4R9OA

Crystal structure of putative aldo/keto reductase from salmonella enterica
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
MVQRVTIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALTLAPHLREKLQIVTKCGIATTARAENKLGHYITDRRHIILSAEQSLKNLATDYLDMLLIHRPDPLMDADDVAEAFQHLHQSGKVRHFGVSNFTPAQFTLLQSRLPFTLATNQVEISPVHQPLLLDGTLDQLQQLRIRPMAWSCLGGGRLFNDEAYQPLRQELSVIAQELNASSIEQVVYAWILRLPSQPLPIIGSGKIERVRAALEAETLSLTRQQWFRIRKAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Aldo/Keto Reductase from Salmonella enterica
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
molecule keywords Putative aldo/keto reductase
total genus 99
structure length 293
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4r9oA00
2R9RA 4XZMX 3UZXA 4XVEA 4DBWA 3H7RA 4WEVX 1Z9AA 2IKGA 3Q65A 2IKHA 1EXBA 5HNUA 4QXIA 5JH2A 5AZ1A 2DUXA 3MC5A 3FJNA 4QBXA 2FZ9A 2HVOA 3U2CA 2FZ8A 4PR4A 2WZMA 4PRRA 5JH1A 1Q5MA 4JTQA 3BUVA 4YVVA 4OTKA 4ZFCA 4JIRA 3M0IA 3LZ5A 1VP5A 3LD5A 1S1RA 1T41A 2PDKA 3BURA 1Z89A 1PZ0A 3G1RA 1HW6A 4EXBA 3COTA 1S2CA 4IGSA 4LBSA 4XO6A 3UWEA 4JQ3A 3RX2A 3FX4A 1EKOA 2HVNA 1C9WA 1MRQA 3F7JA 4IJRA 5LIYX 3LUTA 3S3GA 2IKIA 1X97A 4WDXA 2ACSA 2FGBA 1MI3A 4JQAA 3UGRA 4JQ1A 2PDMA 3GHSA 3LQLA 2C91A 2WZTA 4PRTA 1S1PA 4HBKA 3R8HA 1FRBA 2PDWA 2PDQA 1EF3A 1Z8AA 3O3RA 4XZHA 3C3UA 1XJBA 3LENA 4QX4A 2QXWA 4ICCX 4XAPA 2PEVA 3N6QA 1PZ1A 5HNTA 1ZUAX 3VXGA 3NTYA 3RX4A 1YE6A 4WDUA 3WBYA 4L1XA 2PDBA 2IQDA 1YNQA 4GA8A 1UR3M 3P2VA 2HV5A 1AFSA 3CAVA 1RY0A 4IJCA 3R58A 1ZQ5A 2IKJA 4FAMA 1EL3A 1RY8A 3DOPA 3KRBA 3LBOA 3V35A 1AH4A 2I16A 3LNMA 2IPWA 4Q3MA 4WGHA 3QKZA 3WBWA 2F2KA 3GHTA 1T40A 5LIWX 3GHRA 1IHIA 4LBRA 3ERPA 1A80A 3CMFA 3ONBA 3LQGA 2IPFA 4FA3A 4LB3A 4LAZA 2DUZA 4R9OA 5M2FX 1YE4A 2PDIA 4JIHA 3UZYA 4JTRA 3CASA 4GQ0A 3LEPA 4PUWA 2BGSA 4WRHA 3R8GA 3EAUA 2R24A 3WBXA 3MB9A 2HDJA 3UG8A 2PDPA 3V36A 1AH0A 2INZA 4JQ4A 2J8TA 3UFYA 1PWLA 4MHBA 4JTCA 5LIXX 1SM9A 1QRQA 4Q7BA 1GVEA 4GIEA 5AZ0A 3UZZA 3WG6A 1LWIA 4XO7A 2PF8A 3N2TA 2ALRA 4YVXA 1LQAA 5LIUX 4PUUA 2IPGA 4ASTA 3GHUA 4YS1A 2PDGA 1MZRA 5C7HA 2BP1A 1AZ1A 1RALA 2I17A 4RPQA 3M4HA 2IQ0A 2NVDA 2PFHA 3ONCA 4L1WA 4GQGA 4FZIA 4LB4A 3BV7A 4JIIX 4JTDA 2VDGA 5LIKX 3DN5A 1K8CA 2ACQA 4GACA 3V0SA 3M64A 3UP8A 1AH3A 2ACRA 2PDXA 4G5DA 4WDWA 4HMNA 4XZNX 1IEIA 1ZSXA 1PWMA 3O0KA 2PDNA 3V0TA 1R38A 3RX3A 1Q13A 2PDCA 4PMJA 4DBUA 1Z3NA 3R6IA 3UYIA 2PDUA 2HEJA 1M9HA 2A79A 2DV0A 2NVCA 1AZ2A 3R43A 1VBJA 1XGDA 4XZIA 4XZLX 3LZ3A 3UZWA 1J96A 2PD9A 3T42A 4QR6A 4AUBA 4DZ5A 2IS7A 2HE5A 3CV7A 5KETA 4H8NA 3R7MA 4F40A 2HE8A 4NKCA 2AGTA 5DANA 4XVDA 2PDYA 3CV6A 2FZBA 5HA7A 3V0UA 3EB4A 1US0A 3H7UA 2PDJA 2P5NA 3R94A 2PDFA 2IPJA 2PZNA 3G5EA 4I5XA 4EXAA 2BGQA 1X96A 1S2AA 1YNPA 4FALA 3H4GA 1JEZA 2CLPA 2INEA 2ISFA 4JTAA 4YU1A 3BCJA 2PDLA 1HQTA 2ACUA 2FZDA 2PD5A 3WCZA 3D3FA 1ADSA 3GUGA 3EB3A 3CAQA 4JQ2A 4WDTA 4YVPA 4GCAA 1PYFA 3Q67A 4GABA 4H7CA 4DBSA 1XF0A 4XK2A 3B3DA 2PDHA 1OG6A 4LAUA 2F38A 1X98A 3LN3A 1QWKA 2FVLA 1ZGDA
chains in the Genus database with same CATH superfamily
1W5MA 1NOUA 1C7SA 1BKSA 1W2PA 3E74A 1GZ1A 4MWAA 1V6UA 3MP3A 4C6JA 1Q6CA 1Z9AA 3N04A 4S3JA 4KWWA 1EIXA 3C2FA 1FA2A 1VJIA 4QBXA 3L4XA 3BLKA 4RKAA 4XKYA 3UA3A 4S1FA 2EHHA 3FYYA 1R47A 1CLVA 1Q66A 4CGTA 3THUA 2DH3A 3URAA 3GIPA 3FVDA 1M3UA 1DP0A 2EJAA 3KVJA 4LAOA 1EHAA 1R7OA 1EIBA 1K6WA 5JUVA 4HZMA 2FTYA 3SCTA 5FF0A 1W5OA 3BZGA 4G7EB 4MY1A 5AC4A 4I9JA 5FJPA 1F74A 1ZAHA 1EC9A 4H8VA 2JQXA 1C8VA 3DERA 3NNTA 4C1NA 2XGBA 4AD1A 3W7MA 3AWOA 2QMJA 2OSWA 2PLJA 3LS9A 5CPSA 3DFQA 2HVNA 4DAFA 4JEQA 4RLIA 1O5QA 4D6HA 4ALDA 2XSAA 4DJEC 4E2VA 4EWND 2VFDA 2IKIA 3KOFA 4G7EA 4HNCA 1J4EA 3N3TA 4RE4A 2PGRA 1EX1A 1B9BA 2Y7GA 3PZVA 3MMDA 1W1YA 3W3OA 3LHZA 3TYAA 4WSHA 1O6IA 1F05A 5D8ZA 1E4NA 2XN1A 4XZHA 3C3UA 4R7OA 2QVNA 4U3CA 3KXQA 1XJBA 1W17A 3UXDA 4OWGA 4MYXA 2PEVA 3NQVA 1SJDA 4LEQA 2FPTA 2YL8A 2OR2A 2GVYA 4LCSA 3DECA 1RA0A 1ZP3A 2QEZA 1QNRA 3PZNA 4B4FA 3DG7A 1H5VA 1UWUA 4GA8A 3N4EA 3OQ8A 3LRLA 4Y9PA 1PX3A 2R6OA 2QUMA 1OX4B 2Y5JA 4Q8QA 1CTNA 4B5VA 3UPBA 1A5BA 2CCRA 3M41A 3IIZA 3M6DA 4IPLA 3ARTA 2DZXA 1E43A 3RILA 4S3EA 3LNMA 5DXYA 3B40A 1Y0EA 1GZGA 1XGEA 1SW3A 3B0UX 3TC7A 1HKJA 3ZXWA 4E3VA 3GNDA 4FNSA 1T40A 4LNYA 3FA4A 1TFVA 3VKBA 4FS9A 4UFMA 4QDMA 1RJQA 4BF7A 1XGZA 3T4CA 2QUNA 1ZZMA 4JIHA 2QCHA 3TP4A 3WX7A 1TG7A 1PZ3A 3RJYA 3K8LA 3B8SA 4M7TA 5I3FA 1SMDA 1KXQA 4R88A 1N8IA 4WCJA 1YHTA 1OIMA 1BGGA 1AA1B 3E0WA 3CUXA 4D6DA 4RE2A 1DBTA 3BXWA 4JQ4A 2TODA 4XIMA 5EL1A 4MMWA 4PBEA 4G1KA 1LBMA 5ENLA 3OP2A 3VDHA 5HWMA 2W4XA 1VQTA 2ZRUA 3LHVA 1OFPA 2WSPA 4JL2A 4DYKA 1MXSA 3MDWA 4AISA 4GGHA 3TA9A 3SUSA 2P53A 1Y8BA 3I7QA 4EE9A 2QVHA 1UWTA 3W7JA 1R87A 2V3FA 2Q3OA 3AJXA 4W86A 4UQBA 1E0TA 1E55A 3HG4A 2XINA 3EPMA 2VDGA 1DQUA 4PTWA 4WUIA 2ACQA 1EJWC 3EX2A 4XSMA 5JBDA 4E5TA 1QW8A 2CESA 3A47A 1MYRA 3WEZA 4TXEA 2BLEA 3UZJA 3VIJA 3QC0A 2GUUA 4YTRA 2G4FA 3HPXA 3ANYA 4AC1X 4UTHA 1W37A 3RUBL 3GFYA 4I90A 3PFMA 5G5IA 4Q7IA 5HK4A 1KO0A 3WMCA 3HGJA 3R6IA 3LTPA 1V3IA 3BWWA 1KR0A 1BWVA 1BFNA 2NZLA 1Z44A 1HFBA 4US5D 2POZA 1DWAM 5BOOA 2AOSA 3KCOA 5T9CE 3WIJA 4KCTA 4LXFA 3TX9A 3TW6A 4H83A 4C5YA 2GOUA 5H2ZA 5I78A 4FF5A 4ZTYA 2FZNA 1HNYA 2OZ3A 5H8PA 4LUJA 2OO6A 1WUFA 1F3XA 3M0YA 3T09A 1Q8JA 1K8YA 3LPPA 1XRSA 1M68A 5DANA 5I3HA 1BYBA 4LH8A 3K1DA 1CXFA 2RDWA 2ZUSA 3E38A 1K4GA 3A9IA 3RHGA 4E2BA 5KZEA 2B7OA 1OFRA 1NAL1 1IWAA 1SW7A 1B30A 2ZDRA 1OCBA 2Y7EA 3WMSA 1G4TA 1XH0A 3VIOA 3MWAA 4V27A 3JZUA 1JEZA 1B3YA 3QLLA 3P0WA 3GB6A 4A2SA 1AW5A 2V67A 3AIBA 4PUEA 1UUMA 4B3KA 2PLCA 2ZRXA 3MPGA 2R91A 3W2MA 3AS3A 2J8FA 4UTWA 3K4AA 3QGAC 4MGGA 3EEGA 1JPIA 3GIYA 4JQ2A 2YIHA 3DX5A 1VPQA 5FAGA 1KNWA 4ZOCA 2VJXA 5I2UA 1KFJA 4Z2JA 4RNJA 1OFEA 4XK2A 1LQ2A 3SRKA 4CQ9A 4LAUA 2CEQA 3BJFA 4XAFA 4M5PA 3VABA 2CC0A 1QWKA 2FVLA 3RU6A 5EKYA 1LLWA 4CD5A 3GS6A 4WKHA 3UZXA 2A85A 3TFXA 1F4HA 1F9CA 4H41A 2ZWYA 5BXPA 4FP1A 1R6WA 5C2CA 1OB0A 2BWGA 4NVTA 3PZTA 1DXEA 1HJWA 4B91A 1Y5VA 1C9DA 3FDGA 2D2HA 4O54A 3QH2A 2A5HA 1TRIA 5DMNA 2J8GA 2H6RA 3UJRA 1FHVA 5A6AA 2ZADA 4HK6A 3PAOA 5JH1A 1WOBA 5FJOA 4DLFA 4GWEA 1IIGA 4YVVA 1DJYA 3AIRA 3TFCA 5EMYA 1YDYA 4R7WA 4IJBA 4P7RA 3KOXA 1RCOB 2O4MA 2W79A 1JXKA 3KUMA 1SPQA 2QAPA 4K7VA 1SVDA 1U83A 4YXGA 1FWJC 5FF7A 3B05A 1IT8A 2GQAA 2WVUA 1GK8A 2VC6A 4IGSA 1OD0A 5FEZA 3CL8A 5LZLA 3HN3A 4JNMA 1EKOA 2RH9A 3HB9A 1E6RA 4DY1A 3MUIA 1JXJA 4KWVA 3W24A 4OBRA 4ZQCA 5LKYA 1XBVA 3BW2A 3L7RA 3SUVA 1MI3A 3W7OA 3EKLA 3AXIA 4DO7A 5TD4A 2DJXA 3ANVA 2FH6A 2PTDA 1PTGA 2PDMA 4C6DA 4OHQA 1RV8A 1L6WA 2WKGA 1AJ0A 3R8HA 1FRBA 1H41A 3OZOA 4RDVA 4F0MA 4QJ1A 4IP7A 4XSLA 2VEKA 3N6QA 3QPYA 1RCQA 2WJZA 3GDTA 3TN6A 1E4MM 3DYPA 3R2GA 2VGGA 3UD6A 5K4ZA 3OODA 3TH6A 3VIIA 1U1JA 3W53A 1TWSA 3P2VA 1DE5A 2CLFA 4ZO7A 3N25A 4NAEA 2XG9A 1BGAA 1VENA 4HPGA 3TVAA 4JTLA 4Z1YA 3HURA 4FAMA 1OCNA 4RW3A 2QJIA 1R8LA 1J2WA 3KRBA 4PBGA 5FL0A 4Q7NA 2NLIA 3C2OA 4DPQA 3EWBX 2E1WA 3M44A 1E15A 5CGQA 2G96A 4ZXOA 4A8LA 1A5KC 2HNEA 3EA2A 4XD4A 3U7BA 4BS0A 2OSYA 1SZNA 4JHOA 3N9RA 4Q8PA 1C3FA 1FCBA 4UIOA 1TV5A 2BY3A 1FTXA 2C13A 4O1DA 3NPUA 4JTEA 3W29A 1N55A 4GZ7A 1B31A 3IJIA 2H3BA 3KLLA 2GJNA 2VENA 4QM1A 1VCGA 1GG0A 4B5UA 3BLIA 1A5SA 1LL7A 2PAJA 4PTDA 2NUXA 1AH0A 4UTTC 4ICNA 4JCLA 4C6NA 4DLMA 1H4PA 4PB5A 3OBKA 1SM9A 3PPFA 1GVEA 3FCPA 5A8OA 3T7VA 2OZTA 5I09A 1ZLPA 4URIA 1P48A 1OFOA 1SO4A 5F4WA 2ALRA 2A3CA 1QI4A 2DGAA 5HPCA 1VYPX 3EPNA 2D20A 2EGZA 1NARA 4IX2A 2J27A 1LLOA 1DJGA 3GTNA 4DWSB 4DPPA 1MZRA 5C7HA 3V5FA 1I45A 1M7PA 3W2NA 2OVLA 1UPMB 5G1YA 5AYBA 3R8RA 4IT1A 2DDXA 3NZ1A 4JIIX 3V16A 4MUPA 5MKGB 1CXEA 3V0SA 1HKVA 1T5AA 4CU8A 4PEEA 4MZ8A 1KM5A 3SO7A 5BYWA 4G5DA 3S8HA 1NOFA 1YBQB 1UKQA 5I00A 1ZSXA 1OYCA 3PPCA 1P4CA 1R38A 1O94A 1VIZA 3W1UA 1CXIA 3PUGA 4PEKA 1H1YA 2J7DA 5C54A 3F5LA 2P8CA 3H6OA 1UCWA 2QAFA 3UYIA 2DSVA 3S0CA 1EFZA 1W3TA 4CNOA 3O7UA 3GXDA 2NV2A 4L9XA 4IHCA 1HKIA 2DT0A 4XZIA 3PTDA 3C2YA 1FP9A 3UZWA 3HZ3A 4BQ5A 3N34A 4WY0A 4L4PA 3MKKA 5D05A 4BA0A 3TR9A 1M6JA 4P8XA 3PUDA 3ZLFA 5FJRA 5F2IA 4IWWA 1EZ2A 5LA2A 4NKCA 4AIUA 3OHMB 3LHUA 4LNCA 2W5FA 2IUZA 4X3ZA 3WDIA 5HA7A 3NIYA 4AF0A 2GK1A 1J5SA 3GR4A 4B3LA 2EPHA 2OB3A 3TYZA 1NWTA 4ZE5A 2V2DA 1V3HA 1ZBCA 4KEUA 1E56A 3P67A 4JY8A 4XTIA 4LPCA 1IGWA 3WDRA 2VEIA 4NZ5A 3TYDA 4F0KA 4MWAC 5BWFA 4DRSA 3P60A 1KWKA 2WSYA 3IJ6A 3DI1A 1OF8A 2BB0A 3NDYA 3ZJ6A 5REQA 1PUDA 3GVGA 5GNYA 2BDQA 3TYCA 2UY5A 2OKTA 1F6KA 4CEUC 3ITVA 4HNLA 4DELA 5EGRA 4ZOBA 1PYFA 1A5OC 4DVOA 1UA7A 1W3LA 4O15A 1W56A 3WNMA 2XVLA 2HPIA 2HISA 5D30A 3MS8A 2ZRZA 4CD8A 1XIIA 4FXFA 2QJMA 1ZGDA 5E6ZA 1S2UA 4TO8A 1PKMA 3RR4A 4HB7A 5H1WA 3QHOA 3W2UA 3FS2A 5TNVA 4A8RA 2Y6ZA 3TUUA 4GVHA 5D2XA 3W1LA 3NQGA 5K7JA 1KBBA 4AZCA 4DF0A 1NF0A 2WNZA 2HQAA 4K37A 1EPXA 3WSUA 4G2DA 2GVEA 1VFHA 3TWAA 1KKOA 2DW7A 3BUVA 2D2GA 3F1QA 4WJXA 4PMQA 1E5JA 4JTGA 1V0KA 1HKWA 2FDSA 1JVNA 3WQ5A 2ZZ5A 3WFLA 4KS0A 4E8CA 3GXTA 3DFTA 1JYNA 1LM1A 2J7HA 5IBXC 3G24A 3CH9A 5HJLA 4YTTA 1HW6A 3CUGA 4EANA 3OEXA 5CCZA 3ZO9A 2O9PA 3CHCA 1EJUC 2OGYA 3ELFA 3NSMA 4UQ9A 1R5YA 3IIXA 2J79A 4FXRA 4AX7A 3LUTA 1FY6A 4MPQA 5FSDC 2REQB 4M6QA 2A3AA 3RCNA 3UEQA 3O07A 1EJVC 1G7VA 1OABA 1WB0A 1EEPA 1J0YA 4FX6M 3L2IA 4PULA 3H21A 1ZRQA 3LLFA 3A12A 1HX0A 4KIEA 3LPGA 3GE7A 1QU4A 2MUCA 4BWLC 4IMEA 1QPRA 3H12A 4HKPA 4WDUA 3VDAA 1RD5A 3BMVA 4HTBA 3CMJA 2XFYA 3G1SA 3PWGA 1TX0A 3II1A 1UH3A 2NX1A 4EOUA 1J6PA 3AMCA 3N29A 4P61A 3R58A 2ZIDA 1QI0A 2YDAA 4IPPA 3VDCA 3IGXA 3LMYA 4K8HA 1YDOA 4F2UA 1UWQA 1V6VA 3WLPA 2DPEA 4PMUA 4LBUA 3O9NA 4NXSA 4R53A 3N9KA 2FGLA 5DQPA 2I9EA 1U2YA 2WC3A 5GJMA 3I6TA 1G5AA 2Q6ZA 5K9CA 3VKDA 3GAYA 3ARWA 3T0CA 3UU0A 4MJ4A 5HUPA 1A80A 1VPYA 5C7VA 2R1KA 3UWVA 4FOUA 4UTWC 4V28A 2CNCA 3XINA 5D09A 3EOLA 1W8GA 1FWFC 5A2AA 2PTXA 1SSDA 1VZWA 2V81A 2RGMA 4D8ZA 2PDPA 4XX6A 3ZVHB 1ODZA 4Z17A 3PTKA 2ZYFA 5I03A 2H90A 3MZNA 3R79A 1E4LA 4MHBA 4EAMA 2ZTJA 3HPAA 2Y63A 4GNVA 1S38A 3UZZA 5FJIA 4L1GA 1SO3A 1TV7A 1XLBA 5HAOA 2A1YA 5AHLA 3GTXA 3WLQA 3TSBA 3DCPA 4IF2A 1V6XA 4GJJA 4E4FA 1AUSL 1UC4A 3KM8A 3O6CA 3S5ZA 3KOZA 5EYWA 4OKDA 2EF9A 3WBEA 3V7PA 1AZ1A 4OV9A 1MUWA 2IQ0A 1XD0A 3M0XA 4Y9NA 3I3DA 1FWHC 3PJTA 4FZIA 1O68A 3OBEA 4EPBC 3EMCA 2NQLA 3LRMA 3QFEA 3C8NA 3WY1A 3TMLA 5LHFA 2E3ZA 2NQJA 4O14A 4G6CA 1M03A 3R4IA 3W2KA 3AS0A 3TN5A 1HJVA 3DYOA 5DT5A 4IFRA 2VYOA 3WDQA 2QQ6A 4RXFA 3MBDA 1I60A 4O1FA 1WDPA 3V0TA 1HJXA 4WHBA 2GSHA 3TJLA 4LX4A 7REQA 2BHYA 3S9YA 3TKFA 3UXIA 4AZCB 2QHAA 3BE7A 3G22A 1G4EA 4XD3A 3L5MA 3BDKA 2P8BA 2Y8UA 5FACA 1A4LA 3ITCA 4G9PA 4Z1BA 3WF4A 5G1MA 1REQB 2VFEA 3HO8A 2DZBA 2NVCA 1AZ2A 1GVOA 2GSJA 1TWDA 2YXGA 3IGSA 3NXLA 4DM1A 3STGA 2EEXA 2XH0A 3OA5A 3EWWA 1A5AA 4MY8A 4GK8A 2HZGA 2V5LA 3WDPP 1DIKA 1GJPA 1XIHA 4L4LA 3ZM8A 3VNJA 4QQUA 3UG4A 1E9ZB 4TQTA 1GW9A 1S5TA 2PGEA 1Z48A 3WZ0E 3TW9A 5DRIA 3S1XA 5KETA 3ZJ7A 4Y9AA 4CUCA 4W7UA 1LWHA 1YMYA 1UR8A 2OU4A 4GY0A 2R1PA 3DFSA 1KM1A 2WJDA 4C60A 2PDYA 1NDYA 3KBMA 1H5YA 1K7EA 1F7BA 2W67A 5I3IA 2EKGA 3MHFA 3CZKA 1JPDX 5EFFA 4AWSA 3S83A 3MBFA 5HBFA 3UWUA 1TJ1A 2PDFA 3QR3A 2G37A 4I5XA 6XIMA 2XH7A 4AU0A 5IFPA 1BLIA 8A3HA 3PTMA 2TMDA 3W72A 4RDZA 3F2BA 4OBSA 5G2WA 1WXZA 5DCEA 1UD4A 1BPLB 4JFUA 4JDBA 1HQTA 4CLMA 1E4IA 2GGHA 2E8ZA 2V2CA 3G1VA 4V1XA 3WCZA 1J0ZA 4AHOA 2XZ9A 2OX1A 2Y2WA 1LUCA 3JZEA 3PNUA 4GX8A 4DBSA 5F2GA 2G3MA 1H7RA 1Q6GA 4F48A 4C6LA 2F38A 4IGMA 4J3SA 2X1RA 4PH6A 3H2NA 3AIEA 3SFWA 3VDGA 4GUGA 2NWRA 1M04A 2I1OA 4ZCWA 1MW2A 2WBKA 2Z2AA 3SCOA 1H2JA 3QN3A 1FDZA 2OKOA 3E9AA 4DHGA 3MKVA 1X1NA 2C0AA 4O1EA 2PTWA 1FDJA 4NAEB 1NJJA 3UCCA 1XDJA 4W8LA 1N2VA 4A22A 2KZHA 5IHSA 4V15A 5AFDA 2NQ5A 2ISVA 3AYRA 1JRBA 3M0IA 3NFUA 3HGRA 3WLLA 5CAHA 1T41A 3U7VA 1YDNA 3LSBA 2O0TA 4GQBA 2HPMA 4RXGA 2BODX 4FB7A 4M1BA 4J28A 4ICMA 4P8VA 3USZA 2UV8G 2NSXA 1QPKA 4DO6A 3M0VA 1BXBA 1JPKA 1J0HA 2RJHA 2P76A 3S1WA 2GFTA 1XV8A 2YJQA 3C0QA 1RBLA 5JBEA 2YBVA 3H70A 3G6LA 1S1PA 1ZL1A 4D8AA 3HA1A 4QNEA 4M0XA 4S39A 4GH1A 4ICCX 4KERA 4AY1A 4EWJA 4AF0B 1ZUAX 3NSXA 4MZYA 4O52A 1GVFA 1VB9A 1KWGA 1A0CA 3P5ZA 3IRDA 4BQ2A 4CNTA 1S2WA 1BXNA 3C3NA 3PSVA 1C8QA 1V02E 3VI2A 4GH3A 3L9CA 4IQLA 4JR5A 1ZJHA 1BYCA 1TWIA 1CX9A 4HN8A 3DOPA 1J0KA 1W9PA 4ADUA 3LCGA 1OGGA 1C29A 3M16A 3GU1A 2DW6A 4FLRA 1GOMA 3EXTA 3EWDA 1OIFA 1L6YA 2QDHA 4O10A 3TTOA 1H51A 5E93A 4JFTA 3BG3A 1V02A 4ORIA 5FL1A 2F8QA 2Q8ZA 3G1HA 3OB8A 4P8UA 1JI2A 5B7ZA 3BOLA 4S3FA 3OLIA 4H1ZA 5CPQA 3MMWA 2GGJA 1TIMA 1ZAJA 4M19A 3L2MA 3QZ6A 4R9OA 3K4DA 2RDUA 3MCNA 3TK7A 1TUFA 3PBVA 5FJUA 2W61A 3CHDA 4YPJA 2A7RA 1EBHA 2HMCA 2C7FA 3LERA 1GVSA 3H2FA 3WLSA 1JCJA 1UD6A 3V36A 3S5YA 3M0ZA 3VZZA 1XYAA 1VIWA 2R82A 5CC3A 4HSNA 4QS5A 4QJ4B 4KFNA 1EJTC 5DY2A 5F2LA 3KWXA 4RZ4A 2O92A 5EMLA 3BTNA 4M81A 4H9UA 3SY1A 3LY0A 2VL4A 2QLYA 3CLMA 1U5JA 4A21A 5GJNA 4TIMA 4GY7A 3ZVIA 4ZO9A 5M1TA 1LJYA 2PDGA 3E6EA 3M4HA 1EDTA 3OQEA 2PFHA 2TPSA 4MJZA 2GYIA 3U2EA 4LB4A 4HVXA 1XDLA 3P3BA 2WZEA 3ZR6A 1TO3A 1L9WA 3TQKA 3VNMA 1BWLA 4PN2A 4W8AA 4B16A 1B4EA 1ZBVA 2DZVA 2QF7A 4QISA 1YYAA 8RUCA 2YL9A 1XYCA 4MNLA 3JVAA 2CU0A 2Y24A 1PTAA 4UCGA 2YA0A 1ODUA 1R3YA 4UR9A 1F07A 1PWMA 1KM6A 3DESA 4MJ2A 2JK2A 1FBAA 1PKYA 3AHVA 2PDCA 4JN8A 4PMJA 2DP3A 1OC6A 3PY2A 4J3XA 1VYRA 2ZXBA 3EOEA 2JEQA 4PCTA 1WP6A 5A8QA 3Q4DA 5XINA 1LROA 3GG8A 1M9HA 5XIMA 3CYVA 2OLSA 2Z25A 4W88A 3WJWA 4KIRA 1GKQA 1XGDA 4US5A 1XG4A 4XZLX 5HR6A 3O6DA 2F84A 3E5PA 2A7NA 5CZKA 4AUBA 1SZRA 1T8QA 4IQJA 1W0MA 3STCA 4EP8C 3F4NA 1T7LA 1Y5WA 4PUKA 3S5NA 2WXDM 4ZQRA 5MHBA 1RK5A 2Z7GA 4P5UA 1JI1A 4WIWA 4W8BA 3K4WA 3RPTA 5DELA 3F03K 1IR1A 3EB4A 1US0A 2GJXB 3ZJKA 2X41A 1PHWA 2RUSA 4MDPA 4GBUA 3RF9A 3AU2A 3PANA 5AYXA 3TWBA 3TC6A 1I4NA 2ZRWA 4KEZA 4AD3A 3W86A 2XWEA 1QFEA 3BAXA 3E2RA 1VBRA 1UD8A 1GGOA 3DKLA 2DFAA 4O13A 3ZVHA 3WQDA 1O7AA 1KFCA 1GEHA 1DWJM 5LYRA 2Z0IA 3CHVA 2O4QA 2XGZA 3HQOA 1K9TA 3BGGA 3ZFHA 1U30A 3TYEA 5HUOA 3T9PA 3W02A 1EJRC 1PYMA 4RUBA 4PFMA 4LQ1A 3TZFA 3R1ZA 1BQCA 3CAQA 1LCOA 3POHA 4DNMA 3VMOA 1A5LC 3LPOA 3Q67A 1OADA 1HVQA 3PPHA 4A8NA 1FCUA 2HWGA 2UY4A 2OCZA 3NPWA 4HMDA 1Q2SA 3TNOA 5BROA 1H7OA 2J78A 2R9RA 3L67A 4D6IA 3CEPA 1JQXA 3W7PA 3ZWTA 5JH2A 4Z1CA 1UC5A 5J04A 4GUJA 4Q4PA 4FX8A 3KTXA 2I9UA 4E6MA 2JIEA 3FOKA 2OT1A 3EGJA 2HVMA 3BC9A 3HV8A 4IZGA 1IXPA 4IIBA 3GDRA 3APGA 2PU1A 4CD6A 1VFFA 3CXOA 5HULA 3KBJA 3M9YA 3N15A 3QQWA 4AZ5A 5HATA 3WQVA 3IJ8A 3EX1A 1P5BA 2BASA 3VILA 3Q58A 4KBXA 3H23A 4ERAA 3IS4A 3GKAA 3E2SA 2HBVA 1VYSX 1TJ2A 2V68A 3S1VA 3EOUA 4MB1A 4AHQA 4BI6A 3D3AA 1Z69A 4NJGA 2CPUA 4O28A 4H9MA 2ZOXA 2OEJA 3R11A 2CHOA 3UGRA 3W7CA 4JOMA 3T78A 1K77A 1QPQA 2JIWA 2QCEA 4XD6A 3ZSSA 1EF3A 3BGJA 3TTSA 4QX4A 5D37A 1LG2A 2E9BA 1BRLB 3WQ8A 3OLEA 1RJPA 4F79A 4UMCA 3UVAA 2FFIA 3A24A 5CKSA 2OYLA 4DF1A 1GPFA 1NY1A 3FGCB 3O05A 4LC8A 1V8EA 1JQVA 5C70A 4RPPA 4IPJA 4TR9A 1BVZA 1A3XA 3G6MA 2X1SA 1VKFA 3TMQA 1EL3A 5FF2A 4L6DA 1JCMP 4CCZA 4G1NA 2BBFA 4O50A 4CN4A 3QPZA 2IPWA 4Z42C 2V5KA 1DOSA 1KV8A 1NH6A 1X1OA 1QAPA 1FWNA 3AS1A 1K9DA 3DHPA 1KM3A 1M41A 1UWRA 4AEEA 2EPOA 3GXFA 2YGYA 3SCVA 5G4WA 3FHAA 2H9AB 4LAZA 1Q6LA 3I10A 3DYMA 4YMZA 1QW7A 1VRXA 5FCZA 3KVKA 2YOCA 4QEEA 2CHNA 1B3VA 5GNZA 3KL0A 2CKRA 2ZXQA 4QLKA 3TSDA 1WBHA 4C1NB 4JS3A 4U5KA 2X7WA 2ZBTA 4AY7A 4GFIA 3UR5A 1R2RA 5K4XA 3WK0A 4CN6A 2X42A 1VHNA 3IJ7A 3DHFA 3WENA 1EJ7L 4GLEA 2C14A 1YW1A 3CBWA 4ZR8A 2Z7KA 3EDJA 1OFQA 1TTJA 1HGWA 1JYXA 1J5TA 2YLAA 3UZ5A 4F9DA 3NYZA 4O0ZA 2J47A 4HA3A 4GIYA 4GI9A 3N18A 4UXDA 3VK5A 2NXIA 5LNRA 1GUVA 3RYSA 4U10A 3TA6A 3W07A 2E5BA 1VBUA 5LNUA 5JMUA 4HSHA 3NQFA 3LU2A 3SADA 1H11A 4FLSA 1ICQA 4GUHA 4TVUA 1P1MA 2XIOA 2TRSA 3TJIA 4GO8A 3STPA 3DFHA 3SJ3A 1XBZA 1NVMA 1OSEA 2ACRA 4JFVA 4PTNA 3S2NA 1V0LA 1CENA 4HMNA 7TIMA 3U9IA 2FQIA 1V6TA 1HN1A 4KRTA 4FLQA 5ABHA 1F3TA 5A95A 5BXTA 3F4VA 3WF1A 1D3GA 4DBUA 5BCAA 3LTSA 3CB3A 3FK4A 3THAA 3CO4A 2FH8A 2XHYA 2F6XA 3VKKA 1O95A 2PWHA 3I7RA 1B3OA 3T2PA 4AZBA 2HEJA 4H9XA 1JCLA 5A3HA 3C5QA 2TYSA 4ADSA 1U5VA 4O8AA 1HF6A 2YCIX 4OOUA 3UNDA 3URQA 3CQKA 1RHCA 5JU6A 5M03A 1Y65A 3LCFA 4U5IA 1JFHA 3RPDA 2V82A 4M51A 9CGTA 1QDSA 4AY8A 3UW6A 4CQBA 1IZKA 1WXJA 4M8UA 1DIOA 3R7MA 1CYGA 4Y7EA 3W1AA 1GNXA 1LDCA 3ES8A 3NG3A 1QMLA 2OSXA 2AGTA 3NGJA 1MW1A 4U28A 4K8EA 2JEPA 2CXEA 5K9XA 1W8SA 2C16A 3WH7A 1HVXA 3B06A 1DIDA 2QYGA 3HOJA 1S2AA 2VKZG 3LB0A 1W1B1 3S6TA 1SJBA 2YCLA 5TIMA 1RBOB 1BEUA 2BXZA 1JUKA 4AEOA 4QHRA 3SSZA 4QE5A 4FNPA 3TXVA 2UBPC 2ZVIA 1S39A 3QV7A 1MDLA 4GJIA 2VGFA 3LK6A 2PWEA 3QBUA 4NZ3A 2ZZ3A 1IV8A 4DWDA 4N9BA 2Y85A 3B97A 4H19A 1F8MA 5F1UA 1SFLA 1EDQA 3BSMA 1RJRA 4Y2WA 3TYBA 5L9FA 1XF0A 1XP3A 2YZRA 3DG3A 1H7XA 1ESWA 4ZQMA 1QASA 4HT3A 4DUOA 1QK2A 1TRDA 2O9TA 2E5DA 4N4QA 1OGBA 3H7RA 2GJLA 5I5RA 3Q65A 3WDJA 1HL2A 3SUWA 2H9AA 4QLJA 2GSEA 3NYDA 3FJNA 3VM7A 5F2MA 5ABGA 3ARQA 2GJPA 3UESA 5J5DA 2ZZ1A 3PFRA 2ICSA 1XH2A 3HG5A 3PZMA 4OTKA 3G1XA 1XHGA 4QG9A 2ZC8A 1MQRA 4GVGA 1Q6FA 4HP5A 2XSBA 1Z89A 3W7QA 1FWDC 3MW7A 1S2CA 1LL4A 3GTHA 4PMVA 4H6KA 3MWCA 1YPIA 2VGIA 3RG6A 4NZCA 2Z2UA 5CBJA 3M5XA 3BMWA 4H6RA 3DKJA 2A4AA 1JULA 3THCA 2CKSA 1EJXC 4YWIA 1B1YA 1LORA 1XXXA 4POCA 2VTFA 3NQBA 4MY9A 2UWFA 3O3RA 3LGEA 3I3BA 1ITQA 1VF8A 3W7GA 4M56A 5D32A 1FWSA 1IEWA 2IQTA 4XAPA 5EBUA 1VAHA 4N4PA 4FNRA 5LSMA 3VUPA 4FI4A 3KHDA 3MSDA 2A3HA 1UR3M 6A3HA 1MMFA 3GDKA 5DX7A 3PJXA 2Y5SA 4JX5A 3TV8A 3W87A 1OYBA 4G8TA 1LZOA 4OFCA 2CBUA 1ALDA 2VD9A 1NTHA 1LT7A 4EPEC 4B9YA 4AZ7A 3DENA 2YDSA 1AH4A 1TR1A 3QQ1A 3BLFA 1JG9A 3ARRA 4D6CA 1TVNA 3AI0A 4RR4A 3QKZA 4HOZA 3LM3A 1PEZA 1XIDA 3QTPA 3I68A 2CETA 1C8YA 3NQCA 3E3HA 1XIJA 4OUEA 3W74A 4CVWA 3FNDA 4JIPA 2XSXA 3VVGA 2XIMA 1WQ5A 2AQWA 3CEUA 4C65A 3CTLA 4WZHA 2PDIA 2D0FA 3IEBA 2R24A 1JL8A 3VOGA 4JYDA 4E3TA 1AJ2A 4YTUA 2O9RA 1SZGA 1I6NA 3MY9A 5GVJA 7REQB 1OY0A 4R85A 1AVAA 3LHWA 2WNWA 3G1FA 1ZJAA 4XQ6A 4YL2A 2E5CA 3FJLA 2QDDA 2GGIA 1OK6A 4GC3A 1FQ0A 4ZOEA 1CLKA 5CLTA 3WELA 1CDGA 3TIMA 5I02A 5FJTA 4YTQA 4CCDA 3GHUA 3A4AA 3CZGA 1P0DA 3QKEA 4B2DA 3PVFA 1W3JA 2OGJA 4HYWA 4L65A 3UERA 4PMOA 4QS6A 3VE7A 3B0XA 1XBXA 3AXKA 3W25A 2O7QA 4AD0A 1MNZA 2AMXA 1XICA 1EWEA 3M64A 4FSAA 2QZRA 1WPCA 3SIMA 1YRRA 2DQXA 2ZX6A 5D4YA 4PGLA 4AWEA 1NM9A 3S2CA 1RD6A 5FD0A 4DO4A 1WBJA 2OWCA 3JS3A 4C6CA 3LI0A 4LW7A 2VVSA 1HO4A 3T2QA 2WMJA 5CZTA 1GOWA 3RCYA 2VOMA 1JYWA 1NP2A 1NU5A 2VZSA 3FV9A 2C71A 1QWGA 4JKMA 4JFWA 2RKXA 1HGYA 1TIWA 4D6EA 4A3HA 1UZ4A 2ZUWA 4DX3A 4NUWA 3EX6A 3ABRA 1ZS2A 3CHFA 4O12A 2ZRYA 4JGDA 1OVDA 1T8XA 2HE8A 4Q4SA 4C1LA 3R0KA 4HTYA 3BCDA 3MSYA 3QMRA 4PMRA 5J8LA 1IZJA 3BAJA 3D5HA 3AWNA 3GXMA 2NXGA 1ZCOA 4RNIA 2CXGA 4MPKA 1MZHA 2VC9A 3GTFA 3OLGA 3R94A 4NX0A 4I7WA 1XG3A 1NFGA 8CGTA 2C79A 2E0PA 4GKLA 4ACYA 4MB5A 3M43A 1KRAC 1VFSA 3GYEA 3PTQA 1TX2A 1ME9A 1OX5A 1E6PA 3GC2A 2OZ0A 4KRZA 1LWJA 3WLHA 4LVBA 5EFDA 2VDIA 1D3CA 1RQEA 1J10A 1J18A 3AMDA 3SSJA 4HPNA 2VCBA 4MUZA 3R13A 1E6NA 1U22A 4ZQNA 3G8RA 1DWGM 3S2MA 3GUGA 4F2BA 3OGVA 4TV5A 4YNGA 1AK5A 1JCYA 1TVPA 1WX0A 4IIEA 2J74A 2WBGA 2Y8VA 3FAWA 1SGJA 3OYXA 1TWZA 3U3HA 1X98A 3HJZA 4ZSUA 5EMMA 3TOYA 5I3KA 5LA1A 1UHVA 2E09A 3FN9A 4M6VA 4XZMX 1W9BM 3SQSA 2VZVA 4PFHA 4I7UA 4GMEA 1TCDA 3VZYA 1VLIA 4PMZA 3TN4A 4LUSB 3B8IA 5EU9A 3R10A 1GCYA 4RNFA 1E0UA 1TQJA 4TV6A 4MIMA 3NEVA 2Z6IA 1CB7B 3UJ2A 3ARXA 1UR0A 3WNOA 4UZUA 5EMJA 3F4CA 1QUMA 4ZB0A 1CBGA 4DO5A 2X2GA 1SR9A 2Q8XA 3QY7A 2J7GA 2CITA 3TLQA 3IPWA 1PZ0A 4QDPA 1UKTA 2QR6A 5LNVA 3FAXA 1XRTA 1HKKA 3SEPA 3QV6A 2ZUTA 3CC1A 3IVTA 1BAGA 1KFEA 1OM0A 4JY9A 1C9WA 4WY0B 3VGEA 3O0FA 1X7FA 2QGYA 2VFFA 2YPIA 2GDVA 3P6LA 1GTEA 1TPB1 3L23A 4LRTA 4PCSA 1UIPA 4J3VA 1QOXA 4JQAA 3T81A 4AX6A 3WMLA 3ZQ9A 2DIJA 4RDYA 4LVDA 5EY5A 1KBIA 2C91A 2JKAA 3AYTA 4B90A 4KGJA 3UR8A 1TA3A 1W91A 5LXEA 2I14A 4KWUA 1EO5A 1IE7C 2WM1A 3AC0A 3TQPA 3W2LA 3PBWA 2FVMA 3MTWA 4Y90A 4K39A 5BZAA 3CV1A 3S9IA 3CB8A 5DLCA 4S3KA 3W37A 4LY4A 2W91A 5AC6A 1J8VA 1EYEA 3S47A 1XYFA 3MUAA 2B81A 5JXQA 4P2VA 4QE1A 2V63A 2ZA3A 4JTJA 2E6DA 4PB4A 1XQLA 1KW1A 4R33A 1O5RA 3GVRA 5BNKA 1XBYA 5ABFA 3BQ6A 2RFGA 4WGHA 1KFBA 4NILA 1D8WA 1D2KA 3N1AA 4OQVA 2VGBA 1XRVA 3EX4A 5C9XA 5C2XA 3SM0A 3LA4A 3BAKA 3DC8A 3BCFA 4KMQA 2ZRVA 1IHIA 5XIAA 1E0VA 5CQ1A 3CUJA 1RXOB 3CQJA 4E8DA 4NZFA 1VD6A 4AZIA 3M5VA 3RIKA 1NIUA 3OBAA 4FA3A 3M7SA 3W4RA 2DUZA 2E1DA 3UZYA 3LEPA 4PUWA 2BGSA 2CFFA 3HBLA 4WF7A 4UZSA 3S9ZA 2G4JA 2XDFA 3BW3A 2CW6A 1SW0A 5CSUA 4ECLA 3P81A 1SZFA 3L5LA 1EPVA 2WVSA 3DC0A 4UMAA 3USBA 3Q94A 1HO1A 1IWBA 2J6XA 1ISZA 3NCOA 1IT0A 3VD7A 1EF2A 4TU1A 1GVRA 3P5YA 5A8PA 1R9ZA 2ATSA 2Z28A 5HJYA 2CHRA 4HU3A 4KT2A 3FY1A 3IIOA 4M7SA 4QG8A 3W7NA 4IUGA 1QO2A 1GKRA 1XLCA 3VU2A 1VJSA 1SFSA 3C4UA 1PV8A 3ONCA 1MEIA 1ONEA 4W9TA 2QT3A 1TKKA 4O19A 3DHUA 2G3JA 5IDIA 4FF7A 3DN5A 1K8CA 2O9OA 4E2OA 2W66A 3TW7A 1KLYA 4IICA 1JIBA 1SJAA 2QV4A 4YTSA 2PDXA 2WV8A 1XLIA 3EB2A 1LL6A 3AIWA 1R3VA 1YQ2A 1DE6A 3HGOA 3N2MA 3POCA 1PAMA 3DIPA 1KCZA 1AJZA 2PDNA 4D1JA 3AZTA 1QXLA 4A6GA 1J12A 3W00A 4C91A 4BHYA 1R2TA 3MHGA 3SGUA 4GYPA 4LSBA 2FZMA 3XIMA 3GTIA 4H6EA 1VCFA 4W7VA 3H4XA 3SCQA 2HRWA 1UKOA 1S2VA 4QCEA 2DVXA 3TTQA 3RLGA 1NWUA 4EF9A 3KE0A 1O60A 2HS8A 5HMSA 4LYPA 7ODCA 2DSZA 5CPNA 2IS7A 3VX1A 4WOQA 4DJDC 1X6NA 2GQ9A 2J77A 2NQ9A 4G56A 1ISWA 2YBUA 3OVGA 3LHTA 3AUOA 3PBGA 1Q7QA 3PS7A 1MUCA 1TTIA 1NDZA 3GY1A 2Y89A 3LGDA 4JDYA 4BI7A 2FZBA 3N2CA 3PJUA 4AQLA 2DSKA 3MUZ1 4BJHA 1KTNA 1CXKA 4GNJA 4HCHA 1TA3B 1Q2RA 3E0VA 2FKPA 4C6IA 2DZSA 4XZ9A 1UMLA 3S5OA 4Z1AA 4NAFB 5CZSA 1AODA 3NQAA 4KESA 4NSBA 4FALA 1YEYA 3QMSA 3WFAA 3GVQA 3EMZA 1JUEA 5I3GA 5HWNA 4ORMA 2NV1A 4QEHA 5LGXA 1JUBA 1Z42A 4OZOA 4PCPA 1ZP4A 2WJFA 1ADSA 1FHDA 2VC5A 3G8EA 9RUBA 1W3IA 3EB3A 1V3LA 1BHGA 1YPFA 1ZPTA 3LXBA 4PZVA 3VINA 4H2CA 3L68A 4UTTA 2OJPA 2ZQ0A 4QAWA 5DMMA 1EOKA 1R85A 2DZAA 2ZXDA 4AFYA 2R1LA 3RLVA 4J3ZA 5KZMA 6TIMA 5A8GA 1ITXA 4DF2A 3P61A 5AHMA 4JN6A 1OQFA 4DBWA 1Q4WA 4U31A 4O0QA 2XTKA 2QIWA 5C5YA 1SJCA 3LSCA 1KD0A 2VX5A 2YDRA 3A23A 1WKYA 5IDZA 2WANA 3WD2A 4E2DA 3WH6A 2WNQA 3MUXA 4PSRA 4QSHA 4UTMA 3O06A 5FEPA 2GZXA 1WDSA 1TMLA 1H7NA 1Q5MA 2GLKA 5E5CA 3W81A 2F6KA 3QZAA 1JNDA 4A2RA 2FHFA 4RL3A 5DN1A 3U8GA 2FHBA 4HPXA 3W76A 4CD7A 1S1RA 3JR2A 4UTLA 5A6TC 1IF2A 4HMCA 1HP5A 4LF1A 3FXYA 1W5NA 1GVIA 3VNLA 3A3HA 4DJDA 2E77A 4Q4QA 4R5EA 3QSTA 3ISIX 2DZTA 3F4DA 5C0QA 3RX2A 4IX0A 1W31A 3PN8A 1J0IA 4GHRA 1JDDA 1UWAA 1K9FA 4DJDD 4L56A 2XVKA 1WYIA 1XLKA 1XCXA 4D8LA 4QDWA 1VFLA 3DI0A 1UKPA 1YPXA 3B8DA 5CSYA 3RO8A 3LQLA 4J4KA 3WQWA 4LRSA 2Y88A 3FA5A 4PODA 3TAKA 3H8AA 2W92A 3A4XA 5AOUA 4DIAA 5C2GA 1QBBA 3CIVA 2PBOA 4OOZA 4O0KA 4DYJA 2WK2A 3HQPA 2JKEA 4RW5A 4F0RA 4DJEA 4GQRA 2G41A 4RK8A 3WLOA 5G1TA 4N02A 1JDCA 2EXOA 1QHPA 1AFSA 1QW9A 3U48A 1QK0A 5E9XA 3VOIA 3BO9A 4GRSA 1UKSA 3CIXA 4LV4A 2PWVA 1YKWA 1SUXA 3RMJA 3GZAA 4OUIA 1FCQA 1JD7A 5AYYA 1S5VA 3AFBA 4LYQA 1YNYA 2YFNA 1MXGA 3RRAA 3B9EA 3GAKA 1R2SA 1I1WA 1MSSA 4J5NA 5BRQA 4LOCA 3B0YA 2Z1SA 5BU6A 4HNNA 3NQDA 4F4RA 4PUNA 3UR2A 1KCKA 4FOJA 1NFBA 4NG3A 3C2RA 4LB3A 4H00A 4NY2A 5JQ9A 5DEZA 2V2HA 4JZ5A 4UNLA 4WRHA 1GONA 1DJXA 3WBXA 1G0CA 3L4YA 3DZ1A 4F0LA 1PDYA 3N11A 3G0SA 1TPDA 4GZJA 1BVWA 4QJ5B 3T05A 3UFYA 4AMCA 2V9DA 3A9BA 1SSGA 3WG6A 1W3HA 1I75A 1LWIA 3OVPA 3LNPA 4BF5A 4O53A 4J27A 2GVGA 3A6OA 4ATWA 2VEMA 5D9NA 3U4AA 2V0TA 3B8TA 5LHEA 4YCPA 3QQ0A 2V3EA 4GD0A 4RPQA 2DVUA 3UNTA 1B3ZA 3WLTA 2BV9A 3GNOA 1JZ7A 1PZ2A 3BV7A 4H8UA 3DFNA 1UD5A 3QPEA 1E73M 4LUYA 3WJYA 4K6AA 4CN1A 3QLDA 2AKMA 3I4EA 4DN1A 1PXGA 1E1FA 1D8CA 1H50A 4KPLA 1VFOA 1PX8A 4A3QA 1WDQA 2OPJA 4IXXA 1J93A 1AH3A 4AZGA 3TCSA 5I6SA 2ZCGA 2G97A 3M0LA 2B7PA 2GWGA 3W7LA 4LYRA 4DUVA 3PUOA 5ECVA 3SCSA 2QCDB 3W6LA 3UXLA 1XH1A 2G8ZA 1MO0A 3HU7A 2GJRA 2W3ZA 3U57A 3SUTA 3LBMA 4X63A 4O57A 1P1XA 3UA4A 3GDBA 3SCNA 2OG9A 2Q02A 3KTCA 1J96A 1H1NA 2PD9A 1VFTA 3K1GA 5C55A 2BMBA 2EG6A 3EDFA 3AYVA 2P0OA 3H22A 4X0NA 1FVPA 3O6YX 1NQ6A 2QCDA 2EJ1A 1TZ9A 3ATZA 3UCQA 5A5WA 1OCJA 3T08A 4GQQA 1W54A 4EXQA 1ICPA 1OBAA 5EB8A 1Q3NA 1GVYA 4A3YA 4I7VA 1THFD 1J01A 3BLDA 1VFUA 4RDWA 4RX0A 2ABAA 3CV6A 4NT0A 3R0UA 1KRCC 4Y9OA 1AG1O 2VC7A 2ADAA 2Q3RA 4Q6JA 1E51A 4QLLA 3OU8A 2ZKMX 4CCCA 1G69A 4X61A 1J0JA 2GDQA 2OLAA 2A6NA 3IACA 3R25A 4WXYA 4EXAA 1TZ7A 2Z26A 1WDDA 3VD4A 5HNRA 2CBVA 4GY1A 4WKFA 4J9JA 1WXYA 3B4YA 2XIQA 3R12A 3DAQA 1VC4A 2CLPA 2INEA 1FH8A 2WO5A 2BFGA 4YU1A 3PBUA 3SY8A 5BMXA 5TBOA 3G3DA 2V30A 1CGVA 4LS1A 3UF9A 2O56A 1H62A 3CJPA 3IVUA 1CIUA 3KWSA 5GNXA 3HV9A 3N19B 3QYSA 1HXJA 1XFBA 3JW7A 3OVRA 1LBLA 3TONA 4UQAA 4GCAA 3NJ3A 1I1XA 3KRZA 2YSWA 4JYFA 4US6A 5MKGA 2PDHA 4GCXA 1NDWA 4MOZA 3M0KA 3N13A 5E9AA 3LN3A 2V3DA 3P0XA 4QFUA 4OU1A 5E70A 1JR1A 2A21A 1QR7A 2B31A 2X0YA 5HNUA 1UBSA 1DKWA 3FKRA 4CU7A 5CC7A 1XPGA 1VEMA 2QW5A 3S46A 4FO4A 2KAUC 3WQFA 1WOAA 3TTYA 1EGVA 2FZ8A 3RN6A 5G4HC 2GK1B 5CPOA 4K1WA 2XUCA 5BWAA 3W6YA 3W82A 3ARVA 2PE4A 3O15A 4IMGA 5KZDA 1VP5A 4NNAA 3RJXA 4I8DA 5D04C 1E3XA 3SUUA 2PB1A 3FIGA 3IUDA 3PB2A 3G1RA 5L6UA 3EKGA 3IGHX 3COTA 4R7JA 1LRQA 3UWEA 1OD8A 2VX7A 1A49A 3BQ5A 3ES7A 1PVNA 4X60A 1I9CB 4WY0F 1A53A 3VZXA 1MRQA 3NVTA 2Z1BA 1A3WA 4PB3A 4O1AA 1A3HA 1FXPA 4ZO6A 3S1UA 1NWRA 3IJ9A 1JNEA 3M0HA 2Z29A 3ITYA 4I6KA 4JIEA 2ZTKA 5CPTA 2VWSA 1WA3A 4HZ6A 4E0CA 2BX7A 3ICJA 4LY8A 4Z2KA 1DTNA 4H3DA 1JDAA 1TR9A 3NL2A 1XYZA 3SRFA 4C6FA 1GQKA 5I23A 4ZSTA 4H7VA 1YBQA 1AQHA 3WBYA 1EXPA 2PDBA 4UUIA 1D3HA 3LCWA 1T6MA 4RZ5A 1YNQA 1VCVA 1KXVA 4BFAA 2QF8A 4IJCA 4JL1A 2VT0A 3ITXA 5I3DA 1R3RA 3VIMA 5EPDA 1EO7A 5I24A 4U3AA 1RA5A 3ARSA 3RFAA 3PJWA 2YBTA 1N7KA 4Q3MA 3BVJA 2X0SA 4XV0A 3IUIA 1GWJA 2F2KA 4XB3A 1P0BA 5LIWX 2CZ5A 3TSMA 4EACA 2X30A 5A6JA 2WWDA 5A69A 3WLNA 4DI8A 5AB3A 2CLMA 4AXNA 4AWUA 2ZVRA 5HQLA 4L4MA 2G3NA 1V7YA 1TPFA 4HPHA 4GYJA 2XH4A 4NRRA 1R3QA 1B90A 2P10A 3UQNA 3C2EA 4MLJA 4RV3A 5HXMA 2HDJA 2Z24A 1UA3A 3EBVA 2OMAA 2G5WA 3BK0A 5KEZA 2BS9A 3STEA 1NWSA 4LV9A 2WMFA 1XI3A 1XLDA 2NXHA 1A5CA 1IQ8A 2JBMA 4S2CA 1UH4A 3B9DA 2BVWA 1E6QM 4W89A 1SO5A 3VCCA 5IBXA 3E5BA 1CNVA 4ML4A 2J4GA 5FESA 4GUIA 1RZMA 1TWWA 2J24A 3U5UA 1VS1A 1M1BA 2MNRA 3NAVA 3H26A 3MA8A 3MJMA 2J9ZA 4JTHA 1LOSA 9XIAA 3MP5A 1EUAA 2FJKA 3SI9A 3T44A 3VD9A 2QV5A 3FLUA 4N42A 3UBPC 3DFYA 3N6HA 1E5NA 4KGLA 3G1DA 2XH2A 1G6CA 4PYSA 3IV8A 4NNBA 2CZDA 3LCHA 4WXZA 4XZNX 1CGTA 1ZBKA 1E3ZA 5PTDA 2CLKA 4I5RA 3A5VA 5FOOA 2ISWA 1EA0A 3PHAA 1IT7A 2FLIA 4GPNA 4IGHA 2INFA 4EF8A 1IIHA 2FYMA 3NR0A 5ECUA 3NVDA 2QPXA 3H54A 8XIAA 1O12A 4LVAA 4HHMA 1KRMA 1XUZA 4GZEA 4E38A 1EP1A 1FWCC 3L21A 3GW0A 5D9MA 3LOTA 1IXNA 3CQHA 1H3GA 4M24A 3DU0A 3WF3A 5HOSA 3PBYA 3BW4A 3N4FA 4LUTA 2I5GA 3C0SA 4S3BA 4AH7A 2XFFA 3W38A 1UWSA 5M3WA 4ZQOA 4WVXA 2NW0A 4IISA 4DUWA 2VWTA 3E2VA 4GXWA 5LA0A 4IIFA 5F1VA 3VDBA 4OE7A 4XVDA 4LT9A 4GG9A 4LJ3A 3GZ3A 3WH8A 1DV7A 1VEOA 3IV3A 3SY5A 2IW0A 1QT1A 4OVXA 4UWMA 1U5HA 2OLHA 5H8UA 3SJNA 5M17A 2QPUA 3HPSA 4H9ZA 3VGGA 3AZSA 3VIPA 2W62A 1DPMA 8TIMA 4DJFA 2QUVA 3QMTA 2ZE3A 1XYLA 2ISFA 2XVPA 1BTCA 1IYXA 2E40A 4UCFA 4XZBA 3H2OA 1KTCA 3D47A 1MNSA 3IVSA 1M7XA 2JE8A 3RLHA 5GPRA 2OQHA 1E6SM 1BRLA 3RR1A 4Y8EA 3PUEA 4AEFA 3NOYA 4GISA 1EOMA 3L65A 3OZYA 3QVQA 1V03A 4HQVA 4WJEA 3NDZA 4LUSA 4PBFA 3INPA 1RCXB 3ZS4A 4HZ7A 4KFPA 2VMFA 4MVAA 2TAAA 3M46A 1QPNA 5SWUA 2PODA 2QS8A 2WOQA 2HSAA 5IXEA 1RP8A 6XIAA 1HJUA 3GFZA 4JFSA 5DCDA 4WEVX 3V18A 2VR2A 3WEMA 2YA1A 1CPUA 1OJXA 3SCWA 3KVMA 3W9ZA 3ABSA 2C19A 3PF3A 1ZENA 2AAAA 3KDNA 1TUXA 4V1YA 4PR4A 2G50A 1XC4A 3LPFA 4FNQA 2VP8A 4EIVA 4ZFCA 1HTIA 4U4MA 2QDEA 2WKLA 4JIRA 2OODA 3MJYA 2ZDSA 2YXOA 1DQXA 3L4UA 2VQTA 4W5ZA 4WX2A 3W7KA 4MWAE 3TE9A 4A29A 2WCSA 3YPIA 1CGUA 1TPC1 1OCQA 3WLKX 1VBGA 4O8RA 4DWSD 2OT0A 3W6MA 1RPKA 1RK6A 4QRNA 4Q8WA 3S3GA 3UY7A 2Q09A 2PP3A 3OGSA 3LTYA 3FYOA 4B5XA 5LNSA 3KTSA 2A2IA 3VC5A 1BF2A 4M1RA 4HBKA 2NQHA 5HANA 3GBDA 1F76A 4NU7A 3ARZA 4P7QA 1VH7A 1DORA 5E6YA 1JJKA 3AROA 4JTKA 5I77A 2ZUVA 2A3LA 3GUWA 3RX4A 3NURA 1PIIA 1GG1A 2PSNA 4XAYA 1Y5XA 1S2TA 1XINA 2V5JA 4J7RA 3B0VC 1JDEA 1UBPC 1K8XA 2DH2A 4LYKA 3U6WA 1GHRA 4XG1A 4MLRA 2YLLA 5BRPA 3CAVA 1Z7AA 5BMWA 2CIPA 4JICA 4HMEA 2D2JA 2C3ZA 3BAWA 2AGKA 1DYSA 4IMDA 4Z0SA 4JKLA 1BQGA 1QOQA 2DQWA 1P0EA 4NJKA 2FGZA 2OFJA 1A0DA 3PB0A 1EGMA 1OGSA 3S4TA 1LF1A 1RH9A 4LBRA 3UJEA 1W9DM 3BGAA 4OV4A 3SCPA 5I7GA 4NYYA 5D02A 1PE1A 2VD8A 1PCKA 4NIRA 2VCCA 3WQCA 4XKMA 3QV9A 3LYEA 2WM0A 3GNXA 3WFZA 2Y8KA 4MAVA 2WMKA 4EVZA 2RGLA 4N6FA 3RM9A 1DJZA 3KBNA 3TNBA 3HGSA 3VIFA 2E6FA 3FKKA 1EGZA 4FXSA 2ALDA 4GO9A 3ZLHA 1CW2A 3OHIA 3VPLA 3SDOA 3W2JA 4Q4MA 4W93A 2QCFA 2INZA 3E49A 3KZSA 2UZ9A 2D3NA 2D69A 1XRFA 3NQ2A 2J8TA 3VKJA 1EC8A 5JIPA 1XL9A 1LRNA 2W9MA 5CPLA 3V1PA 4AYGA 4EAYA 3APTA 4A3UA 3ZT6A 1EUNA 2QMKA 2H8XA 5RUBA 2EG8A 3G3MA 5E1QA 1LQAA 1XC6A 2PTZA 2X16A 3GW3A 2IPGA 4ASTA 1IEVA 4YS1A 3RGTA 5I0DA 2EPNA 3PZQA 4Q4OA 1FWWA 1GQIA 4QROA 3CQ0A 3LBCA 1QNPA 2NWSA 1HT6A 3NQ7A 4QGCA 1S5WA 5CGTA 1K7XA 4ZXLA 4IIGA 2XIIA 4JTFA 3OGRA 3OJGA 2YZ5A 1P43A 1WZLA 1W2VA 3S5SA 3L12A 1OT2A 3H4WA 3PZ9A 3TXZA 4IQDA 3F5KA 1V79A 2HS6A 4FNUA 5BOFA 4BQ3A 2W63A 1C93A 3EEZA 1NSJA 1QNQA 1BG4A 4X22A 4QITA 3L2LA 3TQ0A 3NZGA 4PRWA 1RUSA 3BAYA 1KFLA 3UPWA 3NL6A 3QTGA 2QCLA 1E9LA 4QP0A 2DSWA 3BARA 1OFDA 1P0NA 3AXXA 4GXMA 2BTMA 1FKXA 5TF0A 3CT7A 4NZ1A 3T42A 3SR7A 4K36A 2C6QA 5DMLA 3QOMA 2PCEA 3WD3A 3WQPA 4C7GA 1ELSA 1LOQA 4Y6GA 4RV8A 4GYKA 4IMAA 3TTEA 1EQCA 4O4WA 1ONRA 3CV7A 1K70A 3AO0A 1M53A 1KTBA 2OEKA 1QI5A 2Z1KA 1XIEA 1E0XA 3MYOA 4UR7A 1XX1A 2WAGA 5DMYA 3WJXA 3SGGA 1ISXA 3N2OA 2J75A 3B0PA 1GEQA 1SFTA 5DCBA 4KFOA 1PSCA 4DXKA 5AY7A 1GYLA 3B8WA 1F5ZA 1CEOA 4NI8A 1VGAA 3VCNA 3G5EA 4U33A 1L8NA 1X96A 3N12A 1YNPA 1FH9A 3NZQA 4TX8A 2ZX5A 5DBUA 1AQMA 3QHNA 4Q8VA 2NT0A 2PP0A 7XIMA 1RPXA 4D9PA 1PKLA 3S6OA 3H53A 3GYCA 4D6FA 4IH3A 3ZYZA 2A3BA 3SN1A 4I3GA 4DZAA 1TPEA 3GIQA 4LGXA 1DXFA 4IIDA 1SR0A 2ONEA 4YLWA 1WCGA 3W7EA 2Y0FA 1GKPA 3W85A 4YVPA 4I9AA 1G7UA 3ABXA 3NZRA 4K7YA 2IXUA 4RJEA 5CG0A 3GNRA 4NJJA 5D2YA 2WB5A 4NZ4A 4F2TA 2Z2BA 5E09A 1ENUA 2BY0A 4MNMA 1TYGA 1B3XA 1CCWB 2C1GA 2JF7A 2XVNA 1HKMA 2XFWA 4B4HA 1XSKA 2IKHA 7PTDA 1EXBA 1U1HA 1TV4A 2C1IA 1TJ0A 4HCLA 3WL0A 3MC5A 3L66A 3VNYA 3GXPA 1JZ2A 2D1ZA 1AD4A 2FZ9A 3U2CA 4WK9A 5MF5A 1PJ9A 3GG1A 3AIQA 4WD0A 3E02A 3A13A 3NPVA 2DY3A 4XWUA 2E4TA 5CSSA 2PWFA 2RDTA 3GNPA 2ESCA 3VNIA 3WJZA 5TQLA 4QCFA 1PKNA 2VFIA 3FW6A 3TLLA 5C9RA 1M7JA 4EXBA 2DJLA 4CNNA 4BK9A 4XO6A 4JQ3A 4JAWA 5A2CA 5A1AA 5CZ0A 2CLEA 1QBAA 1G67A 4EPKA 2CLHA 2E28A 2HCVA 2XGIA 3PP7A 3C0JA 3FVMA 2ACSA 2QKFA 3M5YA 4LWWA 3UJFA 4AXKA 2XISA 3GX9A 3K30A 1EBGA 3GNNA 4H9VA 4JX4A 4HD5A 4QG6A 3RNDA 1LOLA 2WPGA 4S23A 3AALA 5A94A 1OC7A 3O63A 3IJQA 1UR4A 3NL3A 4MSSA 3VKCA 1XDMA 3ITTA 4UMBA 1PZ1A 4LANA 3AXMA 4FR6A 1LUCB 2WSQA 4W4QA 4XBKA 1GZJA 2IQDA 1ZALA 2X05A 3RU8X 1V6YA 3G0XA 5CJMA 3KCLA 3ANUA 4PUMA 2HV5A 4S3CA 1JPHA 1TCMA 5D2WA 1A4MA 5KITA 2QUUA 4H9YA 4C6BA 5AHEA 2J13A 1XCFA 1RY8A 1NF7A 1VFMA 2ON3A 3CWOX 1OF6A 5ABFB 1G4SA 2VEPA 3ME3A 3W83A 2GWNA 3CPUA 1WV2A 2I16A 1DJWA 1UJQA 1E1EA 4PL2A 4ERGA 1W3NA 1PCWA 1KFWA 3GHTA 4BQ4A 2QIIA 3QGVA 1C90A 4DJFC 3ERPA 3LDVA 1W1IE 5FEWA 1EB3A 3LGGA 4C7DA 1C8XA 3CZEA 1X7IA 1LYXA 3NXFA 3DEQA 3U5YA 3P93A 4UFLA 2GGGA 5CBBA 3P8JA 1PX4A 3KRSA 3VAVA 3XISA 4NHVA 3KDOA 2W0UA 4F66A 3M1ZA 3SURA 2VR5A 2XIJA 2A3EA 1JD9A 1WO2A 3CS2A 5A6SA 3GRIA 1H63A 3BLEA 4AIBA 4FX7A 2YYTA 4J3TA 4ZL1A 2QULA 5CEWA 1KR1A 1EEXA 3D46A 4MKNA 2OTDA 3SFKA 2E67A 2PF8A 1LLZA 5C6MA 4AIEA 2X2YA 5A8MA 2J88A 1RQBA 4IPIA 5LIUX 2I56A 3RITA 3LMZA 3MKCA 3U0HA 3EDKA 1QATA 4AMAA 1Q6OA 1DWFM 3MMUA 3T07A 4DM2A 4J3UA 4Q33A 1EYWA 5CZJA 1CLXA 1KGUA 3N2BA 5HMEA 4L4OA 3CL6A 4L61A 1C91A 3IK4A 3B4UA 3UP8A 3NO1A 2QJNA 3ABQA 1S46A 4AD4A 4ZGYA 4MKVA 3GQYA 2Y61A 2XFRA 1SQ7A 2RJGA 4Z2LA 5JBFA 2X09A 2DIKA 1GYNA 3ORWA 4OJYA 1P6BA 3WLRA 2PWDA 4GI6A 4KH2A 2WKJA 3KRUA 2PDUA 2VFGA 3IJDA 3GH4A 4CQCA 3IIPA 4GKTA 3UWQA 1AL7A 3NL5A 3WMBA 3GD6A 2DSUA 2Y7DA 3NO5A 4AVFA 1EDGA 1KRBC 4QR6A 5E0FA 3P80A 4TOQA 2PURA 4DYEA 5EMUA 3ZLGA 3VNZA 1B0IA 4H2HA 4J40A 4LALA 3W88A 3ARYA 4H8NA 4LUIA 3TYUA 3R0DA 4H6QA 2GOKA 2V5DA 1FHUA 2AL2B 5A6LA 2PLKA 1B4KA 1KM0A 4L64A 5C9ZA 2C8NA 4DEFA 4G7FA 3U2ZA 4O16A 4PE8A 1OX4A 4FIRA 3V5CA 4GVFA 2XPKA 1WKFA 3V0UA 3VNDA 3EPOA 1V08A 4F0SA 2PDJA 5CGMA 3REQA 3FEQA 3LV5A 3GR7A 4Z2GA 4DJED 4AAJA 1UR2A 4OBTA 1H09A 3HMCA 5LGZA 4WQ6A 3C61A 2QCCA 4HU4A 4I5UA 2XJ7A 3BCJA 4JEJA 3BLOA 2QJHA 4MAZA 4U2ZA 5EMKA 1KA9F 5FA5A 4JBRA 4ZFMA 4F3HA 1QHZA 3GC4A 1DJNA 3QM3A 1ISVA 3UWZA 3A5FA 1TV2A 2PI6A 3KLKA 3WK2A 3OPSA 1SYTA 3WH9A 3W28A 3QF0A 3QW3A 1K3UA 1O66A 3BG5A 1MW0A 2R8WA 4LC6A 4FEZA 3URNA 1PHQA 3AICA 2AL2A 3BANA 1FWRA 1MEWA 2ZUNA 4C6OA 1X8FA 1RR2A 4UFJA 3CQIA 4MFDA 5FEXA 2AKZA 5A6BD 1V3KA 2WHKA 3WL1A 3EZ4A 3KOYA 2IKGA 5HJXA 4ZB2A 4QXIA 5AZ1A 1MW3A 2CLLA 1EZWA 3WK3A 3Q37A 1GOIA 4HCDA 1GQNA 3MZ2A 3KW3A 2CLOA 2SFPA 3GWQA 1EHNA 4LS0A 4BEQA 2P1FA 3EOOA 3I6EA 2WCGA 2EPMX 4GX9A 2WPBA 4XZWA 4HA1A 3LD5A 3AHTA 5FI8A 1C7TA 3FYPA 4OT7A 1EP3A 2BVYA 2ZA1A 3O6AA 1GPWA 4S38A 3PZIA 4UFIA 1R9YA 3VMPA 4B15A 4M82A 2GL5A 4EKJA 1FUYA 3FX4A 4BWLA 3VFLA 2WQDA 3VGBA 1TPVA 4Z08A 3F7JA 3NGFA 4RCXA 3T4WA 2D3LA 2FGBA 2J7EA 3H2CA 3MI6A 3B03A 4HPJA 3W27A 1V0NA 2PLMA 2GUYA 4JQ1A 1XISA 3GHSA 1S3HA 3RM4A 2WZTA 2ZWZA 3NQMA 1KQYA 3ITLA 1AQ0A 3CO8A 3UG5A 1K4HA 2YKKA 5I07A 5D2TA 1UD3A 1UR9A 2QXWA 2ZX9A 3LCLA 5HNTA 2ZUUA 1K1DA 2DVTA 4XUGA 3VCRA 7A3HA 3EA1A 3C56A 1GJUA 1AW1A 1JYVA 9XIMA 1WNOA 1ZJBA 3U4FA 3NQ8A 3WN6A 2R14A 2I5QA 2X0HA 4X9SA 1W5PA 4PMXA 3UPMA 3K46A 1XSJA 1L0PA 2WVVA 2DIEA 5D03A 3V35A 4ONVA 2HK1A 3TEVA 3WUEA 3HG3A 4GIRA 6REQA 7CGTA 3L0NA 2OELA 2WMHA 4TX9A 3H2MA 1Z41A 4V33A 1BYAA 3PZUA 4DNHA 3EOSA 1UH2A 4ZZ9A 1V7AA 3EWXA 4INFA 1VBHA 4OECA 1A5NC 5BXRA 3ONBA 1F61A 2XIBA 3WEOA 2IPFA 1ZTVA 3GXIA 5C9WA 4CCEA 3BH4A 4P7LA 1UOKA 3S6DA 4XBJA 3UETA 2J9XA 2Q01A 2A7PA 1TSIA 3DBNA 3C52A 3BLLA 5D8WA 1ZBWA 1XLAA 1OT1A 5CJNA 4N7QA 1WKDA 3W7IA 4C6PA 3R89A 2VQUA 1ONWA 3Q2DA 4L9YA 2EKCA 1EA9C 2CERA 2VCAA 4Y8FA 4S3AA 5ABEA 2PRHA 4GUFA 1XLMA 5AZ0A 1LRTA 2WVTA 4UTUA 1FCVA 3MVIA 2WW5A 3VIHA 3AISA 4MNJA 4XO7A 3VFCA 4NZJA 1PB0A 3AU6A 3KBSA 2OQLA 1F73A 4MJMA 4BKNA 1W1VA 1T0OA 1I2RA 2DT1A 3OLDA 4FHAA 4MDOA 4PUUA 4GIAA 6ALDA 4KCWA 4IIHA 3CNYA 3AMGA 4UNKA 3V3WA 1K8ZA 1PIGA 4Y96A 4C7FA 1Q7MA 4Q8MA 2H8ZA 1TB3A 3RMEA 1RALA 2WHJA 4JHMA 4XAZA 4DJFD 5F7UA 1J6OA 3A4WA 3H24A 1TMHA 3BMXA 1CZ1A 1UWIA 1YXDA 3QGKC 5LIKX 1UYQA 4O1CA 2ANUA 2ATMA 2HJPA 1WZKA 1W5QA 3CH0A 5H8MA 3PBMA 4MNKA 1RAKA 2ISDA 2DU2A 1PDZA 1G94A 4LTSA 5BXSA 3STFA 1H0GA 4W85A 3CUIA 3QOKA 4PMDA 3W7DA 4NP7A 1UZHA 4C6KA 1Q13A 2EO7A 2E25A 1HUVA 2EG7A 3W0KA 1X39A 1E1CA 1QHOA 3EDDA 1RVGA 2FTPA 1GOOA 3MQTA 3BJSA 4NYUA 4XD5A 5H91A 3ECQA 2NQZA 4IL2A 4ZBCA 3ABOA 1VBJA 1IEXA 3PG9A 3T6CA 3M07A 3CV2A 3THDA 1MVYA 3LZ3A 4D72A 1ECQA 2QPSA 3G77A 3UXKA 3K5XA 3OVQA 3VC6A 1HJQA 4UC5A 2J7CA 1HZYA 1SU5A 2I5IA 3BPWA 4F40A 5T8GA 3ARPA 1XS2A 2PC8A 3KHJA 3N14A 4KKXA 3DXIA 1K03A 2YA2A 1ZNNA 2Q71A 3F2CA 3FJ4A 4LVGA 3VO0A 1ZFJA 2J7FA 1V4YA 1OWQA 1N8WA 2B7QA 1CT5A 4MZ1A 2WQPA 4UTKA 3GR8A 1V3MA 1E9YB 3MYPA 2F2HA 1J2BA 1TREA 1P7TA 1XR2A 3NZPA 1Y7VA 2P5NA 3B8UA 1ECEA 3OIXA 4IFKA 1Q85A 2G0WA 3KL5A 3CK5A 2QNEA 5M5DA 1YADA 1JZ4A 3EA3A 2OWWA 2FVKA 3GU2A 2VOTA 3AAMA 3K13A 5HDRA 4C90A 3IAPA 1I2OA 3SQMA 2IMRA 3GH7A 4ILSA 1KGXA 4IFKB 2FZDA 1OG0A 4O17A 2GPTA 4HIBA 1V77A 3JRKA 2XWDA 2GUBA 3GG0A 1GOKA 1NFPA 1YXCA 1KBKA 4X9YA 4WSJA 4LF2A 2ISSA 1R46A 2VX4A 1O5KA 1XKJA 4IPNB 3VIKA 1I2PA 4M6UA 3E96A 4S3GA 5KZ6A 2BNJA 1IXOA 1OG6A 3SCUA 4AWTA 1TVLA 2YCKX 1MRAA 3WNKA 3TCEA 4GI4A 4C5ZA 3N2XA 3SW6A 2OEMA 2GVJA 2V38A 4QIUA 1ISYA 1K9EA 3BSHA 5A6BA 3M5ZA 7TAAA 2DT2A 2Z1VA 1B3WA 1XWYA 2QDGA 2Q8LA 1QOPA 1JCXA 2XYLA 3FSTA 3B9AA 2GQ3A 2HVOA 4O4VA 4MYAA 5AECA 3QHMA 1LP6A 5IRPA 2WZMA 4PRRA 1LTDA 1B2YA 4BI5A 3AHYA 2I57A 4L7ZA 4MM1A 3H55A 4HOWA 1W1TA 4N0RA 2I7GA 5CAKA 2OWXA 3PNZA 4N9EA 3SRHA 1JDFA 2PDKA 3BURA 4MB3A 4KEMA 4Z0JA 2D2OA 1L2UA 3I7SA 4YCOA 4A3RA 4CVUA 1BD0A 4N2YA 4CNUA 3MSGA 3NQEA 3RLUA 4HNTA 3NA8A 3T40A 3I4KA 4HOXA 4HA4A 1E70M 1R3WA 5C71A 3HQ1A 2DORA 5CPMA 1TPH1 4FNTA 2P50A 1NQKA 2BOEX 1F3WA 5G2IA 3W26A 5EA9A 1VRDA 4PRTA 5A6KA 5GJPA 4ZMGA 3KBWA 5DO8A 3P74A 3LXCA 6REQB 3F5JA 4QJ3B 1RLCL 2FB2A 3RPMA 3VXGA 2QCNA 2ASHA 3NTYA 1YE6A 2YDQA 2V5CA 4HK7A 1JGIA 1MWOA 1SZEA 3T8LA 4S2BA 4UQDA 2F7FA 4JN7A 4E4PA 4PMYA 2FB3A 4F0HA 4XAGA 1XPYA 1Q4NX 1MUMA 4L6HA 3VUSA 1OK4A 4ZVJA 5AHIA 1ZQ5A 2PPGA 1A47A 4KWOA 2QCMA 4HHPA 1Q45A 4YYFA 1TE1A 3V75A 1XQKA 3HIJA 2YCEA 1CGXA 2J25A 4NL1A 1E40A 1DJIA 3W71A 3A64A 4I9MA 4PCFA 3WBAA 4QNWA 4YJ5A 3CWHA 3QEZA 3CIWA 4KCVA 5HR7A 3FXGA 1KC7A 4WKAA 3ZT7A 4IMFA 2PWUA 1QJWA 1POKA 2VEGA 3LM7A 3QZEA 2EPKX 3ID7A 1TJRA 3AZRA 1DQWA 3CUHA 4E4UA 1Q65A 5FSEC 2YX0A 1VHCA 3SZ8A 4EK7A 3WYZA 3P7YA 3UWYA 3CASA 1X38A 2YB4A 3O1NA 4IP4A 5DRCA 3R8GA 4Q8OA 2NX9A 3EAUA 1OZMA 3AHZA 5CG7A 4BCEA 3GG7A 4PTVA 3GBEA 1P7TB 2FPVA 1GYMA 2WYSA 4CQ8A 1IXQA 4AZ6A 5I3JA 1PWLA 1PL9A 1V6WA 1TZZA 4TVCA 4QAIA 3CM4A 3J7HA 3MANA 3CUFA 3RCMA 3WQ6A 2ZE0A 3UGVA 3OG3A 1FWAC 2WMIA 2B7NA 1DHPA 2DUAA 3VD3A 4AIOA 4J1OA 3GH5A 2EQDA 3W1NA 4HYRA 3MVTA 1GHSA 3EYPA 4I6VA 3N6JA 4HNUA 3GFXA 4I9TA 4UBPC 3VOJA 2NVDA 3L5AA 4XIAA 4L6OA 5B7YA 5HQEA 3LRKA 2YB1A 1TV3A 3IIVA 4GQGA 1GQJA 1CWYA 5LXXA 1MQQA 3GKFA 3DUGA 4JIQA 4PUDA 3W73A 4ADTA 4A4AA 3O16A 4IUOA 1XIMA 3BL3A 2D22A 2E9MA 3SN0A 3ZR5A 3OYZA 2WZHA 4LVFA 3ZT5A 1E9IA 5TAOA 4JXCA 3CGTA 3EXSA 4FPSA 1AW2A 2QJGA 2ABBA 2WLYA 3ENLA 1ADDA 3G0UA 5F4XA 3RX3A 1MQPA 1TJPA 2H3DA 3ITGA 1F4AA 3P82A 1NEYA 3GM8A 3MCMA 3CHEA 3PC0A 1H49A 1U1UA 4TX6A 3TJXA 2A79A 2DV0A 4KRUA 3S2LA 3S42A 1UJPA 1CXHA 1LT8A 2ZC1A 3WNLA 3SAZA 1H7PA 5KTLA 2CBJA 5A8NA 3QC3A 1UASA 3GXNA 3E0LA 3HPFA 4JTIA 1ITCA 3S2JA 4O1BA 1FHLA 3WF2A 4C6MA 2BG5A 4CU6A 4HU0A 2CZVA 3E12A 3W1XA 1P0KA 3CU2A 4L9ZA 4PTMA 3UY8A 3DGRA 2V6AA 4AD5A 4AD2A 2BSLA 4DWSA 2PBGA 4LFYA 1R86A 3M6YA 6TAAA 1R9XA 2L5HA 3QFWA 1KBJA 3GVVA 2VUYA 1ML1A 1SFJA 2CBIA 1V3JA 1SMAA 3I65A 4IFOA 1CXLA 1IGSA 3T0AA 2GJXA 3FGCA 1UP0A 1B54A 1YLVA 3W7HA 2BGQA 1XIFA 1E72M 3MV11 5DXXA 1QO5A 1E71M 3F4WA 1BSLA 3DBPA 1I2QA 2Z1XA 1L6GA 3MO7A 7ENLA 1MFUA 2VHLA 2OOFA 3CYJA 4FMVA 1LQ0A 1H0IA 1UP3A 3V4BA 1OYAA 3HTWA 2C1HA 3CWNA 3CZLA 4DZIA 2PF0A 1ME8A 2PD5A 3M0JA 3PWAA 3QY8A 2D73A 2MANA 1GT8A 4FK9A 3D3FA 2DZWA 4DBEA 1RQHA 3WH5A 3H2EA 3PAJA 1O1HA 4B9ZA 3AQUA 5U7SA 3L4VA 4C1KA 2DEPA 4MG4A 2FDMA 3NSNA 1E6ZA 3B3DA 1DWHM 2W6RA 3TR2A 4JCMA 2O7SA 1UQYA 1HP4A 1WDWA 1XSIA 4Q22A 3TDFA 1JF5A 4JTSA 1CECA 3LG3A 5CJ5A 1D9EA 1XIGA 3DFOA 1Q6RA 2NSOA 3MUCA 2GDUA 1DIEA 3WF0A 3DHDA 3PG8A 4K38A 2HNHA 2WVVB 1ITUA 1QCWA 3ZJ8A 4NXKA 2PUZA 1UW9A 2UY3A 3VTRA 1OC5A 2BVDA 3SGZA 4L80A 4EX4A 1E6XM 1TPUA 3B9NA 4ZEPA 2Y1HA 3ZWSA 4IOTA 1OFBA 4GGBA 3OZPA 3KZPA 3BSGA 2XU2A 2ZX7A 1O1ZA 3LZ5A 3M47A 3OG2A 4H4IA 1JAKA 3W22A 3WK1A 2YW4A 2VRKA 1XYMA 4MTVA 4JTTA 1AQFA 2ZX8A 4JNYA 4K3ZA 2D0GA 3MHUA 1FP8A 2P3EA 4LBSA 1WZMA 1S3TC 4HK5A 1KM4A 2VNCA 1DHKA 2BZNA 3ALGA 4ERIA 1NP0A 4Q4RA 4DWSC 3O2LA 4WJ8A 5A2BA 1US2A 4Q8TA 1Z32X 3UWWA 4ENLA 1WKEA 1F6PA 1GORA 4MWAB 3PPGA 3K2GA 2PMQA 3GVWA 1UUOA 2VXNA 4UFKA 5FF3A 2D23A 1UB3A 1CB2A 3EDEA 1QNVA 4W7WA 3LENA 4S3DA 2E68A 4REQB 2VI0A 3ALFA 2C15A 1B5TA 4B5WA 3IRSA 5IHRA 3WQGA 1AD1A 4L1XA 2AAMA 2R1MA 4Q6XA 4H04A 1R7AA 2GGEA 3SRDA 2ZZ2A 5D9PA 2EAWA 2OZ8A 2WSRA 1OX6A 1RY0A 2VVNA 1EWDA 2IKJA 1GW1A 2G3IA 3LCIA 3IAQA 1YX1A 3P62A 1KLZA 2BVTA 3UCDA 4C6QA 2J62A 4KETA 3BAIA 1WZAA 5DFAA 5T91A 1WAWA 1AL8A 3WBWA 1XM3A 3OO2A 1TPWA 1TTPA 3ZR4A 1ADOA 4K68A 4JHZA 3MV01 2V5BA 4A8IA 1KCLA 1S5NA 1P6CA 3NUKA 2FMOA 2B4GA 4V2XA 5M2FX 1YE4A 2POTA 2WCAA 3C86A 2NUYA 4REQA 4GQ0A 2EBNA 1QI2A 2OX4A 2Z1WA 3W75A 3A4JA 1L6FA 1E1CB 5FJJA 3G1YA 3E0FA 1QI3A 3M0MA 1E0WA 1NDVA 3DFPA 3UG8A 4GYPC 2W27A 2C0HA 3GK0A 3GLCA 4HGXA 1MFVA 2OYKA 2G95A 1UQZA 4NQ1A 4DXVA 3UJSA 2HXTA 4HZ8A 3OA3A 4JTCA 4AVOA 1QVBA 2BOFX 4GVIA 4Q7BA 5AKQA 4LAKA 2Z00A 4MWAD 3BOXA 4W5UA 4EPDC 1WAUA 2PWGA 1UD2A 1BG9A 4X0VA 4AB4A 3CLWA 3OZMA 4JX6A 5AVNA 1B9ZA 1DTUA 5DY3A 5AYIA 5FKYA 2OXNA 1X1ZA 3CZ8A 5BOEA 2UY2A 2FTWA 4YHEA 3TJ4A 3PM6A 1XLEA 4R27A 2XVGA 4D6JA 4FIQA 2J9YA 1EH9A 3HJEA 4GACA 3W1RA 4XISA 1RVKA 1EJSC 3RAOA 2Y4SA 3MU7A 1W32A 4XUYA 2DZUA 5D33A 2GQ8A 2P0IA 3QY6A 4GOAA 5K3VA 2CWNA 2F61A 1IEIA 3O0KA 5BW6A 3W01A 1H1ZA 3KOWA 4FLOA 4CD4A 1DEDA 2DT3A 8XIMA 2D0HA 3I3EA 4HHLA 2QGHA 2VRJA 1Z3NA 1D7KA 3VD5A 3PWIA 2NV9A 2VRQA 5CXPA 3QXBA 1XLGA 3P8IA 3WLJA 3L4TA 1Q6QA 3LLXA 3UYCA 3VIGA 3ZZ1A 2FHCA 3TN3A 4GINA 4F8XA 2NUWA 4AHPA 3T55A 1Q63A 3BOFA 4HNOA 1QNSA 4QSFA 2E9LA 3N4AA 4PL1A 4GJ1A 3THQA 3Q45A 4L5ZA 3AXHA 2IXVA 1MXDA 4UFHA 1DJQA 3WO8A 3MI2A 3CTTA 3REQB 4BY3A 3SN4A 3KAOA 3SIZA 1JCNA 3TZNA 1TMQA 2E8YA 1XLHA 2JF6A 3W7RA 2AL1A 5AHFA 2X40A 4J35A 5LNWA 2ZZ7A 4D6GA 1XYBA 3N17A 4DAIA 4Q32A 3IANA 4I8YA 3HM7A 4K2SA 2YR1A 2YXXA 1JRCA 1EC7A 3RRXA 4P7NA 2ZUMA 3W70A 2X8RA 2IPJA 3AMLA 4O11A 4RZBA 3GC5A 4NAFA 1UMYA 2YCJA 4LUTB 2X1UA 3NM1A 3W1QA 1KXHA 2JALA 1XKYA 2V8ZA 1XUUA 2ZZ6A 3L0KA 3NM3A 1FWGC 1Q6DA 3R5EA 5REQB 3PULA 2QCGA 4H7ZA 3OTRA 1FX6A 4YYCA 2R1NA 4K8GA 3M7WA 3C6CA 3KEHA 4D2JA 4IQEA 4GABA 1WUEA 4H7CA 4JD4A 2E7FA 4UOZA 4NRSA 1JGMA 3VMNA 2J6VA 1JZ8A 1CI1A 4J3WA 2AMGA 4GBDA 5GQBA 3AHXA 2WLZA 2FPYA 4J2MA 4RE3A 5HQMA 2OQYA 1I0BA 2JFEX 2DUXA 5U4NA 3VE9A 1A50A 3F2DA 3MSRA 4LU0A 3HFTA 3WNPA 3T8QA 4DZHA 4GFSA 3H2AA 3BJTA 4E8GA 1Q7ZA 1XLLA 2WC7A 3SCRA 4W84A 5DT7A 2Z27A 1GOXA