2QCMA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain (asp312asn mutant) of human ump synthase bound to 6-hydroxymethyl-ump
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
257
structure length
256
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFENRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 100
structure length 256
sequence length 257
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qcmA00
2DJLA 2ZRZA 1SFJA 5KINA 2Q8ZA 1XBZA 4OBTA 1ME9A 2CU0A 1K7XA 3ZWTA 4JYEA 2YDAA 5CGQA 4ICNA 1GVSA 3EX3A 2ABAA 4O16A 1W1ZA 1JRCA 2A1YA 3QC3A 4O0KA 2G96A 1XBYA 2PURA 1PS9A 4HNNA 1TJRA 4MOZA 1XUUA 1H1YA 3PBWA 3A23A 3B03A 3NG3A 1PHWA 5CPNA 4WUIA 2HMCA 1OFPA 2Y70A 2QCGA 1P4CA 4W9TA 1XBXA 4WOZA 4YLWA 4NJHA 1FX6A 4TIMA 3EXRA 5HJLA 3FIGA 3PBUA 3CU2A 4Y9AA 2PCQA 3GKAA 3GDMA 3C0JA 4RV8A 4IMDA 3W2NA 4Y8FA 3GB6A 1QO5A 4IMGA 3SIZA 3MHFA 2B4GA 4MYXA 2A6LA 4ZQRA 3S1XA 3C2FA 1PV8A 1FCUA 3I7RA 2YZRA 4UTJA 3TAOA 2TMDA 2W0UA 3LV6A 1LBLA 1R47A 1KFEA 2E6DA 1PHQA 3BG9A 1B57A 3NNTA 4N02A 3PR2A 5DCDA 1SZFA 3CQ0A 3W1RA 3G24A 3ABRA 1FY6A 3W7RA 3CEUA 3WK2A 4CNPA 1A53A 3BW4A 3IVTA 4CCDA 3DGRA 3G1SA 3RNDA 5FEZA 3EWUA 1J2WA 2R8WA 1B4KA 2PRMA 2X1RA 4UMCA 1T99A 2VFDA 4O50A 1JCXA 1YXCA 4WY0F 1OFOA 3W9ZA 2Y89A 1OFDA 3EWZA 3KHJA 1R46A 2BTMA 1YDNA 4EVZA 3F03K 5LKYA 2R91A 4GJ1A 2Y7EA 4Q32A 4UFHA 4O57A 2QUVA 3C2EA 5FESA 3QSTA 4NZJA 5CZ0A 5AB3A 1OF8A 3W86A 3L21A 1L9WA 2ZYFA 4RX0A 1KM4A 3QJAA 3NOEA 2V0TA 4LC6A 4LVFA 3NEVA 4YL2A 3L5AA 1KLYA 4AVFA 3L0GA 1OF6A 1TPC1 3N9RA 1DKWA 2NZLA 3QQ1A 2FIQA 2VELA 2GQ8A 3TSBA 1B3OA 4OU1A 5E93A 4UFLA 2B7QA 4IGHA 2C19A 2VENA 1IXPA 1XUZA 2FLIA 3W73A 3RFAA 1AW2A 4DO5A 2QKFA 1T0OA 2J9ZA 4HIBA 3FKRA 2ATMA 4UIOA 1TV5A 1QPRA 4FB7A 3GAYA 1TO3A 3RF9A 3DH7A 2TSYA 4O1CA 4S1FA 3SR7A 3MI2A 2KZHA 4NJJA 3H55A 2V2HA 4AMAA 4G1KA 2HSAA 1KM1A 2YFOA 2W6RA 1FCQA 5FF7A 2WQPA 3L9CA 1ICSA 3R8RA 4UNKA 3TW7A 3LLDA 1TRIA 3O1NA 2QCFA 3DKJA 1W54A 1IXNA 3LRKA 3S1UA 3TC7A 1YXDA 4NQ1A 4UR7A 4ORMA 1KW1A 1TQJA 3S5NA 5CSRA 3BW3A 1EX5A 2DZSA 4X9SA 3TH6A 2B0MA 3JR2A 3C4UA 1Q6QA 3C2VA 3PULA 3N14A 3NPWA 3W1AA 4R33A 3KVLA 1JULA 4UTUA 1B4EA 2RH9A 4MIMA 1O5XA 1SQ7A 1VZWA 4OE7A 3P5ZA 1AW5A 5FF0A 2X1TA 5IBXC 4I7UA 2WPBA 2ZFAA 3AO0A 3TSDA 3FS2A 3P67A 1NEYA 2P1FA 3ATZA 1WYIA 3KRSA 2ALDA 4FF7A 1YYAA 4LRTA 1GTHA 3EWBX 4JX6A 4O28A 3W88A 2Y7GA 3NQ2A 3G1XA 1Q6OA 2YFNA 4FXSA 4KWVA 1OFBA 3WJXA 4Q33A 1LBFA 1YDOA 2YSWA 4LV4A 3G1HA 4GC4A 3NL2A 1JUKA 1VHCA 2CZ5A 4UFKA 5EMUA 3KRZA 2NWSA 1Q3NA 1RQBA 5D09A 2Y7DA 3TE9A 2ZZ3A 1OYAA 1XDLA 2NX3A 4GWEA 3WJSA 2EKCA 4CQAA 5CPLA 1ZAHA 2VXNA 4JY9A 1WQ5A 4YCOA 3T4CA 4BWLA 4MZ8A 3LX9A 5FF3A 4A3UA 1Q45A 1HL2A 3DI1A 5G4WA 3M43A 3W7KA 3M7WA 2B7PA 4Z0SA 1FBAA 4ZL1A 4FEZA 3MI3A 5G5IA 1G4PA 3LBMA 3W7OA 4NJKA 5G2HA 4LOCA 3BGGA 1F05A 1JCLA 1KA9F 2I14A 1VHNA 4EIVA 1T96A 3NO5A 1LLWA 2FB3A 1LZOA 2HS8A 3LV5A 2X1SA 3E12A 2QUTA 4UR8A 1EIXA 4O19A 1FCVA 4LW7A 3N19B 1K8YA 2E68A 1H7OA 3QEZA 3MJYA 4QITA 4DBEA 2XN2A 1NAL1 5U7SA 4LVGA 3QPZA 2CLMA 1A5BA 1QWGA 1TSIA 3B05A 3G0SA 4QM1A 1KM0A 1N55A 2QCMA 4DO4A 3DFOA 5LHFA 3O15A 4K7VA 3LCLA 4I7WA 1LROA 3QPYA 4XQ6A 3W71A 1LBMA 4QJ1A 3BW2A 3VFLA 2F7FA 4Z1DA 1LRNA 4ALDA 1JUEA 2CZEA 4AHOA 4AHQA 1TYGA 2H8ZA 2VEPA 1NF0A 3MHGA 1ZCOA 1WAUA 2G95A 2VFHA 3FYOA 3MWAA 1LRTA 2J6XA 1ZAJA 2XFWA 3LXAA 4QQ3A 3G8EA 3LLFA 4MY8A 2AAMA 3HJZA 3LM7A 1X6UA 3B4UA 3HPZA 1LTDA 4MPQA 1G67A 1RPXA 1HG3A 2HTMA 1I2QA 2ZZ2A 3N9SA 4JYDA 3HG5A 3QW4B 2NV1A 4BI6A 4RZ4A 1EP2A 1VCGA 3CT7A 2NUXA 1XC4A 2H6RA 3BG3A 4KFNA 4GFSA 3DAQA 4M19A 3QRHA 4UTHA 3DXIA 1ZJIA 1X7FA 4LUJA 1HUVA 5IBXA 4E2DA 5HR7A 2BLEA 3NQGA 3TMLA 1LORA 2QAPA 3P60A 2CZDA 3A21A 3MO7A 3G1FA 4JS3A 4AF0B 2BZNA 1LM1A 1F76A 3WK3A 1YPIA 3LCWA 1QAPA 3W1PA 3CTLA 3TJXA 3LERA 1OFAA 3N34A 1K7EA 1OFQA 3PB2A 5AYYA 3ZR4A 1GVRA 5HULA 3W6YA 1KFBA 4K39A 2YCEA 4CQ9A 1OJXA 1D3HA 3GDKA 3PWAA 3HMJG 2VEKA 1VCFA 4IMEA 3ZWSA 1TTIA 4HKPA 3A9IA 5AOUA 3W1UA 5F2MA 4FIQA 1KTCA 4PC8A 5E1QA 1YADA 4TX9A 3OBKA 5FF2A 3NM1A 3S5ZA 3M5VA 4FO4A 4FNTA 5LSMA 3IIOA 1GG0A 2WO5A 4E0CA 2H8XA 5BMXA 5DY2A 5LNUA 1RZMA 4UTTA 3HOJA 3NQ7A 4O18A 2YGYA 3B04A 4RLIA 1SSDA 2A7NA 5I3JA 3E96A 2WNNA 5DCEA 4OQVA 2O7SA 3PUEA 5F2GA 5D38A 5C54A 2DZTA 3N2XA 4JTKA 1WOAA 1OX5A 4O4WA 4K6AA 3C2RA 2FDSA 3G0UA 1VLWA 2NWRA 5DXXA 1A5SA 3DZ1A 1H7RA 5FEXA 2VFIA 3LCHA 1GQNA 1KV5A 1TPDA 1UUOA 1WV2A 1LCOA 5EBUA 3ABQA 5H2ZA 3EB2A 2Z2UA 2CLKA 4JYFA 1OVDA 1K8XA 3LTPA 5ABTA 3IEBA 1XI3A 4OT7A 1HFBA 3NA8A 3Q58A 4C1LA 2GQ9A 4UMBA 5HQEA 3NQDA 1ADOA 1AMKA 3NPXA 4M6VA 1TPVA 2O7QA 1ME8A 4YXGA 2QCNA 1XKYA 3TV8A 4WD0A 3SFKA 5E0KA 4TMCA 1GWJA 1OHLA 4LT9A 4X22A 4UCGA 3QMSA 3TX9A 2A7PA 1GVQA 4BFAA 4FNPA 1FCBA 2EAWA 1S5WA 2Q8LA 4XTDA 2R94A 1QFEA 5EY5A 2QJGA 3TR2A 3LHVA 3UWVA 4JTIA 1ALDA 1AW1A 1G69A 1YXYA 3C3NA 3HG2A 3M44A 1FDJA 2ZTJA 4OV9A 4DO6A 2C0AA 3W2JA 1VS1A 1MO0A 4EF9A 3NL3A 1SZEA 4LU0A 3HPXA 5F4SA 3FA5A 2AQWA 4NNBA 3QSRA 5CPMA 1LRQA 3W7EA 3BLFA 3L66A 4XKYB 4HN4A 3VCRA 3DENA 1QCWA 3INPA 3SJ3A 4IPIA 4ZQOA 3A5FA 3FJ6A 4H6KA 3R2GA 1W56A 2PRLA 7TIMA 1J4EA 3H54A 2I9EA 1W5NA 5HWJA 5AC8A 1E51A 3W22A 2WKJA 4OWGA 4LS2A 4IPJA 3NYZA 4Z08A 2X1UA 1FWSA 5A5WA 3QF0A 1OX4B 4JGDA 5BOOA 4JY8A 4A21A 1ZHAA 3WJYA 3W84A 2V8ZA 4LS1A 4D2JA 5G1TA 3UD6A 4ORIA 3GNNA 1QOPA 3EEGA 3GDTA 4XZ9A 4IX2A 4I7VA 4Y96A 3ZS4A 2WJZA 4IWWA 2YXGA 3OVRA 5F2IA 4LTSA 4M6PA 4JIPA 3STCA 3ZFHA 5FEPA 3P82A 1YTKA 3M1ZA 2NX9A 3LI0A 1VGAA 4NNAA 1SZNA 2C3ZA 3BV4A 1X1OA 5CSSA 1FXQA 2ZBTA 4NVTA 5LHEA 3FFSA 2Q3RA 4LVDA 4ML9A 3W76A 1G7UA 2J27A 1W3TA 5T26A 2QAFA 2Y61A 1W3IA 4WQ6A 3IVSA 4MFDA 3LRLA 3FJLA 3GX9A 3S6DA 5KSWA 4OV4A 1SO6A 3WFAA 3L0KA 1QR7A 1OG0A 2QUUA 1CX9A 3W7HA 3W07A 1M5WA 2DZXA 2OMAA 5F4WA 3CM4A 1OABA 1KM5A 4LNYA 1BKSA 4UFMA 3ATYA 2QF7A 5BW6A 2Y88A 5EPDA 4O53A 4UTMA 4TR9A 1JJKA 3YPIA 4K36A 4FNSA 3C6CA 1QPNA 3KVKA 4UTIA 4NXSA 3UXAA 5HUPA 1GYNA 2CLFA 3W70A 3F4WA 3RLUA 2TPSA 2BXVA 2JBMA 3PY2A 1IXOA 1F74A 1Z48A 3E0IA 1M7PA 4MJZA 5EL1A 3TUUA 1KFJA 2LLEA 3BG5A 3LHYA 4E2BA 1I4NA 3O05A 2Z0IA 3A24A 3W2LA 4NT0A 3W7IA 1JCNA 2Y85A 3FLUA 4Y6GA 1T8XA 4WXZA 4M6QA 5KMYA 4J9JA 3HIJA 3EWXA 3O16A 3HB9A 1JQVA 1GZGA 1KM6A 4WOQA 5TIMA 1GYLA 1PE1A 2YR1A 4X2RA 3W7JA 1Q6LA 1QDSA 4NX0A 2DORA 1RQHA 3UXDA 1I2PA 3G3DA 2X16A 1UJPA 3C8FA 2V81A 3LHUA 1G4SA 3GDLA 1W5QA 5IM51 2DZUA 3BO9A 4N4PA 3P74A 1F6KA 3NQMA 1A5AA 2VEIA 1W5OA 3IV3A 2GVGA 3KAOA 3QM3A 8TIMA 3W2KA 3LTSA 3UY8A 1DVJA 1SW3A 3DBPA 1O94A 2NXIA 1C29A 5K4XA 2PC4A 1K8ZA 1IIHA 1DJQA 4HT3A 2NXGA 5MHBA 1FWWA 4TMBA 3U2OA 4RKAA 5D2YA 1WXJA 4JIQA 4FHAA 4HHPA 2RDTA 2VEMA 1N8FA 2B7OA 1H51A 1WBJA 2H3DA 4RJEA 2B7NA 5L6UA 4AXKA 1LOSA 1BTMA 3UWYA 4H4IA 1TPEA 2C16A 1I45A 1O5KA 2ZZ7A 4POCA 2ISVA 3M9YA 3DFSA 3LBCA 2ZRVA 1HO4A 1X1ZA 3LI1A 3U8GA 4XKYA 1L6YA 1GJPA 4UFJA 3FKKA 1ONRA 4KFOA 4XUGA 4OHQA 3W2UA 1TREA 4CCCA 2J24A 4JTFA 3QMRA 1P1XA 3HPSA 4CCEA 3W74A 3CIWA 2GVJA 4BR1A 1SU5A 3N3MA 2Y7FA 5K3VA 2DZPA 4NNCA 3NL5A 4N9BA 1G4EA 4GNJA 1UB3A 3EWWA 2ZZ5A 3O63A 3EKLA 1FXPA 4FX7A 2V82A 3M5YA 3W7DA 3SECA 1OYCA 4U4MA 4ZMGA 4KWWA 4RK8A 4LUIA 2QJIA 3TKFA 3O07A 1KFCA 1EP3A 3I7QA 3E49A 2X30A 4XTIA 2E77A 4O1DA 2CZFA 4JX4A 4JICA 1S5TA 1ZY9A 2FPVA 3OA3A 4P61A 1ZALA 1VJIA 2UV8G 5EA9A 1EWEA 1DHPA 4FNUA 4S2CA 5K9XA 2F84A 3GKFA 4NJGA 3CLMA 1U5JA 1F6PA 5K2ZA 3IGXA 4GUFA 2A0NA 3HF3A 1DL3A 2ZTKA 5CZTA 4IXXA 1BWLA 1QMLA 2YYTA 4LRSA 2QCHA 4DF2A 4MYAA 3T7VA 3QMTA 2E09A 1K02A 4UMAA 3JRKA 2YYUA 4GE8A 3TQKA 1AG1O 2V5LA 1FDYA 1UBSA 1S3HA 1LOQA 2YPIA 2GVLA 3P8JA 3QZEA 5D04C 2DZVA 4JN6A 3KVJA 1VPXA 5HWNA 3ABOA 5KZEA 2RKXA 3GDRA 3GZ3A 3NQAA 1YTEA 5FF4A 4UTLA 2EF9A 1QPQA 5HUOA 1SPQA 2CFFA 4M7SA 5BMWA 4KFPA 1L2UA 4A29A 1GOXA 4ZVJA 1I2NA 2A7RA 3NM3A 3W72A 2WV8A 5C55A 3THQA 3OIXA 3V1PA 1TTQA 1H63A 2CLIA 1Z42A 3T44A 4JTTA 2Q3OA 3GK0A 1VLIA 4QNWA 4JDYA 3TK7A 4UUIA 4L4MA 1ZFJA 4ZQMA 4ADSA 5DN1A 4NXKA 3C61A 1RVGA 5K4ZA 3E9AA 5D2VA 4CLMA 1ICQA 2JGYA 1W0MA 4UXDA 3UPWA 1XXXA 2G5WA 4N4QA 2WNQA 3LHZA 3CWOX 3L67A 2ISWA 3KXQA 2V9DA 3I7SA 2QDHA 2A85A 1P0NA 1AL7A 2P0OA 2ZZ6A 3A5VA 4A2SA 3RU6A 2CWNA 4U28A 4MLRA 1NFBA 1GPWA 5L9FA 3MBDA 1KFKA 4PODA 3G1YA 1W8SA 2P10A 1P0KA 4O10A 4UFIA 3G0XA 5HMSA 3UPBA 3CWNA 1UUMA 3N2MA 4UC5A 1R2TA 3UWQA 2GOUA 1OX6A 3W2MA 2ZA1A 4IMCA 3LCGA 4QNEA 5BRBA 3OHIA 3IGUA 3M47A 2E5DA 3NPVA 3NDOA 3GXNA 3PSWA 3C2OA 3NQEA 4BI5A 4EF8A 3T40A 5KZMA 1IF2A 5F1VA 3M41A 2CLHA 3PM6A 1KM2A 3H53A 3FEMA 2NX1A 5BNKA 3IIVA 1ZNNA 4GBUA 4JTEA 2OZ0A 4MKNA 4MJMA 3TROA 4H3DA 3G3MA 4FX8A 1N7KA 3W7MA 1PIIA 4AWUA 4NX5A 2J9XA 3G22A 4HPXA 2ZA2A 2E5BA 3GXPA 3C56A 5F1UA 4MY9A 4O4VA 2JKEA 5F2LA 5HWMA 1V7YA 3DHDA 4AH7A 3DFNA 1D3GA 1H7NA 3P81A 3T55A 1DORA 2E6AA 1H1ZA 4QAIA 3DFQA 2XN0A 3NVTA 2FFCA 3LCFA 1DQWA 3DKLA 4M5PA 3UNDA 5DCBA 3NZ1A 1XL9A 4LS0A 2V2CA 5CPOA 2NUWA 1GVFA 1SSGA 4AWSA 3NQCA 4XBSA 4N6EA 1GG1A 1VYPX 2WSRA 3W1TA 1I8JA 2H90A 4X3ZA 3SI9A 1JCMP 3I6RA 1DOSA 4O52A 5SWUA 4AHPA 4DEFA 1GTEA 1IXQA 5G2IA 3PSVA 4UNLA 3PC0A 3OVPA 3W1XA 5K9CA 1YTDA 5D30A 1VR6A 1WX0A 1H60A 1FWTA 4FNRA 1RR2A 3LXBA 3QQ0A 5EYWA 4HNVA 4Z1CA 3EX1A 4BF9A 1G6CA 3P8IA 4N2YA 3WJWA 2G97A 4MVAA 3NR0A 3PB0A 3TMQA 1D9EA 1OK6A 3V75A 1PVNA 4PA8A 4QSHA 4JX5A 2FJKA 1SFLA 2CW6A 2ZRXA 3TC6A 1K3UA 4O1AA 1EEPA 5CZJA 4O8RA 2EPHA 1NSJA 3D0CA 1H7PA 4CNOA 3IRDA 4JTLA 3BPWA 5DBTA 4WXYA 3G1DA 1XDMA 1RV8A 3KRUA 1P5BA 3I65A 3LDVA 4LVBA 3S9YA 5I3KA 2TRSA 1TB3A 3LCXA 4K38A 1QOQA 1W3NA 1JQXA 1LOLA 2CLEA 3PAJA 3HG4A 3G1VA 4R34A 1JVNA 2E6YA 5D32A 4Q4KA 5TQLA 3RK8A 4K8EA 3I68A 4JTGA 4AWTA 3RMJA 1F2JA 3K30A 4XBKA 1DV7A 3PS7A 4JDBA 1R30A 4HNUA 3DFPA 3EKZA 5J5DA 1O95A 1IIGA 2WSYA 3UWWA 1VRDA 4MZ1A 3OVQA 1KBJA 2WOQA 3VE9A 1GVOA 3CHVA 3UZJA 3TXVA 4O12A 4RXFA 4DELA 1K03A 4TU1A 1QO2A 1F7BA 3M5XA 4JD4A 3MP5A 2A21A 5A8GA 2DJXA 2ZRUA 3EX6A 3NQVA 5TBOA 3UWUA 1B9BA 2R14A 1Y0EA 3GR7A 2A2IA 3PUDA 3S42A 3W7QA 1NVMA 1KLZA 4DPPA 5AHNA 3IIZA 4B5NA 3W7GA 3JS3A 5D05A 4K37A 4LVAA 4CQ8A 4JTUA 2GJNA 3BVJA 4Z1BA 3EWYA 3SSJA 2FPYA 4CNNA 4P2VA 5K7JA 5D2XA 1TTJA 4AF0A 1DJNA 4N9DA 3QH2A 1WA3A 1FQ0A 2CLOA 4WY0B 2YW4A 4LY8A 3BK0A 3W85A 3IIXA 3UWZA 1KV8A 3HGSA 3S8HA 4PTNA 2QJHA 2JGQA 3QYQA 4OGZA 1MZHA 3GVGA 1EP1A 3ANYA 2BX7A 2BSLA 1OK4A 3S1VA 3W7PA 5LNVA 1TPWA 3S1WA 1CI1A 2FPTA 3T78A 1IGSA 1JUBA 2GQAA 1GT8A 1G4TA 3CEPA 5AFDA 4FNQA 5AHLA 4IOTA 3FYPA 3FOKA 1QPOA 3S5OA 3M5ZA 4L4LA 4Z1AA 5F4XA 4ZQNA 5AHFA 5C6MA 3W75A 4JEQA 2QEZA 4IUOA 1L6SA 4K7YA 3R12A 5AHMA 1TTPA 4DQWA 2E1DA 3L5LA 1FDZA 2ZZ4A 2I1OA 4O11A 2OX1A 2ZRWA 3U6WA 4A2RA 2OJPA 3UYCA 3LB0A 2RFGA 4HNTA 4O14A 5G1YA 3NQFA 5AN7A 3DI0A 4BWLC 2QCDB 5HINA 3SW6A 1XM3A 2OT1A 4E38A 3PG8A 3Q2DA 3F1QA 4PL1A 1ME7A 3KFTA 4LWWA 4DBDA 1TIMA 1TPB1 1I2RA 2EGZA 2RDWA 5LZLA 2FQIA 1TJPA 1O4UA 2VFFA 3E02A 1AK5A 5LGXA 2NLIA 4NUWA 5H91A 4O54A 4QISA 1DBTA 5J5RA 4R53A 2C18A 1TCDA 4PCFA 2OCZA 1TMHA 3KVMA 3DU0A 1FWRA 4RCXA 1H7WA 4JTJA 2Y6ZA 3MI6A 2A6NA 5EKYA 2A5HA 4MY1A 1H62A 3IIPA 1NF7A 3DHFA 3QW3A 3GR8A 2ABBA 4JR5A 3EXTA 3THAA 3GYEA 4WZHA 1WDWA 2Z6IA 5D37A 5LNWA 3GXTA 5D33A 3O6DA 3NZRA 2V2DA 2QDGA 3L5MA 4FX6M 4C1KA 2H3BA 2X2GA 3LXCA 2J88A 4IJBA 3EXSA 3LRMA 4BI7A 3PVFA 3R13A 1Q6RA 2TYSA 3TU9A 5FI8A 3VKJA 3B0VC 3MYOA 3TJLA 2ZZ1A 3SGUA 1FUYA 3W1QA 2C15A 2C1HA 3W23A 2WSQA 3W1MA 3TQ0A 4N6FA 1MEWA 4N9EA 4AB4A 2AGKA 2DZWA 2JKAA 4AEOA 4ZQPA 4DF0A 1L6WA 3TW6A 4K8HA 5GVJA 4Z0JA 1THFD 2PE4A 3IGSA 1SO5A 1Z41A 4ONVA 3Q94A 4UTWC 2Y62A 1YLVA 5D02A 1OX4A 4ADUA 3EX4A 1BEUA 1Z44A 2QCLA 1GEQA 4ZZ9A 2RHGA 5FEWA 3TNOA 1SO4A 1TPH1 3MW7A 2FB2A 2VFGA 5C2XA 2YX0A 4ADTA 3KOFA 4YCPA 3VNDA 3GIYA 4IX0A 4NZFA 4TO8A 5G4EA 5HR6A 3A22A 1MXSA 5D2TA 1H7XA 3UZ5A 3M16A 2EHHA 3TDFA 3GAKA 3W7CA 3AJXA 3NQ6A 1HTIA 1O60A 1TRDA 1WBHA 3MBFA 3SGZA 3MYPA 4WY0A 1SZGA 3BLEA 5KTLA 3O8AA 3PUOA 3EX2A 5K9DA 4EOUA 3LOTA 4JNMA 2GJLA 5DLCA 2JK2A 3DFTA 3UY7A 3G1AA 3B06A 1QNVA 4MLJA 4UTKA 2VFEA 4UTTC 3MP3A 4S2BA 1OFRA 4GUHA 3HBLA 1K7FA 2RDUA 3ELFA 3PBVA 4Y90A 1JCYA 3BARA 4YMZA 2D73A 4EWND 5AYZA 2V30A 2YW3A 3L68A 3VE7A 4N9CA 3CIXA 4KKXA 6TIMA 3BGJA 1LYXA 2ATSA 3LGEA 3L0NA 1HO1A 4M7TA 3B0PA 4A22A 4LC8A 5CKSA 5LNSA 4MZYA 3TXZA 1A5CA 5AHIA 3TFCA 3G18A 4HSOA 3TAKA 1FWNA 1LLZA 3PF3A 1A50A 1XFBA 1C8VA 1EB3A 3OG3A 5LGZA 4WX2A 3MMTA 1ICPA 1W5PA 2J9YA 4GUIA 2QCDA 2JKPA 4BK9A 3S5YA 5D03A 5I3HA 3TCEA 3HGRA 1EWDA 4AAJA 4DXVA 3USBA 1H61A 1JCJA 4JTSA 3S0CA 3O06A 5KZDA 1M6JA 3G8RA 2WNZA 1LP6A 3PG9A 3O6CA 3MP4A 4WJEA 4NU7A 5CZSA 5DELA 4JTHA 1RD5A 3R89A 1F73A 4GRSA 3F4NA 3W1NA 1KTNA 3CC1A 3HG3A 3WK1A 3TIMA 3Q37A 1RQEA 2C14A 3TA6A 1R2RA 4ZQCA 1OFEA 1SUXA 3STFA 3NL6A 4RZ6A 1H50A 1VH7A 3C52A 5LNRA 2ZRYA 3R5EA 1WOBA 4XWUA 5KITA 1J5TA 1KFLA 3GNDA 3O6YX 6ALDA 2NV2A 3P80A 4DF1A 2V5BA 1TQXA 5AC6A 4NJIA 4UTWA 4O15A 2QCEA 5DXYA 3GLCA 3SY5A 4PFMA 4LV9A 2ZCGA 4O17A 3HGOA 1TPFA 3CB8A 3W7NA 4I9AA 1EA0A 2ISSA 5AC7A 3L65A 3M0ZA 4FXRA 3TQVA 1X8FA 1XBVA 5G2WA 2NXHA 2Z1BA 2VC6A 2VKZG 1KTBA 1PCKA 5CG7A 1ZENA 2GUUA 4PL2A 4QIUA 1CW2A 1SW0A 2NUYA 2HS6A 2QCCA 3ABSA 3UQNA 1DQXA 1LDCA 1V5XA 1W5MA 2QR6A 2E5CA 3WJZA 3IVUA 1EUNA 2W79A 1SW7A 3B0UX 1UASA 1VQTA 2CLLA 3PBYA 1G7VA 5U4NA 4IMFA 2IQTA 1EUAA 3TFXA 1VYSX 2ZQ0A 3W7LA 4HPJA 3QFEA 4PH6A 4DPQA 3B8DA 1XCFA 2DP3A 2C6QA 2Y63A 3STEA 3NGJA 2C13A 3W3OA 2FTPA 1U83A 5D2WA 3L2IA 3MHUA 3CPRA 3LTYA 1W37A 4FIRA 4RR4A 1TV7A 4IQLA 1KBIA 1H5YA 5DBUA 1ML1A 1ZAIA 3BLIA 4HSNA 2OT0A 1UCWA 1SR9A 1AL8A 3W1LA 4O0ZA 3P84A 4PEKA 4YWIA 5C5YA 3HQ1A 4GUJA 3P61A 3M6YA 1OYBA 4O1BA 5AYXA 1TV8A 5HNRA 1M7OA 4MFEA 4MUZA 3P5YA 3W87A 1SO3A 1R2SA 1MEHA 1VC4A 1MEIA 3NXFA 3KX6A 4RXGA 1W31A 1TPUA 2BWGA 3N73A 3LCIA 1EPXA 4R7JA 1I2OA 1KM3A 1MSSA 1VYRA 1JR1A 5DY3A 3HGJA 4GXMA 3NQ8A 3P62A 3LHWA 1BWKA 4GUGA 2ZDRA 2XN1A 4RZ5A 3MUXA 5I3IA 5AHEA 2ZA3A 3WK0A 3RLVA 1VCVA 2Z6JA 1YPFA 4O13A 3W83A 1PL9A 1JRBA 3P7YA 3TSMA 5I3FA 4IXHA 1F5ZA 3NPUA 2DU2A 4JXCA 2A4AA 3OEXA 3STGA 1C9DA 2E6FA 2PRHA 3VI2A 1YDVA 3LHTA 2VOMA 3HO8A 1S5VA 2GPTA 5I3GA 3SZ8A 1PCWA 3NAVA
chains in the Genus database with same CATH superfamily
2DJLA 4XAZA 1HJSA 5KINA 3RIKA 4MNKA 3T0BA 2Y5SA 3DFYA 4GZJA 5C9ZA 1GVSA 1DIOA 1TJ0A 1GQKA 1ITUA 1PS9A 3DYOA 4HNNA 5DO8A 4IM4A 3A23A 5H8PA 3B03A 3KCJA 3VKAA 1MXGA 4WUIA 3M6DA 2Y70A 1P4CA 5A94A 1DXEA 4W9TA 1XBXA 4PTMA 4YLWA 2XVLA 1J10A 3AICA 3DBNA 3PBUA 3GDMA 5HXMA 1EX1A 4PMDA 4IMGA 3WH8A 3MHFA 5H1WA 1P48A 2GDVA 1G94A 2JIEA 2UY5A 1PWMA 1PJ9A 2C71A 1R9ZA 3TAOA 2TMDA 1W91A 4N42A 5FACA 1PHQA 1B57A 4NP7A 1DJWA 4D6HA 3WDIA 2A3LA 4X0NA 4QJ5B 3W7RA 3Q45A 4I6VA 5IDIA 5FEZA 4E8CA 1R3QA 1B4KA 4O50A 2I7GA 3PJWA 2Y24A 1RP9A 4WY0F 3W9ZA 2Y89A 3KHJA 3R11A 3O6AA 4WLCA 1YDNA 1A5OC 3M4HA 5DEZA 2ZXAA 1GJWA 1XHGA 2QUVA 5DX7A 5FSDC 3QSTA 4NZJA 5CZ0A 4ZEPA 3W86A 1K4HA 5DT5A 3ALFA 3BMXA 2ZYFA 4YN5A 1D2KA 1T6MA 3MJMA 1QUMA 4DWDA 2J7HA 3A4WA 2J78A 3NEVA 2D1ZA 1H4PA 4W5ZA 4YL2A 2E1WA 3VD4A 3VNKA 1JPKA 3KOYA 3L0GA 4HMNA 1XLFA 5A6SA 4NAFB 1DKWA 4RNJA 3H2NA 5I5RA 3TSBA 1LT7A 2Y0FA 2X09A 1J0YA 2FLIA 4GO9A 3WNNA 3VGDA 4G9PA 3RFAA 3CV6A 1R9XA 4PUMA 5A6LA 3H2OA 1UD4A 3BSHA 4DM2A 3APTA 2ZWZA 3GIPA 2CBJA 3V0TA 1A4LA 3SR7A 4IJRA 3V5CA 1UOZA 1XSIA 2F38A 5JBDA 1KM1A 5FF7A 3SCWA 2WQPA 3L9CA 2UY4A 3R8RA 4C7GA 3BAIA 3Q4DA 1OWQA 3R7MA 1CXFA 3BAWA 3O1NA 4HYWA 3S46A 2QCFA 3DKJA 2XGBA 3LRKA 3WUFA 4AZ5A 1YXDA 3KTCA 2ZUMA 3IJ9A 1TQJA 2WLZA 3S5NA 4IZGA 4FPSA 3BW3A 2DZSA 4X9SA 1UR8A 1OEPA 3UNTA 2B0MA 1V3MA 2PF8A 2ZKMX 4AIEA 4TVCA 1Y65A 4QX4A 3ERPA 4JFTA 3MANA 1VZWA 3PPFA 4Q8MA 3BCDA 3GG8A 5IBXC 4I7UA 1XIJA 2ZFAA 1S46A 3AO0A 3KW3A 1OIFA 3W0KA 3OZMA 3ES8A 2P1FA 1ADSA 1UZDA 3AOFA 3BOLA 2Y1HA 3ITGA 3EOUA 2W62A 2ON3A 1UA7A 5DRIA 1RXOB 3A3WA 4O28A 2BGNE 1VFOA 4BF5A 1Q6OA 3WJXA 8XIAA 3SAZA 2YSWA 3P0WA 4LCSA 1JUKA 1VHCA 2CZ5A 4UFKA 3SN1A 3TTQA 2OEMA 2G4FA 1NY1A 2EJAA 1Q3NA 4YTTA 1RQBA 3UZYA 3EAUA 2Z27A 1OYAA 3SUUA 2EKCA 4GGHA 4WGHA 3HZ3A 1EOKA 3MTWA 3T4CA 2WNWA 3W28A 4BWLA 3W7KA 4Z0SA 3B8UA 3VILA 4ZL1A 2VNCA 3LBMA 4M1RA 2HWGA 3W7OA 1A3HA 2AL1A 5GJMA 1JCLA 4EIVA 3NO5A 1LLWA 4HCLA 2HS8A 2X1SA 2QUTA 4UR8A 5GPRA 4AYGA 4A3HA 1FCVA 1T40A 1K8YA 2E68A 3QXBA 2CLMA 1A5BA 3G0SA 4HBKA 1QNQA 4H7CA 4K7VA 3LCLA 1LROA 3S2JA 4YHGA 1LBMA 4QJ1A 3B0XA 3THCA 4HU3A 1JUEA 4EAMA 2PSNA 5E0CA 2CLPA 1TYGA 2H8ZA 1TA3B 1ZCOA 1WAUA 3MWAA 1ZAJA 2OOFA 2HQAA 1GHRA 3O7UA 2FZ8A 3B9AA 3LM7A 2CHRA 2J7GA 3B4UA 3L4YA 1LTDA 1VIWA 4MPQA 3WNOA 2GGHA 1HG3A 2HTMA 2WCAA 5EU9A 4C6QA 2DIEA 3ARQA 2INEA 1BRLA 9XIAA 3HG5A 4L9ZA 3QW4B 4FLRA 2R1PA 1DWJM 2NUXA 1U5HA 1XC4A 3BG3A 3M0HA 3QLDA 3M0MA 1CLXA 3QRHA 2POZA 2IKJA 3DXIA 1AQFA 1X7FA 4YVPA 1F3EA 5A8NA 3KDOA 5IBXA 4E2DA 5HR7A 2BLEA 2CCRA 4JS3A 4IGMA 1F76A 1R7AA 1YPIA 4DX3A 1V6YA 3HMCA 4GIRA 5AYYA 3S4TA 5HULA 3LK6A 4GQBA 5FIPA 3KZSA 1KFBA 1UWQA 3BOXA 3TTOA 4AY8A 1VAHA 3PWAA 2VEKA 1VCFA 3ZWSA 4J1OA 1OGGA 4FP1A 2JFEX 4IFOA 3A9IA 3LBOA 4FIQA 4DUVA 4BEUA 5E1QA 4EANA 4UTFA 5LSMA 4WVXA 1GG0A 5A69A 1RLDA 4E0CA 2H8XA 1RZMA 4UTTA 3HOJA 4U31A 1FKXA 4JTDA 5HPOA 2VWSA 4XISA 2ZVIA 4U10A 2O7SA 4EXAA 5F2GA 3BCJA 5C54A 4RPQA 4XO7A 4O4WA 2OSYA 4GIYA 4GINA 2FDSA 2PDHA 5DXXA 1UC5A 1H7RA 3CUHA 3S1GA 3FV9A 4GD0A 2OO0A 4GVGA 3RX3A 3EB2A 4F0MA 4JYFA 1OVDA 1AQHA 5ABTA 2XIMA 4OT7A 4XUYA 2AQOA 1JYWA 4H9VA 2V5DA 4NYUA 4M6VA 3T8LA 4YVVA 1J6PA 1XLDA 2QCNA 4D8LA 4WD0A 3SFKA 5E0KA 4DVOA 1OHLA 1FH9A 5CAKA 2FVMA 2GJXA 1GVQA 4L61A 2WMIB 1XIFA 3B40A 7REQB 3GO2A 3K1DA 2MANA 3HQOA 3TR2A 1KD0A 2VT0A 1CXIA 1ALDA 1E70M 2DT0A 1AW1A 2V3EA 1FDJA 3U48A 3CBWA 1VS1A 2AQWA 2ESCA 3QSRA 3CMFA 2A3HA 4HN4A 2Y5EA 3DENA 3SJ3A 1SVDA 3L23A 3W24A 3VINA 4PRTA 3FJ6A 4H6KA 4ZO7A 3VKCA 3GRIA 2BXZA 2AMGA 4OWGA 4A8LA 2XIIA 4CEXC 4IPJA 2J8TA 1HJUA 1XIMA 1FWSA 4IL2A 4HNCA 1VEPA 2OSWA 1VD6A 1EIBA 4M6UA 3REQA 3U4FA 4LS1A 4D2JA 5G1TA 4ORIA 3TZNA 4K68A 4GI9A 4AWEA 3GHUA 4Q8WA 1NELA 2VCCA 3M0JA 4KT2A 3OIHA 3H4WA 3BV4A 2VCBA 2DFAA 2CXGA 3W27A 5ECVA 2WC7A 5LHEA 4C6DA 4UQCA 4LVDA 1Q7QA 1G7UA 2J27A 3GE7A 2Y61A 2PWFA 3HN3A 4QDWA 1MW2A 3FJLA 3WD2A 3KZPA 4OV4A 3SGGA 5BRPA 5CGMA 3SO7A 3LPOA 2NSOA 3CHCA 1AVAA 5DANA 1EJTC 1G0CA 3W07A 5MKGA 3AMLA 4HHLA 4HA1A 4NKCA 3LUTA 4N7QA 2QF7A 3GVWA 3ZVIA 4TR9A 4XZMX 1Q6EA 4GKTA 4FNSA 1QPNA 3CV2A 3CL7A 2CNCA 3UXAA 3F4WA 1Q2SA 2BXVA 3PY2A 1A47A 3NURA 1O68A 3E0IA 1M7PA 4XZNX 1DTNA 2LLEA 3LHYA 1WZLA 3UFYA 4HGXA 1YE4A 2V67A 4I8DA 1IEIA 3W2LA 2OYMA 3CUXA 4NT0A 5HNTA 5I06A 4KRTA 3ZJ8A 4Y6GA 2J74A 4WXZA 2VZTA 4Y9MA 4B5WA 3EWXA 2R82A 1E4IA 1JQVA 4MB5A 3PWGA 1GYLA 2YR1A 4X2RA 3IK4A 3UXDA 1X38A 4PR4A 3QR3A 2RJGA 4GLEA 4WEVX 4Q4MA 3CH0A 5IM51 1K8CA 1WKEA 2PWVA 3QY8A 2DZUA 1S2WA 4F8XA 3UGRA 4F0SA 2BHZA 1C8XA 1EFZA 1HXJA 1V6TA 2GVGA 3ITCA 2XZ7A 3QM3A 4D8ZA 1OIMA 4ZTYA 1O94A 5K4XA 3F2BA 1K8ZA 4G7EB 2NXGA 5MHBA 4BF7A 4ZOAA 1FWWA 4TMBA 3EB3A 4RKAA 4LAOA 1DJZA 1BFNA 1LL7A 4JIQA 2GUBA 5CSYA 3T2OA 2VEMA 1N8FA 2XZ9A 2B7OA 4IJCA 3PN8A 2H3DA 3R25A 5L6UA 2PLCA 3FGCA 1J8VA 4AD0A 2FHFA 1BTMA 1NIUA 5BWAA 3AC0A 2C16A 1IHIA 2ZZ7A 3BV7A 4WJ8A 1HO4A 3KOWA 1BTCA 1W2PA 4UFJA 2HRWA 4XUGA 4JTFA 1X98A 1B1YA 2XSXA 1SU5A 1J01A 3N3MA 4G5DA 1UR4A 3VZXA 2ACRA 4IH3A 1US3A 4HA4A 2HCVA 4JQ2A 4W88A 2ZC1A 4Q8OA 1OYCA 1YMYA 4RK8A 4LUIA 1KFCA 3O07A 3PAOA 1JI1A 4XTIA 1E72M 1EZWA 4O1DA 5A6AA 4QG8A 1OQFA 3KBSA 2EPKX 5FAJA 5EA9A 5I2UA 1ECQA 3C8NA 1DHPA 4FNUA 2YCLA 5K9XA 2F84A 3GKFA 4GUFA 2A0NA 3HF3A 3MUY1 2YYTA 2QCHA 4MB1A 2OSXA 4DF2A 4KQNA 5JH1A 2R24A 3TQKA 3PHAA 4GJJA 4Q8NA 3GFZA 4J35A 1FDYA 1UBSA 3NZPA 3L2MA 2ZVRA 1BLIA 1YIXA 3QZEA 3T6CA 1V7AA 3AIBA 1K9TA 1TE6A 5KZEA 1IV8A 1YTEA 2DQWA 4UTLA 5HUOA 5CC7A 3OPSA 4KFPA 4CVWA 3SCRA 1W1TA 1L2UA 1JXKA 4AD2A 1KWKA 1GOXA 4ZVJA 3UG3A 1I2NA 3MUCA 3V1PA 3N6JA 4QFUA 1TTQA 2CLIA 3A4JA 1QWKA 1FP9A 3K8KA 4DBUA 1E3XA 4JIIX 1KRCC 2YB4A 3SN0A 5T91A 4JDYA 4ZQMA 1FHVA 1QATA 2QVHA 5DMLA 4NXKA 4JOMA 5JMUA 4EWJA 4S39A 3E9AA 1NDZA 2PU1A 3KCOA 3VUSA 4DHGA 3JVAA 3L67A 2PP0A 4JCLA 2QDHA 2O0TA 2P0OA 2ZZ6A 4FF5A 1NDWA 3A5VA 3RU6A 1GOKA 1F6YA 4MLRA 1DWIM 1U33A 4TTUA 1MUCA 5LIUX 1GPWA 5TAOA 3TYBA 2XWEA 2AKMA 3USZA 1P0KA 4O10A 3G0XA 5PTDA 3BC9A 1OX6A 3W2MA 1KGXA 4QNEA 1TVNA 5JVLA 4HJFA 3IGUA 2E5DA 5ABFA 2WM1A 2CHNA 4QCFA 3K4AA 3GZAA 3GXNA 3EZ4A 1EDGA 3ARWA 2OO6A 3DN5A 5HNNA 5XIAA 3EDDA 5F1VA 1JYXA 2VEFA 3WBEA 1KM2A 3CUZA 1BF2A 2QGYA 3FEMA 4XV0A 4BQ5A 2NX1A 5BNKA 3IIVA 4JTEA 3APYA 4MKNA 4MJMA 3V7PA 4U2YA 4HA3A 3AFBA 1ZU8A 1PIIA 4F0HA 3G22A 5E0FA 4HPXA 3R79A 1I60A 2Q09A 4MY9A 3WDQA 4J5NA 1RVKA 1D3GA 1QU4A 4DLFA 1OC7A 4XG1A 1V6WA 3P81A 1DORA 2E6AA 1KRAC 2FFCA 1XFCA 2WZTA 4LF2A 4M5PA 1BKHA 5DCBA 3N4EA 1OD0A 1UWAA 2VM8A 3BSMA 2V2CA 2PDGA 4WK9A 2V38A 2HROA 3BCFA 2DSUA 4ACYA 2WSRA 3IJDA 3WMBA 4AZ6A 5SWUA 4DEFA 4NAEA 3GG0A 1IXQA 5G2IA 1RD6A 3PSVA 1W3JA 4UNLA 2GLKA 1WNOA 3JU2A 3OVPA 3BOFA 3W1XA 5K9CA 1WX0A 3W37A 3BDKA 1KCKA 1R6WA 4NASA 5C2GA 3EX1A 1QNSA 2XFYA 4BF9A 3P8IA 3FA3A 4N2YA 4MVAA 3PB0A 3GFYA 2XPKA 3I3BA 4E4FA 3COTA 4Z2JA 2YDRA 4CQBA 1NDYA 4PA8A 4JX5A 2FJKA 2ZRXA 2PTYA 1KXVA 3AIRA 1K3UA 4MB3A 4UOZA 4C65A 2INFA 4Y9OA 3BSGA 4CNOA 5CC5A 4JTLA 3BPWA 1E6QM 3TN6A 3G1DA 3BLPX 3G6MA 3LDVA 3P6LA 4UBPC 2TRSA 1KR1A 2ALRA 1C8YA 3V3WA 3HG4A 4FLSA 3LG3A 4R34A 1JVNA 1RJRA 2FMNA 2E6YA 3M0VA 3RK8A 5TQLA 4DJEC 4DXXA 3I68A 4CGTA 1F2JA 3K30A 3DFPA 2ZXDA 1O95A 4LB3A 4NSBA 1XISA 1IIGA 2WSYA 3BUVA 3OVQA 2D2HA 1Q13A 3CHVA 3E2SA 4HJWA 3C2YA 1XRTA 1HGYA 4RXFA 1OCBA 2CKSA 1K03A 1MQPA 2A21A 2QDDA 2ZRUA 1E4NA 3SJNA 1DEDA 5TBOA 3CYVA 1B9BA 1GZJA 3S42A 5AHNA 2BB0A 3E0LA 4B5NA 1NTHA 5BU6A 1W32A 4LVAA 4CKQA 1DJGA 1GQIA 4LYKA 4JTUA 5C0QA 1MQRA 3W38A 3EWYA 3SSJA 1OM0A 3WLIA 5K7JA 4C5ZA 2ZX9A 1CLKA 4N9DA 3ITLA 4Z2IA 1UUQA 2C0HA 2EG8A 1EOMA 3G5EA 5E6ZA 2P5NA 4JFVA 4IQDA 5CC6A 1J0JA 3AMKA 2VGGA 1ITQA 1ESWA 3MC5A 2PA6A 2WZIA 3T78A 1PX3A 1FWAC 1IGSA 4GXWA 1GT8A 2QIIA 1QPOA 4C6JA 3M5ZA 5AHFA 5GQBA 3W75A 1POKA 4IUOA 1TUXA 4XIAA 5FJOA 5AHMA 1HJVA 4QDMA 3VGEA 1J11A 1X7IA 1GHSA 1J96A 3TTYA 3CZ8A 4M8UA 4O11A 4FOUA 2OX1A 3U6WA 3UGVA 4A2RA 3VD3A 3UYCA 3LB0A 2RFGA 3V5FA 4CU8A 2X0SA 2Z4GA 4C1NB 2YXXA 4KCUA 5HINA 1BPLB 2DVTA 3BH4A 4E38A 3UJEA 1BVZA 1ME7A 4LWWA 4JL1A 4ZSUA 4C6PA 5DQPA 2G0WA 2OLSA 1UD5A 2PB1A 2XIBA 4GQ0A 3OZOA 3E02A 4H9TA 5HMEA 3T08A 2PDJA 1MDRA 4O54A 4DJEA 4G56A 3WIJA 4R53A 3TR9A 3W6LA 2A3EA 3VKKA 1HJQA 4PCFA 3KVMA 4RCXA 4JTJA 1JAEA 1FFQA 4UZUA 3VXGA 3UZXA 7CGTA 3E1F1 4EKJA 1IWBA 4MY1A 4G2DA 3QW3A 1XLBA 7REQA 3THAA 3GYEA 1H2JA 4H6RA 6REQA 3RAOA 4CD8A 3CYJA 3L5MA 4C1KA 2PDUA 4ZFCA 3EXSA 4BI7A 3TNBA 1XIEA 3WKZA 4DBSA 3UR2A 2TYSA 3VNMA 1OC5A 3VKJA 4DI8A 4ERGA 3SGUA 3W1QA 2C15A 4DWSB 4QLLA 2OKTA 1FOBA 4LBRA 3RLHA 4AB4A 5M2FX 2DZWA 3GW0A 2YCJA 1XLJA 4DYJA 9RUBA 5GVJA 1THFD 2C1GA 3Q94A 4L1XA 4UTWC 1YLVA 3B9EA 4DLMA 2EQDA 1LQ0A 3ARUA 4KETA 1YW1A 5D02A 3EX4A 1W1VA 3UESA 1BEUA 1Z44A 5GNXA 2Y8KA 4L64A 4AEFA 3S9ZA 3ARPA 1XSKA 4R3UA 1SO4A 1H1NA 1MNSA 3MW7A 4M51A 4LAUA 4H1ZA 1HZYA 4YCPA 1JF6A 3VNDA 4NZFA 1CXKA 4JNYA 3IJQA 1DE6A 1F3XA 4DJDC 2YA2A 3VMOA 1I75A 2VGBA 3WX7A 5KTLA 3GTFA 3PUOA 2O4QA 4M80A 3EX2A 4IL0A 4CQCA 3PZOA 5M1TA 4JNMA 3DFTA 3VNYA 4FLQA 3LSBA 3ARVA 3IACA 2PU0A 1QNVA 1AZ1A 1GK8A 3MP3A 4KEZA 1OFRA 2NLYA 2EPMX 3LGDA 3BARA 5CZKA 4YMZA 3UA4A 1E71M 3WSUA 4EWND 3AROA 4IIFA 3L68A 4CD5A 3BGJA 3H7UA 1LYXA 2ATSA 2WYSA 1KXQA 1P0EA 1XH1A 3B0PA 1M53A 1TV4A 3TJ4A 4MWAB 4MZYA 3TTEA 1ECEA 1E5NA 5AHIA 3G18A 1M7JA 4GYPC 3VOFA 2YLLA 1US0A 2Q02A 5BRQA 1XFBA 3TQPA 1EHNA 3OG3A 4WX2A 1ICPA 5M5DA 2P53A 4GUIA 4YVXA 2JKPA 3S5YA 4AAJA 3Q67A 1H61A 2A79A 4ZO9A 4ML4A 3MP4A 1VB9A 4WJEA 2QS8A 2FGBA 1RD5A 2D69A 1HKMA 4GRSA 1KTNA 2PC8A 3QBUA 4DUOA 3CC1A 2VC9A 3VIGA 3WQ8A 3A6OA 3Q37A 3AMCA 4ZQCA 3M7SA 4C7DA 2OELA 1ZCCA 3GBEA 1EGMA 4L65A 4PTXA 4IQEA 4D6DA 2NVDA 1DJHA 1JNEA 3MSGA 3R43A 3R5EA 3PJUA 1J5TA 1UP2A 5A6BA 3O6YX 4FR1A 3P80A 1KQYA 1TQXA 5C2CA 4GCXA 4UTWA 4G7EA 4PFMA 4AISA 4G7FA 5E09A 1Q6GA 4QJ4B 3WLQA 2ZCGA 4O17A 1EBGA 3ENLA 4F0RA 3HGOA 4F0KA 3CB8A 3W7NA 1M01A 3KM8A 3L65A 4GO8A 3TQVA 3TYUA 2NXHA 4B3LA 1KTBA 5J8LA 3WF3A 2PGEA 3BAXA 2QCCA 4M24A 1LDCA 4FMVA 1V5XA 1A5KC 1E0XA 2QR6A 3WJZA 2BGQA 3IVUA 1MW0A 3AIQA 2PD5A 2PZNA 5U4NA 1QK2A 1QHZA 1S5MA 3CQIA 4IMFA 1EUAA 4GKLA 3AWNA 2EG6A 3N04A 4Y2WA 3W7LA 4HPJA 3ONBA 3IARA 4PH6A 4DPQA 3B8DA 4DJED 1ITXA 2Y63A 3NGJA 4QLKA 3W3OA 3MU7A 2FTPA 3WQDA 5FL1A 2VP8A 4FIRA 4RR4A 4IP4A 1TV7A 4ATDA 1Z9AA 4GNVA 1ZAIA 4PRWA 1N8IA 3W00A 2IKIA 4QCEA 1UCWA 1SR9A 1P6CA 4ERIA 3NIYA 4H9UA 5AYXA 4GUJA 4MTVA 3M6YA 4MFEA 5CC3A 2IXVA 1B31A 1XLHA 3AAMA 1SO3A 1R2SA 4GYPA 3TONA 5C70A 2WC4A 3SCQA 5HA7A 4NL1A 1KR0A 3AI0A 1KM3A 4LQ1A 1JR1A 4GXMA 2ZX7A 3NQ8A 1BWKA 3PPCA 2XN1A 4PBFA 3MUXA 4RZ5A 3WLMA 1W1B1 3N4AA 3RM9A 1E0WA 4RE2A 1IZCA 4E8DA 3W83A 1P7TB 3VU2A 1JRBA 1TZZA 3TSMA 5I3FA 4MDOA 3CB3A 4AIOA 3OEXA 4GZIA 4M82A 2AGTA 3T9PA 4NZ5A 4AD4A 4XZWA 4W93A 3VI2A 1HP4A 2ODOA 5CJNA 3HO8A 1PCWA 3KP0A 1V6UA 4Z1YA 3HJEA 2J7EA 1K7XA 3ZWTA 5CGQA 2IKHA 1BG9A 1XLGA 3WBXA 4F2BA 2OXNA 3EX3A 1W1ZA 1JRCA 2A1YA 4O0KA 3EOOA 3SSZA 2PURA 1TJRA 1QW7A 4X63A 5BOFA 1E9IA 4HMEA 1L2QA 1OFPA 4B5XA 2WZHA 3TA9A 4WOZA 4NJHA 2Z1XA 1FX6A 2V69A 2IPGA 3E0VA 4IGNA 5HJLA 3FIGA 3CU2A 3SEPA 4HTYA 3M0KA 3GXMA 2XM2A 3IJ7A 4PCTA 4HHHA 3A64A 4P5UA 2A6LA 4UOQA 1E0UA 4JKMA 1XCXA 3UZWA 2YZRA 1E1CB 4UTJA 1UYQA 1R47A 5AECA 2YL8A 3W25A 2H9AA 1JDDA 2E6DA 2I56A 3PR2A 2WMJA 4K8GA 1BHGA 1FY6A 3CEUA 3WK2A 3UU0A 3DGRA 3G1SA 3RNDA 3WNMA 1XGDA 3EWUA 1J2WA 4A3QA 1JCXA 5FJPA 4F3HA 1XYZA 1OFDA 2VR5A 4BQ3A 3V36A 3F03K 2R91A 4GJ1A 4UFHA 3C2EA 4OBRA 2BS9A 4QGCA 4KF1A 2PPGA 4H6QA 3LPPA 3T8QA 1KM4A 3QJAA 3NOEA 3RM8A 4LC6A 4HVXA 4HMCA 5AZ0A 4A4AA 3GNRA 5M3WA 4RDYA 5XIMA 7XIMA 3RJXA 3T05A 3ZM8A 1KLYA 5LIWX 1VFHA 3AHVA 1OF6A 3N9RA 2NZLA 3Q65A 4A3RA 3HQNA 2VELA 4G6CA 1GZ1A 1H5VA 4WSHA 5A6BD 1B3OA 3BMWA 5E93A 5EFDA 3H23A 2VENA 3P14A 3OW1A 3WQ6A 1AW2A 3UW6A 3FKRA 1E15A 5J04A 1QPRA 4FB7A 3GAYA 5HAOA 1EEXA 4RE4A 4O1CA 3FHQA 4S1FA 3E74A 4S3FA 2V2HA 3A3HA 1VEOA 1CZ1A 3MKVA 1IT7A 4Q8UA 2W6RA 1FCQA 3O0FA 4UCFA 3LLDA 3AXIA 1Q85A 1E5JA 5AC4A 3CAQA 2CIPA 4GQQA 2UZ9A 3IAPA 1V3KA 3S1UA 2X1IA 4JEJA 1Q2RA 4NQ1A 4UR7A 1EF3A 1KW1A 3SADA 3QKEA 4B9YA 1EX5A 3TEVA 1IWPA 3TH6A 4F0LA 2PZ0A 3JR2A 3C4UA 3DG6A 3F5KA 1TG7A 1A5UA 2GL5A 3APGA 4UTUA 1J0KA 4JNZA 4MIMA 5GJPA 1SQ7A 4OE7A 1AW5A 3H8AA 3N1AA 4D6JA 2Y2WA 1I1WA 3TSDA 3HM7A 3HQPA 3ATZA 1WYIA 3WD1A 3DUGA 1FH8A 4FXFA 1GTHA 3VIFA 1ADDA 2VL4A 1JDFA 1XLMA 3NL2A 1UJQA 3A9BA 2XG9A 2NWSA 1MUWA 3WEOA 4B2DA 2ZZ3A 2NX3A 4GWEA 1E6ZA 1UPMB 1B3VA 3HV9A 3IUDA 2D20A 3RU8X 1WQ5A 3OLGA 3FW6A 3LX9A 5FF3A 4A3UA 3GHRA 1Q45A 3DI1A 5DT7A 3M43A 3M7WA 2B7PA 3KL5A 1FBAA 1UP0A 5G5IA 1G4PA 1WPCA 3MQTA 3U2CA 2OQHA 4V28A 3M07A 4H7ZA 1PIGA 3UXIA 1T96A 2WQDA 5I7GA 1HNYA 4LGXA 3ZSTA 5EMJA 4REQB 3UWEA 4O19A 1H3GA 4LW7A 4EE9A 1G1YA 1XF0A 1IEQA 3CLWA 2XN2A 5U7SA 1DJYA 3VIKA 3B05A 2QCMA 3I10A 3QGKC 5A1AA 1HJWA 4BS0A 4XZBA 3ARYA 2OQLA 3QVQA 2HBVA 4XQ6A 2QF8A 2NQZA 1ZJHA 3KBMA 1HKIA 4PCPA 4AHOA 4AHQA 1NF0A 2VVNA 1XLKA 2G95A 2VFHA 3QZ6A 1JL8A 1X97A 4QQ3A 4C6FA 1LG1A 4MY8A 3HJZA 3VYLA 3KBJA 3S47A 1W1A1 1K9EA 3DHPA 3IK2A 5DF0A 1I2QA 2ZZ2A 3H24A 3KLLA 2HV5A 3E5BA 1V51A 3GTNA 4JYDA 2XH7A 4L1GA 4ZO6A 2ZIDA 1EP2A 1VCGA 3C0SA 4KFNA 4Z2KA 3U7BA 1MUMA 1CGWA 1ZJIA 1W1YA 1BD0A 4QAWA 4LUYA 2X40A 4W86A 2D23A 3AUJA 2VYOA 4FOKA 3TMLA 2CZDA 1OCQA 3RCMA 1MI3A 2D0GA 4AF0B 3SIMA 3F5JA 3UG5A 3LCWA 3CAKA 1QAPA 2GWNA 3N4FA 3W1PA 2CITA 3CTLA 1EXPA 2YKKA 3N34A 1OFQA 3ZR4A 2ZOXA 4ZBCA 4CQ9A 2E7FA 1X6LA 3GDKA 1D3HA 2BOGX 2WVVA 4ILSA 2F6KA 5BWFA 4MPKA 1TTIA 2REQA 5AOUA 5F2MA 1PPIA 4TX9A 4QROA 3DEQA 1ZP3A 5FF2A 1W9UA 4W8AA 3NM1A 2WO5A 2TODA 1IGWA 3N29A 1TZ7A 4E3TA 1K4GA 3NDZA 1NU5A 3NQ7A 4HPGA 4O18A 3K46A 1WXZA 5I3JA 5DRCA 4M56A 5DCEA 4ATWA 4OQVA 2NQ5A 3T0DA 3PUEA 2WM0A 1F07A 3N2XA 4JTKA 1WOAA 4HZ6A 1JXJA 2QJMA 4PUJA 4F2UA 1XCWA 3GTIA 3S2LA 2FVLA 3N11A 1ONXA 3H26A 4IMAA 2G3FA 4KEVA 1VPQA 3F4CA 1GQNA 1TPDA 1EJSC 1CDGA 1UUOA 1LCOA 4LF1A 4ZXOA 5H2ZA 4HOXA 2BGSA 2Z2UA 1KC7A 4DUXA 4GYFA 1CGUA 3IEBA 3MMWA 3VM7A 1HFBA 3NA8A 3Q58A 3ICJA 5I78A 1QHOA 5HQEA 1QW8A 3VOJA 4HCHA 3NQDA 1ADOA 1EQCA 1R7OA 3RX2A 4FR6A 4YXGA 4W8LA 3BAKA 4TMCA 1SMDA 1TUFA 4B4FA 3TX9A 1Q63A 3T2PA 2QYGA 4FNPA 4WIWA 2EAWA 3RR1A 3C86A 4MWAA 3R8GA 1EJ7L 1QFEA 3LHVA 3UWVA 4JTIA 1DP0A 3KWSA 5CSUA 3DFHA 3MCOA 1PDYA 2WK2A 4DO6A 3W2JA 3TC3A 1KRMA 1D3CA 3PPGA 4LU0A 2PWGA 5F4SA 3KOXA 3VOHA 5CPMA 2OLHA 1GVYA 3W7EA 4PN2A 2G41A 3BLFA 1J0IA 4LALA 3T1GA 2WXDM 3L2LA 3LGGA 3VCRA 3ZR5A 3INPA 3CPUA 4IPIA 4F4RA 3VDCA 4F2TA 4CNTA 4LUTA 1W56A 2PRLA 4Q8VA 1J4EA 3H54A 2XSAA 4B2DD 1B2YA 2NT1A 3AYVA 3PZ9A 3WLSA 2VURA 1XKJA 4AUBA 4BEQA 2X1UA 4EPDC 3VAVA 1OX4B 2J66A 4JY8A 2P0IA 4A21A 4JCMA 2WVUA 1XPYA 3MO4A 4AY7A 3GNNA 2IS7A 4IX2A 3NEHA 2YXGA 3BLKA 3STCA 2OODA 1CENA 1BXCA 2I5GA 1YTKA 3BZGA 4J40A 3M1ZA 2NX9A 4NNAA 3AHTA 3TYZA 4JQ1A 3IJ6A 1X1OA 4DJFC 1FXQA 4NVTA 3MA8A 2Q3RA 4ZODA 4B5UA 5T26A 3KE0A 1AFSA 2SFPA 4MFDA 5KSWA 3U2EA 2DY3A 4CEUC 4PTVA 5XINA 3KP1A 1V3IA 5TNVA 1QR7A 4ZOBA 2PDKA 4ZE5A 4DIAA 1TZ9A 4S3DA 1JPHA 1M5WA 2RJHA 4M3PA 3CZGA 4QE5A 1KXHA 3M46A 4L9XA 4ECLA 5BW6A 2Y88A 4O53A 4XVEA 2ZDSA 4NXSA 1V02A 1GYNA 3W70A 3RLUA 2JBMA 2WHJA 2YDQA 4QEHA 1DYSA 3OZPA 3EYPA 2ZUUA 1ZBCA 1FA2A 1NDVA 4R5EA 5EL1A 3TUUA 3BG5A 2CC0A 4E2BA 1CBGA 2AL2B 3A24A 5D9PA 3WLRA 3UEQA 2V5JA 3W7IA 4J3ZA 3KCLA 1FWFC 2Z7KA 4J9JA 3HIJA 1FVPA 3LMZA 4WOQA 4KEMA 1PE1A 1NOFA 1MRAA 1FRBA 2X16A 2OR2A 3C8FA 3OLIA 1S39A 3KLKA 4OKDA 5A6TC 4L56A 6A3HA 1Q7ZA 4YTRA 3CS2A 3ZVHA 4ICMA 3P74A 4N4PA 1VBGA 1XYAA 4LJ3A 3NQMA 1T5AA 5TF0A 4W7VA 4D6EA 3PFMA 3U7VA 3BURA 1FHDA 2XDFA 3IV3A 2ADAA 3TYAA 4KMQA 1UBPC 1L6GA 4D72A 1DVJA 4C6NA 5FJIA 5AKQA 4JFWA 3RJYA 2NXIA 1C29A 4PMNA 4IQJA 2WCGA 2F61A 2XGIA 1IIHA 3SY1A 4X60A 3U2OA 5D2YA 4JQ3A 1WXJA 1XLIA 4FHAA 2V63A 1WBJA 2CYGA 1HL9A 4PE8A 2VD9A 3DYMA 1XH2A 3SQLA 3IUHA 3TOPA 3EMQA 5BXTA 1X1ZA 2V68A 3LI1A 4XKYA 3F4VA 4TX6A 4UZSA 3FKKA 3ARSA 3UERA 4WCJA 3OJGA 4CCCA 1P1XA 3HPSA 4CCEA 4DJFA 1ZBKA 3WNPA 2Y7FA 4NNCA 3NL5A 3PWIA 2FZDA 4GNJA 3EWWA 3SCUA 3O63A 3EKLA 1PTAA 1FXPA 4FX7A 2V82A 2OZTA 4NI8A 1J6OA 3M5YA 3W7DA 1QK0A 4KWWA 4UR9A 3WDHA 1EP3A 3VNJA 2UY2A 4DAIA 2E77A 3RO8A 2YJQA 4JICA 3CUIA 1P43A 4Q4QA 2FPVA 4RW5A 3AISA 3EPMA 4P61A 1VJIA 2Z00A 1VJZA 3VD7A 3KBWA 1GW9A 2O9OA 4WHBA 1E6RA 4MG4A 4K3ZA 5EMKA 4V1XA 1U5JA 1F6PA 5K2ZA 4MWAD 1BWLA 4LRSA 4MYAA 3T7VA 2E09A 2VRKA 3JRKA 2YYUA 1H11A 4EXQA 4AXNA 2IXUA 2V5LA 3UR8A 2ZC8A 1NP0A 2ZX5A 1S3HA 4HPNA 2D2JA 2YPIA 2GVLA 3S2MA 3P8JA 4CNSA 1DXFA 4JN6A 1C90A 5A3HA 5CBIA 5CBBA 1VPXA 4GPNA 3ABOA 5CCZA 2RKXA 3GDRA 3NQAA 3RM4A 1QPQA 1V0MA 1RY8A 2OOGA 1SPQA 4M7SA 2XHYA 4YPJA 3BLOA 5FOOA 4E6MA 4A29A 2A7RA 1SFTA 3OIXA 4RDZA 2YOCA 4PBEA 3ZT6A 4JTTA 1VLIA 4QNWA 3IV8A 3QN3A 3ZLGA 4L4MA 1EGVA 4QS5A 3BJTA 1A80A 3QY7A 3C61A 4US6A 5D2VA 4PB3A 4CLMA 2JGYA 3LHZA 3R58A 3II1A 4A05A 3VDBA 3KXQA 2V9DA 3DESA 3I7SA 4GZEA 1UR0A 1AL7A 5H6HA 4A2SA 1Q4NX 2GZXA 1BVWA 1R86A 4F66A 4BZYA 5L9FA 3MBDA 3CNYA 2VX7A 3OLDA 1WKFA 4PUNA 2CEQA 2P10A 4UFIA 1W6TA 3UPBA 3CWNA 1UUMA 4IICA 3N2MA 3SUSA 2GOUA 3ANVA 4H83A 1OGBA 3QYSA 4CN4A 3E0WA 3M47A 1PKYA 2XH4A 1ELSA 4JKKA 3PSWA 4CQDA 1C3FA 1IF2A 2J79A 3CJPA 4CN6A 3M41A 3RYSA 2CLHA 3PM6A 2VUYA 4INFA 1PTDA 2X8RA 3S3GA 4GBUA 1SJCA 4GI4A 1TWSA 3TROA 3D6NA 4CD4A 1E9LA 4J3UA 1N7KA 3L7RA 3W7MA 4NX5A 3W6MA 2Z1SA 3MDUA 1GCYA 4X9YA 2J47A 4GI8A 2ZX6A 4O4VA 1NFPA 4Q8PA 3GU1A 1V7YA 4X2PA 3N17A 1JNDA 4AH7A 3DFNA 4LUSA 4WRHA 1PDZA 2FMOA 2YBTA 1WZKA 2PDCA 3DFQA 1B9ZA 2XN0A 3ARTA 3QC0A 4GX8A 1DQWA 4XB3A 3LPGA 1BSLA 2RDXA 5JUVA 3VC6A 3FN9A 4LS0A 4Z2HA 2V6AA 1O5RA 3NQCA 4XBSA 5T9CE 3POHA 2H90A 1EHAA 1GTEA 2IPJA 5MF5A 4HK6A 1WDQA 3PC0A 3ID7A 1YTDA 5D30A 1VR6A 2GSJA 4TTGA 1H60A 4FNRA 4JTAA 2QUNA 1RR2A 2QNEA 4HNVA 5M03A 4Q6XA 2X05A 1G6CA 2O56A 2XGZA 3SM0A 2OYKA 4Q8TA 1E0TA 1SM9A 3OB8A 2DQXA 4LAZA 3TC6A 1XC6A 5E5CA 1U1HA 2ICSA 5CZJA 1VEMA 1H7PA 3DCPA 3QTGA 2DZBA 2Z25A 4LVBA 5FJRA 5I3KA 1UZHA 1TB3A 3HPAA 5ECUA 4K38A 1QOQA 1VFTA 4DJFD 1LOLA 3VMPA 3H4XA 1P1MA 1RSCA 1TCMA 5E70A 3G77A 3EOLA 4AW7A 4JTGA 4RE3A 4AWTA 3RITA 4XBKA 5FA5A 3WG6A 1AH4A 1XICA 1R30A 4HNUA 1FWIC 4V33A 1XG3A 1R3RA 1RHCA 1ZJBA 1AA1B 3UWWA 1VRDA 2E0PA 4QBXA 3VE9A 1S1PA 4HK7A 5HBFA 4MUPA 4O12A 1HIZA 5D9NA 1Q5MA 5AVHA 4JD4A 5FSEC 5A8GA 2DJXA 1VFMA 2YL6A 3HTWA 2DSWA 3NQVA 1Y5XA 3GR7A 2A2IA 3W7QA 2WJDA 1NVMA 1KLZA 4MHBA 2PDBA 4CVUA 4GQRA 3TW9A 1TVPA 5D05A 3TN4A 1SR0A 4UQAA 3N6HA 2FPYA 3CHFA 2HBXA 5D2XA 4AF0A 1DJNA 2QPXA 3QH2A 1WA3A 2A3AA 1FQ0A 2WC3A 4WY0B 2YW4A 3PANA 3HGSA 1M9HA 1MW1A 3PZMA 1MZHA 3GVGA 3POCA 5F7UA 3N15A 5ABEA 3KOZA 3AIEA 4OBSA 2GDUA 1CYGA 1EJUC 2BSLA 1OK4A 5LNVA 1TPWA 1G9HA 3S1WA 2R6OA 1CI1A 4WDXA 1S2UA 4KESA 2XFFA 2OYLA 4ACZB 3GYCA 2GQAA 1G4TA 5AFDA 1AJZA 4IOTA 4XAYA 5REQB 4L4OA 4HMDA 2BY0A 1GNXA 3K8LA 3T07A 1R9YA 2QEZA 1TJ1A 2E1DA 2ZZ4A 1KBLA 2ZRWA 4ZCWA 2VUNA 2Y8VA 3DI0A 4BWLC 1QI2A 3SW6A 1TJ2A 4IIDA 3F1QA 4PL1A 5JIPA 3BTNA 1TIMA 3XISA 4B4HA 4ZA0A 3GH4A 1B90A 1TKKA 4LX4A 5LZLA 3JUGA 1A5NC 2FQIA 4EXBA 1QI3A 2GJPA 4WDUA 4NG3A 4AD5A 1O4UA 2VFFA 4YJ5A 3E3HA 3NUKA 3KDNA 1AK5A 1GW1A 5H91A 4H6EA 1DBTA 3EDEA 2OCZA 4DUWA 1FWRA 1EQPA 1PZ2A 1TV3A 2A5HA 4EP8C 2DIKA 3LNPA 3V0SA 1H62A 3CQJA 3IIPA 1QNRA 2ABBA 3VIIA 3H12A 3UJ2A 1L8PA 1UR3M 4WZHA 1WDWA 2Z6IA 3GXTA 2G50A 2QDGA 2H3BA 2X2GA 2QULA 3LXCA 2GVEA 2BG5A 3H2FA 1Q6RA 3TU9A 2KX9A 3B0VC 1E6SM 4J3XA 5I0DA 3URNA 4C6BA 2C1HA 4KPLA 3A47A 3TQ0A 1DQUA 2JKAA 3QGVA 3IS4A 3OBEA 4DF0A 4K8HA 2ZWYA 3DYPA 3IGSA 1K1DA 1SO5A 4HU4A 1Z3NA 1Z41A 4ONVA 3RN6A 4MJ4A 3CWHA 1XYFA 2EG7A 4Q7IA 1ISZA 6ENLA 3MUAA 1OX4A 1IWAA 4LPCA 4JN7A 5E6YA 4MNLA 3CMGA 1EJVC 4GH1A 4AFYA 3FX4A 2YXOA 4J3TA 2QCLA 3WZ0E 3TNOA 4Y7EA 2FB2A 4XX6A 1ZBWA 3PZIA 5C2XA 3E0FA 2BHUA 4IX0A 3A22A 1MXSA 1H7XA 2EPLX 3M16A 1LQAA 3TDFA 1HTIA 1TRDA 1WBHA 3MBFA 3WQEA 3K1GA 3RO6A 1JGIA 3LOTA 4HD5A 2GJLA 2JK2A 1J12A 3UY7A 3B06A 4GY1A 4UTTC 4OVXA 1MYRA 3MCNA 4GUHA 3QGAC 1DWFM 4L4PA 1V4YA 2D73A 3V4BA 4Q22A 5HJYA 4XIMA 2YW3A 3VE7A 5DFAA 3F7JA 4JZ5A 3AXHA 3L0NA 2E25A 3LGEA 1HO1A 4A22A 2DEPA 3NSNA 3DX5A 3RPTA 3TXZA 3TFCA 3UPMA 1PYFA 1T7LA 1XIGA 3QKZA 1EC7A 1C8VA 1IEXA 4Q4PA 5LGZA 1ITCA 3VNLA 1UWRA 1W5PA 2J9YA 2QCDA 4BK9A 4IG2A 3T0AA 5I3HA 4KRZA 3S0CA 1DIEA 3O6CA 3AHXA 2GGIA 3MT1A 4NU7A 3PJXA 3GFXA 1W3HA 3EA1A 4NI3A 3PFRA 4TUFA 3B8SA 4XZIA 3TA6A 2VQUA 3TWBA 4GH3A 1V03A 4IIEA 2RUSA 4U5IA 2OTDA 1H50A 3LYEA 5LNRA 1YE6A 2ZRYA 5BYWA 1JCTA 1WOBA 3G2GA 1KFLA 1H49A 2D0FA 2HVNA 2OZ8A 3GU2A 3GNDA 2W3ZA 2NW0A 1AD4A 5B7ZA 1UZ4A 3BLDA 4NJIA 5DXYA 3MCMA 1CB2A 3GLCA 4TX8A 1KXTA 2PTWA 5I79A 3H70A 4HOZA 4LV9A 4XZLX 3VIPA 1XIBA 3F2DA 4CNUA 1JF5A 3DC8A 2VTFA 4I9AA 2ISSA 4DNHA 3M0ZA 2VQTA 1UH4A 4KERA 1RLCL 3TWAA 1PCKA 5CG7A 2NUYA 1CXLA 3ABSA 2ACSA 2WZEA 3L4TA 4XD6A 1X8CA 3ARRA 1W5MA 4GY7A 4Q4RA 1C93A 4MSSA 4RDVA 4IIGA 2W79A 1SW7A 3B0UX 1UASA 1VQTA 2CLLA 3CASA 1G7VA 2HXUA 5C7HA 1VYSX 4AZCB 3QFEA 4I9JA 2IQDA 4HHMA 3VABA 1V8EA 1BSIA 3H7RA 3FHAA 1RCOB 3ARXA 4PMUA 4JQ4A 3UJFA 4H01A 1R0MA 1DWGM 3MHUA 3CPRA 3WLOA 3LTYA 3QZAA 3WLPA 3W82A 3MKKA 1MW3A 2IMRA 3CO4A 4NRRA 2XFRA 3W1LA 4O0ZA 3FA4A 1EJXC 4YWIA 4DN1A 5EMMA 1E6PA 1TV8A 3QHNA 1M7OA 1WAWA 4MUZA 2MUCA 3KS5A 1XLAA 1IZKA 1MEIA 1DXIA 4P8XA 3NXFA 1UQZA 1TPUA 3N73A 3MS8A 3WBWA 4R7JA 4MAVA 5KEZA 1GJUA 1MSSA 2HZGA 3NQBA 5LYRA 4H2CA 2W63A 2ZDRA 2WSKA 3D3FA 1KCZA 5IFPA 4ERAA 4Q7NA 5I3IA 3H6OA 3CTTA 3HURA 1VCVA 3CPGA 4WDTA 1YPFA 4O13A 3CZJA 1EO7A 3VDGA 5CJMA 3WMLA 4IXHA 1Y5WA 1F5ZA 2EXOA 3NPUA 4U3CA 3QR0A 8A3HA 4JXCA 1LL6A 2PRHA 4GIEA 2OEJA 1CT5A 1S5VA 3IAQA 3NAVA 4XAFA 4HB7A 2Q8ZA 3OOQA 2G3NA 1R3WA 4OBTA 1ME9A 2CU0A 4H2HA 5FKYA 4JYEA 3QLLA 4A8RA 4ICNA 4O16A 3QC3A 1XBYA 1QXLA 4I5XA 4MOZA 1XUUA 3LY0A 1I1XA 4QS6A 3RG6A 5CPNA 2GK1B 5T9BG 3B9OA 1NQKA 4U5KA 1WDPA 4TIMA 2HPMA 1JGMA 1GQJA 4Y9AA 2PCQA 3GKAA 2VX4A 4FAMA 3C0JA 4IMDA 3BMVA 2WMKA 3N2BA 3QOMA 2W61A 1TX2A 3C2FA 1FCUA 3I7RA 1IR2A 4AYSA 2W0UA 1LBLA 3PZGA 1JAKA 2DIJA 1RP8A 1QNOA 3V16A 1ZS2A 3NNTA 3T81A 1UHVA 5JBFA 1TWDA 3NSXA 3R10A 2PLJA 3G24A 3ABRA 1OB0A 1UKTA 4CUCA 4CCDA 1BAGA 4FI4A 2R8WA 5B80A 2PRMA 4OOUA 1T99A 3EWDA 4LEFA 1E40A 1TMQA 2WMGA 4JL2A 4OECA 3EWZA 2YL5A 2OWCA 3WDJA 3WFLA 4DXKA 4EVZA 1IEVA 2Y7EA 4O57A 1WCGA 5FESA 2XYLA 2V3GA 4DAFA 1OF8A 3KBNA 1R85A 3L21A 4ZR8A 4PCSA 1L9WA 3UZZA 1A5LC 4HNOA 3GVQA 3VZYA 4RX0A 1VFUA 1QVBA 2J75A 2V0TA 1J0HA 3TZFA 4ZB5A 2CPUA 3WN6A 2GWGA 3L5AA 2OU4A 3QQWA 4AVFA 5BZAA 3OYZA 1TPC1 2F8QA 2DUZA 3EDFA 2J8FA 4UFLA 4PTWA 2EPOA 3CHDA 2QJJA 1XUZA 3E6EA 4JHOA 2HJPA 1VFFA 4DO5A 2QKFA 1T0OA 2J9ZA 1XYBA 2VEGA 4DYKA 2VVSA 1TV5A 2V5KA 1TO3A 1QTWA 3RF9A 2W67A 3DH7A 2BMBA 4GOAA 1ZQ5A 2KZHA 2UBPC 3RX4A 1GKPA 4AMAA 3R0UA 1P6BA 4O8AA 3SCVA 4I5UA 4I6KA 1C9WA 1MDLA 3I4KA 1IXNA 2HNEA 2OX4A 3TCSA 1B3XA 2PEVA 4ORMA 3WEZA 4LFYA 1U5VA 1A0EA 4I9TA 4GK8A 1YBQA 3N14A 3P93A 5D9OA 4R33A 2XIOA 3MZ2A 2IPWA 5IHRA 1JZ8A 2E9LA 1O5XA 5ENLA 2X1TA 4ZOEA 3QHMA 1FP8A 4IIHA 3W53A 4E2OA 3VGFA 3P67A 3FXGA 1NEYA 2WVTA 3D3AA 3QTPA 5BU9A 1YYAA 4LRTA 1BYDA 4JX6A 2Y7GA 3NQ2A 1JZ3A 3GC2A 1OFBA 3PP7A 3ABXA 1YDOA 4LV4A 3SUTA 2YDSA 2DDXA 3WH5A 3THDA 3TLQA 3VX0A 5D09A 3TE9A 1XDLA 3WJSA 3LN3A 1ZAHA 3J7HA 2JE8A 1U1UA 5A6MA 2QGHA 3WBYA 4R88A 4GZ7A 2QT3A 1JZ5A 2FDMA 1HL2A 3W29A 4ACZA 4FEZA 3MI3A 3URBA 1M7XA 3VPLA 4ZE4A 5C71A 2CETA 3LS9A 4LOCA 3BGGA 1KA9F 2DT1A 3M0LA 1VHNA 1XSJA 3QV8A 2FB3A 1CIUA 3E12A 1EIXA 3TYDA 4O0QA 2WWDA 3O9NA 3OQ8A 3MDWA 4OUEA 3K4WA 1C7TA 4E5TA 1QI5A 2ASHA 1H7OA 4Z2LA 1BXBA 2F6UA 4QITA 4DBEA 3ZXWA 1GOMA 1SJBA 1NAL1 1PSCA 4LVGA 3D46A 1QWGA 3GSMA 4QM1A 2GQ3A 1DWAM 3DFOA 5LHFA 3W71A 3UJRA 4C6IA 2F7FA 4Z1DA 1GOQA 1RH9A 4ALDA 2CZEA 1XYLA 1EPVA 2QV4A 2VEPA 3MHGA 2J7BA 1LRTA 2PTZA 2ZXBA 2XFWA 4PYSA 4H9MA 4DI9A 4NAFA 3G8EA 3BXWA 2AAMA 1EZ2A 3LNMA 1G67A 1LWHA 4FSAA 4L6HA 3LZ3A 2NSXA 3MVIA 3SRHA 3SY8A 3U4AA 4DYEA 3N9SA 4U33A 2PGFA 3AZSA 4FS9A 2YZ5A 4RZ4A 3CZKA 2OLAA 5BXPA 2BNJA 1F9CA 2H6RA 4GFSA 4M19A 1W9XA 4D6GA 3FNDA 4G1NA 4J3VA 4E4UA 3VOGA 3ALGA 4JIHA 1HUVA 3LQLA 3AUOA 4KS0A 3NQGA 1LORA 3MO7A 1ISYA 2BHYA 1X6NA 3GS6A 4GABA 2BZNA 3WK3A 5HMDA 3SB0A 5BCAA 1NM9A 3GXDA 2GSHA 1OFAA 1K7EA 3PB2A 2J4GA 3AIUA 2GDQA 1N82A 1AQMA 1OJXA 4F79A 3SRFA 4IMEA 1Q66A 1EXBA 4HKPA 4P7RA 2W27A 2AAAA 5E9XA 3W1UA 1UWUA 3WQGA 1KTCA 5MKGB 3OBKA 1EJWC 3S5ZA 1E4MM 4FO4A 4ZFMA 3IIOA 5BMXA 4GYJA 2YGYA 3V35A 1UMLA 3NYDA 1SSDA 3T2QA 4HU0A 4A35A 3AXMA 2WNNA 1HW6A 4XD3A 2WLYA 3ITXA 5D38A 5LIYX 2HPIA 1OX5A 2VCAA 1W8GA 4K6AA 2WBKA 2XINA 3C2RA 4BY3A 3H4GA 3OA5A 3AYTA 4S3GA 2NWRA 2FGLA 2X7VA 1A5SA 3DZ1A 1MMFA 5FEXA 2VFIA 3LCHA 3OLEA 4L5ZA 1WV2A 1XWYA 3WO8A 3VCNA 2CLKA 1RAKA 3F4DA 1XQLA 4H8VA 2FJUB 3LTPA 2ZUTA 1S1RA 4C1LA 2GQ9A 4J27A 1U2YA 1OCNA 1O12A 1TPVA 2O7QA 1UG6A 2NVAA 1ME8A 4R9XA 4M81A 1XKYA 1GWJA 2PBGA 4DBWA 3CQHA 4B92A 4LT9A 3CAWA 4X22A 3QMSA 2A7PA 3WLJA 2NQLA 1WZMA 3LD5A 2Q8LA 4XTDA 3IGHX 5EY5A 2BDQA 2QJGA 2CHOA 1B0IA 1G69A 3HG2A 3NWRA 4PRRA 4GX9A 1UWIA 2BP1A 4TV6A 4DO7A 2C0AA 1MO0A 3DECA 4EF9A 2P50A 3NL3A 3HPXA 1V6XA 4XSLA 4PMYA 2DSZA 4NNBA 3VGHA 3NXLA 1LRQA 1TA3A 4HOWA 8RUCA 2QXWA 4W5UA 2GVYA 3CO8A 1TVLA 3L12A 2WW5A 3KWXA 4ZQOA 4QTGA 3R2GA 2J6VA 3SQSA 1CPUA 1F8IA 5G1MA 3QFWA 1TR9A 4GVFA 5HWJA 5AC8A 1E51A 3W22A 3SCTA 3ES7A 2GSEA 4AC1X 1QI0A 4Z08A 4S38A 4GYKA 3QF0A 4RNIA 5BOOA 2PDLA 3W84A 3EGJA 3WQPA 1QOPA 2E40A 3EEGA 3GDTA 4HN8A 4MM1A 3VZZA 4Y96A 1RY0A 3ZS4A 1PUDA 2WJZA 4IWWA 5F2IA 4LTSA 4M6PA 4JIEA 4GA8A 4GNKB 3ZFHA 2YCLB 5IXEA 3EWCA 3LI0A 1VGAA 1VKFA 2C3ZA 1TFVA 2DH2A 5LA2A 1VIZA 2PDNA 2ZBTA 4ML9A 4PUDA 1AQ0A 3WH7A 2QAFA 3K5XA 5A2AA 4TOQA 3IVSA 1EF2A 3GX9A 4OUIA 3I3EA 1SO6A 3WFAA 4UQBA 1HKWA 3AHYA 1IYXA 2QUUA 1CX9A 2DW6A 3VNIA 5A6JA 2HE5A 1YNPA 2OMAA 2DZXA 3PNZA 5F4WA 4W85A 1YKWA 1KM5A 3ATYA 1LG2A 5AYBA 4RUBA 4UTMA 4AZCA 1UIOA 3YPIA 3ITVA 1MWOA 4K36A 4RZBA 3KVKA 4UTIA 5HUPA 4JTRA 2DT2A 2ZICA 1IXOA 4BHYA 1F74A 1PX4A 1Z48A 4MJZA 2I17A 1KFJA 4PTDA 2EO7A 1I4NA 4RPPA 2HE8A 2ISFA 1KNWA 2B31A 1JCNA 2OGYA 3FLUA 3VIMA 1T8XA 4LBUA 3O16A 3HB9A 2HNHA 4P7NA 1GZGA 4IPPA 5FD0A 4F40A 3ZIZA 4NX0A 3WQVA 4C90A 1UJPA 5FJUA 2FHBA 3NZGA 3AXKA 2V81A 3LHUA 1G4SA 4AZ7A 3N25A 1F4HA 2WCSA 1VBHA 3NJ3A 4GG9A 4PUWA 1PX8A 3AYSA 7ODCA 4PBGA 1F6KA 1A5AA 5A8MA 2R1KA 4BKNA 4PB5A 2VEIA 4B5TA 3WLLA 4AZHA 4QEEA 3TJIA 4J2PA 1ISXA 3UY8A 1SW3A 5ABFB 2P8BA 2WMIA 3C0QA 4QE1A 4YYCA 1P0BA 4HT3A 1AMYA 1EC9A 1ISVA 4J28A 4JKLA 4HHPA 2RDTA 4QG6A 4HCDA 4AVOA 2VC5A 3UWYA 4POCA 1U30A 3M9YA 3DFSA 4IPNB 1L6YA 1GJPA 1XRFA 4NHVA 3V1HA 4KFOA 4OHQA 3W2UA 1QBAA 1CGXA 3S9IA 1UZ1A 3QMRA 3VUPA 2GVJA 4BR1A 5K3VA 1PZ3A 3K8MA 1MRQA 3IPWA 2J7FA 4HZ8A 5A2BA 1UB3A 2GK1A 2ZZ5A 3P2VA 3NFUA 2E9BA 2EEXA 1C92A 2XH0A 2JALA 4PB4A 4YTSA 2QJIA 3FDGA 2QIWA 2DW7A 3P0XA 3CZLA 1WKYA 3PTMA 5A8OA 1ZY9A 1GUVA 1REQB 3GHSA 2ANUA 4NAEB 2UV8G 5I3DA 1E6XM 1U1JA 4S2CA 3A12A 3FJ4A 4ZTXA 5CZTA 4IXXA 2G8ZA 5CGTA 4NRSA 3I3DA 2DUAA 2E9MA 3CL8A 3QPEA 2ZUVA 1FWGC 3EBVA 5FJTA 3H7VA 3EEZA 2VD8A 3EA3A 3PZVA 1XX1A 4F9JA 4PMRA </