1NY1A

Crystal structure of b. subtilis polysaccharide deacetylase northeast structural genomics consortium target sr127.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
235
structure length
235
Chain Sequence
VPNEPINWGFKRSVNHQPPDAGKQLNSLIEKYDAFYLGNTKEKTIYLTFDNGYENGYTPKVLDVLKKHRVTGTFFVTGHFVKDQPQLIKRMSDEGHIIGNHSFHHPDLTTKTADQIQDELDSVNEEVYKITGKQDNLYLRPPRGVFSEYVLKETKRLGYQTVFWSVAFVDWKINNQKGKKYAYDHMIKQAHPGAIYLLHTVSRDNAEALDDAITDLKKQGYTFKSIDDLMFEKEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable polysaccharide deacetylase pdaA
publication title Crystal Structure of Polysaccharide Deacetylase (PDAA_BACSU) from B. Subtilis (Pdaa_Bacsu) Northeast Structural Genomics Research Consortium (Nesg) Target Sr127
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 84
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 1ny1A00
3CL6A 1V6TA 3RXZA 2Y8UA 2I5IA 4V33A 2XU2A 4NZ4A 1W1B1 2C79A 2DFAA 4WCJA 4L1GA 4NYUA 2J13A 4U10A 5BU6A 2NLYA 4F9JA 4NZ3A 3WX7A 4NZ1A 4F9DA 4HD5A 1W1A1 4NZ5A 3CL8A 2IW0A 5JMUA 4LY4A 1NY1A 2C1IA 4NY2A 4M1BA 3VUSA 2CC0A 2W3ZA 1W17A 1XW8A 2C1GA 3HFTA 3CL7A 4NYYA 4OUIA 2E67A 2QV5A 3S6OA 3QBUA 2C71A 1Z7AA 2VYOA
chains in the Genus database with same CATH superfamily
5A6SA 4FLSA 2X05A 1SJAA 1FY6A 4I7WA 5AZ1A 1P7TA 4DRSA 1QTWA 3IVSA 1X7FA 4MB3A 4XTIA 1AG1O 4Z2HA 3CQ0A 2WSKA 4INFA 1EEXA 3I6TA 3DHUA 2XFWA 2Y8VA 3EB4A 2YPIA 4XUGA 2PGEA 2PDHA 3LNPA 1TFVA 4IGMA 3A9BA 3WQOA 1W1YA 3VFCA 3R94A 1BQCA 3B9DA 3ABOA 1ZAJA 4A29A 3PBUA 3WQDA 4HN4A 4GC4A 1GG0A 4D6HA 3AIUA 1FCBA 4C1NB 1TVPA 3G1HA 3IK2A 1XICA 2OSXA 3WIJA 5H1WA 3KLLA 4HA1A 5IHSA 3L9CA 2V3EA 1W0MA 3D46A 2XVPA 2VEFA 4AZCB 3POCA 4MLJA 5I2UA 4AW7A 4YTUA 2P50A 3OHIA 2MANA 3O0KA 4F3HA 3S8HA 2YDQA 5IFTA 2HVOA 4O4WA 3MTWA 1GOXA 4CCZA 4DO4A 3GZ3A 4YYCA 1G69A 1IT8A 1QI5A 2QDEA 2DY3A 2FTWA 3NA8A 4YWIA 1M7XA 1VJSA 1JUKA 5C7VA 2JE8A 7REQB 2OCZA 2Y7DA 2R14A 2AL1A 3TA6A 6REQA 1KM6A 2DW7A 2V2HA 1RBAA 2G3MA 1W5OA 2E40A 3HTWA 2J78A 3NQEA 4XIAA 2F61A 3N13A 2WC3A 2VZSA 3KW3A 3XINA 1UOZA 2PDPA 6A3HA 1CW2A 4FS9A 1FH9A 4H7ZA 4A22A 1ZJAA 2JKPA 4PUDA 2VGFA 4OJYA 5A5WA 5D09A 3G5EA 3VXGA 4HSNA 3B8TA 2PP1A 4JOMA 4UOJA 4I9MA 1CLKA 3G1VA 4FB7A 4HMNA 2NQ5A 4WRHA 1OFBA 4FXSA 1WDSA 1V3HA 2X16A 1HL2A 3OBEA 3H7VA 3THUA 5C55A 1AD4A 4PULA 2CFFA 1IGWA 1K70A 3VIMA 1K6WA 4P8VA 3FS2A 4AB4A 2A3EA 2NV9A 2BV9A 2BXZA 4NT0A 4UC5A 1RVKA 3SQLA 2GL5A 3VKKA 1LORA 1T7LA 3WLJA 1NQ6A 2QUMA 4UTLA 3VM7A 4B91A 1GW1A 2D1ZA 2RKXA 3FYYA 3EPNA 1N8WA 1W1IE 3VOCA 2PURA 2ZDSA 2QMKA 4OFCA 4FR6A 5IBXC 1C7TA 4OGZA 2WNQA 3HZ3A 2WAGA 4EVZA 2V81A 1JXKA 3T4CA 5A1AA 2FZ9A 3CAWA 4QJ3B 1MW2A 1KCZA 1CYGA 4KGJA 1GKQA 1WPCA 1ZJHA 4U4MA 3UD6A 3B05A 3RX2A 2OX4A 3ZZ1A 4MB4A 3E3HA 5AYYA 4B4FA 2IKGA 3CC1A 3F7JA 3LGEA 2ZX8A 2J7HA 3K1DA 4LBSA 3QR1A 4MM1A 2ZOXA 2HVMA 2GDUA 4MWAE 3M0XA 5CC7A 1H1ZA 5H6HA 1RHCA 4QNEA 4LSBA 1RAKA 2HS6A 3O6CA 5A8GA 2CPUA 3FSTA 1E0WA 1LBMA 2O4QA 3G1DA 4HA4A 4AIBA 1A49A 1GORA 3W7LA 3REQA 4OWGA 1PE1A 4O57A 3TQKA 2Y62A 4S3JA 2J8FA 1UWAA 3WFLA 3VFLA 5D9PA 4LANA 4LWWA 1HT6A 3DI0A 1JR1A 5F2GA 2RDUA 3P8IA 1XRTA 4XKYB 1WP6A 1BTMA 4GNKB 3L68A 1XXXA 3QW3A 3VGHA 2WLZA 1WKFA 1OY0A 3CLWA 2AGTA 4UWMA 4S3CA 2VX6A 3WH7A 1ICQA 4BK9A 1MW3A 5F7UA 3LLXA 3FYPA 4GYJA 1TA3A 1B3YA 2VR2A 2PZ0A 2ZE3A 4KWSA 3CUFA 3KHDA 2VVSA 5KZ6A 2DPEA 1F73A 2CLOA 3KOZA 5HJYA 4E0CA 1BD0A 4GKLA 1UH2A 1XV8A 2HRWA 4C1LA 3GXMA 3T78A 4D6EA 3UR7A 2QR6A 1I60A 3RCMA 3KDOA 4FALA 5BRQA 1PYFA 4JTJA 4X2PA 2DW6A 3HGRA 3W7KA 5CG7A 2GYIA 1QW8A 2W27A 3AYTA 5LGZA 2O55A 4S39A 2QULA 5HBFA 3WLLA 5HWNA 1H41A 1QPOA 2YDRA 3ISIX 4IIEA 1OJXA 1JQVA 2R24A 3VKBA 5SWUA 1XIJA 2PRLA 1TTJA 1KXTA 3LA4A 1VAHA 3L23A 1OC5A 3IIPA 1UKTA 3AYSA 4NXSA 5JU6A 4XVDA 1EA9C 1I9CB 5CC5A 3NL2A 4I9AA 3EA2A 2HROA 1SSGA 3OVPA 1HFBA 4A8LA 1M7PA 4Q8VA 2A6NA 2VCAA 3QMTA 4WOQA 3LZ3A 2VELA 4RZBA 2GK1B 3R6IA 4GUJA 4WKAA 2C6QA 2YDAA 3SIMA 2GGJA 1E0TA 1XLHA 1JFHA 1W9XA 1EC9A 1W9VA 1P0EA 3GDMA 1H50A 2F2HA 4G56A 1PKYA 1U22A 1FWWA 5I3DA 1X6NA 1CXLA 1GHSA 2E77A 3ELFA 4K68A 3VX0A 4R53A 1TPWA 3Q65A 1O1HA 1ZQ5A 3OYXA 4NAFB 5CAHA 1E6NA 3WKZA 1AODA 2OOGA 1QNSA 5HXMA 4YL2A 2G4JA 5HMDA 1EJVC 1EDQA 4JCLA 3LCFA 3S5ZA 2O7QA 1FCQA 1RCOB 4CNNA 4WK9A 2EPNA 3B04A 1G94A 3VUSA 1P0KA 4E4FA 3NOYA 1IGSA 1E1CA 3KZPA 3W22A 2WCSA 3W88A 5CSUA 1MNZA 3V7PA 4XWUA 3QGKC 3K8LA 4PUMA 1RA5A 4D2JA 2X1SA 4BS0A 1XIBA 1XLLA 2QPXA 4DJFD 2WSPA 2CKSA 3QHMA 5AC6A 1V7AA 3G24A 2Z1KA 1XYZA 4KWOA 3P0XA 1ZAIA 2WMFA 3GAYA 3U6WA 2G3IA 4AX6A 1TVNA 5MKGB 2C13A 4UQAA 3A5FA 3L12A 3OPSA 4X3ZA 4NILA 2Z00A 1ZJBA 1ZFJA 4E2VA 1JJKA 2YX0A 2RDXA 4M6PA 3OVQA 3U5YA 3L4YA 5CLWA 5LNUA 1B90A 3PWIA 4ATDA 3L5AA 1LT7A 3RUBL 1OABA 5FJPA 2OYLA 5K9CA 5C54A 1PO9A 4IUOA 3BUVA 1P48A 3BSMA 4WSHA 1E9IA 3WDRA 3VKAA 2IPFA 2ZA1A 3VYLA 4IG2B 5BZAA 3R4IA 3O15A 4MWAC 3VC5A 1E4LA 2D3LA 1ISXA 4DXVA 3DC8A 1GTHA 4OUEA 4I8YA 4W85A 1V6TA 1R3QA 4WCJA 3C56A 1F3WA 1Z44A 4LY8A 4RCXA 4IX0A 1FUYA 5GVJA 4YIWA 3TIMA 3B8IA 3M5YA 6XIMA 3STPA 5FI8A 4DUWA 1L6FA 1IZJA 1UKPA 1XD0A 3MA8A 1TV4A 1CLVA 4HT3A 3UZJA 1CGTA 3SB0A 3WFAA 1CZ1A 3MDWA 2UY2A 2GQ9A 3GDKA 5BOOA 1Q6RA 4L80A 2VOTA 4OT7A 3HJEA 3GNPA 3S6OA 1ZBCA 3MYPA 1FDJA 3ITYA 2CBIA 3TOPA 1SMAA 1ICPA 2VGBA 2WJZA 3JW7A 4AFYA 1ZGDA 4C6QA 2E1DA 2NVAA 4GZEA 2YR1A 2XIIA 3ONBA 4M80A 2ZQ0A 2HZGA 1E6XM 4O15A 1E56A 5FL0A 3MV11 1JNEA 3A21A 4Q7NA 1X8FA 2VDHA 1Y0EA 4HPNA 7TAAA 4LNYA 2XH7A 1W91A 3MY9A 1NWTA 3NO3A 1WBHA 1P4CA 1KBIA 1UWQA 3WD0A 5I06A 2VJXA 3NQBA 3DH7A 3DFQA 4JTKA 2PS2A 3TYEA 3H8AA 2Y89A 3VGGA 3W28A 4GCXA 1OZMA 4GI6A 5ABHA 3NURA 4GQ0A 2IQTA 5HJLA 3BW3A 3W86A 1P43A 4Y8EA 5D4YA 3QR3A 2E8ZA 4DO7A 3W0KA 4B3LA 1ELSA 4LV9A 1GEHA 1OX5A 4TV6A 1O60A 1V93A 1PIIA 1Z6KA 4Q6JA 1L8PA 4Z2GA 1H0IA 1V3MA 2ISWA 1G7UA 4ZL1A 1MZRA 2V3FA 1JCYA 1HP4A 1QU4A 3B3DA 1GONA 2CHRA 2P0OA 5CQ1A 1GVOA 1I45A 3P5ZA 3IWPA 4PZVA 3GR8A 5CGTA 3GYEA 3AIBA 4DBWA 3TYZA 3NR0A 4GUIA 4UTWA 4GUGA 1H62A 4MDPA 2J9YA 1M3UA 1Z89A 3GXIA 3NGJA 4JTDA 3CHEA 3ZLFA 5EMKA 4M19A 3S5YA 1P6WA 1T8XA 5A69A 4JIPA 3DAQA 4KFOA 1AMKA 2BGQA 3PZIA 3EDJA 4OUIA 4NU7A 2ACUA 4L7ZA 2WMGA 3EXTA 4FNSA 4NSBA 4PUNA 3E02A 3B9NA 3MPGA 1TPVA 4IHCA 3BOXA 1V0LA 3T2OA 3AMGA 2NXGA 3GO2A 4UUIA 2G4FA 2CKRA 4WVXA 2D2HA 3AROA 1ONEA 3NL6A 4JTRA 4KFNA 4KCUA 4W7VA 5M17A 5DCDA 2I5QA 1YPIA 2CBJA 1QHPA 3RX4A 4L4LA 4QJ5B 4UB9A 1A5MC 3OZPA 3BG5A 4GYPC 3ZR4A 1Q7ZA 4D6GA 2PDKA 4YTTA 4GK8A 2V5JA 3IJDA 1EGVA 3PJWA 2ALRA 1E9LA 1NWUA 4H8HA 3BH4A 3PZQA 2GQ3A 1YPXA 5M3WA 3CYVA 1GQNA 3SW6A 3O8AA 5KSWA 3KCLA 1HG3A 3TXVA 3BQ6A 1KFBA 1W5NA 4H9MA 1ZCOA 1XGDA 5I3GA 9XIMA 3W76A 4PN2A 4A2RA 4GH1A 2QJNA 2P1FA 3STGA 1GOQA 1FTXA 2B4GA 2GZXA 4TMCA 3F2BA 2WV8A 4AG0A 1HJSA 2DQWA 3MKKA 5FF0A 2TAAA 3TN6A 3S5NA 1E40A 1A47A 4AEOA 5D2WA 1QI3A 2WJEA 3MKVA 3LCXA 4BEUA 3ZWTA 5CLTA 1L0PA 1UPPA 3FFSA 3GBDA 4HSHA 4LB4A 3BMXA 1EUAA 3BGJA 3G8RA 4TX6A 2PCEA 3IGUA 5A6BD 4H8NA 1C8YA 3KWSA 2QJIA 1TJ2A 4IP7A 3KM8A 4LPCA 2PDQA 3R0DA 1BSIA 2OEMA 3LV6A 1OC7A 3MHGA 3TTYA 4H8VA 4ASTA 3URNA 3L4TA 5DRCA 4CD7A 3ME3A 3PJXA 4O1AA 1I8JA 1O4UA 5I79A 4UQ9A 1EFZA 2AGKA 1JF5A 1RK5A 4DJFA 3S6TA 3KBMA 4LBUA 4N02A 2PAJA 3H55A 3BAKA 2OZTA 3HV8A 4DPPA 4Z1AA 3BTNA 1R2RA 2E6DA 4AY8A 5DELA 3HQ1A 2E6AA 3CASA 3NFUA 4ACZB 2XHYA 4H83A 4GFSA 1H7RA 4PFHA 3NIYA 3U2ZA 3ZS4A 2C79A 1FWJC 5HINA 1IT0A 3TYAA 3EDKA 4IMDA 4ZTXA 4AF0A 1MSSA 4MKVA 2QJMA 2WM0A 3E0LA 5C9XA 4N7QA 1R3SA 3E2SA 3CEPA 4QE1A 1AW1A 3TZFA 3MKCA 2BGSA 3I3EA 2IKIA 3MV01 2G97A 2C1IA 4ZO6A 4AC7C 3NSMA 3UT0A 3M5VA 3MHFA 3FDKA 2PFHA 5AYIA 2EKGA 4HHHA 3WUGA 2C3ZA 4N0RA 4M6QA 3GG7A 2VWTA 3AHXA 3FGCB 1ADDA 3FKRA 1Z69A 4JIRA 3C2EA 4IFRA 1OF8A 4HK6A 2WVTA 4Y9AA 3WZ0E 3CBWA 2J9XA 5KZMA 4Y6GA 4QIUA 1BYDA 3UZYA 2FHFA 3K8KA 3N2CA 1H11A 4ATWA 1SJDA 1OGGA 4KCTA 4LJ3A 1GEQA 2XM2A 5JBEA 4K1WA 1YE6A 3G0SA 3UG3A 4JYEA 5EFDA 4Q4OA 2E0PA 1Y7VA 1CDGA 1R47A 2BOEX 5RUBA 1OYBA 1LRTA 2PDMA 3AXKA 3AFBA 4HU8A 1GJUA 4WUIA 3UXLA 1XDLA 1YTDA 4PBGA 3N17A 3VNMA 4JTCA 2XINA 2UY4A 2J25A 1QW9A 3CO4A 1QPKA 1H2JA 2BS9A 3LS9A 1ZTVA 3E2VA 3OO2A 3WD4A 3WEOA 1QR7A 2XIOA 2PCQA 3BAYA 3O16A 1R9YA 4N9DA 4ZB5A 3WEMA 2P53A 1Z8AA 4B5TA 3TZNA 3TFCA 3GC4A 2WZHA 3TR2A 4ZZ9A 3II1A 4QAIA 2ZZ3A 4HNNA 1RCQA 5FJJA 1HJQA 1PSCA 3ATYA 4WOZA 4QSHA 4UTUA 1JAKA 3V0TA 4AHOA 3LERA 2VTFA 1V51A 3M41A 4E3TA 4UQEA 4XSMA 2YL9A 2FJUB 3LY0A 1N82A 2QUNA 3PG9A 3W73A 1SZRA 3SCUA 1HJUA 5CBBA 1L8NA 1V3LA 3Q2DA 5GPRA 2VQTA 3NQ7A 3HOJA 4I9JA 1OD0A 4BHYA 3M0HA 5G1MA 1ECEA 1TUFA 3AQUA 1FWBC 2Q8XA 5EMYA 3P0WA 2GVYA 4AD3A 4JTEA 1DBTA 1V6YA 3W6LA 4A35A 2BVYA 4WJXA 3ITTA 3I4KA 5KEZA 3M4HA 4AXNA 3TTEA 4HA3A 4EXQA 3TLQA 1CGYA 4UFHA 1V5XA 2Q02A 3HMCA 3PZNA 4AH7A 3TUUA 2V2CA 3ZT7A 1DP0A 1UZ1A 3LHTA 1UH4A 5HPOA 3KRZA 4NJHA 1EC8A 4H7CA 1BXNA 3PTQA 3R0UA 3FK4A 4KMQA 4HIBA 1OD8A 2ZUVA 4TTGA 3COTA 1V02E 4G6CA 1AJ2A 4C7FA 4M5PA 3B4YA 4J3ZA 3HMJG 2QGYA 3FA4A 4IMAA 3G0XA 3RMEA 4AX7A 5FESA 2I56A 3CQJA 4E6MA 3TMQA 4DJEC 1GOIA 4J2MA 3PAOA 3MI3A 3FAWA 1H3GA 1KRBC 1P1XA 1PB0A 3WBAA 2JEQA 3VDGA 1ZNNA 2CWXA 1MRAA 2PGRA 2V69A 2XU2A 1VD6A 3KL3A 1WZAA 4WDWA 4R88A 3K4DA 2CITA 3W02A 1GQIA 2IKHA 3M9YA 4ZQOA 2NQLA 1S2VA 3CUGA 4IMGA 4I5UA 1HP5A 2NSXA 3WQFA 2DVXA 3DHDA 3C0QA 3HO8A 3HBLA 1ZL1A 4MPKA 1K77A 2QGHA 4H1ZA 5EPDA 3BICA 3MUCA 2DIEA 5H8MA 8XIAA 3LXCA 1IR2A 1V3IA 3KE0A 1D9EA 3VIGA 1DHPA 3THQA 3LSBA 3GY1A 4JFWA 4D1JA 3VZYA 1O6IA 2X1IA 3V1PA 3OU8A 2Z27A 3TK7A 1YMYA 3ZO9A 3QFEA 2OTDA 4O0ZA 5KZEA 1DJYA 4ZO8A 2VT0A 1SQ7A 2FB3A 1YKWA 4IZGA 3STFA 1S2WA 1HO1A 2ZUMA 4LVGA 4CQDA 3P6LA 2WWDA 1E6QM 4X9YA 2PWHA 1TJRA 1W5MA 3UPMA 2J8TA 5IDIA 1UCWA 1PXGA 3A6OA 1R0MA 1MDLA 4ZQPA 3S2JA 4NZ4A 5A6BA 3QKEA 4P7LA 3DCPA 1SJCA 1H51A 5C2CA 1KTBA 4CEXC 4DPQA 2KZHA 1BKHA 1MW1A 4MZ1A 1GKPA 1EGZA 3IGXA 2QCDB 3TV8A 3T8QA 2GDVA 1N8FA 1EDTA 3MI6A 3UCDA 1M6JA 1UPMB 3WQ8A 4XG1A 3HURA 1JVNA 3G3MA 1IIGA 1KFEA 3UZ5A 2Q09A 3QZAA 3C4UA 4D6CA 2PTDA 5LIYX 2BY3A 4HJWA 2RH9A 4V28A 2FTYA 3AWNA 4IPIA 3MSDA 4MWAD 3LSCA 3DGRA 1LQ2A 2E9MA 1IXNA 3VIFA 1X6UA 3TR9A 3UVIA 1EJ7L 2A3AA 5IDZA 2CHOA 2CESA 2Q01A 4O18A 2AQOA 1WKYA 2Z28A 3AJXA 5G4HC 2QT3A 2ZWYA 4FO4A 3GIPA 1M7JA 3D5HA 4LS2A 3KFTA 4BY3A 5FEPA 2PMQA 3BPWA 4Z2JA 2I9UA 2AAAA 1TPB1 2O0TA 1E3ZA 2UWFA 3I3DA 3N2TA 3TSBA 5EMUA 2P88A 4IT1A 2W3ZA 3CM4A 3B06A 3AMDA 1X7IA 4Q4QA 1XL9A 4AZIA 2G3FA 4CD8A 3LLFA 4AIOA 2O9TA 4PMYA 4FOJA 3DFYA 2JEPA 4I6VA 3S6DA 2DUXA 1OZQA 4C1KA 1XYBA 4QR6A 1PUDA 1K8YA 5ECUA 1KA9F 1F7BA 1JPKA 1O66A 3LHYA 2PDCA 4NAEB 5EKYA 4Y9NA 5IBXA 3PR2A 4HYWA 1US2A 2PWGA 4ZXLA 3LMYA 1NOWA 2VI0A 4IJCA 4LC6A 4IIGA 3MHUA 2VDGA 2ZZ4A 1KTCA 4LW7A 2CU0A 5J8LA 1PWMA 5M1TA 1THFD 1EP1A 4H9TA 1C92A 1JRBA 3HU7A 4JQ1A 2PC8A 2WZTA 3PS7A 4DXXA 3AS2A 3KRSA 4I5RA 1HVXA 5F4XA 3IAPA 4D1IA 1NJJA 4C6MA 4IJRA 4HQVA 4KEZA 1MUMA 4FXJA 1NM9A 2BTMA 3B8WA 3GVRA 3NG3A 1JZ3A 3FEMA 2A3CA 5EU9A 1CTNA 3UPBA 3OIHA 4HA0A 4MAVA 1AQ0A 2DIJA 1CXKA 3RPMA 1KKRA 2IPGA 5KETA 3I6EA 3IRSA 1WB0A 4N2YA 3HGJA 2RDTA 3PPGA 5C0QA 3KBNA 4JFVA 3QHNA 3W37A 2VOMA 4HBKA 1SZEA 5K2ZA 3W6YA 3I7QA 1TSIA 2DVUA 3TTSA 3IANA 1XM3A 3CZGA 3NCOA 6PTDA 1C8XA 1TPH1 1QI4A 3VD4A 1OFRA 3O9NA 4EOUA 1NFPA 5A3HA 2F8QA 1H7NA 2G41A 1WOAA 5FKYA 1RALA 1HF6A 1LCOA 3L4ZA 1ECQA 1DTUA 3LTYA 4D6FA 1RBLA 4OZOA 1HL8A 4M0XA 3NYDA 3WNKA 4RJEA 7ODCA 1MFUA 3R8GA 2PGFA 2PI6A 2WSRA 2CETA 1Q85A 1TV8A 2Y5JA 6REQB 2GJXB 5E9AA 3PB0A 2PF8A 3R58A 4W93A 4Z1BA 3EXRA 2XIMA 5FF7A 4I6KA 4IPLA 3MO7A 5CGMA 3KS5A 4JAWA 2FZ8A 1RQEA 3CIXA 1UR9A 4CKQA 1HX0A 4DVOA 2QIWA 4UCGA 2ON3A 4FNTA 3H6OA 2D2OA 2WHJA 3MJYA 4MNJA 1XIFA 4MB1A 1XDMA 3VMNA 5TF0A 3MP4A 2OB3A 1UUQA 2GOKA 2V38A 3F4VA 2V5KA 3B40A 1W32A 4WJ8A 3L2IA 3MBFA 4UR9A 1OGBA 4ZQRA 3V0SA 1IEIA 4LNCA 3F1QA 2D2JA 4QLKA 4NJGA 5M5DA 2I57A 3NXFA 5AC8A 2JALA 4GWEA 4Z17A 3S1VA 1WKDA 3K2GA 4XKMA 1TVLA 2ZUUA 3W2LA 1R3VA 1MEWA 3RJXA 1EJSC 2TRSA 2ZRUA 4PBEA 4AEEA 3A3WA 3D3AA 2J7GA 4C6JA 1VFFA 2OODA 2YBTA 5FAJA 3FJ4A 2INFA 4IQEA 1IZCA 3IJ7A 3EMCA 3R1ZA 4PMDA 5I00A 4XAPA 4ML9A 4DN1A 3HPSA 4HMEA 1BLIA 4HU4A 1XLBA 1HVQA 4HZMA 3OHMB 4FEZA 3SRHA 3B9AA 4JX6A 3AUOA 2GK1A 3IJ6A 4PGLA 1SW7A 4Q8UA 1GQLA 4LYQA 3KOFA 1T5AA 3QRHA 2VRKA 4XVEA 2B0MA 4QCFA 4Y2WA 3NQ6A 5T9CE 3PVFA 3GBEA 3KLKA 2OWWA 2OFJA 5DRIA 5LHFA 2ZFAA 5D9OA 1XCWA 1W17A 3FYOA 4GRSA 4ROPA 2OLHA 5HQLA 2NQZA 1D3HA 4JCMA 3GZAA 3R8HA 1E9ZB 1OK4A 3STEA 2NVDA 3KOWA 4G1NA 4JX4A 3REQB 2XSBA 2NV2A 3I6RA 4WXYA 4WX2A 3WG6A 3CUIA 1ONWA 5J5RA 4XX6A 4GACA 2ZZ5A 3DKLA 2BG5A 3PSVA 3OQ8A 2CZFA 3EWYA 4KT2A 3NAVA 3DX5A 3YPIA 2E9LA 1EQCA 3WCZA 2QCMA 4HTYA 2VP8A 2EBNA 3ATZA 3HFYA 4OTKA 3CQKA 3S2MA 2IUZA 5EMJA 1S2TA 4HU0A 3P8JA 4G5DA 1R2TA 3KUMA 4W5UA 4EPDC 3T08A 3SRKA 1WDQA 2Z1BA 1B3WA 4TXEA 3SGGA 3EKLA 5MKGA 4M7TA 5D38A 3SUTA 2R8WA 4MWAA 5HAOA 2DJLA 1JYNA 4KRTA 1E3XA 4AZHA 4AMCA 4LCQA 4O1BA 1ESWA 2WNZA 4TO8A 3FXGA 4U5KA 3GM8A 4Y7EA 1YXDA 4G8TA 3NO1A 2ABAA 4K2SA 2V6AA 3VO0A 1LQ0A 4N4QA 3ARYA 3GHTA 1MDRA 5IM51 5FOOA 3NZGA 2C18A 3CUJA 1VIWA 1PCKA 3VIOA 1ZRQA 3UGVA 3VIIA 4U33A 1W3KA 3DXIA 1ONXA 1EJTC 1T8QA 4PCNA 2EKCA 4Q33A 4LUYA 5ENLA 5DMLA 2Z2UA 1EP2A 3BMVA 1EWDA 3GWQA 3GR7A 3URBA 4JHZA 1G1YA 4TTUA 2GSJA 4A8IA 1PCWA 6ALDA 1DPMA 4JTIA 3LM3A 2P76A 3BV7A 2VNCA 2REQB 2VEKA 5HK4A 1F3TA 4S2BA 1MUWA 4HCDA 3L4UA 2INEA 2XSXA 4R9XA 1WDWA 1ITQA 1QJWA 5A6AA 5AECA 3FOKA 5KMYA 2HJPA 1ZENA 5FACA 4GJJA 4RX0A 6CGTA 1R86A 4ORIA 2C71A 4S3AA 2BMBA 4MDOA 3SY1A 4XZHA 2W79A 1Y5XA 3WUFA 4F0SA 2R1LA 5AHFA 2DZTA 3GFYA 3G18A 1S1RA 1E1CB 4OVXA 3R0KA 2R9RA 9XIAA 2EAWA 4HPJA 2PDNA 2WW5A 1Z41A 1JDCA 4PA8A 3WQ5A 3L4VA 4MB5A 3AYVA 3NZRA 3V5FA 1QO5A 1IXPA 1XBYA 1RV8A 4GJIA 2X0YA 3BO9A 5I5RA 3CLMA 3TKFA 3M7WA 3SCOA 2WB5A 4GD0A 4O12A 3SJNA 3VOFA 5IXEA 3MUXA 4NZCA 4GXWA 2XN2A 2D2GA 1KBJA 4QE4A 4ZFCA 1ITUA 3CNYA 3KS6A 4GX9A 3MP3A 1B57A 4LAOA 1XX1A 3UY8A 3W81A 1UASA 4C6CA 5DXYA 1Q66A 4R27A 2J7FA 5KINA 4BI6A 1OX6A 1LG2A 4JQ4A 4ZODA 4V1XA 5LNVA 1XLAA 4K39A 1RPKA 1ZU8A 2XPKA 4JN7A 1Q4WA 3AXMA 1KD0A 2W6RA 3DDMA 1AD1A 3VABA 5TNVA 4FLQA 4DJED 3DFPA 3UBPC 4FHAA 3NQAA 2BY0A 3H4GA 2GGGA 1PZ1A 4IOTA 4UOZA 5TBOA 1Y8BA 3AWOA 4WZHA 3MBDA 4F8XA 1O12A 1VPXA 1SZGA 1S2AA 4C91A 2EF9A 5CPNA 1FWRA 1CX9A 5HPCA 1NDVA 2PTWA 4JZ5A 3GH7A 3M0JA 1TZ7A 5LNRA 1QNPA 2A5HA 4KCWA 1XR2A 4N6FA 3VNKA 1XW8A 5EMLA 4RDYA 3GFZA 2XN1A 4GYPA 1SFLA 4JEQA 4ZTYA 3U0HA 3NDOA 4ZB0A 1KRMA 4JHOA 2NW0A 1AVAA 1I1WA 1QAPA 2DZPA 2WO5A 2QDHA 2WHKA 2H9AB 3AYRA 2D22A 4XZBA 2YCIX 1GVSA 2CLIA 4JS3A 1FP8A 3HV9A 2G3NA 2X8RA 3K4WA 4OOUA 1BWVA 1P0NA 3TFXA 3FKKA 1X96A 3NQGA 5HA7A 2JK2A 4EF8A 3SIZA 5A8OA 4LUTA 4NXKA 1K03A 1ZBWA 3H4WA 1JZ7A 3LU2A 2FFIA 4DXKA 1LM1A 3GH4A 3ARPA 1KR0A 3MYOA 1G5AA 1J79A 2CZ5A 1DQXA 2BHUA 5CSYA 1UIPA 5C9RA 3BURA 4UNKA 1IHIA 3OZOA 5E9XA 1OBAA 2PC4A 1LUCB 2TPSA 3QC0A 3S3GA 4MY8A 4CQ8A 3W84A 1QNRA 2FIQA 3H23A 4XZWA 2FLIA 1OFEA 2EJ1A 3RDKA 3ZWSA 2GLKA 1RH9A 4J4KA 4QGCA 4W7WA 3TQVA 1HIZA 3C2YA 1B3VA 1G4TA 2ZDRA 4REQB 1VHCA 1B5TA 1AL7A 5A8QA 9RUBA 4YVXA 4A2SA 2OWXA 1H5VA 2ZVIA 4PMVA 4X9SA 5D04C 2NT1A 1M65A 3CUZA 3M47A 4KFPA 5A6JA 4WY0F 1EBGA 3LMZA 4WHBA 2POZA 3P82A 2VX5A 3UWZA 5H8PA 2NT0A 3B8DA 1O5KA 4L6OA 1XHGA 4IGSA 3IRDA 4C6EA 3O1NA 1E4MM 2YBVA 2OPJA 4GA8A 1W1ZA 1V77A 3WH8A 4K7VA 3QW4B 5CZ0A 5AYBA 2PTYA 3MVIA 4G7FA 4PRTA 1KBBA 2X1UA 3LBCA 1JDAA 4RE0A 3SQMA 4S38A 2PDLA 1GQKA 3N6HA 3DESA 4G2DA 1W1VA 5FF3A 1XH2A 4L9XA 2V5LA 3CPUA 3TU9A 2VX7A 3RMJA 1R30A 1BXBA 4CVUA 1AJZA 1X98A 4H9XA 2CHNA 1XGEA 3TJ4A 4UTWC 4YVPA 3EWZA 3PWGA 3WUBA 3ARQA 1K02A 4XD6A 3V5CA 4A6GA 1NFGA 1EHAA 2OQLA 4RV8A 3EB2A 5T91A 1MRQA 5F2MA 4GABA 3QY6A 4M6UA 3GS6A 4G9PA 3N2XA 4L1WA 2UBPC 4TR9A 4JIEA 1J01A 3ES8A 2C15A 3W7CA 4PMUA 1J11A 4J3SA 3P62A 1N8IA 4PE8A 1HJWA 1F9CA 3LBOA 1H61A 4DI8A 1AL8A 5A8MA 4PTXA 3G1YA 1DWJM 5AC4A 4JQ2A 1KM2A 1B4KA 1NY1A 1DE6A 1C90A 5IHRA 1GJPA 2OJPA 3W72A 1XIHA 4W86A 2E4TA 3ABRA 3T0AA 1DJZA 4PCTA 1V3JA 1V6WA 2VEGA 2WWCA 3E0IA 1NWSA 3SCWA 4F9DA 3A4JA 3LG3A 3GXFA 4V1YA 1Q7QA 1TX0A 1FH7A 4J3UA 1A4LA 1QPNA 2B31A 3UYIA 3S1XA 1FXPA 1A5SA 1EXBA 3HQPA 3ZT5A 1UA3A 4HTBA 1QOQA 4DNHA 3JZEA 3FDGA 2IW0A 3DFTA 4LY4A 3IK4A 1XP3A 1LJYA 3FHAA 4WR3A 1G4PA 3PJUA 5BCAA 2FGBA 1FWTA 1XLIA 3T6CA 3ZJ8A 3N4AA 3BDKA 1FFQA 1U1HA 2XGBA 4N42A 4GISA 4LTSA 5H91A 1XLFA 3EMZA 4NY2A 2IMRA 3SCVA 2WJFA 1AZ1A 3LK6A 1TWWA 1OG6A 2FPYA 1FHDA 4HZ6A 1HGWA 3TN4A 3ZJKA 2GVEA 4YXGA 2BWGA 3N2OA 3BGGA 1L9WA 3VGDA 2E3ZA 4AF0B 3CUHA 2ZZ1A 3WLRA 3OLIA 3KOXA 1NDZA 4WSJA 2Z1XA 5BWFA 5FSEC 3BOFA 3RLHA 2ATSA 3TROA 4DJFC 1YDYA 5A8PA 4LU0A 1UR0A 5E0KA 4JFTA 4H9YA 1VZWA 3M5ZA 2BGNE 4UCFA 3EX3A 3ARSA 1K9EA 1ZJIA 3B8VA 1UIOA 2NQ9A 2OZ3A 3C5QA 4DJEA 1DWIM 2RUSA 2VL4A 1XLCA 4O52A 3SCSA 2Q3RA 3WJXA 1FWCC 1VEPA 4ORMA 4DF0A 3A22A 1V0NA 4F66A 4LB3A 4C6DA 3N4FA 3W1QA 3SI9A 2ZXQA 4DYJA 2PE4A 4QG9A 4ZOCA 3CT7A 1J0ZA 3OVRA 4HJFA 2C0HA 3QEZA 3AZSA 4S3DA 4NNAA 2WQPA 4LH8A 3FLUA 2J74A 4E4UA 2WSYA 4PUUA 2OYKA 5D9MA 3CL8A 4L9YA 3UWQA 2E5BA 4PTWA 4LFYA 3NGFA 4QROA 2G0WA 1B30A 2ODOA 2W66A 4ZQCA 3W1MA 3BARA 3PNUA 3VNIA 4TVUA 1JAEA 3BVJA 3R10A 3LXBA 4KIRA 3AXHA 1FWSA 4HU3A 4V2XA 1J10A 3HM7A 4B3ZA 2J8GA 2JQXA 3PZOA 1W9DM 1E71M 5AN7A 3MSGA 3W7NA 4KPLA 2BY1A 2RGMA 4AVOA 2ANUA 4A8RA 4DY1A 1MZHA 5KITA 1B31A 1HL9A 5A95A 3EGJA 2HWGA 3R89A 4BF5A 4QRNA 4GVIA 1UW9A 1KM5A 4O8AA 3WQGA 1WOBA 1YHTA 2W62A 3WMCA 4X63A 1W9UA 3C3NA 3TYDA 1BVZA 2YCJA 5C70A 4C6LA 1IEVA 3SRDA 3ZLHA 5HANA 1OVDA 1IQ8A 2VO5A 1LOLA 2ZRXA 4H04A 3SSJA 3IIVA 3E6EA 4KETA 1PEZA 4CN1A 3QHOA 2OQYA 2J4GA 2I1OA 1UP2A 1A53A 1UR3M 5GJMA 1I2OA 3B0VC 1ME7A 3BC9A 3H2AA 4W87A 4EANA 1VKFA 3PUDA 4IIDA 1CI1A 1Q6QA 1QCWA 2AKZA 1UB3A 3CU2A 4YJ5A 4S3BA 1XLJA 1AMYA 5HQEA 3R13A 4D8AA 4UOQA 2DT2A 2IS7A 2VC9A 3USBA 2OGJA 3FAXA 3OTRA 1LTDA 4QP0A 5K9XA 1KO0A 1HGYA 4BEQA 5G4WA 1IWAA 1LLZA 4EP8C 1NP2A 3N15A 4JTLA 1FWHC 1SM9A 3GXTA 5A2AA 3CAQA 4KRUA 4HN8A 2F7FA 4MG4A 2X2GA 2RAGA 5CKSA 1WO2A 3W6MA 3BJFA 2JF6A 5I02A 3BLOA 5GNXA 4IGHA 3ZXWA 1W8SA 2W0UA 4XBKA 1JI2A 1MEHA 3MS8A 5MF5A 2YGYA 3A64A 4NZFA 1D7FA 4FXFA 4UMAA 1GWJA 2FHCA 1TTIA 1NFBA 3UWWA 3W7DA 3A3HA 3BLLA 3FA5A 1WYIA 1U5JA 2QHAA 2FDMA 3EZ4A 2OSYA 3DZ1A 3PPFA 5FF4A 5D05A 2QS8A 1ZS2A 3BQ5A 5LXXA 2WZIA 4A3RA 1DORA 1TE1A 1JL8A 4NUWA 1KV8A 4B9YA 3B9OA 3CYJA 1M1BA 4YTRA 4JN8A 2VUNA 4AISA 1FH8A 3ZFHA 1POJA 1CLXA 1KW1A 2POTA 2ZUTA 1ZB5A 4PMNA 2OR2A 2PLKA 3MMWA 1V02A 2VMFA 4CLMA 5CJNA 2E28A 2PEVA 3G3DA 4PCFA 2PPGA 4FNUA 1NWRA 2OOFA 4JTGA 4R7OA 4L4OA 3N3TA 4NAEA 4ATLA 4GVFA 2WVSA 2PB1A 1E5NA 1JCTA 3U4FA 1OEPA 3EXSA 3V4BA 4ICNA 3EB3A 4XZIA 3EEZA 3LTPA 4WGHA 4IX2A 4GJ1A 4KIEA 2FVMA 3KHJA 4NI8A 4F48A 2XWDA 1YXCA 2YCEA 4MLRA 4AMAA 1K4HA 1VCFA 3E2QA 2OT0A 2Z25A 1QRQA 2HNEA 5A94A 2I5GA 1TPDA 3V5OA 1VBJA 1J0YA 4H19A 1MO0A 1WUEA 1VYSX 3N2BA 2PTXA 3LI0A 1GQJA 2Y4SA 3VTRA 1EQPA 4XAGA 4LRSA 1V7YA 1C9WA 1PIFA 3NYZA 1JUBA 4JL1A 2WSQA 4ZOBA 1JZ8A 4HD5A 4W9TA 1TMQA 2HCVA 1W3HA 1A5OC 4WQ6A 2QDDA 4NZ5A 4DWSD 4BCEA 1ISZA 1X39A 1BYAA 1AZ2A 2OKTA 3VE7A 1U83A 4PYSA 4NYYA 4DZ5A 3VNZA 2R1NA 3UY7A 1CXEA 4JGDA 2H8ZA 2WPBA 4K6AA 3LNMA 3EDFA 4PCPA 3W3OA 9CGTA 4J5NA 1P6CA 3M64A 3P61A 3BSGA 1R5YA 3THAA 3W7EA 4F4RA 3IEBA 4HCHA 3RLVA 1E4NA 4M7SA 5LA1A 3EOSA 4YTSA 1F6PA 1TJ0A 4BQ4A 2QYGA 4AUBA 2GUBA 2WK2A 3GTXA 5GJPA 4J3TA 4L4MA 4AYGA 1XUUA 2ZIDA 4JNZA 1Z32X 4F0KA 1V4YA 3VK5A 2ASHA 5DY3A 1EJXC 6ENLA 3EWXA 4GUFA 2GJXA 2PUZA 5G2WA 3VD7A 3TW9A 3M0ZA 1EP3A 1W1A1 3WBXA 3SAZA 1DE5A 3TXZA 2D20A 3F5KA 4JFSA 3GTNA 4UR8A 2XN0A 3ITOA 2ZX7A 3RM9A 3MW7A 2X0HA 5D2YA 2CLKA 4W8BA 2OSWA 2A3HA 2GPTA 3UJSA 3BLKA 3RITA 3UG5A 4JDYA 2D69A 1YXYA 1QUMA 4YMZA 3KVLA 4LVBA 1YYAA 1QFEA 5XIMA 3BCDA 4KQNA 1KNWA 2Z2AA 4MY9A 3WQ6A 3DFNA 4P7NA 1OFOA 1FWGC 4HOWA 4C6KA 2AQWA 3BLEA 4GQBA 3W2KA 2P0IA 4KGLA 1TKKA 5BW6A 2NV1A 3W82A 3M43A 2BOGX 3EWBX 4GQRA 4D8ZA 5ABFA 4PSPA 4JDBA 3QFWA 1C3FA 5C2GA 5CC3A 1ODZA 4B9ZA 2E1WA 2ZICA 1Q8JA 5I24A 1LBFA 1H1YA 2ZUNA 3RM4A 5GJNA 2QDGA 3Q58A 1AK5A 1VR6A 4EWJA 3E12A 4ICMA 1OCQA 3PBVA 1HKJA 4QE5A 5FEXA 4LUSB 3S42A 4HVXA 5BWAA 1W3TA 3I4EA 2ZBTA 3R43A 3KVKA 1EKOA 1XG4A 2OLSA 1V6VA 3CB8A 1RSCA 5IOBA 3B0UX 2HNHA 3SSZA 1B3OA 4ZQMA 4MY1A 3FNDA 1ADOA 3AJ7A 4L6DA 3CMJA 1RD5A 2WCAA 1IF2A 1LL4A 4XZ9A 2G3JA 1R3WA 4FNQA 4BJHA 2Y6ZA 3SEPA 1GVIA 1K8XA 3FJNA 4FR1A 2E25A 2QCLA 3LENA 3P93A 4IL2A 5F2LA 2DZSA 3BG3A 1HW6A 5AC5A 1F8MA 1IV8A 4AD4A 2Z7GA 1FP9A 3SUVA 3S2LA 3W2NA 2Y63A 3QY7A 3KOYA 3W1NA 2WC4A 3OG3A 4J27A 2VGIA 3U2EA 1S2UA 5DEZA 3QBUA 3IIXA 3T0BA 3VX1A 1JPHA 3NQDA 5D30A 3WLMA 4JICA 1VFHA 1YIXA 1MYRA 1A5NC 2VZUA 1ML1A 3NUKA 2TODA 4KEMA 3Q37A 2ZRZA 5JIPA 4AD1A 3ARXA 5J5DA 3RXZA 2Q71A 4NL1A 1XUZA 3E5PA 3NOEA 2QUTA 2ISSA 3CMGA 3EEGA 3M0YA 2FGZA 1XFBA 3WN6A 3QOKA 2WMHA 2EEXA 4J9JA 3LPPA 1JGMA 1U5VA 2C7FA 3A3XA 4HHLA 4Q4KA 4UTHA 5HMEA 1FWIC 5HR7A 3W1AA 3CWNA 4HMCA 4K38A 2ONEA 4WDTA 3U4AA 1ZP4A 4YCPA 4ERIA 3WX7A 3MT1A 3R7MA 1D2KA 3OEXA 2JGYA 5HULA 2PSNA 4GIRA 1NOFA 5C9UA 3FHQA 3FXYA 3GNXA 5AC7A 8RUCA 4UNIA 2R91A 3M7SA 4RW5A 2OO6A 3BV4A 4HK5A 5CSRA 3BZJA 3WQCA 1LWIA 2PRMA 3KDNA 3LN3A 5C6MA 2VC7A 4XAYA 3DHFA 2I14A 3RPTA 3GSMA 2IQ0A 2W5FA 1XPGA 4UQCA 2D0GA 5E93A 5E6YA 3W1UA 3UU0A 2OO0A 2UV8G 1BSLA 4TUFA 1OYCA 3GHUA 3K5XA 3SADA 1HJVA 2VEIA 2REQA 5DBUA 2NWSA 3S0CA 3QQWA 2PWEA 4PRRA 4TMBA 5F1VA 3ALFA 2C19A 2QVHA 4PMJA 3NVTA 1QWGA 2CZEA 1ZPTA 3VNJA 3GIQA 5CPOA 4YVVA 3TN5A 4LYPA 1JNDA 5HMSA 1GW9A 3EWDA 2XJ7A 3H12A 4P61A 4E4PA 1VYRA 5CPLA 3KZSA 3BXWA 2QCEA 2CXEA 4S23A 1QI2A 2HMCA 4GGBA 3OW1A 5BROA 5G1TA 1XIEA 1AFSA 4Z2LA 5U7SA 1HKMA 3I65A 3BK0A 4MYAA 2DEPA 4F0HA 3MUY1 4QG6A 3OBKA 3CMFA 2WVVB 7TIMA 3VNDA 1AQHA 4P8UA 5XINA 4ALDA 3AUJA 2CLFA 3XIMA 4GY7A 2EGZA 5I6SA 4BWLC 3VDAA 1FRBA 2P3EA 4UFMA 4MGGA 3VOGA 3IGHX 4M56A 4XISA 3TWAA 4MWAB 4RPQA 3H22A 5DLCA 3SN1A 3SZ8A 1EBHA 3G77A 3C0SA 2EG7A 2WLYA 1ITCA 3B8UA 4LAMA 3PHAA 3SCRA 1FHUA 4MUZA 4AY7A 4L1XA 3C52A 1G4SA 4M24A 2A1YA 2PDUA 5CCZA 3UZWA 3GAKA 2CLLA 4CNUA 4FI4A 4QS6A 4LGXA 4B90A 1US3A 1R7AA 1FHVA 4M51A 1IYXA 1M53A 4LEQA 4DI9A 2GDQA 1TZZA 4HMDA 2Y1HA 3S47A 4P7OA 1JZ2A 4FPSA 3FX4A 3C0JA 1VFTA 4M6VA 4EXBA 5DMMA 3FVDA 5T8GA 3W53A 2A7PA 4CN4A 4PTNA 3LCLA 3TC6A 3AU2A 4H6RA 5CXPA 3PULA 4HPGA 4O1DA 4GLEA 1BGAA 1DYSA 2QLYA 1Z9AA 3CAVA 1JYXA 4CQ9A 3CH9A 2FGLA 3F4DA 3F5JA 4URIA 3UW6A 2OXNA 3GNRA 1PBGA 1EOKA 4HZ8A 4IIHA 4GFIA 1W5PA 3F4CA 3VOHA 3ZMRA 1I0DA 3BLFA 1VBHA 1UA7A 3AS0A 3LD5A 5GQBA 1TMLA 2EPOA 1XIMA 1XRVA 1EIBA 1W56A 4PFMA 3UPWA 4O1EA 4ZSTA 4A05A 5EMMA 3ARRA 3CTTA 1JQXA 1B9ZA 3K1GA 2C16A 4GXPA 4ACYA 1UP0A 2H9AA 3I10A 2ZRVA 4IM4A 2WMKA 3EOEA 4MJZA 3PC0A 5DT7A 3W75A 5FJIA 2J79A 3B0YA 3MUIA 3W27A 3CH0A 4R3UA 2JGQA 4POCA 4O0KA 3PZMA 1OT1A 1JRCA 1DVJA 2EO7A 3RHGA 2J7BA 5G4EA 1HXJA 8TIMA 3A4AA 1OIMA 1HO4A 1XF0A 1EYEA 3VC6A 4MTVA 2PTZA 3O2LA 1KLZA 1UZDA 4DO5A 3LCWA 4NZ1A 2PWUA 4HYRA 3H24A 1SW3A 3HG5A 4KBXA 3IJ8A 1PTDA 3JS3A 1O5XA 4EAYA 3WBEA 2MUCA 2XVKA 1G67A 3QV9A 3UFYA 5HOSA 2NZLA 4GE8A 2NUXA 1DQUA 3GW3A 4KW2A 5CBJA 5BRBA 1C9DA 3ANYA 2NQJA 3PZ9A 3HJZA 1RLDA 1PX8A 1LUCA 1V08A 1E5JA 5H2ZA 2GQAA 4D8LA 1DL3A 3QPZA 5XIAA 1FWDC 5M03A 1LG1A 4LEFA 2CCRA 3V35A 2B7OA 1EX5A 4REQA 1TWIA 3CZ8A 2CLMA 1AW2A 2YA1A 3IJLA 5E5CA 1C8QA 5LA2A 4CNSA 4QHRA 5DCBA 5LIUX 4XZLX 4J40A 4M82A 3PFMA 3U2CA 5AHIA 1GK8A 1S5NA 3AHTA 2XTKA 1W37A 4L9ZA 5FL1A 1CB7B 3F03K 2DSZA 5BOFA 1XG3A 2JIEA 3S9YA 1EO5A 1V6XA 2OLAA 2DQXA 1JPIA 1XSIA 1QPRA 3C8NA 1YADA 2GUUA 4AVNA 5I0DA 1KRAC 2Q8LA 3V3WA 3IPWA 1Z7AA 4QTGA 3UEQA 4QITA 4QAWA 4GY1A 1OFAA 4ZEPA 3NQVA 3K4AA 4JFUA 1XS2A 1XLMA 3QVQA 3N9KA 3B8SA 3NDZA 1NOUA 1SW0A 3OLGA 2Z1SA 2YKKA 1EL3A 1S3HA 3XISA 3W01A 2WHLA 4XAZA 1PZ2A 2PP0A 3EA3A 1YDOA 4AWEA 3MCOA 5DF0A 4AQLA 3D6NA 1H5YA 1UKSA 3H7RA 2WCGA 4PL2A 1SU5A 1I2RA 2ZC1A 1E1FA 3L7RA 1W3LA 4JTHA 2HXUA 1TE6A 1ME8A 3BWWA 2ZRWA 2HEJA 4P8XA 1KV5A 3F2DA 3IUIA 1UC4A 5D8ZA 4GQQA 4NVTA 4RNIA 8CGTA 4S3KA 4QDWA 3EOLA 3LCHA 1E15A 3PF3A 4LUTB 1TV2A 3N9RA 1L6WA 2OEKA 3SFWA 4JTSA 4PMQA 1LYXA 2OZ8A 2QF8A 4W5ZA 3PZUA 1A5BA 1SPQA 5I07A 2R1PA 5BMXA 1S2CA 4CNTA 2PODA 4AWSA 3A5VA 3AIEA 1UD3A 2CLEA 4ZFMA 4PMRA 3APTA 1SGJA 2X30A 2FH6A 2ZVRA 3R12A 3DERA 4F2TA 4RE3A 2Z29A 3IJ9A 4ONVA 1D7KA 3AICA 1VPYA 2BASA 2AKMA 4YPJA 1MQQA 3OQEA 4X60A 4FZIA 1DIDA 3W7PA 4XZMX 4KESA 4AYSA 4KH2A 1LBLA 3UA4A 2PWVA 1FDZA 1JCLA 1KXHA 5LHEA 1SMDA 3Q94A 2E7FA 3SUUA 5M2FX 3EAUA 3MMUA 3VM5A 3BCJA 2CEQA 1SVDA 3F4WA 3PP7A 1TTQA 4Q8TA 4QDPA 2VQUA 1F3XA 3BAXA 3CIVA 3UXIA 3MZ2A 5D02A 4IH3A 5C9WA 2CZDA 1UYQA 3A12A 2DSVA 4H2HA 2YYTA 3ECQA 2Z24A 1U5HA 2R1KA 4BFAA 3LM7A 5FEZA 3W07A 3WQWA 1DHKA 4IMEA 1RK6A 3GNNA 2IXUA 3WLNA 1VQTA 1KM3A 1WBJA 2AL2A 5TQLA 4GI8A 1LZOA 2BVDA 2AOSA 4U2ZA 5F2IA 3E74A 1LRQA 3O07A 4FX6M 5E0FA 1QHOA 4J28A 4ZXOA 3TAKA 1PPIA 3L0NA 3RX3A 2WC7A 1XGZA 1AQFA 4XSLA 2GQ8A 4IICA 4IUGA 3EDDA 2HPMA 3E0FA 2J7EA 1W6TA 4RZ5A 4TVDA 4UMBA 3L5MA 4W8AA 3W9ZA 1UJPA 5BOEA 3VDBA 2XISA 3WDJA 1JI1A 1YQ2A 3T09A 5AVNA 1I4NA 1FWEC 3H21A 4OECA 1ISYA 1UD6A 4O13A 2GGEA 2EHHA 2ZX5A 4K3ZA 2XWEA 3OGSA 2FPVA 4O19A 4AVFA 1E6SM 1J93A 2XGIA 3AHYA 2YXOA 4LBRA 2RJHA 4PMZA 3WQEA 5DY2A 1R38A 4FP1A 4O1FA 2FYMA 3M0IA 3CZJA 4IQJA 1X8CA 3LQLA 4KEUA 1XDJA 4B5XA 2MNRA 1K7FA 5EA9A 1W9PA 4JNYA 4ECLA 5I09A 1F76A 2PWDA 3KX6A 4WDXA 1WZLA 3QLDA 1LL7A 1J8VA 1KLYA 1F6KA 1XYCA 1FWNA 2JKEA 4LYKA 1HUVA 2ZCGA 3WF2A 4UTTA 3G1RA 3SM0A 4L5ZA 4TX8A 2IXVA 1H7PA 4GBDA 1Z48A 2JF7A 3WBWA 5JBDA 1CXIA 2XGZA 4ZO9A 1PZ0A 1PJ9A 4CNPA 5EBAA 1KWKA 3GVVA 4JXCA 1VEOA 3CL7A 3AIVA 4X0NA 1QHZA 3C8FA 3R79A 1WE5A 1CWYA 5BYWA 2ZA3A 1VP5A 3LX9A 4OIFA 3GU2A 3IJIA 2ACRA 1J6OA 2DIKA 4FX7A 5AYXA 2FJKA 3CO8A 3WJWA 1IWPA 4CD6A 3KXQA 1A5UA 5FJUA 3MWCA 4UXDA 3VUPA 3ITXA 3FY1A 4GGHA 2J27A 3LLDA 3IV8A 2GJRA 1SO4A 3INPA 3DN5A 1QK2A 5HDRA 1K7EA 3UERA 5LSMA 1BWKA 1VHNA 3OLDA 5D2XA 1JEZA 4QFUA 2QMJA 2ZZ7A 5I3FA 3KVJA 2YXXA 3NQFA 1VH7A 4BA0A 5CJ5A 5DFAA 1UKOA 3EKZA 5H8UA 4WEVX 2X40A 3ANUA 2DZVA 3AS3A 4PRWA 1OGSA 3N11A 1FWAC 3OGVA 5C9ZA 1QBBA 3TTQA 1PKMA 3PBYA 1IZKA 2HPIA 1S39A 2CWNA 1NDYA 3GKFA 3TONA 3M0KA 3ZSTA 1K6AA 3ZR6A 1CBGA 2XIQA 4RL3A 2VEMA 2ZZ6A 4RR4A 1AA1B 1QASA 2BHZA 5JXQA 3DFOA 4EIVA 3DBPA 2YLLA 1R85A 3FEQA 5JMUA 3CWOX 1NF0A 1SO3A 1MXSA 1PAMA 1UD2A 2D0HA 3UESA 3L4XA 5DMNA 2PGWA 3CAKA 2FZMA 5HUOA 1L6SA 1WCGA 2CXGA 1ITXA 1V8EA 1R46A 2ZADA 4QJ4B 2Z7KA 1RCXB 3HPZA 4V27A 2VD9A 1EX1A 3ES7A 3N18A 4JKMA 4JHMA 1XIDA 4MFDA 1PKNA 1T6MA 1XH1A 5DN1A 2YFOA 4LOCA 2RHGA 5B80A 3Q67A 4WGXA 1FKWA 3QV7A 3UF9A 4LVAA 3O63A 2A3LA 3SCQA 3CT2A 3VDHA 5JIWA 3L21A 1PV8A 3WLSA 2XVNA 3RM8A 5D9NA 1TWDA 4XO7A 1GG1A 3FN9A 1A50A 4ADSA 1KCLA 5LNSA 2G50A 1BAGA 1QMLA 1KCKA 3KRUA 4IWWA 1DJQA 3LZ5A 5CPQA 2V8ZA 1DIOA 2WANA 1JYWA 1OFPA 2QEZA 1ZCCA 3VCNA 1ENUA 1LLOA 2W92A 5PTDA 1Q13A 4DQWA 3O6DA 3DKJA 5KTLA 2SFPA 2VYOA 3PBMA 1F8IA 3ARVA 3PM6A 1U30A 3R5EA 3S2CA 1HKWA 3FIGA 3TH6A 3U48A 2QPSA 1QWKA 4HNOA 1ODUA 1PHQA 3CS2A 4ERGA 2LLEA 2XFRA 4LF2A 4DLMA 4JIIX 2D3NA 5HQMA 3QR0A 4C6OA 4HZ7A 4EXAA 1VPQA 2QAPA 4TQTA 4LALA 3GD6A 5EYWA 4I7UA 3WUEA 2OELA 1TPFA 3AZTA 4GQGA 4IIFA 4W89A 4H2CA 1DJGA 2QZRA 1J0JA 1R3YA 4UFLA 1NF7A 2FZNA 1J2BA 3VCRA 1G4EA 2JIWA 2PDIA 3N34A 4FMVA 1AH4A 5E70A 3KL5A 4CGTA 2W67A 1H7WA 1EF3A 2HTMA 1XCXA 3T4WA 1F5ZA 3ARZA 3VZXA 1BF6A 1VGAA 1XBXA 1CGVA 2F2KA 3OA5A 3LV5A 3JZUA 1GVQA 3PY2A 2Y5EA 1ZZMA 4M81A 3CHFA 3QQ0A 3RU8X 4QJ1A 2VR4A 4B5VA 3LBMA 4IQDA 1QXLA 5AHEA 4HPHA 4MNMA 4AZ7A 1D3CA 1G9HA 1FVPA 3E0WA 3EWUA 4IFKA 4B3KA 1P1MA 1UD4A 1DJWA 4Y96A 2O56A 3WFZA 1XSKA 3VINA 1OWQA 2NWRA 3W74A 3NJ3A 4QSFA 4E2BA 3BCFA 3FJLA 1ICSA 3WLOA 4FK9A 3UQNA 4Z0SA 3NZPA 4LYRA 5ECVA 2ZA2A 1MQPA 3H4XA 1GZGA 1SYTA 3R11A 2Z26A 1RP8A 4Q4SA 1BGGA 2ISDA 2ZUSA 5DXXA 1E0XA 1KFKA 1XISA 3W7HA 2DDXA 3N12A 1VCVA 3LUTA 3SECA 1KGUA 4PMXA 4K1GA 1QT1A 2RDWA 3HPXA 1XKJA 1BVWA 3ZYZA 4PB4A 1J4EA 5TD4A 4W88A 3VIPA 2L5HA 2VFGA 3HPFA 1REQB 4MUPA 1DEDA 1HNYA 1QO2A 1OM0A 4JTUA 2H3DA 1E51A 1O95A 2NXIA 4IMFA 1MFVA 4J35A 2NX9A 2V68A 4TIMA 1DJHA 1NELA 4QISA 1TTPA 2BXVA 3EBVA 2C8NA 2H3BA 4ROQA 3ONCA 4GZIA 4NP7A 2HV5A 2BNJA 2EPLX 1JD7A 4UTMA 3RG6A 4I90A 3G1XA 5ABTA 3OVGA 2P10A 4LQ1A 5DT5A 4GVGA 3U5UA 3NPWA 2FFCA 1NEYA 3CQIA 2V5CA 3EDEA 3L65A 3G22A 1JGIA 5CPMA 2X1RA 3W26A 4IJBA 1OF6A 3CUXA 4Z1DA 4ZO7A 3DFHA 1EYWA 4FOUA 3ZVHA 2XIJA 4HNUA 3WELA 3T1GA 3A47A 1YBQB 2G5WA 1R3TA 4IF2A 1PYMA 4OOZA 4XAFA 2YW4A 5LIKX 5TAOA 3TSDA 1R7OA 3W7JA 2YA2A 3BG9A 1DWHM 3APGA 1S5TA 2YXGA 2ZUWA 4HK7A 2R6OA 3T2PA 1WAWA 2F6UA 4A8NA 4MJMA 3A23A 2ACQA 4WY0A 1LOSA 1W1TA 3GTIA 1B3ZA 1LL6A 1VBGA 2NX3A 3T7VA 3DG3A 3P74A 4PCSA 1CCWB 1P0BA 2O92A 5BNKA 3N2MA 3UZXA 2DH2A 1WDDA 3NSXA 3V36A 3DOPA 3GG0A 4LRTA 3L4WA 1UJQA 1J9YA 1RLCL 1Q6OA 4UR7A 2Y8UA 2Y88A 4RE4A 2W91A 3W7GA 5C71A 3GR4A 3DC0A 4LUSA 2GOUA 4KRZA 1EC7A 2VZTA 4IIBA 4S3GA 4C5ZA 4RZ4A 1LDCA 3WMBA 2PBGA 2Y7EA 4UZUA 4S3EA 2O9PA 1LQAA 2DSWA 4UQDA 3QM3A 3EWWA 4IMCA 4Q6XA 4UTKA 2VCBA 2AMGA 3W1XA 3RLUA 3QLLA 3SCPA 2QQ6A 2PZNA 1CB2A 4CCEA 2P8BA 5DANA 2CLHA 4CUCA 3K30A 4QDMA 4DYEA 1GVYA 3RK8A 1UG6A 3M46A 3W2UA 1GVRA 2OQHA 3TNOA 1XRFA 3KTCA 7ENLA 1VJZA 3KCJA 4AZGA 4QBXA 4GIAA 3VOIA 4QS5A 3VDCA 2A7NA 3RCNA 1WZMA 3VIKA 1MI3A 2QV5A 2A0NA 1VFUA 3RRXA 2XG9A 3I7RA 1GYLA 1WZKA 2J6XA 1OB0A 1LF1A 3GXPA 3MSYA 4FX8A 2X7WA 4R33A 1A5KC 1JUEA 1NU5A 1TB3A 2WKLA 4OBTA 3O06A 3F4NA 2PDWA 4IFOA 4NZJA 1UWTA 3TP4A 3TYCA 2VFHA 4YS1A 3DECA 4ADUA 3N9SA 3E1F1 4Q3MA 4M1RA 1TV3A 1N2VA 4TVCA 1UQYA 5FF2A 4F9JA 2CBVA 4K36A 3N1AA 5IFPA 4X2RA 3MU7A 1TCDA 1AUSL 1DTNA 5CZTA 2QJJA 4M29A 3QTPA 4PR4A 1W2PA 1RA0A 3QSRA 1N55A 3OJGA 1XFCA 2ABBA 1PHWA 3CZEA 2FKPA 1A4MA 4QXIA 1VJIA 4L61A 2FZDA 2WYSA 4Y9OA 4RDZA 1GCYA 5B7YA 3CEUA 1J0KA 1K7XA 3WL0A 5ABFB 2OZ0A 3WH9A 3BJTA 4P5UA 3NTYA 1FHLA 5DMYA 5C7HA 2YL8A 3ARWA 5U4NA 3TNBA 4JKLA 1QDSA 3S9ZA 3MDUA 2NX1A 4ZQNA 3C61A 3OGRA 3TW7A 2KX9A 4GI9A 3BL3A 3IUHA 1I2NA 4YCOA 2WJDA 3VGEA 3G1SA 3PNZA 1Y65A 5JBFA 2FVLA 4IXXA 2RFGA 1OFQA 4LT9A 4PMOA 4E38A 1ZBKA 3W85A 1JPDX 1M03A 3GG8A 1X1NA 8XIMA 3B4UA 4XUYA 1XYAA 1D8WA 4H41A 1RQBA 1FQ0A 1R6WA 1KC7A 4FIQA 1W3JA 1IR1A 1VENA 4FLOA 5AHMA 2NUYA 3WJZA 1RQHA 2WVUA 2YZ5A 4AAJA 1ISWA 1SFSA 1EJUC 3KTXA 3K8MA 1UZHA 4U5IA 3L66A 2X0SA 4DJDD 4BWLA 3AI0A 3R25A 3GNOA 4JTTA 2DT1A 3RN6A 3LPOA 4RK8A 2CBUA 3WY1A 4C6IA 2G95A 3TMLA 1FA2A 1S5MA 1V79A 3DUGA 5CAKA 1TIWA 4KEVA 1GVFA 3GYCA 3W71A 1FDYA 4PBFA 3E2RA 1TJ1A 2DUAA 1FKXA 4Z1YA 2Q6ZA 2JKAA 3RFAA 5CZKA 2ZYFA 4DF2A 5LGXA 3RILA 4JN6A 4DM1A 3WD1A 4DBSA 4JEJA 1J0IA 3T05A 2VENA 2QVNA 3UJ2A 3PANA 5EGRA 2WVVA 1OADA 3GDTA 1UWUA 3IUDA 4XBJA 3QYQA 3GVGA 2DVTA 1NDWA 1R9XA 4EF9A 2PLMA 1OCBA 3ZR5A 2ESCA 3CIWA 3A9IA 4ILSA 3AMCA 4ZMGA 3OB8A 3M16A 1EOMA 1R3RA 1H7XA 3WLKX 3B0XA 1UQZA 4DB7A 3SY8A 3UG8A 1LOQA 4ICCX 5D03A 4D6DA 1UR8A 3HG4A 1L2QA 3N73A 2HSAA 4R7JA 2A2IA 4PUJA 3VILA 1Q63A 2BVWA 2PRHA 2OU4A 2H90A 5BRPA 4TOQA 4AY1A 4H00A 2HXTA 1RJPA 2C91A 2VFDA 1CXHA 3T07A 3VOJA 2D23A 4IGNA 1QATA 4QLJA 3N3MA 4A21A 4LC8A 2CERA 2VURA 2UY5A 1Q7MA 2CNCA 3MANA 3S5OA 5FD0A 4F2BA 1RJQA 3GC2A 1CT5A 3WK0A 1XQLA 4H9UA 1H49A 3WNPA 1XIGA 4U3CA 3NM3A 2WXDM 4NIRA 2YZRA 1L6GA 5FSDC 2HK1A 3QZEA 1AH0A 2Y5SA 1T99A 3W7MA 3P60A 2VWSA 1QK0A 4JYFA 4FOKA 1ZALA 4E8GA 4PUWA 3URQA 2J77A 3TDFA 1UH3A 3TVAA 1MW0A 4K7YA 1F4HA 1JDEA 3K46A 4HNCA 3KP0A 3N25A 1CECA 1HKKA 1ME9A 4J3WA 2R1MA 4JYDA 2X09A 3CZLA 5CH9A 2QCNA 5L9FA 3PTDA 3B9EA 4J3XA 4QQ3A 1OX4A 1W3IA 3O6YX 3POHA 4NG3A 4CNOA 3GC5A 3UJEA 4O4VA 4Q4RA 3LEPA 1ZP3A 1EGMA 1M68A 3CV6A 1UWRA 4GI4A 1SO5A 3THDA 3W2JA 4DYKA 1Z3NA 1V03A 3RGTA 1GOOA 2HQAA 2Y7GA 3NQ2A 1F3EA 2WZEA 1ZY9A 4N9BA 2DP3A 4IPNB 2EPKX 5I77A 3W2MA 3H54A 3WJYA 3IACA 3T40A 4HPXA 4XV0A 1VFSA 4CEUC 2HK0A 1X6LA 2C0AA 4RZ6A 4DWSB 2UZ9A 1JFXA 3VA8A 2X7VA 3P84A 4QQUA 1YW1A 2G8ZA 1XINA 1BXCA 1KB3A 3RO6A 3ZJ6A 1GYMA 3CZKA 3SN4A 4HHMA 3TCEA 3VGFA 4EPBC 3PTKA 2GJPA 4DUVA 4BR1A 1JZ4A 3RLGA 1RY8A 1UROA 1R2SA 3AIWA 3OIXA 4QX4A 2YJQA 1XC4A 3B03A 1EA0A 2GVJA 3STCA 1J0HA 3LYEA 1K3UA 4NI3A 4C6NA 4FF7A 5K4ZA 4GXMA 3TYBA 1GHRA 3UCQA 1JZ6A 4Z0JA 4ZA0A 4BZYA 4H01A 2ZC8A 4DWSC 3AAMA 3IVTA 3SUWA 1T0OA 1TR1A 2WMJA 4CU6A 2DZAA 4Q8QA 4QCEA 3GKAA 1WX0A 3NDYA 2V3DA 3T44A 1G0CA 3SCNA 3NQCA 3HN3A 3GH5A 4MKNA 1X1ZA 1L6YA 4H4IA 4NASA 4H6QA 3QC3A 1E0VA 5FAGA 1BRLA 3ITGA 5A2CA 2O9OA 4H9VA 3U2OA 1ALDA 3FW6A 1BHGA 2INZA 3BMWA 3LRKA 3NPVA 5JH1A 4XZNX 2YB1A 2VCCA 1E55A 1KQYA 1KKOA 3OG2A 4P7QA 3UJRA 2V0TA 3AIQA 4U28A 2W63A 1TCMA 2PU0A 5GNYA 3VNYA 1Y5WA 2BBFA 3OBAA 4L65A 3F2CA 2QIIA 2V67A 3T0TA 4EE9A 2E6FA 5L6UA 3KVMA 1QI0A 4JNMA 2AMXA 3G1AA 4PB5A 3T55A 2WMIB 5HMFA 3LTSA 2GGIA 1TYGA 3DENA 4Q22A 4RV3A 3PUGA 3CHVA 2A7RA 1TQJA 2J47A 2PP3A 3UR2A 2PLCA 5F4SA 3HIJA 4E3VA 4MJ2A 1WDPA 4C60A 1E43A 1A3XA 1UWIA 3G6MA 3RF9A 3WD3A 1GUVA 2Y7FA 3WH5A 1E6PA 3AC0A 1WQ5A 2CC0A 2OGYA 3GDRA 3T0CA 3RU6A 1E4IA 4GPNA 4IISA 3H53A 4MAZA 3UWVA 4ZR8A 4YLWA 4MNLA 4XO6A 3MZNA 4ZB2A 4GO8A 2GVLA 2OWCA 1GTEA 1WKEA 2V3GA 1W3NA 1XI3A 4WD0A 2G37A 1TELA 4E5TA 4J7RA 1W1PA 1XYFA 1B9BA 3H2FA 4S3FA 4F0MA 1ISVA 5D2TA 3WF1A 3C0LA 1SFJA 4GUHA 3V75A 2HVNA 1MUCA 1H60A 1MMFA 2P5NA 4GOAA 3AHVA 4J3VA 3W7IA 4BI5A 2XIBA 3GU1A 4HOXA 1CNVA 4AWUA 3WLQA 5BXPA 5D33A 1GYNA 2EG6A 1VB9A 1I0BA 4J1OA 1TV7A 4FSAA 4AZBA 3GK0A 2WKJA 1GPWA 3QSTA 3FA3A 1OIFA 3LRMA 3EOOA 4DJDA 3QPEA 1XLGA 3MMTA 3WLHA 1U33A 2W9MA 3PG8A 1E73M 4MMWA 4NF7A 4Q8MA 3TC7A 4I5XA 1TIMA 4B5WA 2OKOA 1GZ1A 2PDBA 3KRBA 5CJMA 4MFEA 3KWXA 4MHBA 1BKSA 1K8CA 1VF8A 3N04A 3DFSA 4JY8A 4KWVA 4UMCA 1XLDA 3HA1A 1EJWC 5K9DA 1YNYA 2QXWA 4WKHA 1J5SA 5A2BA 3WF4A 2JFEX 3DYMA 3P67A 2QNEA 7CGTA 4B5NA 4NX5A 3PFRA 4G7EA 3LXAA 2PD5A 1M9HA 3LHWA 1VRXA 3BGAA 4HNLA 4IL0A 4LXFA 4EPEC 1VS1A 1D8CA 1CPUA 1Q6FA 4R7WA 1K9DA 4YTQA 2E09A 3BAJA 2YCLA 4ZSUA 2GWNA 4GYKA 1RVGA 5A6LA 2ZE0A 3H2MA 1A3HA 4PEKA 3PUOA 3WDQA 4Q32A 2X1TA 5FJRA 4DZIA 2RJGA 1DXEA 3EOUA 1VEMA 4GG9A 3DEQA 5E1QA 4GINA 4N4PA 1QBAA 5REQA 3WK2A 3WNNA 3RNDA 5KZDA 2J6VA 4JIQA 5HJXA 1EZWA 2GVGA 3C2RA 3VKCA 1WA3A 1YE4A 2ATMA 3AIRA 1UR4A 4RNHA 3MQTA 5K3VA 3GHRA 2UY3A 1SUXA 1PDYA 4TV5A 4PTDA 5C2XA 3H26A 4ZOAA 3W4RA 3O7UA 3KBVA 2NLIA 2IKJA 2XFYA 1DJIA 2C1HA 4ZBCA 5HWMA 4IP4A 1BEUA 2WHMA 1Q6GA 3I68A 1YDNA 3RJYA 1NAL1 3BW4A 2FH8A 2VXNA 5HNRA 2YB4A 3P80A 4UZSA 3CPRA 4JIHA 2QUVA 1KBLA 5AY7A 4FA3A 4N9CA 1GVEA 4UFKA 1UMYA 4Y9PA 6XIAA 4ES4A 1KM0A 3QMRA 4IXHA 1GJWA 3L2MA 4WKFA 2DORA 4OV9A 1J12A 1PKLA 1YEYA 4B92A 1DWAM 3AZRA 4AXKA 4JY9A 4NX0A 2A79A 3U9IA 4O53A 1I75A 1JD9A 1RJRA 5DBTA 3M1ZA 3W00A 1EXPA 3BJSA 3M5XA 4D6IA 1E1EA 4EPKA 4HCLA 3WLPA 4NJJA 3C6CA 4D71A 2Y70A 1HZYA 3UZZA 3GDBA 2A6LA 4UFJA 4FNRA 3DG6A 1OINA 3M44A 1XYMA 2VFFA 3P14A 1UC5A 2B7NA 4XBSA 1DXIA 2YL5A 3AALA 1IEXA 1B54A 3W1RA 3ZQ9A 1E6ZA 5FJTA 3VGBA 1JULA 5AOUA 1DIEA 1O68A 4OBRA 5G5IA 3BOLA 3BLPX 3NPXA 4PB3A 1A0CA 4FIRA 4MZYA 3D47A 5HR6A 2DZBA 1W2VA 2Q3OA 1SJBA 2AL2B 2IPWA 3A13A 1I2PA 3NPUA 5AYZA 5D8WA 5A8NA 1M41A 1B3XA 3QPYA 5G2HA 3CJPA 3U3HA 4C6FA 3QN3A 1XD1A 3PWAA 3TC3A 3VKJA 4RPPA 3WSUA 5CZJA 2WPGA 5E0CA 3ZJ7A 1GGOA 1NTHA 2DGAA 4CCCA 4GZJA 1XSJA 3UJFA 3JUGA 1EH9A 2B7QA 1KBKA 4LX4A 4C1NA 3ZVIA 3V0UA 2GSHA 3PK7A 4DLFA 1XC6A 4FXRA 3TWBA 2GJNA 5CPSA 2J7CA 5FA5A 3HG2A 5K4XA 5F4WA 2QAFA 1OG0A 1S46A 1OSEA 3S9IA 4AZCA 1NP0A 3ALGA 4MNKA 1LLWA 1ZUAX 2ZRYA 4EAMA 1YRRA 4Z42C 1LT8A 3IS4A 2J66A 3PBWA 3VPLA 4LVFA 4JX5A 4DIAA 1B1YA 4UTJA 1SZNA 4JTAA 5FEWA 2CYGA 4NHVA 5D2VA 2QCCA 3NZ1A 1IT7A 2XH4A 3QV6A 7PTDA 4EK7A 7REQA 5CEWA 3EPOA 3ABXA 2Z1VA 1VCGA 4O8RA 3ABQA 4F0LA 1J2WA 4GIEA 1TQXA 1PTAA 3QMSA 1SZFA 2ALDA 1HTIA 1U1JA 2NQHA 1IXOA 3LRLA 2JBMA 1J18A 3JU2A 4L64A 3B97A 3C3UA 1UR1A 4LV4A 1KCXA 3H2NA 1RUSA 2YFNA 2BX7A 4C6BA 4PSRA 3CV1A 4PTMA 3ZLGA 3WJSA 3KBWA 4E2OA 2W4XA 3URAA 4JQ3A 2C1GA 4DO6A 3ITVA 2VUYA 4GO9A 3QH2A 4Z2IA 3SDOA 2BOFX 2J62A 5T26A 3MC5A 1WNOA 4S2CA 2J13A 1J6PA 2H6RA 2XH0A 1WXYA 4R34A 2BFGA 3ARTA 4UTTC 1T96A 2YA0A 4HKPA 2R82A 3QGVA 5LNWA 1OK6A 1H4PA 2XVGA 4V33A 4X22A 5ABEA 1P7TB 1BPLB 1W54A 5BXTA 4O11A 2DZUA 1TO3A 3G2GA 5CBIA 1WUFA 3GW0A 3M0MA 4OHQA 3SQSA 2OX1A 4C7GA 3O3RA 2QKFA 1RY0A 4Q8NA 3W7RA 4AWTA 2VR5A 3T81A 2QV4A 5FJOA 7XIMA 3W25A 3B0PA 4K37A 3QZ6A 3GUWA 1KQZA 4D72A 5CG0A 1H7OA 4ZE5A 1KR1A 1JZ5A 1OCNA 5JUVA 4I7VA 1JF6A 1KFWA 1F61A 3EX4A 5BU9A 4MYXA 2Z0IA 1TWZA 4WIWA 3S83A 3E96A 3GG1A 1U1UA 3QJAA 3U7BA 6TAAA 2GSEA 5AFDA 4EWND 1UZ4A 4FNPA 3MUZ1 2QUUA 1O7AA 1TWSA 3GHSA 1VLWA 5LXEA 4XB3A 4Q8OA 4GZ7A 4XD3A 3PJTA 3PN8A 4HOZA 1CGWA 1CGUA 3JVAA 4FLRA 2D24A 2NUWA 1V0KA 1YLVA 1P0DA 3NVDA 4YNGA 4LAKA 3ID7A 4CQBA 4MVAA 1XJBA 5LYRA 3CWHA 1E70M 4Q4PA 3BAWA 1K9TA 4Q7IA 5EFFA 4JKKA 1VIZA 2O9RA 1POKA 4UQBA 3TYUA 1HN1A 4XKYA 1WV2A 4DEFA 2FTPA 1REQA 4LVDA 4KWWA 5JQ9A 3MMDA 3TE9A 3WQ4A 4MKSA 4GMEA 2HBVA 4US5D 3AOFA 3UXKA 3P5YA 1TPUA 2F6XA 4AEFA 1UMLA 1NIUA 1I2QA 1UKQA 2PDYA 4IPJA 5HWJA 1YX1A 5DX7A 4P8WA 3E5BA 3UR5A 4CN6A 5EB8A 3NL5A 3WK1A 4CU8A 4JTQA 6TIMA 1V0MA 4DAIA 1MQRA 4I8DA 3H2OA 2ACSA 1XWYA 3MVTA 3H7UA 3P3BA 1EIXA 3DU0A 1GOWA 4PC8A 1UP3A 5CGQA 2X2YA 2ZX9A 5AVHA 4AU0A 1WAUA 1YBQA 4W4QA 5FIPA 4YU1A 1Q6LA 2ZXDA 4PTVA 1B2YA 1KFLA 4Y8FA 3WLTA 1IEWA 3L0GA 3BW2A 2WNWA 4JTFA 3VIHA 4IQLA 2DJXA 2PLJA 1O5RA 4C90A 3U8GA 3ERPA 1HKIA 3VMPA 1TRIA 3UYCA 2RGLA 2A3BA 1H1NA 3GDLA 1LROA 4GKTA 2J24A 1S1PA 3E0VA 4CD4A 1G6CA 2DSKA 1JG9A 3SR7A 4JR5A 3HGOA 1Q3NA 1PWLA 4ZE4A 1ZAHA 1IIHA 2WBGA 1T41A 4IFKB 1F4AA 1OQFA 5I03A 4QNWA 1DOSA 2AQVA 3TCSA 3GRIA 2FHBA 3WYZA 1EWEA 4PL1A 3NWRA 3QXBA 4UNLA 4JL2A 2VC6A 3THCA 1AQMA 4DHGA 3HF3A 3Q4DA 3GXNA 2FQIA 3AXXA 3MCMA 1YTEA 1BWLA 3N29A 3M6DA 3TN3A 4U31A 4O16A 4NAFA 2CLPA 3ZT6A 1JIBA 3W1PA 5A6MA 1P6BA 1YNQA 3KBSA 2J88A 7A3HA 4LCRA 2VRJA 1XIIA 2KAUC 4NKCA 3HFTA 5LZLA 1SO6A 2XYLA 1B0IA 1PX3A 1SFTA 5EY5A 2FMNA 3BE7A 3DI1A 4HHPA 3VU2A 2EJAA 4DX3A 1EJRC 3H2CA 2F84A 3W83A 1L2UA 5FCZA 3NSNA 1MVYA 1OC6A 2E67A 4NNBA 3EPMA 1TA3B 4X61A 1TV5A 1SSDA 3C2OA 3UG4A 3GTFA 3LGDA 4W84A 4MIMA 2Y0FA 3QV8A 4PODA 2Y2WA 1KTNA 4ZVJA 4GX8A 3C86A 1EEPA 2BP1A 1KXQA 3TJIA 4MADA 4DBUA 1A80A 4I9TA 1PVNA 1YPFA 3R8RA 2ADAA 4LF1A 2NSOA 4R85A 4YHEA 5AZ0A 1EPVA 1UHVA 3WNLA 2DSUA 3USZA 1QVBA 2E9BA 1K4GA 3LHZA 4HYVA 4PH6A 1IE7C 3EKGA 2F6KA 3AMKA 3UVAA 2EG8A 1BVNP 3K13A 3ZVHB 1E0UA 1BF2A 2E5DA 3V16A 1EF2A 3QYSA 1DXFA 2YYUA 3GX9A 4DNMA 4H8UA 4K8GA 4ZGYA 3BAIA 2NLYA 1CXFA 4ADTA 4IG2A 1KM1A 4TX9A 3BANA 1GOMA 2EPMX 4H6EA 5JH2A 4HNVA 2XZ9A 5CZSA 5CSSA 1R9ZA 5D37A 3SURA 2HE8A 3UXAA 1Z42A 4WY0B 1ADSA 1UD5A 1IWBA 2FMOA 3OLEA 2Z6IA 2GJLA 3MSRA 1CENA 5G1YA 3RO8A 1ZHAA 2PA6A 1ONRA 1DKWA 3TTOA 4M8UA 2Z1WA 4O1CA 1X38A 1OHLA 1UOKA 3J7HA 1GNXA 3H2EA 3AXIA 2EPHA 3I3BA 3BSHA 3ENLA 1VRDA 1U2YA 1A3WA 3OYZA 3TA9A 1UBPC 3SRFA 3DYOA 1Q2SA 4DBDA 2I17A 1B4EA 1C8VA 2ZTJA 3GLCA 3W29A 4F40A 1F74A 5CPTA 5EL1A 4QM1A 1Q45A 1RP9A 4X0VA 4DBEA 1ZLPA 3T2QA 3LCGA 3W23A 4DWDA 3HB9A 4YWSA 3GUGA 3RYSA 3EWCA 3IGSA 3OZYA 3S2NA 1XBZA 4RXGA 3UWUA 2HISA 1JCXA 1PL9A 2WM1A 4L4PA 2QCHA 3EMQA 3CHDA 5I23A 1FCVA 4W7UA 3S1GA 4AHPA 4PEEA 1CGXA 1Q8AA 3ZM8A 3CHCA 4IPPA 5E6ZA 3VD3A 1WXJA 1KFJA 4AD0A 2Z2BA 1K8ZA 3FV9A 3W38A 4JBRA 2ISFA 3FJ6A 3EA1A 4NZ3A 1I6NA 3MP5A 3WBYA 1XH0A 4RNJA 1DQWA 3S1WA 3M0VA 3CQHA 4MPQA 1FFRA 4A3HA 5E09A 4WDUA 2O7SA 5F1UA 3W1TA 3W87A 1V6UA 4AC1X 1XRSA 4WXZA 2PWFA 1JCMP 2BODX 2CIPA 4LS1A 4C6PA 1F05A 2PBOA 3EX2A 1QNOA 3LOTA 3UWEA 5BXSA 1RPXA 4Q8WA 4Q4MA 1W31A 2BZNA 3E9AA 2FDSA 2FPTA 4N6EA 3VD5A 4U3AA 1KXVA 1XBVA 3W24A 3TW6A 2OT1A 3RR1A 2XSAA 3IIZA 3AMLA 3WQVA 3PZTA 3RRAA 2PDJA 1TG7A 1W9BM 2HBXA 4S1FA 3WK3A 2XH2A 1OT2A 3GVWA 3AU6A 3O0FA 4DF1A 3LB0A 2P3ZA 1EUNA 4RE2A 1C29A 1QW7A 2XDFA 3UNDA 2H8XA 3VCCA 1JDFA 2QF7A 3FCPA 4CQAA 1QNVA 2DFAA 3KP1A 4GH3A 4US5A 1CEOA 3WLIA 4NNCA 1FCUA 2BY2A 3ARUA 3PB2A 3EYPA 4MOZA 3PZVA 1S5VA 3T8LA 4A4AA 4B2DD 2VKZG 1GT8A 4HGXA 4NRRA 4F79A 1QPQA 4H3DA 2D0FA 3W70A 5T9BG 5I3JA 3VKDA 1X97A 1MWOA 2XUCA 3SY5A 2V63A 5A6KA 3SCTA 2J75A 4MF4A 1XLKA 2FZBA 4L6HA 4H7VA 2QCGA 3CXOA 1RZMA 1TUXA 4A3YA 3G0UA 2TYSA 3GVQA 2Y85A 1W1B1 4BI7A 4RW3A 4QEEA 2NXHA 3LQGA 3F5LA 1GZJA 5J04A 1QNQA 3W7QA 2Y61A 4EKJA 3UXDA 3VD9A 2C14A 2FB2A 2WNNA 2ISVA 3L67A 1Q6CA 1BTCA 2GGHA 3KTSA 4QG8A 2GWGA 1O94A 2DZWA 5BMWA 4E8CA 3WNOA 5I78A 1RXOB 3PTMA 3ZSSA 4OBSA 1W8GA 4GY0A 1TPEA 4BQ5A 1DJNA 1QOPA 3TJXA 4O0QA 1CIUA 1A0EA 2X41A 3CPGA 1QOXA 2YIHA 3NM1A 2J7DA 5I3KA 3TX9A 2YOCA 3M07A 4FAMA 3VE9A 3C2FA 3S46A 1Y5VA 4XD4A 4ZCWA 3OZMA 2OEJA 3JRKA 4DWSA 2VZOA 4UFIA 3WDHA 2F9RA 3LGGA 4K8EA 2XFFA 1TJPA 3WQPA 3UWYA 1EO7A 4AD2A 4MJ4A 2ZTKA 2V5DA 1VFOA 3MWAA 4O10A 2CZVA 5HNNA 2VFIA 4BF9A 3HPAA 3TQ0A 3ABZA 1XLEA 1AH3A 4RDVA 1VFLA 3NEVA 2BSLA 1VBUA 4U10A 4B4HA 1Q5MA 1YNPA 4D6JA 3L0KA 2E6YA 3NEHA 3L2LA 2IPJA 3MB9A 1DJXA 3G6LA 2VHLA 4BQ2A 3IARA 2G96A 2VD8A 3AS1A 2QJHA 4HSOA 1F6YA 3PBGA 2ZXBA 3O05A 4C5YA 4L1GA 3WDPP 1R8LA 1TREA 3ITCA 1S3TC 1VBRA 1K1DA 4AHQA 2PDXA 3E49A 1LWHA 2EQDA 1PS9A 4GC3A 4HB7A 1JCJA 3D3FA 2VZVA 4ERAA 1H09A 2WQDA 1DV7A 4U2YA 1X1OA 4DZHA 5I3HA 3ANVA 4ACZA 1O5QA 2A21A 5LIWX 1BYBA 1XPYA 3N19B 3I7SA 1ZSXA 2E68A 4JD4A 3KBJA 4CCDA 3A4WA 3A4XA 2ZWZA 1EB3A 5DO8A 2TSYA 1KFCA 2VC5A 3GTHA 3IAQA 1AW5A 1KGXA 1D3GA 4M3PA 4P2VA 2ZKMX 2QPUA 3SJ3A 1MNSA 3R2GA 1NARA 2ZXAA 3UP8A 3CTLA 5LIXX 1WXZA 1Q4NX 1M01A 3GIYA 1O1ZA 2WMIA 1OX4B 3BLDA 3CV2A 3RIKA 2ZX6A 3NQ8A 1OCJA 1EZ2A 4ZOEA 1M7OA 3KCOA 3EX1A 3UGRA 2DT3A 3V1HA 1A5LC 4OV4A 5LKYA 4GNJA 3TQPA 4Z2KA 5GNZA 3T0DA 1HJXA 4I3GA 3FGCA 2VX4A 5C5YA 5HATA 4P7RA 1TZ9A 4R5EA 2NVCA</