3ITGA

Structure the proline utilization a proline dehydrogenase domain (puta86-630) inactivated with n-propargylglycine
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
524
structure length
398
Chain Sequence
b'PQSVSRAAITAAYRRPETEAVSMLLEQARLPQPVAEQAHKLAYQLADKLRNQFVTGETIAEALANARKLEEKGFRYSYDMLGEAALTAADAQAYMVSYQQAIHAIGKASNGRGIYEGPGISILSALHPRYSRAQYDRVMEELYPRLKSLTLLARQYDIGINIDAEESDRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPLVIDYLIDLATRSRRRLMIRLVKGAYWDSEIKRAQMDGLEGYPVYTRKVYTDVSYLACAKKLLAVPNLIYPQFATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIYAPVGTHETLLAYLVRGANTSFVNRIADTSLPLDELVADPVTAVEKLAQQEGQTGLPHPKIPLPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein putA
publication title The structure of the proline utilization a proline dehydrogenase domain inactivated by N-propargylglycine provides insight into conformational changes induced by substrate binding and flavin reduction.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 156
structure length 398
sequence length 524
chains with identical sequence B
ec nomenclature ec 1.2.1.88: L-glutamate gamma-semialdehyde dehydrogenase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01619 Pro_dh Proline dehydrogenase
A PF14850 Pro_dh-DNA_bdg DNA-binding domain of Proline dehydrogenase
A PF18327 PRODH Proline utilization A proline dehydrogenase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3itgA00
4O8AA 3APYA 2FZNA 1ZP3A 3E2QA 1ZPTA 1ZRQA 1TJ2A 2FMOA 3APTA 3FSUA 3E2SA 4JNYA 3ITGA 2FZMA 3IJDA 4JNZA 1B5TA 3FSTA 1TIWA 2FMNA 1ZP4A 1V93A 3E2RA 1TJ1A 1TJ0A
chains in the Genus database with same CATH superfamily
3L4UA 4IPNB 2RGMA 3H2FA 4GY0A 4UQAA 1DWFM 5LIXX 1QPKA 2IXVA 2J27A 3M44A 4EP8C 3EGJA 5BU6A 2ZZ6A 3CV2A 5CZJA 5CGQA 2QZRA 1VRDA 1RALA 3M1ZA 4MZ8A 5CAKA 7XIMA 5A6KA 2XISA 3JUGA 4DO7A 1KBJA 3A23A 2E9BA 5A2CA 1WDSA 3WBEA 3KBMA 4JDBA 2CLIA 1GVIA 1XGDA 1PE1A 4I7UA 1ZLPA 5I3JA 1OD8A 3RM8A 3FVDA 4MWAB 3N3TA 2IKJA 2WKJA 3R0KA 2E5BA 5C9WA 2YFNA 4ORMA 4X2RA 1S5WA 4C65A 3CB3A 1KXTA 1NDWA 1QOPA 3R58A 2ZX8A 3VZYA 4URIA 3A4AA 1TX2A 5D9OA 2VCAA 1XLGA 4X2PA 1JZ5A 3L7RA 5HANA 2YYTA 5ABEA 2ZRUA 1FCQA 4HNLA 1UWQA 1A50A 4GLEA 1C29A 2XTKA 3OGSA 4L1XA 3W85A 4WKFA 1M03A 1K6AA 1QRQA 3LI1A 3B0YA 4IXHA 2ADAA 2CBJA 4HNNA 4FIQA 3SW6A 4EK7A 4GYPC 1OX4A 2Y89A 4K8EA 1RK6A 1KFBA 1MXSA 4B9ZA 3EMZA 3TMLA 4XUGA 3VD3A 4CGTA 4FNRA 3FVMA 2WHMA 2BY3A 3C3NA 4Q8MA 3BGAA 1ZBKA 1VHNA 3L2LA 2BSLA 2HROA 4A3RA 3QHMA 3RLGA 4J3WA 4C5ZA 5CKSA 1F9CA 2OO0A 3DHFA 3PZGA 4Q33A 1D3HA 1CW2A 5HATA 4C6BA 2ZE0A 2Y7DA 3SN0A 1I75A 4LAUA 2VFHA 4BQ5A 4CEXC 4TTUA 2P53A 3GFXA 2PDGA 1IR1A 5EMJA 1P6WA 1RY8A 2GJXA 4IMEA 4B5WA 4C6LA 3E2VA 3DG7A 1UBPC 4H2HA 3K1GA 5C9XA 2R1KA 3E0LA 4GO9A 2OELA 4EIVA 6REQA 1Y5VA 1RV8A 3WLIA 4BK9A 2CLOA 1M5WA 4LC6A 3W28A 1A5UA 2GUYA 3WDQA 4NJIA 4WX2A 4HBKA 5DMMA 3UD6A 4LRTA 7PTDA 3R8RA 1M41A 3PWIA 1SQ7A 3IGHX 3R25A 3ITLA 4L1GA 4PB4A 1TZ7A 3RLHA 3N18A 3MBDA 3LTYA 3W23A 3ONBA 1BF2A 3E6EA 3W7JA 3AFBA 3M6YA 3QSTA 2FGBA 3G6MA 1V7AA 4RDZA 3BAXA 1MWOA 3QPYA 3EEZA 2QV5A 3WX7A 2ASHA 3LM3A 1P6BA 3P3BA 4Z08A 2R14A 3VDAA 4NRRA 3B8IA 3NZQA 3R5EA 3SBFA 2OGJA 2QJGA 5I03A 3ZT6A 4DZ5A 1M68A 2ALRA 2WSRA 2XSAA 2X16A 4XKYB 3U2CA 2VT0A 1W31A 1V4YA 1TMLA 1W3KA 2DSZA 4PUUA 2ZWYA 1KM1A 3BZJA 4YN5A 3YPIA 4R9XA 4JPGA 4FHAA 3O6AA 2V5DA 4JTLA 2ZC8A 1Z44A 3M7WA 2FHCA 4UTTA 4LSBA 3T08A 1DWIM 1E6PA 3OZOA 1EHNA 2J88A 3K13A 1UQYA 1GTHA 4RJEA 2VRQA 1CXIA 3AYSA 3QV9A 5D2VA 2XDFA 4OT7A 1ZALA 1H11A 4HP5A 4V15A 2WM0A 1TPC1 5LIKX 4DI8A 4ZZ9A 3SY1A 1BKHA 1J5SA 2A3LA 2PTXA 5CPQA 4W86A 2A2IA 1FCBA 4JAWA 2DZTA 1OC6A 2OJPA 1UR9A 4O4VA 4QJ1A 3WEZA 4FSAA 4U31A 1GCYA 5I78A 3OIHA 3Q4DA 4QS6A 1PIGA 3N2XA 5EY5A 8RUCA 1XV8A 3KTCA 2P1FA 1GWJA 3R2GA 3VFLA 2A0NA 4PL2A 2PDNA 1MQRA 5FJTA 4AZGA 5D9MA 3W73A 3B40A 5D02A 2G96A 2ZUSA 3S0CA 1ML1A 2QDEA 1UP0A 3M5ZA 2PRMA 1L9WA 2ONEA 4XZWA 1YBQA 3B0UX 1FHLA 4A2RA 5DRCA 4QDMA 2UY2A 1SM9A 2QUTA 3FDGA 3A13A 4E38A 4FAMA 4ENLA 1S2CA 2JF6A 3G5EA 4Q3MA 4GOAA 4HPXA 3BLKA 1TUFA 5HAOA 4JTHA 3SCOA 4UC5A 2QYGA 1G7VA 1V03A 1YW1A 3S6DA 1LWHA 3L2MA 3LCIA 9XIAA 4QITA 5ABTA 3G6LA 1F74A 1IIGA 4WY0A 1B3WA 4DYEA 1AG1O 2R1LA 3V5OA 1UH2A 4TV5A 4UXDA 5CPNA 3JS3A 1E3ZA 5DXXA 4MKNA 3LXBA 4BEQA 3WMBA 1E4LA 3S5NA 2D1ZA 1ZJBA 2W66A 1G5AA 1ZCOA 1EEPA 3B9NA 5D37A 1FTXA 4I8YA 3RGTA 1A0CA 2ZADA 1ZHAA 3CHVA 4ZBCA 1L0PA 3S9YA 2WWCA 3HG2A 4ACZA 3EX4A 1K7EA 2YGYA 5U7SA 3W7OA 2WC7A 2ZA3A 3CHDA 4GXWA 2D2GA 3FN9A 4IUGA 2VZTA 4PTMA 5CXPA 4YCPA 1JFHA 1TELA 1WDRA 2IPFA 4BR1A 3U7VA 4F2TA 3KRZA 4IMCA 1G0CA 1TPWA 2J8TA 3IUIA 4K38A 1G4SA 3CUHA 4IFOA 2IPJA 1RLDA 3THDA 5CC7A 3B06A 1T41A 1LOSA 2SFPA 4CCZA 3KBWA 4J2MA 1NEYA 1K8ZA 2XVNA 3OODA 3TCSA 2NUYA 1V6WA 4ROPA 1OFQA 1PDYA 2VOTA 3GTNA 4WDUA 2EEXA 1KW1A 3GVRA 1MVYA 1LT7A 2OCZA 3S2CA 4NHVA 5EGRA 2YXOA 1KM4A 2B7PA 4MJ4A 5E6YA 2ZKMX 3GW3A 3LEPA 1TYGA 3LHZA 3LUTA 2ZRVA 4OOUA 3WQ4A 5I02A 2UBPC 1PHQA 3B04A 4C6FA 4NAEA 1TTQA 5C9UA 1PIFA 4F48A 4UFMA 1A3XA 2VZSA 1J0KA 2GUBA 2DQXA 1DKWA 5HXMA 1VBUA 1GVQA 2ZX5A 3N6QA 3CB8A 5EMMA 4Y9AA 4U2ZA 3S4TA 1R3WA 3CLMA 3C0JA 1POKA 1VD6A 3TW7A 3WDJA 4W8LA 3LLXA 2TODA 2FTWA 4DBWA 3WL0A 1CXFA 3NZPA 3EMCA 1P48A 1TA3A 2JIWA 3VUSA 1R8LA 1EBGA 5AVNA 1K3UA 5BXTA 4L9YA 5GJMA 2QW5A 4RE4A 5JBDA 1AW2A 3P84A 3VOFA 4DJDC 4DNHA 5ECVA 1ZU8A 1HKWA 5A6AA 2XN0A 4EVZA 1FHUA 3G1RA 4FK9A 3MQTA 3BPWA 2XN1A 5CEWA 3GNOA 1T96A 3KBVA 4OVXA 5E93A 1NSJA 2UZ9A 4Y9NA 1QDSA 3A4JA 2RH9A 4CQ8A 3PWGA 1NVMA 1U5JA 4J2PA 1K9DA 5DN1A 3U57A 5CH9A 4E4PA 2W5FA 1Y65A 4JYDA 1R30A 2YLAA 3KOZA 1XF0A 3STEA 1V08A 3ARSA 3URAA 3PP7A 1W3HA 4L64A 4G56A 2FH8A 4NRSA 3G1XA 3UXIA 2DZUA 3DI1A 2F61A 4O53A 2UY3A 4XD3A 1RR2A 3PZVA 4L4OA 4RPPA 3QZAA 3WLQA 2IQ0A 4R5EA 3G3DA 4JEQA 1NU5A 3MKKA 3BW2A 4JL1A 4HJWA 4C90A 1OX4B 4IOTA 4AVOA 3TA6A 1GVRA 1UCWA 4EPEC 3SGGA 4JN8A 4LNCA 3LGDA 2PDCA 3L67A 4KIEA 1NDZA 4V33A 4W8BA 2E1WA 1E0WA 2PDYA 3E0WA 4KGJA 3GIPA 2E9LA 1OFEA 2CZDA 4X0NA 2J9YA 4IL2A 3MP4A 4EACA 3EKGA 2ZC1A 1E9ZB 2YLLA 1QPOA 3CS2A 5C6MA 2DJXA 3WL1A 2V2CA 2VOMA 3NO3A 1RUSA 2J7EA 2D22A 3CQ0A 4RZ4A 2VUNA 3ZZ1A 1QU4A 3NDZA 4UTKA 3EAUA 3GXPA 4WGXA 1R3TA 1VFUA 3I6TA 1E4IA 1Q6QA 4HZ6A 2DPEA 1FBAA 1QCWA 1PZ3A 1BRLB 4GX9A 1RD5A 5A6MA 2E4TA 2XH7A 2WHJA 2RDWA 3IS4A 1ZP4A 3R8HA 3TYDA 3VKCA 4TMBA 4M6VA 3QQ1A 3P81A 4QBXA 1QAPA 4AHOA 2VFGA 2B81A 3S1VA 3B9AA 1W3JA 1FH8A 3CZEA 4U33A 4F4RA 2AL2A 4XUYA 2Q01A 4UTJA 2Z1XA 4HZ8A 4XBKA 4W93A 1Z9AA 1J93A 2WCGA 3IEBA 3ME3A 5AVHA 2PLKA 1IWAA 4M56A 1CLKA 4QGCA 2Q71A 3VD7A 4C6KA 3VFCA 4ZQRA 2GJLA 1LJYA 3O15A 4UMBA 4N42A 1TTJA 1QNPA 1R3VA 3PB2A 4AMAA 5KMYA 1ME8A 2CLFA 3NSXA 3URBA 3HMCA 4ICNA 5HA7A 4PCPA 2X30A 4P7RA 1IT7A 2Z26A 4GVIA 2QUVA 5U4NA 2D0GA 4HU4A 1ADOA 1YPXA 2E5CA 4P8UA 2GQ8A 3CYVA 4DJDD 4DLMA 3KXQA 1JL8A 1XWYA 4UNIA 3W7RA 1LOLA 3FHQA 1WB0A 4P8WA 4HIBA 3NR0A 4O54A 2G95A 3SJNA 5DBTA 1O7AA 3B03A 5JBEA 2Y8KA 4MMWA 2XSBA 5EFFA 4LYKA 1HJXA 1D8WA 5D04C 3PC0A 4GYPA 2QXWA 1L2QA 3VDHA 1RVKA 3WQPA 3UWYA 4KEUA 2IS7A 1GGOA 1JNDA 2Z6IA 3AOFA 1PBGA 1RPXA 1QHPA 4N4PA 1GT8A 1NP2A 1XP3A 4QSFA 1KFEA 4KF1A 1CCWB 3GD6A 2EO7A 5DMNA 4AX6A 3H2EA 4GO8A 4GUIA 5FACA 5A6BD 5G2WA 4QEHA 3ITXA 4GI6A 5MF5A 3GU9A 5DO8A 2CBUA 5CG7A 4S23A 3DFQA 4M81A 4IJBA 1PAMA 2ZVRA 4PULA 4NT0A 3AHXA 3MW7A 3XIMA 3WLTA 3BV7A 3W2NA 3WD1A 3F4WA 2ZUTA 1EBHA 4B5NA 4AD5A 1UUOA 4UR8A 1JPKA 1F6YA 4P61A 4M19A 1V6XA 1YBQB 1O68A 4C1LA 1R87A 1UD5A 2XH4A 2E68A 2Y70A 1ECQA 4V27A 1J11A 1FKWA 2P0IA 4WOZA 1MDRA 1EUAA 1M3UA 3HO8A 2FDMA 2UWFA 4QQ3A 1UD6A 2PFHA 4A8IA 4KWOA 1CYGA 1LCOA 4JICA 1WQ5A 4HU8A 3B0VC 2FMNA 3IIVA 4WY0B 3HJEA 3LLDA 3GLCA 4HNVA 4Q7IA 1XLEA 3AIRA 4MNLA 2VX6A 1FWRA 3VMPA 1ENUA 1ZZMA 2VD9A 3TTEA 4LF1A 3UVIA 4HSHA 1HW6A 4JQ4A 4MPKA 3CH0A 2PPGA 1NARA 1E0TA 5FCZA 3N14A 2VJXA 3V16A 1UC5A 4ACZB 6TAAA 1VIWA 4B16A 1SSDA 4GJ1A 4JQ2A 3S46A 2GJNA 1E1FA 3HZ3A 1R86A 1F61A 3NO1A 1CGUA 3FNDA 4KT2A 2E67A 3A12A 5D9PA 4RV3A 1Q45A 5E5CA 4DHGA 1J01A 1QNOA 3EOUA 1CZ1A 3NA8A 3HGOA 2HXTA 2FZMA 3PPGA 4PH6A 1YMYA 3VNJA 4GQQA 3CUFA 2ISDA 2VEMA 1DE5A 4U5IA 1GYLA 4ZSTA 1EA0A 3NYZA 4HU3A 4CNOA 4CD5A 4X63A 4C6NA 1S38A 4E5TA 2CWXA 4EXQA 3DKLA 4Y2WA 5KEZA 3OG2A 3QC3A 4OUIA 2QEZA 4MGGA 1FP8A 5GVJA 3GG8A 2KX9A 3LZ5A 1QWKA 3BAKA 2G3JA 1SO5A 3OIXA 3N4FA 2NX9A 3UG4A 1MW1A 4H7CA 3CAQA 3S5OA 1O60A 3UG8A 3VNZA 5DY2A 3WDRA 2XVGA 1OFDA 2IKGA 1H7RA 3P8IA 3A6OA 4NAEB 6A3HA 3PJWA 3DCPA 4IL0A 1REQA 3L4XA 3WQFA 4H9XA 4J3XA 4QM1A 3INPA 1HUVA 1ZNNA 2Q8LA 5LHEA 1OK4A 4LUYA 1BSLA 3ARVA 4EF9A 2V2HA 2R1NA 1UOKA 5LA1A 1XG3A 4M51A 3KP0A 4S3BA 2OZ3A 3ANVA 4PFMA 1QPRA 3PBVA 3PPHA 4K39A 2QCHA 3CUXA 5EL1A 3G0UA 1R2RA 2IPWA 3L5MA 1W8GA 1CI1A 2VYOA 2QV4A 3BQ6A 3UJRA 3ATYA 4GJJA 1PCWA 1Z41A 3IUHA 5CLTA 3IGUA 4ZFMA 2NQJA 4DWDA 4OBSA 1YE6A 2WZTA 4UFHA 3M5YA 3QZEA 3E9AA 4NVTA 1MFUA 4O8AA 3VVGA 3GU1A 3E0VA 3BLIA 2QJHA 3CYJA 1A5LC 2C79A 4E3VA 2DH3A 4K68A 4HNTA 4B3ZA 1XH0A 1UJPA 3STGA 4ATLA 1X6NA 2ZXDA 2ZX6A 1ZL1A 4ZQPA 1KTBA 3TR2A 3GB6A 1A5SA 3VC5A 4L1WA 3RLVA 1QUMA 4I5XA 2A3EA 2PDXA 3TQKA 1J2WA 3O07A 5CSSA 4A2SA 1PX4A 4LYPA 2E8ZA 3VI2A 3O8AA 2GUUA 1HIZA 4ZO6A 2FJUB 4A3HA 3NL2A 1RH9A 2OX4A 3ZIZA 2YXXA 1SZFA 4L6DA 3AHTA 1E5NA 4R53A 3UZXA 2X1UA 2W6RA 3H4XA 3WD0A 3TLQA 2DT0A 3DGBA 3Q67A 4HVXA 3LZ3A 2QHAA 1IV8A 1A5NC 2CWNA 2POZA 3LB0A 3NDYA 2YCJA 2FGZA 3THUA 3W1UA 3VE7A 4HNUA 3TDFA 4YMZA 5HQEA 3W7PA 5EBAA 3NWRA 1DJNA 1XPYA 4DZAA 3TFXA 2E6YA 5AC7A 4HT3A 3LHUA 2WJEA 3UWEA 1Y7VA 3L65A 3PULA 2QLYA 3MV11 4H7ZA 2UY4A 4EWJA 3W2MA 3GH7A 1CGYA 4AYGA 1GOKA 3ERPA 3UNTA 2GDQA 4FALA 4PCFA 4O1BA 4O11A 3WUFA 3VIIA 2HMCA 1F2JA 4YTTA 1JD9A 4CU8A 4J5NA 2AL2B 4S3KA 5TNVA 4GG9A 3GZAA 3ZO9A 1T5AA 1QTWA 1GVSA 2NXGA 2PTWA 3HV8A 3D46A 2XVLA 1PX3A 3MB9A 4JTGA 3N29A 3N3MA 3PBWA 2ZBTA 1I2RA 2YCIX 1TUXA 4C6QA 1E0UA 3GUWA 4ZOAA 4NI8A 3O05A 3BSGA 2PWUA 2QCCA 2Y0FA 3WDHA 2OWCA 4CVWA 1EUNA 3BG5A 3OTRA 4AY1A 3TJLA 4PL1A 4N6EA 1SFTA 3LSBA 4BHYA 2Y5EA 4GUGA 3RR4A 1NDYA 4I3GA 1EF3A 2Q3OA 1AQFA 1W17A 1B3VA 3CMJA 2ZQ0A 4MFEA 1BWLA 3K30A 5AC5A 1WDWA 3QZ6A 2W4XA 1T8QA 5A6JA 5HUPA 5G4HC 2DSKA 4B5VA 3NQEA 2V5LA 4S38A 3H21A 4ZB0A 2GGJA 1TZZA 1KM5A 1EC8A 2YYUA 4ZQMA 4E2DA 2Y24A 2OZTA 3EWXA 2NV1A 4B5XA 3T8QA 4YHGA 1JCJA 1W9DM 4YTRA 4Z0SA 4UTUA 2BGNE 3ABSA 5M1TA 1KTNA 1VH7A 5HDRA 1KLYA 4N6FA 3EXRA 1AH3A 4IH3A 4DWSC 1VRXA 2R8WA 2CLEA 4MDPA 1RA0A 3PUOA 1RAKA 3PVFA 1TPH1 2DVTA 4ZQCA 4ZA0A 2XPKA 1G4TA 1RCQA 3OLGA 3P7YA 1IYXA 5EB8A 5MKGB 4DAFA 2VVSA 1HXJA 1TCDA 2VEGA 4WGHA 5L6UA 5LIWX 3UZWA 2XGZA 4MKVA 4A3QA 3M0YA 4ZODA 3P8JA 4I7VA 3H4GA 5FSDC 4M7SA 3GH5A 1B5TA 2NV2A 4DBEA 1YNQA 3GXIA 5CPTA 2WC4A 2Q8ZA 4QCEA 3DERA 3CU2A 4JTCA 5REQB 5JIPA 3CWNA 4IMGA 3W7NA 5D09A 1MZRA 3CO8A 4HZMA 2JEQA 1CXEA 8TIMA 2NQZA 3W7EA 3SAZA 1HVQA 3MS8A 1YDNA 3GTXA 3W53A 3PSWA 1ZENA 3VE9A 3W7DA 3PANA 3EYPA 2A85A 2D0HA 4LS1A 2AQOA 3WELA 2I17A 1FWEC 2CETA 3STPA 3WH9A 2O4QA 4NJKA 3WUBA 5CC6A 3CWHA 1GOQA 4HSOA 3GE7A 2DSVA 4H6KA 3FJ6A 4M6QA 4WSJA 3GBDA 5DMYA 2I14A 3UERA 2PWFA 4WDXA 1EFZA 4K2SA 3QVQA 5FJUA 1AUSL 3B8SA 3EPNA 3TW6A 4DF0A 1BD0A 2ZA2A 3G3MA 5CJMA 1DJZA 4HYVA 2WNWA 3F2DA 4ILSA 1WNOA 4CKQA 4X61A 2UV8G 3H22A 4Z1DA 6TIMA 1Q3NA 3FS2A 4H9UA 3TCEA 3BICA 2Y88A 4M7TA 1KV5A 1SFJA 2C6QA 4PR4A 3M0JA 1UPMB 1S1RA 3HURA 4TXEA 4MNMA 5CSYA 4P7OA 1SMAA 4M0XA 1FDJA 3DBNA 2GQAA 5CCZA 4GCAA 4MB1A 4GACA 4TVCA 3W22A 4DELA 1XJBA 2BFGA 1O95A 1KKOA 1XRFA 3WZ0E 2WNNA 4M1BA 2NLYA 1HKVA 1SZNA 3CM4A 1I0DA 3EX6A 4UQEA 3W83A 5LNRA 4ADUA 3GNRA 2GOKA 1L6GA 3I68A 4JYEA 4GQBA 3N4EA 3GH4A 2QCEA 1NWUA 5LGXA 2V82A 3ITOA 2YCEA 3KRSA 2Y8UA 2GQ3A 2ZZ4A 3GY1A 1TWWA 1XLHA 3THCA 2RDUA 1F3EA 4EXBA 1IF2A 2BODX 3W7CA 3BK0A 1F3XA 1YNPA 2RDTA 1REQB 3ZFHA 1R0MA 1XX1A 3UZJA 4BF7A 1JDEA 4XBJA 3WD3A 1S1PA 2BXZA 4O8RA 3NZRA 4NX5A 1C8XA 5C2CA 1DJGA 1XD1A 1QBBA 2JFEX 5A3HA 3FYOA 4I9TA 3L9CA 4FLRA 3MDWA 4WKAA 1ONXA 3WUEA 2JALA 4FOJA 4A3YA 1SJAA 3DOPA 5TAOA 5E6ZA 4A8LA 4M3PA 3U5YA 1OABA 4CQDA 3KRBA 3T9PA 1MUMA 3HQOA 3M46A 4LTSA 3T40A 2VFEA 3CIVA 2A7PA 2BBFA 4Q8QA 4XSMA 3EOLA 1YLVA 4UFJA 2GJRA 3NTYA 4PE8A 3G8EA 3W7GA 3IV8A 3H6OA 1KC7A 3VGGA 4U28A 3N12A 1C3FA 1R38A 4UTFA 1SJDA 4WXYA 1PDZA 2RJGA 4HYRA 2DZPA 4O14A 2X05A 3U2ZA 4ZO9A 1QNRA 1EGMA 3DFTA 3GXTA 3IGXA 5F2LA 1A4MA 4LY4A 1Z89A 4GNKB 2A7NA 5T8GA 4CEUC 2PDPA 8A3HA 3RU6A 2CERA 1TE6A 3N04A 5F2GA 4ZMGA 3LMYA 4P5UA 4GUJA 1V3IA 1U83A 1VJZA 3HU7A 1W2VA 3LX9A 1B3YA 1TQJA 3KZSA 5D05A 2OZ0A 4B3LA 4JXCA 1HQTA 2YPIA 3E0FA 3EOEA 4JIHA 3RCYA 2D2HA 3L12A 3N9SA 3E49A 4NZ1A 2CPUA 3NSMA 1G6CA 2HS6A 2MANA 1W37A 2HVNA 3DECA 3GC5A 5C54A 3DC0A 3TJIA 4MNKA 2DIKA 4J1OA 3ARWA 4DPPA 3HIJA 3IIOA 3A47A 2C16A 4BA0A 1EP1A 4NZCA 4LEFA 3V0SA 2WNZA 4I9AA 3UZ5A 2CZFA 4J3VA 4ONVA 2VC6A 1KM6A 3GIYA 4IXXA 1FKXA 3HF3A 4IPJA 3WNNA 4L6OA 1XC6A 4MHBA 4GUHA 3V0UA 3AROA 2GK1A 3NQDA 1JCNA 5FL0A 4UR9A 3GG7A 4UOQA 5CC3A 5EFDA 1YPIA 3SGZA 2F9RA 4ZO8A 4HTYA 4Y90A 3BTNA 1TWDA 2DZXA 5LXEA 4MYXA 4LAKA 3N19B 2XZ7A 1QPQA 3OVPA 3NL3A 4PMZA 3W02A 2Z2AA 2QJMA 7REQB 1UPPA 4CU7A 3MMTA 2WVTA 4AD2A 4XB3A 2ZXBA 3GM8A 1VKFA 1AMYA 3NNTA 2R91A 1HL2A 3BO9A 1B90A 1UD8A 3T6CA 3S2MA 1IGSA 1F07A 4HNCA 3VX0A 3BCDA 5C55A 1W5NA 2GPTA 5E0FA 4PRWA 1YDYA 1CPUA 4AUBA 1O6IA 3F1QA 4R33A 2CZVA 3VIMA 3PJTA 2HE5A 5HQMA 3KEHA 1XINA 1EHAA 1F6PA 1BXBA 4RUBA 4XSLA 4FXRA 2Y85A 1WX0A 5HMDA 1FCVA 5K9CA 3VIOA 3WYZA 4KWVA 2ZA1A 4QTGA 1NF7A 1H63A 1J9YA 4E8CA 3M47A 2C7FA 1PXGA 3EKLA 3KCOA 4BJHA 2R9RA 3AS0A 1K9FA 1XRSA 3AZRA 4JQAA 5J8LA 1PWLA 1XKYA 3PPFA 4DLFA 2XIJA 1EZWA 2D2JA 1X6LA 4RE2A 4JD4A 3EB2A 3NQ7A 5C9RA 1ISZA 1OF8A 3OLDA 3OVGA 3TVAA 3FOKA 1GK8A 3UGVA 2VCCA 3Q94A 2OOFA 3M5VA 1A5BA 1QNVA 5I2UA 4AD1A 7ODCA 4AWTA 1ZTVA 1YX1A 1US0A 2C18A 2J7GA 2G41A 1FWTA 2AMGA 3B9OA 1OY0A 3PN8A 2W79A 2XYLA 4B5SA 3TH6A 3V18A 4F2BA 2VR2A 4F0SA 1IZKA 3DKJA 1LP6A 5IDIA 3WQVA 3QPZA 7TIMA 4CQCA 5I77A 2J8GA 1K8CA 3A5FA 1LROA 4LS0A 3UQNA 3IJ8A 2KAUC 1AA1B 2BHYA 3O06A 2ABBA 5DEZA 4D1IA 1X7IA 1EO5A 1BQCA 2V63A 2R1PA 3SB0A 1BVZA 1TPFA 1DV7A 2ABAA 4Q4RA 1W3TA 2C91A 4IIGA 2Y7FA 1W0MA 1Q4WA 3I3DA 3BGGA 4JQ1A 1TR9A 1O12A 3RF9A 3LS9A 1FWSA 4B92A 3KL3A 1UUMA 1JZ3A 3KHDA 3UZZA 4O10A 1P43A 3BOFA 1HL9A 4JZ5A 2YCLA 4ZGYA 5IFTA 1RVGA 1XG4A 4GFIA 3TIMA 2GVGA 5DLCA 4JIIX 3W84A 4DB7A 1BF6A 4FPSA 4DF2A 4GY7A 3EOSA 4H7VA 1ITQA 4W84A 3BG9A 4S3AA 3GTFA 4JS3A 2WCAA 3AYRA 2IUZA 3WG6A 1JPDX 3SRKA 1D3GA 1B4EA 1VEOA 1XSIA 3GXDA 1XCXA 4IMFA 2PDUA 4NJHA 2A3CA 6PTDA 3EPOA 3N2CA 1T99A 2X41A 2GJPA 2WMGA 2V67A 3TC7A 1GORA 2PUZA 3CZGA 4JQ3A 1XXXA 1M53A 2E7FA 2QULA 3I4EA 4PUNA 1VGAA 2GZXA 3W7MA 5IM51 2G3NA 1GOXA 3M0IA 3N2BA 4W7UA 4UFLA 3G2GA 3H24A 1SO6A 3B9EA 4DJEA 4X22A 4WVXA 2WMIA 3BJTA 4GQGA 1Q6RA 4DWSA 4O52A 1QW9A 3P0XA 2CLHA 3SCUA 2HS8A 2E9MA 3OQEA 1JZ8A 3OHMB 4C7DA 3MSGA 4A3UA 3TR9A 4W4QA 1MRAA 1UR8A 3L0NA 2QF8A 4XZLX 3HPAA 4DN1A 4GVGA 3A21A 3MHUA 3W26A 4Z2JA 1V3KA 5ENLA 4UCGA 3CIXA 5HPCA 4JFTA 2Y5SA 3RO6A 5D33A 1E4NA 2WZEA 2VZOA 3CEPA 3DEQA 5HWJA 4F9DA 3E1F1 3MUY1 4MUZA 3L68A 5ABHA 2DT1A 3N2TA 3SIZA 2I9EA 5EMUA 4ZXOA 3FJ4A 5G4WA 1J5TA 1SZEA 3P14A 1JJKA 1F4AA 5HNNA 2V6AA 1AZ2A 1K7XA 3U9IA 3T0DA 3VU2A 4EF8A 3M0VA 4FX7A 4LALA 3VNIA 4PUJA 2PF8A 2HJPA 5DRIA 3MP3A 2PE4A 4YTUA 4M5PA 3FSUA 3BSHA 4EE9A 3UU0A 4GD0A 4Q7BA 3GHRA 1VQTA 2VQTA 3C2FA 3ZM8A 3E74A 2A6LA 4O28A 4MVAA 3MC5A 3PS7A 4KRZA 4YVXA 2QGHA 1MNSA 3HQ1A 2VO5A 3AU2A 5DX7A 1HO4A 1ISYA 1OF6A 4JN7A 3EWBX 1O5KA 4R27A 4MTVA 1GQIA 3VKJA 4IIHA 2A7RA 1EXBA 3AIQA 5ABFB 3FW6A 2DDXA 3A24A 4WKHA 2JIEA 4KGLA 3BW4A 3BJFA 2DQWA 4FLSA 4MB4A 1BXNA 1WKDA 1OCBA 4J7RA 4FLOA 5HNUA 1H61A 2OT1A 2V68A 5EU9A 1P1MA 4FX6M 3NM1A 2JGYA 2RHGA 3W29A 2X1IA 1GW1A 5C9ZA 1TV2A 1KA9F 1MYRA 2CNCA 1VPXA 4AIBA 4AEEA 2OYKA 1RK5A 3VGDA 1BHGA 2VRKA 3AHVA 1CIUA 2J78A 3NEVA 4AYSA 3R79A 2HZGA 3NQVA 1T6MA 3QMSA 4NASA 3TK7A 4W7WA 4GWEA 1YE4A 2R6OA 3FIGA 2BVWA 3F5JA 3QY7A 3NO5A 3VKBA 4LNYA 2X2GA 1X6UA 4W88A 1XBVA 4K1WA 3A9BA 3K5XA 1WP6A 4ATDA 1UP3A 3ITVA 4KH2A 5AC8A 4QROA 3G1YA 2GK1B 4JDYA 4QE1A 4HSNA 2NSXA 3GTIA 3CO4A 5CZ0A 2ZFAA 4LBRA 3LRLA 4E2VA 1X97A 3LYEA 3T0CA 4N2YA 5GNZA 3UR7A 4FF7A 4AXKA 3UJSA 4PSPA 1SW7A 2YOCA 1H7WA 1DWHM 3CNYA 1KXQA 1Z3NA 1SFSA 3SCTA 2HISA 2J6VA 1CB2A 5AKQA 4B9YA 4O1EA 4CLMA 1V0LA 4UTLA 3O16A 4RZ6A 2Z24A 1TMHA 2NWSA 3NGJA 1M9HA 1MUCA 1GKQA 1ESWA 1WPCA 3RILA 4BFAA 3I6EA 5D2WA 2IW0A 1PTDA 3ES7A 2NXIA 4K7VA 2WJDA 1YTKA 1AW5A 1OCJA 1EIXA 4TX9A 3UCDA 3MDUA 5C2XA 2FZ9A 4LEQA 4RV8A 2OG9A 3NUKA 3C61A 1UD4A 4CN6A 2R82A 2PWGA 4C6DA 5T26A 2VCBA 3NQAA 3V35A 1WKEA 1RCOB 2INZA 2G3MA 3LBMA 4REQA 5RUBA 1E56A 1JDFA 2VR5A 1T0OA 8XIAA 5EYWA 3W87A 3H7VA 1SJBA 1S46A 3MUXA 4UR7A 4DBUA 3CQKA 1VAHA 4WUIA 2NQ5A 3GNXA 3QQWA 4NU7A 1UKPA 3VAVA 3S42A 5A8OA 3LLFA 1HF6A 2NQLA 5HWNA 4U5KA 1VF8A 1O66A 1FWHC 3RX4A 5I00A 3WFLA 4JGDA 1EX1A 4WQ6A 3U2OA 1HGYA 1JR1A 3S1GA 4F9JA 1AJ2A 2DU2A 2EKCA 2XHYA 3FXGA 4LU0A 3WQCA 4ERAA 1JQVA 1VBHA 3SEPA 2OGYA 4Q4SA 2NX3A 1VBJA 3L2IA 5JMUA 2VC5A 1LRQA 5AOUA 5KINA 2WVUA 1XIIA 1B9ZA 5E1QA 2P0OA 1XLCA 2D2OA 5A8PA 5BOOA 1BXCA 1OGSA 1GYMA 1O4UA 1FVPA 3RNDA 4HHHA 1L6SA 5FJIA 2DH2A 2RJHA 1A53A 1SJCA 3DBPA 3GNPA 4P8VA 1LBFA 4RW5A 3NL6A 4ZFCA 3V0TA 3TE9A 2J62A 3GR4A 1YTDA 2V0TA 4L5ZA 1H60A 2HNEA 3MT1A 4OIFA 1XIDA 1BYCA 4JTAA 5H8PA 1I0BA 4XIAA 3WK0A 3A3WA 3W7KA 3GFYA 3K1DA 1UMLA 4EOUA 2DT2A 1IE7C 3LTPA 5BRQA 2VHLA 3G8RA 3V4BA 4AZBA 1FFQA 5D38A 4U2YA 1XCFA 3AS2A 2RDXA 5EKYA 1K7FA 4LUJA 4CD7A 2YSWA 2YBVA 2YCLB 3AAMA 4HZ7A 5FIPA 4MPQA 2OWXA 2Z2BA 2CESA 4W89A 4PBEA 2XGBA 4PTNA 2PWVA 4D72A 4IZGA 3BLPX 1BG9A 2XN2A 4D8LA 4GNVA 2YL5A 2HXUA 2GWNA 1MZHA 4GJIA 3PHAA 5JH1A 1X38A 3CQHA 2X1TA 5T9BG 3E0IA 1EGZA 4HPGA 1RSCA 1H7OA 3R0UA 1ONRA 1DWJM 1KM3A 8CGTA 1RQEA 3VIJA 2YIHA 3HPFA 2CKRA 5AY7A 1DE6A 3IV3A 1OQFA 1XIEA 4JTQA 4D6DA 1DOSA 3F7JA 1NY1A 4UB9A 3PNUA 4LCSA 3DG3A 4DUWA 2OLHA 1O5QA 1KM0A 3WBWA 4YWSA 3P5YA 3LCXA 3ZLFA 4MKSA 3PTMA 1GKRA 4JN6A 3EA3A 4KIRA 3BMVA 1R9XA 1H62A 4G2DA 1EQCA 3VCCA 2PWEA 5CZSA 1GUVA 1IZJA 3GFZA 3RMJA 4B3KA 3CZJA 3TAOA 1EP3A 2A79A 4D6FA 2FHBA 3LCLA 2W67A 2PDQA 1L6WA 1W1VA 3R0DA 3CMGA 3VK5A 1J0JA 1GOOA 4Y6GA 4Y9MA 4DWSB 1PJ9A 1KXVA 2FVMA 1V6UA 1OYAA 3AC0A 3DFPA 4UMAA 5IFPA 3WMSA 1NFBA 4WK9A 1TV3A 5J04A 2QNEA 4L9XA 4PUMA 2EPOA 3RHGA 3OLEA 3AMGA 3QQ0A 2CLPA 2F8QA 3N15A 3T7VA 4D2JA 4C6EA 1D7FA 3KTXA 1N8WA 4A4AA 2PU1A 2Q02A 1Z42A 3KUMA 5I3GA 1NFGA 5JBFA 1RQBA 1K77A 3DN5A 4B5TA 3LSCA 4AZCA 1OSEA 3WLRA 3HFYA 4US5D 1FWJC 4FI4A 1B3ZA 3TYZA 2Y1HA 1XLDA 3PUDA 5AN7A 1TIWA 3UFYA 3W1NA 1E6RA 3VOIA 4JBRA 1WDDA 4HJFA 1XLAA 3H12A 1OGGA 1I60A 2PRHA 5A8GA 1NAL1 4M24A 1O1ZA 2J7BA 3B0XA 2O7SA 2EG6A 4EPDC 3WQ8A 1W6TA 1ZB5A 3DYPA 6ENLA 2PRLA 2BY1A 1LG2A 4HGXA 4MY1A 4JY9A 4BWLC 4DUVA 1OWQA 5LA2A 3UCQA 1TREA 3T1GA 2ZWZA 1PO9A 3UESA 4RKAA 4IHCA 2TMDA 3HG4A 4R9OA 1ZRQA 3POCA 1EOMA 1HNYA 5F1VA 4RPQA 3RLUA 1KGXA 4LVDA 1KGUA 2ZUWA 3W1XA 3H23A 4GIYA 2X0HA 1Q7QA 1XFBA 3SCQA 2QQ6A 1GHRA 5HQLA 3WLOA 2OWWA 1OC7A 3KFTA 3BL3A 4RXFA 5D4YA 2PBOA 4FZIA 1F3TA 2YW3A 5CG0A 3WDPP 1G01A 4LWWA 3AO0A 4PTXA 1MUWA 4LGXA 1LORA 2PDLA 3I3EA 4DY1A 4IQDA 5IHSA 3MWAA 2OX1A 1LLZA 3LHVA 2PTDA 5BCAA 1TPUA 3BOXA 5JIWA 4CNUA 5CZTA 5D9NA 1WZKA 2VM8A 3T0TA 4BQ2A 5LA0A 1VFOA 1XW8A 2GOUA 4H9MA 4TVUA 3WUGA 4PTVA 1UD2A 3QTPA 1Z8AA 5E0KA 4AMCA 1SR9A 3L0KA 1UROA 1UKOA 4LUIA 2WAGA 3R7MA 1K6WA 3R89A 1A5MC 3O63A 5JQ9A 4C7FA 5LYRA 1V02A 1ISWA 3BV4A 4GINA 1X7FA 3DIPA 3MHGA 3T07A 5DCEA 3ARQA 1PV8A 1TJ0A 4UTHA 1FWWA 3LG3A 4AG0A 1N2VA 1OBAA 1AJZA 2FVLA 3N9RA 3HG5A 3P2VA 3V1HA 2VD8A 1C8VA 3N2MA 1VCGA 3VMOA 1JPMA 3VIPA 2X2YA 2F84A 2PCQA 2E8YA 1T40A 4N4QA 2E40A 3GU2A 1B1YA 1LUCA 2O56A 5D03A 4TR9A 1Q65A 1HG3A 5LSMA 4DUOA 4PN2A 4XG1A 1PCKA 1W3IA 3VC6A 1XLKA 2GGEA 4DYJA 3DC8A 1TJ1A 2WM1A 1BYBA 2C15A 1TTIA 3EMQA 1KTCA 1B54A 4F2UA 4YS1A 2PC4A 2VFDA 2XFWA 1H4PA 3IANA 1XIFA 1WKYA 1XR2A 4XD4A 2VWSA 2FKPA 4KFPA 3O2LA 3TX9A 1H0GA 1ZBWA 1JPIA 3SUVA 3ARXA 2QAFA 4UFIA 3NDOA 1EKOA 3WQOA 3OBEA 2XH0A 3W1LA 1OFPA 4WZHA 3P80A 1BTMA 1P4CA 3BMXA 1MEIA 3OOQA 4LOCA 3KOYA 1TKKA 4LVAA 3HG3A 4IIFA 3GAKA 3SECA 5AHLA 2XVKA 3DZ1A 1VFSA 4IQEA 2ZTKA 2ZICA 2P8CA 2VR4A 5CPOA 3ARUA 1EOKA 4REQB 2DUXA 2A3AA 2MUCA 1KFKA 3C8NA 4TUFA 1E55A 4J3ZA 3TYAA 3FEMA 3LCGA 1W1YA 3SM0A 3VPLA 4C6IA 3M0ZA 5FAGA 5A94A 3IK4A 4HOZA 4PODA 4E8DA 2EKGA 1RHCA 3ZWSA 1XH2A 4NNAA 4GK8A 3B3DA 1HKMA 3AHZA 3PF3A 4QHRA 3U48A 5BWAA 2GDVA 2ZRZA 1SVDA 3WBXA 5IXEA 2J75A 1U22A 1GG1A 2H6RA 3C2OA 3QHNA 3ZMRA 4RNFA 1QR7A 1UIOA 3MA8A 3V3WA 3VDGA 4Z2HA 3APGA 3VKAA 2YB1A 1QNSA 2HWGA 3ALFA 1OYBA 2OEKA 3SQLA 1KQYA 3W75A 3QGVA 4HN8A 1Y5WA 1JVNA 2VX4A 1OCQA 2PTYA 1LT8A 4FX8A 1VZWA 3E5PA 4F66A 1WE5A 5I23A 2WMJA 1HKKA 1V6VA 3EWCA 3GRIA 1US3A 3FDKA 3VXGA 3C2YA 5BYWA 3P82A 4G6CA 4YVVA 1EQPA 1UKTA 2BS9A 3MTWA 2BVYA 3WBYA 1QI5A 3EA2A 3U2EA 5FD0A 2FYMA 4OBRA 3RAOA 3MO4A 3UXDA 3IIZA 4C6MA 1HTIA 3WQ6A 4IIBA 1AD1A 2V5JA 3SN4A 2PGFA 1ITUA 1CLXA 1O5XA 3RITA 4XAGA 2J13A 3GDKA 4FXJA 3UPMA 3QW4B 4HKPA 1OVDA 4NXKA 5DFAA 2NQHA 5DBUA 4GGHA 2VZVA 1F73A 1TV5A 2QJJA 4C6JA 1EDGA 3ALGA 3CL6A 4Z2IA 3USBA 4IMAA 1BRLA 3LM7A 2ACSA 2XFRA 1J12A 2QS8A 2NVAA 1KBLA 3KCLA 4G1KA 1AMKA 3BH4A 3RXZA 4MJ2A 1M65A 3CPUA 1KRCC 5DQPA 4K1GA 1W2PA 2WXDM 4B2DD 5JU6A 4ZE4A 4YL2A 3E2RA 3TTYA 4HHLA 2EQDA 5M5DA 2VEFA 4M6PA 2I5GA 3VNLA 2TRSA 1ZPTA 1RD6A 3EZ4A 2EPHA 2ZRWA 3TSDA 2NV9A 3RM9A 1Y5XA 3GDMA 1U1UA 3QY8A 4KFOA 3KLLA 4GC4A 2A3HA 3BLFA 2V3DA 2XIIA 4NZ4A 1Q8AA 1D9EA 3ELFA 4Z42C 1S3HA 3TC3A 4GNJA 1JRBA 3GDRA 4V1XA 4DVOA 1WUEA 2CHNA 3I3BA 3QH2A 2VEKA 4KRUA 3QOMA 3W76A 1IR2A 1XIBA 4HHPA 1Q4NX 1XLMA 1JXKA 2ZOXA 3ANYA 1LM1A 4H6RA 3S2JA 1WAWA 4FOKA 4IFKA 5M17A 4HPNA 2POTA 5AHMA 3MI3A 4HU0A 4LFYA 3K2GA 1NWSA 4KCUA 5HWMA 3NOYA 4Q8UA 4IGMA 2H3BA 2PP0A 3CIWA 4ACYA 3L0GA 3L5LA 3ZR4A 1EL3A 1UYQA 4AZCB 1I2NA 5FL1A 1FP9A 1AVAA 4RW3A 5GNYA 2EPLX 1SU5A 2VC7A 1YXCA 1JF5A 2NLIA 1PZ1A 5DT7A 3KVJA 5BOEA 4PA8A 1XQLA 3GNNA 4HCHA 1U1HA 2D0FA 3ZQ9A 1JZ7A 3KVMA 3C0SA 4G7EA 2YX0A 5H6HA 1GG0A 4XD6A 4NJJA 3VM5A 2YFOA 3ZLGA 2VX7A 1XYLA 5GNXA 4XX6A 3D5HA 4L56A 1HT6A 4LBSA 4XZMX 3RO8A 3GZ3A 2WBKA 3OLIA 2PLMA 3GKFA 3CPGA 4DEFA 1LL4A 1FCUA 2DZAA 1I8JA 3FKRA 3SQMA 4Y9PA 1TTPA 5A8QA 1TX0A 3PAOA 4L6HA 3RJXA 1UH3A 3L21A 2HSAA 4JTJA 3BUVA 3VX1A 3EWZA 3S1UA 4C91A 3HQNA 1BYAA 2FJKA 1HP4A 3PBMA 3Q65A 1H5YA 1I2QA 1WO2A 1BKSA 3AYTA 4JTKA 3O9NA 1Z6KA 3WMLA 3KS6A 1H7PA 2GDUA 2WMHA 3AU6A 3DI0A 5AYYA 5KZ6A 4H3DA 4QIUA 5DMLA 3SCVA 3U6WA 3IUDA 1EC7A 3CT2A 3BAWA 3K8KA 2F2KA 2VVNA 3QY6A 1F7BA 4DRSA 1V7YA 1VFFA 3QLDA 4YCOA 4GXMA 1XYFA 2GVLA 4C1KA 3UCCA 1IXNA 2CFFA 2OQHA 5HJLA 4RZBA 2ZRXA 2OEMA 4JNZA 4O15A 3DUGA 1S5MA 1WKFA 3PBUA 1K9EA 4JTRA 2P88A 4AVFA 5B80A 3IRDA 4FNUA 2WWDA 3VIKA 1NM9A 1KFJA 4NIRA 3T78A 3DFOA 2CZEA 4JNYA 4ZOEA 4AC7C 3JVAA 4R88A 1KRMA 1E3XA 5IDZA 5LZLA 3N17A 1OT1A 4ORIA 5FJJA 3B4UA 1B3OA 2NT1A 1PZ0A 1DJQA 3KBJA 4QG6A 4Z1BA 3UJEA 5D32A 1H7NA 2FPYA 3KP1A 4B4FA 3OEXA 4Y8EA 4N7QA 4HA1A 1XIGA 1WYIA 4MADA 3PZQA 2V3FA 3OA3A 3UR5A 1HKJA 1LUCB 3M6DA 3AMDA 3NZGA 3IJDA 4ZB5A 1MMFA 4J27A 3GR8A 4L9ZA 3QW3A 4H41A 4IX0A 2AL1A 2AMXA 1ITCA 3B8DA 4QJ5B 1K1DA 4G5DA 1VYPX 4ASTA 3UG5A 4BWLA 3H26A 3ABRA 4HK7A 1BGAA 4Z17A 4N02A 5D8ZA 3MSYA 4OJYA 3SFKA 2J25A 1J8VA 4QRNA 3TTQA 1RLCL 2BGSA 4H01A 2BVTA 2YCKX 2Z28A 3WJZA 3QM3A 2O9RA 3PZNA 4IPPA 1E6NA 4LQ1A 5EPDA 2VELA 2PTZA 4LB4A 2XGIA 1JUBA 1XRTA 3TMQA 3W1TA 4BZYA 1JYWA 2Z1KA 4XTIA 1CBGA 4EX4A 3I6RA 1ZAHA 3SRDA 4W5ZA 3D0CA 1KCLA 3SUSA 3GVVA 1B3XA 1DJIA 3S9IA 2RUSA 4US6A 1DYSA 3K4DA 3FJLA 3KCJA 5K2ZA 2OO6A 2OB3A 2G50A 3TROA 5CJNA 4MSSA 4F0LA 2V69A 2NW0A 4GBDA 4Z2GA 4Q4OA 3W70A 4CNSA 2ZRYA 1XRVA 4E3TA 4RK8A 2ICSA 2Z1WA 1E0VA 1YDVA 2G0WA 2YDAA 2CBIA 4JYFA 4PUDA 3NQ8A 3ZJ8A 4W7VA 3Q2DA 2E28A 2B7QA 2INFA 4GYFA 1A5AA 1FWCC 1IT8A 1B4KA 4GQ0A 4KCVA 3H2NA 3C6CA 2V3EA 2O92A 4AD4A 4KRTA 4R3UA 4AXNA 2XJ7A 4D8ZA 2IQDA 1GOIA 2JGQA 3T2QA 3UJ2A 4B15A 4MYAA 1BSIA 1XL9A 2ZTJA 5D30A 4MY9A 4S3CA 4BKNA 1YEYA 3ID7A 1Q63A 3TYBA 3MUCA 3RR1A 3NPVA 1A4LA 2FVKA 3KHJA 3TSBA 1KBBA 2ATSA 4UQDA 4AY8A 1FDYA 2BMBA 4YIWA 2JBMA 1VBRA 2CXGA 1FOBA 4LAZA 3GXFA 1TPVA 3UR2A 4DNMA 2EJAA 1YNYA 2YL8A 2WO5A 4L80A 4WSKA 5BOFA 4AWEA 1LQAA 4K3ZA 3SUWA 1E70M 3MP5A 4OU1A 4YWIA 2G37A 3MKVA 4H6QA 1F4HA 4PUEA 2FZDA 4IP5A 3PG9A 9XIMA 3WLMA 4PRRA 2NT0A 2A3BA 1DVJA 2DVUA 1S3TC 4RDYA 4PB5A 2WANA 3NPUA 2IMRA 2ZZ3A 2QDDA 1VP5A 4GKLA 1TV4A 5BXPA 1S2UA 5E0CA 3OGVA 2X0YA 3IVUA 4WIWA 4LUTA 2YBUA 2V5BA 1O5RA 5MHBA 3CAVA 3ZWTA 3FFSA 1JYVA 1V0KA 2C1GA 5GPRA 2Z1VA 4WJXA 1HJUA 1FHVA 4DM2A 2ACUA 1DWAM 4JX6A 2B7OA 4J3SA 4IWWA 1FXPA 2FTYA 1GJUA 3CHCA 4BEUA 3AJXA 1K4HA 5XIMA 3TXVA 1RXOB 1E40A 3C86A 2D24A 3T44A 4A05A 3BLOA 4J9JA 1JEZA 1LRNA 2X40A 1FX6A 1F05A 2V30A 1W1IE 1CXKA 1Y8BA 3WQGA 4UCFA 2WSPA 3ABOA 3EB3A 2QPXA 4NZ5A 3U8GA 2OODA 1XYZA 1JQXA 2V5KA 5K7JA 4GMEA 1C91A 4A8RA 1H7XA 4H8VA 3ARYA 1W91A 4YNGA 4IICA 2DZSA 4L61A 3TN5A 3APTA 4GE8A 1MSSA 4H8UA 1FXQA 2Y61A 1OFAA 3V75A 1U30A 4AISA 2ZZ2A 4IFKB 3C3UA 5CSRA 3QOKA 1PTGA 2G3FA 1EJTC 4TO8A 5KETA 2ANUA 1JF6A 5AECA 4LPCA 1W1TA 4O57A 4JFVA 2P76A 4JFUA 3QEZA 4U3AA 3G1FA 3MY9A 1UP2A 1FWGC 1VS1A 4GXPA 2FPTA 2GL5A 2PWDA 3VABA 3R43A 3AUOA 5LNSA 3EWUA 1G4EA 2WQDA 1L6FA 2F2HA 4G1NA 4A35A 4LBUA 2P50A 5J5RA 3HM7A 5FOOA 3PM6A 4G7EB 5I06A 4GISA 1VLWA 3MVIA 1Q2RA 1G94A 2V3GA 3WD2A 5C2GA 1RJRA 4ALDA 1FDZA 4CN4A 5MKGA 4QCFA 3WCZA 1H3GA 4UTMA 3IJ7A 3QYSA 1UWIA 1EDQA 2VMFA 1SYTA 2DSWA 1XICA 1DQXA 2J7HA 1J96A 1H50A 1UG6A 3II1A 4JFSA 4I6VA 1UR1A 5REQA 4ZE5A 2RAGA 3WLLA 4S3FA 4RE0A 3WEMA 4LY8A 3IAPA 1C7TA 4UZUA 4IP7A 1JGMA 2OYLA 5CAHA 3O3RA 3GAYA 4C1NA 4IG2A 3PZ9A 3VD5A 4M80A 4ZB2A 1CB7B 3W86A 4IUOA 4PSRA 1CX9A 3BLDA 1OM0A 3W81A 4WLCA 3CV7A 3IK2A 2CXEA 3TFCA 1A49A 4PEKA 3E2QA 1PX8A 3DESA 3LD5A 3R1ZA 3H2OA 3AALA 3QTGA 3GS6A 5DCBA 3LOTA 2HTMA 3S6OA 4DXKA 1AJ0A 1YPFA 2WJZA 4WJ8A 1K8XA 2VGIA 4S2BA 3P74A 4PUKA 5FEXA 4B91A 5I5RA 1JI2A 4JX5A 1R3RA 5AZ1A 2D73A 2L5HA 3QRHA 3CEUA 1YRRA 1JDCA 3UNDA 1GVYA 3OG3A 2MNRA 2OFJA 3ZJKA 4HYWA 4ZCWA 2RGLA 3M0KA 3KE0A 2FTPA 2J7CA 2PC8A 2CIPA 1X8CA 4AAJA 1KR0A 3EOOA 1V0MA 4W9TA 5GJPA 1QNQA 2TYSA 5HMEA 3VA8A 3EWWA 2WQPA 4BCEA 1BLIA 1J0HA 3SY8A 1NF0A 1DXFA 4GA8A 1Q6FA 4A22A 3SSJA 3FXYA 1J18A 4XTDA 1P0NA 2A5HA 2B7NA 3M0XA 4XAPA 4Q4PA 1AQHA 2X7WA 1QHOA 1MW0A 1JZ4A 2B0MA 4A21A 5AHNA 1JYXA 1XGZA 2P5NA 1XI3A 1J0IA 3AISA 1IXQA 4KEZA 4NX0A 5KSWA 3IPWA 3TOYA 3SY5A 3CAWA 3STFA 4M29A 4OGZA 3N13A 1AL7A 3IVTA 2AQVA 4HD5A 2W61A 4Q8OA 4GIRA 5TF0A 1UIPA 5F4WA 3UXAA 3ITCA 4S1FA 3DFSA 3MKCA 1EJRC 5HNRA 4BF9A 3GWQA 2YL6A 4LF2A 3JU2A 4GZEA 2ZZ1A 2Y63A 2CKSA 2B31A 1CGWA 1GPFA 3H7RA 2VQUA 3N6HA 3D47A 2FMOA 3IJQA 2QR6A 3L4TA 3B8UA 3FV9A 4HK6A 1R9ZA 3SRFA 3BSMA 3SDOA 4LV9A 1E1CA 4WXZA 4AWUA 3CH9A 4QLLA 4EAMA 5KTLA 3CHFA 1XUZA 3PWAA 1UASA 1X1ZA 4XAFA 4ADSA 2WPGA 1R3QA 1XBXA 3CV1A 1TJRA 4FF5A 4IJRA 4W87A 2VC9A 4MLRA 1WZLA 2Z00A 5AYBA 2CC0A 4DO5A 1DP0A 1POJA 4YLWA 5KZMA 1J79A 2X1RA 1LL6A 3VD9A 3CQIA 5F1UA 3QGAC 5G2IA 4GH3A 2DP3A 1A47A 2R24A 1R85A 3IJIA 1HGWA 4KKXA 3UBPC 1QJWA 3T05A 4E8GA 4LVFA 3AS3A 4J3TA 1I1XA 2DVXA 4M8UA 2BHZA 3U0HA 3NXLA 5FF7A 4QXIA 2GVYA 1OZMA 2O0TA 3UF9A 2C1HA 5FF2A 4UQBA 3NXFA 1OHLA 2BXVA 4CD8A 4UOZA 3URQA 4JTIA 4HA0A 2OSXA 3UXKA 1R2SA 5AFDA 5CGMA 3CPRA 2NWRA 1UA3A 1DJHA 3TWBA 1JNEA 4PGLA 2JKPA 1CXHA 2WHLA 3PUEA 5M3WA 2GSHA 4ZL1A 4YVPA 3FAXA 3WLJA 3AXIA 1OG0A 4Q8VA 2BP1A 2VWTA 4Z1CA 2OSYA 5G1MA 1FWFC 1SPQA 2P10A 4XWUA 4LUTB 1JGIA 3KRUA 3QHOA 1LWIA 1BQGA 3MO7A 3TV8A 1NOFA 4DXXA 5CBIA 1XLIA 4MY8A 3BARA 1WOBA 4JHOA 3AICA 4UWMA 1GTEA 4DJDA 2Y7EA 1QW8A 1ODUA 2V8ZA 7REQA 1LRTA 2CCRA 1P5BA 3AZTA 4D6EA 2I5IA 2PDMA 2E77A 1GQJA 1BAGA 1Q6EA 2FB2A 2HBXA 4KW2A 4Q22A 3B8TA 1WXYA 5C7HA 4AIOA 4GBUA 1PHWA 4CUCA 4LJ3A 3E12A 2HK1A 4O1FA 3UGRA 3G1HA 1UD3A 2VDHA 4MB3A 4F0HA 4BF5A 4MIMA 5AZ0A 4MUPA 2Y2WA 4O1DA 3C0LA 3GVGA 3DDMA 3CTTA 5FF4A 2PODA 4XBSA 2RKXA 4B5UA 3W25A 5A6BA 5FEPA 1TPB1 2HRWA 3GQYA 4JTUA 3CZKA 1F6KA 2FIQA 5A5WA 3W27A 4UZSA 1Q6OA 4B4HA 4JTTA 2CBVA 2PZ0A 2WCSA 4OWGA 1GONA 3S2NA 5G4EA 4NNCA 5G5IA 2CLMA 1R46A 3ZSTA 3HOJA 1SZGA 4R7OA 2HPMA 3MMDA 3ZXWA 4QE4A 2FQIA 2JE8A 3TN3A 3NJ3A 3S8HA 3GC4A 3RFAA 4MZYA 1UR4A 5A6TC 1DHKA 3QMRA 3M43A 3W3OA 3TONA 2GVEA 3CJPA 3WY1A 3LCHA 1Q7ZA 4HNOA 1OYCA 4ML4A 4AF0A 3VIGA 3GK0A 1TPDA 1W5PA 3P5ZA 4LAOA 1V77A 3WNOA 3NSNA 2OU4A 3MVTA 3LA4A 3ARZA 4WEVX 4PMJA 4OTKA 3RX2A 5CQ1A 3NQMA 1PTAA 5A6SA 1WZAA 2F6KA 2I5QA 3C2RA 4OE7A 1VFLA 4IX2A 3TNBA 3KLKA 1B2YA 3ABZA 1N7KA 2VGGA 1ONEA 3CWOX 4U4MA 2AAAA 5I79A 1W56A 4O0ZA 4ZR8A 1ZY9A 3WF2A 3WFAA 1G7UA 1DQWA 2YB4A 5CGTA 4DYKA 3QGKC 3EDFA 1TVNA 2XIOA 4QFUA 4K36A 1UA7A 3HFTA 4J35A 4FXFA 3N1AA 3FX4A 1LYXA 1EC9A 3WN6A 4ATWA 3CT7A 3E2SA 3OBKA 1A5OC 2W91A 5K9XA 3VOHA 3WIJA 2QCMA 4C1NB 4IG2B 1F3WA 1FHDA 1BVNP 2OXNA 2X7VA 3PR2A 5F4XA 4I8DA 4QX4A 1U1JA 3O1NA 1CXLA 4HA4A 3DFNA 3BQ5A 3OYZA 1FWNA 4GPNA 1IGWA 3AMKA 1W8SA 3NQBA 1X1NA 4WY0F 4HN4A 3OYXA 3O6CA 3L66A 2EPNA 1EYWA 3EWYA 1EPXA 4LRSA 1L2UA 2PD9A 4KEMA 2ISVA 3LRMA 5K9DA 3TTOA 3GDLA 4C6CA 4PMQA 3LNMA 3QV8A 4NQ1A 5FF0A 2ZUMA 1XBZA 2XU2A 1MEWA 4CCDA 4QEEA 1OZQA 1W5OA 3QV7A 1E72M 3EXSA 4F3HA 1TJPA 4QNEA 5LXXA 1Q13A 3QYQA 3UY7A 2OQYA 3LERA 3GVWA 3WNPA 3PTKA 1D3CA 3NZ1A 1GYNA 1EF2A 1JCMP 3I7SA 1IIHA 1DEDA 2BOEX 3WF4A 3T55A 4H04A 1PB0A 3WEOA 4XVEA 3BMWA 4KEVA 5CLWA 3WF1A 1W9UA 4LYRA 5BRBA 2HNHA 2DSUA 3F4CA 2LLEA 3TP4A 3W1AA 2CW6A 5AHFA 1R6WA 4XIMA 2H8XA 4PC8A 1U2YA 1DIEA 4DUXA 4WJEA 1XSKA 3TN4A 5LNUA 1GZJA 3RPDA 2FFIA 5I0DA 2NVDA 1GNXA 1LLOA 1KWGA 1R9YA 4HCLA 2WV8A 3FA3A 2DY3A 1E15A 4LC8A 5T9CE 5FA5A 3HA1A 1EJVC 3BAIA 4DAIA 2REQA 3VYLA 3EDJA 3ES8A 4R85A 5AHEA 2CEQA 5A8MA 1ZP3A 2E3ZA 3ZS4A 1DORA 1QK2A 3W7IA 4MWAE 4LH8A 1TVPA 1AODA 1GZGA 2FB3A 1MQQA 1UHVA 3U4FA 4E6MA 2WW5A 4HMNA 5KZEA 1Q85A 2VZUA 4D6JA 2WBGA 3ABQA 5XIAA 5CC5A 1HN1A 2QVHA 4NXSA 4JIRA 1K70A 3AIEA 3AI0A 3AIVA 1IHIA 3QXBA 1CT5A 3IGSA 1W54A 1EZ2A 3TTSA 4GQRA 3SUUA 5SWUA 1E1CB 2ZCGA 5H91A 4FB7A 1J2BA 5I7GA 1FH9A 4AH7A 3UWZA 3U3HA 3CL7A 4TVDA 1QI0A 4LT9A 4HOWA 4A8NA 3HBLA 1A5CA 4IGHA 3FEQA 3UA3A 3SADA 1QO2A 4RNJA 1GJWA 2ZZ7A 1ZAJA 3U7BA 1VCFA 3WF0A 3W7QA 3UP8A 1W9XA 1LQ2A 1H51A 4H83A 4DO6A 1KFCA 4JTDA 3VIFA 4CQBA 4KERA 5ABFA 3FYPA 1IXOA 4UTWC 3PZOA 5HOSA 3NIYA 5CPSA 3IRSA 4YJ5A 1S5TA 5E9AA 4HMDA 2WYSA 3UPWA 2VNCA 3LXAA 4PCSA 4QSHA 4OQVA 4DJFC 2BXYA 3SSZA 2ZXQA 4K37A 2QJNA 3ZT5A 1OIFA 1RBAA 1NJJA 4MLJA 1IZCA 4QDPA 3CL8A 5K4ZA 1VEPA 2QCFA 5I3KA 3LPGA 3ORWA 1EWEA 3EWDA 4FOUA 4UQ9A 4L7ZA 3S1XA 1XYAA 2YW4A 1C90A 4R34A 2X42A 4RX0A 3RCMA 1I45A 4JEJA 2YDSA 1J0ZA 1H1NA 2QIWA 4MJMA 4LXFA 3ITYA 5JXQA 1RBOB 4O16A 5C7VA 3ZVHA 4D8AA 2J9ZA 4P7QA 3LBCA 3NVTA 2BB0A 2DUAA 4CD6A 1AK5A 2CYGA 1VJIA 4PMDA 3I7QA 4HMCA 4F0KA 1GOMA 3KX6A 3NURA 2ZX9A 3ANUA 1UWRA 1UR2A 3MZNA 3WJYA 5D2XA 3RMEA 7CGTA 1RQHA 4BQ4A 3E96A 1W3NA 3M7SA 3BJSA 2W63A 5I3IA 2ZDRA 5H8UA 4IQLA 4E0CA 5H2ZA 1PKYA 2INEA 3BXWA 1VYRA 2HV5A 2PDKA 2E1DA 4I7WA 3S47A 2CLLA 7A3HA 1JUKA 2QGYA 1DL3A 3MUAA 2PS2A 5ECUA 1EXPA 3IARA 1O94A 1CENA 1QFEA 2YDQA 3J7HA 1M7XA 3NL5A 1J6PA 5DT5A 1UOZA 4BY3A 4PMOA 1P0DA 1MEHA 3H2MA 2GJXB 4GIEA 5BNKA 4AX7A 1E71M 3NPXA 1NQ6A 3IJ9A 1DXEA 3MI6A 3G1VA 3HGSA 2HDJA 1TB3A 1C7SA 2Z1SA 1QI3A 4JR5A 3T09A 4YPJA 1TPEA 2XFYA 6REQB 4EPKA 4J28A 4I9JA 1VFTA 1LF1A 3PJUA 3BANA 2XZ9A 4WD0A 3STCA 1EYEA 1J0YA 3GXNA 1BYDA 3N73A 3FK4A 4DO4A 1TJ2A 5CBBA 2CLKA 2BOGX 3DG6A 2WZIA 5GJNA 3V5CA 2PDIA 1HJQA 3WK3A 3E02A 1UWUA 2BZNA 1NFPA 2ISFA 2WC3A 3WQDA 1WOAA 3UETA 1KGWA 4PMUA 5AC6A 3PZTA 4N9CA 4AF0B 1DWGM 3ZR5A 5CZKA 3W1PA 4I9MA 1XYBA 3C2VA 1EIBA 3P62A 1XC4A 2PU0A 2YA0A 4DJFD 2GGHA 3NQGA 4FLQA 3LV5A 1CGTA 2FPVA 5A2BA 2Q3RA 3EDEA 3VD4A 2OVLA 4ICCX 3CGTA 3EXTA 3MCOA 4QS5A 3FCPA 3FKKA 3L4VA 1PS9A 1MDLA 3AWNA 2Z7GA 1Q6GA 3K8LA 2HVMA 4A29A 1GQLA 2JF7A 3NFUA 4XV0A 2WVVA 1GQKA 1E6SM 4PB3A 3ENLA 5EBUA 4QAWA 2J4GA 3TLLA 1FWBC 3VKDA 3IJLA 3HQPA 3PAJA 1JULA 1IQ8A 3AJ7A 2PDFA 3LPPA 3HMJG 1VPYA 3CK5A 2XUCA 2PGWA 3PFMA 2J79A 3W71A 5TQLA 4GX8A 1V02E 3WNLA 4CN1A 4GCXA 1AW1A 3W01A 4R7JA 3BOLA 2FZNA 2WZHA 1R3YA 5K4XA 3A4XA 5BXRA 4J3UA 5EMKA 1HL8A 4ADTA 1W9PA 3WK2A 1YDOA 1TRDA 2HQAA 2VGBA 2X0SA 1ZCCA 4HPJA 3USZA 2YL9A 2XIQA 3RPMA 3P0WA 1QMLA 2XWEA 2BHUA 3AZSA 4TIMA 1ADSA 5F2IA 2Q09A 3VCRA 1LTDA 3K4AA 1MW2A 3OJGA 4ZOCA 4GRSA 2JKAA 1IXPA 2ZUUA 4H8NA 2QMKA 3UWVA 4HOXA 3ARRA 5H1WA 4B90A 1H1ZA 1ZJIA 4AIEA 2DW6A 2P8BA 3D6NA 2D69A 1XCWA 1P0BA 1K02A 2EPKX 4GI4A 3WH5A 5BZAA 2Z4GA 3LNPA 3TJ4A 3K46A 2O9TA 4QE5A 2ZDSA 5E09A 4BS0A 2FGLA 2ZUNA 4MM1A 3ZLHA 4JOMA 4QG9A 4IIEA 4OFCA 4GUFA 2UY5A 2DUZA 3NEHA 3R4IA 4ICMA 3LDVA 1XIJA 3T2OA 3VNYA 4UBPC 1XM3A 3UWWA 3OU8A 4AZ5A 2GQ9A 3M0HA 5CSUA 5HJYA 1AQMA 3TEVA 4N0RA 3SCSA 4NY2A 2ZYFA 1TCMA 3URNA 4RLIA 1QXLA 3W72A 3QC0A 1Q66A 4S39A 3BLEA 1X98A 4FR6A 2O4MA 2REQB 3P93A 1NWRA 3NG3A 3W6LA 5FJPA 1KB3A 4DXVA 2PLJA 2XG9A 1I4NA 1QW7A 1TFVA 5G1YA 2AKZA 4G8TA 1LWJA 5LNVA 3CASA 4D71A 3VKKA 1OFBA 1UMYA 3M0LA 5J5DA 2DFAA 2W0UA 1AH0A 1K8YA 2BOFX 5I09A 1ITXA 3UJFA 1HFBA 1NOWA 3COTA 3RRAA 4S3JA 2Q6ZA 4ES4A 4CQAA 2XM2A 3EX2A 3OZYA 2E25A 3GTHA 3FJNA 1J10A 3UZYA 1LZOA 1KBKA 3CAKA 5IHRA 1JZ2A 1EJSC 1XIHA 2WMKA 4LANA 5F7UA 3M07A 1XYCA 4PMNA 3AUJA 1GVFA 1EDTA 1JCXA 4NUWA 4JTEA 1WDPA 5AB3A 5JVLA 3BW3A 2J8FA 2J66A 2B4GA 2WNQA 2Z1BA 4U3CA 4IPLA 1C92A 2PURA 1XLJA 9CGTA 4M6UA 1S2TA 2BVDA 4WF7A 5HMSA 3L4YA 1UWAA 4RE3A 3NYDA 3HN3A 3N6JA 1HP5A 1XPGA 3SQSA 4WOQA 4ZVJA 2NUXA 1TWSA 3OBAA 3F03K 2VP8A 3B0PA 1OADA 2Z29A 3B05A 3C2EA 4I6KA 3SIMA 2E6FA 1TA3B 1U5VA 1CECA 2JEPA 1X8FA 3MBFA 1FY6A 4JL2A 3S6TA 1OGBA 3LCFA 2WB5A 5C0QA 1W9VA 3ICJA 3NPWA 4NP7A 3OPSA 2PMQA 1VCVA 4O17A 2FHFA 2ISWA 2P3ZA 4GZIA 1P0KA 3F4VA 2PDJA 1DHPA 4RL3A 3TYCA 1S2VA 1BWVA 1QBAA 2J74A 2AAMA 1K9TA 2XWDA 3WO8A 1EO7A 1KNWA 4XZIA 2BY0A 2WVSA 2YZ5A 5HR6A 4POCA 3VNMA 1LL7A 3ZVHB 4AHQA 3H7UA 3F2CA 3EDKA 3MMWA 2NX1A 1Q8JA 3GDTA 3LGGA 1MFVA 3W2UA 4X9SA 3W7LA 1PSCA 2VEIA 4KCTA 4PUWA 2EBNA 3DYMA 2VXNA 1A0EA 4OZOA 3PNZA 2XVPA 2YBTA 1ME9A 3A3XA 3BC9A 4IGSA 1SFLA 4KESA 3VZZA 4Q7NA 3VIHA 1C93A 2F6UA 4CCEA 3EX3A 1LOQA 3B4YA 3O7UA 4GFSA 1PKNA 3H2AA 4DBDA 4FP1A 1F76A 1M01A 3XISA 4OHQA 4Y8FA 1E6XM 4TTGA 3MV01 1E5JA 3CTLA 3KWSA 1SW3A 4CU6A 1JG9A 2DZWA 4V2XA 3IWPA 4GABA 2HPIA 5E70A 3M0MA 4ZTYA 1KO0A 5FEWA 4PMYA 4DPQA 1UKQA 3MHFA 1L8PA 4QNWA 5AHIA 2W62A 1FUYA 1R5YA 1XKJA 2PSNA 5BWFA 3CLWA 4XO6A 1XSJA 2O55A 4AY7A 4Q8TA 4H2CA 1BFNA 4G7FA 3MMUA 1QK0A 4UTWA 4NYYA 1PEZA 2VDGA 4FMVA 4HPHA 4GI8A 3TQ0A 5HPOA 4IISA 1QI2A 3SCNA 5BMXA 2Q8XA 2PF0A 3CBWA 4DJFA 3PTDA 3VINA 3KVLA 3T4CA 2C14A 4RZ5A 3B8WA 1I6NA 1GZ1A 3WF3A 4QJ3B 3GXMA 3DHUA 4AW7A 2CITA 4FS9A 4S3DA 5AYIA 4LAMA 3DHPA 2BX7A 4C5YA 3H2CA 1MXGA 3KL0A 1EB3A 2IKIA 3WDIA 3IACA 2NSOA 2HE8A 3MUIA 2C0AA 1CTNA 3ARTA 4LUSA 3B97A 2EGZA 2G97A 3CUJA 2NUWA 4YTQA 2GGGA 4XVDA 3TWAA 4S3GA 1PUDA 1YIXA 1QO5A 3DX5A 1B31A 1R47A 3VTRA 4RNIA 1C8YA 1E51A 3GG1A 1GKPA 5DF0A 2EXOA 4AHPA 2EPMX 3MCMA 1THFD 4IM4A 3VOGA 3R6IA 2FLIA 3N9KA 4JX4A 1XIMA 3TW9A 1XH1A 3NGFA 2WVVB 3ATZA 3DYOA 3VGEA 4PYSA 1FWIC 2GYIA 3TKFA 1EJUC 5LGZA 4CNTA 4IPIA 4L4PA 1NP0A 3MSDA 3S3GA 2GWGA 3QFEA 1FFRA 3PPCA 1PL9A 4JCMA 1C9WA 3TYEA 1XDLA 2GGIA 3PBYA 3T42A 1VIZA 1CWYA 1G67A 1XD0A 4KBXA 3F4DA 4DJEC 1P7TA 3ZJ6A 4JIPA 4JTSA 1P1XA 3W1RA 2I57A 1H49A 2WSYA 4Z1YA 1XQKA 3C5QA 3PZUA 3AIWA 4MB5A 3F2BA 1VYSX 2QCDA 1MI3A 4FNSA 5I3FA 1D2KA 4H1ZA 4TOQA 2OQLA 1ADDA 3WNMA 3PUGA 1V79A 3GBEA 3C56A 3TQPA 3QKZA 1TIMA 1LBLA 3VOCA 4EANA 1EA9C 5E9XA 2GFTA 3DXIA 4TU1A 4V1YA 4KCWA 1H0IA 1NTHA 3OB8A 3UA4A 3W37A 2WOQA 5EMYA 2QDHA 2I7GA 4LYQA 3TA9A 4H00A 1B30A 2WZMA 1D8CA 3WQEA 3HPXA 3CMFA 1AD4A 1YXYA 1DPMA 3OA5A 1E6QM 1UW9A 2EAWA 2DEPA 4ZENA 2VRJA 1ZSXA 4S2CA 2WLZA 1QOQA 2R94A 5FKYA 2DV0A 2D23A 3QN3A 2H3DA 1EJWC 1TQXA 1AL8A 3SJ3A 1A5KC 5A1AA 4ZOBA 4Z2LA 1KM2A 1M6JA 5C5YA 4JCLA 3WLNA 4RXGA 5DY3A 2BLEA 2ZIDA 2H9AA 2D3NA 2W27A 1WDQA 3ITGA 2A21A 1YKWA 4N9DA 2DT3A 2PLCA 1QOXA 2W3ZA 3W1MA 4NZJA 4PMXA 3BAYA 1ISXA 3GKAA 4XO7A 2X1SA 1C8QA 1OFOA 2QPUA 2E5DA 1JD7A 3TQVA 1SMDA 3RPTA 4Q8WA 2EG8A 3KBNA 3BG3A 4EPBC 1PVNA 4RCXA 4AEOA 3NCOA 1XDJA 1QATA 3DHDA 1L6YA 4FNQA 4GIAA 2YDRA 3PJXA 3GHSA 4ZXLA 1D7KA 3PK7A 2ZXAA 2Y7GA 1OB0A 2G3IA 4DZIA 1V51A 2PP1A 1Z7AA 3FAWA 5HMFA 4KWWA 3PTQA 1UC4A 4AQLA 1G1YA 3A3HA 2YJQA 4C7GA 2O7QA 3UXLA 5G2HA 1PPIA 1YHTA 3NQ2A 1TZ9A 3F5KA 4Y96A 3BAJA 3QR3A 3ZSSA 1Q6CA 1J4EA 3ECQA 4GHRA 4AFYA 4H9YA 4EAYA 1ZJHA 2VTFA 5DCDA 1K03A 2ATMA 6XIMA 3WJSA 3RU8X 2ZVIA 3GHUA 5I07A 1PYFA 2ZX7A 2WSKA 3SR7A 4J40A 4DJED 3TXZA 4FEZA 1I2PA 1YADA 1ICPA 2O9OA 1BPLB 2Z25A 4DWSD 1YQ2A 3FY1A 1VPQA 3IJ6A 1ZGDA 3GHTA 3FLUA 5F4SA 3EEGA 4LCQA 3WH7A 2VL4A 2I16A 2PDWA 3LN3A 4KWSA 3CUGA 3QLLA 3UEQA 3NVDA 3U5UA 3T8LA 4WCJA 4YTSA 3QKEA 2QIIA 4DIAA 4QR6A 4G9PA 3VMNA 1XDMA 1KR1A 3VNKA 5CPMA 1KWKA 4JKKA 4GI9A 4QLKA 3BCFA 2PGEA 1XLFA 4U10A 1TG7A 1DJWA 1E0XA 3V36A 3O6YX 1X39A 4W8AA 3G18A 2TAAA 3FYYA 2WMFA 3GVQA 2DORA 2OTDA 1JFXA 3FGCA 4WDWA 1OD0A 2FZ8A 4FNTA 1Q5MA 3DU0A 4KQNA 4M1RA 3AYVA 5BMWA 4UIOA 3THAA 3TC6A 2QAPA 4NKCA 2Y5JA 1AFSA 4QLJA 1IWPA 4CNNA 2J7FA 4XZNX 4D6HA 3WMCA 1JCTA 3WLKX 4KWUA 3WQ5A 1RJPA 3QPEA 3G1AA 4GZJA 3G0SA 5I3DA 3EBVA 2A1YA 4O1CA 1WXJA 3KOWA 1CNVA 2F38A 3GC2A 4Z0JA 3K4WA 3AMCA 3OP2A 3C0QA 4AWSA 4YXGA 2TSYA 2IKHA 3S5ZA 1V3HA 4NYUA 3NM3A 1RJQA 4Q4MA 1W1B1 1RPKA 4K7YA 3CC1A 4JFWA 1PZ2A 1G69A 1ONWA 1GOWA 3QR0A 4UOJA 4INFA 1UB3A 4MWAC 1E9LA 3WNKA 4E2BA 1JAEA 3M5XA 3W2JA 1Q6DA 3HB9A 1V3MA 3TUUA 4AU0A 1DIKA 1GQNA 3N11A 4PCTA 3B9DA 2VFIA 2ACQA 2PEVA 2I9UA 1U5HA 3MU7A 2F7FA 3CQJA 2VKZG 4K8GA 4QQUA 3W4RA 7ENLA 3M9YA 4D1JA 1H09A 2Z0IA 4XQ6A 3LHTA 3HJZA 3TAKA 3DFYA 1Q7MA 3N25A 2NXHA 3CXOA 2VFFA 4Q32A 3E5BA 3N4AA 1V6TA 1VBGA 3LV6A 4OBTA 3EA1A 3AWOA 2DW7A 3RRXA 1O1HA 2OLAA 4S3EA 1S5NA 4RDVA 3R13A 3L4WA 3KDNA 5TIMA 1OJXA 4P7NA 3SUTA 2XINA 5AC4A 3RIKA 4ZEPA 3NAVA 3SI9A 3SZ8A 3M41A 3UPBA 9RUBA 1WUFA 2PDBA 3BDKA 2IXUA 1EP2A 3O6DA 1UUQA 2XSXA 2WKGA 4X0VA 2W9MA 3ZJ7A 1ELSA 1TRIA 4OV4A 4RR4A 1TVLA 2OSWA 1EJ7L 4MG4A 3KWXA 3BVJA 3S9ZA 1A80A 1L8NA 3SFWA 2G4JA 5CJ5A 4DF1A 2BASA 3IIPA 3GO2A 3R10A 5FAJA 1UZDA 2ODOA 4LUSB 1CEOA 4MOZA 3Q45A 3PFRA 2D3LA 4MAVA 4AB4A 5L9FA 4GVHA 2OOGA 3H53A 2PZNA 4CQ9A 1E43A 4O13A 3BURA 3T81A 4AEFA 3L4ZA 1VJSA 2WJFA 1NWTA 3KW3A 3VGBA 3VNDA 4CNPA 3GUGA 4AD0A 4IIDA 4O0QA 3AXHA 4AIUA 1EH9A 4Z2KA 4CCCA 5HNTA 1RZMA 2YXGA 3CZ8A 2PAJA 4HCDA 4N9EA 2J7DA 3SCWA 2QMJA 4EWND 1XUUA 3WSUA 3DGRA 3EX1A 2Y8VA 4WSHA 4PTDA 4X9YA 3SCPA 3AIUA 5GQBA 3TZFA 4QJ4B 4GGBA 2BWGA 5HINA 4Q4QA 4JNMA 1Q2SA 1XFCA 1BGGA 5HULA 4V28A 4UTIA 2DIJA 1UR0A 4W85A 4KETA 4F79A 4JIQA 1JZ6A 1E9IA 1Z32X 1IWBA 2DZVA 4Y7EA 2XFFA 4OOZA 3M64A 3C4UA 3PY2A 1VLIA 1T7LA 2EG7A 5C70A 1S5VA 1P7TB 4H19A 4ZTXA 4NJGA 1ECEA 2QDGA 3R11A 4AVNA 1ZFJA 1VFHA 2CHRA 3BZGA 1YYAA 3V1PA 3UT0A 4F0RA 2JK2A 4ZSUA 3W7HA 1ZUAX 1ZS2A 1B0IA 2BDQA 2QCDB 3WFZA 5A69A 4BI6A 4MWAD 3F4NA 5FI8A 3TSMA 1KCXA 1V93A 4FA3A 1LBMA 2Z2UA 3I65A 3VILA 4H6EA 2YA1A 3KOFA 3WH8A 5M03A 2ZUVA 3MYOA 4IQJA 1U33A 3LENA 3VM7A 3MCNA 4DQWA 1AH4A 4OV9A 2E09A 1RBLA 1HZYA 4C6OA 1UZ4A 4YHEA 3W9ZA 3NQFA 3LPFA 1X96A 5FSEC 1LLWA 1Z48A 3HTWA 4JKLA 2DZBA 4LS2A 3KL5A 1CGXA 1QT1A 2F6XA 2NZLA 3EB4A 3GYEA 3DENA 2ISSA 4A6GA 1WXZA 1MO0A 1NH6A 3BE7A 3JZUA 4AZ7A 3TN6A 3H4WA 1PIIA 4JY8A 4YYFA 4MJZA 5JUVA 1R2TA 4P8XA 1ICQA 1PKLA 2PCEA 4US5A 2PB1A 5H8MA 1HX0A 3ITTA 4FXSA 4FIRA 3CZLA 4BI7A 1A3WA 1VEMA 4FNPA 1JRCA 1XLLA 3PSVA 5ABGA 2QF7A 5IBXC 2H9AB 1GPWA 3S2LA 5HUOA 1QHZA 4NZFA 4H8HA 5F2MA 3FA4A 4NNBA 3THQA 1FQ0A 1WV2A 3E38A 2ACRA 3OVRA 4TX8A 2GLKA 3P67A 1AQ0A 4LCRA 5FEZA 2CHOA 3H54A 2VX5A 3L23A 4KMQA 1BWKA 1IEWA 5EA9A 3SN1A 4O19A 1TV8A 5BROA 3SO7A 3MPGA 3OQ8A 2QUMA 5DANA 2QUUA 2X8RA 3UY8A 3GG0A 3S83A 3AQUA 4XAYA 2I56A 3QFWA 1QVBA 3RG6A 4L4MA 3VDBA 4TV6A 4FO4A 2G4FA 3H8AA 3T2PA 3G1SA 3ZR6A 1V5XA 2X09A 5HK4A 3POHA 1W3LA 4O1AA 4HQVA 1DQUA 4PBGA 1I1WA 1QWGA 3OGRA 1W5QA 3LXCA 3P6LA 1ODZA 3RJYA 3OZPA 3IIXA 1CDGA 2G5WA 1TE1A 1KXHA 1KFLA 1XLBA 3WQWA 1DJYA 1OCNA 4LW7A 2IQTA 4HTBA 5LHFA 2OLSA 1GJPA 4DBSA 3SURA 5KITA 4PEEA 3DFHA 3BCJA 1IT0A 5FESA 2WSQA 3LY0A 3E3HA 2PD5A 3WBAA 1SZRA 5A8NA 3LTSA 4EXAA 3L5AA 3PZIA 1W1A1 3W1QA 5DXYA 3PB0A 2P3EA 3RCNA 3AS1A 2QCLA 2OT0A 4GYJA 3GR7A 2ZE3A 4NAFA 1H1YA 3ARPA 4Q8PA 3UR8A 4D6GA 2VI0A 1CGVA 2Y4SA 1EX5A 1NQKA 2QT3A 3EPMA 3W00A 3WLSA 1TSIA 1IEXA 2OYMA 3UW6A 3MUZ1 1GVOA 3C52A 3WKZA 4AZ6A 1S2WA 5A2AA 3UWQA 1C9DA 2W92A 2AKMA 4F40A 2GVJA 1ZBVA 2YKKA 3VOJA 1ALDA 1JPHA 3REQA 4JIEA 3HPZA 3W2KA 4EKJA 4ZQOA 3WENA 1S2AA 2J9XA 1F5ZA 3UG3A 3FGCB 3VUPA 3M4HA 1LG1A 1P0EA 1OX5A 4IGNA 2Y62A 4HK5A 1JDDA 2AOSA 1XBYA 4F8XA 3TYUA 3BWWA 2NQ9A 2PBGA 1PKMA 1UH4A 5A6LA 1JDAA 3KOXA 1WAUA 2BY2A 3MSRA 2E6AA 5B7YA 1HJVA 1HJWA 5LNWA 4KFNA 1YXDA 3GNDA 4M82A 1MW3A 3T4WA 4Q4KA 3WJWA 2AQWA 3A22A 3QJAA 7TAAA 1UKSA 4GY1A 2GSJA 5I6SA 1BTCA 1RCXB 3EKZA 1EEXA 3HGJA 5XINA 3RN6A 3W07A 1E73M 1NDVA 4XKMA 4Z1AA 3HPSA 1G4PA 3SRHA 5I24A 4BQ3A 1TV7A 1VC4A 2A6NA 3VDCA 3H70A 5HBFA 4WHBA 4TX6A 5BU9A 1XYMA 4MF4A 2PGRA 2WKLA 1SO4A 4Q8NA 1R7OA 4MNJA 3LMZA 2H90A 4ROQA 3A4WA 2C19A 1JXJA 1WBHA 5FJOA 3EDDA 1RY0A 1ME7A 2PWHA 2VEPA 1K4GA 3JR2A 4KS0A 4F0MA 1W32A 4QDWA 5K3VA 2DIEA 5B7ZA 5EMLA 5BRPA 1KQZA 4PRTA 3KZPA 5FF3A 3WLPA 1X1OA 1BVWA 3KBSA 4IFRA 3ZT7A 3JRKA 2C8NA 2YA2A 3D3AA 1KCKA 5FJRA 1W1PA 2BV9A 3LGEA 3H55A 2WHKA 5TD4A 4RNHA 2ALDA 1VENA 3MJMA 3U4AA 3KS5A 3T0AA 1TO3A 4O0KA 1MNZA 2WK2A 1BG4A 2KZHA 2QVNA 3SCRA 5M2FX 3GYCA 4IJCA 3G22A 1B57A 3QBUA 2VUYA 2AGTA 1ISVA 4KPLA 1LQ0A 4PMRA 1OT2A 1ZAIA 1W1ZA 3RYSA 3AXXA 4XZBA 4GVFA 1HVXA 3A64A 3P60A 2JKEA 2FFCA 1OG6A 3DAQA 4OKDA 1E6ZA 3G77A 1JAKA 1E4MM 2OPJA 2PP3A 1MQPA 4XD5A 5CPLA 1RP8A 4H4IA 3ZVIA 2TPSA 4UNLA 4FR1A 3W24A 3QF0A 3S5YA 6CGTA 1UR3M 3W2LA 1EPVA 2OKOA 1E9YB 4UFKA 1XGEA 1NIUA 3FHAA 4QG8A 2C0HA 4I90A