1NY1A

Crystal structure of b. subtilis polysaccharide deacetylase northeast structural genomics consortium target sr127.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
235
structure length
235
Chain Sequence
VPNEPINWGFKRSVNHQPPDAGKQLNSLIEKYDAFYLGNTKEKTIYLTFDNGYENGYTPKVLDVLKKHRVTGTFFVTGHFVKDQPQLIKRMSDEGHIIGNHSFHHPDLTTKTADQIQDELDSVNEEVYKITGKQDNLYLRPPRGVFSEYVLKETKRLGYQTVFWSVAFVDWKINNQKGKKYAYDHMIKQAHPGAIYLLHTVSRDNAEALDDAITDLKKQGYTFKSIDDLMFEKEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable polysaccharide deacetylase pdaA
publication title Crystal Structure of Polysaccharide Deacetylase (PDAA_BACSU) from B. Subtilis (Pdaa_Bacsu) Northeast Structural Genomics Research Consortium (Nesg) Target Sr127
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 84
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 1ny1A00
4NYYA 3CL8A 4NY2A 2J13A 1W1A1 3VUSA 1W17A 2VYOA 4LY4A 2XU2A 3CL7A 4NZ5A 1V6TA 1Z7AA 2NLYA 2QV5A 3HFTA 3QBUA 4L1GA 2C1IA 4OUIA 4WCJA 2C79A 1NY1A 4M1BA 4U10A 4NZ4A 2W3ZA 3CL6A 2Y8UA 4F9DA 2C71A 2IW0A 2I5IA 2E67A 1W1B1 3S6OA 4HD5A 5JMUA 4NZ1A 4NYUA 4NZ3A 2CC0A 2C1GA 3RXZA 4V33A 2DFAA 3WX7A 4F9JA 1XW8A 5BU6A
chains in the Genus database with same CATH superfamily
3DFTA 3LPPA 4X3ZA 2CLKA 3GHUA 4GUHA 1EJWC 1VEMA 2HVMA 4NNAA 1HFBA 5AYYA 3UNTA 3VZXA 1FWWA 4RXFA 3UG4A 4GGHA 3KTXA 5M17A 3WJYA 1WBHA 2I56A 4FK9A 3LU2A 2OODA 5CSUA 3PAJA 3FDGA 3W76A 4BS0A 5EMLA 1BRLB 3W7HA 2C1IA 4KFOA 1TE6A 3QHOA 4C6NA 1B3ZA 1GW1A 3NXFA 1GOWA 3T8QA 1W9PA 4V1XA 3TYBA 4X0NA 1HNYA 3V7PA 3HGRA 2BHYA 1IT8A 3TYDA 2H9AB 3IUIA 3B4YA 3CZGA 3GXFA 1VEPA 3UGRA 5DMYA 3ELFA 3WK2A 1K3UA 1QNSA 2WVVB 4I7WA 5A8GA 3AQUA 1LCOA 4UMBA 1NDYA 2E28A 1GOMA 2GWGA 1KXQA 4JTGA 4ZOCA 2DIKA 4PULA 1TPDA 3KVKA 4JTFA 4IMDA 4W8AA 1OQFA 4IPNB 2PZNA 4O11A 4FLSA 1FHLA 1Y5XA 4NJIA 1E0XA 3C2VA 3AMCA 3K46A 3GTNA 2O9PA 3SEPA 4NI3A 5D9MA 1KFJA 4N9DA 4I6VA 1WB0A 1JI1A 5FJPA 5D37A 3RX3A 4C5YA 3AROA 1IZJA 1ADDA 2X7VA 1D8CA 2GQ3A 2ZRZA 4PMXA 3ANYA 3NAVA 4F0SA 2GSHA 3PZTA 1TSIA 2ZUVA 3OVRA 6A3HA 3NQGA 1TUXA 3R58A 4PUMA 3BAJA 4ZB2A 1V7YA 2YL5A 3GHTA 1YNPA 3GNRA 1HVQA 1LOQA 1W1B1 3BV7A 3HB9A 4N6FA 5D9NA 3WDQA 1XSIA 2Y88A 3WF1A 3KHDA 1JFXA 1N7KA 3G18A 3FN9A 1HO1A 3LOTA 1UH3A 4OWGA 3G1YA 2VC6A 3GXNA 2OEMA 3KAOA 6XIMA 2QUUA 3P93A 4ACZA 4YTQA 3KL3A 1EEXA 4MJ2A 4FMVA 1VPYA 1O1HA 3MJMA 2ZXAA 2NZLA 4ZQPA 2I9UA 2OOFA 2J7FA 1FVPA 1XIGA 1JNDA 1TYGA 6CGTA 3EX3A 4BEUA 3EMZA 3DFSA 1KLZA 1O60A 4GYFA 4CD8A 4LU0A 1XLBA 2PWFA 3STFA 1PS9A 1TPFA 2NW0A 4GNKB 4IJRA 1KBBA 2BY1A 4REQA 1VCFA 4O1AA 2QMJA 4U10A 5GJMA 3K1DA 1B5TA 5CAKA 4GI9A 4DXXA 2IKHA 3C4UA 4NXSA 3WLNA 5CZTA 1OFPA 5D2XA 2AKZA 3S5SA 1RD6A 3CH9A 4NVTA 2E5DA 4IG2B 3UG8A 3AIBA 1QK0A 1D8WA 5GNYA 5KITA 3DFPA 1Q7QA 5JQ9A 1EZ2A 2VC5A 5CZKA 4ZO9A 9XIMA 4QROA 2V5CA 2UBPC 3E5PA 1B9ZA 4LPCA 3UJSA 4OZOA 3QOKA 3S6TA 4JX5A 4DLMA 2HK1A 4XKYB 4I9TA 2QDGA 2FTWA 2EPHA 1J96A 4LVDA 2C0HA 3W7DA 4RV3A 2XUCA 3WMSA 3IK2A 2R1LA 2Z0IA 4AZ7A 4PMZA 2WZIA 3DAQA 3EB3A 3RLVA 1SJCA 3W1AA 2VRJA 4K7VA 4WUIA 4XIMA 1Z42A 2YDSA 3CWOX 4C6JA 3HA1A 3KP1A 1D2KA 3GHSA 2PBGA 3L2LA 5TIMA 1FWJC 2XIQA 1R3QA 1K9FA 3R2GA 4X9SA 3T0AA 1FHDA 1UP3A 1RP9A 1VEOA 2J9XA 4B16A 1MWOA 1J01A 3MI3A 1VH7A 5C55A 2QCMA 5EFDA 3H2EA 1XIHA 1EP1A 1QPNA 2BHZA 1WOBA 3BLDA 2PDQA 2VZOA 5I3JA 4NHVA 4LQ1A 1KTNA 3PB2A 3N73A 1HO4A 4RZ5A 4ZTYA 4G2DA 3N19B 4L65A 3CIWA 1EB3A 5G4HC 3CZKA 2VVNA 4NYUA 5CSRA 5LIXX 2GOUA 3BSHA 1KTBA 1SZRA 3KDNA 3V0UA 1W9UA 3GC4A 3NL3A 1YQ2A 3MKCA 3WFZA 3IIVA 5L9FA 1EJXC 1UJQA 1SSGA 3IJDA 1CXLA 4UTUA 1PPIA 4JX4A 4F48A 1OJXA 1J10A 4NAEB 2EG6A 1WXZA 4JKMA 2EEXA 1OC6A 4XZHA 3BE7A 3ES8A 1CXKA 3W23A 1E55A 1ZRQA 4DO4A 2CZFA 4GI4A 5H1WA 1G94A 3WF0A 1XD1A 2OZ8A 2W79A 3BK0A 4QX4A 4AY7A 2QCDB 5AC6A 3SAZA 1Z89A 1ISXA 1G7UA 2JIEA 4AXKA 4NNBA 4IPIA 3OZYA 5FJIA 4TQTA 2YCLB 2HPMA 4MJ4A 4H9MA 2A4AA 3OLGA 4QSHA 3U8GA 3UNDA 1YE4A 3GIPA 2E8YA 3WG6A 3NL2A 3NVDA 4KWUA 3CQHA 3T4CA 1FH7A 4WD0A 3OYXA 1BGGA 3WNKA 4UTHA 3L23A 1JGIA 2PLJA 2XSAA 1AL8A 1LRTA 4G5DA 4KS0A 3HGSA 3V3WA 3OBEA 5CC7A 4JTSA 5BMXA 3SN4A 4UOZA 5BZAA 4IIHA 2WANA 2PDPA 2GK1B 2WC3A 4H9UA 2ZRWA 4MOZA 2ZA3A 1L8NA 4RZ4A 5CPNA 3QW3A 3GBDA 3RX4A 1QNOA 4GZEA 3CIVA 2PAJA 2O0TA 4Q4PA 3BXWA 1C7SA 4I3GA 4YCOA 4PTMA 1TPUA 2DVUA 1KV5A 3DHFA 5C2CA 1OWQA 1T8QA 1O68A 5I23A 4C6CA 4IP5A 3KEHA 3UPBA 3JUGA 2OYMA 3UU0A 4ADSA 3K5XA 3HV8A 4L56A 1SO6A 2ZRUA 2YGYA 5H8UA 1U2YA 1KC7A 4E8DA 1JPMA 4XQ6A 2VX6A 1IWPA 1R3SA 3B0VC 3H4GA 3NM3A 4JN7A 2BY0A 3RDKA 3GH7A 1XP3A 2OFJA 1SO5A 4HHMA 4D6CA 3E2SA 1XCXA 4DWDA 2ZYFA 2C18A 3V36A 5FIPA 2ZWZA 3TTSA 2FHCA 1KQYA 4YHEA 3BG5A 4M6PA 1OIMA 4HCLA 3PPFA 1UBPC 2FFIA 3WFAA 2V63A 4JD4A 5I79A 4AHPA 3BZGA 5AVHA 3O15A 3F1QA 5JBDA 1ZP3A 1POKA 2W6RA 3QW4B 1AA1B 1V02E 4F40A 4ZO7A 1IXOA 7CGTA 2Z1XA 4H04A 4PRTA 3GIQA 1QPQA 4YVXA 4CQ9A 3WJSA 1KFKA 3R13A 1V8EA 3TTOA 4PCSA 3GNOA 4NAFB 1MMFA 1BXCA 4B5TA 1BWKA 3TWAA 2XG9A 4MMWA 3PTMA 5FF3A 5IHSA 2XPKA 3LLXA 2O55A 2AGKA 4WXZA 4WHBA 5D38A 1E6RA 1VFUA 2CIPA 2RDTA 3QRHA 2Z7KA 4OOUA 1UG6A 2QJMA 1XRVA 1F74A 5PTDA 3L5AA 2NUYA 3CV2A 1TIMA 2XU2A 1IWAA 4AYGA 2WVVA 1TB3A 1GPFA 4E3VA 3BAKA 4Z1AA 1U5HA 4OV9A 1YXYA 3BMVA 3QXBA 4NZ3A 4DYKA 2GFTA 1XICA 1KBJA 3SQLA 4C5ZA 1DWAM 4PCFA 3K2GA 1ONEA 1XLHA 1GGOA 3E0LA 3M0MA 4FA3A 5HQLA 2AQOA 4TUFA 4JIQA 4QS6A 1LL7A 3NQAA 1TWSA 2A85A 3VM7A 2ZX7A 2WLZA 2GGJA 4QXIA 1R7AA 1UASA 1I2OA 1BSLA 3ZIZA 3L4ZA 1PWMA 3V18A 2DZVA 4A21A 1HJVA 1GKPA 1UC4A 3GG1A 2X1SA 1OG6A 1VF8A 4CVUA 3KVMA 1U83A 5C9XA 1XQLA 4PFMA 5AC5A 2IUZA 2RDXA 3RG6A 1P1XA 2JEQA 4AIEA 1E4IA 4JY9A 4YS1A 2Y63A 1UD6A 2FHFA 4LAMA 3RJYA 4GFIA 2CWXA 4O54A 1OK6A 3OHIA 3NG3A 5LIKX 4U3AA 5JUVA 4I5UA 4OU1A 4US5D 1TWWA 1AQFA 4HYWA 1JUKA 2J6XA 1I60A 4WK9A 4ZFMA 3THUA 2E67A 4FZIA 1CGVA 4Q8WA 4ATLA 3QM3A 1F4AA 1P7TA 5CEWA 3ARSA 3GM8A 5I0DA 2X41A 5HATA 2VQTA 1X8FA 1DHPA 3KCLA 1BAGA 1XG3A 3DXIA 1LUCA 2FJKA 3WLRA 1HL9A 3B8IA 2GJNA 4UNLA 4MDPA 3S1GA 1VBHA 1EOMA 2PDNA 1QBBA 4AZHA 4GX9A 2PDUA 1KRMA 1VJIA 1WZKA 1A49A 1ZS2A 5CBJA 1LT8A 3ZO9A 4NILA 3POCA 3GDMA 3H2CA 1ONRA 3L4VA 3ZR4A 1F6PA 2PTXA 2DUAA 3ATYA 4K37A 3UWWA 2J88A 5H8MA 2VOTA 4PYSA 1TV2A 3BARA 4GG9A 4WY0F 2HE8A 3CWHA 4HK7A 2BXVA 2ZUWA 4BK9A 5FEXA 5A94A 1YX1A 3FVMA 3A5FA 2FZMA 4NI8A 3KL0A 3D0CA 4TVUA 1CCWB 3FOKA 1BSIA 2F6KA 5A6BA 1MQQA 1QASA 2NQJA 4J40A 1FWIC 4AD0A 1KFLA 5C71A 4H6EA 3G1RA 4LAKA 5FJRA 3MUCA 2WMKA 1YPIA 3NO5A 1B0IA 2WXDM 3NQMA 4OGZA 4FXSA 3PS7A 1FFRA 5LZLA 3DHDA 1L2UA 4ATDA 2WLYA 3BLLA 4BI6A 3A6OA 4GCXA 1V08A 3GH4A 3FHQA 3DGBA 2V0TA 3TYUA 3B04A 4KT2A 2J7BA 3BLFA 6TIMA 1VPQA 3C3UA 1H7XA 3RRAA 4W86A 1JCYA 3D46A 3KDOA 1H3GA 1OIFA 1R3YA 1VFHA 2PMQA 3MUY1 4UB9A 4F0HA 1OEPA 3OLDA 3IGSA 1J0KA 2NV1A 4JTHA 4HNUA 3AIQA 2V3FA 4JIHA 4URIA 3NTYA 3M6YA 4UMCA 1NWTA 1UA3A 1YKWA 3DBPA 3NSNA 4QISA 1TELA 4IFOA 3ZJ7A 2ZVIA 3TLLA 3QV8A 3HJEA 1ONXA 1U1JA 3GC5A 5EYWA 4FXFA 1ICSA 3CO8A 3EXTA 1WAWA 1WQ5A 2HROA 3DFQA 3CT2A 3PFRA 5D04C 1LF1A 4GOAA 3ZJKA 1ICPA 3W2KA 4IQJA 1LBFA 3W2JA 3R79A 4HNLA 1VCGA 2CITA 4GVFA 2DPEA 4NX0A 3VNKA 3MZ2A 1EJUC 4Z2GA 3C2RA 3WDIA 1EJ7L 2YX0A 5KEZA 3QH2A 3AXXA 2X16A 4Y9AA 4I9JA 3CBWA 1XH2A 1NP2A 2WO5A 1X98A 1G4EA 3MQTA 3NM1A 3W4RA 2VFGA 3DZ1A 1ZBWA 3HPZA 3LGEA 5C54A 1TJ0A 4KRUA 3N3TA 1CXHA 4PEEA 2O9RA 4UMAA 4E8CA 9CGTA 2JGYA 3VC5A 5CC3A 3G1DA 4E38A 5FSDC 1KM0A 2XH4A 4DY1A 3RO8A 1XFBA 5BRPA 3DKJA 5BWAA 1SW7A 1JCXA 1OB0A 5A2CA 4Y8FA 3MA8A 4XV0A 2BGQA 3UA4A 1OHLA 1MUMA 3CB3A 2NQZA 4B3ZA 1K7XA 2RDUA 3FNDA 4XTIA 4E4UA 1ME7A 1PZ0A 4JL1A 1GJPA 1ZHAA 1K4GA 3WD4A 2PURA 5CPQA 3U2EA 2XN2A 2HK0A 3N4AA 1GT8A 1J0IA 3MO4A 3MKKA 4TX8A 1V6TA 3IK4A 4O4WA 2Z1SA 4P7NA 1QU4A 1GVRA 1F05A 3MY9A 1B54A 1LLZA 5I3HA 3JR2A 3HPAA 2FVLA 3VNDA 1W5QA 3QQWA 5G5IA 1YTEA 4G7EB 4FALA 2A3HA 1TCMA 3R89A 3QF0A 3V5OA 4MB3A 1GQKA 3MU7A 4YCPA 2EGZA 3FK4A 1KCKA 3VFCA 3WBYA 2G41A 3L0GA 4JYFA 1AZ2A 4LGXA 4HN8A 4MWAA 2AQVA 1HL8A 3QOMA 4Q8UA 3WQWA 1UWQA 3TC6A 2CLOA 2W61A 3TSBA 5G2WA 3N4FA 2CU0A 1Q6FA 1R6WA 2PSNA 3PWGA 3WLSA 4LCQA 3UXKA 3CJPA 3ATZA 3MUIA 1JUEA 1IQ8A 3FCPA 1VLIA 3TKFA 4JHZA 4HZMA 5H91A 1PO9A 3CV7A 1W54A 5J5DA 3S4TA 3SFWA 2G3NA 4AEOA 2AMGA 1D7FA 3PPGA 2QGYA 2VGIA 4QLJA 2YZRA 3BG9A 4LRSA 1AL7A 1W9BM 1JI2A 1TR1A 3L5LA 3T2OA 3KVJA 4JICA 2QDDA 3AS2A 3WQDA 2DQWA 1A3WA 3VC6A 3GLCA 4YWSA 4Y9OA 1P6CA 2FH6A 2Y8UA 1LL6A 3QLDA 4YMZA 4NRSA 3O1NA 1W3KA 3C8NA 3MCMA 4XD4A 4GI6A 1T0OA 4LWWA 1HJQA 4ZXOA 3S2NA 3TLQA 3LBOA 4C1LA 3LV5A 2HCVA 2ACUA 3CTLA 4KCUA 2G3JA 3CQIA 3GVWA 3GDBA 1IIHA 1WUFA 3ARXA 3W7NA 2OPJA 2W27A 3ZWTA 1HG3A 1E0VA 5C9RA 2ZX9A 4AVNA 1UD4A 3GSMA 3Q58A 5HMDA 3EPOA 4WVXA 4KETA 1TKKA 4BA0A 1MDLA 1X39A 3T05A 5ABTA 4AZ5A 1EYEA 4PA8A 1CGTA 3S83A 2J74A 4S3JA 4P8UA 3NQBA 3P82A 3L65A 4QE1A 2F9RA 1SUXA 2A3CA 4DELA 4J3XA 3AYVA 3LSCA 1I0BA 3TQVA 4JTEA 3VABA 3WQ8A 3S1WA 3E2QA 2C1GA 3CWNA 1Q65A 2GSEA 3SCWA 4OFCA 4LUTA 2YW3A 1V3LA 7XIMA 2Y0FA 1M03A 2VC9A 4O0QA 2D73A 4Z42C 4D72A 4CCCA 1XCFA 3T9PA 3WLJA 1TFVA 2YCIX 2DZPA 2CYGA 4K39A 3BW3A 2CZ5A 3UGVA 2IPJA 5FF4A 5LKYA 3GHRA 3LEPA 2NLYA 2IXVA 1H7RA 2VMFA 3R4IA 3K13A 4XZLX 3FEQA 1WA3A 3CXOA 3ZVHA 1JFHA 1Y0EA 3QY7A 2UV8G 2X40A 4MLRA 2ZUUA 3ARQA 4NF7A 2KX9A 3B9EA 3NQVA 3G0XA 2WVSA 1TTQA 5LGXA 3LPOA 5F4XA 3WH9A 5FA5A 1YMYA 4IPLA 4WOQA 4FNUA 4MPQA 1MXGA 2FKPA 4IXHA 4CVWA 4RE0A 4NL1A 1WDRA 1W9VA 3H54A 3OQEA 2ZX6A 4TU1A 4BQ5A 3HZ3A 1WKFA 2P5NA 3S5OA 2YXGA 4O10A 4J2PA 4D6FA 1XIFA 3UY8A 2V2DA 4EXAA 1K8ZA 2VEMA 5I3KA 3P74A 1W3TA 1QW9A 1ZUAX 3LD5A 4YYCA 3A24A 2X1UA 4S1FA 2A7RA 2XFRA 5A6LA 3T0BA 3M9YA 3EDJA 2XH7A 2A0NA 1BGAA 3AMGA 2PDCA 3G1AA 1WXJA 4S3DA 4AIUA 1AH3A 1S2WA 3NSMA 3W73A 5M2FX 4K3ZA 3KBSA 1PKLA 2CHOA 4Q6XA 1OYAA 1M41A 2V3EA 1L6GA 2C3ZA 2QULA 3W7KA 2ZUNA 4MZ8A 5A69A 1GVSA 3W1QA 4J3VA 1TPC1 4IL0A 5AYBA 4DZHA 3MWCA 2DZWA 8RUCA 1BVZA 2QVNA 1QATA 2RFGA 3QFWA 1MRQA 2A6NA 1E9IA 1W1ZA 5D8ZA 2CZEA 4IHCA 1Q5MA 1Z7AA 2B7OA 3IPWA 1DTNA 2HMCA 3DYMA 5EU9A 1TCDA 1QHOA 1UD2A 1F73A 3QV6A 4ROQA 1MW2A 4AEEA 2B81A 4FO4A 4LY8A 4HK5A 4HNTA 1W31A 4Q4OA 4Q4SA 3TN6A 5A95A 3W38A 4D8ZA 4A3UA 4AC7C 1TV3A 3H2NA 3M07A 4W87A 3AISA 5AOUA 4PN2A 2HISA 4K36A 1EXBA 4Y9MA 3BMXA 3R8GA 2WKJA 1E6QM 3RCMA 3E0IA 5C9WA 2PDBA 1UOZA 3GFYA 3NQ6A 2OOGA 3E3HA 2NX3A 3KE0A 3N11A 4FR6A 4M7TA 4CEXC 3WBEA 1JXJA 3SY8A 1H4PA 3AXHA 2GGGA 3QY6A 3E9AA 1VFSA 4ZL1A 1KKRA 1OX5A 4GVIA 3LHWA 4FAMA 3P0WA 2B7PA 2XGBA 1TJ2A 3VIFA 4QAIA 3PC0A 4GISA 3UWZA 4DXKA 1OD8A 1SQ7A 4RR4A 3O16A 5FJJA 4AHQA 1KGXA 2JE8A 4UTKA 3ES7A 1XYBA 2D69A 2TPSA 4O1CA 1JZ3A 4GC4A 4IMCA 1JD9A 3ALFA 2Y1HA 4KPLA 1VHCA 2NSOA 4F2TA 1E6SM 3GU9A 3CQ0A 1V79A 2OWWA 3W85A 1W1A1 2UY2A 3FYOA 1R38A 4B9ZA 1P1MA 3MDUA 1XIIA 2XTKA 2YBUA 1S1PA 1G69A 1JDFA 2PU0A 2GQ9A 1ZP4A 3VKKA 4L7ZA 1UR3M 1J8VA 1J2WA 1SZGA 4ZENA 5MKGA 1WKEA 3DESA 3NQEA 3UXLA 3AU6A 1TV5A 3AO0A 4UBPC 1GORA 3WUFA 3DC0A 4H3DA 1AW1A 2WQPA 2PD5A 1GKRA 4G7FA 4ERAA 3N2BA 3GVVA 4GABA 4Q8MA 3ARVA 5BU6A 3NEVA 1BQCA 1W91A 1ZZMA 3FVDA 1UWRA 3OODA 2NXHA 3VZZA 4BWLA 3VCNA 1SVDA 1JNEA 3ZOAA 4MDOA 1B31A 3PUOA 1P48A 3M5XA 1RBLA 4FX8A 5FF0A 3N6QA 1XYAA 3HURA 1NDVA 2E1WA 3MO7A 3FIGA 2HS6A 3MYPA 4ZQOA 2V2CA 2BOFX 3GG0A 4LFYA 4XAGA 3B0UX 3LHVA 5I78A 1S5TA 1FKWA 5GQBA 4G56A 1DWHM 2VEIA 3WFLA 1G0CA 2CLFA 2YXOA 2E9LA 4GD0A 4AU0A 5HNRA 4ZA0A 3L2IA 2V5BA 2J4GA 1E3ZA 1TA3A 3EB4A 4C91A 5DELA 4Y96A 1XLFA 5LXEA 4NZ1A 1WDDA 4EPEC 3UZZA 1GHSA 4ZO6A 5HJYA 3CZLA 2DQXA 4R33A 3WDPP 1E0TA 3WQ5A 3ITVA 3NYZA 3W71A 3NZRA 4H7CA 3RJXA 2D20A 4ASTA 5GVJA 2J66A 2EHHA 2QYGA 3OZPA 1NWRA 3FKRA 2C6QA 3W07A 1G6CA 3V75A 3R25A 2EPLX 4JQ2A 4Q7BA 3TJXA 3EXSA 1C9WA 1E71M 4H6QA 2NV2A 2PDJA 4HA4A 1HGYA 5M1TA 4IPPA 3UG3A 1DVJA 4H2HA 4LUYA 3SM0A 1UD3A 3IS4A 4QE5A 4QRNA 3H7RA 1S3TC 2IQDA 2KZHA 4AZBA 3G1XA 4C6FA 4RDVA 3P81A 4RL3A 4DXVA 1BLIA 1R7OA 3C3NA 4B91A 2ZA1A 1OX4B 2F7FA 4ZMGA 4RDZA 4ZCWA 4YPJA 1H09A 3OO2A 3PZVA 3GW3A 2VZVA 3HG3A 4W4QA 2WOQA 2YL9A 2NT0A 2YA2A 2FQIA 4GKLA 2J79A 3TZFA 1LRQA 1RUSA 2VELA 2PC4A 3VMPA 2AQWA 3GNNA 4GQ0A 1C29A 3GS6A 3RCYA 1O6IA 3WD1A 2REQB 3BMWA 3EX4A 1RBOB 3STGA 3VVGA 3YPIA 2QT3A 3IV8A 1XYMA 4ZOBA 1J11A 3UPMA 1EJVC 1AFSA 1E1CA 3B0PA 3IGUA 2QUTA 5I77A 2BGSA 2FPYA 1W3NA 2WMIA 1HT6A 4JEJA 5JH1A 5G1TA 1OSEA 3GAYA 4D8LA 1E43A 1NF7A 1TZZA 3EPNA 1MFVA 4HU8A 1PKNA 3AIUA 4HIBA 3S1VA 2VRKA 1E70M 2RUSA 3UBPC 1POJA 2VEPA 1JEZA 4WOZA 4AISA 3CUGA 3L5MA 3VMOA 3BAWA 4Q7NA 4CKQA 1OINA 2E68A 1ECQA 5E6YA 2CBUA 2DIEA 1M68A 2ZCGA 4LT9A 3HBLA 4GY7A 5CG0A 3VKBA 4B2DA 2RJGA 4D8AA 5AHEA 5DCBA 3HG5A 4W88A 4ENLA 4KRTA 3G1VA 2ASHA 4Z0JA 3BGJA 3TR9A 5K9DA 4LOCA 4AXNA 3VKCA 2OX4A 4R7OA 5E1QA 3W82A 3NDYA 3RILA 2OZ3A 2HNEA 3DCPA 4WRHA 1XWYA 5KINA 4WKHA 5C9UA 3EA3A 1J93A 3G3DA 2PCEA 3TJIA 2CLHA 5E5CA 1OFDA 4FXRA 4O8RA 4U5IA 5IBXA 2Z27A 4CNNA 3E49A 4EKJA 1CGUA 4GH3A 4XZIA 4Q3MA 4GRSA 1FQ0A 1PXGA 4H2CA 2WMHA 3BTNA 2EO7A 1YDYA 2QR6A 3BH4A 2VDGA 1IXPA 2ABBA 2B31A 3H2OA 3QR1A 1EX5A 4L6HA 3EPMA 1VHNA 2GDVA 4V15A 1TWZA 4RPQA 2YDRA 5CBIA 2JF7A 3DFHA 4HJFA 1NU5A 5A2BA 3N2TA 4DN1A 3OVQA 1W3HA 4UTLA 3BV4A 4ADTA 1DWJM 1GKQA 1JF6A 5D8WA 1M7PA 1Z69A 5EFFA 1BXBA 3VIHA 4M24A 3A3HA 3TUUA 2VYOA 2G96A 2AKMA 2QCGA 2H3DA 5L6UA 1GZGA 1XCWA 1XLCA 1W1TA 1I45A 3IJ9A 5D03A 4HPGA 4PCTA 1J12A 3ITXA 1EPXA 1JQXA 3BW4A 3PPHA 4LVFA 2GJXB 3W88A 2OU4A 3BUVA 5ABFB 3HG2A 1XIEA 5FL1A 2BY3A 1ZLPA 2ZUTA 1V6XA 3O6DA 2VGGA 2YLLA 3CZJA 2FDMA 2NUXA 4GIEA 3ANVA 1EL3A 2FB3A 4FNQA 2V67A 3P2VA 2VXNA 3MBDA 3FEMA 3WO8A 4IFKB 1ZJIA 1T96A 1CGWA 2OG9A 1BHGA 2B4GA 3AXMA 3MP3A 1OC7A 5EMJA 2GQ8A 3THDA 4EP8C 3UWEA 1A53A 3RN6A 3MANA 2CLLA 4AD4A 3M5VA 1JRCA 3T78A 2QJGA 3U7VA 3DEQA 2CKRA 1BVNP 4Q4MA 5D05A 3ZFHA 4V27A 3VDCA 5ABGA 1EWDA 2QUVA 1EF3A 2GQAA 4X61A 4HCHA 3M5YA 2QIIA 3UZ5A 3KCJA 3TN3A 5IHRA 4HKPA 1UR4A 1C8YA 3G5EA 3GTFA 3IGHX 4AZCB 1DXFA 3H24A 2ISWA 1C9DA 3CAKA 3VCRA 4GHRA 3N29A 3RLGA 2BVDA 3GNPA 3SUWA 5F2GA 2A79A 5BYWA 1XRFA 4JCMA 2B7NA 5DCEA 2XVGA 1JCLA 3QGVA 3A22A 2W91A 2C15A 3VGBA 2F84A 5FJTA 1CGXA 4P5UA 1QNRA 4XG1A 5I24A 1V4YA 3VNLA 1QWKA 4M29A 3NSXA 2WPBA 3F4WA 3B8VA 4DJFA 1W3LA 3LMYA 5FEWA 4CD7A 3DG3A 1H51A 3TXZA 1HN1A 4QGCA 1XIDA 3R94A 2ZXDA 3TAKA 1RVGA 3WQEA 5DT5A 4W5ZA 4MHBA 3EDKA 1K8YA 4YXGA 1S39A 2ZC8A 3LENA 1IR2A 2ZZ5A 3GDLA 3OTRA 3ZS4A 5I3FA 4O28A 1OC5A 1WKYA 3OJGA 4ACYA 4QEEA 5KZMA 3S2JA 3VIOA 1PTGA 1DEDA 4IGNA 4P8WA 2FJUB 5BW6A 3VO0A 4M6VA 4W93A 4R27A 1T6MA 4GNJA 3O6CA 1MZHA 4JIPA 2A3BA 2VEGA 5GJNA 2CZVA 3NDZA 3OPSA 5BRQA 5I06A 4M6QA 3S42A 1KRBC 1B3VA 1FA2A 5HNTA 3VNZA 5C5YA 1RBAA 4Z2HA 2D0FA 4UQDA 3C2OA 3A47A 1YW1A 4XVEA 3CO4A 4PUJA 1RK6A 3VGFA 4PMOA 3S5ZA 4EK7A 4PTNA 2ZX8A 3N14A 4ZZ9A 4O1DA 3AHVA 4S38A 3FSUA 4GO8A 4UC5A 2Q02A 3HU7A 1R3VA 4KCTA 1FCVA 4IX0A 4LV4A 3BW2A 1XYLA 5C2GA 1EGZA 1ZU8A 3EBVA 4MJZA 1NDWA 2ZICA 1RCOB 2HXTA 2WM0A 4O13A 1W2PA 1V6VA 2VCCA 3R0UA 1S5WA 1ISYA 3RUBL 8XIMA 3T55A 3O63A 4ZQCA 1CWYA 1PZ1A 3OYZA 2X30A 3PTDA 4EXBA 4HU3A 2W63A 4KKXA 2XFWA 4UFHA 1OCQA 5HBFA 5KZ6A 1F61A 4DX3A 2ALDA 3LRLA 4MG4A 3MSYA 3STPA 1OF6A 3LXBA 1WOAA 1FH9A 1G4PA 4JFUA 3C2FA 3AMKA 3FDKA 1Q8AA 4CNPA 1CPUA 2OWCA 3S9IA 3W83A 3WK0A 1RD5A 1WZAA 4JL2A 4WY0A 3HTWA 4GJJA 4CQCA 2WKLA 4B4HA 4C60A 5HANA 2IXUA 3REQB 4DPQA 3W24A 4W8BA 3JW7A 2DORA 2J75A 5FJUA 3RR4A 3HQNA 2Y70A 2PWHA 1GOKA 3EA1A 3HF3A 1V6UA 3OG3A 3L21A 4J27A 2DZSA 3LGDA 5DY2A 4LW7A 3WDHA 4GXWA 3S6OA 3TP4A 2PLKA 1R5YA 1W8SA 2O4QA 4HHPA 3U0HA 1UD5A 3F2CA 2DFAA 3INPA 5XINA 2HSAA 2INZA 3MUZ1 1F76A 1TZ7A 2OQYA 3A23A 7REQA 3RRXA 4FLOA 3THQA 3WLLA 4O50A 4KIRA 2NUWA 2XH0A 4P8VA 3B03A 3LSBA 3MZNA 3GFXA 2VTFA 3VIGA 3QC0A 4LSBA 2EJAA 4XO7A 2BMBA 3GG8A 4C6PA 4K1WA 4WIWA 3GTHA 1EH9A 2X0HA 4OTKA 4I9AA 2P53A 1K9DA 1XIBA 4GUJA 1E15A 4K6AA 4BF5A 5AHMA 1XW8A 5FACA 4W85A 1TPVA 2OYLA 1H11A 3SSZA 4IICA 4J7RA 1QTWA 4GYPA 4WJEA 4L61A 4J3WA 1FX6A 4HNNA 3KOFA 1SYTA 3SUVA 1DIOA 1OK4A 2QMKA 2WPGA 4PMJA 3II1A 4GX8A 1K03A 3CC1A 5HULA 4HSNA 1V02A 4DRSA 3QKEA 4GKTA 3GUGA 3P14A 1WAUA 4E2VA 6TAAA 2X05A 4OJYA 3RM9A 4JIEA 1LT7A 1LG1A 1ZBKA 3BURA 3M0HA 1NOWA 3VKJA 3CMGA 1XPYA 2DSZA 1GVOA 4LCSA 3RU6A 1LYXA 1ONWA 4S39A 2NVAA 4AVFA 1ITUA 3AS0A 3LDVA 2G95A 1Z3NA 3I3EA 1EA0A 1OD0A 5HMEA 2BTMA 5DLCA 5DBTA 1CT5A 4NZ5A 2XH2A 1FWAC 3PB0A 3SECA 4YTUA 3SRFA 1VFOA 3U3HA 1A3XA 1KV8A 4HOZA 1OY0A 3PZUA 2GVEA 4CQDA 2A5HA 1E72M 3GRIA 3ITLA 3KOZA 3H7UA 3RCNA 2BGNE 1Y65A 4X2PA 2VR5A 3KL5A 1VLWA 4J4KA 1H49A 1JXKA 4HNVA 1CX9A 3HFYA 2XZ7A 4I9MA 2VFIA 3GH5A 2ZXQA 1UCWA 1SZNA 3PUGA 3F7JA 3N2XA 3N25A 1I2NA 1R86A 2WJDA 5HPCA 2QPXA 1QWGA 3OB8A 1D3HA 4N9BA 5K9CA 1NARA 1NFGA 3NCOA 3PJTA 2JKAA 3TDFA 3WQ6A 4KWWA 2PE4A 2QCFA 1J6OA 4PEKA 1X1NA 1NEYA 1JYWA 3T09A 4EACA 4ACZB 4J28A 2QQ6A 4MKSA 1I2QA 2ZZ6A 3CB8A 1KFWA 2I16A 3HM7A 3FHAA 4O18A 4GLEA 4UTTA 1UA7A 2E6AA 4AZ6A 4QE4A 3AIWA 5EA9A 2V68A 1AH0A 4MB5A 5BWFA 2NVDA 5E0KA 4Q6JA 1LQAA 3GTXA 2BODX 2X0YA 4L1XA 1LTDA 3IANA 1I2PA 3QR3A 2WSKA 4G8TA 2FIQA 2P3EA 2FGLA 2HVOA 4REQB 1HKIA 2IPFA 1OVDA 2PPGA 3QVQA 1I1WA 5I02A 4XSMA 3MI2A 3SUUA 1VC4A 3B3DA 3EX2A 4BFAA 3DG6A 3LCXA 3KP0A 2O9OA 1EKOA 3MKVA 1JQVA 2PDXA 4RJEA 3M7WA 4OOZA 2ZUMA 3CHEA 4OBRA 4JX6A 3WKZA 1HKJA 5FD0A 4MIMA 1EOKA 1QDSA 2ZIDA 1MUCA 5DX7A 2YKKA 2ZXBA 4OBSA 1U30A 3U5UA 4A8LA 3BCDA 1D9EA 5RUBA 1UZ4A 2GL5A 2WC4A 3QTGA 3ZLGA 4NQ1A 4XBKA 5B7YA 1W32A 3FA5A 5I7GA 4I90A 3GR8A 3W7GA 3SCQA 2CXGA 3QKZA 5HAOA 3TOPA 4HYRA 3LV6A 4G6CA 1Q85A 3CM4A 1SJAA 4UTWA 4AX7A 2H8XA 2R1KA 1UROA 4A6GA 3LCLA 4LF2A 1H7PA 2G3MA 1LOSA 4UR9A 3GW0A 1TVLA 3W72A 2ESCA 2GVJA 4NJGA 4PR4A 5AHNA 1XC6A 1ZCCA 1B9BA 4O53A 1XLEA 1VRDA 1VR6A 3EX1A 2X1RA 5C6MA 1I8JA 4PH6A 2OSWA 5C8BB 2PDGA 1FOBA 4Y7EA 3O2LA 5ABEA 1J18A 1KGWA 2DSVA 1DL3A 1TJPA 1PIGA 4LXFA 4DZ5A 1CIUA 2HEJA 2POTA 2J8FA 1XGDA 4IL2A 1C93A 4W89A 2Y85A 3PZMA 3K4WA 4LS2A 4Z2KA 3UQNA 3STEA 2V8ZA 3DOPA 3WH7A 1FFQA 1TRDA 4GMEA 3ICJA 2ISFA 4MPKA 1SW0A 3N34A 3WQPA 3CHVA 4ZBCA 4LNCA 4O19A 5CZSA 1ZCOA 3GZ3A 1UR9A 1EDQA 5CJ5A 2XIJA 3AALA 2PTYA 3AOFA 2EJ1A 3V4BA 1T7LA 5E0FA 4D6IA 4HOXA 1WDPA 3VDHA 5BCAA 2ZOXA 5REQA 4H41A 3PP7A 1EC8A 2OLHA 5T91A 3O0KA 3L2MA 5SWUA 4DM1A 4V1YA 4ICNA 1F6YA 4DJEC 1K6AA 1CB2A 5ECVA 1XYCA 5A5WA 1M3UA 3G1FA 4O14A 1AJZA 4B5VA 2VR4A 1JULA 3P0XA 3ITYA 4AW7A 1BXNA 4PRRA 3S1XA 4GUIA 3NQFA 2XM2A 3U2CA 3ARWA 3KRZA 4DIAA 5HJLA 1KGUA 3I7RA 4OV4A 5CZ0A 3W7RA 3URQA 4US6A 1O5XA 3EWWA 2CXEA 3L0NA 4O0KA 2Q8LA 4UFJA 3GXMA 4KCVA 5CPTA 5CSYA 3HGOA 1MVYA 2Y89A 4XZMX 1S2UA 4TTGA 2QPSA 3UVIA 4KWVA 3DUGA 1ODZA 4N4PA 1E9ZB 2R1NA 5I6SA 3B8UA 1G4SA 4JTIA 3AZTA 3WMCA 4RE4A 2XHYA 3GAKA 3NPUA 2J8GA 3T42A 1P0NA 2Y5EA 1DHKA 3S8HA 1DP0A 1CLVA 3LRMA 3LUTA 3EKZA 3W7MA 3COTA 4F79A 2QIWA 2WZEA 1NOUA 4MZYA 1F3WA 1UH4A 5XIAA 3B06A 1FCQA 3M0ZA 3T0DA 3G6LA 3VNIA 4PMYA 5K4XA 4J3UA 1TE1A 2INFA 3HO8A 5FF7A 2GUUA 2GJRA 2CCRA 4GZJA 2O7QA 4ZQMA 4K7YA 3VAVA 3N9KA 1E40A 3KBVA 3WQVA 2VGBA 4ATWA 1FWBC 3JZUA 3VD4A 1BF6A 5FL0A 1PDZA 3R5EA 5EGRA 4DF0A 4L5ZA 1KNWA 2VT0A 3KOWA 3WLMA 4I5RA 1IZKA 1UMLA 1VAHA 3HN3A 4HCDA 5EL1A 5T9BG 4HB7A 3MV11 2PP0A 2R8WA 2AGTA 3TQPA 1FWSA 2X8RA 4O1EA 3FYPA 3OBAA 5CPSA 4EX4A 4LJ3A 1U1HA 1EP2A 4QQUA 3PZ9A 4KRZA 3HQ1A 1XLDA 5CCZA 1CXFA 3UYCA 2DUXA 4CQ8A 3FAXA 3FJ6A 3LA4A 4JTTA 1F4HA 4MADA 4H9XA 1GW9A 2UZ9A 1TG7A 5FI8A 1D3GA 1RH9A 4IPJA 3EA2A 3ARUA 1U33A 3B0YA 1SMDA 4LUSA 3H4XA 1TMQA 1V3JA 4TV5A 1TWDA 4DJDA 3AZRA 1FKXA 4M1RA 1HIZA 3GYEA 2VP8A 5F1VA 4LEFA 3OGVA 4CNSA 3LLDA 2GGEA 2PDHA 4WSHA 3RYSA 2TODA 3SRDA 3SZ8A 4QNEA 4RW3A 3AYSA 5LA0A 4Q33A 2FTPA 1RXOB 4QG6A 4UR7A 1EJTC 4DZAA 1JG9A 4PMRA 2W92A 5CC6A 4B5UA 1YADA 1GJWA 2WZHA 4AEFA 4UTFA 1IEQA 3AHZA 4S3EA 1IYXA 2FPVA 1PX4A 5JBEA 3KRUA 4TV6A 4Q22A 4X0VA 1IGWA 1FY6A 2I57A 1G7VA 2Q71A 3DECA 2YJQA 3L66A 1LBMA 4MLJA 4IXXA 5CH9A 2EG8A 1JZ4A 3R8RA 2CLMA 1QJWA 3RMJA 3LGGA 3QMRA 3TEVA 2G4FA 2JIWA 4ORMA 4IUGA 1EA9C 2WC7A 4F3HA 3G24A 4B15A 2W3ZA 5DCDA 5IFTA 4AUBA 1DE6A 1R2TA 4CD6A 1X8CA 3FGCA 3ZXWA 4F9JA 1QVBA 4D6DA 1S5MA 3TTYA 1HTIA 2PODA 3C52A 2J24A 3ENLA 1ISWA 3NYDA 2G50A 5AYZA 1XC4A 2OR2A 3BJSA 3WF3A 1XYFA 3BOFA 3LCHA 4PUWA 4E3TA 4NU7A 2VOMA 4D1JA 4OUEA 2EBNA 1V51A 2Z2AA 4JHMA 3PG9A 4JTQA 4UQAA 4ICCX 3T40A 4BF7A 1P4CA 1ME8A 3GTIA 1E73M 1PBGA 2V3DA 3E0VA 3N04A 5EMYA 3C2EA 2HNHA 1EDGA 3BSGA 4DJED 1NSJA 3RPMA 2EPNA 3WH6A 1AQMA 9RUBA 4XO6A 3W2MA 4H19A 5DXXA 1LLWA 2ZFAA 2EXOA 3W9ZA 2PF8A 2I5GA 5C9ZA 4A3RA 2HTMA 1HGWA 4HNOA 4UOJA 3UJRA 5A1AA 1JIBA 5A8OA 4L4MA 4JFTA 1EQCA 1PSCA 3CNYA 1PEZA 4C90A 1P7TB 3PZGA 1ZQ5A 1E4LA 4GZIA 3OGSA 5M3WA 2FDSA 2ZE3A 4ONVA 3EWYA 3EOLA 3TMQA 5A8NA 1LUCB 1FWDC 3UA3A 4HA0A 4M8UA 3WL1A 3MUXA 5A6JA 1BKSA 4M82A 2DU2A 2OMAA 2AL2A 3UXDA 2KAUC 8TIMA 3CUXA 3TH6A 1R3WA 3E1F1 1KFCA 3PUEA 4DUWA 3PHAA 4F0KA 1SU5A 1T41A 2G0WA 4KF1A 4DJDD 3HV9A 2PD9A 1OBAA 1RK5A 3OOQA 5E09A 3MYOA 2WHLA 2VI0A 3IJQA 3HJZA 1Q6DA 4XAYA 3CMJA 3BGGA 2OO6A 4K8HA 3DN5A 1HKMA 3E0WA 4EIVA 1GZJA 3F03K 4FX6M 4LBUA 1SZFA 3TQKA 4ZEPA 1GEQA 5K9XA 1GQNA 2IKJA 2A3LA 3QLLA 1F7BA 3G3MA 3LBMA 1G5AA 2YB1A 1JRBA 4RNIA 4FNTA 2DT0A 1EUNA 4QEHA 5D2YA 1E4MM 3AFBA 3KS5A 1K4HA 2VEKA 1QNVA 1E4NA 3SO7A 3DI0A 3CEPA 3NURA 1DJZA 1XLLA 1A4LA 1PIIA 4BI5A 4LEQA 3ZWSA 4UFIA 2P88A 1Q6GA 4EPDC 2XIOA 3L9CA 4NP7A 2YXXA 1QT1A 3PTQA 1RCXB 1E6NA 3QPEA 5EMMA 1K1DA 1W1YA 4UTIA 3CTTA 2FZNA 1R30A 4HMCA 4PMDA 2VCBA 1GPWA 4NZCA 4WKFA 1QOQA 2I5QA 5LNVA 1J0YA 4PL2A 2GVGA 1R3RA 3RITA 5BU9A 2XVKA 3BOLA 3UXAA 4Z0SA 4PMNA 3BGAA 3A9BA 3UERA 3W7OA 2FVMA 4XAZA 3EDDA 1FHUA 1HJUA 3PK7A 3KCOA 3EZ4A 1MFUA 2JKEA 4LUIA 1KXVA 4XISA 5LYRA 3A4WA 1SGJA 1JZ6A 4Y8EA 1NF0A 8A3HA 2JALA 4RV8A 2ODOA 1VBGA 3CUIA 4WLCA 3DDMA 1NM9A 3W87A 2WVTA 4TO8A 1W0MA 4CQBA 2WB5A 3C0QA 2PGRA 4M51A 5F2IA 1LROA 1DQUA 3URAA 4Z1BA 4FOJA 5K4ZA 1CENA 1OCJA 1QCWA 5FEPA 1ZAIA 2G3IA 3NPWA 3TJLA 3W1MA 1NWUA 2IMRA 3AJ7A 2R14A 3GFZA 1AD4A 3UWVA 4C6BA 5AYIA 1W6TA 1UR0A 3VIKA 2VR2A 2VJXA 3ZMRA 3PSWA 3IIOA 4H9TA 3LB0A 4Z08A 3MDWA 1CECA 3WD0A 1AW5A 1S2VA 1AQ0A 3DFOA 4ROPA 2WZMA 4M81A 3VINA 2XISA 4GI8A 4KWSA 3W3OA 2PWVA 1GCYA 1PJ9A 1EUAA 4TR9A 3T44A 3L4XA 3IWPA 3PN8A 4MY1A 4RE2A 2VNCA 2V5JA 2DZUA 1US3A 5IXEA 1K9TA 4DO5A 3VDBA 1BYAA 2XYLA 5AC8A 3UZXA 3QTPA 3EWUA 3CIXA 1H63A 2J7GA 4S3GA 2AAMA 4EXQA 1YNQA 3DENA 1V7AA 4DHGA 1TVPA 3MW7A 2DJLA 4EWND 1MZRA 1KM4A 4M1BA 3VYLA 2DZTA 5ENLA 5CPOA 3VA8A 5AHFA 4GQBA 5HQEA 3M0JA 3PNZA 5HINA 4UNKA 1AODA 2MUCA 4GBUA 3LTSA 1UUMA 1RJQA 1B3WA 2O92A 3QV9A 1LDCA 2J7CA 2V30A 4P7QA 4ML9A 3SADA 1W3IA 2O4MA 4D6EA 2QJIA 4ZSUA 1IT7A 1IEWA 2XVLA 4H4IA 3SBFA 2VFHA 3ITGA 1NFBA 4B90A 3S1UA 1W1IE 3J7HA 1NOFA 2YCJA 3PWIA 3EEZA 4IIDA 4WGXA 2C0AA 1JL8A 2CHNA 2VFEA 5KETA 4FIRA 4MWAB 2TMDA 1RQBA 3VPLA 1LG2A 2PTWA 3IIPA 3PZIA 2HBXA 4N6EA 4DAIA 1QO5A 1O95A 4GYKA 5GPRA 5I00A 4R85A 3H8AA 3G6MA 3DYOA 3WUGA 3GXTA 1IEXA 1D3CA 3WBWA 4Q4RA 3JRKA 1QI4A 4MZ1A 3GKAA 4KCWA 4H9YA 2L5HA 2DEPA 3Q65A 3CASA 3NOEA 3KWSA 4BZYA 3BAYA 1ITXA 1DORA 1WXYA 3EEGA 4NIRA 3W53A 3CK5A 2PDYA 1BKHA 1P6WA 2R1PA 4HPNA 2H90A 2F61A 4FHAA 2DZXA 2GLKA 3SB0A 1JZ5A 4DAFA 2BS9A 3FW6A 5D02A 1LWHA 1NFPA 2I9EA 3S5YA 2J78A 1HX0A 1MI3A 3TSMA 4ZXLA 3DH7A 3KX6A 3UVAA 2W4XA 3I4EA 2R24A 4K1GA 2DVTA 4WEVX 1H2JA 1FXPA 2RHGA 3JU2A 3THAA 3E5BA 4TIMA 1CXEA 4BI7A 2Y5JA 5FAJA 1ZJHA 2OLSA 3T81A 3SUSA 3B05A 4AVOA 3RX2A 5T9CE 1X1ZA 1XS2A 4QDPA 4C7DA 3L4YA 4UR8A 1PKMA 1PX3A 1N8IA 2WSQA 1TPWA 4YJ5A 3OQ8A 1M1BA 2XGZA 3WELA 4GZ7A 2BB0A 4IF2A 2GOKA 5D2VA 3D6NA 4GGBA 4ORIA 3UFYA 1JYVA 1RSCA 1P6BA 4PMVA 3KTSA 3NGJA 2XINA 1H61A 1DQWA 1M53A 3EWCA 2Y24A 1V93A 2CLPA 1K7FA 4TOQA 4PUUA 3CQJA 1E6XM 3IJ7A 5D2TA 3KS6A 3C86A 3KZPA 1XV8A 1ZL1A 4KEVA 3SQSA 1AG1O 1ZTVA 3K8KA 1F8IA 1PKYA 3UCCA 3TW7A 2DW6A 1ZAJA 5AY7A 4LUTB 4YN5A 3K4DA 3QPZA 1UZ1A 3E96A 3SRKA 2DT2A 2QV4A 5G4WA 2PDKA 3FXYA 5EMKA 3ORWA 4DEFA 4ZE5A 4PSRA 2GJLA 1BWLA 5A8QA 3AIEA 1ADSA 1DJYA 2I7GA 4LVAA 4Z1CA 7A3HA 2O9TA 2AAAA 2PB1A 4KGJA 3ZVHB 1BTCA 4Z17A 1BG9A 3BCFA 1A80A 4Y90A 1J5SA 1QW8A 1EP3A 1N55A 1M04A 1KM6A 5EBAA 2VCAA 3BC9A 5TF0A 2Z6IA 4UOQA 3VKAA 2QZRA 3EB2A 1I2RA 3W74A 3VM5A 1P0DA 4IUOA 4JTKA 1GYLA 3K4AA 2NXGA 3ERPA 1FCBA 1P43A 3GXIA 2EKCA 3EOUA 3MMTA 4YL2A 2GYIA 4LNYA 5E0CA 3C56A 5MHBA 5D33A 3OA5A 4F2UA 1MEWA 2VDIA 1FUYA 2FZ8A 5DFAA 3P7YA 3HG4A 4P2VA 2LLEA 3CZEA 5BXTA 3M0IA 2OXNA 4TMCA 4PTDA 3WJWA 3RHGA 3I65A 1ISVA 3VZYA 5HMFA 3VMNA 2ZRVA 1G1YA 4GCAA 1JCTA 1V0KA 4U31A 4BQ3A 3HMCA 3OP2A 1HJXA 2CFFA 3MCNA 3IJ8A 3KZSA 3SCOA 3WD2A 2X42A 3TTEA 3VXGA 3G8RA 1MW3A 3AUOA 1M9HA 1FWTA 4UCGA 3LTPA 4PMUA 4DWSA 4GK8A 5D09A 1R9XA 3NQ8A 2HS8A 3PBMA 1S3HA 2PP3A 3TW6A 1R85A 4IM4A 1XSJA 4MFEA 3LY0A 4AX6A 3L0KA 2WWDA 1QOPA 1JF5A 3M5ZA 1CEOA 3EOOA 1KD0A 1TZ9A 5IFPA 3MHFA 1VZWA 5CPLA 1A50A 1WZMA 2XIMA 1UBSA 2ZC1A 1SZEA 2J13A 4XWUA 2YR1A 5CAHA 1TUFA 4LAOA 2BFGA 2NSXA 2P0OA 2D2GA 1LLOA 4KIEA 1XBYA 3BCJA 1DQXA 2CBJA 3OA3A 1IXNA 4FIQA 1JAKA 4QR6A 1GOQA 4W9TA 4ZB5A 4WJ8A 1TPB1 5B7ZA 5JXQA 4C7FA 1N8FA 2FMNA 5TBOA 1KLYA 5H2ZA 1ICQA 4GY1A 3C8FA 1FWNA 2XIIA 1VJSA 2QJHA 4LY4A 4R7JA 5DQPA 3A3XA 3KHJA 2V5DA 4LVBA 3LHUA 4PSPA 3H2AA 1XM3A 1NWSA 4J3TA 3WD3A 3QZ6A 3RAOA 1MEHA 3FA3A 1E9YB 3N2OA 5LNWA 2QNEA 3I10A 2HV5A 3SCPA 2D24A 2XWEA 1GYMA 2D2JA 3PTKA 1QK2A 4QTGA 1A3HA 2HWGA 1U22A 1RQEA 3U57A 3GNDA 2MANA 3HOJA 3P5ZA 4MTVA 4O16A 3LZ5A 2A6LA 1UKPA 2H8ZA 2J47A 4C65A 3CT7A 5CJNA 1SFSA 2E9BA 3FA4A 3ARZA 2XN0A 3MPGA 4B5WA 3UR7A 3V1PA 2BG5A 2PF0A 3WLOA 4GIYA 5DF0A 2NX1A 4FOUA 5HPOA 1TO3A 2WMFA 3O9NA 3P62A 1KB3A 1GVEA 1AQHA 2BZNA 4JQ4A 3E0FA 3R12A 3GC2A 4KEMA 3MMDA 5B80A 1O7AA 4MYAA 2JBMA 4LH8A 4MWAC 3GNXA 3H4WA 3M64A 2OX1A 3W00A 4PBFA 2X2GA 1FWRA 5MKGB 3E38A 2GDUA 4FR1A 1A5OC 3M44A 4M80A 4AF0A 1X6LA 4RW5A 1XDLA 1KTCA 2NT1A 1W56A 3WCZA 3WK3A 1NELA 1JDDA 1RR2A 3B97A 3GO2A 1V6YA 1VQTA 1JDAA 5LHEA 1SFJA 4HTBA 3FSTA 4CNUA 4ZQRA 1SM9A 4PB4A 4AAJA 3EWZA 1E5NA 1A5MC 4BKNA 1S2CA 2PGEA 3S5NA 3SDOA 4F8XA 8CGTA 1Q7ZA 3SY1A 2WCAA 1KM3A 1NIUA 5FCZA 4YTSA 2DZAA 3CL6A 3IJIA 5F2LA 3TR2A 2C91A 4PGLA 2G8ZA 2QCCA 5A6BD 4ML4A 4ZOAA 1E1FA 2YPIA 3AIVA 4A3HA 3VUSA 3A21A 3V0SA 5DEZA 4B5XA 2PU1A 3IUHA 1HVXA 4Z2IA 3P80A 3GUWA 3W1XA 5AFDA 3H2FA 3DFNA 4D6JA 3GD6A 4IIBA 3USBA 1DOSA 1OFBA 4EF8A 2C71A 3SUTA 1SSDA 3LBCA 3ITCA 4JXCA 1UIPA 4J1OA 3LM3A 1TA3B 2DT3A 1KXHA 4C6OA 4LANA 4JOMA 4E2BA 4OT7A 2P3ZA 4CLMA 1YTKA 1XBVA 1FDYA 2J25A 1QMLA 3KBNA 1AZ1A 1OFEA 2OCZA 2OB3A 1V3MA 3MBFA 3RLHA 1WDSA 3NDOA 3SCVA 2ZUSA 4V2XA 1ZBCA 2BWGA 1FBAA 1IWBA 4RX0A 4GNVA 4O8AA 3UXIA 1WPCA 5EPDA 2ZKMX 5DRIA 4QHRA 4G9PA 2ZVRA 1DWIM 2ZE0A 1YTDA 4H9ZA 5HWJA 3T08A 4DO7A 2DV0A 3ONCA 4GFSA 1EO5A 6XIAA 4OECA 5ECUA 3GR4A 3H70A 3FX4A 2Y8KA 4A29A 1NP0A 4IQEA 3QBUA 4O15A 3WL0A 4HZ8A 3W86A 4CQAA 4LS0A 2WNNA 1PZ3A 1XF0A 1H0GA 2ZWYA 3C6CA 3EX6A 3NZGA 4AWSA 3NUKA 4XX6A 1EHNA 3BOXA 3VD5A 3IAPA 4AMCA 2A7PA 1IR1A 3NJ3A 2V9DA 4AIBA 2QJJA 3NO1A 1BD0A 2YBTA 1QOXA 2WWCA 1X97A 4OUIA 3QHMA 4PB3A 3U7BA 4V28A 4OBTA 1LP6A 1UWSA 3WJXA 1DTUA 4XZWA 4QQ3A 3DG7A 1ME9A 2P1FA 3LNPA 4MFDA 1BYDA 2GWNA 3NQDA 1QPKA 3U4FA 5DY3A 1NAL1 2ZX5A 1JGMA 1LQ2A 2WCSA 1YYAA 3W2LA 1DJWA 4D6HA 1W2VA 4LC8A 4AWEA 1O1ZA 3CYJA 4NSBA 1E1CB 3S9YA 1AD1A 3URBA 1BVWA 2WMIB 3T2PA 3RGTA 3SCSA 4H6KA 1H5VA 1XLMA 5HQMA 3ARTA 4GA8A 1BF2A 3W6LA 3E02A 3U5YA 4CNOA 2XFFA 4PL1A 4EPBC 2QF8A 2VX7A 1Q45A 2Q3OA 2QCNA 1TRIA 4A2RA 5IOBA 2YW4A 4CCEA 5BNKA 5I5RA 3IARA 3GK0A 4YIWA 2BHUA 2P8CA 3EWXA 3WY1A 3I3BA 3HQPA 2GJPA 1HJSA 1CLKA 4X60A 3SCRA 1ZBVA 3L4WA 4HNCA 3CQKA 4GACA 1EC9A 1JJKA 3I6TA 4WDUA 4UQ9A 1PCKA 2Z2BA 2OJPA 3M0VA 3GVQA 1E0WA 5DMNA 1DWGM 3LQGA 1GOIA 2NLIA 3NPXA 1JPDX 3CV1A 3NOYA 5LIYX 4LRTA 5K7JA 1OGSA 1TV7A 3LXAA 2P76A 2OZ0A 3VD9A 1SMAA 1EIXA 1PCWA 2XFYA 1RLDA 4HMNA 5KTLA 3ZT7A 4OVXA 4PTWA 2PI6A 3N2MA 3QGKC 1X7FA 1KQZA 5E9XA 6REQA 1RJRA 3UG5A 1MEIA 4AD3A 4AMAA 1LZOA 2X09A 3OIHA 4QCFA 1S5VA 1H62A 4MWAD 1VFLA 3W7EA 2NVCA 4YTTA 7ODCA 3TC7A 4IGMA 3KRSA 1REQA 4IZGA 5T8GA 3TYCA 2W0UA 4FNSA 3TAOA 4JYDA 5BMWA 3WBAA 4DBWA 3VIMA 1FDJA 3RR1A 3WLPA 4IMEA 3AMDA 2GDQA 1FCUA 3VIIA 1TMLA 2ANUA 4DI9A 5CQ1A 1P0EA 3LQLA 3AZSA 1DJQA 3TYAA 2XDFA 3M7SA 1M7XA 3CV6A 4GXPA 4WSKA 2FHBA 1UKOA 2FFCA 1J0HA 3LN3A 1FWEC 5G1YA 1XISA 3WEMA 3NZQA 1XSKA 5G1MA 1YPFA 3PANA 1YBQB 5A8MA 5BRBA 2OKOA 1E3XA 4XBJA 1ADOA 4ZO8A 1G67A 3S47A 4EPKA 3PSVA 3NZPA 1L6YA 2VVSA 3ABSA 2CETA 3K30A 2PLCA 2ZRYA 4D6GA 1XHGA 3BAIA 3V0TA 3A4AA 3DHUA 1RPXA 2OYKA 1H0IA 2VX4A 3UJEA 4RDWA 1W9XA 1DWFM 3VE7A 1RVKA 3APTA 1M01A 2J7HA 3H12A 1A0CA 1W1VA 3CAWA 4GBDA 3SRHA 1QUMA 4ALDA 2D22A 1S5NA 3A9IA 2YL8A 3EMCA 1FDZA 3FAWA 3UESA 3QMSA 2I17A 2HZGA 5CC5A 4DUVA 1GEHA 1K9EA 2Q09A 1XG4A 3W26A 1LJYA 1R2RA 2GVLA 4H8UA 1VYRA 4BWLC 1PX8A 4RNHA 1BFNA 3UT0A 3GDKA 1F3XA 3D5HA 3VNYA 5A8PA 2DY3A 4QSFA 2ZDRA 3F4DA 1YRRA 2F6XA 2G3FA 2NQ9A 2QUMA 1BYBA 2BOEX 2IPWA 4JNZA 4R9XA 2CC0A 4NJKA 4HSOA 3TMLA 1T40A 4HSHA 2ACQA 3H23A 4MY9A 4M5PA 4XAPA 1K77A 1WV2A 3R0KA 1NTHA 3ZT6A 1DJGA 3DKLA 1PYFA 1JZ8A 1EX1A 2DUZA 4QLKA 2NWRA 3JS3A 3KBJA 3UP8A 4RE3A 2FVKA 3IUDA 4NZ4A 2WYSA 1Q4NX 3BPWA 4F0RA 1O94A 3UW6A 4BQ4A 2EKGA 4CGTA 3M0LA 4C1KA 3ZSSA 3WMBA 2A7NA 3S3GA 1EO7A 2D2OA 2FZDA 3KBMA 3Q67A 5CGTA 4C6KA 2CLIA 5AC4A 4Z2JA 3T1GA 3RO6A 3VOCA 1FWHC 2C79A 3F5LA 3IIXA 4HU0A 1VD6A 4TMBA 5AB3A 2DSWA 4MKVA 1X96A 2QLYA 5FESA 3ZJ6A 4ZSTA 3P3BA 3OVGA 1MNSA 5E6ZA 1HKKA 3TSDA 3CAVA 4UQEA 1THFD 2VEFA 2D1ZA 2ISVA 3G0SA 2Y7FA 1XD0A 3OLIA 3C0SA 3F4NA 1AUSL 4UUIA 4PRWA 5E9AA 1JPHA 5HDRA 4Q8TA 1PDYA 4AC1X 3BQ6A 3F4CA 1NQ6A 3ITTA 2P10A 5FEZA 1MYRA 4AZIA 1XL9A 3VI2A 1Y8BA 2DH2A 3W1UA 1NVMA 1LM1A 4R88A 5J8LA 1VBUA 2VD9A 4HYVA 3UYIA 4GUFA 1W9DM 3AS3A 5I03A 3EDFA 4IGSA 4NG3A 2RGMA 3LHYA 4HBKA 4WR3A 4DO6A 4QLLA 1CB7B 1DXEA 4Q8OA 4CCDA 2PC8A 1XIMA 5JIWA 2CWNA 3V16A 3D3FA 3KRBA 4DLFA 2TSYA 1UP0A 3D3AA 4GQRA 1KBKA 3ZJ8A 4BEQA 1SW3A 1C8QA 1WX0A 4V33A 1WNOA 4JTRA 1UHVA 4AWTA 4US5A 2IQ0A 1V5XA 1OFQA 4UWMA 5BXRA 4FNRA 4J9JA 3FXGA 3WSUA 2WNWA 5FAGA 3URNA 2YA1A 3QMTA 2OEKA 3LS9A 4C6EA 2BVWA 2CW6A 1B4EA 3UZJA 1KXTA 1H1YA 1MW1A 1H41A 3TK7A 3WH5A 4HMDA 3WNOA 3ZR6A 3OHMB 1K6WA 1WUEA 3FFSA 1RALA 2VURA 2RKXA 3ANUA 5AECA 4FB7A 2BSLA 6ENLA 1RPKA 4DNMA 5DN1A 4IX2A 2CZDA 1VFFA 1TPEA 2OWXA 4WY0B 1AK5A 1MXSA 3IIZA 1BRLA 3G8EA 3N17A 4BR1A 4K2SA 2BBFA 1B57A 3IVUA 1XH0A 5A3HA 3K8MA 4ZODA 1V0NA 1GNXA 3MHGA 3A64A 4X22A 1Y5VA 4GJ1A 1SFLA 5LIUX 3I7SA 4IMAA 2H9AA 4FF7A 1S2TA 4RXGA 1L6WA 1UKSA 4FI4A 4HU4A 1CXIA 1E56A 1UQYA 3O07A 3ITOA 3PG8A 4B92A 4PUKA 1KRCC 1K02A 2VZUA 5IBXC 3VFLA 7REQB 3CUZA 2EQDA 3W28A 4LBSA 5A6AA 2Q8ZA 4PUEA 2D3NA 1GHRA 4E4FA 3FY1A 3ZQ9A 3VX1A 2ZZ7A 2V2HA 3GR7A 3U6WA 4QDMA 1C90A 1W8GA 1GONA 1PB0A 3A4XA 4G1NA 4DBUA 5IM51 2PTDA 3Q37A 3GE7A 5BROA 3ECQA 2PTZA 5AHLA 1KBLA 3CLMA 3B40A 1MDRA 2EPKX 1OZMA 1J4EA 4HMEA 4E5TA 2WKGA 3CPGA 5JIPA 2OTDA 1PVNA 1QI0A 1XBZA 1XKYA 3CHFA 3T2QA 3H55A 2PRMA 2Z25A 1W5PA 2EPOA 4DF1A 1AW2A 2WHKA 3WNNA 1HKWA 1W5NA 1OADA 4RUBA 3VIJA 3VX0A 4GVGA 4WDWA 4DYEA 2PGWA 3SQMA 2ACSA 1Q8JA 3BAXA 4JDYA 3DX5A 1R47A 1TMHA 4NZJA 3R7MA 1Q2RA 4G1KA 3R43A 4GUGA 2YDAA 1VIWA 2YOCA 2JQXA 3N6HA 2Z1BA 3MP4A 2WHMA 1UZHA 2WSYA 4QITA 3SJ3A 1UPPA 4EAYA 4FP1A 5A6TC 2ISSA 3WEOA 3ZR5A 1KO0A 2QXWA 2PDLA 4E8GA 2PZ0A 2PBOA 3PR2A 2OLAA 1J0JA 1GOXA 4WDXA 2J9YA 3SR7A 3G0UA 5U4NA 4D2JA 1VYSX 1VYPX 5FOOA 1BTMA 3K1GA 3AICA 3LHTA 1O5QA 3NO3A 5AZ1A 2C19A 2WSPA 3TWBA 4PZVA 5D30A 3VNJA 4S3BA 4IGHA 4U2YA 4D9PA 2VKZG 5KZDA 3SCTA 1N82A 4YHGA 4ADUA 4X2RA 1OGGA 2ZZ2A 5DRCA 3CLWA 3S0CA 1FHVA 4IP4A 1A0EA 4JFVA 4HP5A 5DO8A 1DJNA 4GH1A 3IVSA 1J5TA 4JDBA 1HXJA 4BJHA 4IG2A 4A2SA 4INFA 4AHOA 1GVYA 2XVPA 4KEZA 4HTYA 4JFWA 1JCMP 1UKTA 2FB2A 1EBGA 1VPXA 4FPSA 1YBQA 4CN6A 4XKYA 4A05A 1AJ0A 2W9MA 1Q13A 4MM1A 2D23A 4RKAA 3UD6A 4O52A 2PDFA 1GWJA 2XVNA 1TIWA 1KWKA 4EVZA 2FTYA 3N1AA 4DJFC 2PWUA 3U48A 3B4UA 3W22A 4H1ZA 4EE9A 3PBUA 3OVPA 3H21A 4MY8A 3PBVA 3GY1A 6PTDA 2HBVA 3M0XA 3VKDA 3W84A 3RNDA 3WQGA 5I09A 3UWUA 1KKOA 1JPKA 2Z28A 2XSXA 2ADAA 3M41A 1F5ZA 3W7QA 2WV8A 1SO4A 3PJWA 2BVTA 1V3KA 1Q6CA 2A3EA 3O7UA 4U28A 2WZTA 2FGBA 4PBEA 3IEBA 1GTEA 5ABHA 4XZBA 1YDVA 1X1OA 2VENA 1SJBA 4DBEA 2G97A 1WDWA 2RDWA 2WHJA 1IXQA 4A8NA 3GU2A 4AD5A 2EG7A 2QDHA 1WYIA 1RP8A 1S46A 4MJMA 3E74A 5AN7A 4AD1A 1ITCA 4RNFA 4E2DA 4UZUA 3HPXA 1D7KA 1UIOA 3MVIA 4B2DD 4HPHA 1ODUA 3VK5A 4NAEA 4Q4KA 3TONA 2V38A 3IVTA 2ZTKA 3LCWA 3P6LA 1T8XA 2BASA 1NJJA 4LTSA 2SFPA 3PPCA 4F2BA 4HPXA 3QC3A 4LC6A 3WNMA 1I0DA 4PE8A 2WM1A 3DERA 2QCDA 1F07A 4U33A 3PZNA 5AKQA 4AZGA 3BJFA 2ON3A 2QW5A 5JU6A 1KCZA 1V3HA 5CXPA 1K8CA 4BQ2A 4LYPA 2VFDA 2YCLA 4IMGA 3UWYA 3WYZA 4LALA 5LNSA 1NQKA 1M65A 4XVDA 3A4JA 2O7SA 1DJIA 2C14A 3MT1A 3TNOA 2PDMA 3BG3A 2J62A 1OYBA 1GK8A 3A3WA 2E7FA 3N4EA 2IQTA 4PUNA 1A5LC 1DE5A 1C8VA 1QNPA 3VNMA 2JK2A 3CL8A 1EQPA 2Q8XA 4W5UA 1UOKA 1KCLA 3C5QA 4FSAA 1CYGA 4QG9A 1X6UA 4JIIX 3LERA 4C6DA 4GXMA 2D0GA 2HJPA 4H8HA 2XSBA 1A5SA 2GK1A 4JTJA 5REQB 5HUOA 1B2YA 2E4TA 4L4PA 5JMUA 1Y7VA 3DIPA 1UUOA 2OELA 1QI5A 5HJXA 4ZVJA 1A5KC 2CNCA 4FNPA 3V5FA 2W62A 3HQOA 3APGA 2Z1WA 2YB4A 3B0XA 2ONEA 3WN6A 1IEVA 5D2WA 4Q8PA 2PP1A 4HPJA 4ZR8A 4X63A 4XKMA 1XRTA 2NQLA 3GXDA 1IZCA 4DBSA 1AJ2A 3LYEA 2JFEX 2PRLA 3MJYA 4N7QA 3BDKA 2D2HA 3GDTA 4AD2A 2DDXA 4ZFCA 2YL6A 4O1FA 4S3CA 1Q63A 2B7QA 5T26A 1VCVA 2IS7A 4KEUA 1W3JA 2OQHA 2BLEA 5DANA 1AH4A 1GYNA 2CHRA 3MWAA 2F6UA 3B9NA 5CG7A 5LXXA 3OU8A 1H60A 3EGJA 1H5YA 3CMFA 3SURA 4XK2A 1R8LA 2IKGA 3AJXA 2YBVA 4CN4A 3C0LA 4WZHA 1Q6QA 2Y7DA 3VE9A 3OIXA 5IDZA 1PL9A 1W37A 3TJ4A 4JTLA 2CPUA 3NNTA 1GVIA 3LI1A 3RPDA 2DW7A 3UPWA 3TA6A 4YYFA 2FLIA 4GQGA 3UETA 2QS8A 3VDAA 3PVFA 2Z6JA 1UKQA 2VZSA 3C0JA 4FOKA 5G4EA 1UWTA 4GYPC 4Y2WA 2CBIA 2HQAA 3B8SA 3G22A 3WK1A 4MF4A 3ABRA 3WNLA 2QHAA 3MVTA 1Q66A 3VU2A 1AVAA 1B3OA 3KVLA 5M03A 2E6YA 1VP5A 2Z4GA 4NAFA 1TQJA 4PB5A 3UWQA 2G37A 2WSRA 1XLGA 3VGDA 2OVLA 4IOTA 2DP3A 1J9YA 2ALRA 3BZJA 4Y9PA 4O17A 2JEPA 4AY8A 2GUBA 2H3BA 3F2BA 4ICMA 3TYZA 1Z32X 5FSEC 5M5DA 4ERIA 4DJFD 5DMLA 3UR2A 3NEHA 1ZPTA 3WLQA 2WMJA 4FXJA 3EDEA 5CSSA 4L6OA 3T07A 1WP6A 5C70A 1G01A 4JPGA 2BVYA 1GG0A 1BEUA 2CEQA 3O06A 5TD4A 4LUSB 4NJHA 2ABAA 4MNKA 5KZEA 3Q45A 3MHUA 2P50A 4JFSA 5HR7A 4M19A 3TN4A 4JN8A 1CNVA 4U2ZA 1YDNA 2HE5A 1L9WA 2E8ZA 2X0SA 4EWJA 1XLIA 3TIMA 1XINA 2QCEA 5CKSA 1HP5A 3H2MA 2E0PA 3IJ6A 1FWFC 1UYQA 1I4NA 3CUJA 1F3EA 1ZSXA 3QY8A 4TX6A 4H7ZA 1DV7A 1F2JA 3AC0A 3GWQA 3W6YA 3OZMA 1QBAA 2J27A 5LNUA 3LPFA 1OGBA 4IJBA 1UQZA 3GKFA 3R6IA 1OABA 4EANA 2PLMA 3BICA 4IQLA 4UTTC 2OKTA 4XD6A 5U7SA 1HL2A 1JD7A 2GGIA 4MGGA 3QZAA 4IMFA 2P8BA 5GJPA 3OBKA 2NV9A 2IW0A 3W1LA 4M7SA 4DUOA 1R87A 3PNUA 4CU7A 4DYJA 1B4KA 1HP4A 2POZA 3QEZA 4LAUA 3KWXA 2VM8A 5DT7A 3FGCB 1XQKA 3CL7A 1DPMA 3O8AA 1CZ1A 3BLOA 4HZ7A 4F0MA 1YIXA 1R3TA 2V69A 4PCPA 1JZ7A 4GYJA 2HXUA 4NYYA 4KFNA 2BXZA 4H8VA 1JYNA 1FWGC 4AWUA 4K8EA 1SPQA 2BOGX 5JH2A 2XN1A 3E2VA 3PZQA 3PBGA 2Y7EA 3MSDA 2GGHA 3I6RA 3H7VA 1TV4A 4H9VA 3LRKA 4F0LA 5CLWA 3W27A 3TYEA 1RY0A 3ZLFA 3AAMA 1XYZA 4FF5A 3T0TA 2W66A 2OZTA 4Q32A 3SN0A 2J77A 4D1IA 2RGLA 2YA0A 1R9ZA 1JDEA 5H8PA 1SR0A 1UUQA 3T8LA 3WEZA 3KW3A 4DVOA 3BLKA 3GVRA 4UTWC 4DI8A 1FTXA 4QCEA 3E6EA 2ISDA 3P84A 4YLWA 4I6KA 3NA8A 3OLEA 5C7VA 4OQVA 1L2QA 1K7EA 5H6HA 4DZIA 3RPTA 1ZGDA 4H01A 1QHZA 3IRDA 1VS1A 2ACRA 1ALDA 2FH8A 4EOUA 4CU6A 1KM2A 1MSSA 1V3IA 5CZJA 3U2OA 1RA0A 2V6AA 3W25A 3S6DA 1YXDA 3KBWA 2E9MA 3ARPA 1YPXA 4KW2A 3BO9A 1O5RA 3O05A 3R0DA 2VX5A 5MF5A 3CGTA 3L4TA 3HGJA 3VIPA 4MUZA 4A8RA 2TAAA 1E6ZA 1V6WA 4WJXA 3B8TA 4DNHA 1QPOA 3AI0A 2AL2B 2UWFA 3ABOA 3EMQA 4MNLA 2BY2A 3QFEA 2Y2WA 4O4VA 2QAPA 1B90A 3H6OA 3HPSA 1O4UA 4HZ6A 3AHTA 1VGAA 5CPMA 4BHYA 3FLUA 3TVAA 3SY5A 4LYKA 1WE5A 1R9YA 2ICSA 4HT3A 2VWTA 1Z48A 1Z6KA 1IHIA 2EPMX 2ZZ3A 4UQBA 4AB4A 4ES4A 4UZSA 4OKDA 3FV9A 3DHPA 3M6DA 3UR8A 1LWIA 1TX0A 2F8QA 4LB3A 1KW1A 2DSKA 2DJXA 2WNQA 1LWJA 3WDRA 5IRPA 3M43A 3TX9A 4AYSA 1DIEA 4JCLA 4UXDA 3AYTA 3LPGA 2VGFA 4XD5A 3W1TA 4LB4A 1VBJA 4LX4A 4TTUA 2F38A 1I1XA 4TVDA 1S38A 3CHCA 3HIJA 3CEUA 2V5LA 3BLIA 1WBJA 1OCNA 2QVHA 3CU2A 2YSWA 4JTDA 1XGEA 2XJ7A 2WJZA 1VFTA 1XPGA 1G9HA 3G77A 1B1YA 4R7WA 2R94A 1NH6A 1DJHA 4PMQA 3WJZA 3WX7A 4B3KA 1WZLA 2Y4SA 4JQAA 4MKNA 2CBVA 3FJ4A 4ZQNA 4FLRA 2OO0A 4J3SA 3VD7A 1MRAA 4FS9A 2C1HA 1VBRA 3W1RA 2PCQA 3CH0A 4JBRA 2PA6A 4PFHA 1H1ZA 4Q8QA 4U5KA 3LM7A 1KR0A 1QI2A 1IF2A 2PDIA 1B3YA 2V82A 3NWRA 3WQFA 3NL5A 7TIMA 3VILA 2WJEA 1WDQA 5AZ0A 4RZ6A 4N42A 3N13A 3W75A 5KSWA 4RPPA 1UB3A 3PULA 1DKWA 3LMZA 4IIEA 2E3ZA 5I3GA 3KM8A 4O57A 4QS5A 3EWBX 5A6KA 3EWDA 4RNJA 3U2ZA 3VOGA 4XIAA 1YHTA 3B9AA 2E40A 3TXVA 1VENA 3B8DA 4CU8A 1A5UA 3SGUA 1RY8A 2YFOA 3PBWA 4UFLA 4IT1A 2QAFA 3CS2A 3GBEA 4PC8A 1H7OA 2V81A 3O6AA 3SGZA 2VO5A 4K38A 1Q2SA 3UJ2A 2W5FA 5F2MA 4GE8A 4FX7A 4R53A 4G7EA 1LRNA 3BLEA 3GXPA 4UCFA 3LLFA 2INEA 4J5NA 1C92A 4M6UA 4GQQA 1UWUA 5LHFA 2X1IA 1W5OA 4L64A 1QAPA 4DJDC 4H00A 4C6MA 1DBTA 3TTQA 1EC7A 4KBXA 3ID7A 3NXLA 1R46A 5IDIA 1TREA 4QFUA 1ITQA 1WCGA 3VOJA 3NQCA 1CBGA 3IGXA 4QJ3B 3ZLHA 1P0BA 3EKGA 3T0CA 3MMUA 1F9CA 2YIHA 1O66A 1KA9F 2OT1A 3AHXA 5F7UA 1N8WA 2Z7GA 2E6DA 1XKJA 1C91A 2WCGA 1GZ1A 2E5BA 4HN4A 3TCSA 1XLAA 2FPTA 3WMLA 3FYYA 4Z2LA 3RFAA 4RLIA 3MB9A 1H7WA 2YDQA 3WUEA 3PWAA 4ZOEA 3WF4A 1U5VA 1W17A 3UCQA 1ZENA 1X38A 7ENLA 1WO2A 3O0FA 2V3GA 2VUYA 3SCUA 2DGAA 5C7HA 5LA2A 1OG0A 4HA3A 1XGZA 3I4KA 3P61A 3ABQA 4QP0A 1QPRA 2DH3A 3E12A 2PWDA 4AG0A 3QQ0A 1GTHA 5EKYA 3EYPA 3PJXA 4H83A 5BOFA 4L6DA 4QJ1A 4I8DA 5D9OA 4I7VA 2E25A 2QPUA 3NFUA 1V03A 1PUDA 1E51A 4UTMA 1M7JA 4S2CA 4Z1YA 3LCIA 2QUNA 4B4FA 2VWSA 3W37A 2ZA2A 1EPVA 3U9IA 5JVLA 5BOEA 1HW6A 3AXKA 4XZNX 4K68A 4LV9A 4C6QA 1XJBA 2WJFA 5C0QA 2WQDA 3CHDA 4GWEA 4JS3A 4B3LA 3T4WA 1BPLB 1W1PA 3GIYA 4HD5A 4LCRA 5GNXA 3OEXA 2BNJA 4JKKA 2WBKA 3H26A 4ZTXA 2NQ5A 4PCNA 3BSMA 4W7VA 3W6MA 2GSJA 3PJUA 4GVHA 3NGFA 2PUZA 1EHAA 3UCDA 4QJ5B 4N9CA 3CAQA 4NRRA 1IV8A 1MW0A 2J7EA 4W7UA 4XSLA 3HMJG 4L4OA 3BANA 4YTRA 2XIBA 1MQPA 3WQCA 1PAMA 4ERGA 2GUYA 4UTJA 3F4VA 1K8XA 2Z1KA 4JGDA 2CESA 1M6JA 2YZ5A 3WQ4A 2HPIA 2R9RA 5LGZA 4YNGA 2Y6ZA 3WF2A 4WF7A 3AYRA 2PFHA 1OX6A 1A5AA 4NY2A 5JBFA 2DZBA 1Z44A 3BWWA 2VL4A 4J2MA 2PRHA 3ISIX 2BV9A 4AIOA 4LF1A 3PAOA 4YVPA 4E0CA 4C6LA 4GY0A 1Y5WA 2VHLA 3CYVA 3RF9A 3TFXA 1HQTA 1UWAA 4B5NA 1B30A 1TTPA 3V35A 4TXEA 4MNJA 3W70A 1VIZA 1EWEA 3P8IA 3A13A 3W7LA 3OZOA 3KLKA 1TWIA 3F2DA 1F6KA 1XUUA 3B9OA 3N6JA 1TJRA 5BOOA 4L1GA 3UF9A 3WDJA 2Z1VA 1FRBA 3N15A 4N4QA 5K2ZA 3RK8A 4QM1A 2W67A 1KBIA 3EKLA 3WLTA 1YLVA 2FYMA 3C2YA 2XGIA 5LNRA 1QR7A 3F5JA 2WNZA 3WBXA 1VJZA 1Q6EA 2Q6ZA 1PWLA 1C7TA 1Q3NA 4K8GA 2ZADA 1GVQA 3PY2A 1RAKA 1XDJA 2ZZ1A 4LBRA 4D71A 1B3XA 4JQ1A 2ZBTA 2ZDSA 1FH8A 4AH7A 2QCLA 5D4YA 1PHWA 3VOHA 5BXPA 1O12A 1Z8AA 3P60A 1CW2A 3KUMA 1XX1A 1GQLA 5EBUA 2ZTJA 1OYCA 3LG3A 3AHYA 3W7CA 3R10A 1N2VA 4HGXA 3DU0A 4GIAA 4CUCA 4DPPA 5FF2A 3NQ2A 3WIJA 3ME3A 4LYQA 3B9DA 2OT0A 4HK6A 1BWVA 8XIAA 4R3UA 3GZAA 2OSXA 1QXLA 3S2CA 1NDZA 1UR2A 5E93A 2EAWA 3FJLA 1V0MA 2UY4A 4L9ZA 3GX9A 5DXYA 1XLKA 2E77A 2Q3RA 3RXZA 3TFCA 3WZ0E 3B8WA 3I6EA 5HA7A 1XBXA 1E5JA 1OFOA 2OGJA 3WNPA 4KGLA 5EY5A 1YEYA 3LZ3A 3TE9A 1DIKA 4L1WA 3WLHA 4NXKA 5E70A 4M0XA 2H6RA 3UZWA 3TV8A 7PTDA 5FKYA 3QGAC 3I7QA 2OSYA 4IISA 4MAVA 3KLLA 3S9ZA 2J9ZA 4R5EA 2UY3A 4L4LA 1JCNA 3L68A 5KMYA 1IIGA 1UWIA 2J7DA 4MUPA 2A2IA 3W0KA 4IFRA 3PM6A 3M0YA 2YCEA 5I3IA 2QCHA 5K3VA 3FS2A 1K70A 1UMYA 1ML1A 4FLQA 4ZGYA 4EAMA 4PODA 1RA5A 1S2AA 4XTDA 5F4SA 4DWSB 3R11A 2D0HA 4ILSA 1HKVA 3BLPX 3IV3A 1VB9A 4QJ4B 2BDQA 2HRWA 5AHIA 4GIRA 3MS8A 1TVNA 3O6YX 3EXRA 3GG7A 2Y61A 5G2IA 5LA1A 2I1OA 3T7VA 1U1UA 1ZJBA 3A5VA 4GINA 1ZAHA 4XD3A 1QFEA 4JZ5A 4U3CA 3TQ0A 4JTUA 3ABZA 4EF9A 3L12A 1IGSA 4UQCA 4C1NB 1H50A 3W2UA 2R1MA 4IQDA 2WK2A 1QW7A 2F2KA 4OHQA 3N9SA 1EEPA 1XH1A 2Y8VA 4CD5A 4AFYA 1KWGA 1TR9A 4XB3A 3QZEA 1KFBA 3DI1A 2RH9A 4S3FA 3LCGA 3ONBA 2OQLA 2X7WA 2P0IA 3BJTA 1HJWA 4YWIA 1Q4WA 2XZ9A 3IRSA 3K8LA 1I9CB 3AWNA 3ZYZA 3MV01 1BG4A 1CTNA 3M1ZA 3P67A 4I7UA 1A4MA 4NKCA 1T99A 4KESA 3MP5A 4CNTA 2R6OA 4XZ9A 3SIMA 5AVNA 1CI1A 3NIYA 1LQ0A 3G1HA 1A47A 5LIWX 3M47A 2Z2UA 1RQHA 4RCXA 1YDOA 5I3DA 4J3ZA 2YCKX 1QO2A 2QJNA 2WMGA 5TNVA 4MWAE 3GYCA 3RM8A 1XUZA 1Z41A 3NR0A 3USZA 2A21A 5HOSA 4H6RA 5D9PA 1XR2A 4Q8VA 1XRSA 3TA9A 2V5KA 2Y5SA 2YLAA 3W7IA 5XIMA 4NASA 2J6VA 3WQOA 4QAWA 4Q7IA 4I5XA 4JQ3A 2ATSA 1E0UA 4S3AA 3ZSTA 4M3PA 1HF6A 5CBBA 4CEUC 3EAUA 4DB7A 3KTCA 1JVNA 4AF0B 1GJUA 1X6NA 3AWOA 4HQVA 1JCJA 3AU2A 1XXXA 4DBDA 1TPH1 1LORA 4MSSA 4MYXA 2E5CA 1PZ2A 4ZE4A 1KRAC 2QV5A 3W7JA 4HOWA 9XIAA 1TQXA 4MB4A 4JKLA 4FEZA 3STCA 4W7WA 4JR5A 2VQUA 2QGHA 1CLXA 1EJSC 3TNBA 3PBYA 4LVGA 2WBGA 4Y6GA 4UIOA 3APYA 1S1RA 1RCQA 2I14A 3SIZA 3NPVA 4YVVA 5TAOA 4NZFA 3XINA 4WDTA 1ZFJA 4IJCA 5CGMA 5AYXA 4H7VA 1Q6LA 4B5SA 4QDWA 1LBLA 2ATMA 4PBGA 4IP7A 3CUFA 3KOXA 3A12A 3IAQA 2EF9A 3PZOA 2XM1A 5D32A 3S2LA 1FP9A 4IIGA 2UY5A 4LUJA 5HMSA 3VUPA 4WQ6A 7TAAA 3AUJA 3DBNA 3WH8A 3MMWA 1DYSA 1GVFA 3POHA 3SFKA 1PTDA 4I8YA 1Q6OA 4XUYA 4JHOA 4PUDA 3LNMA 1OX4A 1OZQA 2J8TA 3SI9A 3MUAA 3Q94A 6ALDA 1UPMB 1WKDA 4WCJA 2Z24A 4U4MA 1A5CA 1VFMA 2R82A 2Y7GA 4JNMA 3GB6A 1XFCA 1CDGA 3MSGA 5CLTA 1OFAA 3N3MA 3LXCA 2REQA 4IWWA 1R0MA 1MUWA 1SFTA 4F4RA 3XIMA 1NY1A 4TVCA 1AMYA 1UP2A 2GVYA 1KM1A 4M56A 3N12A 4KFPA 3AXIA 2C13A 4WKAA 4L9YA 2BP1A 3N2CA 1JAEA 2WVUA 3OGRA 1MQRA 4IIFA 2JF6A 1GOOA 1QNQA 4C6IA 5F4WA 1UZDA 2FZ9A 3CZ8A 3W01A 2Q01A 3VGHA 3TCEA 1UR1A 3TROA 2PWEA 4P7RA 4ZB0A 3W2NA 1TTJA 2MNRA 4HHHA 1AMKA 3KOYA 1UJPA 3P8JA 4WXYA 2QKFA 4Q4QA 3QSTA</