1NY1A

Crystal structure of b. subtilis polysaccharide deacetylase northeast structural genomics consortium target sr127.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
235
structure length
235
Chain Sequence
b'VPNEPINWGFKRSVNHQPPDAGKQLNSLIEKYDAFYLGNTKEKTIYLTFDNGYENGYTPKVLDVLKKHRVTGTFFVTGHFVKDQPQLIKRMSDEGHIIGNHSFHHPDLTTKTADQIQDELDSVNEEVYKITGKQDNLYLRPPRGVFSEYVLKETKRLGYQTVFWSVAFVDWKINNQKGKKYAYDHMIKQAHPGAIYLLHTVSRDNAEALDDAITDLKKQGYTFKSIDDLMFEKEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable polysaccharide deacetylase pdaA
publication title Crystal Structure of Polysaccharide Deacetylase (PDAA_BACSU) from B. Subtilis (Pdaa_Bacsu) Northeast Structural Genomics Research Consortium (Nesg) Target Sr127
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 84
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 1ny1A00
4NZ5A 4NZ3A 3QBUA 3RXZA 3CL6A 2CC0A 3CL7A 4HD5A 2J13A 5JMUA 2XU2A 1XW8A 4OUIA 2I5IA 2Y8UA 4NZ1A 1W1B1 5BU6A 1W1A1 2C79A 3S6OA 2VYOA 4U10A 4NZ4A 4NY2A 4WCJA 4V33A 2NLYA 2W3ZA 2C1GA 3WX7A 4F9DA 4NYUA 1W17A 2C1IA 4L1GA 1NY1A 3HFTA 4F9JA 2E67A 3CL8A 2QV5A 1Z7AA 4M1BA 2DFAA 3VUSA 4NYYA 4LY4A 1V6TA 2C71A 2IW0A
chains in the Genus database with same CATH superfamily
3LXAA 2V68A 3EOOA 3UEQA 4MPQA 4HA1A 3FNDA 2CXGA 1KXTA 3JVAA 2J9ZA 2PSNA 1OGGA 2H3DA 4NI3A 1BRLB 1NARA 4AXNA 3UYIA 4AEFA 3HZ3A 1V93A 3WQ5A 4IIHA 1YKWA 4M6VA 2WYSA 4AWUA 2PFHA 3AICA 4DO4A 3GHRA 4W93A 3MY9A 4XIAA 1QK2A 2PA6A 2A21A 3HU7A 1BTMA 4E0CA 5GNYA 2Q8ZA 2BNJA 1YTDA 3G1DA 3HGOA 3N6HA 1OGSA 2DY3A 4I8YA 4XWUA 1WXZA 2D22A 3EDDA 1H7RA 1HN1A 2ZZ2A 4LNCA 1MXSA 3O15A 2ZXAA 5HPOA 3SY8A 1ZALA 3W3OA 5BWFA 3OYZA 2XWDA 2CCRA 4L6OA 3E0WA 3WEMA 2DUAA 2WZTA 1U2YA 1VCGA 3NJ3A 2YDSA 2X0SA 1VH7A 1UUOA 3CWHA 4HKPA 3R13A 3UR2A 3UXAA 2QHAA 3IGUA 4EOUA 1F61A 1BGGA 2XIIA 4IP5A 5M3WA 4LFYA 2GJXB 5SWUA 3BJSA 1B3YA 3PPFA 3URBA 1AK5A 3O8AA 3TU9A 4AXKA 1A80A 1TZ9A 4KF1A 1LLOA 2PLMA 3E5PA 4Z1AA 4WSHA 2NQ5A 2CZVA 1K7FA 1I2QA 4MNKA 2VQUA 3ZJKA 5HNRA 2A7RA 4QISA 2X41A 2VNCA 4C91A 2DQWA 3B4YA 1WDPA 1EYEA 4GNVA 1TMLA 2BTMA 3VIJA 4BKNA 2YCEA 1KXVA 2YBTA 5DBUA 3ZS4A 3P14A 3BQ6A 5D2VA 4CU6A 4QJ1A 4UQEA 1PTDA 1EOMA 4QITA 1N7KA 1PL9A 3UXIA 1B57A 3GDMA 4URIA 5BRPA 4U28A 1TJRA 3W7JA 3NM3A 4W5UA 1UCWA 4QG8A 2QF8A 2AQWA 4Q7BA 3QMSA 4MG4A 4RR4A 2HXUA 1XYFA 1W9UA 4HPXA 3ZT5A 1EC8A 4PUEA 1JCTA 4ASTA 4MLJA 3OB8A 2GGJA 1G67A 2CIPA 2FHCA 2Y70A 1UPMB 2A6LA 5LA1A 1M6JA 3W7CA 3NL5A 4WX2A 2FFCA 2BXVA 2GL5A 3I3EA 4OBTA 5TAOA 4IIEA 1SSGA 5TQLA 3KEHA 5CPSA 3DHFA 3V0SA 1RH9A 1E70M 4NYYA 5DLCA 1YHTA 4H6EA 4F2TA 1QPQA 3OLDA 1HF6A 3TZNA 5I02A 4DQWA 2P50A 3W53A 5HMDA 3WMBA 5HJXA 2PTYA 1AG1O 2Z29A 3AZSA 5EBAA 5D32A 4AMCA 4IP7A 1B3WA 5JBDA 2EGZA 2A5HA 1VFHA 4A4AA 1GOIA 3T0TA 2YDRA 3TMQA 3CM4A 4FOJA 2NWSA 3K8MA 5E9XA 3KOZA 1W2VA 1PHWA 1IR1A 4WDXA 2XH7A 2O55A 5EU9A 3BK0A 2ADAA 3P62A 2BXZA 3H6OA 3UWEA 2Y4SA 1LWHA 4V27A 4RE4A 3ZLGA 4QJ5B 4FOKA 1ALDA 3CAQA 4ICMA 3ZQ9A 3PNZA 3UF9A 3T1GA 1DWFM 4RDYA 4JY9A 3TONA 2PD9A 2OOFA 3KOXA 1VBRA 5XIAA 2CESA 1NH6A 4U2YA 4QLJA 1BD0A 3TKFA 3BGGA 3LLXA 2R1PA 6XIMA 4UCFA 4WDUA 4J35A 1GTHA 2CLMA 1XR2A 3W9ZA 1IZCA 2I14A 2FZ8A 1L6YA 2J8GA 3QHMA 4AIBA 3NVDA 4EXQA 1JPDX 1L9WA 3SRFA 2OPJA 3EA1A 3W83A 3NQ8A 1SO6A 2OSWA 3GTXA 1K9TA 5LA0A 1EX5A 1AL8A 3A3XA 3UXDA 3D5HA 4ZXLA 1QASA 2J6VA 1YE6A 1R0MA 3W7GA 4AZ6A 3KVJA 4LWWA 2RDTA 1BXBA 2MNRA 2QCEA 1VQTA 3KVMA 5EY5A 3AXIA 3MB9A 3W88A 4GO9A 4XZIA 1QW8A 2PDMA 4QE1A 3QTGA 3RJYA 1QNVA 2JK2A 3MA8A 3W6MA 2OWWA 4D6JA 4N4PA 1TWWA 1R30A 4L5ZA 2VFEA 3CWOX 4LBUA 3R10A 4GISA 5D04C 3L67A 2PP0A 1O5QA 1UR1A 3KS5A 3W1QA 1B30A 1XJBA 3F4VA 1RK6A 4PTMA 4X3ZA 3R79A 1EF3A 2YA0A 2D24A 4D6FA 1V6WA 1K4GA 4FLOA 4P7NA 3RM4A 1RY0A 5HWMA 2EPNA 3ARTA 4DYKA 2QDDA 3BG3A 1OCNA 2Q3OA 4C90A 3FEQA 3NUKA 4WR3A 3S5ZA 4G1NA 3RGTA 2X42A 3A4XA 1KBBA 4NILA 1I60A 1BSLA 1C8YA 1P43A 4BFAA 3B9EA 1QNQA 3WO8A 1MDRA 4FMVA 4XG1A 4R7OA 1EXBA 4PUDA 1KFWA 3KLKA 3MMWA 1WXJA 4LVDA 4P2VA 4DJFC 3IIZA 2V3EA 2QS8A 1TJPA 3S83A 3PAJA 1EF2A 2Z2BA 3DFSA 4MMWA 1TMHA 4F66A 2IPGA 3MDWA 5A2CA 1PE1A 5DRCA 2F2KA 1ZBCA 4PBGA 2ZUNA 3FKRA 3NO1A 4RW5A 1NDWA 4L1GA 3A4JA 3N2CA 3N9KA 1UP2A 4HK6A 4NHVA 4DO5A 2E5CA 1K8XA 1LQAA 3HGJA 1DIEA 1AA1B 4RW3A 3RN6A 3AS3A 5M5DA 1X7FA 4LYPA 3EKZA 1E40A 3WNPA 1KNWA 3RILA 1AL7A 2A7NA 3T0BA 3IV8A 5D8WA 1O12A 5DANA 1RBOB 2WWCA 4R27A 4AMAA 5A2AA 2XTKA 2E68A 3VKCA 4I5RA 2A3HA 4NNBA 4XD5A 3U2EA 4NZ4A 1X96A 1DIOA 1JUBA 4YYFA 4JTLA 3L2LA 1QVBA 4NZJA 1OFOA 1UR3M 4H9MA 3CV7A 4UOZA 2DZBA 5H91A 3SFWA 2X2GA 3FYYA 1V3MA 2O0TA 3NQDA 4MDPA 3WD2A 1Q4WA 4HCDA 3BLIA 1KXHA 1M04A 5FSEC 1VYSX 4ILSA 1RV8A 3C3NA 4IPIA 1NJJA 2D3NA 4QX4A 1F05A 2NT0A 2VZTA 4UFLA 1JGIA 2YKKA 4AY7A 3QMRA 3U3HA 4FXJA 3IUHA 3OTRA 3R58A 4ACZA 5G5IA 2OZ0A 3FYPA 4PN2A 3HGRA 2PDPA 2HVMA 3R94A 2HQAA 4XVDA 3K1DA 3KCOA 4PCPA 4A3UA 3ARWA 4B91A 1KBIA 2BZNA 1C91A 1KV5A 1T8XA 1KTCA 3JUGA 3VKAA 4C6LA 3BMXA 4GE8A 1VIZA 1V02A 1SO5A 1G7VA 2H8ZA 4G2DA 2XISA 3IV3A 3SCOA 2CETA 1DXEA 3ZWTA 2ZE3A 1QW9A 4AVNA 4O4WA 1AJZA 4B9YA 2BY1A 1HGWA 4WJEA 1AW5A 1QTWA 5HULA 1OFPA 2YL9A 4MNMA 1JCJA 1XD1A 2OELA 3QGKC 2WLZA 5FESA 2J7CA 2QF7A 4GYJA 4RDVA 1XD0A 1VB9A 4FLSA 3I3BA 4IICA 4H01A 1X1ZA 1A5OC 4PMDA 1FY6A 1LRNA 3A6OA 1F7BA 3W24A 5I09A 4LT9A 1E6ZA 3GNOA 4H4IA 4FNSA 1CXLA 2VZVA 1UZHA 2HV5A 3PWGA 3KRSA 1IEVA 4O54A 3VGEA 1YMYA 4JX5A 1JZ2A 4ZQCA 4NZ3A 3QPYA 4N4QA 1J11A 3M9YA 2G3FA 1H1YA 2W61A 2PWEA 3UJRA 4GZ7A 1NELA 2OQLA 4A8NA 3SADA 4A35A 1A5KC 4BEQA 4MUZA 3OP2A 2YFNA 3C2FA 3GYCA 2W92A 1BYBA 1ITXA 1J9YA 4LC8A 2VCAA 3HPFA 2WB5A 1V6YA 3AIUA 3EWYA 4RNIA 4HB7A 3RLGA 1XYMA 3PZMA 1XIHA 3CQKA 4HPJA 4A2SA 2ACUA 5CLWA 5FF7A 4AIEA 1O60A 2VZUA 1UR9A 4AZCA 3U7VA 5A6MA 4XBKA 3CLMA 3IUIA 1TV7A 4GQQA 5DY3A 4L64A 1OM0A 1W3KA 4A3RA 2CYGA 3HG3A 4XZHA 2JIWA 2DW6A 2X1IA 2OU4A 5BCAA 3N2TA 1J2BA 1TJ0A 1YNQA 1PIGA 1NF0A 2RGLA 2J4GA 2YB1A 2JKPA 3U9IA 4BR1A 4PBEA 2DZAA 4MJZA 4ZZ9A 4JDYA 1LRTA 4Z0SA 1FCBA 2DT1A 3NQ2A 3G5EA 3GG1A 1H7WA 2J62A 4AD1A 1U1JA 2PWGA 2H6RA 3CPRA 1YTEA 2F6UA 2R9RA 3NL6A 4KFNA 5A8NA 2DDXA 4J3WA 4KIEA 3B8DA 4TMCA 3TYAA 3UZXA 5LYRA 1KRCC 1MUMA 2A79A 4D6GA 5DT5A 3MCMA 1UW9A 5T26A 1W1IE 2E7FA 3VMPA 1HL9A 3CL7A 4HD5A 4O1EA 4YL2A 3LENA 4TVUA 3CNYA 2Y88A 2QEZA 4HYRA 1CLXA 4FB7A 1I2PA 1CCWB 1PAMA 2DW7A 3HFTA 5AECA 1Q6CA 1JDAA 3GX9A 3W7PA 4OOZA 3ZMRA 3TOYA 3SIMA 3M41A 5M17A 1JPKA 5C9ZA 1KFJA 1JULA 4HPHA 3RDKA 2D20A 1I2RA 3TK7A 1IT8A 3VAVA 4GUJA 2YL6A 3VIGA 2OB3A 2H9AB 1P4CA 3VIFA 4AX6A 2XVKA 3QC3A 1AH3A 3LS9A 5E1QA 4DYEA 3POHA 3P61A 1SFLA 3V0TA 2Z1BA 5BYWA 4KEVA 3WH5A 2ZKMX 2EPMX 2JEPA 4JCMA 5CC7A 4XD3A 3IIXA 3VNYA 4B92A 2CZFA 3N2XA 2CLFA 5JIWA 3NPVA 4I6KA 3UQNA 5HMEA 3LA4A 4B5NA 3Q37A 3W01A 2OKTA 1BWKA 1R85A 3PK7A 4DAFA 5TIMA 2VWSA 2XVNA 1DWAM 3SB0A 1BF2A 3H2MA 2PDJA 2PGRA 1J79A 4H9ZA 3TX9A 3HM7A 3NYZA 1PUDA 3TE9A 4PZVA 4WKHA 1SM9A 4M24A 1TQJA 1QT1A 3AZRA 2ZXBA 3VTRA 1TVPA 4QCEA 4DUXA 2FJKA 5LHEA 3H21A 4H04A 3UJFA 1RQHA 4GXMA 3TC3A 3IJQA 3WLIA 3H23A 5A2BA 4HNNA 1TIWA 1IHIA 1VBJA 1SW3A 2PTDA 4IMFA 1TCDA 2WNNA 1AVAA 1W31A 1UG6A 4QJ3B 4S3GA 4WSKA 3MI2A 1NWTA 1VBUA 3DU0A 4R33A 4UR7A 3VOHA 3PZNA 3W73A 1SZEA 1K4HA 3W02A 2FIQA 1T8QA 1PZ0A 1RALA 1EKOA 3W1TA 1FHLA 1UB3A 1GVOA 1PCKA 1XIIA 2J9XA 4LX4A 2WC4A 1CNVA 3E0LA 2CZ5A 4K6AA 4LY4A 1EC7A 4LS2A 1VF8A 1IWBA 3NOYA 4O57A 1KBKA 3WQOA 4GACA 3PTKA 1UJQA 1XHGA 2PI6A 4J3XA 1X39A 2VJXA 1W9BM 3HB9A 2QJJA 3TDFA 2ACQA 4YN5A 5CPOA 3D46A 1PWLA 1QI4A 3BG5A 3UYCA 4PL2A 1GQLA 4BY3A 2BOEX 2LLEA 3BTNA 4J7RA 1OZQA 4AU0A 1SZGA 1YNPA 5D2XA 5F1VA 2AGKA 3MKCA 1LYXA 3OVRA 1HP5A 3LCXA 2O9OA 2WM1A 3TQKA 4DWSC 1U1HA 4IMCA 5FJUA 4X2PA 3TJLA 3V5OA 2R1KA 4CD5A 4RZ5A 1KW1A 3ABQA 3A3WA 1Q6QA 4J3TA 4O11A 3GO2A 3AIBA 1MO0A 3KFTA 1J01A 5A8MA 5A94A 1V7AA 3GU2A 3KLLA 4ORIA 4I3GA 4XBSA 4MF4A 1SYTA 1T5AA 1XLMA 1LLWA 4AEOA 2VUNA 5HXMA 2JGYA 4QM1A 1BPLB 2C1GA 1CLKA 7TAAA 3GHSA 1K8YA 4QROA 2GVYA 4FZIA 2HPMA 4AF0B 2FGZA 1TJ1A 4JN8A 3R12A 3E2RA 2Y85A 3NQEA 5DRIA 3ONCA 5HQLA 5L6UA 3WL0A 3VUPA 2QIIA 4B5SA 4YTRA 6REQB 4V1XA 2D2GA 2VRQA 4G6CA 1OZMA 1Y8BA 3WJZA 4K38A 3VPLA 2PURA 3RF9A 1NFGA 1OADA 3QZEA 2HISA 3VMNA 3TEVA 1C8VA 1DXIA 5AVHA 3MHUA 2E1DA 1I1XA 3GY1A 5I2UA 4FIQA 4HSNA 4UQCA 3IGSA 3IJ7A 2REQA 2D0HA 4JTTA 1EP2A 4B5UA 2WC7A 9RUBA 5B7ZA 3U5YA 1H7OA 4HK5A 4IJBA 3UPMA 1NEYA 1IT7A 3N73A 4NAFA 1VYRA 2J9YA 4CN1A 1A0EA 4ZQPA 3WMSA 3W7DA 1RHCA 3TYUA 1XBYA 1W9XA 3RNDA 2JBMA 5E5CA 2C14A 2EF9A 1H1ZA 3PNUA 4BWLC 5F4SA 4BA0A 5BMWA 4REQB 3C2YA 5A6BD 2KAUC 1OC7A 4CKQA 3A23A 2WZMA 4ZOAA 1UWRA 4K7VA 3TTYA 1C93A 4FSAA 3WDRA 1A3HA 1T41A 1YIXA 2DSWA 4WEVX 2ZOXA 5IBXA 1G01A 1PVNA 4FX7A 4BK9A 3H24A 2DZSA 4C1NA 4PTVA 4WJXA 4DRSA 2WMFA 3C0QA 1TRDA 1D7KA 2WHKA 4UFJA 2F84A 3FLUA 1UD5A 4MGGA 1US2A 2OEMA 3W1AA 2OGYA 4PB4A 2OZTA 3MJMA 2PS2A 3C2EA 4Q4OA 3C86A 2HJPA 3HTWA 4J3VA 3DX5A 1EYWA 1X8FA 4GO8A 1F74A 1B90A 1DBTA 4JPGA 3SZ8A 2WBGA 3OHMB 1V6TA 1UD2A 3WBYA 1HUVA 5EMLA 3GLCA 3GG0A 3BAXA 3OZMA 1JZ7A 2XM2A 4S23A 5LIXX 1W1ZA 4LAOA 1JIBA 4WJ8A 4JYEA 5LZLA 3M0XA 2VFFA 3B8TA 3ES7A 3AIEA 3KOYA 4TTUA 1W54A 1V3LA 4IUOA 4YHEA 4E2VA 2Z1VA 3SSJA 1DIKA 1AH0A 4MWAA 1XDMA 1OX5A 3NNTA 3MJYA 3WDJA 4D9PA 2CBUA 1CEOA 3WLOA 1VD6A 4R7JA 4PUUA 3JS3A 1XIDA 1E1CA 4DJDA 3WH8A 3I7RA 3TJIA 4ECLA 3DUGA 3M5VA 1FUYA 3RAOA 1VEMA 4OFCA 1UA3A 4LNYA 1WYIA 1Z9AA 1XLJA 4CQAA 4JEQA 4KETA 3ZR5A 1WZLA 4ICNA 3KTXA 5C70A 2B7QA 4OUEA 5F2LA 1A3WA 3IJ6A 1F9CA 3WF2A 3DCPA 1H3GA 1QHZA 3T78A 3QSTA 4YLWA 1M9HA 1FWSA 3SW6A 4ATLA 4AC7C 1HTIA 1CBGA 4HNLA 2IPWA 2XWEA 1H60A 2OYLA 1XINA 1LM1A 2D69A 1BXCA 3YPIA 1TPC1 2Q6ZA 1WA3A 1T7LA 1XFCA 3A13A 1GOWA 3UCDA 4M56A 3POCA 5AC7A 4KH2A 2PEVA 1HKMA 2DZVA 3T4WA 1SJBA 2FLIA 2WSQA 1NTHA 1JGMA 3MSYA 4XIMA 4PFMA 3E49A 2ZDRA 1ZJAA 2VDHA 1KLYA 4NJKA 4A3QA 2NQZA 3TUUA 3N25A 4K68A 4LSBA 5LIYX 4DUWA 2YDQA 2C18A 3MMUA 3Q94A 3SCRA 2I5IA 2WJZA 5LGZA 2HBVA 4MYAA 4QAWA 3N9RA 3IANA 1I45A 4NP7A 3LSBA 1J5TA 1H7NA 3OW1A 3EDKA 3L4WA 3TYDA 3PJUA 1CDGA 3B06A 5CSRA 3B4UA 3JRKA 3E0IA 1GYNA 1V8EA 3M43A 5BOOA 3TA9A 2XUCA 3VIMA 1Q7ZA 3LK6A 1P0DA 4AIUA 4GYFA 1JFXA 4LB3A 1E6PA 4QSFA 4Z1DA 3VNIA 2GVJA 3SCSA 4R9XA 2HS6A 4ZTXA 4UZSA 5CZ0A 1OJXA 3QOKA 2VOMA 3U8GA 2ZXQA 3KM8A 5DT7A 2GK1A 4IX0A 3V36A 3VX1A 1UKOA 4I8DA 4JEJA 4O1DA 3TIMA 1GW9A 2PZNA 2E0PA 4HIBA 5K9XA 1TFVA 7REQA 2X7WA 3CUFA 3GH4A 5FEWA 3PC0A 3VDBA 3W74A 2VHLA 1PTAA 3FVMA 2WCGA 3VDAA 4H8UA 4H9YA 4E2DA 4QGCA 4UTWC 5ABGA 3B03A 3UGVA 3G3MA 1ZL1A 4PMJA 2BOFX 4QLKA 7PTDA 1D3HA 2GFTA 3FHAA 1B31A 2NV1A 1QI3A 3P5YA 5HWNA 2HPIA 3QV7A 4JNZA 3G1RA 4YPJA 1FVPA 4O17A 3KRZA 4C5YA 4UXDA 1YNYA 3N18A 5CJNA 2VCBA 2ICSA 1GOOA 1JD7A 4KWWA 4NX5A 3LCIA 2EJ1A 3CZLA 3LCHA 3PPHA 3SQLA 1KA9F 4IISA 1XIGA 1VJZA 3KBMA 2G0WA 4XZMX 4XSLA 3ZJ8A 1W8GA 2W4XA 2J47A 4PEEA 3KS6A 4F0KA 4Q33A 3VFCA 1VJIA 3HJZA 4DUVA 3O0FA 2HNHA 1TSIA 2GOKA 3ZVHA 4EWND 4Z1YA 4O52A 2ISVA 4PBFA 5LHFA 3TQ0A 1MXDA 4MHBA 1EA9C 1TG7A 3TXVA 5FCZA 1EQPA 4GVIA 6TAAA 2QGHA 4KCWA 2YJQA 5HNTA 1UP3A 1NP2A 2C71A 4DLMA 3LZ3A 4XX6A 1BVWA 1TWDA 1XYCA 2P3EA 2WVTA 2JFEX 4DNMA 1OEPA 4HHMA 3N2MA 3R5EA 2QMKA 3FN9A 6XIAA 1O4UA 1GVSA 5LGXA 4F0MA 2QUNA 1J0JA 3PS7A 4AHOA 1XG4A 3B8VA 4U33A 4LVGA 3D3FA 2CZDA 1PX3A 2G95A 3IARA 4GABA 5MF5A 1YXCA 4GJIA 3R11A 3ZJ6A 3N1AA 2P8CA 2TRSA 3QGVA 5EKYA 1VZWA 4IXXA 3LPGA 4FF7A 2QGYA 2O7QA 2VWTA 2V67A 4MKNA 1SW0A 4GFSA 2PCQA 3CEUA 3MCOA 2OJPA 4W5ZA 1WOBA 2V69A 1VRDA 1DQUA 1UZDA 1NDZA 4UTHA 1FWIC 4WDTA 1JUEA 3TYBA 1V6VA 2CPUA 2FVMA 1WKEA 4JQ1A 4AZ5A 3VKJA 3OZPA 1TPDA 2CKRA 5H8UA 3VKKA 1FWBC 1SSDA 5CZJA 1K02A 4XUYA 1TTQA 3BLDA 4DF0A 3UVAA 3T42A 3GXPA 3PJTA 3W7LA 2NVDA 1O94A 5IOBA 3OVQA 3TLLA 1IZKA 1X8CA 2XGZA 3K4DA 5CPTA 3UWQA 3BV7A 1AJ2A 2CHRA 1W1PA 2ON3A 2C1HA 2DVTA 3ANVA 3KL3A 3AXHA 3UWUA 4AD3A 1KWKA 2W62A 2XHYA 2DT3A 3L66A 3USBA 1L6GA 4AQLA 2CLEA 4EANA 4RNFA 3WL1A 1GVRA 3KBJA 1SJAA 3WDQA 1TV4A 2NX9A 1Z89A 4QS5A 4CVWA 4ACZB 2WO5A 3L23A 3RIKA 4ZODA 3ITLA 1Q2SA 2V30A 4NVTA 2FYMA 2R1LA 4H83A 2IKIA 1XLEA 4F9DA 1F5ZA 3NZ1A 4C6OA 1M1BA 4N7QA 4ZB0A 3CH9A 2QAPA 4UNKA 4LF2A 2B81A 4LBSA 4E4FA 4KEMA 3BLOA 1LG1A 4EIVA 3BWWA 2AAAA 3CB3A 4HTYA 3F4WA 1EPXA 4D71A 3KW3A 2WJEA 2AGTA 1TA3A 3GW0A 3O9NA 4JN6A 1KM2A 1QHPA 1ZY9A 2QUUA 3H7VA 3HPSA 4NZFA 2NUYA 2QR6A 1GJWA 3RCYA 5C7HA 5KZEA 1HJUA 4YTTA 1IXNA 3CJPA 2XZ7A 3S2NA 1OB0A 3XIMA 3G0UA 3WBXA 4LS1A 4TMBA 3EDFA 2Z24A 3M5ZA 4HMCA 5C9WA 2F8QA 2Z1KA 3OIXA 3IVTA 3SY1A 2WM0A 2GGIA 1NQ6A 2RJGA 1JXKA 4E8DA 1B4KA 3P67A 3TW9A 3ANYA 4GINA 3LRKA 1MRQA 3RU8X 1HX0A 1OD8A 1XW8A 2INZA 2EPKX 5GNXA 5KEZA 4PMNA 3LB0A 5G2WA 4O0ZA 4N9DA 3I7QA 1JD9A 2ZTKA 1J0HA 4QE5A 2DZXA 4NL1A 3T05A 1CGYA 4GY0A 3LBOA 2AQOA 3WK0A 1TUFA 4AD0A 5CH9A 2Z1XA 3T0CA 4GJ1A 3M5XA 4U31A 2FTYA 3U2ZA 1GEHA 4FEZA 4QAIA 2RGMA 1HT6A 3KUMA 1S46A 4I7VA 1OFEA 3NQVA 4HZ8A 3T07A 5AC5A 3BLPX 5HNUA 3LERA 5HBFA 5FF0A 2CLHA 1ISXA 2FZMA 2Z25A 3CZJA 1KFEA 2ASHA 3BCFA 3BGAA 4NT0A 4AZCB 1AQMA 3OZYA 2FZ9A 1G4TA 4HYVA 1VBGA 5CGQA 3SGUA 3AIRA 2X05A 1CXIA 4W84A 5K3VA 3AS2A 3NO3A 4X60A 1GNXA 2E25A 3AO0A 1C29A 5I06A 4S2BA 2F61A 3ZOAA 1PX8A 2HE5A 1B3VA 4ZR8A 1H51A 1OFDA 8TIMA 5I3KA 3EWCA 4N6FA 3OOQA 3AHVA 2QV4A 3V18A 2RH9A 2OLHA 2ODOA 3S1UA 4GG9A 1PCWA 4JOMA 1GQIA 2NVAA 4ZXOA 3VIHA 1E43A 3NWRA 3MUZ1 3GZ3A 2YXXA 4S1FA 2ZXDA 3AMLA 1E4MM 4PE8A 3WMCA 4N0RA 1UZ1A 1OSEA 1B54A 3MPGA 4FR6A 1W6TA 2W79A 3E2SA 2OX4A 1TPVA 5CGTA 1TPWA 2J25A 4OQVA 5T9BG 2Q8LA 4TIMA 3PTDA 2XIMA 3I4KA 3EX2A 3WNOA 1LTDA 5AHLA 1ZJIA 1FTXA 1Y7VA 2IKHA 3TYEA 4DWSD 4KCTA 1WZAA 2R91A 3AWNA 2ZIDA 5D9NA 3VABA 3C8FA 3RX4A 4NQ1A 5A6LA 2VX7A 3W1XA 2Z1WA 1HKKA 3BG9A 3K4AA 2J24A 5CSUA 2VGFA 1E72M 4PSRA 2DSZA 1KCLA 1NU5A 1P0EA 4JAWA 2NWRA 5CPNA 3H53A 3CU2A 5IDIA 4X63A 1C9DA 4XZBA 2DT0A 3L0GA 1GPFA 3VD9A 1F4AA 5DMLA 3UWVA 2TAAA 2G3NA 2GWGA 2DZWA 5EFDA 4A3HA 3UXLA 2QCMA 4HCLA 3Q45A 3W38A 3HA1A 4Y9PA 4MOZA 2ANUA 4WK9A 3W7EA 1EHNA 3HGSA 4Q8MA 1TB3A 1VKFA 2AKZA 2DZPA 3PULA 3HJEA 4XD4A 4R85A 2GGGA 1MQRA 2V82A 3W7OA 1DWJM 3PPGA 1JAKA 4UZUA 3H22A 5FOOA 2IQTA 2GGHA 2YCKX 1KRBC 1X6UA 3AWOA 4W8LA 1LCOA 4KPLA 3OIHA 2ZUVA 3ZR6A 1OD0A 2PDCA 3CEPA 3TA6A 1FKXA 3QV8A 3FDGA 4G9PA 3UVIA 2ZICA 2PLCA 4U2ZA 1RCXB 4LYRA 4IZGA 1KWGA 3G22A 5I3IA 5A5WA 1W1B1 3DFNA 3OGRA 3VIKA 1S1RA 3L5AA 5LA2A 3ITXA 1A0DA 4DY1A 4UQDA 4PUMA 2GQ3A 4DO6A 4UMCA 3KTCA 3HPZA 3IVUA 3MMTA 1IF2A 1CTNA 4DF1A 2A3EA 3W84A 4UTMA 4U5KA 2IPJA 1ZBVA 2Z2UA 4Q3MA 1GQNA 3V4BA 3GG7A 1EGZA 2CITA 3RXZA 1ZP4A 4D1JA 1XIFA 4C1LA 1OIFA 4WRHA 2ABAA 3I4EA 3L5MA 4IQDA 4Q8OA 4R5EA 1OFRA 3AYTA 7A3HA 2WKLA 3VCCA 4LUIA 3PM6A 3SO7A 3I6EA 5JU6A 1TYGA 3SJNA 3NXFA 2OOGA 1DHKA 2VC5A 4HT3A 1YBQA 1L6WA 1Q7QA 1Q6OA 3UPWA 3QXBA 3W6LA 2EPHA 4IIBA 1YYAA 2IS7A 5AYBA 5D33A 4KW2A 1G4SA 1Z42A 3VOGA 1O1HA 1XLKA 4KRTA 1G1YA 1RJPA 4MADA 3W25A 3ZSTA 2GQ8A 4HZMA 1HL2A 1AD1A 3KBWA 1M68A 2WPBA 4AHQA 1ZAHA 3SBFA 1TVLA 1V08A 1HVQA 1K9FA 3CTTA 1V6UA 3VGFA 1H0IA 3B97A 2PDIA 4LCSA 3GNPA 4LXFA 2X1RA 1HO1A 2PE4A 3L0KA 4DZIA 1LBMA 3ALGA 2GSJA 3ITOA 4TVCA 1JYWA 4WOQA 3BZJA 3KOFA 3ZYZA 2GUBA 3FSTA 1LL4A 3QR0A 3RLHA 3BXWA 2VEIA 4PCNA 3ARPA 3UGRA 1HVXA 2NZLA 1ZQ5A 2GPTA 1JNDA 1KGUA 1V3KA 1RQEA 4GH1A 3VZZA 2ZX8A 2WHJA 3RU6A 4GY1A 1XI3A 1GK8A 3AJXA 3DEQA 2IQDA 1PV8A 2J8TA 4RXGA 4CD8A 1ZTVA 1PTGA 3HQOA 2INFA 4HYWA 4Y9AA 3UWWA 3WH6A 2J66A 3KP0A 3IEBA 2EKGA 2PGFA 5ABFA 1BEUA 1JNEA 2Y89A 1E1EA 4PMOA 1RPKA 1RD5A 1AJ0A 4QXIA 4DZAA 5LNSA 3BO9A 4WVXA 1XSIA 4J2PA 5LNUA 4W85A 1IIHA 2JKEA 3CLWA 4GI6A 3TP4A 1XIJA 1E0VA 4MJ4A 3S42A 2OZ8A 2FVKA 2RHGA 1GGOA 5JMUA 2YZRA 2QCHA 3S2JA 3GC4A 1NFBA 1V79A 1TCMA 3SGZA 3HQPA 2I5GA 3GB6A 4DBWA 1BGAA 1DE5A 4GZEA 2I5QA 5GQBA 3SJ3A 3B9AA 1GQJA 2PDGA 4JTAA 2JALA 4KWOA 1CIUA 1UWUA 4JQ2A 5K4ZA 3QPZA 4LH8A 4L1WA 4GVHA 3MTWA 3CQJA 4UR9A 3EYPA 4WY0F 4L4MA 4AH7A 4H6RA 1W9DM 3MV11 1HKVA 3NVTA 1FDZA 2J7EA 4C1NB 4B5XA 1O5XA 4F9JA 1J18A 3IJ9A 1RAKA 4DXKA 1YE4A 2DUZA 1DWHM 1KCKA 2VFGA 3LV6A 1B3ZA 4IMGA 1JF6A 1E0UA 1J96A 3LTSA 1OFBA 1OQFA 1DKWA 4GCXA 4IH3A 3VNKA 4GC3A 3GU1A 4C6JA 5D9OA 4P8VA 1QOPA 3RX2A 2W6RA 9CGTA 1B5TA 1P1XA 2ALDA 3DXIA 2HVNA 5GJNA 4WD0A 1K6AA 2H8XA 1IWAA 4YTQA 2EEXA 4F4RA 4B4FA 2Y8UA 3CHDA 3FFSA 1N82A 1H63A 2BGNE 4KGLA 3W4RA 1HNYA 3T08A 3QH2A 4JY8A 1BYCA 3A4WA 5TNVA 3RYSA 3UY8A 4BJHA 1R9ZA 4ZQNA 3SCTA 2XSXA 4ZGYA 4R9OA 3EWBX 3FKKA 3S6TA 4EPEC 1U83A 3G1VA 2EBNA 3QSRA 4QR6A 4MWAB 1OX6A 4UTLA 4QDMA 2ATMA 4K8GA 4BI6A 4PTDA 1GVIA 4MAZA 7CGTA 3TVAA 3AIQA 4UFKA 3W2NA 3KCJA 1E1CB 2PDQA 4I7UA 4IT1A 3WELA 1JPHA 3Q65A 3ECQA 3VIOA 2WSRA 3OVGA 3A9IA 3C0SA 2R82A 4LAZA 2WOQA 4H3DA 2G41A 3PSVA 3VGHA 1QI0A 1OC6A 4I9AA 3KZSA 3CHVA 4KERA 4E8GA 3H7UA 5I24A 2X8RA 2VC9A 5E09A 5ECVA 1MUCA 3K46A 4O1CA 4YHGA 3V5CA 3HURA 4DIAA 3H2CA 1MFUA 5EMKA 4G1KA 5F2MA 3KE0A 2HEJA 5EMMA 2ABBA 4QQUA 1PS9A 2ZUTA 5HK4A 4W86A 3BW4A 4GQRA 3UJ2A 3CAKA 1DJIA 4S3AA 4JFUA 1YQ2A 3WBAA 5FA5A 5AHNA 1EEPA 3F5JA 4CNUA 3AALA 3WQ6A 1V0NA 6ALDA 4MZ8A 1NWSA 3TQVA 4DHGA 4DXXA 2QDEA 4JX4A 3A4AA 1SO4A 1A53A 3LTYA 5DBTA 1GTEA 4PUJA 3AYRA 5DELA 1ESWA 1PZ1A 5C9RA 3LYEA 4H9XA 3BLLA 4MB4A 2OO6A 2PLKA 4X9YA 2ZUWA 4BI7A 3PZTA 1KM5A 2NXHA 2YBUA 4MPKA 3QTPA 3V16A 3M0HA 2XN1A 3CGTA 4LJ3A 4IUGA 4LCRA 1EIBA 2HNEA 5C7VA 4YVXA 3M47A 4DN1A 3GU9A 5B7YA 3TFCA 1X97A 1JYNA 1EDGA 1NSJA 4L9YA 2ZRVA 3B9DA 3IIVA 1LBFA 3KDOA 1HJSA 3FA3A 4LU0A 4UTFA 3FYOA 2UY2A 4MDOA 3VGBA 2PF8A 1JVNA 4HNTA 3R6IA 1XV8A 1QR7A 4AUBA 2VZOA 3S6DA 2FB2A 3MT1A 4ZSUA 3NEVA 1QNOA 1UJPA 2QJHA 4TV6A 3ONBA 3W7MA 3HN3A 1ZCCA 4AVFA 4B3ZA 4AWTA 1QI5A 2F6KA 2GK1B 2MUCA 3ARVA 3MBFA 3K4WA 3GHTA 4UOJA 4JGDA 3VMOA 3CHFA 1GVYA 2XYLA 4H19A 5DY2A 1ONEA 1EDQA 5KTLA 1DE6A 1PWMA 4P7QA 1XQLA 4NF7A 1ODUA 4XZ9A 4JTUA 4GOAA 3CUHA 1UMYA 1KM1A 2ZE0A 3N4FA 3PUEA 5FKYA 4K1WA 2VX5A 2PC4A 1FWNA 2CHOA 2WVVB 4QG6A 4M7SA 4U5IA 2XGIA 3GWQA 3H2EA 3B8IA 5BXTA 4H9VA 3P0XA 2DIEA 3EZ4A 3I3DA 3N12A 3MVIA 4QCFA 2E5DA 1O5RA 3VA8A 1FWFC 1VFSA 2WMGA 2WSPA 5CC5A 3OO2A 1FKWA 1GUVA 3WLKX 4AC1X 2KZHA 3PZ9A 3CPUA 3QBUA 2FQIA 5A8GA 1AZ2A 5CC3A 3M07A 2VDGA 2B4GA 5FAJA 2ZA1A 3GHUA 1FWGC 1XUZA 1TMQA 3LEPA 1EP3A 3PVFA 2O4QA 1YW1A 1E3XA 1R8LA 3GVWA 4L6HA 2V8ZA 2O9PA 4HJFA 5CG7A 4K39A 3DAQA 3HFYA 2ZUSA 3A3HA 1LORA 1C90A 1A50A 1PSCA 4DYJA 1F3EA 4XKYA 1JJKA 4Y9OA 3BOFA 3W85A 3BCDA 4ROPA 2ZDSA 3N9SA 4HOWA 1BHGA 2XJ7A 4IFRA 3NG3A 1EX1A 3R0KA 1FH8A 4LRSA 3W28A 4CN6A 3EXRA 3OLGA 4UBPC 2JIEA 4EPDC 4CNNA 4U4MA 4PA8A 1A4LA 1YX1A 3N34A 3TW6A 1OINA 4TU1A 2BWGA 4LW7A 4XVEA 4WUIA 3WUBA 4W8AA 1R5YA 4M29A 5FACA 3QRHA 5TD4A 2PMQA 1UP0A 4AF0A 1ME8A 1PO9A 3N4EA 3W87A 5EMJA 5D30A 3R8RA 4ZENA 1U5HA 3PTMA 2P1FA 1PKLA 2PB1A 3AHZA 3LI1A 4M1RA 3VU2A 1XPYA 3BE7A 5H2ZA 3WLLA 2FPYA 4LUYA 1MEIA 2A3AA 2CBJA 1UH3A 4DNHA 4NAEA 3S1XA 3IVSA 4EF8A 5K7JA 1WV2A 4IL2A 3FAXA 3VD3A 3AUJA 5HUPA 2O9RA 4BQ5A 4H9UA 4P5UA 1VR6A 3BLEA 4I9JA 5AC6A 3CUZA 3JZEA 4RKAA 2VZSA 1KBJA 4KS0A 1JAEA 4XTIA 3DFYA 3NSNA 4YWIA 1E73M 1Q5MA 1OT2A 4OZOA 4HPNA 5EGRA 3IIPA 3OA3A 3DKLA 1DOSA 2CLKA 5DO8A 2FPVA 3GE7A 4O1FA 5AHEA 1JPMA 4Z08A 3ABXA 1QOXA 3GKFA 1UKPA 1XUUA 3GNDA 4Q8VA 3HO8A 4ERIA 1X6NA 1OF6A 3GNXA 4IQEA 4AFYA 1R3WA 1I0BA 2OFJA 2OT0A 4TUFA 4FA3A 4H7ZA 4W9TA 1NWRA 1OHLA 3DFPA 3MUXA 3N2OA 4M81A 4ZOCA 3T09A 1KFCA 1KFLA 1Q6RA 3WMLA 3OZOA 4BHYA 1AFSA 3CQIA 1L6SA 3O6YX 2QULA 1VAHA 1U1UA 3N04A 4QS6A 4H1ZA 3TNBA 1FP9A 3SEPA 3W22A 3G1YA 4JYDA 1UPPA 2Y8KA 4A3YA 4A22A 5HMFA 3VINA 3S0CA 3FJ6A 3UR5A 3S9ZA 1R2TA 2GWNA 1PB0A 3AXKA 3F5KA 4Q6JA 3EOLA 1E1FA 1M7PA 1VFFA 1E5JA 3F03K 3PZGA 4ZQOA 4KWVA 5I3JA 3HG4A 1TA3B 1PHQA 1GZ1A 1E9ZB 4DBUA 2ZZ4A 4JYFA 2OWCA 2JQXA 1XM3A 1LP6A 2OODA 3I10A 1RBAA 1CB7B 4P8UA 2J7BA 1B4EA 1HW6A 3IK2A 4TXEA 3FS2A 3ATYA 1FFQA 1QFEA 5FJPA 3ZT6A 1MWOA 4MB5A 1Q66A 2VENA 3BAWA 1G5AA 4WIWA 1UD8A 4NRRA 2WCAA 1FXPA 3UJSA 1XLCA 3WIJA 3CQ0A 1EWEA 2QJIA 3CIXA 5HQEA 1BKSA 3SIZA 1H7PA 2OSYA 3QOMA 3QQ0A 4IHCA 5A95A 4NASA 3QW4B 3B40A 3L4YA 3M0IA 1G4EA 2ZADA 3WKZA 2PDHA 4ERGA 3NSMA 4OWGA 4OKDA 2OQYA 3PBUA 2QIWA 3WG6A 2JGQA 4X9SA 1FXQA 1IZJA 3WD1A 1UWQA 1BFNA 1VRXA 3CH0A 1SR0A 3H2OA 1WPCA 3DESA 3KVKA 3R7MA 3GUGA 3AHYA 3PY2A 3WF0A 1SZFA 2AQVA 2OMAA 1T6MA 2X0YA 3DHPA 3FA4A 2OYKA 4KWUA 5H1WA 4E5TA 1ECEA 3I7SA 3VDCA 3ZWSA 3BSGA 3TAOA 1PYFA 2AKMA 2HS8A 3UJEA 3P0WA 1UR4A 2J27A 1P7TA 4PUNA 1FP8A 1TE1A 4XAYA 1JCXA 2YR1A 4XBJA 2X1TA 3QJAA 1Z6KA 2B7PA 2C19A 5FL1A 3UFYA 4ENLA 2P5NA 2W66A 5HANA 1RUSA 4AZIA 5F7UA 5J8LA 4F2UA 3G1SA 1B1YA 3ANUA 1UYQA 3L0NA 3T44A 1IYXA 4HU0A 1EGMA 3FHQA 3O3RA 1Z7AA 1GW1A 3W7KA 3CXOA 5FEZA 4M6UA 3BMWA 4KRZA 3W26A 1I6NA 1LWJA 4NNCA 1GJUA 1H1NA 2DZTA 4KKXA 1BKHA 1UUQA 3H70A 3LOTA 2FH6A 1XLIA 2VEFA 2E5BA 2VRJA 3CZKA 3V1PA 1VFTA 1CGWA 1ONRA 5LIUX 4W4QA 5C55A 2V6AA 4MZYA 3NQCA 4UFMA 4XAGA 3QC0A 2D0GA 3MZ2A 1JRCA 4QDPA 1CZ1A 3NEHA 2PRHA 3OJGA 3MANA 3PG9A 1MNZA 3NZGA 1XICA 4HHHA 5C9UA 1IT0A 1S2VA 2O9TA 1N8FA 2PUZA 2Q09A 3H2AA 4UTUA 4D8AA 4Z0JA 4PMUA 4D8LA 3WFAA 3VVGA 4WZHA 1ODZA 3TC6A 4Q22A 1ITQA 4JIRA 3BW3A 4UTKA 3WK1A 1LDCA 1KM0A 1CLVA 2V9DA 1FWAC 3NXLA 2VO5A 4S38A 3M0LA 1Y0EA 4PB3A 2DZUA 4DJEC 2Z28A 3SUTA 1G7UA 1D3CA 3N3MA 4NZ1A 3K8KA 4DJFA 1PBGA 3U2CA 4AY8A 5I0DA 1TX0A 4GBDA 1GOMA 3RM8A 3THDA 2FTPA 1K8ZA 3EX6A 2PP1A 4LV4A 2IW0A 1AQ0A 1A5CA 1O1ZA 1LWIA 3I6TA 5T8GA 2EQDA 2Q02A 1SW7A 3DHUA 2HK1A 5G4WA 3MC5A 3EB3A 4RCXA 5AC4A 1LUCA 1G94A 2R1NA 3WFLA 3C2OA 2YA1A 3LM3A 3EXTA 1ZFJA 3EXSA 3DI1A 5CPMA 3BARA 3O07A 3FY1A 2VXNA 3G1AA 1QUMA 2V5LA 1GZGA 2QPXA 4EK7A 4J3UA 4I6VA 4AWEA 1I75A 3BAKA 3WF1A 3W2JA 1EO5A 3QM3A 1AW1A 1D2KA 3EPNA 1BXNA 3DBNA 3WCZA 3GIYA 3M64A 3M0JA 4FAMA 1XYLA 2W5FA 1UUMA 2X0HA 3WF4A 3PB2A 5AY7A 4ES4A 1QW7A 1FWWA 3GD6A 4DUOA 1SO3A 5DMYA 1I4NA 3TJ4A 3QY7A 1BLIA 1PKNA 4US5A 5AOUA 1F6PA 2GGEA 3CS2A 3BOXA 1TTIA 3CO4A 3LCGA 3G0XA 1RSCA 1TKKA 1IEIA 1TX2A 3GNNA 4O12A 2BMBA 1YBQB 1UC5A 3ARSA 4O0QA 3OQEA 3STFA 4ZA0A 4EXBA 1QWKA 1HJQA 3WNKA 4C65A 1W56A 2DSUA 3CQHA 5F4XA 4FXFA 1D3GA 4GBUA 1XIMA 1XBZA 1A47A 3EOSA 4ZQRA 1DORA 1KR1A 4I5XA 2VR2A 4POCA 1ADOA 6TIMA 4MNJA 4OHQA 3W07A 1A3XA 3E0VA 2POZA 3SCUA 2D73A 4O15A 2X30A 1XC6A 4OECA 2C16A 3EA2A 2AMGA 4A05A 1XYAA 3RJXA 2YXGA 4PTXA 5XINA 1I1WA 3CBWA 3EMZA 4D6HA 4C6NA 4M82A 1TV2A 1IQ8A 3NAVA 1KFBA 2EKCA 1JF5A 1ZSXA 3LDVA 4NYUA 3CYJA 1R7AA 2W0UA 1E4IA 3LG3A 1W5NA 5DMNA 4JDBA 2Y7FA 1W1TA 2G96A 1ZRQA 4JIIX 1OC5A 2BB0A 3GBDA 2CLIA 4OV4A 3STGA 2I57A 3N6QA 3WQVA 4C6QA 4NG3A 1LOSA 2Y7GA 3VNJA 4MKVA 5AVNA 3VGGA 2GDVA 3LSCA 2ZFAA 1Z48A 5ABFB 2E77A 4WSJA 1VFMA 3LLDA 4WF7A 4CLMA 4AWSA 3DG7A 3F1QA 4OV9A 3QR1A 1SU5A 5IFPA 1QK0A 3W0KA 1F8MA 3K2GA 1FQ0A 1G0CA 4LS0A 2E4TA 3W27A 2H90A 1HG3A 2VI0A 5CBBA 2V2HA 1LF1A 4EP8C 2X1UA 2PPGA 1WP6A 1YDNA 4KRUA 2RUSA 4FALA 4GY7A 1DP0A 3FX4A 4IIFA 3UY7A 3B3DA 4I5UA 5D9PA 2C3ZA 3F7JA 1EJTC 3L4ZA 4I7WA 1RPXA 3M0YA 3ARXA 1J6OA 1A5NC 3GSMA 4UTIA 4DJDD 3H8AA 4F3HA 2YIHA 5HWJA 4IQJA 2CXEA 2XIBA 2ZX6A 3ARUA 1F2JA 4GXPA 1QO5A 4ZFMA 1G9HA 1ONXA 4BF9A 2FDSA 3UWZA 2H3BA 2OXNA 1EGVA 5CAHA 2WHLA 3OBEA 3RHGA 4D8ZA 1MW2A 4P7OA 1FWDC 2R1MA 4JKLA 3K5XA 1RLDA 4ML9A 5LKYA 3ITCA 3WUFA 5H6HA 1S39A 4WOZA 1TTJA 3T4CA 3CIVA 2Y5JA 3EX1A 2YL8A 3U57A 3WZ0E 2NV2A 2XN0A 3KL0A 4AYSA 1Q6DA 1A0CA 3VDGA 5JXQA 3ZM8A 2W63A 5CZTA 3IAPA 1NOUA 3QKZA 2PC8A 4C6BA 2NSXA 3DFHA 3K30A 1T0OA 1H5VA 4PRWA 4AX7A 1BG9A 2CBVA 4XUGA 4BQ3A 2WXDM 2HRWA 3W2MA 2Z6JA 4J3ZA 4ZO7A 4B9ZA 1W9VA 4CNPA 1WUFA 2E09A 3MKVA 4L9ZA 2ZZ6A 4OTKA 1GEQA 3VKBA 4NJJA 3G6LA 4GVFA 1UOZA 1XKJA 2QDHA 4LF1A 3WJSA 2PWDA 3SRHA 4IIDA 4J4KA 4Q4KA 4X0VA 5CPLA 4IFOA 2E3ZA 4YXGA 3F4NA 1ML1A 1ZENA 1XLGA 1Z69A 1RVGA 1CGTA 3B05A 4JTDA 4EPKA 1VC4A 3GDBA 1IXQA 5G2IA 3U2OA 4BF5A 1POKA 5E0KA 2DV0A 5AYXA 5D8ZA 4N42A 3UNTA 3TLQA 4P8WA 4IX2A 1JI2A 1EP1A 3SUSA 3SN4A 1A4MA 3ORWA 1HKIA 5I3HA 2VT0A 4ZMGA 1AODA 1K7EA 2DPEA 2EJAA 3S8HA 3C2RA 3OG2A 4E2OA 3PSWA 1UH4A 4JTHA 2HCVA 4LUTA 1F3TA 4M3PA 2BVTA 3WF3A 1J10A 3Q2DA 4NXSA 1ISZA 4MLRA 3NDYA 1T40A 3UERA 1DHPA 2ZRXA 2P10A 4O13A 1H5YA 1XL9A 4JFTA 1EBHA 4DI8A 3GVRA 4AD4A 2CERA 3W6YA 3WFZA 3AJ7A 4BEUA 1R47A 1R86A 1HJXA 1O7AA 3CTLA 1NQKA 1V4YA 5AB3A 4D6EA 1ZCOA 5I79A 4Q7IA 1EQCA 3F4CA 1WO2A 3A5VA 3BOLA 1IEXA 2HSAA 1WXYA 4Q4PA 3GH7A 2EXOA 1D8WA 2PGEA 3IAQA 1LJYA 1Y5WA 1Y65A 2GJRA 1E9IA 4CNTA 5GJMA 3U7BA 3QLDA 3T0DA 4CQ8A 3W75A 3GTNA 3WQEA 1UR2A 4PMYA 1QI2A 1QNPA 3O2LA 3DG3A 3DFQA 5BOEA 3JR2A 4TV5A 3H12A 4JNMA 1XYBA 2CLPA 3EWZA 2VUYA 2A0NA 4DWSA 3RPTA 4E3VA 1QBAA 2BSLA 1N2VA 2Y0FA 3URQA 4QP0A 4CNOA 4LTSA 3WLMA 1JQVA 7ENLA 2SFPA 3KWXA 3AI0A 1E9YB 5A8QA 5KSWA 4R34A 1M7OA 3H4XA 4HCHA 2QUVA 3OQ8A 1DJQA 2A7PA 3PTQA 2XIJA 3E3HA 2PDLA 5J5RA 1DWGM 5AZ1A 1FX6A 2RDUA 3HMCA 4IMAA 2QCDA 4JD4A 3S1GA 4FO4A 4P7LA 4L4LA 2Y24A 1HJVA 2PGWA 5FJRA 1K8CA 4C7FA 4H2HA 2D1ZA 2ZTJA 2XVLA 2V3GA 4CCCA 5BU9A 1D7FA 3SQMA 4JBRA 3CHEA 3GDTA 3NL3A 3MW7A 1PKYA 3ELFA 4S3KA 1Z8AA 1XSJA 3GDRA 2O56A 3LUTA 3W00A 3CAVA 3T2PA 2VFHA 1LRQA 2RDWA 3QFEA 3ICJA 4MFDA 2IKGA 1OBAA 3TCSA 3PB0A 1UIOA 1H0GA 5BROA 2F7FA 4ZB2A 4WXZA 2OCZA 4B3LA 3SN0A 4JHMA 1QPOA 2FJUB 4UTTC 4V28A 3NSXA 3LXBA 4HNVA 3VC5A 5M03A 1AD4A 3QVQA 1JL8A 1Q6LA 1SQ7A 1FHVA 4C6KA 3DC0A 2E28A 3TAKA 4MY1A 3N3TA 2J88A 1GKPA 2QYGA 2VDIA 4IIGA 3L4XA 1YEYA 1ZP3A 3T55A 3VNZA 4PR4A 2AL2A 3BV4A 4XKYB 2DJXA 3WD4A 3UG8A 1POJA 3UETA 2QVNA 4AZ7A 3P81A 1BSIA 1MXGA 3SCWA 4CQ9A 3B8WA 4IMEA 1P6CA 4BWLA 4NI8A 3GR4A 4DAIA 4Q8WA 1S5NA 3TCEA 1NM9A 4C1KA 3A5FA 3GZAA 3PWAA 3S1WA 4JTQA 2A3BA 2HMCA 2PWHA 3TN4A 3B9OA 1ELSA 4GYPC 4LEFA 4UTJA 1ISYA 3WQGA 1US3A 4Y8FA 3W2UA 3MHFA 1W5OA 1RCOB 4FLQA 2X2YA 3LN3A 2VELA 1VHCA 5C2CA 3GIPA 2X09A 4RPPA 1K77A 5G1TA 2VFDA 4L4PA 1Z32X 3VK5A 1VP5A 3U6WA 4AD2A 5CG0A 4J5NA 4O14A 2VURA 2TYSA 4E8CA 5BXPA 3EWXA 3MUY1 4JTCA 2FGBA 4UNIA 5A8OA 3TTOA 5MKGB 3HPAA 2GSHA 1F07A 2BGQA 5CQ1A 2WV8A 4NAEB 4NZ5A 5G4EA 1TPEA 2E1WA 3B0UX 3CO8A 3CIWA 1GG1A 1OK6A 1B3OA 6A3HA 2BY2A 1Q6EA 5H8PA 5C2GA 1HP4A 1VBHA 2B7NA 3GVQA 4MM1A 3H55A 1OY0A 4BS0A 4IP4A 3VNLA 1LL7A 1SVDA 3LU2A 3Q67A 5ABHA 1KGWA 2DT2A 4JTRA 4LCQA 5HDRA 4HSHA 3WNMA 1TR9A 3EOEA 4Q6XA 3GM8A 4M8UA 1GG0A 5FEXA 5BZAA 2VD9A 2YCIX 3ES8A 3UZ5A 1E4NA 4QNEA 1EXPA 1ISWA 4S3FA 3LQGA 3N29A 4FP1A 2YA2A 3OG3A 3VCRA 4ATDA 5JIPA 3DERA 3CV2A 4MB1A 4RV3A 4D6IA 1TPFA 4UIOA 3S1VA 1I9CB 3H2NA 1OCQA 3FVDA 1FCQA 1RQBA 4K8EA 3EPOA 3GK0A 1BWVA 2GYIA 4LAUA 2QUMA 4Z42C 1YRRA 3TC7A 1MQPA 1OYBA 2NXGA 1Q7MA 2YYTA 1OWQA 1THFD 4HOXA 4C7GA 4YTSA 3BQ5A 3GXTA 4PMXA 1TWSA 1UBPC 1ECQA 2PU1A 5I7GA 2WW5A 4D2JA 8XIAA 5I07A 1EUNA 1KM4A 3PP7A 4ICCX 5HQMA 1MQQA 3R25A 3O6DA 4W88A 3UZWA 3HV9A 4HPGA 2PTXA 2VEGA 4Q4QA 5DMMA 4CQCA 4XAZA 3VILA 2J8FA 4UQBA 4Z2LA 4KEZA 2PWVA 1L0PA 4ATWA 5EMUA 3C8NA 4K7YA 1IV8A 2WJFA 3W86A 3UR7A 4QRNA 3VD4A 3QFWA 5MHBA 1IIGA 3KWSA 3Q4DA 4L56A 1VGAA 2D23A 5BWAA 1TIMA 5CJ5A 1EOKA 2QKFA 8CGTA 3K13A 3MI3A 7TIMA 4C7DA 4LALA 4NZCA 4MY8A 4BQ4A 1JZ5A 3DENA 4RL3A 3TTQA 4JQ3A 1K6WA 3T8QA 4K2SA 3STPA 2PCEA 3OODA 3ITGA 3W37A 2P76A 1HO4A 3B0XA 1IEWA 4K37A 2OZ3A 1OYCA 3LHTA 2XU2A 2JE8A 4KFPA 3OLIA 2PDKA 4AZGA 1H49A 3VD7A 3MUCA 4A29A 2FZBA 1QMLA 4PGLA 4IM4A 4DJED 3RCMA 3ALFA 3MMDA 3WLTA 2VD8A 3DN5A 4XSMA 3W81A 2Y5SA 1TWZA 3MP4A 1DJZA 4YWSA 1GQKA 2QMJA 2YSWA 4AIOA 3AZTA 2FB3A 2G3IA 2NUWA 3UCQA 4FXRA 3N17A 3NO5A 2O7SA 3T8LA 2A85A 4KFOA 4AZBA 3DH7A 1XRSA 1REQA 1UH2A 3M0KA 4XO7A 2Y2WA 2Z4GA 1KKRA 2G97A 4KGJA 3W7NA 3BUVA 3VO0A 4Y2WA 3NGJA 3A24A 3BJTA 1CGXA 2X7VA 3DC8A 3UD6A 2VKZG 1LOLA 3KTSA 4EE9A 2QW5A 1B2YA 5I03A 4HNUA 4R53A 4FIRA 1R6WA 2QCCA 4C6FA 3UXKA 3GFXA 3SUWA 5HNNA 1XXXA 2OVLA 3UCCA 1Q6FA 1P7TB 4FX6M 1FCVA 3NQFA 1GORA 1O6IA 3SR7A 2WANA 1Q85A 3UP8A 4HP5A 2V5KA 1E5NA 1TV5A 2VR5A 2E6FA 4WY0A 1EJWC 2OT1A 3WBWA 4Z2HA 2ZRZA 3FV9A 3MUAA 4CD4A 5DCDA 1KTNA 4UTWA 4PFHA 1UR0A 3C61A 4F40A 4P8XA 4A21A 5HR7A 3DFOA 3DBPA 5DCEA 4IPLA 2VYOA 1A5UA 1XGEA 3C2VA 3TTEA 5FJJA 3KRBA 3BMVA 5DXXA 4LANA 3NR0A 1W32A 4IOTA 4O28A 1TTPA 5EBUA 4LBRA 4HGXA 3VE9A 3GXNA 2DP3A 3M0VA 2XIQA 2V5CA 1E6XM 2G4JA 4C6DA 4Z1BA 4RUBA 4W87A 3MSGA 4HNOA 3UA4A 1WKFA 4N9BA 3QV9A 1IWPA 2DVUA 2YW3A 2Q8XA 4XZWA 3M7WA 1A5AA 3BLKA 3T2OA 2C7FA 1MRAA 4N9EA 2P0OA 2E9MA 3S5YA 2IUZA 3JU2A 3EEGA 3EKLA 3DYMA 2WNQA 4RK8A 3E02A 4V33A 2V2CA 4D1IA 4Q8TA 4L65A 3FXYA 4AY1A 2VC6A 2OLAA 5DN1A 3II1A 2D2JA 4OVXA 5IM51 2YCLB 3GFYA 4DEFA 1Q2RA 2JKAA 1KO0A 1FH7A 2WVVA 1GHRA 3MP3A 2ZUMA 3V0UA 2OGJA 1EJXC 3TSMA 4WXYA 1EJVC 3ATZA 2PF0A 1UA7A 3LPOA 2WZHA 4IFKA 1DIDA 2V0TA 1VPXA 3W7RA 4CU8A 1PIFA 4TX9A 1J6PA 4LYQA 4C6PA 5GPRA 1LOQA 3G6MA 3G1FA 2JEQA 4R88A 3HG2A 3R43A 1XF0A 1W1A1 1BG4A 1LBLA 2XFFA 1AQFA 3PPCA 5GNZA 3P8JA 1LROA 2WSKA 1VHNA 1AZ1A 1OVDA 4X61A 3S4TA 4GK8A 4QQ3A 4IQLA 4JTEA 1LUCB 4QLLA 3S9IA 3M7SA 4JL1A 3PZUA 2D2HA 2ZRUA 3LHUA 4S3CA 1ME7A 4O1BA 1IR2A 1KQZA 5BXRA 2YXOA 1XSKA 2B0MA 1UWAA 3TSBA 2QQ6A 1AUSL 4XAFA 3QGAC 1LT7A 1H62A 3W71A 1PKMA 2ZZ1A 5HAOA 3GUWA 1H11A 2VEKA 4JTJA 3FIGA 3HQNA 4YMZA 3EDEA 4DBDA 3SCNA 4NY2A 5K9CA 1GVQA 2DU2A 1MI3A 4JTGA 3TN5A 5C9XA 1IXOA 3VM5A 3BCJA 3AU6A 5F2IA 2V63A 3LBCA 2ZC8A 5U7SA 4JR5A 4MKSA 3MZNA 4HQVA 2IXVA 4UMBA 3AS1A 4YCPA 3CWNA 4UQAA 2NX3A 4HOZA 4KIRA 1LLZA 2VTFA 1HKWA 3LZ5A 4OBSA 3VOIA 2DIKA 5ENLA 1O68A 3JW7A 3LGGA 3GTIA 1FWRA 3GH5A 3H4GA 1V03A 4C6IA 3MDUA 2R14A 1F6KA 1P6BA 4RV8A 4Y96A 3ITYA 1TR1A 3S2LA 4ZSTA 4QBXA 3CL6A 5H8MA 1U22A 2KX9A 4B90A 4H6KA 1R2SA 2BVWA 4MNLA 1V6XA 3SRKA 1JUKA 3MS8A 2C91A 1J4EA 1J93A 2PBOA 4MUPA 4PMZA 3CASA 2ZCGA 1S1PA 1J0KA 1MDLA 3C3UA 1PXGA 2P8BA 3ZR4A 1L6FA 3CMGA 4N6EA 1BVZA 4F0RA 1X6LA 2EHHA 5C8BB 5G2HA 1XS2A 1P48A 1M7XA 5LNWA 5CPQA 2HZGA 3SUVA 4XV0A 2YB4A 5CSYA 2XH0A 3D6NA 3TJXA 3N19B 4JHZA 3IWPA 1EC9A 3E9AA 3D3AA 4FS9A 1MEWA 2C1IA 1EEXA 1PIIA 1QNSA 1HL8A 1W37A 3V5FA 3NCOA 4TX8A 4AG0A 1W3JA 4JFVA 1E3ZA 1UC4A 1X38A 1N8IA 3TSDA 1E51A 1E15A 3GXDA 4IJRA 2C79A 2WVSA 3PBMA 2YBVA 3F2CA 1OYAA 1S5VA 3F4DA 5CC6A 3OLEA 2X16A 2VX6A 4FLRA 5FI8A 4GMEA 1LL6A 1EPVA 4O4VA 1AW2A 4LVFA 3E2VA 5FF4A 4UFHA 1VIWA 4IG2A 1F4HA 3A22A 4R3UA 3SCVA 5REQB 3W2LA 4JIEA 2YYUA 1JYXA 3RFAA 5BNKA 2I56A 3QW3A 2J75A 2RAGA 3RPDA 3WBEA 3NZQA 4O10A 5M2FX 3FSUA 4Q8UA 1ME9A 2WNWA 3FA5A 4M0XA 1JFHA 2ZUUA 2Q3RA 3RG6A 2IKJA 3N11A 5D02A 1UQYA 4CU7A 4RZBA 2PTZA 4W7WA 4CNSA 3DIPA 2Z26A 2BHUA 4Q4SA 3WEOA 1I8JA 2GDQA 4LAMA 4CCDA 3B04A 1MMFA 5M1TA 3VM7A 1V0KA 3GS6A 5JBFA 5HATA 2YLAA 1UWTA 4S2CA 4F0HA 5GJPA 2XZ9A 2QCLA 3WH9A 3FJLA 3KCLA 3MUIA 1ZJBA 4WHBA 1ZS2A 3EPMA 3PFMA 4X2RA 1XX1A 2CZEA 2QCGA 3TW7A 3EX3A 4OE7A 3S5NA 1CXEA 3APTA 2BOGX 4MZ1A 1DXFA 2UY5A 1ZHAA 3G1XA 4JCLA 4M51A 9XIAA 3APGA 1OX4A 2XINA 4I9MA 1A5MC 4A2RA 1J0ZA 5HA7A 1R9XA 5PTDA 2VVSA 1JDCA 1TRIA 1J0YA 4CQBA 2YW4A 3IACA 3WSUA 5D05A 4ACYA 3UWYA 3V35A 1CGUA 4LGXA 4Z2GA 2OTDA 5G4HC 4LQ1A 3ERPA 1NY1A 3RLVA 3DDMA 3MSDA 1MZHA 5I3DA 1JZ8A 1X1NA 3JZUA 2PLJA 3LBMA 4LAKA 3S5OA 2D0FA 4JX6A 1DL3A 5AN7A 4QEHA 4EACA 4S3JA 2ZZ3A 1GVEA 3IJLA 1J2WA 4B4HA 6CGTA 1C7TA 2GSEA 2WMIA 2FHBA 1KC7A 2V3FA 1ZNNA 3KBSA 3LHVA 1JZ6A 3TN3A 1TZZA 3STEA 2CLLA 1UD3A 2ONEA 3SGGA 4XKMA 3BPWA 5F2GA 3EKGA 2DQXA 4FI4A 2VRKA 4ZO8A 3RMEA 3E12A 2PBGA 5FJTA 1RR2A 1EWDA 3C56A 4HA3A 1X1OA 2DORA 4HVXA 3SFKA 4IPJA 3ABOA 3VUSA 3SN1A 1XH0A 3SY5A 4JTKA 4JFWA 2W9MA 1L8PA 1R3YA 5AYYA 3QY6A 2YZ5A 3VE7A 5EL1A 2GVEA 4GI4A 4G8TA 4R7WA 2QJGA 3WJXA 3BDKA 1GONA 4O50A 2HBXA 3GC5A 4XAPA 3G18A 3KDNA 3SRDA 1FH9A 4LY8A 1CT5A 3ZZ1A 4CD7A 4GUHA 1YPIA 4FNUA 5FJOA 4IPNB 5D2YA 4LC6A 4GX9A 1A49A 3W1MA 3M0MA 5BXSA 8A3HA 4AISA 1NP0A 2QCNA 3HQ1A 4LUSA 3LNMA 4MJ2A 2NQHA 5G1MA 1R38A 4OGZA 3E0FA 3O7UA 1SFSA 3L4TA 3EWUA 3DZ1A 2ZZ7A 1OG0A 2FMOA 2YL5A 4UCGA 4E3TA 2VQTA 4ORMA 3CZGA 4NJHA 4MY9A 5BOFA 2R6OA 1O95A 1CB2A 4J27A 3QYQA 1BVNP 4A8RA 1AH4A 3LY0A 2ACRA 3LNPA 1DJNA 3A64A 3VDHA 4F48A 1BYDA 3MO7A 3PBYA 2A3CA 1JRBA 5BU6A 4DBSA 1XDLA 4ZOBA 3S2CA 2P3ZA 4LUTB 2WPGA 1OIMA 4AEEA 1HZYA 3IGXA 3QR3A 1LT8A 3P84A 3RM9A 4Q8NA 3DG6A 4O16A 3NQAA 2WLYA 4WLCA 5A6AA 2EAWA 3B9NA 3WLPA 3N2BA 8XIMA 3OHIA 1R3QA 5A3HA 1FWCC 4FOUA 2QNEA 4DF2A 4Q4MA 3AOFA 2OO0A 3U0HA 1V5XA 1UASA 4G7EA 1WOAA 3RCNA 1W3NA 2E6DA 3R4IA 5LXXA 3BURA 2HWGA 3IJIA 4DPPA 3QMTA 5TF0A 2ISSA 4C6EA 1EZ2A 3EAUA 2CU0A 3G3DA 3WH7A 3WY1A 1HJWA 5KMYA 4PEKA 2HXTA 3OGSA 3L12A 1DTNA 3F2BA 4L80A 1ICQA 1BWLA 1D9EA 4ADSA 5JH2A 4BI5A 1P6WA 3NYDA 3MP5A 1E9LA 1KM6A 4F79A 4RE3A 4D6CA 4O19A 2XGBA 4B2DD 3ABSA 2DH3A 4IWWA 2PRMA 4ZO6A 2ZX9A 3CZEA 3A9BA 3LMZA 1PEZA 3VOJA 1TPH1 4DWSB 3QEZA 1E6RA 1M01A 1C3FA 2HE8A 2FDMA 3GAYA 4HMEA 4M6QA 4AYGA 5DXYA 1R7OA 3PJWA 1TREA 3REQA 1MZRA 4PH6A 1Q13A 5C5YA 1FWEC 4ALDA 2QCDB 1L2UA 4GUFA 2UV8G 3QQWA 1V51A 3BSHA 2IXUA 3A47A 3WDPP 4PUKA 1XLHA 1VJSA 3MU7A 5KZDA 4FX8A 1K3UA 2VEPA 4RE2A 3LX9A 4IGNA 1WAUA 2EO7A 1V02E 3SI9A 2YPIA 4J3SA 5A6SA 4JZ5A 5CZSA 2C0HA 2ZRWA 4DI9A 3RX3A 1NOFA 4PCFA 1TELA 1PX4A 4UNLA 1OT1A 1M65A 1NOWA 4HA4A 5DQPA 1I2OA 1RJQA 2PDNA 3THQA 4LV9A 2XG9A 4NKCA 2AMXA 1E56A 1ONWA 4RLIA 1S5WA 3EEZA 4Z2KA 1A5LC 4HK7A 4ZVJA 3IIOA 3W1PA 3AUOA 3EA3A 4ONVA 1VLIA 3RO8A 5XIMA 2GVLA 1MEHA 4IPPA 2XSBA 3R89A 3U4AA 3ZVIA 4PRRA 1Z44A 3M46A 1S2WA 4FNTA 4L1XA 2PDBA 5I78A 2AL2B 1P5BA 3VD5A 1F76A 5E93A 5CLTA 2VP8A 1XP3A 4F0LA 3HBLA 1UD6A 1XH1A 2VCCA 3MWAA 3W29A 3HPXA 3CMFA 3V3WA 3VGDA 2XH2A 2ZX5A 4E6MA 4DO7A 3ZFHA 3VYLA 4B3KA 4BZYA 1VFUA 1GKQA 5E0CA 1XRVA 2FTWA 3ITVA 4E4UA 1XPGA 1SUXA 1I0DA 3CAWA 5FAGA 3MWCA 4M6PA 3ZXWA 4XTDA 4EAMA 6ENLA 4HSOA 1XLLA 3O06A 2QJMA 1FHDA 4PUWA 1TO3A 3J7HA 3LXCA 3URAA 3CUIA 1ISVA 3PF3A 1XISA 4OUIA 4K1GA 5JQ9A 5EPDA 4B5WA 2PD5A 4GQBA 3TOPA 1CWYA 1Y5XA 2V38A 3AFBA 4OIFA 3P8IA 2TMDA 3NURA 2BODX 3G8RA 1EBGA 1GHSA 4Y90A 2OG9A 4GNJA 3O05A 2QZRA 4H2CA 3FGCA 3WX7A 1GZJA 2CWNA 5AKQA 1UWIA 4CEUC 3NGFA 2XFWA 2AOSA 4KEUA 2Y5EA 1E0WA 2PODA 3IRDA 3UW6A 3O6CA 4US6A 4KT2A 3XISA 1DVJA 1S3TC 3IGHX 1TJ2A 4NU7A 2FHFA 3UBPC 1C8QA 2DH2A 2WMJA 1NDVA 2WQPA 4M1BA 5AZ0A 4Y8EA 1DPMA 3B8SA 2O92A 5BRQA 2OWXA 3IK4A 4W8BA 3L4VA 4AZHA 2ZC1A 2VL4A 3DGBA 1DV7A 2C8NA 3TTSA 1PDZA 1FA2A 4P61A 4JICA 4HZ7A 4UC5A 3MQTA 1V3HA 3EOUA 2NW0A 3EBVA 1PZ3A 1MYRA 3OYXA 3P6LA 3EGJA 2G3JA 1XLFA 2FH8A 4LUJA 3W7IA 3R2GA 1XIEA 1S3HA 3CUXA 4EF9A 4IGMA 4IMDA 3PHAA 2EG8A 4MSSA 3P82A 2QJNA 2C15A 2E67A 1WX0A 2YX0A 2OEJA 2Z0IA 3AAMA 4XZLX 1ZPTA 3UZYA 1EHAA 2OQHA 1IGWA 1QATA 3CMJA 1RP8A 4JTFA 1S2UA 1ICSA 3TWAA 1SR9A 2F6XA 4GGHA 1KB3A 5CKSA 1YPFA 1KRMA 4GIYA 4GVGA 1MVYA 1RP9A 4C6MA 5DCBA 2PU0A 2Z7GA 5I3FA 2FPTA 1M3UA 4GX8A 2ZBTA 2VGIA 2J6XA 1RD6A 4JIQA 3QLLA 2A3LA 4DZ5A 4M5PA 5EA9A 3VNMA 4Z2JA 3BLFA 3ZT7A 1W9PA 1JPIA 3E6EA 4N9CA 4Q32A 5KETA 4C60A 5C54A 5AHIA 1QCWA 2V5BA 3MBDA 3WDHA 5IHRA 3B0VC 3BW2A 2W27A 2I9EA 4DM1A 4H8HA 4DB7A 4GJJA 3M44A 3PR2A 5IBXC 3UESA 1JEZA 1C9WA 1RJRA 2NLIA 2WZIA 3WJWA 2RFGA 2GZXA 4QDWA 1U30A 3NPUA 3A12A 1WQ5A 3PJXA 4CGTA 3S2MA 1Q4NX 2V5JA 1GKRA 2PWFA 3ZSSA 5BRBA 3OBKA 1W1YA 1R3TA 3LTPA 1XWYA 4MFEA 3MO4A 3GBEA 2GJPA 1FWHC 4CD6A 2W3ZA 5L9FA 2NV9A 3VCNA 2Z27A 3H54A 3E38A 1W2PA 1XFBA 3UU0A 2XVPA 4J40A 4LRTA 1V0LA 4JS3A 2ZRYA 4ZBCA 1WBHA 3RO6A 1KXQA 2GJLA 1J8VA 3S47A 2IPFA 4DBEA 5RUBA 4H7VA 4WGXA 1UBSA 1P0KA 1REQB 3U48A 4H6QA 3GRIA 4NRSA 1OABA 2E8YA 8RUCA 4NXKA 3MCNA 1QNRA 4KQNA 2OKOA 4EPBC 1SZNA 2ZWZA 1LQ2A 1LZOA 1WB0A 4FHAA 4MWAC 1KLZA 1Q8JA 1RBLA 1B9BA 5GVJA 1MUWA 4DELA 4JIPA 4TOQA 1DJWA 4EKJA 1S2TA 2ISDA 5A6JA 4XISA 4F0SA 4YYCA 5ABEA 1XLBA 4UMAA 4B5VA 2GQAA 4DJDC 4OBRA 2XSAA 2Z2AA 3GXIA 1UOKA 1UQZA 1CW2A 4HZ6A 3U4FA 4WY0B 4DJFD 2BS9A 3BC9A 1XCFA 2XFRA 3TR9A 2QAFA 3L7RA 2E9BA 5F4WA 3WQWA 3EMQA 1X98A 4RX0A 3E74A 5JUVA 5LIKX 4GQ0A 3LGDA 1TE6A 1JCMP 3UG4A 3C5QA 4L4OA 4PODA 1FRBA 1FOBA 3P80A 4WDWA 3EB2A 1EIXA 3PAOA 3WNLA 3EWDA 4H8NA 1MSSA 1XGDA 2HVOA 3W82A 2QDGA 3WD0A 4PB5A 1DYSA 2IMRA 3AROA 4ADUA 1ZUAX 4OOUA 4KMQA 4GIRA 2I1OA 3WENA 1DJHA 1DJXA 3NA8A 1FDJA 4M80A 2G4FA 2P53A 5D9MA 1CENA 1P0BA 4O8AA 3PUOA 5BW6A 4MJMA 1M41A 4MTVA 2NX1A 3AYVA 4CN4A 5A6KA 1XRFA 3OU8A 4BCEA 5HOSA 2XM1A 3CT2A 5IFTA 4HJWA 4G56A 2E6YA 2PP3A 3GNRA 5IDZA 3E1F1 5FL0A 3PZVA 1E6NA 3N15A 2PWUA 4YS1A 5DF0A 3N14A 5D03A 2POTA 3DYOA 4IL0A 1QHOA 3WQPA 4GFIA 1T99A 3W1UA 3GVGA 2BG5A 4GQGA 3LQLA 4US5D 2QLYA 4EX4A 3VZXA 4H8VA 2DSVA 3VKDA 1QXLA 4K3ZA 1W0MA 4EXAA 2PDYA 4GKTA 2C6QA 1H7XA 4RZ4A 5FF2A 4GNKB 1EJRC 4IFKB 3DOPA 2PAJA 2WMHA 3ABRA 3LV5A 1NWUA 5E9AA 4WCJA 3CK5A 1DQWA 2NQLA 1UKTA 1QRQA 1YPXA 3M0ZA 2ISWA 3MHGA 1E0TA 1R46A 5LIWX 1D8CA 3GXMA 4PCSA 5U4NA 3QHOA 1A5BA 2NUXA 4HBKA 1QO2A 4YU1A 4KBXA 5HPCA 3FK4A 3RK8A 1M7JA 3DHDA 1R3VA 3FAWA 3NDOA 4LPCA 2W67A 2WBKA 4MVAA 1KR0A 5J04A 1JCYA 2ZX7A 4M19A 1R9YA 4GWEA 1Z3NA 4JIHA 3E2QA 4W7VA 4LB4A 4GIEA 3P2VA 2WMKA 2ALRA 3BANA 4S39A 3LM7A 4J1OA 3TN6A 3UG3A 2VX4A 2FZDA 4RJEA 4A8LA 5JBEA 3KP1A 4GPNA 3MYOA 3SCQA 4FNRA 3SAZA 1YXYA 3MYPA 2TODA 1X7IA 3WN6A 1NIUA 2GVGA 4ZCWA 7XIMA 4TR9A 1KTBA 5I3GA 2CKSA 5E0FA 5D2TA 4HA0A 4GHRA 2XIOA 2D2OA 1K70A 4J9JA 3G2GA 3AMKA 1CX9A 3MVTA 4LVBA 4CQDA 4D6DA 3PG8A 1VFLA 2BX7A 3T0AA 3LHWA 4UWMA 1WUEA 2DJLA 4QTGA 1GOXA 1ZLPA 2TSYA 2GUUA 2TPSA 1ITCA 1XGZA 4MWAE 4GI9A 3WQ8A 4HU4A 1TPB1 1KFKA 5FJIA 3GVVA 2A4AA 1OGBA 3DECA 1JCNA 3C52A 2ZWYA 5CSSA 3SQSA 4UB9A 3ABZA 5CBJA 3LLFA 4LOCA 3PN8A 2WVUA 1QWGA 2WNZA 5HJYA 3WDIA 4PMQA 3WJYA 1EB3A 1W91A 4Y9NA 2Q01A 5MKGA 4MAVA 5TBOA 1WZKA 2I17A 3N13A 4FPSA 1TZ7A 5KZMA 3AXMA 1ADDA 2WAGA 4JTSA 1K9DA 3GTHA 4K8HA 3WK3A 3G1HA 2ISFA 1V3IA 3IJ8A 3LD5A 3WD3A 1H09A 2UY4A 3THUA 3WYZA 2HTMA 2QUTA 4PSPA 4JKKA 1XLDA 3QPEA 1BQGA 3LCWA 4JTIA 1K03A 1P0NA 1JR1A 3I6RA 4ZOEA 3NM1A 1WKDA 4Q8PA 4IG2B 3QF0A 1YLVA 3LI0A 3NQBA 1WKYA 4XO6A 3EDJA 3OGVA 1T96A 1S2CA 4IGHA 5CXPA 1V7YA 3TWBA 1PYMA 5C0QA 1BRLA 2QVHA 1PZ2A 2BASA 5LNVA 3L65A 4HMDA 1L8NA 3CPGA 1KD0A 3URNA 2E40A 1KM3A 2Z6IA 1KCZA 4RPQA 5D4YA 3IJDA 3B8UA 3H7RA 2VEMA 3MSRA 2GUYA 2Y6ZA 5IRPA 3T81A 5A69A 1FBAA 2I9UA 4HN8A 1JQXA 3GG8A 1WDWA 1J5SA 4DM2A 1TPUA 5K2ZA 1RZMA 3S46A 4CCZA 4Z2IA 4CEXC 4AVOA 1ADSA 2J78A 4I9TA 3L5LA 4DXVA 3HMJG 2JF7A 5I23A 2G8ZA 4ZE5A 3AYSA 3LCFA 3TXZA 1VFOA 5KINA 1UHVA 1GWJA 4C6CA 3AQUA 4M7TA 3UT0A 2OX1A 1W5PA 3ZIZA 2BFGA 3PWIA 1KKOA 4O1AA 4ZTYA 3WLHA 3NIYA 3OEXA 5A6BA 5KZ6A 1N55A 4WKAA 4C5ZA 1OFQA 2GJXA 2WWDA 2ZVRA 3V75A 5KITA 5K9DA 1OX4B 1BYAA 3GDLA 2Y61A 1W1VA 4QHRA 5CZKA 1DQXA 1V3JA 4P7RA 3PZQA 1W3IA 1EL3A 2WQDA 1H41A 3GXFA 5C2XA 1UROA 1ZB5A 3WQ4A 1YDYA 4GRSA 2VVNA 3CYVA 2OLSA 3DKJA 4UR8A 4UOQA 5D37A 2PDWA 1EJUC 3SURA 3SUUA 3NZPA 2BXYA 2OEKA 3PUDA 2J7DA 5I00A 2JF6A 1TQXA 5AHMA 5B80A 1B3XA 1Q8AA 2E9LA 4JQAA 3FXGA 2WMIB 1VENA 2FZNA 1DTUA 1CI1A 3RMJA 4RZ6A 2R94A 1GPWA 3HF3A 4GLEA 4LEQA 1BF6A 3LRMA 2NT1A 1J0IA 2CEQA 3KHJA 5AYIA 3B0PA 1B0IA 1VPQA 3L21A 1JDEA 4EVZA 1Q45A 1AMYA 3WK2A 5HINA 1DJGA 1BQCA 1WDSA 3VC6A 3SDOA 4WQ6A 3E5BA 3QY8A 2WSYA 1O5KA 4NNAA 4EAYA 2OSXA 4KWSA 4RNJA 4Q8QA 2AAMA 3T6CA 4S3DA 3THAA 1H50A 2ZZ5A 4JL2A 4EWJA 1NAL1 3QZ6A 4INFA 3SCPA 4HU3A 2Z00A 3VI2A 3R8GA 4ADTA 2YDAA 6PTDA 2UZ9A 5LNRA 4XB3A 3TH6A 3SM0A 2YOCA 3KHDA 4KCUA 4TX6A 2Y62A 4OJYA 4DJEA 1XKYA 3VNDA 3ARQA 4GUIA 4BQ2A 4PYSA 4XQ6A 3RR4A 4HN4A 4YCOA 2RJHA 2INEA 4RDWA 3A21A 1SMAA 1SPQA 3O16A 4LUSB 5E70A 3N4AA 3NQGA 3NL2A 4L7ZA 3TYZA 2VR4A 1XBXA 5EYWA 2XPKA 3WLNA 1WDDA 2PTWA 1R3SA 2V3DA 4GXWA 1EJSC 1SGJA 4AD5A 3W1LA 3INPA 4RE0A 1VPYA 1SFTA 1RCQA 3PUGA 4FK9A 4W7UA 1XDJA 2R24A 1VCFA 4HMNA 3QQ1A 3WQCA 1UIPA 3FJNA 4NSBA 5F1UA 2VGBA 2VC7A 2Y8VA 5T91A 2EPLX 1E71M 2QT3A 3BSMA 1E6QM 3G0SA 3D47A 3GDKA 2WJDA 3HOJA 4G7EB 3AHXA 4BF7A 3GQYA 1UKSA 4ZQMA 1OCJA 2L5HA 4QIUA 4U10A 2OR2A 1KQYA 2YCLA 3WLQA 2J7FA 3QV6A 4A6GA 3IUDA 3W72A 1Q63A 2UWFA 2QXWA 3TZFA 1Y5VA 4S3BA 4JNYA 2OYMA 3BZGA 2PDUA 1YDVA 3CB8A 3SSZA 3RUBL 4CCEA 4U3CA 1JCLA 3I68A 3W1NA 4G7FA 3AC0A 4ZB5A 1GYMA 2ZYFA 1W3LA 4YVPA 1RXOB 3APYA 3G8EA 3WLJA 3OVPA 3S5SA 3WUEA 1V0MA 1WBJA 2QPSA 3HG5A 2B31A 1ENUA 3GKAA 3KX6A 3AS0A 5D38A 4O18A 3FCPA 2C13A 4B16A 5FEPA 2G50A 3OBAA 4GUGA 3WLRA 2BVDA 2MANA 4F2BA 3LPFA 3VFLA 2FVLA 4UFIA 3REQB 2UBPC 4D72A 1KV8A 1PPIA 1G4PA 1ZBKA 2EG6A 1JZ3A 2CWXA 3M1ZA 1RA0A 3QN3A 1OCBA 3B0YA 3V7PA 2ZA3A 3R0UA 3AISA 4Q7NA 3CC1A 3CL8A 1F8IA 2GQ9A 4GGBA 3ISIX 2BLEA 2G3MA 3P5ZA 5FF3A 1UZ4A 3F2DA 4JN7A 1GT8A 1WDQA 4TTGA 2I7GA 1UWSA 4PRTA 4AB4A 3K1GA 1YTKA 1S5TA 1YADA 3W70A 3PFRA 1FHUA 4YVVA 2BVYA 3GW3A 1OF8A 5ABTA 1E4LA 4QEEA 1ITUA 2BBFA 2R8WA 1ZAIA 2W91A 5BMXA 4O53A 2AL1A 3LHZA 3T2QA 1GOKA 1ZZMA 4PTNA 4NX0A 2YLLA 1VYPX 1SFJA 3NQ6A 1GOQA 3KAOA 1YXDA 4H00A 1RK5A 3VIPA 3BAJA 3RR1A 3GAKA 3PZOA 2GDUA 3W7HA 3AMGA 1VLWA 3WEZA 2BV9A 4AW7A 4Y7EA 3RRAA 5AC8A 1FDYA 4FNPA 4X22A 4FR1A 3R8HA 1H2JA 3CUJA 3K8LA 2BY3A 4MIMA 2I16A 3TQPA 4W89A 4J2MA 3WLSA 5A1AA 1S5MA 3G24A 2NQJA 4ZE4A 5AHFA 4J28A 5FD0A 3LMYA 2GOUA 1ZU8A 1FCUA 4PMVA 3FEMA 1WDRA 4GZIA 1H61A 1GJPA 1LG2A 5REQA 3ARZA 3M6YA 3C6CA 4L6DA 5DEZA 2REQB 4NUWA 3NZRA 2NQ9A 1VEOA 2A2IA 1JZ4A 2Q71A 3NFUA 4GA8A 4X0NA 1XG3A 3EB4A 3M4HA 4NAFB 3ZLFA 5DFAA 3AMDA 3COTA 3WQDA 2CFFA 2X40A 3FGCB 3BGJA 3NQMA 3UNDA 2PZ0A 3W23A 2V81A 3O63A 4KESA 1NDYA 1F3XA 1UD4A 2CW6A 4PC8A 1K7XA 3TFXA 3WUGA 4XZNX 5HJLA 5CAKA 4B5TA 3ARYA 2G37A 2O4MA 1W5QA 2Y7EA 3C0JA 3VXGA 1KGXA 4ERAA 5JVLA 3PBGA 2ZQ0A 1B9ZA 2BP1A 1ZGDA 2NXIA 2PDFA 1AMKA 4WKFA 4IGSA 1UR8A 1XRTA 3NQ7A 4MWAD 1XIBA 3KZPA 2UY3A 3AXXA 5C71A 1U5JA 3HIJA 2QV5A 5A8PA 3DGRA 4Q4RA 3ZO9A 3VZYA 1CYGA 1E55A 4LVAA 1BTCA 4H41A 1OFAA 1XQKA 1JYVA 2WZEA 1JDFA 5HR6A 1XH2A 4RXFA 1DJYA 2IQ0A 3P93A 5DX7A 2ZVIA 1RLCL 3LCLA 1TUXA 3O1NA 4N2YA 2VMFA 4HU8A 2CHN