1BQCA

Beta-mannanase from thermomonospora fusca
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
302
structure length
302
Chain Sequence
ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHDHSDGNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (BETA-MANNANASE)
total genus 134
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1bqcA00
1NQ6A 2XGBA 4AZ7A 1LWHA 3ARUA 1JDCA 2VT0A 4NSBA 3RO8A 3PZIA 4GO9A 1TA3A 1UZ1A 2JIWA 1UD8A 3NSNA 4UZSA 2ZICA 3AMGA 1H4PA 4R5EA 3VU2A 4WF7A 2DDXA 1I75A 3MKKA 4D71A 1PIGA 1QBBA 1UR8A 1UD6A 4LGXA 2DT3A 4AW7A 5LA2A 3EMZA 3QOKA 4EANA 1ZL1A 3PBGA 2VZTA 1NWSA 4OIFA 2Z1KA 3PN8A 3SEPA 4IPNB 1UYQA 5I79A 4HOWA 3N17A 4CD5A 4CCCA 1XHGA 2O9TA 1OINA 3T09A 1F4HA 1GZJA 2XG9A 2XHYA 3II1A 1VFOA 4AD3A 2BNJA 1B9ZA 3OLDA 1XGZA 1E1EA 3LPFA 1J0ZA 1C8YA 1E6PA 4PCSA 3ARXA 1CPUA 3RDKA 1V3KA 1ZBVA 3CHCA 1LLOA 2ZOXA 1W1PA 4B3KA 1J9YA 3WFZA 1ISZA 1PX4A 3EDEA 1WZKA 1OD0A 2ZUMA 2J7CA 1UD4A 2BV9A 3PZGA 3G6MA 4LYPA 5IXEA 2FH6A 2E0PA 2JF7A 3AS2A 2VR4A 1NOFA 4RL3A 3S6TA 4ZE5A 4Q7NA 3RM4A 4DM1A 2VI0A 5JIWA 1CXHA 1OT2A 3MMDA 2VNCA 3AIUA 1B0IA 4M81A 4HOZA 2G41A 4V2XA 4CCDA 3WENA 3MMWA 3VVGA 1V6YA 3A47A 1FP9A 5BXRA 1CGVA 1QW8A 2XVNA 2YA0A 3UCQA 2WHMA 3VNYA 2ZX8A 1OWQA 1NOUA 3ARYA 1UUQA 4HP5A 1W2PA 1JFHA 5JBEA 1W3KA 1E4MM 4QLJA 1KXQA 3VINA 1UWUA 1MW0A 3K8KA 3B8SA 1JZ2A 4E8CA 1C7TA 1GQJA 1CGWA 1AQMA 1JF5A 4PBGA 4BCEA 4DWSA 3VDHA 2ZXAA 1JYXA 3MO4A 4ZFMA 1V0KA 1W9XA 3AQUA 1EHNA 1LL6A 3WMSA 1UH2A 3WMCA 1VFUA 4GI6A 1TVNA 4ZXLA 1CLXA 2Y24A 3THCA 2QMJA 4AC1X 2EPKX 4MB1A 1HKJA 3NUKA 3WMBA 1G01A 2WWCA 1H0GA 5JBDA 4B9ZA 2QHAA 1KQYA 5JBFA 3GH4A 1SMDA 2BXZA 3I3DA 1DP0A 3AMCA 4HZ6A 4P7NA 2VO5A 2WVVA 4P7LA 5LA1A 1MXDA 4OOUA 4U33A 6TAAA 2ZUVA 2GDVA 1AQ0A 5FL1A 3VIKA 3W6LA 2W5FA 4JKMA 2J78A 1EIBA 2WCSA 1AMYA 1K6AA 2BFGA 4TXEA 2VZOA 1JAKA 5A6JA 1QI2A 4PEEA 3RM8A 2IUZA 3L4VA 4J3SA 3UG3A 2ZX5A 3WSUA 2VC9A 3B9AA 1CIUA 2Y5EA 1V3LA 4HMCA 4UQAA 3OA5A 1HL9A 4M24A 1X6LA 3AIEA 3AMLA 3SUUA 1JZ4A 2A3CA 3NCOA 3OZPA 1GJUA 2XSAA 1TZ7A 5HXMA 2X8RA 1HJQA 1V08A 1BAGA 1WP6A 1GOQA 1NH6A 1J10A 2AOSA 3WF2A 2J7FA 2PWEA 3WQ4A 1OSEA 2CHOA 1XYZA 3BSHA 5E6YA 1IZKA 1VEPA 2UY2A 3UG5A 4ATDA 1GVIA 1H1NA 5A6SA 1JXJA 4W7WA 2QF8A 1UD5A 4GQRA 1VFFA 3L2LA 4E4PA 5I78A 3AZTA 1WO2A 1JZ8A 5GNYA 2GSJA 3VPLA 4J28A 4K68A 4DWSD 3OZOA 1KWKA 1V3MA 7A3HA 1BVZA 1WCGA 1BTCA 1E0XA 2ZXBA 5AYBA 1HIZA 1LJYA 2JALA 4FF5A 4HA1A 2ZE0A 3DECA 1MQRA 5LA0A 1V6WA 1VF8A 2ZX6A 4FLQA 3BCFA 1CBGA 3GDBA 1BYAA 2VRJA 3B9DA 3F5JA 2WHJA 3UESA 3N04A 4EK7A 3VMOA 3T08A 1BHGA 3GNPA 3GZAA 3NYDA 2WC7A 4AZ5A 4JAWA 3M6DA 5A2CA 4WSKA 5E70A 4JFTA 1KB3A 1W1TA 3WF0A 1ZBKA 1E6XM 4AZCA 3OLGA 1E15A 1TMQA 2EPMX 4GQQA 1JYWA 3MUZ1 3AYSA 2YL6A 2J7GA 4PSRA 5D8WA 3SCNA 2YA1A 1MVYA 3ZQ9A 4W8AA 3A4AA 4W85A 3L4YA 5A8MA 2Z1SA 4UR9A 9CGTA 1GQIA 5AC5A 2X2YA 2XFFA 4HZ8A 1E6QM 4AEFA 3PZMA 3ZO9A 1C90A 3VUPA 2OWCA 2VZUA 4AD1A 4MPKA 3WL0A 1X6NA 2GJXA 3KL5A 4HOXA 1W3JA 3W27A 5LYRA 1LF1A 2WZHA 4GZJA 3WNPA 4D6IA 5D9NA 3WH5A 1FHLA 2JF6A 3AJ7A 3WNOA 3U5UA 2WHLA 2XPKA 1GQLA 3W0KA 1W9BM 3D3AA 2UY5A 5KEZA 4AZHA 4MNKA 3ZM8A 1JFXA 4JIEA 4YN5A 3ZJKA 4UTFA 1VJSA 2GK1B 4D1IA 3LMYA 1B30A 1ZBCA 2J7EA 4JL1A 2G3IA 1GNXA 4TOQA 3UETA 4H04A 4D6CA 1E4NA 2G4FA 4KRTA 4BF7A 3ALFA 3OG2A 3WQWA 1QBAA 2JE8A 1PZ3A 3ZOAA 4J3VA 2BXYA 4D6HA 1G9HA 4ZE4A 1TFVA 3GXIA 1JI2A 2ZUNA 4IUGA 4MDPA 1Q6CA 5EFDA 1OM0A 1ISYA 2FHFA 1GOWA 3SCVA 3CTTA 3UERA 4Y7EA 4Q22A 3RCNA 3TTOA 1RD6A 3THDA 4WSJA 3WNLA 2WWDA 3TONA 2ZUUA 3RPMA 3CMGA 3WL1A 4HU8A 2C0HA 4QAWA 2A3EA 1UWIA 2PI6A 2CBVA 3L4UA 3AZSA 1P6WA 1UR2A 1W32A 3FAXA 1DWHM 2YDSA 3WQVA 1JZ6A 3G6LA 4RE2A 5FCZA 1RP8A 4DUVA 1E9LA 2BHUA 1MW2A 1V0NA 2BY3A 3VIFA 2DSWA 2X0HA 2WANA 3DHUA 3VGEA 1CECA 1WE5A 1RPKA 3RM9A 1GOIA 3CUJA 4UZUA 2C8NA 5M17A 2Q8XA 3CHDA 4GZIA 1OD8A 1W3HA 4Z2HA 1EH9A 3J7HA 2G8ZA 3MS8A 5IFTA 2D1ZA 3AIRA 3WDPP 1QHOA 1MXGA 2WYSA 2WBGA 4PRWA 2WW5A 3MUY1 3VMPA 3K8MA 4MB4A 4ZENA 2A3BA 4A3HA 3F4VA 5A3HA 3WD0A 4BQ4A 1UQYA 2D24A 2WMHA 4CVUA 4YHGA 1JIBA 4J3TA 2WLZA 3RJXA 3L4XA 3MV01 5EBAA 2WZEA 4CN1A 1OGSA 1M03A 5FD0A 1V6VA 4HA4A 1IT0A 3ARQA 2BS9A 2Y8KA 2CEQA 4S3JA 4W88A 1FOBA 1UD3A 3CBWA 1XC6A 3MMUA 1V0LA 3T0AA 1V3IA 5A6BD 4BQ2A 4UQCA 1TVPA 3FW6A 3T2QA 5DF0A 3RMEA 1JL8A 4UFJA 2GFTA 4C7FA 2RGLA 2WHKA 5A6LA 3VM5A 4Z2KA 3W25A 2VCCA 1Q6EA 2UY4A 1EOMA 4WKAA 1XRVA 2VX4A 3ALGA 6CGTA 2WCAA 4V27A 3WEZA 1V6XA 1GCYA 1TA3B 4IM4A 1B3XA 2DSUA 3QR3A 4CU7A 5CGMA 4P8UA 1C93A 1CGUA 5CPSA 4A3YA 3WH8A 1BYCA 3ZT7A 1HL8A 3AIVA 3QHOA 1F4AA 3WF4A 5CSYA 1EXPA 3W37A 2XSBA 3A4XA 4NF7A 2WZIA 5IDIA 2YLLA 5D9OA 1SMAA 4JFUA 1VBUA 2EJ1A 2ZUWA 3VKKA 1W9DM 3K4AA 2CBJA 2XWEA 4JHOA 3ZT5A 4PMVA 1M53A 1C7SA 1ESWA 1DWAM 4TUFA 5CPQA 1AQHA 2PWDA 4V28A 4WKFA 2BVTA 4PMQA 3NSXA 2QLYA 2Y4SA 4OKDA 3WBEA 2GJXB 5A8QA 2J8FA 3MUIA 1UKQA 4MDOA 5JUVA 1EO5A 1JXKA 2E8ZA 3AXXA 1ZB5A 3BAYA 4U5KA 2E40A 1CGXA 2D23A 3TTYA 1C91A 2TAAA 1W3LA 2DSZA 2XUCA 1B3WA 1KBKA 2PBOA 3W38A 3AIQA 4MAZA 4JFWA 3K1DA 3WH9A 4NRSA 4RE3A 4LYRA 1EQCA 2CBUA 4IPLA 3CUGA 1EDQA 4P7RA 3WEMA 3K4DA 3AOFA 1ITCA 1W1YA 2QV4A 4Z2LA 3WEOA 1KCLA 1KR1A 5GPRA 2W67A 3BLKA 3B9EA 2AAAA 4XZBA 4W89A 3W81A 5BXPA 1X1NA 1SFSA 2UY3A 1K9EA 3ARZA 2J77A 5IHRA 1S46A 1H5VA 2FGZA 1DTUA 3S2CA 4PTXA 1ECEA 3GXFA 5FKYA 1BVNP 5I2UA 2WMGA 5CGTA 3MUAA 5A69A 3WN6A 5A6BA 4TTGA 3ARSA 1OT1A 4N0RA 1ODZA 1O7AA 3TTSA 4ATLA 1ODUA 2ZUSA 5CLTA 5E0CA 1G94A 3IK2A 1OCQA 3ARWA 2WAGA 4GZEA 3BSGA 3VIIA 1D3CA 2D0FA 4FLRA 1E6NA 2E9BA 1OGBA 2WSKA 3POHA 3A6OA 1E4IA 3HJEA 5DEZA 4AZGA 4PMNA 2A3HA 3IJ7A 4HPHA 2BVDA 4X9YA 3A4WA 1OB0A 2WMIB 3NDYA 5DT7A 4AZCB 4YHEA 1WZLA 2VZVA 4CKQA 2ZX9A 1UR1A 1GHSA 1GONA 2V3FA 4ACYA 3SCPA 1BLIA 4CD6A 5E09A 3AROA 1LL7A 1EDTA 5AC4A 5I6SA 3KL3A 1EQPA 3GNRA 4CN6A 4DUWA 1UG6A 1SYTA 1CEOA 1WB0A 2YJQA 3WDIA 5M3WA 4WIWA 3UR8A 1US2A 5CXPA 1QNRA 4UNIA 1R86A 4N42A 3LPGA 3ZJ7A 2ZUTA 2HISA 4NI3A 4DUXA 1E5JA 3AS1A 1KXTA 2CXGA 4D1JA 1KGXA 4M82A 2X05A 4JKLA 4MNJA 3CH9A 5ABHA 7CGTA 2D2OA 4AWEA 1KXHA 3ECQA 3FXYA 4W7VA 1QI4A 5EFFA 3GTNA 4QCEA 1XSJA 1BQCA 4UFLA 2ZXQA 1PBGA 2VUYA 3ARVA 3CUFA 4U2ZA 4UFHA 3VMNA 5IHSA 3QHNA 4E2OA 1CLVA 2J62A 3L4TA 3F5KA 1E3ZA 4CD4A 2Y2WA 2FGLA 1XH0A 3VIGA 1FFQA 4MB5A 1H41A 2DT0A 2YIHA 2J7BA 1HVQA 5BWFA 1UKTA 2ESCA 1CTNA 3PTMA 2YL9A 4D6GA 1QNSA 1VBRA 2OYMA 1NM9A 2GJPA 3TOPA 3U7BA 1L8NA 4MAVA 3AIBA 3WIJA 1NARA 1RH9A 1UD2A 2XVLA 4PMDA 3MU7A 1Y7VA 2FHCA 4OZOA 4MADA 2WC3A 1GW1A 1LG2A 4QDMA 3VTRA 1M7XA 4IISA 1E4LA 3WH7A 1KR0A 2D22A 3ZIZA 1GQKA 4BA0A 1UR0A 4PTMA 2W61A 4CN4A 4KGLA 1HT6A 1GHRA 4UFIA 4W7UA 3PZNA 5I24A 3VD3A 3AMKA 3ZSTA 5DFAA 2VJXA 2F61A 3PTQA 1CGTA 5BXTA 4UQ9A 3KEHA 3CUHA 1ZBWA 3VGBA 4EKJA 3SCUA 1MW1A 3WDQA 1A47A 5A8OA 4UCFA 1I1WA 4DWSC 4TVCA 3AXIA 3T0BA 1UKPA 1EDGA 2EBNA 2DIJA 2QMKA 3CZLA 3BAJA 1HVXA 1HKKA 4QP0A 2XVKA 3KE0A 2EPLX 2XFYA 1B3ZA 1W9PA 1E5NA 3BMWA 3FNDA 4PMXA 2A3AA 3UEQA 8CGTA 2YL8A 3WD4A 1JAEA 1CZ1A 1OIFA 3BAXA 1V02A 2W62A 1B90A 4W84A 3VX0A 2DH2A 3W24A 3SURA 1I1XA 4H2CA 5DMYA 3MV11 2CKRA 1CWYA 1BYBA 1CXIA 1KBBA 2BY2A 5I77A 3WUEA 3NJ3A 2WCGA 1E6RA 4GXPA 2J8GA 3ARRA 2WMJA 1DWIM 1UR9A 4JCMA 4AZIA 1PX3A 1VRXA 1VIWA 2PWFA 3OLEA 1LQ0A 1MFVA 4OBRA 2NSXA 3CZ8A 1WDRA 5HPCA 1VB9A 5CJ5A 2WNWA 1UWSA 2WB5A 2J75A 3WDJA 1OIMA 1BG9A 3WUFA 3L4WA 2OSWA 5I23A 2ZX7A 1KGWA 4MJ4A 2NW0A 3L4ZA 1H2JA 4Z2GA 2FH8A 1JNDA 1W1VA 2PB1A 5BRPA 1GJWA 1U2YA 1TR1A 1MWOA 3N13A 5IFPA 4GI8A 3K46A 5CZKA 1E43A 2QPSA 4NZCA 5ABEA 1DHKA 4GI9A 3W29A 1H49A 2CKSA 3CZJA 1ISXA 3O6AA 4AIOA 4BQ5A 1R87A 3VDBA 2CERA 1DWFM 4WK9A 3N1AA 4GPNA 5CSUA 1UZ4A 1B3YA 3VGDA 1ISWA 2CETA 4U2YA 4UQBA 1BYDA 4J7RA 1HJXA 2JFEX 2WK2A 1E6ZA 2YLAA 1WDQA 1V02E 1HF6A 3AHXA 4GIAA 2RGMA 2YOCA 3VOCA 1XD0A 3VD4A 2WXDM 3L2MA 4MNMA 4PYSA 4KRUA 3CGTA 4F9DA 4PN2A 4W5ZA 3GBDA 4AD4A 3EBVA 1V0MA 4A4AA 2XFRA 2X1IA 1WKYA 1W9UA 3WH6A 2BHYA 1R85A 3CUIA 5GNXA 5F7UA 3DC0A 1YHTA 3W26A 4PUDA 4CCEA 4LX4A 3IJ9A 5ABGA 2E8YA 3ZR5A 3W28A 3BMVA 1BSIA 3HU7A 1J0IA 3VM7A 1YQ2A 2D0HA 1GOMA 4OUEA 1E55A 2OWXA 1J12A 3WUGA 4ACZA 1DEDA 4DWSB 2CNCA 4BZYA 4M29A 2D20A 1Q4NX 1UQZA 1H09A 4WJXA 5E6ZA 2DGAA 4S3KA 3VDAA 1AVAA 2FHBA 4AY1A 3MSDA 5HNNA 1TCMA 4H8VA 3WFLA 4AISA 7TAAA 2WKGA 3NIYA 3ZMRA 4LPCA 5ABFA 1E40A 2W92A 1UWQA 2CESA 1CXKA 3W4RA 1FA2A 1JDDA 3GH5A 4W86A 3SCSA 3AHZA 3KL0A 3WNMA 2WMFA 4AXNA 1O6IA 5TD4A 1HP4A 3TTQA 2CBIA 3SUSA 1E71M 1U33A 1BFNA 3VNZA 1QNPA 2VRQA 1CENA 1HNYA 2WMIA 2JEQA 3WNNA 3WY1A 4TTUA 2W63A 5GNZA 3PZ9A 2Y8VA 3N15A 3HN3A 3HMCA 5DT5A 1J0JA 4EE9A 4PMYA 1JZ7A 1HJSA 4OOZA 3VDCA 5E9AA 4M1RA 4JZ5A 3KWXA 5D8ZA 1UKOA 4U3AA 4UQDA 5A8PA 2J7HA 2WM0A 3AFBA 3OB8A 4KGJA 2PBGA 1EHAA 3AICA 4HA3A 1N82A 1QPKA 4W8LA 1HJUA 4TVUA 4F79A 2DSKA 3W53A 2VX7A 2VVSA 3RILA 2NT1A 3VGFA 4H8UA 2VL4A 3FAWA 2DT1A 4ACZB 4JKKA 5I0DA 1KFWA 4OJYA 1JDAA 3T0DA 3WD2A 4CU6A 3D5HA 5I3DA 2XVGA 4ML4A 1XYFA 1CXLA 3SUVA 3VD9A 1E3XA 1QVBA 2MANA 4H8HA 1WZMA 1JNEA 1E73M 1QHZA 3CZGA 5BXSA 4W93A 3PZTA 1ZU8A 2VOTA 4ZXOA 2VR5A 1E0VA 3EMCA 1HKIA 2VZSA 3VILA 2DPEA 1B2YA 5A6MA 3KZSA 3N18A 4UFMA 4AD0A 1VJZA 1J0YA 4AIEA 1R7AA 3UR7A 3FY1A 1C3FA 4AZBA 3SUTA 1LWJA 4JFSA 2VCBA 1WDSA 1FHDA 2VCAA 1ZJBA 2E4TA 2X09A 3VIPA 1VAHA 4RE4A 1GVYA 1PPIA 3BCDA 3U7VA 1K9TA 2O9OA 1J18A 2WBKA 1HKMA 4KMQA 2WLYA 3N9KA 1E70M 2VX5A 3DYOA 5CG0A 4HTYA 1IV8A 2PC8A 3PTKA 1ITXA 2VTFA 1H0IA 3POCA 4HZ7A 4BQ3A 1JD9A 1UA7A 5GQBA 3WBAA 3IANA 3O9NA 4TVDA 1J0HA 1XH2A 2XYLA 4B15A 3M7SA 2D3NA 5A8NA 2F2HA 1GUVA 3GH7A 4FLOA 3DHPA 3PZOA 1QW9A 2JIEA 3WNKA 1NP0A 4CD8A 4CU8A 4MJ2A 1E1FA 3AHTA 1VEOA 2WPGA 4AZ6A 4P7OA 1NWRA 1SR0A 3T2PA 1UR4A 4XZWA 1PZ2A 1WDPA 1EOKA 4JFVA 4HMEA 2QPUA 3K8LA 3E1F1 2VVNA 4PSPA 4C7GA 4ZEPA 4P8VA 4L4OA 4M8UA 1FFRA 1UHVA 1XSKA 4DM2A 2YDQA 1R7OA 3PZQA 5ECUA 5BRQA 4EAMA 2ZWYA 1V03A 5AYIA 3BGAA 3OIHA 1OGGA 2DIEA 1J01A 3OGSA 4Z2IA 4YPJA 5ABFB 1UOKA 5FL0A 1TG7A 1HJVA 5A6AA 4J3UA 2VQTA 3SCWA 1K9DA 5C70A 1V6UA 2G3JA 3AISA 2WSPA 2XTKA 4FMVA 3AZRA 2XIBA 1LL4A 2WVTA 1LG1A 1NP2A 1PEZA 1HP5A 3CLWA 2YBTA 3T2OA 5EMYA 3CMJA 2W66A 4GINA 4PTWA 4UFKA 2BY1A 2XGIA 3GBEA 3VX1A 1CXFA 2CYGA 3AHVA 2EEXA 1M04A 4D6FA 4B16A 3CHFA 1GPFA 3CHEA 1XCXA 3ZJ8A 1U30A 3GYCA 3LPPA 2J74A 4UOQA 1KXVA 4XV0A 5M5DA 4B3LA 2G3MA 2IXUA 5A2BA 3VO0A 1JGIA 1B31A 3BAWA 3GXMA 2E9MA 5C8BB 3JUGA 3VGGA 1H3GA 5BROA 2O9PA 1JYNA 1EGZA 2YKKA 2VX6A 3AMDA 3F5LA 1CXEA 2ZWZA 1VENA 3I3BA 4HU0A 4H41A 1WNOA 1XCWA 4PCTA 3OGRA 2YBUA 5E0FA 3BAIA 4W8BA 2O9RA 2DEPA 2B31A 3WQ5A 4L4PA 2DT2A 4PMUA 1M01A 3IAQA 1PX8A 3I3EA 4TX6A 1QNOA 2DH3A 1B1YA 3NSMA 3APGA 1Z32X 3GM8A 2GVYA 4P8WA 4D6JA 4XUYA 3ZT6A 1GOOA 1NWUA 1UWRA 4AD2A 4D6EA 3PZVA 2PF0A 3MSGA 1JZ3A 4MB3A 4CGTA 2WVSA 3OGVA 3AHYA 1D7FA 3VIMA 1KGUA 3BH4A 4Z2JA 4MNLA 3OBAA 1MQPA 5CQ1A 5HDRA 5HPOA 1RP9A 4UOJA 2XIIA 1XV8A 4LYQA 1QI3A 3IJ8A 1E56A 3MANA 1C92A 4R27A 2DSVA 4C7DA 5HBFA 1JZ5A 4CUCA 1US3A 4QFUA 3ZJ6A 1C8QA 4LQ1A 2VURA 5JIPA 1FH7A 2D0GA 1NWTA 6A3HA 3AIWA 3BXWA 3AYRA 3SCRA 5D9MA 2WKLA 1K9FA 1W91A 3LPOA 4PMRA 1XD1A 3WDHA 3AI0A 4KH2A 3SUWA 1D2KA 2VRKA 4QLKA 3M46A 1H11A 2V3EA 2WVUA 4WLCA 2PWHA 3VGHA 1EO7A 1XH1A 2J47A 1OBAA 3AXHA 1CNVA 5AY7A 5I5RA 1TUXA 5C71A 3SCQA 1MQQA 1BGAA 1E72M 3WUBA 3U5YA 2D3LA 3AS3A 4ATWA 1E0WA 1UH3A 4AEEA 3SCOA 3NDZA 1EA9C 2BY0A 1FH9A 1HN1A 3WF1A 1TE1A 2FDMA 8A3HA 5A2AA 2CHNA 2V3GA 3WELA 1FP8A 1VEMA 3BC9A 1GOKA 4U31A 4J3WA 1J0KA 4F66A 1G0CA 1BG4A 2CPUA 5KZ6A 1KQZA 4J3XA 4F9JA 4NRRA 1WZAA 4QLLA 3CZEA 1QI5A 2XM2A 2YA2A 1G5AA 3EMQA 2IXVA 4KWUA 3WKZA 3ARTA 4D72A 4OBSA 1WAWA 1A3HA 1ZJAA 5FOOA 4U3CA 2J4GA 4D6DA 1G1YA 2G3NA 1UWTA 1V3HA 1HX0A 2CITA 4B9YA 2XJ7A 1UA3A 4CVWA 2HVMA 1KCKA 3TP4A 4HMDA 5DO8A 2V5DA 2CCRA 2OSYA 3M07A 2J79A 3FN9A 4BS0A 1ZS2A 3EDFA 4PTVA 3CPUA 1UKSA 3WD3A 2JEPA 3QHMA 2W91A 4LXFA 5HOSA 1JI1A 1CDGA 4URIA 4M56A 3U57A 5M03A 4QCFA 5D4YA 1BF2A 2GJRA 2DQXA 1JD7A 2OLHA 1CYGA 3UG4A 1XSIA 4HPGA 4TX8A 2AMGA 2GK1A 1B3VA 1Q6FA 2V38A 2C7FA 4U5IA 3QOMA 2J25A 2E3ZA 4AMCA 1Q6DA 2V5CA 4W5UA 1W2VA 4XX6A 4P7QA 3PZUA 2EO7A 1WPCA 3ZSSA 5CLWA 1QHPA 3VIOA 1L0PA 1VFMA 3QGVA 1DWJM 1BGGA 1QNQA 3EDDA 3IAPA 4J27A 2YDRA 2EPOA 1QOXA 1V3JA 3WDRA 3EYPA 1R8LA 2V3DA 3BLPX 4PUEA 2BHZA 5BCAA 4JCLA 2EPNA 1QI0A 3BAKA 1KWGA 2XVPA 3VD5A 4FLSA 4AIUA 1E6SM 1Q6GA 4CD7A 2EQDA 4E8DA 3FHAA 2OYKA 4JL2A 3GNOA 3A3HA 3VIJA 3AS0A 3WF3A 5A6KA 2VMFA 3VD7A 3PHAA 2YL5A 3CIVA 5CPTA 1C8XA 2W4XA 3EDKA 3WQ6A 4UOZA 2X0YA 3CO4A 4JHZA 2GDUA 3GXDA 4FK9A 4XB3A 3RIKA 2CIPA 2XWDA 3DYPA 4AYSA 2OYLA 5BYWA 1J11A 3OLIA 4P8XA 1JF6A 4AD5A 1FH8A 4PMOA 1NOWA 3ARPA 3W6MA 1MYRA 1PJ9A 2WC4A 3CZKA 1ISVA 3SCTA 1CGYA 1MFUA 2UWFA 4H7VA 1HJWA 2EXOA 1PIFA 4PMZA 5A1AA 1BPLB 1HXJA 5A94A 4GKLA 3EDJA 3N11A 2WVVB 3WD1A 3O2LA 3SIMA 2J7DA 3VIHA 2F8QA 4WKHA 3WQ8A 2WMKA 3DYMA 2OSXA 3FHQA 4UQEA 5A95A 2BVYA 5EB8A 3TA9A 2ZXDA 1DWGM 2VQUA 1JYVA 3N12A 2ZIDA 1MW3A 3ZR6A 1UH4A 1JG9A 2GUYA 4GO8A 1IZJA 1PAMA 1GORA 2NT0A 3W82A 3RJYA 4F8XA 2O92A 1W9VA 4M80A 5FIPA 4X0VA 2XM1A 2E9LA 4X0NA 2OWWA 5D9PA 4W87A 2PWGA 4MTVA
chains in the Genus database with same CATH superfamily
2XGBA 4AZ7A 1PCKA 3ARUA 3RO8A 1JDCA 3OIXA 3VC5A 1X39A 3LYEA 1W56A 3S42A 3S1GA 2OJPA 1F9CA 1QAPA 4QG6A 1NF0A 2ZICA 3ES7A 4L9YA 4R5EA 1IGWA 2WJZA 1RY8A 2DDXA 3IUIA 1YE4A 2Z2UA 1UR8A 2OGJA 2E67A 1UD6A 1XFCA 1IXNA 4EANA 1YXYA 1DIEA 4AWUA 2Y0FA 1NWSA 1XLDA 1PKLA 2QGHA 4IPNB 4K8HA 5I79A 1SZRA 2O9TA 1F4HA 2X0SA 2XG9A 1KLYA 1S3TC 4YWSA 2OU4A 1QK0A 1UZHA 3K2GA 4UIOA 3DFNA 1EA0A 4PCSA 3RDKA 1V3KA 1ZBVA 3CHCA 1LLOA 3VZZA 1K8XA 3ITLA 1QJWA 3WFZA 3EDEA 4D8ZA 2PGEA 4GA8A 1UD4A 4GUIA 4IP5A 5IXEA 2WZMA 2E0PA 2JF7A 3R1ZA 3TYEA 4Q8WA 3RRXA 4Q7NA 4KESA 1O4UA 1SO5A 5JIWA 4Z17A 1OX4B 2J6VA 3UXAA 3AIUA 5E5CA 1GWJA 4M81A 4KCVA 1AZ2A 1TYGA 4Z1DA 4O53A 1W1IE 3MMWA 4OTKA 3VVGA 4LV4A 5BXRA 1CGVA 4GZ7A 4HHHA 1DHPA 3LZ5A 3UCQA 1OWQA 1OC5A 4JN6A 5CC7A 3ARYA 4EXAA 3NQ6A 1W2PA 2NX3A 1JFHA 4J2PA 2YW4A 2A6NA 1KXQA 4QLJA 1XYMA 2V0TA 4UTMA 1IEQA 4E8CA 2R6OA 1AQMA 3LCXA 4HYRA 4BCEA 3UZXA 4YS1A 4C6OA 5LSMA 4O1DA 1JVNA 2PDYA 1W9XA 3SB0A 4IL0A 1FDYA 1UH2A 2YDAA 3O1NA 4YTRA 3THCA 2QMJA 3MYOA 1TREA 4MB1A 3NUKA 3R79A 4F2BA 1E1CB 3HPAA 4B9ZA 1GGOA 2QHAA 1SW3A 5JBFA 3W7JA 4HT3A 4E4UA 3W74A 3JR2A 4O18A 4EF8A 1T6MA 2QDHA 3L12A 1XP3A 2VO5A 2WVVA 4GXWA 1PHWA 2OT1A 3DOPA 3W6LA 1KD0A 2EAWA 4H6RA 4JKMA 2J78A 1M3UA 2WCSA 3BQ6A 1SQ7A 1K6AA 2BFGA 4PL2A 3TSBA 1EJXC 5A6JA 3WJXA 1IXQA 1X1ZA 1G4EA 2P50A 2PDUA 3L4VA 4J3SA 4OV4A 2ZX5A 2B7OA 2VC9A 3NGFA 1CIUA 2Y5EA 4HCHA 3T0CA 3OA5A 3P5ZA 3SUUA 3NCOA 1LUCA 1RLCL 4AAJA 4QJ4B 2ZZ4A 1V08A 3V4BA 1RLDA 1J10A 2ZRVA 5CZSA 2PWEA 3WQ4A 2CHOA 5E6YA 3TJ4A 3ZLFA 1WKEA 2UY2A 4RJEA 4ATDA 2GGGA 1OC6A 1H1NA 4AYGA 1IT7A 2PU0A 4GQRA 1VFFA 3L2LA 4HK5A 3T81A 3S2MA 3BTNA 3ABZA 2GJLA 3MHGA 5GNYA 2GSJA 3RLUA 4PTDA 3I7QA 7A3HA 1WCGA 4JX4A 1WUEA 1KCZA 1L9WA 3DH7A 1WBHA 1S1RA 3NL5A 3CTLA 3T78A 3H2OA 4KCUA 3BCFA 3REQA 4PC8A 2VRJA 1A0DA 2V2DA 2H8XA 3N2OA 3N04A 1VGAA 1T8XA 4EK7A 3ITTA 3VNKA 2NQLA 4Z0JA 1Z9AA 2WC7A 4AZ5A 3SIZA 3S8HA 4JAWA 3S0CA 2B4GA 5A2CA 4K36A 4O50A 4WSKA 5E70A 2VD9A 1KB3A 4YVXA 4DF1A 4Y8FA 3WF0A 1E6XM 1XDJA 3RU6A 3KOXA 4HNUA 4JTTA 1J5SA 4JICA 3AYSA 2YL6A 1QCWA 4IIGA 2BSLA 2J7GA 3ATZA 4AU0A 4NZ4A 3BZGA 1MVYA 5A8MA 3QPEA 4Q4SA 1DQXA 2X2YA 2CZEA 4HZ8A 4AEFA 3PM6A 3VUPA 2OWCA 2VZUA 1SVDA 1EJ7L 1X6NA 2Z7KA 3APYA 3T0TA 3M43A 3G1RA 5D9NA 3WH5A 1FHLA 2NXGA 3W22A 2DUXA 3CAKA 2WHLA 4JYDA 1AW2A 2BG5A 3W0KA 3BLOA 4AZHA 3M7WA 2GK1B 3LMYA 1B30A 2P10A 4N9DA 2J7EA 4JL1A 2UZ9A 4AF0A 1GNXA 2RHGA 3IIXA 4YIWA 3M0YA 1AH0A 4BF7A 3DFHA 3RCYA 3FJ6A 3NWRA 3H6OA 3TUUA 1PZ3A 1UASA 3ZOAA 3VCNA 1G9HA 3R0KA 2VFHA 2X1TA 1KTBA 1P7TA 1VPQA 3SN0A 4L4LA 3PJTA 4NNAA 4XVEA 5EFDA 1ISYA 1DIDA 1GOWA 3SCVA 3N19B 3UERA 1PCWA 1AJ2A 4QGCA 3WMLA 2D69A 3TTOA 3W1PA 2B7PA 4S3CA 3WLRA 5DQPA 2ZUUA 3TONA 3RPMA 4GNKB 1BVWA 2A3EA 1UWIA 4B4HA 3A9IA 1W5QA 1YDYA 1W32A 3O06A 2R91A 3WQVA 5FCZA 4DUVA 2X1UA 2BHUA 3BOFA 2BY3A 2QCMA 3DHUA 1KFEA 3XISA 4OFCA 4B91A 1XQLA 2QCGA 3LSBA 2Q8XA 3CHDA 4GZIA 2IQ0A 2G8ZA 1JRCA 3KLLA 3LHYA 4HCLA 1N7KA 3DKJA 1O60A 3B4UA 4MB4A 4K3ZA 2ZC8A 2A3BA 1YW1A 5J5DA 4JOMA 5A3HA 2Y89A 1QPQA 2D24A 1MEHA 1OFAA 3NNTA 1TTQA 2HK1A 3CPGA 1QPOA 1JPIA 3MV01 4CN1A 4US6A 1V6VA 3DG7A 1SZNA 4M7TA 1UD3A 1WDWA 4V33A 4XO6A 1DJNA 5DF0A 1JL8A 3L67A 4RX0A 4ASTA 1U5HA 1Z42A 3PPCA 2RGLA 2BB0A 4FXJA 4LAKA 3LRKA 5A6LA 3VCRA 4PL1A 4Z2KA 4OT7A 2VCCA 2UY4A 3R7MA 1RR2A 1VZWA 3RR4A 3LQGA 3U2EA 5JMUA 2PTDA 4LF1A 1TTIA 1TTPA 4IG2B 3S5ZA 1XBZA 1A53A 3PBUA 2NXIA 3BLDA 3QBUA 1B3XA 4CU7A 3TE9A 3PPGA 4RW3A 3GD6A 3E2QA 3VNJA 4WRHA 3E0WA 2NLIA 3AIVA 4GE8A 4JNMA 1TV8A 2CWXA 3LM7A 4IMEA 3FA5A 2ON3A 3ABQA 1TJ0A 4DJED 1RCQA 2XSBA 2JGQA 1KRBC 5IDIA 3IS4A 4JDYA 1W17A 4LNYA 4GKTA 2OX1A 4AQLA 3VKKA 2VEPA 3P3BA 4A29A 4JHOA 1M53A 1DWAM 4V28A 4PMQA 1KW1A 3DIPA 3KVJA 2QQ6A 1T96A 3WJWA 4OKDA 3FOKA 2J8FA 3AXXA 4U5KA 9XIMA 1UJPA 5C54A 3GHTA 2TAAA 3RITA 4A05A 3F2BA 2PWVA 2NV1A 3EX4A 3WJZA 4I9AA 3VKDA 1AH4A 4DI8A 2FFCA 5IBXA 4JFWA 4L6DA 1NIUA 3H2FA 4RE3A 3PNUA 4WQ6A 4IPLA 2CBUA 1XS2A 4FI4A 4C1NA 2CLEA 1ADDA 2Q01A 4F0SA 2QV4A 4U28A 3WEOA 3TLQA 3QZEA 4XKYA 5GPRA 2YSWA 3BLKA 3LV6A 1EIXA 4S38A 2NSOA 1TPEA 2GGIA 1SGJA 5BXPA 1SFSA 1K9EA 4JTHA 3CC1A 2FGZA 1ECEA 3ERPA 5TBOA 1PZ1A 5A69A 1DBTA 2DW7A 1XRTA 2ZE3A 3ARSA 1OT1A 1ZTVA 4PB4A 2DUZA 2ZUSA 5HMFA 3MKCA 1G94A 4NILA 5C9XA 4YYFA 3BOXA 4JQ3A 2FTWA 3WBYA 3TYCA 2E9BA 1OGBA 3POHA 4ZQRA 2RH9A 5DEZA 4PMNA 1PTDA 2FFIA 2IQTA 1K03A 3PUEA 3F4WA 1WZLA 3QMRA 3LUTA 4CKQA 4O13A 2ZX9A 4KEUA 5D37A 4FALA 4ACYA 4MM1A 4I6VA 4OECA 2IMRA 1BLIA 4GVGA 3AROA 5E09A 1F6PA 2OFJA 5C2GA 3M1ZA 1SYTA 1EYWA 1V6TA 3DAQA 3DHFA 1CEOA 2YJQA 5CXPA 3M64A 3H12A 1R86A 3SAZA 4M5PA 4LBUA 4IT1A 1FY6A 2ZADA 1T8QA 2CLOA 3W72A 2HISA 4PODA 1E5JA 2NQJA 1DQWA 1KXTA 2CXGA 2XZ7A 3WBXA 4JKLA 3QW3A 2D2OA 4AWEA 2FQIA 4XTDA 1QI4A 3GX9A 2FDSA 4QCEA 2ZXQA 3M0HA 2VUYA 4UFHA 1GT8A 1CLVA 4CD4A 4HPXA 5HUOA 4KWVA 4Q4QA 1NVMA 4AB4A 1EB3A 1RV8A 2QUUA 3TKFA 2BXVA 1HVQA 3B9OA 3PTMA 4D6GA 1VBRA 2OYMA 2YXOA 1TJ2A 1TVLA 1V51A 3I4EA 4MAVA 4HIBA 3AIBA 3E02A 1QDSA 1IWAA 1RH9A 2IPJA 4C91A 2XVLA 4CNTA 3O3RA 4TMBA 3VYLA 3SO7A 1GW1A 3HQNA 4LCSA 2FZNA 1XLIA 3RPTA 1E4LA 3WH7A 2YFNA 2C18A 4FOKA 2D22A 3KHDA 1S5NA 3VKJA 3G2GA 3CB3A 3E0IA 4FNRA 4XZHA 1KBJA 5LNSA 3PZNA 5JH1A 3F2CA 3ZSTA 4GC4A 2F61A 1CGTA 5BXTA 3C61A 1POKA 1ZBWA 1F6KA 3EOLA 4EKJA 1Y5VA 2X41A 3GK0A 5A8OA 3NFUA 4DWSC 5HQLA 3T0BA 1UKPA 4OQVA 1HVXA 1HKKA 2XVKA 4GVHA 2XFYA 3BURA 1B3ZA 3PC0A 2PLJA 1E5NA 1V77A 2VGIA 1VYRA 2Z0IA 2YL8A 2I5QA 3MPGA 1TWDA 2FJKA 3VX0A 1QU4A 1GTEA 2EPHA 1BYBA 2MNRA 3OODA 4FOUA 4H6KA 3VKBA 4PH6A 4I9JA 2WMJA 5C55A 1DWIM 4AZIA 3KX6A 2PWFA 3GZ3A 3MWAA 2NSXA 1XXXA 4AY7A 3R4IA 5HPCA 5CJ5A 4XZIA 2XIOA 2VYOA 4GI4A 2J75A 4I6KA 3K4WA 3L66A 1F8MA 3R43A 2HK0A 1H2JA 4FNPA 2PA6A 2WSRA 5IFPA 1XM3A 4GI8A 2QPSA 1VCGA 3V3WA 2R1NA 3U48A 2ISFA 1BWVA 1ISXA 4I3GA 4AIOA 3EB2A 4BQ5A 1R87A 3QV7A 1W54A 3EWYA 3ONCA 2HQAA 3DFSA 4F40A 1B3YA 1LP6A 3GVRA 2RKXA 2VGGA 2ZZ5A 1MI3A 4IHCA 1HF6A 3GR7A 4M6PA 1T0OA 1P43A 4KFNA 1A5KC 4UUIA 3PUGA 3V16A 2PODA 3NZQA 4FR6A 4F9DA 4W5ZA 3GBDA 3BW4A 1TV5A 1JCTA 3NPXA 2Y5SA 3T4CA 2Y7EA 3H2NA 3CUIA 3EWBX 1SSDA 1EP2A 3DC0A 3H55A 2QV5A 4NX0A 3MUXA 3DFOA 2J9YA 2BLEA 3UZ5A 4O28A 3H26A 5T91A 1EZWA 2NZLA 4TV6A 3QV8A 4DF0A 1GOMA 1J12A 4Y9NA 3WUGA 4ACZA 1OABA 4GYPC 3GVGA 3SN4A 1ONXA 3TEVA 5I3JA 4DRSA 4NJHA 2DW6A 4Q8QA 1UQZA 3BG5A 1C8VA 3UJ2A 1SO3A 3Q94A 2FHBA 4KEMA 1XIJA 3UXLA 1UJQA 4GYJA 2HTMA 5ABFA 3LRLA 2ACSA 2W92A 4AUBA 4MJMA 3VCCA 2PU1A 5FF0A 3KL0A 3OEXA 4DBUA 3DX5A 1ZAJA 2WMFA 5TD4A 1NY1A 3RLGA 3H4WA 1QNPA 3GDKA 1CENA 4RNHA 3M0XA 4JTSA 2W63A 4Y96A 2Q3RA 3MVIA 3GC4A 4NHVA 1UPMB 4PMYA 3CWNA 1LRQA 3MT1A 2FPVA 1JZ7A 2SFPA 3KRZA 4JZ5A 2PLCA 4H9MA 4QQ3A 3THAA 4ZQNA 2HMCA 2HNEA 1U1JA 4BKNA 3TQ0A 4XAFA 1S38A 1ITUA 3R12A 5EY5A 3LERA 1N82A 2C14A 1QPKA 5DLCA 4HNTA 4J4KA 3W53A 1Y0EA 3C0QA 2IS7A 2VVSA 3RILA 4H8UA 2G4JA 3DHDA 1G4TA 3SJNA 4ACZB 1M7JA 3MDUA 4KETA 2DQWA 1KM1A 2ZA3A 3T0DA 4REQB 3D5HA 4RXFA 2J88A 1QWKA 2XVGA 3N2BA 2DU2A 1CXLA 1ZAHA 3SUVA 3VD9A 1K8ZA 3QTPA 1W37A 4H8HA 1WZMA 1E73M 4S39A 1YKWA 3CZGA 4AEOA 1NQKA 1M6JA 3UT0A 1HKWA 1ZU8A 3AWOA 2WNQA 2F84A 1E0VA 1OF8A 2B0MA 3W7RA 2VZSA 3VILA 2HXTA 2DPEA 2WQPA 1B3OA 5LIUX 3UA4A 3RK8A 1BEUA 3IIPA 1J0YA 1OVDA 1CB7B 4MMWA 3OVGA 4LC8A 4LAMA 4JQAA 3P0XA 2WSYA 1NDYA 4JFSA 4B2DA 1PL9A 1TPVA 1WDSA 3LTPA 1RALA 3HQOA 2VCAA 3AWNA 1ZJBA 4GGHA 2X09A 5D33A 4RE4A 2OEKA 4Q7IA 1PPIA 4LAUA 3QYSA 3HGSA 2W6RA 3UXKA 1K6WA 1VYPX 2R82A 1ZCCA 4XIMA 3DBPA 2WLYA 1E70M 1TPFA 1Q7ZA 3GR4A 1ITXA 4ICCX 2HWGA 4QG8A 4MHBA 4BQ3A 1JD9A 3WLQA 3NZ1A 3LMZA 1Z41A 4UR8A 4PCFA 5HINA 4ZQPA 4GJJA 4B15A 3VC6A 2F2HA 4FLOA 1G6CA 3V7PA 1NF7A 4NAEA 3VOGA 4GFIA 1OQFA 3KBSA 4MSSA 1QW9A 1RJPA 2IKHA 2JIEA 5LHEA 1AJZA 2XSXA 3GFZA 4CU8A 4DO5A 1E1FA 1VEOA 3DFPA 4P7OA 1LQAA 1GEHA 3SADA 4HQVA 4Y2WA 2QIWA 2E28A 2QPUA 3K8LA 4ZEPA 4P8VA 4M8UA 1SM9A 4DM2A 1R7OA 4C1KA 1XYLA 1HFBA 3IGHX 5BRQA 2Q8LA 2JKPA 2WJFA 2ZWYA 2NV2A 1VIZA 4JIIX 4I7WA 4ADTA 3O7UA 2V5LA 1T7LA 1LTDA 1ENUA 1UOKA 1TG7A 1LOQA 1HJVA 2GGHA 6ENLA 2VQTA 1K9DA 4Q33A 3AISA 1Z6KA 1EGMA 1LL4A 5U4NA 1NP2A 4XD5A 5FAGA 3OHMB 3UWEA 1EC9A 2YBTA 3MBFA 1X1OA 4ES4A 2Q6ZA 4DEFA 5FA5A 1J93A 1B4KA 2AQOA 2Y6ZA 4R9XA 1AA1B 3E2VA 3NVDA 3CU2A 1J2WA 1I45A 3C8FA 3V36A 5I3GA 4CLMA 3VO0A 4A8IA 2PF8A 3WQGA 1B31A 3QKZA 3C52A 5CAKA 1PWMA 4XBJA 3GXMA 3SRHA 4YVVA 1WV2A 2Z1WA 3CQHA 3VGGA 1H3GA 3TNOA 5AZ0A 1EGZA 4ZQCA 2PTWA 1A5UA 1L8PA 3GFXA 3I3BA 5DMNA 4H2HA 1PTGA 1A5LC 2YBUA 3BAIA 1S5MA 3EB4A 1BKSA 1JUEA 2VP8A 2DT2A 4H9VA 2X42A 3QLDA 2XH0A 7PTDA 2DH3A 3GDRA 3UPWA 1XRFA 1Z32X 2G95A 2GVYA 4P8WA 4XUYA 1A5AA 5D09A 4WZHA 3SGZA 4GUJA 3PZVA 2PDPA 2O55A 2PF0A 5AYYA 4CGTA 2WVSA 3CAWA 3OGVA 4GCAA 2R24A 4EPEC 2CHRA 1W8SA 4FR1A 2OKTA 4QJ3B 4UTIA 2CLIA 3OOQA 2XIIA 1XV8A 4LYQA 4PMJA 4UTWC 2PDQA 4LNCA 3IJ8A 3MZ2A 1FCBA 3MANA 3IGUA 4R53A 1C9WA 3HTWA 1SFLA 1TRDA 3VE7A 2AQWA 3E0VA 1US3A 3MHFA 4BI6A 1FUYA 4QFUA 1ITQA 3ENLA 1TE6A 4MG4A 4P61A 3W7QA 4M51A 2VURA 1W5NA 1FH7A 4BF5A 6A3HA 3G5EA 3L0GA 3BXWA 2J24A 4IQLA 3I6RA 4DJFA 4XZMX 2QS8A 1B54A 3NL3A 1WX0A 3VNIA 3B8DA 2HS8A 3NQ7A 3AI0A 1QUMA 3RUBL 1DYSA 1AW1A 3FA3A 4LH8A 4NL1A 3DGBA 1H11A 4BI7A 3QR0A 4PB3A 5AY7A 3T8QA 1K8YA 3VI2A 3UWWA 1DE6A 4GH1A 3SCQA 4NX5A 3NQ8A 4O4VA 1EA9C 4DJDA 1TE1A 3UA3A 3KOYA 4ZOCA 3WK3A 4L4MA 1FCVA 3C5QA 3PR2A 3WELA 3BC9A 1F3WA 4U31A 3MUCA 1J0KA 4F66A 1P7TB 3DG6A 1JQXA 4J3XA 4YYCA 1WZAA 2WQDA 2YA2A 1RA0A 3EMQA 2IXVA 2W27A 4LEFA 1ZGDA 3GU9A 3GDTA 3BLLA 2HEJA 1E0TA 3MDWA 2HPIA 4G7EB 4B5VA 2DV0A 3A13A 3SY1A 1V3HA 3G1FA 1XI3A 4B9YA 4IFRA 2XJ7A 1F8IA 1PO9A 4KWOA 4WGHA 2HVMA 4CVWA 3TP4A 3PJXA 3TX9A 2V5DA 2CCRA 2OSYA 2P53A 3H2EA 1W1ZA 3EA1A 1W3IA 4L80A 1YADA 4FXSA 4EIVA 5E1QA 4PTVA 1R3VA 1A0EA 3MJMA 4HK7A 6REQB 5HOSA 1JI1A 1PS9A 3N14A 1IT8A 4QS6A 4IGSA 3U57A 5M03A 3NQVA 4QCFA 4QEHA 3LB0A 3E12A 4C6LA 1JD7A 3UG4A 4TX9A 4DO6A 2B7QA 2DFAA 4X2RA 3IUDA 1LOSA 2AMGA 3DBNA 1KV8A 3IJQA 2ISVA 3LHWA 3C56A 4W5UA 3LX9A 3LCGA 4XX6A 4P7QA 1R9ZA 4GNVA 4QJ5B 4G6CA 3ZSSA 4G7FA 1BGGA 2FZ9A 2F6KA 2EPOA 3NOEA 1QOXA 4JX6A 3D47A 3GHUA 2BHZA 1U83A 4JCLA 1QOQA 4A35A 3VD5A 4CEUC 4AIUA 1E6SM 5LNVA 4E8DA 3FHAA 2IKJA 3AS0A 4S3AA 1J79A 2PTXA 3STPA 3CIVA 3A5VA 1C8XA 2W4XA 1R38A 4Q6JA 1RK6A 3C0LA 3TYZA 4FK9A 4UTTC 1Q4WA 4AYSA 4C6JA 3OLIA 1JF6A 1FH8A 1CX9A 4S3DA 3CL6A 3HFTA 5K9DA 3W6MA 5IDZA 2WC4A 4K39A 4QR6A 1ISVA 2OLAA 1CGYA 3PJWA 5DMLA 2WV8A 2PZNA 4YTUA 4HNCA 2GDQA 1HJWA 1OX6A 2EXOA 3U2OA 4DJEC 1PIFA 3FLUA 5A1AA 5A94A 1BD0A 2DY3A 2J7DA 3GXPA 3VIHA 2POZA 4QITA 5B80A 4GJ1A 2WMKA 3NR0A 1DWGM 1ICSA 2ZIDA 1IXOA 4H1ZA 1DORA 2ACUA 3UBPC 3ZR6A 2HZGA 1FDJA 2GUYA 2WKJA 5DXYA 4LY8A 4S3GA 1PAMA 4ICNA 1Q6LA 3W7EA 3GU2A 2O7SA 3EX2A 4X0VA 3QYQA 4E2DA 3GO2A 4MLJA 1T40A 1I8JA 4NKCA 4DYKA 4NSBA 3H7RA 2AQVA 2TMDA 4BR1A 3LV5A 1UD8A 2PSNA 4UZSA 3V18A 4GQ0A 1F3TA 2A1YA 4DUOA 1E9YB 4D71A 5FSDC 3TXZA 1A5NC 4GIRA 2NV9A 4RPQA 4CQ9A 2RDTA 4LGXA 1RA5A 1YTDA 2Z6JA 3QOKA 1PV8A 1KM0A 1IEVA 5H8MA 1ZL1A 5G1MA 2VZTA 4UTJA 8XIAA 4OIFA 3IV3A 3SEPA 2GOUA 3PG9A 4MWAA 4CCCA 1XHGA 5T9BG 3II1A 3BGGA 5EBUA 2CLHA 3DERA 3WLNA 2I1OA 2P76A 1ME9A 1XGZA 3LBCA 1C8YA 1XYCA 4AX6A 2H9AA 1CPUA 3URNA 1H1ZA 4G9PA 2ZOXA 3CAQA 1A4MA 1GVOA 3N34A 2NLYA 1OD0A 2EHHA 4IL2A 2DVUA 2X7VA 3FJNA 5CGQA 3G6MA 4LYPA 2YFOA 5F2MA 5BNKA 1OFOA 3AS2A 3QLLA 1DIKA 3S6TA 4EAYA 4AHOA 5CBJA 1JPKA 2EF9A 1DIOA 4WDUA 1OT2A 2VNCA 4HOZA 9XIAA 2QUNA 4CCDA 1PYFA 3RPDA 3A47A 2XVNA 2YA0A 2HDJA 2ZX8A 4KQNA 3I68A 3EWUA 1UUQA 4DJFD 4HP5A 2CLPA 1V79A 3B40A 2E6DA 4IMGA 1JZ2A 1XUZA 1GQJA 3TXVA 3PF3A 3BARA 3UCCA 3FIGA 4PUKA 1K3UA 2TODA 4PBGA 4DYJA 3VDHA 3KP1A 4LW7A 4JHMA 2NQHA 1I2RA 4ZFMA 1V0KA 4ROPA 3NPVA 1EHNA 2PGFA 1HG3A 2ZA2A 1EYEA 2Q71A 2INZA 1YMYA 4ZOBA 1K8CA 1TMHA 3KDOA 3QXBA 2EPKX 4Q8VA 5JBDA 2GQ3A 2ZBTA 1KQYA 1YDNA 3U4AA 2GGJA 4DLMA 1JJKA 2A21A 3OU8A 3AMCA 1KRCC 1SFTA 3PK7A 4IWWA 2TPSA 4DX3A 2P8CA 5LA1A 1MXDA 2ZUVA 3VIKA 1XG4A 4US5D 2PTYA 1AMYA 1RD5A 3NOYA 1QI2A 3NA8A 3TOYA 5D32A 5HULA 4GY1A 3Q4DA 1OX5A 2GVLA 4UQAA 4M24A 3M41A 4GRSA 3AMLA 5D2WA 4JIPA 2XSAA 4XK2A 5AFDA 1BWLA 2X8RA 1NH6A 3FKKA 4BFAA 3W1XA 4MVAA 2AOSA 1JQVA 3IRDA 3SFKA 1XYZA 2E6FA 2Z1XA 5JU6A 4MKSA 2YR1A 4MYXA 5A6SA 4W7WA 1XCFA 2QF8A 4K6AA 5I7GA 2ICSA 3GC5A 4RNJA 1JCMP 1JZ8A 2OKOA 1W5OA 3UXIA 3HG2A 3N4EA 1KWKA 1V3MA 3DUGA 1BVZA 2A4AA 1BTCA 2C19A 2HROA 1REQA 3VNLA 2ZXBA 1TCDA 2JQXA 2JALA 3CQIA 3MSRA 3DECA 5LA0A 1V6WA 2ZX6A 1JRBA 1OFDA 1CBGA 1BYAA 1PKNA 3B9DA 4MFDA 1DJYA 3N6HA 2QGYA 3T08A 3VMOA 1BHGA 3NYDA 3KFTA 2GUUA 3CIWA 4K38A 4ZO9A 3SM0A 1DJXA 1W1TA 5FEXA 1G69A 3B06A 4H9XA 1JGMA 4AZCA 1E15A 2ZFAA 1EC8A 1TX0A 2AL2A 3FSTA 4GUFA 2XN0A 4DO7A 5D8WA 3S1VA 4W8AA 3S1WA 5HWNA 5EMJA 1LLZA 4UR9A 9CGTA 1GQIA 1X8FA 2BDQA 2XFFA 4O0ZA 2PS2A 2R94A 3PZMA 1UBPC 1TUFA 4HOXA 3AXKA 2VFFA 5LYRA 1JEZA 2WZHA 3W23A 4GZJA 1S3HA 2Z2BA 3WNOA 3JZUA 1B9BA 3S5NA 3CWHA 3D3AA 3WK0A 1OCBA 1XBXA 4MNKA 3ZM8A 4YN5A 1WA3A 4WXZA 5G1TA 4D1IA 5FAJA 2IPGA 2GUBA 3FEMA 3LM3A 1KFLA 3UETA 4H04A 4D6CA 3HBLA 3HB9A 3T44A 4WOZA 3WLLA 2OG9A 3WQCA 3ALFA 1ZFJA 1O5KA 1MRAA 3WQWA 1QBAA 1FWIC 1PB0A 3N9SA 4ZE4A 1OZQA 1WOAA 4ICMA 4LFYA 1JI2A 1DJQA 1Q6CA 3FK4A 2FHFA 4LOCA 5LXXA 4M7SA 4K7YA 3RCNA 3KBJA 3L9CA 4DNHA 4BI5A 4WSJA 4M0XA 3WO8A 3VZYA 3WL1A 4BJHA 4HU8A 4WGXA 4QAWA 4UTHA 1FWGC 2CBVA 4GXMA 3L4UA 4IX0A 1UR2A 1GG0A 3FAXA 4FHAA 1JZ6A 4RE2A 2G50A 4ERGA 2V81A 1E9LA 3IK4A 3BO9A 1MW2A 4L5ZA 1V0NA 4GABA 3VIFA 2X0HA 2WANA 4OE7A 1CECA 1WE5A 1X96A 4MUPA 3G0SA 3LXAA 1QRQA 5TIMA 4EPBC 3DKLA 4UZUA 4NP7A 4GC3A 5E93A 4ZQMA 1VKFA 3O6YX 1TIWA 3J7HA 4HU3A 4Y6GA 3U2ZA 1ZLPA 2WYSA 3EX1A 2WW5A 3MUY1 3WYZA 4HHPA 4L1GA 3TH6A 4DPPA 4XD6A 4WDWA 3WD0A 1EP3A 3TDFA 5C9ZA 1UQYA 1EBHA 3EOSA 2H90A 5I06A 3A5FA 2ZYFA 1ICQA 5EBAA 4KFPA 3EEGA 1DVJA 1M03A 5FD0A 5CSSA 3P81A 3F4NA 4W88A 3SSJA 1FOBA 4MY9A 1V0LA 4NAEB 4BQ2A 4UQCA 3VABA 3RMEA 3OTRA 1MDRA 3LHVA 3L5MA 4LTSA 4FB7A 3TN4A 5EA9A 3TQPA 2WHKA 3VM5A 1Q6EA 3B0YA 3W1NA 4Q4KA 2P1FA 5DBTA 5EU9A 3S2LA 3VNMA 3UYIA 2WCAA 3R2GA 4V27A 2VGBA 1I0DA 3PBVA 1GCYA 1TA3B 4IP4A 4WEVX 4IM4A 4WD0A 2V2CA 4WDTA 4FIRA 2DSUA 3QR3A 3GAYA 3EPMA 1CGUA 5CPSA 5F2IA 3UVAA 3WH8A 1BYCA 3MP3A 3ZT7A 1ZCOA 1HL8A 1VQTA 3QHOA 5LNUA 4Q4RA 2V67A 3VFCA 3W37A 2WZIA 1EUAA 4GLEA 1VBUA 2EJ1A 3B8VA 2E1WA 4DYEA 1W9DM 2VENA 5G4WA 4W4QA 2CBJA 1O95A 1TV4A 4PMVA 5LHFA 3N3TA 3BG9A 5CPQA 1AQHA 4WKFA 2E1DA 1S2UA 4FO4A 6TIMA 2QLYA 1XJBA 3GXTA 4US5A 5CBBA 1E9IA 3MUIA 4O11A 1IIHA 4L9ZA 1NFGA 2E6YA 4GUHA 1JXKA 1F07A 1XR2A 1ZB5A 4QS5A 3W75A 1EBGA 4X22A 3VE9A 2D23A 1C91A 1W3LA 2OQLA 1GKPA 1B3WA 1KBKA 2DZPA 2PDGA 1XG3A 1T99A 2PDXA 1I4NA 3AIQA 3K1DA 1P6BA 1PXGA 4LYRA 4REQA 3EWWA 3A23A 2YX0A 5U7SA 3AOFA 1XPGA 1ITCA 1G4SA 3GVQA 5JQ9A 1KCLA 4EPDC 2I57A 3FDKA 2AAAA 2C71A 4W89A 4O12A 3W81A 1X6UA 1YLVA 4BEQA 5IRPA 5L9FA 1Q63A 2J77A 2VWTA 4GOAA 1S46A 3EWDA 2OELA 1X8CA 3U0HA 3KVKA 5I2UA 2WMGA 3KOZA 3MUAA 1TZZA 3UU0A 1FCQA 6ALDA 4TTGA 1KTNA 2OOFA 5EMMA 4RZ4A 4LU0A 3LCLA 1W5MA 3E2SA 3ARWA 4CNPA 2WAGA 4GZEA 3BSGA 1EEPA 1F7BA 2D0FA 4XO7A 3V5OA 4R3UA 3RX3A 3LHTA 3G3MA 3HJEA 4HHLA 4IQJA 4AZGA 3P61A 4LYKA 1DXEA 3A4WA 2XISA 5C7VA 1OB0A 2WMIB 3NDYA 2PEVA 3WK2A 3O15A 4YHEA 1X98A 4ORIA 1KV5A 2VEIA 3C6CA 4DLFA 4C1LA 1FHUA 4YNGA 4S23A 2NXHA 1VBGA 5I6SA 3KL3A 3RF9A 1BTMA 2D73A 4AVFA 2Z1VA 4CN6A 1XIFA 1XIDA 2A79A 3P0WA 2PC4A 1ZAIA 5M3WA 3WK1A 1ONRA 4K8EA 1Z8AA 4MY8A 2C13A 3TV8A 4AC7C 3LPGA 1A4LA 4LS0A 3ZJ7A 1UB3A 3W1LA 4GYPA 4G1KA 4E6MA 3W83A 1H7WA 2EGZA 1KGXA 1EJUC 4MNJA 6XIAA 5ABHA 3LHUA 4OBTA 1OY0A 4GH3A 4W7VA 3GTNA 3P6LA 1FVPA 3TCSA 3NQCA 1BQCA 4UFLA 1PBGA 3ARVA 4U2ZA 4GBUA 1Q2SA 1KFBA 1BQGA 2FGLA 4JDBA 1TPC1 5LZLA 2NVCA 3VIGA 1XDMA 3QFEA 2J7BA 1REQB 4WDXA 3TSMA 1RQHA 3VA8A 2FVLA 2DZTA 4PUWA 4A8NA 2ZKMX 3GRIA 2A85A 3MTWA 3TOPA 5F2LA 3URQA 2QCCA 1Z69A 1M5WA 3WIJA 1IEWA 4IOTA 1MSSA 4A6GA 1AD1A 4PMDA 4GK8A 5H1WA 2Z26A 2WC3A 1LG2A 3GU1A 4QDMA 4ALDA 1R6WA 4MLRA 3IV8A 5HMEA 1XISA 1R47A 3ZIZA 3B8UA 4BA0A 1UR0A 4IMAA 2W61A 3FXGA 4CN4A 5CSRA 1Q66A 3UZYA 4RPPA 3THUA 2CLLA 2TRSA 3WLMA 4QHRA 4W7UA 5I24A 1DTNA 3DFQA 4TO8A 2VJXA 3GQYA 4NJGA 3CS2A 4UQ9A 4NZJA 1SUXA 3HG5A 3VGBA 1Q7QA 1I2QA 4GJIA 4CQDA 5FESA 3QMSA 3PPHA 3AXIA 3R13A 3RRAA 5I07A 2DIJA 4QP0A 3LHZA 3KE0A 2VFIA 2ZTJA 4PMXA 2QZRA 4S3EA 3VXGA 3UEQA 3TC6A 2UBPC 8CGTA 3F03K 3KOFA 2PRLA 4NZ3A 1OIFA 3IVTA 3VOIA 4W84A 4JGDA 4F3HA 3STGA 1I1XA 1PIIA 2QDDA 5DMYA 3N25A 1KBBA 3HPZA 3KAOA 3QR1A 3WUEA 2ZQ0A 3LEPA 4AXKA 3UPBA 4GYKA 2VC6A 1Q5MA 3FJ4A 5DXXA 1UR9A 3OVQA 1DL3A 5FEZA 1OFRA 3TFCA 3GKAA 3N4AA 1MFVA 4JQ1A 3QY8A 4Z1BA 4WY0B 3VKAA 3DDMA 1WDRA 1VB9A 2WNWA 4JQ2A 2QDEA 2WB5A 2ZRYA 3SFWA 4F0LA 2JKEA 4F2TA 2ZX7A 1KGWA 4JEQA 4QDWA 2FH8A 4L64A 4GVIA 1W1VA 3FSUA 3A12A 4NQ1A 2Z00A 2EKGA 1U2YA 1VLIA 1MWOA 4E0CA 1VBJA 3N13A 2Z7GA 5HJYA 4ZB0A 3K46A 3EXRA 3ABSA 1DHKA 4V15A 3W29A 1Y5XA 2R8WA 4Y9OA 3VDBA 3P60A 2X30A 5CSUA 1A5OC 4XAGA 1UZ4A 5FF4A 2PDIA 5DMMA 2HS6A 3VGDA 1ISWA 2VD8A 4O1AA 4ILSA 4UQBA 5CPLA 3TJXA 1BWKA 4M6VA 4NYYA 2YLAA 1WDQA 2WXDM 4KRUA 3SY8A 3CGTA 4WJEA 1UW9A 4A4AA 4ENLA 2XFRA 1ZQ5A 3B0PA 3LY0A 2EJAA 3WH6A 3SN1A 2BHYA 1LLWA 1R85A 5GNXA 5F7UA 1WOBA 1WBJA 3TVAA 5XINA 3W26A 4CCEA 2KX9A 2CLMA 3JVAA 3QZAA 5HWMA 3FYOA 2YGYA 1K7FA 2PTZA 4GY7A 3W28A 1RZMA 1BSIA 5REQA 4LRSA 4ZVJA 1YQ2A 1E51A 4TMCA 4OUEA 2OWXA 3EKZA 1DEDA 1TX2A 2CNCA 3W7NA 3GWQA 2H3DA 4S3BA 2WZTA 1SW0A 3JZEA 3TAKA 3W3OA 1XIMA 2J27A 3P74A 1WAUA 4S3KA 1WDDA 2ISWA 2HBXA 3MSDA 1RQEA 3LI0A 2OOGA 2QVNA 4AISA 3DCPA 3B4YA 1E40A 1UWQA 2CESA 3IGXA 1CXKA 1AODA 2FMOA 4N9EA 1U1HA 4W86A 4M3PA 3AHZA 1M7OA 2C79A 1AUSL 5IOBA 1O6IA 4GY0A 1HP4A 4UTTA 2CBIA 1L2QA 2J66A 1U33A 4RK8A 2VRQA 2ZRWA 4JTEA 5JVLA 2ONEA 2WMIA 1XLJA 3WNNA 5GNZA 4XAPA 1BRLA 3W2MA 1FRBA 1BKHA 4C6CA 3MO7A 3OYXA 4OOZA 5E9AA 3V5CA 3DXIA 2QXWA 4U3AA 4MKVA 4UQDA 1TWSA 5A8PA 3H4XA 3PNZA 3OB8A 3LCIA 3FV9A 2PBGA 1EHAA 3AICA 2R9RA 2YCIX 4L7ZA 3NTYA 1N55A 4ZGYA 4TVUA 3N2MA 1XGEA 2YB1A 3BMXA 1KNWA 1P48A 3RNDA 3DG3A 2VL4A 3FAWA 3NVTA 4MWAB 2ANUA 1KFWA 3W70A 5G4EA 4QTGA 3T42A 4KPLA 2YXGA 3MSYA 3AXMA 3QQ1A 5C7HA 5I3DA 4DY1A 1XYFA 4DJDD 3LXBA 1JNEA 3RX2A 3MZNA 1S1PA 4HNNA 2GOKA 4JY8A 2HRWA 4ZXOA 2VR5A 1DJZA 1TIMA 1R2RA 3M5XA 1FKWA 2DZUA 1B2YA 2PAJA 3KZSA 4AD0A 2ISDA 2QCDB 3QVQA 4HMNA 2C1HA 2I5GA 4AIEA 3TYAA 2V82A 3UR7A 4FEZA 4G2DA 1L6SA 1GVSA 1C3FA 3KTSA 4UMAA 2I7GA 5A6TC 3W2KA 4O4WA 1G7UA 1UBSA 3IARA 1AQFA 2XINA 3DFYA 2QCDA 3D0CA 4GX8A 1K9TA 1CT5A 1XKYA 2O9OA 3FX4A 5AC8A 4ZOAA 3SZ8A 1IHIA 4JIRA 2WBKA 1HKMA 4KMQA 2QJJA 3N9KA 4NZFA 3V5FA 3DYOA 2PRMA 2PURA 6PTDA 1IV8A 4RNFA 3DEQA 3LGEA 2GQ8A 3N2XA 2VM8A 3P8IA 2QCHA 5GQBA 3T7VA 3IANA 3O9NA 1XH2A 4QXIA 4YVPA 2D3NA 3UZJA 4JTGA 3PZOA 3CAVA 3LXCA 2HNHA 3WNKA 3OZYA 2WJDA 5LIYX 3CQJA 4MJ2A 3S2JA 4LUJA 4I7UA 3VK5A 3M0VA 1F2JA 3IVSA 1PZ2A 1WDPA 1EOKA 4FNQA 4LT9A 3E1F1 4C7GA 2AL1A 2ZZ7A 2IW0A 1UHVA 2OT0A 1TQJA 2P88A 4CQAA 2E25A 4H9TA 1T41A 1LBLA 4QIUA 1YBQB 3BGAA 3OIHA 3VOFA 1J01A 4Z2IA 1JCJA 4GQBA 3GDLA 5ABFB 3CLMA 5B7ZA 1PWLA 2ALDA 3CT2A 2XTKA 4QM1A 4JX5A 4HN8A 1EF3A 1LG1A 1HP5A 4NU7A 1XWYA 2IQDA 3CLWA 4G8TA 1XLBA 5EMYA 4R7OA 3CMJA 1O5XA 4RDYA 3G1SA 1R46A 4GINA 3NAVA 2Z1BA 4LVGA 4UFKA 3BJFA 2XGIA 1LT7A 3SQMA 3UNDA 3IPWA 4D6FA 3NYZA 2VKZG 3CHEA 4HPJA 1XLLA 3GYCA 3LPPA 4UOQA 1KXVA 2I56A 1ZP3A 2FTYA 5M5DA 4A3UA 5K3VA 1FBAA 2IXUA 3OPSA 2OEJA 4Q6XA 4XSMA 4YTTA 2DZVA 1RBAA 3VAVA 3STEA 4GYFA 4U4MA 2O9PA 5FJRA 4ZSUA 3URAA 3VFLA 3AMDA 4NNCA 3F5LA 3E5BA 4Y90A 3A24A 3Q45A 4H41A 4LB4A 4PCTA 3GB6A 4DXVA 3OGRA 5E0FA 3ES8A 2O9RA 2B31A 3EWCA 4BWLA 3WQ5A 4L4PA 4XISA 1JCYA 3IAQA 4HK6A 2O7QA 1KC7A 3EA3A 2GVJA 3HG3A 3ITOA 1ZSXA 2FIQA 1Q45A 1UWRA 2JK2A 2CZVA 4D6EA 4Q8TA 1F5ZA 3ME3A 3MSGA 4P2VA 3SW6A 3N4FA 3E0LA 3AHYA 1D7FA 3KCLA 2L5HA 5K9CA 3OA3A 5G2HA 4A21A 4BF9A 4J9JA 2VFDA 5CQ1A 3ITXA 1RP9A 1D8WA 3SQSA 4C5YA 2GWGA 3ZYZA 3TQKA 5C0QA 4S1FA 4R27A 4C7DA 5DELA 5J04A 3BW2A 5G2WA 3UD6A 1IQ8A 4EP8C 4QE4A 2PDCA 2AGTA 2D0GA 3AIWA 3L68A 3S1XA 4WY0A 5D9MA 3CQ0A 3GTHA 1XX1A 5H91A 1W91A 3LLDA 1QT1A 5AC7A 3WDHA 4UTLA 4NXSA 3P8JA 3EZ4A 3SUWA 4QSHA 4QLKA 3M46A 2PFHA 4WLCA 3VGHA 1EO7A 1XH1A 3NM3A 8TIMA 1OBAA 3AXHA 1CNVA 1HKVA 2V5KA 4ZQOA 1MQQA 2G96A 4BEUA 4LY4A 4ATWA 1O94A 1UH3A 1XFBA 4NT0A 2OCZA 4B90A 1EUNA 4HNOA 5CKSA 3P82A 8A3HA 5A2AA 2CHNA 4Q8UA 5L6UA 5FF3A 3W1TA 4PRRA 3W01A 1XLAA 1XL9A 3BGJA 3N6JA 1BG4A 2CPUA 4I7VA 3CZEA 3N29A 2OVLA 3WKZA 2YYTA 2DZAA 1ADOA 4D72A 4C6QA 1WAWA 2QW5A 3H70A 1A3HA 1ZJAA 5D38A 4D6DA 3RGTA 1G1YA 2G3NA 1UWTA 4J40A 3S3GA 4FA3A 5T9CE 1UZDA 1KCKA 4FX6M 1JCNA 4I9TA 4EXQA 3T55A 3M07A 3G3DA 4JTLA 3H7VA 1HL2A 2V69A 1ZS2A 1EKOA 3QM3A 3K30A 1UKSA 2PP3A 3P7YA 2JEPA 2ZC1A 4URIA 3HGJA 4MYAA 3FEQA 2QNEA 4C6FA 1W3TA 2OLHA 3QY7A 1IZCA 1KM4A 4LEQA 2HVOA 1Q6FA 1LT8A 2C7FA 3I6EA 3MA8A 5BW6A 2E3ZA 2C1IA 5CLWA 2EO7A 1WPCA 4O1BA 1QHPA 4ZTXA 3QGVA 1QNQA 3IAPA 4XKMA 1OYAA 2CU0A 5CBIA 3PANA 4I8YA 4LAZA 4XG1A 3BLPX 1M65A 2V3DA 2EPNA 4GHRA 3W85A 1QI0A 2QEZA 3BAKA 4FXFA 1PDZA 3R89A 3S5SA 4FLSA 2R1MA 3WLKX 4MFEA 4YTSA 2YCLB 1YE6A 3M0KA 1UROA 3VIJA 3W1RA 3VD7A 3GY1A 2CC0A 3A9BA 3EDKA 3LGDA 1A5SA 5CPOA 1XLFA 3NZPA 1UOZA 3KRUA 3E3HA 3UJRA 2CIPA 3DYPA 1I9CB 5BYWA 1RQBA 2ALRA 1VCFA 3LTYA 1FWBC 4AD5A 1YBQA 2YPIA 1ELSA 3CV2A 1MYRA 1PJ9A 3CZKA 5T26A 3W84A 2F38A 1TB3A 1V4YA 3LNMA 1TWIA 4JTUA 4Z42C 1BPLB 4E3VA 3N11A 3WD1A 2WVVB 2VEGA 3V0TA 2HVNA 4I9MA 5BOOA 4MKNA 3DYMA 3FHQA 5A95A 4W9TA 3SY5A 2BVYA 3TA9A 2ZXDA 2VQUA 3MC5A 3N3MA 1MW3A 7XIMA 4UMCA 1T5AA 1UH4A 1JG9A 5HK4A 1IZJA 1EJSC 1GORA 4QSFA 5K7JA 4GVFA 3C0SA 3QN3A 3AUJA 1TR9A 2O92A 2CW6A 1SW7A 1EJTC 4PFHA 3E2RA 4YJ5A 2E9LA 4X0NA 1ME8A 4XZLX 1SJAA 1OFPA 2OWWA 3UR2A 4H9UA 1IR2A 1XIIA 2OPJA 3ZVIA 4MTVA 1J6PA 5GJPA 1YTKA 2GQAA 5EYWA 4GO9A 1TA3A 3E6EA 2JIWA 3H23A 3NSNA 5DRCA 2BVWA 3O0KA 1G67A 3AMGA 4WF7A 3VU2A 3TW9A 5DY3A 2RAGA 3O63A 1I75A 3MKKA 3CUZA 4AX7A 1K4HA 1PIGA 4IH3A 2DT3A 4AW7A 3TN5A 3EMZA 3EPNA 1VLWA 1UPPA 1I60A 2FKPA 3C2FA 3IJLA 1L6GA 2V63A 4LUTA 1OCNA 1UYQA 1RK5A 4CD5A 3AJXA 4XZNX 4JY9A 5K4ZA 2XHYA 1F3XA 1R3WA 4JNYA 1GG1A 4R33A 1B9ZA 3TTEA 4UC5A 1J0ZA 2DJLA 5BWAA 1E6PA 2BOGX 3HQPA 5AYXA 3M16A 3HPFA 1W1PA 1J9YA 1ISZA 3TAOA 3BV4A 1WZKA 4XIAA 2J7CA 2BV9A 4ZB2A 3ZWTA 1QMLA 2VR4A 3GIQA 1NOFA 3R10A 1V8EA 4ZE5A 1AMKA 4YMZA 4DM1A 2VI0A 4QG9A 4DB7A 3S83A 1K70A 1SSGA 3BJTA 2VEKA 3MMDA 2Z25A 1RSCA 5LGXA 5EMKA 1NDVA 2FVKA 4CNUA 4RV3A 3DENA 1A5CA 1QW8A 5BU6A 3U9IA 2WHMA 3VNYA 2I9EA 4PTNA 3I4KA 4WUIA 2XDFA 3R58A 3GTFA 3M0MA 3W07A 3NZRA 3HO8A 5JBEA 4B5WA 1W3KA 5EKYA 3QF0A 4ML9A 3RX4A 2J6XA 2V2HA 2NQ9A 3K8KA 1Q8AA 3B8SA 2C15A 2OLSA 1KCXA 3KBMA 1CGWA 3PBWA 5LXEA 3URBA 1MRQA 4DWSA 1JYXA 2NWSA 1JPHA 2XGZA 2REQB 3AQUA 3I6TA 1LL6A 3BPWA 1VFUA 4GI6A 1VYSX 2NQZA 3EWZA 4ZXLA 1D9EA 4D9PA 4ZZ9A 4HVXA 3MB9A 4FNUA 2BGNE 3GH4A 3LTSA 5EL1A 1SMDA 2BXZA 2A6LA 3I3DA 4IIFA 1DP0A 3BCJA 2GVEA 4I5XA 2P3ZA 5AHEA 3QGAC 4IICA 1PHQA 4P7NA 1Q85A 1G7VA 4S2BA 4U33A 4OOUA 6TAAA 2G0WA 1NDWA 1AQ0A 4M1BA 5REQB 4X2PA 5MHBA 1XRSA 4MWAD 5I3KA 3KUMA 1WYIA 5DCDA 3RM8A 2IUZA 3NO5A 3B05A 3UG3A 3WSUA 2DZSA 3B9AA 3W00A 1V3LA 1R30A 1HL9A 1X6LA 4JTDA 3AIEA 1JZ4A 3AYVA 4HSOA 1GJUA 1NAL1 4DBDA 5CC6A 4ZODA 5HXMA 1HJQA 1WP6A 1BAGA 3QV9A 3MWCA 3S5OA 2PLMA 3WF2A 2J7FA 3QQWA 2C3ZA 3GVWA 3TN3A 3BSHA 1C29A 1JXJA 1MUWA 5AOUA 4RCXA 5I78A 2J8TA 1WO2A 3QFWA 4J28A 3M6YA 4K68A 4DWSD 3OZOA 2KZHA 1XINA 1HIZA 1C9DA 4FF5A 4HA1A 1JUKA 2ZE0A 1VF8A 3A64A 4FLQA 3GDBA 4HN4A 3L23A 3LS9A 3EOUA 2WHJA 1V93A 2HJPA 3TYDA 4Z08A 2F9RA 3OG3A 5HANA 1KKOA 3QKEA 3HOJA 1MO0A 3NURA 4FNTA 3C0JA 1TV7A 1TMQA 4HZMA 2EPMX 4GQQA 3U3HA 1PYMA 2F6UA 2TYSA 3P5YA 3LDVA 1MEWA 1DPMA 3A4AA 1EJVC 2Z1SA 1XPYA 3GG7A 1E6QM 2A2IA 1O66A 2HBVA 1AW5A 4HHMA 4H83A 4MPKA 4O10A 3WL0A 2GJXA 3KL5A 3W27A 1F3EA 1LF1A 4XBKA 1CLKA 1EGVA 5FJJA 1EEXA 2JF6A 3CO8A 2ZZ2A 3U5UA 3LA4A 1OF6A 2XPKA 2VC7A 2UY5A 5F1UA 2EG8A 3NM1A 3UG8A 3JRKA 1JFXA 4JIEA 1OADA 5D03A 4IXXA 4JXCA 1VJSA 3T05A 1ZBCA 3M5ZA 4ZB5A 4JTRA 2YYUA 2G3IA 2BTMA 4TOQA 1E4NA 1VHCA 2ACRA 3KCJA 2G4FA 4LUIA 3G1HA 3OG2A 1E9ZB 4ZSTA 2QAFA 1ZZMA 2JE8A 3LCHA 1R5YA 1RJQA 3CH0A 5C9RA 1TFVA 2ZUNA 1QWGA 1VCVA 1F76A 1D7KA 4IUGA 4RR4A 4LF2A 3CTTA 1JCLA 4Y7EA 2FZBA 4KKXA 4LUSA 4Z1AA 3G8EA 2WWDA 2IKGA 3IIZA 1VFLA 3GSMA 2E77A 4UTUA 1P0NA 2PI6A 3LZ3A 2WJEA 4R7JA 3AZSA 1P6WA 5DCEA 3TWBA 3WQDA 3BQ5A 3S9YA 1MEIA 1YPIA 4HU4A 3RMJA 1RP8A 3W71A 1E1CA 1FWDC 1VJIA 5G1YA 2DSWA 3LRMA 3VGEA 3HV8A 3M47A 3RM9A 1GOIA 4KRZA 4R85A 5M17A 3UCDA 4Z2HA 3HM7A 1EH9A 4ONVA 2O56A 3E5PA 3MS8A 4ROQA 5IFTA 3QC0A 4E2BA 3AIRA 2RDWA 1RPXA 3WDPP 1MXGA 3U2CA 3G22A 5LNWA 3VMPA 3GKFA 5C6MA 4A3HA 3F4VA 1F74A 3BZJA 2A5HA 1OEPA 4CVUA 4YHGA 5CJMA 1JIBA 3OJGA 4XBSA 4LVBA 2A7NA 3RJXA 1LM1A 3L4XA 2WZEA 1DXFA 3GXNA 4TU1A 1FWRA 2E09A 4HA4A 1GKQA 1IT0A 1WKFA 3O0FA 3O05A 2CEQA 5D2VA 4K7VA 1FXPA 3CBWA 1XC6A 1RCXB 1J6OA 2PDNA 3T0AA 3MP4A 5A6BD 1XICA 2QYGA 1TVPA 3T2QA 5M2FX 3CHVA 3W7OA 2C0AA 3B0XA 3R25A 4GFSA 2FZ8A 4IIHA 1BXBA 4XD4A 4LV9A 1TMLA 2VXNA 4WKAA 4RKAA 1XRVA 2DZXA 2VX4A 3GE7A 1TV3A 4DQWA 3T9PA 1R9YA 3UWYA 3WEZA 4O57A 4JR5A 4H9ZA 2PDLA 5CGMA 2PMQA 3GTXA 3ATYA 3BUVA 4F0KA 2BBFA 4F0HA 3SECA 4IMDA 3UF9A 3TCEA 2INFA 1F4AA 1LOLA 1Q2RA 3WF4A 4N6EA 5CSYA 1EXPA 3KDNA 3PB0A 5CPNA 4MZ8A 4PUNA 4N02A 4UBPC 4INFA 3BVJA 5HNTA 4J1OA 2FB2A 4Q8OA 2ACQA 4C5ZA 1SMAA 4JFUA 3G1VA 5CZ0A 1GYNA 5H6HA 1EWDA 1DE5A 1GZ1A 3K4AA 2XWEA 1FWAC 3JS3A 3ZT5A 1C7SA 4L1XA 1ESWA 4KCTA 3KOWA 4TUFA 2DVXA 3GR8A 2PWDA 5CZJA 5A5WA 1BXNA 3NSXA 2Y4SA 3CEPA 1AZ1A 1ZP4A 2V9DA 3WBEA 2FPYA 3HPSA 3QV6A 5A8QA 3UPMA 1ZENA 2J9XA 4RNIA 1EO5A 2E8ZA 3UVIA 4L6OA 3BAYA 3NQAA 4LRTA 2E40A 1CGXA 3EPOA 2DSZA 4TV5A 4ZBCA 3RFAA 3W38A 3NEHA 4H7CA 2NUWA 3ITVA 2G97A 3LN3A 1VS1A 4P7RA 1UR3M 3GG1A 5ECVA 1A50A 3K4DA 1KM3A 4Z2LA 4MZYA 2GWNA 1YEYA 3PWIA 2I17A 3QPZA 1RXOB 3NQGA 3I10A 4LUTB 2WOQA 3GG8A 3T6CA 3ARZA 5IHRA 3E49A 3CASA 4PTXA 3GXFA 3MCMA 1BVNP 4PBEA 1EC7A 3NEVA 3WN6A 3YPIA 4FX7A 3C2OA 3SRFA 4N0RA 4LS2A 2PWUA 3TTSA 3F7JA 3GTIA 5E0CA 1XLHA 5EGRA 1POJA 4UXDA 5T8GA 3VIIA 1Q6OA 3VNDA 4IMCA 1IR1A 1Q65A 4FLRA 2WSKA 2FVMA 3F4CA 4OHQA 1TPWA 3B0UX 4AHPA 1KKRA 3SI9A 2A3HA 3IJ7A 4WR3A 2BVDA 3BW3A 4KS0A 1HO1A 2QCFA 1XIEA 4AZCB 3TYBA 1W0MA 1IEIA 2PDWA 1H7OA 1GHSA 1GONA 1NSJA 1QO5A 1MZRA 3SCPA 3WLOA 3ZWSA 4CD6A 1EDTA 5AC4A 1EQPA 3GNRA 2YZ5A 4UB9A 1UG6A 1AD4A 3W2LA 1WB0A 2NX1A 4WIWA 4IIEA 3RLHA 3UR8A 3GNDA 3H4GA 2D2HA 2ZZ3A 2PLKA 3GUGA 4BHYA 3PPFA 2ZUTA 5AN7A 1W5PA 3B03A 3TFXA 3VUSA 4D1JA 4M82A 2X05A 2J9ZA 3OBEA 3FGCA 3JW7A 7CGTA 3T07A 1P0KA 4IJRA 5EFFA 5KITA 3SJ3A 3LI1A 4H6EA 3TQVA 3C2YA 1TTJA 3VMNA 4IPPA 5IHSA 4I8DA 2J62A 1YDVA 2QUMA 3P93A 1P0DA 2YW3A 4IZGA 3UJFA 5HQEA 1XH0A 4P5UA 3ZLHA 5BOEA 2PD9A 3LK6A 4MB5A 3ONBA 2YIHA 3V1PA 5LIXX 2ESCA 1CTNA 2YL9A 1QNSA 5CPMA 1NM9A 3AALA 4O14A 3U7BA 2I5IA 2VOMA 1NARA 5HMSA 3GC2A 1UD2A 1S5TA 3VZXA 4IQDA 3MU7A 3PBYA 4BWLC 1EJWC 1XLCA 4MADA 5ENLA 4AMAA 3VTRA 1KR0A 1D3GA 3H2AA 1GQKA 3UZZA 3MHUA 3B0VC 4KGLA 3M0JA 3LBOA 4RXGA 1HT6A 3GHSA 1GHRA 2XIJA 2MUCA 2E6AA 3COTA 2QR6A 3NO3A 3VD3A 4NJKA 5D2XA 1IWBA 5EMLA 3Q2DA 4RZ6A 5FJOA 3KEHA 3CUHA 4R34A 3D46A 3LG3A 3SR7A 5FJTA 4AWTA 3SCUA 2ZRUA 1N8IA 2PDKA 3WDQA 2DUAA 2IPFA 4C6IA 1TV2A 1A47A 4K1WA 1IIGA 4TVCA 1VH7A 3BAJA 1P0EA 7REQA 3S2NA 2EPLX 3BLEA 4TQTA 7ENLA 3FNDA 3K13A 2J13A 1TQXA 3WD4A 1JAEA 5GJMA 2W62A 1B90A 3W24A 3DESA 1L6YA 3NXLA 3SURA 5KINA 2G5WA 3MV11 2CKRA 1CWYA 1CXIA 2BY2A 4PCPA 5IBXC 3CV1A 3ICJA 3NJ3A 1E6RA 3NQFA 4GXPA 1K7XA 1IGSA 3ARRA 2OQYA 1UC5A 2FGBA 4GIYA 4J35A 1OZMA 1PX3A 1QO2A 1VIWA 1Q3NA 2KAUC 4I90A 3OLEA 4NUWA 1LQ0A 4OBRA 4O17A 4WY0F 5FSEC 1FWHC 1Z44A 4MGGA 3UGRA 1BG9A 2P0IA 1H63A 1M1BA 3L4WA 2OSWA 2BOFX 3ELFA 4PULA 3L2IA 1FWJC 2VEMA 4N2YA 4OGZA 1YXDA 3QSRA 1SZEA 4Z2GA