3ITGA

Structure the proline utilization a proline dehydrogenase domain (puta86-630) inactivated with n-propargylglycine
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
524
structure length
398
Chain Sequence
PQSVSRAAITAAYRRPETEAVSMLLEQARLPQPVAEQAHKLAYQLADKLRNQFVTGETIAEALANARKLEEKGFRYSYDMLGEAALTAADAQAYMVSYQQAIHAIGKASNGRGIYEGPGISILSALHPRYSRAQYDRVMEELYPRLKSLTLLARQYDIGINIDAEESDRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPLVIDYLIDLATRSRRRLMIRLVKGAYWDSEIKRAQMDGLEGYPVYTRKVYTDVSYLACAKKLLAVPNLIYPQFATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIYAPVGTHETLLAYLVRGANTSFVNRIADTSLPLDELVADPVTAVEKLAQQEGQTGLPHPKIPLPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the proline utilization a proline dehydrogenase domain inactivated by N-propargylglycine provides insight into conformational changes induced by substrate binding and flavin reduction.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
molecule keywords Bifunctional protein putA
total genus 156
structure length 398
sequence length 524
chains with identical sequence B
ec nomenclature ec 1.2.1.88: L-glutamate gamma-semialdehyde dehydrogenase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01619 Pro_dh Proline dehydrogenase
A PF14850 Pro_dh-DNA_bdg DNA-binding domain of Proline dehydrogenase
A PF18327 PRODH Proline utilization A proline dehydrogenase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3itgA00
3FSUA 4JNZA 3E2RA 1TIWA 4JNYA 2FMOA 3IJDA 2FMNA 1ZRQA 3APTA 2FZMA 2FZNA 4O8AA 1ZPTA 3ITGA 1ZP4A 3APYA 1TJ2A 1B5TA 3E2SA 1V93A 1TJ0A 3FSTA 1ZP3A 3E2QA 1TJ1A
chains in the Genus database with same CATH superfamily
2Y61A 1RBLA 3I3EA 4TVDA 3UESA 1UR1A 3N6JA 1AJZA 4XG1A 3D5HA 2YZRA 4UTMA 2ZXQA 3EWXA 1LQAA 3QR0A 1X1OA 1P43A 3WL1A 4QTGA 4AY1A 1GZJA 1K8CA 1CI1A 3UR5A 3EDKA 2XIQA 1Y5WA 3TXVA 1EZ2A 2OX4A 3CK5A 3VD3A 1I2NA 1GG1A 3WL0A 2ISWA 1OK4A 4XO7A 2XJ7A 4RXFA 1TKKA 4Q8PA 4UMAA 3PZ9A 3TN4A 3S6DA 5DXYA 3GZAA 4XBJA 3HIJA 2UWFA 4YCOA 1RVKA 4AUBA 3KCOA 2I9EA 4JKLA 2HEJA 2TODA 4Y6GA 4ZSUA 1DJHA 1OCQA 2G5WA 3GBDA 2ZZ6A 1S5MA 3P81A 2A7NA 1GW9A 2PDNA 3H22A 4MNLA 3ZSSA 1NFPA 4MJZA 2WXDM 4GX8A 2VZVA 5DBTA 1XLBA 1SZFA 2BY1A 3UD6A 2DT2A 5FF2A 1RUSA 1YW1A 2OQLA 4Y9MA 3IK2A 4GUFA 1W17A 3T8QA 2ZWZA 4IX2A 3C3NA 4LB3A 4JFVA 3GXPA 2Z25A 4PUEA 3TN3A 4RNIA 1HJWA 2XU2A 3U2ZA 4WDWA 1P0NA 3TOYA 1GVOA 3OHMB 3GTHA 3GHRA 2VX4A 6REQB 4UC5A 2V3DA 3LGDA 3MCMA 5HOSA 3KFTA 1OEPA 3R6IA 3NWRA 1HFBA 1OFEA 3N2TA 1LBLA 3UT0A 4P7NA 4BQ3A 1HKVA 3ZLHA 1P48A 1XR2A 3CEPA 1XGZA 4PUKA 4MWAB 1NQ6A 3CPGA 4UNLA 4UZSA 3SO7A 3F2CA 4GJJA 5BRBA 2PWUA 5EMMA 3PM6A 1UKTA 3CB8A 3K4WA 2E4TA 3BGJA 2A3LA 2ZADA 3AIEA 3MP5A 1UHVA 4XBKA 4B5TA 1KLZA 4RW3A 2R9RA 1Q8JA 4O10A 1KXHA 3NVDA 4NZFA 3LY0A 3JUGA 2NX3A 3W2KA 5AHFA 4IUGA 1EYWA 3V16A 4DUWA 3UA3A 1WB0A 5K7JA 3I3BA 4S39A 1GVFA 3OVRA 2UZ9A 3WO8A 3PPGA 5DCBA 1K9DA 2DU2A 1UWIA 2RDWA 1TQXA 1ITXA 2ZTKA 3CT7A 2ZZ4A 1M7JA 3G5EA 1W1TA 2JEPA 4Q8TA 5GPRA 1E9YB 1PKNA 5EMKA 1CPUA 3APGA 4CKQA 1E70M 5F2GA 3LSCA 3QHOA 3KHJA 4PCFA 2NUWA 3LDVA 3KXQA 4MFDA 3WD1A 3EKZA 2BY2A 1HKWA 3M0JA 3W6YA 4DBUA 4HP5A 1J93A 2UY3A 3HG5A 1J10A 5AZ1A 4RE4A 4UFKA 1WDWA 3TW9A 3CQIA 4D1IA 4MWAE 2ZZ2A 4IT1A 1EWDA 2V5DA 1W1B1 2QUUA 4RNFA 3RF9A 2ZQ0A 3GU1A 3VNYA 1RCQA 1XQKA 1H0GA 5BXTA 1REQB 1FWTA 3K30A 1HKKA 3W1TA 4GBUA 1N55A 1OGGA 4HNOA 4B5SA 3WQCA 2Y4SA 3VDAA 1LOLA 4PB4A 1L2QA 1R6WA 4NAFB 4Y90A 2GJXB 1R5YA 4TR9A 2O7QA 1Q85A 4WY0A 1MXGA 3AROA 4ZTYA 3C2OA 4RNHA 2VRKA 2BZNA 1RD6A 1TWIA 3CUJA 1UP2A 1JUKA 2ISVA 1KBLA 1PX3A 3KRUA 5EFFA 3WJSA 2DEPA 3F4CA 2NSOA 3AJ7A 4ECLA 3T0DA 4N6EA 3R1ZA 3NO5A 2J47A 4Q7IA 2X16A 1X7FA 4QNEA 1UOZA 4H9YA 1KQZA 1UWSA 4UQ9A 3RK8A 3O7UA 4O4WA 5HQLA 2VFFA 5I09A 3BZJA 4W87A 1OFPA 3BURA 3AICA 4P2VA 3V1HA 3EDJA 3A9IA 4ZQRA 4AZ5A 2DP3A 5JBDA 4GVIA 4R33A 2ABBA 1AH3A 3B8VA 4EXQA 3STFA 1JNEA 3EYPA 4KCUA 1HL2A 3GQYA 5A6SA 4U2ZA 3L5LA 1OF6A 1JDEA 1E6PA 1XPGA 4NILA 3VNZA 1OFDA 4DF0A 3LXCA 3DG7A 2BMBA 2EG8A 4XAPA 2YL5A 3LZ5A 4KEUA 5IHSA 3S2LA 4AD4A 3GIYA 3CLWA 2GYIA 1I0DA 2PDYA 3D3AA 5DFAA 3W7IA 5AN7A 1FH8A 2DV0A 3TYDA 2V30A 3VYLA 4W89A 4JTKA 4N7QA 1OG0A 2ZUVA 4QHRA 4LC8A 1X7IA 1TPFA 2Q01A 3SRKA 2RHGA 4MKSA 3ATYA 2VX5A 3DUGA 5A5WA 2Y1HA 3M4HA 3NQEA 1CT5A 5EA9A 4UTTA 1NWSA 4MNMA 1XGEA 1P0BA 1VCVA 3W7CA 4I6VA 4FXRA 5T9BG 3G1FA 1GOQA 2G0WA 3L2IA 1Q66A 4DO4A 4B3ZA 4UTUA 5E9AA 1P4CA 2A3BA 4RUBA 2HVNA 3RLUA 5I02A 4ZQOA 3C0SA 3LCLA 3C2RA 3AAMA 1VBUA 1L6GA 1NEYA 4I6KA 3DOPA 3N3MA 4BI7A 3QTPA 2P53A 2GDVA 1AW2A 1F61A 1XH2A 5AY7A 4JTCA 3CO4A 4F8XA 1E1CA 2XH4A 3EXTA 4C6PA 1CWYA 3KE0A 1RR2A 1XYAA 4Y9PA 3PZTA 5CPNA 5I7GA 1XH0A 2XGZA 1TJ2A 5C5YA 1K4GA 3CZGA 4C6IA 4PMNA 1EJSC 1KW1A 3OJGA 2DW6A 3UPBA 4AD0A 2VGIA 3UPWA 3E1F1 1TUFA 1PXGA 3EGJA 2NUYA 2OTDA 5BMXA 4IH3A 3NQ8A 4MB1A 3L12A 3TC7A 1VHCA 5EGRA 4WY0F 4V28A 5EMUA 1BAGA 1X6LA 3OVPA 3BXWA 1NQKA 2Z1KA 3DESA 4QDPA 3BDKA 3KVLA 4GC4A 3FX4A 2W6RA 1VIZA 1GOIA 4J5NA 3XIMA 1VYSX 3T8LA 2DQXA 4UFLA 4S2BA 3SQMA 1XL9A 3L4UA 4F0HA 2OKOA 1AUSL 5DLCA 2YKKA 3KS5A 3QKZA 5HATA 1EJ7L 1CXHA 1I1WA 3QMRA 2XGBA 4PGLA 4LYRA 1WV2A 2A3HA 3UR7A 1VGAA 3GW3A 1AG1O 1BGGA 1N82A 3TSMA 4A05A 4GJIA 4XWUA 2XG9A 4I9JA 3K1DA 4GIRA 2F38A 4YIWA 3E0FA 4IFKA 2QJJA 3FYOA 4N9CA 4O18A 2ANUA 4GYPC 3U7VA 3S5SA 3HGJA 1US2A 3GM8A 1WKEA 4ZO8A 2GSHA 3W83A 3NEHA 5F1VA 4QR6A 4IJCA 5LHFA 3GDKA 3MWCA 3ANVA 1FWEC 1CGXA 4G9PA 3ENLA 4X22A 4AIEA 2WVSA 3CYJA 2A85A 4UNIA 4FAMA 3VKKA 5D32A 2D73A 1GVIA 1SFJA 2CLOA 3W1XA 1V6TA 4BF7A 2D2HA 3I7SA 2HISA 2OGJA 1GWJA 1K9TA 3U9IA 1LLZA 4W84A 3WH6A 5CZJA 1BPLB 3P62A 4F0SA 1ZJHA 2X0SA 2VC9A 2QR6A 4GY0A 4PRRA 1SJDA 3B3DA 1A53A 1KM2A 1OABA 1I6NA 1JL8A 3WQEA 2GVLA 3L0KA 5LNSA 3EDEA 3UGVA 4DEFA 1YKWA 3H2MA 1FWDC 2DUAA 4IIHA 3HG2A 1UP3A 1OK6A 4ICNA 1WDQA 4A22A 3VIKA 4E8CA 1WOAA 4J28A 5EYWA 4H2HA 1V77A 2X09A 1DPMA 3NOEA 3RDKA 5E70A 2QT3A 2WCSA 5DMLA 3H2OA 3CAKA 4JTLA 3WNNA 1U22A 5D38A 1HO4A 1ZRQA 4MDOA 2X05A 4PTWA 1VH7A 2WNNA 3TTQA 1JR1A 1KV8A 3CH9A 3VD4A 3CZKA 3GZ3A 3I3DA 4Q4OA 3F5JA 3I68A 3V5OA 2ZUMA 1A3XA 4DB7A 2QF8A 1SSDA 4DELA 1F5ZA 2VGFA 2AL2B 4MAVA 4X60A 4HHMA 3AISA 4HNVA 3TQ0A 4W86A 1R2SA 4RR4A 4PSPA 4KWUA 2ISDA 4D1JA 4EACA 4PMUA 4DN1A 3SJ3A 1B9BA 1PJ9A 5D33A 1YNPA 4HN4A 3QR3A 3GKFA 2Y5JA 2PBOA 1LRQA 3VD9A 3MUY1 1ONEA 3V75A 3G6MA 1CYGA 1CB2A 1ISVA 4WF7A 1PZ0A 3WCZA 2DSWA 4FXJA 2W66A 3VIHA 3N2MA 1GKRA 3QYQA 5IDIA 1QRQA 3AU2A 4G2DA 4ERAA 1QI0A 1E1EA 3RRAA 4WY0B 1TZ9A 1WKYA 1VFHA 2DUZA 3OU8A 4URIA 1RK5A 3GDMA 5CCZA 4HT3A 1UW9A 4IGHA 2QXWA 4HMNA 1VBHA 1XC4A 4DBDA 2YIHA 5LIYX 3M7SA 1ITCA 1WO2A 1UCWA 3KEHA 2ZC8A 4R7JA 1XM3A 4GO8A 1EF2A 4BI5A 4MYAA 1EO7A 1K6AA 3AYRA 5HBFA 4DUVA 3GAKA 3GG0A 1TELA 3WQDA 4LPCA 3UERA 3ZJ6A 4Q4SA 4CQAA 2NZLA 3VFCA 4CNSA 2ZDSA 4V1YA 2V9DA 4C6MA 1QAPA 2EG7A 2RKXA 3SEPA 1C8VA 1Q7QA 3GC5A 4D6FA 3AZTA 1AL8A 2C71A 3G0XA 2C91A 4AHOA 2ZXBA 2FLIA 4WXYA 4E4UA 1TTQA 4YLWA 1MNZA 2WVTA 5KZDA 3SURA 2UV8G 1H1YA 2ZUUA 1OF8A 1TWZA 5IM51 2IKJA 1Z41A 2NSXA 3GXIA 4K39A 1PB0A 1WXZA 2FTWA 1QK2A 3PPHA 2Q6ZA 3UJFA 3IEBA 3RPDA 1EPXA 3O6DA 1FWRA 3BAJA 1XX1A 3PWAA 3RITA 1GPFA 3ABSA 4AD2A 2F6UA 6TIMA 2PWDA 4KCWA 4D6DA 1KBKA 1UH3A 3ABZA 1QNSA 1A3HA 1YPIA 4AQLA 3H7VA 5REQA 3LPPA 4FA3A 2CLEA 2BHZA 4GH1A 2AL1A 4FK9A 5D04C 3ITGA 5D03A 3MI6A 2OOFA 1GQJA 3I6EA 5AVNA 1ZBVA 5HMSA 1LL6A 1YNYA 5E6ZA 2EKCA 2DJLA 1I2PA 1OYAA 4WKHA 3WLQA 1ONRA 1HKIA 1TA3A 3SFKA 2V69A 3W71A 1EP2A 5I3DA 3UNTA 1UUOA 5G1YA 2A3AA 3DECA 4U5KA 2HMCA 3S83A 4OOUA 3W75A 1MEWA 1EJUC 1W1ZA 2WZMA 5A1AA 3S1WA 3VZZA 4GX9A 4HMEA 1EEPA 4PUMA 1TUXA 3ECQA 4HD5A 1U2YA 2J7HA 4HPNA 3P3BA 1O5KA 4PUNA 3T7VA 1XCWA 5DMMA 4INFA 4LCSA 4TTGA 3LCXA 2J8FA 1MYRA 2E9LA 2PAJA 1W9XA 2XM1A 1T8XA 3BLFA 4HKPA 4JKKA 1EXPA 2H3BA 3BSMA 3RPMA 3GNXA 4YTTA 3LPFA 3MWAA 3LPOA 2Y85A 5I3GA 2ZRWA 2PF0A 2YFOA 4ZZ9A 1JFHA 1UG6A 1YE6A 2BDQA 4ZOBA 1XRSA 1UZ1A 4RW5A 2AGTA 1W8SA 4WJEA 3WJYA 3CB3A 3H53A 3N18A 4S3DA 1TPVA 1JPMA 2EXOA 3QFWA 1E15A 2DVXA 3ITCA 1P1XA 4JX5A 1AZ2A 4FNTA 1OIMA 2J13A 4AEOA 1DKWA 1Z6KA 3S6TA 1NP0A 3PBWA 5AC5A 1WUFA 1BG9A 3C8FA 2VR5A 3AIQA 4EXBA 2BOEX 2INFA 2CNCA 4Z2HA 2E77A 4HA0A 4GUJA 2Y0FA 3R25A 3HF3A 4IQJA 1LWJA 1DWJM 3OQEA 3UXLA 1QMLA 1OC6A 3STGA 4M82A 4PUDA 3SSJA 2V38A 3TJLA 4ERGA 5KMYA 1TTJA 1W3IA 2QJMA 3QV6A 1QI4A 5CSSA 3V18A 3GYCA 1TA3B 5DRIA 1OY0A 4H8HA 3SUVA 1IEQA 1VHNA 4OECA 1E71M 3UY8A 1X98A 1A0CA 1G4PA 3QGKC 4JIIX 2C18A 4KT2A 1H7XA 2R1NA 3C2EA 4L9ZA 3TSBA 4P8WA 2EO7A 1DJXA 1UQYA 1E5JA 1SJBA 2OYMA 2Z4GA 4WCJA 2GQAA 3UA4A 3CTLA 1JRBA 3E0VA 2YB1A 3O0KA 2VZSA 1UH2A 2FZNA 4MWAC 3Q67A 1VJZA 1WPCA 1ZSXA 2CLMA 2WBKA 2ZFAA 3QFEA 2V2CA 4IIDA 4QSHA 1EX1A 3DHPA 2WVUA 2XM2A 4IX0A 2Y7GA 3CQKA 3UQNA 2P50A 4QQ3A 5TAOA 3CM4A 4Q33A 5HUOA 1VBJA 1WDRA 4Q8UA 2QGHA 1E0VA 5BRPA 3P0XA 2PU1A 1T0OA 1X6UA 3GFXA 3HPAA 1KRMA 5LNRA 4ZBCA 1VD6A 2C19A 5HNRA 5D2VA 5F2IA 3PPCA 2Y63A 3HPSA 4GNKB 4LYPA 1ZNNA 2OLSA 3UYCA 4I8DA 2UY2A 3M0XA 1W9VA 4DO6A 3T09A 1UKPA 3VKBA 2XINA 3NZPA 4W8LA 4XKMA 3ANYA 3RM4A 1WAWA 4RZ6A 1H7RA 4GG9A 2V6AA 3UYIA 3V1PA 2YDAA 3AU6A 5MHBA 1AA1B 2YA1A 3I7RA 4H6QA 2NX9A 3E2VA 1NWUA 4IHCA 4HOZA 3NO1A 1GOKA 2WMGA 4A8RA 2HVOA 1FHLA 1Z89A 2CW6A 3SBFA 2AAMA 2YCKX 3IV8A 4LS2A 4BWLC 3SR7A 1KFLA 1GQNA 2IKHA 3TTYA 1SFSA 4MOZA 3GTIA 4MWAD 3KOFA 1KWKA 5HR7A 3IAPA 2DVTA 1QFEA 2R14A 4YHEA 1DHPA 1XCFA 3EOLA 3M6DA 2E3ZA 1BXCA 2CWXA 3O6AA 4R88A 4ML9A 3H7UA 2A7RA 4FNPA 3W02A 1IT0A 4CCZA 3JVAA 4BKNA 3FCPA 1SR9A 4IGNA 4AX7A 5CH9A 2WOQA 4HGXA 5FIPA 1ICSA 1TG7A 3VK5A 1IIHA 3GD6A 1H1ZA 3S46A 4ROQA 4GJ1A 4OE7A 1R7AA 4E2BA 3KBJA 4AIOA 2BWGA 3R0DA 3DFNA 4CCCA 4LX4A 1OYBA 3MP3A 3AS2A 1QNOA 4LF1A 4DJFA 2EQDA 1UZHA 2QPUA 3C61A 2CKSA 2QCHA 5FA5A 2I57A 3LGGA 3W27A 3C5QA 2HXUA 3EWWA 1ZCOA 4H1ZA 5FSDC 4YTUA 3W7KA 3DU0A 4NYUA 1OFOA 2XIBA 3UU0A 4JQ2A 2JGYA 3S2JA 1XLMA 4ASTA 4W7VA 3BMWA 1LWIA 4JNYA 4PTMA 3MYPA 3VO0A 4CCEA 1VS1A 1O12A 4KETA 2GJLA 2G3MA 3CZJA 4MIMA 2XIJA 4Q8VA 1IF2A 1TJPA 2ONEA 1VFMA 3UXIA 3BOFA 3URAA 4D6CA 2ZUWA 1RLCL 2PRLA 2O92A 4V27A 4C6BA 1HG3A 4H6KA 3GG7A 1SFLA 1BSLA 2VVNA 2E5BA 3S4TA 1QO2A 3LG3A 1W9PA 4AISA 4R34A 3SQLA 3FJNA 3GVWA 4WLCA 2O4MA 4XSLA 1EJVC 3O06A 2ZDRA 1XYFA 1U30A 2XUCA 3W84A 1R9YA 4FZIA 3B9DA 1UZDA 4N6FA 2Y5SA 1JF6A 2DDXA 3N4FA 1OQFA 4K37A 4LU0A 3OYXA 3LSBA 3ZT5A 1RP8A 1ZB5A 1QXLA 1P0KA 1IHIA 2PCEA 4NY2A 3B8IA 4JCMA 5LIUX 4C6CA 2BASA 3UG3A 3WH7A 3IGXA 5TD4A 4CUCA 1FOBA 4RDWA 3AIWA 4X63A 4N9EA 2OSWA 3RLVA 2C13A 2P88A 1TPUA 1NOWA 2BFGA 2O56A 3OLIA 3RCNA 1ESWA 5FJOA 2F2HA 3ZWTA 1TB3A 2CZ5A 4HBKA 4DJDA 2ZX6A 4HNUA 1LRTA 1OX5A 1LUCB 2YBUA 5C9UA 1BVNP 3GH4A 3MMWA 3PAJA 2PURA 3UCQA 1M03A 2VDGA 5I77A 1RD5A 2B7NA 5DT7A 1KO0A 1IT7A 4PZVA 2FDMA 3P60A 1FQ0A 2B81A 5AC4A 4AD1A 3OB8A 3LI1A 2GUUA 3PWIA 1VQTA 1UPMB 4M5PA 4M51A 4JTHA 1AQFA 2C0AA 3M43A 1YHTA 3MHUA 2WSRA 1LLWA 4PBGA 3KHDA 3AIBA 3KL3A 5DMYA 3BICA 3D47A 3V7PA 3VPLA 3IANA 3ALGA 1V08A 3IS4A 5D9PA 1HGWA 3M5VA 1VFTA 2PDGA 2I56A 3FYPA 3WG6A 2WK2A 5LZLA 4QEEA 4RLIA 3UY7A 4W5ZA 2J24A 2J7EA 5CQ1A 1H7NA 4HZ8A 2IPJA 2NVCA 4FX7A 3IACA 3KCLA 3NQFA 4QISA 2FH8A 3RPTA 1JZ6A 4C91A 3RG6A 1G69A 6TAAA 3KLLA 3TXZA 1WKDA 3BLEA 4GA8A 1IXPA 4PMRA 2J7GA 3C0QA 3AHYA 2GUBA 4UMCA 2QS8A 1R47A 2X2YA 1UKQA 2ZX7A 5HMDA 2HK1A 2XSXA 4EXAA 3AXHA 1WOBA 3HO8A 3ZJ7A 5F4WA 3QBUA 2IPGA 1BEUA 3W88A 3MU7A 7PTDA 3LHYA 1S5WA 4O8RA 4LH8A 4H8NA 3FJ6A 2JALA 4TX6A 1DL3A 4GQGA 1RJRA 3NJ3A 4LFYA 1CXFA 3NEVA 4AC1X 5A69A 3W73A 1BFNA 4FXSA 2I9UA 1XRVA 4JS3A 2BVYA 3UNDA 1HNYA 1DEDA 4GHRA 1TIWA 1GGOA 2X0YA 3T0BA 1AD1A 2DZAA 2VJXA 1XRFA 2BHYA 4KWSA 3VKAA 1D3HA 2OELA 3THCA 2XFWA 4GI6A 4JL1A 3JW7A 3PUEA 2B7PA 4AY7A 2A3CA 5TIMA 1XD0A 4E4PA 3TCEA 1HT6A 2NLYA 1UR3M 4J3UA 5A6BA 5I2UA 3VIIA 2E6YA 5HNUA 1DV7A 1YTKA 2G41A 3GFYA 2HWGA 3FGCB 4DAFA 3BG9A 1HJSA 3B9EA 1TPEA 3WQ5A 1UJQA 2WC4A 4JQ4A 5FEPA 1D8WA 3EWBX 2DIKA 4CD8A 1MDLA 5GJPA 3AZRA 4P7LA 1NM9A 3ZR4A 2WJDA 2VRJA 5LGXA 4WSKA 4CGTA 3VGEA 2D20A 1R3VA 4Z1YA 3M07A 5I3IA 3AXXA 5HQMA 1S5TA 4BY3A 1QU4A 4MYXA 3Q58A 3UXKA 1JFXA 2ZZ1A 3VMPA 3FA3A 1ZJAA 4QITA 3WEOA 4DNHA 4H6EA 3AMLA 4JZ5A 4WDXA 3W1UA 3G2GA 4IIFA 4Y8EA 2G8ZA 3TIMA 4QE1A 3MTWA 3FIGA 5M2FX 5AKQA 2HBXA 3CS2A 3CYVA 2D3NA 4NX0A 4GH3A 4K6AA 3QR1A 3QQ1A 4MADA 3TP4A 3PK7A 1V02A 5KZEA 2CBIA 4QRNA 3ITYA 2O9RA 1OD0A 1J6PA 3PUOA 1ZTVA 3OA3A 1A5MC 1VRXA 1JYVA 1HJUA 2V0TA 2JBMA 4GZJA 4BEQA 4JTDA 1UR9A 1RPKA 1GORA 2I1OA 4XZBA 1PE1A 1XV8A 3LXAA 2OT0A 2YCIX 1KV5A 5GJMA 4K7VA 4ACZA 3KBVA 3W2JA 2DZBA 4GXPA 3G8EA 4S2CA 1WA3A 1OCBA 3TN5A 1B3WA 1M7PA 3GAYA 4RDZA 4HOWA 4DRSA 3SY5A 3WUEA 1J12A 1A5UA 1TCMA 5SWUA 3CUZA 5HINA 4OWGA 3LI0A 3S6OA 1NU5A 5G4WA 1BRLB 2G97A 2WMIB 4MY8A 3WLTA 5M1TA 1VCFA 1R8LA 2XSBA 2PLCA 4XD4A 4PTNA 2VKZG 3S5NA 4LNYA 2IXVA 3BUVA 5FL1A 1B31A 3GG1A 3VILA 3FXYA 2AQOA 4IJRA 3S9IA 1FWJC 3GNNA 3IWPA 3QEZA 2QHAA 3G1XA 4MKNA 2REQA 2Z1VA 3BLPX 2WKJA 3WQPA 3EA2A 1K02A 2Q8XA 1R3YA 4IGSA 3NQAA 3P67A 1XINA 4HA3A 3WELA 1NVMA 4JIHA 4H3DA 4JNMA 2ALRA 2YDRA 4KKXA 3T08A 3TTSA 2PP1A 1FXQA 1H11A 3CMGA 1F6YA 2VR4A 5CEWA 3TYCA 4XD5A 3GB6A 1EUAA 3DFOA 1H2JA 5MKGB 3KBNA 3KBWA 3GSMA 1BWLA 3EOUA 1GJWA 4E5TA 4R27A 1C9WA 2OQYA 1ODZA 2D0HA 8RUCA 2DZVA 4REQA 1R3TA 4MZYA 1E40A 2CLFA 3LBCA 1YDVA 3VA8A 4Y7EA 5C2XA 1XLIA 3ABQA 5JIWA 3PNUA 1VLIA 5CXPA 2BLEA 4Q4PA 2PDXA 3PZVA 1Q63A 4AFYA 4MWAA 4JBRA 2Q3OA 3BLKA 2YBTA 4TXEA 3TCSA 4CU6A 3BOLA 1O6IA 2RDTA 3W07A 4EIVA 5A6MA 2R91A 5XIAA 4W85A 2X8RA 1I9CB 4IQEA 5CAKA 2PWVA 2BOGX 4G6CA 4ATLA 7A3HA 4CLMA 4ML4A 4PBFA 4X2RA 3VZYA 3PTMA 1JCNA 4F2BA 1PL9A 4HNCA 4J1OA 4U4MA 4WKFA 2AL2A 2PBGA 5CPTA 3FEMA 3G22A 5EY5A 3AHZA 1VB9A 3ARUA 3LUTA 2WNQA 4AHQA 4LUSB 1DWFM 3W0KA 4A35A 3ITXA 1ENUA 1F2JA 3KOXA 4K8HA 2Y8VA 4LJ3A 3DGRA 1JCJA 3EOSA 2QCDA 6CGTA 1S39A 1WAUA 1E56A 1XGDA 3ITVA 3WLLA 3TR2A 2XVNA 1F9CA 4ORMA 1V5XA 4IISA 4CNNA 3PULA 1SGJA 4OV4A 1IXQA 5D4YA 4L4LA 1V3JA 1LP6A 2GPTA 1PTAA 3ABOA 1GJPA 4HQVA 5FI8A 4ZB0A 1ISXA 1R7OA 5I3FA 4GD0A 1FVPA 2XSAA 3W7DA 1UA3A 2NQHA 1DWIM 2PWFA 2WSYA 4Q4MA 1O1HA 2IQDA 1EHAA 1HKJA 1S5NA 4YWIA 3CHDA 3N73A 4NJGA 4ZE4A 5T26A 1RJPA 4KCTA 3UBPC 1BVWA 2VL4A 3RXZA 4ZQCA 3M0VA 4K8GA 2VFHA 1IR1A 3TZFA 1M01A 5CZ0A 3V0UA 3ZMRA 4GXWA 5F2MA 3O2LA 2CESA 1W5MA 2QJHA 1G7VA 9XIAA 2VT0A 1K8ZA 4I7UA 1Z48A 1RPXA 3RN6A 2PI6A 1U1UA 3CQJA 1YTDA 4KRZA 3U48A 2PLKA 5J8LA 4HJFA 4AU0A 3CPUA 5A8QA 1KM0A 3CV6A 4EF8A 2IQTA 1E72M 2XH2A 3WDPP 4ADTA 4NXKA 4U3CA 4RCXA 5C6MA 1N8IA 1Y7VA 1IT8A 4N02A 2RJGA 2GDUA 4DWSD 2HXTA 3VDHA 4ADUA 2X1SA 2J74A 4KGJA 4L80A 1XG4A 3ZLFA 2JIWA 2D3LA 2VEPA 4IIBA 3W81A 2ACQA 3DKJA 3QHMA 2V68A 1N2VA 1KFWA 2WC7A 3RMJA 2DY3A 2WMFA 2XH0A 5IOBA 2J62A 3IRSA 3G0SA 5I07A 2VOTA 3O07A 1D9EA 2D24A 1MZHA 3VKDA 1V6YA 3B9AA 2Y6ZA 2CLLA 1OJXA 1MQRA 3OODA 4M3PA 5ABHA 4IWWA 2CLPA 1A50A 1KRAC 2E67A 1NH6A 3R11A 1S2CA 3OZPA 4XV0A 3WKZA 4WGHA 1XJBA 4ZO6A 2JIEA 2ZRVA 3EB3A 3OHIA 4EPBC 3A9BA 2XN1A 2QDHA 2E40A 1DXIA 1ZBWA 4AZGA 3PP7A 5U7SA 4JX4A 3WK2A 2CHOA 3TFXA 2QAFA 5LXXA 3SCRA 3UG4A 3CASA 4ICCX 2Y7EA 1S5VA 4A4AA 2B4GA 2CWNA 6XIMA 1EGMA 3NQCA 2VCCA 4IL0A 1HXJA 3M0KA 3NTYA 3KDNA 3SIZA 4Q32A 1SO6A 5BXRA 1MUMA 1MXDA 3MVIA 1E3ZA 2ISSA 1A80A 1XIHA 3DXIA 4DIAA 3BCFA 1C7TA 2J9ZA 1FP9A 4DBEA 3V36A 1DIOA 4BQ5A 1LROA 1CDGA 1E6XM 2EG6A 5I3KA 3B8WA 2QCDB 5DRCA 3W2LA 4H9TA 1BTCA 4JTEA 3NPUA 4NJKA 3P84A 3PFRA 3D0CA 2YPIA 3INPA 5FF0A 3WD3A 1JYNA 1A5KC 2BODX 1OT2A 1W5PA 2WWCA 2VFDA 3KW3A 4QX4A 4DYKA 2PU0A 4GXMA 3USZA 1LQ0A 1A5OC 4V15A 1E0TA 2VO5A 2XWEA 7TAAA 3W7QA 3BLIA 4I5XA 2WHKA 4Y8FA 4ZL1A 1W56A 4L5ZA 2ABAA 3PTQA 4IP7A 3VGDA 3CWHA 4JHZA 2WMKA 2A5HA 2GGEA 4O28A 1EWEA 3ZYZA 4PTVA 4Q8MA 8XIMA 1ISZA 3MQTA 4JTAA 1EX5A 1PV8A 2YCJA 4DPPA 4YS1A 3OZOA 3PG8A 1TJ1A 2JQXA 4MJ4A 2Z29A 2Y24A 3IARA 3XISA 2DZWA 4Z42C 5E09A 1KFJA 5CSYA 1JXKA 2HSAA 4JKMA 5I00A 4IMDA 3DH7A 2I5QA 5D02A 3S2CA 1SU5A 4W7UA 4LBRA 4Z2KA 2FB3A 3QM3A 2C15A 3T0TA 3ONCA 5BROA 3VXGA 2DJXA 5B7YA 3W72A 4M56A 3NVTA 4XSMA 3U0HA 3F7JA 1XUZA 5HJXA 4K68A 2YW3A 5EPDA 3TTOA 5IFPA 2VURA 2E9MA 3HV8A 4UUIA 3K8MA 1ZP3A 1R3QA 3LZ3A 4P8XA 2QCLA 2GLKA 3BK0A 4UQAA 4JICA 3OBAA 1FWWA 3KL5A 3PF3A 3MHFA 3DBNA 2OLHA 3F5KA 3MJMA 4MNKA 2AGKA 4XB3A 3GVVA 1UD3A 4GI8A 1M7OA 3RRXA 5ABFB 3OLGA 3CUFA 5G1TA 2WHMA 3LCHA 2ZIDA 4QS6A 1EQPA 1S1RA 4AVNA 5GNYA 3DBPA 4BS0A 1PS9A 1H3GA 1QHZA 2YZ5A 3PUDA 1OFAA 3CZ8A 4MVAA 5FEXA 4GVHA 1GTEA 3DFQA 4PE8A 2QEZA 3U2EA 1JVNA 4D8ZA 4E38A 4DBSA 2W4XA 1Q5MA 1F3TA 3VD5A 1GOWA 3H2FA 2J66A 4FSAA 4IP4A 1E0XA 1PKMA 3PNZA 1R2TA 3AS1A 1S1PA 3IJQA 1TIMA 3G1SA 6XIAA 3PZMA 2OT1A 1EUNA 3B0VC 4ICMA 2GJPA 3H4GA 2QCEA 1UD4A 5LXEA 3BWWA 2HPMA 1TSIA 4UXDA 2FDSA 4JDYA 2MUCA 3EX4A 2YA2A 3DEQA 4PL1A 3HURA 3NDZA 1CECA 1E73M 2YCLA 1NSJA 3VU2A 1KRCC 3LYEA 1FCVA 1BYDA 1RBOB 2CYGA 4BR1A 2JEQA 1P1MA 6REQA 2NQJA 2NQLA 5D9NA 3PS7A 4EWND 1GYLA 4HA4A 2ZUNA 4Y96A 1BYAA 4ENLA 4WR3A 3EWZA 2HE5A 2D0FA 3Q65A 4B5WA 1GOMA 3EDFA 4HYVA 3WMLA 4GMEA 1V7AA 3CXOA 3MP4A 1J0HA 4WKAA 3WLSA 1UR0A 5B80A 2XZ7A 2BBFA 3BW2A 3A3WA 2BGSA 1GOOA 5IBXA 3EOOA 3UWQA 2ZVRA 2OZ0A 3RX3A 5C8BB 2DUXA 5CJNA 3VOJA 1IWPA 1F74A 2PD5A 5LSMA 1OZQA 1ZPTA 2YSWA 5GQBA 2XVPA 1GPWA 3B06A 3HOJA 3BLDA 1M04A 3VMNA 1YMYA 3W28A 1X38A 3TVAA 2PDKA 2OLAA 1I2QA 3CZEA 3FVMA 1Q3NA 1KC7A 1UASA 2J7BA 4K2SA 1MXSA 3LEPA 2G3JA 4C6NA 2A79A 1FWAC 5FL0A 1UMLA 5H91A 2D2OA 3WBYA 1WUEA 1XDMA 1QT1A 4NZJA 3SJNA 1GZ1A 3B03A 3LBOA 4B9ZA 5HA7A 4GVGA 3B8UA 4GACA 3VINA 2V82A 2V2HA 4C6KA 1JUEA 3REQA 3LBMA 4CQDA 5DANA 4OFCA 4JIPA 2XHYA 1QATA 3MI2A 4LY4A 1A0EA 1M9HA 1E4NA 4R7OA 3FY1A 1F8MA 1V6VA 5G2IA 2PPGA 1D8CA 2AQVA 1JCTA 4H4IA 2WMHA 2J4GA 4ZODA 9CGTA 3CPRA 4MY1A 5GJNA 3GVGA 3BSHA 4REQB 3UWVA 5DXXA 3WLNA 3W76A 3OZYA 4WOQA 4C6DA 1UZ4A 4AMCA 5GVJA 3UG8A 2NXIA 3EBVA 1DJGA 3LHUA 1MEIA 5M03A 5JMUA 3W37A 2QVNA 4LVDA 2UBPC 3A4XA 1E6QM 3R12A 1LQ2A 3M0MA 1POJA 1XBZA 4DNMA 4FMVA 3OQ8A 4LUJA 5CGMA 3W1PA 2PGRA 1VFOA 2XZ9A 3IGSA 2PDIA 1CX9A 4LY8A 1CW2A 3F4NA 2WSPA 3E5PA 5I06A 3TNBA 1LBMA 4GBDA 4TMBA 1VIWA 4GY1A 3AIUA 1SZNA 5FSEC 1QNPA 4D8AA 2P3ZA 2PEVA 3E0IA 4PEKA 4XZHA 1E4IA 1LM1A 2X30A 2XN0A 2DQWA 1SSGA 1IZCA 1RA0A 3AHTA 3OO2A 1XLHA 4AG0A 1PHWA 3QSTA 4OHQA 3VNJA 4JN8A 4XBSA 2V3FA 2J8GA 2BVTA 5H6HA 3ZR6A 3AXMA 4Y2WA 1TVLA 1B30A 4HZ6A 1PIFA 3W2NA 4IICA 4Q7BA 3R8HA 3LLFA 3TYAA 1F3EA 1SPQA 1OM0A 1ZZMA 3ARWA 4AHPA 4GIEA 2XFRA 3GWQA 2WV8A 3M46A 5A94A 2G37A 4AD5A 4XTIA 4YTRA 4J3XA 1T7LA 1W2PA 2Y70A 2J78A 5HPOA 2IQ0A 4HMDA 2QQ6A 4OOZA 3URQA 4JYFA 1CGUA 4AZ7A 2PUZA 1XP3A 1JCYA 3BG3A 3WH8A 1KGWA 2QPSA 1P7TB 3P5ZA 2G4JA 2FVKA 3A47A 1VBRA 1EGVA 3MPGA 4DWSA 1TWWA 4PMYA 4WSJA 2VXNA 3S47A 2J88A 5JVLA 5H8PA 4E2OA 4KWVA 2VEKA 2PMQA 5CPMA 1EH9A 2C1IA 2ZZ5A 4LANA 1HJVA 2WJZA 3F4DA 3M6YA 3W87A 3KL0A 4ONVA 3ABRA 2DZPA 1QNVA 1FCQA 1EF3A 3TAOA 5CSRA 2WQDA 4NAEA 3PAOA 2OU4A 3CWNA 1DBTA 4LW7A 4QIUA 3W7NA 4DJEC 1OIFA 1VZWA 3S8HA 3AWNA 3EA3A 2QV5A 3SCOA 4XUGA 4KBXA 5LGZA 1BWKA 1K3UA 3UG5A 2W91A 3L67A 4O53A 3WUFA 5G1MA 1D2KA 4IPJA 1IV8A 4W88A 4AIBA 3CQHA 1X39A 1XIBA 4MFEA 4F0MA 3DFHA 1RP9A 5U4NA 3NNTA 3PJUA 1A4LA 3NL2A 3W22A 2SFPA 1KXTA 1FWFC 5K3VA 4RDVA 3M0IA 3CQ0A 1BXNA 3MUXA 1CLXA 5BZAA 4EX4A 1QW8A 1DQUA 1PEZA 2FHFA 1JF5A 1FFQA 1OD8A 4B5XA 4OJYA 5CPOA 1JCXA 3YPIA 3E38A 3FN9A 5KZ6A 4QFUA 3N12A 3T9PA 4O13A 1X8CA 4JTSA 3A24A 4UIOA 5C2CA 4DUOA 3I65A 3KZPA 1UKSA 3N3TA 3VIMA 1RQEA 2O7SA 3DFYA 4IFOA 5BOOA 4PEEA 5AFDA 5A6AA 4XKYA 1W9BM 1A0DA 3NA8A 3UEQA 2CZFA 1EYEA 2W9MA 3P5YA 2WCAA 4GE8A 2E6FA 3H2AA 3VM7A 4JN6A 1GQIA 4NU7A 3NUKA 3P61A 3VDCA 2DFAA 1V3KA 1UWTA 2WC3A 3W23A 3ISIX 3TQKA 2VD8A 3M5YA 1QI2A 4RV3A 4Z1AA 2NVAA 4CNTA 1JGIA 1R46A 3LTYA 5GNXA 1US3A 4L6HA 1LBFA 2QGYA 4FOJA 4L9YA 2W0UA 3WLMA 4B9YA 5A6JA 3STEA 4J2PA 1TV4A 2OQHA 4V1XA 1EL3A 2FMOA 5D9OA 1Q6DA 3ES8A 3IJLA 1JZ8A 1W3HA 3NQ2A 3SW6A 4EANA 3W7LA 1OBAA 2Y89A 4D6GA 2ASHA 2V3GA 1JAKA 2E5CA 3IJ9A 4EAMA 1MW3A 4XAZA 1W1IE 3UWYA 1KRBC 3BANA 1YE4A 3VCRA 1DWHM 3P8JA 5A6LA 2FJUB 2ISFA 2WVVA 3W7HA 3WFZA 1ZS2A 3UVAA 5KINA 2R8WA 5FF3A 1JIBA 1JDCA 3B8TA 2OXNA 3OVQA 1W32A 2CBVA 1A47A 3O8AA 2Q8LA 1ZALA 3EMZA 1JI1A 3TONA 5FOOA 1WZAA 1W3JA 2QUVA 2RFGA 2EAWA 1FWGC 2Q09A 3AYTA 4D8LA 1E6NA 5A6BD 3PTKA 3WBEA 1QI3A 3UF9A 3CIVA 3R5EA 3POHA 4FXFA 5DO8A 1UB3A 5BMWA 4Z2GA 3HGSA 3ORWA 1P6WA 5C54A 4TMCA 2NX1A 3G18A 5I0DA 3HN3A 4YTSA 3FXGA 4QE5A 4K3ZA 2DZTA 4MG4A 1ZAIA 4H9VA 1F73A 1G5AA 5BYWA 1XFCA 1RAKA 5AYZA 5DELA 4CVWA 3MI3A 4IMEA 3TWAA 2WPBA 1W3LA 3RFAA 1XSIA 1AODA 2Q8ZA 1K7XA 2WLZA 2ZX9A 4PRTA 1RY0A 4C65A 4WGXA 4K1WA 4WJ8A 3GNPA 2X42A 4WDTA 3GNDA 3HPZA 2JF7A 2PDJA 4WHBA 3PB0A 3VE9A 2WAGA 3ERPA 5AHMA 3V5FA 3WDIA 1W0MA 2VYOA 1TTPA 1CBGA 2OWXA 1VR6A 3QPYA 3HBLA 2D22A 5M5DA 1K4HA 1ZAHA 1KBIA 1X1NA 2PZNA 4A3HA 2JE8A 5G2WA 1J96A 3WDQA 1KQYA 4ZFCA 1KKOA 2MANA 2E9BA 2W61A 3UCDA 1OFQA 1TO3A 3BZGA 3LMYA 3WENA 4AWUA 5BXSA 3WN6A 4JTIA 3F4WA 2FQIA 2HJPA 1E3XA 4NZ5A 3K5XA 1EA9C 3CUGA 1TR1A 3POCA 1ZJIA 2EJAA 3U4FA 4H9UA 1Q6OA 3W29A 1PHQA 4L65A 1K03A 1CIUA 3TYUA 2PB1A 1BTMA 3AIVA 3WNPA 1ME8A 5D2WA 1UC5A 2F8QA 3E49A 3WLHA 4H9MA 1RQBA 3MANA 3PBVA 3UJRA 4DXXA 2Z1SA 4PTXA 5HNNA 3FVDA 4HU4A 2YX0A 3G1YA 1Q6QA 3WUGA 5H2ZA 3BCJA 1O5RA 3FFSA 4HSHA 2Y7FA 3NFUA 4XZMX 4R9XA 4Z2IA 4RNJA 4CEUC 5IRPA 4OT7A 3AC0A 1EFZA 3WQ8A 1K70A 3RM9A 5AOUA 2J7CA 4XQ6A 4WX2A 3UCCA 3IGHX 3WNMA 3RR4A 3G1HA 3KOWA 3GDRA 3C52A 1A5NC 1TV2A 3DC8A 3QZ6A 1EB3A 1UUQA 3M0HA 8XIAA 4FB7A 3GC4A 4S3GA 4GFIA 4IQDA 1KGXA 4PMOA 5DF0A 3BLLA 2ZUSA 2W62A 4HSOA 3ITLA 3W7MA 4GGBA 3PZGA 3KOYA 3P80A 3WLPA 4GUGA 2ZYFA 3OLDA 4O1AA 2QMJA 1KA9F 1KCLA 3K4DA 4OQVA 1VEOA 2WWDA 4AF0B 1ME9A 3TJIA 3SCPA 1JYWA 2CZDA 4B5UA 4BQ2A 3E9AA 4XZLX 3VVGA 3ANUA 5K9DA 3BO9A 3U2CA 7ENLA 3UP8A 1I60A 1FWHC 4H9XA 4MKVA 6ENLA 2BHUA 2CHRA 2HS6A 2Y8UA 2GZXA 5A8NA 2PTYA 4NX5A 1ZU8A 4FPSA 1X8FA 2QF7A 1J5SA 3GU2A 2D1ZA 2TAAA 3GUGA 1DYSA 2YOCA 3K8LA 4NNAA 4WVXA 4F2UA 1OX4B 4LS0A 2ZVIA 3NCOA 1RY8A 4FHAA 3SN4A 3RHGA 4E8DA 1Y0EA 1Y5VA 3R13A 3Q37A 3SIMA 1XF0A 3L2MA 3PBGA 3NYDA 4F0KA 3RAOA 3P93A 5CZSA 3TYBA 1BVZA 2V3EA 4J3TA 1RXOB 3W01A 3EMQA 4ZO7A 2ZA2A 1V6UA 1GUVA 4N4QA 1JD7A 1S3TC 3PBMA 2VR2A 3C56A 5H8UA 3L68A 2R82A 3HU7A 4UOQA 3WBAA 3V4BA 4GC3A 1EZWA 4GZ7A 5AHNA 3RYSA 1TWSA 1RZMA 1D7KA 3CO8A 3G3MA 1W1VA 4MB4A 3KAOA 1YRRA 1DVJA 5AYIA 4FR1A 2R6OA 5I79A 3Q4DA 3L66A 2FZBA 5FF4A 1GK8A 1PBGA 4DHGA 4M81A 3C8NA 3WH9A 4DJDD 1GQLA 4EAYA 1TMHA 1SO4A 1E0UA 1B3XA 1E0WA 1J18A 3A3HA 4LXFA 4YTQA 3ZQ9A 1DWGM 3C0LA 5H1WA 3MHGA 4B92A 2HK0A 2WJFA 4A8LA 2BOFX 1G94A 2ALDA 1FWSA 5CBBA 4QJ4B 1F4AA 3HA1A 1RLDA 2HV5A 5F4SA 4LALA 1A5SA 1JD9A 5RUBA 4GK8A 1C8YA 3DN5A 3QPZA 3W3OA 3H4WA 5HJLA 1RBAA 1J2BA 4J9JA 1SW3A 3W25A 3WH5A 1M68A 4H00A 1V02E 1U33A 2VHLA 3PHAA 1N7KA 5BNKA 3TH6A 1AZ1A 1HO1A 3A5FA 2UY4A 1O5QA 4HCHA 4KEMA 5A2AA 1BKHA 3SN1A 4KH2A 4L6OA 1Q65A 4PL2A 2PE4A 1S2TA 1TMQA 3DERA 2VQTA 3CIXA 3PJWA 5D30A 2XIIA 3A4WA 3MUAA 1VRDA 3LV6A 4IPNB 2DZXA 3LCGA 3WMBA 4B4HA 4GKTA 4GQRA 4X3ZA 3H8AA 2HDJA 2R1KA 1I4NA 1ZQ5A 3T07A 4C5ZA 5EB8A 1A49A 2PWGA 4AIUA 3NOYA 2P5NA 4YHGA 3O0FA 1IEVA 1HF6A 3VIGA 4CQ8A 1ZGDA 1R3WA 1Y8BA 2DGAA 1XS2A 1W1A1 4IF2A 1YXDA 2E8YA 3B97A 4OUEA 8CGTA 1GVQA 3LENA 3OA5A 4L56A 1XISA 2VD9A 3O6YX 4FNQA 2F84A 2AMGA 4RE3A 1W5OA 3RM8A 4FF5A 5M3WA 4IPLA 3L9CA 4PBEA 3BAKA 4ZQNA 3RILA 1L9WA 5HDRA 3T0CA 4DM2A 1JXJA 4EPEC 1PX8A 3AXKA 3ARPA 3TFCA 1LOQA 4LTSA 1H50A 1SQ7A 3NURA 3VAVA 1SZEA 3MV01 5REQB 2CEQA 1QPNA 4UOZA 1JYXA 1GT8A 3WQGA 3CL7A 3O1NA 2VEIA 1XLCA 3PWGA 3WLKX 3VOGA 1YBQB 1V0NA 8TIMA 4JAWA 3EAUA 5HJYA 1XIGA 1KTNA 1Z9AA 3TV8A 2A0NA 4HOXA 1NF0A 1K77A 3G0UA 4QM1A 2E09A 3S2MA 4LRTA 1ZJBA 4LEQA 1KFCA 4U5IA 4I5UA 4XZNX 1K1DA 1GCYA 2X40A 4GY7A 3NDYA 2IW0A 1LRNA 1F07A 1H0IA 4B3LA 3N2BA 2ACRA 2ZOXA 3URNA 4QBXA 3NGJA 4NG3A 1U1JA 2QJIA 1R87A 3B8SA 4GI9A 1LTDA 4YYFA 1OG6A 1AW5A 4DO5A 5JIPA 4K7YA 4H7ZA 2WHLA 3H12A 2Y88A 3SI9A 5LNWA 2QDGA 3AOFA 3GH5A 4ATWA 2FJKA 2IXUA 4NXSA 1FWNA 5D37A 5EKYA 2ZA3A 3GXFA 1GJUA 5LYRA 1OC5A 4OTKA 3COTA 4IMGA 1V8EA 1IYXA 3U5YA 2CFFA 2PP0A 3WQVA 3HQNA 3TDFA 1XKJA 3EX6A 2H90A 5FJJA 3MSDA 1QPOA 1EP3A 3AWOA 4Q4QA 1Q6LA 5DT5A 3L65A 4E2DA 1H60A 3PB2A 4HHLA 3K1GA 4UB9A 4HK5A 3NL5A 1AD4A 3TTEA 3QQ0A 5K4XA 2VDHA 4FNUA 1JQVA 1XYLA 3NZQA 3AMKA 1I2RA 4JQ3A 4XK2A 2IUZA 4QCEA 1SZGA 4P7QA 2NVDA 3IJDA 2YB4A 1FX6A 2R24A 4CNOA 2BP1A 1FCUA 4FALA 4O11A 3RLHA 2VI0A 2HBVA 1AH4A 1REQA 3W70A 3GFZA 4QXIA 1LORA 5D09A 1YXYA 3GW0A 1BF2A 4MPQA 2E1DA 1U5JA 2ZX8A 2WKGA 4PN2A 2OO6A 2PDHA 3R0KA 5BU6A 3MDUA 3K8KA 5KSWA 5I23A 2GK1B 3CAVA 3ELFA 3MZNA 5AC8A 1V3HA 1JPKA 3TYZA 3H4XA 4D2JA 4HNNA 5EMJA 1I1XA 1XPYA 4XUYA 2GGHA 1TVNA 5FKYA 3AS0A 1C92A 4PUJA 5FEZA 5FACA 4C90A 2F61A 3M16A 2ACSA 5ENLA 2WW5A 3KTSA 3MSYA 3NGFA 4DPQA 1EJWC 3AS3A 4Q6JA 2O4QA 4MPKA 1DQWA 4O8AA 5TNVA 3P7YA 4FX8A 3IRDA 4U3AA 1KGUA 3GR4A 2I14A 1YLVA 2BVDA 4D6JA 3R43A 3UGRA 4JTGA 1NY1A 1O60A 2VGBA 2XIMA 4D72A 3NIYA 2Z6JA 3A21A 3RJYA 1Z69A 2VELA 3BV7A 4U33A 4TV5A 2EPMX 3NPVA 1HGYA 3WK0A 4XISA 1F3XA 1HKMA 4V33A 1GVRA 4MGGA 3N9RA 3VIPA 4AZCB 3GHTA 3R4IA 1D3GA 5ABTA 3BC9A 1X97A 4JNZA 1CENA 3T40A 2DT3A 1ADOA 2ZZ7A 2VEGA 3ARTA 2PTXA 2PTDA 1QPQA 4UFMA 5JQ9A 3M5ZA 2AMXA 2FTPA 3G1AA 1WZLA 2FZMA 3WY1A 1ZFJA 2OKTA 5E93A 3APYA 3SCVA 4L1GA 2DT1A 3LNMA 4Q4KA 2BX7A 1PYFA 3RUBL 1B3YA 4RDYA 2YA0A 1U5VA 4DZ5A 3CT2A 2IPFA 3R89A 4BEUA 1G9HA 1XDJA 4JPGA 1H51A 4QLJA 5G4EA 1HL8A 1L6YA 2ZTJA 3JR2A 5AB3A 4GIYA 3I7QA 3NQDA 1IZJA 2I16A 3P74A 3MW7A 1MRAA 4ALDA 4WJXA 3A23A 1Q45A 1RH9A 2QUNA 4DI8A 4OBRA 3TW6A 3ABXA 1V0LA 1W9DM 3FYYA 1V79A 2ZXDA 4PRWA 1RALA 1Q7MA 4E3VA 4W93A 2VUYA 2Z26A 4PA8A 4HU0A 2KZHA 4TVUA 3JZEA 3H6OA 4JEQA 1VJIA 4UFJA 4LNCA 3GDLA 4JTRA 3WQFA 2W79A 1KTBA 3O63A 1EC9A 3QHNA 4NNCA 5CZTA 4ZSTA 1BF6A 3W2MA 1J5TA 2A6LA 1IXNA 3TA9A 1X96A 4WQ6A 1SR0A 1JCLA 3N6QA 2YBVA 1W5QA 2QNEA 3LHWA 4B5NA 4DVOA 2FGBA 3AMDA 1YNQA 3I4KA 1EC8A 4FOKA 4IMCA 1XW8A 5LIXX 3K13A 2GVJA 5T9CE 2PA6A 3LCFA 1PTDA 1JI2A 4P61A 2E25A 3BJFA 4ZOAA 1J79A 4JQAA 4XKYB 1XLJA 2BGNE 3TR9A 4O1BA 5FAGA 4GABA 2QULA 1CLVA 3MC5A 4O15A 2H8ZA 3WF0A 4NZ4A 2OG9A 1M53A 3O9NA 1TYGA 4XD3A 3MJYA 4NQ1A 5CC6A 2VC6A 2XPKA 4QS5A 4KERA 1VYPX 4RX0A 2P0OA 4P5UA 1YQ2A 4KFOA 4J35A 4HK6A 3BJTA 3SADA 3PR2A 3L0NA 1OSEA 1QVBA 1QTWA 4B2DD 1Q6CA 3N9SA 3VC6A 1JULA 2BXYA 1PDZA 3BH4A 5LIKX 1O68A 2Y7DA 3WMSA 4IMFA 3KTXA 1GQKA 1P5BA 5JXQA 2FHBA 1XI3A 4CN6A 5XIMA 1EEXA 4R53A 5E0CA 3EWUA 3TOPA 1H63A 1GYMA 1TRDA 4Z1DA 2BXZA 4DYEA 3TSDA 3EWDA 3DI0A 3OPSA 2F6XA 1I45A 4LVGA 1XCXA 4S3EA 2TYSA 1C3FA 4PR4A 3H23A 4XZ9A 4MJ2A 4GNVA 4LWWA 3S9ZA 3RR1A 1DJZA 3QC0A 3CMFA 1B4KA 4G56A 5EBAA 3FKRA 5CG7A 2P3EA 3R8GA 3N2CA 2PDFA 4HCDA 1W3NA 1VJSA 1KXQA 1N8WA 1V93A 1TJ0A 3SQSA 1YDNA 1US0A 1UA7A 1ZBKA 3BAWA 4HB7A 3QGAC 1UWRA 3RO6A 4GZIA 2VFEA 4S3BA 1OCNA 3ZFHA 4MJMA 1KM1A 3P6LA 1J0ZA 3BARA 4UCGA 2GK1A 2VZTA 1UH4A 4JFSA 2Z2AA 3R0UA 1EIXA 3T4WA 4JFUA 4MZ8A 2V5BA 1UR2A 2J9XA 5TF0A 3M0YA 3VABA 1B1YA 3C6CA 4PUWA 1NF7A 2BTMA 4CQBA 1L8PA 4LSBA 1I8JA 1UR8A 1XLKA 4IMAA 4C5YA 5FCZA 2OR2A 4A2RA 4BA0A 4H83A 2ZRXA 2E0PA 3DI1A 3ZVHB 3MBFA 4JFTA 3QF0A 3L7RA 2PWHA 3WEZA 3WIJA 4IOTA 3R7MA 1ALDA 3BAYA 1I75A 1R9XA 3LM3A 3OP2A 4UMBA 3HQ1A 3NZGA 1QCWA 3VKJA 3QZEA 2QPXA 2V67A 1YDYA 1ZP4A 5G4HC 1FFRA 3GE7A 5D2XA 1MO0A 4F0RA 3PZUA 4IJBA 2VTFA 1S2AA 4NRRA 5HWMA 4MY9A 1U1HA 1DJWA 4JEJA 4AB4A 3WLRA 3S2NA 3HTWA 5E9XA 4HPXA 1MDRA 2ZRZA 3TMQA 3NXFA 1SM9A 3BW3A 4A29A 5C71A 1QOXA 4L9XA 4J3SA 3E0WA 2ODOA 1T41A 2TMDA 5ABFA 7REQA 1G4SA 4O17A 1BWVA 3VMOA 2WLYA 3USBA 2NV9A 1QASA 3W7PA 4CN4A 2QKFA 2FPYA 4H7CA 1TX2A 4BCEA 1Z42A 4LEFA 3RX4A 3BTNA 3ZJ8A 1E6RA 2D0GA 1B3ZA 1XH1A 3DENA 1VPYA 1BRLA 4YU1A 2Y62A 2QV4A 5A2BA 3NO3A 4NZ3A 1SO3A 4IQLA 4G7EB 2FVLA 1P0EA 1QBBA 1SO5A 2H9AA 1NDVA 3OBEA 3UWEA 4M6UA 2Z28A 2P8BA 4W8BA 3IIXA 3P0WA 2WMIA 5ABGA 2C14A 5C9ZA 1PO9A 3HB9A 1WCGA 1XRTA 4Q8OA 3BCDA 3HM7A 3SRDA 4HYWA 1XLAA 2QUMA 3CGTA 3EA1A 4AXNA 1E9LA 3W74A 3I10A 1MQQA 2Y5EA 3M9YA 3E0LA 2PDBA 5B7ZA 2AKZA 2J9YA 2BXVA 1K7EA 9XIMA 4QSFA 4J3ZA 4F40A 2ACUA 3REQB 2WZHA 4AC7C 2VM8A 3VFLA 1SUXA 4LUYA 2VC7A 1TE1A 1IEWA 5T8GA 2R1MA 1KFEA 3LCWA 3GG8A 1DOSA 3RU8X 3OLEA 3IJ7A 2CLHA 4C1NB 4A8NA 2RDUA 1JZ2A 2E28A 4DYJA 3WD4A 3MDWA 1J2WA 1VEPA 3ZM8A 1NOUA 4ORIA 3AUOA 3WYZA 2JKPA 2WCGA 1DJYA 3LERA 3LM7A 3SB0A 4H7VA 4UTTC 1G4EA 3LCIA 3KRSA 4M8UA 3UZWA 3GXNA 5DCEA 3GTXA 3O15A 2W92A 1CEOA 3OW1A 5A8GA 1Z32X 3QMTA 2VEMA 4KEZA 2CHNA 4U28A 3QV9A 3WSUA 4LCRA 1FP8A 1AL7A 1NDZA 2C6QA 1AVAA 1XHGA 4Q22A 5AHLA 2BY3A 2ZRUA 4NF7A 1LYXA 1HP5A 2PDLA 2FKPA 2XFFA 1DWAM 1LL4A 4FO4A 3I4EA 4Z2LA 5BOFA 3STCA 1B9ZA 3KVJA 3F1QA 5KETA 2ATMA 3RGTA 4DJFC 3OG3A 3UETA 4ZO9A 2WSKA 2VWTA 5AHIA 1NWRA 2QW5A 3TZNA 1G4TA 2O9OA 3KOZA 3AMCA 3M44A 4YXGA 5CLWA 1AQHA 4JYDA 1P7TA 4ZFMA 4ZTXA 2DT0A 3G6LA 2VZOA 5C9XA 3TE9A 3FNDA 1WDDA 3FSTA 2CZVA 4M6VA 1ML1A 3VUSA 3A12A 1L8NA 2PLJA 1ICPA 4JR5A 1IXOA 3DAQA 4W7WA 4WUIA 1F76A 4CD6A 4POCA 1CGYA 3QH2A 1DJIA 1EC7A 3ZWSA 4C6LA 4RK8A 1H41A 1Z8AA 4RPPA 2VENA 4CU7A 3MY9A 4M7TA 3KX6A 4M1BA 3B0UX 4C6FA 2A21A 4QP0A 5K9CA 3CV2A 3B4UA 3AYSA 4JDBA 3LD5A 3HPFA 3HZ3A 4Q8QA 2QYGA 3QKEA 4UFIA 5EFDA 3FHAA 1ECQA 4GISA 2G3IA 4JTTA 5HR6A 3LU2A 1EDGA 5FJPA 4ZR8A 1BLIA 1R0MA 3TUUA 7REQB 1L6SA 2P10A 3WD2A 4GKLA 1BYCA 3NSXA 4LAOA 5CPQA 4DO7A 3GIQA 1OVDA 4S3CA 3DZ1A 1IQ8A 3H21A 1CGWA 4W9TA 1N8FA 2FZ8A 4QLKA 1Y65A 2V5CA 3ZLGA 1VLWA 3J7HA 4PB5A 3CUIA 2V5LA 4ZCWA 3TK7A 4NIRA 4LAKA 1GG0A 3CAWA 1EDQA 4HPJA 1SW0A 1S2UA 3G24A 2PF8A 5A6KA 1AJ2A 1AQ0A 2NWRA 2GWGA 3P8IA 4US5D 2X7WA 3UZJA 1JGMA 2P0IA 2WZIA 1UBPC 1GVYA 2VDIA 4ACZB 1MW2A 1MI3A 3C2FA 3IIVA 3GNOA 1LLOA 3ARZA 2WZTA 2PGWA 5FAJA 4TIMA 1DIDA 4IL2A 2BS9A 1KCZA 4HZ7A 1G6CA 4NHVA 2WANA 2F2KA 1UQZA 2C7FA 4M1RA 3W6LA 4LGXA 4JTJA 5FD0A 4PH6A 4BK9A 5ECUA 4WK9A 2J75A 3U4AA 4B91A 3VNDA 3QXBA 5AYYA 1M41A 1TX0A 3FAXA 3HFYA 3L4YA 2ZUTA 1RV8A 2VWSA 4DZHA 1W91A 2Y8KA 1OX4A 3SY1A 5IXEA 3GRIA 4QJ1A 2H9AB 1KCXA 1GKQA 5K2ZA 1B5TA 4F9DA 3KWXA 3LQLA 1ZAJA 3MT1A 3L23A 1E5NA 3EOEA 2NT1A 5HQEA 4BFAA 1UC4A 3WLJA 1OHLA 3EZ4A 1EP1A 4HPHA 1TR9A 4KESA 4P8UA 4DWDA 5JBFA 2WO5A 4O19A 4KRTA 5F4XA 1YX1A 2V5JA 4FIQA 2F9RA 4E2VA 3IJ8A 1TPH1 4GYJA 4QG6A 1J0YA 3WNKA 1LCOA 3SGUA 1UWUA 2PC4A 1FUYA 3WDJA 3WF2A 1JEZA 4G1NA 2OZ3A 3QY8A 5D8WA 4OV9A 2JKEA 2E1WA 2NW0A 1JPIA 3UZYA 2OEJA 1E4MM 3V35A 2QZRA 1T40A 2CBJA 4QG8A 5D2YA 3ICJA 4O14A 2PDPA 1CLKA 3EKGA 4NT0A 5FESA 5KTLA 3WLOA 1JNDA 1T99A 1MVYA 4UQBA 1FHVA 1NARA 1QUMA 4TX9A 3MA8A 3HJZA 1VEMA 3U2OA 4WZHA 4UCFA 2ZX5A 2YCEA 1VFFA 1J8VA 3N14A 3BV4A 5LA0A 2YLAA 1JDDA 4ZEPA 1RHCA 1IE7C 3AQUA 1JZ7A 1XIDA 5HAOA 4CU8A 5BWAA 5BWFA 1MSSA 3BPWA 2ZE0A 3TKFA 2JGQA 1W8GA 4RZ4A 2Z27A 5AHEA 1PTGA 3CWOX 5H8MA 2A1YA 2QDDA 3ZS4A 1O4UA 1V0KA 2B7QA 5D05A 2DW7A 2VZUA 2YL9A 2P1FA 4GO9A 2EBNA 3FEQA 4A6GA 4D71A 1EA0A 2RUSA 3O05A 1VBGA 1KM3A 4MM1A 3AJXA 4L64A 1XSJA 2I5GA 2C0HA 4LVAA 5LNUA 4O4VA 1VCGA 4H04A 4PC8A 4KWOA 1C93A 4NZ1A 1S46A 3MS8A 2VCBA 3N13A 1C90A 4AEFA 2PTWA 4YNGA 2GQ9A 2GJXA 4DAIA 1QBAA 2CCRA 3T78A 3E96A 1W3KA 2A2IA 3G3DA 1AJ0A 4TUFA 4AX6A 2VQUA 1YADA 5I3JA 2NQ5A 4D6IA 3ARXA 1OGSA 3THAA 3N9KA 3HMJG 2DSZA 3L0GA 4E0CA 3LTPA 5D2TA 1P6CA 3MYOA 1YYAA 4MB3A 5PTDA 4OIFA 1JZ3A 1TE6A 4IPPA 1LG2A 2OJPA 4H2CA 3CHFA 3BL3A 3EWYA 1EHNA 1NELA 3CEUA 3W26A 4GGHA 2Z1BA 4IIEA 3KUMA 1MFUA 1F6KA 4K38A 3M47A 4FF7A 2DPEA 4W8AA 4BJHA 4ZQPA 5I3HA 4F4RA 4N9BA 3NG3A 4ZOEA 1H4PA 1BKSA 2CITA 3NL3A 2PGFA 3JZUA 4N0RA 1PKYA 3DG6A 1R3RA 2BB0A 3BJSA 3HMCA 3T0AA 4QCFA 5CJMA 2OSXA 3KBMA 2PWEA 4O1EA 1RSCA 2W5FA 6PTDA 3N2OA 5T91A 1Z3NA 4LUSA 1M65A 2CXEA 4OU1A 4R3UA 2XYLA 1VKFA 5DY2A 1H5VA 2AOSA 1GONA 1NFGA 3P14A 4V2XA 3VNMA 3MUIA 4Q7NA 3CBWA 3KWSA 1B54A 3AFBA 4EKJA 1GZGA 3DFTA 3WDRA 1BQCA 1V3IA 1YBQA 1B3OA 3BE7A 3EX2A 3STPA 3IVTA 3WEMA 3IK4A 4IXXA 4KIRA 4DI9A 1PDYA 5EBUA 2WNZA 2Y2WA 4HTYA 3T05A 1TV3A 2GL5A 2PD9A 2NXHA 3FDKA 4UTWA 4LBUA 2FTYA 5HWJA 1WDPA 1KFKA 4LAUA 1K9FA 1OX6A 5J5RA 4Z1BA 1G0CA 2G95A 4YL2A 3CL8A 1GVEA 3LGEA 3CU2A 3LXBA 4M80A 5A6TC 1AMKA 3SCQA 1JRCA 3F2DA 4XVEA 4A2SA 4AVOA 4GYFA 3BMVA 3VGHA 5EMYA 4YPJA 1QOPA 1GTHA 2INZA 4UR9A 5FJTA 3CNYA 3TROA 1H7OA 4D9PA 4JIRA 4B4FA 4J27A 1R2RA 2H3DA 1M7XA 4IFRA 4AF0A 4ZXOA 1XLGA 3SAZA 1DORA 3PN8A 2ON3A 3UW6A 3A13A 3M5XA 1UBSA 3VNIA 3T6CA 1TJRA 3R8RA 1B57A 1VFLA 1XUUA 1LL7A 2HCVA 3EDDA 4KFNA 4IM4A 5E1QA 5C9WA 3WQ4A 5AC7A 1ZUAX 3N04A 4ZE5A 3DYPA 5GNZA 1H1NA 3AALA 4L61A 4QGCA 4HU3A 4KIEA 4S3AA 5EMLA 4B3KA 4N2YA 4E4FA 3QW3A 2D2GA 4LB4A 1GOXA 3MSRA 1PZ3A 1ZL1A 4NP7A 2P8CA 3GUWA 4UTHA 4PCNA 4S3KA 3HJEA 3GC2A 4QAIA 1D7FA 4ES4A 1R30A 3EMCA 2A4AA 4DLFA 1W9UA 3SECA 4AVFA 3M1ZA 4DF2A 4MF4A 1KLYA 4XAYA 3TN6A 2R94A 3RCYA 1ISYA 3UXDA 4NRSA 3DG3A 1J0KA 1XBYA 3UJ2A 1H61A 4C7DA 2RAGA 3VD7A 3PZQA 3OGVA 3E2QA 2EPKX 4B5VA 2GVGA 1PIGA 3NSMA 4I90A 4EVZA 1G01A 3DFPA 4HK7A 1H62A 4U2YA 1XQLA 4DM1A 1UD8A 3LS9A 3II1A 1KB3A 3QLLA 3U5UA 3I6TA 1XBVA 2DZUA 3CUXA 4AZ6A 1V3LA 1TZ7A 3E6EA 4C7GA 2YL6A 4F48A 3L4ZA 1FDYA 2V63A 3W1MA 2B0MA 5CBIA 1SMDA 1J4EA 5I03A 3MB9A 1TPB1 1W37A 4A3RA 1WYIA 3W7RA 4Y9OA 4NVTA 5J5DA 1MUWA 3C86A 4DJFD 4PYSA 4PULA 1XIMA 3ZOAA 1PVNA 5CJ5A 2AAAA 3ZT6A 3WD0A 4DZAA 3U57A 1RJQA 7CGTA 1KNWA 1RCXB 2RDXA 1T96A 7ODCA 4HIBA 4PCTA 4UQDA 3VOIA 3W7GA 1W31A 1A5CA 4GYKA 1VF8A 1FH9A 3LPGA 1TREA 5TBOA 3BOXA 5L9FA 4JY8A 3V0SA 1EJXC 5CPSA 4K8EA 3M7WA 2WZEA 2PDMA 1OZMA 3VOHA 4U31A 4FS9A 4DZIA 4GOAA 3VM5A 3TYEA 2GOKA 5HMFA 1XDLA 1KM5A 1R9ZA 3C2YA 3S0CA 2ZKMX 5I24A 2X1UA 3UWUA 1HN1A 4PFHA 3B8DA 1MW1A 1E6ZA 3N34A 3W24A 3V3WA 4HNTA 3DYMA 1QW7A 1O7AA 4GRSA 1V0MA 3NQVA 5HK4A 4WSHA 3OG2A 4DJEA 3SRFA 1OFRA 1A5AA 2D69A 3DIPA 2Q02A 1VENA 4IUOA 2AKMA 2XFYA 4Z08A 1KR0A 2ZXAA 4R85A 3GIPA 3HGRA 2X1IA 3IJIA 3GYEA 3T2QA 1YXCA 4XX6A 4R9OA 3PBUA 1WBJA 3KDOA 3L4XA 4OKDA 5D9MA 1OCJA 5AVHA 2REQB 3TLQA 2Z1XA 3VOFA 2XGIA 4D6EA 1E1CB 1HW6A 1DTUA 3WQWA 4S23A 1EJRC 2ZCGA 4P7OA 1PAMA 5A2CA 1PCWA 5DCDA 7TIMA 4WD0A 1AFSA 1L6WA 4KRUA 4O0QA 4CD7A 2PDCA 2EPLX 3EPOA 4HMCA 3TX9A 3W7JA 4XO6A 2PS2A 3QLDA 3S1VA 3S1XA 1VPQA 1UYQA 3EX3A 3FW6A 1XLEA 4YVPA 4JXCA 4LUTA 4NI3A 4DUXA 3OGRA 2VVSA 5M17A 1XFBA 4UTIA 4XIMA 1HP4A 2GOUA 1C91A 3IIPA 2GWNA 5LA1A 1TPWA 2OVLA 4ERIA 3MMUA 3H2EA 2HE8A 3LHVA 3O6CA 2W63A 2Q71A 3WMCA 2V81A 3W53A 3R2GA 3F03K 3CTTA 4WEVX 4LF2A 3OZMA 4DY1A 1KFBA 3VGFA 1JDFA 3KCJA 2OPJA 1ELSA 5ECVA 3Q45A 3RIKA 1AQMA 4F79A 4JYEA 5BCAA 3U6WA 2GQ3A 2QVHA 3BVJA 4OUIA 3PPFA 4GYPA 3L5AA 4Q8WA 4JIEA 1V6XA 4ZMGA 2CXGA 2XIOA 4GQ0A 3TAKA 4ZB5A 4FLOA 4MTVA 3W86A 3F2BA 3S42A 2HS8A 4F9JA 2NUXA 2OCZA 3CV7A 1QR7A 3O16A 2F7FA 2QIIA 4UOJA 3D46A 1VP5A 1OB0A 2OEKA 2QCMA 1OYCA 2F6KA 2HTMA 4JTFA 3WJWA 2VGGA 3NZRA 2G3NA 1DXFA 1W5NA 3T4CA 1VAHA 3A4AA 4X2PA 1BXBA 4CN1A 5C2GA 2FHCA 2BVWA 3QYSA 1HTIA 3KVMA 3ZJKA 1Q2RA 4LV9A 3HG3A 5E5CA 3NQ6A 5ABEA 4XAGA 1W54A 2XWDA 1ADSA 5FJUA 4GCAA 1TCDA 3NQGA 3B9OA 4NASA 3DYOA 4AYGA 1K8YA 5LNVA 2WJEA 2WNWA 3MV11 3P2VA 4DF1A 4OBTA 4AW7A 2WVVB 1ZENA 1H09A 2CBUA 3V5CA 4NYYA 3DHUA 4JX6A 3BAIA 3GR7A 4AH7A 3G8RA 1B90A 1QJWA 1X1ZA 3VDGA 3H24A 5CC7A 4IP5A 1WNOA 3MUCA 2OX1A 2OGYA 3HGOA 3NPWA 1ITUA 3E02A 2NT0A 4KF1A 1VPXA 1WX0A 3E2SA 3M41A 3W82A 3UZ5A 4O1DA 2PP3A 4G5DA 1W3TA 2YLLA 3URBA 1F3WA 4MAZA 2IPWA 3E5BA 4GCXA 4MLRA 3GDBA 2DSVA 1DE5A 1KBBA 4DBWA 4JGDA 2ZA1A 3FLUA 1R3SA 2ZC1A 3DC0A 1UD5A 3MKKA 2EKGA 1CNVA 1TPDA 2PDWA 4HHHA 2FVMA 3W1AA 1OC7A 4W4QA 3SGZA 3AIRA 1UUMA 4LVFA 5JH2A 3VIOA 1A4MA 2FB2A 5IBXC 5HXMA 3DFSA 4B16A 4Q4RA 4ADSA 1QO5A 1H49A 4ATDA 1KTCA 3FSUA 4JTQA 1DP0A 4FIRA 3A22A 2XVGA 4KQNA 4IIGA 4HJWA 2B7OA 1UIOA 2NLIA 4M6QA 2GJNA 4C7FA 1SMAA 5E0FA 2GFTA 4PCPA 3NQBA 2Z6IA 1GHSA 1Q4WA 3CAQA 2A7PA 5A8PA 3B0PA 5CAHA 1LT7A 3MSGA 3WF1A 2EF9A 3B9NA 1V51A 3MO7A 4MMWA 3VKCA 9RUBA 2L5HA 1KXVA 1POKA 3DCPA 3TJXA 3VGGA 4FEZA 4G8TA 4JFWA 3W1NA 3UWWA 3T44A 3SCWA 3CJPA 2ADAA 3W85A 3VE7A 1JPHA 4BQ4A 1OWQA 3QTGA 3NZ1A 5JBEA 4UFHA 4Q3MA 3PJTA 3PZIA 1KM6A 4GUIA 4EE9A 2VEFA 1EO5A 4YYCA 3B04A 1UMYA 4QQUA 4HZMA 6ALDA 1HIZA 3BSGA 4X9SA 4Y9AA 1VC4A 3W7OA 3QPEA 3GVQA 1SYTA 2IKGA 3W6MA 1SFTA 5HANA 1NP2A 4LRSA 3LTSA 3N11A 3TNOA 4DLMA 2VX6A 4C6OA 1IZKA 1UP0A 1U83A 4LT9A 4UR7A 4UZUA 3AHVA 3VNKA 5A3HA 1LF1A 3R58A 4IG2A 1PIIA 4IGMA 3CHVA 3FOKA 4JN7A 2CLIA 4MUZA 5C7HA 3T1GA 1QPRA 4H41A 1X6NA 3T42A 1GVSA 1HL9A 2YDSA 1FCBA 3HQOA 4XD6A 1UR4A 4H8UA 1F7BA 2WYSA 1IEIA 4RXGA 3QV8A 3GO2A 3W7EA 1KWGA 5JU6A 3BG5A 1MNSA 3Q2DA 1J0IA 4LV4A 1FDJA 3UWZA 2Z00A 3FGCA 1NFBA 1D3CA 3BMXA 3KVKA 3CC1A 4CEXC 1LZOA 5CC5A 1JAEA 5K4ZA 4TU1A 3PY2A 1Y5XA 1XICA 1W2VA 2RH9A 1BG4A 1G7UA 4LS1A 2FGZA 1Z7AA 4PMZA 3SUUA 1J11A 1QW9A 4X0VA 3W9ZA 3AHXA 2GGGA 4JQ1A 1UD2A 3VTRA 3NSNA 4AY8A 4ACYA 1MFVA 4OZOA 3MZ2A 4KGLA 1L6FA 2QMKA 1WDSA 2B31A 3H2CA 1QI5A 1PKLA 3LHTA 3C2VA 4GUHA 2GQ8A 3AI0A 4D6HA 1ITQA 2DZSA 4X61A 1UOKA 1G1YA 4TQTA 5CPLA 1VFSA 2J7FA 1MRQA 4MHBA 3OBKA 2YYTA 3C4UA 7XIMA 3S3GA 3OTRA 4PUUA 2D2JA 3MMDA 4L1XA 3C3UA 2FPTA 3E74A 1ADDA 1C29A 3SZ8A 3KZSA 2X41A 4H19A 1Q8AA 3K4AA 1TV8A 2POTA 3NAVA 3ZVIA 5CSUA 1E9IA 5LA2A 3UVIA 2HQAA 4KW2A 4CCDA 3ARSA 1MEHA 3KP1A 3T81A 2OYKA 2C1HA 4C6EA 1MQPA 5FJIA 3WK3A 4LC6A 4WDUA 1DHKA 3GXMA 2FMNA 1K9EA 3DX5A 2FPVA 1DJNA 3EPNA 2OODA 2QLYA 3SUWA 3GX9A 5C70A 4AD3A 3WUBA 1EGZA 3VIJA 3VUPA 3ONBA 4L6DA 1OADA 3L4WA 2HPIA 2QAPA 3GXDA 4BHYA 1CXKA 2HRWA 1P6BA 3OVGA 5KITA 2GUYA 1JJKA 4RL3A 5AECA 3LMZA 2PRMA 3QC3A 4QNWA 1W6TA 3VI2A 3LOTA 2XTKA 4KFPA 3LX9A 3SSZA 1UPPA 1GYNA 1FA2A 2FGLA 1KR1A 2RGMA 2C1GA 3LA4A 1B3VA 3S9YA 1E51A 4A3UA 2OZ8A 1LDCA 1NWTA 2CETA 5HPCA 1F6PA 3PTDA 4MUPA 4PMQA 4UQCA 4MZ1A 1HVXA 2BNJA 4O0ZA 1PZ2A 1XYMA 4JY9A 5LHEA 3PJXA 3IAQA 5A8MA 3LHZA 1WXYA 3CHEA 4J7RA 1TV5A 4PODA 4QDWA 2OWWA 3SGGA 1IGWA 2C79A 5C0QA 2DORA 2V5KA 1V4YA 3RMEA 2PC8A 1TTIA 3JS3A 3A6OA 3W1RA 3IIZA 2IMRA 3KRBA 1PZ1A 4ZA0A 2GVYA 3TW7A 3QW4B 3OIXA 3BGAA 3GS6A 3APTA 3P82A 5AYXA 4NNBA 4O52A 3IJ6A 3UPMA 2Z7GA 4GQQA 3NPXA 3VNLA 4RV8A 4QJ5B 4DWSB 1O66A 5BOEA 1EJTC 1HJQA 1FWCC 3TEVA 2HVMA 1S38A 4UBPC 4XIAA 4JIQA 1EKOA 4I7VA 2OMAA 4JTUA 1VYRA 3PVFA 2Z24A 2J79A 1YEYA 1A3WA 5IFTA 5MF5A 1O5XA 2FZDA 4C60A 5DX7A 3SFWA 3VDBA 4ZXLA 4YN5A 1TQJA 1XD1A 3D3FA 1F8IA 1HQTA 3IPWA 2D23A 3WBWA 3HV9A 4PSRA 3G1VA 5HULA 4A21A 2BV9A 3GBEA 1Q7ZA 3S5YA 1V03A 2DVUA 4I3GA 3QSRA 1MMFA 4EPDC 1UROA 5A8OA 3LRKA 3EEZA 4HSNA 4DJED 1B0IA 1EIBA 1RCOB 3ZO9A 3JRKA 2PODA 3N25A 2GVEA 3NDOA 4AZIA 3FDGA 4A8IA 1UKOA 3KS6A 2PTZA 4PFMA 1PPIA 3IV3A 2YR1A 4MDPA 1SZRA 2ICSA 1FWIC 1V6WA 1CXEA 1FKWA 2WB5A 2V8ZA 1SW7A 3S1UA 1QOQA 2X1RA 3SUSA 3N1AA 4L4MA 5LIWX 4FNSA 5JH1A 3NM3A 5DBUA 3ATZA 4IG2B 3DDMA 1V7YA 4HVXA 3M0ZA 1JPDX 2CZEA 1T6MA 2FIQA 2YCLB 3ARYA 4CD4A 4PCSA 3BAXA 2RGLA 3WF4A 4GLEA 4DWSC 2EPOA 4R5EA 1IWAA 2E7FA 1JQXA 1UD6A 4NUWA 3UZZA 3BQ6A 2PLMA 1C8XA 2CPUA 1IWBA 4HPGA 4O54A 3RJXA 4P7RA 2OFJA 1ICQA 1OGBA 3EX1A 3IUHA 3SY8A 3WNLA 2GJRA 1TMLA 1EXBA 2IS7A 3SCSA 3AXIA 1XYBA 3THDA 2WM1A 2Z0IA 5D8ZA 3NM1A 1XC6A 4CQ9A 1L2UA 1XKYA 4AYSA 1XIFA 1CGVA 4Z0SA 3TWBA 1V3MA 2WM0A 5A95A 3S1GA 2HNEA 3KLKA 3LQGA 5F2LA 3ZZ1A 2GDQA 1Q6GA 1LT8A 4I5RA 5I6SA 2ZZ3A 5BW6A 2C8NA 1DTNA 2KX9A 3QJAA 3CIWA 3FK4A 4C6JA 1CGTA 3PZNA 3MUZ1 4NJJA 3RX2A 4J3VA 4A3YA 1Z44A 3QN3A 4LQ1A 1S2WA 2J77A 4K36A 3PUGA 1FY6A 1NDYA 4ZENA 1M3UA 4GFSA 3AYVA 1DQXA 1EOMA 1MZRA 3GH7A 4JCLA 2QCCA 2VFGA 4BF9A 1ME7A 1DE6A 2PFHA 3H2NA 3AO0A 3ES7A 3U3HA 3QY7A 2Z1WA 2GGJA 1TRIA 4HU8A 1T8QA 3ALFA 3FHQA 1OT1A 3NQMA 4KEVA 3SCTA 1UIPA 4LBSA 1WKFA 2EJ1A 3CHCA 2YXOA 2G3FA 2E5DA 1M1BA 1A5LC 3TC3A 2CLKA 4G1KA 4U10A 3BLOA 4ZB2A 3TQPA 3FS2A 4I7WA 3PBYA 1C9DA 4J4KA 4JL2A 2Z7KA 4DX3A 1CB7B 1KKRA 2XDFA 3C0JA 1RVGA 3VX0A 3ZR5A 1FHDA 5FF7A 1IGSA 4AAJA 2FFCA 5CC3A 3ZIZA 3D6NA 3H70A 1YTEA 3M64A 3GY1A 4TVCA 1H5YA 3OYZA 4JOMA 3W1LA 4O0KA 2TPSA 2PGEA 4ZQMA 2O9PA 1U5HA 3QZAA 1O1ZA 1CZ1A 3N2XA 2YJQA 3L4TA 2X0HA 4H8VA 4XZIA 4BF5A 4US6A 3WFAA 6A3HA 4S3FA 3F5LA 2DH3A 2C16A 4HYRA 4S38A 4YWSA 3VCCA 2I7GA 1S2VA 1M5WA 3H54A 4UR8A 2ESCA 1YDOA 4HHPA 1TWDA 3NQ7A 4GQBA 1THFD 4UQEA 5IDZA 1RQHA 3SCNA 4L4OA 4WRHA 3WQOA 4UNKA 3ME3A 2NV1A 1XXXA 1R85A 3AZSA 3OIHA 5EL1A 2VNCA 4ROPA 2QCFA 4OBSA 4O57A 2E8ZA 4NJIA 4MSSA 3A3XA 1NJJA 2P76A 4E3TA 3IVSA 3R79A 1JCMP 3GVRA 1W1PA 3U8GA 4N9DA 3ARVA 2OWCA 2UY5A 2R1LA 2QCGA 3ZXWA 4GZEA 1RK6A 4PMJA 3GR8A 4FP1A 1HX0A 4KCVA 4H9ZA 4L1WA 4PMDA 4O16A 1DXEA 1HVQA 1XLFA 4F66A 4ZVJA 3RLGA 1GNXA 3K46A 4AWEA 2NXGA 4FI4A 4O1FA 1EQCA 4EK7A 3UJSA 1Q6RA 5MKGA 1PX4A 1C7SA 3WF3A 2NQ9A 3WDHA 2YL8A 4S1FA 1KM4A 3VC5A 4A3QA 3ITOA 2FYMA 1K7FA 4LAMA 2V2DA 4W5UA 1ZCCA 3PC0A 1QK0A 2POZA 1UWQA 3NYZA 1KBJA 1SJCA 3T2OA 5CBJA 4M24A 3TQVA 3WJXA 3IUIA 2RJHA 2W27A 2QJNA 3CL6A 4AZHA 1ZBCA 4AMAA 1WZKA 1XIIA 3WBXA 3EB2A 4RKAA 4H6RA 1K8XA 3W38A 3QRHA 2QCNA 2NQZA 3EKLA 3IUDA 2O9TA 5L6UA 1KCKA 2G4FA 3WNOA 3CZLA 2ZBTA 4M29A 2WBGA 4LYQA 1XYCA 3W2UA 1DIEA 1QNRA 3LLDA 3N19B 1ONWA 1MWOA 1QWKA 2XN2A 4XVDA 1AW1A 4M19A 3SN0A 1MW0A 4RZBA 2J7DA 2VOMA 3UZXA 2VC5A 3E3HA 3RU6A 3FJ4A 4OGZA 1AK5A 5G2HA 1LUCA 5K9XA 1WE5A 2LLEA 1NIUA 4KMQA 1LJYA 2A3EA 4PB3A 4NI8A 1XIJA 3V0TA 3G1RA 3UXAA 4Q6XA 2J6VA 2VCAA 4P8VA 2I5IA 3F4VA 4X9YA 2VX7A 2Z2BA 3IGUA 4NAEB 2ZRYA 1T5AA 1AH0A 4GVFA 4UTLA 4UTFA 1IR2A 3A5VA 4Z2JA 3N15A 3OEXA 2QJGA 1NTHA 2YYUA 5JUVA 1QPKA 1PCKA 5I5RA 1FHUA 5FEWA 3CLMA 2NWSA 1B2YA 2PDQA 1OINA 1SJAA 1CCWB 2PRHA 1OFBA 2YW4A 5AZ0A 5LKYA 4FR6A 3WJZA 1WQ5A 5FJRA 4FLQA 4JD4A 1WXJA 1E43A 4PMVA 2O0TA 5CZKA 1GKPA 1FBAA 3ID7A 3QV7A 2OB3A 3KRZA 3LB0A 2I17A 2BY0A 3B40A 3SDOA 5I78A 5BRQA 1EDTA 3G77A 5E6YA 4TOQA 4M6PA 4IPIA 5E0KA 2KAUC 3W00A 4HA1A 5EU9A 3GXTA 4G7FA 3TMLA 3CH0A 4M7SA 3MVTA 4BZYA 2OEMA 4ZGYA 1O94A 4G7EA 1KD0A 3FA5A 3UR8A 3BW4A 3LV5A 2E68A 5CGQA 1ODUA 3E2RA 3FV9A 1XIEA 1GEQA 2X1TA 1Q4NX 1GW1A 2DIEA 2NV2A 3MMTA 3S5OA 4RJEA 5KZMA 2E6DA 3CMJA 2OO0A 2HZGA 2CU0A 3LK6A 3EB4A 1RA5A 2WPGA 4RE0A 4FLSA 4GPNA 4ILSA 3U7BA 3GU9A 4GIAA 1L0PA 1AMYA 4BI6A