA 1XIIA 2VOMA 2QCMA 3HG2A 4X60A 4AZHA 9CGTA 3AS3A 3ATYA 2FB2A 2I9UA 1B3OA 1OYAA 1RP8A 3JZUA 4PUKA 1E56A 3S8HA 4QLKA 3QM3A 1KM1A 1IGWA 1MUWA 3W85A 1MEIA 3FDGA 3EPOA 3ECQA 2NXGA 2J7DA 1XFCA 2PA6A 2WMFA 1IHIA 5A3HA 2D0GA 4X2RA 4REQB 4WEVX 2A6NA 2H9AB 5GNZA 3D46A 3KOXA 4HOXA 4IHCA 3CL6A 3UJEA 2C71A 2CETA 4LRSA 1JCJA 4J28A 4B5WA 4GNVA 4LJ3A 2HZGA 4U31A 1V0MA 1W9DM 4I9AA 1FDJA 3UGVA 1PKMA 4PA8A 2J62A 1XIHA 1KA9F 4UMAA 4CN1A 2XPKA 3VE9A 3NSMA 3LHZA 2GJXA 1EPXA 4LB4A 3CIWA 1H49A 2FZDA 1TFVA 3GM8A 3S2NA 2G50A 4PMYA 5EL1A 2G3JA 3KEHA 3IRDA 1LDCA 2UY4A 4XAYA 3GAYA 5GJPA 3OB8A 4GJJA 4GINA 4E6MA 3E38A 3LPFA 2B7PA 3GB6A 3MU7A 5D9NA 2B7OA 1EOMA 4HSNA 1M9HA 4MB3A 1MZRA 3GSMA 3IJ8A 3SCOA 4GFIA 4EWJA 2PGFA 3NQMA 4NJKA 4CEXC 3EX3A 1RQBA 5BRBA 1OVDA 4HOWA 2GUUA 3O7UA 3L12A 4L5ZA 3QKEA 1ZGDA 3PVFA 1F8MA 4FIRA 2A0NA 4ZOCA 3NL3A 4Q8MA 4GUJA 1EDGA 2YCIX 4US5A 2GGIA 5C5YA 3TP4A 3Q58A 3N9KA 5I3JA 1J01A 2Q02A 4NYUA 5HWJA 3HM7A 1F2JA 4QNEA 1YDVA 3TSBA 1E0VA 1FWCC 4S23A 1IE7C 5E6ZA 3W1QA 1EP2A 4AHPA 1GCYA 3LERA 1Z6KA 3TFXA 1V51A 4KESA 3E49A 4Z2KA 1RPXA 3T1GA 1KQYA 4IJCA 2OWCA 2C0AA 3QN3A 1PIGA 2H3BA 3CZJA 1M7PA 4MLJA 2O7QA 1M03A 1YXYA 4JOMA 1D9EA 3HF3A 4DPPA 2X0SA 2PDHA 1MXSA 1HFBA 2VFDA 4AMCA 2ZX8A 5I3HA 2IW0A 4U3AA 3UP8A 3VE7A 2A79A 4PB5A 5I3KA 4NF7A 3WJSA 1ZS2A 1Q13A 2DSUA 1GOWA 5JQ9A 1BKSA 2A2IA 1FCQA 1P0DA 4QEEA 4MKNA 2D23A 1TTQA 1XL9A 3QHOA 4BI6A 4E2VA 3U4FA 3POCA 4FS9A 3COTA 3SUVA 2RDTA 2OGYA 3AMDA 3WNLA 4JHOA 5F4WA 3M9YA 4WIWA 1W3LA 5A8QA 1FWSA 3M0ZA 4H6QA 1VD6A 3TJ4A 1H1ZA 2C0HA 1FCUA 1UP3A 3KTCA 1GQKA 1XGEA 3W27A 4IWWA 1JVNA 1DWGM 4Q8QA 2J7BA 4ZA0A 4H9ZA 4MM1A 3WDQA 3BV4A 5H2ZA 4U10A 5C71A 5CKSA 1T0OA 1ONXA 4UUIA 3LSCA 5JBEA 3MDUA 1KKOA 3MSRA 5F4XA 2JIWA 3VC5A 1CCWB 4WQ6A 4JS3A 5M2FX 1KTCA 3QYQA 2ASHA 1TWZA 3SBFA 1FXQA 3GQYA 1OT2A 4LT9A 1TZZA 5DLCA 3W1AA 4KGLA 3DDMA 1M7JA 2HNHA 3D3AA 3INPA 3OP2A 3KBSA 1C7SA 3PC0A 2ZC1A 3N6HA 4DEFA 5CPOA 3DYPA 2ZZ1A 4NJGA 1JCNA 4AD3A 4AMAA 1WB0A 1XLCA 4V2XA 2OG9A 4LF2A 3L0KA 3DAQA 3ARVA 1KCZA 3WUEA 2PDGA 4S38A 4G5DA 4GQRA 1CGTA 3YPIA 2PURA 3H54A 1FWTA 2EEXA 3WKZA 1WA3A 4LSBA 4S3CA 4C91A 2DH3A 4U33A 4D1JA 3MBFA 4GUIA 1R3SA 3TJLA 3OU8A 4C1NB 3L68A 2VZUA 5HJLA 4D9PA 2H8XA 1RVGA 2W27A 4JKLA 3ITXA 2NV9A 4UTUA 1YNPA 4PMJA 4L9YA 4OTKA 3RCMA 1NSJA 3VX0A 1W3HA 2ZRZA 4TV6A 4ASTA 3ALGA 3ZR5A 4DIAA 2OYLA 4DI9A 1MMFA 3ZM8A 4NILA 4JAWA 5E09A 3EB4A 4BEQA 4G56A 4HYVA 3M6YA 1UZDA 1UASA 4BF7A 3UA4A 2IS7A 3LX9A 3EXRA 4FNRA 5E5CA 4ZXOA 5AVHA 5M3WA 3GDLA 1QK2A 1XC4A 1OZQA 3C3NA 1CGXA 2WHKA 3B8VA 3AZRA 1E0TA 2JGYA 3BCJA 1TPVA 3B3DA 2VR4A 2Q71A 3NIYA 4Q8OA 4CQDA 1GHRA 2EPKX 2R82A 3AS0A 1RP9A 4MFEA 1FWBC 1ICSA 2DQXA 1XBVA 1BF2A 4Y8FA 2QDGA 2HEJA 1I1WA 2Q3RA 3LQGA 4DBWA 1R2TA 1P0BA 1W5QA 1ZHAA 4JHMA 1J4EA 3DECA 4NJIA 4WCJA 2ALDA 3E5PA 1TJRA 2WMIA 9RUBA 3BSMA 3WNOA 4H9XA 4O1EA 5AVNA 1UR4A 5H6HA 3TXVA 3H2EA 4PUJA 5EYWA 3Q45A 1R3YA 4O17A 2GGEA 2E25A 2YKKA 2Q8ZA 3TDFA 4AZIA 4J4KA 1KCKA 1ISXA 1HNYA 5AZ1A 4LUYA 5I24A 3WL1A 1F5ZA 3W2KA 1VJSA 3A6OA 3N4AA 1PX4A 1I2OA 4RNIA 1KRMA 5IFTA 4TVDA 4BJHA 1G4TA 5L6UA 2R6OA 3ABZA 3GDKA 3L5AA 4F0LA 3WLKX 5BXTA 3MP5A 1GYMA 3IIZA 1MNZA 3RLHA 3ONBA 3DC0A 4RZ4A 3TNOA 3JR2A 1D8CA 3KOYA 4U28A 4LVDA 4LEQA 1Q5MA 3S1GA 4H8UA 3AS2A 1E5JA 1G6CA 4TX8A 3HV9A 1WAWA 4MVAA 5AC6A 3GYCA 1TREA 1PO9A 4WDTA 3PULA 3WLPA 2WMHA 3CTTA 1WOBA 5HPCA 4M19A 2VVSA 2WM1A 1RR2A 3L2LA 4ES4A 5CPLA 4JN7A 3QY8A 4XWUA 4ZCWA 2HISA 5BNKA 3GZAA 3M6DA 4GH1A 4GYPC 4GK8A 1JZ2A 5BXSA 1JUEA 4JDYA 3DFSA 3G3DA 3WH8A 3RMJA 2QS8A 3I6EA 2DZAA 3WLRA 1O7AA 4GACA 1W3IA 3QJAA 5D33A 4TXEA 2GPTA 4I6KA 1T7LA 4TVUA 3OGVA 3PBMA 3I7QA 1TSIA 4I5UA 2ZA2A 3L4VA 1X1OA 4WK9A 3MS8A 3G77A 1X38A 2JKEA 1XLFA 2OEMA 1H11A 1HG3A 4LUTB 3WQ4A 1ZU8A 5J04A 4RL3A 4CD6A 5HAOA 2VRQA 2W5FA 3BANA 2EGZA 3AIQA 3THDA 3UWEA 1UD3A 3N73A 1CPUA 1LF1A 3V35A 1WXJA 3FS2A 4ZENA 4YS1A 5CBIA 1ZCCA 5C9RA 2QYGA 1WDSA 1XISA 4US5D 4EPBC 1LL7A 1W1A1 3IJ6A 4C6LA 3B9OA 4ZSTA 3S6OA 4GFSA 2J7GA 4QQUA 4AH7A 1I6NA 1MW1A 2VZSA 4F0SA 3SY1A 1LORA 4UFKA 5LYRA 1SJDA 2NQ5A 3VAVA 4P7NA 2JBMA 3EA2A 4KRZA 3GR4A 3QKZA 3MYPA 1WXZA 2BFGA 4MNMA 3DHFA 3RN6A 1EO5A 3TMQA 1UWRA 5B7YA 1PSCA 3UPWA 1LJYA 1H7WA 3TXZA 2VM8A 1KO0A 3PJWA 4XZIA 5FAGA 4BKNA 2ZXQA 4M6VA 3SCUA 4GZEA 1YDYA 3OZOA 4UQEA 3LZ5A 5E93A 3CO4A 1PL9A 4XVEA 3S4TA 1VENA 4FZIA 2YXXA 4JX6A 1KRCC 3VNKA 1W5MA 3JU2A 4XG1A 2IKGA 3UG8A 4EKJA 3G1XA 4MUZA 4ZFMA 3ZMRA 3MA8A 2ABAA 4YTUA 2J7FA 4YHGA 2KAUC 1XRVA 3VNLA 2CBJA 2HWGA 3CWHA 3EDEA 3QH2A 3MSDA 3P62A 4PSPA 1TJPA 4P2VA 3GVRA 4R5EA 3S9ZA 3WG6A 3W2NA 3TA9A 1DKWA 2YZRA 5E9AA 1BG9A 2ANUA 3LPOA 3N9SA 3QQ0A 3CUFA 3DGRA 1O60A 1FOBA 1Q6LA 3UWVA 3GDTA 4O4WA 2E67A 3AISA 4DF1A 2O9PA 4LWWA 3G1VA 5MF5A 4FF5A 4JBRA 1KBLA 4HD5A 3B8WA 1C8YA 3HG4A 4URIA 1J12A 4DLFA 3KBJA 4J3TA 2AGKA 4QP0A 1NDWA 3K4WA 2VP8A 2PSNA 2V63A 3LPGA 3IV3A 1SMAA 1LBFA 1XLHA 3MKCA 4UNIA 4ZB2A 3CQKA 3DHDA 3QGKC 1LROA 2XVKA 3W7IA 5FI8A 1A5NC 3DKJA 5A2BA 4EPDC 3FGCA 4QXIA 3FDKA 1CZ1A 4HK7A 1QPRA 1OFBA 3WCZA 2OQLA 3KL0A 2ZE3A 1QASA 3HA1A 1DJZA 1QHZA 4NX0A 4ADSA 4R7OA 5KEZA 2ZXAA 4GI4A 4N42A 1JCYA 4IUGA 1S46A 1XRSA 1JZ4A 4Q4MA 1JDAA 3G1HA 4S3DA 2V5KA 1QFEA 1O1ZA 3NZPA 2ACRA 1KBBA 3VOJA 3B9NA 4Z1CA 1X7FA 4DXVA 4PEKA 2PDQA 4LPCA 4PE8A 4M51A 1KCXA 3K8LA 5G2HA 3VD5A 4C6JA 2A21A 4KCUA 2PF8A 3BMWA 1VRXA 2G0WA 2CKSA 4H2CA 3AU6A 2PCEA 4DYJA 2J7HA 4GI9A 2YXGA 4UNLA 3QV8A 5D9MA 5XINA 1VR6A 5C9WA 2VFGA 3ORWA 5FOOA 2DZUA 3VNDA 4IL0A 5D2WA 4PL2A 4Z2JA 4XBSA 3CT7A 5IOBA 1ZJAA 4N9BA 1PX3A 3MZNA 1XBZA 2QCNA 1SU5A 1FH8A 2C14A 2WV8A 4GA8A 4KCWA 2CPUA 3P82A 4FSAA 4WF7A 5H91A 3RO8A 1AUSL 5F2GA 4IP7A 2FMOA 3PZGA 5HNRA 1G69A 2X42A 1WCGA 2FPVA 3DN5A 1EBGA 2O0TA 2ZZ3A 3KBWA 2OSYA 2JEPA 1NWSA 3WQOA 1BWLA 2YFNA 3TJXA 3L7RA 2WOQA 4S3JA 1VPYA 3POHA 4GHRA 2X8RA 3BAIA 2CKRA 5CSUA 4FLQA 4HYRA 4IIBA 1W32A 2Q3OA 1TTIA 3FA3A 4UIOA 5DO8A 3VOGA 3QHNA 1YX1A 4HNTA 3TTSA 2PDYA 4ZMGA 1UIOA 3ABSA 2PDWA 1UIPA 4NNCA 4PCFA 1KBKA 1ZPTA 2HV5A 2W92A 2X30A 3PUDA 3P7YA 3UA3A 3NM1A 4WHBA 1FWAC 3MI3A 3CZGA 4O15A 4IICA 2ZICA 1S1RA 1T5AA 1W5OA 2QUTA 3VCNA 4A21A 1E51A 4UQDA 4W87A 1OG0A 3CQ0A 4Q8WA 3O07A 1EQCA 4AYGA 4PUWA 5IXEA 1HGYA 3HOJA 3K2GA 4FOJA 3NQEA 2Z6IA 2DUXA 4O0KA 1QO5A 4ZQNA 1DTUA 1G9HA 3HURA 3L0GA 3QFEA 1GHSA 3S5NA 1EJVC 4ML9A 3GXTA 4ZOAA 4R27A 4AZ5A 4W84A 3C2RA 2CERA 3TW6A 3DKLA 1XKYA 3EOLA 3WLNA 3S2JA 1C90A 1PEZA 2I56A 3EDFA 4PR4A 4WD0A 3S47A 1XYAA 2ISWA 2AL1A 2VXNA 3T7VA 5LNRA 2V5DA 3SRFA 1WZLA 2Z28A 3WUBA 3UYCA 3RITA 2QDDA 3UWZA 1JPDX 1Q2SA 2ZUWA 2W66A 4WJ8A 5GJMA 3N9RA 1QPQA 3DFNA 1UOKA 3M0XA 4WKAA 3S6TA 4MWAD 2QAPA 3AU2A 3L9CA 4DUXA 2FPTA 3UU0A 5F7UA 4IPLA 1TPB1 2ZZ2A 3SDOA 1D2KA 3B8TA 2WVVA 1TV2A 3LCXA 1HKWA 1YDNA 1S2VA 3KCJA 4YLWA 1JYWA 1EJRC 1ICPA 3VKJA 3QV9A 2E1DA 2JEQA 4NAFA 4LQ1A 4A3QA 3ABXA 4HU3A 3W71A 3TE9A 4XD4A 2VUYA 3SURA 4ATDA 2HXTA 3TFCA 1T99A 3LS9A 4IMGA 5EMJA 1YXDA 4EPKA 2OR2A 1MRAA 5DCDA 3NYZA 4BI5A 4XKYB 1RBOB 3T09A 3ZWTA 3AAMA 3BLIA 4QTGA 4YN5A 4BQ5A 3BAJA 3FIGA 5AHNA 5A8PA 3F5JA 2FZBA 3MTWA 3LSBA 3EXTA 2X1RA 4WY0F 4UTTA 4WXYA 5DF0A 5LZLA 2G3FA 3ES7A 4Y9OA 1SJAA 1K9EA 1H5YA 1HIZA 5EBAA 5LSMA 1CGYA 3NNTA 3WELA 3VGBA 2PE4A 2WSYA 3ZS4A 3J7HA 2ZX7A 4HA4A 5MKGA 3BG3A 1UYQA 1OX4B 4OV4A 3G1RA 1O94A 1QCWA 4DWDA 3NL2A 3THUA 4MB1A 1KLZA 5LXEA 1XR2A 1OIMA 3EX4A 4C6PA 1FY6A 3N25A 2IKHA 1HZYA 3NEHA 3LGDA 1HL8A 2WK2A 4HCDA 3SQLA 3VGEA 2E4TA 4GE8A 4JIQA 2CHOA 3T40A 4OHQA 2BOGX 3STFA 3MO7A 1E71M 3EOSA 8XIMA 5JIPA 3ZLHA 2IUZA 5HA7A 3WF4A 1Q6FA 3CBWA 4R88A 3ZO9A 1PDZA 2DZVA 2GK1B 1JUKA 2PWEA 1ITQA 1VKFA 2CZVA 2VZOA 3BLEA 4QBXA 2UY5A 4LUSB 2PI6A 4XBKA 2EPMX 1F74A 3EDKA 2VJXA 4W5UA 4LS0A 1WZMA 5I0DA 4PMZA 2PWHA 1XM3A 2XFWA 4GNKB 2A3CA 1TV7A 2QCCA 5A69A 4QHRA 3FA4A 2DQWA 4MF4A 1VIWA 4NIRA 2BASA 2A7PA 2PDIA 1C8VA 1FA2A 2DJLA 4HT3A 4UTLA 4F0RA 1UR0A 2V2HA 3AZSA 1B30A 3ITGA 3B40A 3OG2A 1VJZA 2XVPA 4LNYA 3SEPA 2I17A 3PJUA 3NPVA 3T0AA 1K9DA 4N6FA 1AH3A 1UOZA 1S5TA 3EEGA 4HCHA 3AMCA 5H8MA 1ISZA 3PSVA 1G5AA 2EQDA 1ZB5A 4W5ZA 1IXNA 4OU1A 1MWOA 3FYOA 1XH0A 3R79A 2V68A 3GLCA 1XIMA 1HXJA 3EPMA 4GXMA 2AKMA 2OT1A 4M7SA 3IJ7A 1E0XA 4B5NA 7REQB 2XVGA 1PTGA 2F6XA 3I3DA 2PGWA 3ARRA 4XVDA 4DRSA 5K7JA 4UR8A 3VZYA 2CBIA 1X1NA 3E96A 1EIBA 3IRSA 4IOTA 3WK0A 3BOLA 3QW4B 1H51A 3LK6A 1QUMA 4OIFA 5CBBA 4REQA 1ONWA 3H8AA 3MDWA 3F2DA 3NQBA 3WBAA 3NZ1A 1AQHA 4RR4A 5FACA 4MB5A 3P5ZA 4RNJA 3OQ8A 1FH7A 1UZHA 2PRHA 4RXGA 1BVZA 4Z42C 4WXZA 5FIPA 1EC7A 2PWVA 5DMNA 3QOMA 4OUEA 4O12A 4NZ5A 2Y70A 3FVMA 1F07A 2Z4GA 1MO0A 3EZ4A 1B0IA 1M41A 1GVSA 3LZ3A 1VQTA 1R3TA 4W4QA 3E0VA 2DW6A 3GVGA 2ZUTA 3SECA 4JEQA 4RKAA 1A5CA 1YRRA 3GNRA 4JL2A 2QIWA 2UV8G 1EDQA 2PODA 1A80A 5G2IA 2D69A 3PBGA 4E4PA 4CD8A 5GPRA 4A8NA 4D6EA 2OZ0A 2CLPA 5AHIA 4WRHA 5MHBA 1WBHA 6ALDA 3ZR6A 1SO6A 2HXUA 2ZA3A 3T4WA 4EF8A 4F4RA 3O15A 3EBVA 1PHWA 5DY3A 1V6UA 3QXBA 1XLLA 2YB1A 3UNTA 2Y6ZA 3R1ZA 5HXMA 4HHHA 4MJZA 3STCA 4AZ7A 2PWGA 3PUEA 2X1IA 1IXQA 4H9TA 1FRBA 4IMCA 1LTDA 4DWSD 4RW3A 3S46A 3S1VA 3L4XA 2FQIA 4AD5A 3I3BA 3B8IA 5LA0A 2I14A 1DE5A 3LBMA 4Y9NA 4JTFA 3CHEA 4CQBA 3NQ7A 4L6DA 3HV8A 3WD1A 4RV3A 4EX4A 1XLMA 1K02A 1TTJA 2QDEA 3RR4A 2RJHA 5G1TA 5LNVA 3T2QA 4XSLA 1RA5A 3WJZA 3BOFA 5J8LA 1WX0A 3TC3A 3ZWSA 3M44A 2YXOA 3MWCA 3MY9A 4XD6A 4RDVA 1A47A 3ARPA 4NI8A 1E1EA 5HBFA 3N1AA 1RQEA 4Z1YA 3BGGA 3NXFA 5CGMA 6XIMA 1B4KA 3CV1A 4JTDA 4AEEA 3ELFA 5DFAA 2C3ZA 1UH2A 2WVUA 1QNOA 4KQNA 5FJJA 1W1PA 2QR6A 4GYJA 1GORA 2XGBA 4O4VA 2OODA 4HIBA 1VFHA 4AZCA 2WKJA 3CWNA 3PPGA 4O1DA 2JIEA 2V3EA 4GQQA 2G95A 3HG3A 3WJWA 3NGJA 1BRLB 5C7VA 2A85A 3R6IA 3R10A 1GOMA 1O12A 3DERA 1IEIA 2HSAA 1BTMA 4HMNA 3QY7A 4QISA 1LG2A 1O95A 3SCWA 1GQNA 4PMUA 4XO6A 3WLIA 5C8BB 4QCFA 2H6RA 3HB9A 4H3DA 7CGTA 3II1A 4QM1A 2E9LA 3F4CA 3WDRA 3VYLA 4HTYA 1HKJA 1JNEA 4IXXA 2VQTA 3HGJA 4L1XA 2WNNA 4HNLA 3TOPA 4B5VA 1PVNA 3LCIA 3QMSA 1QAPA 4F9JA 3W28A 1WKDA 1Y5VA 3U2OA 4RNFA 1R2SA 3WNMA 3GX9A 5C2GA 3RDKA 3NSXA 3SIMA 3KOWA 3S1WA 2PMQA 4RDZA 1XDLA 4W88A 1WUFA 4V33A 1O1HA 3MKKA 2OLAA 1EUNA 1RCQA 1NOWA 1P7TB 2FJKA 4P5UA 1XH2A 1GNXA 2GSHA 1GT8A 4KGJA 2WZHA 3FNDA 3ITYA 2VRJA 3SQMA 3A3HA 1UKTA 1Q4NX 1SQ7A 1WP6A 3PSWA 3ARYA 3B97A 3KVLA 4GO9A 4JIIX 4CNOA 4NY2A 3THCA 1X1ZA 4NRRA 4LEFA 1GVIA 2BS9A 5AHFA 2VR5A 2YJQA 4PMQA 1E15A 4DLMA 1KCLA 1K4HA 3PJTA 2OB3A 3TQ0A 3UXDA 3L2IA 3ZSSA 1BWKA 3SN0A 1YMYA 4AISA 1KD0A 1MQQA 1KFEA 4X22A 1XSJA 3REQB 3VFCA 5IBXC 3SGZA 1ONEA 4YTRA 1C9DA 2OSXA 1RAKA 3FAXA 4B4FA 4C1NA 1NWTA 1W6TA 3DESA 4V28A 1V79A 3MVIA 4IJBA 3G18A 4Q8TA 4CNSA 1SFJA 4LAOA 3GG7A 3WFZA 1QMLA 1OF6A 1XCWA 4CD4A 3KW3A 1Q45A 4IMEA 2DZWA 3OG3A 1KGUA 1VCVA 3UXLA 1VFSA 3ANYA 5DXYA 4IZGA 1B3YA 4MKSA 1O5KA 2P76A 2VNCA 1QOQA 2RGMA 3B9DA 4D6HA 1FFQA 2Q09A 4L4LA 4CQ8A 2ZRYA 4XK2A 2Z29A 3IVUA 1Q6CA 1R87A 2E8ZA 2DH2A 4CN4A 4LNCA 1W54A 4S1FA 4ZQPA 2G41A 3O6YX 1BGGA 3CUXA 4TO8A 4ZEPA 1I1XA 2E6FA 2RDXA 3UNDA 1G7UA 3WX7A 4JIPA 1E0UA 3K8KA 3G3MA 2QDHA 4C5ZA 2YDQA 2ALRA 1B2YA 4LC8A 1DQWA 2QLYA 2A3AA 4TMBA 4CU8A 4DJEA 2HE5A 2UBPC 4HNVA 1V6WA 2V5JA 3UD6A 4PFHA 1TV3A 4V1YA 2QEZA 5LIKX 1UBSA 3VD9A 5D9PA 3RM4A 5IDZA 3TSMA 3P6LA 3EWWA 1AH0A 3L23A 1J18A 2ZWZA 3CUJA 3SIZA 1SGJA 1ZUAX 3SFWA 1XKJA 5HNTA 1DTNA 3U48A 5C7HA 3U9IA 1RCOB 3G0UA 3ITOA 4Q33A 4QJ3B 4H00A 4LUIA 3WNPA 2W91A 3V4BA 1LLWA 1FWGC 1UWUA 3THQA 1MQPA 4MZ8A 4N02A 3IUIA 3ZR4A 1AZ2A 2XHYA 4XZMX 5DBUA 4R9OA 3KL3A 4QIUA 2XUCA 1S2WA 1JZ3A 1I2NA 3G22A 3M5VA 3TCSA 4JTKA 3VO0A 3BG9A 1YIXA 3IJLA 4DO5A 2XN0A 4B5XA 1UP0A 3PBWA 3GHSA 1TIMA 2X0HA 1CLKA 2W0UA 1S5MA 1M04A 4BF5A 1DYSA 2HS6A 3LXBA 2CLOA 1Y8BA 4DBUA 3MUCA 1EDTA 1CXLA 2QJJA 1MZHA 1P48A 2ACUA 4EANA 1E1FA 4Y9PA 4H8VA 1TPWA 4ERAA 2ISFA 1SR9A 4LAMA 2VWTA 4PCNA 1S38A 4AC1X 2FZ9A 3KDNA 2NW0A 3TYUA 3I3EA 4MJMA 4QLJA 6CGTA 4CLMA 3VIHA 4RV8A 3WH5A 1H61A 1IGSA 3C56A 7TAAA 1PWLA 1F3TA 2F84A 2YL5A 3DU0A 5DY2A 2YW4A 2ISVA 3FN9A 1Q6GA 4JGDA 2QCGA 1MYRA 2XFYA 3BJFA 4FPSA 3UPBA 4RE2A 3I6TA 3XIMA 1JDFA 1OT1A 4GOAA 3I4EA 1VFOA 3SRHA 1EJXC 4GZJA 3N2TA 2P10A 4GIRA 4BHYA 2YDRA 4D8ZA 2CLMA 1UKSA 3C52A 1XFBA 1CXFA 5DCBA 1I60A 4XZNX 3VU2A 1OFDA 2QXWA 3W26A 3F4DA 2X1UA 3UBPC 5HMFA 4WGHA 3RRAA 3WQVA 1BKHA 1OWQA 4KH2A 2MNRA 3JS3A 1SUXA 1Z32X 3WF3A 1KBIA 4GGBA 4BY3A 5JXQA 1XYFA 3JZEA 4J2PA 1RVKA 4DZAA 1V3KA 3GRIA 2VRKA 2NZLA 5ABFB 4UCGA 1XIEA 3IK4A 4PEEA 4KEMA 4V27A 1F3XA 2FKPA 3AYSA 3B05A 1QOPA 1F3EA 4TUFA 3BPWA 4CD5A 2FTYA 1UR8A 3V5FA 2D20A 3RILA 5KETA 2QT3A 1B31A 1W3KA 3FHAA 2YZ5A 2PLJA 2WKGA 1TCDA 4AF0B 3K4AA 2GVEA 4Z0SA 3GO2A 3WBYA 5IM51 1XX1A 5DN1A 4RW5A 4GCAA 3S2CA 3T8LA 4D72A 2EAWA 3B8UA 2FGZA 4YXGA 1LL6A 1A5BA 4QG8A 3GDRA 1YE4A 1TR9A 3UERA 4EAYA 4GCXA 1JRCA 3TEVA 4QRNA 5BU6A 4IGHA 4LALA 1HL9A 1BSIA 2QCDB 1A5AA 1ZCOA 2DW7A 4KRUA 5M17A 1Z41A 1K3UA 1C29A 1GPFA 1I4NA 3MUXA 1Q63A 3OGSA 4RZ6A 3LHYA 2EPHA 4EAMA 5KZDA 3TZNA 2J79A 4JIEA 4C7FA 3MMWA 3UVAA 2WB5A 3WLQA 2QPXA 4A29A 4CQCA 3LM3A 1XLDA 4TR9A 1ME9A 1VGAA 1BG4A 4IG2A 1P43A 1EHNA 2QNEA 3GBEA 3WLJA 2C13A 3LI0A 3DIPA 3SUSA 3L4WA 3H6OA 3WMSA 1WKEA 4DJFA 1FWNA 4GXPA 4KERA 4G8TA 2EPNA 1PS9A 4W8LA 4AX6A 5TD4A 1XLGA 4MUPA 2WNZA 3W76A 2Q8XA 3WMLA 4PTVA 1W91A 2Y8KA 4JQAA 1FWEC 2AKZA 3EWZA 3FFSA 3UWQA 4IX2A 1QATA 4FXSA 1SZEA 1T41A 1ODUA 4V15A 2AL2A 4M80A 3USZA 3G0XA 3STEA 1JDDA 4IISA 2ZDSA 3BH4A 4NJJA 3GH5A 3WO8A 3HPSA 3GIQA 4IIFA 1QRQA 1XG3A 3W84A 1ZY9A 1OZMA 3QR0A 4IPIA 2EG7A 1EXPA 1IIHA 2HNEA 4X61A 3VIOA 4D1IA 1A3XA 2QV5A 2ABBA 3E3HA 4GBDA 4AB4A 5K3VA 3OBKA 1R3QA 1Q7QA 1P1XA 1RK5A 2ZADA 3KTXA 4LXFA 2V3FA 2BMBA 4O1AA 1D3GA 3KDOA 3Q2DA 3UWUA 3MMUA 3LDVA 2B4GA 2VL4A 1LG1A 4YYFA 3VOHA 5HQMA 3EDJA 1SZFA 2G96A 3HMCA 4IP4A 2QJIA 5AYYA 3BQ6A 3DH7A 5AHEA 1IT7A 1JZ8A 2XIBA 3CYVA 1NDVA 3R25A 2WSPA 4DJDD 3LXAA 3QZEA 4XD3A 5HJXA 4ERIA 1VCFA 2BY3A 2W79A 3IGHX 4IMDA 4HHLA 3UY7A 1OIFA 1CTNA 4PRTA 5AYZA 3VX1A 4Z2IA 5F1VA 3SUWA 4GJIA 1KM5A 1DV7A 3EB3A 2VGIA 4HA1A 1PCWA 2DP3A 1HW6A 1ZAHA 4M6UA 5DEZA 2VCCA 5T9BG 3DFTA 3C2FA 4R9XA 5HATA 1BLIA 4H9YA 3EKGA 4E38A 3RMEA 3V16A 1OG6A 3CXOA 1XIGA 2F38A 2XH4A 3T4CA 3MWAA 4A05A 4K8HA 3KFTA 3SN1A 3Q65A 4Z0JA 2GOUA 2OOFA 3VKCA 4L1WA 3ANVA 3M0KA 3U8GA 1UCWA 4UFLA 4L4PA 5E9XA 3VGGA 1L9WA 3RX3A 4PUNA 1DQXA 2B7QA 4GC4A 5I3IA 3IS4A 1DJNA 1OFPA 4DJED 3S6DA 4C6KA 4GKTA 4J5NA 3IAQA 4NAEB 1V7AA 1AK5A 2PTZA 2WW5A 1SW3A 4PUMA 4FX8A 2ATMA 3DI1A 2IKIA 1VLIA 2PDJA 4QGCA 5I3GA 3UZZA 3ZJKA 1Q8JA 4DI8A 4JTUA 3NCOA 2E5CA 3PK7A 4DBEA 3DXIA 3WDHA 5GNYA 4ZO9A 2XH2A 1UBPC 4H7VA 4HPXA 3PG9A 4X9YA 1CXHA 2WZMA 2Y62A 1BWVA 2JGQA 1QI5A 1PKYA 4M5PA 2ADAA 2FZ8A 4WR3A 3ARTA 3TN3A 4N4QA 6REQB 2GJRA 5IHSA 3TTYA 4QJ4B 1U33A 2GSEA 5K9CA 4PRRA 1EX5A 3BCFA 2HBVA 4Q32A 3NSNA 1T40A 5CCZA 2XSXA 4ZTXA 4B16A 1PYFA 2CBUA 2TYSA 1YXCA 2Z00A 1GK8A 1TUFA 3LRLA 3K8MA 2YB4A 3TVAA 2QUMA 2MUCA 1RJPA 1PPIA 2NQHA 1P6BA 3QMRA 2R1LA 1VEOA 3L65A 1OF8A 1TB3A 4MY9A 1PIFA 5HULA 3O16A 5HWMA 1XD0A 2WC7A 1V6XA 4D71A 1X8CA 2INEA 2W4XA 3DOPA 1M7XA 3KVMA 3VKBA 5CG7A 2F6UA 2VEPA 3S2MA 3NQ8A 4FOKA 3EOUA 4Y9AA 4IFKA 4JN6A 1MW0A 4AC7C 3C2OA 2VTFA 2CITA 2D0FA 3CMFA 3AC0A 1PX8A 4JTGA 3BW2A 3R5EA 4ZL1A 1YTKA 1F4HA 2OO0A 3GR7A 5EU9A 4H19A 5B7ZA 5U4NA 4RPQA 4UFHA 2E68A 3ZJ8A 3GC4A 1KM4A 3PAOA 3UCCA 1L6WA 1EJUC 3CAVA 3JUGA 2BDQA 3ARSA 5T9CE 3LOTA 4M29A 1XD1A 4N4PA 5DX7A 2PS2A 4XKYA 3TQVA 3FLUA 2PLCA 1TO3A 2X16A 2PDMA 1XIJA 3FK4A 4H4IA 3R11A 3EAUA 3I7SA 4S39A 4NRSA 2OWXA 4DWSC 3TAKA 1JAEA 1AW5A 2GQ3A 4HZ6A 2YOCA 2GOKA 2FFCA 1C92A 2OYMA 1GZ1A 3SUUA 1KNWA 5A8OA 3NVTA 2B81A 4QE4A 2WBKA 4JTCA 1MSSA 2RH9A 1UH4A 3PNZA 1E6NA 3NDOA 1WE5A 5F1UA 4C6DA 1JQXA 5IHRA 3HGRA 3QW3A 2YDAA 4NYYA 1OINA 4FNSA 1RD5A 2OLHA 3DUGA 3VUSA 5EMYA 4GZIA 5C2XA 4DBDA 1R85A 5FF2A 1SO3A 1SR0A 4PMDA 1MUCA 3WN6A 4H1ZA 4Z2LA 2JK2A 8TIMA 3RO6A 2WQDA 3IIOA 3LMYA 3LGEA 1L2QA 3A3WA 4HPNA 5M5DA 1K03A 3GS6A 1ICQA 2DVXA 4O50A 5EPDA 1KQZA 4H04A 2NVCA 2GK1A 4AIUA 2VT0A 1KFWA 4O53A 3W87A 5CC7A 2PDPA 3QGAC 3UWWA 2YL6A 4LUSA 3Q37A 2P53A 2BB0A 4H83A 3KP1A 3T0DA 5D2TA 1I8JA 2PEVA 3MUY1 5FEPA 3LRMA 3V7PA 4BCEA 4MDOA 2VWSA 1E9LA 3WENA 5B80A 1GPWA 4GYKA 3UGRA 3BTNA 1TZ9A 2J8TA 3G1YA 4L4MA 1VFMA 3WEMA 2Y63A 4HA0A 1E1CB 1G67A 3ZT5A 4DJFD 1KLYA 1LWJA 2XN2A 1WZAA 1KB3A 4Q6XA 4LF1A 1EFZA 3CMGA 1XQKA 1SVDA 3GU1A 5CZ0A 4OKDA 4HN4A 5CPTA 5A6AA 2PWDA 4JKKA 1DEDA 3WK2A 1A5LC 1XXXA 3IPWA 1KKRA 1EC8A 3BLFA 1PB0A 4TX6A 4K1GA 2GDQA 2ZOXA 5JH2A 1H2JA 4DB7A 5LHEA 4PCSA 3WQPA 3VDCA 5L9FA 1Q2RA 1V6VA 2R1PA 3P67A 3NPUA 5I00A 4AFYA 2RJGA 4BF9A 7REQA 4GVHA 2POTA 1H63A 2WSRA 3B0YA 2PDFA 3VKAA 4HSOA 3EOOA 1UUMA 4NP7A 4R34A 5DMMA 4GX8A 4HYWA 3W81A 3TN5A 4N0RA 4KF1A 2VFFA 3W88A 1JPHA 3OYXA 1HL2A 1JI1A 4ML4A 4ADUA 2ZUMA 2REQB 3U7VA 1A5UA 2ZA1A 4NX5A 4NQ1A 4B91A 5LNWA 4YL2A 3BAYA 3ARZA 3U4AA 3GC2A 3FSTA 3AOFA 5LXXA 3HMJG 3PZNA 1E6ZA 4TVCA 1PZ2A 3GFZA 3EWCA 1G4SA 1Q65A 2J13A 2AOSA 1XYBA 4GY0A 4GVIA 4KWUA 4P7QA 1N8FA 2PDBA 4HGXA 2BGQA 4A2RA 4C6QA 1UB3A 2NT0A 2FIQA 5HOSA 3B9AA 1K7EA 1WZKA 1LL4A 3M0IA 3UW6A 1FCVA 1BXNA 3CJPA 3CV2A 4IPPA 4FB7A 5JUVA 4HCLA 1FKXA 3NOEA 1UWQA 3LCLA 5BCAA 3I7RA 1LOQA 1H7RA 2XDFA 3O06A 1ONRA 4EP8C 3FHQA 2CC0A 4I90A 1F6KA 4OUIA 4YYCA 3KWSA 3CEPA 1QWKA 2O55A 4ZE4A 1W2PA 4HOZA 2XGIA 4AWUA 1Q6OA 3BLKA 3AZTA 3DG3A 1J0JA 1AFSA 3L4UA 1A49A 4Z17A 2XIOA 3RAOA 3GTIA 1RV8A 3BG5A 1K7XA 3FKKA 5TF0A 2NV1A 2VUNA 3C2VA 1EWEA 2ESCA 3A12A 5A94A 3TLLA 4GGHA 3WJYA 1UMYA 4IQLA 4W7WA 5FEXA 3BK0A 2GJXB 3W7DA 3MKVA 3QV6A 2Q8LA 1TPH1 1ME8A 4HU8A 5I79A 2OYKA 3CL7A 1HKVA 4O54A 2D73A 1QNSA 4AHOA 2NWSA 1BXBA 3Q67A 4TQTA 4HK5A 1TMQA 4YTSA 4KETA 1SZGA 1JCMP 3LNMA 3GXMA 4Q8NA 2O9OA 1RALA 2ZX5A 3MCNA 3TN6A 3P0WA 5ABEA 3W7GA 3BQ5A 1UC5A 3T81A 4CQ9A 2WLZA 4KFNA 5J5RA 3QPYA 8RUCA 1A5KC 5TQLA 4WJXA 3EA1A 3CB3A 3WUGA 2HK0A 5D2VA 1QI4A 2POZA 4NL1A 3NUKA 5E6YA 2C1GA 3N2XA 3TONA 4W7VA 2ZWYA 4M81A 1TWDA 2XWDA 4PB3A 1IZJA 3MANA 1ZQ5A 2VFHA 4DO4A 1XUZA 2OMAA 4L9ZA 4M1RA 5I3FA 4PUDA 1RLDA 3N4EA 3NZGA 3P80A 4PTDA 1YPFA 3ZLFA 7PTDA 5I7GA 3FA5A 2WANA 5EB8A 3TQPA 3W7RA 4JTLA 3FSUA 1JEZA 2G8ZA 4H9VA 2EJ1A 3ZOAA 4RJEA 2J24A 1X6UA 2Z6JA 4DZIA 5LIYX 1C91A 1IIGA 3P5YA 2OQYA 3QQWA 1ZALA 3OBAA 3LA4A 1M53A 4GLEA 1UUOA 3AIUA 4GMEA 1LT7A 3OIHA 3WD0A 1J5TA 3HN3A 3TTQA 3N17A 1KFCA 1HKKA 4NVTA 4A8IA 1REQB 1TTPA 5FJRA 3M07A 1P7TA 1C93A 2J4GA 4LC6A 3HG5A 3VDBA 3M0HA 1BAGA 2ODOA 3VIPA 4OJYA 1O5XA 2O9RA 1R8LA 3WJXA 2NVAA 3T6CA 1CT5A 4CNUA 4Q7IA 5AKQA 2D24A 2IXVA 3AWOA 4WY0B 2XH0A 3A64A 3N2CA 3AXXA 3SY8A 4DF2A 1MNSA 4XKMA 3UG5A 4BQ2A 1LBLA 3VIFA 2WMJA 1C8QA 3L4YA 2DU2A 2VCBA 3R12A 1JCTA 1XPYA 4JYEA 1ITXA 1WKFA 2E6YA 4DUVA 3BXWA 2YBTA 3REQA 3CAKA 3LEPA 2O56A 5C9UA 3TN4A 1NY1A 4X2PA 4ORIA 1E40A 1OSEA 2QAFA 4JR5A 1BF6A 2GUYA 4IIDA 3EMZA 4YTQA 5D03A 2AMGA 3LCFA 3QTGA 2VURA 3NFUA 5CZTA 4C90A 1W0MA 1EPVA 2PC8A 1AW2A 4UOQA 4ICNA 4TTGA 4ZO8A 3PG8A 2UZ9A 1X98A 3E0IA 2GGJA 1H1NA 2X05A 2J25A 1CYGA 2GVYA 2E8YA 3GXPA 3G8EA 2FMNA 4C1KA 1VF8A 3BOXA 4FX7A 3MJYA 3MP3A 4JIHA 1Q66A 3DX5A 3ZZ1A 2HS8A 4GQ0A 3CHCA 3WNKA 3NQGA 3LLFA 4E5TA 3A24A 1F6PA 4AXKA 1YTDA 3B8DA 3U2EA 3PBYA 3AI0A 2QJGA 3U7BA 1B5TA 4IFOA 4KRTA 4YCPA 1C7TA 4GYPA 5G5IA 1BYCA 1V0KA 4LOCA 4P61A 4KIRA 3FXGA 1TPC1 2V69A 4P8WA 2GQ9A 3W6YA 3QR3A 1ENUA 3LV5A 1SFTA 3C6CA 1F73A 3HFYA 2C8NA 1I0DA 5CPSA 2VCAA 3A3XA 3ABOA 3L66A 5A8MA 2V6AA 4BQ4A 3N3TA 3MJMA 2CHRA 5GNXA 3LCGA 1QW7A 4OGZA 4JHZA 4TOQA 1TV4A 2FFIA 1GYLA 4M0XA 1CB2A 4O28A 5HJYA 4MYXA 3ONCA 1W17A 2PF0A 5J5DA 5JU6A 1HJUA 2AQOA 3H26A 2Z1BA 2CIPA 3F03K 3P14A 1E9IA 3CUZA 1R30A 5DBTA 1UKOA 1GGOA 2ZRUA 4C6OA 1AD1A 3W7KA 1PZ3A 4JFUA 3LTPA 4ACZB 4ZFCA 3HBLA 4A3YA 4XQ6A 1BSLA 1KFKA 3S1XA 3WFAA 1DJGA 2D0HA 3MSYA 2P50A 4N9DA 4U2ZA 2D2JA 3QF0A 2BODX 1W1TA 3U0HA 1DJWA 1H62A 3W7LA 4J2MA 3O6AA 1V0LA 2PRMA 2GVLA 5CZKA 3ZVHB 2FJUB 3WH6A 2WMIB 5D9OA 3WQWA 1GZJA 3N2OA 3WH7A 5LNUA 1AQMA 1YW1A 4JFWA 1YNYA 4NT0A 2Z1KA 1JF5A 1J79A 1EEXA 1R46A 1TX0A 4GD0A 1TPFA 1D7KA 4HMDA 5LIWX 1MW3A 3GDMA 1QU4A 2O9TA 2CLLA 4XIAA 4GY7A 4AZ6A 1W1YA 2XJ7A 4AVNA 3CPRA 7XIMA 3PHAA 3QPEA 1OABA 1DOSA 1V3JA 3EGJA 3F4VA 2ON3A 5LIUX 2J8GA 2XH7A 1DIDA 4GVGA 2YYTA 3BO9A 1NOFA 2D2OA 3V0SA 3AHXA 4A6GA 4W89A 4GUHA 1R2RA 2PZ0A 3RU6A 1JCXA 3G1DA 4CCCA 3GKAA 4P8UA 4HTBA 3UR7A 3PY2A 5AC7A 4XO7A 3OQEA 3SN4A 1KXQA 2PB1A 1ZLPA 3IANA 2EHHA 4I7UA 3C8NA 3G6MA 2HDJA 2BTMA 4ZOEA 4E2OA 3BUVA 1H41A 4C6CA 2WQPA 4MWAB 5D8ZA 2BHZA 2WKLA 1O5RA 3KS6A 2C91A 4K8GA 4JPGA 3S0CA 2ZZ7A 4GUFA 3N2BA 1RLCL 5ABFA 4Z2HA 5A95A 1UD4A 3H22A 2BSLA 4DY1A 3A13A 1VCGA 3GNPA 1POKA 4ENLA 3W25A 8CGTA 5CSYA 3OVQA 4A8RA 1QR7A 2CNCA 3M16A 1LQ2A 4Y96A 3M7WA 3SW6A 2MANA 5LA1A 1GWJA 5E0CA 4UZSA 1X39A 3NM3A 3XISA 3SY5A 1SJCA 3QOKA 4KMQA 2GWGA 3VD3A 5LKYA 2FGLA 4B4HA 1IYXA 4AWSA 4CU6A 1NF0A 4LVAA 3VVGA 4CNPA 4UTWC 4Y90A 4BA0A 1SSDA 5A8GA 3IK2A 5LA2A 3UZXA 1G4PA 1ZNNA 2XINA 1P5BA 1QNQA 3NZQA 5REQB 4IX0A 2CYGA 4K37A 1FVPA 1IEQA 4X9SA 2KX9A 2Y89A 2A3LA 5RUBA 4UFMA 4PL1A 3T2OA 2OPJA 2TRSA 5I06A 2B0MA 1U1UA 1GG1A 4K39A 4B3KA 1I9CB 2DT2A 5LNSA 1VHNA 4XSMA 2WHMA 4HJWA 4NKCA 3LHVA 4I3GA 5HQEA 1RY8A 4AHQA 1K9TA 1F9CA 5I09A 2AMXA 1ZJBA 1UC4A 3E1F1 2ZX6A 3F4NA 1JXKA 5A1AA 4DNMA 4DM2A 3BGJA 1XYCA 4D6FA 4R33A 1W9BM 3BGAA 3LCHA 3CL8A 3DCPA 1TX2A 3H12A 3VCRA 3RCYA 3BVJA 1S5NA 1V4YA 1JNDA 1FWRA 5G2WA 3CQJA 2XM1A 3MQTA 3WLTA 1EF2A 1HJQA 1LYXA 2VMFA 1JPMA 4J40A 3SAZA 3W83A 4JFSA 1JDEA 4HK6A 1FWHC 2VD9A 4DXKA 1Z89A 3PZUA 1ZJIA 3MC5A 2EPLX 3ZVIA 3P81A 5AFDA 4S2BA 4B5UA 2NT1A 2Z1SA 3AWNA 2E9BA 2W61A 4DELA 1VEMA 4OFCA 4RE0A 5FL0A 2PU0A 4M6QA 1LQ0A 1TG7A 3IIXA 5CEWA 2VZVA 1F8IA 1TV5A 1TUXA 3WSUA 4JFVA 1AVAA 3TV8A 3GH4A 5I07A 4G7FA 1GVEA 1E9YB 1EJSC 2WO5A 3ARQA 3G1FA 1B54A 4QG9A 3ARUA 1M1BA 3WDPP 3GBDA 4AVOA 3WF0A 2DUAA 3WD3A 2QUVA 1W56A 2TODA 3N6JA 4PTXA 3PN8A 5FJTA 1PBGA 4MPKA 3CV7A 1J0KA 5TIMA 1R38A 3BMVA 3VZZA 3W86A 3OZMA 5FJPA 2BHYA 4E8CA 1CXIA 3AIEA 1XW8A 3KX6A 1ZJHA 4NZFA 3KTSA 4O13A 5CJMA 3CT2A 3L4TA 1FWJC 1OFAA 4JL1A 4JYDA 3AXHA 3SJ3A 3KE0A 2ZUUA 1YQ2A 3FGCB 3GNOA 3NZRA 2D2GA 2Y5JA 3RK8A 4PBFA 3B04A 3UVIA 4ZB0A 2JF7A 1GKRA 3UR2A 3BZJA 1W9PA 2EKCA 3BLLA 3EEZA 4JX4A 1BYDA 4LV9A 4EACA 5EFDA 4ZO6A 3G1SA 1FWWA 2DZTA 4NASA 3AJ7A 3C2EA 3ITTA 3LLDA 3D5HA 1V7YA 2SFPA 4KCVA 3R8HA 1XLJA 4C65A 1LUCA 4W7UA 3R89A 1P4CA 3QZ6A 5JVLA 1MRQA 4O57A 4ICCX 1JI2A 2OSWA 1HP5A 1IV8A 4S3GA 3SJNA 3I6RA 1JAKA 3GVVA 4B9YA 2NXIA 1JIBA 4NAEA 1NQKA 4C7GA 2RDUA 3AJXA 4U3CA 3QQ1A 1FHUA 3DEQA 4LAKA 2TPSA 4QJ1A 2Y7FA 2HVMA 4NHVA 2OEKA 1EYEA 2NXHA 3LV6A 4DYEA 1QI2A 1P0EA 1TA3B 1L6SA 4LGXA 5HUPA 1OYBA 1ALDA 3AUOA 1PZ0A 2VR2A 3TA6A 3VIGA 2Z1WA 3KS5A 4CGTA 5CSSA 4E8GA 5D05A 1PZ1A 2QJHA 3CM4A 5AHLA 2ZC8A 3H7VA 5M1TA 2W6RA 6REQA 3VC6A 1NP0A 2XZ9A 1P0KA 5JH1A 2Y8VA 3VM5A 4DWSB 4Q4PA 3MCOA 1BVWA 1B4EA 3WQDA 4NXKA 4XIMA 1AQFA 5K4ZA 2BV9A 3ATZA 2ZRVA 3AXIA 2CLFA 2DGAA 2E7FA 3N04A 3ITCA 2NSOA 2NSXA 2DSZA 5K2ZA 1XPGA 1G4EA 2J7CA 4OBRA 4CCDA 3GVQA 3CK5A 3E0FA 4ZVJA 1XYZA 5EBUA 5CLWA 4GNJA 1W3JA 3A4WA 4CN6A 4BEUA 4ALDA 4LYQA 4F2UA 1TVNA 3OPSA 1RK6A 5BXRA 4J7RA 1UUQA 1IWBA 3H7UA 4JTIA 4W8AA 1CGVA 1LRTA 3W2UA 4NZ1A 3T44A 4JFTA 4AWEA 3MI2A 3W1UA 4P8XA 4EXAA 5JMUA 4MJ2A 3IUHA 8A3HA 4W85A 1BTCA 1EYWA 5TBOA 5FEZA 1VFUA 3MZ2A 4XTDA 4G9PA 1VPXA 4O18A 1Y7VA 2R1NA 3ZIZA 2ZX9A 5AN7A 2YBVA 4ZQOA 3LB0A 2GJLA 3R8RA 2V0TA 4HNUA 3BSGA 4C6EA 1SZRA 2QPUA 3LQLA 1B3XA 1LRNA 1OD8A 1C9WA 3IIVA 2PC4A 3VMPA 4GYFA 2BVTA 1QVBA 1VS1A 3T9PA 2BXYA 1MXGA 3KBMA 3N18A 4NG3A 1YNQA 3TZFA 5CLTA 2HQAA 1FX6A 3H2MA 3NTYA 2WC4A 3CZKA 3WY1A 2P8CA 3W72A 2Y61A 1KXTA 3UPMA 4QAWA 4JNZA 1KGXA 3R7MA 3E9AA 3K4DA 4WKHA 2NQJA 1IWAA 2YL9A 2ZZ4A 4IF2A 1D3HA 2F2KA 4PRWA 1JZ7A 4ZE5A 5HWNA 3SCNA 4ZGYA 1SFSA 3ZT7A 1XSIA 3KHDA 1WXYA 5A6MA 2Y8UA 2ZXDA 4E2DA 5AOUA 1KTNA 1UR1A 1QBBA 3EX2A 3C86A 3PTKA 3O9NA 3SCSA 2BY1A 3ZQ9A 4QX4A 2HRWA 1E4MM 3OZYA 4M6PA 1TR1A 4H01A 3W82A 2UY2A 3KVJA 4D8LA 4QE5A 2Z1XA 1QXLA 2BXZA 1H4PA 3RNDA 1GTHA 4NU7A 3TNBA 2QVHA 1FWDC 4DN1A 3H55A 1DQUA 3K46A 4Y2WA 2Z2AA 2PTWA 1H7OA 1EGZA 2EG8A 1I0BA 1ESWA 4GY1A 1JDCA 1LWHA 2Y2WA 4KWOA 3MVTA 3VABA 5DQPA 2DIJA 2O4QA 5CC3A 1GKPA 4AX7A 3MHGA 4JTQA 2VEFA 3HQNA 1ECQA 2PDXA 3GTXA 2DY3A 4DO7A 4AQLA 1GEHA 3E12A 4UOJA 3SSZA 3W01A 5SWUA 2YBUA 3W3OA 1Z44A 5BZAA 2XZ7A 3MO4A 3USBA 3LHWA 1GKQA 3O0KA 1UW9A 5HNUA 5EFFA 4N7QA 2PBOA 5MKGB 3RG6A 1FFRA 9XIAA 2QV4A 5G4HC 3MUZ1 5LHFA 1WV2A 2XTKA 1E1CA 2WSQA 2E77A 4J3ZA 3APYA 4UWMA 3F4WA 1X6LA 4XBJA 2O7SA 4PH6A 3PTQA 1OFQA 3CH0A 4IMAA 2FH8A 2DZPA 1EIXA 1S39A 4CNNA 4J35A 5A6BA 1Q85A 5T26A 4HHMA 4QNWA 1HO4A 3PUGA 4ZQMA 2OQHA 4IQDA 3C0SA 4XAZA 1Y65A 4AYSA 1HKIA 3ISIX 5EMKA 5ABGA 1GTEA 5BOOA 2R14A 2ZUNA 4G6CA 1D3CA 2PWUA 5I02A 3VPLA 5AHMA 1N2VA 3LBCA 3W7PA 1V08A 2Y85A 2YSWA 3GY1A 3RM8A 3UY8A 4RE4A 1AH4A 1S2UA 4JD4A 3BWWA 4LCSA 2DZSA 5BRQA 3KCOA 1TE6A 2W67A 3IWPA 2Z2BA 1AJZA 4UQ9A 3RJYA 1VFLA 2REQA 3P0XA 3V3WA 3W7NA 3M0LA 4JX5A 3N4FA 1ML1A 1K9FA 3WEOA 3ENLA 5CQ1A 3BZGA 5I6SA 5JBDA 2WCSA 1EWDA 4CNTA 3UT0A 4E2BA 3GC5A 3TCEA 4JDBA 3AHVA 4XZ9A 3WLHA 5H8UA 3PS7A 1GOXA 2DJXA 3OA5A 2P8BA 4GG9A 3SZ8A 4F0KA 3EX6A 2BNJA 5CJNA 3AIWA 1LRQA 4NJHA 4CCEA 1ZBCA 4C1LA 1NM9A 1Q6QA 2P1FA 1US2A 5ABTA 1XIBA 7A3HA 2GVJA 6TAAA 3W0KA 5A5WA 4EXBA 3PWAA 3E6EA 2TSYA 2DEPA 3CQHA 5D32A 5CAKA 1XBYA 1WDQA 2HBXA 4K2SA 5EGRA 3PTDA 3LUTA 4H9MA 1H50A 3AMKA 3WEZA 4UB9A 2YCEA 4NUWA 4J3XA 3LCWA 3C4UA 3BCDA 4HNNA 3VI2A 3B0PA 1NIUA 4W9TA 3E2RA 3QTPA 1RBAA 3AUJA 1U5VA 2YCKX 4DHGA 2J9YA 3M46A 1QBAA 3ITVA 3P93A 1L8NA 3E0WA 3BARA 3L4ZA 4A3RA 4OQVA 2FDMA 3FVDA 2WJZA 1R86A 2E6DA 3URAA 4XAFA 4GXWA 3OLGA 5FSEC 1EL3A 3VDAA 1ISWA 3BLOA 2XVNA 1W2VA 4Y9MA 4AEOA 3VNJA 1DHKA 2YCJA 3SCVA 1LLOA 4UTIA 3OEXA 4E3TA 1EKOA 3EYPA 2XIMA 5IDIA 1OQFA 3HPXA 1OGGA 1V77A 1UHVA 1BD0A 4A3UA 2QW5A 3D6NA 3FXYA 1GOIA 2QCHA 1KM3A 4IGMA 4TX9A 1NF7A 2OU4A 1K8YA 4KPLA 1J0HA 1OADA 4XZLX 3NWRA 4HU4A 4N6EA 3AIRA 3W7QA 4O8AA 2DIKA 3SRDA 2HE8A 4W86A 4OOUA 1ADSA 5FEWA 3WNNA 4F2TA 3GIYA 1CENA 3R0KA 4NI3A 1Y5XA 4R7JA 2J8FA 2FTWA 4UR9A 3HQ1A 4RZ5A 5KMYA 3AYRA 3EKLA 1XF0A 5C55A 4ZZ9A 1DWHM 1EJ7L 5FESA 4MOZA 3RIKA 1NJJA 3NQDA 4KW2A 2WHLA 1KFBA 1V0NA 3I65A 1KXHA 4A8LA 4MZ1A 3GHRA 1N7KA 2YX0A 4Q3MA 1S2CA 4EK7A 1VLWA 4MNLA 3KCLA 5F2LA 2X2GA 1EEPA 1ZAJA 4NXSA 1WUEA 5IBXA 1B9BA 1CXKA 3PZQA 1KTBA 2BVYA 3M5YA 2ONEA 3HIJA 3PZOA 1DIEA 2VC6A 1IR1A 4B92A 4RZBA 2XGZA 3GG8A 4D6JA 1TVPA 4PC8A 5DXXA 3ZYZA 3V0TA 4Y8EA 2V2CA 3WFLA 4HNOA 2JKPA 5HK4A 3VMOA 1QI3A 1E0WA 4M82A 1SO5A 1U2YA 2Z24A 1I2RA 2I9EA 1DHPA 1JGIA 1YDOA 2YIHA 3LN3A 3QLDA 1B3VA 1UPPA 4AZCB 2OFJA 5A2CA 4LU0A 4NSBA 2I16A 3ALFA 1BXCA 1NFGA 2H9AA 4JTJA 3CS2A 3W7EA 1XCXA 4S3KA 1KFLA 3R8GA 7ENLA 1REQA 5A6KA 2C7FA 1QW8A 4I5RA 4GIAA 1S5WA 4K3ZA 3VK5A 1IT8A 1VC4A 1K77A 1ZBWA 1JYXA 1DXFA 1KM6A 5D02A 3MW7A 2X41A 4E4FA 2X09A 3H23A 2PDUA 1U83A 1I75A 4WY0A 4D6CA 4FNQA 1EHAA 4UMBA 1POJA 2R1MA 3N29A 4ZQCA 4PCTA 2ZTJA 1XYMA 1TRDA 1F4AA 2HPIA 4POCA 1MEHA 2AQWA 3IGXA 2DSVA 4L6OA 3WIJA 4S3BA 1EB3A 2PP1A 4AZGA 1PUDA 2OKOA 1GYNA 4TMCA 2XSAA 3M1ZA 1NVMA 4I7VA 3H2CA 1RJQA 3AROA 3F5LA 3UZJA 1G7VA 3S5YA 4Q8PA 3GVWA 4CKQA 4DO6A 4F8XA 3URNA 1F61A 3KZPA 4XAPA 3S1UA 4F0HA 1BQGA 1SPQA 3KRUA 3UR8A 3E2SA 2QULA 5AYIA 3DBPA 5C70A 2VD8A 3EWDA 5DMLA 1QK0A 1XIFA 4L4OA 3VDHA 3BDKA 3K1GA 4Q4OA 1GG0A 3VINA 1TQJA 1VBGA 1JXJA 3QEZA 1CLXA 1ISYA 1X96A 3HZ3A 1GUVA 2Z27A 1BEUA 1KRAC 1JYNA 1OY0A 1JPIA 3PTMA 1F05A 1FBAA 4AD2A 3SCTA 4LBSA 2R24A 3BC9A 2QMKA 1U1JA 3U5UA 2DVTA 3A4XA 4O10A 2B7NA 3TYAA 4HHPA 1JD9A 3ABRA 4HP5A 3TH6A 3GW3A 1H7PA 3BAWA 2YA0A 1WDRA 2ZTKA 5CAHA 3KWXA 1CIUA 3CNYA 2C1HA 2QF7A 4H2HA 3V36A 1ME7A 1XLIA 1GJPA 4AW7A 2X0YA 3RUBL 3OLDA 3ID7A 4K36A 3W1NA 1DE6A 1DWAM 1KR0A 2IQDA 3TROA 3MB9A 3R0UA 4QG6A 1HP4A 4DXXA 4OV9A 5DANA 1AD4A 3PB2A 3GAKA 2OKTA 3MPGA 2E9MA 5I77A 2P0OA 3AHTA 1DIOA 1GJUA 5FJOA 2C16A 2OOGA 1H7NA 1E5NA 1R5YA 1S1PA 4MB4A 3PJXA 5A6BD 1TWIA 3GXFA 3HQPA 3DYOA 1LQAA 1VP5A 4LS2A 4L64A 4N2YA 5CH9A 3M0YA 1OFRA 4FIQA 3W29A 4H41A 2F2HA 2VDIA 1WAUA 2RHGA 4LW7A 4ACZA 4PTMA 1YTEA 3G6LA 2PDNA 4LCQA 1SW0A 1FHVA 2QZRA 4FEZA 3W2MA 1CBGA 2Z26A 3EA3A 3S5OA 1IEVA 1ZRQA 3PZVA 4DQWA 1KR1A 2PP0A 3H4XA 3O63A 1CWYA 4UBPC 3SQSA 3V0UA 6TIMA 3B03A 2EF9A 3ZVHA 1H3GA 4S3EA 1OHLA 1VHCA 3WF2A 2ZKMX 4H9UA 5FF4A 4E0CA 2BGNE 2FYMA 1L6FA 3W02A 3VFLA 3C3UA 1EP3A 1OCJA 1K6AA 2YA2A 1JZ6A 5BMWA 4XZBA 2E0PA 2DT1A 3FOKA 1VBUA 2CBVA 3U3HA 2PAJA 1XSKA 2V67A 3LY0A 3PNUA 5C54A 1EJTC 4B5SA 3W00A 4B15A 1E6XM 1QT1A 2QHAA 4WUIA 1FKWA 3WZ0E 4MWAE 3KRZA 1XUUA 4FX6M 5CJ5A 3TMLA 3UZWA 1GJWA 3BE7A 4FO4A 3TJIA 4O1FA 5FF7A 1XLKA 4AG0A 2F6KA 1VBHA 1X7IA 2VX6A 3E74A 2BOFX 2Y7EA 4IQEA 2CHNA 3KM8A 4QSHA 2WXDM 1A4MA 2Y24A 1LOSA 2PFHA 1M3UA 2A7RA 1Q6DA 4GUGA 2F61A 1HVQA 4MWAA 4G7EB 1SMDA 3S42A 2GGHA 1LOLA 3TW9A 3UG4A 2GDUA 3V1HA 5I2UA 3RHGA 4OBTA 5HR7A 4K7YA 4RDYA 3CASA 1U5JA 2NQLA 2YPIA 4FNTA 2D2HA 1V6YA 4YCOA 1W5PA 1W37A 3SR7A 1Q7MA 1ZP3A 1EZ2A 1RCXB 4YWIA 3W38A 1V02E 2R94A 2WLYA 1EBHA 3VIIA 1KFJA 1UZ4A 2DDXA 4HPGA 5K4XA 1FWFC 1RUSA 1W9UA 3CUGA 4WZHA 1OFEA 3SSJA 1GVFA 4U5KA 4JZ5A 4I9JA 3QLLA 4R85A 2E40A 1EF3A 2GGGA 3S5SA 1TWWA 1WDDA 3WYZA 3EWUA 3WLMA 3SGGA 3ANUA 3P8JA 5REQA 1OM0A 4BR1A