4R9OA

Crystal structure of putative aldo/keto reductase from salmonella enterica
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
MVQRVTIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALTLAPHLREKLQIVTKCGIATTARAENKLGHYITDRRHIILSAEQSLKNLATDYLDMLLIHRPDPLMDADDVAEAFQHLHQSGKVRHFGVSNFTPAQFTLLQSRLPFTLATNQVEISPVHQPLLLDGTLDQLQQLRIRPMAWSCLGGGRLFNDEAYQPLRQELSVIAQELNASSIEQVVYAWILRLPSQPLPIIGSGKIERVRAALEAETLSLTRQQWFRIRKAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Aldo/Keto Reductase from Salmonella enterica
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
molecule keywords Putative aldo/keto reductase
total genus 99
structure length 293
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4r9oA00
1ADSA 3CASA 4YVVA 3S3GA 3EB4A 4Q3MA 1PWLA 4L1XA 3FJNA 4OTKA 3COTA 3V0UA 3V0SA 2HV5A 4QXIA 1Q13A 3BV7A 4JQAA 2PZNA 4GABA 1K8CA 2IQ0A 4ASTA 4XZHA 4FA3A 3LN3A 3BCJA 4EXAA 4GA8A 1ZSXA 1X96A 1T40A 4H7CA 4JIRA 1MRQA 2AGTA 4LBRA 4XK2A 3G1RA 1LQAA 4YU1A 3CAQA 2IKJA 4H8NA 3N2TA 4YVPA 4JQ1A 4DBUA 1FRBA 3WCZA 3V0TA 4HBKA 3UZXA 2QXWA 1YNPA 2WZMA 3MB9A 4WDWA 3RX4A 4MHBA 3R58A 2IPFA 3BURA 3LENA 2NVDA 4QX4A 2A79A 1AH3A 2ACRA 2INEA 5LIUX 3LQGA 3ONBA 2PDGA 3R7MA 2HDJA 2IPJA 3LNMA 2PDUA 2IPWA 4WGHA 3UG8A 2IQDA 2FGBA 4LBSA 3WBYA 1EKOA 3LQLA 2ACSA 3F7JA 2ISFA 4JQ4A 2FVLA 1PZ0A 2BGSA 4ZFCA 1X97A 2DUZA 4GACA 4HMNA 3UZWA 1QWKA 1IHIA 2BGQA 4L1WA 4XZNX 4WDUA 4GIEA 3T42A 5M2FX 5LIYX 2PDIA 3O0KA 1YE6A 3NTYA 5KETA 2PDWA 3UFYA 2P5NA 4LAZA 3R43A 1S1RA 2ACUA 2PDPA 4XZMX 4IJRA 1T41A 2IS7A 1GVEA 5LIKX 2PFHA 4GQGA 4RPQA 3O3RA 4PUUA 3CAVA 2PDLA 4XO6A 3LZ3A 3CV6A 4JQ2A 3GUGA 5LIWX 3D3FA 3QKZA 3WG6A 5AZ0A 3LEPA 4XZLX 1Z8AA 2PDQA 1AZ2A 3KRBA 1Q5MA 1XGDA 3V35A 4WRHA 3N6QA 1C9WA 3CV7A 1S2AA 1VP5A 4I5XA 1MZRA 4PR4A 4IJCA 4F40A 4Q7BA 5HA7A 2PDKA 4LB3A 1PYFA 2HE5A 2WZTA 4FALA 4YS1A 1LWIA 2R9RA 4LB4A 5C7HA 3V36A 2IKIA 1QRQA 4JTQA 1AH0A 3DN5A 3RX3A 1Z89A 2NVCA 4YVXA 1S1PA 1MI3A 5HNUA 1EXBA 1YE4A 2PDMA 3GHRA 4JTAA 2PDYA 3EB3A 3GHSA 3GHTA 3H4GA 3ERPA 1HQTA 3UZYA 3LUTA 3G5EA 3DOPA 4XVDA 2I17A 3UGRA 3CMFA 3VXGA 4XAPA 1ZQ5A 3UYIA 4WDTA 2PDFA 1X98A 1UR3M 2I16A 2DV0A 4QBXA 2PDHA 3R94A 2INZA 1ZUAX 2IPGA 5LIXX 3Q65A 1XJBA 3H7RA 4GQ0A 1JEZA 4DBWA 4ICCX 1XF0A 5DANA 2PDBA 2ACQA 4NKCA 1A80A 3GHUA 4G5DA 2BP1A 4QR6A 3MC5A 3EAUA 4DZ5A 1YNQA 4JIIX 4JTCA 2PEVA 2VDGA 2ALRA 2PDCA 1PZ1A 1HW6A 2HEJA 4JTDA 5JH1A 1PWMA 4PRTA 2FZBA 3R6IA 3RX2A 1Z3NA 2C91A 4XVEA 3H7UA 4XO7A 2PD5A 1EL3A 2PF8A 1J96A 3B3DA 1SM9A 2FZDA 2FZ8A 2IKHA 1EF3A 1ZGDA 3BUVA 2IKGA 2HE8A 2PDXA 2R24A 3U2CA 2F2KA 3LZ5A 1OG6A 3C3UA 5AZ1A 3R8HA 2F38A 1S2CA 1AFSA 4FZIA 3ONCA 4JTRA 4PUWA 2PDJA 3Q67A 2PDNA 4XZIA 3P2VA 1RY8A 4LAUA 1RALA 4JQ3A 2CLPA 1IEIA 4DBSA 3M4HA 3M0IA 4PRRA 1VBJA 3WBWA 2HVNA 1R38A 3UZZA 1AZ1A 4AUBA 4EXBA 3R8GA 2PD9A 2J8TA 5JH2A 1AH4A 1M9HA 3WBXA 1RY0A 3UWEA 4IGSA 1US0A 2DUXA 3LD5A 5HNTA 4GCAA 4FAMA 4JIHA 4WEVX 3FX4A 4R9OA 3M64A 2HVOA 4PMJA 3UP8A 3LBOA 1Z9AA 2FZ9A 4WDXA
chains in the Genus database with same CATH superfamily
3SCTA 4BQ5A 2ZZ3A 3NL6A 4MDOA 3WJSA 5A2CA 3LSBA 1KWGA 4M51A 4AMCA 2PLJA 1A5AA 3QW3A 4DO7A 4EK7A 1VFTA 4HPNA 2ZCGA 1P7TB 1V08A 3M5VA 1FXPA 1WXZA 2GDQA 4REQA 3LN3A 3BCJA 4MOZA 1AQHA 3UVAA 3GD6A 4JFTA 3A5FA 4OJYA 1CGUA 2R8WA 3N34A 3UCDA 2YCJA 2VZVA 3BQ6A 1U83A 4C7FA 1LQAA 4IT1A 3TR9A 1A47A 1UMLA 2NV2A 3KHJA 3PZGA 5EMYA 3KHDA 4LRTA 1M7JA 3VZZA 4DX3A 2OWCA 3E3HA 5M1TA 3V0TA 5AECA 5CBJA 1PDZA 1HJVA 2PGFA 6REQB 5CLWA 3L2IA 1TJPA 2G41A 2QJHA 4Y6GA 2FKPA 2VZOA 1IV8A 2WAGA 3WBEA 4PH6A 1UP3A 4W7UA 4QLJA 1FHDA 1LRQA 2EPLX 3KBVA 2DZWA 2J24A 1M7PA 3AHXA 4MB5A 4OOZA 2IPWA 3MU7A 2C79A 4RNJA 2FGBA 2PZ0A 2R1NA 5B7YA 2VR5A 2PB1A 1S5WA 2ZXBA 2NWRA 3DX5A 1B2YA 3WYZA 2F8QA 3VIGA 1PZ0A 4PUKA 1TQXA 1RUSA 4GACA 1IXNA 5JQ9A 2PTYA 5G1TA 3LK6A 3MANA 1KFBA 5F1UA 4H6KA 1I6NA 4AWSA 4MWAB 1OFBA 3W29A 1XBZA 1GZJA 1V0MA 4ZQOA 1D2KA 3B03A 1E9LA 2I7GA 3NQGA 5EU9A 4H9ZA 1H7OA 4OVXA 3GDMA 3KTXA 5JBEA 4IGNA 1C90A 4HSHA 4F2TA 1SUXA 2VNCA 3LHVA 4FK9A 1EJ7L 1MFUA 4ZODA 3WQPA 2E8YA 4JX6A 1OADA 2Q3OA 3MUXA 4RPQA 3NDZA 3PZ9A 4IIDA 5CPOA 1R9XA 3W07A 4AIOA 3QKZA 2LLEA 3HIJA 2DSZA 4J4KA 4M7TA 1I60A 1WQ5A 4N0RA 3QV9A 1QI5A 3WZ0E 1W3IA 3H54A 3WEZA 1SO5A 3U0HA 1JPHA 2DGAA 4GGBA 4DXKA 3QY7A 5BROA 3LCLA 4NI3A 3SURA 5GNXA 3OIXA 3TA9A 5GQBA 5DMNA 3OZYA 3GXMA 2HE5A 1V6WA 3CU2A 3H2CA 2NT1A 2RAGA 5I78A 1ONXA 4DM2A 2E09A 1WZKA 2J75A 2BDQA 1FWEC 1G0CA 3WLOA 4JTQA 3LB0A 2YPIA 4DYEA 4C6FA 2WYSA 1TG7A 3VE9A 3RX3A 2ZUNA 4NJJA 2BVWA 1MI3A 1R6WA 1FA2A 1ZB5A 4QSHA 4IPPA 3AHYA 3DHUA 1OX6A 4BWLC 3MJMA 1A3HA 4B91A 5HMSA 3NSNA 3EB3A 2ZXAA 1YW1A 1LQ2A 3EDFA 2VOTA 3NPXA 4JYFA 5J5DA 3NZRA 4YN5A 3EEZA 1HKIA 4MKNA 3H26A 1P1MA 1TPEA 1KTBA 5F2LA 1JJKA 3CPRA 1MQPA 1ZQ5A 2PGRA 3W1NA 4HK7A 2MUCA 2DH3A 3DECA 4CD4A 1OF8A 2HRWA 4W93A 1EEXA 5RUBA 3NQAA 3DFOA 1X6NA 3E2RA 1W3KA 3N1AA 4OT7A 4KFPA 3JZEA 4WSKA 4HPGA 2YZ5A 4S1FA 4BA0A 1OFQA 2FTPA 3PZTA 3AWOA 1R3WA 2PDBA 1YDNA 1K7FA 1UKTA 1W31A 3BGAA 3M5YA 3G1DA 4H2CA 4JS3A 3V5CA 3KVMA 2XVKA 3SGGA 4EWJA 4JN8A 4AEOA 5FESA 4HA0A 2O4QA 2YL5A 1JQXA 7CGTA 3H70A 2G3NA 4B3LA 3TOYA 4KCVA 1NARA 2VO5A 3BH4A 4URIA 4S23A 1AD1A 3U7VA 1EL3A 2OXNA 4LYPA 1TVNA 4X2PA 5FEZA 4UCGA 4NG3A 2OWWA 3TTEA 3KL0A 1C7SA 3KP0A 2F2KA 2GSHA 1MUWA 1EDTA 5MF5A 2F38A 3APTA 4J1OA 1QHOA 2WWCA 4DBSA 4O15A 1WYIA 2HISA 4AD0A 3N18A 5BXTA 4GUGA 4QIUA 3IJLA 5C5YA 3CH0A 1RY0A 1DWFM 3TROA 4JTJA 4BY3A 2XH2A 1Y5XA 3PY2A 5J5RA 1Z69A 4M24A 1YKWA 1XGEA 1VFHA 4KEVA 2QLYA 3WNKA 7PTDA 1ADSA 3WD0A 1GZ1A 5D2VA 3MJYA 1W1B1 1VR6A 4WGXA 4H6QA 1XIEA 3VCNA 4AF0A 1ZBWA 1FCUA 3M41A 4PMNA 3TK7A 2D24A 1Q6FA 4NJKA 4DN1A 1K9TA 3FEMA 3MMUA 4C6IA 4F9JA 3DKJA 2G3IA 4XSMA 2J7DA 3A3XA 4DWSD 4YYFA 3BLEA 4OWGA 2J4GA 4RV8A 4IQLA 4IMEA 2J7FA 3POCA 5A6BD 4GYPC 3WUEA 5BNKA 4TIMA 5FJRA 3F4VA 1OINA 3VGEA 3UXIA 3WSUA 3ITTA 4GJJA 1RH9A 4NY2A 4IZGA 1NTHA 3NUKA 4E2BA 2VGFA 2XYLA 2GUUA 2BB0A 4YVPA 1IWBA 3SM0A 1E6NA 3B05A 1GOXA 1O4UA 3FAXA 4GI4A 4M6VA 3IIXA 4WD0A 1MEIA 1DOSA 2JKAA 3R58A 3RXZA 2PBGA 3S5NA 1UD3A 3AUJA 1GVFA 1JCTA 2VCBA 5FSEC 4C6CA 1HO4A 4LOCA 5CSSA 2VUYA 1H63A 2GGGA 3P8JA 1DWJM 2FJUB 2OEMA 4P7QA 3MYOA 4LYRA 2QF8A 7XIMA 3C0QA 1Y5VA 2OT0A 1E3XA 3L0NA 3AIWA 1PJ9A 5A95A 1DJIA 4LUTB 3HPZA 1XWYA 3SCWA 2JBMA 3W6MA 3VD7A 4KETA 3PPCA 1EX1A 1KW1A 2DUZA 3EX4A 2UY3A 2EJ1A 4ONVA 1U5JA 2V38A 4EAMA 2E6DA 1GOKA 2C19A 5LHEA 1FHLA 3NGJA 2REQB 4I9AA 1Z6KA 4A2RA 2J88A 1WKEA 1K03A 3IAQA 1OWQA 4A29A 1SPQA 2GUYA 1IE7C 4GIEA 1JRBA 3EX6A 5AHIA 3N15A 1OK4A 6REQA 3GNPA 2BHYA 3B04A 2CITA 3S2CA 2WW5A 1BKHA 3OBAA 3RU6A 2X05A 5D8ZA 3SIZA 4LANA 1TA3A 3PB2A 3R43A 4N42A 3WLJA 4IP5A 1HJXA 4FX6M 1VGAA 2QJGA 2WCSA 2CCRA 1OF6A 2J8GA 2WNQA 1BTMA 4MB4A 4G1KA 3RRXA 4J3VA 1W5OA 1EP3A 2C3ZA 3AS0A 4GO8A 4AHOA 2XN0A 3W7JA 3VOCA 1K02A 1CX9A 2A21A 2R1MA 3WLKX 1RXOB 4QEHA 2XH7A 3DCPA 3LV6A 5FJOA 2D0FA 2WVUA 3B97A 1EBHA 4Q8MA 1AD4A 4TX8A 3M7WA 2Z4GA 3CV7A 2QJJA 1F74A 5F4WA 1IEXA 3RHGA 4H8HA 4IJCA 3QMTA 4H6EA 1QNRA 2V3GA 2WHJA 2ZBTA 1TJ0A 3MSYA 4H41A 4QRNA 5CJ5A 3OVQA 3HFTA 2CLKA 4C1NA 2F6UA 1EWDA 1DPMA 1KV8A 3G1YA 4W8BA 2Y89A 3G6LA 1KBKA 3VGBA 3ARYA 2XN2A 4DNMA 3HURA 3FYPA 1V51A 5L9FA 3V3WA 1HVXA 3BZGA 2PDYA 3ERPA 4HSOA 4JDYA 2Y8KA 4P7OA 1TPDA 2Q3RA 4FLSA 4CU6A 1MXDA 3UGRA 4XAPA 3QQ1A 2C13A 1Q65A 3PJUA 2A7RA 2ZZ5A 2RDWA 4M3PA 1EGVA 2ZX7A 1UR3M 4GYFA 3FNDA 3KE0A 3P61A 4MMWA 4YTQA 3RCNA 1LTDA 3EDDA 5C9UA 4FXSA 2WMHA 4FIRA 4JKMA 3AJXA 2C0AA 5K2ZA 4O1BA 3HM7A 2OPJA 4HVXA 5KZEA 5MKGB 2OX4A 1S5VA 1TJ2A 3BJTA 4IQJA 2DSWA 3B4YA 3BSHA 3W1LA 1JFXA 3CQ0A 4XTIA 4IUOA 3SUTA 4C5ZA 1X6LA 3P60A 1QUMA 4GCXA 1KGUA 1UKSA 1YPXA 4DF2A 2J6VA 4WXYA 2DIKA 3QN3A 4JHOA 3VOJA 5HWJA 3OHIA 2WSKA 4EVZA 4NZFA 4QGCA 2PDCA 1IZCA 4CNNA 3EMQA 1Z48A 1LORA 1W5NA 2CLOA 4IHCA 1PZ1A 1R46A 4FXRA 3WL0A 4DO6A 1NM9A 3QY6A 2OR2A 1VHCA 1W3NA 3R11A 3B8IA 1SR0A 3T05A 2X2YA 3WDJA 3D47A 2PD5A 2CETA 1GTHA 2VOMA 3M5XA 3FEQA 4FNUA 4Q8UA 4MJ2A 2OOGA 1XD1A 4JHZA 3SY5A 4FP1A 3VCRA 4RLIA 4AG0A 3TU9A 3USZA 5DQPA 5EYWA 3WH6A 1AFSA 2YXOA 3MHGA 6XIMA 4GIRA 4BF7A 4LYKA 2CLPA 3AS3A 4HA1A 3M4HA 1HL2A 2XUCA 4PTNA 1OYAA 3WBWA 1UH3A 3EOUA 1W1PA 4E6MA 3EYPA 2F84A 2JK2A 2X1TA 5EPDA 3O1NA 4PTVA 4P8UA 1ENUA 5E5CA 1GVOA 2VKZG 3KL5A 1AW2A 2IQTA 4GVGA 4CKQA 1E0VA 2Z25A 3AYRA 3L4UA 4NI8A 3M64A 1BSLA 4RE0A 1PSCA 2HVOA 4PMJA 3ITLA 1GCYA 3IAPA 3GXIA 1Z9AA 2SFPA 1QRQA 3QHOA 1VYSX 2WVTA 2GGHA 3BL3A 2EQDA 4TR9A 2VZUA 3EXSA 3N6JA 2VD8A 4Q3MA 4FNQA 4QAIA 2X09A 4LY8A 5I23A 1MWOA 4I7UA 1HKJA 1F3EA 3M9YA 1GW1A 2VM8A 3FAWA 1TRIA 1VFLA 3VIJA 3E38A 1MFVA 3C3NA 3UXDA 4K2SA 1X96A 1N8WA 3VM5A 3KVLA 1QHZA 2DU2A 1V0LA 1MRQA 4TUFA 1BD0A 5HWNA 2YCLA 1OQFA 2FIQA 4C6PA 1ZPTA 5TIMA 3HPSA 3MBFA 2CESA 2G3JA 3N12A 2GJNA 4JOMA 4O54A 2V3DA 3OB8A 1YNPA 5CPTA 4J3TA 5I3GA 4OOUA 2P76A 1Z44A 3GVRA 3A4JA 3L2LA 4CCZA 5BWFA 5K9DA 3GH5A 3L4TA 2C16A 1F05A 3TTYA 4BS0A 4Z2KA 2INEA 3TQ0A 1W37A 3H2EA 4R85A 3GWQA 5LIUX 3STEA 1JULA 3GIYA 3VD3A 4WGHA 1IT8A 4A8NA 3F2BA 3ITOA 3H4WA 3OQEA 3HPFA 1BTCA 1ZJHA 1EKOA 4YLWA 1I2PA 3URQA 3OLEA 2DUAA 4NNAA 4FHAA 3VX1A 9XIAA 1X97A 1K6AA 3IACA 3ITGA 3NSMA 5D2XA 3VYLA 4RZ5A 4ZO8A 3UCQA 3CIVA 2E6AA 4RE3A 4XB3A 3E2VA 4Q4SA 4RJEA 1XRTA 3IANA 4WDUA 2PTDA 4KCUA 2ALDA 4KERA 4IH3A 1BHGA 3GFYA 3QV7A 3KZSA 2QCGA 1G6CA 1XGZA 3OW1A 4ZB2A 1RCQA 1DTNA 2Z6IA 3SRDA 3VKDA 3S5OA 3CUXA 2WZIA 4S3JA 2GPTA 1S1RA 2PDPA 2ZUUA 4OECA 3KBWA 1T41A 2P88A 2ZUVA 4Q4PA 1LBLA 4ICMA 3QW4B 3LXCA 2YKKA 3AFBA 3CHVA 1DJXA 1XV8A 3PUOA 3F5JA 4PMVA 1GVSA 3NZ1A 5HJLA 1O94A 4JTTA 4PCFA 5FJTA 4PMDA 3IEBA 4R7JA 4IIHA 1VRXA 3M0YA 2XJ7A 5CPMA 1EC9A 4PMUA 4OHQA 2HXUA 2QVHA 1UKOA 1I2NA 3M6DA 3C52A 3V1HA 4FLQA 1XIFA 5HJYA 1Q7QA 3W1TA 1WDSA 4Y9OA 1GJWA 8TIMA 1QWGA 5F4XA 3TYEA 1LWIA 4HMEA 1TA3B 4GXPA 4UUIA 5C7HA 3VNLA 3KCLA 3M7SA 4E8CA 1U1JA 3THQA 3AI0A 3WNOA 4AMAA 3FKRA 3VNIA 1F8MA 4FB7A 3WLIA 4KS0A 3RIKA 4GI6A 4Z17A 1SGJA 4H19A 2A85A 2V3EA 2QUTA 1A4LA 3C2FA 1QU4A 1ZTVA 4GIYA 3PF3A 2C6QA 1V0NA 1FWJC 1KBLA 1P48A 4JTFA 3O9NA 4NJHA 5EMKA 2PDFA 3NEHA 1TPUA 3HV8A 1POKA 5DCBA 3BLLA 1L6YA 1GKRA 1H1ZA 2ISVA 3OGSA 5C8BB 5REQB 4DLFA 1I4NA 3HG2A 1JNEA 3L5MA 4Q8OA 1A0CA 1K4GA 2DQWA 1WPCA 1XLDA 4MAZA 1C92A 1GTEA 4L4OA 3PWIA 2NZLA 1J0HA 3SI9A 1GVQA 3W71A 3MI3A 2NX9A 4O13A 2ZA3A 2PU0A 3BG9A 2G5WA 3I6RA 1PZ3A 4CQ8A 4LAMA 1Z42A 2YBUA 3QGAC 4K38A 3OODA 2PC8A 3WQ5A 4A8LA 3B0PA 1TTIA 1FHVA 4P61A 1OIMA 3RX2A 3VGGA 4XTDA 3EX2A 4LYQA 5CZ0A 1RQHA 4XAYA 3CBWA 4LC6A 1DHPA 3W23A 5DX7A 2V81A 2EG8A 1UG6A 5MKGA 1IR1A 2QAPA 3VC6A 4AZ7A 3OVGA 2BXVA 2XU2A 1EC7A 1NY1A 4I5UA 1VBHA 4YHEA 2VDHA 1E6QM 1QPQA 3JR2A 2Y5JA 2ZQ0A 4UFMA 4B5VA 1TX2A 1ECEA 4WKHA 3KDNA 4HZMA 2F6KA 3JS3A 3AS2A 3DFHA 3HGJA 4CLMA 1WKDA 2NXHA 4O11A 1XP3A 2ZKMX 3NL3A 1NFGA 2GSJA 3E0WA 3OHMB 1O7AA 1V7AA 4HCLA 2QNEA 3GIPA 4LEQA 1WOAA 2YXGA 4GWEA 4IICA 2P10A 3T08A 3LTSA 2DSUA 1C3FA 3GKFA 3ZJ6A 4DBEA 2DJXA 3LGDA 1UR9A 2A6NA 3FJNA 4CCEA 3IIOA 3GNRA 2V3FA 5G2HA 3M43A 1OBAA 3WDPP 3DG3A 2QW5A 5D02A 3WLSA 5BMWA 1LQ0A 3DG7A 5K4XA 1YTDA 4W86A 3SEPA 4Y7EA 3GW0A 5FJIA 4AW7A 3W7EA 4B4FA 2Z00A 3ORWA 1JZ3A 3KDOA 1T40A 4LBRA 5J8LA 1FY6A 4FR6A 4BI6A 2QPUA 3W88A 3W53A 3V1PA 3PZMA 2PAJA 5BYWA 5CBBA 2E68A 1WKFA 1UASA 5A3HA 2ZICA 4O19A 3EWZA 2YFNA 2PMQA 1G7VA 1T5AA 3BLOA 4G9PA 4RXGA 3GXDA 1B0IA 4B5XA 3W4RA 4M6PA 2GK1A 2OQYA 1F9CA 4KEUA 1FDYA 1KRAC 3L7RA 1QPNA 4A21A 4NQ1A 1W56A 4LV4A 3AOFA 2DZUA 3L9CA 3RJXA 3S5YA 2NQ5A 4JDBA 2UZ9A 3SUSA 4FOJA 3NXLA 4FOKA 5AKQA 4ACYA 3VUPA 1GUVA 2EF9A 4RNIA 3W1AA 1UIPA 2H9AB 3IJ6A 1ODZA 3AMLA 2XIOA 1J79A 3LGGA 1ECQA 4DUOA 2WBGA 3IUHA 4FSAA 3K1GA 4ZXOA 5I06A 4MJZA 4I9JA 1EA0A 5AFDA 3MSRA 2W27A 5BRBA 2DVUA 3T2OA 3T42A 2EHHA 3CHDA 4Z42C 2QF7A 2H8XA 2Z2AA 5D30A 5GNYA 2HK1A 2A7NA 1OJXA 3ALFA 5LNUA 5E0CA 3W83A 2Y88A 3LU2A 4ZE4A 3EOEA 4J3WA 5U7SA 1M53A 2J25A 2HQAA 3RCYA 3LHWA 4JQ2A 4MWAE 4MLJA 4O1DA 1AQFA 3H2AA 3GUGA 2BVYA 3GDRA 3QH2A 4X63A 4DWSB 4BQ3A 3W72A 3GLCA 3P0WA 3GZAA 1WBJA 3FKKA 5I7GA 1QPRA 3MYPA 5DLCA 1Q8AA 3EOSA 3T4WA 2FB3A 2OZ0A 3RFAA 1RV8A 3RILA 4AWEA 5BCAA 3SUVA 3CTLA 4LT9A 5D32A 3UY8A 2Y7DA 1OHLA 3BARA 2QAFA 3MDUA 2PRMA 3V5OA 1UD8A 1K9DA 3AIBA 1UWUA 1P0NA 3L4ZA 5HA7A 3MP4A 4PULA 4LB3A 4IX0A 4UNLA 3GTNA 3B0XA 3C86A 4GZEA 3MY9A 3UWYA 3VIPA 3UBPC 3BAXA 2YA1A 5AN7A 4A3YA 3S2JA 1TYGA 3U7BA 2J7GA 1EJUC 1VCVA 4IL2A 4D6EA 1RQBA 4ORMA 3MS8A 1EXBA 1NWUA 1GT8A 3FGCA 5FSDC 1L6FA 3W76A 1RA5A 5K4ZA 3GHTA 3LHZA 1CLXA 4LUIA 2DZTA 2PODA 1L8PA 3G5EA 4EX4A 1PKNA 4D9PA 3C0JA 4Q33A 2AL1A 2E4TA 3E0IA 4HNLA 3CZGA 1BYCA 3UYIA 4FXFA 1UH2A 5EBAA 1W9UA 1HJQA 1OGGA 1P0DA 4WKFA 4ML9A 2XWEA 4PA8A 3TC7A 3ARZA 4YL2A 2Z2UA 3FIGA 5E9XA 1W9XA 1ZUAX 5DF0A 1RCOB 1OFAA 1YLVA 4DELA 3MI2A 3TXZA 4R9XA 4MG4A 1TPC1 1P6WA 3AU6A 3EA2A 3OVPA 1KM3A 2AQWA 3TYDA 3ARRA 1KCLA 4AX6A 2FDMA 4HK6A 1VENA 3GKAA 5I2UA 2J7CA 4R33A 1JCJA 1BVWA 2QUMA 1ZU8A 5XIMA 5AYXA 1K8YA 1FWTA 2EO7A 2W67A 3HQNA 4Q22A 3PTDA 4YTTA 5JUVA 3SCVA 1TV4A 3R6IA 2F7FA 4JXCA 3B4UA 1JD7A 1N82A 4MAVA 3RK8A 3HZ3A 3QOKA 4E5TA 2ZZ7A 3H7UA 4R7WA 3MQTA 1J0JA 1HP5A 6TIMA 1XSIA 3PBUA 1H7PA 1XYMA 4PZVA 3SUUA 1JDCA 1EF3A 2I5QA 3A22A 3S83A 1E6ZA 1UWQA 3DUGA 1SZFA 3W7QA 1FWBC 1WV2A 2PUZA 3N2OA 4V15A 2ZX9A 2BVTA 3A3HA 4PUWA 1QOXA 1K8XA 3P2VA 2R1KA 1G67A 3NWRA 3O6DA 5D2YA 4CQAA 1AMKA 3MW7A 3ZIZA 5LNWA 3CL6A 1BYDA 1SVDA 3SSZA 4QISA 4ZOCA 3UERA 1XIJA 4GJIA 4P7LA 3UPMA 1M7XA 3VILA 2Y0FA 4UNKA 1LCOA 2O7SA 2ZXDA 3MP5A 2DUXA 5G2IA 4NL1A 1IWAA 3NFUA 3W87A 4QITA 3H23A 3W9ZA 1E1CA 1BFNA 4KCTA 3W37A 2E40A 4LF1A 1UW9A 1VIZA 4JAWA 1S3TC 2QQ6A 1KKOA 1RK5A 2AKMA 1A5OC 1PUDA 2ZUSA 3GG1A 1FX6A 2XN1A 2Z29A 4Q8PA 2ICSA 2VD9A 3WF0A 3NZPA 3ZT6A 5FI8A 3KOYA 1XDLA 3VMOA 3WMSA 1BG9A 3BAJA 3K4AA 1QOQA 3Q4DA 6TAAA 2PWGA 1ISVA 3RMEA 3VD5A 2WWDA 1VCFA 2IQ0A 4R3UA 4XZHA 1QPOA 1ZSXA 1XLCA 1EOKA 1IXOA 3GIQA 5CC7A 2ZX5A 3E9AA 3ZJ7A 4NNBA 3VDBA 3N3TA 3AMGA 3STGA 2HS8A 2DZAA 2QZRA 3W7OA 4GY0A 1I75A 3NZQA 1E1FA 4W8AA 1VEMA 3AJ7A 1RD6A 1KCXA 4IPLA 4NXKA 1X8CA 1OYCA 2CZDA 3CT7A 3QZ6A 1SZGA 1YNYA 3UETA 4C6BA 1V93A 2GVJA 1H7NA 5A6SA 2REQA 1VPYA 2TPSA 3DG6A 3QXBA 3W1MA 1ZP3A 4PMYA 1CENA 3S6DA 3O06A 4RV3A 3N19B 1KFJA 3TLQA 2MANA 2VC7A 3SR7A 4PUDA 3FYOA 3VFLA 1PX4A 2IQDA 3N17A 3MWCA 4UQ9A 2G37A 4R53A 2ACSA 3AICA 1Q63A 3OIHA 1A4MA 4MNLA 1LRNA 2ZX6A 3MSGA 3DXIA 4CNOA 3S1WA 4ZXLA 1OSEA 1VC4A 1B57A 1ZCCA 3IARA 1PBGA 5H8MA 2Y63A 4G6CA 4TV6A 4AFYA 3IVUA 3CUJA 4ERGA 3NQBA 3VKJA 4ILSA 2D2GA 1KTNA 4OBTA 3I7RA 3PBYA 1XM3A 5JBFA 4XQ6A 2CW6A 4LUSB 3TP4A 4KWWA 1A5BA 4M0XA 4LAZA 2O9PA 3WQGA 5CC6A 1G4TA 1FHUA 2FHBA 3LRMA 4Q8WA 4BI7A 1OC5A 1IEVA 1XBYA 2I9EA 3DI1A 4J3SA 2X7WA 3W75A 5LIKX 3NPVA 4RW5A 3K4DA 2PDLA 3MVIA 1W54A 3CEUA 4B5SA 3C2VA 4QDPA 3D3FA 4D8LA 3U2EA 2ON3A 3V5FA 2E6YA 1ZBVA 3O6YX 3V35A 3S9IA 1PYMA 3TH6A 4GINA 3MDWA 5G4EA 4S2CA 5C55A 1E6SM 1EQCA 1VP5A 3VIKA 2ZRWA 4LJ3A 3TFXA 2YW4A 1TWIA 1H51A 3GK0A 5BRPA 3N3MA 1NWSA 3TN5A 2QCNA 5FF4A 3AIRA 1XLBA 3DFYA 3WNPA 1B5TA 3L4WA 5A69A 1DIEA 1M01A 1I0DA 1TWSA 2J77A 1UD2A 4WY0B 3D3AA 2XPKA 2QGHA 1H41A 1XUUA 3V18A 2ZUWA 3LM3A 1DJHA 4ZTYA 5HNUA 5A94A 1Q6CA 2R91A 5FCZA 3GHRA 2ZUTA 2E9BA 2VVNA 1Z41A 2CU0A 4M82A 1PL9A 1HQTA 4O18A 3LNPA 3FSUA 3ITVA 1L6WA 3BAKA 3L68A 4H01A 1BQCA 2ESCA 3AXXA 1RJRA 2PRLA 4FO4A 1ITQA 2VGBA 4HOZA 2DT3A 4GLEA 4R5EA 1I2QA 5JU6A 1OX5A 3HPAA 1X98A 1I1XA 2X1UA 3FS2A 1TV2A 1DXFA 2FLIA 1FWRA 3TAOA 3ES8A 3VIFA 1DIKA 3F5KA 3WUGA 2XISA 3F2CA 1XH0A 2ZA2A 1OFEA 3UU0A 4JPGA 2G97A 2V82A 1EDQA 1V77A 2A3CA 4NAEA 3URNA 1XLAA 2QULA 4DHGA 1VLIA 4AY1A 1X1ZA 1FWNA 2R82A 2GUBA 2BXZA 1K1DA 3XIMA 1L8NA 1VYPX 2QDEA 3CMGA 2GFTA 4O8AA 4JIIX 3HJZA 2E5BA 2PEVA 1GWJA 8XIAA 2QCMA 4JTIA 2Z1BA 1CEOA 1G4PA 2JIWA 4HPHA 2HEJA 1Q6DA 4AY8A 2B4GA 3L0KA 4NYUA 3OU8A 5AC7A 3N25A 1Q6GA 4DWDA 3QC0A 4KKXA 2ZOXA 3FN9A 1LL4A 2BOFX 3S1UA 1F6PA 1TMLA 1DWAM 2IUZA 1LYXA 4ZE5A 1UWAA 3UJRA 4GBUA 1Q6LA 1RALA 4ATDA 3ZS4A 3QR3A 2UV8G 3PFRA 1VBJA 3AIUA 3O63A 1GEHA 3UZZA 4HU8A 3EWBX 1BF6A 1YBQA 1IWPA 4Q4OA 5F7UA 2V5JA 3TIMA 1A49A 1XSKA 2WNZA 5GJNA 5L6UA 3U57A 1OB0A 1US3A 1O95A 3G8EA 3WQFA 4WOQA 2FHFA 2D0GA 2XH4A 3KCJA 4WJXA 4M56A 1A5SA 2FZ9A 3W7GA 5ECVA 2OYKA 4XX6A 3W1XA 4ZB0A 3JVAA 1GZGA 1QR7A 1ZCOA 3R0UA 1J9YA 1G1YA 3ABOA 2KAUC 5E09A 3QYQA 5LZLA 4B5UA 5LA2A 2HV5A 1WDDA 4Y2WA 4XKMA 3PJXA 3KXQA 5I3IA 1CGYA 4D8ZA 2V5LA 4GRSA 3VA8A 1MUCA 4NZ1A 3RLVA 1FWCC 2GQAA 1V79A 4C60A 2VZTA 2HZGA 1JUEA 2XM1A 1WDQA 4JL1A 1D7KA 3S9ZA 3O0FA 3RGTA 2XINA 5BXPA 3MMTA 4F0HA 2VFGA 2CC0A 1PX3A 3OLDA 4KW2A 5EFDA 7REQB 4HZ8A 1O60A 3R79A 3B0VC 4BEQA 4AZHA 5DEZA 4GE8A 4E38A 3P74A 5IOBA 1E4NA 2WZMA 3ZR6A 1UR0A 3BICA 1UH4A 1UD6A 4A3RA 3FDGA 3WLRA 4CD8A 4AYSA 1FP9A 2CKSA 4ECLA 1GKQA 1MSSA 2PCEA 3BURA 4LVDA 3WQCA 2IW0A 4MNKA 2Y5EA 1JPMA 5I3JA 2OKOA 3ABSA 2W63A 4UNIA 3RU8X 5I24A 3SFKA 5GJPA 4F79A 3JW7A 2X8RA 3CNYA 5HUPA 1TWDA 1H62A 1VJZA 1TE6A 5AHLA 3B8TA 1KO0A 3P0XA 1XLEA 3SN1A 1JYWA 3OP2A 1TZ7A 3MP3A 5A6MA 2H9AA 1JI1A 4B3ZA 2DSVA 3PR2A 3ANVA 3T1GA 4OUEA 1W3LA 5AC5A 4WIWA 2BY2A 4NF7A 3VCCA 3N14A 4XD6A 1SO4A 2OLSA 5E93A 4AD2A 1WOBA 4G56A 1Q6RA 1A5LC 1HGYA 3M0KA 2VEMA 1UP0A 3DENA 2PDWA 2VC6A 4YTSA 4HPXA 3TTOA 4HMCA 2E1DA 2Y7GA 1UYQA 4UMCA 1GOMA 2FH8A 2ACUA 4ZZ9A 2B81A 2J9XA 4EPEC 2Z2BA 3PPHA 4QEEA 3CAVA 4PUNA 2P3ZA 4M81A 1OCJA 4UQCA 4XSLA 1TV3A 1UZHA 1SSGA 4XZ9A 3GTFA 1EPVA 4XZLX 2PDQA 1BQGA 2DT1A 1M1BA 2NUXA 3T78A 4LNYA 3UZ5A 1XGDA 3MCNA 4FS9A 3ARXA 2G4JA 4QDMA 1MEHA 2PS2A 5IXEA 3U9IA 4AD1A 4DF0A 1UZ1A 4UFKA 1XIHA 3M0HA 2VEKA 5G5IA 3ZQ9A 4H9TA 3PBMA 3VAVA 2E28A 1RR2A 3A12A 1TWZA 2FMOA 5HMFA 1U22A 1JD9A 4DZAA 3M47A 2GJXB 1JDEA 3E0FA 3W85A 3OZOA 1XDJA 3P81A 4CNPA 3QF0A 1EJWC 4AC1X 1WA3A 5FF3A 4AAJA 4AD4A 2QYGA 3BG5A 3VIOA 1CWYA 1KR0A 1XX1A 5HMEA 1BRLA 1TV7A 3TA6A 5I5RA 3VX0A 1WCGA 5IHSA 1I9CB 3LUTA 3CL8A 1WX0A 1RP8A 2WJZA 1RK6A 3W24A 3G18A 2AAMA 1ZHAA 1JQVA 1SO6A 4S3BA 4HCHA 3NQ8A 1RLCL 2INZA 5HAOA 3WQ8A 4LGXA 2W91A 2OEJA 3SW6A 3XINA 3W01A 3MO7A 4E8GA 2WHKA 1VBRA 1GOOA 2ZRXA 1XF0A 3CLWA 2I14A 2CIPA 4PGLA 1REQB 4G5DA 4Q7IA 3CWOX 3IK2A 4E3TA 1OD8A 4IPNB 2XHYA 3DGBA 3K46A 3LHYA 1NP0A 3GTXA 3T0AA 4HPJA 2ALRA 1TPVA 1JZ4A 1XXXA 2WNWA 4JTDA 3O16A 4OU1A 2J7BA 1LBFA 3BLPX 1TTPA 3N2CA 3FA5A 1MZHA 4UR8A 2OU4A 1PXGA 2O0TA 2C71A 3TJXA 1G4EA 1OC7A 2X40A 2J9YA 3BUVA 4G7FA 5DXXA 1R7AA 1UBPC 5DN1A 1NEYA 3B0UX 3QV6A 3PUEA 2D22A 5A1AA 3A9BA 3PANA 3ZR5A 1E0XA 4IPJA 2V69A 3QJAA 1HKMA 2NLYA 5ABTA 1RY8A 5EB8A 4LCSA 3R1ZA 2VRKA 3SO7A 2YDSA 1XISA 2GWGA 2FPTA 1W2VA 3BLDA 2YOCA 3HGOA 2HVNA 4C90A 4Q8TA 2PPGA 4ZL1A 1YMYA 1XLHA 7TAAA 4N9DA 1KXQA 3AISA 3OJGA 1PS9A 1PO9A 3FGCB 3U8GA 1NELA 1XYCA 3LD5A 2VP8A 4GFSA 3QKEA 2XWDA 1SMAA 3FA4A 3JUGA 5DT7A 3E0VA 3NCOA 1K7EA 1XIIA 1P0EA 3GG0A 4QBXA 4CD6A 1WXJA 4ZQMA 1R3QA 3C6CA 4O52A 3CPGA 4TQTA 3VE7A 3F4WA 1SFTA 1T8XA 4KEZA 2EPOA 4HU3A 5HNNA 2Q6ZA 5CPQA 3V0UA 1FCVA 3LRKA 4RUBA 4YWIA 3HQPA 1TTJA 1F6KA 5D05A 3KOZA 3P5YA 1PKYA 1V6VA 4HGXA 4LEFA 4JQAA 1OFPA 4X0NA 1MW0A 4FA3A 2V6AA 3EA3A 3WH8A 4GA8A 5BOFA 3BCFA 3SGUA 2WSRA 1DL3A 1S5MA 3QYSA 1W32A 4LALA 4PRWA 2Z1XA 1S2VA 4XKYB 5D37A 4H8UA 4QROA 2GQ8A 1HVQA 1XLJA 3ANYA 1K6WA 4FLOA 3N13A 4AZIA 2WVVB 5J04A 1D7FA 1DBTA 3H2MA 1WBHA 3W22A 1REQA 3W86A 1JDFA 5CC5A 3P6LA 1SQ7A 3CGTA 1RPXA 1E1CB 2P3EA 1TUFA 5HULA 4UZSA 3TAKA 2J9ZA 3UR2A 4XV0A 2A79A 4QFUA 3LV5A 1R9YA 2ACRA 4UB9A 1WZAA 3CZLA 4QQ3A 2WMJA 4LCRA 3QHMA 4KESA 5LKYA 2Q09A 2VMFA 2E25A 2CBUA 3MUY1 2JALA 4DJEC 1WXYA 1BEUA 3CV1A 4EPKA 4RE4A 1FH9A 3QLDA 4LF2A 4O10A 2Y7EA 4WX2A 1E0TA 2O7QA 4DO4A 3BOXA 3QVQA 4KRUA 4C6NA 3ITYA 1RBAA 3VNYA 2AGKA 4Q8VA 4PL2A 4L1WA 4CEUC 4UTWC 3RPDA 3THAA 2W9MA 3EOOA 1KD0A 3H24A 3A4WA 1ADDA 3E02A 4PBGA 3ARTA 5KEZA 1HGWA 3WLHA 3LSCA 3AQUA 2G50A 1XC4A 3MUZ1 2WBKA 3OEXA 1M3UA 4NVTA 2IS7A 4D6GA 3TC3A 3CM4A 1F4HA 5D03A 2W0UA 4EPDC 2VFHA 1LZOA 4NJIA 4OBSA 2HS6A 2WC7A 4TMCA 1R0MA 2P8CA 2JEPA 1NOFA 2VQUA 5EBUA 2DSKA 3ZXWA 3SJ3A 4PB5A 1EBGA 4H9MA 3UD6A 2RH9A 3UG3A 1D9EA 4GNVA 1J6OA 2X30A 3AXIA 4V1YA 2DY3A 2AQOA 1RLDA 1WO2A 1FBAA 2PDKA 2Z24A 1J0ZA 8RUCA 3VMPA 4BQ4A 2GLKA 1LG2A 3WF4A 4MTVA 4JCMA 1XKJA 2BFGA 4C6JA 4L65A 4AVFA 3KBJA 4QJ5B 4HNOA 3KM8A 4AZ6A 1DQXA 2PDMA 3DBNA 3T09A 4LUSA 3R0DA 4IMCA 3BWWA 4O0KA 1SJBA 5JMUA 3CUGA 3MMDA 2WXDM 1FTXA 3RLUA 1BGGA 2WK2A 4AWTA 3R8RA 4YIWA 3KTSA 4I7VA 2GGJA 4HD5A 5DBUA 2Y1HA 1Q4NX 1GNXA 5CJMA 2VURA 2V5DA 1RBOB 1QATA 3JRKA 4X9SA 3H7RA 1FFRA 3L5LA 1HX0A 3L66A 5DMLA 4DLMA 4BQ2A 2OZ3A 5BOEA 1JRCA 1FVPA 6ALDA 5CC3A 2XFWA 2Y4SA 4J3UA 4B5NA 1XS2A 1ITCA 4L9ZA 1JYNA 3WH9A 3TJIA 2BHZA 4JYDA 1S3HA 1NF7A 4YCOA 3WMBA 1VEPA 2FZBA 3MHUA 1DJWA 1OABA 2BY3A 1JDDA 3AHTA 4H7VA 3VZXA 2WKLA 2CZEA 1A5KC 1V6TA 4J3XA 3LG3A 1BWKA 3FHAA 1YTEA 2PF8A 2OFJA 1SM9A 2ONEA 2UWFA 1ZGDA 2ZX8A 5AHNA 2OODA 4MUZA 1UCWA 5T26A 4XD3A 3TNOA 1AJ0A 3LZ5A 1J18A 1DTUA 2OO0A 1NWTA 1S2CA 3GXPA 3SADA 2XZ7A 1NP2A 2CFFA 1E51A 3AO0A 4PMRA 1JUKA 3CQIA 3LPPA 1HUVA 5KITA 1P7TA 2FVMA 3F03K 1XSJA 4AUBA 2F61A 3AS1A 4LNCA 5JH2A 1M9HA 4O1CA 4L7ZA 4IGSA 4D6FA 3PG9A 2POZA 4DJDA 4ZA0A 4JKKA 3Q37A 4IFKB 2WMFA 2E5CA 2WM0A 4MJ4A 3ZFHA 1UBSA 4GO9A 3GNXA 3TN3A 3TMLA 3FY1A 3GW3A 1QI4A 1ZAJA 1T0OA 3BAWA 1XYZA 1M03A 3VUSA 5BMXA 2PWVA 4L1XA 3C4UA 1JGIA 3OZPA 2Y2WA 3C61A 3U6WA 5IRPA 2WMIB 1J0IA 2NX1A 2ZE3A 1EP1A 3NIYA 2QUVA 2JF6A 4N2YA 1ONRA 1UWRA 1GHRA 4JTSA 3KZPA 2A3AA 1QVBA 2XSBA 4UFLA 1EJSC 1F2JA 1QNOA 3IPWA 4NZ3A 3CC1A 3Q45A 7TIMA 4XK2A 4XUGA 2A3LA 3VC5A 4PODA 1DJGA 3PNZA 3MUCA 4WQ6A 1L6SA 1UR4A 4IISA 4TXEA 3M16A 1DXIA 2QV4A 3WCZA 1PAMA 3UY7A 2CXGA 3DAQA 4F0SA 3W1UA 3T9PA 2VUNA 5DRCA 4DJFA 4ROPA 1EHNA 3W7PA 4FX7A 3I68A 3F4DA 3E1F1 3LBCA 2E6FA 3CHCA 3KP1A 1LJYA 3ZLFA 3B06A 1QBBA 3NURA 1AVAA 3ONBA 3WL1A 1QO2A 2PGWA 4CNTA 5HATA 3UXLA 3W7HA 1D8WA 1VQTA 3W25A 6CGTA 3TYUA 2A2IA 3B9DA 1T96A 2XVNA 1IR2A 3VNKA 1HJWA 1YTKA 4US5A 3IJ7A 4INFA 3ARSA 5C0QA 2FVLA 4J35A 1KFKA 4CD7A 3W0KA 3E49A 1C8QA 3P5ZA 4YCPA 4OBRA 1J2WA 2VFDA 2VELA 2WZHA 4HJFA 1TUXA 4MY8A 4AWUA 2BGQA 3B8UA 4L9YA 1UP2A 3B9NA 1FUYA 5KZDA 3T40A 2CLEA 2ZADA 4IWWA 2C1HA 1PPIA 1BVNP 5FACA 4L6DA 4NYYA 1YPFA 1JAKA 3TLLA 3ATYA 3FHQA 2V9DA 1E5JA 2QJMA 2NQJA 4AF0B 3TNBA 2CLFA 3WKZA 4PSPA 2J13A 3KL3A 5TNVA 3W7RA 2C1GA 4UOJA 2D20A 5FD0A 5KINA 4GOAA 4XO6A 3CV6A 2IMRA 6ENLA 1GONA 2VEPA 3UA4A 1V3MA 2C18A 3MCMA 1B3VA 5T8GA 2C15A 5AZ0A 2G0WA 3WK3A 1ITUA 3SCQA 1O5RA 1Z8AA 3A9IA 3WEOA 3ZWTA 2ZZ4A 5G1YA 4A4AA 3POHA 1Q5MA 3FDKA 3VTRA 5DXYA 1B3OA 1C9WA 1TVLA 1Y0EA 4M8UA 5A6BA 3P80A 1IZKA 1KCZA 3PAOA 1PX8A 1XLIA 1R3YA 2EG6A 3FFSA 4YWSA 5CH9A 1FDJA 3FK4A 2WZTA 2ZRUA 5H6HA 3UCCA 2RGLA 2Z1VA 3QOMA 3HOJA 1QT1A 1EA9C 3V36A 3OQ8A 4XAFA 1FWHC 1CXEA 1QCWA 3EWCA 1AH0A 3RDKA 3P7YA 3LLFA 3I3BA 1VF8A 4G7EA 1CYGA 2RDXA 4OUIA 4ATWA 1VJIA 1ZAHA 3R89A 2WM1A 3GAYA 1EO7A 2DQXA 4BK9A 3KX6A 3F5LA 4EWND 3NEVA 1EPXA 4JTAA 4AZGA 3KBSA 4JD4A 3HBLA 2Z26A 1B4EA 2AAAA 1KM1A 2G4FA 3KTCA 3VO0A 4WSJA 4S39A 1W9DM 3KW3A 1GORA 4ZO9A 2R14A 4JY8A 1K7XA 3IGSA 4RZBA 2HK0A 2CBVA 3ZJKA 2RJHA 1R9ZA 3M0MA 4DUWA 3BAYA 5HPCA 3QPZA 3VXGA 4L64A 1P0KA 1F76A 2CZVA 4IOTA 1H1YA 3R4IA 2YDAA 2I5GA 4MUPA 4FF7A 1ISWA 4IG2A 3R94A 2XDFA 3K4WA 3RMJA 3UWWA 3HG4A 3RYSA 5FAJA 4ML4A 2WOQA 5LIXX 3PWAA 1XLLA 4M80A 1ZENA 3NR0A 4E3VA 4KIRA 4BR1A 4OV4A 1H3GA 4MB3A 1SW3A 3T44A 2WPBA 1AL8A 4IXXA 1DP0A 3DFTA 5ECUA 2OQHA 5LNVA 1BXCA 1KM2A 1TJRA 4CNSA 4QS5A 3BO9A 4IQEA 1E4MM 4Q4KA 4K37A 2VDIA 3VK5A 2VQTA 1VH7A 3DFSA 4US5D 3KOFA 2OCZA 3WNMA 4US6A 5CBIA 3PJTA 1ICPA 1R3VA 3N04A 1YPIA 3EKGA 1EJXC 3F4CA 1P43A 1S2WA 2Q02A 3BSMA 3KWXA 4C1LA 3KWSA 2XFRA 5AYBA 4DBDA 3CUFA 1DYSA 1OY0A 5CGQA 3GO2A 3F4NA 3W7IA 5AZ1A 1J8VA 2NXGA 1YHTA 1ZAIA 3B40A 3DYPA 1YIXA 3S42A 2BOGX 4RW3A 5EMLA 1PDYA 4XZIA 4NZCA 2BX7A 2CXEA 4U3AA 1HNYA 2NT0A 3R12A 3DFNA 4FI4A 1VFOA 3SN4A 3SQSA 2WB5A 4GUIA 1R38A 3WFZA 1Q6OA 2QMKA 4CVWA 1CB7B 2PD9A 3K8MA 5JIPA 4TTGA 3NL2A 2VFIA 4CN1A 3N6HA 4IL0A 3NOEA 4S38A 4DJEA 4MZ1A 4U31A 1RD5A 1LOQA 3PSWA 4U33A 3LCXA 2DZVA 5HQLA 1VIWA 1R30A 3IIZA 2CYGA 4W84A 1E4LA 3L12A 2X41A 2VEGA 2J27A 1BYAA 1TKKA 2G95A 3AIVA 5K9XA 4WK9A 1V03A 4FMVA 3OLIA 3S3GA 1AMYA 1HL8A 2PCQA 4QS6A 4RDZA 3WD3A 2Z0IA 1F73A 4HQVA 1U5VA 5G4HC 2ABBA 1QI0A 3S1VA 2AL2B 2RKXA 1TV8A 4R88A 3I4KA 1NWRA 4HN8A 1M65A 3IK4A 3KBMA 1DXEA 3TDFA 2PZNA 2OSWA 5G2WA 3CT2A 4N9CA 2GOUA 4H7CA 4U5KA 4IM4A 4HK5A 3CZEA 3TKFA 5CZTA 1HF6A 3V75A 2O55A 4ZSTA 3ID7A 1XIBA 2I1OA 5CZSA 4C65A 2AOSA 1TZZA 1PTGA 5I3DA 2Z7GA 2ATSA 1E3ZA 3A64A 3WK0A 2YIHA 3VNDA 2X0HA 2PP0A 2OTDA 2IPFA 2YDRA 3PG8A 5G4WA 1HJSA 4AXNA 1XLMA 4L4PA 2FZNA 2Y61A 3TQPA 1GW9A 3UWZA 3GAKA 1MO0A 3LQGA 4IP4A 3H12A 3TSBA 3WO8A 3W7KA 3NOYA 3SCUA 1XYLA 3BXWA 2DP3A 2OSXA 2B7NA 4WY0A 2QCCA 1UKPA 1GPFA 3WBYA 3S9YA 1VHNA 5CGTA 2PP3A 4NP7A 4AHQA 2HTMA 2ISFA 2PLMA 4AISA 4EF8A 3RO8A 2OGJA 3RPTA 3W7LA 1IYXA 1QNSA 3VIIA 3IRSA 3M0XA 4HMNA 3R2GA 5DFAA 4F0MA 2B31A 4DIAA 3THCA 4D6HA 1Q8JA 2VCCA 4NRRA 3VDCA 2VWSA 3GXTA 2XGIA 4NSBA 3WK2A 5AB3A 1K3UA 4FPSA 4L80A 3TQKA 3O0KA 1YE6A 1E43A 2UY5A 4X61A 1BGAA 2FDSA 5H1WA 1BXNA 3AXKA 4Y8EA 3PVFA 4FEZA 2YLLA 1AA1B 4HHMA 4XZMX 1SW0A 4IJRA 1UJQA 1GVEA 1VD6A 1XQKA 2PFHA 2Q71A 2VYOA 3PZVA 3O3RA 4JICA 4AEEA 5CLTA 5FF7A 2KX9A 4JBRA 2QKFA 1F3XA 3HQOA 4ZOBA 4QLKA 1KNWA 2GQ3A 3CEPA 4NZ4A 1NF0A 3P8IA 1JFHA 1KQYA 1QW7A 2WCAA 1I1WA 4D6JA 3RO6A 1EJTC 2WKGA 1SJCA 1OFRA 4KWUA 1CXLA 1JPKA 3L4XA 3UZJA 3UJSA 4S3DA 2FGLA 4PB4A 1FH8A 3EWXA 4UR9A 2ZC8A 2V5KA 3QR0A 4AU0A 4YS1A 3BCDA 4I8DA 2TYSA 3FV9A 3VDHA 2QPSA 3MCOA 3S4TA 3DN5A 4AY7A 2VENA 4IIBA 3WK1A 3KAOA 1SYTA 5D9PA 5GJMA 3CZ8A 3YPIA 1YE4A 5MHBA 5HXMA 3RR4A 2DDXA 3W1RA 4C91A 5ABFB 3SRHA 4GHRA 1VB9A 2EKGA 4UC5A 3CAWA 3WLPA 3WD2A 5ABEA 3GDLA 5LXXA 3LBMA 2AKZA 2E9LA 2OLHA 2INFA 2NWSA 3H4GA 1HTIA 4HU4A 1TPB1 3UZYA 1S2TA 2WC3A 3NXFA 2E8ZA 3QV8A 1R47A 1MVYA 1GVIA 3DOPA 1V3LA 1A50A 1ZBCA 4AQLA 2NVAA 1XPGA 3DH7A 3CMFA 2V30A 1BVZA 4DPPA 3LXBA 3APYA 4KGLA 2NUYA 3HFYA 3C8NA 3H2FA 1RBLA 4GI8A 4DM1A 5FEXA 1XD0A 1MQRA 4GQBA 1QK0A 3KFTA 1KWKA 1ZZMA 3G1AA 4GVFA 3NQVA 4HN4A 3UNDA 4LBUA 3VGHA 4B9ZA 2A7PA 3PTMA 4GVHA 5LHFA 2BP1A 1M04A 3MC5A 1G94A 1C91A 4DZ5A 1GVYA 3IGUA 4KH2A 4PMXA 1FCQA 4UTWA 3TWBA 2YDQA 3FW6A 3VM7A 3GR8A 4ZQCA 1KRCC 1C9DA 4Z1YA 4JTHA 4GMEA 1G9HA 2IXVA 3ANUA 4N02A 3TSDA 1R8LA 1DWIM 2R6OA 4HHLA 3N29A 2NLIA 3MUAA 2HE8A 4KWSA 5HANA 3U2CA 2L5HA 4W88A 1IIHA 3R8HA 4HT3A 4I9MA 3A5VA 4PMZA 1MNSA 4JTRA 3EKLA 3Q67A 5H2ZA 3OBEA 3IUIA 3DI0A 4B2DA 1YDOA 4ZSUA 1UJPA 4IIFA 4N6FA 4E4PA 5I09A 5JBDA 4X0VA 3IGHX 1W2PA 3GH4A 3WBXA 4C6EA 2ZE0A 3VGFA 3KCOA 3CXOA 3TYAA 1DQWA 3RN6A 4GCAA 1NDYA 4O12A 4JIHA 3O05A 4OV9A 4CU7A 4U2YA 4DQWA 1QASA 3RF9A 3EMCA 1PHQA 3LX9A 5TBOA 4UTIA 3G0UA 4NXSA 4W4QA 4WF7A 3G24A 3R5EA 5DRIA 3GFXA 3QHNA 4M5PA 4WDXA 4JX4A 1O5XA 4WLCA 1KC7A 4BJHA 1G4SA 3CASA 3EXTA 1RA0A 1J01A 1J5SA 1ISXA 4IFOA 4N4QA 4P7NA 3RM4A 1JYXA 3LGEA 1ME7A 2WJDA 4W8LA 3R25A 1UPMB 4PMQA 1J4EA 4W7VA 1U30A 1KGWA 3OO2A 4MVAA 3EPOA 3LI1A 1RHCA 2BASA 2D73A 3R10A 1ZL1A 5K7JA 4YTUA 1Z7AA 1X6UA 4G1NA 1JNDA 3RLHA 1DVJA 3PZNA 4EXAA 1JDAA 2YB1A 4Y8FA 2Y5SA 1EDGA 1SR9A 1J0KA 4AB4A 4GH3A 1U1HA 3G1RA 2AL2A 2ZYFA 4YU1A 4MJMA 3G3MA 4DJDD 1B3XA 1PIIA 3TW9A 3QR1A 4K6AA 4JQ1A 4NX5A 1RCXB 2GJPA 1XRVA 3IJ9A 5C54A 1IZJA 1E9ZB 5HR7A 3WBAA 3RNDA 1F6YA 4KWOA 3NL5A 2OJPA 5FJUA 2POTA 1WZLA 4UTKA 3I7SA 1CB2A 4B92A 2CLLA 1NOWA 4LV9A 2ZIDA 3UR7A 3UEQA 2VGIA 1CNVA 3CHEA 5LGZA 4W7WA 1G01A 4HA4A 5HMDA 1GYLA 2X7VA 4LW7A 1GOIA 3W26A 4Z2GA 2OLAA 3LQLA 3SRKA 2WJFA 5EGRA 1PVNA 3CHFA 5LA0A 1SO3A 3E2SA 1R5YA 5D9OA 2W3ZA 4ZQRA 3BV4A 4H00A 5EY5A 4MNJA 1XYAA 4ALDA 4J28A 2EXOA 3DBPA 3ZZ1A 3NQ7A 5FL1A 4UFJA 2VCAA 1V7YA 2W61A 4IIGA 2GGEA 3TV8A 2GWNA 1PCKA 5HINA 1KCKA 1TB3A 3M5ZA 5CAHA 1OFOA 3BLFA 3UFYA 4JFSA 1CPUA 3OA5A 2ODOA 1ZS2A 3GRIA 2NX3A 3DU0A 5DY3A 4CCCA 3L23A 3T07A 2VZSA 4KCWA 3AZSA 3GDKA 3R0KA 3W81A 2NQ9A 3TJLA 3PZOA 2O9RA 5LIWX 1P6CA 4IMDA 3LEPA 3L21A 4I8YA 2Q01A 1QO5A 2H8ZA 3DDMA 2V5BA 1MW2A 3FJ4A 3V16A 5BXSA 5I02A 3TTSA 2HVMA 3FXGA 3QZAA 4IMFA 4PSRA 2X42A 1H0GA 4XG1A 1IXQA 1PIGA 3BTNA 2VXNA 3UJEA 3L4YA 4GYKA 3LCFA 4PR4A 4BI5A 3D46A 4LRSA 1WDPA 1W91A 1E9IA 2W92A 1TO3A 5C2GA 3VDAA 4PCNA 5PTDA 3T8LA 1SW7A 3BMXA 4FNRA 4TO8A 4AVNA 3CV2A 3MV11 4E0CA 3QBUA 3EBVA 5HDRA 3A4XA 3UA3A 1GOWA 5AC4A 1EIXA 3TCEA 1XCXA 3BJFA 1XC6A 4XD5A 5A6KA 2OYLA 3B8SA 1X39A 1UC4A 1PEZA 3LCIA 3K8LA 4B16A 5A6JA 2XZ9A 5CPSA 1XKYA 4F66A 2QVNA 3AYSA 3UPBA 4KEMA 2V0TA 1OK6A 1YQ2A 1WDWA 5JXQA 4NJGA 5BRQA 2NW0A 5DO8A 4H1ZA 4XVDA 1G5AA 3GTHA 2I17A 1ONWA 4XIAA 2NQLA 2QIWA 3HF3A 2QUUA 1JAEA 1U1UA 4ZO7A 1EUNA 1TVPA 3HA1A 4ENLA 2I16A 2PDHA 5G1MA 3GC2A 4XBSA 4X2RA 3SCPA 1XICA 1VBGA 3VOFA 1M68A 5AYIA 1ZNNA 1BAGA 4OZOA 5C9ZA 1W1VA 4MY1A 3NO1A 4QNEA 4HNCA 2ISWA 1I0BA 3WD1A 3O07A 1TZ9A 4JCLA 3HG5A 2YA0A 4NKCA 1XIMA 2FH6A 2X1SA 1MRAA 3EAUA 4MADA 1MEWA 2E7FA 4HTBA 2PE4A 4F3HA 4N7QA 2NQHA 4PTWA 4LX4A 4BKNA 1FWFC 3SY1A 3LCWA 2QJIA 1HW6A 3KOXA 1PWMA 1QI2A 4HA3A 4M1BA 1KBJA 8XIMA 1HKWA 1UOZA 2F2HA 1KTCA 3SN0A 4XUYA 1BWVA 3TC6A 4CQCA 2RHGA 2GVYA 1KM5A 4RL3A 1LOSA 2WJEA 2DZXA 2P8BA 3ICJA 3PULA 3G1XA 4ICNA 1JCNA 1VPXA 2WSPA 3GXFA 1EJRC 4FXJA 1OG6A 1GK8A 1XL9A 3DIPA 3DYOA 1XYBA 1J12A 3FLUA 4RDYA 5EMMA 1GG1A 4A6GA 2PDJA 5EMJA 4GQRA 3GR7A 4S3FA 4BFAA 1KXHA 2YLAA 5I03A 3W00A 3ECQA 3AC0A 1W0MA 1X8FA 1BYBA 3HG3A 3RCMA 3QPYA 5JVLA 5I79A 3NDOA 1R3SA 1PIFA 1UB3A 1XCFA 3R8GA 2YYUA 4LUYA 4A8IA 3LCGA 2UY2A 4H04A 4DO5A 1V0KA 3IS4A 4YTRA 1US0A 1N7KA 5HNTA 4L61A 1M6JA 1CGTA 2GVLA 4DWSC 3NQCA 1ZLPA 4R9OA 1IGSA 1E56A 2FPYA 3AAMA 3PPGA 3UP8A 4QG9A 2XGZA 3EX3A 1W1IE 5GPRA 4JL2A 2YGYA 4MWAA 5CSUA 1LDCA 2G8ZA 3UJFA 3T6CA 3GVWA 4L6HA 3WLLA 1EXPA 1V3IA 1PWLA 4GY1A 5CAKA 4EPBC 8A3HA 2UY4A 4OTKA 4Q7NA 1QW8A 4NILA 4QXIA 1TELA 1M41A 4A3UA 5C6MA 3BOLA 5M5DA 1GQLA 1TWWA 2W6RA 3INPA 3B8WA 2YW3A 3K8KA 1BPLB 3A21A 3UG5A 3BSGA 3ZJ8A 3AUOA 1SMDA 4B9YA 1C8XA 3LMZA 1W3TA 3W2KA 1S39A 2A1YA 2BY0A 3GU1A 2W5FA 1EHAA 1OX4B 3AZRA 1YRRA 4WCJA 1EC8A 1RSCA 1R87A 2QCFA 4LSBA 1LOLA 1TMQA 1L6GA 1A5UA 4V1XA 2VJXA 1EFZA 4HBKA 1H4PA 1SFLA 3P84A 4HOXA 3HTWA 1GPWA 1KB3A 5F2MA 4RE2A 1DE6A 4ZQNA 3UF9A 4LS0A 2J7EA 4RXFA 3W6YA 3DESA 3M6YA 2WKJA 1VBUA 3TYZA 5HOSA 2HPIA 1IT7A 4H2HA 1DEDA 2XTKA 4O1AA 5M3WA 3P14A 3CH9A 1TPH1 3JU2A 4YNGA 2PDGA 2XVGA 2HDJA 2WSQA 1K8ZA 1QNQA 3E6EA 3WUBA 3LNMA 4AH7A 4FOUA 1AQ0A 3P93A 1JVNA 3DERA 4W85A 1Q3NA 4HMDA 4IFRA 1VFUA 3I4EA 9XIMA 1SJAA 3NQ2A 3UNTA 4MKSA 5ENLA 4ROQA 1XUZA 4MNMA 3GR4A 3TUUA 4TOQA 3G1HA 1CZ1A 3B9OA 4PEEA 3ZLGA 3BW3A 3LA4A 2GK1B 3A3WA 4AZCB 1S38A 1QJWA 1Q66A 2ASHA 4GNJA 3GG7A 3P82A 4UTFA 7ENLA 2Y8VA 4EOUA 2V68A 3EDEA 3SB0A 3GU2A 2EPKX 4AZBA 4Z2JA 4O4WA 3G0XA 1ZJBA 1FWWA 5D04C 4Z08A 5SWUA 1JCLA 3PZUA 3M0LA 4MZYA 3TE9A 2CHNA 2XIIA 2YCKX 4KFNA 4PFMA 4ZQPA 3VNJA 1P5BA 1QTWA 4C1NB 4H3DA 2YBVA 3OPSA 1F5ZA 1H5YA 4L4MA 5FF0A 1KGXA 3ZSTA 4Q8NA 1ITXA 5A2AA 2PBOA 2ZRVA 2I5IA 9CGTA 2XIJA 4CN4A 4OQVA 1W9PA 2DIEA 1MZRA 3OGVA 1FOBA 4UTTA 3AIQA 3WX7A 1EF2A 1GQJA 1PYFA 1XRFA 4WVXA 1KRBC 1TMHA 4TMBA 4KT2A 3XISA 3WQEA 1X7IA 4Q8QA 3O7UA 1J2BA 2VX7A 3DZ1A 1DIOA 1GKPA 4C6LA 3WDHA 5KZ6A 3Q2DA 4C5YA 1TQJA 3CPUA 1NFPA 1YDYA 3GB6A 4KRZA 2E77A 1W5MA 2WQPA 4JN6A 2TAAA 2ZVRA 2EG7A 1FP8A 5KMYA 3QLLA 4JTKA 4BEUA 2HWGA 1MW3A 3H53A 3W7NA 2FGZA 3ZT7A 2FTYA 4R7OA 4YYCA 1ZFJA 3KVKA 4XKYA 2TMDA 3OBKA 1JL8A 3PSVA 3U3HA 1T99A 4LAOA 1YYAA 4GIAA 4X3ZA 1IIGA 3Q65A 1XJBA 2Q8LA 4MWAD 4CNUA 3WENA 3ITCA 1KA9F 2E5DA 3WQVA 3A23A 3UWQA 3FJ6A 3RM8A 2CZ5A 2ACQA 2YL6A 1JZ7A 1O68A 3OA3A 4QTGA 3EMZA 3ZVIA 4OFCA 1JCXA 4AIUA 1A5MC 3E5BA 5C2CA 1J11A 2OG9A 7REQA 1S46A 3UXKA 4LXFA 3K1DA 4WHBA 1YADA 4X9YA 1IQ8A 1JZ8A 2C91A 1LM1A 2CLIA 3BZJA 5LSMA 3FJLA 3CJPA 4F0LA 1LBMA 3B3DA 1JUBA 3S2LA 2BTMA 4YPJA 1EH9A 3GH7A 3OG2A 4ZOAA 1QI3A 1UKQA 2PURA 1H1NA 3SRFA 1XFCA 4UFHA 1OT2A 3GXNA 5XIAA 3KLKA 3SZ8A 2QCDA 3HMJG 3WUFA 1A3WA 2WMKA 3VGDA 4LAUA 4JQ3A 4AIEA 3WQDA 4DPQA 4E8DA 3ME3A 1YXYA 3LERA 2FB2A 6PTDA 1P6BA 3SCSA 2BNJA 4S3KA 3CO4A 3CO8A 3NQEA 5FEPA 3DFPA 4I90A 4UOQA 1W5QA 1E71M 2PTXA 3HB9A 2DW7A 4HSNA 3UGVA 4F8XA 2ZRZA 4DJDC 4FAMA 3B9EA 4IIEA 3TONA 4Z0SA 4Q4QA 3PZIA 4JIQA 4O1FA 5FJPA 4LVGA 4DZHA 2OZ8A 2X1IA 3QQWA 1Q7ZA 1LRTA 4QP0A 5B7ZA 3EB4A 1SJDA 1BLIA 1MDRA 1SFJA 1JZ6A 3LY0A 3WDQA 3GBDA 4UTHA 3KVJA 3V0SA 1OGBA 1US2A 2XM2A 2PLCA 3AALA 3TWAA 3ARUA 3BV7A 4B3KA 2OEKA 3H22A 4ZCWA 4E4UA 1NDWA 2TODA 3DKLA 4N4PA 2BLEA 3T0CA 4Z1BA 4F2BA 3GNNA 1LUCA 2G3MA 5FIPA 2PWDA 4PTDA 2DZBA 1FWIC 3LTPA 2NV9A 1UROA 3M0JA 1F3TA 4DZIA 4XD4A 1C8YA 4HCDA 3CAQA 5HQMA 3QGKC 1R2SA 2QDDA 2A6LA 3M44A 1LUCB 2A0NA 2ADAA 5I07A 4UCFA 3W2NA 2V2DA 2HNHA 4EP8C 3ABZA 4DXXA 2GOKA 2A3HA 2EPNA 4NRSA 3U4FA 5FEWA 3FYYA 1HKKA 3AZTA 2WCGA 1TCMA 3BE7A 3N4AA 5AC8A 4AZCA 1QBAA 2VRJA 4CQDA 1ZP4A 1JZ2A 2NVDA 1H09A 4IMGA 3WLNA 3HV9A 1JXJA 5I3HA 4FIQA 2Y85A 1V6UA 1AH3A 1IT0A 1BWLA 5EL1A 4AEFA 5CXPA 1W1A1 2X0YA 3LPOA 4J9JA 1H49A 2PDUA 2J78A 3UG8A 3L67A 3UJ2A 4TVUA 1D3HA 4ZBCA 3LXAA 3VVGA 4DWSA 2FQIA 3LLDA 2OKTA 3F7JA 3WF3A 1UPPA 1YDVA 4S3GA 3GC5A 3CB8A 5CEWA 2PWUA 4K1WA 3ITXA 5LA1A 4ZFMA 2VX4A 4QE5A 4PCSA 3RJYA 1L2UA 2CLMA 1QPKA 2BGSA 1E6RA 1MQQA 2YCEA 3W2JA 4IJBA 4B4HA 4DXVA 2QCHA 2BSLA 2B0MA 2E67A 2YA2A 5A8PA 1B1YA 2O4MA 4HIBA 1OGSA 4GKLA 4XZNX 4NAFA 5AVNA 4LFYA 1JCMP 3N9KA 2PWHA 1QOPA 4U2ZA 1TCDA 2AMGA 1TFVA 4RR4A 1KBBA 1HKVA 3PNUA 3SSJA 2R1LA 2VTFA 4XBKA 4IFKA 1E5NA 1WUFA 2D3NA 1K77A 4J5NA 1OCQA 2D3LA 2W66A 4GQGA 1DE5A 4LPCA 4EF9A 4S3CA 3LZ3A 1DHKA 4UWMA 3HQ1A 4ACZA 3AYTA 1FCBA 4M6QA 2QCLA 4JFWA 1NFBA 3AMCA 4GGHA 4O4VA 1ICSA 1BG4A 2CHOA 1JF6A 1AZ2A 4FNTA 3NM3A 4Q4RA 4U3CA 5F2IA 4D1IA 1K9EA 2CLHA 4GK8A 1S2AA 5CG7A 2Z1KA 1LLZA 3PBGA 5CZKA 4K68A 4BF9A 3P3BA 4HB7A 5TAOA 4NT0A 3B0YA 3AU2A 1RJPA 1BF2A 1VRDA 3GSMA 4GY7A 4LB4A 3ATZA 3VDGA 5F2GA 4ERAA 3P67A 3Q58A 1UUMA 5IM51 2PGEA 5IDZA 1WAUA 1QNVA 5M03A 1UQYA 1WNOA 3THUA 2NVCA 2YL8A 1V5XA 3I10A 4W87A 5C9RA 3BW4A 4QAWA 4RNHA 3TN4A 1KRMA 1C7TA 1PTAA 4GZ7A 2FHCA 3WLQA 4BF5A 2OQLA 2PC4A 1LP6A 3WFLA 1DV7A 2Y6ZA 3D0CA 2V2HA 3TW6A 3ZMRA 4JYEA 2JGYA 3S5SA 3W7DA 4WKAA 3H2NA 3V7PA 4UTTC 1O12A 2EPHA 1EEPA 4W5UA 1E1EA 5A6LA 3QC3A 3TZFA 2C14A 4UQBA 4WDTA 2HXTA 5KTLA 3T7VA 2BHUA 2HJPA 3EPNA 3MHFA 3SCOA 3BANA 3H6OA 4JHMA 1O66A 3NQ6A 3TQVA 4GISA 2A3BA 3GZ3A 3HU7A 3QMSA 4H9VA 1PKMA 1NDZA 2EPMX 5B80A 4HNVA 3II1A 3WDRA 3W7CA 2HNEA 2O92A 3HJEA 2D23A 1GQKA 2BZNA 3MPGA 1NQ6A 4PUJA 3L5AA 4OE7A 3NJ3A 5DELA 4QR6A 3EDJA 3QTGA 1UA3A 1YNQA 3H55A 3GC4A 5EA9A 1XHGA 1PTDA 1JG9A 1KQZA 4UXDA 1XH1A 3TTQA 1MW1A 5KSWA 4IF2A 1KFCA 3PK7A 4AD3A 4UTMA 3PS7A 5D38A 1S2UA 3NQFA 5FL0A 1W3JA 4K3ZA 4LY4A 3N2XA 3IV8A 1Y65A 3WLTA 1Z3NA 1MXGA 3EOLA 5I0DA 1T6MA 1FQ0A 3SY8A 3QRHA 4DB7A 5AHMA 5TF0A 1Q45A 2QDGA 2NSXA 1LWJA 3VD4A 3QY8A 3CUZA 1CGXA 3TN6A 1DJZA 1IEWA 4ADUA 4MZ8A 5AY7A 4D8AA 1B4KA 3OTRA 1HFBA 2IXUA 3LDVA 3CYJA 1K4HA 4EACA 1EWEA 4O8RA 1YX1A 2J47A 4GD0A 5FKYA 4O28A 2WHMA 4S3AA 3CB3A 4RDVA 2YZRA 1EP2A 1NH6A 4ZO6A 5HUOA 5D9NA 3N9SA 1MNZA 2Z1WA 3C5QA 3ELFA 2C0HA 3U2OA 5A8OA 4K8GA 3ZWSA 5F1VA 4E4FA 3UWEA 3PZQA 1JGMA 1AK5A 4QDWA 3VPLA 4HYWA 1DIDA 2CBJA 3FX4A 2OO6A 1KFEA 4EKJA 2WNNA 1W6TA 3SUWA 1VEOA 3WH5A 3PAJA 4EANA 1JPIA 2ZZ2A 3EKZA 4N9EA 2ZTJA 1VLWA 2OSYA 1E40A 1FWAC 2F9RA 5HK4A 2A3EA 3NPWA 1WP6A 3E0LA 4S3EA 3EWYA 2I57A 2OT1A 4OKDA 3COTA 1C93A 4HTYA 1OYBA 3VKKA 2C7FA 2WLYA 1B3WA 4LUTA 2W62A 4QG6A 2WHLA 3GDTA 1JI2A 4M29A 1K8CA 2WMGA 3TFCA 1UD4A 1FKWA 3CWHA 4JIRA 3I7QA 4NUWA 2X2GA 3MV01 1A53A 3SIMA 4PL1A 3PTKA 1VPQA 3NSXA 1MUMA 3UWVA 3N2TA 1D3GA 1W1YA 5CCZA 1GOQA 3M46A 7A3HA 2YR1A 2CHRA 4DBUA 3SQLA 4RPPA 3NO3A 1XLKA 4LVBA 3E12A 3WQWA 4Z2LA 3WF1A 4DNHA 4K8HA 4QCFA 1VFMA 4AVOA 1AW5A 3H4XA 3MO4A 3RX4A 4DJFC 3EWDA 3A4AA 4PTXA 3GFZA 2WVVA 3G0SA 3VNMA 2BGNE 4WXZA 5DT5A 3CS2A 3ABQA 3LM7A 1XH2A 4YXGA 1WKYA 1OCNA 1N2VA 4LUJA 2V63A 4GFIA 1EUAA 3WQ4A 4QJ3B 4PC8A 4UMBA 3R7MA 1GYMA 1CIUA 3HPXA 1DORA 4C6KA 2D0HA 2QGYA 1BXBA 1QAPA 1OEPA 1W1TA 3RM9A 3VOGA 1NOUA 3L2MA 3UESA 1DKWA 2J79A 3LHUA 3CK5A 1J0YA 1ONEA 1D3CA 1N8FA 2WV8A 3KOWA 4JTGA 4H9YA 3LPGA 4O0ZA 1HJUA 2XVPA 3NDYA 4D6CA 4ERIA 2ZZ1A 2GL5A 3NYDA 3O15A 3DYMA 1IHIA 2Y8UA 2FMNA 4I9TA 4UBPC 4I3GA 2G3FA 3VKCA 3QEZA 3BAIA 3NTYA 1XRSA 3I6TA 1ISZA 4DF1A 2J66A 3CYVA 3UXAA 2R1PA 1BKSA 2XSXA 1UR1A 2JF7A 4XIMA 1TPWA 4J3ZA 1UQZA 1IF2A 2XIQA 1RQEA 1OFDA 1H2JA 5ABHA 1EOMA 1GEQA 4AHPA 1W8GA 4IGHA 2H3BA 2O56A 5BWAA 1L9WA 4UIOA 3U48A 5T91A 4MDPA 4MYAA 4XAGA 3VOIA 5K9CA 3WG6A 1JIBA 1N8IA 1OD0A 1XI3A 2PF0A 1TE1A 4RDWA 3WLMA 1DWHM 1PB0A 2CKRA 4L1GA 4B90A 3UG4A 3VFCA 1XFBA 3GNDA 3KRSA 3L4VA 1W9BM 3P62A 4M6UA 3WJZA 5D09A 1RAKA 4I5XA 4KRTA 2V67A 2Z27A 4GC4A 3AWNA 1J6PA 1CGVA 1LT7A 3TR2A 2R9RA 3WDIA 3CZJA 1W17A 1CCWB 4MFDA 2FYMA 4V2XA 2HBXA 3WD4A 3G1VA 4LCQA 3MKKA 5I3FA 3LRLA 1HXJA 2VEIA 4O17A 3QQ0A 3M1ZA 3HMCA 4XBJA 3E74A 3K30A 3PP7A 3SFWA 1ISYA 3Q94A 3A47A 4UZUA 4PCPA 3AMDA 3U5UA 3REQA 1OT1A 2OMAA 3QMRA 2ZXQA 5EFFA 3TVAA 4A3HA 1POJA 2CBIA 5A8GA 2VEFA 3NZGA 1RVKA 4WJEA 3WJYA 3ALGA 1B9BA 2VGGA 1KFWA 3THDA 3S46A 1Y8BA 2D2JA 1H61A 1OCBA 1TIWA 5E6ZA 4PBFA 4C6DA 2HCVA 4M7SA 1ZBKA 4BHYA 4FR1A 4NZJA 2DV0A 4WUIA 3S47A 1UR2A 2VFFA 4YHGA 2OWXA 3DC0A 3IWPA 4K36A 5LNRA 1Q2RA 4LTSA 1KM6A 4UR7A 5K3VA 1CT5A 3S2NA 4A22A 1XPYA 1JF5A 4UMAA 2J7HA 4HP5A 5CSRA 4QHRA 1BRLB 3USBA 4Q6JA 2V2CA 4LVAA 3URAA 3MA8A 4JTCA 3LYEA 2D69A 4GYPA 3N73A 3KRUA 2GQ9A 1KV5A 3HGRA 5E0KA 5JH1A 4NASA 5IFPA 3T0BA 5EMUA 5I77A 3TX9A 1D8CA 1ME9A 1M5WA 4EE9A 1FFQA 4HOWA 2VR2A 1OIFA 3PUDA 3BPWA 1ODUA 1UWTA 3IUDA 4QCEA 4K39A 1A0EA 3IIVA 2GVGA 3PJWA 1F7BA 3WQ6A 3M0VA 1OX4A 1Q4WA 4PN2A 3C3UA 1I8JA 3AIEA 5LNSA 5H8UA 4RKAA 4HU0A 1CXKA 3CZKA 3C8FA 3PUGA 2P1FA 1GG0A 1NAL1 2ANUA 3T0DA 3IJ8A 2CPUA 3CL7A 4QJ1A 3S2MA 1NDVA 1XBVA 3T81A 3T8QA 1VCGA 1AH4A 1UR8A 2GDUA 5HR6A 5E6YA 2C8NA 3FA3A 1L2QA 3MZNA 3KRZA 5IFTA 2KZHA 3B8DA 2F6XA 4DVOA 4TTUA 4JKLA 2OYMA 4A8RA 1B31A 3G77A 2EEXA 4JFVA 4LQ1A 3M0ZA 1XQLA 3SECA 3SCRA 2RJGA 1R2TA 3GM8A 5CGMA 1ELSA 4TVDA 3WNLA 2JIEA 1HIZA 4YVVA 1ZRQA 3KLLA 4EXQA 3B9AA 3GE7A 4J7RA 4UTJA 4ZOEA 1ALDA 1CLVA 3PBVA 3UR5A 2BY1A 3C0SA 4BZYA 4MYXA 4H9XA 4HNUA 1H7XA 1FXQA 2JEQA 5CQ1A 1MMFA 1N55A 4O14A 4ZMGA 4MB1A 1E73M 1OVDA 3NG3A 4LS1A 1V6YA 2YXXA 4J40A 2NQZA 3WNNA 4ASTA 4DY1A 3W6LA 5BU9A 4C7DA 1S5TA 2J62A 3DEQA 2JGQA 2GJRA 3KS6A 2HBVA 3PTQA 2BWGA 4KF1A 4H8NA 4MWAC 4R34A 2ZDRA 4N6EA 4QSFA 2DZPA 1FRBA 2P0OA 1L0PA 2VR4A 4IMAA 3GS6A 3L0GA 3VKBA 4D6IA 2DVTA 1ZJIA 4GUJA 3GQYA 4M1RA 2X0SA 2BOEX 1NQKA 3K2GA 4HNNA 3IIPA 4P8XA 5CSYA 5CPLA 1TR9A 1PKLA 2XH0A 2DW6A 4JEJA 3BOFA 4K8EA 1R86A 1CI1A 2H6RA 1V02A 4I6VA 3EGJA 4YMZA 2FPVA 3BGJA 1V3HA 4LBSA 4POCA 1LROA 1F07A 2E3ZA 3EB2A 1RP9A 3S1XA 1J93A 3NVDA 2VC5A 2WSYA 4O50A 1DQUA 1SZRA 3NPUA 4GUFA 3W02A 1UZ4A 1QHPA 3STPA 3OYZA 2JKEA 4PYSA 1K70A 3S8HA 2QEZA 2ABAA 3MVTA 1B30A 1Z32X 1CXHA 2Z6JA 4FF5A 1JYVA 4QJ4B 3WY1A 5LIYX 2WO5A 5E9AA 3OGRA 1CXIA 5A6TC 3DC8A 5KETA 1LF1A 2CWXA 2RDTA 3EX1A 5C71A 4DI8A 2P5NA 2ZTKA 2ZVIA 4G2DA 1NU5A 2I56A 4D72A 5HJXA 4JTUA 1W8SA 4U28A 1EX5A 3FVDA 4PUUA 3UW6A 3UYCA 4PBEA 2YBTA 3L65A 2P50A 2WZEA 4K1GA 1QXLA 3OLGA 3SCNA 3LOTA 3GU9A 5GVJA 2B7PA 3O6CA 4CQBA 3MT1A 5XINA 1IEQA 1LL7A 3BQ5A 2QDHA 4B2DD 3O6AA 3VIMA 3U5YA 4F40A 1GGOA 3FOKA 5BW6A 5M17A 4ZGYA 3SBFA 4GUHA 4J2MA 1A0DA 3LHTA 2P53A 4WY0F 4O53A 2OELA 4QE4A 4ADSA 3BW2A 3URBA 2W79A 4DYKA 2QJNA 5CKSA 3W2LA 2GJXA 4DAFA 3ZVHB 5HPOA 1Z89A 4MF4A 4F9DA 5BXRA 1WAWA 3VI2A 5ABGA 4HKPA 1FWSA 3VOHA 2BMBA 2FJKA 4DJFD 1PV8A 4HZ6A 1Q85A 5D8WA 1XCWA 1T7LA 1VYRA 3TOPA 4MY9A 3I6EA 1EZ2A 1I2OA 2CERA 4C6MA 3H2OA 3W7MA 1OM0A 4X60A 1SZEA 1EGMA 1U2YA 3PWGA 4NX0A 2V5CA 4A2SA 3W84A 4NAEB 3AXMA 2BBFA 4PE8A 2VI0A 4KGJA 1OZQA 4DJED 4DUVA 1E6XM 1HT6A 2QHAA 1Y5WA 4IG2B 2X1RA 4ZVJA 2GVEA 3MKVA 3BG3A 4D6DA 1UA7A 3FSTA 4AD5A 2RGMA 3ARPA 3WJXA 4JNMA 2J8FA 4UTLA 5E1QA 3BDKA 2DH2A 3UWUA 4H7ZA 5E0FA 3CUHA 3T55A 3EWUA 3TEVA 2E0PA 1TPFA 1X1NA 4XISA 1QNPA 5LYRA 4QLLA 2CNCA 1A80A 3GHUA 4C6OA 3GVGA 2D2OA 2O9OA 4H4IA 3ISIX 4PEKA 3N11A 3WQOA 4QE1A 3C0LA 5AYYA 3S5ZA 4MSSA 3BVJA 1UWSA 1FWDC 3EXRA 3AYVA 3G3DA 3IVSA 4ZR8A 1ML1A 4PRTA 3VNZA 5F4SA 3G6MA 5CZJA 2FFIA 3HO8A 3WFAA 1O1ZA 1ZY9A 2WQDA 4XVEA 4B5TA 3F2DA 1X7FA 1EZWA 2GZXA 1CLKA 3E5PA 3H7VA 3KS5A 2FZDA 2FZ8A 2Q8XA 1FH7A 4CVUA 4F4RA 2PDXA 4PB3A 4IXHA 3KEHA 5REQA 1VS1A 4GBDA 4FZIA 1UHVA 4UQAA 3AHZA 5D33A 2ZWZA 5DCDA 5FF2A 3RAOA 1W5PA 1XG3A 1E70M 3DFQA 4A3QA 4OGZA 1NJJA 1IEIA 3WEMA 4E2VA 4HJWA 2HPMA 1TSIA 4UQDA 1WDRA 1C29A 4I7WA 4J2PA 4Z1DA 4F48A 3EZ4A 3KBNA 2HROA 1Q6EA 2OGYA 2VRQA 2XIMA 4E2OA 3ABRA 3TYBA 3A24A 2I9UA 3I3EA 4PFHA 3EEGA 4XZWA 4Y96A 5D4YA 2PTWA 3GBEA 4H6RA 3W27A 1R2RA 3C2OA 4YJ5A 4GX9A 3ZM8A 5FJJA 4JIEA 3VKAA 5DCEA 3ZR4A 3IVTA 1U33A 3G1FA 3GYEA 1J5TA 5AVHA 3QGVA 3BMVA 1AUSL 1QK2A 3W74A 1M7OA 2JE8A 1V02E 4P8WA 1AL7A 5DBTA 5H8PA 4GQQA 2WANA 5AC6A 2OB3A 1KM0A 3FCPA 4MM1A 4G7EB 1Q13A 1EO5A 3ARVA 1VKFA 2GDVA 4IP7A 4GXMA 4V27A 5IHRA 2TSYA 5CPNA 2ATMA 3WIJA 4CCDA 1B90A 4G8TA 2GYIA 5FOOA 4DEFA 4NZ5A 3QFEA 1NSJA 4FX8A 4GNKB 2IKJA 3TCSA 3A13A 4GPNA 1MXSA 1TIMA 1KBIA 1KXTA 3QM3A 1V3JA 3SAZA 2JQXA 1LWHA 4QG8A 3UZXA 3N2MA 3MB9A 3EPMA 3AHVA 1EGZA 1CBGA 3ARWA 4PMOA 3QSTA 1T8QA 4JZ5A 4Z2IA 3LENA 1YXDA 1PHWA 1SU5A