1BQCA

Beta-mannanase from thermomonospora fusca
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
302
structure length
302
Chain Sequence
ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHDHSDGNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (BETA-MANNANASE)
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
total genus 134
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1bqcA00
4AC1X 5CXPA 1QI4A 1UD8A 5GNXA 2W67A 5AYBA 3N18A 3K4DA 1B3XA 3B9EA 1QHOA 3BMWA 1AQ0A 1EQCA 4BQ4A 4JAWA 1HXJA 2J47A 4F66A 4IPLA 2ZXQA 4TX8A 2WVTA 1BGGA 2YLLA 1TE1A 1K9TA 1TA3A 4EK7A 1NP0A 5D9PA 1E6NA 2YDRA 1HJUA 3WELA 1OD0A 1W9VA 2XJ7A 1Q4NX 3VX0A 2BY3A 2ZXDA 4UQ9A 2QLYA 1ZS2A 2WHJA 4XZWA 3N13A 4GPNA 4QAWA 1XSKA 1V3IA 1WDRA 4W5ZA 5I79A 3OLIA 1ISYA 5A95A 2XSBA 4U5KA 4UFHA 3SCVA 1CDGA 3GH7A 2ZX5A 2XWEA 1A47A 4JFWA 1DWIM 4CVUA 4J3SA 4WLCA 1RP8A 4PTVA 2XM2A 1VRXA 4AZHA 1KQYA 1GHSA 3AICA 1E73M 4GI9A 7CGTA 4HA4A 4HA3A 1OT1A 3WNNA 2JFEX 3UEQA 2TAAA 3VIPA 3MS8A 5F7UA 1W3JA 5GNZA 4PRWA 1JF6A 5M17A 3SCTA 2J25A 3WF2A 3NJ3A 3AIRA 2G4FA 2W91A 4OBRA 3LPOA 3N11A 2PWEA 1ZBWA 2WMIA 2WWDA 3AZSA 3PZ9A 4MJ4A 4UQEA 1CBGA 3GBEA 3GNOA 4XUYA 2YBTA 1CXFA 1E4MM 4HPGA 3OGSA 4MDOA 3AMKA 3VGGA 4B9YA 2VL4A 6A3HA 1I1WA 3SCSA 1X6LA 1E6QM 4EKJA 4GI6A 4QDMA 4LQ1A 2C7FA 5JBEA 3WQ6A 1QI0A 3ALFA 1E6XM 1NH6A 3EMQA 4GKLA 1N82A 2VX7A 3T08A 2CESA 5CGTA 1UD6A 5FL1A 2W62A 1UWQA 4Z2GA 3ZO9A 4D6CA 5ABHA 4Z2KA 1L8NA 3ARRA 3BXWA 4LPCA 1C7TA 4M29A 1WZKA 4PMOA 1VIWA 1UA3A 2WCGA 3PZOA 3WNOA 4FLSA 2VCAA 3ZQ9A 3DECA 4JKMA 4W8AA 1EA9C 1R87A 3PTQA 1H09A 1BG9A 4FLRA 4WSJA 1HN1A 1KXVA 1VENA 4J3TA 4V28A 3VM7A 3NDYA 3GXFA 2PF0A 2BS9A 1RP9A 1V0NA 2DSKA 5EFFA 1JNDA 3O2LA 4KGLA 4S3KA 1FHLA 1F4HA 5M5DA 2WB5A 5CSYA 1HVQA 3IANA 3D5HA 2ZUMA 1CXIA 5BXTA 3AQUA 3WH6A 1QNOA 4PMUA 3QHMA 5BRQA 7TAAA 4A3HA 2WBKA 1GORA 4MB1A 3T0BA 2DT0A 1E0XA 1E15A 4W7WA 4LGXA 2Z1KA 2D1ZA 2IXUA 3TTYA 4KRTA 3PZTA 1XYZA 3ZJ7A 1DWFM 2BXZA 1J0IA 1JNEA 5E9AA 2WVVA 1F4AA 1LJYA 1LF1A 2WAGA 3VD3A 4HOXA 1G0CA 4MDPA 3OGVA 5HNNA 4XZBA 4W93A 1HNYA 3NSMA 4GQRA 2YL8A 4HMEA 5CZKA 2EPOA 4HMCA 1H0IA 1KXHA 3VDHA 2DSWA 1VFOA 1DWHM 2G3JA 4QCEA 2D0HA 3GM8A 2G3IA 2UWFA 3VNZA 2VURA 1JYXA 4OUEA 4JL1A 4PMDA 3OZPA 3K8MA 1QW9A 2B31A 2UY2A 1V3JA 3W29A 3CUIA 2W61A 3AROA 2V3DA 1ISWA 1C91A 2VO5A 3U5UA 3ECQA 5A6JA 1RH9A 3THCA 1MVYA 7A3HA 1KXQA 3PZVA 2DSVA 3EBVA 1G5AA 2OYKA 1BYBA 1E6PA 3K8KA 5I3DA 3T2QA 2YJQA 1UQZA 2G41A 5E70A 3EMCA 1V6WA 2BXYA 2E40A 1V02A 1UR1A 3VVGA 3RJXA 5CLWA 4CN4A 2WMJA 1KGXA 1R8LA 3AYRA 1HKIA 1Q6GA 4N0RA 3AIEA 4AZ6A 2VNCA 1W32A 4F9DA 3MSDA 1PX3A 3AXHA 3OBAA 2WPGA 3WMBA 1VJSA 2QHAA 1MXGA 3LPGA 1QNPA 4R5EA 3L4XA 1FP9A 1JI1A 2VZVA 1ZBVA 3IJ7A 4UNIA 3VUPA 1LLOA 2ZX7A 3UG3A 3VIIA 2WZIA 3VGFA 2YOCA 5AYIA 3F5JA 2CBVA 3N9KA 1UR4A 4UQDA 5E09A 2WSKA 3I3DA 2XVNA 3T2OA 4BA0A 1VF8A 4LYPA 3VMNA 4JFUA 1HP4A 2PC8A 4KGJA 1VFFA 3QR3A 2WANA 3CUJA 2BY1A 4GXPA 3MANA 2GFTA 4UFMA 5A2AA 3BC9A 1DTUA 3MKKA 1GQKA 1EGZA 1B3WA 1EHAA 1Y7VA 1VFMA 2VR5A 4TVUA 1ZBKA 3K1DA 2FGLA 3RDKA 1NWUA 1BPLB 3RILA 3RO8A 2D3NA 3F5KA 4MAVA 3WH7A 4GZEA 1VEOA 3PZMA 5BWFA 1QPKA 1J0HA 2XVGA 3WH9A 4JZ5A 2V5DA 3U7VA 4NZCA 4PUDA 3BH4A 2E9BA 1ODZA 1XRVA 5ABFA 4B15A 1HKJA 2JEQA 5A6MA 1K9EA 1DP0A 2DT2A 4D1IA 1NQ6A 1PPIA 2G3NA 4A3YA 2PWHA 3W26A 4CD8A 2Y24A 2GK1A 3PZQA 3G6MA 1JGIA 3OB8A 3W37A 1V6YA 1FFQA 4CVWA 3CZGA 1KBKA 1Z32X 3OGRA 2CEQA 4U33A 5I5RA 3AXXA 5JIPA 4JCLA 2YL6A 2QPSA 5GNYA 2DPEA 2CPUA 4PMVA 3PZGA 1KGUA 1J9YA 4P7LA 5D4YA 3SCRA 5EB8A 1CGXA 5EBAA 4YPJA 3VPLA 4AEEA 4U2YA 5FKYA 1BVZA 3QHOA 3WD0A 4BF7A 4DM1A 2FDMA 2WLYA 3PZIA 2ZXAA 4M24A 3ARQA 2GJXB 4X9YA 1MW0A 1NOFA 2BY0A 3VD5A 1HJVA 4EE9A 2CHOA 3BAIA 1HP5A 4ZEPA 1UWRA 1HIZA 4FMVA 2BHUA 4GZIA 5HPCA 1HX0A 2F2HA 2YA1A 3MV01 4JFTA 3WQ4A 2WLZA 2HISA 4C7DA 1UQYA 3ARXA 4U5IA 3WNPA 3ARWA 2FH8A 1JXKA 3VIHA 1GOIA 1W1YA 2ZWYA 4AIOA 1GONA 5A2CA 5AC4A 3T2PA 4BQ5A 4AY1A 3NSXA 1OIFA 5HBFA 3CZJA 4P8UA 3L4TA 4XX6A 4MTVA 4E2OA 3QOMA 3LPFA 4A4AA 4AZCA 1XGZA 4ACYA 1E56A 2PI6A 1HJQA 1TFVA 1E43A 4OKDA 1E1FA 1UWTA 2O92A 1LQ0A 1EHNA 4JKKA 1XSJA 3CMJA 2ZUTA 3WKZA 1FOBA 1E6ZA 1WDSA 2A3BA 4AISA 4CD7A 1VFUA 2ZUVA 1UZ4A 4PMZA 3MMUA 4Z2HA 3AISA 2J8GA 3FXYA 1CWYA 5FD0A 1JXJA 4D6EA 3SIMA 1UWSA 2E4TA 1JDDA 3CHEA 4UFJA 5CSUA 2CITA 1CLXA 1NP2A 3ZSTA 1CPUA 4W85A 2VRKA 1U30A 3BAXA 3SURA 4PSRA 2PBOA 5CG0A 5BROA 4FLOA 5CPTA 5TD4A 4UQBA 1HJSA 4CCCA 1PZ3A 4D71A 4ACZA 1GOOA 3BMVA 3L2MA 3AJ7A 3VIMA 2OLHA 2DIJA 2G3MA 2JF6A 5CGMA 1FHDA 1CGVA 4CUCA 3VDAA 1EXPA 5IFTA 1O6IA 4D6JA 3CBWA 2JIEA 4UQCA 1MQPA 4AZIA 3VIFA 3W6MA 1QBBA 1PEZA 4R27A 1KGWA 3MMDA 4Q7NA 1FH9A 1HL9A 1JDAA 4PTMA 3SCOA 3GXIA 1OD8A 5I0DA 2Q8XA 3B9DA 1X6NA 1GPFA 5A8MA 3RPMA 1XSIA 4PTWA 3ARZA 4W5UA 4AD4A 3WF4A 5I2UA 3W38A 3VU2A 3WF1A 3RJYA 1TMQA 1WB0A 3K8LA 2VRJA 4DWSA 1G94A 1ITCA 1VBRA 3VDBA 1UKSA 2JF7A 1XH1A 3MMWA 2UY5A 3WD3A 2UY3A 3OG2A 2X8RA 3BCFA 3OA5A 3ARTA 2X05A 3OIHA 5M03A 3ARPA 2XIIA 1TZ7A 1OIMA 1LG1A 2J78A 1UH3A 1XC6A 3MUAA 3U5YA 1PX4A 4C7FA 4LX4A 4UOJA 4QLKA 5EFDA 1CLVA 3SCNA 1V02E 4J3UA 3FHQA 4AEFA 2BNJA 3A4XA 1BYCA 5A2BA 4J28A 3FN9A 3AIVA 2VX6A 2XVLA 3WMCA 3VD9A 1WPCA 4AZ5A 1W9UA 2VQTA 1GJUA 4KRUA 3F5LA 1ECEA 1CXKA 4HOZA 5A6BD 3WDRA 1C7SA 1EIBA 1V0LA 4ZE5A 3MUZ1 1TVPA 3LPPA 3F4VA 1JZ6A 5DFAA 4TOQA 1JD7A 4W88A 2DH2A 4N42A 5E0CA 4CCDA 1KR0A 4QFUA 4UCFA 3W81A 4P8WA 2BVDA 1RD6A 2XVPA 2WHLA 4M56A 1CGUA 4Y7EA 4CD4A 4UZUA 1GQLA 1E6SM 3UR8A 2VJXA 1J0YA 1DWAM 4CU8A 1OM0A 1VAHA 3GZAA 1PJ9A 4RL3A 2XM1A 4WK9A 1E70M 2BY2A 4PYSA 1US2A 4D72A 3CZKA 3PTMA 3AIBA 3WSUA 1CZ1A 1OGGA 3GBDA 2E8ZA 3VGEA 3MUY1 3SUVA 1D3CA 3UESA 1OBAA 1M7XA 1D7FA 2W4XA 3CTTA 3SUTA 2XIBA 3KZSA 4TVCA 5KEZA 3CO4A 2XPKA 3WD2A 1P6WA 3THDA 1RPKA 4JL2A 3WDJA 1NWTA 2GDUA 2W66A 3T0DA 3EDJA 3ZIZA 1B90A 1B3VA 2XFYA 1E3XA 3GH5A 3VGDA 3VO0A 1WO2A 3UG5A 4MB4A 3BAKA 3SCWA 3QHNA 2BV9A 4LYRA 3ZT7A 3QOKA 5IHSA 3T09A 5E6YA 3WF3A 4RE4A 4BQ3A 2FHBA 4NI3A 2PBGA 4AD2A 1UR9A 1W3KA 3AS3A 3AS2A 4K68A 3AS1A 2YLAA 1XHGA 1QBAA 2VUYA 2VCCA 3EDKA 1MW2A 1UD3A 4HP5A 4W7UA 5D8ZA 1HF6A 1WDQA 1C8XA 3GXDA 2PWGA 3TONA 3OLDA 3AXIA 1DEDA 3L4YA 1EOKA 3WNMA 1OT2A 2C8NA 5CLTA 2D0GA 1WZAA 4L4OA 4CU7A 5A8OA 2CIPA 5IHRA 4W7VA 1XH0A 3FW6A 2PWDA 5IXEA 4H41A 2XUCA 3S2CA 1SYTA 3WY1A 4Z2LA 3BCDA 4AIUA 2BVYA 1J01A 1Q6CA 4JFVA 1FH8A 3G6LA 5LYRA 1UR8A 4M80A 1MQRA 3TP4A 3ARUA 3IAPA 3TOPA 1XCXA 4JHOA 4IPNB 3CH9A 1IT0A 4BQ2A 3VD7A 3WUBA 1M01A 2WCAA 3VIKA 1XD1A 1QW8A 3VNYA 4CGTA 4GINA 4WKAA 2X09A 4OZOA 4AZGA 1TR1A 1JZ4A 2CNCA 1FFRA 4J3WA 4DUVA 3BAWA 1XYFA 3WD1A 3MUIA 1KB3A 1QI2A 3AMCA 1UH2A 2J7EA 1YHTA 3W25A 3WBAA 3ZOAA 2WKGA 1AMYA 3M46A 4V2XA 1GOWA 3AS0A 3O6AA 3SUWA 1QNSA 2VT0A 1KR1A 1FA2A 4NRRA 2E3ZA 2VX5A 1Q6DA 3CLWA 4PEEA 3WQ5A 1UR2A 2DIEA 3VDCA 4TVDA 3WD4A 3SCPA 3GNPA 1K9FA 1KWKA 1TCMA 3WQWA 1GZJA 1TA3B 4PUEA 1UWIA 4PSPA 4D6IA 2XSAA 1JYWA 2FH6A 1E40A 3UERA 1I75A 2G8ZA 5FIPA 3MU7A 4P7OA 2YDSA 2ZIDA 3WH8A 2D20A 2IXVA 1E4NA 2EJ1A 4TXEA 2QPUA 1LL4A 1UKOA 5BCAA 1MFVA 1UKQA 1ISVA 3IAQA 3WL1A 1B3YA 2AMGA 2QMJA 4M81A 3WQVA 3GNRA 3O9NA 2OWCA 4WJXA 2OSXA 5DEZA 2WMFA 5FCZA 2ZICA 2V3GA 3UCQA 1Q6EA 4BZYA 4W86A 3AI0A 1UWUA 2OWXA 6TAAA 1B1YA 1LL7A 1C8QA 4H04A 3AMGA 2WHKA 4HZ8A 1GUVA 2RGLA 3AHXA 1W9PA 3RM8A 3FY1A 4UFKA 1PZ2A 4H8VA 5GQBA 1UUQA 4YN5A 1E0WA 1KCLA 1JL8A 2IUZA 3AZRA 1C92A 3WDQA 2DQXA 3CIVA 1VJZA 5BYWA 1BF2A 2WMIB 4W89A 5A6AA 4M82A 3A47A 1JZ2A 2A3AA 1AQMA 3MSGA 2Z1SA 3TTSA 1HVXA 2V38A 1QHPA 1TUXA 2XGBA 2BVTA 1WE5A 1FP8A 1UA7A 2EXOA 3BLPX 3BLKA 5E6ZA 3VX1A 5I24A 3VGHA 2BFGA 3W4RA 3U57A 3U7BA 2ZOXA 1PIFA 1XD0A 4M8UA 4RE3A 3VIOA 4D6DA 3ALGA 1J0ZA 2CCRA 5EMYA 1H11A 4MJ2A 2PWFA 4TTUA 4OOUA 4OOZA 1EH9A 3PBGA 2J8FA 2OSYA 1EO7A 4E8DA 2WKLA 4AYSA 1H3GA 2OYMA 5BXRA 2O9TA 2F61A 4LYQA 1GQIA 3M07A 2WXDM 2XGIA 1K6AA 3WMSA 5CPQA 4S3JA 4EANA 3OLGA 4UR9A 1CXHA 2CBUA 1OINA 3HU7A 5BXPA 1J0KA 4J3VA 1UD5A 5IDIA 3M7SA 1JZ7A 1ISZA 2XYLA 4CU6A 2D0FA 2QF8A 3FHAA 3WFZA 1ZB5A 3FAWA 3HMCA 1L0PA 5BXSA 3EDFA 4PMQA 1D2KA 3I3EA 1AVAA 3II1A 4UTFA 5BRPA 2WW5A 2AAAA 3K46A 3MO4A 2D24A 3NDZA 2BHYA 1CYGA 1V0MA 1M04A 1IZJA 5HOSA 3SCQA 1C3FA 4QLLA 2JALA 4HMDA 2CXGA 2WVVB 1B3ZA 3POCA 1OWQA 4MNLA 3TTOA 2J7DA 3ZSSA 4UOZA 1W2PA 2CBJA 1IV8A 4H8UA 1E71M 1H41A 1IZKA 1JD9A 5HXMA 4P8XA 1GOMA 4AD3A 4HU0A 3DYMA 3W24A 4F8XA 5FL0A 3KE0A 5I78A 5LA0A 2UY4A 1BHGA 2DT3A 5D9OA 2J77A 2WNWA 4U3AA 1G01A 2VZTA 4IUGA 2EQDA 3IJ9A 1NOUA 3N04A 2ZUNA 4JCMA 3T0AA 4PMRA 3HN3A 4GO9A 1KQZA 4FLQA 2PB1A 3EDDA 2WC4A 5M3WA 3AOFA 3AHTA 2W92A 4B16A 1V03A 3WIJA 2EPMX 3WN6A 4D6FA 4AXNA 1ZU8A 1TVNA 4HTYA 1UOKA 4OBSA 1TG7A 1J0JA 4D6HA 4DUWA 1DWGM 3N17A 2EPNA 1J11A 1LL6A 1W3HA 3K4AA 3WF0A 3N1AA 4C7GA 3WL0A 3WNKA 4JFSA 3ZT6A 4MNKA 2J7GA 2WMGA 3N12A 1MW3A 3WUGA 1CTNA 1W1TA 1NARA 2EPKX 1GVIA 3CPUA 1LG2A 2J75A 3RM9A 4LXFA 3KL5A 3AYSA 3WDPP 4XV0A 2CETA 4IM4A 3SEPA 1B2YA 1E0VA 1V6VA 3RIKA 1V08A 2DSZA 2WC3A 3VTRA 1E9LA 3GH4A 3W53A 1PBGA 4KMQA 2ZUSA 3WBEA 3AZTA 5D8WA 5CJ5A 1E1EA 2YL5A 3NSNA 1GOQA 4NF7A 1E5JA 1W9BM 2BHZA 1UD2A 2Y2WA 1W9XA 4H2CA 1R7OA 4AD0A 1PX8A 4UFIA 8A3HA 1DWJM 3ZJKA 4P7RA 2DT1A 1KWGA 4HPHA 1QNQA 1WP6A 2GSJA 4PCTA 3B9AA 3KL3A 3CUGA 1A3HA 1OGSA 3EYPA 1UHVA 2VI0A 4QLJA 2D23A 1E72M 5ABEA 2OSWA 1NWRA 1SMDA 4E8CA 4P8VA 1BVNP 3OLEA 2VMFA 3GDBA 5C71A 2WZHA 4TTGA 1CGYA 5HPOA 2VTFA 4RE2A 4DUXA 4U31A 2GJPA 3DHPA 3AHZA 1H1NA 4AMCA 2QMKA 4AWEA 3GTNA 4D6GA 3WEZA 2XTKA 3WUEA 2JIWA 2D3LA 5ABFB 1LWHA 3PTKA 3BGAA 1S46A 3A3HA 5DT5A 4B3KA 2DDXA 3DHUA 3KL0A 4Z2IA 1MXDA 3WEOA 3GYCA 2J7CA 3VINA 2GK1B 1Q6FA 1H49A 4ATDA 1SMAA 3ZT5A 1V3LA 1VBUA 4ZXLA 1QI3A 2GVYA 1XH2A 3AMDA 3W0KA 4ATLA 1CNVA 1JAEA 3OZOA 1JFHA 5A8QA 3VIGA 1WKYA 2J62A 2E9LA 1R7AA 4B9ZA 2Y5EA 3DYPA 2V5CA 1QNRA 5A94A 1J18A 5C8BB 1M53A 4MB5A 4CD6A 2XG9A 2CYGA 1OCQA 5A6SA 2WC7A 4ZXOA 3ZR6A 3PZUA 1G1YA 1US3A 1ISXA 1LWJA 1HJXA 1CGWA 2X0HA 3CHFA 1U2YA 4URIA 2W63A 5LA2A 1BYAA 4CN1A 4V27A 4YHEA 4Z2JA 1WZLA 2CERA 2VCBA 4P7QA 4NRSA 3ARYA 1GOKA 2VVSA 3WEMA 1JAKA 3WENA 1QVBA 4IISA 3CMGA 5DO8A 1BLIA 1E4LA 4WKHA 1MQQA 2Y8VA 1SR0A 3WDIA 1EDGA 8CGTA 1KXTA 2CBIA 1H5VA 1E5NA 4HA1A 1NWSA 5AY7A 3A4WA 2DH3A 1ZJBA 3BSHA 5DT7A 1O7AA 1BAGA 5JBDA 1UD4A 1W1PA 4HZ6A 3PZNA 2HVMA 2J7BA 2JE8A 2MANA 1JDCA 2E8YA 2FHCA 1E6RA 2YA0A 4PMYA 1X1NA 1I1XA 4AZCB 3A6OA 3AHVA 5DF0A 1UG6A 4FF5A 5A1AA 4B3LA 4XB3A 5JIWA 1E4IA 3L4WA 4P7NA 3VMOA 2A3CA 2ESCA 1B0IA 2OWWA 4DWSC 3SUUA 3CZLA 2NW0A 4KWUA 1W91A 4CKQA 2XVKA 5A6KA 1EDTA 1DHKA 2GJXA 9CGTA 3I3BA 2C0HA 3ZM8A 2O9OA 1CGTA 2V3FA 4JIEA 4X0NA 2YBUA 3WDHA 1H0GA 5I6SA 4AD5A 2YL9A 2E0PA 1C8YA 4UOQA 2J7FA 4EAMA 5A6LA 3HJEA 5AC5A 3NYDA 3ARSA 1W2VA 3RMEA 4U3CA 1PIGA 3LMYA 2XFRA 2VVNA 3ARVA 5CPSA 3S6TA 5E0FA 1H2JA 5A8PA 3APGA 2VR4A 1KFWA 3WQ8A 4PMNA 1XCWA 4AZ7A 4ACZB 2GUYA 3E1F1 3L4ZA 6CGTA 3SCUA 5KZ6A 1AQHA 2DSUA 1EO5A 1H4PA 1GCYA 4ZE4A 3L2LA 4WKFA 1GHRA 3CGTA 1HJWA 3CUHA 3UETA 4H8HA 2VZSA 2WCSA 2D22A 2QV4A 3FNDA 2XHYA 4W84A 5HDRA 1HL8A 4FK9A 1V0KA 1MYRA 3W6LA 2AOSA 1QHZA 1HT6A 1VB9A 3ZJ6A 1J10A 1W1VA 3NUKA 3JUGA 5D9NA 3WH5A 1UZ1A 1KBBA 2RGMA 4YHGA 1ZBCA 1JI2A 2CKRA 4GI8A 3VOCA 3AMLA 4GO8A 4H7VA 3ZMRA 4MB3A 5A8NA 2EEXA 1FH7A 1UR0A 4J7RA 2X0YA 4HZ7A 1VEPA 2OYLA 5A6BA 4JHZA 4DWSB 2A3EA 2FGZA 2GJRA 4HU8A 2X2YA 4CCEA 4KH2A 2WZEA 2VQUA 3CHDA 5I23A 1WDPA 2O9RA 4F79A 2WSPA 3KWXA 4J3XA 1B31A 3N15A 3AHYA 1WNOA 4AW7A 1E55A 3NIYA 1EOMA 1WCGA 2J7HA 3UR7A 3BSGA 2EPLX 4TX6A 3B8SA 4PCSA 4ZFMA 3CZEA 1ODUA 3TTQA 2J74A 2WK2A 1W9DM 1GJWA 3CUFA 3VD4A 1W3LA 2WVUA 2W5FA 1JIBA 5GPRA 4PBGA 4GIAA 4QP0A 4M1RA 4W8BA 3AIQA 3VILA 1V3KA 4J27A 3M6DA 3QGVA 4PMXA 4MAZA 1GNXA 3WFLA 5A69A 2Y4SA 4AZBA 1V6UA 1CXEA 1BFNA 4TUFA 4WIWA 3PN8A 1BSIA 1GQJA 4E4PA 2F8QA 1JZ5A 4CN6A 4AD1A 4GQQA 1EDQA 1WZMA 1GVYA 2J79A 4UZSA 1BYDA 1R86A 5A3HA 1ZJAA 4PTXA 2VC9A 3CZ8A 1U33A 3UG4A 3VMPA 5IFPA 4WF7A 2WMHA 4ML4A 3ZJ8A 2DGAA 1R85A 5ABGA 1OSEA 1BTCA 2VRQA 1YQ2A 2WWCA 3ZR5A 3RM4A 2CKSA 3IK2A 4U2ZA 2O9PA 4OJYA 3SUSA 2ZUUA 3VKKA 4Q22A 1CIUA 3WUFA 5I77A 1HKKA 3D3AA 3EDEA 1UKPA 1KCKA 1WAWA 4DWSD 1MFUA 4W8LA 1NOWA 1BGAA 3VIJA 1MWOA 3DYOA 4PN2A 2VZUA 2ZE0A 2NT0A 2YDQA 1CENA 2WBGA 1B30A 3IJ8A 1PAMA 3CHCA 1HKMA 4WSKA 1MW1A 4D1JA 4W87A 2DEPA 2VZOA 2WYSA 2ZX8A 2VOTA 4CD5A 1J12A 1QI5A 3W28A 2ZX6A 1CECA 2ZX9A 1OB0A 1C90A 4MNJA 2EBNA 3WNLA 5JUVA 2YKKA 2ZUWA 5C70A 1JYNA 2FHFA 1C93A 2D2OA 2J4GA 1VEMA 4X0VA 2A3HA 5LA1A 5JBFA 1JZ8A 1K9DA 5ECUA 4BCEA 1EQPA 2VX4A 3KEHA 3J7HA 4GZJA 2CHNA 4BS0A 3BAYA 4MNMA 2NSXA 1OGBA 3RCNA 2JEPA 1ESWA 4ZENA 4UFLA 3PHAA 3TA9A 4UQAA 1ITXA 4JKLA 2WM0A 4QCFA 5CQ1A 1V6XA 3MV11 1CEOA 3GXMA 1G9HA 1GW1A 1BQCA 2V3EA 1M03A 1UKTA 3AIWA 4NSBA 3L4UA 2WHMA 1CXLA 3W27A 2ZWZA 1JZ3A 4L4PA 3W82A 4AIEA 1UYQA 4MPKA 3FAXA 1E3ZA 2ZXBA 1B9ZA 2EO7A 3A4AA 5DMYA 2X1IA 1SFSA 3NCOA 3AIUA 1V3MA 3EMZA 1ZL1A 3POHA 1JFXA 1BG4A 5FOOA 2GDVA 5D9MA 1JYVA 2WMKA 2YIHA 3BAJA 4DM2A 2XFFA 1NM9A 2YA2A 3VM5A 1XV8A 2E9MA 2XWDA 4F9JA 1JG9A 1QOXA 4OIFA 1JF5A 1UH4A 3VGBA 1V3HA 2NT1A 4HOWA 2Y8KA 2WVSA 3L4VA 4ATWA 3AFBA 3DC0A 4MADA
chains in the Genus database with same CATH superfamily
3NOEA 3SECA 4PTDA 1QI4A 3T8QA 2ISVA 1RJPA 2ZVIA 1I9CB 3B9EA 3BMWA 1EQCA 2Q09A 4KT2A 4CNUA 4JAWA 1H5YA 1S2CA 3HFYA 1E1CB 3V16A 3QQ1A 4AHOA 1EJSC 3CV1A 4L9YA 4JN7A 2IKHA 4KCTA 5D9PA 3L5MA 1E6NA 1OD0A 3EPOA 3N19B 5JVLA 3TSDA 1FWSA 4QE4A 2BY3A 3FLUA 4XZWA 5LKYA 4PE8A 5HNTA 1W5MA 1VPYA 1X6UA 2W79A 3H8AA 3FJLA 2XSBA 2D2GA 4S1FA 3SCVA 1CDGA 4X22A 3H24A 3ZWTA 4NJGA 2XIMA 4EIVA 1K70A 4I9AA 4WLCA 4PTVA 4KERA 2B7OA 5D37A 1VRXA 2XH2A 3G1YA 2WJZA 2RDUA 3S8HA 4GI9A 3H2NA 3W2MA 4HA3A 2JFEX 1OG6A 3VIPA 1S1PA 1XC4A 3EOEA 5GNZA 2WNNA 4RNHA 3Q45A 1POJA 4RZ4A 3H54A 3I7RA 3NJ3A 3UWEA 2G4FA 1WUEA 1GVSA 1BQGA 3LPOA 3N11A 2PWEA 2WWDA 3GNOA 5HMSA 2NQ9A 4Y8FA 1KBIA 3K13A 1XDMA 3SCSA 3H2AA 3W2UA 4JX4A 2Z2AA 1TPB1 4QISA 3QZEA 1NH6A 3EMQA 5BOFA 4GKLA 2VX7A 3KHJA 5CGTA 2W62A 1ADDA 3KOWA 3ZO9A 1PCWA 2QUUA 5ABHA 3MKVA 1L8NA 4Z2KA 2DU2A 1TJPA 2Z29A 2X42A 4FB7A 2OXNA 4IX0A 1TX2A 3NVDA 3CT2A 1GJPA 4NKCA 2VCAA 3B4YA 1KM5A 3STPA 3DECA 4JKMA 1XG4A 3ZLFA 2NX3A 1EA9C 1R87A 3MYOA 3PTQA 1H09A 4XWUA 3VKBA 4G6CA 3WK1A 4DELA 2ZRZA 2PDCA 3VAVA 1UWAA 1EP3A 3NDYA 3GXFA 4N9DA 2PF0A 4FZIA 1FHLA 3OYXA 5M5DA 1GKRA 3D5HA 3MI2A 1PS9A 3AQUA 1QNOA 2Q8ZA 2VEKA 4MYAA 3KBMA 1GORA 2JGQA 1XBVA 4IGNA 3JRKA 2DT0A 1E0XA 1RQBA 3B0VC 2Z1KA 2D1ZA 2FGBA 3TTYA 4KRTA 1TX0A 1SW3A 1SVDA 5AHMA 1F3EA 2BXZA 1J0IA 1Z6KA 4A8LA 5LNSA 1F61A 3GKFA 3LM3A 4JQ4A 1SPQA 4MLRA 4J2MA 6PTDA 6TIMA 1TTIA 1BKHA 2EPOA 4HMCA 1KXHA 3EX6A 3TFCA 4GIEA 3VDHA 2ZRWA 3PULA 4FNTA 4LVFA 1RVKA 4DJFD 5D38A 2HMCA 4LS1A 5CJMA 2VURA 3NPVA 4OUEA 3P60A 5AYZA 1QW9A 1V3JA 3M0HA 3O16A 3W29A 1H61A 2V3DA 1C91A 3U5UA 1TRIA 4WDTA 2WNQA 3THCA 1YNPA 1MVYA 7A3HA 4GHRA 5FF2A 1KXQA 3PZVA 2DSVA 3LQGA 1G5AA 1BYBA 3UYIA 4PRRA 1QOPA 3GKAA 1DPMA 3MYPA 4HHHA 3GXNA 1E6PA 4M7TA 3K8KA 5I3DA 2AL2A 4HYWA 2ZA3A 4YIWA 4LCQA 1MUCA 3S5ZA 5E70A 5D2VA 4GIYA 1KRMA 1TPC1 4NX5A 4ADTA 3EOLA 3MPGA 1XJBA 3PAOA 3AYRA 4N0RA 3AIEA 1OC6A 1P7TB 5HMFA 5LNUA 4QJ4B 1DVJA 3OBAA 3WMBA 4Q8NA 3N9RA 3TMLA 4CNSA 1ADOA 3S9YA 4E4UA 1QNPA 2PDJA 2Z0IA 3LCHA 4JPGA 4Z1CA 5LIYX 2BX7A 3TXZA 4UNIA 3A5VA 2QEZA 3QQWA 4FXSA 2WSKA 3I3DA 2XVNA 2BWGA 1W8GA 1TZZA 5LNWA 2PTWA 4AEOA 3VMNA 2PGEA 3W2KA 4OE7A 2WANA 5F4WA 2PSNA 5T9CE 4AXKA 5A2AA 3TW6A 3Q67A 4IMDA 3OJGA 2I57A 3MKKA 2GGGA 1XDLA 1W5QA 1ALDA 1VFMA 3S1GA 4TVUA 3BANA 1ZBKA 5HUPA 1NWUA 3QY7A 3QY6A 2D3NA 3OEXA 4GZEA 2I56A 4HA0A 3DI0A 1J0HA 2XVGA 4JZ5A 1R9ZA 3B05A 5EYWA 4LH8A 1KFJA 1HKJA 4UTTC 1NF0A 1MDRA 2DT2A 3TOYA 3LDVA 4A3YA 2PWHA 3FIGA 1VRDA 2YBVA 1LRQA 2GK1A 3PZQA 4E3TA 9XIMA 1V6YA 5KTLA 1A5AA 1KBKA 1Z32X 3GD6A 3GWQA 4BHYA 4LRTA 3TYZA 3GTXA 3OA3A 3PB0A 1H60A 2QUMA 4IMFA 1QRQA 1KFBA 2BOEX 3VPLA 1JPIA 3UVAA 4UNKA 4MVAA 2WLYA 1LRTA 4US6A 3VE9A 2CLEA 2ZXAA 2AQWA 3ARQA 1MW0A 2E67A 4PB4A 1NIUA 1SJAA 1FCBA 2H8ZA 3O15A 3HQNA 2YFOA 3SJNA 2E6AA 4JTIA 5B80A 2P3EA 4CCZA 4DAFA 1W17A 4REQB 3LV6A 1QASA 2F2HA 2WJFA 1P0DA 3O6DA 2EKCA 2EG8A 4WXZA 3WNPA 3ARWA 1JXKA 3VIHA 1ECQA 1GOIA 4UUIA 5I3KA 4LSBA 1TWIA 4PUJA 5A2CA 4Q4MA 5U7SA 1NF7A 3W88A 4G7FA 2OGYA 4FNUA 3L4TA 3TROA 3LPFA 4A4AA 2FZ8A 2P0OA 1IXPA 4ERAA 1E56A 2PI6A 4Q4RA 1TE6A 1EJRC 1TFVA 3QZ6A 4Y96A 1Z8AA 3OZMA 2Y85A 2O92A 3UXAA 3RU8X 5G4WA 2V0TA 3B97A 3O63A 5G4HC 1ICQA 3L67A 4DI9A 1EUNA 1US0A 1LOSA 1RSCA 4Z2HA 2J8GA 2Y62A 4WDXA 2P50A 5H6HA 1PE1A 1A3WA 7ENLA 1CLXA 3ZSTA 3RX4A 3DOPA 2ZZ5A 2NV1A 3BAXA 2HQAA 3SURA 5CG0A 3AU2A 1F05A 1F8IA 5TD4A 4B5WA 5DX7A 4G8TA 3L2MA 3AJ7A 3VIMA 4K36A 1FWBC 1AJ0A 1FXQA 2JF6A 4ZOCA 1FHDA 8RUCA 3KTCA 3KBJA 1O6IA 1QO5A 5E93A 4A6GA 1EYEA 1MQPA 2D73A 2EG7A 3MMDA 5JU6A 2DUXA 5HWNA 3SCOA 3GXIA 4BY3A 1H50A 3DFOA 2PD9A 4W5UA 4WOZA 4IFOA 3WQCA 5HAOA 5I2UA 3W38A 3CAVA 1XDJA 1KO0A 2A5HA 4DWSA 1G94A 1ITCA 1VBRA 5DANA 1XLHA 2H3BA 4K39A 2W0UA 3WD3A 3OG2A 2X8RA 4JTKA 3ARTA 2XIIA 4GWEA 4RXGA 2V9DA 3DHDA 3MUAA 3C8NA 4ZOAA 4BR1A 4XZHA 1TPDA 3P93A 3RAOA 1K4GA 3PNUA 4I9MA 3UA4A 2VX6A 4MMWA 3LCXA 3B8VA 1I60A 5CPMA 1EIBA 3G0SA 1H7PA 1TVPA 2CC0A 4POCA 3RO6A 1KKRA 4DUOA 1JD7A 4RDYA 2DH2A 4N42A 5E0CA 3URAA 4A2RA 4O1DA 4P8WA 1DTNA 2MNRA 1QWKA 4DZAA 1RD6A 1DQXA 4GIRA 3HGOA 1CGUA 4UZUA 1GQLA 3OP2A 4XUGA 2W9MA 3GZAA 2EHHA 3PC0A 5C7VA 1AL8A 7REQB 3DZ1A 2XM1A 4WK9A 4JTTA 3PTMA 4LOCA 3AIBA 4S3EA 2PS2A 1CZ1A 5FSDC 4O1FA 3VGEA 1VLWA 3WLPA 1D3CA 1OBAA 1M7XA 1D7FA 2XH7A 3CUXA 4TVCA 5KEZA 4DXKA 1P6WA 3RUBL 3WLJA 2ZA2A 4U28A 3L21A 1ONEA 3QXBA 3WDJA 4L1XA 2PU0A 2DZAA 3W7PA 5G1TA 3EDJA 1B90A 2XIJA 3GH5A 4QJ1A 1WO2A 3UG5A 3GIYA 2BV9A 4HT3A 3ZT7A 1IXQA 3M44A 4CNOA 4RE4A 1BEUA 4YTUA 4OVXA 1QO2A 4YCOA 1RUSA 4TV5A 4CQ9A 3LHVA 4AD2A 1W3KA 1EJ7L 1JJKA 2YLAA 3LN3A 3O1NA 2VUYA 2R8WA 3STCA 3EDKA 4HP5A 4W7UA 1HF6A 1C8XA 2PWGA 3MP4A 1Q13A 1DEDA 3L4YA 1EOKA 3B8UA 1OT2A 5CH9A 3P74A 4O4WA 4CU7A 3I65A 3G1SA 4W7VA 3FW6A 4YVXA 1EC7A 1KNWA 3S2CA 4Z2LA 2BVYA 3G6LA 4YL2A 4M80A 1R3YA 4JHOA 4LAUA 2PZNA 1M01A 1XD1A 4CGTA 1DJNA 4WKAA 1JZ4A 2QXWA 2CNCA 4KW2A 3M0ZA 2CLHA 1FFRA 4J3WA 3T78A 5CSRA 2XSXA 3EGJA 3QV8A 4DF0A 3GR7A 1LUCA 3H12A 1KB3A 2QJJA 3LXBA 3I6RA 3TKFA 3BO9A 3WBAA 5DXXA 4EP8C 3WFAA 3MJMA 4HK5A 1QCWA 4ZOBA 3V0TA 1DIOA 3GHRA 2V82A 1QNSA 1R9XA 2E3ZA 4IP5A 3R1ZA 3SCPA 2P10A 1TCMA 3TA6A 1XLDA 2TRSA 3N29A 2XSAA 2FH6A 4JTEA 2ZIDA 3AWOA 3GC5A 1E4NA 3DFNA 5C6MA 2O4QA 2QPUA 1UKOA 3H2FA 1ISVA 3WL1A 2AMGA 5D30A 4M1BA 4M81A 3WQVA 3GNRA 1G4PA 1UOZA 5DCBA 1DJQA 5CG7A 2OSXA 5DEZA 5FCZA 1OG0A 3TW9A 2V3GA 1CB7B 1Q6EA 1WKDA 3THQA 3VC6A 3DFHA 2QCCA 2WO5A 2WZMA 4GYKA 5AYYA 4RK8A 4B4HA 4D9PA 3SGUA 1UUQA 3ERPA 1E0WA 3LNPA 1JL8A 2YFNA 1CI1A 1EBHA 4L4LA 1C92A 4K3ZA 3W7QA 2WMIB 5A6AA 3CL6A 4M82A 3QQ0A 2Y88A 1AQMA 5KITA 5AC8A 2Z1SA 4XQ6A 2VD8A 5D32A 3TW7A 2V38A 5K4ZA 2Z2UA 3UA3A 2BVTA 4IL0A 3URNA 2F7FA 3HV9A 1ZGDA 2EXOA 2HWGA 4JIHA 3VX1A 3FS2A 5I24A 3W1NA 2VYOA 3RHGA 3VGHA 3VXGA 2BFGA 5I00A 3NQDA 5TQLA 4ZQOA 4XO6A 4RE3A 3RPTA 3QMTA 2CCRA 1L6GA 4K1WA 1H11A 4NZ3A 2FYMA 1PV8A 4MJ2A 3CC1A 4OOZA 3PBGA 3W7DA 2OSYA 4DYEA 4IMGA 5BXRA 3LU2A 1QNVA 3UJSA 3M07A 4IIEA 3URBA 3IK4A 1VFTA 3OOQA 1PZ0A 1YDYA 1AW1A 4S3JA 3TMQA 3H21A 3M4HA 1KFKA 3K5XA 1IQ8A 3HU7A 4LF2A 2NUYA 2ZVRA 4O15A 2QJMA 1UP0A 5FF0A 3OW1A 1UD5A 3C2EA 1JZ7A 2FTYA 3USZA 2XYLA 1A5BA 3ABRA 1LBMA 4H6EA 4Q4KA 3SFKA 2ZYFA 3WFZA 3HMCA 1L0PA 4PMQA 2OTDA 1A5MC 4GK8A 1D2KA 1NFBA 3II1A 3M0YA 4GCXA 4LUYA 5BRPA 2WW5A 3I68A 3MO4A 1TTPA 3NDZA 2BHYA 4E8GA 1IXOA 4L9XA 3P6LA 3MC5A 2WVVB 4N02A 3TH6A 2J7DA 1DJZA 3ZSSA 4UOZA 3T6CA 4UCGA 3I10A 2CBJA 1C9WA 4FAMA 1RBLA 4JY8A 2JGYA 1H41A 1IZKA 5HR7A 5HXMA 3TR2A 5LXEA 4HU0A 1SU5A 3W24A 5I78A 1A50A 4GC4A 2WNWA 2DVUA 3N04A 1NOUA 3WQOA 4JCMA 3NO5A 1TYGA 5FACA 3O6CA 4GC3A 1YPFA 2CZEA 3UXIA 2PB1A 4GNKB 3TE9A 3EA3A 3UBPC 2W92A 3DKLA 4Y9MA 3MSYA 1XW8A 2EPMX 1M6JA 1PIIA 5JQ9A 2PP0A 1O5QA 2OKOA 2XN0A 1AH0A 1J5SA 1FCUA 1TVNA 3E0WA 4HTYA 1UOKA 4OBSA 2VDIA 4A2SA 2EPNA 1J11A 3WL0A 4DXXA 4ZQRA 1F76A 4JFSA 4MNKA 1U1UA 2J7GA 4FOUA 1VYPX 2MUCA 1CTNA 1R3WA 1NARA 2EPKX 3ANVA 3HF3A 2GSHA 3CPUA 4ADUA 2VDHA 2EJAA 3AYSA 3S2NA 1XQKA 3WDPP 4XV0A 3PS7A 3RIKA 1ZTVA 3K30A 3LI1A 3MI3A 3SW6A 4HSOA 1PBGA 2ZUSA 4QR6A 2Z28A 2V30A 5D8WA 5CJ5A 3NSNA 1RK5A 1E5JA 4JIRA 5EY5A 1UD2A 2Y2WA 5DMMA 2JBMA 2XGZA 1MEHA 1LZOA 2GGHA 1H7OA 1BVWA 2DT1A 2FFIA 3ME3A 4DZHA 4JDBA 1QNQA 2GSJA 3CUGA 5LHFA 3MZ2A 2O55A 4LU0A 1E72M 3CXOA 2OSWA 1UZDA 3UQNA 5FSEC 3BLIA 1AH4A 5C71A 1P1MA 3V1HA 4TTGA 3A24A 4WGXA 4U31A 2GJPA 3TQPA 2QIWA 4AWEA 5E0KA 2QQ6A 2CLMA 2QW5A 3VI2A 3W7OA 3KLKA 3WUEA 1BWKA 5ABFB 3SIZA 1S46A 4A05A 1TV3A 3L12A 1H1ZA 4GXMA 3EWYA 3PPFA 1BXCA 3GYCA 2C71A 1H49A 1QPQA 3UT0A 7XIMA 1SMAA 1HZYA 5CJNA 2GVYA 1R5YA 1EF3A 5A8QA 2WSRA 1K02A 5HMEA 1WKYA 5IBXA 3WLIA 2E9LA 2Y5EA 4B5SA 3INPA 3DN5A 5A94A 2BGNE 5EMMA 1JDEA 1WA3A 4E4FA 4MB5A 2XG9A 4DBUA 1QFEA 1MXSA 5I07A 1OCQA 3TC6A 1UPPA 3UXKA 3PTDA 2CFFA 4XZ9A 3LHUA 3PZUA 3GW0A 3W6YA 3MB9A 1XF0A 1C8VA 2X0HA 4BFAA 3EXRA 2YZRA 3GE7A 4RCXA 3OBKA 2BLEA 1WZLA 4GRSA 3W01A 2CHRA 3H2EA 3WO8A 3GVWA 4EPKA 2TODA 4NZFA 2BASA 3RR1A 1GOKA 3WEMA 1JAKA 5F4XA 1QVBA 1XGDA 1TJ0A 1MQQA 3EOSA 4NG3A 3S1XA 1EDGA 2JQXA 3NQAA 1H5VA 1E5NA 3A4WA 4E3VA 3GS6A 4FPSA 2XIOA 5JBDA 2R82A 2J13A 3GDKA 3PZNA 5FAGA 1QATA 3PG8A 5KZEA 2E8YA 3GXTA 2YA0A 1OC5A 2R1PA 4PUUA 4AZCB 2ZZ6A 2FFCA 4MUZA 2F84A 4TU1A 1ZP4A 3BURA 1UG6A 4FF5A 3TLLA 2A79A 1CCWB 1XRSA 1A5CA 5JIWA 1RXOB 1E4IA 2J88A 3G1RA 1K8XA 3REQA 3VMOA 3FSTA 2OWWA 4DWSC 4GFSA 3CZLA 5H8PA 4KWUA 4DVOA 2GJXA 2YCIX 9CGTA 3I3BA 1REQB 2V3FA 3L0GA 4X0NA 4WRHA 2ZZ3A 3WDHA 4G2DA 2E7FA 3W2JA 4XSMA 2E0PA 2J7FA 2RAGA 4H7CA 3NO3A 5B7ZA 1GVFA 4U3CA 3U4AA 3EWBX 4GUJA 3ARVA 3S6TA 5E0FA 3KOYA 3APGA 3M9YA 2GUYA 3OVPA 3UY7A 5BU6A 1H4PA 1TIMA 4HHPA 5LHEA 3L2LA 4Q8WA 3P5YA 1S5TA 1EJVC 4QITA 2I7GA 2OEMA 1PCKA 2D22A 4IG2A 4JX6A 4LY4A 3IIZA 4YTQA 3THAA 5HDRA 1HL8A 1WQ5A 1MYRA 2BDQA 3UPMA 3OPSA 2IQTA 1Q45A 5LNVA 1UBSA 5K9DA 3GG8A 3VKAA 2FJKA 1WKEA 4LAMA 4JTQA 2CKRA 4GI8A 4H7VA 3ZMRA 1FH7A 3DFQA 4HZ7A 5A6BA 2CWNA 3U3HA 1JPHA 4R88A 1GKQA 4TMBA 4F79A 1ML1A 4J3XA 1A80A 1B31A 2ZTJA 3N15A 3O0FA 1KFCA 3N2CA 3P67A 3NIYA 1GG0A 3W3OA 2J7HA 1FDYA 3P0XA 3DHFA 4Q6JA 4ZFMA 3CZEA 3BJTA 4MY8A 1W9DM 1FWNA 3LXAA 4LTSA 4QP0A 4G7EB 1V3KA 3M6DA 1ONXA 4PMXA 1GNXA 1PXGA 5A69A 2VUNA 4I8DA 1CXEA 1BFNA 4WIWA 4E4PA 4KFNA 1JZ5A 3UWWA 4AD1A 1XIHA 3UWQA 1EDQA 3KZPA 3QRHA 2ZQ0A 4E5TA 6REQB 2GVGA 3WQEA 1R86A 4KPLA 1TWSA 4HPXA 3HOJA 2VC9A 3UG4A 1XRFA 5EKYA 1LP6A 1T99A 1XBZA 2DGAA 1R85A 4NJIA 5ABGA 1XPGA 1W1A1 2BVWA 1HKWA 1BTCA 1E9ZB 1ZP3A 1N8WA 2J9YA 3RM4A 1WDDA 2CKSA 3IK2A 2PRLA 1PKNA 2FZNA 4Z1DA 1CIUA 3MDWA 1AODA 1UKPA 1KCKA 1WAWA 1YRRA 4FNSA 1BGAA 4F40A 1MWOA 1WDWA 3E2RA 3DYOA 4AMAA 3CQIA 2BOGX 2YDQA 3UD6A 3O07A 1R38A 3IJ8A 5AKQA 4H9TA 4R9XA 5C9ZA 1PUDA 2CZVA 1R30A 2DEPA 2VZOA 2QUTA 2ZX8A 4DRSA 4CD5A 1V8EA 3BDKA 3L66A 1OQFA 2ZX6A 1CECA 1IGSA 2QULA 2EBNA 2UBPC 1SO4A 2E5CA 3UWYA 3VCRA 3QC0A 1TB3A 4DZIA 5JH1A 2J4GA 4IFRA 3ZWSA 1JCNA 4PUWA 4X0VA 1RBAA 2X1UA 2A3HA 1RA5A 4GYPA 6ALDA 1XLBA 1OADA 4O18A 4PZVA 1JCTA 3GAYA 4IQLA 1EQPA 5H8MA 3KEHA 3C0QA 2CHNA 4XD4A 3BAYA 2NSXA 3M0KA 2Y1HA 1J2BA 2ZZ4A 3TV8A 4C5ZA 3PHAA 4UWMA 4IMEA 3ZVHB 3SRFA 3MCNA 1ITXA 1KM0A 2WNZA 4EF9A 4C6MA 5CQ1A 3FGCB 3MV11 3CU2A 1GW1A 2V3EA 4MKSA 3FKKA 1YTKA 3L2IA 4PUNA 1HL2A 5DLCA 1CXLA 2ZWZA 1OF6A 2VWSA 4B4FA 3OTRA 3KUMA 4EF8A 1XIFA 3BW3A 3FAXA 1E3ZA 2ZXBA 1B9ZA 1S5MA 2ON3A 2X1IA 3U8GA 1V3MA 1UMLA 4LB4A 3N25A 1DE6A 4O57A 3ZYZA 3QR1A 5G2WA 4H6QA 2E5BA 4MWAC 2WMKA 4NJJA 1Q5MA 2BG5A 2XFFA 2YA2A 1FWCC 1W1IE 1XV8A 3SY5A 4UIOA 2E25A 2VC6A 3I6TA 1A5UA 4BI7A 3DESA 1NU5A 1QOXA 4GJJA 4B2DD 2CLFA 5DQPA 1X97A 5B7YA 4GQ0A 4I3GA 2OX4A 3H2CA 2PDHA 2GGJA 5DMNA 4FXJA 3VGBA 3N6HA 4O1AA 2C1IA 3CAKA 2NT1A 4CLMA 2Y8KA 3JU2A 3LERA 3BV7A 1J96A 4W9TA 4KFOA 1UD8A 3W23A 1EX1A 2W67A 2QJIA 5AYBA 3K4DA 4AH7A 4DF2A 4DJDA 4IOTA 4NZ4A 1D3HA 1GYMA 1RLCL 3F4CA 3EEGA 3KOZA 3E0FA 1SZGA 3S4TA 3NQFA 2G0WA 2J47A 4BWLA 3E3HA 1HGWA 3V0UA 1TA3A 4RNIA 3WELA 3KOFA 1W9VA 4FNQA 4HHMA 1QPOA 1GW9A 1ZS2A 2WHJA 5DY3A 4NT0A 4QDWA 4C6KA 4RW3A 2Q01A 4QAWA 1XSKA 3NQ6A 1V3IA 4S3GA 5A95A 4UFHA 2P5NA 2OR2A 2X7VA 1EB3A 2ZX5A 1A47A 4JFWA 4CVUA 4JNMA 1RP8A 2XM2A 4AZHA 1KQYA 1FKWA 1GHSA 3VFLA 4C6OA 4KEMA 5H8UA 3HMJG 4PRTA 2GOKA 2POZA 4D8ZA 1OJXA 5M2FX 3P81A 1U83A 1G67A 5F7UA 1XIGA 3GSMA 1JF6A 3SCTA 1IE7C 3QFEA 3WF2A 4GNVA 1NY1A 4LV9A 1RJRA 1PSCA 4DIAA 1ZBWA 4JICA 3MKCA 3QC3A 4H9VA 4MJ4A 4UQEA 1CBGA 4FX7A 4HPGA 1W1B1 2VL4A 1X6LA 4Q7IA 3GG7A 2X1RA 4EKJA 4GI6A 2ZRYA 4QDMA 4KBXA 1LQAA 2C7FA 5JBEA 1QI0A 4PUMA 2J27A 1DL3A 1E6XM 3FFSA 4L65A 1M7JA 3T08A 1IT7A 2CESA 1YDOA 4ZB0A 3ABXA 1X7IA 1XLGA 3MMTA 3KTSA 4EWJA 4IPPA 1DJHA 1TWZA 2J9ZA 3ARRA 3BXWA 4RX0A 1XS2A 4PA8A 3T8LA 3ATZA 1UA3A 2WCGA 3PZOA 4NX0A 3WNOA 1LLZA 3U2EA 1F3XA 1R3VA 1VKFA 4W8AA 1KCZA 3W85A 4FLRA 4WSJA 1HN1A 5C9XA 2Z27A 4KF1A 4ICNA 4GFIA 4RW5A 1RP9A 4UMCA 3QLLA 2VEPA 1F4HA 1SO6A 4NXSA 2REQB 3KVJA 4LUSA 1C29A 1CXIA 3NEHA 4B2DA 3WH6A 4PMUA 1UASA 4NZJA 5BRQA 4A3HA 4Z1YA 2GUBA 2XZ7A 3MA8A 1YW1A 1XR2A 3HPAA 3EOOA 1MZHA 1TJ2A 2IXUA 4XAPA 4XZNX 3M5VA 4GUIA 1SM9A 3PB2A 1CX9A 4HJWA 3ZJ7A 3FJ6A 3V75A 4IMCA 4JDYA 1LJYA 2YGYA 3KP0A 3RRAA 1LF1A 1EGMA 5BW6A 3OGVA 1GG1A 1HNYA 2H9AA 4Y9OA 2YL8A 3GUWA 4P2VA 4GE8A 1DWHM 1JCJA 3S2JA 4C6FA 2D0HA 2PRMA 2FDSA 3N9SA 3VNZA 3W7MA 3G0UA 1JYXA 3BJSA 1NDZA 5IBXC 3DUGA 4LVBA 1OZQA 2W27A 4JL1A 1EP1A 1LM1A 3OZPA 3K8MA 4CNPA 4EACA 3PAJA 3MSRA 1Z9AA 4K8HA 2R1LA 3CUIA 1Z3NA 3MO7A 1ISWA 2VR2A 2VO5A 3DH7A 3T55A 2RH9A 5A6JA 3C56A 3MCMA 4NY2A 4DY1A 4L1GA 4B5UA 1NDYA 2OYKA 3PF3A 4WVXA 5HMDA 1FXPA 4JQ1A 2PWVA 3CJPA 1XUUA 3KS5A 4A21A 2Q02A 3TJXA 4HCDA 3L5AA 2E40A 3EZ4A 1Q2SA 4KWOA 1G4EA 5C2XA 3W83A 1KGXA 1R8LA 4BF9A 3UY8A 3GLCA 4PC8A 4Q6XA 3C2RA 4H1ZA 2WPGA 2ODOA 2QHAA 1EP2A 5CKSA 3TQKA 3B8TA 2BSLA 2DQWA 2PTXA 5D2TA 2JKPA 1JQXA 4GJIA 3IRSA 4AFYA 5HNRA 1FP9A 1JI1A 1U5VA 3TYAA 1VS1A 1ZBVA 4YWIA 1M68A 1X1OA 3VUPA 1LLOA 2B7PA 3UG3A 1FWTA 2GLKA 2YOCA 3N9KA 4Q8MA 1VF8A 4HN4A 1HP4A 1VBGA 4C90A 2BY1A 2SFPA 3BC9A 1V51A 3OHMB 1SSGA 4MGGA 1GQKA 1IXNA 4R7WA 4XIMA 1XIDA 2VR5A 5CC5A 2PTZA 1YX1A 1TUFA 5C54A 1F8MA 3RO8A 3P82A 4MAVA 4X60A 1VEOA 2J9XA 3CQHA 4Z08A 3U7VA 4PUDA 1W5NA 3P8IA 3OVGA 2E9BA 3NQ2A 4EX4A 4MM1A 2OT1A 3S6DA 1ELSA 2JEQA 1K9EA 4DJEA 4D1IA 1L6FA 2G3NA 1RQHA 5K4XA 3W26A 3ABSA 1EKOA 3LEPA 4M7SA 2Y24A 3G6MA 1M3UA 3UU0A 5T26A 3FVMA 2CEQA 2OO0A 1AL7A 4QS6A 1Z89A 4U33A 2ALRA 1K8ZA 5JIPA 2YL6A 3SJ3A 2AGKA 2QPSA 2PDIA 3TC3A 2DPEA 2CPUA 5U4NA 1J9YA 4P7LA 4JS3A 5D4YA 3SCRA 5FEPA 2V67A 1CGXA 4YPJA 1F5ZA 2OZ0A 1IEIA 4U2YA 5HA7A 2FZBA 4HVXA 3QHOA 5HUOA 2DZSA 4M24A 4JD4A 2BY0A 3KBWA 4O16A 3VD5A 5F2IA 4GQGA 5HQEA 3CEPA 1HJVA 1TPUA 1R2TA 4KWVA 1OX4B 2BHUA 4GZIA 3MWAA 1HX0A 4A8RA 2CLPA 3CAWA 2YA1A 4DO6A 4JFTA 3WQ4A 5CPLA 3VC5A 1UQYA 3TNOA 2C6QA 3KTXA 1VD6A 3TWAA 1Q7QA 3T2PA 5AVNA 3LTYA 4BQ5A 1A0DA 1G4TA 2A6LA 3N2TA 3GC4A 1XYBA 5H91A 4AY1A 1OIFA 5HBFA 2PTYA 4XX6A 3W02A 3LM7A 3SFWA 3QOMA 2YW3A 2FB2A 4HBKA 1F9CA 2OMAA 3GG1A 4KCVA 4HTBA 1IR2A 1PYMA 2GYIA 5G2HA 3RN6A 1LYXA 4IGMA 5HJXA 1HJQA 3CO8A 1TV7A 2DZXA 3BCJA 1Q65A 4OKDA 1UWTA 1HGYA 1EHNA 1R3QA 3PANA 1XSJA 4PULA 5AHFA 1QDSA 2XFWA 3ONCA 1FOBA 4ZCWA 4C6JA 2A3BA 2FZ9A 4AISA 1FWDC 1VFUA 1RQEA 3MUCA 2PCQA 3V1PA 2ZC8A 1JXJA 1PWMA 3SIMA 3WBXA 2C18A 1UWSA 4R53A 2E4TA 2EG6A 4O12A 4UFJA 4LS0A 1QJWA 5I3JA 4YWSA 1NP2A 4KQNA 1DV7A 1TWWA 3B9OA 1PTDA 5CPTA 3NR0A 3IGUA 4D71A 4ACZA 1E0UA 2OLHA 2YXOA 2ACSA 1A5LC 3MHGA 1FWEC 2DIJA 2G3MA 3MW7A 1QUMA 1ZRQA 4QG8A 4C6BA 1CGVA 3OU8A 3VDAA 3Q37A 1XLEA 1OCBA 4D6JA 1UP3A 1LLWA 1YXCA 3VNKA 3ITTA 4LUTB 2DZPA 4D8LA 3L68A 4UQCA 4AZIA 3ES8A 1F6PA 1QBBA 1KGWA 4J4KA 4Q7NA 5GVJA 2BXVA 2WM1A 1HL9A 3UW6A 1H1YA 1OHLA 1JDAA 4OGZA 3U6WA 3ABOA 4I9TA 1GPFA 3RPMA 3TZNA 4PTWA 1BKSA 1FBAA 2GPTA 4DF1A 4DLMA 1DIDA 3WF1A 3MWCA 4M0XA 3TJLA 1GEHA 4FA3A 3A64A 1XLIA 3VDBA 1UKSA 2JF7A 4GY1A 2UY5A 5HANA 3BGJA 1JPDX 3BCFA 4JTJA 3OA5A 3MVTA 4IIGA 2PE4A 2NQJA 1TZ7A 1JCXA 1XC6A 4IIBA 4M19A 3U5YA 3BL3A 4C7FA 4LX4A 3C2FA 4UOJA 4C6DA 4QNEA 4QLKA 3DDMA 1OFEA 1CLVA 1V02E 2XISA 4J3UA 3FHQA 5A2BA 3K2GA 1OFOA 3AIVA 3WMCA 4AZ5A 4ZQMA 2VM8A 3F5LA 3T44A 3OIXA 4ALDA 1C7SA 3VUSA 1M7OA 1V0LA 4ZE5A 1O60A 3F4VA 5DFAA 5AHLA 3FXGA 4TOQA 3W2NA 2HBXA 3M64A 4QFUA 2Z6IA 4MY9A 3W81A 2XZ9A 2BVDA 4YYFA 3BLFA 2XVPA 1TJRA 2WHLA 4E2DA 4Y7EA 3G3DA 3FSUA 4CD4A 2QCDB 4O0KA 1VC4A 1KFEA 3IGSA 2OOFA 2VJXA 4IICA 3DENA 2VFFA 5KINA 4GVGA 1OM0A 3S9ZA 1I2NA 3W7LA 1RJQA 4B92A 1E70M 4PYSA 4OHQA 1KKOA 1IEVA 1K03A 5D2WA 3FV9A 4PFHA 1B5TA 5CZ0A 1BRLB 3SUVA 1GOXA 4XK2A 2DZVA 3CTTA 3SUTA 1B4KA 3GR4A 1K7EA 2XPKA 1B3OA 3THDA 1RPKA 3PUEA 4YTRA 4WJEA 4KIRA 4NXKA 2X1TA 5C7HA 1PKLA 3P3BA 4XISA 3T0DA 2YSWA 3E0VA 2C0AA 3WQFA 3VGDA 1S39A 4MWAE 3BAKA 4HU4A 3SCWA 4DJDC 1GZGA 3EPNA 3M6YA 1OYAA 5J04A 3T09A 4UTWA 4BQ3A 2FHBA 3U0HA 1OFPA 4BWLC 2WKJA 1UR9A 2CU0A 1FX6A 3AS2A 5MKGA 4OBTA 4S3AA 1WDQA 3TONA 3OLDA 1UR3M 3PUDA 3SRDA 3S0CA 5CLTA 3CYJA 4Y9NA 5I3HA 4L4OA 3U48A 3LHTA 5D09A 4CQBA 1XG3A 4DB7A 1DJXA 2Z4GA 3WY1A 4Z1AA 3MVIA 4AIUA 3T0TA 4JFVA 4UC5A 3VNDA 3IAPA 1XCXA 2CLLA 3LUTA 3CH9A 3VIKA 1YMYA 4O1EA 3VNYA 1E9YB 2OZ8A 2A1YA 1YDNA 1V93A 3P5ZA 1QI2A 2VHLA 4US5D 2J7EA 1RVGA 1YHTA 3LXCA 1FCQA 3EA1A 4WGHA 2OO6A 2C13A 3Q65A 1GTEA 1FA2A 2XH4A 3IVUA 1Q6DA 3CLWA 1FY6A 3VOHA 3HG2A 3WQ5A 2DIEA 4Q4PA 4XZLX 1K9FA 3IVTA 3AUJA 4XTDA 3ZVIA 4ENLA 2PGFA 3GNDA 4D6IA 2PCEA 1TCDA 4LEFA 3UERA 3N6QA 4ZODA 2G8ZA 2R91A 5FIPA 5F2LA 3WLHA 2AAMA 2EJ1A 4ICMA 4QBXA 1UKQA 5JMUA 2ISSA 1B3YA 5G5IA 4AF0A 4GXWA 1J5TA 5CBIA 4S38A 2OEKA 1W5PA 1S5VA 4BZYA 5XINA 2OWXA 4WCJA 3RCMA 1JGMA 3CLMA 2WZTA 4H04A 3LG3A 3H70A 3AMGA 2RDTA 2RGLA 2FVMA 3RM8A 3FY1A 4F2BA 1YLVA 2OZ3A 3PFMA 3W72A 6XIMA 4YN5A 4FALA 1NAL1 1V4YA 2IUZA 1IT8A 2DQXA 3CIVA 3JS3A 3TJ4A 4NHVA 1XIIA 3WMLA 4BJHA 4L1WA 2P3ZA 3TTSA 2G37A 1QHPA 1TUXA 1Q4WA 2E77A 1XYLA 4XD3A 3ZLHA 2GVLA 2OG9A 1FP8A 4S2BA 3EAUA 1A4MA 1TMHA 3BLKA 3QZAA 4GBDA 3W87A 3UGRA 3W4RA 1TREA 1D7KA 1AZ2A 1P4CA 3VIOA 3F4WA 4PCNA 1PB0A 3ALGA 1X8CA 4FEZA 5CC7A 2PWFA 2QAFA 1EH9A 3LQLA 1EO7A 2WKLA 4AYSA 1H3GA 1XFCA 2F61A 3R8GA 1AA1B 4LYQA 4LALA 4Q4QA 2XGIA 1YIXA 4XAGA 1G6CA 3G1VA 3RFAA 5CPQA 1X98A 1LQ2A 4EANA 4IPIA 1JQVA 4RKAA 3CIWA 1DJYA 4B5TA 1J0KA 4H9UA 3H53A 5IDIA 3M7SA 5TIMA 3A9BA 3FAWA 4FF7A 3A9IA 3KP1A 5I02A 3TCSA 3W76A 3I3EA 2G96A 2D24A 3W75A 2ACRA 3GZ3A 1M04A 1IZJA 5HOSA 2YYUA 3VOGA 1C3FA 2I9UA 3N34A 5AHEA 1EC8A 3POCA 4HSNA 3GG0A 3DI1A 5EPDA 3NAVA 3IIOA 1KRBC 1W2PA 1U5JA 3MTWA 3UR5A 3W1QA 4P8XA 1GOMA 1IWAA 2ICSA 5FL0A 3T07A 4QQ3A 1SO5A 3KE0A 4H9YA 5LA0A 3UNTA 1BHGA 2DT3A 2YZ5A 5D9OA 2J77A 4K7YA 4FX6M 1YADA 2ANUA 1DE5A 4NNBA 3IJ9A 3QH2A 1WX0A 3IGXA 3HN3A 4XVEA 4F2TA 4L80A 5CAHA 5AVHA 3AOFA 3W7EA 1V03A 3ITXA 2VKZG 2IMRA 1DQUA 3WN6A 5AZ1A 4AXNA 1JR1A 2IQ0A 2R14A 2AL2B 5CZJA 1TG7A 1J0JA 5XIAA 4HNNA 1GEQA 2BBFA 3K4AA 2OVLA 3WNKA 4DJEC 2TYSA 3EWDA 3ZT6A 3S1VA 1AW5A 3CB8A 3LS9A 3T1GA 1ITQA 2Y7FA 4XD6A 2VGGA 2WMGA 3NQCA 1MW3A 3WUGA 1WV2A 4QGCA 4QTGA 3NVTA 3BLDA 2NWRA 4LXFA 2CETA 3QYSA 4IM4A 3KRSA 3SEPA 1B2YA 3L23A 3GHSA 1E9LA 1ZUAX 2QV5A 3W53A 4IP4A 3WBEA 3AZTA 1DHPA 2YL5A 1GOQA 1T6MA 2BZNA 1W9BM 3G8EA 3FJNA 2PRHA 4AD0A 1PX8A 8A3HA 3BLEA 4DQWA 2GQ8A 4F0RA 4IHCA 5DRIA 5I06A 4LAOA 2DUAA 3WLOA 1WP6A 3KL3A 1A3HA 2QDDA 4LUIA 3RX2A 1TWDA 2O56A 1OYCA 4AQLA 4Z42C 3D0CA 1ME9A 4O53A 5ABEA 4LYKA 2OQYA 1NELA 3A22A 2PU1A 2YDAA 3OLEA 4XKYA 9RUBA 2WZHA 2DZWA 1JDFA 3GDTA 4YTTA 5HPOA 3TX9A 4DUXA 2ZRXA 1H1NA 5G4EA 3G24A 2FPYA 3WEZA 3S5YA 1F74A 4R7JA 1QR7A 1EYWA 1E9IA 2D3LA 3DCPA 4ZTXA 3BGAA 1NQKA 3A3HA 5DT5A 2I1OA 3O6YX 3KL0A 3Q58A 1VPXA 4Z2IA 3WEOA 3CTLA 2J7CA 2GK1B 4UNLA 3ZT5A 4AG0A 1L6WA 4JNYA 4L6OA 3TXVA 1JAEA 2L5HA 3OZOA 1JFHA 3TWBA 1IZCA 3HTWA 2V5CA 5C8BB 4JY9A 5AB3A 1LCOA 3KFTA 4V15A 4MKVA 2CYGA 4C6EA 5A6SA 4ZXOA 4WUIA 1ZENA 3IJIA 1US3A 1ISXA 4Q4SA 1HJXA 4GISA 1VP5A 3CS2A 4V27A 2BTMA 4RUBA 2PDFA 4NRSA 1TPFA 4S2CA 1A3XA 3BLOA 3SAZA 5C0QA 5DO8A 1BLIA 1E4LA 2Y70A 3G1XA 3QSRA 4NIRA 3TUUA 3KRZA 2I5IA 5AY7A 2J66A 4EVZA 1VFSA 5DT7A 3VABA 4RE0A 1RR2A 1O7AA 1BAGA 4AWSA 5A5WA 1W1PA 1XIMA 2Z2BA 5I7GA 1VPQA 2GL5A 4CNTA 3H7RA 2ONEA 1JDCA 1Z42A 1WBHA 1KTCA 4J35A 5FJOA 1I1XA 3A6OA 4LBUA 3E9AA 4FXFA 2W6RA 1VH7A 1FWJC 1KRCC 3QKEA 4XB3A 1I45A 5CAKA 4L9ZA 4P7NA 3W1XA 1V5XA 5D2XA 3G1DA 4QX4A 4RZ5A 2Z7GA 1W31A 2NW0A 3NZ1A 3PY2A 5AFDA 5A6KA 3ZM8A 4FX8A 1CGTA 2YBUA 1XIBA 2DJXA 2YL9A 3LYEA 4M6UA 3WJYA 1RBOB 4EAMA 1HUVA 5A6LA 5F1UA 4NAEA 3ARSA 3FKRA 3LMYA 2VFHA 2VVNA 5CPSA 1H2JA 1V7AA 3ONBA 2E6DA 3V7PA 2VR4A 2AGTA 3WQ8A 4AZ7A 4UTIA 1XGEA 1JPMA 1ZFJA 2OOGA 3SCUA 3B0YA 1SW7A 1GCYA 4Z0SA 4ZE4A 3C52A 4WKFA 1GHRA 2DZBA 1EJTC 1PTAA 1HJWA 3CUHA 3I4EA 5CGQA 5AOUA 1VYRA 3W22A 3FYYA 2FPVA 2QZRA 4X3ZA 2FKPA 5D03A 4GZ7A 4L6HA 4K2SA 1TQJA 3W6LA 1VB9A 3ZJ6A 3NL6A 3NUKA 3SADA 1OFRA 1UROA 3KBNA 4IGSA 1W0MA 2GWNA 4HNLA 3E5PA 3GVGA 1KBBA 1ICSA 2IS7A 4GO8A 2GOUA 1M65A 3OVRA 4MB3A 1UR0A 2OYLA 4DWSB 3SRKA 1FQ0A 3CWHA 1XYMA 1TJ1A 2GJRA 1Q63A 2WZEA 1L8PA 1WDPA 3MBFA 1ZPTA 2WSPA 3AHYA 2ZZ2A 4AW7A 1ENUA 3E0IA 1ME7A 2AQVA 1EOMA 3P0WA 4ZQNA 3BSGA 3C2OA 3XINA 5IM51 4TX6A 5ENLA 4TR9A 3B8SA 3DFPA 4WR3A 4GD0A 2INEA 4K7VA 3TTQA 5E9XA 3QPZA 2GQAA 3GFXA 3VD4A 3CUFA 4DO7A 4EPEC 2W5FA 1WXJA 3SI9A 1XLCA 1XYCA 4W8BA 3MJYA 3VFCA 4MAZA 4UTWC 3S5SA 3HPZA 4GYFA 2Y4SA 3CV6A 2OX1A 1XLKA 2NVDA 5AECA 1BSIA 4L6DA 1GQJA 1T41A 5REQA 5XIMA 3WG6A 4GQQA 3I7SA 3ATYA 4S3BA 1GVYA 4PODA 1TV4A 2J79A 4MYXA 1H7NA 1KM1A 1F6YA 4DWDA 2Z25A 4K6AA 2WJDA 3KBSA 4PTXA 2NX9A 4O13A 2NSOA 4JBRA 3O3RA 4WF7A 1LORA 1A49A 2YCLA 4WJ8A 4E6MA 4INFA 3F03K 5E1QA 3ZR5A 3CASA 3DBNA 1TTJA 2VGFA 1ZAIA 3OBEA 2QDGA 4OJYA 1BTMA 3GQYA 4RLIA 2ZUUA 3UZ5A 2Y7DA 2HK1A 3P7YA 1HKKA 4HQVA 3D3AA 2RKXA 3H26A 2I14A 4DWSD 1MNSA 4ZTYA 1MFUA 2Y5JA 2ZCGA 3IIXA 3E2QA 2I9EA 1B4EA 2A3LA 2VWTA 3RG6A 3NQVA 2ZE0A 1DQWA 2NT0A 1CENA 4LBSA 4JQAA 1B30A 1XP3A 2R6OA 4QS5A 3CHCA 3CPGA 3S1WA 5HR6A 3ELFA 4HU3A 4W87A 2P8BA 2VOTA 3KS6A 3W28A 4MF4A 4YU1A 4AAJA 1C90A 1AJZA 3ZLGA 1GVOA 4ZO6A 1PZ1A 2YKKA 2ZUWA 3PJXA 1DBTA 2FHFA 3Q2DA 8XIMA 2D2OA 2NV2A 5H1WA 5LA1A 1TPEA 3QTPA 2PP3A 3T40A 5JBFA 3VYLA 1K9DA 1JZ8A 1FDJA 2OELA 3R7MA 4C6QA 2VX4A 3HB9A 3J7HA 5DBUA 4BS0A 5I09A 2QF7A 2HNHA 4DBWA 3RF9A 1TKKA 3RCNA 2JEPA 1ESWA 3SQSA 3M5XA 4ZENA 3NM3A 4RPQA 3HG4A 3GHUA 4JKLA 2V81A 2WM0A 1LUCB 3ITVA 3LGGA 2NQZA 3BW2A 1QU4A 4C1NA 1CEOA 4JEQA 4GACA 1XUZA 3AIWA 7ODCA 4HK7A 3WLKX 3L4UA 3W27A 2E68A 4UTJA 2WQDA 4L4PA 4XAYA 4GY0A 4AIEA 3F7JA 3SSZA 4MPKA 1O66A 1X8FA 2Z24A 5DMYA 3NCOA 3EMZA 4WHBA 3NPUA 3E02A 3BARA 3POHA 3M47A 4I9JA 3TYEA 2PDUA 1SFTA 3BQ6A 4AHQA 3UPWA 3TYDA 4X61A 3CYVA 4LNYA 4OIFA 2PF8A 4A8NA 3EWUA 1JF5A 1MMFA 4GH1A 3EPMA 5BNKA 3PWGA 3C6CA 2GJLA 1G7UA 4N7QA 3TYBA 3R8HA 1QWGA 2WVSA 4ATWA 4O50A 3QGAC 3H7VA 4MADA 2QNEA 3ABQA 1KTBA 2NX1A 1QMLA 1KLZA 3BQ5A 4AC1X 4NNAA 4UMBA 1Q6QA 2G4JA 4LRSA 1RAKA 3N18A 4LC8A 1B3XA 2QPXA 5I3FA 4UXDA 2Z26A 4JYFA 1QHOA 5CZTA 3WLSA 3URQA 4JGDA 2IQDA 4F66A 4IPLA 1A0EA 2ZXQA 4D8AA 4JXCA 2YLLA 4H83A 4LBRA 1KM4A 1FRBA 5FJRA 4EK7A 1LOQA 1NP0A 2PLJA 2YDRA 2V6AA 2XJ7A 1Q4NX 3VX0A 3VCCA 3GK0A 4L61A 4UQ9A 2QLYA 5CSSA 4ZVJA 4RDZA 4GJ1A 4RDWA 3N2MA 3N13A 4GPNA 4PMJA 2Y7GA 4S3CA 4DZ5A 4W5ZA 2R94A 4HK6A 5DCEA 3VKDA 4DN1A 3G5EA 2XWEA 2RHGA 5AC6A 2UV8G 3EKGA 3BUVA 3AICA 1E73M 3U2ZA 4HSHA 1WUFA 7CGTA 1HKVA 1P1XA 3A3WA 3WNNA 3UEQA 3VNLA 2NV9A 2TAAA 3IUDA 2V2HA 2C1HA 2PWUA 3V4BA 2J8TA 4OBRA 3PBWA 1VR6A 3PZ9A 2FIQA 2OEJA 3GBEA 2YBTA 3HPSA 5TBOA 3OGSA 3AMKA 3VGGA 4AWTA 2R1MA 4IXXA 1CLKA 4B5NA 2PUZA 3ISIX 2YR1A 3WYZA 1PKYA 2B7QA 4LQ1A 3ALFA 1A5NC 2Q3RA 3TSBA 4CNNA 1N82A 4GBUA 2ZA1A 2P8CA 1UWQA 4Z2GA 4Y6GA 5RUBA 4LPCA 1EIXA 1O68A 4GVHA 2HPIA 5K7JA 1VIWA 3BOLA 2O0TA 4FLSA 1JCYA 3ZQ9A 1I2PA 3HIJA 1BG9A 4H9ZA 4RJEA 5L6UA 1KXVA 2ISDA 1VENA 1H7WA 4J3TA 2GUUA 2HS8A 4O0QA 4O1BA 2DSKA 2V2DA 5EFFA 1JNDA 3O2LA 1LBFA 1OY0A 1KM3A 5CSYA 1YEYA 4ZR8A 2ZUMA 4Q8VA 4MWAD 1GK8A 1UJPA 3MY9A 2WBKA 3MP3A 3C3UA 4PCFA 1E15A 4W7WA 3EB2A 4GY7A 3NEVA 3PG9A 4UBPC 3P62A 1IIHA 1ZLPA 1TZ9A 3DC8A 4LJ3A 4NYUA 5J5DA 3PZTA 1XYZA 1O94A 3ZZ1A 3LLFA 4WQ6A 1IGWA 3SR7A 2WQPA 1JNEA 5E9AA 4H7ZA 1F4AA 1SW0A 3TFXA 3AALA 2WAGA 3VD3A 4HOXA 1OC7A 1G0CA 4GG9A 4IH3A 5C55A 4XZIA 4XZBA 2PDBA 2YW4A 4GQRA 1YBQA 5CZKA 4HMEA 4C5YA 5FF7A 1VFOA 2XH0A 2G3JA 3GM8A 2G3IA 2RUSA 1IF2A 1FHUA 4K8EA 1F73A 1VHCA 8XIAA 3TNBA 4LB3A 4YLWA 1AD4A 3ECQA 1U1JA 1RH9A 3WBWA 4NAFA 2PMQA 5F2MA 3F2BA 3XIMA 3EBVA 3L0KA 5LIXX 4QNWA 5BMWA 2EF9A 3T2QA 2ZE3A 5EMLA 3IACA 1AUSL 2G41A 1TTQA 3LA4A 3EMCA 1KFLA 1V6WA 2CZFA 3DX5A 1V02A 3TTEA 1UR1A 3APYA 3VVGA 3IV8A 4IWWA 3RJXA 4JX5A 2WMJA 4X2RA 3DERA 4OV4A 2VNCA 4H19A 7TIMA 3D6NA 1W32A 4F9DA 1PX3A 3AXHA 2E09A 1XKYA 4KRZA 4R5EA 3L4XA 4LVAA 3QPYA 4X63A 2VZVA 3ENLA 3KRUA 2VDGA 3VIIA 2WZIA 3KCOA 3F5JA 2CBVA 4H9XA 1UR4A 3T2OA 1PDYA 1YTEA 3G1FA 1Q85A 4G56A 4LUJA 4BA0A 2GVJA 4MPQA 3IV3A 3NTYA 4FS9A 1BXNA 3U2CA 1P0NA 4JFUA 3M5YA 4KGJA 3W1LA 3SN0A 2HXUA 3CUJA 4GXPA 4O19A 3U9IA 3WK3A 2GGEA 1DTUA 5LNRA 4RPPA 2FTPA 3LRKA 3QKZA 4UTHA 1EGZA 4XAFA 1EHAA 1Y7VA 1UP2A 3K1DA 4QG9A 1BPLB 1R2RA 3RILA 1QPNA 3P61A 1KC7A 3FDKA 3F5KA 4ROPA 2RJGA 4GA8A 1QPKA 4NZCA 3QGKC 3BH4A 3CM4A 4NP7A 1ODZA 1XRVA 4B15A 4KIEA 3SGGA 4QDPA 4MWAA 1DP0A 1OFBA 1PPIA 3G77A 1EUAA 4YXGA 2HVNA 4I7VA 3BSMA 2C15A 3UFYA 3W70A 2HDJA 1I4NA 3OB8A 3W37A 2DVXA 1FFQA 3CZGA 4HIBA 4RR4A 3OGRA 5I5RA 4AVOA 3AXXA 2PLMA 4JCLA 3QMRA 1KBJA 2IPWA 4PMVA 3PZGA 2JKEA 1KGUA 5DXYA 1YTDA 4UTKA 5EB8A 5EBAA 3REQB 4J2PA 4TV6A 4IFKA 3OZYA 4F0HA 5FAJA 4OV9A 1DORA 3A13A 1BVZA 1Y5XA 2FDMA 2C91A 3PZIA 2GJXB 4NZ1A 4X9YA 4H6RA 3GTIA 2QT3A 4QSHA 4LF1A 3LZ3A 2Z1BA 3FOKA 4EE9A 2INFA 3BAIA 1HP5A 4ZEPA 1ZSXA 1UWRA 5HPCA 3LCLA 3E6EA 3W7IA 1TPVA 2PDNA 2XN1A 4ML9A 2QJHA 3MV01 2WLZA 2B7NA 2HISA 4C7DA 3ARXA 4U5IA 1T7LA 3M0MA 1LT7A 2WJEA 2FH8A 4FSAA 2Z1XA 3SB0A 1GONA 3NQEA 2OU4A 1TR9A 1Q7ZA 5DMLA 3NSXA 3CZJA 4AB4A 4P8UA 4E2OA 3NZPA 4PL2A 3UJFA 1EWEA 4ACYA 4IG2B 5F1VA 1E43A 3TIMA 3WQDA 1E1FA 2A0NA 3VDGA 4JKKA 4I8YA 1J93A 2Q8LA 2X30A 1WDSA 1XLLA 4HZMA 3M0JA 4PMZA 2HE8A 3FXYA 1CWYA 5FD0A 3LOTA 4D6EA 4R34A 4C91A 3QF0A 3BLLA 1OVDA 4C6LA 2PAJA 3HGJA 4RNFA 5CSUA 2CITA 4FXRA 4W4QA 3TAKA 1V79A 4WY0F 5HATA 5HWJA 1U30A 4PSRA 5BROA 4FLOA 3LTSA 1HJSA 3IIVA 1GOOA 3BMVA 5FF3A 3QTGA 1C9DA 3G18A 4O10A 5CGMA 4CUCA 1EXPA 1XX1A 3ITCA 3CBWA 2JIEA 3HFTA 2Y6ZA 4WSHA 3VIFA 2NQLA 3PBYA 3W6MA 1PEZA 3IGHX 1TELA 4L56A 5JXQA 1OD8A 5I0DA 4ZO9A 4FNPA 3QFWA 4L64A 4Y9AA 4PUKA 3CUZA 1XSIA 4N9EA 1WAUA 4O11A 4AD4A 1F3TA 1TMQA 3SY1A 1GKPA 3K8LA 2VRJA 4QM1A 1PKMA 4GGHA 1Q6LA 3KM8A 2HJPA 4XO7A 1TO3A 2X05A 3HBLA 1M1BA 3OIHA 1PVNA 3V5CA 2NXIA 1LG1A 2J78A 1R46A 4M3PA 1SR9A 3WCZA 4MFDA 2B0MA 1RA0A 1ZCOA 4Q7BA 2DUZA 3HGRA 4G9PA 1S38A 1JVNA 2PLCA 1O5XA 2ASHA 4AEFA 2FB3A 1AG1O 4MZ8A 3N73A 1BYCA 3ITGA 3QJAA 3FN9A 1LOLA 3LHZA 3UWUA 3UR2A 2R1NA 1W9UA 2C14A 4C1LA 1GJUA 1KM6A 1ECEA 3NNTA 1YKWA 4HOZA 5A6BD 2PGWA 4R33A 4V1YA 1JZ6A 1XLMA 5CZSA 1EPXA 1GTHA 1UMYA 2VEMA 3DAQA 1ZZMA 3B06A 1KR0A 3RYSA 2GQ3A 8TIMA 1FWHC 3VKJA 3CEUA 1I0DA 1OFQA 2IPJA 1E6SM 3S46A 4DO4A 1J0YA 1DWAM 4CU8A 1VAHA 4ADSA 4QRNA 4RNJA 4F4RA 4RL3A 4ZMGA 3BOXA 2BY2A 3B4UA 4RV3A 1SJBA 4D72A 3CZKA 1OEPA 4WZHA 1SZRA 2GJNA 4CEXC 2W4XA 3NOYA 3STGA 4DBDA 3CO4A 1RK6A 2AMXA 5KZMA 1EXBA 2PGRA 1GVEA 2D69A 3GVQA 2W66A 1F7BA 1OZMA 4PR4A 2B4GA 3R94A 2XFYA 3RR4A 1E3XA 3QMSA 3AU6A 1LDCA 1Q6OA 3VO0A 4LCRA 1JUBA 1EPVA 4MB4A 1KV8A 2JK2A 3QHNA 1W3NA 3GXPA 3ZR4A 3HZ3A 3QOKA 5IHSA 5E6YA 3R8RA 3M1ZA 3WJXA 1UIOA 3EA2A 3LRMA 1X7FA 3W74A 2PDXA 4NI3A 1J6OA 2PBGA 1S1RA 3SM0A 1GYLA 1XHGA 1XPYA 2VFEA 1O95A 1N8FA 5C9UA 2BGSA 1GWJA 3RLVA 3GXDA 4PH6A 3L5LA 3AXIA 3IRDA 1XKJA 2C8NA 3PR2A 4EOUA 2D0GA 5AYXA 1WZAA 3NGFA 3VZXA 4DAIA 4JQ3A 5A8OA 2CIPA 5IHRA 1TQXA 1XH0A 5IXEA 4H41A 1JRBA 3JW7A 3CPRA 1SYTA 1OFAA 1J01A 1Q6CA 2DJLA 5HWMA 3OQ8A 1MQRA 3TP4A 2A4AA 3ARUA 3TOPA 3KCLA 1ZJIA 3WUBA 4WY0A 1QW8A 3FA5A 5FI8A 4LVGA 4OZOA 3GR8A 3W9ZA 1TR1A 3JR2A 3NA8A 2VC7A 1VBJA 3RLGA 4MSSA 3SRHA 2A2IA 3WD1A 3MUIA 1LROA 2FTWA 3AMCA 3CK5A 3NL3A 1AK5A 3XISA 3W25A 4MJMA 3ZOAA 1S2UA 2WKGA 3AYVA 2AL1A 1AMYA 3M46A 1DXIA 2PD5A 1TSIA 2PP1A 2HK0A 3AS0A 3O6AA 4ONVA 3TSMA 2VT0A 1KR1A 4DNHA 4NRRA 1KV5A 3C8FA 4PEEA 2QAPA 3VDCA 3WD4A 4TX9A 3GNPA 3PPHA 1TA3B 3I4KA 1UWIA 4PSPA 3HG3A 1GVRA 4FHAA 1I75A 3MU7A 3CT7A 3E0LA 1JRCA 4JTAA 3WH8A 2IXVA 4TXEA 3S2MA 1MFVA 4S23A 1ME8A 3FVDA 3IAQA 1TVLA 1SGJA 3EXTA 3E2SA 4IT1A 2OWCA 3UVIA 3R0KA 4WJXA 2HNEA 4MUPA 2BP1A 2FPTA 1RZMA 2WMFA 2ZICA 3DFSA 3B9NA 4E2BA 3UCQA 1QK2A 4W86A 1B1YA 1LL7A 4HNUA 1AH3A 3C2VA 3T42A 3YPIA 4HZ8A 1H63A 1W9PA 5DCDA 2O4MA 3LGDA 2EPHA 4H8VA 4UFKA 5GQBA 2QCEA 3GB6A 2JKAA 1KCLA 4PEKA 1E1CA 2VFIA 3WDQA 2FMOA 3NQGA 5FJTA 3N4EA 1OK4A 3BK0A 3DG7A 1K8CA 1HVXA 4YVVA