2QCMA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain (asp312asn mutant) of human ump synthase bound to 6-hydroxymethyl-ump
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
257
structure length
256
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFENRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 100
structure length 256
sequence length 257
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qcmA00
3W75A 1DL3A 4UFMA 4RXGA 4JR5A 1W0MA 3M44A 1I2OA 3INPA 2Y7DA 1GT8A 2RKXA 5K3VA 1LLZA 2Y70A 3DI1A 2EHHA 5FESA 4Z0SA 1H63A 2XN2A 3G1VA 4TR9A 3P74A 1TPFA 5D02A 1XBVA 3EXSA 3S0CA 3LBCA 3T78A 3NGJA 4IOTA 2V2CA 4C1LA 2QR6A 5CG7A 1TTJA 1ZENA 2RFGA 1OFOA 3NQ6A 4NZFA 1HTIA 1QAPA 3BG3A 4FIRA 3C2EA 2ZZ6A 1SUXA 3HF3A 4GUHA 4OE7A 3M43A 1GG0A 4O14A 3TMQA 3EX6A 1RQBA 1UBSA 1K7FA 1RZMA 3W7EA 5D38A 4JTKA 1AL8A 1W5OA 2ZCGA 1JQVA 3DFQA 3QSRA 1ZJIA 1H5YA 1BWKA 3ATZA 5J5DA 4ADSA 1F6PA 5FF7A 3G1XA 3S42A 2X1UA 1TTIA 3S8HA 3EWZA 5D2VA 4N9EA 4AH7A 1O95A 5L6UA 1SO4A 3H54A 2W6RA 5I3FA 1I8JA 5DCDA 4JTIA 3S9YA 2J9XA 3S5NA 1KV5A 1F5ZA 4NJIA 1OFDA 4WY0A 3ZWTA 4MY1A 5LNWA 1LRNA 3NDOA 2HMCA 5F1VA 1OK6A 1X8FA 2NXIA 4JYFA 1S5VA 3KVKA 1HO4A 3M47A 1KM0A 3NQVA 4ZQOA 4HT3A 1AK5A 2NUXA 3LRMA 5AC8A 2UV8G 2V82A 3NOEA 2GQ8A 2QDGA 4LS2A 5L9FA 3BO9A 4LVAA 1KFJA 3QMSA 3GXPA 5C6MA 4O12A 1VHCA 4DO4A 1VYPX 4NNBA 4JTUA 1VZWA 4UFJA 2ALDA 4NJKA 1YPFA 4CNOA 4QIUA 5LHFA 3HBLA 2CWNA 3EXTA 4HIBA 2DP3A 4PTNA 4DBDA 1RPXA 3ELFA 1MEHA 2VEPA 3GAYA 3C2OA 1EB3A 4RLIA 2CLOA 1V7YA 4Y96A 1TPWA 3RNDA 3WK3A 2QKFA 3KAOA 2Y6ZA 4O18A 3TSBA 4PA8A 4JTLA 4K7VA 1YPIA 3GDTA 2A5HA 4IUOA 1YXCA 2XFWA 3W1RA 3GXTA 4UTJA 1QPQA 4ORIA 2CLFA 3DHDA 2RHGA 2NX1A 3IIPA 3W71A 4E38A 3QZEA 1I45A 2WOQA 4NXKA 3NAVA 4O1AA 3KOFA 1NAL1 3MJYA 5LNUA 3SECA 2Q8LA 2JKAA 2PRMA 4JN6A 2WSRA 4LTSA 4AAJA 1PHWA 1L9WA 3NM3A 4UTLA 2QJIA 2JK2A 4JIQA 2CLKA 3W2LA 3WJZA 2ZTJA 1H62A 1EUNA 2FIQA 5K9CA 3LCIA 3UXAA 3RK8A 3N9RA 3LDVA 4S1FA 1VYSX 4JTEA 5AHLA 5AHFA 4M6VA 3ABRA 2VFIA 4WJEA 5LSMA 3QYQA 4FX7A 5G5IA 1WAUA 5D05A 1WQ5A 1QPNA 2NX9A 4JICA 4MJMA 2NX3A 1GEQA 2GVLA 2GVJA 5G4EA 3L2IA 4K7YA 1G4PA 1LTDA 3G1SA 1H50A 4LW7A 1B9BA 1K7EA 3W74A 1JCXA 4RV8A 3IIXA 2A2IA 4HNUA 1DKWA 2YFOA 1GJPA 4OV9A 1K8ZA 1K03A 1ZAJA 3U2OA 1K3UA 4AHPA 2QCFA 4N02A 2YW4A 3PUEA 1QCWA 3HQ1A 3NR0A 4TMCA 1G4SA 3UYCA 3W76A 3B0UX 3E0IA 3ABSA 5A5WA 3P8IA 4QNWA 3IGUA 1JCMP 2QF7A 4P61A 4YCOA 3NQDA 4UTHA 4O4WA 3LCFA 4EF9A 3QRHA 3UY7A 2PCQA 4OV4A 1GOXA 3N14A 4GWEA 5CPOA 3NL3A 4JYDA 2WNQA 2WQPA 1NFBA 1TIMA 4MLJA 1VR6A 3L65A 3WK1A 3V75A 2VFHA 4R7JA 3L0GA 3E49A 4OHQA 4JX5A 1RV8A 2J9ZA 1TTPA 1ZHAA 4ZMGA 2C16A 3FEMA 3UWVA 3NZRA 3TA6A 6TIMA 4QM1A 1XFBA 4KFNA 2ISWA 3QC3A 3RU6A 3W1AA 4N9CA 3CPRA 5FEPA 3SW6A 1JUBA 5F1UA 1DQXA 4FNRA 3W72A 3SGUA 3FFSA 3MBDA 4CCCA 1DV7A 4FB7A 3W1TA 3LV5A 5HWNA 1ICQA 1W8SA 5F4XA 3TQVA 2VEIA 1PIIA 1KTBA 4MPQA 4UUIA 3MI3A 2WNZA 4Q33A 5E93A 3W2NA 4N9BA 3O6CA 3G1AA 2HS6A 2JGYA 3TU9A 4LOCA 1VQTA 1W5PA 4XTDA 1JUKA 1LM1A 4TMBA 1Q6OA 2X2GA 5CPLA 5DN1A 3N9SA 3PBWA 1H7PA 1ME7A 3T40A 3LCLA 4DBEA 3TV8A 4LV4A 1YADA 1VS1A 3S6DA 4AEOA 4ZVJA 3TSDA 3LTPA 1LYXA 3CIXA 2E1DA 2GJNA 6ALDA 1EEPA 4WD0A 3L66A 1WOAA 3LHYA 2B7NA 2B7QA 2HSAA 1HUVA 3FIGA 1H7NA 2ZRYA 1TSIA 4GNJA 3DFSA 4WOZA 1ICPA 5F2LA 4CQ9A 1A5SA 4A3UA 1O5XA 1KBJA 1KFEA 3W2MA 1K7XA 1YTKA 5AHNA 4HN4A 1TJRA 3GB6A 4ZQNA 4EOUA 3H55A 3GVGA 4NU7A 4HSOA 3VFLA 4UIOA 3QH2A 3TAKA 4QJ1A 4IMEA 4E2DA 2PRHA 1XL9A 2ZDRA 2A7RA 1JRBA 2Z6JA 1OFEA 2ZA1A 5BRBA 1PCWA 1JCNA 1OX4B 4A29A 2C14A 2PE4A 1P0NA 4QQ3A 3GKAA 4K37A 1MEWA 2AGKA 3N19B 4O4VA 3CTLA 3QM3A 2A6NA 4Y6GA 3KVMA 3O07A 4HNVA 1V5XA 5SWUA 3DKJA 3OVQA 4CNPA 1AW5A 4WQ6A 4BK9A 1DORA 5C55A 2WPBA 4GE8A 4DQWA 2ZRZA 1TB3A 1G69A 1W56A 2OMAA 1JJKA 3L21A 3GK0A 2ZA3A 1QDSA 3QF0A 4IPIA 1LBMA 4DF2A 1ZALA 3M16A 4JTGA 4EF8A 4YCPA 1MXSA 3EEGA 1PVNA 4ML9A 4N6EA 4Y90A 1SPQA 1VRDA 3DI0A 3O8AA 3PC0A 1TPDA 4AWUA 2JKEA 3QSTA 1RQEA 3TH6A 5AYYA 3UZJA 3IIOA 4EWND 2QCDB 4S2BA 1SZFA 4XKYA 5F2GA 1EP2A 3S1VA 3MWAA 4YMZA 2ISVA 5KSWA 1JR1A 3E96A 3NL2A 3S5ZA 3G1DA 3USBA 3PG8A 3GX9A 3FOKA 3LHUA 5EL1A 1TV5A 4LS0A 4UTWA 3QPYA 4MYAA 5C2XA 1P5BA 3LRKA 1T0OA 3SR7A 1F74A 2EKCA 3O6YX 1LLWA 1NEYA 2WSQA 3TR2A 4O52A 3R12A 2RDWA 2EAWA 2ATMA 2YGYA 2PURA 1JULA 4MYXA 4RX0A 3CQ0A 5HQEA 3BW3A 3M5XA 5I3KA 3KFTA 2VKZG 5HJLA 3A23A 3W88A 4DF1A 1Z42A 4GUFA 1WA3A 2ZRWA 3W7GA 1EX5A 2J6XA 4UFIA 4UMAA 4Y8FA 4A21A 3S5OA 4Z0JA 1H7RA 3CHVA 2A4AA 4JTTA 2YW3A 3DFPA 1F76A 3HOJA 5H2ZA 3EX4A 3O16A 3PULA 3W07A 2VELA 1OFPA 3Q37A 4NX0A 4QAIA 2YX0A 1UCWA 5FF3A 4K36A 5CZSA 4JTHA 5AYZA 3STEA 3P82A 4GXMA 2X16A 3O06A 1XBYA 3UQNA 2CZFA 4MLRA 1LZOA 2WO5A 3WJSA 1VPXA 3NM1A 4UXDA 1TPH1 1FQ0A 1SQ7A 2V5BA 1Z41A 5HR6A 3IGSA 1R47A 2ZRVA 3NQMA 3IIVA 3TFCA 1RQHA 3AJXA 3W7JA 4CCDA 2ZZ5A 5DXXA 3B4UA 4UTKA 1JQXA 4IX0A 3CB8A 4JIPA 2QEZA 4L4LA 4O19A 1XXXA 3LXCA 3YPIA 1PCKA 5KZDA 1WDWA 3BLFA 3NQCA 3OA3A 2TSYA 3PG9A 2E6FA 2DZWA 1KV8A 5CGQA 5BMWA 3N2XA 3TQ0A 4FXSA 4DF0A 3LTSA 3RLVA 1KA9F 2NUWA 1TPB1 3GLCA 5CKSA 4UR8A 4HHPA 5EPDA 3F03K 5AHIA 5TBOA 1KFKA 4UFHA 1NVMA 3THQA 4MFDA 4XBKA 1VYRA 4O0ZA 2FB2A 5AN7A 1LBFA 3DAQA 4U4MA 1AMKA 3IV3A 3DHFA 3QPZA 3P67A 1ZFJA 1W5MA 4LS1A 3HJZA 1FCBA 3IRDA 3MO7A 3A21A 4N9DA 3IVTA 3NQAA 1O60A 1KM3A 5U4NA 3LCGA 1R30A 3A22A 3QQ1A 2FDSA 2ZRXA 3PBVA 3NQ7A 1SR9A 3MUXA 2J88A 3HPZA 1LCOA 1L2UA 4HPXA 4AHOA 3P7YA 3A5VA 1XDLA 3QW4B 1R2TA 3RMJA 3QJAA 1N8FA 1OYBA 1ZY9A 3HB9A 5EBUA 1OFBA 5AC7A 1IXQA 1BTMA 1TCDA 3NVTA 5DBTA 1OX5A 3EX3A 5F4SA 3DKLA 4RK8A 1KLZA 1OFAA 4MY9A 1GPWA 4ZQPA 5CPNA 1Z48A 3DXIA 3OIXA 2E5DA 1H60A 3NL6A 2H6RA 3ABQA 1ALDA 1A5CA 4UR7A 3L0KA 1LP6A 3ANYA 5IM51 5A8GA 4IXXA 2HS8A 1KLYA 1MZHA 4FO4A 1FWTA 3VI2A 2JGQA 1BKSA 1CX9A 1QOPA 2C0AA 5FF0A 3W1MA 1M5WA 3M5ZA 1SZEA 2G95A 4IGHA 4X22A 5K4XA 3L0NA 4OBTA 5CSRA 2WNNA 1YXDA 2BSLA 3BK0A 3VNDA 1X1ZA 5I3JA 3UWUA 3DZ1A 4S2CA 2OZ0A 1DJNA 2Q3OA 2JKPA 3G3DA 3PR2A 2ABAA 1TMHA 2H8ZA 3D0CA 4HNNA 4MY8A 3A5FA 1JUEA 3PF3A 4FNQA 2OX1A 4UTIA 4O1CA 3NG3A 2C6QA 4OWGA 5EYWA 3TAOA 2Q8ZA 1Q3NA 2OCZA 1L6SA 2FPVA 4O28A 2A7NA 4WOQA 4O0KA 4X3ZA 5KZMA 4E2BA 2EPHA 4K38A 2ABBA 2GUUA 3GR8A 4GUIA 2V9DA 1EIXA 3B06A 4CLMA 5IBXC 1FCQA 1YDNA 1IGSA 1PHQA 5BOOA 3HG4A 3QEZA 4JY9A 3DGRA 1S3HA 4NXSA 3B0PA 2A0NA 3C61A 4K8HA 5C54A 2W0UA 4PC8A 3LHWA 1FWRA 2ZZ4A 3T7VA 3I68A 1RR2A 3MHFA 5CPMA 4YLWA 2A1YA 3NZ1A 2Y61A 2E68A 4ZZ9A 1X6UA 1VH7A 1YXYA 1H61A 2WV8A 4JYEA 1QWGA 4A22A 4O54A 3EB2A 4ZQMA 3L67A 1XCFA 3W1LA 3GDMA 4IXHA 1I2RA 1FWWA 3IEBA 2QAPA 2OJPA 3P61A 2Y88A 3W84A 3WJXA 4RZ4A 5GVJA 3DBPA 3MP3A 3T55A 1ADOA 3AO0A 3NEVA 4AVFA 3A9IA 3G0XA 3GIYA 1VCGA 4YWIA 4G1KA 1FUYA 3TXZA 2GQ9A 4LVDA 3EWXA 5D2WA 3SGZA 3W1UA 5FEWA 4EIVA 3L68A 1OK4A 1L6WA 3FKKA 1PL9A 1DOSA 1W1ZA 5D09A 1SO3A 5J5RA 5CSSA 2XN0A 4ZQCA 5HWMA 3P62A 2RH9A 4PH6A 3SIZA 2Y89A 4JEQA 4ZQRA 2CU0A 5D03A 4GFSA 3JRKA 4BFAA 3C52A 4AWSA 4AF0B 2TRSA 1W31A 2PRLA 3W7KA 2ZYFA 4FNUA 5DY3A 1E51A 2Y63A 3LERA 2G96A 2E09A 1R46A 1Q6LA 3PVFA 4LY8A 5DBUA 4NUWA 3F1QA 5TIMA 3BG5A 3MI2A 1F7BA 2CLEA 2P10A 4Q4KA 1TQJA 5AFDA 3CU2A 1XBXA 1F2JA 4KWVA 3DU0A 2QCGA 5KZEA 3LHZA 3QMTA 1OVDA 2I14A 3W7NA 2FTPA 3W70A 4K6AA 1EA0A 1OX6A 4XQ6A 3M6YA 1XI3A 2J9YA 1S5TA 3A24A 4O1BA 5AB3A 1YTDA 3TQKA 1H7XA 4XTIA 3EX1A 4LVGA 3PSVA 1OX4A 4MKNA 3O1NA 4A2SA 3MP5A 3P80A 4QNEA 5AHEA 1NF7A 1FY6A 1SW0A 3TC7A 1GVQA 2B0MA 4I7VA 1XKYA 4ADTA 4HNTA 3NNTA 2GVGA 2XN1A 3TC6A 3S1WA 4R34A 4BWLA 4RZ5A 5G1YA 5I3HA 1EPXA 1WOBA 3GDRA 4UTTC 4DPPA 3BW2A 5KITA 3NQEA 1TREA 3CEUA 3RFAA 2O7QA 3HGRA 5KTLA 3IIZA 5ABTA 4RR4A 5AYXA 2QCDA 2AQWA 1J5TA 4NNAA 4LVBA 1IXOA 1SW3A 2EF9A 2Y7FA 1GG1A 4RCXA 1PE1A 4WY0F 2I9EA 3OHIA 3OEXA 4AWTA 4BR1A 2GJLA 2A7PA 4N2YA 4JS3A 3MW7A 3RF9A 2V0TA 1VHNA 4IMCA 2QUTA 3GDLA 3UWYA 5DCBA 4ORMA 3NPWA 1U83A 3TMLA 2BTMA 5LNVA 3G8EA 5KMYA 4Z1CA 5HR7A 2E5CA 4QSHA 3LCWA 3NQ2A 1B4EA 3M1ZA 5C5YA 1QNVA 1G7VA 1OG0A 3M41A 4FNSA 4AMAA 2TPSA 2O7SA 3GNDA 4A2RA 1OFQA 1ML1A 5F2MA 3E12A 2B7PA 3U8GA 4IJBA 1VJIA 1W37A 2RDTA 1ZCOA 2QCMA 2X1SA 2DZTA 4MIMA 5K2ZA 3NO5A 2Y85A 4Z08A 5HMSA 1Q6QA 2V5LA 1M6JA 3M7WA 4UNKA 2DORA 2H3DA 1TQXA 1IIGA 4MZYA 1L6YA 2QDHA 3MHUA 3QQ0A 4TU1A 1SSGA 2H90A 1GYNA 4DPQA 5DLCA 2YFNA 3E9AA 1RD5A 3LXAA 1OHLA 4JGDA 2G97A 1XM3A 4NVTA 4RXFA 4DO5A 1OABA 3C4UA 3W1XA 3SZ8A 4CNNA 4PODA 1FDJA 1GZGA 3HMJG 4DEFA 3PAJA 3S1XA 1CW2A 3TCEA 1ME9A 4WXZA 3M5YA 2DZPA 1B57A 4DO6A 4HPJA 5HUPA 1W54A 5TQLA 3W7MA 4O13A 4GBUA 2HTMA 4FF7A 4JDYA 3LCXA 4LNYA 4BI6A 4YL2A 4AB4A 1OF6A 2CZEA 3MYPA 4FIQA 2QCEA 3NPUA 4LUIA 3M5VA 3CEPA 1IIHA 2P1FA 2QCNA 2ZRUA 4GC4A 3GNNA 1QMLA 3BLEA 2R91A 1A53A 4LC8A 3DENA 1FWNA 1BEUA 4IMFA 4RZ6A 2R94A 5LHEA 2V2HA 2YXGA 1J2WA 3LCHA 2V8ZA 3IVSA 2YSWA 3BGGA 4JX4A 4M5PA 3EWWA 4OGZA 3DFTA 3PB2A 1TRDA 1W3IA 3L5MA 3LOTA 1IXNA 4RJEA 1ZNNA 3W7IA 5HINA 1D3GA 1AW2A 1B3OA 3B05A 1KFCA 2ZZ2A 1JCYA 1FXQA 1VGAA 3T4CA 2B4GA 3I65A 1KM2A 2CZDA 4R33A 2DJXA 1ZAHA 2NV2A 3TFXA 1OF8A 1GQNA 1KW1A 1SFJA 4LV9A 2ZZ7A 1JVNA 3Q94A 1I2PA 3O15A 2NLIA 1DHPA 2CZ5A 3GAKA 1KFLA 1AW1A 1WX0A 5EKYA 1QPOA 4X9SA 4DELA 4UCGA 3W2KA 5FF2A 2D73A 5K4ZA 1SO6A 4ONVA 1GTEA 3VE9A 1ME8A 2NUYA 1I4NA 1O4UA 5LGZA 1WXJA 2Y7EA 3R13A 2FPYA 1DVJA 2YPIA 1EWDA 4NZJA 3W87A 4O1DA 2OT1A 5HUOA 4ZL1A 4XWUA 4I9AA 1JCJA 1S5WA 4DXVA 2J27A 3LX9A 1K02A 3P81A 4FNPA 3DFOA 1I2QA 2F7FA 5I3GA 4GUGA 3FKRA 2VXNA 3PM6A 3L5LA 3GXNA 3W7RA 1LOSA 3N2MA 4UFLA 2QCHA 3PBUA 3UPWA 3TIMA 1TPC1 1TV7A 1IF2A 5IBXA 4UMBA 1WBHA 1T96A 1LOQA 1BWLA 5D32A 2ZA2A 3UWWA 3UWQA 1NSJA 1KM6A 3DFNA 2NWSA 1JRCA 2YCEA 1JCLA 3FYPA 3HPXA 3TSMA 5BNKA 1LBLA 2ATSA 2EGZA 3LHTA 1W5NA 1X1OA 4WZHA 4GRSA 2TYSA 3BGJA 3W6YA 2FB3A 4LRSA 1T99A 4XUGA 1XBZA 2DZUA 1NF0A 1OYAA 5CZ0A 5LKYA 1TPEA 4UMCA 1CI1A 1GVSA 3PY2A 3KVJA 3UZ5A 3LI1A 4AXKA 1EWEA 3T44A 3OBKA 4Y9AA 5FEZA 1UB3A 5E1QA 3MMTA 3K30A 5G2IA 1OFRA 5G4WA 3TKFA 3LGEA 2Y62A 1G7UA 3SSJA 4O8RA 3NA8A 3M0ZA 5EMUA 4CQAA 1A50A 3W7CA 5K7JA 4JNMA 4JY8A 3LLDA 3P60A 4CCEA 1LRTA 1O94A 1SZGA 2X1RA 4UTWC 2QAFA 1P1XA 4NJHA 2R8WA 3HGSA 2JBMA 1WBJA 2DU2A 4UTMA 2NXGA 3ZS4A 3C2VA 5D30A 3TXVA 4Z1BA 3BV4A 2TMDA 2CW6A 1GVRA 1H7OA 1Y0EA 3TX9A 4JTSA 3SJ3A 1XUZA 3MHGA 4LUJA 3W7LA 3TJLA 3NL5A 2CLLA 4GUJA 2B7OA 3GYEA 1KTNA 2C19A 4UFKA 3R89A 2H3BA 3W22A 2CFFA 3EXRA 4JXCA 5KINA 2YDAA 3EKZA 2X30A 3PB0A 1DQWA 4O10A 1QO5A 1YYAA 5D2TA 4O50A 1GVFA 1KM1A 3G3MA 3LBMA 1SFLA 3G22A 3KXQA 2NWRA 3STCA 4PEKA 4MFEA 3P5YA 3UXDA 3UNDA 4IMDA 2QUVA 3TNOA 3PSWA 1GYLA 3CC1A 3ZWSA 1VCVA 1FX6A 3TW7A 5G1TA 3CWOX 3V1PA 4WX2A 3LXBA 3TK7A 4U28A 1H7WA 2QUUA 3S1UA 5FI8A 3PUOA 4XZ9A 5D2XA 5E0KA 1XUUA 4EVZA 4AF0A 4JTJA 1G4TA 4KFOA 2RDUA 1G4EA 4FX6M 1F6KA 4LVFA 5DCEA 1KTCA 3KRSA 2NV1A 3G18A 1TV8A 4LT9A 3STGA 2KZHA 4UTTA 4NX5A 5AHMA 3NQGA 3O05A 3ABOA 3N3MA 3G24A 3VKJA 3NPVA 5D2YA 4HSNA 5LZLA 1Q45A 2BXVA 2A6LA 1W3NA 2F84A 2I1OA 2GPTA 2VFDA 4IPJA 4P2VA 1TYGA 4M7SA 4WY0B 5EY5A 5U7SA 1I2NA 1D9EA 2FJKA 1P0KA 4IWWA 1ONRA 2ZBTA 1TRIA 3QMRA 4JDBA 4IMGA 1XDMA 4FHAA 3OVPA 4NJGA 2QJGA 2X1TA 3KRUA 4O53A 5D04C 1LORA 1LRQA 5D33A 4D2JA 5D37A 1X7FA 4UNLA 1SZNA 2VENA 3FJLA 3BARA 1U5JA 4W9TA 3FS2A 3P8JA 1QPRA 3W86A 2C15A 2IQTA 3W7HA 2VEMA 3W7PA 4BF9A 3NQ8A 1UUMA 4Z1DA 1HFBA 2C3ZA 1N7KA 3FJ6A 5G2WA 1Q6RA 1KFBA 3KVLA 3W85A 1UUOA 4KFPA 1GTHA 3PWAA 5CZTA 2BLEA 3HGOA 1O5KA 2YZRA 2QCCA 2G5WA 2VEKA 3BG9A 5FF4A 1W5QA 3LM7A 1W3TA 4O16A 2NXHA 4OQVA 3N34A 3TUUA 3WJYA 4Q32A 3SI9A 1FCVA 4WXYA 1FBAA 4M7TA 2GOUA 1TPVA 2PC4A 3JS3A 1YLVA 4GJ1A 2V2DA 1VC4A 3W83A 5BW6A 2A21A 3N73A 3W1NA 4KWWA 5F2IA 3WK2A 4I7UA 3ZR4A 3G8RA 3TE9A 1P4CA 3NPXA 4FEZA 3GDKA 1MSSA 1DJQA 2CLMA 5K9XA 5CZJA 3CLMA 3W1QA 1EUAA 4M6QA 3I7SA 1KM4A 2Z6IA 3BW4A 2A85A 3HG5A 3MI6A 5DXYA 3VCRA 1YDOA 1FDZA 3P5ZA 3HPSA 4FX8A 3L9CA 2FFCA 1F73A 4FXRA 3R2GA 2AAMA 2Z1BA 1PV8A 2WJZA 4MJZA 3W7DA 3SFKA 1UJPA 2VOMA 3VE7A 4AHQA 1LROA 3F4NA 3EWUA 3QFEA 4MZ1A 3FA5A 3MBFA 2BZNA 1F05A 4MZ8A 2Z2UA 3G1YA 3LTYA 2DZVA 1H1YA 1M7PA 3THAA 3W73A 4O15A 2ZFAA 3W23A 3W7QA 2YR1A 3I7RA 1J4EA 2FLIA 3STFA 1TPUA 4H4IA 2QJHA 1TO3A 5AC6A 2YYTA 4MVAA 4E0CA 4N4QA 2E6YA 5DELA 2WKJA 3NXFA 1GVOA 1R2RA 5T26A 1FWSA 3C3NA 4JD4A 4LC6A 2W79A 1R2SA 3MYOA 2J24A 1LOLA 4N4PA 3S5YA 1OYCA 4BI5A 3Q2DA 1YDVA 2VC6A 3GR7A 2Y7GA 4PCFA 2CLIA 1GWJA 1N55A 3I7QA 3H53A 3BVJA 2LLEA 3EWYA 2WSYA 5HWJA 5G2HA 3C2RA 4RKAA 4CQ8A 1EP1A 3TROA 2V81A 5HNRA 1PS9A 3KHJA 2NZLA 2C18A 1THFD 4HKPA 5I3IA 1Z44A 1SSDA 4IQLA 7TIMA 3JR2A 2FPTA 3EX2A 5F4WA 1SU5A 1FDYA 1H1ZA 3WJWA 1HO1A 3KRZA 3GZ3A 1TJPA 2OT0A 2ZZ3A 3Q58A 4NQ1A 4C1KA 4R53A 5LNSA 4LU0A 4BI7A 4FNTA 4JX6A 4LWWA 5EA9A 3PBYA 3SY5A 1QR7A 3HGJA 3O63A 3BPWA 1G6CA 3UD6A 3W2UA 3C2FA 4MOZA 5AOUA 2VFFA 1DBTA 1UASA 1QFEA 3G1FA 1EP3A 3CWNA 1C29A 3W9ZA 3RLUA 1C9DA 2C13A 3HG3A 3IVUA 4J9JA 1VLWA 4M6PA 4UC5A 4ALDA 4JTFA 4N6FA 3I6RA 4TO8A 3ZFHA 3G0UA 3LI0A 4WUIA 5LNRA 3F4WA 1KBIA 3MP4A 3U6WA 3C6CA 4IX2A 1VCFA 3GKFA 3HO8A 3HG2A 2Z0IA 4K8EA 5HULA 3PS7A 4M19A 4UTUA 4PL1A 3B04A 2VFGA 4X2RA 3C56A 2ZQ0A 1AL7A 1LDCA 4I7WA 1MO0A 1VLIA 1XC4A 1FCUA 2GQAA 5FEXA 5BMXA 1SO5A 3EWBX 4H3DA 3B8DA 4ICNA 4QISA 1RVGA 2E5BA 3UY8A 4TIMA 4OT7A 4ADUA 1QO2A 1HG3A 3G1HA 3OVRA 3HIJA 2E77A 3CIWA 5DY2A 3CM4A 4PL2A 2E6DA 1A5AA 2Q3RA 4O11A 3W1PA 2BWGA 4Z1AA 2CLHA 5MHBA 3NYZA 5K9DA 4B5NA 3W7OA 3TDFA 2ZTKA 1QOQA 2DZSA 1MEIA 4XBSA 4K39A 3NQFA 2R14A 3LV6A 4NT0A 3TW6A 4BWLC 3LB0A 1B4KA 2FQIA 1IXPA 2V30A 3FLUA 3R5EA 2C1HA 3EKLA 3O6DA 3UWZA 4O17A 4QITA 2BX7A 1AG1O 8TIMA 3C8FA 3QW3A 4NNCA 1C8VA 1G67A 3L5AA 3LHVA 3PUDA 2VFEA 3B03A 1M7OA 2YYUA 2H8XA 3WFAA 3CT7A 4YXGA 4L4MA 1HL2A 1KM5A 3OG3A 5H91A 3W2JA 3G0SA 1OJXA 1TTQA 4PFMA 3ATYA 3TJXA 4MUZA 1K8YA 4OU1A 1T8XA 3UPBA 2E6AA 3P84A 5LGXA 1ZAIA 1SW7A 3W3OA 1D3HA 4NJJA 1FXPA 3FYOA 3IGXA 4POCA 2ZZ1A 3LRLA 2P0OA 2QCLA 1K8XA 1ICSA 1A5BA 4TX9A 2DJLA 2ISSA 3DH7A 3LLFA 4LRTA 3M9YA 1H51A 4XKYB 3B0VC 3WK0A 3R8RA 3KX6A 1WYIA 3C0JA 4O57A 1WV2A 3E02A 1YTEA 4H6KA 2DZXA 3BLIA 4KKXA
chains in the Genus database with same CATH superfamily
2JE8A 3W4RA 5BXSA 3W75A 3CYVA 2YXXA 3A13A 1YW1A 5ENLA 3M44A 1QVBA 2Y7DA 1TA3B 1K6WA 1X1NA 3UESA 2QJMA 3DI1A 3WH7A 4C6KA 3GNXA 5HQLA 3A4AA 3TYDA 4Z0SA 1TR1A 3P74A 1J0YA 2EO7A 1M7JA 1NOWA 3NGJA 4C1LA 2W62A 4ATWA 1TTJA 2RFGA 3SUVA 4NZFA 3CH0A 2C7FA 3T0AA 4GX8A 4KCUA 3TMQA 1GG0A 4I3GA 2HNEA 1RZMA 4HZ8A 3VC5A 3B8SA 3GH4A 1BFNA 1ZJAA 2QS8A 3B0YA 1PO9A 1ZJIA 1UKQA 1UWSA 1F6PA 5C9ZA 4ZBCA 3MSYA 2OODA 3QOKA 2WXDM 3S8HA 2I7GA 2PGRA 3LG3A 1MZRA 3CQKA 5L6UA 4PFHA 1I8JA 2I57A 4MADA 5DCDA 1E55A 5J8LA 3ZWTA 2W63A 4MY1A 2PD5A 3NDOA 3RX4A 4XZWA 3GNOA 3V0SA 1HO4A 1KM0A 2J7GA 3OLIA 2PDKA 3W81A 2V82A 3NOEA 2GQ8A 5L9FA 4LS2A 3BO9A 3V18A 3L4YA 4CD6A 5LXEA 4Y9PA 4LVAA 3OODA 1KFJA 4HYWA 3WQOA 3NJ3A 1TMLA 3IV8A 1VZWA 3WQ4A 3UPMA 4NJKA 2Z27A 1ODUA 4HIBA 5G1MA 4JCLA 4PTNA 1W9BM 4DBDA 3ELFA 3BAWA 6A3HA 2CLOA 1JYVA 4W4QA 3RLGA 3RNDA 3KAOA 4PR4A 1VIWA 3QLLA 2WLYA 4JTLA 2YCLB 2BY3A 2WVVA 3E0FA 4IUOA 1ISVA 4ZENA 3WDIA 4ECLA 3MKVA 2CLFA 3DHDA 2NX1A 4PBFA 2AQVA 2DUXA 3KUMA 1I45A 3IUHA 4XO7A 3CMGA 3LU2A 1ISXA 1TWWA 4J28A 3ORWA 5A95A 1PHWA 4UTLA 3QY7A 1KXQA 4JZ5A 3LZ3A 1WZAA 2ZTJA 3RM8A 1H62A 3ISIX 1QNOA 4S1FA 6PTDA 3M0VA 1HF6A 3VD3A 1V77A 4ES4A 2VFIA 3ARSA 4WJEA 3VNIA 3WDQA 4AZCB 2PTXA 3S2JA 2VM8A 3N13A 3MZ2A 5DRCA 3HQOA 3JW7A 1U5HA 1EOKA 2GVLA 4U5IA 5G4EA 3CV7A 3L2IA 4GI4A 3WLKX 4K7YA 3WD3A 1IZKA 2YB4A 1UIOA 2XVPA 1YBQB 2H9AA 3IIXA 4RDVA 4H04A 2XGIA 5C7HA 4JKMA 2YW4A 1WE5A 1RY8A 2HQAA 4X63A 3H8AA 3GW3A 2X0YA 5GQBA 3W76A 2DSZA 3ABSA 4QFUA 4YTUA 3TJ4A 5DF0A 3QRHA 2PCQA 3I4EA 2F6XA 2J7CA 3NL3A 3LYEA 3R1ZA 2WNQA 2WQPA 5I03A 1VPYA 2QPXA 1QPKA 3R94A 3GQYA 4MTVA 2YBVA 3CLWA 4GIAA 1KCZA 2BMBA 2W5FA 1ZHAA 1PBGA 3NZRA 3UWVA 6TIMA 3NZGA 1YHTA 4JNYA 1XFBA 2JF6A 1Q63A 1O66A 2WHMA 2VGGA 3EA1A 3SW6A 5FL1A 1JUBA 3SAZA 1DV7A 4QAWA 3ANUA 3AXIA 3LV5A 3L12A 5XIMA 3W1TA 4Q8QA 3WF4A 5EGRA 3PWGA 2VEIA 2C8NA 5CEWA 3MI3A 1KWKA 3SY1A 2IS7A 4Q33A 2V38A 1H1NA 2GGJA 4LAZA 2HS6A 3HV8A 3VX1A 1VQTA 1RBOB 4DVOA 1W5PA 2D3LA 1JUKA 1Q6OA 5DO8A 1A0DA 5JH2A 3PBWA 3GNRA 3GFXA 1JPDX 1H7PA 1ME7A 4HMDA 2J75A 4L9YA 4DBEA 4LV4A 3ABZA 3LTPA 1LYXA 2C0HA 2WVUA 4WEVX 2E1DA 2GJNA 2CC0A 1M3UA 3L66A 2OQYA 2PU1A 4GYPC 2B7NA 3VVGA 6TAAA 5JIPA 3BOFA 1H7NA 2ZRYA 3AIUA 4CD7A 1LL7A 1QI3A 1ICPA 4L4OA 4C6CA 3W2MA 1K7XA 3BAIA 5FJIA 4ZQNA 3P3BA 2BVYA 4UIOA 3TAKA 4LX4A 4IMEA 4IH3A 2PRHA 5JIWA 2ZDRA 2A7RA 2Z6JA 1H4PA 3BDKA 1J6OA 4D6EA 2C14A 3GKAA 4K37A 4HQVA 2AAAA 2AGKA 3N19B 3U4AA 3CTLA 3QM3A 2A6NA 3KVMA 3QGKC 3O07A 4GYKA 4H2HA 4N42A 2DSVA 2OLAA 4B92A 3DKJA 3OVQA 4CNPA 1DORA 5C55A 4GE8A 1AQFA 4LUTB 3WQPA 5I5RA 3GVQA 3RPDA 1GJUA 4JTGA 2WVTA 1US3A 2HNHA 3W38A 3CV6A 3RXZA 4YCPA 3FY1A 4GXWA 2VC5A 3VDGA 1PVNA 1TIWA 2Z4GA 1XYAA 2P76A 1EHNA 1NWSA 3AUJA 1IT7A 4W7UA 5FJJA 4GO9A 1K4HA 2VNCA 4XKYA 3KZPA 3S1VA 2E8YA 1UUQA 1V6XA 2ISVA 4KT2A 2J7FA 4I6KA 3NZQA 4PRRA 1ZBCA 2B31A 3OVGA 1OC6A 2XZ7A 1TV5A 4E4PA 4GX9A 3UR8A 3WZ0E 1SJAA 1GEHA 2XSBA 3QHMA 3SR7A 3TJIA 3HFYA 2HK0A 1EEXA 2ANUA 3FDGA 2HJPA 4D6CA 4ZE4A 1QNSA 3EA2A 3SCOA 2VKZG 5HJLA 3EWCA 4XSLA 2X2YA 4R5EA 2Y5SA 2PTYA 2J6XA 1J18A 3M0IA 4DJFD 4U2ZA 3AFBA 2FVKA 2DDXA 4Z0JA 1H7RA 3AYVA 1SFSA 1JPIA 3EMCA 1F76A 1ENUA 1FWIC 4H8HA 1IEIA 3EX4A 3O16A 3PULA 4TVDA 3WLRA 4AD3A 3N25A 3QFWA 3Q37A 4NX0A 5FF3A 5GJMA 5AYZA 3STEA 2NQ5A 3O06A 1XBYA 1Q6DA 3UQNA 2WO5A 1GOOA 3SQMA 2DH3A 3GXIA 3T1GA 5HR6A 2UZ9A 4WK9A 1PTAA 3TFCA 1VENA 1VFOA 2XH7A 2ZZ5A 5EFFA 2GZXA 4IX0A 3UR2A 3NGFA 1XXXA 2I56A 5KZDA 3AAMA 1G5AA 3RRAA 1GCYA 3KEHA 1MW3A 4ZB5A 4DWSA 3BMXA 3FSTA 2DZWA 2XVKA 3WNKA 2FJUB 4AIUA 2NUWA 4IQJA 4HHPA 4ZTXA 1QNQA 5AHIA 2DUAA 3THQA 1F9CA 4C6QA 1XLLA 1RALA 2DVXA 2J7BA 1OD8A 2QHAA 3V0UA 3QPZA 4H6QA 3QYSA 5A6LA 1FCBA 3N6HA 2HE5A 3IRDA 4N9DA 3NQAA 1O60A 3L4XA 3R8GA 4K1GA 2VEGA 1E56A 4PUJA 2ZRXA 1C93A 4MNKA 2DIKA 3E0WA 2J88A 3BZGA 3HPZA 3VD9A 3WUFA 3I3DA 4AYGA 5JMUA 1R2TA 2XUCA 4BQ2A 1GZ1A 1ZY9A 1OFBA 2OR2A 3OU8A 1IXQA 5C2CA 5CC3A 3EX3A 1UPPA 3DKLA 4MY9A 2FZ9A 1GPWA 2VGFA 5CPNA 3CMFA 3NL6A 4Q8NA 1EJWC 4N7QA 2ON3A 1ZCCA 1IEWA 4PMOA 5A8GA 2OFJA 4EPKA 1KLYA 1Q4WA 1V3JA 3GBEA 4ERIA 1NU5A 3VI2A 5ABFA 1BKSA 1W1YA 1CX9A 2HV5A 2WMHA 4E2OA 2C0AA 3W1MA 4TVUA 3M5ZA 2G95A 4W7WA 3EAUA 4IGHA 5ECVA 2O55A 2NVDA 1HJVA 5CZKA 4QDMA 1W1VA 1GKQA 1U33A 5C8BB 3RPTA 3UWUA 3DZ1A 2PDXA 1KKRA 3RRXA 2ABAA 2Z29A 3WUEA 2DY3A 2PA6A 2ZUSA 4FNQA 4H9TA 4O1CA 3AIWA 1NDYA 3RO8A 2Q8ZA 1L6SA 2A7NA 3T09A 1FWJC 5A8QA 4FMVA 3FXYA 1EIXA 5E6ZA 1FCQA 4S3CA 2Z26A 1MI3A 2ZICA 2VTFA 3QEZA 2J62A 3AHVA 3A3XA 2X7VA 1WCGA 5JU6A 2DSWA 1QRQA 4NXSA 2A0NA 4K8HA 1F6YA 2W0UA 1DEDA 3BMWA 3ZVIA 3T7VA 4DJDA 5CBBA 1FWCC 4GQ0A 2C1GA 2Y61A 3U2CA 3VILA 1XPGA 4ZZ9A 1HKIA 2OGJA 4GYPA 2AL2A 4XIAA 4Q6JA 3EB2A 1RBAA 2Y0FA 5ECUA 2FGLA 3W1LA 4GZEA 4PTDA 1F8IA 1FWWA 3IEBA 2DT3A 4D8ZA 2QAPA 4GABA 2CKRA 3CL6A 1U1HA 5BXPA 4WJ8A 4EXAA 3WDPP 4UQCA 4A8RA 2VR2A 3VM5A 3OP2A 1ADOA 2V63A 3AO0A 1J0ZA 3G77A 4NSBA 3ITCA 4YWIA 1FUYA 5JBFA 1XWYA 4NRRA 1JZ7A 3VNKA 5HMEA 2GQ9A 5D2WA 2JIWA 1C90A 1OGBA 5A8NA 1D7FA 3RO6A 1PL9A 2OOGA 2FVMA 1RCQA 1DOSA 3CHFA 4AG0A 4PH6A 2WSKA 1OBAA 2Y89A 2WZIA 2CU0A 1VJSA 1US0A 4AF0B 1XRVA 2TRSA 1KNWA 5FSDC 2PRLA 2ZYFA 1E51A 1UKTA 1BVNP 2Y63A 3LERA 1S2UA 1R46A 5HPCA 1TQJA 1ZTVA 2YLAA 2RAGA 3UA4A 5JH1A 1EJXC 3EKGA 3QMTA 3QQWA 3MV01 2FTPA 4QE1A 1YPXA 2ZE0A 4XQ6A 3M6YA 3W00A 3B8VA 3A24A 2DT2A 2QF8A 3ZJ7A 4HPNA 3TQKA 4A3HA 1PZ1A 1BG4A 3PSVA 4G1NA 4HK6A 1O68A 3KM8A 3O1NA 3VXGA 9XIAA 4QNEA 4LBSA 1FY6A 2GDVA 2JF7A 3TC7A 3OO2A 4EAYA 3G6LA 4PUMA 4HNTA 5DFAA 4NILA 1CCWB 1ECEA 5HNTA 4BWLA 1JXJA 2X09A 4G7EA 3EPMA 3BW2A 3M0JA 5KITA 4L1GA 3TN6A 2DQXA 3VZXA 1TREA 3IIZA 5ABTA 3GTNA 5T91A 4RR4A 2DH2A 1MVYA 1J5TA 1PIGA 3KTSA 1KGWA 5FOOA 2FVLA 3VIMA 2RDXA 4AYSA 1ONXA 4WY0F 3OHIA 1XH1A 2GJLA 2A7PA 4N2YA 2O4QA 3LNPA 5B80A 4JS3A 1EOMA 3MW7A 3EOEA 1JNDA 1A4LA 3GDLA 3UWYA 1CEOA 2BB0A 1UD3A 5KMYA 5DX7A 5HR7A 4H83A 2FMOA 4QSHA 3AWNA 1CXHA 5C5YA 1YE4A 2OLHA 3NVDA 1GQJA 2QULA 3CL8A 2TPSA 2O7SA 3GNDA 1ML1A 1OCJA 4PGLA 4IJBA 3F5KA 4BHYA 4M0XA 3PJXA 2DZBA 1EGZA 2A3HA 2FDMA 2GUBA 3KDNA 2DT1A 4NAFA 2V5LA 1V0KA 3M7WA 2ZUVA 4ZOEA 1HL8A 2DORA 2H3DA 1IIGA 1VBJA 2QJNA 1K9TA 1MRAA 3DC8A 4JQ3A 3GYCA 4WKFA 3OZOA 2E8ZA 2YFNA 4AD4A 2FZBA 1OHLA 4AIOA 1FOBA 4RXFA 1QBAA 1B0IA 3E5PA 1CW2A 2G4FA 1ME9A 4WXZA 1R7AA 4RNHA 1W54A 2PWFA 4FF7A 3LCXA 3UXLA 4OUEA 4YL2A 3MYPA 2NSOA 3WQDA 3TTOA 3RJXA 4L64A 2ZRUA 1F4AA 1S2AA 2PDPA 3BLEA 3DENA 1FWNA 2NLYA 4IMFA 4RZ6A 5LHEA 1OWQA 2V2HA 4RDYA 3CUIA 3OQ8A 3CHDA 2YSWA 3UR7A 2Z1SA 4CNUA 3NURA 4M80A 4PE8A 3DFTA 1UWUA 2GVYA 3LD5A 1M53A 4IPNB 4NZ4A 3W7IA 3V16A 3WBAA 2G37A 1J2BA 5HINA 1V6UA 1UR2A 2D1ZA 2ZZ2A 1JCYA 4Q22A 1JYXA 3OGSA 2NV2A 3TFXA 5AC5A 1GQNA 1KW1A 2EPOA 1B3XA 1XKJA 3Q94A 1I2PA 2FH8A 3REQA 4WDUA 1S5MA 1ZSXA 3MMUA 3P0WA 3UVIA 2CZ5A 3GAKA 1AW1A 1WX0A 1QPOA 3H2OA 3SM0A 3W2KA 3WQ6A 5K4ZA 2E28A 1S46A 2OEMA 3H26A 3VE9A 3SCWA 5LGZA 2Y7EA 1CGTA 4V15A 3DYOA 1DWJM 1EWDA 2EPKX 3W87A 2EXOA 5HUOA 4DAIA 4Z2IA 1JCJA 3CTTA 3B9DA 2J27A 2WCGA 4FNPA 3TVAA 1BXBA 1IR2A 3L5LA 4YU1A 1CT5A 4GY1A 1C3FA 7XIMA 4PSRA 1MXGA 1U2YA 3KS5A 1TPC1 4CEUC 1IF2A 4H9YA 1Z9AA 3MY9A 5HJXA 4DBSA 3COTA 2PTZA 1VFHA 4QCFA 1WBHA 1T96A 3DFNA 4V2XA 2NWSA 2TODA 3ARQA 2YA0A 2YCEA 5JXQA 3TSMA 2WJFA 3QY8A 3QGAC 2IKGA 2ZX9A 3SJNA 4I5XA 3DUGA 3BAXA 4WZHA 2TYSA 1C8XA 3FYYA 3AIQA 4LRSA 5EMMA 4XUGA 5JUVA 4C6DA 3MS8A 1TPEA 4QEHA 1E9IA 1CI1A 1EDTA 1UYQA 3KVJA 3LI1A 3AMLA 4AXKA 4JIIX 3VKDA 1AA1B 1IE7C 1TZ9A 2CYGA 2WWCA 1OEPA 2HROA 5G4WA 5CC6A 1GORA 2PODA 3QTPA 4JHOA 2Z1VA 5FJUA 3M0ZA 5K7JA 4CCEA 4EE9A 1E72M 2ZUTA 1UC4A 4J3UA 3R7MA 1OD0A 3SUSA 4IGNA 2X1RA 4GACA 3VNLA 2DSKA 1EL3A 3E0LA 4J5NA 1CXIA 3U2ZA 4G2DA 3TXVA 2CW6A 1MDRA 4I5RA 2BV9A 1FWEC 1YMYA 3QV7A 3FSUA 3VABA 2P50A 3NL5A 1M04A 2B7OA 1KTNA 3LK6A 2C19A 3R89A 3EXRA 3KTCA 2PLJA 4JXCA 3IAQA 4NYYA 4KF1A 2V68A 1YYAA 5D2TA 1GVFA 3DYPA 4RE0A 3G22A 1VFMA 2R1PA 4JHMA 5D4YA 3VDHA 4AW7A 4MFEA 3UXDA 3B0XA 1MW0A 3TNOA 3OB8A 3CGTA 1GNXA 3CC1A 3ZT7A 1DJHA 3TW7A 4L61A 3V1PA 2F6KA 3TK7A 1XLFA 4CEXC 1EC8A 3FGCA 4TV6A 2VC9A 3HPFA 1VBUA 4EVZA 1I0BA 3MSRA 2PEVA 3N29A 3TYBA 1SGJA 4FX6M 1F6KA 3STGA 1TV8A 4LT9A 2KZHA 2PDIA 2WWDA 3D3FA 5AHMA 5C2GA 5AVHA 1GQLA 4PMXA 2J7HA 4GINA 4PMDA 5LZLA 3K4AA 1N8WA 1W3NA 2VFDA 2O4MA 2GPTA 4DN1A 6XIMA 4M7SA 1RVKA 4Q4RA 4Y9MA 1TRIA 5BZAA 2P3ZA 1XDMA 5PTDA 5ABHA 2MUCA 1DWGM 2VENA 2J47A 3BARA 3EWDA 3P8JA 2C15A 3SCSA 1KD0A 4Z1DA 4JN8A 3LQLA 1Q6RA 2XWEA 3SCUA 4XD4A 4CVWA 5AKQA 3N2BA 1I60A 1GTHA 1BSIA 2UY4A 5HXMA 4JN7A 2VEKA 5FF4A 1XGZA 1W5QA 3LM7A 1NFGA 3AS2A 3I3EA 2BVDA 4M7TA 3KP1A 4ZSTA 1VC4A 2CZVA 5BW6A 1EF3A 2A21A 1Z89A 4GZ7A 5DEZA 1JGMA 4KWWA 2NSXA 1Q65A 2WVVB 4NYUA 3F4CA 4B2DA 3UBPC 3WK2A 1EPVA 3G8RA 3WDJA 1J01A 1P4CA 1FWHC 1MSSA 2GQ3A 1XYLA 3WIJA 3CUGA 1V6VA 2CLMA 2ZDSA 5CGMA 2WMGA 3MSGA 4F3HA 4LNCA 2Z6IA 3K46A 4FOKA 3TP4A 4BF5A 3M7SA 4W89A 3KOXA 3HPSA 1CGVA 1Y5VA 1MUWA 2WW5A 1S2CA 4OTKA 2QV5A 2WJZA 3W7DA 1UJPA 1K4GA 3F4NA 5EBAA 3EWUA 4UZUA 1W3KA 4HNLA 4PBEA 4W87A 2BZNA 3LQGA 4MZ8A 3V35A 2DIJA 4NP7A 2DZVA 2E4TA 3THAA 1FH8A 2QYGA 3SCTA 4W93A 3W7QA 2GDQA 3LY0A 3GTFA 1E6ZA 3W29A 1GVOA 1FWSA 2DGAA 2WC7A 3B8IA 3C3NA 3KDOA 2H9AB 2OQHA 4F0RA 3BOXA 5A6SA 1LOLA 2R6OA 4L6OA 3OYXA 3KCLA 1I75A 3EDDA 1B2YA 1BVWA 1E6NA 1W1A1 3FW6A 3ITOA 1E6SM 1GWJA 4IMAA 2EQDA 3BVJA 3EWYA 5HWJA 1RPKA 5A8PA 5CPSA 4GNKB 2J4GA 2ZADA 1HJQA 1U5VA 1EP1A 4QHRA 4BJHA 1PS9A 3KHJA 1QATA 4EACA 1THFD 4HKPA 2ZX7A 4M8UA 4AD1A 4KCTA 4P8XA 1BYDA 3EB3A 4DI8A 1H41A 3KRZA 3KWSA 5I79A 1DPMA 4CCZA 1VFUA 2ZZ3A 4NQ1A 4ZFCA 1DIDA 3PBYA 5E70A 1JF6A 4XIMA 1X39A 1G6CA 1QU4A 1OB0A 4MOZA 3RCMA 5AOUA 2VFFA 1UASA 3KBMA 1WP6A 1FHUA 1C9DA 3FHQA 3WLOA 3HURA 1R0MA 3OLEA 4UC5A 4GJIA 1O5RA 3ITGA 3MANA 2R9RA 1XIFA 4KETA 4WUIA 3VMPA 3C6CA 1XLCA 1VCFA 4HB7A 2V3DA 4F8XA 3VOGA 1Q13A 4X2RA 4NI3A 5FEXA 5BMXA 2AKMA 4FS9A 3KOYA 1T8QA 4KWUA 4HNCA 1E0TA 1XYBA 4ICNA 4DXXA 4TIMA 4OT7A 3VD4A 2PDNA 1S38A 1C7SA 1HG3A 3G1HA 3IAPA 2X7WA 4MF4A 4DNMA 3CM4A 4C6JA 2E6DA 2R1NA 3W7OA 1N82A 3S46A 3SBFA 4DAFA 1L2QA 1MEIA 4XBSA 2P8BA 1V3KA 4C90A 4JFVA 4DWSD 4PMQA 4NT0A 1B4KA 2FQIA 1IXPA 1POJA 3EKLA 2ZUWA 3O6DA 1XICA 2GWNA 3UWZA 2QUNA 1VBRA 1W91A 1AG1O 3T42A 1NIUA 1OC7A 1G67A 3PUDA 3ITLA 1WAWA 2VFEA 2YYUA 1ZQ5A 3WFAA 4YXGA 3G0SA 1TTQA 2FMNA 4PFMA 3ATYA 2VWTA 3TJXA 1BAGA 7ENLA 1YRRA 1QWKA 1FHVA 1IT8A 1T8XA 1UG6A 3P84A 1ZAIA 2C91A 3GC2A 1SW7A 2IPFA 3ZSTA 1D3HA 2GOKA 3PPCA 5HK4A 3IGXA 4ZOCA 1GOIA 1FH7A 2P0OA 3FK4A 4MNMA 2OZTA 1A5BA 2DJLA 3DHPA 2SFPA 1VEOA 2ISSA 3T08A 3DH7A 3LLFA 4KH2A 3VIIA 3HN3A 3R0DA 4A3RA 1Q6EA 3M9YA 3E2RA 1H51A 4XKYB 3N12A 1AZ2A 2WM1A 2DPEA 4PB5A 1GONA 3KL5A 1YTEA 3BLIA 5GNZA 4LUYA 4UFMA 4RXGA 3BAYA 1Q4NX 1J8VA 3U5UA 4GZIA 4GCAA 4LQ1A 2EHHA 3WQEA 3WQCA 3CAKA 3U9IA 4C6EA 1FKXA 3RITA 5D02A 1QOXA 2CBJA 3LBCA 3T78A 4CQCA 1OFOA 3W27A 1HTIA 1QAPA 2Y5EA 3C2EA 4LFYA 1SUXA 2VRJA 9CGTA 5IHSA 1K7FA 3W7EA 1K70A 2G4JA 2VWSA 4IHCA 1E1CB 4UNIA 2E25A 3ATZA 3S42A 2HDJA 5EB8A 3QZ6A 4ZR8A 1Y5XA 1O95A 2HVOA 2W6RA 5I3FA 3CZ8A 4PUEA 3WH9A 1ZJHA 3RGTA 4WY0A 2R82A 4DB7A 4KGLA 5AECA 3LPFA 3CMJA 3ZJ8A 4MUPA 2I17A 3ARZA 4GNVA 5F1VA 1OK6A 1X8FA 4ZXLA 3SRHA 4DJEC 1S5VA 2HE8A 3GBDA 3NQVA 4ZQOA 4HT3A 1IEXA 2NUXA 1WPCA 5D9OA 3MVIA 4KIEA 1GZJA 4CNSA 1CB7B 1UOKA 2JQXA 4DWSB 3NDZA 3SCQA 5C6MA 4O12A 4JTUA 2ALDA 1YPFA 2XU2A 3HBLA 3VMNA 2CKSA 3EXTA 1U22A 2DP3A 1LF1A 4GO8A 1MEHA 2VEPA 1XG4A 5A6AA 4RLIA 4LSBA 1TPWA 4RNJA 3G2GA 3UG4A 1W17A 3HZ3A 2XTKA 2XIMA 5M03A 5FIPA 4H9XA 3VFCA 5CC5A 3WLNA 3GXTA 2Z7GA 1I6NA 3VDAA 4F0SA 4UTJA 4D1IA 3W71A 3H2NA 3V5FA 3VK5A 5E0CA 4BS0A 3BURA 2GGIA 1PKNA 2WCSA 1QTWA 2GGGA 1QNPA 2AGTA 3S5SA 3IK2A 5LNUA 2Q8LA 2VO5A 5GPRA 2YBTA 2WSRA 1UD8A 1V51A 3BQ6A 3T8QA 3NM3A 3RR1A 4HJFA 2JK2A 2CLKA 4O0QA 4UQBA 1UOZA 1C8QA 4Q8MA 2VD9A 1A5MC 2FIQA 5K9CA 1VYSX 1EKOA 4GVGA 4HU0A 1MMFA 4H9MA 3ABRA 4QS5A 1HT6A 3N2TA 5D05A 4DJFC 1BG9A 2O9TA 3T0BA 2NX9A 3S47A 5ABFB 4MJMA 1Y5WA 2Y2WA 2GVJA 1XIBA 1P48A 3I6EA 3CL7A 1B9BA 1UQZA 2P53A 2PWHA 3W74A 3GY1A 1JEZA 1CNVA 1CYGA 3TN3A 1ZAJA 3SADA 4GY7A 3VOHA 1UA3A 4LPCA 4J3ZA 3HQ1A 2ZX8A 4TMCA 4W85A 3ZLHA 3B0UX 1MFVA 1JZ2A 3CBWA 1O12A 4YCOA 4UTHA 4EF9A 3LCFA 5FACA 1OGSA 3THUA 5CPOA 5I0DA 3K8LA 4B3KA 1TIMA 3O9NA 2D0FA 1RK5A 3A9BA 3L65A 2PPGA 2VX5A 4OECA 5TNVA 3V75A 3QR1A 4B3LA 1A4MA 1M7XA 1TTPA 4ZMGA 2C16A 3FEMA 1UP3A 3TA6A 3VKKA 1Q6GA 2NVAA 2OLSA 3A4JA 3W1AA 4W5ZA 4N9CA 1XIJA 4MKVA 3CPRA 5FEPA 4H7CA 5F1UA 4PTMA 1TKKA 4M82A 2MANA 4LF1A 3CO8A 4B5VA 2ZWYA 3VKBA 3MBDA 4CCCA 2CLPA 1DJYA 5F4XA 3TQVA 3PZOA 1PIIA 3CQJA 5FJOA 2WNZA 4K1WA 3DESA 1J0JA 4NHVA 3OIHA 4N9BA 3O6CA 3ALFA 3RPMA 4WGHA 4YS1A 1VFTA 3ID7A 3UWEA 1LM1A 4TMBA 5CPLA 1RY0A 3DG6A 1OG6A 3T40A 2WMKA 3LCLA 4MMWA 3TV8A 3A47A 6ALDA 2QVHA 5AZ0A 3KE0A 4KEZA 2F6UA 4HHHA 1EJTC 2HSAA 3AU2A 2E0PA 4TX6A 2GFTA 2VJXA 4GNJA 3Q67A 2PDHA 4FZIA 1MQPA 1DTNA 1YTKA 4KESA 1KCXA 3S2NA 4EOUA 3Q4DA 1XLIA 1JDCA 3LGGA 1Q7ZA 4QJ1A 4RW5A 1Z32X 1HP4A 3GUWA 3PZGA 7ODCA 5BWAA 1XL9A 4JIHA 2NQLA 4HP5A 4LB3A 4TTGA 5BRBA 4I8YA 3ARXA 2EG8A 1P6WA 1Z6KA 4A29A 3OHMB 3OGRA 1MEWA 2P3EA 1J96A 2VT0A 1V5XA 2AL1A 3T4WA 2W91A 1OINA 3I4KA 3ZIZA 3C5QA 4BK9A 1VF8A 4ZO8A 3K4DA 1ISWA 2WPBA 4D8AA 1JPHA 4XK2A 4DQWA 2ZRZA 3S9ZA 1G69A 2OMAA 1JJKA 1H11A 3ITVA 3QF0A 4LH8A 2G3JA 2FHFA 3F7JA 3WCZA 4EF8A 1TVNA 1ZALA 3M16A 5CLTA 1A3HA 1MXSA 3PUGA 5CC7A 3VIHA 3N9KA 1GKRA 3O8AA 1E4NA 3PC0A 3AWOA 4IPLA 3QSTA 2GK1B 1M68A 1EH9A 2WZEA 1SZFA 4C1NB 4I5UA 2OWCA 4GQGA 3WQWA 5BRPA 1UA7A 3ZYZA 3G1DA 1X8CA 3USBA 3PG8A 3GX9A 2PDMA 1V93A 3LHUA 1RK6A 3LPOA 5EL1A 4F0KA 1E5JA 4US6A 4UTWA 4UQDA 2W27A 4MYAA 4D1JA 1P5BA 4HSHA 4AVNA 1VEPA 3LRKA 1F74A 4JTCA 3O6YX 4AX6A 1LLWA 2WSQA 4XZLX 3TR2A 3R12A 2EAWA 2ATMA 3VO0A 3IPWA 2YGYA 1JULA 4RX0A 1B5TA 5I07A 3ERPA 3CQ0A 5I09A 2IXUA 1MW2A 5HQEA 1V6YA 2OG9A 4RPQA 4KBXA 1EDQA 2BGQA 3KFTA 3W88A 1R7OA 4DF1A 4GUFA 1WA3A 2XH4A 4NAFB 3B3DA 3F5JA 1QK0A 2OELA 3UP8A 4FA3A 1PIFA 2OSXA 1NP0A 1EF2A 1V03A 2A4AA 1WKFA 4X0NA 2IKJA 1JAKA 3DFPA 5H2ZA 5CAKA 5ABGA 3W07A 2VELA 3D6NA 1YKWA 4H8UA 3PN8A 1J0HA 5CZSA 2X16A 2CETA 3QBUA 3U0HA 2CZFA 3DX5A 3ZO9A 4H2CA 3W25A 2WJEA 3CUZA 2ZRVA 1DJZA 1V8EA 3NQMA 5LXXA 3IIVA 1IZJA 3GG0A 4CCDA 3AJXA 2QGYA 5DXXA 1AJ2A 4REQB 4UTKA 1JQXA 1PX4A 3ZVHA 4L4LA 3YPIA 1JFXA 3OA3A 2TSYA 3PG9A 1XIEA 3RLVA 2Y8UA 1KA9F 5BCAA 5CKSA 5EPDA 4A05A 3NO1A 3CPUA 1TE1A 1KFKA 2DW6A 1NVMA 4C7FA 4QG9A 4W88A 4MFDA 4XBKA 1VYRA 4HOWA 2FB2A 3K8MA 4M51A 1OIFA 3RM9A 2WHKA 1AMKA 3IV3A 3DHFA 3CH9A 1HJSA 3HJZA 3GUGA 1AODA 2JEPA 3UW6A 4XZIA 3TWAA 3V36A 2IKIA 6XIAA 3A22A 4M3PA 3REQB 2Z2BA 3URNA 2REQA 1GOMA 2XZ9A 4HA3A 4HPXA 5C70A 3P7YA 3A5VA 5BRQA 3RMJA 5HJYA 2O9RA 3UVAA 4RE3A 4LCSA 2GGHA 2Q8XA 3HB9A 1TG7A 4S3EA 4S3JA 2QT3A 5AC7A 4DI9A 1BTMA 3AMDA 5DBTA 1OX5A 5F4SA 2DZAA 3GR4A 1TWIA 4Z2HA 1CGWA 1W9DM 2E5DA 3ABQA 1ALDA 4KW2A 2I9UA 4G7FA 4XX6A 2BGSA 4QJ3B 3L0KA 1LP6A 3B9EA 2A3CA 4IXXA 1TJ0A 2OYLA 1MZHA 4GD0A 1UKPA 1IYXA 4FLRA 5H8MA 2Z25A 4Q4MA 2CHNA 3JVAA 4QG8A 1WB0A 4US5A 4WDWA 2F61A 1RUSA 4X22A 3TWBA 3L0NA 5CSRA 2PCEA 4UZSA 1X1ZA 4MJ4A 1NWUA 4S2CA 5FJRA 1SVDA 2OZ0A 1BD0A 2JKPA 3PR2A 1JYNA 3PJTA 4HNNA 4MY8A 3A5FA 1JUEA 3R25A 2OX1A 1UD4A 3CAVA 4JL2A 3TAOA 3H21A 1Q3NA 2OCZA 2FPVA 2V3GA 4LCQA 4O28A 4WOQA 2PDYA 4E2BA 1E4MM 3ARPA 5IBXC 4B2DD 3GG1A 1V02E 2WZMA 4W8LA 1PHQA 5BOOA 1XISA 4S23A 4PMRA 1UW9A 1PJ9A 2R24A 1DXFA 3EPNA 1CIUA 3UGRA 3DGRA 3F4VA 3URQA 1KR0A 3C0QA 4AD5A 1UR9A 2PF8A 4PC8A 4W5UA 3NSXA 2J13A 2A1YA 1ADDA 3SB0A 2E68A 4IP4A 1FRBA 1KGXA 4U31A 4A22A 3O3RA 4O54A 1NDWA 3L67A 1XCFA 1UD2A 3GDMA 1I2RA 4UCFA 2XFYA 2OJPA 3P61A 3W84A 3A12A 4CN4A 3L4VA 4RZ4A 5GVJA 4S3KA 3G0XA 3QHNA 3LSCA 4XZMX 3SUWA 3HM7A 3QKZA 3BL3A 1S1RA 4FSAA 3SGZA 3RHGA 3VDCA 4EIVA 4DO7A 4D8LA 1OK4A 1L6WA 3ZXWA 3VD7A 3LBOA 3L4UA 1TX0A 1W1ZA 4S3DA 1L8PA 3FGCB 5J5RA 4IGSA 2E7FA 3SIZA 3P0XA 3FA3A 2YDSA 4JEQA 3RG6A 4BFAA 2P88A 4AWSA 1JYWA 3MPGA 4FNUA 5DY3A 3T0TA 3LS9A 1CWYA 1TVLA 2GVEA 2OYMA 3PVFA 4IISA 1W2VA 1HKKA 5TIMA 3MI2A 2P10A 3GHSA 1R3VA 2V5DA 2QCGA 2X8RA 1M01A 3LNMA 2UY2A 3PNUA 2QJJA 3LHZA 1OVDA 1E71M 4L4PA 3K2GA 2J9YA 1S5TA 2ONEA 3CZLA 3TN4A 4O1BA 2PGFA 2Y1HA 1H7XA 4XTIA 1KB3A 5XINA 4QROA 3SO7A 4OBRA 3P80A 1WXZA 3N2OA 5BWFA 3D46A 3MKKA 2BFGA 4HPGA 2J8TA 2Z1KA 4HYVA 1G9HA 4C65A 4Q7NA 2B0MA 4FOUA 4LJ3A 5HANA 2GVGA 4B4HA 1EJVC 4B3ZA 2XN1A 3DYMA 2WCAA 4R34A 5CCZA 4RZ5A 4Z17A 1C91A 4Y9OA 5I3HA 2HRWA 2INEA 5CSYA 3M07A 2J77A 1UWRA 3H12A 5CPTA 1E6PA 2ISDA 3R10A 2QCDA 3ZLFA 4NNAA 4LVBA 1SW3A 1HIZA 1EC7A 1O6IA 2Y7FA 1GG1A 1DIEA 2I9EA 4Q8VA 4CD5A 3OEXA 4EPEC 5A2BA 1VHNA 2QUTA 4JQAA 4ORMA 3NPWA 3TMLA 4AX7A 3E2VA 1DJXA 3G8EA 4Z1CA 8A3HA 4PUKA 4WKHA 1G7VA 2PWVA 2NQJA 2ZIDA 4AMAA 2OKOA 5F2MA 3WLIA 3U8GA 1VJIA 1KQZA 3R0UA 1OIMA 2RDTA 2WHJA 1ZCOA 3VC6A 2ZE3A 3PZUA 2X1SA 3WELA 5GNYA 2DZTA 4MIMA 1SJBA 4G56A 5HMSA 3WBEA 1Q6QA 4I9MA 4UNKA 1TQXA 2QDHA 3KBJA 2BNJA 1SSGA 4MM1A 1GYNA 2VUNA 3E9AA 1RD5A 4WHBA 1XM3A 3PZNA 4NVTA 1HVXA 1OABA 4Q4QA 3GNPA 1J6PA 4KRTA 3SZ8A 4PODA 3HMJG 3AQUA 3S1XA 1KCLA 1R8LA 4DO6A 1Y7VA 4MAVA 1H0IA 4GBUA 2WMIA 2E40A 2BOEX 4WDTA 2CZEA 3F2CA 4IM4A 3CEPA 1IIHA 2P1FA 4FLOA 5H1WA 1Q7QA 2PS2A 4OJYA 1RXOB 1U1JA 1AH0A 1K77A 1KBBA 4D6GA 3IVSA 1V6WA 3BGGA 1ZBWA 2VDIA 1W3IA 4LCRA 1IXNA 4RJEA 2J8GA 2ZXDA 3MT1A 9XIMA 4XKMA 4LAUA 1NWRA 2L5HA 3I65A 4E4FA 2CZDA 4QE4A 4MKSA 3A3WA 4S3GA 3O15A 2VCCA 3ENLA 4HZ6A 3WYZA 4H00A 4UWMA 3IS4A 4NZ3A 1LL4A 1A5LC 4DELA 1SO6A 4YTTA 4ONVA 1GTEA 1I4NA 4H1ZA 1HNYA 1DVJA 1PX3A 4NZJA 1UC5A 3TLLA 4XWUA 4FF5A 2PBGA 1KRCC 3IANA 1DIOA 3P81A 2ACSA 3DFOA 2F7FA 1R9YA 5I3GA 2X05A 4GUGA 1W9XA 4F0MA 3GXNA 4YHEA 1CXKA 1LOSA 2OO0A 1P7TA 3H22A 3CB3A 2QCHA 5BU6A 4ZSUA 1TV7A 5IBXA 2DFAA 1Q66A 4PUNA 1H5VA 3SN4A 4AUBA 2ZA2A 4URIA 1OGGA 2HVNA 3URAA 4GVFA 4PCSA 4TUFA 5BNKA 2ATSA 3BSGA 4S3FA 3LHTA 3NDYA 1X1OA 2O0TA 2XYLA 1FA2A 3TTSA 3V0TA 1J5SA 4GHRA 1XBZA 2DZUA 5LKYA 3PWIA 4ZTYA 2O56A 3T2QA 4EK7A 3PY2A 3UZ5A 2ZOXA 1ISZA 1EWEA 4FOJA 3OBKA 4Y9AA 1TR9A 5G2IA 1OFRA 1LL6A 1UZ1A 3TKFA 1E9YB 4J3XA 2Y62A 1U30A 4O8RA 3NA8A 4CKQA 5EMUA 2FTYA 4WDXA 4JNMA 5LIYX 1M9HA 1AQHA 3DECA 1P1XA 4NJHA 2WANA 2R8WA 2JBMA 2E1WA 2TAAA 3VCNA 2DU2A 3DGBA 4QLKA 3AOFA 1F3TA 3AXXA 2TMDA 1GVRA 4AZGA 1MYRA 4TQTA 1XUZA 3MHGA 1ADSA 4ZE5A 1OCBA 4LUJA 1JPMA 1QI2A 3W7LA 5AYBA 2OVLA 2HK1A 4GUJA 1NJJA 4MG4A 2G3MA 3E74A 2X30A 1E0WA 3PB0A 4O10A 4TTUA 3G3MA 1YIXA 3TEVA 3QOMA 3LMZA 2RJHA 3N18A 4D6IA 3WLPA 1NQKA 3STCA 3VGGA 4IMDA 2QUVA 1IEVA 4PMZA 5G1TA 1H0GA 1WO2A 3URBA 2FKPA 3IARA 2PAJA 5HA7A 2Q01A 3VU2A 5FI8A 3PUOA 4XZ9A 4WIWA 1XGDA 1XUUA 1V02A 1TJ2A 4JTJA 3U4FA 4AC7C 4G9PA 1UMYA 5DCEA 3G18A 4I8DA 4NX5A 3ABOA 3N3MA 1F61A 3GM8A 3GXFA 3NPVA 4DWSC 3OJGA 2Z00A 4AH7A 4QSFA 4IPJA 3CJPA 4WY0B 1M03A 5U7SA 1D9EA 3S9IA 1ONRA 2ZBTA 3QMRA 1XSIA 4HA4A 4IZGA 4F9DA 4QQUA 2X1TA 3KRUA 1P0BA 4O53A 4GZJA 3HFTA 1LORA 1LRQA 5D37A 3OZYA 1SZNA 1XGEA 4JL1A 4Q8TA 4W9TA 4D72A 4DUXA 1QPRA 3W86A 4WKAA 4YTSA 3NQ8A 1UUMA 1R86A 1MUMA 1KFBA 1UZ4A 3KVLA 4XV0A 3W85A 2OEJA 5LIXX 4JTQA 2C71A 3AXKA 3BLLA 5LIKX 2W92A 4L80A 2VURA 3VNMA 1O5KA 2OB3A 1QNRA 5CJ5A 3BG9A 3AXMA 2IQDA 1LQAA 1S2VA 2PLMA 4O16A 2RGLA 3MTWA 1VEMA 5XIAA 4GI9A 4LB4A 4Q32A 4BQ5A 1FBAA 4ERAA 2GOUA 3JS3A 3WBXA 1YLVA 2V2DA 3GU1A 3W83A 4D6FA 4IFRA 1Q5MA 1CXLA 7CGTA 1UR8A 2W67A 3BAJA 4QR6A 1CXFA 3HV9A 1I1WA 3CLMA 1RJQA 4ZO9A 4PTWA 5DXYA 1NY1A 1YDOA 2PWGA 2XISA 1JNEA 5T8GA 5IHRA 1F73A 3R2GA 2NV9A 3SSZA 1PV8A 1BSLA 1L6GA 1XPYA 2IKHA 3BLKA 1ZP3A 3FA5A 3T9PA 2VVSA 1F05A 2Z2UA 1UWIA 1MFUA 3UZWA 1H1YA 1M7PA 3W73A 3VGDA 4O15A 2ZKMX 3W23A 1MRQA 3WEZA 3I7RA 1J4EA 3STFA 5AC6A 4N4QA 2OWXA 4E8DA 1I1XA 1R2RA 2PD9A 4LEFA 4LC6A 2FGBA 1DE5A 4N0RA 5MF5A 4N4PA 2EG6A 2UWFA 3L4WA 4XG1A 3S5YA 1OYCA 4BI5A 4C6MA 4R85A 1TUFA 3IWPA 3Q2DA 4GIRA 3AIRA 3RYSA 2VC6A 2X41A 3GR7A 2Y7GA 3OZMA 2CLIA 2PGWA 1N55A 4JFUA 3H53A 2WSYA 3VIKA 3MCOA 5G2HA 4DJDC 2JIEA 3IUIA 2F8QA 4B5XA 5HNRA 2NZLA 2YDQA 1QI4A 1Z44A 2PP0A 1SSDA 1KKOA 4R3UA 7TIMA 1EGMA 1JZ5A 3EX2A 3WQGA 4FR6A 5CBIA 1SU5A 1FDYA 3WJWA 1HO1A 3PZVA 5BXRA 4XAPA 3N2CA 5A69A 1TJPA 2VZTA 2OT0A 5LNSA 1JXKA 4BI7A 4FNTA 3AIEA 4F2BA 4PCNA 4QEEA 3SY5A 4ZA0A 3WNLA 1R3YA 3BPWA 4S38A 3W2UA 5REQA 2VUYA 1W2PA 1DXIA 1QFEA 1P0DA 4GBDA 3W9ZA 3RLUA 3IVUA 3FJNA 4PMJA 4DJED 3VYLA 2QUMA 4ALDA 3PZQA 4C6LA 4IIDA 1MWOA 1B3YA 1BF2A 3CASA 4PULA 3N6QA 1HVQA 3MMWA 1XLGA 3HG2A 5HULA 4XZNX 2W3ZA 1HN1A 1JDEA 1BRLA 2VFGA 3D3AA 1QI0A 2ZQ0A 1XC4A 1FCUA 4E4UA 3BE7A 3H2FA 4J2MA 3UY8A 3D47A 4G8TA 4ADUA 5BOFA 3VCCA 4B5SA 3OVRA 1IGWA 2E77A 1NM9A 1MQRA 4WSJA 4HBKA 1LG1A 6REQA 3W1PA 3GZAA 1G1YA 1NOFA 2G0WA 3NYZA 5K9DA 4XBJA 3TDFA 2E67A 4ZO7A 4RW3A 1QOQA 2DZSA 3GH7A 2YCJA 2R14A 3LV6A 4BWLC 5A6BA 2XGZA 3WL1A 1R3SA 3FLUA 3VIFA 1XD0A 4YVVA 2WB5A 5CXPA 1H3GA 3S1GA 2POZA 4GA8A 3C8FA 4FLQA 4JPGA 2PWDA 3LHVA 3B03A 1UJQA 2H8XA 4L4MA 1P43A 3OG3A 2XM1A 4JQ2A 5H91A 5A94A 2QLYA 4HMNA 4OIFA 4C60A 5D8ZA 4MUZA 1FP9A 1E1CA 2PLCA 1K8YA 4OU1A 1D3CA 4XD5A 2KX9A 4DLFA 2KAUC 3P2VA 4OFCA 4Q8WA 3VIGA 1ZBKA 3BJTA 1LWHA 4NJJA 4POCA 1JD7A 3LRLA 4LBUA 1K8XA 4BKNA 3FHAA 3APTA 2FZNA 4DRSA 2VZOA 3AHXA 1V3HA 5M2FX 5T9CE 4H9UA 1HW6A 2HPMA 2OQLA 3ZMRA 3KX6A 5D9NA 3C0JA 1WV2A 2VYOA 1RA5A 5HMDA 1IHIA 4BA0A 1JG9A 2I16A 4DZAA 5I3DA 3R4IA 1DL3A 4U2YA 2G50A 1I2OA 1CLKA 1PZ3A 3A64A 3INPA 1QUMA 3BGAA 4HVXA 1GT8A 2J6VA 4Q6XA 2Y70A 3E3HA 1A80A 1WKYA 2F38A 2P5NA 2Y24A 2F9RA 1BWVA 2XN2A 1V0MA 5I06A 1TPFA 3SEPA 2P8CA 4IOTA 4US5D 5CG7A 1ZUAX 4JTAA 3NQ6A 1ZENA 4QJ4B 2DSUA 1K9DA 4FIRA 2ZZ6A 4GUHA 3RDKA 3EX6A 1RQBA 1REQA 1C7TA 1UBSA 2ZUUA 1JAEA 4JTKA 1AL8A 4HOZA 2QQ6A 1CZ1A 1AZ1A 2ZCGA 1JQVA 1LG2A 2PDWA 1OC5A 3QSRA 5J5DA 1H5YA 2Y8VA 4ADSA 5FF7A 4YNGA 5BROA 4C5YA 2X1UA 3ARTA 3CZGA 1TTIA 5D2VA 2AQOA 3TA9A 4G5DA 4N9EA 4G6CA 1SO4A 3H54A 1XF0A 4E8CA 3WFZA 3LN3A 3S9YA 2J9XA 5T9BG 1BKHA 4B16A 1F5ZA 1QW7A 4WJXA 5IOBA 1LRNA 1IWPA 2EPMX 2HISA 4GXPA 3ZJKA 2NXIA 3KVKA 2BOGX 3LRMA 1UZDA 5AC8A 3L2LA 3ZVHB 2QDGA 3MDWA 4OOUA 1FWFC 1OADA 3QMSA 1CGXA 3GXPA 5JBEA 4DO4A 2NQZA 4RNIA 4UFJA 2G3IA 4P7LA 1CDGA 4CNOA 4QIUA 2CWNA 1GGOA 3VINA 1K6AA 1RPXA 1MNZA 3GAYA 2WM0A 2UY3A 1KBLA 1EB3A 1V7YA 1HZYA 3CAQA 4Y96A 3WK3A 2QKFA 4NG3A 2Y6ZA 5HATA 3S2MA 4DZIA 4FP1A 4PA8A 4U33A 1YPIA 4GPNA 3GDTA 3TZNA 4ATDA 4D9PA 3ECQA 2A5HA 4HK5A 4LYRA 1YXCA 4B5TA 4HJWA 2REQB 4ORIA 4CVUA 3IRSA 4LAOA 3IACA 2VZSA 3QZEA 1MDLA 1XFCA 2PP3A 3HQPA 4NXKA 3NAVA 4O1AA 1NAL1 2JKAA 1J0KA 4QRNA 1P6BA 2D2GA 5A6KA 2QDDA 4AAJA 1L9WA 1V08A 2I5QA 3VNYA 1QI5A 2QJIA 4JIQA 1EZ2A 1UWTA 3W2LA 1HKWA 2IPJA 3SGGA 2V69A 1EUNA 3LCIA 3UXAA 3RK8A 5CPQA 5I02A 4JTEA 3CK5A 5AHLA 5CG0A 4M6VA 3MQTA 3TONA 5LSMA 1F4HA 1WAUA 2XGBA 5D8WA 3BCDA 3VA8A 2XHYA 1WQ5A 4R27A 4JICA 2NX3A 1GEQA 3ARRA 3WQFA 4XZBA 3MZNA 3U57A 4XISA 1G4PA 3C2YA 4LW7A 2BBFA 3E0VA 2HBXA 3TR9A 1JCXA 1BHGA 4RV8A 3TOPA 2A2IA 2R1LA 4HNUA 2OPJA 2YFOA 5LYRA 1K8ZA 2FZDA 1NELA 3MMDA 1K3UA 4NZCA 2QCFA 4DBWA 3PZMA 3O7UA 3EDFA 3KP0A 2VQTA 1G4SA 1MQQA 3E0IA 4MWAE 5A5WA 1T7LA 3P8IA 4QNWA 1JCMP 4P61A 4XVEA 5ABEA 3CHEA 4UOZA 4ZO6A 3PTDA 4OV4A 4XZHA 1NDZA 2VQUA 3VOCA 1VR6A 1ZL1A 4PEEA 1XX1A 4JTRA 4H8NA 3WN6A 3HQNA 2CXGA 2VFHA 5CH9A 4R7JA 3PPFA 1WZMA 4OHQA 4JX5A 1F3XA 1CGUA 1NWTA 4Z2KA 2J9ZA 4DZHA 1BYCA 2DUZA 3VNJA 1LWJA 2EG7A 5I2UA 4K3ZA 2FTWA 1R6WA 4ZOBA 4HK7A 4KFNA 3QC3A 2OKTA 1FWBC 4OBSA 4ENLA 2IPGA 3A4XA 1Z3NA 4RZBA 1XIIA 4FNRA 3WFLA 3BMVA 3N1AA 3TTYA 3W72A 3SGUA 1VFFA 3KRBA 3FFSA 1R3QA 5HWNA 1W8SA 1RJRA 1UMLA 1J0IA 1KTBA 3CIVA 4MPQA 1AJZA 1XS2A 4EWJA 4J3WA 1O1ZA 1PWMA 3P14A 3G1AA 4DBUA 4LOCA 4J40A 3CUHA 1PSCA 4XAYA 1W1B1 4YVXA 4FALA 3EGJA 3MKCA 4JKKA 1W3LA 2QGHA 3EZ4A 3S6DA 4ZVJA 2GK1A 3TSDA 1AD4A 1J79A 3NSMA 4WD0A 4C1NA 2B7QA 3CZEA 1TSIA 1E15A 1AMYA 2GSJA 5F2LA 3IJQA 1Z7AA 4A3UA 2PTDA 4BQ4A 3WX7A 4F4RA 3FNDA 4Z42C 4HN4A 3GB6A 4P7OA 3H55A 1XV8A 4NU7A 3WNPA 5FKYA 3VFLA 1J9YA 2VI0A 2Z24A 5DMNA 3QV6A 1TV2A 4H19A 1JRBA 1R9XA 4J7RA 4MWAC 4U10A 2ZA1A 4R9XA 2OO6A 5EU9A 1P0NA 4QQ3A 2IMRA 1R3WA 3AZRA 4Y6GA 4PN2A 4HNVA 4XAFA 5SWUA 3AC0A 1L0PA 5D9PA 4R7WA 2A3EA 3BCFA 1TB3A 4Q4SA 4L6HA 2D2HA 3GK0A 1E6QM 2ZA3A 3W28A 4IPIA 3E38A 4DF2A 4UQEA 4ICCX 1TE6A 3T05A 1A0EA 2BY0A 3MJMA 3NFUA 4DLMA 3EEGA 3ES8A 4X60A 4TV5A 4ML9A 4N6EA 4Y90A 3SQLA 1VRDA 3DI0A 2NW0A 1MNSA 1JL8A 3KBVA 5AYYA 5A6TC 3UZJA 3GS6A 4J27A 1UR3M 3IIOA 4EWND 1XCXA 2QCDB 1EP2A 3MWAA 4YMZA 4IP7A 2VD8A 3UG3A 2FZ8A 8RUCA 2UY5A 2A3LA 4JQ1A 4W7VA 4GOAA 3N6JA 3S5ZA 4NASA 2OZ8A 4H9VA 3UGVA 1B90A 3IJ9A 4FPSA 4R88A 3FOKA 4REQA 2YJQA 3CQHA 3N04A 1DWAM 1BVZA 4GI6A 4IL2A 3H6OA 3QPYA 3H70A 5C2XA 2PDCA 1T0OA 2EKCA 4IJCA 4YIWA 2YBUA 1GVIA 1NEYA 4HZ7A 4O52A 4W84A 1UD5A 2RDWA 2D22A 3H4WA 2PURA 1GQKA 3BW3A 3M5XA 5KEZA 5I3KA 4B9ZA 4V33A 1AFSA 2Q02A 3A23A 3BZJA 1KO0A 5A6JA 3DG7A 1EX5A 3UJSA 4Y8FA 2QNEA 3HPAA 3CHVA 1YQ2A 7PTDA 2D23A 3WSUA 4KS0A 3HOJA 4C7GA 2O9PA 4WF7A 1QASA 1OY0A 1OFPA 5A2CA 2PF0A 4PBGA 4K36A 4JTHA 1XLAA 4KMQA 3P82A 1FFQA 3WLTA 1BGGA 1LZOA 3WJSA 1VPXA 3FXGA 1S39A 3NM1A 2WMIB 4QG6A 5AVNA 3IGSA 3B9OA 4A4AA 1EJUC 1R47A 3C8NA 1Y8BA 1RQHA 3W0KA 3B4UA 4GQRA 3WH8A 4YTQA 3V3WA 4JIPA 2QEZA 3W82A 3LXCA 1WDWA 1PTDA 2ZVIA 3BLFA 5JBDA 2WBGA 2E6FA 5CGQA 3CAWA 3TQ0A 3QKEA 3LTSA 3GLCA 3QR3A 3PANA 4QLJA 1ZGDA 1BPLB 4LXFA 5TBOA 1UH3A 4UFHA 3S3GA 1DJWA 3DAQA 2FFIA 4L65A 4U4MA 4PZVA 5FJPA 3NYDA 1BF6A 1ZFJA 1W5MA 3SIMA 4CNTA 4YTRA 4LS1A 2YIHA 2MNRA 3MO7A 2JEQA 3IVTA 1KM3A 4U3CA 3NEHA 1XHGA 1E9ZB 3QQ1A 4QX4A 3N4AA 1SR9A 3MUXA 1LCOA 1L2UA 4AHOA 2HXUA 1ECQA 1LUCA 3QW4B 1VJZA 3QJAA 1V79A 2VZVA 3WH6A 3MC5A 5EBUA 4LYQA 3ARWA 3K13A 3ITYA 2F2HA 1E4IA 4DYEA 1MUCA 5HQMA 3NVTA 3R43A 4RK8A 1KLZA 1OFAA 3ZR6A 3E1F1 1Z48A 3GC5A 3DXIA 4YWSA 3OIXA 1GK8A 3UF9A 4O8AA 2H6RA 2PUZA 3EOOA 4GQBA 4UR7A 3EBVA 3K1GA 2C1IA 5IM51 4ZB0A 1LT8A 3TC3A 2CWXA 2HS8A 4D6JA 1P7TB 5AYIA 1IEQA 4YN5A 4FO4A 4DWDA 5JVLA 1FWTA 3FEQA 2DT0A 4OZOA 4GH3A 5A2AA 1JI1A 3WKZA 1M5WA 1SZEA 3IGHX 5K4XA 3DN5A 4LAKA 2WNNA 1YXDA 2BSLA 3ALGA 1Q6FA 3VNDA 3DG3A 1HKVA 3JZUA 1JGIA 4D6DA 3MB9A 3G3DA 2H8ZA 3D0CA 4X2PA 2V5KA 4GKTA 1CB2A 5F7UA 4UTIA 1SJDA 1PTGA 4RE2A 3NG3A 4OWGA 5EYWA 1E3ZA 2OWWA 5LIWX 2IQ0A 1NH6A 5KZMA 2EPHA 4K38A 4W8BA 4J4KA 1W3HA 1ZP4A 2ABBA 2GUUA 3GR8A 2V9DA 3POCA 3BC9A 4E8GA 3UT0A 3B06A 1ITXA 1EDGA 1IGSA 5IDZA 1P6CA 3TTEA 3NCOA 1TV3A 3KW3A 3E2QA 2PB1A 1SMAA 1RJPA 3B0PA 5TD4A 3C61A 2INZA 5C54A 3LUTA 4LBRA 1DWFM 1FWRA 2RJGA 2ZZ4A 3I68A 1RR2A 3MHFA 5CPMA 3NZ1A 5DMLA 3TYAA 5RUBA 2BHZA 4AIEA 1X6UA 1VH7A 3EB4A 2WV8A 4JYEA 5C9WA 3WF0A 2Z1XA 4MDOA 1XR2A 3WJXA 1RLCL 1M1BA 3TOYA 3VMOA 4C6OA 1QT1A 3DBPA 3T55A 2FH6A 2UBPC 5CSUA 3A9IA 5CGTA 5HDRA 4G1KA 3QXBA 4X61A 4LVDA 3EWXA 4B15A 4MWAA 2VVNA 3W1UA 5FEWA 4AEEA 3FKKA 4LGXA 1BGAA 3ZT5A 1TVPA 4PCPA 4JAWA 1SO3A 2XN0A 5HWMA 3P62A 3G5EA 2CESA 4ZQRA 4J2PA 3TNBA 2VR4A 3W7KA 4RNFA 1V6TA 2G96A 4OUIA 4L9XA 3WD0A 1Q6LA 1Z8AA </