3ITGA

Structure the proline utilization a proline dehydrogenase domain (puta86-630) inactivated with n-propargylglycine
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
524
structure length
398
Chain Sequence
PQSVSRAAITAAYRRPETEAVSMLLEQARLPQPVAEQAHKLAYQLADKLRNQFVTGETIAEALANARKLEEKGFRYSYDMLGEAALTAADAQAYMVSYQQAIHAIGKASNGRGIYEGPGISILSALHPRYSRAQYDRVMEELYPRLKSLTLLARQYDIGINIDAEESDRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPLVIDYLIDLATRSRRRLMIRLVKGAYWDSEIKRAQMDGLEGYPVYTRKVYTDVSYLACAKKLLAVPNLIYPQFATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIYAPVGTHETLLAYLVRGANTSFVNRIADTSLPLDELVADPVTAVEKLAQQEGQTGLPHPKIPLPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Bifunctional protein putA
publication title The structure of the proline utilization a proline dehydrogenase domain inactivated by N-propargylglycine provides insight into conformational changes induced by substrate binding and flavin reduction.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 156
structure length 398
sequence length 524
chains with identical sequence B
ec nomenclature ec 1.2.1.88: L-glutamate gamma-semialdehyde dehydrogenase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01619 Pro_dh Proline dehydrogenase
A PF14850 Pro_dh-DNA_bdg DNA-binding domain of Proline dehydrogenase
A PF18327 PRODH Proline utilization A proline dehydrogenase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3itgA00
3APTA 3E2QA 3FSTA 3E2SA 4JNZA 1TJ2A 1B5TA 1V93A 1ZRQA 1TJ0A 2FZMA 4O8AA 1TJ1A 3IJDA 2FMNA 2FMOA 3FSUA 1ZP3A 2FZNA 4JNYA 3E2RA 3APYA 1ZP4A 1TIWA 3ITGA 1ZPTA
chains in the Genus database with same CATH superfamily
3RAOA 1DORA 1BSIA 4YL2A 4Z17A 1LP6A 4WY0A 3VCCA 2QCCA 4MGGA 2V5KA 4KETA 3KCOA 2FH6A 2OWXA 1AFSA 4RUBA 2WKLA 1S3HA 3EPOA 4B5NA 4RNJA 2DT0A 4JIQA 5C7HA 1WO2A 3NXLA 1UMYA 2ABAA 1J8VA 4FX6M 3HV8A 2QMJA 3CL6A 2ZE3A 1YE6A 2WJEA 4EVZA 2UWFA 1FY6A 2IQDA 1Q6FA 4IL2A 3PJWA 1B3XA 1W8SA 2XWDA 2EG6A 3GIYA 3PTMA 3KRBA 1M68A 1CXEA 4GGHA 2EPNA 5M3WA 3R13A 3PPFA 3G3DA 4AYGA 5LGZA 2QDGA 1TV7A 3HQ1A 2P0OA 3OVQA 4L6DA 3WH5A 3TC6A 3WQDA 5FJPA 1W9UA 1SYTA 4H7CA 4P7NA 2FTPA 2IXUA 4IG2B 1CGWA 4QM1A 1AZ2A 3R8GA 3N2CA 3GIPA 3O6CA 2EG8A 2Z1WA 4LUIA 3RX2A 1KTNA 3SCUA 4GIYA 4E0CA 2CBVA 4NQ1A 2J47A 2FFIA 4AISA 3ZWSA 2XUCA 1KM0A 2WW5A 2WZEA 1UA7A 3HURA 5EGRA 5HAOA 1PV8A 1V3JA 1JCMP 1N82A 2BBFA 4AZ7A 4OTKA 2O7QA 4FNTA 4NNCA 1XG4A 4F0SA 4WY0B 4PMRA 1A3XA 2ZOXA 1RJPA 3AMGA 2Z26A 3W1NA 4JQ4A 3LMZA 2D2JA 3EB2A 4LSBA 2VXNA 4HPNA 1GORA 1HKKA 3GY1A 2FZ9A 2V5LA 3E12A 4DXVA 1HKJA 1QNVA 2Y5EA 1IR1A 1E9ZB 4XAFA 3CMGA 2ZUSA 1UKSA 2TSYA 2RDUA 3B3DA 1RLDA 1TO3A 5CC3A 3DI1A 5B80A 2FHCA 3ZLGA 4DXXA 5LSMA 1UIOA 2OG9A 3NPXA 2P3EA 1JVNA 3L0GA 1G7UA 2Y62A 1KBBA 1Q65A 4L4MA 4DF1A 2BSLA 3BLIA 3ZFHA 2OWCA 3OHIA 4Q8TA 4GYPC 4X22A 4FIRA 3MBFA 4L80A 1ZU8A 4PFHA 1YIXA 3QC3A 3EA3A 3T07A 1ADOA 3PZGA 2ISWA 1US3A 2Q8ZA 4P61A 4W8LA 2PCEA 3MZNA 1JULA 4PBFA 1YPXA 2PDFA 3NOEA 4GRSA 3BURA 1A5NC 5GQBA 1K9FA 1XDJA 2V0TA 4PUWA 3MSGA 1EJRC 5LXXA 2GOKA 3VDBA 1QAPA 2B4GA 1NIUA 4UB9A 2X1UA 4JXCA 1IEWA 3G6LA 5TQLA 1SFSA 1H0IA 1YKWA 3UCQA 3A13A 5DY2A 4HTBA 3W7OA 4ZQNA 3YPIA 4BQ3A 4GO9A 2DW6A 5I0DA 4PYSA 1G4EA 2C18A 2Q6ZA 5EMJA 4LVBA 3T0TA 5I77A 5CLWA 3UR8A 2ZWZA 1UR0A 4PL1A 4KCUA 4H83A 3CAKA 2ZWYA 1D8CA 2TODA 3DFQA 3E74A 5C2GA 4IP7A 4KKXA 3R25A 2CLOA 1G1YA 5TBOA 4D6HA 4O1EA 4F66A 2WVTA 3GZAA 1LCOA 1MUMA 1LM1A 5CCZA 3I6RA 3NQEA 5FF0A 2ISSA 3GDRA 3DENA 4I90A 3UZ5A 4Q7BA 3KHDA 3NDZA 3R11A 5AVNA 3P82A 4IPLA 1ICQA 3WZ0E 2VZSA 5HQMA 4UTKA 4B3KA 1Z42A 4S23A 2HS8A 4O57A 1GT8A 2NV2A 4YTRA 1E5NA 4R27A 2HK1A 2DUAA 4M80A 3DYPA 4QNEA 4QCFA 1OFQA 4OT7A 1W1B1 1TV5A 2FH8A 3AS2A 3NPUA 4UZUA 4JTJA 2R14A 4AX6A 3RPMA 2VGBA 4KWOA 2VCAA 3MZ2A 4PCFA 1THFD 3S6TA 4G9PA 4EIVA 3FHAA 4TV5A 2J6XA 1HJXA 3CZKA 1HIZA 4Y8FA 3WNKA 4B5UA 2DIEA 3GU9A 4Q4RA 4PZVA 4MB5A 2XJ7A 1TVLA 2P10A 3TV8A 1R6WA 3L4VA 3PB2A 4YPJA 2RUSA 1HO4A 3W2NA 1LQ0A 1A50A 2GQ3A 5GNYA 4XKMA 4MY1A 3G1VA 4B2DA 3UXKA 4HNNA 4EXAA 4F4RA 3D46A 2HE5A 1HW6A 1RALA 1NM9A 2X2GA 5CPNA 2OEMA 3HGOA 2NLYA 4CEUC 5DLCA 4CQBA 4HIBA 4V15A 5KITA 4NXSA 2WHJA 3BAXA 4RE2A 1DHPA 5BCAA 2V81A 3CTLA 4FR6A 1OY0A 7PTDA 2GOUA 3KEHA 3LSBA 4O18A 3WH7A 4D8LA 2W3ZA 4W85A 5FAJA 4C6QA 4WGHA 3MPGA 4RW5A 1NSJA 2VP8A 4LQ1A 4G56A 1XSKA 3MCNA 5E9AA 5FJIA 4BQ4A 3QH2A 4PR4A 4OKDA 1SZRA 1XD0A 1C9WA 2DIKA 2AL2B 1KGXA 1H63A 5LNUA 1QWKA 2OO6A 3UGRA 4MB4A 3W1QA 4ZGYA 2GJRA 2XHYA 3W2KA 3DBNA 2HROA 5C2XA 4FXFA 3AS3A 2DEPA 1UKQA 3UXLA 1JXJA 1HKIA 1LL7A 4I5XA 3W2UA 2PLJA 4GXPA 4B3ZA 1FP8A 1JCNA 4ACZA 2DZBA 3MWCA 1IXPA 2P1FA 3BSGA 4JIRA 1SO5A 3WLHA 4TO8A 2PDWA 4AZ5A 2BDQA 1JQVA 3RM9A 2YDAA 1B90A 3NQAA 2WMKA 4AXNA 2AOSA 4ATLA 3GDBA 1QVBA 3AIRA 1QBBA 1A5OC 3MQTA 4RNFA 3NQFA 4UOJA 3A5VA 3AISA 2J7CA 5D9MA 3UPWA 1MXSA 1ITCA 5REQA 3PPCA 2WHKA 4RCXA 3WUBA 1V3LA 5CPQA 3TQVA 4WOQA 3LCFA 4PUKA 2PZNA 2ISVA 4CN6A 3TA6A 1EPXA 1VS1A 4PUJA 1G4PA 1KCKA 3UW6A 2R1LA 2ZVRA 5E93A 2DFAA 1Q13A 1T8QA 3BMXA 4ZFMA 2CIPA 3FJLA 1SQ7A 3SRHA 4HZ7A 1N8WA 1BYCA 3CUIA 3VFCA 3ZT6A 3WFAA 3SY1A 3GNPA 3LHVA 2ZUTA 3FIGA 3RR4A 7A3HA 4O11A 3OZMA 2JBMA 1ZHAA 2INEA 3ISIX 4M8UA 4PMYA 2EGZA 1P4CA 4ACZB 4AZ6A 4K1WA 5HMDA 1V0KA 3UJEA 3N3MA 3AAMA 5PTDA 1GTEA 3N4EA 1EHAA 2OZ8A 1I2NA 3W26A 3L23A 4UTFA 2UBPC 4CVWA 4NZ4A 4PUMA 4D6CA 2WMGA 3VDHA 3VD4A 4M6QA 1KV8A 1XRFA 5F1UA 3VGFA 1RP8A 1JNEA 3DHFA 5CJ5A 2WC3A 3V36A 3ARYA 4E2VA 2ZKMX 3VYLA 3QF0A 4GY7A 1NDWA 1XV8A 5REQB 3GAYA 2XPKA 5K4ZA 2OYLA 1BF2A 3NQ7A 4BCEA 2OJPA 3P5YA 3BARA 4MVAA 1KFLA 2QR6A 1FCBA 5C2CA 1VPXA 1H7RA 2J13A 1L6GA 3L0KA 3O0KA 3REQA 3VOIA 4MPKA 2PWGA 4WHBA 2HRWA 4XUYA 3LK6A 3B9NA 3T81A 3OG2A 5FACA 1LWHA 4N4QA 3NL3A 3CMJA 4GOAA 2VM8A 1ZP4A 1F74A 3HPSA 5TIMA 1XH0A 3N11A 3WJYA 3OGSA 3QV9A 4FEZA 4JQAA 3A24A 4WR3A 1QK0A 4ZOBA 2ZA1A 3MDWA 3U3HA 4MWAC 4MUZA 1DQWA 4KWUA 3GXNA 4RE3A 5D2VA 5BXRA 3LG3A 3E0LA 3PTQA 4QR6A 3DFNA 1JPIA 3ZVIA 1DWIM 1MW2A 2VUNA 2Y5SA 3QGAC 2QCLA 2IQTA 4HQVA 1WBJA 3WQCA 4QBXA 4QEHA 1GEQA 1HG3A 3H2MA 4R9OA 2JE8A 5L9FA 3T8QA 1ISYA 1AH3A 3PHAA 5FEWA 1W54A 3OBKA 4MYXA 2YDRA 3BLEA 4TVDA 3VZXA 3BW3A 2ZC1A 2PTZA 2FPVA 2C1IA 4N4PA 1I8JA 1O5QA 1GVQA 5CAKA 1XLGA 4K37A 1XIGA 4C7DA 4DXKA 5DMMA 3UJSA 2QJMA 4AW7A 3EDEA 3B03A 4HTYA 2V3GA 4RDZA 4TTGA 1DPMA 4QAWA 2OSYA 4DBDA 4QCEA 3CQIA 3EOUA 1W1TA 1R2RA 2NX1A 1IQ8A 2Z1XA 1KKOA 2PS2A 2Y7GA 1EBGA 1Q6DA 3MUCA 3VNMA 2Z1VA 3A64A 3IGHX 2O92A 2J7DA 1FX6A 4LBUA 5G1YA 4A3QA 4OV9A 4PTVA 5AB3A 5DCBA 4G7FA 4HNVA 5ABGA 2CBUA 4E8GA 2GL5A 1TTJA 4IISA 1R87A 2DIJA 3VX1A 3AZRA 5HINA 4GH3A 1XDLA 2WCGA 4RZ4A 3M0LA 3M0XA 1VRDA 4WCJA 4E5TA 4LVDA 2R24A 4AXKA 3WD1A 2AGKA 4IQJA 1LLOA 4Y9PA 1KRMA 1H3GA 4AHPA 3WDHA 1EIBA 4LPCA 2Z29A 1MWOA 4CD6A 1H49A 1RY0A 1XC6A 3ARWA 1ONWA 1K6AA 2ZX6A 4U10A 5D32A 1UPPA 3W7PA 2WCSA 3UBPC 4S1FA 1BFNA 3GDLA 5CZJA 3BK0A 4GJJA 4MWAD 3A12A 2PBGA 1M53A 4CD8A 1KBKA 1EA9C 4US5D 5BWFA 4W5ZA 2AQVA 2PF8A 2Z2AA 3V3WA 1H7NA 2ZRVA 4C5YA 3GYCA 3WLOA 5KZEA 4IIEA 4WRHA 3M9YA 1DJHA 5IDZA 3UWQA 5CGQA 3T1GA 3DIPA 9CGTA 1TG7A 5JMUA 4GLEA 3SCWA 2V9DA 1JAEA 4NZ5A 3LTSA 4P5UA 4GPNA 2D23A 3WBEA 2WOQA 4C1LA 4QE4A 2GJXB 3QSTA 1MNSA 1HX0A 1NP2A 2PSNA 4GQRA 3TTEA 1VBHA 4PRWA 5A6AA 1UCWA 4UFHA 5A8PA 1ELSA 4RJEA 1XBZA 3CLWA 5TAOA 4R33A 3O16A 4CUCA 4XTIA 3MT1A 2PDJA 1K77A 4LEQA 4DJDC 1PTAA 3EOEA 2DORA 4ZB5A 3GKFA 2H3DA 3VOCA 1Z7AA 1Z6KA 3CUJA 2TRSA 5E09A 3VOGA 5LNRA 1IZCA 2OOFA 1H1ZA 1S38A 4RR4A 3JUGA 1OD8A 2D0HA 3DG3A 3WK0A 3MA8A 2OQHA 2X30A 1OIMA 2BXVA 4CN4A 2PPGA 1XSJA 3NUKA 5C71A 3PB0A 2HK0A 2WHLA 3KOWA 3C86A 2HBXA 1VFMA 1FHUA 1A5LC 1VAHA 2FDSA 1IIHA 5D2XA 2QDDA 3SECA 4AWEA 3P8JA 5EKYA 1KR0A 1Q66A 3G77A 5BXTA 3TYAA 5F2IA 3QMSA 3N9KA 4E8DA 4V2XA 5AECA 2JEQA 2P53A 2EPLX 3L2MA 1OADA 3U7VA 2Y2WA 1VYPX 2YB1A 2QLYA 3CAVA 4N9EA 4DPPA 1V4YA 3RDKA 1QU4A 2ACQA 1XGZA 3TYBA 1V77A 1M41A 1XPYA 2YIHA 2YPIA 2CLEA 1WAWA 3MU7A 1F2JA 1KWGA 1EXPA 1LRNA 1C91A 2X40A 2X41A 2EBNA 3W7RA 4LW7A 5HPOA 5DN1A 2DZVA 1B31A 4FMVA 3IV3A 4EE9A 1LORA 1A3WA 1EJVC 4KCWA 3BCFA 1DJYA 3TW6A 1VJZA 5T8GA 1M9HA 4PMOA 5C5YA 3EWDA 1JZ3A 5I3DA 3KL3A 4AH7A 2VDHA 4PE8A 4GZ7A 3BLFA 3WD2A 3AFBA 5MF5A 5A6TC 3QHNA 3S2NA 4X3ZA 4O17A 3QQWA 1XPGA 1R3SA 3S1XA 3LI1A 5XIAA 2RKXA 1OGBA 1O66A 1PX3A 1P7TB 4WJ8A 1MFUA 2OELA 4D71A 3IVUA 2FGLA 5G5IA 1KQYA 3SGZA 3N18A 1S2CA 1W31A 1RSCA 4XKYA 3WY1A 3BOLA 2QVNA 5I2UA 3M5YA 2I16A 3NQMA 3FKKA 3OU8A 4DJDD 4UTTA 4TVUA 3GR7A 1XIEA 3GVRA 4H6KA 4AD1A 2CNCA 2QCNA 4US6A 2YA1A 1GQKA 1LRTA 1LL4A 1FCUA 2QCHA 1VEOA 2HNEA 4IPIA 1MDRA 3CZ8A 1KCLA 1FWCC 3MSYA 4UTWC 3GDKA 3TJLA 4WKFA 4LAOA 2OU4A 1OYAA 1O12A 4O14A 4ZO8A 2DSVA 1HVQA 3W2LA 3CH9A 1GK8A 2X1RA 2VCBA 2VNCA 1Y0EA 3VKKA 4D72A 1HL2A 2WJDA 2Y4SA 1KXTA 1GW9A 2E6DA 4L56A 3GYEA 4GI6A 1E73M 2VRKA 3CTTA 3LRMA 3UZXA 2ZXAA 2J7BA 1UD2A 2BFGA 3DC8A 1AK5A 3TLQA 4TX8A 5D9PA 3IRSA 2BGQA 4HNUA 3PNZA 4M3PA 3S47A 2QGYA 4JBRA 1ONXA 5FJOA 3S9YA 3ARZA 2YXXA 3F1QA 3V5CA 1FFQA 3GUGA 3URNA 4QDPA 1FWGC 4AEOA 1MQQA 5B7YA 1HFBA 4MIMA 2Q8XA 3T0AA 4WY0F 3GU1A 5FJUA 4GFSA 1YTDA 3E2SA 4M0XA 1YDNA 1WBHA 4XKYB 3TEVA 1L9WA 2PDQA 4O53A 4UFKA 1GJPA 2G3FA 3QYQA 2PCQA 3ATYA 3B0XA 3NEVA 1U5JA 3TTYA 5IXEA 4IT1A 4WKAA 3IARA 1NWUA 2P50A 3MMWA 5HJXA 4FNRA 1TWZA 3HPFA 3CUFA 1BGGA 3STFA 3I65A 3UYCA 3LHWA 2PTXA 2EQDA 3P93A 3BANA 1UB3A 3DFOA 1ZY9A 5C9UA 2FB3A 3OB8A 5D9NA 4J28A 1X98A 2EEXA 3T2OA 1RCXB 2FZMA 4PBEA 4UR9A 3MB9A 4V1YA 4MJ4A 4HSNA 1JNDA 3SY8A 3WNOA 3RM4A 1FH8A 3E0FA 4XZNX 5FJRA 3STPA 4QXIA 4PUDA 3S9ZA 3WLJA 3SUVA 1C7SA 3PR2A 1XLAA 4PRRA 2VVNA 3MKVA 4DO7A 2VEMA 2ZYFA 3BG5A 2VX6A 4D1IA 3HBLA 3S5NA 1QI5A 3T6CA 5BRPA 4LJ3A 5DBUA 1OYCA 4CGTA 4I7VA 4HPXA 5HNTA 4O8RA 4PBGA 4ERGA 2YBUA 4FALA 3M43A 1S2AA 2FJKA 1CTNA 1PWLA 4GQGA 4AMCA 1LUCA 2FTWA 2VRQA 5K2ZA 3STGA 3ALFA 3KVJA 3LD5A 1ADSA 3CHCA 2WZMA 4HA0A 3BGGA 5BZAA 1ALDA 1DJWA 4WIWA 2QPUA 3RLVA 1EJUC 2WANA 4R88A 2ZFAA 3G3MA 2OOGA 1VZWA 4LAUA 3VD9A 1YADA 4TU1A 4KWWA 5D38A 5BOFA 2GJLA 2ODOA 3WDRA 1V6YA 2VC7A 3TYEA 4UIOA 1B5TA 4JTDA 3HQOA 1EEXA 4BJHA 4DLMA 4JGDA 3SUTA 2DUXA 3EEZA 1MEWA 1BWLA 4S2BA 3DOPA 3QPEA 4D6EA 4K39A 3VUSA 3VMPA 1TPEA 2CFFA 1V6TA 2Y85A 3ITCA 3LCXA 4DJEC 4E2OA 1QJWA 3O3RA 1EZWA 2YJQA 1GOKA 3WJXA 1TZ9A 2BVYA 3NJ3A 2ACSA 3EX2A 4TMCA 3CV7A 3F2CA 1S5TA 1TQXA 4MFEA 2RGMA 4KMQA 2YA0A 2PRHA 1UC4A 2UV8G 3P84A 4MZ1A 3C3NA 2JIWA 5LIYX 4JQ1A 1H5YA 4RNHA 5EB8A 1XIJA 1LUCB 4RV3A 4S3AA 1W6TA 3HFYA 2A6LA 4PGLA 1OSEA 1HP5A 3TSDA 1FWBC 2JEPA 4ZO7A 1YE4A 4KH2A 3IV8A 1D3GA 5FI8A 1E70M 2EKGA 1W5PA 4HOWA 3O6DA 1O6IA 4FF5A 5EMMA 1KFKA 5D02A 4C1NA 3QQ0A 3LPGA 5JBFA 4YHEA 3VNLA 4UMBA 2IXVA 3QN3A 3TE9A 4LGXA 1R3WA 4UTHA 1H41A 2X05A 1KO0A 1UR3M 1J5TA 5AHEA 1QI2A 4OWGA 3C2EA 3FNDA 6REQA 1YNYA 4J40A 3IANA 3VIMA 3HFTA 1ZBKA 2F84A 4TUFA 4XO7A 1B0IA 4POCA 4L1WA 4UTUA 3H2AA 1TJ2A 4TTUA 4W89A 1G4TA 4P8WA 2QAFA 3BAYA 2EG7A 1J4EA 1TVNA 1RCOB 5CPSA 1HGWA 1HJUA 3P14A 4KBXA 4E4PA 3HG3A 2O9RA 1DJIA 4UBPC 1J0KA 4FOUA 4DJFA 4GBUA 1CW2A 1X8CA 1E4MM 2R1PA 4W7VA 4ZQOA 4U5KA 4O54A 2VX4A 1FOBA 4JIPA 1S3TC 1G6CA 4GMEA 2VHLA 1GKQA 3K46A 1C8QA 3W25A 5FEPA 1U33A 2DH2A 1AW2A 1UR4A 2WQPA 3VDAA 2Z6JA 3CUXA 4FX7A 4N0RA 3THCA 3ELFA 2PUZA 2CLIA 2VC6A 3EWUA 3KE0A 1YMYA 3WBXA 1H7WA 3THDA 3THAA 1XM3A 1W5QA 1VH7A 3DG6A 5DELA 1DKWA 1GPWA 3NQ2A 2QF8A 3PSVA 2FZBA 4GFIA 4HKPA 4JTQA 1K9EA 4AX7A 3S1GA 1V3HA 4Q8UA 5IBXA 1TUXA 2H9AB 3AWNA 4QG9A 3SURA 1XLFA 4DUWA 3N6QA 4WQ6A 2D3LA 2CU0A 3H55A 4IWWA 3WQFA 4N9CA 2WJFA 5IOBA 3U4FA 3QLLA 4H41A 1UP0A 5HPCA 4ICCX 4PTMA 3LPOA 4GBDA 1Q2SA 2CEQA 3N6JA 4ZE4A 3CUGA 3KWSA 3ABZA 2UZ9A 4NNBA 2XYLA 4KERA 1WOAA 5G1MA 1VQTA 1MYRA 3LV6A 4K1GA 1EOMA 1J2BA 2FGZA 1O5RA 4O1DA 1DTUA 2VYOA 1MW1A 4DRSA 1FWJC 3IAQA 4PMQA 1DJZA 1KC7A 1UUQA 3NO1A 3NOYA 3H2EA 3IUDA 4FR1A 4R7OA 3BCDA 1M6JA 3EX4A 1GQLA 2GK1A 1YPIA 2RDXA 1YPFA 4IMFA 5AYIA 2FMOA 2W61A 2Y89A 4NKCA 1K8YA 2VCCA 3K30A 1GJWA 4J2PA 4M56A 1XLBA 2BY3A 3W7EA 4EX4A 4UZSA 2YKKA 1UWQA 3N1AA 4LYRA 1VCVA 2RDWA 4Z2IA 3OA5A 3I4KA 2GVEA 5JBDA 3QRHA 1YRRA 5G4EA 3WQ8A 3T0CA 2I7GA 1H2JA 2Q8LA 1ZB5A 3T55A 1KWKA 1F8MA 1L6YA 1OM0A 1C90A 1N8IA 3LXCA 3P61A 4JN7A 4O13A 2XISA 1HTIA 1W3TA 2J24A 2X2YA 3BJFA 3W7LA 4OQVA 2EHHA 3EZ4A 2UY5A 1PZ1A 3AHYA 2A21A 2RFGA 1OB0A 3CHDA 1AJ2A 2PBOA 3L4WA 4I9TA 1OD0A 3BZGA 2W66A 1O68A 2Z7GA 4FXJA 3WFZA 2YDQA 1F61A 1PL9A 4N7QA 1S1RA 4Q8NA 5A8QA 1Y7VA 1EF3A 3C5QA 4AC1X 1PUDA 3DAQA 4DIAA 1OFOA 3C3UA 2Y8KA 1W9XA 1QPQA 4KCTA 1MQRA 4H04A 3PPGA 5I79A 2FYMA 3GQYA 3MMDA 4AVFA 3V5FA 3KOFA 6CGTA 2NV9A 2POTA 3BWWA 2R1MA 4LEFA 2V5JA 4NZFA 5FSEC 1YXDA 3ABOA 4X63A 2F6UA 1K70A 4B2DD 1TSIA 1POJA 3P6LA 1AH0A 3FHQA 3R7MA 1EC9A 1V7YA 2QGHA 1L6FA 1W91A 1YBQB 3M1ZA 3URQA 1G9HA 4ML4A 2PGWA 3UXAA 1P6WA 1Q6LA 5HWNA 3AMDA 3LI0A 1H50A 2OSXA 3LV5A 4XBJA 1Q2RA 4JFTA 3L65A 4UOZA 3TUUA 3UA3A 1TELA 3O15A 1O7AA 4NYYA 4QISA 2XWEA 3K4DA 1FWSA 5RUBA 2HCVA 2VQUA 4F2TA 3VAVA 1LLZA 4JDBA 4RK8A 4GUIA 1UR8A 4GYPA 4HMCA 2XFFA 3LZ5A 5F2MA 3ARVA 1MXGA 1LJYA 5IFPA 3WL0A 3VD5A 5AHNA 1RPKA 3BAJA 1OWQA 2WMIA 4GWEA 1E6NA 3VUPA 2E77A 4EKJA 3TJIA 4LV4A 2XIMA 3KTXA 2PDXA 1B3WA 3BV4A 4QSFA 3ARXA 4MB1A 2QDHA 1GKRA 2RDTA 5CEWA 2AL1A 4LNYA 3S2CA 3RCYA 1ME8A 3NDYA 3OEXA 4KEZA 3GXTA 4U2YA 4W8AA 3OGVA 4GD0A 1AQHA 1NDVA 3PG8A 3W6YA 2W6RA 4QIUA 3IGXA 1SMDA 3R4IA 2V63A 1XLHA 3DZ1A 2ATMA 4V27A 4JQ2A 3LNPA 1KM5A 4JYDA 1ME9A 1E1EA 3Q65A 2CLHA 1NJJA 2O9TA 4L9YA 4L6HA 3RPDA 5C9RA 1X6LA 4AIEA 3JW7A 1VBJA 4CCDA 5FF7A 3VIHA 1UROA 4HNOA 4ZSUA 4GY1A 3MWAA 3NXFA 2FHFA 3A21A 3SR7A 1QATA 1XISA 1EF2A 3O8AA 4U3CA 3L4UA 3MHFA 4PTWA 1BTMA 1ZRQA 1S2TA 3EWBX 1O4UA 4YTUA 3PSWA 1E5JA 2J8GA 4NL1A 4XD6A 5EL1A 3IUHA 3WLRA 2HPIA 1VFOA 1NDZA 3EKZA 2ZA3A 5CKSA 3I3EA 1GONA 4EPDC 3HJZA 3HOJA 3SCSA 2WMIB 5I3FA 2QPXA 4JYEA 1KKRA 3AO0A 2QHAA 1EJSC 1RCQA 3ARSA 5EMUA 1HF6A 3TH6A 3UFYA 4AY8A 3KHJA 2G4FA 4Q7IA 4N9BA 2E8ZA 5FL0A 4KPLA 2ON3A 5CPOA 1E0XA 5LA0A 1JL8A 3NA8A 1LTDA 1ZQ5A 2CBIA 3GFXA 4Z2JA 3L4YA 3SADA 3MI2A 1JDFA 3BLOA 3G1SA 1R7OA 1KBJA 3VE7A 3R8RA 3LN3A 3VNJA 5GJNA 3N4AA 4UQDA 3CJPA 3AIEA 2R8WA 4I3GA 4XBKA 4H9TA 2YL6A 3AHXA 2QPSA 3CQKA 4XISA 2FPTA 3CYVA 3TR2A 3PK7A 1TR9A 4A3YA 1V3IA 4B5TA 3EA1A 3ZXWA 2H90A 2YL8A 1UKOA 3DYOA 1BPLB 1E6XM 4GCAA 3SZ8A 3L4TA 1PIIA 5I00A 3LNMA 1UR2A 4QG6A 4Q6JA 1SO6A 1ZCOA 1ZJAA 3QLDA 1QOXA 2F2KA 3GE7A 3UWUA 1RQBA 2Z2UA 4OJYA 2OGYA 3FJ4A 1MUWA 5F4XA 6XIAA 3GC2A 4OOUA 4DZHA 2VFDA 5H6HA 4CQCA 1IZKA 4G5DA 4I6VA 4A35A 4XAPA 3W3OA 1OABA 1TV8A 5BYWA 1BWKA 1TJ1A 2GQ9A 3DU0A 2J77A 4ECLA 1P0BA 1EGVA 5HATA 5HMEA 3NIYA 5CSSA 5KTLA 2CITA 4J3TA 3W7CA 4RZBA 2IKJA 1TB3A 3S1VA 3HG5A 1V5XA 4DUXA 1R85A 3BUVA 3FXGA 4FF7A 3KDNA 3MSDA 1ZNNA 1DTNA 4JN8A 1DEDA 1M7JA 1YNQA 1UKTA 3NZQA 1E56A 3CPRA 2J78A 3T42A 1JCJA 1ZL1A 4PUEA 4CU8A 3B0PA 3CT2A 2ASHA 3T0BA 4CQDA 3HPZA 4L61A 1QOQA 4RW3A 4X2PA 3OYZA 4IQDA 3S8HA 4DBWA 1K9TA 4RDYA 2OKTA 2R1NA 1A4LA 2GDVA 3RK8A 3ARRA 4CD4A 5CLTA 4C6CA 3FN9A 4UFIA 4DYEA 3LCGA 1XG3A 3ECQA 4B5XA 3IJ9A 3O07A 1BSLA 3S2LA 1CPUA 3GS6A 3RN6A 1GHRA 1OBAA 3G1DA 1ZSXA 2J79A 3PBUA 1NFBA 5JQ9A 1ISZA 1A5KC 1VHCA 2OWWA 3W24A 1W0MA 3P67A 2VZVA 1WKFA 3HQPA 3KBVA 4B5WA 4AU0A 1BKHA 3O63A 3GHSA 4XTDA 3MANA 3T78A 3DC0A 3PAJA 4RPQA 4KEVA 3EWWA 3W7IA 1OIFA 1ICSA 3H8AA 3NQ6A 3U2OA 3MJMA 3SM0A 2YLLA 3C2FA 3S46A 3VKAA 4JEQA 3QR0A 1BXNA 3WDIA 2POZA 2NVAA 1VCGA 3UCCA 3RR1A 3L5MA 1SU5A 1DP0A 1F6KA 4CQ9A 2ALDA 1OZQA 3OLEA 4UXDA 5DMYA 4FNSA 4OBRA 4MADA 4B15A 3LDVA 1FWTA 4UFJA 5E0CA 2BHZA 4GZEA 3QSRA 4DY1A 3MHUA 2EAWA 5DRIA 3M6DA 3OLDA 1V6UA 1WX0A 4AC7C 2GSHA 1VFSA 2I14A 1XQLA 3EWYA 2V3EA 4I9MA 3MV11 4BY3A 5DT5A 4RXGA 3G24A 4S3JA 3FSUA 4P7OA 3C0SA 4JKKA 2PWEA 3RLGA 1FA2A 4B90A 3W2JA 2GWGA 2NT0A 2DZUA 4L6OA 2NXIA 3GVVA 2D3NA 4AF0B 3MMTA 3QR3A 2V3FA 4JTIA 3W74A 1Q8AA 1VFHA 1SJCA 2IPGA 3SCNA 1GTHA 1FVPA 1QI4A 4J3XA 1X8FA 3W1MA 1TPUA 3S9IA 2G3JA 3NM3A 4HYRA 8XIAA 3S2JA 5G2WA 4H01A 3EX3A 2YCKX 4F0LA 4F0HA 4YVXA 4C6EA 3E5BA 4EANA 5CPLA 5JIWA 1RV8A 1CB7B 2J8TA 4YNGA 4MZ8A 1SJDA 1YW1A 4KF1A 3QV6A 3UU0A 4XBSA 2DSZA 1OFAA 1WNOA 3H4XA 2DT2A 1F7BA 4UTTC 3VI2A 4YVVA 2JGYA 3H53A 3TTQA 1V6VA 1V08A 1W2VA 3C2YA 1P48A 2NZLA 2ONEA 1JZ4A 3G2GA 1VHNA 5A2AA 1PKMA 4XZIA 1KB3A 2PZ0A 3WMCA 3WF1A 2WJZA 1A5BA 2W27A 3EPNA 4V28A 1XCXA 4ZQMA 1W3JA 4A3HA 1QO2A 5T9CE 1IV8A 1QK2A 1U1UA 4ZR8A 3GTIA 4REQA 1LWIA 5HDRA 1Q6RA 4E8CA 4O0ZA 3W85A 1GVFA 3VGEA 1QXLA 1JCXA 1H0GA 1JDCA 3VK5A 3A4JA 4B16A 3WF2A 2XH7A 4HYWA 1VR6A 4J5NA 4ZXLA 2F6XA 4ASTA 5MKGA 3RMEA 3C61A 4S3GA 4W7UA 4QJ5B 1OHLA 3N4FA 1NFGA 1F9CA 4U3AA 1Z89A 4AYSA 4CN1A 4DPQA 4EK7A 4Z08A 4YYCA 1S5NA 4HCDA 3GFYA 1KQZA 2QEZA 3PM6A 1RQEA 3BGJA 5D9OA 4DYKA 2JQXA 4M1BA 4UTIA 3F03K 2BVWA 4NG3A 1RD5A 3S5OA 1OYBA 3NYDA 4Q3MA 3XISA 3LQGA 4GZIA 4N02A 2JFEX 1HO1A 3U2CA 3TVAA 3UQNA 4NJIA 1AMYA 5IFTA 4XZMX 4D1JA 3PVFA 2QULA 3VNDA 3NQCA 2EO7A 2CKSA 1IWBA 1AL8A 4NI3A 4W9TA 3A3WA 2BX7A 2J75A 4WSKA 8A3HA 2V30A 1A0EA 2YCIX 3HIJA 1W8GA 3TYZA 2JK2A 1UASA 2V2HA 5CXPA 4KT2A 4I7UA 2VUYA 4IOTA 3IJDA 4J27A 4MWAB 1XUUA 4REQB 3TMQA 2DSKA 3DYMA 2QIIA 4IJRA 4DF2A 3V18A 3PJTA 4ZCWA 5M5DA 3FEMA 3AXKA 3T44A 2RGLA 3AYSA 2V5DA 3P8IA 4YJ5A 3ABXA 4W84A 4Z1AA 1BEUA 5CC6A 2W0UA 1AVAA 5C9XA 1J2WA 4UQCA 5MKGB 1GCYA 3M64A 4UNIA 3G5EA 1XQKA 2Y6ZA 1ICPA 4EPBC 2QZRA 2XSAA 4K36A 4WDTA 1H61A 2G3IA 7ENLA 3QMTA 4ZQCA 1F3TA 1GGOA 3MP5A 2NVCA 1UWTA 1UH4A 2EPKX 4MF4A 4H9XA 1IF2A 3U4AA 4HJWA 5FIPA 3M7WA 4MKSA 9RUBA 1Q6OA 4LB4A 3VC6A 3UY8A 4GQQA 1QUMA 2ZZ7A 3WQVA 3URBA 3TAOA 3CASA 2Z1BA 3MO7A 5K7JA 4N6EA 4JNZA 2O0TA 3THUA 1SZFA 3CUHA 3TX9A 1WOBA 1GHSA 3GTFA 1PTGA 3EDKA 1R3TA 3FX4A 3ZVHA 5KZ6A 1L2QA 1P0EA 5BXSA 3LGDA 3S1UA 1XLCA 5A6KA 3VXGA 1A5AA 1MRAA 1E0TA 4W4QA 3M0VA 2XVPA 4QX4A 3IJ7A 3EWXA 3WQOA 3LOTA 4M6VA 3LBOA 4BHYA 4LBSA 4AD5A 5LIKX 3F2DA 4HHLA 4QLJA 2ZUUA 3KL0A 1UIPA 4WXYA 3H2NA 3B4UA 3SSJA 3SRFA 3F2BA 1F76A 2DT3A 5AHLA 4YTQA 1S5MA 1GYMA 2HV5A 1PIGA 6A3HA 2XSBA 1KLYA 4LXFA 5JU6A 3KVLA 3SN0A 3GDTA 4KQNA 4RL3A 3W7DA 5CQ1A 2I5GA 2I5IA 2NW0A 1M1BA 3WQEA 1EJWC 1Z69A 3WSUA 2G8ZA 1U5HA 3KVMA 4JFSA 4Z1BA 1KV5A 1CXIA 2W91A 5I07A 1BGAA 1RZMA 3GC4A 1T40A 3LBCA 5A94A 4BEQA 5DX7A 3UEQA 3P5ZA 5BMXA 1R3QA 2OSWA 1LG1A 1U83A 3ZWTA 2ADAA 3T7VA 3EPMA 1ME7A 2ZRZA 1FHLA 1K4GA 4JAWA 1UUOA 1PE1A 4I5RA 1IEQA 3GWQA 3W1LA 1J18A 3GU2A 2AAMA 2GJNA 1J79A 4WDXA 3ZVHB 3TNBA 3V16A 3SB0A 1ZJBA 4OUIA 1KRCC 4P8VA 1QI3A 2W67A 2E09A 5AYZA 4AIBA 3WLNA 5CJNA 4TVCA 1SW7A 3HTWA 4M29A 1FCQA 3W53A 4GA8A 3WDPP 4ENLA 4B9ZA 3FJNA 4UFMA 1TWIA 4AEFA 1OK6A 1E3ZA 4EF8A 2GLKA 1ENUA 4OUEA 2H6RA 3GHUA 4ADTA 2WMFA 2ZXQA 7CGTA 1KFJA 1QWGA 1OT1A 4QG8A 5DT7A 1VF8A 2R1KA 2DQXA 1UBSA 1C8XA 2D22A 1XFBA 4L9ZA 4OFCA 3W38A 1H09A 5A5WA 3W27A 2OT0A 2PP0A 4A6GA 3WDQA 1E6ZA 1V0LA 1XUZA 4WSJA 3GD6A 4O16A 4Y7EA 1EBHA 4ADSA 3P0XA 1DWHM 4JFWA 5FAGA 2Z00A 3WYZA 3WNNA 1U22A 3N2BA 7XIMA 2VURA 4GUHA 2QS8A 4HMDA 1CI1A 1OT2A 1WXZA 3DN5A 3KWXA 5I3HA 3OQ8A 1VFUA 2J7EA 3QPZA 2P76A 3QZ6A 4DJFC 3CMFA 4X0VA 3KBWA 4NZJA 3PULA 2H8ZA 1QPNA 1V93A 1J5SA 2WHMA 1PS9A 4H4IA 4NHVA 3CIXA 3M41A 4Y6GA 1KFEA 2PFHA 4GUJA 1EFZA 3VIKA 2ALRA 4UTWA 1GKPA 2A79A 2CLFA 4Z42C 3N2XA 1I2RA 3COTA 5D8ZA 2PDIA 3Q58A 3G0UA 4LC6A 1OGSA 4XZ9A 3SO7A 4XSLA 1HJSA 1NOUA 2FDMA 4H7VA 3FGCA 4XVEA 4M5PA 1SZGA 2XZ7A 4Z1YA 2VD8A 3NDOA 4R7JA 4H6EA 5A8OA 5HQEA 2QF7A 3VM5A 3E9AA 3LGEA 1RY8A 4QLKA 2ZC8A 3ANVA 5IBXC 1PBGA 2ISDA 4C6BA 1PO9A 3TFXA 1Z32X 3AS1A 3M07A 5F7UA 1K02A 3VMNA 5XINA 3AZSA 3N2TA 4R9XA 4R5EA 3MI6A 8RUCA 3WLIA 1TQJA 2BOFX 2O9PA 5C70A 2V2CA 5GJMA 3TYCA 3DHDA 1KBLA 1JCYA 3DGRA 3SCTA 1XSIA 1XL9A 3VA8A 3FAXA 5HANA 3C52A 4H7ZA 1WPCA 3GR4A 3KTCA 4QRNA 2EF9A 4JL2A 1T7LA 1TREA 3ARUA 2J9YA 4H8VA 3SAZA 3EX1A 3CEPA 2CZFA 1J0IA 5DFAA 3RCMA 3AU2A 4B4FA 4HN8A 3BO9A 1U1JA 1W56A 5D2WA 4H2HA 5G2IA 4DEFA 1XBXA 1J96A 4AEEA 1F5ZA 2OQYA 3H26A 4MJZA 2XFWA 2E25A 2FMNA 5CG0A 1HGYA 4FAMA 4ICNA 3FGCB 1SJAA 4IPNB 3KFTA 2XVKA 4W5UA 3SEPA 1B9BA 1PHWA 4DJFD 2YCLA 3OVRA 3SQMA 3VD7A 2JKPA 3I68A 4HU4A 1Q5MA 3LSCA 2NUWA 1TX2A 2QIWA 4LUYA 3GG8A 3UZZA 4QAIA 4CU7A 4XWUA 3IJLA 4A8IA 3N19B 1EDQA 2IPFA 4BFAA 3ANUA 4O1CA 1G01A 1HNYA 2WAGA 4ZZ9A 3VILA 3WQ5A 1RBAA 2JKEA 3GNXA 3LBMA 5XIMA 1ZZMA 2C79A 1IT0A 4UTJA 1A53A 1H51A 1SPQA 2VEGA 3FK4A 3M0JA 3PZNA 4JD4A 1Z8AA 1XR2A 1WA3A 4ZFCA 1EP2A 1J9YA 1KA9F 2C15A 3GZ3A 3DUGA 5F2LA 2VFIA 1RD6A 4K2SA 3QXBA 1XYZA 2E6YA 3N2OA 5FF4A 3TMLA 5I78A 1ZPTA 3O06A 4CNTA 3RPTA 4E3TA 1RA5A 1NTHA 1TRIA 5FEZA 1B3OA 4D2JA 3APGA 2J7GA 2O4MA 4S2CA 3WEMA 1W3NA 3KOXA 1FUYA 1I2PA 3MYPA 5MHBA 3UETA 4W8BA 1LRQA 3KOYA 4M24A 5G4WA 3CQJA 3TCEA 2YCLB 2VFHA 1V3MA 3W7JA 4ICMA 5DXXA 5K3VA 3UZWA 4PMZA 4DJEA 1SW0A 4RDVA 4PTDA 4PN2A 2Z24A 1F3XA 3MW7A 2WXDM 2PDGA 1DE6A 3UG4A 5K9CA 3OG3A 4INFA 4S3EA 2Y1HA 4AWUA 1V0MA 3AMLA 3ZYZA 2FKPA 1O5KA 2DZSA 3QKEA 3TN3A 4TIMA 1QTWA 1XLEA 4GYFA 3W1AA 1IT8A 3QOKA 1LWJA 3ARQA 1TIWA 2O9OA 3N6HA 1GVOA 2X0YA 3NL2A 2VJXA 3QFEA 3S42A 1LQ2A 3V4BA 1N55A 4DWDA 1O95A 2PWVA 5JH2A 1EXBA 4F9DA 1I1XA 5DO8A 3PG9A 1POKA 2XVNA 2ESCA 3FEQA 3MI3A 2YSWA 3VCRA 3APTA 1UWAA 4EXBA 1AUSL 4GVFA 4HHHA 4LF2A 4ZEPA 4J3VA 4U28A 5A6SA 1ITUA 1BQCA 5CZKA 4A8NA 4AZBA 3QV7A 2Z4GA 1HKVA 3DESA 1TV3A 1VGAA 1ZAHA 3MUIA 2Y70A 4XZLX 4C91A 5BNKA 4FXSA 1VEPA 3OLGA 4PSRA 1QPKA 3L67A 3RX4A 1OG0A 3A22A 3B97A 1F6YA 1XDMA 5D04C 4HVXA 1PIFA 3AYVA 2G3NA 3MC5A 1DBTA 4K6AA 4GC4A 5HA7A 1QNOA 6TIMA 3IEBA 1YDVA 3K1GA 2DJXA 1O1ZA 3GNRA 5KETA 1T99A 4U5IA 2WC7A 2PGRA 1ZFJA 1XCWA 3C2OA 5BW6A 2NUYA 1E72M 1AH4A 2OLAA 1GOWA 4IGSA 3M5VA 3M0MA 2V38A 4QSHA 1UD5A 3MVTA 3G0SA 4KGJA 3W75A 3PZVA 4NJHA 4NX5A 2AKZA 1D7FA 1JD7A 5CZSA 2I56A 1ITQA 3ZR6A 4FPSA 2XTKA 3R6IA 3M16A 5EY5A 5H2ZA 1F8IA 3CWHA 4LANA 3A9IA 1HKMA 3TR9A 1BVWA 2OX4A 1TKKA 1TPH1 1YEYA 4JY8A 4YMZA 3GO2A 4LAMA 3VNYA 1XJBA 4ZB0A 2ZBTA 3EYPA 1JZ8A 1RBOB 3IK2A 4HSHA 3QOMA 4Q4QA 2XFRA 4ML9A 3ES7A 4B3LA 2CZEA 2B7NA 5EMLA 3T40A 3TU9A 1P1XA 4UQBA 4FO4A 3MCOA 5DQPA 1DXIA 3F4NA 4LV9A 3HV9A 2DP3A 5TD4A 3RM8A 1EWDA 3VO0A 1ZBCA 1SGJA 4XG1A 2BGSA 4PMDA 3BLLA 3GDMA 3UG8A 1V6WA 2R91A 3RJYA 3AUOA 4JTRA 1TRDA 3GHRA 2REQA 2PGEA 4UOQA 1QPRA 2ZQ0A 5DMLA 3PBMA 2D2OA 4IFKA 1GVIA 3W84A 1MEHA 1IGWA 2QXWA 3LRLA 2OYMA 3FJ6A 4AIUA 3PFMA 3W29A 3TSBA 4YIWA 5HK4A 1LDCA 4F0MA 4Y9AA 3IIPA 4J3SA 5H91A 4UCFA 3FV9A 2PC4A 3GXFA 1Q7MA 4LF1A 3WD3A 1EDTA 9XIMA 4JTHA 3BQ6A 4NJGA 3W7QA 1UC5A 3AYTA 3GW3A 2B0MA 4GG9A 3UJFA 5AC8A 4HMEA 5HXMA 4IP4A 1C3FA 1KM2A 1E55A 4O52A 2WK2A 4XIAA 1UD3A 2GGIA 1PZ3A 3ERPA 4LB3A 2V3DA 3G1XA 2OMAA 3FLUA 1KFCA 1XIDA 4JICA 1XXXA 4GXMA 1VEMA 1X6NA 3EOSA 3UP8A 4KRUA 1B9ZA 2INFA 3CZLA 3CC1A 4D6GA 1CXHA 2ATSA 4JL1A 4BI5A 3M5XA 3NPVA 4IZGA 3FVMA 1RLCL 1TTPA 1KM4A 3SFWA 2YW4A 2V67A 5EMYA 2AKMA 5CJMA 1GQNA 2REQB 4BQ2A 3A5FA 3NQGA 1WE5A 4ZO9A 2C0AA 1VP5A 3M0ZA 1FTXA 1HJWA 3VKJA 4IFKB 4JFUA 3I4EA 2XIIA 4ZXOA 3PUDA 3DKLA 3WK2A 3PFRA 1KFBA 4JHMA 4O4WA 4ALDA 3WUFA 3ORWA 4ZA0A 4ZBCA 1OCNA 1OCJA 2DT1A 1K7EA 2ZCGA 3W7HA 5U4NA 4GY0A 1TUFA 4Z2GA 1KRAC 3LCWA 1VFFA 2OCZA 3ZJ8A 2YB4A 4QJ1A 2J88A 2PLCA 1AQ0A 3L2IA 5HOSA 4LALA 3I10A 3U2EA 3QQ1A 1H4PA 1EPVA 2OEKA 2I17A 2VZTA 4WVXA 1BXBA 1U30A 3KRSA 4F8XA 3EDDA 4PTXA 3B9AA 4HOXA 1OFEA 4JZ5A 3WH6A 1K8CA 1FWNA 1W1A1 4J2MA 3U5YA 3NVDA 2X1TA 1WDPA 4JS3A 1ISXA 4DF0A 2OX1A 4JY9A 1KGWA 2NWRA 4KWVA 4Q22A 3AS0A 4HD5A 1W5NA 2E4TA 2NSOA 4J35A 2GPTA 1CT5A 3PWIA 2NUXA 1ECQA 1Y5XA 3D47A 4H1ZA 2V8ZA 3EXSA 4GIRA 3R94A 2I1OA 3UXDA 4DI9A 3VIFA 3VKDA 2DVXA 4ZQPA 5F2GA 3N9RA 1N8FA 4XX6A 2VX7A 2VC9A 3R1ZA 1F4AA 1TTIA 1T96A 3VGHA 2AMGA 3MTWA 2WZTA 1H62A 4LCRA 4P7LA 3F4VA 4MHBA 3WNPA 2DU2A 5JVLA 3UYIA 1RK6A 1RUSA 1RR2A 2QVHA 3UA4A 1ODZA 5C7VA 2P3ZA 3VDCA 2TMDA 4HYVA 1OF8A 3CZGA 1Z48A 2E5CA 4XAZA 3Q45A 2PDUA 3QW4B 1D9EA 1CGUA 2YOCA 4J3WA 3TW9A 1AD1A 4GKLA 4IHCA 2V2DA 4Q4KA 4IMEA 3IIOA 2Z2BA 4FSAA 4UWMA 4DUVA 5GJPA 3GH5A 1DVJA 3QGKC 4F9JA 2NQJA 2PTWA 5T91A 3INPA 1LOLA 5FF2A 1GVEA 4H8NA 3ITVA 3KDOA 4QLLA 3G22A 1XBYA 3H70A 3LU2A 4IJCA 3NZGA 2CLLA 3LY0A 2QYGA 4DWSA 2DJLA 1O94A 3CXOA 3UNTA 4IGNA 5CC7A 1IT7A 4N2YA 3U5UA 3CU2A 3AWOA 4BF9A 1T0OA 2WV8A 4UMCA 5I3JA 1PZ0A 4YN5A 1SZEA 4C6MA 1I2OA 3W22A 4XZHA 2PA6A 3TONA 3OBAA 1L6WA 2W62A 4WJXA 3L12A 1VC4A 3MS8A 5DF0A 1B3ZA 4IX2A 2XN1A 3CL8A 3KCLA 4C6FA 1B3YA 3ARTA 1M7OA 1UBPC 1RBLA 4DNMA 1M01A 3HGRA 3KLLA 4I7WA 4AY7A 2C71A 3GX9A 3S83A 4L5ZA 3W87A 4HB7A 1I0BA 3REQB 4JDYA 1PEZA 3VIGA 4UMAA 2XZ9A 4DZAA 3P62A 3LX9A 3L7RA 5I3KA 4W86A 5F4WA 3V7PA 5E1QA 3NGFA 1JRBA 3WUGA 3K8KA 4ZQRA 2HEJA 2IPWA 3II1A 1HT6A 1PX4A 5EBAA 1XYAA 1XIIA 1W1VA 4F0RA 3ZQ9A 1SFTA 3WD0A 4DWSB 1NU5A 3ABQA 2F2HA 2D73A 4LX4A 3AJ7A 2V69A 4G1NA 5CBIA 4ZO6A 3IK4A 5E9XA 1K1DA 3LENA 1TYGA 3MP3A 1JDAA 1JI1A 4IF2A 4Q7NA 3AXXA 4Z1CA 1H7PA 1CZ1A 2X7VA 3UJ2A 4MZYA 4XUGA 3NO3A 1TTQA 1R2SA 4J7RA 1OC7A 2XGIA 2Z25A 1FDZA 3V5OA 3LPPA 5K9DA 1GWJA 2Z27A 3CQ0A 3IJ8A 1UWRA 3IVTA 3LHUA 2AQWA 4MY9A 3G8RA 5HUOA 2CXEA 2WLYA 3TCSA 4O28A 1JCTA 1HN1A 1EO7A 3G1AA 3WLMA 4Z0JA 4DO5A 5TF0A 3N73A 1XIFA 1S46A 4YVPA 3SIMA 1E1CA 4LUTA 5I06A 2CLMA 3F4DA 4GCXA 4HK5A 4F3HA 4HGXA 4B5SA 3IGUA 4PL2A 3QYSA 2NVDA 4IH3A 1Q6QA 5KMYA 1J12A 1KBIA 2NV1A 2EPHA 3VIIA 3V1PA 4NXKA 4JCMA 2H3BA 3BCJA 2YZRA 4IMDA 4XAYA 1KXVA 1C9DA 1UYQA 3OIHA 3T0DA 2D0GA 4AAJA 4CKQA 1M3UA 1LBMA 1KD0A 4P7RA 1VLIA 1PKLA 1XIMA 4GVHA 4QS5A 1ITXA 4AMAA 2E6AA 2BHYA 2VR2A 3A4XA 4DHGA 4MFDA 4KS0A 3ZJ6A 5ABEA 2X7WA 5M1TA 1FWHC 2R6OA 1CGXA 1QASA 2QCMA 3AXIA 4A8RA 4MOZA 2PE4A 1DJGA 4QEEA 1WZAA 2BOEX 2WCAA 1UMLA 2DDXA 2J7FA 1XRVA 2V68A 3J7HA 4PUUA 2ZRUA 3DX5A 1Y5VA 1UP3A 4O12A 2ZDRA 2DGAA 4GIAA 3C2VA 2VWTA 4C7GA 3LXAA 3TQKA 4UFLA 4HNTA 4H8HA 2VO5A 3HF3A 1EWEA 2GSEA 3HPXA 1HXJA 4DBUA 3G18A 5AC6A 5A6MA 2Z0IA 3PUEA 5K9XA 2A7PA 1DWJM 3G1RA 1E1CB 4LUTB 1EQCA 4JPGA 4FS9A 3E6EA 4HK6A 1JYXA 6ENLA 2WVSA 4ACYA 3EWZA 3F7JA 4OGZA 3TOYA 1UZHA 3TJ4A 2HPMA 1XINA 4C6OA 3EOOA 3FS2A 1JPDX 3GXMA 1P0DA 2XG9A 5CZTA 3Q4DA 1OEPA 2X1SA 3S4TA 1OJXA 2CC0A 3H2FA 3QHMA 1OX6A 3QKZA 3AUJA 5HBFA 4QITA 4QGCA 4AD0A 1UHVA 3PANA 3WL1A 3BAWA 4AZIA 1ZBWA 2PDMA 2PD5A 1YNPA 5BOEA 1R2TA 1AA1B 2JGQA 3U9IA 4A8LA 5FESA 2YBTA 3WLLA 5LNWA 4FOKA 3W9ZA 2QCDA 3CEUA 2Y7EA 1WDDA 1M04A 1IWPA 1OX4A 4GI8A 1M03A 2KAUC 4GVIA 4Q4MA 4AWTA 3JZEA 3P2VA 4GIEA 3BOXA 1UG6A 3TK7A 3C0JA 1LOSA 1NQ6A 2HJPA 3H12A 3KRZA 2E6FA 2ZXBA 3OYXA 5I7GA 1NDYA 3NQ8A 5BMWA 3KS5A 1R47A 3UG5A 1FXPA 2PDLA 4IXXA 1R3RA 3RMJA 4NUWA 2X8RA 2NXGA 4B91A 1XYCA 1WUEA 1TR1A 1H5VA 2EPOA 2OO0A 2WBKA 1R3VA 1XF0A 4WZHA 3PJUA 5CPMA 4JHOA 2I9UA 3PS7A 4IPJA 4H9ZA 1XYBA 4Q6XA 3HJEA 3UXIA 3VOHA 1CXKA 1YXCA 4ZTYA 2HNHA 1MQPA 4MNJA 2XH4A 3ZSSA 3V0UA 3VNZA 2Y7FA 2GVGA 3WQGA 1H60A 2GVLA 4S3CA 2ZA2A 3GBDA 4XIMA 2FVKA 1EDGA 1I1WA 4KIRA 1F73A 3W83A 5KZMA 3SRKA 2QJGA 2PD9A 3U0HA 1EKOA 1FDYA 2PU1A 2A7NA 3ATZA 2GGJA 3PNUA 1WDRA 2J7HA 3USZA 1HP4A 4FI4A 3UR2A 2QCDB 2BZNA 1R86A 5D37A 1TV4A 1OX4B 1DQXA 1QNQA 4IG2A 1MSSA 2VWSA 1W1YA 1UH3A 5GPRA 4JCLA 2J25A 4J4KA 4PMJA 2VR4A 4FB7A 1JFHA 3GG7A 1E9YB 3WF3A 4DB7A 3EB3A 5AFDA 4CCZA 4IIGA 1UW9A 5GVJA 4CNSA 5HMFA 4GNVA 3G6MA 5CBJA 3DKJA 1BD0A 3E0IA 1PAMA 3CV1A 2QT3A 3VKCA 2UY3A 4MKVA 3SGGA 5E70A 4EAYA 4XZWA 1RAKA 4F40A 2PEVA 4GABA 3TC7A 2VDIA 4QJ3B 3N29A 4GYJA 1OINA 3GK0A 1TPC1 3UVAA 2MANA 1TIMA 3C6CA 2E67A 4LRSA 3POHA 2J9ZA 1T8XA 2ZZ2A 4R7WA 3WQPA 3LB0A 2XDFA 1TJPA 3CL7A 2Q71A 4IIHA 3TKFA 4P7QA 1RQHA 1EYWA 4DAIA 3VC5A 2BV9A 1HJVA 5TNVA 1RP9A 5ABFA 3H7VA 1IXQA 3SUWA 3NL5A 5D8WA 4C6IA 4Z0SA 2FIQA 1YTKA 5LIWX 2PDKA 2E1WA 1RJRA 3H21A 4D9PA 2GUUA 2IMRA 4H9YA 3W88A 5A8NA 4CNUA 3DHPA 2OYKA 2GDQA 2BLEA 3NSNA 2YL9A 2VENA 4YS1A 4MB3A 4ONVA 4L4LA 3AMKA 3U57A 4UTLA 3SQSA 4O15A 3JVAA 1OGGA 4Q4SA 4Q8PA 3QGVA 1EX5A 4MLJA 4OBSA 2YYUA 1S5WA 5AYBA 2Y24A 1C7TA 2BXYA 1O60A 2KZHA 5K4XA 4G7EA 1FWWA 4E2BA 3AI0A 3WK3A 5IHRA 1OZMA 4C7FA 5A6JA 1B30A 4H00A 5D30A 3W1UA 1W17A 1QDSA 1CIUA 2ZRYA 4PC8A 3S5YA 5IDIA 1SW3A 1WZMA 3I6EA 1ZALA 3TC3A 1D2KA 2FZDA 2SFPA 2HISA 4HNLA 2VEIA 3MYOA 2RAGA 2VKZG 3UPBA 3CO4A 3E38A 1NWSA 2Q02A 4N9DA 4O0QA 1K7XA 1QBAA 1CNVA 2F8QA 4LWWA 3BTNA 4H6QA 1JGMA 4A2RA 3PZQA 3K8LA 3PWAA 1FHVA 5ABFB 2VFGA 1WKYA 3QHOA 2G3MA 1JJKA 4JQ3A 1HZYA 1E9LA 1TVPA 1DJXA 6XIMA 3T2PA 3UNDA 3VX0A 3B8DA 1D3HA 4CCEA 2INZA 5HNUA 3W72A 3VZZA 3OGRA 3GXDA 1B57A 3N34A 2E3ZA 4PCNA 3L4XA 2C91A 1ADDA 4DO6A 3B4YA 1W3LA 1QW7A 3W01A 4TMBA 2ZTJA 2PLMA 2GDUA 3XIMA 3F5LA 3DFTA 3W86A 4OHQA 5AVHA 2WKJA 4G7EB 4F0KA 3D0CA 3RU6A 3CWNA 2WPGA 2XGBA 3B9OA 4AQLA 3E3HA 2X09A 1FQ0A 3O6YX 3HA1A 4JTKA 1I45A 4KRZA 2E5DA 1XWYA 3GNOA 3T8LA 2XH0A 4IM4A 2FLIA 1ESWA 2HWGA 4C60A 1P0KA 2P88A 3HB9A 3TP4A 1QOPA 3DCPA 3CUZA 3S5SA 1A0CA 5ECVA 4YU1A 1WZLA 3WLPA 5JXQA 2VFFA 8TIMA 4U2ZA 4G2DA 3B8VA 1JF5A 1PDYA 4W7WA 4MWAE 1PWMA 1OC6A 2HS6A 2QUVA 4OBTA 4MPQA 4LYPA 4O19A 4EXQA 2GGHA 1RJQA 1EH9A 3KTSA 1JYNA 1S2UA 2HVNA 1JZ6A 5H1WA 3TIMA 3EBVA 3NNTA 1W9VA 1W9DM 4ES4A 1JXKA 1XIBA 1A49A 2PDCA 2XIBA 3AICA 2X0HA 2Q3RA 3AALA 3FOKA 3UT0A 4ORIA 5DMNA 3EOLA 1R30A 1DL3A 2AL2A 1VYRA 3PBWA 1N7KA 4JX6A 3OO2A 1YDOA 5BRQA 1RH9A 1B1YA 3KOZA 5C55A 1I0DA 4H6RA 3M47A 1QNRA 4LC8A 3OQEA 1AODA 4YYFA 1M7PA 4M1RA 3EX6A 3SBFA 2O7SA 2AQOA 4IP5A 4H9VA 5A1AA 3M0HA 2YLAA 3VGGA 3TROA 4LFYA 5I6SA 1UWIA 3SJ3A 3CAQA 4P8XA 3DBPA 4DUOA 5JH1A 1JZ2A 1CXLA 5A3HA 3OTRA 3B0UX 3A23A 5A95A 4JIIX 4PUNA 3JZUA 5C6MA 3E2QA 4DJED 2OKOA 1GYNA 1B2YA 3OIXA 3B9DA 2XH2A 2WC4A 3FVDA 4QE5A 4C1NB 1W32A 4LS1A 3VGBA 1UQYA 1CWYA 2QUTA 4QE1A 1PKYA 2DZTA 3LGGA 2WPBA 3ZOAA 2Q3OA 3HG2A 3V1HA 3BW2A 4XD5A 1V3KA 4C65A 3GVWA 1DE5A 4X2RA 5AC4A 3TYUA 1Z44A 4EPKA 3IWPA 6REQB 3CZEA 3WBAA 3CPGA 2JKAA 4A4AA 1XGDA 2R94A 1YYAA 2VDGA 4H8UA 1UZDA 1GVYA 2VEKA 2WM1A 2A3LA 3ITXA 3DEQA 1XX1A 4XQ6A 1SVDA 1GQIA 1TMQA 1P5BA 3I3BA 1CEOA 5EU9A 2BY2A 3NSMA 4DYJA 4RPPA 4ILSA 5C9ZA 3CH0A 4JHZA 3QZEA 5BOOA 3R0UA 4Y96A 3VTRA 3LUTA 4JIHA 3AIQA 4UQ9A 2OQLA 3C2RA 1BYBA 3UZJA 4D8ZA 3BL3A 2ZVIA 4PH6A 3WMLA 3QEZA 4K68A 3LHZA 4KGLA 3BDKA 2QUMA 3KS6A 4MM1A 1MZRA 2I5QA 1MEIA 4TXEA 1VBRA 2YFNA 1FBAA 2WSQA 4JKLA 1XFCA 3AJXA 4ZL1A 1KR1A 2GYIA 1WKEA 4FNQA 3G1YA 4J3UA 1L8PA 4XSMA 4B5VA 2IKHA 2HQAA 5LGXA 5LZLA 3TOPA 2CWXA 4M6UA 2XFYA 3AROA 1A4MA 2E8YA 1UD8A 5HUPA 4NYUA 2ISFA 3D5HA 1EIXA 1EA0A 3RILA 4HBKA 1PYMA 1NEYA 4IIDA 3S5ZA 1K03A 2V5BA 3M5ZA 3SRDA 3SI9A 1E4LA 4YTTA 1DIEA 1W2PA 3PZ9A 3WJWA 3WELA 3CV6A 4C6LA 3TZNA 3U6WA 3VD3A 2A3CA 2VMFA 3UGVA 4NRSA 2VQTA 2PI6A 1T6MA 3FY1A 1ISVA 4C6NA 2FZ8A 1BTCA 3LM7A 4XVDA 1VJIA 5EPDA 3BV7A 3GB6A 2ZXDA 5AHFA 1SMAA 1BF6A 1J6PA 2A3AA 4JFVA 2GGGA 2WNWA 4GK8A 1MVYA 3KBNA 1CX9A 5I02A 4ERAA 4WJEA 2GK1B 1IE7C 4HPJA 1E4NA 1VYSX 2O55A 2BWGA 2WVVA 4RXFA 4RZ5A 3C0LA 4BA0A 1TPFA 3DFSA 2C3ZA 1IEIA 1UR1A 4GC3A 1JPMA 3IJIA 3UWYA 4GX8A 1LBFA 4LRTA 4LY4A 4PRTA 1EO5A 1A5MC 3PUOA 2YXGA 3OBEA 1CGVA 3G1FA 2VELA 3AXHA 1V02E 3PBYA 3WCZA 3HN3A 3ZMRA 1B3VA 1XRSA 4ZOCA 3GAKA 3LLXA 1S5VA 2VGFA 4UTMA 4ZVJA 3G1HA 1WDQA 1JRCA 2L5HA 4RE4A 6TAAA 4DVOA 2OT1A 2PWUA 1OVDA 1MRQA 3IGSA 1ZENA 1K8ZA 3TWAA 4Y2WA 5T26A 2GQAA 4GGBA 3W1XA 3LERA 4PEKA 4XK2A 4B9YA 2X42A 4C6KA 2Y88A 4L4PA 3OODA 4HCHA 1QNSA 1I9CB 2X16A 1AW5A 4N6FA 4JTSA 4AVNA 1J01A 5GNZA 1JFXA 2OPJA 3F5JA 3PAOA 1E0WA 3C0QA 4O0KA 3D6NA 1PYFA 3OA3A 1FWDC 2RJGA 3EXTA 1LL6A 2WVVB 3SGUA 3S6DA 1EX1A 1XCFA 2DQWA 4I9JA 2ZTKA 4HZ8A 2Q01A 4UCGA 4UC5A 5I23A 2E9LA 4WGXA 3TLLA 1FP9A 3LEPA 3ITGA 5LHEA 5LNSA 2XIJA 4JTUA 4YWIA 4FLOA 3O05A 1WYIA 1PTDA 4WUIA 9XIAA 5AYXA 4PB5A 4Q8VA 1G67A 3FYYA 2CLPA 3TN5A 8CGTA 3W1TA 3WUEA 1BLIA 4URIA 1UZ4A 5DY3A 3A3XA 4O50A 5I3IA 4JTCA 1UZ1A 2D2GA 5FL1A 4R85A 3NGJA 4LCSA 4DZIA 1C92A 4DWSC 2OB3A 3MV01 2DSWA 4GQ0A 3P74A 1K4HA 1U2YA 1UQZA 1YQ2A 4JTFA 4V33A 4ATWA 2GJXA 3GG0A 3RUBL 2PMQA 1Q3NA 3SDOA 1Q7QA 3N04A 3WX7A 1H11A 1RXOB 2VOTA 3OZYA 2WVUA 3RX3A 3LLFA 4RKAA 1ZCCA 4QJ4B 2PWHA 3MDUA 5F1VA 1E0UA 5HR6A 4O4VA 2GUYA 1IGSA 3M0YA 4GZJA 3USBA 2E5BA 3U7BA 4CQAA 1PB0A 1W3IA 3W81A 3PTDA 1W5OA 1C8YA 2HE8A 5CC5A 3QZAA 4NAEA 2FFCA 4TR9A 3UJRA 3H2OA 2B7PA 4KEUA 4P8UA 4GNJA 2G4JA 2C19A 1GOIA 2AAAA 4GI9A 3L5LA 4AD3A 3GNNA 1L0PA 3WEZA 4HOZA 4I9AA 3IPWA 5EMKA 1XYMA 1UWUA 5EA9A 1S2WA 4GUGA 2QUUA 2GZXA 4XV0A 1QR7A 1NELA 3P7YA 4QDWA 2CKRA 1G5AA 3R0KA 5AY7A 3H24A 2CZ5A 2P5NA 2E7FA 1CYGA 3Q94A 3P60A 2FTYA 3PPHA 2ZADA 2OVLA 3TYDA 4C6PA 1R9YA 3HGJA 3FSTA 5BROA 4H3DA 1CBGA 3B8IA 3EGJA 3K8MA 4FHAA 2Z6IA 2YBVA 1FWIC 3PZIA 3K4WA 1FWAC 3CHEA 2XGZA 3K2GA 3VFLA 3TQ0A 2VTFA 2ZDSA 4AY1A 3A4WA 2BTMA 1KW1A 3GLCA 4MJMA 2IPJA 3ZJKA 2G50A 4MG4A 1W37A 3M0IA 1NY1A 2Z7KA 3VM7A 3DH7A 1E4IA 3UY7A 3IUIA 5LXEA 3IVSA 4O1FA 1NWRA 4DWSD 4XZBA 1Q6CA 4IL0A 4NAFA 1XLIA 2E68A 1Y5WA 4NAEB 3E2RA 1UUMA 1VFTA 5KINA 1IEVA 4A21A 3KP0A 4RE0A 1O1HA 1Q63A 1P7TA 4NI8A 3BG3A 1H1NA 5G4HC 4DO4A 4XD4A 2F9RA 3VINA 3WH9A 2B31A 5J8LA 2A1YA 3RJXA 4X9YA 3MKCA 4QQ3A 2J74A 1GOQA 4PA8A 3UWZA 5HNNA 2PF0A 2C16A 3EMZA 4M51A 3B8UA 4NZ1A 2R9RA 4GNKB 1IWAA 3HG4A 3QPYA 1UD4A 4CNPA 4MNKA 3WFLA 1FWRA 1PXGA 2C1HA 2WWDA 3UERA 4HMNA 3W7GA 3KAOA 3BJTA 4QP0A 4ZENA 3V35A 2A85A 2A3EA 5AOUA 2D69A 4EF9A 1BG9A 3T4WA 3LRKA 1GJUA 3R79A 1OK4A 4HU3A 4K7VA 1KM3A 3W6MA 3W4RA 2OODA 3GXPA 3NZPA 1EUNA 4R34A 4X0NA 1IEXA 3SQLA 3UWWA 4U33A 1G69A 3K13A 4YCPA 4NJKA 3FDGA 1MI3A 3E96A 1X7FA 4MKNA 2NQ5A 4BWLA 2PDPA 4JTGA 3TQPA 4NAFB 1XLKA 3AOFA 3EMQA 4OIFA 4CQ8A 1W9PA 1JR1A 5KZDA 1P6CA 4IGMA 3O1NA 3BOFA 4L7ZA 3PZTA 3W71A 2E28A 3Q37A 3NTYA 1E6SM 2H8XA 4AHQA 5EBUA 2PODA 2YGYA 5EFDA 2ZUWA 3ZS4A 1ODUA 3G8EA 3NPWA 4BK9A 2YZ5A 4MJ2A 1FRBA 1FXQA 2CWNA 1A3HA 3L2LA 3NQVA 3VOFA 3NL6A 4E4UA 3POCA 4NY2A 2NQZA 1EL3A 2HMCA 3BH4A 2WZHA 2VR5A 4F2UA 1XYLA 2QV5A 4D6IA 1M65A 1WQ5A 3W0KA 1OFDA 5D03A 2YR1A 4HCLA 2HZGA 2B81A 3VPLA 3GR8A 1PSCA 3E02A 1G4SA 1TZZA 4L65A 1R46A 3ITLA 1Q45A 2ICSA 2FGBA 1HKWA 2BVDA 1P1MA 3CO8A 3L21A 1HQTA 4NF7A 3Q67A 3MUZ1 4HN4A 3VU2A 2DVTA 3OP2A 4NILA 2WMHA 1G94A 3H2CA 3T4CA 4EP8C 1TMHA 1T41A 2PP3A 3KCJA 4Y8EA 5AZ1A 2OXNA 3LZ3A 2QCFA 3SUSA 1GZ1A 1I6NA 3NEHA 5T9BG 5LYRA 1FH7A 5HR7A 4DM1A 2R82A 2QCEA 5FSDC 2ZICA 1B4KA 1PJ9A 3PF3A 4Z2HA 5I3GA 4IFOA 3BSHA 1QMLA 2P8BA 1J10A 4GUFA 1Q6GA 1PHQA 3GH4A 4M7SA 4RX0A 2EPMX 4LY8A 3B9EA 4LNCA 2QUNA 2BY1A 1CDGA 3LTYA 3FYOA 4N42A 4M7TA 4PCSA 3BE7A 2Y5JA 1I4NA 3QVQA 3TJXA 3A6OA 4L9XA 4YCOA 4IIBA 2DSUA 2HBVA 3QY6A 2ZUVA 1UP2A 5HMSA 4AUBA 3GIQA 1E0VA 2A6NA 3DHUA 1HJQA 3CGTA 2O56A 2WYSA 4G8TA 4NASA 4IPPA 2YCJA 4L1XA 2LLEA 1QW9A 2D0FA 3LXBA 3N2MA 1Z9AA 1OCQA 4WK9A 3FA4A 3MP4A 4DBEA 1GOMA 4BF7A 1ZJIA 2ZIDA 3IAPA 4KRTA 3R43A 1JQXA 1VIWA 3QY8A 2CHOA 3W76A 1EC7A 4OECA 4QFUA 3WLQA 3KXQA 3R5EA 1GVRA 1US2A 4G6CA 4AD4A 1R9ZA 3DECA 2YFOA 3IACA 4K8EA 4MNMA 4UQEA 4D6JA 3LCLA 2J9XA 1IIGA 2Q09A 3NURA 1E6QM 3BMVA 1JF6A 4NJJA 3WBYA 1JAKA 5LIXX 4AD2A 4FXRA 3NR0A 5H8MA 2PRLA 4PULA 1TPB1 2UY4A 2ZZ5A 3SIZA 4HNCA 3P3BA 5FCZA 3CB8A 5D09A 1QNPA 4MYAA 3KP1A 3CBWA 4IICA 3CNYA 3WLKX 5AN7A 4LOCA 3QFWA 1NH6A 5AKQA 3APYA 3SJNA 4NZ3A 3EA2A 3WIJA 4Q4PA 4HK7A 3ICJA 4C90A 3STEA 2PLKA 3NQBA 2QJJA 4IX0A 4ZOEA 2WSYA 1P6BA 3NZRA 2WWCA 1ONRA 1PX8A 3W2MA 3EKGA 1HL9A 3UESA 3V75A 4M82A 1XLMA 1V03A 4QHRA 1ZAIA 2OGJA 1DXFA 2FZNA 3GM8A 4JIEA 5FOOA 3UPMA 1NAL1 3QJAA 3SW6A 4S3FA 4MDOA 3OHMB 3W37A 5DANA 3O2LA 1CXFA 3WD4A 3C8FA 1QRQA 1XGEA 2GUBA 3H23A 3PBGA 5D4YA 4S3DA 3BZJA 1F4HA 2JF7A 2PRMA 2VZOA 1EYEA 3OOQA 2PURA 2FJUB 1R5YA 5ABTA 1TCMA 3W7KA 3AC0A 6PTDA 7REQA 4O10A 3TXZA 4EWND 3MUXA 2V5CA 1J0HA 2QQ6A 4C6DA 1FWFC 5HWMA 5M03A 3B8TA 2BY0A 3UCDA 8XIMA 1VB9A 1ZBVA 3LMYA 3IIZA 5CAHA 1IYXA 3RLUA 3MJYA 3FA3A 3H7RA 3SY5A 1YXYA 1DYSA 1FHDA 3F4WA 2QDEA 1G0CA 4MAZA 1JI2A 3PWGA 2W9MA 3QC0A 3KZPA 5AZ0A 2XN2A 3PTKA 3WK1A 2PC8A 4JTLA 3OZOA 4QQUA 5BWAA 2VEPA 4AWSA 2F7FA 4GI4A 3UG3A 1PDZA 1FKXA 1F3EA 2DUZA 3K1DA 1ONEA 4LCQA 3KRUA 1KNWA 1TJ0A 3ZIZA 5DXYA 3O9NA 2X0SA 1TPVA 4HPHA 1JEZA 2CERA 2FHBA 3PJXA 4NU7A 4WOZA 1R38A 2H9AA 2F6KA 4EOUA 2DV0A 1QW8A 1B54A 4A29A 1SO3A 3PY2A 1P0NA 3WDJA 1JD9A 1JYWA 5A6BA 3WLTA 1KXHA 2C13A 3WLSA 2WQDA 2PDBA 2CLKA 1UA3A 1XLLA 1ML1A 3BAIA 2NQLA 5A2BA 4KFPA 4L1GA 2E40A 3T05A 1EGMA 7REQB 1REQA 4JKMA 1IXNA 2ABBA 3EXRA 4WDWA 3AIBA 1IR2A 4J9JA 3BICA 2TPSA 3H6OA 4UR7A 3BVJA 4ZTXA 4JN6A 2Y63A 2XU2A 3KM8A 5BRBA 1K6WA 5DEZA 5FKYA 1X7IA 4RZ6A 4KFNA 3U8GA 3A3HA 2D20A 1GG0A 4TX6A 3RITA 1L6SA 3N25A 2E9MA 1CGYA 4KWSA 3IS4A 4HJFA 1V51A 1BYDA 2CBJA 1JDEA 2G96A 1QCWA 3I6TA 1JYVA 4Y9NA 4PMVA 3N12A 1OFBA 1A5CA 2QJNA 1BVNP 3UD6A 4BI7A 5I24A 1MUCA 3C4UA 3CT7A 2NQHA 1JCLA 4MMWA 4HHPA 2W5FA 4WX2A 4BKNA 5H8UA 1S2VA 1OF6A 2HVMA 1XP3A 1U1HA 1GNXA 3ITTA 1DWAM 3BW4A 3I7QA 5FJTA 4LVAA 2PB1A 5BU9A 3M4HA 3WMSA 2G0WA 3AMCA 1NOWA 1KTCA 1W5MA 2WLZA 3OJGA 1W1ZA 1XS2A 7TIMA 4IQLA 4PCPA 3ME3A 3RU8X 3AYRA 2G5WA 1TFVA 3MHGA 3E1F1 1REQB 1U5VA 4LUSA 4CD5A 1B4EA 1NF7A 1TCDA 3QTGA 4S38A 2CW6A 1JIBA 2ZZ1A 3WNMA 3SN4A 1Q4NX 2XINA 3N9SA 3DFPA 1R0MA 3H7UA 3GUWA 1VJSA 2WKGA 4B92A 2J8FA 1SR0A 1TV2A 4NT0A 3GHTA 3AIUA 4A22A 3L9CA 4WD0A 3S3GA 1GW1A 3AIVA 4K3ZA 3RYSA 1BYAA 3OLIA 1J93A 2JALA 3O7UA 3E0WA 1ZJHA 3IJ6A 4K8GA 4CNNA 1G7VA 5KSWA 3BLPX 2E0PA 2P8CA 2DY3A 1KGUA 3IIVA 4MY8A 2ZRXA 1VLWA 3MKKA 4IJBA 1TMLA 4LYKA 4OOZA 1E51A 3W28A 3H4WA 4MLRA 3W82A 1OC5A 3ZR5A 4QROA 4OVXA 3TSMA 1ISWA 4A3RA 2OZTA 3SN1A 5E0KA 3OZPA 4CNOA 4FK9A 1Q4WA 1EJ7L 1R8LA 2WB5A 2EXOA 4Y9OA 1GG1A 4ZMGA 3PBVA 3F5KA 3BC9A 4LS0A 1SUXA 1Q6EA 4IFRA 3KLKA 1YBQA 3SCRA 2FB2A 3IIXA 3K5XA 3F4CA 4BS0A 5B7ZA 1YHTA 2YL5A 5ENLA 1D7KA 3GW0A 1M5WA 3B40A 3L5AA 4LUSB 5LIUX 3V0TA 4RLIA 3AZTA 5L6UA 2JF6A 2NQ9A 1GEHA 4LAKA 3FFSA 4AZHA 1H1YA 3QMRA 2CZVA 1BWVA 3ONCA 3WQ4A 3BLKA 3WQWA 2J6VA 2HVOA 4M81A 5E5CA 5M2FX 1QHZA 4TX9A 5HQLA 3GVGA 4MAVA 1XKJA 1PCKA 3VZYA 3CZJA 4UNLA 2ZE0A 3RLHA 1BRLA 1DQUA 1M7XA 2GVYA 4GQBA 2WMJA 4C1KA 3P0WA 3SCQA 2TAAA 3CHFA 1PKNA 3E2VA 4Z2LA 7TAAA 4FLRA 3RFAA 3CHVA 1K8XA 3RG6A 3ZJ7A 2G97A 3GSMA 3G0XA 3AXMA 1TPDA 4HA1A 1XRTA 3SCPA 3ID7A 4MSSA 4OV4A 1RHCA 1XIHA 2OZ0A 2WZIA 3QBUA 1AZ1A 4PODA 1VBUA 3R8HA 3NSXA 4IUGA 1BXCA 1TX0A 2QJIA 1ZP3A 2GFTA 1SSGA 4LH8A 3RIKA 1GQJA 1DIOA 1ZAJA 2WO5A 2W4XA 1RVGA 4CCCA 3RF9A 3IJQA 4R3UA 4DELA 4B4HA 3WF4A 4CD7A 4QTGA 3K4AA 5IM51 4JOMA 4NRRA 3LHTA 4W87A 4NX0A 1CECA 1E71M 1QT1A 4JTEA 4YHGA 3ANYA 3N3TA 1NQKA 3EMCA 2YXOA 1K3UA 1GZJA 1UWSA 3ENLA 1WAUA 3VDGA 2VGIA 5HNRA 5AYYA 1BRLB 3TDFA 4GYKA 4AB4A 4S39A 4P2VA 4WDUA 2G95A 1FH9A 3CAWA 2CHRA 1JUEA 3LPFA 4HU8A 2NX9A 1TE6A 1YDYA 4L64A 5HJLA 4EACA 1DJNA 5FD0A 2IW0A 1JGIA 2A0NA 3MY9A 1GYLA 3S2MA 1BAGA 3RO8A 1P43A 1EQPA 2CETA 4BZYA 4LVGA 5ECUA 2FVLA 1LLWA 4UQAA 4IGHA 3QW3A 4E4FA 5HJYA 2PP1A 5IRPA 4Q8OA 2Y61A 3OW1A 4GX9A 3HMJG 5AC5A 4LUJA 2J27A 1DWFM 1T5AA 2NXHA 3VIOA 3MVIA 4PTNA 1Y8BA 1SR9A 3O6AA 1NF0A 3VVGA 3L68A 1BHGA 4OE7A 3ZT7A 3GTNA 4MUPA 2I9EA 1WKDA 1MW0A 1KCZA 3HM7A 1TWWA 4KIEA 3VOJA 1UKPA 3WENA 4ROQA 1EZ2A 4NNAA 4AVOA 1CENA 3W7MA 3ABSA 1JG9A 1OFRA 1VENA 5D2TA 5BU6A 3IRDA 2E1DA 2PTDA 2YA2A 3GG1A 1WDWA 3HPAA 4Q8MA 1HL8A 3ZLFA 5C9WA 1X1NA 4EAMA 4Z2KA 2A3BA 4YXGA 3AHZA 3TTOA 2E9BA 1DV7A 2A2IA 1S1PA 4DI8A 3ZM8A 1FCVA 4CVUA 2NT1A 4IMAA 1AL7A 3HMCA 1QO5A 3ALGA 3DDMA 3R58A 1CLVA 3RNDA 2F61A 3U48A 1XHGA 5M17A 4Y90A 1R9XA 3P80A 3XINA 1JDDA 1DHKA 5J04A 3EB4A 1DWGM 4IQEA 4MDPA 1XI3A 2BP1A 4GVGA 1TA3A 1TPWA 4ATDA 2ZX9A 3RCNA 1BG4A 4F48A 2I57A 4TV6A 1TE1A 3W7NA 2TYSA 1X96A 1OCBA 3KZSA 3T09A 5CPTA 1N2VA 2GSJA 2ANUA 4WEVX 2D24A 1C93A 3ARPA 2W63A 4DM2A 1KTBA 2CPUA 3V0SA 5AHIA 5CBBA 2WNZA 1J0ZA 4GINA 1A80A 1QPOA 4K8HA 2XIQA 2A7RA 3TZFA 1SZNA 1Z3NA 4IIFA 2WNQA 1YX1A 4M19A 3R0DA 2A3HA 1MDLA 4X60A 2VX5A 4LBRA 2XIOA 1UPMB 4FA3A 3WF0A 2YCEA 3WNLA 3FKRA 4GJIA 4H19A 4I6KA 1OG6A 1RK5A 2WBGA 3I7SA 2V82A 2ACRA 1V7AA 2CZDA 2VD9A 2QAPA 2ZZ3A 4JYFA 3NWRA 3Q2DA 3KBMA 3LCIA 4S3KA 3SFKA 1UH2A 4HT3A 1XLJA 4ORMA 4LAZA 3VIJA 3WQ6A 7ODCA 3N17A 1GPFA 1LZOA 4AIOA 3THQA 4DN1A 2VT0A 3TWBA 3EAUA 3KBSA 1D3CA 3GNDA 3FCPA 1JZ5A 1OFPA 3VGDA 1TWDA 2WNNA 3T9PA 1J6OA 4Q8WA 1TA3B 2NWSA 2W92A 4NIRA 4R53A 2UY2A 3AQUA 2PDNA 3PN8A 1VFLA 1X1OA 2VEFA 1C8VA 5LNVA 2XVGA 3RRAA 3UR5A 3SCOA 4PB3A 1LROA 3GTXA 1L2UA 5EYWA 1CCWB 4ZSTA 5DCEA 5A69A 4W88A 4AZCA 4GJ1A 3DI0A 1A5SA 1E40A 3FYPA 3M46A 1DJQA 4U31A 3C56A 3O0FA 2FVMA 2P0IA 5JBEA 1W9BM 4S3BA 4FNUA 3PUGA 4GO8A 3WG6A 4TOQA 2IQ0A 3GFZA 2HXUA 4E2DA 2MUCA 3W02A 3WO8A 3T2QA 4JTTA 3ZR4A 2IKGA 3GKAA 2IS7A 4LYQA 5KEZA 3NCOA 2CCRA 2DVUA 3CS2A 5E6ZA 2ZZ4A 4XO6A 4AFYA 1SFJA 2OZ3A 4FIQA 4V1XA 1GUVA 2RH9A 5U7SA 3BMWA 3MUAA 3CB3A 3PZUA 3LYEA 1V8EA 2VVSA 1SFLA 5F4SA 2OFJA 2QW5A 4FOJA 1MO0A 3UVIA 1XW8A 3H22A 3STCA 1CGTA 3SCVA 3DFHA 1WUFA 3ES8A 2G37A 4HU0A 4AF0A 1NWTA 2DPEA 3W73A 5CSYA 5D05A 4D6DA 1W3KA 3H54A 3ZLHA 5AHMA 1XD1A 3BJSA 1EC8A 3PZMA 1Y65A 5JIPA 3HO8A 4XAGA 5G2HA 3MCMA 2CYGA 5J5RA 4G1KA 1VIZA 4L4OA 4NZCA 5G1TA 5A8GA 4HA4A 5BXPA 3AHVA 2PWDA 3LCHA 4IXHA 1R3YA 1J0YA 3LTPA 4PMNA 4AZCB 3QM3A 1GVSA 2FQIA 2J62A 1JPHA 4Q8QA 2VOMA 2VZUA 4X9SA 5EFFA 4RV8A 4GE8A 4JTAA 3AHTA 3ZZ1A 2IKIA 3BPWA 4I8DA 1E1FA 2QV4A 4HP5A 3QV8A 3A47A 4FLSA 3GBEA 3QTPA 1CLXA 3JRKA 4O1AA 4HSOA 1L8NA 2BMBA 3B0YA 3T08A 2OTDA 2X1IA 3LHYA 2DZAA 1IXOA 4JNMA 3BAKA 2DZXA 3PC0A 2WSPA 4FLQA 3JS3A 2PDHA 4I5UA 3WBWA 4IUOA 1NFPA 4ADUA 3PP7A 1O5XA 2RJHA 5LA2A 4KFOA 3KVKA 1HUVA 4HA3A 3KUMA 4DX3A 1ZLPA 2PU0A 2RHGA 1E6PA 2CXGA 3NYZA 5GNXA 4DLFA 4LU0A 4Z1DA 4BWLC 1UOKA 2DZWA 3NM1A 1QFEA 3ONBA 3ZSTA 4I8YA 4IMCA 1A5UA 4C5ZA 2Y0FA 5D2YA 4MTVA 1F6PA 4NP7A 1MNZA 1VD6A 5LHFA 3H4GA 1J0JA 1W1IE 5C0QA 3E5PA 3M0KA 1LYXA 3A9BA 2OEJA 2Z28A 2ZX5A 4PMUA 1XYFA 2Y8VA 1EB3A 2BGNE 2BOGX 4D8AA 4M6PA 4XD3A 3CQHA 1MW3A 3OPSA 1E3XA 2BODX 3WJZA 4GACA 3ZO9A 5FF3A 4WSHA 1AG1O 3EDFA 1XICA 3GC5A 4MWAA 4GH1A 2Z1SA 2XM1A 3WJSA 2OR2A 4Q33A 4US5A 1MFVA 3FXYA 2VFEA 3DFYA 1GOXA 1WCGA 5FEXA 3S1WA 3L66A 4DBSA 1ZUAX 3NG3A 4PSPA 5CGMA 1JUBA 4ZOAA 1AMKA 1V0NA 3KW3A 5DCDA 1IZJA 4GKTA 2O4QA 1NARA 3TN4A 4JX4A 3JR2A 3VABA 1FDJA 4E3VA 1F07A 4LT9A 4K7YA 2D2HA 3B05A 3GVQA 3L0NA 1WDSA