3ITGA

Structure the proline utilization a proline dehydrogenase domain (puta86-630) inactivated with n-propargylglycine
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
524
structure length
398
Chain Sequence
PQSVSRAAITAAYRRPETEAVSMLLEQARLPQPVAEQAHKLAYQLADKLRNQFVTGETIAEALANARKLEEKGFRYSYDMLGEAALTAADAQAYMVSYQQAIHAIGKASNGRGIYEGPGISILSALHPRYSRAQYDRVMEELYPRLKSLTLLARQYDIGINIDAEESDRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPLVIDYLIDLATRSRRRLMIRLVKGAYWDSEIKRAQMDGLEGYPVYTRKVYTDVSYLACAKKLLAVPNLIYPQFATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIYAPVGTHETLLAYLVRGANTSFVNRIADTSLPLDELVADPVTAVEKLAQQEGQTGLPHPKIPLPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein putA
publication title The structure of the proline utilization a proline dehydrogenase domain inactivated by N-propargylglycine provides insight into conformational changes induced by substrate binding and flavin reduction.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 156
structure length 398
sequence length 524
chains with identical sequence B
ec nomenclature ec 1.2.1.88: L-glutamate gamma-semialdehyde dehydrogenase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01619 Pro_dh Proline dehydrogenase
A PF14850 Pro_dh-DNA_bdg DNA-binding domain of Proline dehydrogenase
A PF18327 PRODH Proline utilization A proline dehydrogenase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3itgA00
1ZRQA 1ZPTA 3APYA 1B5TA 3FSTA 3E2RA 4JNZA 3FSUA 3E2QA 2FMNA 3APTA 4JNYA 1TJ2A 2FZNA 1ZP4A 1TJ0A 1ZP3A 1TIWA 3IJDA 3E2SA 2FMOA 1V93A 3ITGA 1TJ1A 2FZMA 4O8AA
chains in the Genus database with same CATH superfamily
2GK1B 1XISA 3O15A 1YIXA 4M56A 5G2HA 2QLYA 1MXDA 4ZQMA 3NQCA 1ME7A 2VC9A 2FZBA 5ABEA 1FDJA 3WD1A 1L8NA 4GUJA 4PCFA 1ZFJA 2ALRA 3EB3A 1RVKA 4IFKA 2X42A 1DTUA 1E6QM 1BHGA 1EJVC 4OFCA 2FJUB 3TLLA 3GE7A 1EP2A 4H4IA 1OK4A 1ZAJA 2J7BA 3AAMA 2VCAA 2ZZ5A 2XH4A 3RGTA 3T81A 1B3OA 1XRSA 3NCOA 4UWMA 1IHIA 3FJNA 4CD8A 3EWWA 4GUGA 1I2QA 3DOPA 3PPFA 3SJ3A 4IIDA 4EXQA 4XUGA 2HBVA 2RDUA 5FSEC 5FAGA 3WUGA 1G0CA 3ABOA 2E0PA 1EC8A 5EL1A 4U10A 5F2GA 3SQLA 4CVUA 2H3BA 4Z2HA 4HSNA 1V0NA 4BKNA 3BZJA 4LW7A 3IIVA 5HPCA 3B8UA 4R85A 1E6NA 1QPRA 1ZSXA 1B9ZA 5I77A 3H26A 2VDGA 4LYRA 3LHWA 3N25A 3MV11 1US2A 4N9BA 4UMBA 3BGGA 1QDSA 4XKYB 4DJFA 2XWDA 4J3TA 1ISZA 3RCMA 1PJ9A 1RQEA 1NVMA 2PDLA 3K4WA 1ZNNA 3PG8A 1A3WA 3ITYA 5DMMA 4O50A 4KERA 1G01A 3DFYA 3STEA 1GKPA 3UGVA 3W24A 4E2DA 3QTGA 1JCJA 2CCRA 2L5HA 5F1VA 3T8LA 2NVDA 3LSCA 3ARWA 2A85A 3C0LA 5DCBA 2INEA 5A6KA 1D3HA 3W4RA 1WZLA 3SADA 5E0FA 4XSMA 2YFOA 1WB0A 2PDQA 4PEEA 1KNWA 3NM3A 4DZAA 4J5NA 4M24A 2YB4A 1XCFA 3B0YA 5AFDA 1E9IA 1NSJA 4QLKA 1U5VA 1FDZA 1TMHA 4I90A 3D6NA 4GVIA 4DPQA 5A2CA 1J9YA 2BHZA 5H8UA 1EJ7L 3WDHA 3QHOA 2XIMA 1TV7A 2VGIA 3LHTA 4HD5A 3F2CA 4M29A 4O1BA 3ZJKA 5A3HA 1XHGA 3AIEA 5HOSA 1ITCA 4LU0A 4ZFCA 2J25A 4FNQA 4HB7A 2WCSA 1JPHA 1ZHAA 3LA4A 1X6LA 3NDOA 5D8ZA 4AY1A 2G3MA 2XTKA 1GONA 1TX2A 1X6NA 4N0RA 5E1QA 3LHUA 3DU0A 2IPFA 1JZ7A 4CNPA 1FH8A 5TF0A 3M47A 1HO4A 4Q32A 3QMSA 5FD0A 3GC2A 5CC3A 1XLAA 1CCWB 1T6MA 4CD4A 1OYAA 1GVFA 3W29A 4FOKA 4Y9OA 1QU4A 5D32A 1G4TA 1GOOA 4BR1A 2YZ5A 1DHPA 4X61A 2GLKA 3L4WA 1VLWA 1ZBWA 3EZ4A 5HXMA 3TQ0A 5A6JA 2BVDA 3T55A 1NDYA 2BODX 1TTJA 2WMKA 3BZGA 4N4PA 3CS2A 3GBEA 4PB5A 4S3EA 4EACA 1OX4A 1OZQA 5DBUA 1TQXA 2DH3A 2NLYA 5BMWA 3VNLA 1BAGA 4H2CA 2DH2A 5G2IA 2Y7FA 3BE7A 3H4WA 1ZCOA 2QIIA 5LNSA 1WAWA 2FPYA 2YKKA 2AKZA 1L6FA 3FGCB 3WNOA 1OIMA 4Q8MA 3P8JA 4JKKA 4XVDA 4K1GA 3MP4A 4AVFA 3AXKA 2HRWA 1XG4A 3AS2A 3JUGA 3JVAA 3RCNA 1A49A 1WA3A 3LV5A 3P81A 2QUTA 3F5JA 1YYAA 3N6QA 3BK0A 4ORIA 3WLJA 1OVDA 4TTUA 1OY0A 1BSLA 1J0IA 5HUPA 4JFWA 2OJPA 3BLEA 1VRDA 3H2EA 4O57A 5FF3A 1ICQA 2CIPA 3ID7A 4CCDA 2Y70A 3G0UA 4JTKA 2PDHA 1OFRA 3WQWA 5BRQA 4BEUA 1OFDA 3VE7A 4A3YA 3LCIA 3OA5A 3W85A 4HYVA 3B0PA 2G3NA 3QFWA 1ZAIA 5D09A 3WMSA 2DORA 3AU6A 4P8VA 4O53A 1QXLA 5JBDA 4RE2A 3ERPA 3E0WA 3VDCA 3FJ6A 2JEPA 2NQ9A 1QOPA 3W26A 1M04A 1AL8A 1TRDA 3EDEA 1K03A 1H60A 3QSRA 2FFCA 1P6BA 2VVSA 2QUNA 1IEXA 5CLTA 3FA3A 1D3GA 1UYQA 4A3RA 1XYBA 3WENA 3ZQ9A 4HN4A 4X63A 5HQLA 1PPIA 4KGJA 1MRQA 1JPDX 3DFTA 1XIBA 4Y8FA 3VD3A 5BRPA 4PH6A 1WX0A 4HSHA 2RJGA 5K3VA 4MOZA 1EA0A 1OADA 1R9YA 1O12A 4EWND 4A29A 2UY4A 1PYFA 3QN3A 4DWSA 3K8KA 4CGTA 3FVDA 3E96A 1Z8AA 4FI4A 3BQ5A 3P67A 3CV6A 3U57A 2HVMA 3R94A 4R7WA 2DSZA 2BY0A 4QFUA 5CLWA 3N1AA 1C7TA 1LLZA 3NOEA 5CBIA 2C6QA 1K8ZA 4HK5A 4I5XA 3O16A 4LBUA 5BXRA 1CT5A 2D73A 4F2BA 3KEHA 1NH6A 6TIMA 3GNRA 3C4UA 3AOFA 4CNSA 3GUGA 1WKEA 3NEHA 3A9IA 1JD7A 4F48A 1GHSA 1AD1A 1S3HA 5LZLA 1UQZA 4LB3A 4BI5A 3OJGA 3L65A 3AMLA 3GTIA 1J6OA 1LCOA 2B81A 4WUIA 4ZSUA 5I24A 2CWXA 2O9RA 1J4EA 3SY8A 2PTWA 2XFWA 3SN0A 4AY8A 3MI6A 3PZIA 1PXGA 4MDPA 1D3CA 3T2QA 1TTQA 3BAJA 2QCNA 3OO2A 4HNOA 1X7IA 4Z0JA 2QCGA 2DZSA 4N42A 4NJHA 4GZEA 1IE7C 1J96A 3F4CA 4E2BA 3JR2A 2AL1A 1TVLA 1XGEA 4B2DA 2G4FA 3GXFA 3KOZA 1JPIA 4Q6JA 1ODZA 1LF1A 3ZYZA 4L64A 4LUIA 3VMPA 2DT2A 4CN1A 3KWXA 3TN4A 2C3ZA 3IJ7A 4YTRA 3ZJ8A 1VFHA 2P88A 4S3AA 3KTXA 3DYOA 1LOLA 1YTEA 4EXBA 2HSAA 3SCVA 1ZGDA 3S5OA 3TUUA 3PZVA 1UUMA 3GKFA 4GKLA 3E0LA 2D24A 3S5NA 3U4AA 1FWTA 3OQ8A 4H3DA 1SPQA 4C6QA 3KFTA 1TPVA 3RO8A 4FX7A 1D2KA 1CXLA 4IXHA 1Z69A 2G95A 3BXWA 2E68A 3FNDA 1TPB1 2HEJA 3OG3A 3HGJA 4LUTA 1AJ2A 3NNTA 4KFOA 3DN5A 2DZTA 3O0FA 1GYMA 1EJTC 3UCQA 3GNPA 3PJUA 3A3XA 1EO5A 5DFAA 3V4BA 4UTHA 1AL7A 4Y9AA 4DBUA 4UR7A 1Y8BA 1V08A 4JFSA 1TR9A 3GNOA 3VC6A 1FRBA 1GVYA 3KHDA 3PZUA 5EKYA 4D8LA 4AY7A 4P61A 1G5AA 1SM9A 2I9EA 3KP0A 1EWEA 1M41A 4K37A 4HMNA 3BW3A 2YPIA 2XYLA 1X7FA 4JTUA 3APTA 3OLEA 1XIFA 1HJWA 3TVAA 4C6KA 5I3HA 4HZ8A 3UJ2A 3CM4A 1OT2A 2NT0A 5HJXA 2XVPA 1V93A 1CZ1A 1K1DA 2HS6A 3WNPA 1YNPA 1W3LA 4PEKA 3USZA 3AIUA 3R43A 1Q6DA 1TPWA 3GO2A 2FPTA 1IYXA 2XH0A 4QQ3A 3TP4A 4B92A 3RMJA 2Y63A 3T9PA 1EJXC 1DQWA 4W86A 1A5CA 1UH2A 1EZ2A 3L67A 5FJPA 2FHBA 1SFLA 2WXDM 1NP2A 2WM0A 3OODA 1P48A 5E9XA 4I7WA 4UNIA 4CQCA 2VZSA 1ZJHA 3F2BA 2DP3A 4R3UA 1VCGA 3WD3A 3CEUA 3S2JA 2WPBA 5EMJA 3J7HA 3L12A 3KBWA 1HTIA 1J2BA 2XN0A 1LQ2A 3WD0A 5CPSA 4FO4A 1XLEA 3C8NA 1JIBA 5FJOA 1CXKA 2QF7A 4HYRA 3DEQA 3GYCA 3MBFA 3TWAA 3THQA 5D9OA 1Q8AA 5H1WA 1Q65A 3RK8A 3MUZ1 2VC7A 4LUSA 2DY3A 1JAKA 2WCGA 3I6TA 4RZBA 2ZADA 3TN3A 1XLKA 3AXXA 3E74A 1YW1A 3RLUA 1TJ0A 1WXZA 5JUVA 1JI2A 2G41A 3A47A 1VGAA 3W1MA 3MKVA 1SVDA 4IPIA 1G4PA 1PIGA 1WKFA 1B3YA 1GEQA 1S5TA 1HXJA 4G6CA 4IP5A 3WQVA 2EPKX 2QMKA 3WMLA 3POHA 2ACRA 4DNHA 1A4MA 1BVWA 1AW2A 1AD4A 1BYDA 4L6DA 1BXBA 3VPLA 2X2YA 5BOOA 4M1BA 4KH2A 1HVQA 1NOUA 1TX0A 4H7VA 1XH2A 1W9BM 4UMAA 3THUA 4O52A 1PX3A 4MJ4A 3E5PA 1B3VA 1V5XA 3U8GA 4IMEA 2BY3A 4E8CA 4FAMA 3DGRA 4LOCA 4PMXA 5CBJA 1X1OA 2YW4A 3VC5A 1O95A 1IGWA 3VGGA 3C2YA 3HGSA 2ZYFA 1J8VA 1DTNA 1BVZA 4JFVA 3BO9A 1R85A 2IQTA 4ZL1A 1I8JA 2E3ZA 2QCFA 2PP3A 3B8DA 3S6OA 3N18A 1JD9A 2YIHA 3VAVA 1JYXA 3TCSA 2WKGA 4QLLA 4O10A 2JQXA 2VL4A 3MUXA 1UKPA 2FZNA 1UWTA 4BQ2A 3CL8A 4DYEA 1B57A 4Q8PA 3GKAA 4M6UA 8XIMA 4PE8A 5FEPA 1YDOA 2YLAA 5FA5A 1RP8A 1CENA 2HVOA 4S39A 5LIUX 1GZGA 3I3DA 3NIYA 4O4VA 1E0WA 3ANYA 1E3ZA 1XBVA 5KITA 1BFNA 3P62A 4H19A 2DGAA 5D4YA 2PLKA 1KM4A 2YCLB 1BG4A 1J0YA 4CLMA 1UH3A 5ENLA 3NGFA 2BXYA 3EMCA 3H6OA 4LCQA 1B1YA 1H49A 1CX9A 1AQ0A 2OR2A 1TB3A 1W1PA 1HVXA 4PODA 2QAFA 1DOSA 3DYMA 1IXNA 3R13A 1HKVA 2FB2A 1KTCA 1Q4NX 3K30A 1US0A 1Q7MA 1XM3A 4XZMX 3GAKA 1AUSL 2P76A 5CZTA 4IGMA 1OFOA 2QXWA 3HQNA 4R9OA 3WLQA 1J12A 3KRBA 3LSBA 2O9TA 1PZ0A 2Y8UA 3ARZA 3KRZA 4YL2A 3UZJA 1JDCA 1HL9A 1MZHA 2VQTA 5E09A 3WX7A 1C92A 1BQGA 2WMIB 5IDIA 4AD0A 4IMAA 3G3MA 3D3AA 4B5VA 4HA4A 4ALDA 5E6YA 4DN1A 3CAKA 4U3CA 1ISXA 3SM0A 2QW5A 3WO8A 1TE6A 3W71A 2PBOA 3PWIA 3A6OA 1E72M 2YYTA 3ITVA 4FNTA 3AYVA 4UR8A 1K77A 2FTWA 1L2UA 4XZHA 2Y85A 1A0CA 4IUOA 3U2CA 2ZWYA 1QVBA 1KR0A 1VBHA 2E67A 2G97A 1NFBA 3CMGA 1B3XA 4GISA 2JBMA 1O1ZA 1E1CB 5JXQA 1R3YA 1UQYA 3RR4A 3FJLA 2Z1VA 1RHCA 2DJLA 1XS2A 4WQ6A 3ZOAA 3NOYA 1B9BA 2WZMA 3A3HA 2D2GA 3AZTA 4BF5A 3C0SA 1BXNA 3LPFA 4Y2WA 2QIWA 2Z1SA 3R2GA 4L65A 2J8TA 3DCPA 4EP8C 3T2PA 3RN6A 4JCMA 4HGXA 4F0RA 4KGLA 2QMJA 3SUTA 5FAJA 1FXQA 2ZXDA 2VYOA 5EYWA 3WNNA 3LHYA 2D0GA 1IV8A 1ONWA 1BF6A 2DDXA 3MZNA 1R0MA 3V3WA 3CHCA 1HZYA 1F74A 2G8ZA 3CH0A 4K1WA 1E4NA 3M1ZA 1RSCA 4FPSA 5M17A 1RQBA 2CBVA 2XN2A 4GXMA 3KLLA 1U33A 3U6WA 2J7HA 4DF2A 4PMNA 1TELA 4WLCA 1ME9A 1NAL1 2NSXA 3UJRA 2V5CA 3W3OA 3WH8A 1GZJA 3CQJA 2VURA 4MVAA 3O0KA 1QBAA 5CSRA 1MFVA 3SGZA 1AZ1A 3G1XA 1H5YA 1OIFA 1U2YA 1QNQA 2J7GA 4P8WA 3STPA 1G1YA 4AYGA 1VD6A 2F7FA 2ACQA 1EQCA 2Q09A 3ARYA 4XIAA 5DXXA 4UNLA 3P6LA 4U28A 3V7PA 3WJXA 3CIWA 1H2JA 4NZ1A 4AZ7A 5LKYA 4C1NB 3GDKA 5SWUA 1Z41A 3A4JA 3K4AA 4D71A 3SUSA 5CZSA 2OGJA 2OG9A 2HK0A 4B5WA 1BYAA 1QNVA 3TC7A 3QYSA 7A3HA 1RK5A 3IANA 3V75A 1OWQA 3ME3A 3NQ8A 1XLDA 4FP1A 3UG8A 3BW2A 5DT7A 3VD9A 1KM0A 1WYIA 3HFYA 3OZYA 3LDVA 4GD0A 2XFYA 1US3A 1EIXA 1V79A 1QPOA 5C0QA 4YHGA 3LMYA 3FY1A 2B7PA 5B7YA 3WQ5A 4H6QA 2CERA 1W32A 3WDPP 1OX6A 4FX6M 1YTDA 3V36A 1PUDA 4LS1A 1QI5A 3TTOA 4PBGA 3S1GA 4Q4SA 2JE8A 4MIMA 1DQUA 1FWIC 5B80A 4Z42C 2PDJA 4NZ5A 5D2TA 4LBSA 3CMFA 1LRNA 4U33A 2VX5A 3FN9A 3BPWA 4C1KA 3CAQA 2AKMA 4FIQA 5FF0A 1LLOA 4GJIA 3ZLGA 1LOSA 1X97A 4QGCA 2JF6A 1E6XM 4JTFA 2CFFA 2PDYA 3FV9A 5A2BA 5TBOA 1NDWA 1QMLA 5F2IA 4EXAA 5T91A 3GS6A 3MHFA 1VEMA 2BGNE 2FQIA 3TA6A 4B5XA 4JYEA 3S9IA 1W54A 3AMGA 4FZIA 3NZRA 1RLDA 2D20A 2WSKA 3QZEA 1ALDA 3TZFA 3KL5A 4B3KA 4XZLX 1JFHA 2VEFA 3W2LA 1EJWC 3ITCA 4H1ZA 1TWSA 1AQHA 1RA0A 4C6FA 1PHQA 2TYSA 2O0TA 1TA3A 4S3DA 3F4NA 2D2OA 5E0KA 4Q33A 4BHYA 1W31A 1CXHA 3CUGA 2V38A 3C3NA 2SFPA 3VU2A 4Z1BA 3ZWTA 4FK9A 5E9AA 5LHFA 1QTWA 4DJED 1Q3NA 3H2FA 4AZGA 3LM7A 4NZFA 4ATDA 4IX0A 4RW3A 4QRNA 1A47A 1XKYA 1UWSA 4HKPA 4PTMA 1DVJA 1GKRA 1QW9A 5BNKA 3GZAA 4X2PA 3DYPA 2O56A 2ZKMX 4KCUA 4W7WA 1MDLA 2WHJA 3ZT6A 3G8RA 5LNRA 2DT0A 3EEZA 4PMUA 1HP5A 3WK3A 4MB3A 4LAOA 1E1EA 4MYXA 4RE0A 2E6YA 1HJSA 3TTEA 4X9YA 1FWNA 5CH9A 1XLHA 4QTGA 1S38A 3S83A 3BL3A 3E0FA 3GFXA 2P8BA 1TRIA 1CWYA 2I9UA 5A95A 3W75A 1KTBA 5L6UA 3NGJA 5G5IA 2H9AB 4JTQA 3T09A 5CC7A 3MANA 4K6AA 4G2DA 5LA2A 4D8ZA 3VKDA 2Z25A 3EMZA 4KEUA 1J93A 1BYBA 4DJDD 5D38A 2VCBA 4PCSA 4PUNA 4Q8OA 3GH4A 2HZGA 1QNPA 1M3UA 2WSRA 2DW7A 3C2OA 2X1SA 4PB3A 2DZVA 1H7PA 1TPFA 4UTIA 4QJ3B 1F4HA 6ENLA 4RZ5A 4QR6A 2GWGA 4S3KA 5CPLA 3SQSA 4DI8A 1XIHA 4CCEA 3R79A 2YA1A 3UWZA 4ERIA 1X8CA 2GJRA 1A5OC 4F3HA 2Z24A 2ON3A 3UETA 4GNJA 1V02E 2ZUWA 3ZFHA 4F2TA 4AWTA 1JYWA 4R5EA 4MAZA 5ECVA 2PLMA 2FMNA 4OGZA 3UQNA 1WDWA 1KM2A 4LWWA 4H8VA 3UY8A 4ACZA 2Q6ZA 1D7FA 3GDRA 2WVSA 3OYZA 4DIAA 3AU2A 1W9DM 3BDKA 4D72A 2C13A 4S3FA 4IJBA 8CGTA 1YBQB 2CHOA 5CC5A 4K38A 5AHMA 1FXPA 4FLQA 4JTSA 4O0ZA 2I7GA 1MUMA 1N7KA 3W28A 5D2YA 2VR2A 2QJJA 2WZTA 4E2OA 1RBOB 4LGXA 2TRSA 2W92A 1SZNA 1UZ4A 3K8MA 3WH6A 1P0BA 2PDFA 2RGMA 4E3VA 1JZ6A 4J1OA 4EWJA 4IMFA 2XFFA 2Y1HA 5C7VA 1Q2RA 3A5FA 2ZICA 3P14A 3S2MA 2YSWA 2HS8A 2WWCA 1SZEA 2F61A 3EWCA 5G1YA 3B8TA 3HFTA 3MWAA 3UPWA 2ZA3A 2Y89A 1BEUA 3W88A 2ZUUA 3IUIA 1SO3A 2Y2WA 4FNSA 3DFSA 4AC1X 4GNKB 3CQKA 3DDMA 1CPUA 4F9JA 1MRAA 3KBJA 5EU9A 2YDQA 5DELA 3A24A 1V3MA 4S3CA 3G1DA 4NXSA 4AD3A 3TYUA 3K5XA 3TSMA 3UA3A 1V3JA 4H04A 1MVYA 3DENA 2ZDSA 3ZM8A 2WO5A 3I65A 4O18A 3DFHA 5BXPA 4QBXA 2ZZ2A 4IH3A 2ZRXA 3VTRA 3W1AA 1E51A 1XC6A 3CUJA 4N02A 2XVGA 4GX9A 2FZ8A 4RDVA 2PURA 2XU2A 4Y6GA 4S1FA 4JX6A 2ESCA 3QEZA 4NL1A 2Q71A 4GA8A 2A6LA 2VUNA 2WVUA 1ZU8A 3T44A 4NU7A 4NY2A 1HGWA 1S1PA 3DHPA 4MKSA 1ZPTA 2FGLA 4HSOA 2GDQA 2FFIA 1XPYA 4DB7A 2W63A 5E70A 1U83A 3LBMA 1L8PA 1TWZA 2Y5EA 2X16A 4UB9A 1Z7AA 4ZO8A 4Q4PA 3EDJA 2ZRWA 3W1XA 3VOHA 4NAFB 2OYKA 5DEZA 3G1YA 3M6YA 3CLWA 1UHVA 4LC6A 4UUIA 2AGTA 3W76A 1B4EA 2BB0A 4HTYA 2NVCA 3A64A 4F4RA 3QFEA 3ABXA 3N19B 3A21A 3RDKA 4GI8A 1NFGA 1G4EA 3ZS4A 1XP3A 4R7JA 2IQ0A 3QMTA 3CPUA 3PNUA 5KMYA 5MF5A 1G4SA 3ARSA 1LT7A 4DUOA 5E0CA 1VBUA 2J6VA 4PUWA 3QPYA 1BVNP 2Y88A 2HXTA 3QY8A 3OA3A 1TJ1A 2VFEA 3BCFA 1KM6A 3CUZA 1LJYA 3VIPA 1A5SA 1O5KA 2E7FA 2VCCA 4XBKA 4JIQA 4HMDA 5B7ZA 4QG6A 2F9RA 4WRHA 1JAEA 2ZX5A 1Z44A 3ABRA 1FQ0A 1Q8JA 1JDFA 3TSBA 2QPUA 3OHIA 3L4VA 3N13A 3PSWA 4NKCA 1U1JA 1AODA 3CV1A 4Z1CA 3L21A 3TK7A 3R58A 5D30A 4XD3A 1WDQA 1N8FA 1JZ4A 2ZA1A 2DVXA 4OUEA 1MWOA 4HPGA 3T6CA 1GHRA 5KTLA 1OGGA 3VO0A 1OCBA 2P53A 3E38A 3K8LA 3MVTA 3KRSA 1JJKA 4P7LA 3RLVA 4PRTA 3LLDA 2JKAA 1NP0A 1V02A 4GQQA 3ITGA 4KWOA 3KBVA 4MB4A 2VFIA 3B9NA 3K1DA 3R8RA 3SRFA 3UXLA 2CBJA 5MKGA 3VMNA 1XGZA 4WOQA 2BV9A 3HMCA 2PD5A 3UEQA 4ZO6A 4I8YA 3WL1A 3E6EA 2C7FA 2WC7A 3GRIA 4D1JA 5H6HA 1R3WA 4ZOAA 3D5HA 1IWPA 6A3HA 1H50A 3FS2A 3KCJA 3WEMA 3K46A 3MSYA 3PUOA 2V2DA 1CXIA 3EB4A 1UA7A 4JHMA 4BK9A 1PKNA 5GQBA 3A23A 4IGNA 3OGSA 3N3MA 1XI3A 1TPUA 4HNVA 6ALDA 1JNDA 3SRHA 3MT1A 1J5SA 4MF4A 5EFDA 1XH0A 2CITA 3W9ZA 3GVVA 3BAKA 2H6RA 4WKHA 1A5NC 5CGTA 3RX4A 2J9ZA 4B5NA 1H63A 3E2VA 3P61A 1R38A 3P2VA 3W7CA 3LBCA 4E38A 3UU0A 4JDYA 2BASA 2QCLA 3QF0A 1DWIM 3C8FA 4QXIA 4DO6A 4UTUA 3TC6A 3QLDA 4DJFD 1XJBA 2J24A 1CGVA 2C19A 1KFWA 3WH5A 1I0DA 1RPKA 4IXXA 2FH6A 4FXSA 4TX9A 5A6SA 4QM1A 1V6UA 1HJVA 4M7TA 5I7GA 3M43A 4PBFA 4IG2B 3DI1A 4J2PA 1QK2A 1F6PA 3KS5A 1HIZA 4JEQA 4XTDA 4V33A 4UOJA 2PGFA 2BVWA 1ZRQA 5HQEA 4GJJA 3QYQA 1MNZA 1A0EA 2X30A 5D9PA 3W7KA 1E70M 3QGAC 1IXOA 3ITOA 2EO7A 5FJIA 4Q4OA 1SO5A 3WKZA 2VRQA 4W8BA 2PWDA 4P7NA 4ATWA 5H91A 3WLMA 3MSGA 4AHPA 4DWSC 1EO7A 2J47A 3RMEA 1UR0A 1MXGA 2CHNA 3Q94A 4JNMA 3W7EA 2WVVA 3RO6A 3COTA 3M4HA 4G1NA 3KVJA 4HNUA 4QAIA 2XGZA 3M0XA 3UVAA 1TPEA 3GFZA 3MHGA 3BH4A 4JDBA 4JKLA 3SSZA 1DIEA 4NX5A 2FJKA 3W23A 3MQTA 4MYAA 1DJGA 4P7OA 4HNTA 4A8LA 4IPPA 4RNJA 3RRXA 1JDEA 1VB9A 1F3WA 1R7OA 4IPNB 2J6XA 4DZIA 5KINA 2XVNA 3UXKA 5AZ1A 3W7JA 3H4XA 1QR7A 4Y9MA 1V3KA 3WF4A 2WQPA 4IPJA 3R8GA 2HJPA 3EX4A 4WKAA 3P84A 1CBGA 1CB2A 1NQ6A 2PD9A 2ACUA 3KOXA 1P0KA 2BFGA 5C5YA 3QH2A 3FCPA 3CIVA 4C7GA 5HR7A 1KWKA 1XD1A 2BOEX 3CV2A 4V2XA 1JDAA 3ZSSA 1TJ2A 2W27A 2NLIA 3AIQA 1XLJA 3BMVA 6REQA 4KCVA 4JZ5A 3IJ9A 2FHFA 3HJZA 3PVFA 4XSLA 3UP8A 1W3NA 2C0AA 5HPOA 2DUXA 4QJ4B 3T08A 1JVNA 1JXJA 3PWGA 9RUBA 3REQA 2IS7A 2I5QA 3DKLA 4J3WA 2JIWA 3BSMA 2I16A 2WNZA 2O4MA 2D2JA 4GKTA 4MWAD 2GJXA 1MEHA 3THCA 2IXVA 4B9YA 1S5NA 2J13A 3MUIA 4BEQA 3WD4A 3P5YA 4MZ8A 4AYSA 2D1ZA 4J3ZA 1P0NA 3ARXA 3H70A 2FVLA 4NNCA 4EE9A 3HPXA 1XSKA 3I6RA 3P60A 4NRSA 2XGIA 1N8IA 1ECEA 3EWBX 5JMUA 1DIDA 4LNYA 1ZENA 4E4UA 3NURA 2OLAA 1H1NA 4BWLC 3TJXA 4C65A 3RHGA 3TROA 2WC4A 5FJUA 1FCBA 1GQIA 2P3ZA 2P8CA 3GZ3A 2PB1A 4XVEA 5M03A 4CD5A 1ZTVA 1SW7A 2ISDA 4WIWA 1O4UA 1CLKA 4DXKA 3FK4A 1WKYA 2F2HA 4HOXA 1Q6RA 2OSYA 4AEFA 5I09A 4ZMGA 3ZLFA 1M6JA 4I7UA 3TTSA 1C9WA 2NVAA 2PRLA 5EPDA 2OSWA 1LL7A 1SQ7A 1PTGA 3MDWA 3FIGA 4OHQA 3GNNA 1LWJA 4WD0A 5I2UA 2E6AA 3BLIA 3FLUA 3UGRA 1S2WA 1WZMA 3PBVA 3FDGA 3BV7A 3PF3A 2J8FA 3KW3A 3GK0A 4XD5A 4M0XA 3GXIA 2NWRA 2DZAA 4O1EA 2YOCA 1JI1A 4L5ZA 3H8AA 1UD8A 4W84A 4E3TA 3LI1A 4A3UA 2YA0A 1KRMA 5CPMA 1XFCA 2XWEA 4CU8A 3F2DA 3TDFA 3OIHA 3W1QA 1EF2A 3GX9A 2Y7GA 3UPMA 2V6AA 1CB7B 1WO2A 4CN4A 1HFBA 1XCXA 4HNCA 5LNUA 4EPEC 1Q4WA 4H9UA 2W67A 4ZE5A 1H4PA 3T42A 2O9OA 1KFBA 1OINA 7TAAA 3W27A 3DFOA 1OSEA 1H5VA 3P8IA 3VZZA 5J5RA 3VGBA 2OWWA 5F2MA 1VPQA 3W84A 4Q8WA 3QTPA 4DNMA 3N2CA 5A6TC 4Z0SA 3IAPA 4C6BA 1FFRA 2PDMA 5DMYA 3WQ8A 4XK2A 3BJTA 4GBUA 4CEXC 1KFEA 3UFYA 5G4WA 3LMZA 4UTMA 2CNCA 3M0YA 1UASA 3TTQA 9CGTA 2V8ZA 2HE5A 2TSYA 1Q63A 3L4YA 2E8ZA 3LRLA 2ODOA 4LCSA 2GVJA 1MUWA 4DJEC 8A3HA 5D33A 3FHQA 3W2NA 1V8EA 1Q6CA 3CQIA 3S5SA 4GI4A 4MJ2A 3BANA 3DFNA 4UFIA 1FWFC 2UY5A 1UUOA 3IUHA 4KEZA 4JYDA 4WR3A 1DJQA 4CD6A 2D3NA 4A3HA 4DF1A 4W85A 2YCIX 5GJPA 3SCQA 2BZNA 2Y0FA 1KKOA 4LBRA 1FHLA 1UA3A 1Y0EA 1GKQA 2VC6A 5E93A 3VE9A 3N4FA 1WOBA 1EP3A 1R3RA 3DC8A 3CYJA 1TO3A 3WY1A 4I3GA 4IWWA 4RL3A 1BRLB 3GXPA 4B2DD 3W7HA 3XISA 2EAWA 1OCQA 1SSGA 1KM5A 2WHKA 4ATLA 1FCUA 2UY2A 3UXDA 1NWTA 2QCCA 1W37A 1QHOA 5F4XA 1UBPC 1KBBA 2VFDA 1MQPA 3U2ZA 4O1CA 1A5BA 4QDMA 4GYJA 3VDGA 3T0TA 3EWDA 2GPTA 5A94A 1QW8A 4Q7IA 2WVTA 2PDNA 1A4LA 2R82A 4C6IA 4US5D 3UPBA 2YCJA 3PJTA 4AZCB 3BJFA 5J04A 1SZRA 1V6VA 2BGQA 4MJMA 3VFCA 1R8LA 4F8XA 4H9ZA 4EX4A 1XQLA 4TQTA 3BJSA 3QZ6A 1GT8A 1U1HA 4O28A 1OC6A 4A3QA 2PDGA 2WJFA 3Q65A 5HJYA 5EGRA 4F66A 4MJZA 3S46A 2OFJA 4IL0A 3IJQA 3B0UX 5U7SA 2G3JA 3KOFA 3LRKA 5K7JA 1XYAA 3URQA 1XPGA 3CL6A 3H23A 1KA9F 4BI6A 4WHBA 1KBJA 1Z6KA 4D6HA 3BGJA 2W6RA 1W5OA 3MYOA 4QIUA 4EAMA 1OK6A 1KFJA 1RD6A 1RJRA 1G67A 1P6WA 5D2VA 3SGUA 1YXCA 4ICNA 4HN8A 2QGYA 2ZUMA 4AVOA 4PMDA 4C6DA 4UXDA 1ITUA 2FMOA 3BOXA 2BVTA 4LVFA 4L1WA 1UROA 4K7VA 4CD7A 4MNLA 1RALA 1TVNA 4L4OA 5AHEA 1E9LA 4IJCA 4AG0A 4KIRA 3PZNA 1VIZA 3VKBA 1XIMA 4D6FA 3WDJA 3UT0A 3L66A 4GVGA 4M19A 1I1XA 5KETA 4IFKB 3E2RA 2PZ0A 2ZVRA 4DRSA 1SJDA 2OZ3A 1KQYA 3LX9A 3AXIA 4PULA 3E2SA 1NEYA 4W8AA 1QHZA 3V0UA 4D6EA 3GUWA 1T8QA 2WSYA 1S2TA 3ICJA 4ZOBA 3G1SA 1J10A 5CXPA 2WQDA 4AH7A 3ZZ1A 5A6AA 4RKAA 5JH2A 2HVNA 2NXIA 2GSHA 4WDWA 3VMOA 1OCJA 1GG0A 1UZDA 5I3FA 4ZQRA 2Z27A 1BPLB 4L80A 2YL8A 3W7GA 2AQVA 3K4DA 5JH1A 1H09A 3NDZA 1NU5A 5D03A 4I9JA 3SR7A 7PTDA 3B9AA 4OUIA 2H8XA 3VM7A 3XIMA 3NL5A 4KRUA 1C29A 1YKWA 2J77A 3HM7A 1SJAA 3QHMA 1XFBA 3BV4A 1RJPA 1UB3A 3OYXA 3DXIA 4RE4A 1GORA 3MP5A 4HYWA 5DRCA 3OP2A 1D7KA 3M5YA 3W53A 4YYFA 4NZCA 3PBMA 2NXGA 1R30A 3ES8A 2FLIA 2DT3A 5A8NA 5FEWA 3L4TA 3DH7A 1HKMA 1DKWA 4D8AA 3GHUA 2WZIA 1Q66A 1DJIA 4TOQA 3EPOA 3GDTA 2P3EA 3T0AA 2ZZ4A 4HIBA 3SCUA 4AZ6A 4TVUA 2GDUA 5T8GA 2YDRA 3BQ6A 1PWLA 1DE5A 4JYFA 1H7WA 3MKCA 4Q7NA 1JQVA 4Q22A 3OZOA 3SGGA 2QDEA 4QE5A 2CXGA 4V27A 1F61A 4JICA 2H8ZA 3IACA 3LK6A 3V0SA 5I6SA 3BLFA 2VD9A 1FWGC 3W2UA 3NQGA 2WSQA 3BWWA 1S5MA 1QBBA 2BMBA 2PRHA 4S38A 1SFJA 4WK9A 1RBAA 1UJQA 4GGHA 5AOUA 4YTUA 1E4MM 3AHXA 4J35A 3QW4B 2QCEA 2QJMA 1YPFA 3I6EA 4NG3A 4CQ9A 3B9DA 2PWFA 4JIIX 1R46A 3ZT5A 2ZZ7A 3ZVHA 1T99A 4H6RA 1ESWA 1MNSA 2C1HA 5HULA 3ZVIA 3N17A 2TODA 5PTDA 3F03K 2BNJA 1QATA 4UC5A 2VWSA 2ABBA 3A9BA 1QPQA 3H7UA 3V16A 4KFPA 4QISA 3SAZA 3TXVA 5DO8A 1DWGM 4CU7A 5ABGA 4YTTA 4BF7A 3QGKC 3FSUA 4O0QA 3VX0A 1MI3A 2YW3A 4DM2A 1P6CA 1YE4A 3QHNA 5EMYA 1GOMA 5REQA 2HDJA 2WNWA 3ECQA 4PFHA 4YVVA 2O9PA 4F0SA 1V0MA 3OLIA 1OX4B 3G2GA 1IEVA 1EPVA 1XRTA 3B8WA 2G5WA 1UG6A 1ECQA 2OYMA 2VOMA 2YL5A 1QK0A 4JHOA 1QAPA 1UBSA 3HG3A 2E40A 3GU9A 4U5KA 1IIGA 1FY6A 1ZBKA 1D8CA 2LLEA 4C5ZA 2OSXA 4NYUA 5KSWA 2FPVA 3EDKA 3HU7A 1OGBA 1PDZA 4Q4MA 1R3TA 3H2NA 2YCEA 4WSKA 3ARQA 2G4JA 4NYYA 1EBGA 1DJHA 4GG9A 4JOMA 1CECA 3TMLA 2WJEA 2QJGA 5GPRA 5XIMA 1KBIA 5DF0A 5FCZA 3WLHA 3RILA 4ZOCA 1O66A 1ELSA 1F7BA 1LL4A 2YFNA 4LB4A 2GGHA 2DFAA 3M5XA 1R86A 4I7VA 3NXFA 5EMUA 4WSJA 1ZS2A 4RV3A 1E1CA 2GGJA 1TUXA 2PWGA 4B3ZA 3TYBA 1GGOA 3OHMB 3W2JA 1C9DA 2PC4A 1BYCA 3MS8A 1IQ8A 5JIWA 3KLKA 3NG3A 3QLLA 1YXDA 4KS0A 1XV8A 4HZ7A 3WFAA 4OWGA 1V0LA 3W25A 4X0NA 2XZ7A 4WF7A 3CO8A 1XIGA 3AHTA 4H9MA 1AH0A 2W66A 3EWZA 2VEGA 5AYZA 1TE1A 3GB6A 4WY0A 4JEJA 2XIQA 3PC0A 4ML9A 2AQOA 1W9VA 1MW2A 4Z2GA 1BD0A 1L9WA 3EOLA 1OFEA 2XUCA 1F5ZA 3SUWA 4YLWA 1TZ9A 4ZODA 3CHEA 3HURA 3UYIA 3GC4A 1Q7QA 1XLFA 1O94A 2V5LA 4MNMA 3B8SA 3THDA 4DWSB 3W6YA 4GC4A 3UG5A 4HHPA 5TIMA 1VBRA 3IVSA 3BCJA 3UWVA 1QASA 4HOZA 5FIPA 3N11A 1QPKA 1LZOA 3DFPA 2OT1A 2VGBA 3PNZA 3BSGA 4NZ4A 2BVYA 3N34A 3RNDA 3A4XA 3LENA 4GABA 4LAZA 3BICA 4JTGA 1E43A 3UESA 2IPGA 4GY0A 3VDAA 4BJHA 3RPTA 2PGWA 3NSXA 3HG2A 4A8NA 5I78A 1Q6QA 2OCZA 3HV9A 1VJZA 2GVLA 4JIRA 3PR2A 1DV7A 3UWWA 3GC5A 2Z6JA 1PO9A 5FOOA 2FYMA 2AL2A 2X7VA 3LPOA 3AJ7A 5BOEA 4LY4A 2A3CA 3WQ6A 3VKAA 3ZXWA 1JUKA 3M07A 3UWUA 3WFLA 4DBSA 5K2ZA 1CXEA 1EUNA 2VQUA 1QNSA 4ADTA 3IEBA 1ZUAX 4UFMA 3H7RA 4IZGA 4XB3A 4CVWA 3I10A 4OTKA 2FKPA 3IJ6A 1XW8A 1Q85A 1B30A 2ANUA 4B15A 5DMNA 2XINA 4CN6A 3UYCA 4GVHA 4OJYA 4XWUA 4YMZA 4S3GA 2FH8A 2R91A 2PMQA 1K8YA 1VYSX 4BQ5A 3E0VA 4DYKA 1PZ2A 3BSHA 2FDSA 3II1A 4DEFA 3BAIA 4IT1A 1EPXA 2P1FA 3L5LA 4NQ1A 3G3DA 4HP5A 5CSUA 4B91A 3M0MA 2CEQA 1CNVA 1Y5VA 2EEXA 2IUZA 1HF6A 2Q8LA 3TKFA 1Q45A 3GXMA 3GDLA 2R1LA 4JN7A 1KCKA 3S1XA 2OTDA 3E12A 1CYGA 2CLLA 3BAXA 3S6TA 5CG7A 3KXQA 5HWMA 2GSJA 3UR8A 3W07A 5HAOA 4MY1A 2EHHA 4W4QA 2OODA 2XH2A 4S3JA 4H6KA 4TV6A 1EH9A 3KL0A 3M0LA 3AISA 3FFSA 3OBKA 1F2JA 1WOAA 4IPLA 1CDGA 3LXBA 1YTKA 4TVDA 2XFRA 3B40A 1QNRA 3GHSA 4HHMA 3CPGA 4LUTB 3R4IA 5BWAA 3M7WA 1EX5A 3PM6A 1UP2A 4ORMA 3NO1A 1J0KA 4XG1A 1BGGA 3PHAA 2OXNA 4YWSA 4GUHA 2D3LA 4HA0A 3RG6A 3T8QA 4HT3A 3EOSA 3F4VA 2QNEA 3PJWA 1TV2A 1NF0A 1ADOA 5FL1A 4XTIA 1ZALA 5CJMA 4L56A 2V5DA 1UC5A 1EJSC 1FFQA 2O7QA 1C7SA 2CLMA 2GZXA 4PTNA 5K9DA 5C9XA 3ITLA 4B5UA 5CGMA 2VZTA 3N2MA 3GTFA 3W0KA 4GZJA 4DI9A 4C6NA 4HHLA 4A2RA 2V69A 1JEZA 4AEEA 3DBNA 5CCZA 2VHLA 1E73M 1XC4A 5HUOA 3D0CA 1VHCA 1J0ZA 1FWDC 4JFTA 3U5YA 3QKEA 2B7NA 1ZJBA 4XKMA 4ZXLA 3UBPC 1E56A 3OTRA 5AHFA 1ISYA 4N2YA 1SGJA 1M7OA 1GQKA 1Z48A 1CGXA 1W9PA 2GJPA 1JGMA 2QDGA 3RF9A 1OBAA 3MUAA 1JFXA 3W2KA 3MV01 1Q2SA 2X1TA 2XVLA 1GZ1A 3HIJA 4LVBA 4RPPA 2AMGA 3MI2A 4IM4A 2NX1A 2ZX8A 3CH9A 3URNA 1NOFA 3VOCA 4UTKA 1VFTA 2W4XA 1EL3A 3SN1A 3TQKA 3SFKA 1YX1A 2ZZ6A 2PPGA 4WZHA 2XG9A 2WMFA 4QCEA 1HKKA 4ONVA 2P0IA 3NQMA 3WYZA 4OBSA 3HQOA 3ELFA 4HK7A 2DIJA 4LUSB 4I5UA 4V15A 3LNPA 3GTXA 2J4GA 3S0CA 5FF7A 5BOFA 1S39A 2WM1A 4GIEA 4UIOA 5AC6A 4JY8A 4LYPA 5K9XA 1CGWA 2B4GA 3LG3A 2WCAA 4UOQA 3M0KA 1LUCA 2BWGA 1YEYA 1M65A 1HL8A 1KC7A 6CGTA 2HPIA 2J66A 3P7YA 3SUVA 1CGYA 3ZR6A 5DY3A 1XYZA 3HO8A 2ZZ1A 1FHUA 5DLCA 1WPCA 1UPPA 1I2RA 2XHYA 1ADSA 4U3AA 1ZP3A 4A2SA 2Y5JA 4J3VA 4GGBA 5A69A 2DSKA 1DXFA 3BMXA 3AIBA 1GTHA 3IRSA 4PTWA 1R9XA 4MZYA 1HUVA 4R34A 1F3XA 2GVEA 4NI3A 5LA1A 4Q4QA 1X98A 4DUVA 3ABZA 2QKFA 3AICA 4NJGA 2DSWA 3W6LA 3NR0A 3CWNA 1ICSA 4FS9A 3O05A 3RITA 2DV0A 1V7YA 1UWRA 1XF0A 4PZVA 1I4NA 3WLIA 1VJIA 1DBTA 5A6LA 4H7CA 1A5KC 3WF0A 3V1HA 2VVNA 3URBA 3MA8A 2J7FA 1C91A 2J75A 4E4FA 1O60A 2PI6A 2VEMA 5AHNA 1OD0A 3W86A 4LC8A 4Z2KA 2J7CA 3HPSA 3URAA 3RPMA 3PUGA 3RJXA 5I3KA 1XSIA 1V3HA 3CZKA 3PY2A 3RJYA 4PFMA 1M9HA 3DERA 4EAYA 3ZR5A 4M6PA 3PPGA 2B0MA 4F0HA 4A4AA 2IKGA 3QXBA 2PC8A 1O5RA 1H0IA 2BTMA 2HXUA 2J27A 2ATSA 1R7AA 4J27A 3GVGA 2R9RA 2XN1A 2DZXA 2VMFA 1SO4A 4GXWA 1VH7A 2EKCA 3KAOA 4RXGA 3R10A 1U30A 4O0KA 2Y24A 3CZEA 1UH4A 2HK1A 4KW2A 3WMCA 2ZUVA 3GVQA 1Q6EA 5AB3A 1GWJA 3OVGA 3ATZA 2IMRA 3ITXA 4HCHA 3C3UA 2FZ9A 1FWSA 2A1YA 2YL9A 3RU6A 1Q6LA 2XM1A 1SZFA 3SN4A 5IXEA 2OGYA 1XBZA 5G1MA 4E8DA 2D0HA 3FSTA 4C5YA 2EPOA 3SW6A 1FH9A 3W00A 2TMDA 2VWTA 3V1PA 1E55A 4ZO9A 4REQA 4V1YA 1IT8A 1KLZA 3G0XA 4E6MA 4UQCA 1E5JA 3ALGA 4JTRA 1V3IA 4YCPA 4R33A 4V1XA 1TQJA 1H1YA 1AFSA 4FF7A 4NP7A 2NWSA 1KQZA 2FZDA 3CT7A 1K6AA 4GINA 1A5AA 2YXOA 5IRPA 4LS0A 5F4WA 1KCLA 2JEQA 2QAPA 4J28A 2Y5SA 1RLCL 2G3FA 3EXTA 1C8YA 4IQJA 1KBLA 3VCCA 1W1ZA 4FXJA 3PUEA 1KV5A 2YLLA 4OZOA 5D05A 4MPQA 3VUPA 2PE4A 4IHCA 1LQ0A 1M1BA 1GVRA 4D1IA 5HWNA 4AD5A 4AC7C 4JD4A 1UC4A 4WDTA 4D6JA 3GIYA 3NZGA 1LQAA 3P0XA 3G77A 3GW3A 3M0IA 3CV7A 4ZXOA 4MY9A 3QPEA 1KBKA 1GYNA 3W82A 1OGSA 4AW7A 2NUWA 4PTXA 5C70A 3DGBA 4QG8A 3WH9A 3M5VA 3E0IA 2EJAA 3AS0A 3K2GA 3M44A 3R8HA 1GG1A 5LIYX 2ZOXA 4PUMA 3KBMA 1W3TA 4J3XA 3H22A 2C71A 3PPCA 5I03A 3H54A 1R2RA 2UZ9A 3W1LA 3MUY1 1Q6OA 2NZLA 1E3XA 4UFJA 5F2LA 1KM1A 4JL2A 4CQ8A 3SUUA 3M6DA 2PAJA 3GR8A 4JL1A 3WK2A 3UXAA 2J9YA 1OEPA 1DYSA 1GOKA 1W3IA 4JNYA 1IXPA 3KOYA 2ZUSA 1VS1A 1PAMA 3ANUA 3LZ5A 4JTJA 1SW3A 1TKKA 4RCXA 1XL9A 2D22A 1ZZMA 1FWEC 3MPGA 1EA9C 3UWEA 2JALA 1WXJA 2GJNA 3B97A 3EX6A 4YTSA 1RH9A 4UCFA 3WDIA 4CNNA 3WUEA 1JXKA 3G24A 2OZ8A 5RUBA 3R25A 2NV9A 3NO5A 2CYGA 3LI0A 4DX3A 3EBVA 5HWJA 1LYXA 1EGMA 3MCOA 4DY1A 4ZEPA 3M46A 1IF2A 4BWLA 1P4CA 3EAUA 1J11A 3OLGA 5G2WA 1CXFA 1PHWA 2UWFA 1GQJA 2QPXA 5A6BD 4QEEA 3DG7A 4M8UA 1JG9A 5GJNA 1V4YA 1M5WA 3N15A 2XVKA 3TYDA 3TEVA 3KDNA 1HNYA 3SCTA 3GFYA 4BCEA 2OKTA 4M3PA 4GBDA 1EDQA 1FH7A 4OU1A 2QJIA 4MY8A 1B0IA 2E77A 4AFYA 1KW1A 3ATYA 2RH9A 3CHDA 4L4MA 3T07A 2A5HA 1FP8A 4H01A 1GVSA 1TUFA 4DZHA 3W22A 1V6YA 1ZL1A 3TYEA 2YJQA 7REQA 4P7RA 1ADDA 1M53A 4DO5A 4O14A 3WH7A 2OOGA 4MGGA 1VBJA 4HJFA 1OB0A 4AD4A 5C54A 1WXYA 3LCXA 1J6PA 1X8FA 3F4WA 2REQA 1PZ3A 3N29A 5A8QA 5JQ9A 1W1IE 5C9UA 4IX2A 2NQ5A 4FX8A 4C7DA 1NY1A 3H2CA 3NEVA 3L2MA 2BDQA 5FKYA 3E02A 1VHNA 5D8WA 2TPSA 2A7NA 3JZEA 1KR1A 3H2AA 1WKDA 4Z1AA 3DX5A 3A4WA 4OBTA 4S3BA 3PUDA 4DXXA 3Q67A 2R94A 3P93A 4TR9A 1SO6A 1RCOB 5ABHA 3GLCA 1JQXA 4J40A 2IXUA 2BOFX 4QAWA 3W7PA 2CBIA 1PL9A 3M5ZA 3KX6A 3KZPA 3L9CA 2Q01A 4L9ZA 3OVQA 2VKZG 3W7LA 4J4KA 5GVJA 4RZ6A 5A8GA 1XH1A 4K36A 1SUXA 3W1PA 3LB0A 5T9CE 3BG3A 4B90A 1TA3B 3QR0A 2J7DA 4ACYA 4P5UA 4M7SA 4DJEA 4RV8A 2VO5A 1ZAHA 4GC3A 3GG8A 3W7IA 4DQWA 2DQWA 2VFGA 3M0ZA 4I9AA 1KGXA 3UNDA 4I8DA 3BOLA 4UTWC 1V6XA 4R53A 2O55A 5EA9A 3BG9A 1G7VA 3HN3A 3VIFA 1GPFA 4QDWA 4HK6A 5CPQA 3T0BA 3OG2A 4AMCA 5CPOA 1UD4A 2GUUA 1LRTA 5AY7A 1XD0A 3MJMA 3LPGA 2DZWA 3OBAA 1QRQA 3APGA 4MADA 1OFBA 1UKTA 4B4FA 2DIKA 2R1NA 2J74A 2XIIA 5H2ZA 1E4IA 1YNQA 4H2HA 4HU0A 3LD5A 1W8SA 2PDWA 3AIRA 2WPGA 3GDMA 5AC8A 3O6AA 3VX1A 5I5RA 2DVTA 3IWPA 3WLNA 3MTWA 4DLFA 5M1TA 2AQWA 4LQ1A 3RXZA 2KAUC 3I7QA 5HNNA 1VF8A 4DJDA 1AH3A 1GOXA 2FB3A 1C8QA 1VP5A 4UQ9A 3WNKA 4GY1A 3CZLA 4QE4A 3DG6A 3O6YX 1TVPA 5TNVA 4PTDA 1M01A 3I7RA 2WSPA 2PCEA 4JAWA 2VZUA 1P1XA 2VR5A 5FEZA 1R87A 4CUCA 4C6EA 3GR7A 2PF0A 4KRTA 1W1TA 4ZB5A 4L4PA 3LTPA 1KLYA 3FHAA 2WANA 5K4XA 1VEPA 3WQFA 5HQMA 3O9NA 1HL2A 1QI3A 4C6PA 3PBGA 2PLJA 3F5LA 4MDOA 2VXNA 5IHRA 2GYIA 4YVPA 2GFTA 1UWUA 2VDIA 3QV6A 3T78A 5AYXA 4ACZB 4NT0A 2OZTA 4FLRA 3GIPA 3WLLA 4HJWA 3AQUA 2V82A 4V28A 1BTMA 3PG9A 4AVNA 4FNUA 4OOZA 4GMEA 3IGSA 1PZ1A 4IICA 3QC0A 5A8OA 5J5DA 4UMCA 5M3WA 4M5PA 4UZSA 4O1AA 1GW1A 3G6LA 1CGTA 1QOXA 1WDDA 1XGDA 2WKLA 2IW0A 1A3HA 4MLJA 4U5IA 1XRFA 3BOFA 1YE6A 1F73A 1PKYA 1ONEA 2V30A 3EKZA 4YIWA 2C16A 3RM9A 3I68A 1TTIA 1JF5A 1C8XA 4WX2A 3PFMA 4NNBA 1RAKA 4KEVA 4ZBCA 2WHMA 2Z7KA 1NIUA 4ZTYA 3TC3A 4DM1A 3NUKA 1PE1A 1UMLA 1DL3A 3R0KA 1MQRA 1F4AA 5D2XA 3GQYA 1K8XA 3PBYA 3FXYA 3GTNA 3C2FA 4PMQA 1EEXA 3WFZA 3FJ4A 4LV9A 1Z9AA 1REQA 5EMLA 3FOKA 2PDKA 5LNVA 4L6HA 2E09A 5LSMA 3OVRA 4NJIA 4KQNA 3BCDA 3W7MA 5EBUA 4C6LA 3BLOA 3B8VA 3NZ1A 2VX6A 5CSSA 4X3ZA 1JDDA 4J3UA 5DBTA 1IGSA 1IEWA 2PGRA 1TFVA 1XLGA 3AYTA 3O3RA 2ZWZA 2OOFA 2X40A 4E0CA 2ASHA 2ZTJA 4JGDA 1XLMA 1TCDA 3LHZA 1UPMB 2WLZA 2WW5A 1FUYA 2I5IA 2QV5A 2B7QA 2E9MA 4MUPA 3N04A 4P7QA 3E3HA 4QE1A 1O5XA 4Q3MA 3S42A 3ZT7A 3WD2A 2AMXA 2V3DA 5LIKX 3T7VA 5CAHA 3ABQA 1VCFA 2VRJA 2OKOA 3CXOA 3PAOA 2VDHA 3W6MA 4XAGA 2V68A 1PX8A 3Q4DA 3SECA 4WJ8A 1IIHA 4LTSA 3LS9A 4C91A 2EJ1A 4F0KA 3CYVA 1ZB5A 2R1PA 1R6WA 4KT2A 2J8GA 4KPLA 2VD8A 3VNDA 1CLXA 2C91A 2HV5A 2OLHA 1TWIA 1CGUA 3ZIZA 3UW6A 4JR5A 5CQ1A 5G4EA 3U2EA 2GGIA 2DQXA 4DYJA 2W61A 1XUUA 5AZ0A 2NQHA 4H41A 1MZRA 5I00A 2YGYA 1YLVA 4HCDA 4BFAA 1A5MC 2VFFA 4TUFA 1K02A 2PODA 2CLPA 2RDWA 1KCZA 5AKQA 4JQ4A 3W70A 2WLYA 4FF5A 1FWRA 1BF2A 2CLFA 3QMRA 4MFDA 3SCRA 3ENLA 3L68A 1XDLA 2J62A 4O1FA 3G22A 1VEOA 1U5JA 3U9IA 2EBNA 2VEPA 2VENA 3L5MA 2GGGA 3C52A 2GOKA 1H7OA 4ES4A 1FVPA 1P7TA 4F0LA 1I45A 2B7OA 3AHYA 3EOOA 1VFOA 4KEMA 1Q6GA 1QWKA 2NQLA 2P50A 3Q37A 5CC6A 4O11A 3S9YA 3IGUA 3LCGA 1RP9A 3GG1A 4MLRA 5AC4A 1HO1A 3R0UA 4QNWA 3TU9A 3TNBA 2WZEA 4MWAE 1SFSA 4UTTC 2X0YA 2QCDA 9XIMA 2WV8A 1TPH1 3FW6A 4FNRA 2ZRZA 3ZJ7A 5EY5A 2ZXQA 3APYA 3S6DA 5HNUA 4NXKA 3NTYA 4XISA 4EF9A 3ARVA 5MKGB 4K8EA 4OE7A 2PDCA 1JUBA 3BLPX 4EK7A 1XDMA 1PB0A 2A21A 3S5ZA 3GSMA 4MAVA 2PWUA 3AIWA 4Q8VA 1NARA 2XPKA 1KXHA 2DIEA 3M0JA 4Z17A 3LNMA 4PYSA 4LH8A 3WJSA 1B4KA 4AZHA 3CUIA 3RIKA 3QKZA 3T4WA 1DJYA 1UR9A 2OX4A 1EWDA 3ZWSA 3PTKA 1XUZA 5CGQA 1Z42A 4LEFA 3LYEA 4ADUA 2BSLA 3PB2A 1DWHM 3DFQA 4U31A 1OG0A 1QJWA 3PN8A 2XDFA 2ZA2A 1W6TA 4W89A 4CKQA 4ML4A 1JZ3A 3W02A 3DBPA 2OQLA 3VD5A 2EPMX 4Z2IA 2RDXA 3NPWA 1XIDA 4Q4RA 1S1RA 4W5ZA 2ZRVA 2VR4A 1BWVA 4GNVA 4U2YA 4H9XA 3M64A 3VKKA 1HX0A 1MYRA 4I9TA 1IXQA 3SIMA 1FKXA 3AFBA 2AAMA 3GYEA 3NQ7A 5DANA 3Q2DA 2QDDA 3FKKA 2PEVA 2YL6A 1WZAA 3CU2A 1WZKA 4B3LA 2NXHA 5DMLA 1IWAA 2PS2A 5DCDA 4WY0F 1QPNA 3GH7A 3TA9A 3WUBA 4W7VA 2OEJA 4JNZA 5LXEA 1LDCA 2RAGA 3EA2A 5LXXA 1EJUC 1I60A 3WNLA 5FSDC 2ZRUA 1S3TC 2ABAA 5D2WA 1GK8A 1UR4A 1VPXA 2QDHA 1PSCA 4QQUA 2VFHA 4JIEA 4PUEA 1PTAA 3N12A 3TV8A 1PKLA 2V3EA 3TFCA 1SJBA 1YADA 2Z28A 1C93A 2EQDA 1KD0A 2YR1A 5JVLA 4AUBA 1LLWA 3QV9A 3QY6A 1ZP4A 2O4QA 2WVVB 1W5QA 4YVXA 2CWNA 2PU1A 2OQYA 3PTQA 1YXYA 3NPUA 4PMJA 2V67A 3P82A 2ZDRA 3VIKA 1WDRA 4HPXA 4IMGA 1EC7A 5HK4A 4C90A 1AQFA 1BG9A 4DLMA 3VK5A 1B31A 1K9FA 5HA7A 3RCYA 3GHTA 4AWUA 3IIXA 1L2QA 2Y61A 2WHLA 1H7NA 3UWYA 2CU0A 4GUIA 5ABFA 1J5TA 4FOUA 4XUYA 1XBYA 4KIEA 3CIXA 1EXPA 1F3EA 1UIOA 4M6VA 1RVGA 3L4ZA 3NQAA 4O8AA 1LT8A 3O06A 1F8MA 4X22A 4DVOA 5F7UA 2OWXA 1RXOB 2DJXA 4HTBA 1S2CA 1VYRA 2C18A 1SR0A 4ZE4A 1WQ5A 3WQOA 1EDGA 3ONBA 1KGUA 2E9LA 6REQB 1VKFA 1CW2A 4NAEA 1EXBA 2Z26A 3AMDA 4LV4A 4W9TA 3EB2A 4KRZA 3PAJA 4G56A 4Y9PA 2RJHA 3WZ0E 3F7JA 4Q8UA 2PU0A 5FESA 3W73A 3THAA 2R6OA 3ARTA 3HG4A 2HQAA 3AMKA 4AZBA 3VIMA 3LRMA 4J2MA 3GY1A 3REQB 2NV1A 3VGDA 1I2NA 4Q8NA 4MWAA 2NQZA 3NSNA 2UY3A 1Q5MA 4JX5A 1JL8A 2QUUA 2Y7DA 2Z2AA 3UWQA 1V6WA 2GJXB 3W01A 5I79A 4XAYA 2A7PA 3BURA 2YX0A 2V3FA 2F8QA 1Y5WA 4ICCX 4O15A 1VAHA 3CUXA 4I6VA 2ZQ0A 1FKWA 3UJSA 4HNNA 4RW5A 2OWCA 5KZMA 2DEPA 3PZ9A 4TTGA 4PUUA 3RYSA 3I7SA 4NIRA 1FHVA 2PTZA 2R8WA 1VRXA 2E9BA 1M03A 4MPKA 3IS4A 3T05A 1CTNA 2V81A 5I02A 2OLSA 2BXVA 1BWKA 1B90A 4AHOA 4INFA 2HWGA 3FYPA 3NL2A 3NQBA 3KP1A 4MKNA 1NQKA 3PPHA 4L9YA 2ZC8A 3P74A 3BGAA 3ONCA 5FF2A 3UD6A 1UWIA 4EPKA 1TCMA 1THFD 4UOZA 6PTDA 1MW3A 1RCXB 3AHZA 3M16A 1JYNA 1GPWA 4R7OA 1N82A 1FBAA 1YPXA 3FKRA 4KWVA 3UJFA 3UR2A 1EDTA 2HCVA 3QW3A 1S5WA 2CPUA 2GGEA 2G50A 2QCMA 1FWBC 4IMCA 3RAOA 4C6JA 1I75A 4GI6A 2PP0A 3JS3A 4POCA 1X38A 1LOQA 4KCTA 2AOSA 2V5BA 4QCFA 3BLKA 4P8UA 4AX6A 2QJHA 3PSVA 5HNTA 3OLDA 4NF7A 3ZR4A 3N9SA 2WBGA 4AEOA 3WQEA 5I3JA 4AIOA 2ZUTA 3LUTA 2OVLA 4IIEA 3WCZA 3TQVA 3KVKA 2PWVA 1GTEA 3VDBA 3CTTA 3GNXA 3UF9A 1KV8A 1E71M 4IQEA 3AC0A 4NSBA 5AYIA 4ZA0A 1XCWA 1P1MA 3KS6A 3ARUA 1LWIA 1N2VA 1J0HA 1XX1A 3U2OA 4L4LA 2XISA 1TJPA 1J79A 4N9DA 4XQ6A 3D3FA 1ONXA 2GVYA 3SO7A 4AF0A 1GEHA 3LGGA 4K68A 1AQMA 1WP6A 1QI4A 2QT3A 3W7DA 1GYLA 1HG3A 1FWCC 3GXNA 1VBGA 1W1YA 3UZ5A 1E4LA 2Y62A 3O1NA 2ISVA 2POZA 3WLPA 2V2CA 4GCXA 3H2MA 2HROA 2CZDA 2GQ8A 1IWBA 3BW4A 1XLBA 3TNOA 5BROA 4WOZA 3TJLA 3GVWA 4B4HA 3S2LA 4IIHA 2RFGA 2PP1A 4FXRA 1E9ZB 2FVMA 2CKRA 3P3BA 4EPDC 1UWQA 1AW1A 2I1OA 1W8GA 3VCNA 2VOTA 3ZSTA 1TPC1 1RY0A 2GUBA 5BRBA 4RR4A 4ENLA 2GQAA 4IIBA 1FX6A 5M5DA 4G7EA 4DBEA 1OYBA 2Z0IA 1T0OA 4DBDA 2GK1A 4JIHA 4LYQA 2VRKA 4XZWA 1LG1A 4LS2A 1KRBC 3L0KA 4YPJA 4YN5A 2ZC1A 3BARA 5IDZA 4XIMA 3W7QA 3AMCA 1WUEA 3QGVA 4MB1A 4PMZA 4GZIA 4BI7A 1CLVA 3NWRA 1DP0A 3A4AA 1PVNA 1VR6A 4FEZA 1OZMA 4Z2JA 5FJRA 5BXSA 1H1ZA 3F5KA 5T26A 4US5A 4ZFMA 3PBUA 4Y96A 4LUJA 2NSOA 3HG5A 3U3HA 3OGVA 3EDDA 2E28A 4GYKA 2WMGA 4IJRA 4YXGA 3R7MA 3V5CA 7ENLA 4GH1A 1NWUA 3AYRA 3IPWA 3CASA 1UP0A 3R1ZA 4YWIA 3WN6A 1ZQ5A 5AHIA 3HB9A 1EJRC 4O4WA 4ZOEA 2CLOA 3C6CA 5C2CA 3G6MA 2Q3RA 5TD4A 3N6JA 4XKYA 1Z3NA 1FCQA 1QWGA 1DORA 1TSIA 3GDBA 4H6EA 3OGRA 4RZ4A 2CZFA 1WV2A 5A2AA 1XYFA 8XIAA 2E5DA 3TSDA 3H53A 3IIOA 1LTDA 2VGFA 2RDTA 1POKA 4ZR8A 2QCHA 3BUVA 4MTVA 3DESA 4QJ1A 3FXGA 1OX5A 3QQ1A 1NDZA 2R1KA 3VOJA 4ERGA 2OEMA 1LORA 4HNLA 4Z1DA 1QI2A 3N2BA 4I6KA 1E0VA 1SYTA 3GW0A 5H8PA 5LIXX 3RUBL 1J01A 1JPMA 3POCA 1W3JA 3PWAA 5HR6A 5HBFA 1OFQA 2JGQA 1H7RA 2ISSA 4GFIA 3WMBA 2VELA 4N7QA 1XLIA 3FX4A 2GVGA 2W62A 4MZ1A 3LXAA 4KF1A 3VINA 1E40A 4K39A 2DZUA 1OHLA 4L7ZA 2Q8ZA 4WJXA 4LYKA 2INFA 4AISA 3N2TA 4GY7A 3CAVA 3DG3A 4MNKA 4O54A 2X05A 3DHUA 4WDXA 1P43A 2P5NA 4GQRA 4NI8A 4XO7A 4JS3A 2CC0A 4NJKA 1UUQA 3UZXA 3JZUA 3LCWA 2MANA 3WEOA 1T8XA 4S23A 4PUJA 3VD4A 1XYLA 1GVEA 5LHEA 4GVFA 2PFHA 3UR5A 2I14A 2PDPA 3MMWA 4C60A 2JGYA 5IOBA 3HPFA 2PDBA 3V0TA 4W5UA 2W0UA 2JKPA 2JKEA 4CCZA 1XWYA 4C1LA 5IBXA 2PRMA 3VNZA 1TR1A 2QYGA 2BP1A 1T7LA 5A5WA 4ZQNA 3H12A 3B0XA 3KBNA 1EC9A 5FEXA 1KFCA 2DSUA 3AO0A 2OEKA 3O6CA 2RKXA 2ZXAA 1GOQA 3WBXA 5GNZA 3MCMA 1YDVA 4C7FA 2FHCA 4HOWA 2YBVA 2G96A 4FB7A 2IPWA 1KFKA 4BQ4A 4WSHA 3UXIA 1W17A 4AQLA 3C0JA 3AWOA 1VFMA 3SCNA 4UQEA 3SBFA 4M82A 2Z2UA 4R9XA 1TV3A 1UMYA 4AWEA 4A8RA 4C6CA 4XAZA 1X1NA 3WBEA 1FHDA 4MMWA 1KXQA 1C90A 3C86A 4LSBA 1ZBVA 3FEQA 3VNMA 1GJWA 2ZBTA 4S2BA 3V5FA 5EMMA 4OECA 1WE5A 4UNKA 1RD5A 3FGCA 3W1NA 4LX4A 3HMJG 4HU4A 3OB8A 4PA8A 3EOUA 4O1DA 3PP7A 3B3DA 2FGBA 1RQHA 4D9PA 5FL0A 3DKJA 3AZRA 1L6WA 4GRSA 2XM2A 2ATMA 1TREA 1NWSA 2QF8A 3LXCA 3AHVA 2ZUNA 1UZ1A 2F6XA 3LM3A 1I2OA 2EPLX 1O6IA 5GNYA 4UBPC 2NQJA 3ARPA 1TPDA 4PC8A 1VPYA 3CUHA 1PX4A 3SSJA 3A22A 2W91A 1UOZA 2J78A 3QQWA 4BZYA 3RRAA 4DPPA 2VZVA 1OFPA 2FVKA 1RV8A 3FYYA 3NVDA 4HU8A 1DJNA 3ZVHB 3IGXA 4FSAA 3TYZA 2OT0A 3SCSA 3NPXA 4PMOA 1GVOA 4IF2A 4KMQA 3CAWA 3PK7A 1G9HA 4GUFA 3H55A 2I56A 1GJPA 1QW7A 3OZMA 1K3UA 4IFOA 2FDMA 2QGHA 2V3GA 3M7SA 1S2UA 2NV2A 2ZTKA 4UTJA 3KDOA 5AYYA 3STFA 1AA1B 2FTPA 3MCNA 2GL5A 2QEZA 1PYMA 4H83A 1AVAA 5KEZA 1LWHA 3VIGA 3NYDA 3W7OA 4BS0A 4JFUA 3UR7A 1JYVA 4JPGA 1R47A 4LJ3A 2VZOA 3LV6A 3CEPA 1RBLA 3BG5A 3P5ZA 3GNDA 4B5SA 2YZRA 5REQB 1XLLA 1QNOA 1KB3A 3UJEA 4YCOA 1L6SA 3H24A 3VKJA 5DT5A 3T1GA 2E4TA 4X60A 4QJ5B 4CQAA 1XSJA 2G3IA 4EOUA 3EEGA 1V77A 2QV4A 2XSXA 4DWSD 3R5EA 3IARA 1CEOA 4MB5A 3C2VA 1VENA 4ZQCA 1U5HA 3P0WA 2NX9A 3C2RA 4QX4A 3U0HA 4JQ1A 3M9YA 4PUDA 1Z32X 4RDWA 4HVXA 5EB8A 3EDFA 5FI8A 4ZQPA 3MY9A 3KVMA 4LANA 1F07A 4FALA 2J79A 3KRUA 3VZXA 2FGZA 4H7ZA 1P0EA 1OC5A 3EXSA 4PMVA 4M1RA 4GE8A 1W3HA 3JW7A 4CNOA 1GJUA 4G5DA 3NO3A 4IIGA 3LCHA 3MJYA 4KETA 1JZ2A 2YXGA 3VGHA 2A3AA 4HU3A 3WNMA 4MG4A 3PZQA 2DVUA 4YS1A 1T96A 3WF3A 1TIMA 1K4GA 4PSPA 3FAWA 2QUVA 2QVNA 1HKWA 1TG7A 3L4XA 3HOJA 2HBXA 3IIZA 2XZ9A 4OT7A 4WEVX 4BY3A 4LF1A 4OBRA 1RA5A 2VEIA 1FTXA 5D04C 2BBFA 4JTDA 3PS7A 3TLQA 7XIMA 1Q7ZA 2DUZA 2QVHA 3GVRA 1ML1A 3HGOA 4JTIA 4RK8A 5AVNA 2R24A 1PIIA 3B8IA 3W87A 3H21A 4WY0B 3BVJA 3EOEA 4XX6A 3QV8A 1JCXA 3QVQA 4J3SA 4AZ5A 3SY5A 1VFFA 5D9NA 5DRIA 5HNRA 5AECA 1XR2A 2AGKA 2DU2A 3N6HA 3WQPA 1GNXA 2VC5A 2A3LA 4UTWA 3WLSA 2ISFA 1AW5A 1TMQA 3TTYA 5A8PA 4DJDC 3VIOA 5BMXA 4DUXA 4WJEA 3SB0A 1UCWA 4K3ZA 1H41A 1CI1A 4JTLA 9XIAA 4RUBA 3WQ4A 1HKJA 2H3DA 4FR1A 4XAFA 3IJDA 4JTHA 2F38A 3SURA 4M81A 3TMQA 3B04A 4LFYA 2W79A 1HJXA 3PFRA 3H7VA 4XBSA 1JCYA 1F76A 4D6GA 1SR9A 1ME8A 3UZWA 2Z1BA 4XZNX 1EFZA 1OF8A 4UCGA 1ZY9A 1UJPA 3C5QA 2ZX9A 2AL2B 1YMYA 1TTPA 3UERA 1QO5A 3VM5A 1KRAC 3LHVA 4BA0A 1E0TA 2PUZA 2NX3A 1BLIA 3AUOA 2WMJA 2D69A 1JZ5A 2PDUA 1R2SA 4P2VA 3LQLA 3UA4A 4I5RA 3QPZA 4LVDA 1OF6A 4GJ1A 3U7VA 1HGYA 3EXRA 3IRDA 4EVZA 4TXEA 2PCQA 3IK2A 1ISWA 2DSVA 2WKJA 3HTWA 1KTNA 2GJLA 4PCTA 4QS6A 2Z6IA 1VFLA 2QPSA 3NQFA 3CBWA 1E6RA 3NDYA 3BC9A 1Q6FA 4DUWA 3OU8A 1UWAA 2O92A 4M6QA 4U4MA 4XAPA 1V03A 4PCPA 3N4AA 4L61A 1EYWA 4Z1YA 3ORWA 2ZXBA 1K70A 1E1FA 1OM0A 3IVTA 1VZWA 1W0MA 3QQ0A 5K9CA 3O7UA 4D2JA 4HPNA 1ONRA 3I4EA 4MKVA 3MI3A 1R3SA 3E9AA 4LPCA 2CESA 5A8MA 3QR1A 1EX1A 3VGFA 1KRCC 1ENUA 2ONEA 2HMCA 1EB3A 3ITTA 2TAAA 2C0HA 2D2HA 4Y8EA 3LGDA 3ZO9A 3C56A 3SCWA 5CPTA 2ISWA 4QROA 1P5BA 1POJA 4A22A 5CSYA 2PA6A 4WXZA 3R11A 3HZ3A 3WBWA 1W9XA 3SCPA 1XICA 5LA0A 2POTA 4NILA 4LVAA 2HNEA 4XZ9A 3T4CA 5DXYA 2BOGX 1I6NA 5XINA 3I4KA 1VFUA 1D9EA 4WKFA 4JKMA 4LAUA 5CPNA 3HPAA 1WNOA 1LP6A 3CZJA 5CAKA 2WNNA 4HZ6A 5DX7A 3NQ2A 4ZO7A 5EFFA 2DUAA 4OKDA 4AZIA 1TIWA 3HGRA 2PDIA 4RNFA 3MYPA 1GW9A 3N3TA 4RNIA 2A4AA 1FWJC 1GOWA 3GD6A 1AZ2A 1N8WA 5J8LA 4K8GA 2A3HA 4TU1A 3LLXA 3TX9A 5BCAA 4IQDA 1XIEA 4NNAA 3MP3A 3ARRA 2KZHA 1CIUA 1NJJA 3GG0A 1XQKA 3VNIA 2Z2BA 2OPJA 2HISA 3IVUA 3IUDA 1HQTA 2Y4SA 4JIPA 3WUFA 4OVXA 4A8IA 3KE0A 5JU6A 2IKHA 3MMUA 4HA1A 1BTCA 2ZX7A 3H2OA 5FJTA 2GDVA 2E1WA 2C79A 2Y6ZA 2X2GA 4NHVA 1QHPA 2B31A 1NOWA 4OQVA 3SRDA 3QRHA 3M41A 4A21A 1GQNA 3MZ2A 4M51A 2P0OA 3OZPA 3LN3A 3LPPA 3STCA 1DJXA 1FWAC 1LM1A 4ZZ9A 1IT7A 4GI9A 3DI0A 3EX3A 3MWCA 3T40A 4YNGA 5KZEA 4LAMA 2NW0A 4PB4A 1EUAA 1PCWA 4QNEA 4AD1A 1QUMA 1SW0A 4Q6XA 3R89A 4P8XA 2X0HA 5BXTA 1NDVA 3LOTA 1UKOA 5C7HA 1EHNA 1XG3A 1AJZA 4GYPA 3WL0A 3BAYA 4GYFA 5I3IA 1EF3A 1V7AA 3WQDA 1G6CA 3LU2A 2YCLA 5LGZA 1WDPA 1WDSA 3LBOA 2BGSA 1LUCB 4FMVA 5LGXA 4G1KA 2E25A 5HDRA 3L7RA 4DELA 4PMRA 2I17A 4ECLA 3TFXA 3TW9A 4ZB2A 2X1RA 5HMDA 1DPMA 2C15A 3EA3A 3B0VC 3B9EA 3ISIX 4UFKA 4UTTA 1UP3A 1ITXA 4TVCA 2E5CA 4ZVJA 2ZIDA 1D8WA 4CU6A 1M68A 4Y7EA 3AXHA 1B2YA 4PN2A 3P80A 5HINA 3MU7A 4RX0A 1A0DA 4DJFC 3NPVA 1RZMA 3WG6A 4ZSTA 4PL2A 2QULA 4ICMA 2WB5A 1OYCA 1DE6A 1IZCA 3TYAA 4WXYA 4DO4A 4XZBA 1UZHA 3UCDA 5CZ0A 3HBLA 1XBXA 4PUKA 2HNHA 2WMIA 4AB4A 3PZGA 4PSRA 4C6OA 3NQVA 3JRKA 3S1VA 4IOTA 2CLHA 1PIFA 2VJXA 3O8AA 1K8CA 2Q8XA 2XIBA 3SFWA 1ITQA 3RLGA 4AIEA 1K9EA 3R12A 1XYMA 1DWJM 2EPNA 3VNJA 1Y7VA 3MDUA 2DT1A 3VGEA 3S1WA 4FXFA 4XBJA 1YPIA 1WBJA 1A5LC 2RGLA 5CG0A 5I07A 2PTYA 1T5AA 3PULA 2EG6A 3W38A 2XJ7A 1BKHA 3GU2A 4O12A 3RR1A 3EGJA 4RDYA 2CKSA 1H61A 2X7WA 2R14A 1FDYA 2X1UA 1KO0A 1OD8A 3KOWA 2E6DA 3HV8A 1F6YA 4Q7BA 4QS5A 4UQAA 4GQ0A 3HPZA 4YHEA 4UQBA 5T9BG 5DN1A 3ZJ6A 4QP0A 4EF8A 4MNJA 4AIBA 3EKGA 2IQDA 1MXSA 3WSUA 1OC7A 3CUFA 2WNQA 3GTHA 5I06A 3SCOA 1JPKA 3G8EA 5HMFA 4Q8TA 3TOYA 2OB3A 3F1QA 3BTNA 4ZB0A 4KFNA 4TX8A 3AROA 1TMLA 5JBFA 3SQMA 3KVLA 4REQB 4GXPA 3IGHX 4HZMA 5DY2A 4MUZA 3NQ6A 2ICSA 3O07A 3G1HA 3TIMA 1SMAA 4GOAA 3DAQA 5F1UA 2QZRA 3PJXA 1JULA 5I23A 3EWUA 5BW6A 4KESA 1WUFA 1UD3A 5DQPA 1I1WA 5HANA 4B9ZA 3KCOA 3PB0A 4C1NA 3TYCA 4MM1A 1W2VA 1E6PA 3GXTA 3GG7A 3CWHA 2INZA 1RUSA 4LAKA 1ZBCA 4HCLA 3TJIA 3FYOA 1LRQA 1O1HA 2KX9A 2WYSA 3WBYA 4KWWA 4GACA 4LVGA 3WK1A 1O7AA 5KZDA 4WDUA 2OELA 1AK5A 5HMSA 2F2KA 2RHGA 2MUCA 5IFPA 1VC4A 3WDQA 1EZWA 3H4GA 3KBSA 3LERA 4MWAC 4FOJA 3WEZA 2V9DA 4PBEA 4RPQA 3A13A 3MC5A 3PZMA 1MO0A 1PBGA 1A50A 1PS9A 1DJZA 3C0QA 2Q3OA 4PMYA 5K4ZA 1DJWA 2PLCA 4NRRA 4ZTXA 1FWWA 3RPDA 2D23A 1ZLPA 3HF3A 3G1RA 2BHYA 3TCEA 4GCAA 1XIJA 1QO2A 1MQQA 1P0DA 4O19A 1JZ8A 4IGHA 3L5AA 2A79A 2W5FA 4FIRA 1TWDA 4W87A 3QR3A 5FF4A 3C61A 2HE8A 4AWSA 3SI9A 1B5TA 3NSMA 3VVGA 4NJJA 4CNUA 1W91A 4GPNA 3CMJA 1EYEA 4PRRA 3O63A 1HP4A 3ZMRA 3VD7A 3U7BA 3CPRA 4JX4A 5JIPA 6TAAA 3IAQA 1LBFA 4Q8QA 4PCNA 4H9TA 3LCFA 5LIWX 4URIA 4XO6A 3PTMA 1M7JA 3W81A 1UR8A 2JK2A 2PSNA 3A5VA 1R9ZA 4M80A 4O17A 4QEHA 1MUCA 1OG6A 1BQCA 2I5GA 4WGXA 3MSRA 2Z7GA 3FAXA 1K7FA 3HQ1A 4GQGA 1TV8A 5F4SA 3STGA 4XD4A 5A6BA 1E0XA 2H90A 5TQLA 4E4PA 5M2FX 2FTYA 3SIZA 2J9XA 4UFLA 1HJQA 6XIAA 4HBKA 3U48A 1R5YA 3T0DA 4IP7A 3G1VA 3TW7A 3WDRA 2QJNA 1UR2A 5BYWA 3AYSA 4EIVA 5KZ6A 4Z2LA 4OV4A 1M7XA 2BY1A 3S8HA 2Y8KA 3T2OA 4L1GA 1E5NA 6XIMA 2EG7A 5C9RA 1IT0A 2PWEA 3UY7A 1MEWA 4G7FA 3SJNA 2W9MA 3UZYA 5LNWA 3NZPA 1SZGA 3INPA 5L9FA 4ROQA 5CKSA 3AJXA 7REQB 4BF9A 1YDNA 3R6IA 3N73A 1MSSA 3LZ3A 3WIJA 1HJUA 1DXEA 1FP9A 3CLMA 2OZ0A 3OQEA 5FJJA 3AI0A 3S3GA 2H9AA 1DIOA 2REQB 2GOUA 4TMCA 1G94A 4GHRA 1U22A 3N4EA 1G7UA 3U5UA 1PCKA 3B9OA 1VCVA 3SY1A 4KWSA 1ZJIA 3A3WA 5FACA 3W7NA 3KHJA 2A0NA 4DO7A 4TV5A 4JN6A 1J2WA 3QSTA 5I3DA 4CQDA 1E6SM 3EWXA 1DIKA 5HJLA 2X09A 4HQVA 3IV3A 3MBDA 5E6ZA 3CZ8A 1SSDA 1DHKA 2WC3A 1PKMA 2X1IA 4MFEA 1YQ2A 1PV8A 2YB1A 3VABA 2ZCGA 1TV4A 3V35A 4LALA 3FA5A 3YPIA 2OQHA 3CWOX 2YYUA 3KUMA 2XSBA 3AXMA 3MKKA 1IEIA 4N6EA 4D6CA 1W56A 1K7EA 1UKSA 1LBLA 4L1XA 1IR1A 3NQDA 2OX1A 5C6MA 5IFTA 3TXZA 2A6NA 5C2GA 1YBQA 5ABTA 2OO0A 2WOQA 4H9VA 1VYPX 2FIQA 3G0SA 3GWQA 3N2OA 2UBPC 4IQLA 5GJMA 3B4YA 3AZSA 2C14A 2IPJA 3OOQA 2CZVA 2DZPA 3PANA 5C9WA 4KWUA 2ZE0A 2WJDA 4TO8A 4DHGA 1H0GA 3QJAA 5AN7A 4OIFA 1H3GA 4N9CA 4PRWA 4D6IA 3Q58A 1JRCA 5BU6A 3DZ1A 1RCQA 3WK0A 4LNCA 2C1GA 3MO7A 3C2EA 3RM8A 4LCRA 3TWBA 3GHRA 3CTLA 3L23A 4UQDA 1VJSA 1X96A 2A2IA 1XKJA 3QZAA 5D9MA 4FA3A 1BGAA 1TZZA 4GZ7A 3F4DA 4ZCWA 2BY2A 2EPHA 5EMKA 5G4HC 3WELA 4A6GA 4G9PA 4AXNA 3GIQA 3DHDA 2PBGA 1W3KA 3UG3A 4OOUA 3EA1A 1VLIA 4Y90A 1OFAA 1JR1A 3GM8A 3EX1A 1TWWA 1ZCCA 2R1MA 1JRBA 3VCRA 4RDZA 4FLSA 2YDSA 3NQEA 1JCLA 3VA8A 1BKSA 1N55A 2DW6A 4HMCA 1B54A 4F79A 1VIWA 4KKXA 2E1DA 5E5CA 2BS9A 4GO9A 3RLHA 1A80A 4JTTA 4XZIA 5CJNA 2BX7A 2NUYA 3TQPA 3NL6A 4O8RA 2CLKA 1IZJA 1KCXA 4H8NA 2X8RA 1XRVA 1S46A 2ZX6A 4FNPA 5C9ZA 1W1B1 3QOKA 3N2XA 2Y7EA 4GH3A 3VYLA 1AG1O 4NAFA 1SJCA 3W74A 4NZ3A 2O7SA 3CK5A 4K8HA 3MB9A 3W1RA 1OCNA 1F05A 3VILA 2CLIA 1UR3M 1IR2A 3TR9A 1X6UA 4G8TA 4RJEA 4E2VA 4H00A 2F6KA 3S9ZA 3S47A 2QQ6A 3HA1A 3OEXA 2JF7A 2VGGA 1K9TA 5CZKA 5TAOA 3UNTA 3VI2A 3TAOA 3LTSA 5IBXC 4F0MA 3GAYA 4JTCA 4EPBC 4TIMA 4HMEA 3U4FA 5JBEA 3G18A 8RUCA 4D6DA 4IIFA 1L6GA 4H9YA 2VM8A 4WVXA 5MHBA 3D47A 3VUSA 1MW1A 3G1FA 4JCLA 4N6FA 1T40A 5H8MA 4AAJA 1YNYA 1EP1A 3RFAA 3K1GA 2VX4A 5IM51 1REQB 3PZTA 1MMFA 2E6FA 4NVTA 3LGEA 3VFLA 3W2MA 4S2CA 3EKLA 4GIYA 1MDRA 1JCTA 2CZEA 1J0JA 3L4UA 2ZE3A 3GU1A 1W5PA 3OVPA 4IMDA 2Z29A 2PF8A 4ROPA 2PGEA 4W88A 2AAAA 1WAUA 1H7XA 4XV0A 2E8YA 3PTDA 1VQTA 4MHBA 3W83A 3CHFA 1QT1A 4QSFA 1JCMP 3KTSA 4WCJA 2V0TA 2XGBA 1K9DA 2WK2A 1FCVA 2OU4A 1TV5A 1PWMA 2CLEA 4AXKA 3V5OA 3NFUA 1X39A 1S5VA 1OT1A 3QBUA 3A12A 3AUJA 4KBXA 3W72A 1Y65A 4C6MA 3GBDA 3VIIA 1HW6A 3IV8A 3L0GA 3BMWA 1H51A 4XD6A 1V51A 3G5EA 1DQXA 2JIEA 3W7RA 3TZNA 3IJIA 1ISVA 3GR4A 3VZYA 3B4UA 1B3ZA 2F6UA 3ABSA 4PGLA 3L0NA 4JY9A 1EQPA 1XINA 1Y5XA 3K13A 2EG8A 1R3VA 3B03A 2GUYA 1K4HA 1GQLA 3EPMA 3BAWA 3NVTA 3NM1A 2BLEA 1W1VA 5I0DA 1KGWA 3IK4A 4A35A 3LY0A 5D02A 2E5BA 2HPMA 2OYLA 3MVIA 2XH7A 4ERAA 2XIJA 4JHZA 2PTXA 1PDYA 2W3ZA 3WLTA 1NM9A 2Z1KA 3CJPA 3T0CA 5C8BB 1AJ0A 5CJ5A 4IG2A 3W1TA 3DUGA 3S5YA 4AMAA 3BLLA 1TYGA 3CB8A 1GUVA 2A3BA 4LXFA 4PTVA 3EMQA 2J7EA 2VTFA 1NTHA 1P7TB 1WBHA 4WGHA 5LYRA 2EF9A 2VT0A 4JXCA 2WBKA 1UW9A 3CL7A 4UTFA 2QCDB 3QY7A 4FHAA 1RR2A 4AU0A 3VNKA 3E1F1 2PTDA 1LROA 2GSEA 1EGZA 4I9MA 3PBWA 1XLCA 3QOMA 3CZGA 5IHSA 2CETA 1EGVA 3VNYA 1AH4A 4R27A 3AS1A 4LUYA 4RNHA 1VFSA 4CNTA 3O6DA 4K7YA 2HTMA 3TW6A 1T41A 2ALDA 2VP8A 3D46A 3E2QA 1X1ZA 1KWGA 1H62A 2VI0A 4AD2A 2Q02A 3QV7A 3S4TA 2YDAA 1Z89A 4GO8A