4R9OA

Crystal structure of putative aldo/keto reductase from salmonella enterica
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
MVQRVTIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALTLAPHLREKLQIVTKCGIATTARAENKLGHYITDRRHIILSAEQSLKNLATDYLDMLLIHRPDPLMDADDVAEAFQHLHQSGKVRHFGVSNFTPAQFTLLQSRLPFTLATNQVEISPVHQPLLLDGTLDQLQQLRIRPMAWSCLGGGRLFNDEAYQPLRQELSVIAQELNASSIEQVVYAWILRLPSQPLPIIGSGKIERVRAALEAETLSLTRQQWFRIRKAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aldo/keto reductase
publication title Crystal Structure of Putative Aldo/Keto Reductase from Salmonella enterica
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
total genus 99
structure length 293
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4r9oA00
3Q67A 3P2VA 2WZTA 5KETA 2PDBA 2HEJA 3UZYA 1HQTA 3UYIA 2HE8A 1MRQA 4DZ5A 3V36A 3WG6A 2PDQA 5JH2A 4GCAA 4HBKA 1JEZA 2PDPA 4JTDA 3O0KA 4JIIX 2PZNA 3R6IA 3R7MA 3GUGA 1GVEA 1YE6A 4WDXA 4XZMX 4ASTA 4PUWA 1A80A 5LIXX 4FALA 1T40A 4FAMA 1PZ1A 1XF0A 4LBRA 3CMFA 2QXWA 4L1WA 4YU1A 4XZHA 3EB3A 2PDWA 4DBWA 1X98A 1J96A 2A79A 1AH4A 4XK2A 3CV7A 2IPGA 3GHUA 2PDXA 2NVCA 3LBOA 2IQDA 3ONCA 2IQ0A 3QKZA 1M9HA 5M2FX 3FJNA 3R8GA 1MZRA 2NVDA 5AZ0A 2PDMA 3LQLA 3DOPA 2PDJA 4JIHA 3M64A 4WRHA 3LD5A 4IGSA 2FZ9A 4JQ2A 2PDIA 1Z3NA 1XGDA 2PD9A 1PZ0A 5HNUA 1Q5MA 4XZNX 3H7UA 2I16A 4MHBA 2IKIA 1AH3A 1RALA 2HE5A 5HNTA 3LQGA 3WCZA 2HVOA 3CASA 5C7HA 1ADSA 3LUTA 1ZGDA 3CV6A 4YVVA 3V35A 3FX4A 3UZXA 5AZ1A 4NKCA 2C91A 4Q3MA 3S3GA 1XJBA 2IKJA 4XO6A 4JIRA 3C3UA 4Q7BA 2DUXA 1AFSA 1OG6A 3UG8A 2PDCA 3RX2A 5DANA 3VXGA 4WDWA 3WBXA 2PD5A 1EXBA 1US0A 2PDYA 3GHTA 3V0SA 1S2CA 1VBJA 3U2CA 4XVDA 4RPQA 2BGSA 1K8CA 4LAUA 1PYFA 4AUBA 1PWLA 2BP1A 1RY8A 2I17A 3N6QA 3WBWA 4ICCX 3EB4A 1AH0A 4DBSA 2DV0A 4DBUA 3M4HA 3GHRA 4JQ1A 3CAQA 1Z8AA 1YNQA 2J8TA 2ACQA 3R43A 1S1PA 5LIWX 4L1XA 2FZ8A 5HA7A 4H7CA 1QWKA 3RX3A 1UR3M 1C9WA 4QR6A 1MI3A 4JTCA 3LZ5A 4WDTA 2FZDA 1S1RA 3UP8A 4FA3A 3H7RA 2HVNA 3EAUA 3R58A 4YVXA 3G5EA 4LAZA 3KRBA 1EKOA 2IPJA 1EL3A 4PMJA 1YNPA 4WEVX 2PDGA 4PUUA 3ERPA 4PRRA 2PDHA 1R38A 3COTA 1HW6A 4FZIA 2ISFA 4YVPA 1X96A 4QXIA 4H8NA 1VP5A 4JTAA 1Z89A 3Q65A 2R24A 4HMNA 3O3RA 1ZSXA 2PEVA 3MC5A 3F7JA 3NTYA 4IJCA 3UWEA 4JQAA 3MB9A 4WGHA 2AGTA 3B3DA 2ACSA 3CAVA 3LENA 5LIYX 4EXBA 3DN5A 2PDFA 5LIUX 2F2KA 2DUZA 4LB4A 1QRQA 2IS7A 3GHSA 4ZFCA 4GA8A 1EF3A 2INEA 2IPFA 1AZ1A 1Z9AA 3UGRA 4WDUA 1YE4A 2IPWA 4QX4A 4EXAA 4IJRA 4JTQA 4JTRA 2FVLA 4R9OA 1S2AA 2PDNA 2INZA 2PDLA 1Q13A 1ZQ5A 3G1RA 4JQ3A 1IEIA 2ALRA 3BUVA 1LQAA 2BGQA 4XZLX 3WBYA 3ONBA 3LNMA 2HDJA 2PDKA 3N2TA 1SM9A 1FRBA 1X97A 2HV5A 4JQ4A 3H4GA 2F38A 5JH1A 4GQGA 1LWIA 4XO7A 4PR4A 3BV7A 4OTKA 2WZMA 2R9RA 4G5DA 5LIKX 3UZWA 3M0IA 2PDUA 3R8HA 4F40A 4XVEA 1ZUAX 3V0UA 3UZZA 3RX4A 2PF8A 4I5XA 3R94A 4YS1A 3UFYA 3BURA 1T41A 2ACUA 4XZIA 4GQ0A 2FZBA 2IKHA 2VDGA 4LB3A 3LZ3A 4PRTA 2P5NA 2PFHA 4GABA 2CLPA 1AZ2A 3D3FA 3LN3A 1PWMA 4LBSA 3LEPA 4GACA 3BCJA 2IKGA 3T42A 4QBXA 4GIEA 2FGBA 1RY0A 2ACRA 1IHIA 4XAPA 3V0TA
chains in the Genus database with same CATH superfamily
1OD0A 3PN8A 2D2HA 4PCNA 3WD2A 5I5RA 2B7PA 4JX5A 3KBWA 3UZYA 1TMQA 2KX9A 1RLCL 2BY0A 4E8DA 4OT7A 1LJYA 2TRSA 4S3EA 1QI4A 2OLSA 3B9NA 1FTXA 4QAWA 1GT8A 3C0QA 2YLAA 3O8AA 4GPNA 3I4EA 1ONEA 3JU2A 4H6QA 1A53A 3TVAA 2B7OA 1V6XA 4AYSA 3NXLA 2Z2UA 2AKZA 4D6DA 4O14A 4HZ6A 1XH1A 2ISSA 3GC4A 4KEUA 4RV3A 1I9CB 5AYZA 4LUSA 2FH6A 3UCDA 1TTIA 1C8QA 4I7WA 4PULA 2ZZ6A 3QQ1A 4HSNA 4IL2A 2DU2A 3H55A 3I7RA 3GC5A 3NNTA 3PSWA 2ICSA 1ISZA 3NZ1A 4PUKA 4JCLA 1VYSX 2MNRA 1QCWA 4QFUA 3TMLA 4IJBA 4Q7IA 2YPIA 1R9ZA 1Z3NA 3IUDA 2OX4A 4ZXLA 1VRXA 3HG2A 2PP3A 5B7ZA 1DKWA 4XWUA 2BOFX 2ODOA 4AWEA 3VNMA 3U8GA 3TYZA 1V5XA 4UOJA 1NM9A 2P76A 4KCTA 3LQGA 1OC7A 3SUWA 1JI2A 4I5RA 4V15A 5BCAA 1TJPA 2QT3A 1GHSA 3TLLA 1X6UA 1WP6A 2Z00A 5CAHA 2NLIA 2OEJA 3WQEA 1UJQA 3WFAA 1P0DA 3LTYA 2XGIA 4UWMA 4NKCA 1WB0A 3PUDA 4LW7A 2ZRZA 4IMGA 4JFWA 2PURA 3FGCB 3W76A 3OLEA 3TONA 3DI1A 3AXHA 3AROA 4H01A 4WKHA 4WLCA 3OG2A 1ZAHA 2E8ZA 1BHGA 2WNQA 3MY9A 4EWJA 4UFIA 3T6CA 2O56A 4GZ7A 4C60A 3MSGA 3ZZ1A 3TYEA 2BODX 1EO5A 1KBJA 1XP3A 4ACZA 4KEVA 2C18A 2J8FA 4AUBA 3N6QA 4CN4A 1GOOA 1FWRA 2YSWA 4N0RA 2XSAA 2V30A 3NPXA 3SRKA 1IYXA 4IIEA 4UR7A 3LXCA 4S3CA 4HJFA 5BOFA 1UPMB 3W7PA 3GG8A 4CD4A 2WJFA 5HJYA 3LTPA 5E5CA 5LIWX 2Z1VA 4YWIA 4ZA0A 2VQTA 4PE8A 5AC5A 5HA7A 5GJPA 3W7GA 1PS9A 1JAKA 3QEZA 4KFOA 3LZ5A 1Q7ZA 3UG4A 1P1MA 1KM1A 4I9JA 1PZ2A 4KKXA 5I23A 4KFPA 2CLMA 3ITYA 1TJ1A 4UTJA 1B1YA 1R86A 1PEZA 4O15A 4A29A 2ZKMX 1ZJIA 2X16A 4R9XA 4F0MA 1YBQA 1NDYA 2NT1A 1UHVA 1M68A 3DFOA 3LERA 1TPC1 5FEXA 5CJ5A 2E6AA 3QZEA 1LBMA 2EG6A 3I68A 1LLOA 5RUBA 3AWNA 3U2EA 1Z6KA 2RH9A 3NZRA 2V82A 1JZ2A 3N6HA 2KAUC 3H22A 5G1TA 2HSAA 1UR2A 4BQ4A 1H49A 3G1SA 3UCQA 3VKCA 4H7ZA 1I6NA 3E1F1 4Z2IA 1CLVA 1C7SA 2FIQA 1M41A 2G96A 3MYPA 3UW6A 1QRQA 1BVZA 4OECA 4S3DA 3SN1A 4JYEA 4H19A 1ZNNA 3PJXA 2YBVA 2Q02A 3UA3A 3B8IA 4HGXA 1RBOB 4MTVA 3QN3A 2YR1A 4KIEA 2PPGA 5H8UA 5CZKA 1DIEA 3AU2A 3UCCA 4LUTB 3RO8A 3M5XA 2BNJA 3T9PA 3FJ6A 4NI8A 4KEZA 4AZ7A 1Y65A 4D6IA 1W1IE 1XRVA 2ZX9A 1XIJA 4GNKB 3S2NA 2Q3RA 1IGWA 4G1NA 2DPEA 2PTDA 2ZQ0A 5DELA 4RNIA 1QBBA 3W85A 2VOTA 3S1WA 3OU8A 4AZBA 4URIA 4OJYA 1OSEA 1XUZA 3UWZA 3VZXA 2VKZG 3B03A 5D02A 1OD8A 1XCXA 4JTSA 1NDWA 9RUBA 3RLUA 1XLFA 5D04C 3AIUA 2D3LA 3NA8A 3L4YA 3KXQA 1YEYA 3A9BA 3RX4A 4N7QA 1UG6A 2DFAA 1RBLA 1T99A 3TAOA 4UQBA 3UFYA 4AHQA 1G0CA 4IMCA 2W4XA 3B0PA 4NAEA 3WLMA 5KZEA 2QUVA 4N9DA 2XFRA 1WZMA 2RKXA 1C92A 2X0YA 5D2TA 3ZYZA 1PCKA 3VKJA 3P82A 3ICJA 2EJAA 4XZ9A 1V03A 3D3FA 3T0CA 1JNDA 4C6BA 2NSXA 5BW6A 3VM7A 1F5ZA 1NTHA 3EXTA 2NZLA 1EJ7L 4A3RA 2PGFA 1FWSA 1I0BA 1KD0A 4B5VA 3L21A 1BKHA 3W7JA 1VIWA 2HEJA 4FNSA 2EGZA 4RJEA 6REQA 1MWOA 2FPYA 1XLEA 1KQZA 1IR1A 1JF6A 2A3EA 4DZ5A 3S0CA 4MJ2A 5IBXA 4JTDA 2E5CA 4WOZA 4B5NA 3W23A 1D8WA 3V5OA 1NDVA 4C6CA 1X38A 4OUIA 4UFLA 2A7NA 1EA9C 4LBRA 3STFA 1J10A 1TIMA 4ZQOA 4C6LA 5D9OA 5D2XA 1WXZA 3EB3A 4QRNA 3BLKA 2O7QA 3PBWA 4YTSA 2YCEA 2ZX5A 3W3OA 3ITTA 3OVQA 1SW0A 1UZ4A 3VOFA 5C54A 2PDXA 4G7EB 3QY6A 5EY5A 3LBOA 1PZ3A 3BAIA 4O52A 3B8DA 1DJIA 3QKZA 1XYZA 4NI3A 2ZZ4A 5M1TA 5BMXA 1RQBA 2WPBA 4MAVA 3W1TA 1CGUA 1V08A 1I1XA 2XGBA 3PNZA 1PV8A 4TVUA 1VCGA 2NQ5A 4XKYB 3HPSA 1FKXA 4F0HA 2R1KA 3AMLA 1J0IA 5A6MA 1PYMA 3FEMA 3MMTA 5DFAA 1EF2A 1QNOA 4FB7A 3ZLGA 3IGHX 3TK7A 1L6YA 3M1ZA 4DAIA 3SQSA 1E72M 2PRHA 1M03A 1E3ZA 1CCWB 2FMOA 1FCUA 3GAKA 2HQAA 3QGAC 4FI4A 2NUXA 4C6DA 4O0QA 3EEGA 4WZHA 4YHEA 3T0AA 2GVYA 2V38A 3FV9A 5C55A 1FWNA 3PZNA 5C9WA 5K4ZA 1LCOA 3MT1A 4NZJA 3OZOA 5CPSA 4BEQA 2V5KA 2X40A 2R14A 2DZSA 2V2HA 2YBUA 4N4QA 3N12A 3TROA 2XU2A 4REQA 3THQA 4OIFA 3TN3A 2ZUVA 1XJBA 1E6QM 5F1VA 1VRDA 2R91A 4NRRA 3AQUA 4LAKA 1SZGA 3AC0A 1AFSA 1LYXA 4DXKA 1A5MC 1D7KA 4BKNA 1TA3B 3BDKA 5I3JA 4Y9NA 3ARRA 2VGBA 1HL8A 3B0UX 4FLQA 4QTGA 1E70M 3EKGA 1AH0A 3MHGA 4HU4A 2Y24A 4OE7A 1Q6CA 5XIAA 4QM1A 2ON3A 3SEPA 1LOLA 1S2UA 1ZS2A 4ZOEA 1E51A 3HF3A 4H7CA 1K77A 1HJXA 1FUYA 1WDRA 5IFTA 1C93A 4PL1A 3UZ5A 3WKZA 2A4AA 4M6QA 1MEWA 3BLLA 3GR4A 2V3EA 1CDGA 3W7RA 3TNOA 3MANA 1V0MA 1K70A 2CZFA 3LCLA 3PZIA 3P8JA 3I65A 3GH4A 1W8SA 2DVUA 2PC8A 3PUGA 2PLMA 4W86A 5H1WA 1E0VA 1S3TC 1XLBA 1EJUC 2C3ZA 1N82A 4PFMA 3Q65A 2XVKA 2DW7A 4LXFA 3EWYA 4GO9A 5FF2A 2ZRWA 3GNOA 2XVPA 1OQFA 3MP3A 3S5YA 3OZYA 1AQMA 4L4MA 2JIWA 3ES8A 5LIUX 1YDNA 4RW5A 4J40A 3CS2A 4B2DA 2VEIA 4O54A 2QAFA 4Z1DA 1LG2A 4CU6A 2GVJA 3OVGA 3W24A 4PTMA 3BW2A 1XLMA 3THUA 3G22A 2QNEA 1FH9A 3EOUA 3IVSA 3HGJA 3B97A 4YCPA 4HHMA 2BVTA 4X0VA 3W7EA 3AZRA 3W1MA 3QV7A 3VNDA 3SBFA 3CHEA 5BU6A 2XFYA 3UPBA 1GUVA 1LLZA 4ZQNA 3L7RA 3GYCA 3BK0A 1V8EA 1Q6DA 5DF0A 5DMLA 4Z1YA 2BGQA 2DH2A 4HOZA 4GYPC 1TTJA 5CXPA 1OCNA 1SM9A 4KFNA 3TYBA 3KL0A 4PN2A 2XWEA 3KM8A 2ZIDA 5JH1A 1JZ6A 1F3EA 1Z48A 2BGNE 2JGYA 5KINA 4X60A 3HBLA 1WKYA 2Q8ZA 3L2LA 4FR1A 2FGZA 4XB3A 4RLIA 4PR4A 4ZODA 1VB9A 1B30A 4DO6A 4DAFA 1U83A 3W7DA 5AOUA 1FXPA 3W00A 1UD6A 4YS1A 1L6FA 4MKVA 1TREA 1UWAA 2ACUA 3ISIX 3ITGA 3MCOA 1KV5A 3VD7A 1QNQA 4C1NB 4NX0A 5TBOA 4OQVA 3ZSSA 1UKTA 1UWIA 1W3NA 4A3HA 2DT1A 4XD3A 4HPHA 3LHTA 2V69A 5AN7A 1SZEA 3AI0A 3LEPA 1HIZA 1KM6A 4GACA 3WF0A 2E6YA 4UR9A 4H6KA 4QBXA 1ZY9A 1RZMA 4C7GA 1L2QA 2IQTA 1HF6A 1JRBA 3NURA 1WPCA 3NOYA 2WSYA 4HZMA 3CU2A 4PL2A 4WJXA 3S4TA 7CGTA 2ZA3A 1JZ5A 3S1XA 1OVDA 3EX2A 4TOQA 4YTRA 4F9DA 4MYAA 4E5TA 3SSZA 4J7RA 2SFPA 2OQLA 2WYSA 3G1FA 3SCNA 2R1MA 1K9DA 4CD5A 4ICNA 3S1GA 4C7DA 3GNNA 3DFPA 5K9XA 2AQOA 4FAMA 5CC3A 3N19B 4Y9OA 3WD4A 3TC7A 4ZENA 2UY2A 3TV8A 2ZZ1A 1Y8BA 3BMXA 1W54A 2BHZA 1PX4A 1J93A 2XJ7A 1W9DM 4KF1A 4M7SA 4FNPA 4QLKA 4M81A 5G4HC 4AIBA 1PVNA 2CHNA 4OBRA 3WUBA 2QQ6A 2HWGA 1YPFA 4E6MA 4AMAA 3KFTA 3TCEA 4JXCA 1PL9A 3GHUA 1KFCA 3P6LA 4M8UA 5CPQA 1DJQA 5A6LA 1XKJA 3R8GA 4E0CA 3CC1A 4AIEA 4JNMA 3M64A 3O6CA 4DVOA 1BEUA 1L2UA 3RJXA 2PRLA 3A9IA 3SJ3A 3P80A 3TXZA 2GJXB 3HA1A 2F84A 4AD1A 1RXOB 4EPBC 4V27A 2OJPA 4W8AA 3QGKC 2HBXA 4P7RA 5A3HA 5LA1A 1RALA 1S5TA 3DI0A 4XZWA 1TV4A 3GD6A 4IFKB 4OGZA 4WY0F 3GX9A 2E4TA 2HZGA 3IIZA 3BLFA 2ZE3A 3WH9A 2JGQA 3NQMA 4NUWA 4UTWC 3NQ7A 2OWCA 1Q6QA 2G3FA 3ZLHA 4XX6A 3HMCA 3MBFA 1FCQA 4AYGA 5XINA 1N8WA 3WLOA 3V5CA 3TMQA 4JDBA 2PBOA 5K4XA 1FFRA 3MPGA 5DY3A 3O7UA 1KXQA 3KDNA 1TV5A 2W0UA 1D9EA 2X0SA 4JZ5A 1J11A 3F4WA 1WOAA 3SCUA 4IQDA 4DO4A 4IGMA 1XH2A 4XVDA 1DJNA 1WUEA 3H24A 4AX7A 4ICCX 3W7IA 1MXSA 1SGJA 4Q4OA 2WBGA 3HB9A 4FR6A 1GK8A 4U33A 3M0MA 1GYMA 4HPXA 1YYAA 5JBDA 5ABTA 4Z1BA 3TQ0A 4HSOA 1KBLA 4O1BA 4BHYA 1D3HA 3MYOA 2VGIA 1W1PA 3B04A 4Z17A 4XD4A 3LHWA 1OIMA 1IZCA 3TW9A 4HHPA 1S1RA 3UXIA 1E40A 2E28A 1IEQA 2Y89A 3GYEA 5L9FA 4D6HA 1SO6A 1EHNA 1T5AA 3U0HA 3KCJA 5HPCA 4O17A 3P0XA 2ZX8A 3AMDA 4H9ZA 2PDGA 3FDGA 3L4VA 1DJWA 2WSPA 2C8NA 4RZ5A 3FY1A 3B0XA 2ISFA 4GY0A 1TMLA 3WNMA 2CLKA 4WJEA 3CEUA 3W81A 3IGSA 3O15A 3O3RA 1SW7A 4IIBA 1U1JA 2YW3A 4R27A 3WDJA 1FP9A 1XLAA 4TVDA 1W1ZA 1VEPA 1S38A 1IIGA 3KS5A 1E4IA 1QTWA 4ZVJA 3GXFA 3H70A 2Y8VA 5C9UA 2V5CA 4US6A 2ZUSA 1KM0A 4U31A 3LENA 2AL1A 3TA9A 4GE8A 4HD5A 5IFPA 1I1WA 5LYRA 4O0ZA 1ZTVA 2P3EA 1RQHA 3IRSA 3N4FA 3QFWA 2C0HA 1W3TA 3GNXA 2ZUWA 3WX7A 2IPFA 3ID7A 1BGAA 4HVXA 4H7VA 3UG3A 1YRRA 1QR7A 4KERA 4R34A 4EOUA 1OC6A 1V3MA 3MZ2A 5HQLA 5D38A 5BYWA 4M7TA 4UTUA 1AQFA 2J88A 3TWAA 3ES7A 1JQVA 2ZBTA 3CB3A 4LVFA 3RYSA 2OB3A 3LNMA 1K7EA 1RP9A 3ARTA 1F6YA 1K02A 3ZVIA 1MEIA 4JQ4A 3E0WA 3DERA 2GDVA 3VOIA 1M01A 1IIHA 2NLYA 1V0LA 1KXTA 4J3WA 1AA1B 4K36A 2C1GA 3URQA 1RUSA 3M0YA 2FJUB 4FOKA 2J9YA 1YDOA 3AMKA 1KM4A 2Y8UA 3EX6A 4Y9PA 5LIKX 1RA5A 1F7BA 4ICMA 3R8HA 2QGHA 4F40A 3W1AA 3RM8A 2HXUA 1FWTA 5MKGA 3M9YA 1XLHA 2VXNA 4CEXC 3BURA 2E1DA 5C2CA 4PUMA 2PA6A 1OFBA 2DDXA 4UFJA 3V75A 2JEQA 6TIMA 4UCGA 4HPJA 2A7PA 3HU7A 4ZO6A 2YDQA 3E9AA 2X1RA 3PB2A 1KFLA 2WAGA 1WQ5A 1W2VA 2NXHA 1YDVA 3OVPA 3QW3A 4S39A 1TWWA 5HR7A 4GKLA 4O28A 3NDOA 5B80A 2Z7KA 3U4AA 3SFWA 2YL6A 1R3VA 3PZOA 3NGJA 1TJRA 2BVDA 4OVXA 3UJEA 5GQBA 1HJQA 1KXHA 3GXNA 1N2VA 2QCEA 3T7VA 1EJTC 1H7XA 1RVGA 4I9AA 1DHKA 2QUNA 1Q6RA 4KWUA 1MXDA 1K03A 3GDKA 3CZLA 1BSLA 3I3DA 2WV8A 1ZB5A 2WSRA 4WVXA 4L9YA 3S5ZA 3S9ZA 1NF7A 2FGLA 1ZENA 2VX4A 2ZXQA 5D8WA 1X1OA 3IVTA 1M1BA 3BG9A 3WELA 3F4CA 1TV2A 1FH7A 4EPKA 1QW8A 4LANA 3OJGA 3R5EA 1E9ZB 3O07A 4AEOA 3MMWA 1HN1A 3DDMA 4IUGA 3SCVA 2QHAA 2WJDA 3I4KA 4UTTC 2CHOA 3VGEA 4GBUA 3VDHA 1UCWA 4KH2A 2QXWA 5HJLA 3RLHA 1MUCA 4HYRA 3BWWA 4LOCA 4GJIA 2O7SA 5AVHA 5KEZA 1OADA 1GTEA 1QI2A 3OW1A 5A6BD 4M80A 2IPGA 4NVTA 1UZDA 5F7UA 4RE0A 4ZOBA 4JTIA 2GYIA 1H0GA 3HFTA 2IQ0A 3NQFA 2AKMA 3VNYA 4BI5A 3NO3A 2G97A 3R13A 2ZZ5A 3DOPA 3MO4A 1ONWA 3LD5A 5AYYA 4QS6A 4N02A 4QHRA 4KPLA 3MKVA 3HPXA 3WK2A 4AD5A 2CZ5A 3BPWA 3L4ZA 1KTCA 3U9IA 1Z42A 2DSKA 2P10A 4XZNX 2XM2A 3AIVA 2VOMA 1JFHA 4RDYA 4HK5A 3BGGA 4AMCA 2VC6A 4AD0A 4BS0A 1O5QA 7A3HA 1TPH1 3W22A 1KLZA 3KOYA 1Z41A 1A0DA 1SJAA 4PUDA 1DIOA 3KVLA 5EBAA 4YPJA 3TSDA 3PZ9A 1K8XA 4Q7NA 1X1ZA 2C1IA 3RILA 3MUZ1 2J66A 5D32A 3BSHA 2VFHA 4D6JA 3Q4DA 2A21A 3KVJA 3NQ6A 5D4YA 5FF0A 3PM6A 3ABRA 3W7NA 3ARYA 1IXNA 1Q7QA 1UR4A 4PCPA 5DANA 4L1GA 2VO5A 4AB4A 5E0FA 2PD5A 4LRSA 5HOSA 4AG0A 2YIHA 2DZVA 4A8IA 1S2CA 3GVVA 3E2VA 3WH7A 3T2PA 2BFGA 3U2CA 3QPEA 4A3YA 1I75A 5CG7A 3BAJA 4K37A 3H2NA 1P0BA 1WBHA 3NL2A 4MWAC 3PBYA 1HVXA 3FGCA 3GDLA 1EJSC 3JVAA 2ZX7A 1RJRA 2NQZA 3RDKA 1DXEA 2J8TA 2ACQA 3TTSA 5I3GA 5IM51 3MSYA 5K2ZA 1ADDA 3M5ZA 2CBUA 1E71M 2EF9A 2YYTA 4QR6A 3PSVA 1CXFA 5CAKA 2PGWA 2CEQA 1OWQA 3H7RA 3OOQA 1VFOA 4QJ4B 2QJJA 1VPYA 3QV8A 2QDEA 4KS0A 3DYPA 3LV5A 4IFOA 3SN4A 4WEVX 4PMUA 4GOAA 3FHAA 3VNLA 3MI6A 3O06A 2WMIA 3KZPA 2KZHA 4RKAA 1EQPA 1KCLA 3PJTA 4IHCA 4HMEA 3G1AA 1FA2A 1CXHA 3G0XA 3SGZA 4TTGA 1MRAA 1XDJA 1HVQA 1V4YA 4F3HA 4NY2A 3VIIA 3NTYA 1NWUA 3LRLA 3L4UA 2GUYA 4UTFA 3LCHA 4N2YA 2E6DA 3PZVA 3CHFA 2P53A 1C9DA 1Q63A 1K4GA 4ERAA 2H8ZA 4QEHA 3CMJA 3P5ZA 2V5JA 4YTTA 1PKMA 2XTKA 3A64A 4D6FA 4KCWA 1EYEA 3GHSA 5T9CE 3BLIA 2E77A 1C8YA 3DFSA 3MCMA 1JULA 2WZEA 3A13A 4HA0A 1PJ9A 3DHPA 1U5JA 1L8NA 1WE5A 1YXYA 2CLOA 3BC9A 3HPAA 4IT1A 4KRZA 5C2XA 4HK6A 1CW2A 1S2AA 1GYNA 3E96A 3U7BA 4F0SA 1ZQ5A 1IEIA 2C16A 1MXGA 3M0JA 3W70A 3LBMA 4XZLX 1U2YA 4L80A 1JQXA 3BOFA 3KHDA 1A0CA 1TX2A 4IXHA 2Y2WA 3PAOA 4E3TA 1XGEA 4BFAA 3B4UA 2OTDA 1LRNA 5HANA 1E0UA 2EEXA 1SQ7A 3WUEA 4U5IA 1TVPA 4DF0A 3ZT7A 3M6YA 4F0RA 3ARQA 3WDIA 1BWLA 3P81A 2JKAA 3TLQA 2GOUA 2H3BA 4ZL1A 2XH7A 1ISWA 4RUBA 1TPFA 2E7FA 2P88A 1RD5A 5C9XA 3M7WA 5XIMA 3NIYA 3WF1A 1K9TA 2YDAA 5JVLA 1CXKA 4F79A 3MHUA 3W73A 4AY8A 4ACZB 4E3VA 1ZBCA 4A4AA 1WDSA 3C0JA 1CLXA 3S5OA 1JDCA 1M7OA 3E2RA 3GTXA 4FSAA 5A94A 1OF8A 1GGOA 3BLPX 4Q33A 2RHGA 1KBKA 1D8CA 1KNWA 2QVNA 5JH2A 1KRAC 1OGSA 2F7FA 5C8BB 4UBPC 4CEUC 2A0NA 1YE6A 4LVBA 4R3UA 4FLSA 4UTLA 4GI6A 4R88A 4HYVA 2ATMA 4LH8A 3OPSA 1UWTA 1DQXA 2BBFA 2CYGA 2C7FA 4MUPA 2Y8KA 1UYQA 3M47A 1O68A 1T6MA 4MKNA 4L1WA 4J35A 3Q58A 3II1A 5HQEA 5BWAA 1W9UA 2CKSA 3M16A 4GIRA 4MJ4A 4MY9A 4QISA 1AH4A 3HN3A 5I7GA 2WMKA 4S38A 3M0ZA 2NVCA 4NRSA 2D24A 4IPNB 2IQDA 3O2LA 3MI2A 3C2EA 3EDJA 3AISA 1A5NC 4K8GA 2PWHA 3CQHA 2YJQA 3HJZA 3C2RA 4IGSA 4BA0A 3RMEA 3G1VA 4NSBA 1ZAIA 3MVIA 3TC3A 4E8GA 4IIGA 4QITA 4X9YA 3WNPA 3G3DA 5FA5A 2J7GA 1PKNA 3UGVA 3KBJA 2Y6ZA 4DRSA 2VRJA 4LS2A 4UUIA 1QWGA 2DVTA 5AKQA 3BJSA 3EX1A 4S2BA 2VC5A 2OT0A 4UQCA 1IEVA 3P67A 4JTLA 3CWOX 4BF5A 1UP0A 4ES4A 5LNWA 1QPKA 1GPFA 4XKYA 3GFXA 3BAXA 3K4WA 4F9JA 3LYEA 4PH6A 2Z27A 1CENA 1GHRA 3SUVA 3ZOAA 4RV8A 1T8QA 1GVYA 3S3GA 3NQCA 2G5WA 3WK3A 3EXRA 4XO6A 1EP2A 4NAFA 3C0SA 3W86A 1GVOA 3IJIA 1UA7A 1AK5A 4ROPA 4ZFMA 4WDWA 3QRHA 1CGXA 3L4WA 3V0SA 2CXEA 2XYLA 2W67A 2Z1KA 1VBJA 2EO7A 2FTWA 3VZZA 2O4QA 2VJXA 4NJGA 4K7VA 4ORMA 2WLYA 1S46A 1A5AA 1FOBA 5FL0A 1UZHA 1QO2A 3JZUA 1X7IA 2XUCA 1V6UA 3OBEA 1JYWA 2REQA 4G56A 1O4UA 1EGVA 1TVNA 3FHQA 5FEWA 4MGGA 1K9EA 4KGJA 1UKPA 4Q8QA 4RCXA 2Y88A 1LOSA 2ZA1A 4CQDA 1HGWA 1XS2A 1R2TA 2FZDA 3PZMA 4R7OA 3UP8A 4O12A 3GIYA 1OK6A 4J9JA 3TTQA 5BU9A 3CL8A 1AUSL 1PUDA 2G3IA 3PPCA 3WF2A 2V67A 3PFMA 1H61A 5GNXA 5A6AA 5K3VA 4F8XA 3ERPA 1UR0A 4DUVA 4JY8A 4L6OA 4F2UA 3GDBA 5FIPA 1UD2A 5C6MA 4LEFA 4KQNA 4NP7A 1Q8AA 3W83A 2PWGA 1W9PA 4PMVA 3T44A 3UBPC 1JD9A 1IZJA 1ZL1A 5I3IA 6REQB 4DUXA 1EUAA 3T0TA 1EWDA 4M56A 3UJFA 2NQLA 4G1KA 3MB9A 4HSHA 1E4NA 4C65A 2PGRA 3ZQ9A 1BRLA 3H4XA 3M46A 4EXBA 2JF6A 2PP1A 5A6TC 4Q6XA 1I2OA 4TV6A 2GSEA 3RLVA 4UTKA 1GVSA 3TN4A 3R1ZA 1HP5A 1F3XA 4WXYA 3N6JA 3W0KA 4IX0A 1MUMA 1JCMP 3AALA 4B91A 2DT0A 4ATWA 5EA9A 4JTRA 5FD0A 1PTGA 4EP8C 3C86A 2Y5EA 4I8DA 4KT2A 2PDNA 2NX9A 1KR0A 3ZMRA 4DLFA 1HP4A 4JQ3A 4HA4A 1E73M 3S2JA 4LYRA 4YJ5A 2HPMA 1GEHA 1JDEA 3K8MA 4KBXA 2WVVB 4CD7A 1G4PA 2V68A 1XLJA 2RFGA 4FNTA 3WL1A 2GQ3A 2BX7A 5EL1A 4MZ1A 1DWFM 1S3HA 2AQVA 2NWRA 3ITLA 4J4KA 4OTKA 1XC6A 3DGBA 3GIPA 5A2BA 7ENLA 3AIBA 2VCCA 1QASA 1OABA 3KRZA 2PTXA 4IGNA 3THCA 1HO1A 3D0CA 4MIMA 2HMCA 3DKLA 3R94A 2QCFA 2VD8A 3KTCA 3TJ4A 4MNLA 4LUIA 1AODA 1DOSA 1OFAA 5HNRA 4MWAD 4IGHA 3BLEA 4ZO8A 2E6FA 5A6BA 4DUOA 2PMQA 3N04A 4REQB 4GK8A 3REQA 1TZ7A 2QCMA 3SN0A 3CIVA 1DBTA 2J7CA 1AZ2A 1FKWA 2YXOA 1KGUA 4XKMA 1WKFA 1RJPA 3B9DA 4JBRA 3UXLA 5CH9A 3D5HA 4GIEA 3MWAA 3LLFA 4D6CA 1PB0A 3DESA 1WDPA 1BLIA 5J04A 3KAOA 4GYPA 3C5QA 3KS6A 2GWGA 4OKDA 3P93A 3UYIA 4JGDA 6XIMA 4GI4A 2VEFA 1EFZA 2H8XA 2CHRA 1ZJAA 2IXUA 1H1NA 4JS3A 1WV2A 3SUTA 4HHHA 1IZKA 3L0KA 3N9KA 1GOQA 3FA3A 3S9YA 2PWVA 3MW7A 4LTSA 2DP3A 4CCEA 1S5WA 3UT0A 3MS8A 3G77A 5CPMA 3TZNA 3W6MA 5DX7A 4WOQA 4YU1A 4E38A 5JBEA 1Q66A 7TIMA 4FIRA 5I07A 4HPGA 4RXFA 1OCQA 3B9AA 4TXEA 3WNNA 3XIMA 3DHUA 3L0GA 1F3WA 4P8UA 4DI9A 4JTKA 2J7BA 2WQDA 5IDIA 3LXAA 3WQGA 3APTA 5H6HA 3DG3A 2HNEA 3FJNA 3PG8A 4M1RA 2WHMA 4DWSC 3UR7A 1LQ0A 3W7HA 4C6MA 1FWCC 5CC6A 2XN2A 3LK6A 5FF3A 1YTKA 5TD4A 1V3IA 2G95A 2O9RA 1A50A 5EMYA 1PZ0A 2Y1HA 1EHAA 3OGSA 3E0VA 2F61A 4GH1A 1TUXA 4HA1A 2OZ3A 1XBZA 1VENA 1JPMA 1VLWA 4KMQA 4DY1A 3U57A 1U22A 1AH3A 3VZYA 1E6XM 1GEQA 1OX6A 1EA0A 1VKFA 3QLLA 4AIUA 2OLHA 1YXDA 4YVVA 1E6NA 1CBGA 2GJXA 1PKLA 3W7OA 2EKCA 1CXEA 1F4HA 2MUCA 3PWIA 4XIAA 2QF7A 4AY1A 2R8WA 3AXMA 2OLAA 3UJ2A 3K8LA 3ORWA 2VD9A 4Q7BA 2VUYA 3MSRA 3GXTA 4QNEA 4KWOA 5I79A 1TKKA 3HIJA 1EXBA 3SCWA 2ZICA 5FF4A 1W1YA 4F2TA 3CUIA 1XFCA 4LV4A 4QG6A 3EPOA 3A4AA 1PYFA 4Q4PA 1P7TA 4YN5A 1HTIA 4LJ3A 4KCUA 5LA0A 4QAIA 1XKYA 3L9CA 3M41A 3WL0A 4ZB2A 1JJKA 1P0NA 3AJXA 4ERIA 3I6RA 1UQYA 1GOKA 3M6DA 1VQTA 2BTMA 3DUGA 3W7QA 4ADSA 1XYFA 2GGIA 5FSEC 3FEQA 1HJSA 2J25A 1DJHA 4QJ1A 3MKKA 3WEOA 1FXQA 1SMAA 1OYAA 1TV8A 2HK1A 1FX6A 2EG7A 1JCJA 5IDZA 3AS3A 2R1PA 4IIDA 1J12A 1BFNA 3EAUA 3R58A 5CJNA 3DECA 3LPPA 3VIKA 3F4NA 1XYLA 1R5YA 3DFHA 4UTWA 2GFTA 4XBJA 1R38A 1W1A1 1Q6OA 2NW0A 1EZWA 1QOQA 2Y62A 2ZA2A 3OA3A 1XG3A 4YVPA 1UC4A 1X6NA 3DC8A 2DY3A 4NYYA 1N8FA 1HJWA 1Q65A 1LOQA 3UWUA 2WWCA 1MNSA 3V5FA 3TYUA 4YLWA 4LFYA 3F7JA 4X63A 2QDHA 3T1GA 4C6OA 4AF0A 2D22A 3D6NA 4AHOA 1QBAA 3W1RA 4QDWA 4N4PA 4J3TA 1XX1A 2ASHA 1NQKA 3GVQA 1G4EA 4YNGA 3F5JA 2ISVA 3NSNA 4JKLA 3WJYA 5EB8A 3A24A 2BHUA 4GA8A 4F66A 1Z9AA 3RM9A 4H9VA 3GH5A 3RR4A 5JMUA 1NWSA 2VFGA 3WZ0E 1MW0A 1C29A 3CHVA 5GJNA 4ONVA 3VIFA 3K13A 1CLKA 5G4WA 2D20A 3DIPA 4HT3A 2INZA 1Q13A 2Y7DA 3D3AA 4NNBA 1H7WA 3ME3A 3UEQA 4IP7A 1J18A 3T4CA 4CU7A 1KRMA 3STEA 1GW9A 3MA8A 3AOFA 3W27A 1R87A 3GVRA 4Y8FA 3LPOA 2W79A 2EAWA 1P6BA 1JZ7A 4A8RA 1OFQA 3UWVA 1VZWA 1VHCA 1IEXA 3W2UA 5REQA 3VCNA 1Y7VA 2XDFA 5FAJA 2R9RA 8XIMA 1TWIA 2Z26A 3UY8A 3EMZA 4LALA 4K6AA 2WHKA 3BQ5A 4CNPA 1S2VA 1ZUAX 4IX2A 3LOTA 3W82A 3UJRA 5LXXA 1W3JA 5C5YA 3MUXA 4XZIA 4G6CA 1MQRA 2QJHA 2J47A 1AD1A 1RVKA 1GQNA 5C0QA 1MVYA 5HBFA 3A21A 1RPKA 2JE8A 1FWGC 4AZ5A 3FKRA 1QW7A 1UP2A 4H2CA 4LBSA 2GJPA 3TOPA 2VTFA 3W2KA 7XIMA 2BXZA 3AICA 5CJMA 1WKDA 2YA2A 4ORIA 1LUCA 1IT0A 4B4HA 3VUPA 1I2NA 3NL3A 3AHZA 3N73A 3FYPA 2YGYA 1JNEA 3OHMB 1ESWA 3B0VC 5HMSA 3IRDA 3TSMA 1OYCA 3FXGA 3ZR4A 1DTUA 4R85A 4JYDA 4GWEA 4PMZA 1ISXA 4JD4A 1I2QA 1H7RA 2PTYA 3USBA 1HKWA 1NP2A 5DMYA 3ZIZA 2PDPA 1DP0A 4GFSA 5LHFA 3O0KA 3R6IA 4IL0A 3FYOA 2WNZA 9CGTA 3AFBA 3MJMA 1V79A 2ZTJA 1G1YA 5HAOA 4Z0JA 2FTYA 2OCZA 1XF0A 3WJSA 2BZNA 4GINA 4H9YA 3QJAA 2X7VA 4RXGA 3QVQA 3EYPA 5U7SA 4AISA 5CPLA 1XRTA 1AL8A 3SUSA 4GVGA 4FXRA 4HCDA 4TVCA 2WCGA 1RR2A 2YB4A 1M9HA 4IQEA 1OFEA 3LS9A 4GBDA 5MHBA 4I90A 4HJWA 2VFDA 1QW9A 3WY1A 3S1VA 3MWCA 4JQ2A 2VC7A 2WSKA 3VIHA 5G4EA 3P14A 2UY3A 4M1BA 1YHTA 2CPUA 2ZXBA 3WJZA 1GOXA 3IEBA 2V81A 1Q5MA 3MMDA 1PX8A 3VC6A 3JR2A 4E4PA 4INFA 3CJPA 3GG7A 3GW0A 1K1DA 4O4WA 3J7HA 1GKPA 1XYBA 3BAYA 4JEJA 4FX8A 1O95A 3CASA 2I5IA 1G69A 1RA0A 2HS6A 2P8CA 3CUFA 2E9BA 3HO8A 3GXIA 1ADSA 2QULA 3FFSA 2ZX6A 1OC5A 1M7XA 3WO8A 2E9MA 4HYWA 4WIWA 1H5VA 2DZPA 1W31A 3R0UA 5AZ1A 4B9YA 1FCVA 1E4LA 1ZHAA 1MUWA 3TAKA 3W1LA 2C91A 2QCDA 3B06A 1CPUA 1VFFA 4DPQA 1Q8JA 4XSMA 2ZUUA 2B81A 2OT1A 3PP7A 1SW3A 5AYXA 5AB3A 1KM2A 4RZ6A 1OCJA 3LHYA 1GZ1A 1J8VA 3HURA 1MW1A 2BOGX 2FDMA 4IIFA 2TODA 4LCRA 3UY7A 1NEYA 3VC5A 1O6IA 3UQNA 1RY8A 1SU5A 4DBSA 4E4FA 2OFJA 4W93A 4MNJA 1MW3A 2DW6A 3RIKA 3MCNA 2FZNA 2QUMA 3UXDA 4YTQA 4GQRA 4NJKA 3EOOA 4A6GA 1TE6A 3JS3A 4ML9A 2EG8A 4DIAA 5CZSA 1UH4A 4R53A 4CD6A 3WLHA 4NZ1A 3H2EA 4RZBA 1W3LA 1CGWA 2X0HA 1W9VA 2OSYA 3AYRA 5DMMA 2GSJA 5E6ZA 2VQUA 2CFFA 2WJZA 2V6AA 4MDPA 3SADA 2GGEA 2TMDA 2CLFA 4U10A 3DU0A 3BOXA 2DJLA 3QHMA 2GGHA 1BQCA 1Q2SA 3M5VA 1CGYA 1W5MA 2QMKA 3GWQA 3UWYA 1XIIA 3CWHA 3E0LA 3NPVA 4J1OA 3JRKA 4W7WA 2EPMX 1K6WA 3I6EA 3HGOA 1VF8A 5A6KA 2R1NA 4U3CA 5AHLA 1ML1A 1W91A 1VR6A 4HOXA 4GI8A 3G0UA 2YDRA 2JKEA 5LKYA 1JL8A 4NF7A 2PLJA 5FESA 1OF6A 5DO8A 4HNTA 1OJXA 4ADTA 4DWSD 3OQEA 4MVAA 3WLLA 3G3MA 3TW7A 1OCBA 3NSXA 2UY5A 4MWAA 4KRTA 5GNYA 1V93A 3FOKA 3F03K 4EKJA 3PTDA 2TAAA 3TQPA 1WA3A 1VPQA 1EF3A 3LGGA 2MANA 1AZ1A 1W3IA 3DKJA 4A05A 1JGIA 2JF7A 4S1FA 2IPWA 1GTHA 4QX4A 4TMBA 3TYCA 5ENLA 1XPYA 2Z1SA 3LRKA 1NOWA 1RCXB 5BRPA 3EX4A 4QEEA 3PR2A 4DBDA 1BF6A 5D30A 3VGBA 2B4GA 3MBDA 4JL2A 2PI6A 3VD3A 1LBFA 3BZGA 4GZJA 4C6JA 3ABXA 1EZ2A 2EJ1A 4PSRA 3RFAA 1ALDA 4RDZA 3TCSA 2FLIA 2E0PA 4NILA 2GGJA 3N2TA 1O1ZA 2QV4A 3SURA 1JZ3A 5D03A 2DT3A 3CTTA 2WANA 4JFSA 1TTPA 2V3FA 4NX5A 3BCDA 3CZ8A 1JIBA 4MSSA 2J7DA 1WO2A 3GE7A 2G4JA 2TPSA 5AHNA 1A5LC 5CGTA 2Y5JA 4DYKA 1IV8A 5EKYA 1UUMA 1A5OC 3MQTA 3WJWA 5I09A 1A5CA 4NIRA 1IWAA 3JW7A 4MUZA 3T05A 1T41A 2QJGA 3PG9A 3UWWA 2FQIA 4IF2A 1MQQA 1LQ2A 3QKEA 3DH7A 1KW1A 1W9XA 4M6VA 4UTIA 3P0WA 4O1DA 2IKHA 3WQ4A 2VDGA 3AXXA 4W9TA 3AWOA 3I3EA 1NOFA 7TAAA 3FVMA 3NVTA 2GL5A 2G4FA 1XIGA 4X22A 1S2TA 3LLXA 3C61A 3BCJA 1Z32X 3W1XA 5JIPA 4K68A 4C6EA 4JX6A 3OYXA 3P8IA 2F6KA 1YKWA 2VVSA 3A23A 1RK6A 4M24A 3ARUA 2AL2A 1UBSA 1BWVA 2PS2A 5HPOA 5ABHA 1PDYA 3ZT6A 4HB7A 1OT2A 1QVBA 1U1HA 2G3JA 4ZXOA 1H63A 1R7AA 1ZAJA 4DF1A 3E0FA 5I0DA 3W25A 1EOKA 3WG6A 1AJ2A 1HO4A 5FJUA 1V6TA 1YLVA 5B7YA 3CO8A 4HOWA 4JIIX 4JTTA 3UU0A 3DBPA 4LV9A 4H9UA 2WBKA 3DFQA 3P74A 4Q4MA 1V6VA 4HP5A 1E0TA 5GPRA 3BAKA 3CMFA 4GH3A 3TYDA 3QMTA 1X7FA 4XZHA 3VMNA 3S8HA 1P1XA 1WAWA 2GUUA 2RDXA 3B0YA 4YYCA 1GOWA 5IBXC 1AL7A 3VVGA 3LU2A 1C90A 4O1FA 3RPDA 2OGJA 4AEEA 1DE5A 5CC7A 2WMIB 4FXSA 4DEFA 2VZOA 2I5QA 4V1XA 5AC4A 5HQMA 1NSJA 3SUUA 4O18A 4FF5A 4D9PA 1A0EA 1DJZA 4RDVA 3LM3A 5AZ0A 4C6PA 1K3UA 3LQLA 3PBUA 1LLWA 3BCFA 4QIUA 3WQPA 4DXXA 4WY0A 3LSBA 3N3MA 5DCBA 1XGDA 5ABEA 4L4PA 1A4LA 3POHA 4PMQA 3FN9A 2EQDA 2HISA 3R89A 4ENLA 2EKGA 5LSMA 4K8HA 5FI8A 4B16A 1MEHA 4DO5A 2EPKX 1W1B1 2VENA 3LCIA 2J8GA 5EFDA 3E74A 1P6WA 3WCZA 1OGGA 1J5SA 5D33A 4Q32A 2YFNA 2I1OA 3R4IA 1K9FA 2Z7GA 4XSLA 3EWDA 1I45A 3AUOA 3CV6A 3GU9A 1RP8A 3GTNA 5DY2A 3W07A 4ZO7A 1OFDA 2FB3A 1WAUA 1NFBA 3B9EA 3NDYA 3ANUA 2QCLA 4ZSUA 5E0KA 2XINA 4KWVA 4C5YA 1UA3A 4MB4A 1XD1A 4JR5A 2R1LA 4DLMA 1E5NA 4LVDA 1J0ZA 2DUXA 1BXCA 4D8ZA 2J27A 1V77A 1DQWA 3H54A 2YL9A 3VXGA 1L6WA 1JYVA 3SY5A 1US0A 4GQBA 4V28A 1ECEA 2VR2A 4K1WA 3F1QA 2WB5A 4RNFA 1F73A 1GQJA 2FHCA 2I17A 1OEPA 4MADA 5EYWA 2QEZA 1QHOA 2TYSA 1S5NA 1TR1A 2ZTKA 4QLJA 2CKRA 2AAAA 3GU2A 4R7WA 3L5LA 2ZZ2A 3ABZA 1JZ4A 4UNKA 1REQB 1OIFA 2HXTA 3VINA 4XAGA 5HWNA 1V7AA 1QOXA 3S5NA 2ZCGA 1B31A 3S6OA 5AHMA 3DGRA 1AW5A 2E5DA 3BW3A 3TR2A 2YOCA 2GDUA 4MOZA 4LC6A 2CBVA 1RK5A 3GBEA 4PBEA 5DMNA 1F61A 4XTDA 3ATZA 3VDGA 4CGTA 3NZQA 3RU6A 1Z44A 2OXNA 3LPGA 5FACA 4D72A 4PRWA 4ZMGA 4JEQA 2XIBA 1QI3A 1PPIA 2X1SA 1DWJM 4Z2LA 1SFJA 4PMOA 1BAGA 1QNPA 4H41A 2QVHA 3NPWA 1OZMA 1RLDA 4LT9A 4Z2KA 5CGQA 4GQQA 5I02A 4HNLA 4MB1A 2OSWA 2X41A 3A47A 2NWSA 1ZSXA 1FWHC 2QJIA 3CV2A 4ML4A 5BOOA 2BVWA 2DT2A 2BLEA 2O9PA 4ZQRA 1ZRQA 3QZ6A 3DYMA 3T8QA 3B8TA 1CIUA 3WD1A 5CSSA 2I9EA 3CAVA 4YYFA 1SR0A 1NOUA 3QTGA 7REQA 2F2KA 2FPVA 4M6UA 1WX0A 2DUZA 2YFOA 5F4XA 1O60A 2XIQA 4QE1A 4PB4A 3O1NA 2INEA 3N4AA 3W87A 5HUPA 1H4PA 2GWNA 4ILSA 2H6RA 5CKSA 1DHPA 2R94A 2QCCA 3QGVA 1UD3A 4MZYA 1FDZA 2A3CA 1P48A 2GZXA 1FWJC 1KRCC 4JTHA 3VD4A 3A12A 1KWGA 2EPNA 3QOMA 2ALRA 3ZJKA 4TX8A 4A35A 1GVQA 4UR8A 2X1TA 3NYDA 3BLDA 1BPLB 1XIHA 1WDWA 4UCFA 4G9PA 3LHUA 5KSWA 3PFRA 1XIBA 1PDZA 1XL9A 3O63A 4E2OA 3UVAA 3TX9A 1V0NA 4DJFC 4K3ZA 1I0DA 3N2MA 5BXTA 2A1YA 3CHDA 1VIZA 4GVIA 3VNKA 2ANUA 3UZWA 3ALGA 2VWTA 3B8VA 4XVEA 2A5HA 2VWSA 4ZBCA 1TR9A 3ZXWA 4H8HA 3H26A 2WVVA 3WSUA 2NUWA 1UROA 2PGEA 4FX6M 4GXMA 1N7KA 1CTNA 4GUJA 1WCGA 1ZLPA 3AAMA 3WLJA 2H9AA 1KBIA 4K1GA 3CPRA 4NAFB 1W9BM 3DHDA 2Z2AA 3PTKA 4HTBA 4HNOA 1JZ8A 4ZQMA 1BQGA 3AIWA 3NYZA 2FGBA 1WDDA 4CVWA 4OV9A 4S3AA 3STGA 3P2VA 3WENA 3HTWA 2W27A 2CBJA 3TZFA 5KETA 3GNRA 4GNJA 2GVGA 3W38A 4HZ8A 2A6LA 3LCFA 1HQTA 3QHOA 1QOPA 3UVIA 2ZC8A 3VGGA 4AC7C 3GUWA 1WZKA 1ZBWA 4CCDA 3MV11 2REQB 4ZB5A 1GVEA 2XZ7A 3UNDA 1LT8A 4PUWA 1DIDA 3PVFA 3V1HA 3NCOA 4AW7A 1UASA 4U4MA 3S2CA 4H1ZA 5AC7A 1EPVA 3PS7A 3DG7A 4AC1X 1ME9A 4WQ6A 2DIKA 3SQLA 1QI0A 3NQGA 4DBWA 3S5SA 3IJ9A 3DENA 3B8WA 4IUOA 2E09A 2I5GA 3CQJA 4ZSTA 3U6WA 2FJKA 4JIQA 5G2HA 2J7FA 3U48A 3OVRA 2BV9A 2CWXA 1A3WA 3DG6A 4IP4A 3S1UA 1ME7A 4C1KA 3VDBA 2PDJA 2PCEA 1MW2A 4TQTA 4AD2A 2F6UA 3KWXA 1XYAA 4XAFA 3CWNA 4LAMA 1A5UA 3L66A 3UA4A 4QGCA 2OZ8A 3A3XA 3CV1A 3GDRA 1EJWC 4MJZA 1ECQA 4R7JA 4WR3A 1KFJA 1JXKA 1BRLB 3NAVA 5I3HA 5D9PA 4GC4A 4DZIA 4ECLA 2J6VA 1E15A 3R25A 4H9MA 5CBJA 4EF8A 4FF7A 1MQPA 2PUZA 3EPNA 3CL6A 5I3FA 5DXYA 2YBTA 2FYMA 4L61A 4ZTXA 3A3WA 4NHVA 4B5XA 2HK0A 2X7WA 3W2NA 3NZGA 4JIEA 4Q3MA 2QIWA 1QHPA 5DLCA 2QW5A 3E02A 4JIRA 4DELA 3CT7A 2DSWA 1O66A 1ITUA 4C6FA 3HZ3A 2D2OA 4ZOCA 5JXQA 2CIPA 1H7OA 3WQCA 1RV8A 8XIAA 1D7FA 5I2UA 4N42A 1UUOA 1JUBA 4DWSA 3IIPA 3VKAA 1GG1A 4M5PA 2D0FA 2NXIA 3KDOA 1LF1A 5FOOA 1UMYA 2I7GA 3H4WA 2YL8A 4C5ZA 4MZ8A 4FNRA 4O50A 4JQ1A 4FPSA 6ALDA 1K7FA 2ZRYA 3TTOA 1W1TA 3R43A 1S1PA 2B7QA 5DCDA 3HG3A 5DRIA 3PBVA 3E6EA 3GFYA 3N4EA 3EWXA 1SJDA 1F8MA 1JCTA 1FHLA 3GKAA 3CZGA 3K4DA 3UWQA 2GVLA 2OEMA 2WC7A 1BGGA 3REQB 3PY2A 1E56A 1RHCA 1KXVA 1YTDA 1UQZA 3HJEA 4KRUA 2NQHA 3C8FA 3VPLA 5AC8A 1WBJA 5HATA 1EKOA 1QNRA 1EDGA 3QFEA 5ECVA 4GG9A 3RM4A 4GKTA 4ZQPA 1CNVA 4H4IA 3DHFA 1L8PA 4V33A 4X3ZA 4UFKA 3QSTA 1OM0A 3U2OA 2X42A 1HW6A 1R47A 1H7PA 4PTDA 5A8QA 3MI3A 1EGMA 2PWUA 1XINA 3IAPA 3QR1A 2D3NA 3F4DA 1NQ6A 4LUYA 3G18A 2WQPA 4AQLA 1ISVA 2CLIA 2ISWA 4FP1A 3LI1A 4A21A 3CMGA 3IUHA 5I24A 1KCXA 1THFD 2QIIA 1VJSA 4AWSA 3AXIA 1RBAA 4ALDA 4DZHA 2WK2A 4NJIA 4AXKA 2I56A 3OODA 5LIYX 5J8LA 2BY1A 3QY8A 2VR4A 4MMWA 4D71A 1XIFA 3OIXA 5K9CA 3WQVA 4ZCWA 5T91A 1B90A 4WDUA 4EX4A 6XIAA 4EXAA 1KM5A 4Q8MA 1M65A 1Z69A 4Q4SA 1D3GA 4R9OA 3RPMA 3QYQA 4DJDC 1G94A 4LNCA 2PDLA 4WK9A 1VYPX 4DPPA 4HN4A 1M04A 4TU1A 1J79A 1LQAA 1ELSA 1TFVA 3AMGA 3RCYA 1DV7A 3OLDA 2BVYA 3PPHA 5HINA 2W66A 4UFHA 2HV5A 1BSIA 4E8CA 1FFQA 4IICA 1KFWA 4U5KA 4IPJA 2P3ZA 1E6ZA 3N18A 4D6GA 2GGGA 3AJ7A 4RNJA 4IPIA 3KOFA 5U4NA 2QKFA 1B3XA 3ARZA 5I3KA 3C2FA 3N2OA 3YPIA 3L2IA 2PF8A 3CM4A 4H8UA 4Y7EA 1UWRA 1W5OA 4V2XA 4XAZA 2Q09A 4V1YA 4Z0SA 4W88A 1FWAC 4HN8A 3W2LA 1PBGA 3LCXA 3FJLA 1CB2A 3PC0A 2Y4SA 2YDSA 4GJJA 3MJYA 2PFHA 2Z4GA 2CLPA 1SMDA 1KM3A 3Q37A 4W5UA 5KITA 3M07A 2V5DA 4AH7A 4HU3A 1XLCA 2C71A 4W7UA 2QMJA 5C2GA 1VFTA 4ADUA 1Y5VA 1MDLA 3MUIA 4PTXA 5CSUA 4GLEA 3LDVA 2P0IA 4MF4A 2ZRUA 4JOMA 2Z1WA 1HJVA 1KRBC 1XSIA 4PGLA 1GONA 3TN6A 4I5UA 2D0HA 1P7TB 5CSRA 3FKKA 5I3DA 3THDA 3W7KA 2YA0A 1E1CA 2HE8A 1M6JA 3IJ8A 1CZ1A 2BWGA 3TOYA 1B3ZA 4K2SA 3CNYA 5D9MA 3CXOA 2XH0A 4GCAA 2PLKA 3OP2A 3GR8A 1KGXA 3OZMA 2ZUNA 4CNTA 2VL4A 3ZWTA 1SFLA 3ARPA 4GUIA 1PZ1A 1TB3A 3S2LA 3IGUA 2B7NA 4AZIA 1GVIA 2XN1A 1JCYA 4KESA 3LXBA 4L7ZA 4NL1A 4B5WA 3ITOA 3QF0A 4Q8PA 3BG5A 3LX9A 3RXZA 2PAJA 4BQ5A 1BG9A 4DNHA 4OHQA 2XISA 3PTMA 3VX1A 3VKBA 3SSJA 4GUFA 4AZGA 1VPXA 2ZRXA 4B3ZA 3SO7A 3W53A 3WK1A 3BMVA 3GK0A 4Q4RA 1PCWA 4KETA 1GYLA 5DT5A 5TQLA 4GUHA 2WLZA 2VM8A 2FVKA 3SDOA 3SR7A 3VA8A 4Z1AA 1VYRA 4GD0A 1WDQA 4AF0B 1MDRA 4I9TA 3QPYA 3VAVA 3BSMA 2QS8A 3STPA 3Q2DA 1CGTA 3WEZA 4UQDA 1NDZA 3I3BA 4FOUA 2OELA 4J2PA 2CZEA 3EDDA 1TYGA 3ZSTA 2CITA 3GSMA 4D8AA 4L4LA 3CTLA 2Q8XA 1KC7A 4YHGA 1VBGA 4DJEC 1B5TA 4DJFD 3QR0A 2XPKA 5H91A 2Q3OA 1W17A 2X1IA 1SYTA 3LUTA 1ZGDA 4RR4A 1NWTA 4Z2HA 4AZCA 4RW3A 5CG0A 1LL6A 1PSCA 5IOBA 2PCQA 1DQUA 5IRPA 4QS5A 2POZA 4AVFA 1QFEA 4JTJA 4Y9AA 3TW6A 1POKA 4LC8A 5F4WA 2AMXA 2ZDSA 1X8CA 4OBSA 2OYMA 5LNRA 1H1ZA 3VKDA 4IH3A 1OG6A 2VDHA 2W92A 4WX2A 5LZLA 1PHWA 4JCMA 3B4YA 5A5WA 3KE0A 2W62A 3E2SA 4AXNA 2ESCA 2VGFA 1TIWA 2ADAA 4F2BA 3DYOA 5REQB 4IPPA 1PWLA 2DSZA 4P8WA 3LNPA 4P7QA 1V3LA 3QBUA 1IEWA 2DV0A 2YA1A 3P5YA 4CQ9A 5K7JA 3CAQA 3DFNA 3MVTA 3AHTA 1TRDA 1QO5A 3EXSA 2HS8A 4NU7A 1YIXA 2ZXDA 1OK4A 5DXXA 2ZOXA 1QWKA 4A2SA 1XR2A 3IANA 4S3JA 3HFYA 3L23A 4FA3A 2RDTA 1U30A 1SZRA 1H0IA 5T26A 2VNCA 3IJ6A 3S6DA 4H00A 3BGJA 2POTA 4Q8OA 3BL3A 3LTSA 4LYKA 3H21A 4PC8A 1LL4A 1LUCB 1KBBA 4O10A 1PIFA 2NVAA 4AHPA 2WM0A 3FVDA 4MJMA 2OR2A 4FNUA 5FEPA 4RNHA 2WSQA 1LWHA 3HG5A 2OQYA 4TV5A 4IM4A 2ZXAA 3A4JA 4JTAA 1Z89A 3W88A 4LRTA 3MUAA 3B40A 5F2GA 3ARXA 1HKMA 2VEGA 2G8ZA 1S5VA 3TTYA 1TQXA 2WVSA 3INPA 1P6CA 5FJPA 3WQDA 2Y7FA 1EBHA 1LM1A 4FO4A 4X61A 4GO8A 1QNVA 3ZWSA 1C91A 5AHIA 2OWXA 1EYWA 4L56A 1P5BA 3LLDA 4U28A 3W2JA 1DWAM 1DIKA 4GX8A 1PE1A 1IF2A 2IS7A 3BO9A 3NM3A 3UPWA 2OQHA 4H2HA 3O0FA 3W71A 4WSHA 3LY0A 8RUCA 1YE4A 1G9HA 3EKZA 3W1QA 4GFIA 3G1XA 3MMUA 4YCOA 1IWPA 1SZNA 4UFMA 4XBKA 1SPQA 1J5TA 8A3HA 1R3YA 1L0PA 5D2VA 3Q94A 3D46A 1UWQA 2OYKA 2A3HA 2ZVIA 1IR2A 5DEZA 3HQ1A 4XV0A 4S3FA 2PDKA 3AHVA 1S5MA 2FKPA 1C8VA 4BQ2A 2X1UA 1ZCOA 2OZ0A 2V8ZA 5GVJA 1KB3A 5KZMA 3W7LA 3WEMA 4DBEA 2OGYA 1VCFA 3NQEA 3WNOA 1E0XA 1P0EA 2INFA 3N9RA 4AEFA 2P1FA 3CIWA 3OQ8A 4OWGA 2WMJA 3CUHA 3VI2A 4W87A 3TXVA 5FAGA 2ALDA 1UD8A 2VHLA 1LL7A 4D6EA 3B8UA 1QT1A 2PTZA 4XQ6A 1XIDA 2NUYA 3BSGA 1F9CA 4MY8A 2VZSA 2PP0A 3G6LA 2C14A 1UKSA 1BYCA 1JD7A 1W1VA 4JFTA 1O5KA 1GJUA 3LM7A 2QCDB 3IIOA 4B92A 3SGGA 2DZWA 2RUSA 2IMRA 3CGTA 4M0XA 1R3RA 3RAOA 3CZEA 3H7VA 1SUXA 1KV8A 5AHEA 1VHNA 1ZALA 5D8ZA 3H12A 3R12A 3CHCA 1IHIA 4ACYA 4EPEC 3N15A 4W85A 5ABFA 1KKOA 4O11A 2PDBA 1NU5A 1W3KA 2YX0A 1NFPA 4BQ3A 5HJXA 3W29A 2QCHA 1MYRA 2Y7GA 1SFSA 4J3SA 2C79A 3V36A 3BH4A 2W63A 4KEMA 2FPTA 1QHZA 1KCKA 3KCLA 3M0XA 2PZNA 4CNOA 3HOJA 1U1UA 4GI9A 3EDFA 1OY0A 1JDFA 1A80A 1EIXA 4UTMA 3GS6A 3F2BA 4WKFA 2GK1B 4AX6A 3TUUA 3MKCA 4KIRA 3U5YA 2QUUA 1BXBA 3TEVA 4P8VA 1F2JA 4DQWA 3KBVA 2LLEA 5E6YA 3UXAA 3O6YX 3A3HA 4O0KA 3F2CA 1DJYA 3BXWA 4H8VA 3FSTA 3ZFHA 1H41A 2JBMA 3GTFA 1BD0A 2J75A 4HCLA 4OUEA 1FCBA 2NSOA 4IG2A 1NELA 3STCA 2EPLX 4O57A 5EFFA 2WNNA 4DO7A 3U5UA 5BXSA 3T2OA 1SVDA 3NM1A 4DJDD 5M5DA 2XFWA 3G24A 3NSMA 3NQBA 2JEPA 1YQ2A 4W8LA 3N11A 2J62A 1W5NA 3URNA 3N34A 1QMLA 1VAHA 3BAWA 3KL5A 1YX1A 4MWAB 1WNOA 4NZCA 1XRSA 2GJRA 1XBXA 3PAJA 3OZPA 5EPDA 3PWGA 5FSDC 3C4UA 2IKIA 4JICA 1HG3A 1H5YA 3WQFA 1NY1A 3ZJ8A 1E6SM 4NZFA 4UIOA 5E93A 3WBEA 3T4WA 3M0LA 1P0KA 3TSBA 1KQYA 4CUCA 2ZWZA 3WUGA 2YCLA 3IUIA 3GXMA 1IT7A 4G7FA 1KWKA 4R5EA 1EJXC 5IHSA 1A3XA 4ZB0A 3R8RA 1HL2A 4FS9A 4DZAA 2IKJA 3G0SA 2F6XA 2XSXA 3LCWA 3VDAA 4JTEA 3UD6A 1X1NA 2VX6A 3AZSA 2I57A 1XXXA 3OA5A 5A6SA 2YCJA 1K7XA 1E6RA 4RK8A 5TNVA 3ARWA 3MTWA 2ZRVA 5HR6A 2G37A 1NAL1 1G4SA 3POCA 1F6KA 2E67A 4LVAA 5H8MA 2HROA 1CYGA 1FDJA 3VK5A 2BP1A 3NGFA 3OGVA 4F0LA 3EB4A 3W01A 1BWKA 4Q4QA 4S3KA 3R0KA 4HNUA 1VFHA 3MUCA 4DBUA 4K7YA 2OOFA 2FFCA 3QM3A 3VABA 3LV6A 5K9DA 1Z8AA 4M29A 4R33A 4Z08A 2WKLA 2YZRA 3W6YA 1UR1A 4L1XA 3FSUA 3MDUA 2J6XA 3ABOA 5AFDA 4QLLA 2CETA 1HKKA 1W8GA 1BXNA 4JTCA 1VFSA 1W5QA 1G4TA 1LZOA 3VYLA 3VIOA 3IGXA 4UQ9A 1WZLA 3AZTA 1BYBA 1CWYA 4O8RA 1JR1A 3AIRA 1ODUA 1HFBA 1ZP4A 1REQA 3NQ8A 4AVNA 2YYUA 2AL2B 1Q6EA 4DXVA 4PTVA 4J27A 1OFRA 1X96A 4MAZA 3NWRA 4Y8EA 1ADOA 2R24A 2RAGA 2DGAA 3MC5A 2QV5A 3U2ZA 3U7VA 2WHLA 3N2BA 2OO0A 3VCCA 1EDTA 4UMBA 1ZP3A 3WMSA 4PBFA 4X9SA 2YW4A 1KFBA 5CBBA 2AGTA 3DBNA 3MUY1 2BXYA 3L4TA 1XUUA 5BZAA 3SZ8A 2Q6ZA 4UNLA 3ARSA 1NH6A 4I7VA 4PUNA 1ONXA 1QK0A 3BICA 2OOGA 2C6QA 4HNVA 3M44A 3QYSA 4QCFA 3W7MA 3SW6A 1FDYA 3G8EA 3GXPA 4GIYA 3AS0A 1U5VA 2VYOA 4DJED 1W0MA 4Z2JA 3LMZA 4GYKA 5A8PA 4I9MA 1HZYA 1QJWA 4W5ZA 3L12A 4EK7A 1JI1A 4L9ZA 3THAA 3W1NA 4K39A 3WFLA 3SECA 4LY8A 1DJGA 1ITCA 3W1UA 2BB0A 4AWTA 2HDJA 4PEEA 2VFIA 4WY0B 2V2DA 3P84A 4BK9A 5EBUA 1ISYA 3CBWA 4IMEA 5EMKA 1V7YA 4XO7A 2NQJA 2X30A 3R2GA 2WC3A 3V4BA 4GVFA 3FLUA 4PUEA 3E38A 3M0IA 3B9OA 4XAYA 1ZZMA 2W5FA 4DHGA 1W6TA 5HXMA 3V0UA 1HX0A 4DYJA 4EXQA 1H51A 3KP1A 1P43A 1QDSA 3BV4A 1A4MA 2NV2A 1R6WA 2OWWA 4ZO9A 4B90A 4J3VA 3IIVA 4UZSA 1TMHA 4LB3A 1B3WA 3L65A 2VFEA 3SCOA 4EPDC 2PSNA 4IPLA 1GOIA 1GJWA 1UB3A 4GXWA 1E3XA 2QDGA 5DQPA 3W74A 3ZS4A 2ZFAA 3CPUA 2H90A 1JPIA 1XI3A 1V3KA 4ZQCA 4XISA 2BS9A 1JVNA 4HU8A 3EMCA 5MF5A 3Q67A 3K30A 3C2YA 1YW1A 3VO0A 2CZVA 4W8BA 2BHYA 4RE3A 4CD8A 4S3GA 2PC4A 3PTQA 3KBSA 3QTPA 1BTMA 2V2CA 4PTWA 5L6UA 4CCCA 1FWBC 5D2YA 2E1WA 2XN0A 4B9ZA 1A47A 4JTUA 3DAQA 3S83A 4DJFA 4UB9A 1HKJA 3GUGA 3GY1A 1K8YA 1DEDA 5J5DA 3IPWA 4HIBA 3QH2A 1B3YA 2XIIA 2VURA 1UR9A 3BMWA 3CQIA 4XZBA 1ME8A 3NEHA 4UOZA 4KWWA 4Z2GA 1QI5A 4RL3A 8CGTA 3SRFA 2PDWA 1LBLA 3JUGA 2J9ZA 1UD5A 4HTYA 4I6VA 1XDMA 2V9DA 1J96A 2ISDA 3EEZA 1MSSA 1CECA 3LPFA 1JUKA 1BF2A 1DPMA 3FNDA 2JQXA 3CV7A 3W4RA 1ZU8A 1VFUA 4GCXA 1EC8A 3VOCA 2Q71A 1TCMA 5JIWA 4KCVA 2Y61A 3NEVA 3GDTA 3FXYA 4F0KA 1L6GA 1EH9A 1T96A 3OG3A 5C70A 3WYZA 3CUXA 2PDMA 2XWDA 3T55A 2FZ9A 5ECUA 3WQOA 3N13A 4C6QA 4MB3A 4WD0A 2Z28A 1R2SA 1V02E 3T0BA 4ZEPA 2UWFA 2DZBA 5HNUA 3APYA 4JL1A 4NZ4A 2V5LA 3A5VA 2DSUA 3C0LA 1DJXA 1YTEA 2ONEA 7REQB 2F2HA 1TPEA 5G2WA 3BOLA 1R46A 3TWBA 4O53A 2D73A 1WXYA 1YDYA 3S47A 4JX4A 1AVAA 1RAKA 3N14A 5CPTA 3L2MA 5C7HA 1WYIA 2DIEA 3CIXA 3ZVHA 4YIWA 3UZXA 3TNBA 1KCZA 5FJRA 1W37A 2HBVA 1RQEA 1E1EA 3GM8A 3GH7A 4ZE5A 4D2JA 1UP3A 2Z24A 3TU9A 1TPVA 3GG0A 3RMJA 3RX2A 1NJJA 3WBXA 3CYVA 2OX1A 3BZJA 2FDSA 4MFEA 3TKFA 1VD6A 4TTUA 3S6TA 4B5UA 4RZ4A 5I00A 1WZAA 1KA9F 1XLIA 4QE5A 2YCKX 4B5TA 3GHRA 4U2ZA 3W84A 5KZDA 5LHEA 1K4HA 3H23A 1YNQA 2OEKA 4CCZA 3V1PA 2QLYA 4B5SA 1XM3A 1Q85A 3C2OA 4MPQA 4U2YA 4PZVA 1B9BA 1UR3M 2CLLA 4BF7A 1ZBKA 2YKKA 1AG1O 1HNYA 1XQLA 6CGTA 4O4VA 2H9AB 3OO2A 1JXJA 1UC5A 5T8GA 2IPJA 4LYQA 4H3DA 1YNPA 3O6DA 3GIQA 3WLRA 4G8TA 5EMJA 3G1HA 5HULA 3RGTA 4FLRA 3EMQA 1IGSA 4P61A 1XYMA 3PANA 4X0NA 2ZADA 3UF9A 4C7FA 4FZIA 1IQ8A 3ZR5A 5BRQA 2XVNA 1M3UA 1DXIA 5JU6A 4D8LA 4PBGA 3VIJA 4RE4A 3EX3A 1LRTA 1TCDA 1O5RA 9XIAA 4MB5A 2WMGA 3QSRA 2XIOA 1FBAA 4JQAA 4XIMA 4WGHA 1YXCA 1PTDA 4FNQA 2UV8G 2RGMA 3DN5A 5C9RA 1Q6GA 1IE7C 1VJIA 3K46A 1HKVA 1CI1A 2CC0A 5LNVA 4PUJA 2WOQA 2V3GA 4QE4A 3UGRA 5CCZA 4B4FA 3DXIA 3VOJA 1B3VA 2D23A 2Y63A 5LA2A 1SJBA 1ZCCA 3TTEA 1F07A 3NOEA 1TJ0A 3UZJA 5GJMA 4UC5A 3BQ6A 3SCTA 4GIAA 3QC3A 1XIEA 1B57A 2J13A 3VD5A 1LORA 1KR1A 4M19A 1XIMA 2XIMA 3TJIA 1CXLA 5BXPA 3AS2A 3VE9A 3ONBA 1TZZA 2VX7A 3KOWA 4EIVA 3TH6A 3H2AA 1LG1A 3WN6A 4RDWA 1OX4A 3VE7A 4P2VA 3C8NA 1EBGA 1QNSA 3GXDA 1OFPA 1XSKA 3GR7A 2NXGA 3O16A 3QC0A 4NXSA 3PPGA 1J0JA 4BZYA 2WXDM 2YZ5A 1HXJA 2QCNA 3FIGA 3H2MA 1TZ9A 4G5DA 4DF2A 4MM1A 1E9LA 2PDUA 3MDWA 1GVRA 3R79A 1TPB1 3CAWA 1XW8A 2GJLA 3N1AA 4JN7A 4NZ3A 3E5PA 4EVZA 2GQAA 1O7AA 1EP3A 1V3JA 4EE9A 5LGXA 3LZ3A 1V02A 4PB3A 1M53A 4HMCA 3HQNA 3I7QA 5LXEA 3TQVA 1I8JA 2HNHA 3QQ0A 3GU1A 3EPMA 3N2CA 3URAA 3RCNA 1KKRA 3UESA 3HG4A 4JFVA 4M51A 1XCFA 4FX7A 3TYAA 3KEHA 1TPUA 4DJDA 3XINA 3ITXA 2ACRA 4QCEA 2QGYA 3V0TA 4CQ8A 3V3WA 4DWSB 1US3A 2WZTA 4GGBA 3RNDA 4GUGA 3FA5A 1V6WA 1JPDX 2O9TA 2CXGA 1OGBA 1R30A 3RU8X 1OZQA 1QPNA 4YL2A 1UKOA 5D2WA 3WQ5A 2G41A 5DBTA 3SCPA 1JEZA 1TVLA 2Q01A 1PXGA 4NT0A 1UOKA 4EANA 1B3OA 1O1HA 4UXDA 3G1YA 4H04A 4JY9A 4HK7A 3P60A 5ABGA 2BDQA 2CLHA 2VEKA 4I8YA 1F76A 4BR1A 1R3TA 1EOMA 2O0TA 4OZOA 5A8MA 1EXPA 4Z42C 3HM7A 4LPCA 3ITVA 2I14A 4QROA 4FEZA 2A79A 3AUJA 3KWSA 1GKQA 1M7PA 1TG7A 2RDUA 3K4AA 1RCQA 2PWFA 2QZRA 3T2QA 5IHRA 5IXEA 4GYJA 2QUTA 3I6TA 5FL1A 3EOLA 5M2FX 2WW5A 1WOBA 3HPZA 2NVDA 2GUBA 4H6EA 1SO5A 2PE4A 4IFRA 4WRHA 1TUFA 5A2CA 3S42A 3WLQA 5A95A 3BARA 2ATSA 1PIGA 3A4XA 5FEZA 4Z1CA 1R0MA 2CCRA 4LF2A 2PU1A 3F4VA 5JBFA 2PZ0A 5JQ9A 1XWYA 3EZ4A 2ZVRA 2WHJA 5CGMA 3IV8A 1TV3A 3T0DA 3PZUA 4W4QA 3W2MA 1RD6A 5C9ZA 1DORA 3N17A 2DZUA 2G50A 3OTRA 4TX6A 3AMCA 3K8KA 4PMNA 3U4FA 3VMOA 2Z29A 2DUAA 3VKKA 3FX4A 1BTCA 2NT0A 1UR8A 3BVJA 3GAYA 1W2PA 4UMAA 4TX9A 3NJ3A 1GW1A 5CPOA 1E1FA 3VNIA 3G8RA 3KOZA 3NFUA 2WVTA 2IW0A 4L6DA 3W7CA 3SFKA 1JGMA 5T9BG 4HCHA 3BW4A 4QSFA 2O4MA 2D2JA 4IP5A 2V63A 3FDKA 2QR6A 3VGDA 3BG3A 2ZUMA 2A3LA 3WLTA 5FJIA 4N6FA 4YWSA 4XUYA 3MHFA 5CZ0A 4JNYA 3CAKA 3EA3A 4TR9A 5A2AA 4OOZA 5I03A 3PJWA 3Q45A 1KFKA 2NX3A 3NQ2A 2YXXA 2O92A 3FYYA 5DT7A 3GLCA 2V5BA 1OHLA 2D1ZA 3NQAA 4LBUA 2VDIA 1EX1A 2D0GA 1NF0A 3W9ZA 1JFXA 2DZXA 4LUJA 4DJEA 3SCSA 4OBTA 2HVNA 3TJLA 4LAZA 3WH6A 1W3HA 3E0IA 4GXPA 4FOJA 3KCOA 4PUUA 4PRRA 3PZQA 4DM2A 2JALA 3KRUA 2DQXA 1NVMA 2BMBA 1W56A 3NDZA 4TUFA 1G01A 1VCVA 3OYZA 9XIMA 1GQKA 4GGHA 4AZHA 3SAZA 1OYBA 2PBGA 2E8YA 3P61A 6PTDA 4M3PA 1TO3A 2Z1BA 3B8SA 2IXVA 3GTHA 4CLMA 1ZFJA 1EIBA 2G3MA 1E1CB 3ECQA 4Y96A 3UPMA 3AYTA 5CEWA 3F5KA 3ARVA 2W61A 1I60A 3O05A 1XLKA 3F5LA 3CQ0A 1FHUA 2ACSA 1RSCA 5CPNA 4JHZA 1RJQA 3TIMA 4XTIA 4BWLC 4IWWA 1B4EA 3N29A 3NXFA 3RRXA 5M3WA 4ZFCA 3RLGA 3DEQA 2ZDRA 5LNUA 2WCSA 1XG4A 3GVGA 3QR3A 1JYXA 1RCOB 2HTMA 3LSCA 1S39A 6ENLA 3WMCA 4O19A 4GY7A 2FVLA 1IXOA 3QZAA 5HDRA 2ZE0A 2O9OA 1DVJA 2DJXA 5F2LA 5FF7A 3SJNA 3VNJA 4A3QA 4JTFA 2Z25A 2OMAA 1EP1A 1Y0EA 3EWBX 2DZAA 3L68A 1JCXA 3DCPA 1ICPA 5E70A 4M82A 4MFDA 2HCVA 4BI6A 1VBHA 4JFUA 1X97A 4KWSA 1EEXA 1XV8A 1J4EA 4Y90A 2F38A 1U33A 5BWFA 3GFZA 1EEPA 1D2KA 3FW6A 3AHYA 1JF5A 3N25A 1YPXA 4PMDA 1GOMA 3KOXA 2OZTA 5E1QA 2RJHA 2PODA 4X2PA 1LRQA 3ZLFA 3NPUA 1HKIA 1NARA 5CQ1A 2X05A 4OOUA 1G7VA 2XIJA 3OLGA 4LCSA 1OBAA 5E9XA 2FFIA 3H6OA 4QG9A 2OSXA 1VFLA 4A2RA 4KGLA 1BYAA 4KW2A 1LWJA 1O5XA 4A8NA 2A85A 3OGRA 4JIPA 4ATLA 4Q8WA 1QU4A 3ZJ7A 1AMYA 2J7EA 3LGDA 2E68A 4GQ0A 4AZCB 4RX0A 1US2A 2WCAA 2AMGA 4N9BA 4QJ3B 3W72A 3QHNA 2P5NA 3DC0A 2VCAA 2XH2A 4GABA 4DB7A 1GQIA 3SI9A 1VBUA 4H9XA 3WQ6A 2VR5A 1LROA 3VU2A 1PIIA 3RR1A 2QPUA 3T42A 3C6CA 4CNSA 5HWJA 3WMBA 3IK4A 5F1UA 2TSYA 4UTTA 3K2GA 4AVOA 1WKEA 3GB6A 1G67A 1PX3A 4XG1A 4EACA 3UR2A 1B4KA 2WM1A 3TDFA 2CNCA 1W32A 3CUZA 2XH4A 4LU0A 4C91A 4LUSB 4RE2A 2PDQA 2ZZ7A 4HBKA 3R7MA 3KVMA 3PB0A 2J9XA 1ZBVA 4N6EA 4B3LA 1PTAA 4ASTA 3CQKA 4IMFA 4IOTA 4QP0A 3UJSA 2F9RA 1NWRA 4AIOA 2FB2A 2GSHA 1I4NA 2JK2A 1H7NA 1A5BA 2W6RA 2RDWA 1FWWA 4NZ5A 1X98A 1LDCA 3GBDA 4XK2A 1XC4A 3GZ3A 4XD5A 4B3KA 2OVLA 4FK9A 2X8RA 2W9MA 3T8LA 1EJRC 4GISA 4N9EA 2DH3A 3ONCA 1QUMA 2G0WA 3L67A 3W26A 4LUTA 3ZO9A 1MZRA 1I2RA 4HPNA 4JDYA 1EJVC 2GK1A 1GZGA 1NFGA 5A6JA 3HGSA 1DE6A 2I9UA 3IARA 3A4WA 1ICSA 4IMAA 1MMFA 3SGUA 1CX9A 2EHHA 3T07A 4JN8A 2DIJA 4I6KA 1O12A 4Q8UA 3L0NA 3SQMA 2EXOA 4MKSA 4MY1A 3H7UA 2I16A 5CBIA 1ITXA 2XZ9A 5AECA 4GVHA 1UPPA 4HMDA 2WWDA 1M7JA 1DWGM 3ALFA 3T08A 2XVLA 4PB5A 4EF9A 1F8IA 4GC3A 3E5BA 4PMRA 3SM0A 5E0CA 3GKFA 3RRAA 2VX5A 1YNYA 4W7VA 3V35A 4HQVA 4XBSA 2YLLA 2G3NA 3TJXA 3U3HA 4YMZA 2W3ZA 1XBYA 2FZMA 1E9YB 3E12A 4A3UA 4FMVA 2WC4A 3C3UA 1JDAA 2Y0FA 3UG8A 3WQWA 3CPGA 3SCQA 1DTNA 3WF3A 3PZGA 1PHQA 5H2ZA 1ONRA 3OBKA 3GO2A 2OYLA 4JN6A 5CSYA 3GQYA 1KGWA 4RPQA 2BGSA 1K8CA 1UWUA 3C52A 4LAUA 1CEOA 3P7YA 3KUMA 2FHBA 3S2MA 3H2FA 3C2VA 2EPHA 1FWIC 1J0YA 3EDEA 5A8OA 3IS4A 3PWAA 3RITA 3H53A 3EA1A 2OU4A 3RF9A 3VOHA 3VIGA 3WD0A 1ZJBA 4PFHA 2D2GA 5I78A 3HMJG 5JUVA 4LS0A 1YBQB 4L4OA 3S9IA 1MZHA 5A69A 3AS1A 3K1GA 3O6AA 1JUEA 1OB0A 4W89A 4AAJA 1BYDA 1TSIA 4S3BA 3WJXA 5FJJA 1Y5XA 4YVXA 3G5EA 1JCNA 3AO0A 4G2DA 4MNKA 4GZIA 5BOEA 3CH9A 1UZ1A 3A5FA 3DZ1A 3NVDA 3EDKA 1JYNA 3MP5A 5FJOA 4UOQA 2PDHA 2C0AA 5KMYA 6TAAA 2E9LA 4G7EA 4L9XA 3WD3A 5ABFB 3AU6A 4CN1A 3WK0A 1RPXA 1TPDA 1AD4A 3AHXA 1J01A 2B31A 4QNWA 1XLLA 2EPOA 1E43A 5CLWA 4Y2WA 4UNIA 4US5D 4POCA 2PEVA 4C90A 3H2OA 1RH9A 1J6OA 2XSBA 5EMUA 4E4UA 1H62A 3LCGA 2E3ZA 3USZA 1EWEA 1FHVA 1DYSA 3OHIA 4J2MA 2WNWA 2PTWA 1Q4WA 3WH5A 1KFEA 3V18A 3KHJA 3G1DA 3IJLA 3VX0A 3C3NA 5BNKA 4LB4A 1GNXA 1JPHA 2WZHA 4CNUA 4AWUA 3CLWA 1D3CA 2QDDA 1EC9A 3VILA 4FLOA 1H11A 3AXKA 5HNNA 4OFCA 3TFCA 4L5ZA 1AMKA 3WIJA 4Y9MA 3KW3A 2ABAA 3NO5A 3WBAA 3W75A 1FWFC 3BGAA 3GTIA 3BANA 5G5IA 3OIHA 2BY2A 1CT5A 3WMLA 3NG3A 5CZJA 3VCRA 1E4MM 3RJYA 3BUVA 4IG2B 5KTLA 2VZVA 3BLOA 4E2DA 4CKQA 3NZPA 4ZR8A 4BJHA 4M6PA 5D9NA 5D05A 3M0HA 4A8LA 3MZNA 4LS1A 2P50A 2A7RA 3H4GA 1B0IA 3BTNA 4NAEB 1TA3A 5EGRA 4CQBA 4PCSA 4MG4A 4P7OA 4UZUA 3PJUA 3FA4A 4O8AA 3WDPP 7PTDA 2UZ9A 4PODA 2VRKA 4UMCA 1R85A 1N8IA 3R10A 1VLIA 1XICA 3BV7A 3T09A 2WZMA 1UKQA 3SIZA 4D1IA 1H60A 1VC4A 2CBIA 1EDQA 3V16A 2WPGA 3CH0A 3UZZA 4I7UA 1A5KC 3PUEA 1OT1A 2GVEA 3WDHA 3ZM8A 2JIEA 1FWDC 4MDOA 3KLLA 4DWDA 4NQ1A 4DI8A 2YCLB 2FZBA 4X2RA 1XHGA 2QPSA 3RG6A 5CC5A 2HRWA 3ATYA 3N9SA 3OEXA 1KTBA 2FMNA 5EU9A 3R11A 4PMYA 3GNPA 2OODA 3QLDA 1PWMA 2X09A 3NQDA 3CZJA 3ITCA 4J3ZA 2IKGA 3IJDA 4BI7A 2PU0A 3OLIA 3JZEA 2AQWA 2C1HA 4Q6JA 1HUVA 1DL3A 8TIMA 1GKRA 4IQLA 1GZJA 1RY0A 2QAPA 2ZUTA 3WLNA 4ZE4A 3TC6A 1XCWA 4TMCA 1FH8A 2VELA 3LA4A 1Q45A 2QF8A 3R0DA 2VZTA 1R8LA 3CYJA 3WLPA 5HMEA 3HQPA 5E09A 4TIMA 1Y5WA 3CLMA 1UD4A 4LNYA 5TF0A 1UOZA 1F6PA 3APGA 1MRQA 3T78A 3EWZA 2CU0A 2XVGA 1J2WA 5HMDA 4BY3A 4P8XA 3M43A 2GPTA 3QOKA 1XH0A 3GVWA 1TX0A 1WXJA 2ZWYA 4XZMX 1J6PA 4D1JA 1V51A 1ZJHA 4WKAA 2P8BA 4C6IA 1T40A 1OINA 3EA2A 4L64A 4TO8A 4FXJA 3PBMA 3WLKX 2J79A 1J9YA 3D47A 2D69A 2QYGA 3EOSA 4ZOAA 5FCZA 4S23A 3T81A 4L6HA 3VOGA 2RGLA 1Q3NA