4R9OA

Crystal structure of putative aldo/keto reductase from salmonella enterica
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
b'MVQRVTIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQCEAAFGEALTLAPHLREKLQIVTKCGIATTARAENKLGHYITDRRHIILSAEQSLKNLATDYLDMLLIHRPDPLMDADDVAEAFQHLHQSGKVRHFGVSNFTPAQFTLLQSRLPFTLATNQVEISPVHQPLLLDGTLDQLQQLRIRPMAWSCLGGGRLFNDEAYQPLRQELSVIAQELNASSIEQVVYAWILRLPSQPLPIIGSGKIERVRAALEAETLSLTRQQWFRIRKAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aldo/keto reductase
publication title Crystal Structure of Putative Aldo/Keto Reductase from Salmonella enterica
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
total genus 99
structure length 293
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4r9oA00
1HW6A 2IKIA 1HQTA 4WDWA 4ASTA 4JIHA 2VDGA 3ONBA 3BCJA 1RALA 3H4GA 3GHTA 1FRBA 4XVDA 3M4HA 4GIEA 4FA3A 1T41A 4QXIA 2PD5A 2PDMA 2PD9A 4JIIX 2IKJA 2PDBA 2DV0A 4JTCA 1Z9AA 1YE4A 3VXGA 1US0A 4LB4A 2INEA 1RY0A 4JQAA 4YVXA 1YNQA 4AUBA 2PDCA 3UFYA 1XF0A 1AZ1A 2PDNA 3FX4A 2R24A 3WCZA 5HNUA 5AZ1A 4WEVX 3O0KA 1SM9A 4WDTA 4EXBA 2WZTA 2BP1A 1EXBA 1K8CA 5LIKX 4XVEA 2DUZA 5HNTA 3EB3A 4G5DA 2PDYA 3CAQA 1AZ2A 4IJCA 3GHRA 2ACQA 4QX4A 4XK2A 2HEJA 2IPFA 4FZIA 5KETA 3V0TA 1LWIA 2PDQA 4F40A 4GA8A 2PDHA 2HVOA 2F2KA 3T42A 3WBWA 4YVPA 5AZ0A 3BV7A 1XJBA 1A80A 4IGSA 4FALA 2IQ0A 4HMNA 3U2CA 3GUGA 2A79A 3LD5A 3UZXA 4XZLX 4H7CA 2HE5A 4ZFCA 1ZQ5A 3O3RA 4HBKA 3UWEA 4XAPA 2PFHA 3LN3A 2ALRA 2FZ8A 5DANA 4I5XA 3LZ3A 3GHUA 3M64A 4JTDA 2ACRA 2PDJA 3CMFA 3WG6A 4JQ3A 2INZA 4JTQA 1ZGDA 3RX2A 1LQAA 2J8TA 4Q3MA 1JEZA 1PZ1A 1YE6A 3M0IA 4JQ1A 3R94A 4QBXA 4DBUA 3RX3A 2CLPA 3CASA 2ISFA 3WBYA 3H7UA 1ADSA 3FJNA 4JTAA 4YU1A 1MI3A 4JQ2A 3DOPA 2I17A 4PMJA 3R8GA 1Z8AA 3F7JA 3UZYA 3GHSA 1S2AA 1EKOA 3WBXA 4GQ0A 1X98A 2IQDA 5JH2A 1C9WA 3LBOA 1EF3A 2BGSA 3R58A 1AH4A 4WDXA 4JTRA 2IS7A 3R6IA 4OTKA 2P5NA 3NTYA 1R38A 4PUUA 1YNPA 4DBSA 4NKCA 3R7MA 1IHIA 4PRTA 4WDUA 3R43A 4XO6A 3CV6A 4WGHA 1PZ0A 2HE8A 4GCAA 2PDGA 2FGBA 1EL3A 3S3GA 5LIUX 1M9HA 1VP5A 2BGQA 4PRRA 3COTA 5LIWX 3H7RA 4GACA 1AH3A 1J96A 3UYIA 3UG8A 1ZUAX 4DBWA 2PDPA 3EAUA 4IJRA 2DUXA 4RPQA 4GABA 1MRQA 3N6QA 3LQLA 1PWLA 2R9RA 4JIRA 2ACSA 2HDJA 4GQGA 2PDUA 4PR4A 2F38A 4QR6A 3MB9A 1GVEA 4LB3A 3B3DA 4XZIA 3C3UA 4XZNX 1PYFA 1X96A 2PDFA 2FZ9A 2PDXA 3ERPA 3LENA 2IPGA 3LUTA 4EXAA 3Q67A 1Q13A 1AH0A 3KRBA 1T40A 1Z89A 2PDLA 4FAMA 2IPWA 2HVNA 2FZBA 3P2VA 4DZ5A 2IKGA 4LAUA 3CAVA 1S1PA 2ACUA 3Q65A 4YS1A 2FZDA 1VBJA 1ZSXA 3LEPA 3LQGA 1X97A 2PEVA 4LAZA 2PDKA 4Q7BA 3UGRA 2HV5A 5LIXX 4PUWA 2QXWA 3V0SA 2IPJA 2PZNA 3D3FA 4MHBA 1QWKA 3BURA 3N2TA 2WZMA 4H8NA 3V0UA 2PDWA 2FVLA 1OG6A 5C7HA 1MZRA 3V36A 1RY8A 4L1XA 2PF8A 1Z3NA 4L1WA 2IKHA 4XZMX 3EB4A 3G1RA 3LZ5A 4LBSA 1AFSA 4JQ4A 3CV7A 3UZWA 4ICCX 2NVCA 1QRQA 4XZHA 3R8HA 2C91A 3DN5A 5JH1A 4XO7A 1XGDA 5M2FX 4R9OA 4WRHA 1S2CA 1Q5MA 4YVVA 3RX4A 3UZZA 3LNMA 3UP8A 1UR3M 4LBRA 1IEIA 1PWMA 2AGTA 3BUVA 3G5EA 3MC5A 5LIYX 2PDIA 3QKZA 3V35A 5HA7A 2I16A 3ONCA 1S1RA 2NVDA
chains in the Genus database with same CATH superfamily
1BWKA 2VELA 3CL6A 4NZ1A 4CNOA 4IP5A 4OOUA 1MUCA 3FJLA 3F2BA 5GNZA 3UJEA 3ONBA 4K8GA 1R47A 1WAWA 4QGCA 3O06A 2QS8A 4UTHA 5A8NA 2GUYA 3CWHA 3UWVA 2ZCGA 4K37A 4A8NA 1WCGA 3DBPA 1FA2A 3EXRA 1ZPTA 4B3KA 4YMZA 4DUOA 1YXCA 1H1ZA 3KOWA 3QTPA 1CB2A 4DJEA 4LRTA 4MWAA 4J35A 4JTKA 1D3GA 2PTWA 2QVNA 1UD6A 4JN7A 1VZWA 7XIMA 1OF6A 4MDOA 1I2QA 1C8VA 1EA0A 2J9YA 3D5HA 3WD4A 5JBDA 5DY2A 5KZMA 4GY7A 1CYGA 3IARA 4G56A 2EF9A 2BFGA 4JTTA 3RLGA 3W81A 4MNKA 3FYOA 1JGMA 4IPLA 4NX5A 2NQ5A 4HU4A 1OF8A 1EB3A 3L4ZA 3FYYA 4O0ZA 3STGA 4RDZA 4KWOA 4WF7A 2EPMX 2WMIA 3FSUA 1XPYA 4ZB0A 1TPDA 1WA3A 2NT0A 2V5BA 3PSWA 4ZOEA 5BU6A 5XIMA 2IPFA 4IP7A 1R2SA 1H7OA 1LWIA 3UNDA 1PCWA 1KGXA 4GA8A 1X8CA 2ATMA 3AXIA 3H2OA 1QFEA 3T0BA 2OO6A 4AMAA 4OVXA 3FDKA 2WPGA 3W7IA 2VWTA 1MFUA 4A22A 3EA3A 4D8LA 4AXKA 4KCTA 3MBFA 1RV8A 1W5NA 3PF3A 3LSCA 3QSRA 4NYYA 3KDOA 4JIEA 2F9RA 4OIFA 1S5MA 4I9AA 3VCCA 1DJWA 3VD3A 2UY5A 2X42A 2XZ7A 4HSHA 5I02A 2P0IA 1J0YA 4GUGA 5KINA 1XLBA 4FS9A 4EANA 4DWDA 1GZGA 3A4AA 1GEHA 3G1FA 4S3JA 5FKYA 4IZGA 3QR3A 4YN5A 2V82A 3L7RA 2OR2A 5FAGA 3WQPA 5HULA 2O92A 3TZFA 1YPXA 5A95A 5I0DA 3WNMA 5BOEA 3GZAA 1G4SA 1R9ZA 3KWSA 3HN3A 4AEFA 3TLQA 4GXWA 4KWVA 3T2QA 5CJMA 4RK8A 1SJAA 8XIMA 2VKZG 2P3ZA 1ADSA 2HCVA 1V51A 2VM8A 3UWWA 3R8GA 4FR1A 1MWOA 3WYZA 1FCUA 3UXDA 4GO9A 1UKTA 4S3CA 1ZU8A 4CN1A 2WHMA 4JCLA 4MYXA 1XBZA 2DT0A 1X98A 5CQ1A 4B2DA 2XVLA 1CXKA 2OZ8A 1FBAA 2X1IA 1IGSA 4HHMA 4PMRA 1P43A 3RK8A 4Y9PA 3EEGA 3P7YA 2JKAA 2R91A 4Q32A 3B4UA 2ZRUA 4GYJA 1OY0A 1YPIA 1TRIA 4QNEA 3FXYA 2FDSA 2XIOA 1FTXA 3BAJA 5CH9A 5LHEA 2I57A 4W8LA 3ARYA 1DEDA 1KR0A 1SQ7A 3S3GA 4O11A 3KLKA 3UPMA 2XN0A 2ZZ5A 3NO3A 1M65A 1WZAA 4US6A 3IVTA 1YIXA 3HFYA 5I78A 3G18A 2V3GA 3PUEA 4O53A 1AD4A 3H7RA 4GACA 2EPHA 3BSGA 1UIPA 3SUSA 1ZUAX 2OO0A 3EA1A 3VINA 5HK4A 4NXKA 5E9XA 3SRDA 3IPWA 2G3IA 3C2OA 1UJPA 3R5EA 3WQCA 5AN7A 4DZIA 4H2HA 2ZADA 2BMBA 4L9YA 3GLCA 1R8LA 3VD9A 2E5DA 1PEZA 4WQ6A 1CXFA 1UUOA 3EDDA 4XTIA 3AHZA 1OEPA 3GVGA 3KTSA 4M7SA 4C7GA 3HPZA 1UA7A 1X96A 4WIWA 1EYWA 4C6BA 2DT3A 3AYSA 3ERPA 3TJIA 4LFYA 3M0XA 1F6PA 1XYAA 3GXMA 5E5CA 3P80A 4EAYA 1H5VA 5C8BB 2OT0A 3MVTA 3VGEA 4NSBA 1P1XA 3LHUA 3WMBA 2Z4GA 1EO5A 4PH6A 3O0FA 4DO7A 2PURA 4ML9A 3DFSA 4D6DA 3D3AA 2PDKA 4GXPA 1V79A 3UGRA 3LCIA 1OIMA 4WOQA 4ZQCA 3S1GA 3VAVA 3IGXA 2EXOA 3V0UA 2BZNA 4BEUA 1UIOA 3M5XA 2E1DA 3IGSA 3BE7A 1G67A 5G2WA 5F2GA 5HR6A 3G1RA 3NUKA 3G0UA 4L6OA 2NUYA 4Q7IA 3F4VA 2DU2A 4MYAA 5DXXA 5LZLA 3BQ6A 1D8WA 3RNDA 1VLIA 4CNPA 1BRLA 2AOSA 2OZ3A 3LGGA 3AIUA 3L0NA 2XTKA 4TX8A 2E0PA 2FHCA 4PA8A 1Q6CA 2QGYA 1B30A 3SRHA 2NLYA 5E6YA 1ISZA 2PTYA 4NT0A 1HKWA 5CGQA 3OVQA 2WC3A 3DH7A 2ZRXA 1U5HA 4O1AA 4D6HA 4XV0A 3TC7A 1SJBA 3VE7A 4RW3A 2OLAA 1RALA 1SYTA 2Y85A 2VC6A 3CLMA 2J7BA 3NGJA 2GGEA 1W5PA 2BHUA 3S6OA 1CB7B 4XKMA 1Q4WA 1YPFA 1NTHA 2DV0A 2GJRA 4PFHA 3VMNA 3TMLA 4ECLA 4O14A 1XH2A 1LRTA 2X30A 3ID7A 3W7RA 3CIVA 2YYUA 3DZ1A 4R85A 4D6CA 4W89A 5A6SA 4C6IA 4HHLA 3NEHA 1W3NA 3WLMA 3F5LA 4IIEA 1YADA 4AWUA 6TAAA 1K3UA 3WX7A 4PFMA 1VCGA 1R86A 3AMDA 4C5ZA 1SMAA 4GGBA 2I14A 2XFYA 5JUVA 5C9ZA 1FH8A 2E6DA 4GRSA 4H1ZA 1DOSA 3EDKA 4M56A 1TX2A 3DUGA 5HNTA 4ZMGA 3UY8A 1OG0A 3TAKA 3W2KA 2EGZA 1JYXA 2QW5A 3RO6A 2CIPA 2DSKA 3V0TA 4YTUA 4ONVA 3G22A 3FY1A 3LHYA 4AMCA 3VOIA 3WBWA 4JTLA 2ZRZA 4PCFA 2YXXA 2GQ8A 3N15A 3NL2A 5KZ6A 2QT3A 4GXMA 2O7SA 2QAFA 1PDZA 3C2YA 3CM4A 1L2QA 3SUVA 1W1YA 1XLLA 1XCWA 2BY1A 1GCYA 3RU6A 2F7FA 4A35A 3F1QA 3W82A 5CSSA 3WDIA 4YJ5A 3RLUA 2ZX7A 3NQVA 1KXTA 4WX2A 3WEZA 3CUXA 4M6QA 1TKKA 3A9IA 1R2RA 1JF6A 3LY0A 5AHEA 2A3AA 1QU4A 2E77A 4LNYA 3PZVA 2DW7A 3R94A 1EUAA 4E2DA 1XFBA 3W72A 1ISYA 2FH8A 3DHPA 1DJXA 4NXSA 3EOEA 1C8XA 3W74A 4Z2LA 1NQ6A 5GVJA 4C6PA 4YLWA 4C6JA 5IHRA 3T44A 3W7CA 1LUCB 1ESWA 1P7TA 2NV2A 4GD0A 4ATWA 1FDYA 1HKMA 3GX9A 5G1MA 1DJQA 1QNPA 3LRMA 4DI8A 4JAWA 4ZL1A 5DRCA 3DU0A 1IF2A 1KC7A 1C9WA 1JAEA 4I90A 3B9OA 4AD3A 2BX7A 1P0EA 3N73A 3R58A 4MAZA 4NNCA 1TYGA 3GXDA 4UC5A 1S5WA 1BSIA 3S2JA 3W71A 3U2ZA 2H9AB 4HYRA 1XH0A 5KITA 3MYOA 5J5DA 3R89A 2DY3A 3QM3A 3I4KA 5E6ZA 4O28A 1BXCA 2WCAA 3ABRA 4LYKA 4B5NA 2BY0A 2QUUA 5ECVA 3S2NA 4KMQA 3DC8A 2OSYA 1WQ5A 1XLAA 4BR1A 1UD8A 1TV7A 1NFGA 2FGBA 3UPWA 1AJZA 2ZZ1A 1KFBA 2IUZA 2EEXA 4GG9A 4H2CA 4A2SA 2XFFA 1V7YA 4P7RA 1MXSA 3RDKA 1F6KA 2YIHA 2BSLA 2DORA 2O9PA 3W1LA 1ZS2A 2J7DA 4C6EA 3N3TA 4GE8A 3CV1A 3B0YA 2R1NA 4ENLA 4KCVA 5JIWA 5SWUA 4WHBA 4GQGA 2TAAA 4NHVA 8TIMA 2F38A 1ZBCA 1UP3A 3EMZA 4ORMA 4LB3A 1QO5A 2ZC1A 3MCMA 4L80A 4LY4A 5D9MA 2OJPA 1FCQA 3EX6A 3N18A 1YRRA 4W7UA 2EG7A 2C3ZA 3UJ2A 3GXIA 3W3OA 3UXKA 1J11A 2VD9A 3E0VA 5A94A 1UQYA 2F6KA 2YLLA 1EA9C 1ZBKA 1JZ6A 2IPWA 1HN1A 3TE9A 2IKGA 2GJXB 4RZ4A 5M1TA 1NDWA 4JD4A 4LNCA 5HPOA 2ESCA 5CBBA 4FMVA 1SZEA 1UMYA 3LQGA 2FPVA 2PEVA 3CH9A 3AC0A 1E4LA 5LIXX 1QCWA 1GW1A 3EKZA 1DV7A 2WVTA 4US5A 3I4EA 1VFOA 3N2TA 3WDJA 5GJMA 3K13A 3H54A 4FP1A 4G7FA 5C7HA 3LHZA 4AD0A 4GVHA 4DELA 4QEEA 1M01A 2PF8A 4UB9A 1VCVA 4PUMA 3ARUA 2H8XA 3WN6A 1W9XA 3AICA 4LBSA 3CUGA 3HMJG 3LSBA 1U5JA 3VILA 4FXFA 1E1CA 4MY1A 2NSOA 1WKDA 4LAMA 2OZ0A 4M80A 2FVMA 2QCDA 1RD6A 1FUYA 2P0OA 2VC9A 3LCWA 5CZTA 1GYNA 4HA1A 2H90A 4C7FA 3LNMA 3UP8A 4LBRA 1W91A 4ZO7A 2VOTA 3EA2A 3WQVA 1POJA 1A5NC 4AVOA 3ZVHB 1S1RA 5EB8A 2Y8VA 4HMDA 4R34A 3SECA 1VFLA 4NZ5A 4NYUA 3AOFA 5D2VA 3STEA 3NZRA 4FEZA 1GKPA 4M24A 2UWFA 4DWSA 4EF9A 4M0XA 2D0GA 3ZWTA 3AIVA 1C7TA 3EB2A 3PZOA 1ME8A 3NJ3A 2JALA 1YE4A 3R79A 3VZYA 1UWRA 1QNSA 1ADDA 1AL7A 4GQBA 1RY0A 3SRFA 1QDSA 4MLRA 2YCLB 1SFLA 1BPLB 4AZCA 4AYGA 1EJ7L 3QR1A 1I0BA 4JFVA 2W92A 3JUGA 3M41A 5D2XA 5DF0A 3MI6A 1KTCA 3SCVA 1DJHA 2JQXA 1J0ZA 5AYYA 4F3HA 3CYJA 3ABOA 1RHCA 4DO5A 1FWHC 2XN1A 1K02A 4IF2A 5FF3A 1XBVA 3GHRA 3FCPA 4FLOA 3DI0A 2BXZA 3ARWA 3KCLA 4AWEA 2HVOA 2F2KA 3W84A 1IEXA 4XZ9A 3DYPA 3Q45A 3O6AA 4ZSTA 3VOCA 3GUGA 4PTXA 2RDXA 2I5GA 4FSAA 3IRSA 4QJ1A 2QULA 3P84A 2DT1A 1CXHA 4LUYA 3UWEA 1UW9A 1DBTA 4QQUA 3M0HA 5D4YA 3WQ5A 4I5XA 1K9EA 1I2OA 4S2BA 4ZQPA 2ACRA 1LRQA 1S5TA 1XINA 4C90A 3WG6A 1XC4A 1VH7A 2YCKX 3ES7A 1GTHA 1YDVA 3PHAA 4GPNA 5F1VA 1EYEA 4JFTA 3MUXA 3VGBA 2TSYA 3LTYA 3GXTA 2DSVA 1RSCA 1EC8A 1HF6A 3LXBA 2WJZA 1LLZA 2A3CA 4V1XA 3TJ4A 3U48A 4Q33A 3LPFA 4GBDA 1PO9A 2G95A 4J3UA 3P61A 1LLWA 3MSYA 3M0YA 2QJGA 1S2WA 3UCCA 4LV4A 3B8SA 2R94A 4R7WA 2OVLA 2AQVA 3A9BA 3KXQA 2ZUWA 3LHWA 3GTXA 1OK4A 5CPNA 2BVTA 4NJGA 2A6LA 5A6MA 1NY1A 2FFCA 3S5ZA 1D7KA 5DFAA 1SGJA 1G6CA 5KZEA 2BGSA 3CQJA 1C3FA 3KVKA 1P6WA 1AQMA 3TTSA 1OC7A 1H60A 5A6JA 4PMDA 4XKYA 3WENA 3PUOA 4GY1A 2WO5A 1L6WA 5IBXC 4MY9A 2W0UA 4Q8VA 2Q8LA 1TX0A 4QG9A 2ZUNA 1AQ0A 1W6TA 3YPIA 1FWSA 3ECQA 3CV6A 1DIEA 1EP1A 4JS3A 1REQA 5EBUA 1B54A 4MWAE 3AU6A 3B8UA 2PWUA 1H1YA 3ABQA 3LG3A 3FVDA 1RCOB 3NSXA 3UG4A 2NX3A 3AI0A 1VP5A 2ABAA 2FJUB 1J18A 1TA3B 1RCXB 2J24A 1SR0A 1W3LA 3LV5A 4CCEA 1UKQA 2AL1A 1EHNA 3S5YA 4JICA 1WXJA 4MB4A 5G4HC 2QF8A 4GVGA 4ROPA 5E9AA 5I2UA 4H6QA 3WDRA 1CIUA 2BOEX 4RNIA 2OFJA 3VD5A 5BNKA 1PWLA 1UQZA 3WBEA 2NWSA 1Q3NA 1X6NA 4O50A 2GWGA 3R4IA 1OX4B 3SBFA 2PDUA 4PR4A 5K7JA 1V6YA 4CD7A 2OQLA 3W26A 3THCA 1XDJA 4U3CA 3HFTA 1OGBA 4NF7A 1TPC1 3CQ0A 5D33A 3VCNA 1OT2A 3NQMA 4YHGA 3LBMA 3M7WA 1F07A 4CN6A 1A5BA 5CC6A 1HKJA 3UWYA 4PUDA 1IXOA 1OCJA 1M7PA 3TLLA 3A3WA 3XISA 3FYPA 5E93A 1OX6A 3CTLA 3M9YA 1PBGA 3BXWA 4KBXA 1GOOA 2YDAA 3WL0A 3M0KA 3AROA 2DVTA 3OYZA 2QJIA 1QPQA 4ZQRA 4C5YA 1M68A 3SADA 1SW3A 1XG4A 4X61A 4GMEA 1OHLA 1D2KA 4GKTA 5I06A 3KVLA 1XLJA 3URBA 3UPBA 7REQA 1VKFA 3P5ZA 3V7PA 4KEZA 1J0KA 2ZVIA 1BF6A 2CBIA 1GOMA 3AISA 4L1XA 3CH0A 1VS1A 4EK7A 3H7VA 3VZXA 5LGZA 1S3TC 4HHHA 1MQQA 5JMUA 3MO4A 1E71M 4ZVJA 3K30A 3FKRA 3CT7A 3E5BA 4HTYA 3NQEA 4PEKA 3LCGA 1XGDA 3BZGA 2VZSA 3LA4A 5EMUA 1S2CA 3GU1A 1V0KA 2NUWA 1F7BA 3N11A 3GTNA 5C9WA 4B5UA 3P6LA 1XPGA 2JK2A 1GHRA 1YHTA 3IJIA 3PR2A 4XBKA 1EOKA 2VEGA 1E6PA 3MC5A 2XN2A 2PDIA 4HB7A 5A69A 3QKZA 1BYAA 3G1SA 5CZKA 3ITLA 2CFFA 4ILSA 1MW0A 5AFDA 4GJJA 5F4WA 2VRQA 1CTNA 2DH3A 3QGAC 3N12A 4JIHA 1GJPA 1VD6A 2VEPA 3LI1A 1YBQA 1VF8A 4D72A 3STCA 1KV8A 3WQ4A 1SVDA 1TV3A 3M4HA 2GQAA 4NZFA 3B0VC 1J0IA 4TTUA 3NR0A 3BAXA 3NURA 4GNVA 4MGGA 1H09A 3NYZA 5B7YA 3STFA 4QG8A 3L5LA 2G97A 3MYPA 3TTOA 5CPLA 4YTTA 2J78A 4F2TA 4KGLA 4GINA 4DYJA 3PTMA 3TCEA 3B8WA 4WJ8A 3H2MA 3USBA 4UOJA 3R8RA 2HPMA 3EWDA 2R24A 4Z17A 3TA9A 2Z1SA 2WCGA 1EIBA 3IEBA 4PL2A 3MSGA 4GH1A 2PRLA 1HP4A 1UZHA 4W93A 1XC6A 2WKLA 2IXUA 4DIAA 3V4BA 2BOGX 1BFNA 2QQ6A 2VFEA 1W56A 1XLDA 4TVCA 4HZ8A 4AZHA 1W1TA 4XUYA 2QCNA 2J6VA 3LCXA 4AF0A 3MP3A 4TOQA 1XBYA 2O4MA 3SY5A 3VI2A 4F40A 3EWCA 3TH6A 1M3UA 1E9IA 1XJBA 3LM3A 1EOMA 3E0FA 2J62A 3DENA 2V68A 3WLTA 1EQCA 3S1WA 3W70A 1BQGA 4WR3A 1UWSA 2CZEA 3M07A 3PPFA 4UMCA 1GVQA 1F73A 2GVYA 1GJUA 4L7ZA 2F84A 1H51A 2EJAA 2E9BA 1QTWA 4GHRA 3B0XA 3O7UA 3GHUA 1KV5A 3NDYA 4K7YA 4NX0A 4ZOCA 4J3TA 4B90A 1E40A 3DFNA 1TB3A 4JBRA 4F8XA 3SCPA 1E51A 4DBDA 3TYAA 4MB1A 3PS7A 1UH3A 5FJOA 1FFRA 4L56A 1E56A 4NILA 4U2ZA 3M5YA 3W7KA 1HGYA 3UJSA 3I6RA 5REQB 3GDBA 2VVSA 4JXCA 4LS1A 2C1IA 4K6AA 2XVGA 3ZOAA 1QW7A 4W85A 2XM2A 4GGHA 3ATZA 1PE1A 3U5YA 4YU1A 1ZY9A 5I3KA 4JQ2A 3DOPA 3GH7A 3BLLA 4MKVA 1QOPA 3CB3A 4B15A 4Y8EA 1OFQA 1SO6A 5FJUA 3OLIA 1ONWA 4B4HA 4BWLC 4LVDA 2X2GA 2IQDA 3VKAA 1ME9A 2CLFA 2VI0A 8RUCA 3WF0A 4TVDA 1CGVA 1E0WA 1XHGA 1GQNA 3Q94A 4WDXA 1XRSA 1FH9A 4HN4A 5DLCA 3DHFA 5LA2A 3M1ZA 3A5VA 3EWXA 5LXEA 4W7VA 2QCCA 1Y65A 1IYXA 2Z1VA 2DQWA 2PE4A 1W5QA 3L67A 3KX6A 3R7MA 4M7TA 4PUNA 3CB8A 4N0RA 5T91A 1OFDA 2A7NA 4FX8A 4Z1DA 2D3NA 2Z7GA 2J47A 1XLFA 3V3WA 4CN4A 3WF3A 4EIVA 1JXJA 5CEWA 1RQEA 4H9VA 3W85A 1FY6A 1I9CB 4MWAD 3VKCA 4DJED 2VZTA 2J8GA 2H3BA 3CS2A 1MNSA 1LL7A 3G0XA 1LQ0A 2FGZA 1V3MA 2CLKA 4RLIA 3BAIA 5JBFA 4P2VA 4LOCA 1QVBA 1UH4A 1S2UA 4FPSA 5C9XA 3ICJA 3WMSA 3CC1A 1NM9A 3C2RA 2JBMA 3N6QA 4Q4RA 4QITA 1XIDA 3SUWA 3KUMA 3LQLA 3LTPA 3M6DA 1OM0A 5I6SA 1P4CA 1J6OA 2WC4A 1IZCA 5BROA 2RGLA 1BAGA 3B3DA 5TIMA 3C4UA 3NQ2A 4NNBA 4AG0A 2WMHA 1Q6OA 2RDWA 5DMMA 5D2WA 3LENA 2V81A 4POCA 1Q13A 5CSYA 3RAOA 1US3A 4IL0A 3IJ9A 1NP2A 1ZZMA 1K8ZA 1V8EA 4GNKB 2XVKA 4CNSA 4UTKA 1WP6A 3EOUA 3FSTA 3BMWA 1J9YA 4AWSA 3CU2A 2VUYA 3EX2A 1ZSXA 3ZQ9A 3QC3A 1X97A 3UR2A 4ZTXA 4Q7BA 2PLMA 2WVVA 5BRPA 1E1EA 2V5DA 2BODX 1TR9A 3TR2A 3OA3A 3VABA 5M17A 3LU2A 1QWKA 4NI3A 1ZRQA 3CPRA 3KFTA 2DZTA 3SCWA 5D03A 4GNJA 4MKSA 1NDYA 1RJPA 3VIFA 1HGWA 3QJAA 4UOZA 2YB1A 4NAFB 3T05A 3UJFA 3E2RA 6XIAA 4P8XA 4Z1AA 3CT2A 4I7VA 4JQ4A 3V5CA 2VHLA 1QAPA 3M47A 3RPDA 3UA3A 1ITXA 4LUTA 2ZA2A 5JH1A 2GLKA 2OGJA 4R9OA 3KDNA 4FXJA 1W1B1 1MXDA 1HNYA 2OT1A 1UKPA 2FVKA 1NWRA 2Z1XA 1W3KA 3GDRA 2PMQA 2R1LA 4M51A 1PUDA 4B2DD 4Q22A 2G4FA 4LVAA 4C1NA 2E7FA 4O17A 1XIGA 5GNXA 4QCFA 1I8JA 2G3MA 4EPKA 1V6XA 4LS0A 2GPTA 1ZJAA 1XRTA 4AZ7A 3TFCA 1RPKA 4M82A 3IUHA 4R7OA 3ARPA 4CQBA 1PV8A 3BCJA 4OOZA 3GHTA 3OZOA 4O13A 3S9IA 1FVPA 2JIWA 4UMBA 1T41A 4QCEA 5CC7A 2PU0A 2PWHA 1QWGA 2HMCA 3GIQA 3T81A 1JZ2A 1N7KA 2VX6A 3OO2A 3W7EA 4WJXA 1S3HA 1R87A 1ONEA 2ZWYA 4O54A 5DEZA 2DDXA 3DFTA 4PMZA 3O07A 1XF0A 3RXZA 3MDWA 1VPXA 1W3HA 4HPNA 3G1DA 3FX4A 2NLIA 1QHPA 4IGHA 4G7EB 1NP0A 1IZJA 1X6UA 3IV8A 5A2BA 4E8GA 3B06A 4Q8TA 4PTMA 1OZQA 1WZLA 4HMCA 2PC4A 4AC1X 1JNDA 2FB2A 2YA1A 1EXBA 3OLDA 1E5NA 2PLCA 4ATLA 3BLIA 4UTWA 2CLOA 5F4XA 3MI2A 2GUBA 2Q8ZA 4R33A 4HU0A 4A8RA 8A3HA 1A0DA 1FXQA 5E0KA 3GTHA 4KEUA 2J77A 4F0SA 4X2RA 6ALDA 4DX3A 3TEVA 1CGUA 3GDKA 2Z25A 4CEXC 1MNZA 4BFAA 2FQIA 3JU2A 4QE1A 1XX1A 1DQWA 1KQZA 4DBEA 2B7OA 4ZOAA 3MTWA 2A7RA 4UCGA 4H8UA 1CLVA 2XFRA 4RJEA 3ARVA 3W6LA 4DJFC 2NQHA 2FFIA 1ODUA 3W7DA 4Q8MA 1UWUA 1V02A 2YPIA 3L4VA 4C6QA 1XYBA 1KBJA 4FF5A 4FR6A 2OWXA 3LZ3A 2DGAA 5EA9A 4HPXA 3NPWA 1Y7VA 4JKKA 1RVGA 4IHCA 2WZIA 2VO5A 2YZ5A 1DL3A 3MMTA 3MDUA 4A21A 3P81A 3GR7A 4DF1A 1LL4A 2J66A 3ABSA 3KL3A 2OU4A 4Q8PA 1QPRA 3MKCA 1XM3A 1MQRA 4WSJA 2RKXA 3TW9A 3QV7A 4JTUA 1DJZA 4JQ1A 5CSUA 2DPEA 2QMJA 3EXSA 4J3VA 1IXNA 2HBVA 3SQMA 1OYBA 3RU8X 1NFPA 4FNRA 3CASA 1ZP4A 2ISFA 4CQDA 3RGTA 3OZYA 4ADSA 4UNIA 4AHOA 3PZUA 2GYIA 4XSMA 3M0ZA 1E5JA 2GGGA 4KESA 4UQBA 2BNJA 3GFXA 1IEVA 3ANVA 4CQAA 2D73A 1XYLA 5JH2A 5G1YA 3PTDA 2YDSA 3LBOA 4I5RA 1I2RA 4HGXA 5FSEC 1X7FA 5C6MA 3VNMA 1MO0A 3AYTA 1ZAHA 4FHAA 3GTIA 3CLWA 1O95A 1AK5A 2YR1A 3RMEA 4S3DA 3THAA 3SDOA 3VKBA 4I9TA 1JRBA 1BVNP 2DQXA 4D9PA 3SI9A 2HE8A 3N14A 1GW9A 1W1A1 3T6CA 5FEXA 4X60A 1XRVA 4OZOA 4GIAA 1F61A 3E1F1 1TTPA 4GZJA 2Z28A 3W1RA 2VCBA 1JCYA 2PGWA 1W1ZA 4FIRA 1JQVA 1K03A 3CUHA 5CKSA 5AY7A 2DVUA 4H9YA 1FH7A 3HQNA 2CKSA 5AYIA 5KEZA 1KCZA 2XZ9A 2WMJA 5I23A 1F6YA 1IXQA 1IR2A 1VBGA 3BO9A 3FW6A 4J3XA 3C5QA 4A8LA 4UR8A 3MB9A 3DHDA 3C3UA 4O19A 3WQWA 3HPAA 4CCDA 3GE7A 1DWGM 4Q6JA 1UWQA 1GG0A 1HX0A 3VU2A 3Q67A 4LS2A 2G37A 1V6TA 3A64A 3DFYA 2ZBTA 4FF7A 4A4AA 2OPJA 3QHOA 2Y0FA 4XWUA 1KXVA 1HKKA 2ZOXA 3ITYA 3L4XA 2E6AA 4FNUA 2VWSA 2ICSA 3LOTA 3Q65A 4H04A 3O9NA 1KM2A 1Z48A 4Y2WA 4MWAB 5I03A 2ZXBA 4F0LA 1EJWC 1RPXA 3U2EA 2VC7A 4LJ3A 1I1XA 3E2VA 1KWKA 3T09A 1VAHA 1UC4A 2PZNA 3GZ3A 4KKXA 4BY3A 4C6OA 4FIQA 5ABGA 2DSUA 2G3FA 4XZBA 4FX7A 3VVGA 3N2MA 2A5HA 1AL8A 1CGWA 5FCZA 1Z41A 1TPEA 4BQ2A 3KBVA 1UR2A 1TTIA 1TELA 4U2YA 3THUA 4O16A 3D6NA 4V15A 5K9DA 6REQA 1W9UA 1E6XM 2QKFA 2WMIB 3J7HA 4BQ5A 1Q2RA 3B03A 5CG0A 1ZBVA 2J9XA 4K8EA 4ZE4A 5LHFA 2TPSA 3N2OA 1XG3A 1JNEA 1E43A 1TJRA 1KO0A 2O9OA 5DO8A 5H8PA 4LALA 2V3EA 4XAGA 4XO7A 1YMYA 2R1MA 2V5JA 1T96A 5ENLA 4W8BA 3W1UA 1RUSA 4GVFA 3NWRA 3BK0A 5TNVA 4JZ5A 1IE7C 1HG3A 1VYRA 4O1BA 3N2BA 1PWMA 1L0PA 3QTGA 2AGTA 5I79A 2J13A 4OGZA 1FWJC 4V27A 5HA7A 4PUEA 1XXXA 2QDGA 2OEJA 1JPDX 2X40A 1G5AA 1G69A 4ASTA 1G9HA 4ZA0A 5FJRA 3VKKA 1UD2A 3SIZA 3EDFA 1XR2A 4GIEA 1V5XA 3QFEA 4O1EA 3C56A 4Q8QA 4N6EA 3QGKC 5HOSA 2HS6A 1L6SA 1R85A 1FHUA 1EX1A 2EG8A 3WQGA 5KSWA 4V33A 4RE0A 1KGUA 3GNOA 4JQAA 1O12A 4YVXA 5MF5A 3KOYA 2OKTA 3OVRA 1AZ1A 3CAKA 2G3NA 2Z27A 3DIPA 4ZXOA 5DELA 2V5CA 4LSBA 3GU9A 3DFPA 1R7AA 3LHVA 4O4VA 1XCXA 1CZ1A 3POHA 4Q4QA 1W5MA 1O66A 1QASA 1K4HA 3VDBA 3HG3A 1AA1B 1K8CA 3W86A 4LC6A 2VRJA 3EPNA 4JIPA 4M1RA 3ABXA 2PC8A 4K36A 2QV5A 2NQ9A 4UIOA 4IJCA 3W28A 4HOXA 2HEJA 3PWIA 4MB3A 1GG1A 2OOGA 5FF7A 3TW7A 4LU0A 4BK9A 5A6LA 1I45A 3S1XA 4IGSA 4DJEC 4MWAC 1PB0A 5DBTA 1VCFA 4NZ3A 1VLWA 4IISA 4OBTA 2VZOA 3CHDA 3FAXA 4RNFA 2ZUTA 5DRIA 3RF9A 2OYKA 5RUBA 2PFHA 4EXQA 3PTKA 4PBFA 4XTDA 4MVAA 2GJPA 1AODA 1VFMA 3WUFA 1R3VA 1QK2A 3NVDA 1TJ2A 1K6WA 4F0RA 2VT0A 4CEUC 1XBXA 1SZGA 4PTWA 4US5D 1B9BA 5HNNA 4O8RA 1M1BA 4L61A 2VRKA 1MFVA 1K9TA 4NNAA 3M0IA 4QBXA 1GOXA 4AD4A 5AHNA 4GKLA 3GVRA 3RO8A 4S38A 3OG2A 3S2LA 3QGVA 1D3HA 1K6AA 1X7IA 2Y24A 3TONA 3HV9A 2WV8A 1XYCA 3WBXA 2XWEA 5I3GA 1IWPA 4U10A 2Z6JA 1JUKA 3CUJA 4GZ7A 4GY0A 3MS8A 3RM4A 4K3ZA 3CPUA 1XLMA 4AEEA 1GKQA 4S1FA 1Q4NX 2P8CA 3FLUA 2PLJA 3SSZA 2QJJA 3L5AA 1XLKA 5C55A 3H2CA 4RDWA 4C6DA 2C8NA 1VQTA 4MNMA 2BOFX 5E0CA 4N2YA 3KEHA 4K2SA 5H1WA 1E0VA 4NKCA 2YFNA 2ZRWA 2C1HA 4PL1A 1TV8A 3L4UA 4I6KA 3FA5A 3KAOA 4ATDA 3G1XA 4DWSD 3VMPA 2NQJA 1VIWA 1WUEA 1E0XA 1PPIA 1FWFC 3BOLA 3ITOA 3MBDA 3BOXA 3UQNA 7ODCA 3DHUA 4K7VA 4C60A 1KFWA 4N7QA 2OYLA 2WVSA 4PC8A 3TYBA 4P8UA 3T2OA 1Q85A 3MP4A 1KBBA 1RJRA 1VEOA 4ZSUA 2P53A 3W53A 2WZHA 3K8KA 4JX5A 4PMYA 1BRLB 2G96A 3WDHA 1LBMA 4OJYA 3AWOA 1VIZA 4ZODA 4DY1A 1PTDA 3WLJA 4YWIA 4M81A 1XGEA 4D6IA 4GYPA 3R13A 1YTEA 4A6GA 2VGBA 4UNKA 3H2EA 3TQVA 1A53A 1TRDA 2HK0A 3TCSA 3KRSA 4O1DA 3CWNA 1L6YA 3C2FA 3PZQA 3W7JA 3DDMA 4AVNA 3H2AA 5AKQA 4ERIA 2CBJA 2QJHA 1EP3A 2XSAA 4INFA 4DLFA 6TIMA 2HRWA 1JIBA 3LUTA 3QEZA 3KTCA 3FA3A 3TUUA 2AL2B 2E8ZA 3ARRA 4GCXA 2HZGA 1P0KA 3PG8A 2ZZ3A 2FZBA 1L9WA 4V2XA 3SIMA 4DAIA 1ZENA 4DJDA 3GG0A 1LOLA 1VYPX 2Y1HA 4YS1A 3NEVA 4J2MA 5F2IA 1M6JA 4QJ5B 1KTNA 3W2LA 2HV5A 2OWWA 3EDJA 4PMUA 3TC6A 5DT7A 2ZKMX 2XIJA 3TIMA 5E1QA 2OG9A 4EPDC 1OBAA 4JNYA 1EBGA 4XD3A 1B3XA 3TROA 3E3HA 3SCNA 4S3GA 4W8AA 5EMKA 1G7VA 4L9ZA 4ACYA 3MPGA 4UTLA 4RXGA 5HMDA 4D8AA 4EKJA 3FFSA 2QHAA 1FHLA 1XL9A 1IZKA 1A3WA 4H9ZA 2PGFA 3H21A 2B4GA 2D2OA 3VIPA 4UFKA 1H0IA 3WLRA 3NOEA 4LUIA 2OLHA 1DP0A 2ZDSA 4HA4A 1UCWA 3Q2DA 3K4WA 3P3BA 4M3PA 2GUUA 3WFAA 2QUVA 3VNYA 2XPKA 2PCEA 4LXFA 1V3KA 3HV8A 3WLSA 2X1RA 1VJSA 3O6CA 4ZR8A 1IEWA 4LEFA 3V35A 2E6YA 3ONCA 4IQDA 1HW6A 1LUCA 2Y70A 1SFSA 1HXJA 4DUWA 3VNLA 3W1NA 3MJYA 1LQ2A 2YL9A 1HKIA 5C9RA 4QE4A 4W4QA 5G2IA 2FMNA 4IPNB 3WSUA 1QBAA 3K8MA 1V3JA 4E38A 3BPWA 2WM1A 3GAKA 2PP0A 3SUUA 1FWNA 4HOWA 4GZIA 3NO5A 3OU8A 1F4HA 3S2CA 4ES4A 1NARA 2OSXA 2WMGA 2O9RA 1KBLA 2H9AA 3THDA 4HD5A 5IFTA 2XSXA 1AQFA 3KBSA 3UFYA 1WXYA 2HTMA 2PCQA 2GQ9A 1QO2A 3WCZA 5BRBA 4QSFA 4DM1A 3QR0A 1B0IA 3UW6A 1Y0EA 3OHIA 4WDTA 1P7TB 4EXBA 1OFOA 2PA6A 4S3FA 4E6MA 4KEVA 3MV11 2ZUSA 5D38A 4L5ZA 1QPOA 4OUEA 3PB2A 5GJNA 4NZ4A 5A2CA 3W7QA 3ZJKA 2G41A 3UXLA 1GZ1A 4WKAA 4LY8A 4WUIA 1BYCA 2E67A 5BZAA 1JVNA 3OHMB 1IGWA 4O0QA 3EWBX 3WEMA 4JR5A 2PDQA 4RE4A 1UR0A 2RHGA 2WJFA 4FALA 1XD0A 2NSXA 1FWWA 3FKKA 1N55A 3AUOA 2F2HA 1RP8A 4ERGA 2ZUMA 2QV4A 1UKSA 2SFPA 3GR8A 4TTGA 2BGNE 2QJMA 3QBUA 2CITA 3QPYA 1TO3A 3PZGA 2MANA 3PUDA 2VQUA 2YOCA 3H12A 1RBLA 5I3HA 3TW6A 2AQOA 3IIXA 1VHNA 2XISA 4F0KA 4Q8WA 2YCJA 1U33A 1KCLA 7TIMA 3R10A 5HUPA 3QHMA 2GJXA 4LVGA 3CHCA 2OX4A 4QLKA 5FI8A 2PGEA 9RUBA 3DEQA 1M7JA 2CLPA 9CGTA 1J6PA 1S5VA 2Q6ZA 1VRDA 4PMQA 4LCSA 3HU7A 1MI3A 4GUJA 4I8DA 5CPMA 1L8PA 1PZ3A 1CGYA 1MW2A 3TDFA 3WMLA 5DBUA 2OWCA 3GHSA 2FDMA 3KOZA 1EKOA 4MSSA 4KIRA 4MB5A 1FP8A 3NO1A 3AXHA 1UPMB 1GTEA 5BRQA 4AAJA 2YLAA 5ABTA 4JTRA 4QQ3A 1E3ZA 5H8MA 2FTWA 1EPXA 3PNUA 4BI7A 3IK4A 1GKRA 4M8UA 3DG3A 3LX9A 3EX1A 3L4WA 3TFXA 5HUOA 1XLHA 2P5NA 1O6IA 1QNQA 2C18A 1A5UA 3TZNA 1Z44A 1WDWA 1KB3A 2JIEA 4OBRA 4KFOA 3KS6A 3UXIA 4ADUA 4ZO6A 3REQA 4CD6A 4LUSB 4HNLA 1GYMA 3ZXWA 3MMDA 3RRAA 3TYEA 3TWBA 3MMWA 3BQ5A 3JZEA 4XAZA 3F5JA 4Z0SA 1R3SA 1PIFA 2BGQA 1E6ZA 2LLEA 3WUGA 4FXSA 5EMYA 3UGVA 3L5MA 1HL9A 5LIWX 2DZPA 2HXTA 4MG4A 2J6XA 2WSQA 2PWFA 1Y5VA 3C2EA 1E1CB 4GQQA 4CU8A 3NQ8A 1JD7A 1PIGA 2Y6ZA 5I00A 5J04A 5CPTA 4ADTA 3MV01 1GVIA 3BVJA 4PGLA 4J5NA 3GC4A 1L8NA 2BHZA 3MUY1 1NAL1 4C7DA 3NL3A 1DORA 1IWAA 2UY3A 4HSOA 3LRLA 1QXLA 3IVSA 5GPRA 3B9DA 1MXGA 3UWUA 2QZRA 2DEPA 4YL2A 1TPWA 1R7OA 3A22A 4IFOA 4XSLA 4G1NA 1Z7AA 2GGJA 1XV8A 3OLEA 4R53A 4GI8A 4UFMA 2DZAA 4KIEA 4PN2A 3AJ7A 1R3YA 1I4NA 1PKNA 2QF7A 3R12A 4MMWA 3I6EA 4MOZA 4JEQA 2I5IA 1UH2A 1ONXA 4YTQA 3DX5A 2VGIA 1RBAA 3FA4A 1YNYA 1RD5A 3MJMA 4AFYA 2FVLA 4XISA 2J9ZA 1WDSA 3RR4A 2QIIA 3PULA 3APTA 5IDIA 1PL9A 4AYSA 1KM6A 3GDMA 2J8FA 2IKHA 6ENLA 2ISVA 4JTEA 4RKAA 1OIFA 4Q8NA 5F1UA 3UVAA 3K46A 1A4LA 3HJEA 5CBIA 2E09A 1RA5A 1ZNNA 1DJGA 4CU6A 4OUIA 1HL8A 3A21A 1GVOA 5HWNA 2CHRA 5AECA 1AW1A 5D2YA 1E1FA 4RL3A 4IX0A 4DYEA 5FJJA 3IAQA 2E5BA 1H62A 1V7AA 4OQVA 4YVVA 3GY1A 1SW7A 5CC3A 5BXTA 2FYMA 3DYMA 2UY4A 6PTDA 1OX5A 3GNDA 2W79A 2FJKA 4YTSA 1XKJA 5AOUA 1NF0A 4L1GA 3IAPA 3VGHA 4JKMA 4C1LA 1TVLA 3SEPA 1W9DM 4JY9A 2P50A 1UBPC 1GGOA 2V69A 4FLSA 4WDWA 1CXIA 5TBOA 1VENA 4MJ4A 3AXKA 1EGVA 1P6CA 3QOMA 3L4YA 3U8GA 3H4GA 4IMEA 4JHZA 1TFVA 4FA3A 5MHBA 1OADA 2I56A 1F3EA 3AS0A 2JKEA 3E38A 3VXGA 2ZX8A 1US0A 4AW7A 1SPQA 3VCRA 5BOOA 1G4PA 5DCBA 1YNQA 1VFSA 1EHAA 1SR9A 3OQ8A 1EDGA 1XLEA 2Y7EA 2FPTA 1C8QA 2Z00A 1OZMA 4XB3A 5EL1A 4AH7A 1DTUA 1HKVA 1C92A 2ZIDA 3URAA 2D20A 3MU7A 4ML4A 1JDEA 4IUGA 4Y9AA 2PPGA 4ZO9A 1WOAA 4GISA 4GUFA 5F2MA 4B5VA 2HPIA 3OBEA 4Y8FA 4I8YA 2A7PA 4DWSC 4WY0F 5EFFA 3O05A 3BTNA 3KRZA 3EWUA 1TA3A 1B4KA 4P7NA 2DIKA 2ZXQA 1JCXA 1VFFA 4XKYB 3T42A 2F6UA 2B7QA 3BV7A 4O52A 1GEQA 1A80A 4JNMA 4AIOA 3ORWA 4IMFA 1PKMA 3PTQA 3EWWA 4WD0A 1V0MA 4PMVA 3IJQA 3K4DA 4PUKA 3LD5A 4RV8A 3TYUA 2H3DA 3VIKA 4H19A 2GVEA 4H8VA 3S1UA 3EZ4A 1SUXA 1U1JA 4F48A 1ICQA 1EXPA 5KTLA 3CZJA 3PZMA 4HU8A 4LUJA 3E2SA 4PRWA 3NGFA 3W9ZA 2WWDA 4JL2A 1F8MA 1V77A 1R46A 2QLYA 5EU9A 4YXGA 1ZJHA 2Y89A 3C8NA 3T4WA 4AU0A 3FIGA 1EEXA 2O55A 4ALDA 3GG8A 2CWNA 1UB3A 2INZA 2X16A 4JTQA 3RX2A 2VFHA 2WVUA 5FAJA 3KBWA 4UZUA 3LMYA 4X0VA 1JCMP 4F2UA 3QRHA 2W27A 3NOYA 2CPUA 4MFEA 2HBXA 1Q65A 1EWEA 1V6VA 3A47A 3F2DA 2NWRA 3BOFA 3A12A 4MY8A 4RX0A 1Z6KA 1JDFA 3A4XA 3TYCA 3GFZA 3OYXA 1I60A 4DEFA 5HATA 3GB6A 1KKRA 3WBYA 4JTAA 1QI2A 3TOYA 2I1OA 4FLQA 3M44A 3PBMA 4H7ZA 2A1YA 1VFHA 1YDNA 3NDOA 2YL8A 4J40A 2V2CA 3W4RA 5AC6A 6XIMA 3UZ5A 1BG9A 4YIWA 2VEMA 3KE0A 5HMEA 3AO0A 3OGRA 4HMEA 2FB3A 4KRTA 3NVTA 1SO3A 4TV5A 1ECEA 4LF1A 5AC4A 1NWTA 4KW2A 3DC0A 1KRCC 1KA9F 3NTYA 4CD4A 3WJZA 3LYEA 2D0FA 2NX1A 2TODA 3SY1A 1H41A 1WKEA 3AMLA 3PBGA 1FOBA 3ZZ1A 1TQXA 1JG9A 4X3ZA 3GC2A 1A5OC 2W62A 3PJUA 3PFRA 3VIHA 3A23A 1JGIA 3IV3A 2XGIA 1AMKA 1UKOA 3BGGA 3P14A 1CNVA 3BW3A 2EO7A 2Y4SA 1UASA 2J7EA 5FEPA 4TO8A 3N1AA 4REQB 4LEQA 4BWLA 2POTA 1H7PA 3GTFA 3PG9A 1U22A 1J79A 4HHPA 1RQBA 1MRQA 1JYVA 2ZE0A 1MZHA 4CQCA 3FXGA 2I7GA 4RZ5A 2POZA 4LYRA 3KVMA 4HZ7A 1JL8A 1QJWA 4O10A 3TXVA 3B4YA 1FHVA 1XIBA 4UCFA 3VM7A 4AZGA 3BV4A 4XZIA 1Q7ZA 1US2A 4B4FA 3KL0A 5E70A 3P62A 2FZ9A 1L6GA 3P74A 4OKDA 1ONRA 1X1OA 3MUZ1 4QJ3B 3QW4B 3UG5A 3BICA 2WSPA 3B9NA 1YBQB 2DZBA 4FAMA 3L0GA 2ZTJA 4GOAA 1RQHA 4DLMA 4HK7A 3ARQA 2TRSA 4N9CA 1BVWA 3IJ6A 1FFQA 2RJHA 3ZLHA 2JEPA 5C2XA 3CNYA 4W86A 4WY0A 1ZL1A 2R6OA 5LNVA 1W3IA 4ACZA 3H8AA 4HQVA 3V0SA 3LCLA 4ZBCA 2Q3OA 3NDZA 5DX7A 2DVXA 2AKMA 3NQCA 1KM1A 1Q6QA 4B91A 1EQPA 3NFUA 1P48A 1LP6A 3MA8A 2A2IA 4X22A 1V6UA 3W7GA 1Z3NA 3PWAA 3UD6A 4QJ4B 5CSRA 1AFSA 1T8QA 2YB4A 3CAWA 3DKLA 1QRQA 2FZNA 4AF0B 4ICNA 1I1WA 2XH0A 1Y5WA 3DN5A 4NASA 3THQA 3U4AA 1GQIA 5T9CE 1XLGA 7PTDA 5I3DA 3AUJA 5BWAA 5M2FX 1IWBA 2WJEA 3FK4A 3TNOA 4BCEA 4LC8A 3NQ7A 4MADA 4NZJA 4Z0JA 1QNVA 1DWHM 1V3HA 3TN3A 1NFBA 4D8ZA 4A29A 4E8CA 1H63A 3QQWA 4JTSA 5REQA 2VOMA 4EAMA 1GVRA 3CIXA 3HPXA 2DT2A 2IKIA 3RRXA 1A5SA 2PWVA 4DVOA 5JU6A 3N13A 1SU5A 2XU2A 3BJTA 3EEZA 3VYLA 2O56A 3NM1A 2G0WA 2OQHA 1QK0A 2YA0A 1FRBA 1DWIM 3SM0A 1J0JA 5DMYA 5K3VA 3CZKA 3B0PA 5CXPA 2YA2A 2DIJA 4I7UA 2IKJA 2C16A 5EFDA 4AY7A 3B9EA 2AGKA 2XM1A 1KKOA 2XUCA 3II1A 3FOKA 3AYVA 3F4DA 3W02A 1IV8A 5J8LA 3HQPA 4RV3A 4DNMA 4C6MA 5HMFA 1EGZA 3H4WA 1C7SA 4UFLA 4PMXA 3M46A 1BKSA 2Y88A 1FWCC 2VC5A 1KLZA 1W37A 4C6KA 2BP1A 1ZCCA 3UERA 1JDAA 4IG2A 4C6NA 2ZUVA 3CTTA 1JI2A 1XUZA 5BCAA 3QYQA 5K4ZA 2AMGA 3PBVA 2PSNA 3NL6A 1TWIA 2ACQA 2RGMA 1LZOA 4KF1A 3HB9A 4FZIA 5KETA 3DG6A 5C0QA 1CXEA 1UYQA 3RLHA 2KZHA 3A3XA 1BTCA 2Y5JA 3MO7A 4QROA 2GOUA 3QC0A 1H7RA 2A79A 1N8WA 3ZJ7A 1J01A 3DFQA 1AJ0A 3WY1A 1ICPA 5G4WA 5LNWA 4IUOA 2C13A 4XZLX 5LKYA 3O1NA 5GQBA 4DHGA 3TAOA 2WMKA 3SCRA 3LN3A 3O15A 1POKA 1DVJA 1WKYA 2XIMA 1MW3A 4B5SA 3PUGA 3VOGA 4W9TA 2YW4A 3CUFA 5XINA 1DE5A 3CMGA 1XSKA 4MNLA 1Q6GA 4N9EA 4P7OA 1HJVA 3WH6A 4GC4A 1YW1A 3GAYA 2W91A 3L0KA 1JEZA 1PZ1A 4H9MA 1AVAA 3GSMA 3V1HA 3WNPA 2NQZA 3VOFA 2VL4A 3R11A 2D0HA 4DB7A 3JW7A 2FMOA 3TSMA 4I9JA 4HYWA 1RK6A 4JOMA 2CZVA 4W7WA 1TMQA 2RUSA 1FHDA 1RH9A 4AC7C 1QI5A 1KD0A 3FJNA 3UR5A 3GYCA 1TJPA 4BJHA 2VD8A 4E4UA 3OQEA 1KGWA 1R9YA 1M03A 4UTJA 1RBOB 3L2LA 2YBVA 1TPB1 2H8ZA 2BBFA 2A6NA 3WH5A 2BY2A 3HGSA 3W22A 1F8IA 1MQPA 2HS8A 1DJYA 2E28A 4MZ1A 4NAFA 5ECUA 4UQ9A 1AH4A 4MIMA 4HNNA 3IIVA 3ZR6A 3RUBL 4Z2JA 4U33A 1E72M 1G4EA 2GZXA 4I3GA 5AHFA 3SN4A 3TQPA 2WVVB 1GONA 4JYEA 4EP8C 2O0TA 1B57A 4IH3A 1IHIA 5FEZA 2ZZ4A 4AQLA 1WDDA 3E0WA 4NQ1A 4HNOA 2WBGA 2EHHA 1PZ0A 4ZXLA 4NP7A 1NQKA 3BSMA 4MJMA 1EX5A 1LTDA 2Q09A 2DUAA 1E0TA 5HDRA 3TJLA 1OWQA 2JFEX 5AYZA 5LXXA 4TX6A 4Z08A 3WJSA 4J28A 1A5CA 2PWGA 4AVFA 3ARXA 1JPMA 3A13A 3TTEA 1B90A 1L6FA 3UG8A 5A6AA 3NNTA 5D2TA 2WB5A 1EDQA 2PDPA 1NOWA 4A3RA 1WE5A 2VZUA 3SCOA 3HA1A 4Y90A 2VUNA 3L12A 2J74A 4AZIA 3S1VA 2PWDA 3QMRA 3WLLA 1NF7A 2ZZ6A 3TU9A 4HTBA 4UFHA 4URIA 3NCOA 1KBKA 1FWGC 3KZSA 3U9IA 2CZ5A 4C1NB 1K9DA 1X6LA 1C9DA 3E0IA 3SJNA 2PS2A 2CLLA 1BWVA 2D2JA 4TMCA 3ZWSA 4LVBA 2ODOA 3GH4A 2JGYA 2XHYA 1T40A 1BG4A 4M1BA 2CHNA 1DJNA 2Y7FA 1H5YA 4K1WA 3M0MA 4I9MA 3OB8A 2W6RA 2GDUA 4LVFA 3URQA 9XIMA 5K9CA 4IFRA 1S1PA 3GM8A 3SQLA 1TE1A 4TVUA 3PPGA 4IIBA 4X63A 3G24A 1R6WA 1U1HA 4LAZA 3TSDA 2YXOA 1F05A 1XCFA 4IGMA 4RNJA 2QXWA 3UG3A 2QUMA 3SR7A 3CHVA 1YXYA 2ZWZA 3CGTA 3RFAA 4HA3A 4O18A 2D2HA 3KHDA 3TYZA 1B1YA 3WQ6A 3CV2A 3OIHA 1RY8A 3U3HA 2UV8G 2BVYA 2CLMA 3FAWA 3S2MA 3WF1A 1W0MA 2VYOA 1M7XA 4Q8UA 3ZMRA 4HZMA 3ZIZA 1GUVA 2WWCA 1OCNA 4A3HA 4ICCX 3W7OA 2VR5A 5EMMA 1KW1A 2E6FA 1AQHA 1GWJA 5B7ZA 3R8HA 1KRAC 3RCMA 2HVMA 3WQDA 4AD2A 1QPKA 3WMCA 2VTFA 2V67A 3GKAA 3K8LA 4WRHA 5G2HA 1JZ7A 3NG3A 2OZTA 1FWRA 1TWZA 4QLJA 3WELA 1OB0A 1TSIA 3B9AA 3G5EA 3ARZA 5FF4A 2FPYA 2VMFA 4P5UA 6CGTA 5LIYX 2CXGA 4TMBA 5BW6A 1B5TA 3ZYZA 1QOQA 5CJ5A 3HPSA 3EMQA 2DSZA 2QAPA 3IGUA 5D8WA 4RDYA 3VX1A 4PSPA 3DYOA 1KRMA 2NV1A 4B16A 1ISVA 2DSWA 3KCOA 3VDHA 2OGYA 1ME7A 1OC5A 1E6SM 4AX7A 4XVDA 4MNJA 1R3RA 3DXIA 2W9MA 4QXIA 1M7OA 2PDMA 3B0UX 2X1TA 3QPEA 3T78A 3N34A 1PTAA 1ISWA 3TP4A 4RZBA 3DKJA 1GQJA 4QS5A 1JD9A 1Q8JA 1V08A 3WDPP 4JPGA 1A47A 3UYCA 3EOOA 2DH2A 3GKFA 4KCUA 5EMLA 3JZUA 4I5UA 2V30A 1DWFM 3WNOA 2J25A 2XVPA 4WEVX 3EGJA 4KS0A 3VDCA 1TV5A 1NEYA 1KM0A 4EOUA 1U5VA 4NJJA 4F0MA 1O7AA 1RZMA 3WUBA 3AIWA 4Z1CA 3UF9A 2QYGA 3GC5A 2XDFA 1Q63A 4UTTA 4V28A 1BD0A 1NDZA 1V3LA 1E73M 1MVYA 1XS2A 4QX4A 4EVZA 5LA1A 1DXFA 1U2YA 2JKPA 1S2VA 3KP0A 4RUBA 2C79A 4M6UA 3S83A 3VUPA 1ITUA 2WQDA 2HNHA 3TR9A 4HMNA 1XISA 4DQWA 1F5ZA 2V2DA 1TPUA 3T0AA 5CC5A 3IWPA 4UR7A 3SGGA 1GORA 1Q6LA 2A3HA 4N9DA 3MUCA 3PN8A 3AFBA 3N6JA 2CXEA 3LPPA 3N9KA 1JR1A 3VOHA 2EBNA 4AISA 2YCEA 2DFAA 3GNXA 1MYRA 4L6HA 2E8YA 4DJDD 4CVWA 1A5AA 1OFAA 3W7LA 4CQ9A 3C8FA 4IQEA 2V5KA 1EH9A 1U30A 3M16A 4DJFD 3MWCA 2O7QA 3R1ZA 4NAEB 1R9XA 4UTWC 4H6RA 3N4AA 3G0SA 1CEOA 2PWEA 4MJZA 1H0GA 3K1GA 2XH2A 2GSJA 3AMGA 3OEXA 2PP3A 3QVQA 5AYXA 4PCTA 1MUWA 3VM5A 3EX4A 3OP2A 5I77A 1WDPA 3RX3A 5A8MA 3OGVA 2GSHA 2B81A 4GVIA 4LQ1A 3CZGA 2X7WA 5TF0A 3W76A 1GVYA 1G01A 4UTIA 3KVJA 4RR4A 3QFWA 1A50A 2I17A 4PMJA 3W2NA 3AIBA 1Z8AA 2WMFA 4NZCA 3AHXA 3UZYA 3DAQA 1HT6A 2CYGA 2BVWA 2EPNA 4R9XA 5LYRA 4H3DA 1UR1A 2JF6A 3WLNA 2C6QA 4G8TA 3APGA 4O1FA 5HWJA 3WLKX 1QR7A 3VC5A 2IS7A 1LDCA 1HO1A 5I3JA 4B9YA 1YLVA 2Y5EA 1XKYA 1OCQA 4IXHA 4PUUA 5IOBA 3IJ8A 3WK1A 4WGHA 3POCA 3LNPA 1ICSA 1W54A 4PBGA 4AD5A 4JCMA 1RAKA 1N2VA 1H7XA 2BTMA 1RVKA 3VX0A 1Q45A 1O60A 2BXVA 4H7VA 3PPCA 4HVXA 3HJZA 3NL5A 3KRUA 4RCXA 4M6PA 1CWYA 2XVNA 1A5KC 6REQB 1W9PA 3T1GA 1KFEA 1F74A 3LK6A 3L9CA 3C0QA 1UD5A 4RE3A 3SN1A 3MHGA 3TN4A 3PZIA 3W0KA 3M6YA 4O15A 3RM9A 4KQNA 4X9YA 1O5KA 4ZE5A 3P93A 1OGGA 4UMAA 3W07A 3SCTA 2IQTA 3BLPX 4ZQMA 1LYXA 4J3ZA 2PGRA 1W9BM 3Q4DA 1TTJA 1C29A 3FGCB 4PYSA 1LWJA 4H41A 4R88A 4BI5A 4H6KA 5LNSA 2J7FA 4FO4A 3GNPA 2VFDA 4OBSA 1YQ2A 2C1GA 4HP5A 3W00A 4PE8A 3S9YA 1NOFA 3IIOA 3W2MA 2PRHA 3KRBA 5DQPA 1SSDA 2GJLA 3UZJA 1E4NA 3W1QA 4MPQA 4AIBA 1SSGA 4AD1A 3I3EA 3JRKA 1GYLA 4W5ZA 1TPVA 4HK6A 3WD0A 1E55A 1EFZA 5FACA 4XQ6A 1VBJA 3IRDA 3IIZA 3URNA 4DZHA 3OG3A 3TK7A 1I0DA 1HJUA 3W7PA 5IM51 3Q58A 3HGOA 4I7WA 4AIUA 1YDYA 3N3MA 1B3WA 1G7UA 3TTQA 3GDLA 4D6EA 3GNNA 1OG6A 2NXIA 4B3ZA 3UY7A 2XIBA 2R1KA 4O57A 4H9XA 5JBEA 5FEWA 3GXFA 4AY1A 3UR7A 3SGZA 3GO2A 5HQLA 4K38A 2JGQA 1EPVA 3A5FA 3IIPA 3F03K 4J3WA 1EF2A 4WK9A 1UD3A 3U5UA 2PLKA 5A8GA 4HCHA 2QVHA 3VIIA 4WJEA 2GJNA 4AZ6A 5G1TA 2OYMA 3Q37A 4FI4A 1XIHA 2AQWA 2XINA 3UJRA 5DN1A 5TQLA 3KBJA 2VR4A 4L4PA 1JQXA 1VEMA 1W3JA 4CLMA 2C71A 1MUMA 4R5EA 2X0YA 4N42A 4L4LA 3CO8A 1DTNA 3ME3A 1WO2A 4IMCA 4DRSA 1UG6A 1VFTA 3T8LA 3CHFA 3PANA 3OZMA 2VDGA 4KWUA 1W1VA 1WDRA 3IJ7A 3T0DA 2G5WA 3CUIA 4HN8A 5D09A 3QMTA 2H6RA 2PD9A 4JIIX 1SZFA 1EBHA 1BKHA 4XD5A 2P3EA 5IHSA 2XGBA 2GQ3A 4E3TA 3ARSA 5M3WA 3IUDA 3XINA 5BU9A 1X1ZA 2RDTA 1GQLA 5ABEA 4OT7A 1EC9A 3UEQA 3O0KA 5C2CA 1XQKA 1TCMA 3CZLA 4NVTA 1SM9A 3E02A 3CO4A 3UESA 1JF5A 1EC7A 2ZRYA 1HUVA 3MZ2A 2DIEA 1VYSX 5FJPA 1J8VA 4G5DA 3GFYA 2WSYA 1KTBA 5A8QA 3APYA 1U1UA 4LT9A 3W75A 3U0HA 5A5WA 3LBCA 2GVJA 5AZ0A 2BASA 2ATSA 2EPOA 3MKKA 3H4XA 3MSRA 5LA0A 5MKGB 4QRNA 2QUNA 4U4MA 4HNTA 2YBTA 1E70M 4HCLA 2ONEA 3M43A 3HURA 7ENLA 1XYFA 3GBEA 3NZPA 4XX6A 4ZFCA 4GBUA 3AS1A 1TMHA 4F0HA 4HBKA 1TWWA 4JTHA 2W63A 4F2BA 3AIQA 3ZFHA 1VJIA 1B3ZA 4E2VA 4JTDA 3MY9A 2XGZA 1XLIA 1IT8A 3LLXA 4JQ3A 4AIEA 2YCIX 2AL2A 1RJQA 2CU0A 2V2HA 1UD4A 2J8TA 1K8XA 4DNHA 1ISXA 3B8TA 3CMJA 1NWSA 1SFJA 1IIGA 4DBUA 3OOQA 4U5IA 3IACA 3O8AA 1JFXA 3GD6A 2XH7A 1Q2SA 3ES8A 3QY6A 4B5XA 4DUXA 1SJCA 5HXMA 1JDCA 2WBKA 4Z1BA 1TUXA 1YTKA 4P7LA 5D37A 2V8ZA 4B5WA 3L23A 4UQEA 3ENLA 1J5TA 1B3VA 1JFHA 1MDRA 2OELA 2CWXA 1ZP3A 4YTRA 3O63A 4BI6A 5CAKA 4D1IA 4D6JA 3NQAA 2VXNA 2Y7DA 3L2IA 3EPMA 3VNIA 2P76A 3BLKA 1PXGA 5HQMA 1YNPA 2W5FA 3W38A 5HQEA 1KBIA 4XZWA 3NAVA 1W5OA 3FHAA 1CGXA 3N04A 1GZJA 5E0FA 1S38A 4EWND 1LWHA 1GOKA 2MUCA 2NXHA 4E5TA 4TIMA 3G1VA 4LANA 3CZ8A 3IJLA 3LI0A 1THFD 3OJGA 3N25A 1P6BA 3G6MA 4ZEPA 4EX4A 5C71A 1GJWA 5KMYA 3VC6A 3NXFA 1GT8A 1BF2A 2VGGA 1Q6RA 1JUBA 3G6LA 2GGHA 1UOKA 4Q7NA 4RPQA 4PMNA 4HIBA 1PJ9A 3L2MA 3F2CA 2WHLA 1J0HA 2WNWA 3WFZA 4AWTA 3GVVA 3BSHA 4A3YA 4PCSA 1WZMA 2PBOA 4ZTYA 3VGDA 1TTQA 1CGTA 4JYDA 1KM5A 4X2PA 5FESA 1BWLA 3GU2A 4LBUA 3W23A 3DGBA 4HYVA 3WJXA 1R3QA 5BXPA 3HTWA 1ZB5A 3W25A 3RG6A 1H3GA 4FNPA 2HSAA 9XIAA 1A0EA 3EDEA 4A05A 1U83A 4Q4PA 2WOQA 4HPHA 1EZWA 4D1JA 3AZSA 1OFPA 2Z26A 2REQA 2QDDA 4ZZ9A 2I9UA 4L64A 3LDVA 4LH8A 3NZ1A 4IFKA 4R7JA 4GYPC 2VEFA 8CGTA 4XD4A 4RDVA 2X0SA 3CEUA 3VOJA 1TZ7A 3K5XA 1CBGA 3W1PA 4DF2A 3BURA 1D8CA 1XDMA 3T0TA 3AMCA 1PVNA 1XI3A 3EWYA 1XRFA 2JF7A 1E4MM 2C0HA 2XG9A 2QEZA 2ZA1A 3A6OA 4GFSA 4TV6A 3S5OA 3RMJA 3UZWA 3ITTA 4JHOA 3E74A 3QMSA 2ALDA 4DJDC 3WH9A 5AVHA 4LV9A 4C1KA 1AJ2A 2OLSA 2FTPA 3OLGA 3UWQA 1AUSL 2YZRA 1IR1A 1ZAJA 2DW6A 2R1PA 3PY2A 3PJXA 3ABZA 3R0DA 3P82A 5F2LA 2NQLA 3WF4A 1T6MA 4GK8A 3AJXA 2WW5A 4XIMA 3WH8A 3KOFA 3ZM8A 4UFJA 2E5CA 4ORIA 3FHQA 4AZ5A 3ZT7A 1R0MA 2F8QA 2J79A 3RN6A 2PTZA 4RXFA 3MHFA 3HIJA 4KH2A 3PAJA 3S6DA 1UBSA 1SMDA 4C91A 3DGRA 2PDBA 4JFWA 1C90A 2CEQA 4LAOA 1OYCA 1UR4A 1SFTA 4J3SA 2EKGA 2ZFAA 3V5OA 4AUBA 1LROA 2ASHA 4JEJA 1NSJA 3UU0A 1DWAM 4JFSA 5EMJA 5CBJA 4G6CA 1BSLA 1DIOA 5AZ1A 3EBVA 4NI8A 3PP7A 3ATYA 1NELA 5H8UA 4M5PA 4K39A 1EJVC 5A8OA 3IVUA 3ZSTA 2WLZA 3W83A 1S5NA 2ISSA 3G8RA 3DI1A 5LIKX 4DN1A 4LUSA 3LCFA 3G3DA 2UY2A 2E68A 1QBBA 2NVAA 4GFIA 2WPBA 4Z42C 1PTGA 2Y2WA 2A3LA 4MF4A 5BOFA 3R0UA 2GK1A 3ZJ8A 4FNQA 5FOOA 1GPWA 3B05A 4WXYA 5M5DA 5ABFB 3BG5A 2Z2BA 2VP8A 3U2CA 2O9TA 2WJDA 1PSCA 1UZ4A 5CPQA 1O5RA 3I10A 5LGXA 4JFUA 3VDAA 3K1DA 2HE5A 2NZLA 3REQB 3WNLA 4FB7A 1BTMA 2YW3A 2HNEA 4QP0A 3AHYA 2QGHA 4V1YA 3C2VA 2G4JA 4Y9OA 3BJFA 2ZX6A 4H00A 3PK7A 1E3XA 1SZNA 1ITCA 2CC0A 3M64A 1BXBA 4Z2HA 3CMFA 2ZXAA 4IJBA 1DYSA 3UCDA 3SFWA 1JULA 3W24A 2J7GA 5F7UA 1ZGDA 4UR9A 4WSKA 2NUXA 1G4TA 1W17A 3N19B 4Q3MA 1E9ZB 2WSRA 5AC5A 1C91A 2JEQA 3CEPA 3QOKA 5G5IA 4KPLA 3EXTA 1FDJA 2GWNA 3TWAA 3MANA 4E3VA 4GIYA 4PB5A 1TIMA 4JDYA 5D9NA 3H7UA 5I09A 1RLDA 3T07A 3RJXA 3WKZA 2J4GA 1DIDA 2QCEA 3PWGA 1BXNA 1VBUA 1ZLPA 2Z0IA 5AYBA 4XAYA 2WSKA 4H9UA 3EPOA 3QPZA 2RAGA 2ON3A 4DI9A 2GL5A 3BARA 1T99A 3PM6A 5A3HA 3W37A 4W5UA 3G1HA 4EACA 1Q66A 4Y9MA 4GIRA 5AHMA 2PTXA 3N2XA 2Y5SA 3W6YA 4LX4A 3VGGA 4K68A 1WPCA 1XIJA 2J7HA 1JCTA 5HMSA 4JYFA 1G0CA 1BYDA 1OCBA 3VGFA 3PB0A 3NPXA 3S46A 4PRTA 4QIUA 4NRSA 1Q7MA 2CW6A 4O8AA 2HROA 5HR7A 2OODA 3QV6A 4CCZA 3I3BA 3AZRA 3PBUA 4KT2A 3TXZA 1EL3A 4PMOA 1DPMA 4QFUA 3W2UA 3UVIA 4BHYA 1JUEA 3GYEA 3GR4A 4H4IA 3U7BA 3AIEA 4DYKA 1SZRA 2WANA 5A1AA 4TXEA 1K1DA 2KAUC 2Q02A 3GVWA 3EAUA 3TV8A 1NU5A 4F9DA 4J4KA 2B31A 2DP3A 1R3WA 1CXLA 3KCJA 4JIRA 2ACSA 4UBPC 1TZZA 3LLDA 1O1ZA 2V5LA 3ITVA 1Z32X 3HG4A 2ANUA 3OBKA 3QV9A 3B8IA 1P0BA 4MFDA 3S5SA 2DZWA 1TG7A 2PDXA 2A4AA 3G1AA 1A5MC 3QQ1A 4EXAA 4IQLA 3I65A 1LJYA 4QISA 1Y8BA 3LCHA 4ERAA 1LOQA 4TU1A 4IPIA 4JIQA 1BEUA 1P5BA 1FWDC 3ZT5A 4BZYA 3CAVA 3RILA 3E5PA 1BYBA 4H01A 4PZVA 1H50A 3WL1A 3WD1A 1KM3A 3W2JA 3ZO9A 2ISWA 3PC0A 3GIYA 3B04A 3T55A 2Y61A 1MEIA 3SRKA 3BW4A 3W73A 4TX9A 1CW2A 3OW1A 4PTDA 4YPJA 4MKNA 3ITGA 1UOZA 2VQTA 2Z2UA 2WZMA 1EGMA 2Z29A 4KERA 4C65A 1OSEA 2ABBA 4EPBC 4NRRA 4S3EA 2D3LA 3GW0A 3SFKA 4L1WA 1HJWA 4NIRA 2X05A 3HGJA 3LZ5A 4HSNA 3H70A 2QPSA 5EKYA 3WIJA 1NDVA 1W1IE 4PCPA 3GWQA 2BG5A 3VNZA 2RFGA 5IDZA 1EDTA 2VNCA 5EGRA 5CJNA 1OD0A 4DO6A 1S39A 2BHYA 1M04A 1J93A 1LORA 6A3HA 2IMRA 3BUVA 1UROA 3V1PA 3GW3A 3ANYA 1JCJA 4MPKA 3MVIA 1F76A 3DFOA 2OB3A 1JZ5A 4IT1A 2WKJA 4JTGA 1FCVA 2NT1A 1V0LA 3PJTA 1HQTA 4NU7A 4HT3A 4D6GA 1B3YA 3TJXA 4XIAA 4GUIA 3SJ3A 1HJSA 2VEIA 5CLTA 1CECA 2F61A 2A3EA 4HJFA 4ZCWA 3B97A 3LPGA 3C0SA 1LRNA 1PCKA 3LMZA 5I3FA 4JTCA 2C0AA 2QCMA 4CNNA 1AD1A 4L6DA 3ZLFA 4B92A 3FNDA 1H4PA 4DXKA 1KRBC 3BAYA 3KS5A 4JTIA 1TVNA 4ZQNA 2WYSA 1KQYA 1UUQA 1KXHA 2D23A 1RLCL 4UZSA 4KGJA 3NPUA 4FXRA 4YNGA 1GVSA 2FLIA 5FSDC 3I7RA 1K7EA 3EWZA 5HNUA 4MUZA 4IPPA 3S9ZA 5DCEA 3BLDA 4IQJA 1ADOA 2CHOA 3T40A 4YYCA 2E9LA 2YSWA 5A6BA 3HGRA 2E9MA 4KFNA 5T8GA 5U4NA 2EQDA 2B7NA 3BDKA 3U2OA 2R82A 3EB3A 3TMQA 1QHOA 4QM1A 2FHBA 1AZ2A 1OFEA 1DXEA 3FEMA 1E9YB 3UA4A 5PTDA 3BW2A 3VKDA 3USZA 2VCCA 3BANA 1D9EA 2PP1A 4QG6A 5T9BG 2D1ZA 3VDGA 5CGMA 1DKWA 4REQA 3HMCA 2PDHA 3MCOA 4PB4A 3A24A 1RXOB 2P10A 3EOLA 1VPYA 4D2JA 3AHTA 2B0MA 5FF0A 1XUUA 3S5NA 4UTUA 3B40A 1MRAA 1KLYA 1YYAA 3W88A 5F4SA 2J7CA 1VGAA 3C86A 1XH1A 1DJIA 3MWAA 3INPA 2CKRA 5K2ZA 2ZZ7A 1OD8A 3DECA 2PDJA 4N4QA 3HOJA 4DO4A 3W1MA 1EJTC 3PBYA 3P0XA 2J75A 4UQAA 4N4PA 4WXZA 3WBAA 1EP2A 1HFBA 4F79A 1ENUA 1RP9A 1VBRA 3BH4A 4Q4KA 2ZUUA 3EOSA 3R2GA 4DZAA 2OMAA 2YXGA 3OVGA 4YCOA 3GQYA 4HZ6A 5GNYA 1YE6A 5JXQA 1UWIA 2GVLA 3TN5A 2ZQ0A 4E4PA 3HG2A 4E8DA 3WEOA 4RE2A 1FDZA 1QNOA 5BMWA 4TQTA 2R14A 1PAMA 2NXGA 1J2WA 2CZFA 2A0NA 1LLOA 1K70A 3PBWA 1HL2A 3P8JA 3R25A 4S23A 3QHNA 1OT1A 4JX4A 4XD6A 2W4XA 2UBPC 3ISIX 5I5RA 3SQSA 4IIFA 3PZTA 1JZ8A 3W1TA 3EKGA 4OWGA 1AG1O 4Y9NA 1UJQA 2Q01A 2PB1A 3QF0A 5K4XA 1HO4A 3I7SA 3R6IA 4OV9A 5H91A 2EJ1A 2ZX5A 3FN9A 3ZSSA 1WUFA 4GUHA 3BGAA 3WH7A 5D9PA 4WY0B 4UTFA 4RPPA 2CBUA 4JTJA 4IM4A 4ACZB 3T7VA 1R38A 1NVMA 3JVAA 4XO6A 4KWWA 4EPEC 3MHUA 5JQ9A 1T0OA 1N82A 3OGSA 4GCAA 2TMDA 5HNRA 2Z24A 2YDQA 1EUNA 1TREA 1J5SA 2C15A 1E6QM 5BYWA 5LIUX 4EE9A 3TVAA 1YX1A 3D47A 4Q4MA 2W66A 3COTA 4IPJA 3E6EA 4J7RA 4HOZA 4GC3A 3MCNA 1PDYA 1IT0A 1XIEA 3LXAA 3SN0A 1WBHA 4WKFA 4DBWA 2B7PA 2DUXA 3GNRA 1FXPA 4QS6A 4AZBA 4E4FA 2EAWA 3BJSA 4GI9A 2MNRA 2R9RA 3CK5A 2Z1BA 1CPUA 1TJ1A 1X8FA 3E49A 2P88A 4KEMA 2OEKA 3CQKA 2P1FA 4QLLA 1G1YA 1KFKA 2PUZA 2PDFA 3FEQA 3MP5A 4HNUA 1K77A 1WDQA 4GI4A 3KP1A 2ADAA 4DXXA 3OTRA 1JYWA 1T8XA 4B3LA 3IUIA 5EYWA 1AMYA 1ECQA 1TWSA 3CIWA 4E2OA 1AH0A 3F4WA 5AC7A 1OK6A 4ZENA 3LTSA 1SO4A 1G94A 4W87A 4U5KA 3D46A 1I6NA 3CWOX 5EBAA 3T4CA 1DQXA 3N6HA 4UTMA 2R8WA 3RPTA 3LEPA 4KRUA 4TUFA 3CZEA 4YYFA 2GOKA 3VFCA 4PUWA 3RR1A 2Y62A 5HJYA 2XIQA 3FJ4A 1K8YA 3D3FA 1VHCA 3W7MA 2O4QA 5I7GA 3U7VA 1XQLA 4S3KA 3W27A 4PBEA 4O1CA 4Z2KA 3QLDA 3FS2A 1MZRA 2BDQA 1H11A 1TV4A 1PIIA 2PODA 3VE9A 3BL3A 4XZMX 4GYFA 3IANA 4IG2B 3IK2A 2VENA 3BLEA 3G8EA 5BMXA 3M0JA 3ITCA 2WZEA 3CV7A 1TJ0A 1OC6A 3PZNA 2I5QA 3H2FA 3ZT6A 3VTRA 4HU3A 4RZ6A 4IX2A 3NSMA 1MDLA 2VR2A 2QDHA 4WZHA 4JGDA 3NQGA 3NXLA 1GPFA 1Q5MA 1XIIA 4S2CA 5CAHA 4O12A 1UR3M 1TVPA 3KLLA 3AU2A 3BCFA 4N6FA 1W1PA 2HJPA 4NY2A 4WVXA 2WNNA 4KFPA 2AKZA 1ML1A 4WCJA 2NVDA 4Z2IA 3DERA 1MMFA 4UOQA 3T0CA 3VIJA 3KL5A 4NUWA 3W7HA 1JPIA 1TPFA 3HPFA 4ROQA 2W67A 3N17A 1QNRA 3U4FA 2X7VA 1JDDA 2PD5A 1FP9A 3O6YX 5HANA 2ZYFA 2BXYA 3ZVIA 3CQIA 3F4CA 3CL7A 3H53A 3S47A 3I6TA 1XGZA 4GJ1A 2DZXA 2X1UA 3TC3A 2RDUA 3C0LA 4PSRA 1DHPA 2PDCA 4JNZA 5A6KA 3SAZA 1J12A 1V6WA 1GOIA 5T26A 1CLXA 2EPLX 2EPKX 1RK5A 4WSHA 2F6XA 1IEQA 2IW0A 3AXMA 3QYSA 3SCUA 3UBPC 3LLFA 1LF1A 4J9JA 4XBSA 4KCWA 3OVPA 4K8HA 2DUZA 4XVEA 5AHLA 4E0CA 1PS9A 2PDYA 1F3TA 2ZC8A 1XWYA 3U6WA 3MUIA 3F4NA 1XFCA 4F66A 5DMNA 3V18A 4RW5A 4H6EA 2D24A 2NV9A 4CKQA 5BXRA 4YVPA 2C19A 3HM7A 1HIZA 3PNZA 2IQ0A 4JY8A 1W2VA 2V63A 3ITXA 3VIMA 4DF0A 5DMLA 1HVQA 3BMVA 1E4IA 1WAUA 1OYAA 2WAGA 1ZJBA 4JHMA 2WHKA 3N4EA 3RLVA 2PZ0A 3AWNA 4H83A 1WKFA 1EWDA 2GDVA 3AIRA 1ITQA 1EO7A 2XFWA 3WF2A 2OTDA 3ZVHA 4QAWA 4HNCA 4XAPA 1NWUA 4LYQA 2PAJA 1HTIA 1DIKA 4PODA 5DANA 1WBJA 4A8IA 2J27A 1Q6FA 3UETA 3QLLA 3QV8A 1XP3A 2WM0A 1QI4A 2WLYA 3OODA 4P7QA 2QCDB 4H9TA 2A85A 4Y7EA 3PZ9A 1M53A 5IBXA 3TQ0A 5A8PA 1LL6A 2QPUA 3QW3A 3KOXA 3PVFA 3TQKA 2YCLA 2X41A 3T08A 3BAKA 1VJZA 1TQJA 3EMCA 3LGEA 2XYLA 4JN6A 1IT7A 5JIPA 4CGTA 1XLCA 1TPH1 1ODZA 1F2JA 3WNKA 3QKEA 3PSVA 1FQ0A 2V3DA 4DWSB 4G1KA 5H2ZA 1KR1A 1JRCA 5FIPA 4JDBA 1M41A 3WQOA 1V02E 1SO5A 2E40A 1EF3A 1V0NA 3XIMA 3GG7A 3P5YA 5C5YA 3CQHA 2IXVA 1A5LC 2PF0A 4AZCB 5C2GA 2OSWA 2ZZ2A 4H8HA 3SCSA 4FOJA 1QI3A 1MEWA 2E25A 5TAOA 4NJKA 3N9RA 4CU7A 4QHRA 1LM1A 3W29A 4GYKA 3WK2A 3H24A 3SO7A 2WKGA 3LXCA 3OA5A 4WDUA 2D22A 2C14A 3FVMA 3BWWA 4FNSA 1DWJM 3E96A 2OOFA 3OPSA 4KETA 2WC7A 4QNWA 1FCBA 1TIWA 3GUWA 4BKNA 2VZVA 5C70A 5FL1A 5CPOA 1VPQA 3WFLA 3VUSA 1A0CA 2WQPA 3NQBA 5L9FA 3TX9A 2W3ZA 3M0VA 2VJXA 4HA0A 4A3UA 1O94A 1HJQA 4GLEA 4GABA 1XICA 4OE7A 1ALDA 3P0WA 1JXKA 3G77A 2CZDA 1CENA 3N29A 5BXSA 1EJSC 3CHEA 4M6VA 2HDJA 4Y6GA 4GX9A 3W01A 1QATA 5E09A 4NG3A 2KX9A 1QUMA 2VURA 4IIHA 2V38A 2V0TA 3AQUA 3MUAA 1F3WA 1WOBA 3C6CA 1EJUC 4IXXA 1Q6EA 4RNHA 3TA6A 4K1GA 3A4WA 3CXOA 2GFTA 1GK8A 1B9ZA 1LCOA 4PCNA 1UWAA 3V16A 3GG1A 3FV9A 4U31A 4PTNA 2FIQA 3G3MA 1ZALA 1Z89A 2CETA 4ZB2A 4FOUA 4L65A 1FWBC 3SW6A 3KBNA 3MI3A 4L4MA 1JPHA 4DZ5A 4CVUA 5B80A 3M5VA 3S0CA 4LAKA 4GZEA 4O0KA 1NOUA 3VPLA 2RH9A 1TE6A 4S3AA 4CUCA 3UXAA 3ALGA 4DPPA 4S3BA 3RPMA 1ZTVA 5HWMA 1GQKA 1A3XA 4MHBA 4L4OA 3DESA 3MMUA 2Z2AA 1PHQA 3NQDA 1F3XA 1OGSA 5AVNA 1OJXA 4DPQA 3GBDA 1TCDA 2OEMA 1KCXA 3V36A 1ZFJA 2YGYA 3W1XA 1E6NA 1WZKA 1MEHA 3U57A 1B31A 1ZJIA 1VRXA 1KFLA 3RITA 3T8QA 5M03A 1NJJA 4Q4SA 4ZGYA 1P0DA 1FWAC 2XWDA 4WGXA 1BLIA 1UA3A 4ZB5A 1W31A 1FWEC 3BMXA 1CCWB 3BAWA 1OABA 4NAEA 1WV2A 3HO8A 4OV4A 3QH2A 1REQB 4BF5A 1OX4A 3KHJA 3GXPA 2Q71A 3UZZA 5I3IA 3KBMA 3G2GA 5EY5A 2VX7A 2ZVRA 3WK0A 3LV6A 2QIWA 4OECA 1QI0A 4PEEA 4PB3A 2CLEA 4FOKA 1Q7QA 4C6FA 2I16A 1GOQA 2VVNA 4XUGA 3O2LA 3NA8A 1UR9A 5FJTA 5H6HA 2G50A 2YYTA 4LF2A 2DZUA 1V03A 1BGAA 4J2PA 1PX8A 1RCQA 2HWGA 3TN6A 1NH6A 1Z9AA 1I2PA 1I2NA 1D3CA 2YL5A 4LB4A 3TTYA 3M5ZA 2INEA 3CYVA 1W3TA 5LNUA 1SW0A 4M29A 2QUTA 3H22A 1TWDA 2PDNA 3DBNA 3E2QA 3BG9A 1F4AA 3GK0A 4WKHA 3PPHA 3WJYA 1Y5XA