1BQCA

Beta-mannanase from thermomonospora fusca
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
302
structure length
302
Chain Sequence
ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHDHSDGNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-MANNANASE)
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
molecule tags Hydrolase
total genus 134
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1bqcA00
2D0FA 1OT1A 1ODUA 1OGBA 2V5DA 2PI6A 5D9MA 1GW1A 1PAMA 4KGLA 4BZYA 4QCEA 1H0GA 3SCNA 2WHMA 4GO8A 2YKKA 8A3HA 3A3HA 4PTVA 1CXKA 4CD5A 4WKHA 3VGHA 2CPUA 2BHZA 3VOCA 1HNYA 3CHDA 2UWFA 1E6XM 1MFUA 1KWGA 3AMGA 3CLWA 3VTRA 4J3TA 1QNQA 4JFVA 2O9TA 3GNPA 1ISXA 2D3LA 5A6KA 3BCFA 1LF1A 1CGYA 4DUXA 2DSZA 3ARSA 2J7CA 4M81A 3VNYA 3DYOA 2B31A 3AIBA 4J3WA 4AD0A 3ARZA 1F4HA 1Q6DA 4KRTA 2CBVA 2JEQA 3UG4A 1HT6A 2ZUVA 3AJ7A 1CENA 3IJ9A 3QOKA 4PUEA 1W1YA 3NIYA 4D6JA 2VQTA 5JUVA 3AS1A 2J8FA 4Z2HA 4W87A 1E55A 3UCQA 3WNLA 1J11A 2PF0A 2WW5A 1C92A 3WF1A 4OOUA 2WC4A 4B16A 1W9DM 2WVVA 3T2PA 4W7VA 3AMDA 1ISWA 4AIUA 1BLIA 1J12A 4HOZA 4W7WA 2XSBA 1UKOA 2YA0A 1CBGA 6CGTA 3IAPA 1C3FA 4C7DA 5CLWA 3WSUA 2ZXDA 4UNIA 3KZSA 6TAAA 4W88A 4E4PA 3WDIA 2A3AA 3GXDA 1WP6A 1IV8A 1UG6A 1BVZA 3POHA 2OWCA 3VILA 2A3CA 3THDA 4PMRA 4WSKA 1V0KA 4ACZB 2YBUA 1EO7A 4Z2IA 4NF7A 3WBAA 2O92A 3AS0A 3VU2A 1UKTA 1JG9A 4H2CA 4GXPA 2WCGA 1BQCA 2WMKA 1OINA 1WKYA 1H5VA 3QR3A 3N9KA 5KZ6A 5ABHA 3BLKA 2J77A 3RM8A 1GOWA 1C8QA 1CXFA 5DFAA 1UZ4A 3RMEA 4DUWA 1QPKA 3SUTA 1EXPA 5BYWA 1E56A 2O9OA 2VX6A 3VGEA 1V3HA 4TOQA 3NDYA 2VRJA 1JF5A 1HJWA 1NOFA 3SUWA 1OWQA 1OT2A 4P8WA 4DWSB 3L4ZA 1VIWA 1TA3B 3A47A 4HMCA 4TUFA 1HX0A 3AIWA 3AIEA 2YLAA 1CGVA 1EDQA 3RILA 4PTXA 1HKMA 4QFUA 2BVTA 3BAKA 2XWDA 3G6MA 3W25A 1AQMA 1H0IA 1O6IA 5BCAA 1ECEA 3WQWA 3GNRA 2G3JA 2BY1A 1UWTA 4Z2GA 1GHSA 5ABEA 2D2OA 3I3DA 5D4YA 5A69A 2EPOA 1FHLA 4MPKA 1JGIA 5FL1A 4UOJA 2DGAA 2Y24A 4HZ6A 4UQBA 3VD3A 3K8MA 2WSPA 3VD4A 3BAJA 3GXFA 1AVAA 4W84A 1CZ1A 4R5EA 4JCMA 4WLCA 3OLEA 1BF2A 4U2YA 2QMJA 1J18A 2WKGA 1BHGA 4HPHA 3ARXA 4OJYA 1Q6FA 2VUYA 3AYSA 4TX6A 2VI0A 2G3MA 3VIKA 3VNZA 4JL2A 4D6HA 3DYMA 1RD6A 4FLQA 5E6ZA 5FL0A 5I3DA 4UQ9A 5DT7A 4CD4A 1CGXA 2V5CA 3L2LA 1H4PA 2WHKA 3NSMA 2GJXB 2OSWA 3WD0A 3LPFA 1VFOA 1J10A 1E43A 5GQBA 2MANA 4JIEA 1OM0A 5CPSA 2WZHA 1KGUA 1UWUA 5C70A 3WMBA 2VZVA 3ZOAA 4TVCA 4FLOA 2XFYA 4M56A 3T2OA 1GVYA 5BROA 2VVNA 1QHPA 3VM7A 1MFVA 1KXHA 2BXYA 1UR4A 2WBGA 4M80A 5GNZA 3OZPA 1Z32X 1VJSA 4UCFA 1TCMA 3HJEA 2WPGA 1EHAA 4MTVA 1U33A 1OBAA 2D24A 2VZTA 1E71M 4XUYA 4HMEA 1VF8A 3WH6A 1XSKA 4J3SA 2X8RA 3EBVA 1E72M 2J7FA 2QV4A 2WM0A 1ZB5A 3OIHA 1NWTA 3N13A 3O2LA 5FD0A 1JZ4A 1ISZA 2VNCA 3VIJA 5I78A 4CN6A 1HVXA 5D8WA 1BGGA 2JIWA 4S3JA 3CZ8A 3D5HA 2BNJA 2YL6A 3KEHA 1M01A 3SCPA 4RE3A 2JF6A 1H11A 1XRVA 1G94A 2CERA 1JFXA 3AISA 1E6PA 3DC0A 7TAAA 2J74A 2WVTA 3WBEA 1TE1A 2E40A 1CLXA 4BQ5A 2F8QA 4OOZA 4UQDA 3WMCA 4GQRA 3CZKA 2Y4SA 5IHRA 4WKAA 1DWGM 1E9LA 1W1TA 4HPGA 1LL4A 3D3AA 5A8QA 1UQYA 2QPUA 1QW8A 1MXGA 4MJ4A 2HVMA 1MW3A 4JFSA 4UQEA 5IFTA 3IAQA 3WF3A 5C8BB 2VCCA 2ZUWA 4PTMA 1UR9A 4U3CA 2J7DA 5DF0A 2J7HA 3PZTA 2GSJA 1JDDA 3ZR5A 1UR8A 1DWJM 4OBSA 4QLJA 4Z2LA 3W37A 5GPRA 4H41A 1V3IA 1HJSA 1GHRA 2WVVB 3RJYA 4AEEA 1J9YA 4Z2KA 3FNDA 3OB8A 5CGTA 3J7HA 3WH9A 3OGSA 1NARA 3OA5A 1GOMA 3WDQA 1X6LA 1UKSA 3N1AA 3ZO9A 2J75A 1R85A 1S46A 4HA1A 2O9RA 2W92A 2XIBA 1BYDA 4GQQA 1MWOA 4YPJA 3VD7A 3PZMA 3AFBA 1J0KA 2WXDM 1EGZA 3AROA 1CDGA 3M7SA 1OIFA 1CGWA 2PBOA 3B9EA 3CTTA 1E70M 2V38A 4AIOA 1HXJA 3U5UA 3MMDA 4U33A 1QVBA 2WCSA 1M7XA 1UD2A 1KBBA 4KRUA 3WQ4A 4NZCA 5A6LA 2BHYA 2PWDA 1CECA 3LPGA 3AHYA 1M53A 4P7NA 1IZKA 5M03A 4CKQA 5BRPA 4RE2A 1UR2A 2TAAA 1BAGA 4D6CA 1PPIA 1BFNA 4WIWA 4W89A 1G9HA 3G6LA 2J4GA 4B9YA 5JBDA 3MSDA 4UQAA 2NW0A 3WIJA 4RL3A 1LWHA 1XH2A 1UD3A 3WFZA 4GZEA 3II1A 4M1RA 5FIPA 3UR7A 2FGZA 1W3LA 3VM5A 3WH7A 4UZUA 4AIEA 2DT3A 3AYRA 4A3HA 5JIWA 1AMYA 3EDKA 3MMWA 2J78A 3TA9A 3NJ3A 1LG1A 4N0RA 1N82A 5DT5A 1FH7A 1QI2A 2ZXBA 4D1JA 2CHNA 1EOKA 1UH4A 2BFGA 4P8VA 2UY2A 2WSKA 5CGMA 4CVWA 4EANA 3CHFA 1HL9A 2JF7A 2WYSA 5I77A 4UOZA 3BAYA 4QAWA 2EQDA 4U5IA 3W27A 1A47A 2DEPA 1ZU8A 1A3HA 1JD7A 5BXPA 1GUVA 3ZT5A 1ZBWA 2WNWA 3OGRA 1I75A 4EE9A 1PIGA 3LPOA 3VIFA 5KEZA 1MW0A 2IXVA 3VO0A 1LLOA 1NWSA 4YHEA 3EDEA 1FFRA 4GZJA 1GCYA 2D3NA 3EMQA 4H8VA 3IK2A 1DWAM 2C7FA 2QPSA 3AS2A 1H41A 4NRSA 3ZMRA 4JCLA 2Q8XA 1DP0A 1OIMA 1UWRA 4D6DA 3WY1A 3WFLA 3AZTA 3VIGA 1PIFA 1WDRA 3WUGA 4IM4A 1AQ0A 1B3VA 4MADA 1UHVA 4UQCA 1ZBVA 2W63A 5A95A 4D6EA 2XG9A 3I3BA 1J0ZA 2DSVA 3GXIA 3F5KA 2V3DA 1OSEA 4MNLA 2Y8VA 4CCEA 3L4XA 6A3HA 1TVNA 1R8LA 2EPKX 4UFLA 1E4IA 4WSJA 7A3HA 1E6RA 1QNOA 1UH2A 2ZE0A 3WKZA 2JEPA 3RO8A 4E2OA 4LQ1A 4XZWA 2VMFA 4S3KA 2DH2A 5A3HA 2ZXQA 3U7VA 1LJYA 5IDIA 1GONA 3L4VA 2OWWA 3OGVA 4F9JA 3B9AA 4W85A 3TTYA 3RCNA 3A6OA 1E5NA 3UERA 4ACYA 1OB0A 5I23A 1V0MA 1CWYA 3QGVA 1JDCA 1HIZA 1QI5A 4EK7A 1V0LA 3QHNA 1DWHM 1HN1A 3WNPA 5M3WA 3BSHA 2VX4A 2NT1A 1G1YA 2CBJA 1NOUA 5I0DA 1VFFA 1VFMA 3PZQA 2EJ1A 1J0JA 3AXIA 1XD0A 2VOTA 3PZ9A 1ISYA 1HJXA 1O7AA 4FK9A 2GDUA 2WLYA 4W93A 2J79A 3MO4A 1LQ0A 3CHCA 2G3IA 2BY0A 2YOCA 1SMAA 3QOMA 3TTSA 2J7GA 3OLDA 5EFDA 3SUVA 1KWKA 3AIUA 3W38A 4N42A 4XZBA 1SFSA 5I2UA 1V03A 1V6VA 3L4WA 2ESCA 4JHOA 3WQVA 3ARYA 4GINA 2YL9A 4XB3A 5I79A 3MSGA 3K8KA 1FOBA 2FDMA 2CNCA 1KCKA 3N17A 1TVPA 3CUGA 2VJXA 1NWUA 1B31A 4J3VA 3BGAA 1WDPA 4AW7A 3VX0A 3WDPP 1VAHA 4PMOA 1UWIA 3BMVA 1W2VA 2G4FA 4C7FA 1XYFA 1XC6A 1KR0A 4IPLA 1JXKA 5E70A 2JE8A 3ARWA 3BCDA 3MV11 4PMXA 2J8GA 2E9MA 4HZ7A 2EXOA 1JL8A 3FN9A 3AMLA 5A8OA 4K68A 3VD5A 2ZX9A 5CG0A 2OSYA 1W3JA 1CXHA 4MB5A 4X9YA 5BWFA 1H2JA 5FCZA 3VDAA 1K9EA 2CIPA 2OSXA 3SCWA 3MUY1 4J28A 3VDCA 2PC8A 4CU6A 1VBRA 2WBKA 3BH4A 2CETA 1FA2A 1B9ZA 3AHZA 1CTNA 4ZFMA 1BYCA 3OLGA 1PJ9A 4UFMA 2YIHA 5JIPA 1ODZA 1VJZA 2G41A 2VT0A 4LXFA 1K9TA 2XGIA 5D8ZA 4ML4A 1IZJA 1GPFA 4M8UA 1XH0A 3ALGA 5HNNA 4H7VA 2XIIA 2ZXAA 3UEQA 2D23A 4ZEPA 4GO9A 1V6XA 2DSUA 1V3MA 4IPNB 2JFEX 1F4AA 5CPTA 1VEPA 3SCOA 2ZX6A 4U31A 4MB1A 3SCVA 3IANA 1E1FA 1UD8A 1UKQA 1TFVA 4AWEA 4HMDA 2OLHA 1LWJA 1UH3A 4CD7A 4C7GA 2BY2A 4J3UA 5M5DA 3B9DA 5AY7A 4TVUA 3DECA 1JFHA 3SUSA 1OGSA 4PMUA 1XSIA 2XTKA 4JHZA 2WZIA 5A1AA 4L4OA 5TD4A 4M82A 4P7OA 4PMQA 3CIVA 2ZWZA 1CPUA 3WELA 5BXTA 2YA2A 1KXVA 2FH6A 3VGGA 4PCTA 3A4AA 4B15A 5A6BD 3OLIA 1J0HA 4NSBA 1QBAA 3RIKA 1GOQA 3CUJA 1QNRA 3BAIA 1GVIA 3GH5A 5E0CA 1Y7VA 3SCTA 3TP4A 1E4LA 2DIJA 2YBTA 4DWSC 4V2XA 2Y2WA 1P6WA 1JYWA 1WDSA 4AZHA 1JZ5A 1BPLB 3MUAA 1V02A 3AOFA 3WF0A 2Y5EA 2GDVA 5IHSA 1BGAA 3CUFA 4QCFA 3FHAA 3EDJA 4LYRA 3BAWA 1US3A 1GNXA 1W9XA 4F79A 2PBGA 4WF7A 1MQRA 1XH1A 3MUZ1 2EPNA 4PSRA 3W82A 2JIEA 3HN3A 1WZLA 3LPPA 5I24A 4PBGA 5I6SA 3T09A 1ITXA 2DH3A 4JKMA 3IJ8A 4ATLA 3WH8A 1GJUA 1YHTA 3NDZA 1ISVA 3NCOA 1W9VA 1XYZA 1E4NA 1V3JA 4W5UA 4GZIA 2GJPA 3CZJA 1JD9A 1HVQA 3UR8A 3PZNA 1NM9A 5EB8A 4J7RA 2BXZA 5ABGA 5F7UA 3L4TA 4LPCA 1FP8A 3VIHA 3ZT6A 1BVNP 1RPKA 4B3KA 2E3ZA 1C91A 2DSKA 2WMJA 2FHBA 4X0NA 4HTYA 5JBFA 3ZJKA 3WQ6A 3VGDA 4M24A 2FHCA 2DT2A 1KB3A 4OKDA 4GI8A 1NOWA 4U5KA 1LL6A 1AQHA 5A6BA 3N04A 3SIMA 5CQ1A 3VDBA 3ARUA 1HP5A 4P8XA 2XM2A 1E3ZA 3WEMA 1CNVA 4ATWA 5CSUA 1E15A 2D0HA 4PMVA 2WC3A 3E1F1 3L4YA 2ZICA 5DEZA 2CKRA 2WMIA 4KH2A 2VRKA 3WDHA 1EQCA 4MDPA 4AEFA 2GVYA 3AHTA 1UZ1A 3GDBA 4X0VA 1WCGA 4AZIA 1QHOA 3AI0A 5ABFA 2YL5A 3AICA 3GBDA 2NSXA 2D20A 3RM9A 1ZBCA 1US2A 3ARRA 1VB9A 2WLZA 1HF6A 3N11A 4AD1A 3ARPA 4DM1A 3WDJA 3CZEA 1VEOA 4LYQA 3CGTA 3S6TA 4KGJA 3WN6A 1JYNA 3WD4A 1HJQA 4D71A 1MYRA 1X6NA 4TTUA 3WL0A 3RDKA 1KR1A 1JAKA 2XUCA 4QP0A 1H09A 3PZOA 4B3LA 1EIBA 1WZKA 2J7BA 1WB0A 1QI3A 1NQ6A 2XHYA 1FHDA 3EMZA 4AXNA 5D9OA 4DM2A 1QNPA 3PZIA 2J47A 2VCAA 3KL5A 3U5YA 3PZGA 2VQUA 1FFQA 3NUKA 1GJWA 5E6YA 1LG2A 1UR0A 2XVKA 2XPKA 3W53A 3PTKA 3EYPA 1R7OA 4MJ2A 5AC5A 3KWXA 3W4RA 1R86A 3W28A 1EDTA 2PB1A 3BAXA 4Y7EA 5AYIA 2VR4A 2QF8A 2YDSA 3AIRA 1PX8A 2JALA 5A6SA 2D22A 1HKIA 2VCBA 2XVGA 3WNOA 3BMWA 3ZSTA 2ZIDA 1WZMA 4JKLA 2DSWA 1NH6A 2VZSA 4AD2A 2O9PA 5BXSA 1B30A 4GI9A 4PUDA 4AZ5A 2DT0A 1BTCA 2XFFA 1WPCA 2CHOA 5EFFA 1W2PA 3A4WA 3AHXA 5CSYA 4BQ2A 3ZM8A 4F8XA 4AD5A 1W9UA 3OZOA 5CZKA 3F5LA 4UFIA 3GZAA 4AZBA 1PX3A 4CN4A 1Q4NX 1J0YA 1UUQA 4QDMA 1EQPA 5HXMA 3DHPA 2ZUMA 4DUVA 1V6YA 1KGWA 3VIOA 1JIBA 3T0AA 3T08A 3CMJA 4E8DA 3LMYA 3W26A 4HU8A 4PTWA 5D9PA 2YL8A 3MV01 1WAWA 2BY3A 5DO8A 4D72A 3ZIZA 1GOKA 2CXGA 3PTQA 2WMHA 2X05A 5CJ5A 3K46A 4GI6A 1VENA 2VX7A 4FLSA 4PMDA 1SR0A 1H1NA 4W86A 1V3LA 1TG7A 3ZQ9A 1B0IA 2GK1A 4MAVA 1D7FA 3S2CA 2E8YA 1U2YA 3WNNA 2EPLX 2BVYA 2IUZA 3AMCA 2WB5A 2YLLA 1M03A 4AY1A 1CXEA 3I3EA 4OIFA 1NP2A 4BQ4A 1WZAA 3VIPA 1E3XA 1E0WA 3WQ8A 3O9NA 4D6GA 3FY1A 1FH8A 3SCQA 3UG5A 3WL1A 1CGUA 3AQUA 1OD0A 3KE0A 3EDFA 2CESA 4U2ZA 3WEZA 4ZXOA 1JXJA 1E4MM 2ZUSA 4PN2A 4UFHA 3T0BA 2XVLA 3FHQA 1QHZA 1XCXA 1W1VA 1UQZA 1HJVA 2Z1SA 2QHAA 1K9DA 1MQQA 1JZ8A 2VZOA 2CITA 4HP5A 4GKLA 3W0KA 3SUUA 2WANA 1GORA 3BC9A 4UZSA 4AYSA 5A94A 1ITCA 2VZUA 4FMVA 2XVNA 3VDHA 2WWDA 1UD6A 4PSPA 1KXQA 3M07A 3GXMA 1UWQA 4JKKA 1G0CA 1JI1A 1TZ7A 3ARTA 4YN5A 4HOWA 2GFTA 4LGXA 3JUGA 3GH4A 1B90A 1JZ6A 1V02E 3EDDA 2BV9A 3VIMA 1E6SM 3TTOA 3F5JA 4P7LA 4Z2JA 1VBUA 2G8ZA 2XGBA 3FW6A 4CD8A 2FH8A 8CGTA 2C0HA 5IXEA 9CGTA 3PZVA 1KFWA 3W6LA 4TVDA 4ZE5A 1CXIA 1DTUA 2YA1A 4HZ8A 4KWUA 4GPNA 3L4UA 3PZUA 4R27A 1EA9C 1HL8A 3WD3A 3F4VA 3PN8A 3PHAA 4FLRA 3AZRA 1PZ2A 4H04A 2GJRA 3ZJ7A 1K6AA 2F2HA 2A3EA 3QHMA 2WC7A 4V27A 5EBAA 3W81A 1E6QM 3RJXA 4V28A 3HU7A 1C8YA 1EH9A 2WMFA 1B2YA 2YDRA 2ZOXA 3CZGA 2Y8KA 4Q22A 4CCCA 4BCEA 2WMIB 2E9BA 5ECUA 4ATDA 1J0IA 2X0YA 5A2AA 1E6NA 3SCRA 2XJ7A 1R7AA 2E9LA 2VRQA 4URIA 4HA4A 1MW2A 5ABFB 4A4AA 1BG4A 3EMCA 4F9DA 5EMYA 1EHNA 3DHUA 2CEQA 4EAMA 1QI4A 1MXDA 3GM8A 3SCUA 2CKSA 1CIUA 1CEOA 1E73M 1JNDA 4MAZA 1KQZA 1ZJBA 3AMKA 2PWGA 3WMSA 4PRWA 2AOSA 3VX1A 2XVPA 4W5ZA 1B3WA 4AZGA 3VGFA 2EBNA 3CHEA 1WE5A 1ZS2A 3U7BA 1E0VA 1E0XA 2WHJA 3POCA 1SYTA 5A8MA 5A2CA 1UYQA 5IFPA 3WEOA 2G3NA 5GNXA 4HU0A 2DT1A 4QLKA 3L2MA 1W3KA 1GQKA 4RE4A 4ZE4A 1MVYA 2VX5A 1JDAA 1W3HA 4F66A 1V08A 1WDQA 4J3XA 5CLTA 3ARQA 5A8NA 3VGBA 2WK2A 3WNMA 4TTGA 1PBGA 2PWEA 1CYGA 2PWHA 1G5AA 2QMKA 3ZJ6A 2ZX8A 3MKKA 7CGTA 2AAAA 3VMNA 3AZSA 1DWIM 4MNKA 4J27A 2X09A 2OYKA 1GZJA 4B9ZA 1BYBA 2W91A 2D1ZA 1UWSA 2A3HA 3KL0A 3FAWA 5A6MA 1K9FA 1OGGA 3BXWA 2UY3A 1UA7A 2XWEA 4PMZA 3T0DA 1Q6EA 2X1IA 1YQ2A 1Q6GA 2ZX5A 3M6DA 3QHOA 3CMGA 3VIIA 5E0FA 4AZCA 1TR1A 2W4XA 3ALFA 1J01A 5D9NA 1U30A 1JZ7A 3ECQA 2DPEA 1E5JA 2VURA 2BHUA 1W1PA 3WNKA 2DQXA 4AC1X 1WO2A 4UR9A 3ARVA 4UFKA 4P7RA 1MW1A 1L8NA 1W32A 1SMDA 4TXEA 4WK9A 2IXUA 4P8UA 1QBBA 2VO5A 3WUFA 2X2YA 3APGA 4CD6A 1JZ2A 1W9PA 1RH9A 2DIEA 5A8PA 1CGTA 1M04A 4PMYA 3W6MA 2WWCA 1UA3A 4CCDA 3ZT7A 2AMGA 3IJ7A 4P7QA 3TONA 2GK1B 2OYMA 2Z1KA 4MB3A 1KGXA 2CBIA 2J25A 5A6JA 4QLLA 1V6WA 3VINA 3BSGA 1D2KA 1B3ZA 1HKKA 3K4AA 2RGLA 4LX4A 1WNOA 4TX8A 1H3GA 2E0PA 2W61A 3WF2A 1UOKA 1HP4A 3WF4A 4L4PA 3SCSA 4ZENA 1CXLA 2CBUA 4CU8A 1EOMA 3PTMA 4CN1A 3VD9A 4AZ7A 1W91A 1QNSA 5HPCA 4A3YA 3CBWA 4CU7A 4W8LA 1JAEA 2XFRA 5A6AA 2YDQA 2WKLA 4UOQA 2J7EA 5C71A 4AZ6A 4U3AA 2V3GA 2VR5A 1KQYA 1DHKA 4W8AA 2XSAA 1B1YA 2CCRA 1BG9A 3AIVA 2D0GA 4W7UA 2X0HA 1QW9A 4CVUA 5LA0A 1XCWA 2ZX7A 3AIQA 2VVSA 2YJQA 2BVDA 4AMCA 3AXHA 1V6UA 4DWSD 1C8XA 2FHFA 5M17A 2VTFA 1ZBKA 5LA1A 4BF7A 1LL7A 1RP8A 3AS3A 2WVSA 4AISA 4JFWA 1XHGA 3W29A 3SURA 2V3FA 2PWFA 2C8NA 1MQPA 1Q6CA 2W62A 3A4XA 5AC4A 1E1EA 3GBEA 3VMPA 2J62A 3U57A 4OZOA 2WZEA 1GQLA 3FAXA 4YHGA 3VMOA 2UY5A 3ZSSA 1B3YA 4LYPA 4MB4A 3CUIA 1X1NA 2A3BA 1ESWA 1ZJAA 1NWRA 4IISA 4D6IA 3WUEA 3HMCA 3AHVA 4JFUA 2W67A 4XX6A 2GUYA 1EDGA 1XSJA 3THCA 3UETA 4M29A 5HBFA 3TTQA 3CH9A 2ZUUA 2W66A 4HA3A 4ACZA 1E6ZA 1H49A 2FGLA 3VVGA 5A2BA 2UY4A 1HJUA 4MNMA 3VKKA 4H8UA 5CPQA 3MUIA 3CZLA 4W8BA 3MANA 5HDRA 1KCLA 3GTNA 3TOPA 2WAGA 3WH5A 4JZ5A 1VFUA 2F61A 2ZUTA 1C90A 5BRQA 2E8ZA 3WUBA 1D3CA 1XV8A 4BS0A 1JNEA 3NSNA 1VEMA 4UFJA 4EKJA 3CO4A 2EO7A 1C7SA 3ZJ8A 4DWSA 1HKJA 4MDOA 1TA3A 3RPMA 2EEXA 1FP9A 5FKYA 4BA0A 3CUHA 3B8SA 3BLPX 4PCSA 3N18A 4NRRA 4KMQA 5LYRA 3GH7A 1IT0A 2WCAA 3OG2A 4D1IA 5E09A 2QLYA 1C93A 3ZR6A 1DWFM 3O6AA 1ZL1A 2ZUNA 1PZ3A 3K4DA 3UG3A 3VPLA 2BS9A 1XD1A 3VUPA 3WD1A 3WQ5A 4HOXA 2DDXA 3WENA 2E4TA 1KXTA 4MNJA 4AD4A 5LA2A 1VRXA 3WDRA 3GNOA 3K1DA 2XYLA 5GNYA 1BSIA 3CPUA 3AXXA 1JYVA 1DEDA 4BQ3A 1GQJA 2OWXA 2WMGA 3FXYA 1UD4A 4CUCA 1C7TA 3RM4A 5I5RA 1I1XA 4JAWA 1UD5A 1GOIA 1G01A 5CXPA 4ZXLA 3UESA 4UTFA 3MMUA 1B3XA 4WJXA 4XV0A 5DMYA 3NYDA 3PBGA 4AZCB 3SEPA 1W9BM 1E40A 1GQIA 2NT0A 4PMNA 4FF5A 5E9AA 1TMQA 3K8LA 2ZWYA 1JZ3A 4OBRA 1OD8A 2W5FA 5HPOA 4OUEA 1RP9A 2GJXA 1GOOA 4NI3A 1QOXA 4D6FA 3WD2A 1OCQA 1V0NA 4GIAA 4AD3A 4JL1A 2RGMA 2OYLA 1JYXA 2WHLA 2VL4A 4PYSA 4PEEA 4E8CA 1L0PA 5AYBA 3OBAA 3M46A 1UKPA 2CYGA 1R87A 5FOOA 1KBKA 1PX4A 5JBEA 1CLVA 1I1WA 4IUGA 1PEZA 3MU7A 2VC9A 4JFTA 5BXRA 1JI2A 1NP0A 3KL3A 2XM1A 1TUXA 4H8HA 3NSXA 1EO5A 1QI0A 2V3EA 3T2QA 3N15A 1XGZA 3MS8A 1UR1A 1V3KA 4Q7NA 2WVUA 3DYPA 5HOSA 4CGTA 2HISA 3W24A 1FH9A 4WKFA 1BYAA 1JF6A 2EPMX 3GYCA 3N12A
chains in the Genus database with same CATH superfamily
1OT1A 3QV7A 1ODUA 5E9XA 2V5DA 5D9MA 1Z8AA 4JIPA 5HINA 3D3FA 1H0GA 3SCNA 4FNSA 4IWWA 3QFWA 1LBLA 4PTVA 4QAIA 4CD5A 1UR3M 1AL8A 3NQ8A 4WKHA 4B91A 3VOCA 1EJRC 5EMKA 1KWGA 3VTRA 4J3TA 4G7FA 4Q4OA 2CWNA 1QNQA 4JFVA 1IXQA 3LERA 3BCFA 4DF0A 4F2UA 2DSZA 1S38A 3ARSA 2QNEA 4M81A 1XKYA 2B31A 4J3WA 3CV6A 4Q4SA 4S39A 4GX8A 3TWAA 4MWAD 2VD8A 2XIQA 4KRTA 5F4WA 3UG4A 3T78A 3LV5A 3AO0A 2Z1BA 3WCZA 3UVAA 3H4XA 1EJWC 4G7EA 4W87A 1Q2RA 1E55A 4JIRA 4ERGA 9XIMA 3UW6A 4G8TA 5KETA 3EOEA 4S23A 3QH2A 2XSBA 3GVVA 4JICA 1CBGA 1KTCA 3W83A 3C0LA 4ZVJA 4TMCA 3B9OA 5CLWA 1LRQA 1W5QA 3S9YA 1VPYA 4ADSA 6TAAA 4US5D 3AUJA 4G56A 3TQPA 4KCVA 2A3AA 4NL1A 2OVLA 3PANA 3POHA 5LIXX 3R94A 1V0KA 2PDQA 1JVNA 4Z2IA 2Y85A 2DV0A 4IQLA 1Q6OA 2O92A 4GCXA 4FOJA 3S5ZA 3VU2A 3W85A 2PZ0A 4I90A 1UKTA 1JQVA 4GXPA 2WCGA 2C1IA 4M1BA 1OINA 4F0LA 5G2IA 1DL3A 1Q2SA 3BLKA 3CS2A 2Z00A 1GOWA 2OQYA 1CXFA 5DFAA 3TYUA 1RA0A 5D2TA 4ASTA 1NAL1 4GD0A 3UNTA 5BYWA 3AJXA 4ZL1A 2P3ZA 3VGEA 3KCJA 4TOQA 4MZ8A 4EPEC 3FX4A 1HJWA 1IEVA 1NOFA 1RHCA 1OWQA 1VCFA 4JS3A 2BXVA 4DNHA 4DWSB 4YTUA 1NELA 3K5XA 4TUFA 1WAUA 1HFBA 2Z2UA 4H3DA 3QKEA 3BSMA 1WQ5A 4K1WA 3BCJA 1A80A 3LGEA 5BCAA 1MSSA 4NAFB 1ECEA 3P3BA 1JCXA 4S1FA 2RDTA 4EPBC 1UWTA 5ABEA 2D2OA 3I3DA 1KM5A 4R33A 3IEBA 5A69A 1FHLA 4LBSA 1JGIA 4B3ZA 2DGAA 4O1CA 1OYAA 4UQBA 4JR5A 2WSPA 3GXFA 1AVAA 2OQLA 2EGZA 4ZOEA 4RNIA 1PTGA 4R5EA 4JCMA 1UCWA 2A5HA 4U2YA 2H8ZA 4HPXA 3PPFA 2QMJA 1J18A 1H62A 1ML1A 1XUZA 3KS6A 1BHGA 4HK6A 3CMFA 2R6OA 2G3MA 2FVLA 1PB0A 4NG3A 5E6ZA 4REQA 5I3DA 3H2MA 4ICMA 5KZDA 3F2CA 1CGXA 3H26A 1H4PA 6XIMA 2OSWA 4L4LA 2ALDA 4WHBA 5GQBA 4JIEA 1OM0A 3BLOA 2WZHA 1KGUA 3PVFA 1UWUA 5C70A 1JEZA 1Q7MA 4WZHA 1NTHA 3RHGA 4FLOA 4GH1A 2A7NA 4M56A 4JQ1A 3VM7A 4I9TA 2BXYA 2PLCA 2WBGA 5K9DA 4M80A 5CC7A 3GHUA 2D69A 2O0TA 3QC0A 3FSUA 5FEXA 2NUXA 1EHAA 4HGXA 3DG6A 1XRTA 2D24A 2VZTA 1ZAHA 1E71M 3QQWA 4JYFA 1A50A 4XUYA 1OFRA 2QAPA 2X8RA 4FIQA 2OEJA 3BJFA 2J7FA 3GNDA 4UNKA 2RJHA 2DVTA 4JTAA 3MMTA 4O1BA 2VNCA 1JZ4A 4CN6A 4LH8A 2ZC1A 5D8WA 3WJZA 1EC8A 1ZZMA 4IXXA 1JUEA 4HJWA 2Y89A 2Q3OA 1OYCA 7ODCA 4RE3A 2WKJA 2V68A 2CERA 1G94A 1GT8A 4MLJA 1DJIA 2WVTA 5MF5A 1TE1A 4JNYA 4AF0B 2QCGA 4WX2A 4JQ2A 4UQDA 1M3UA 3LK6A 2IMRA 4GQRA 3TSMA 1EKOA 3W86A 2Y4SA 2POZA 1FWDC 4GYFA 4YS1A 3HO8A 3JS3A 1E9LA 4HPGA 1LL4A 3EWWA 4JTSA 3D3AA 3QR0A 5A8QA 2QPUA 1VPQA 4OGZA 4PBEA 3BW2A 3GE7A 4DJDC 1MW3A 1OJXA 3OIXA 1G4EA 3WF3A 3BDKA 4ML9A 4LNCA 5DF0A 1JCTA 4G7EB 3T81A 5IDZA 4Z2LA 3W37A 5I06A 4INFA 4JTTA 2QIIA 3O16A 4PEKA 3OA5A 3VOGA 4RNFA 2W9MA 3BG3A 3BPWA 3CO8A 3ZO9A 2J75A 1XIFA 1S46A 3FA5A 1XFBA 4HHPA 3QSTA 1Y5XA 3BW3A 4GQQA 2AQOA 3QPZA 1GYLA 1EGZA 3AROA 3URAA 3UWUA 4EACA 1YXYA 3CM4A 2Z2AA 4G5DA 2QS8A 3Q2DA 1E70M 1PKLA 3U5UA 2DZTA 3MMDA 1JJKA 3FKKA 4WUIA 1YW1A 1VFHA 1UD2A 1KBBA 4KRUA 2F7FA 1CECA 1ME8A 3LPGA 3AHYA 1FKXA 3SY8A 4P7NA 3WQFA 1RBAA 4RE2A 5BRPA 1UR2A 3B8TA 2TAAA 3LRMA 5KSWA 1PPIA 1BFNA 3EA2A 3EOOA 2GUUA 2J9ZA 2J4GA 3LYEA 3B4YA 4B9YA 1E9IA 3N25A 1XBYA 1U5VA 3MSDA 4RL3A 4IHCA 5DMLA 1TWWA 1QK2A 2FIQA 2E6DA 3II1A 4TO8A 5FIPA 1W3LA 3VM5A 3L65A 3TMQA 3WH7A 4D9PA 4AIEA 5JIWA 2J78A 4FNRA 2I5QA 1XLAA 3WJSA 3H70A 3E12A 5DT5A 1FH7A 3V35A 4ILSA 2ZXBA 3G3DA 4ZZ9A 2UY2A 5CGMA 4GUFA 1H7WA 3QY6A 2C71A 3VK5A 5I77A 1YADA 3BAYA 4KWWA 4U5IA 1V7AA 3L5MA 3UBPC 7REQA 1ZU8A 5BMWA 4YXGA 1JD7A 4LUYA 1BXBA 4LB4A 3OGRA 4Q8NA 1PIGA 3PY2A 5KEZA 2RDWA 1MW0A 3WQEA 3B05A 3S1WA 1QR7A 3R8RA 4H6RA 3MO7A 3LZ5A 4QQ3A 4ZMGA 4QE1A 2D3NA 1PWLA 2ADAA 3QV6A 4UBPC 3VI2A 4QJ1A 1JPHA 2OTDA 1DWAM 4GWEA 2QPSA 4L56A 4REQB 4JCLA 3PUDA 2HVNA 1XLBA 5TF0A 3WY1A 1OFAA 2BB0A 3AZTA 4IIFA 2HDJA 1LRTA 2ZRZA 4MADA 4QXIA 2OB3A 3H22A 3PR2A 4GRSA 3IUHA 4IOTA 3F5KA 3TC3A 1H61A 2F84A 2E1WA 5DBUA 1W3NA 3EWDA 3ES7A 3RO8A 4XZWA 2DUAA 3H7RA 2E77A 1PZ0A 3Q67A 3OODA 4NIRA 3GVRA 3G8RA 3GK0A 4GJJA 5CC6A 1L2QA 2NLYA 5BWAA 2BTMA 1KFBA 3IARA 1KC7A 1VLIA 1F3XA 1E5NA 4PUKA 1X96A 3EX6A 1AZ2A 4BKNA 4M51A 4X63A 1OB0A 1UUMA 1CWYA 3F03K 3QGVA 3P8JA 3TYEA 1V0LA 2GGJA 1UP3A 4O18A 1DWHM 3WNPA 2NT1A 2GQ3A 5K9CA 4KCUA 1YRRA 4S2BA 5HR6A 1J0JA 2ICSA 1EC7A 3PZ9A 1HJXA 1O7AA 3EX2A 4F4RA 2J79A 3MO4A 1MDRA 3QVQA 5I3KA 4R7JA 3EOLA 2V69A 1BRLA 4GCAA 2IQDA 1V6VA 3MDUA 4E6MA 2CLHA 4IJBA 2PTXA 3ARYA 2YL9A 1XYMA 2PDKA 1KV8A 2H3BA 2FDMA 3BTNA 4ZQMA 1W3IA 3BGAA 2IS7A 2WM1A 4AW7A 3CQ0A 3P61A 3NQAA 2ZDRA 4LAOA 2GLKA 4OQVA 4S3EA 2GGIA 3P62A 1TTPA 2DQWA 2JE8A 3BCDA 3SFWA 2KZHA 4H7ZA 5JMUA 3MV11 4PMXA 3EX3A 1JL8A 4F40A 5A8OA 3OZMA 4K68A 5EU9A 1UIPA 4Y96A 1CXHA 5BWFA 3TDFA 2VOMA 1K9EA 1JULA 2OSXA 3A23A 3F4CA 4PGLA 1Q3NA 4Q7BA 2V6AA 2PC8A 3BH4A 3N14A 1EEPA 3BMXA 1OFDA 4BI6A 1B9ZA 1CTNA 3FA4A 3LX9A 1VJZA 4QITA 1S2WA 4DVOA 4IIDA 3M5XA 5C9WA 4JTJA 4D2JA 1JCLA 2HQAA 1POJA 5D8ZA 2WOQA 4ML4A 1GPFA 1XRFA 5EPDA 3SGGA 3ALGA 2OR2A 2ZXAA 2V5LA 4GO9A 1UIOA 4DPPA 2DSUA 2JFEX 5CPTA 1TTQA 4WJEA 3O6DA 4AWSA 4KWVA 3SCVA 3I7RA 4M19A 2FPYA 2OLHA 3H4GA 3W01A 3ZYZA 3BZJA 4C7GA 5K2ZA 1WYIA 5AY7A 1TV2A 4PMUA 2XTKA 7REQB 3NPXA 3HV9A 1WKEA 2WO5A 1ZY9A 1OX4A 3EWXA 3FVMA 4ZODA 2YA2A 3OJGA 3W7MA 2Y7FA 1CT5A 3VGGA 1FWHC 1ONRA 5A6BD 1QBAA 4BF9A 5EMJA 3SR7A 3CUJA 1PVNA 3GVGA 1GVIA 5HR7A 3VA8A 5E0CA 2PDPA 3BV7A 3SCTA 4DAFA 1E4LA 2DW7A 4DWSC 1JYWA 1WDSA 3MUAA 1V02A 3OQ8A 2YGYA 4XZLX 4DI8A 2Y5EA 4RDWA 5BW6A 2VDIA 2JK2A 1BGAA 2F2KA 3VOIA 1LZOA 3NTYA 1JRBA 1GQNA 1W9XA 2PBGA 4WF7A 2CLEA 1XH1A 5LHFA 3MUZ1 3TW7A 4E4FA 4RZ4A 3MVIA 5EGRA 3FVDA 3GO2A 3NXFA 1TYGA 1SFJA 3E2RA 4B2DA 1TV3A 1Y8BA 1FWBC 1FWTA 3T09A 9XIAA 3BLLA 5I6SA 1J5TA 4YCPA 1GJUA 3LHUA 4GK8A 2Q8ZA 1K6WA 1XYZA 2YXXA 3CZJA 1JD9A 3SBFA 3GQYA 5EB8A 3KVMA 2I56A 3U9IA 4GQBA 1SJCA 4LPCA 3MI6A 2CZFA 1TPEA 3ZT6A 3UZYA 4B3KA 3IIPA 3U2EA 3M0ZA 3CYJA 4X0NA 1IXPA 1RK5A 4HNOA 4M24A 4CNPA 4ZO7A 1KB3A 4OKDA 1AW1A 2VHLA 1LL6A 3WLHA 4WXYA 5F1UA 3T44A 1KO0A 3N04A 5IBXA 5C55A 3SIMA 5CQ1A 3VDBA 4XUGA 3ARUA 3MZ2A 1V51A 2JKPA 2PCEA 3A5VA 4ZGYA 1RY8A 1XLKA 3MUXA 1WKFA 3QQ1A 4DYEA 4M3PA 4PMVA 3H23A 4B5TA 2OT0A 2GQ9A 2X1TA 4C6LA 1XUUA 2WC3A 1KM3A 1TPVA 2YPIA 3E1F1 5PTDA 4CEUC 3SFKA 4MZ1A 3GDBA 4RX0A 4AZIA 1QHOA 4ROQA 2HS8A 3H12A 1EF3A 2D20A 3RM9A 1ZBCA 1BRLB 1HF6A 1VP5A 1GKPA 3N11A 4DM1A 3WDJA 5FEWA 3B0YA 4GABA 5FF7A 1HKVA 3S6TA 1JYNA 5LNUA 1HJQA 1DYSA 4DBDA 1F2JA 1A0EA 3WL0A 3WLLA 2WJDA 4LAMA 3PZOA 1WZKA 1WXZA 4JDYA 3GWQA 2OFJA 4HCHA 3S1GA 1PHQA 2NV1A 3T1GA 2VCAA 4ROPA 3PZGA 4WDTA 2E28A 1VHCA 1UR0A 4KEZA 5HMEA 3W53A 4MJ2A 5AC5A 1R6WA 3W28A 4O0KA 1GTEA 3B97A 2QF8A 2PCQA 1EFZA 3DGBA 1PX8A 2F6UA 1OHLA 2D22A 3WLRA 1HKIA 3KOXA 2XVGA 3WNOA 5FACA 4B5XA 4UMCA 3E3HA 2VEIA 3OVPA 2CHOA 3B8WA 1LQAA 5F2IA 4BQ2A 3HPXA 3NWRA 1W9UA 4NYUA 1H7PA 3S46A 2PA6A 3GZAA 5G1TA 4L1WA 5KTLA 1YTDA 1Q4NX 1UUQA 1EXBA 2OU4A 4QDMA 1GG0A 4F0MA 5I00A 4DUVA 5HANA 1V6YA 3VKJA 4XTDA 1Z44A 1TX0A 2PTDA 1P0NA 3W26A 5DO8A 3RRXA 3W1UA 1GOKA 3PTQA 2GUBA 3N2XA 3ZLHA 1GJPA 4ZB5A 1SR0A 1IXOA 4Y8EA 3UF9A 3H7VA 1I45A 3P7YA 2Q02A 2VFDA 4L4MA 3W7LA 1D7FA 3S2CA 5C9ZA 3NEHA 1ME7A 2EPLX 3DESA 2PDHA 2REQA 1DJGA 1OX4B 1VHNA 4O4VA 4HYRA 3LBCA 1LUCA 4AY1A 1CXEA 4WD0A 4XTIA 2G5WA 1F05A 1GEQA 2NVCA 3LNMA 3KOWA 1E3XA 4NZFA 3WQ8A 3P2VA 2GVEA 3WL1A 1RCQA 1TRIA 3WLIA 1OD0A 3EDFA 4JN6A 4R88A 4M6VA 4ZXOA 1E4MM 2G3FA 3W2KA 1KLYA 4YL2A 2OGJA 3NQ7A 3S42A 1SZNA 4RCXA 1E51A 1UW9A 2Z1SA 4L65A 4Y8FA 1K9DA 1JZ8A 1FTXA 2CITA 3OYXA 2QV5A 1P0EA 3URNA 5HMDA 1GORA 3BC9A 4AYSA 1KTBA 3N6JA 5HQMA 4D8LA 1XLHA 1ITCA 3DIPA 2V8ZA 4DZHA 4KFNA 4PSPA 3F2BA 1KXQA 3M07A 3GXMA 2SFPA 4FZIA 1PWMA 1G0CA 3S8HA 1NF0A 2NV2A 1JI1A 3RITA 4TIMA 2GFTA 5LNVA 3GH4A 3UA3A 2V0TA 5HNUA 2UZ9A 4IQDA 3TR2A 2BV9A 3ONBA 3F5JA 2G8ZA 4NNCA 3W6LA 1CXIA 2FJKA 5CCZA 2XGZA 4GPNA 3VOHA 1TVLA 3I6TA 1EA9C 1YPIA 4Y9AA 4X3ZA 4PR4A 3QQ0A 4G1KA 3W00A 4FOUA 3EZ4A 3UZZA 5CC5A 4XBSA 3FV9A 2A3EA 4V27A 3PG9A 4QEEA 3UXDA 4D8AA 1QCWA 5CPLA 1C8YA 3I7SA 2ZVIA 4PUUA 3UP8A 2WMFA 4DXVA 5U7SA 1B2YA 3CZGA 4EPDC 1A53A 4E2VA 2Y8KA 2X1RA 4BCEA 4MY9A 1EJVC 3W1NA 1J0IA 1GVEA 1E6NA 2XJ7A 4F48A 3LSCA 2HNEA 1SJBA 4A8NA 1MW2A 4MVAA 4TQTA 4F9DA 4P61A 1AH3A 2PLKA 1QI4A 3R8GA 5HQEA 1RD5A 1QXLA 3CXOA 4DF2A 1F8MA 1Q4WA 3W7NA 4OV9A 4MAZA 2BVWA 3KUMA 1TO3A 3FDKA 4Y9PA 4IMDA 2ZQ0A 4W5ZA 4KQNA 4MOZA 3U7BA 2XN1A 5IFPA 2RAGA 4HU0A 1YDYA 4A3QA 4QLKA 3L2MA 4RE4A 4IH3A 3K4WA 1V08A 1WDQA 2E68A 1X38A 1G4TA 1XPGA 2WK2A 3WNMA 2E6YA 3B0UX 2PWEA 2NQHA 1CYGA 4ZOCA 3IRSA 3H54A 1G5AA 5F2LA 3ZJ6A 2ZX8A 3MKKA 7CGTA 3A3WA 3AZSA 4MNKA 3N29A 4L6DA 3CAWA 3FA3A 1XQLA 5FEPA 2AGKA 2RKXA 2Y63A 1PL9A 1FCBA 4B9ZA 1BYBA 1LWIA 2D1ZA 1UWSA 4I5UA 3S9IA 3KL0A 1V6TA 4RR4A 4DJEA 1PTDA 3CMGA 2YSWA 3QHOA 4QJ3B 5E0FA 1U22A 4PH6A 2W4XA 3PWGA 4C1LA 1EX5A 1U30A 1XLJA 3VC5A 2GWNA 4TV5A 3WO8A 3USZA 3C2VA 3UD6A 3ECQA 1E5JA 2BHUA 1W1PA 2HK0A 3S6DA 1LRNA 1QATA 2VEMA 1L8NA 4FNUA 2ZBTA 4WK9A 2IXUA 1QBBA 1SO5A 2E09A 1SPQA 3FOKA 3KBVA 4O4WA 3HF3A 2OO6A 5T26A 1XX1A 4DWDA 4LF2A 1YKWA 2TODA 1CI1A 1M04A 4NASA 3SRDA 3U2OA 1U1JA 3KHJA 3IJ7A 1XBZA 2YCJA 1W6TA 2VFGA 2Z1KA 4JTEA 3LNPA 4EF9A 3MKCA 3SQMA 4OT7A 4B5NA 3GTXA 2VEFA 4RW5A 4Z17A 2IKIA 4Q3MA 5A6JA 3WLTA 4QLLA 1LUCB 3BSGA 4HB7A 4PA8A 1F61A 5G4WA 2ZC8A 1EJ7L 4LX4A 3SRHA 1W1A1 5I3JA 4MUZA 1HP4A 2W79A 1G7UA 4L4PA 3SCSA 3GVQA 3NR0A 2GSEA 1EOMA 4CU8A 3ABSA 4AZ7A 1W91A 2QQ6A 4GBDA 1QNSA 1XL9A 4JY8A 2ISFA 3CBWA 1HKWA 3NOYA 1AZ1A 2WKLA 3GG7A 4IX2A 5CZJA 5C71A 2FVKA 4LYKA 1EJTC 1YTKA 3UU0A 2ZZ7A 2Y0FA 4W8AA 2TMDA 2OEMA 4W7UA 3RYSA 5LA0A 1XCWA 3NNTA 3AIQA 4JX6A 3V18A 4DB7A 1I6NA 4M7TA 2J9YA 3MBDA 2VVSA 2BVDA 3AXHA 1FDJA 4DWSD 4Y90A 1OYBA 3TJXA 4AH7A 3G1AA 1L6GA 2VTFA 1OY0A 1RP8A 3GNNA 2BMBA 5EY5A 4JFWA 3U2ZA 2PWFA 3SN0A 4JHMA 1Q6CA 5AC4A 4ZBCA 2J62A 2L5HA 3U57A 2WZEA 3VMOA 2UY5A 3AU2A 4GQGA 4WQ6A 3EXRA 4JTQA 4P2VA 5MKGA 1AH0A 1ZJAA 1NWRA 4D6IA 1D3HA 2CZ5A 3WUEA 1KCZA 3E5PA 4ZSUA 2X30A 4JFUA 1XCFA 5DQPA 1YIXA 1XXXA 3BLEA 1TPC1 1XSJA 3THCA 3CH9A 4PRTA 1S2CA 1P7TA 4YMZA 3EB2A 4GNVA 4BY3A 4LAKA 2FGLA 4HNUA 4A2RA 3UY7A 1HJUA 3BE7A 3I10A 1TV4A 4H8UA 3CWHA 4A3RA 2C0AA 1O5QA 4C6EA 3GTNA 2WAGA 3GDRA 4QBXA 4A8LA 1VYSX 3H7UA 3NL6A 2BG5A 5G5IA 2E8ZA 4Q4KA 3C2YA 3F7JA 1D3CA 1XV8A 3DC8A 4DZ5A 4BS0A 1M9HA 1O95A 2J9XA 2VUNA 2XSXA 3M0JA 4HMNA 2FQIA 2EO7A 1C7SA 2QYGA 2F6KA 1TA3A 3PBVA 3WJWA 1UWAA 1ONXA 1R3TA 3FYYA 4O1FA 3B8SA 3BLPX 1EP3A 4GJIA 3N2OA 3N18A 1IIHA 4EVZA 4ZQOA 4KMQA 1WOAA 3GH7A 1KM4A 1FKWA 4X9SA 4MM1A 1C93A 1RAKA 3MT1A 3QYQA 4BF5A 1DWFM 4MWAB 3K4DA 2BS9A 4LS2A 1XD1A 4NX0A 1FUYA 3VZXA 5AC6A 1I2NA 3N2BA 3PUOA 9RUBA 4NJKA 2UV8G 5LA2A 3TQKA 4PUWA 2QUNA 3UPWA 4FHAA 1BSIA 3CPUA 4BQ3A 2C13A 3W1XA 3M0KA 3MUCA 4S3BA 3WLSA 4CUCA 2FB3A 2IKJA 4QEHA 3DFNA 2B7NA 2Q01A 1X6UA 1G01A 4NJJA 4FALA 4M0XA 1Q85A 2BP1A 4WJXA 3BWWA 2XN2A 5DMYA 3M5VA 3NGFA 1W9BM 1E40A 4PMNA 2ZE3A 4N6EA 6TIMA 4FF5A 4QRNA 3WLPA 1TMQA 4OBRA 4OUEA 3KAOA 3WD2A 2VFFA 1HGYA 4F0RA 1HTIA 1O1ZA 2OYLA 2AMXA 4EX4A 4ZFCA 3HQPA 2WHLA 2XFWA 4R3UA 3CT2A 4Q33A 5AYBA 1MNZA 1A5OC 1UKPA 1KBKA 1Z41A 1MXSA 2WV8A 4I9JA 1W56A 3TCEA 2E1DA 3RLVA 3CC1A 1PEZA 3LXAA 3OO2A 2Y7GA 3MU7A 3BQ5A 1E0UA 2VC9A 3N9SA 3LXBA 1JI2A 1FDZA 2PU0A 4IL2A 2QDGA 2PS2A 3GG8A 1THFD 1TUXA 4H8HA 3NSXA 3M9YA 2PDWA 2ATMA 4O10A 2V3EA 2F6XA 5KITA 4AVNA 2PDXA 3MPGA 4KS0A 4NNBA 3DYPA 5HOSA 2HISA 3CWNA 3L5AA 2CZDA 4NKCA 3W24A 2EPMX 2P76A 1U5JA 4QE5A 4DHGA 2ZZ6A 1GW1A 1PAMA 3FK4A 3G1VA 4GY0A 1QPOA 3TJLA 3TSBA 4WVXA 2YKKA 3A3HA 3THQA 4IP5A 2DJXA 1M68A 1E6XM 1WXJA 3MP3A 3CLWA 4PB3A 3GD6A 2WJZA 3GNPA 1K4GA 1ISXA 2J13A 3F4WA 5A6KA 3LG3A 4C6NA 1A4MA 1LQ2A 3MQTA 3VNYA 3DKJA 1A5CA 4AD0A 2GVJA 2TYSA 3TIMA 3TN4A 5TAOA 3AJ7A 1CENA 2NV9A 3C0QA 4IICA 3VUSA 3BANA 4Z2HA 1R3SA 1KW1A 5HA7A 3UCQA 3WNLA 1J11A 2PF0A 4OOUA 1ZALA 2X16A 4B16A 3T2PA 5BNKA 1J12A 3LHTA 2DUZA 1UKOA 3GHSA 4GGBA 2VFEA 4GFIA 4I9MA 2HMCA 2ZXDA 1PCWA 3KZSA 1J2BA 1XLEA 1IE7C 5MKGB 6REQA 4E4PA 2R1NA 4O1DA 1M6JA 4Y6GA 1V77A 3KHDA 3OP2A 4PC8A 3QZEA 1ZLPA 1UG6A 3C4UA 5C9RA 3VILA 1ZUAX 3THDA 3PK7A 1FWAC 4WSKA 2YBUA 3XIMA 3WBAA 1PV8A 1VIZA 2HROA 4H9TA 4AIBA 5EMMA 1J5SA 4AHQA 3T4CA 4H2CA 1BQCA 5LGZA 1JUBA 2P8CA 5ABHA 2J77A 1ME9A 1IWPA 3UJEA 4DUWA 5CBIA 1RQEA 5DCDA 2O9OA 3DOPA 4DZIA 5J5RA 3UPBA 1J2WA 4OE7A 4WJ8A 2VRJA 4LUTA 1V79A 3TU9A 5I3HA 3G2GA 1VJIA 1TA3B 1DIKA 3AIWA 1KTNA 3AIEA 2YLAA 1CGVA 5LNWA 1A5AA 4E2DA 3RILA 3TFCA 3GTFA 4PTXA 1HKMA 3DHDA 2XWDA 3W25A 3HQNA 1AQMA 4S3AA 2KAUC 3WQWA 3GNRA 2Y6ZA 2VP8A 2Z28A 2G3JA 4IG2A 4Z08A 5J8LA 1GHSA 1W0MA 5AZ0A 1G67A 6ENLA 3HGRA 2EPOA 2NXHA 4UOJA 1K8ZA 2Y24A 1NIUA 4DLFA 4UC5A 3BAJA 4UMAA 2IW0A 2P88A 4WLCA 1JPKA 4N4QA 3B06A 4A29A 4LFYA 2WKGA 5F2MA 1AK5A 1QO2A 2PDCA 4MKNA 4MKSA 1Q6FA 2VUYA 4F0SA 3AYSA 4DIAA 3M0IA 4GYJA 2VI0A 1TZ9A 4OU1A 2YB4A 4TX9A 2HEJA 4A05A 3VYLA 3M0HA 3W72A 4JL2A 4FLQA 3P67A 5FL0A 1F3TA 1P43A 5DT7A 1AG1O 2V5CA 3VC6A 3ITXA 4QG9A 3WD0A 3XINA 1E43A 1YTEA 2Z7GA 1EZWA 1TZZA 1JDEA 4LT9A 4L9XA 4LS1A 3ZOAA 2XFYA 3T2OA 1GVYA 3CU2A 4IMCA 1MFVA 5GJNA 1KM1A 1KXHA 4FB7A 3NO5A 1UR4A 4QHRA 2GGHA 4RLIA 2ZRUA 3H24A 3LGGA 3D0CA 4FSAA 2QCEA 1TCMA 2WPGA 4MTVA 1U33A 4XAZA 3IVTA 1UMYA 4HMEA 3WH6A 1XSKA 4J3SA 3EBVA 5TNVA 1NFGA 1E72M 2QV4A 3WFAA 1LYXA 3N13A 5DX7A 3MCMA 2VC7A 2VWSA 1Z48A 4KIEA 3VIJA 4JY9A 4FX6M 3CZ8A 3D5HA 4QIUA 1TJRA 2BNJA 2VFIA 3RU8X 3SCPA 1M01A 4ZQCA 4V33A 1Y0EA 2PZNA 4L9YA 3GXTA 2OKOA 2J74A 3UYIA 1XDJA 1XBXA 1DJNA 1CLXA 2F8QA 1HO1A 3HQOA 3CZKA 5IHRA 3GKAA 1DWGM 4DO5A 1UQYA 2CZEA 1JCJA 4MJ4A 4IJCA 4NJGA 4AUBA 4H01A 4JFSA 1LCOA 4WEVX 5C9XA 3E96A 3GXNA 2VKZG 1KFKA 3IAQA 2VCCA 3EX4A 3NZPA 1UR9A 3A9BA 2J7HA 4FR6A 2GSJA 1G6CA 1UBSA 3ZR5A 1TQXA 1UR8A 1DWJM 3W73A 3CK5A 3FKRA 4I9AA 2PDYA 4QLJA 4C91A 5GPRA 4H41A 1V3IA 1GHRA 5C2CA 2A85A 4AEEA 1ONEA 1ZJHA 1SJAA 4K7VA 4Z2KA 1VD6A 3FNDA 3OB8A 3J7HA 1P0BA 2NSOA 1M7OA 3M5YA 1GOMA 3QMTA 3TFXA 1UKSA 2GJNA 4GFSA 1E1CB 3LCFA 1QASA 2W92A 3UWVA 6REQB 3QY8A 1NDZA 3CPRA 4YPJA 3PZMA 3W7QA 3VZYA 1KA9F 1CDGA 5AFDA 1LROA 1ZAIA 1OIFA 1RK6A 3Q58A 5AC8A 3EB4A 3CTTA 4I6KA 1HXJA 2PRLA 3DN5A 2ZZ4A 5JQ9A 1XDLA 3P14A 1M7XA 4F0HA 2FPTA 3WQ4A 3B9NA 5C5YA 3NO1A 4Q8UA 3W23A 3WLJA 5M03A 1QFEA 2ZKMX 4DQWA 1EB3A 5C2GA 4FA3A 4GZ7A 1SZGA 4LALA 2A79A 4W89A 4AHPA 3PG8A 4P5UA 4ES4A 3GC5A 5JBDA 5LNSA 1MI3A 1U5HA 4UQAA 2NW0A 3WIJA 1LWHA 4JX5A 1EC9A 3R58A 3WFZA 4HA0A 4M1RA 3UR7A 4LVFA 2VM8A 3KM8A 1AMYA 1OF6A 1W17A 1GYMA 3PNUA 3BG5A 4N0RA 1N82A 2F9RA 5HMSA 4YWSA 1QI2A 3VKAA 3O3RA 3G18A 4QS6A 2CHNA 1ZHAA 3L21A 4ICCX 1XLCA 3RF9A 4IG2B 4JIIX 2D73A 4CVWA 4EANA 1AA1B 2NQLA 1HL9A 3MYOA 1YE4A 3N19B 3S1UA 3WQDA 5CZ0A 3STFA 4QAWA 3E2SA 3W27A 1A47A 3W9ZA 3PPCA 1A3HA 3QN3A 1JCMP 3URQA 1GUVA 1RLDA 4UTUA 1FQ0A 1CB2A 1I75A 4GGHA 1EYEA 2RJGA 2QGHA 4UTWA 2IXVA 4H8NA 4S3CA 3VO0A 1LLOA 1NWSA 2Q8LA 1DJHA 3N2MA 4ZQRA 2YXOA 4DJDA 4GZJA 4HU4A 1TIMA 5T9BG 3S2MA 3EMQA 3R5EA 3S5YA 2C7FA 4NXKA 2NQ5A 3PJTA 2Q8XA 4HVXA 2XISA 4UTLA 4KWSA 4FOKA 4CQ9A 2PDUA 3FFSA 1PIFA 3S0CA 2E67A 5C54A 5A95A 3IGXA 3IIZA 4C1NA 2GGEA 1GVQA 4D6EA 3LZ3A 3C61A 1F8IA 5F1VA 3M64A 3I3BA 1J0ZA 4XZHA 3TVAA 1S3TC 2FMOA 1OSEA 2Y8VA 2X40A 6A3HA 2EPKX 1A5UA 1E4IA 4WSJA 7A3HA 1IGWA 4UR7A 2ZE0A 3GDMA 1R3YA 1PDZA 1OCBA 2VMFA 4NZ1A 1Y5WA 5HK4A 3TC6A 2ZXQA 1A5MC 4EF8A 1WOBA 4GI4A 1AD1A 3L4VA 1QK0A 4WDXA 1AJZA 1DJXA 3KW3A 4W85A 4GY1A 5AHIA 3RCNA 1WA3A 4FXFA 3A6OA 5EKYA 2PURA 2RH9A 2AL1A 1YNQA 1V0MA 1JCNA 3LI0A 4Q4PA 1JDCA 1GG1A 2GGGA 3QHNA 3R10A 4PUNA 3C3UA 3WQCA 1BVWA 1K1DA 5H1WA 3UG8A 3N4EA 3IJIA 2EJ1A 1BXCA 3TWBA 1P0DA 2GDUA 4AVFA 4W93A 5KZMA 1IXNA 1LQ0A 3V0SA 3SO7A 4DY1A 3IIXA 3TA6A 1SMAA 3VAVA 1LBFA 3E5BA 3BGJA 3SUVA 3W38A 3QLDA 4N42A 4XZBA 3G5EA 1TPDA 5HNRA 1V03A 3L4WA 4AB4A 1PCKA 5K7JA 4YTTA 5FSDC 1XYBA 2YCLB 4GKTA 2ZA1A 3MSGA 4ZOAA 3MZNA 1FOBA 2CNCA 1KCKA 3CUGA 2VJXA 4A3UA 4UTKA 1XLFA 3E0VA 1I8JA 2Y7DA 3WDPP 1VAHA 1UWIA 3BMVA 4GUJA 1KR0A 3PFRA 5DXYA 4FXRA 3ARWA 2HSAA 3WK2A 3PB2A 2R9RA 2J8GA 1X39A 4AFYA 1EJUC 1F6YA 3V4BA 5HUPA 5CG0A 2Z1VA 4MB5A 1H2JA 3VDAA 3M43A 4J28A 3VDCA 4CU6A 1FHUA 1VBRA 2WBKA 3EPOA 1FA2A 4ZFMA 1EYWA 3OLGA 4K7YA 3IJLA 1ODZA 2EJAA 3T05A 4Z1BA 1UJQA 4GE8A 4Q8OA 1DXIA 1IZJA 4JQ4A 1XH0A 4B2DD 5HNNA 2R82A 4FIRA 3E0WA 1H51A 1QUMA 3L7RA 1RUSA 1VEPA 3SCOA 2R1LA 3HZ3A 3C56A 1WV2A 2HZGA 3M6YA 2CLIA 1TFVA 2BLEA 1GKQA 3WBWA 5D05A 4XK2A 4H1ZA 1PYFA 3FS2A 3L23A 4J3UA 1X7IA 3DECA 4HT3A 1OGSA 1AFSA 3R0UA 3NQGA 5A1AA 5CG7A 1X8FA 2XN0A 2WNZA 1V93A 3LGDA 4L4OA 4M82A 5TD4A 3TQ0A 3VE7A 3LCLA 4PMQA 5BXTA 1KXVA 3PBWA 2FH6A 4MUPA 2Z1XA 1TWZA 4PCTA 4ZQNA 3IVUA 3A4AA 3AU6A 3L9CA 5CPMA 4XQ6A 1VBHA 2DJLA 4E2BA 1GOQA 1QNRA 3CQKA 3OW1A 3EX1A 1Y7VA 3KBJA 2DP3A 1QT1A 1XPYA 2PC4A 1JZ5A 3T40A 2P50A 1M7PA 4RJEA 3BOFA 2GWGA 1S3HA 2WNNA 1K03A 3LQGA 5IHSA 2PDGA 3W1MA 3P0XA 3FHAA 4LUSA 4LYRA 5CAKA 3BAWA 1W37A 2WSYA 3L0NA 4PSRA 3W82A 2IPFA 1Q6QA 4MSSA 4C1NB 1H1ZA 1K4HA 1PZ1A 3TN3A 1A5LC 3FSTA 4WDWA 2J27A 3C3NA 1QPRA 3Q45A 1DKWA 2IKGA 1B4EA 1XIJA 1YHTA 1DOSA 4W5UA 4GZIA 4R9OA 1JQXA 3UR8A 1NM9A 4PFMA 3CAQA 3OVRA 2X1UA 2BXZA 2J6VA 2PRHA 2DZUA 3L4TA 1O60A 4NJHA 3VIHA 1BVNP 3PULA 5C7VA 4JDBA 2WMJA 3DFYA 1ZP3A 4ERAA 4X60A 5JBFA 3N3MA 1PKMA 2DT2A 2YZRA 3QSRA 4DRSA 3EKLA 5ENLA 1R3VA 3W7DA 4J4KA 3ERPA 1RJRA 1SVDA 1HP5A 4JD4A 4P8XA 4DBEA 3RUBL 2NX1A 1EWEA 1CNVA 1OG6A 2V30A 1YEYA 4DX3A 5DEZA 2WMIA 3S3GA 1EQCA 4S2CA 3VE9A 3TJ4A 1RJPA 1XYAA 3QBUA 1UZ1A 2Y8UA 1YE6A 1LBMA 3AI0A 5ABFA 4AMAA 3G8EA 2FZ8A 1UUOA 3SECA 1US2A 3ARRA 2FTYA 4MKVA 3JZUA 3B03A 3GG1A 3VCNA 4NJIA 3ARPA 4IIHA 3O05A 2NXGA 3IACA 3CGTA 4KGJA 3WD4A 4D71A 1JAKA 2XDFA 2XUCA 1H09A 2ZZ2A 5HUOA 4B3LA 3TTEA 4WR3A 3HB9A 1GWJA 2VDHA 1QI3A 3RNDA 1EP1A 1NQ6A 2PWUA 1RY0A 2A21A 4DM2A 3GFZA 2C1GA 3UY8A 1QNPA 3PZIA 2J47A 2V67A 1WDWA 5AZ1A 1FFQA 3NUKA 1GJWA 5E6YA 1RQBA 4XVEA 2CLFA 2XPKA 3CT7A 3EYPA 5I02A 3W4RA 5ECVA 1OFOA 3BAXA 4XO7A 2QVNA 2YDSA 3AIRA 2JALA 5A6SA 1T8XA 1I2PA 1XDMA 1QOQA 2I16A 2ZIDA 3NPVA 4RZ5A 2DSWA 2QJGA 2VZSA 4K39A 4ZB0A 4WGHA 3UNDA 5BXSA 1B30A 1OC6A 4GI9A 2HV5A 4AZ5A 3F2DA 4NU7A 2XFFA 4GVGA 2Y62A 1A4LA 1QDSA 1SO6A 4HJFA 4OUIA 5EFFA 1W2PA 1L6FA 3G22A 2ZYFA 4F8XA 4AD5A 3CTLA 3F5LA 1S2AA 3M1ZA 3VKDA 4IGMA 3ZS4A 4AZBA 5FJJA 1EUNA 1L6WA 1EQPA 3L66A 4HIBA 3CUXA 2WJEA 4XZ9A 5CC3A 3DHPA 5HXMA 3W7PA 4B5UA 3W2UA 3CMJA 1AW2A 4MFDA 2NQZA 4G6CA 1XYLA 3TNOA 2V9DA 1WAWA 5HJYA 4D72A 1F3WA 1G4SA 1O94A 2DVUA 4IX0A 1NDWA 4YLWA 2WMHA 1VENA 4FLSA 4CQDA 3GSMA 1IHIA 2INZA 3ZQ9A 3FGCA 1B0IA 2GK1A 4MYXA 1V4YA 1YDOA 3M0MA 3P93A 2IUZA 3B8DA 1XWYA 2INFA 3KRSA 4OIFA 4BQ4A 1JRCA 4RDZA 1WZAA 4GNKB 3UZWA 5K4XA 1E0WA 4X22A 3FY1A 1BWVA 3HPAA 5LIUX 1NFBA 1CGUA 3AQUA 4PUJA 3SJ3A 3KE0A 2A6LA 3DI1A 2HE8A 3MCNA 2V5BA 3G1SA 2XVLA 4O52A 3R89A 3FHQA 3DCPA 4HNTA 1QHZA 2AKZA 3H55A 1GVSA 3WX7A 4LUSB 1MQQA 1YBQB 4HP5A 3W0KA 2WANA 3LHZA 3MDWA 1KBJA 5AHNA 3VDHA 2WWDA 3CIXA 1XGDA 4I6VA 3ZLFA 3ARTA 2VXNA 4LGXA 4RDYA 2NXIA 4P7LA 4JPGA 1VBUA 3G3MA 2FH8A 3DBPA 4TVDA 2GYIA 4UMBA 1ADOA 3V1HA 3L4UA 3DFHA 3HURA 3BLFA 1XICA 4R7WA 4JTIA 1PZ2A 4WGXA 5FAGA 3P6LA 4H9ZA 2NX3A 1N8IA 1Y65A 2GJLA 2OO0A 1P48A 2F2HA 3IS4A 3ZJ7A 5HWNA 4Q6JA 3V5FA 2ZRYA 2WC7A 2CFFA 2O4QA 3GY1A 2C91A 2Y61A 4QNWA 3RJXA 1LTDA 4DJED 2QZRA 1DHPA 5FJPA 2YDRA 3RX3A 2AQVA 1W1ZA 3H2AA 4CCCA 2WMIB 1I4NA 5A2AA 1R7AA 1TJ1A 4URIA 1GZGA 3C0SA 3K30A 4IFKA 5ABFB 1K7XA 1KKOA 4S3FA 5EMYA 1L9WA 4EAMA 4RZBA 1A0CA 2OMAA 1MXDA 3SCUA 2CKSA 4YWIA 1YNPA 2ZVRA 1ZJBA 3THUA 1SGJA 3UWZA 5I3GA 5E5CA 3VX1A 2XVPA 2OGYA 4AZGA 3VGFA 3CHEA 1O12A 1DQUA 1E0VA 3S9ZA 3POCA 4J2MA 5A8MA 1UYQA 5BOOA 3WEOA 5GNXA 1H7RA 1XYCA 2DT1A 4J1OA 1W5NA 3FEQA 3STPA 1QOPA 1EP2A 4PB4A 3UJ2A 3WLQA 5CLTA 3CQIA 4TTGA 3GDTA 1PBGA 1N2VA 1R47A 1F5ZA 5IRPA 3H2NA 4HSNA 2GOKA 2QMKA 3E2VA 3W1AA 3A12A 1OX5A 4J27A 3NL5A 3O0FA 5MHBA 3LCIA 4I5RA 2W91A 2IKHA 1RV8A 4KESA 3IRDA 5EMUA 1S5NA 1TELA 1GOXA 2VELA 3BXWA 2UY3A 1UA7A 4PMZA 3T0DA 4TR9A 2X1IA 3LRLA 4WXZA 1TR1A 2X0SA 1J01A 1MEHA 1AJ0A 5EA9A 1S2TA 4GXWA 3UWWA 4BI7A 1BKHA 1S1RA 1D7KA 1GKRA 4AC1X 1XF0A 4UR9A 2VGGA 1SSDA 4UFKA 3PUGA 1SMDA 4HPJA 3R2GA 2VO5A 3EEGA 3WUFA 3GTIA 2X2YA 5A5WA 3W7OA 1W9PA 1RH9A 4O8AA 1CGTA 2DORA 4PMYA 4ERIA 4CCDA 1NDVA 2AMGA 4P7QA 3FGCB 2GK1B 3WK1A 1SQ7A 2C15A 4NHVA 1KGXA 3ITLA 3NZ1A 1E0TA 4WOZA 4C5YA 2V5JA 1D2KA 3LN3A 1ZFJA 4HNNA 3CUZA 3S5OA 3CYVA 4O50A 2IQ0A 4DYJA 2E0PA 3WF2A 1UOKA 1XBVA 3WF4A 4EPKA 2C14A 4HN8A 4ZENA 2NUWA 1CXLA 3S5SA 1O4UA 4YVPA 3GAYA 4CN1A 3Q65A 3VD9A 2AL2B 3VXGA 3LD5A 4C6CA 4XD4A 5HATA 5FSEC 1JAEA 2XFRA 5A6AA 2YDQA 3F4NA 5SWUA 4AZ6A 3HA1A 4MJMA 4U3AA 2VR5A 1TJ0A 1B1YA 4Z1CA 1EBGA 3FEMA 1BG9A 1UPMB 2B81A 3RPTA 2X0HA 3OPSA 1X98A 4CVUA 3SW6A 4FPSA 3PF3A 2OOGA 2YJQA 3NPUA 1C8XA 2FHFA 3KOYA 1UPPA 5M17A 3LQLA 5LA1A 2I9UA 1Q65A 1LL7A 4FEZA 3OVQA 3SJNA 5GVJA 3V75A 4AISA 1J6PA 3SURA 2V3FA 2C8NA 3CIWA 4UTWC 4AWTA 3KWSA 1RVGA 3A4XA 2GVGA 1DIOA 1E1EA 3VMPA 4OZOA 5EBUA 3FAXA 1B3YA 4LYPA 1TX2A 3CUIA 3T8LA 4HPNA 4IISA 3ABRA 3AHVA 2GUYA 3OQEA 1EX1A 4ACZA 2H9AA 4Z1AA 3V5OA 1H49A 4S38A 2P1FA 3K1GA 5A2BA 1S39A 4W9TA 2X42A 3LUTA 1KD0A 3CZLA 3C2EA 4IFRA 1KCLA 1XLIA 3TOPA 4LRTA 4PODA 4AX6A 2F61A 3R4IA 4GUGA 4IFKB 5CSSA 1BEUA 5K9XA 2UBPC 2JBMA 3T7VA 3LSBA 5CAHA 4DJFA 4GLEA 3W07A 1EZ2A 4JTDA 4A8IA 1HKJA 1PSCA 2EEXA 3TC7A 1O5RA 4BA0A 1DJWA 2GVLA 3LLFA 4IQEA 8RUCA 4FXSA 2ISVA 3BG9A 4NRRA 1IT0A 4GISA 3TYBA 4H7CA 4D1IA 5E09A 2QLYA 4NNAA 3L5LA 3LV6A 2FB2A 4E4UA 8XIAA 1ZL1A 1PZ3A 2PP1A 4V1XA 3VUPA 3WD1A 3WQ5A 3PJXA 3WENA 4IMGA 5H8MA 4MNJA 4AD4A 1VRXA 3S2NA 2WQPA 1JYVA 4B5VA 2ZFAA 2WMGA 5I5RA 1SZFA 1GOIA 4H00A 2G95A 1H60A 3HG5A 3QLLA 3HFTA 1MEWA 4XV0A 5DCBA 2YFNA 5HWJA 4IGHA 2Z7KA 1VFSA 1X7FA 4UR8A 2NT0A 3C8NA 2XH4A 1F07A 3NYZA 1O68A 3GFYA 4MLRA 3H8AA 3AUOA 2W5FA 5FJTA 1RP9A 3D6NA 2CLOA 1QOXA 1QPNA 4C6KA 1FBAA 1BWKA 3AALA 4JL1A 1HGWA 5AVNA 2C6QA 2RGMA 3DI0A 1JYXA 4HD5A 1TV8A 3WYZA 4JN8A 1HZYA 1PUDA 1VYRA 2CLKA 2NUYA 3RK8A 4GNJA 1EUAA 4Z0SA 2CYGA 5FOOA 5AC7A 2Z6IA 1I1WA 1EGVA 4AVOA 3ZVIA 5FJOA 2PDBA 5BXRA 2I1OA 1R0MA 1CCWB 1NP0A 3KL3A 3RPDA 4F0KA 3ISIX 1XGZA 3MS8A 4FO4A 3RFAA 1G69A 3LHVA 1TWDA 1V3KA 4Q7NA 4RDVA 4CGTA 2Z26A 5H8PA 4XZIA 4WKFA 3U8GA 1JF6A 3GYCA 3N12A 2D0FA 1OGBA 3R6IA 7TIMA 1OVDA 2PI6A 4OTKA 4KGLA 4JQ3A 4PCPA 2WHMA 3TV8A 4IF2A 4LEFA 8A3HA 3B04A 1Q66A 1CXKA 3OVGA 3RR1A 3BL3A 3VGHA 1HNYA 3CHDA 3RCMA 4KRZA 1T6MA 3O0KA 3ATYA 1MFUA 4IP7A 4NY2A 3AMGA 3KTSA 2O9TA 4R53A 3CQJA 4K2SA 4FAMA 4O12A 3K2GA 4IIEA 2Y1HA 1LF1A 5J04A 4DUXA 2J7CA 4IPIA 1F73A 1BF6A 2P0IA 3AIBA 5BMXA 4J3ZA 3T0TA 3ARZA 1F4HA 2G97A 2YZ5A 1EJXC 1HT6A 4AY8A 3PBYA 1W1YA 2GPTA 2QXWA 4D6JA 2VQTA 2QJJA 1AODA 3TXZA 3AS1A 2J8FA 3G1YA 1LOLA 3NQ2A 1AQFA 1C9WA 1C92A 3UQNA 3HPZA 4J35A 1GGOA 5DRIA 1ISWA 4AIUA 4HOZA 4W7WA 1FWEC 6CGTA 1C3FA 4C7DA 3UJRA 2AAMA 2HBXA 4W88A 1KFLA 3WDIA 3GXDA 2OKTA 1WP6A 1K7EA 4H6EA 1BVZA 3MI2A 3W7JA 2PTZA 2CXEA 2A3CA 8TIMA 2DW6A 4ACZB 2H9AB 4NF7A 2TRSA 2OELA 1C8VA 3AS0A 2W6RA 4Q8QA 4AC7C 5C9UA 1JG9A 4ZO8A 3ITTA 2RUSA 4UTHA 1Z7AA 3E9AA 1RQHA 2WMKA 3LM3A 1VC4A 3QR3A 3N9KA 1YXCA 4PRRA 1JUKA 1C8QA 1QPKA 4XZMX 1R2TA 1EXPA 3TQVA 2Q6ZA 2OT1A 3OOQA 2BGNE 3NDYA 1JF5A 4K8HA 1GVOA 3SUWA 1OT2A 2A2IA 3G0XA 1W31A 3RU6A 3KX6A 1VIWA 1SR9A 4QTGA 4PCFA 2PLMA 1KM2A 2R14A 3T55A 1IEQA 3CJPA 3C5QA 3RX4A 4JOMA 1TV7A 4GBUA 3QEZA 3N9RA 3NZGA 3G6MA 1LP6A 1TKKA 2OZ0A 3LCWA 3KOFA 5D33A 4Z2GA 5LIKX 1SSGA 5FL1A 3W1LA 3UPMA 2V2CA 4HZ6A 4GMEA 4GYKA 4PZVA 3K8MA 2ISDA 5DRCA 4QG8A 1CZ1A 3KTCA 1XIHA 5D2VA 3INPA 3BZGA 3ARXA 4I8DA 4EWND 1F76A 3M16A 4TX6A 3VNZA 3U48A 4LBRA 3WJYA 4GUHA 1RD6A 3ZWTA 4UQ9A 4CD4A 4DF1A 3IIVA 2X7WA 1JPIA 3NSMA 3OHMB 5FF2A 2KX9A 3LPFA 1J10A 4QJ5B 4FF7A 2PDIA 5IOBA 3FYOA 1K8XA 2MANA 3E0IA 4CLMA 1NEYA 2P0OA 2JGQA 4L61A 3GC4A 1H7XA 3A64A 4TVCA 1TRDA 2G96A 2XIJA 4AQLA 1AL7A 5BROA 4Z0JA 2FZMA 3P60A 4LS0A 5GNZA 3OZPA 1Z32X 1VJSA 4UCFA 5AYXA 3HJEA 3TJIA 3E74A 4DEFA 1AD4A 1OBAA 1A49A 5H2ZA 3M0XA 2D2HA 1VF8A 2EG8A 4HK7A 1QRQA 1ZB5A 3OIHA 4OVXA 1XI3A 5FF0A 1W1IE 5TQLA 5I78A 1QWGA 5KMYA 2JIWA 3GW0A 2G37A 3R8HA 4O13A 5D04C 2EG6A 2JF6A 1H11A 2V5KA 3N6HA 2OPJA 3DC0A 3C8FA 7TAAA 3QZ6A 4A6GA 3QFEA 4BQ5A 3A9IA 4OOZA 3WMCA 1Z69A 3QMSA 4EXBA 4WKAA 1OFBA 2MNRA 2ACQA 1QW8A 3WZ0E 5EL1A 1MXGA 4R85A 1P6BA 2HVMA 3V16A 4UQEA 4O14A 1TPWA 5TIMA 2GQAA 2QGYA 2ZUWA 1DVJA 4DELA 3V1PA 1B54A 4LF1A 3E6EA 2J7DA 2IPGA 4QR6A 3PZTA 4HYVA 2B7PA 3GDLA 2NQ9A 4S3DA 3TSDA 2P3EA 4H83A 2VR2A 1TCDA 2GSHA 3QMRA 2WNQA 4LV4A 4UTJA 3TOYA 1XISA 5G4EA 3RLGA 1J9YA 1UC4A 3M0LA 2EPHA 3NA8A 1PE1A 3V0TA 3WDQA 1X6LA 2WSQA 4KW2A 3P82A 4GIRA 1WUFA 1KRCC 1VZWA 2XIBA 4LUJA 1MWOA 1IEIA 3ME3A 1A3XA 3AFBA 3VFLA 3G1DA 3DFPA 4N9DA 3M7SA 4G2DA 1TPB1 4NVTA 4O11A 4QG6A 3W7CA 3ZZ1A 1ITUA 2V38A 4AIOA 2Z2BA 3V36A 4AYGA 3PUEA 2PU1A 4U33A 1QVBA 4DJDD 4NZCA 2PWDA 1S5MA 3KCLA 1M53A 3EWCA 4CKQA 1TPH1 2X41A 4D6CA 1SUXA 3H2OA 4WIWA 2HE5A 1G9HA 2IQTA 1EPVA 4NAFA 4JNMA 1PKYA 1Q45A 1XH2A 5D38A 4YTRA 3BUVA 1QU4A 3MKVA 3ABOA 3QXBA 4GZEA 4KPLA 2V2DA 4H4IA 2FGZA 4MGGA 4IT1A 5CEWA 1C29A 4NAEA 3AYRA 1ICSA 3TW6A 4A3HA 2Z6JA 2XU2A 4FXJA 3EDKA 4AWUA 3TA9A 2E7FA 4GC4A 1TUFA 1ECQA 2A7PA 4GOAA 4A8RA 4D1JA 1FWGC 1UH4A 2WSKA 3FXGA 3IWPA 2E6AA 2JF7A 2WYSA 3LU2A 3QKZA 3OYZA 6PTDA 2V63A 3UXKA 5A6TC 3QTPA 5BXPA 4V1YA 3WLMA 3ZT5A 1ZBWA 3M4HA 2WNWA 4EE9A 4LTSA 4IMEA 4PULA 1UJPA 3TR9A 4L6OA 4YHEA 4AU0A 4M5PA 1TMLA 3TX9A 1GCYA 4H8VA 1IZCA 1H41A 4HK5A 4NRSA 3ZMRA 2NQJA 3GW3A 3MY9A 4GH3A 1H5YA 1Z9AA 2PE4A 4MHBA 2OLSA 3WUGA 2OG9A 4IM4A 1B3VA 1ZBVA 3TROA 2W63A 2XIMA 1OK6A 3CV7A 3T0CA 2XG9A 3GXIA 2OLAA 1O5KA 3T4WA 4MNLA 2O7QA 4CCEA 3NAVA 1TVNA 4UFLA 5DY3A 1E6RA 3GIYA 1QNOA 3JZEA 3HGJA 5I3FA 4JN7A 2FLIA 2JEPA 3R13A 3IGSA 4E2OA 4AF0A 1KBLA 4BWLA 2FFIA 2DH2A 1W3TA 5A3HA 3BICA 3U7VA 3DEQA 1LJYA 1VLWA 5IDIA 1GONA 4JTLA 7PTDA 2OWWA 3AC0A 3OGVA 4F9JA 4MY1A 1S2VA 1XIMA 3EOSA 2X7VA 1TTJA 1R3WA 2ZZ3A 1HIZA 1QI5A 4EK7A 3IVSA 3PNZA 3FIGA 4YTSA 5K4ZA 2POTA 4LVBA 3N73A 3A22A 2VX4A 1MZRA 2ZRXA 1G1YA 4IIBA 4Z1YA 2CBJA 4O1AA 5I0DA 2XH7A 4N9BA 1FCQA 1VYPX 4NQ1A 4FK9A 1ZENA 3M7WA 3NVDA 2V82A 1HW6A 1TWIA 1ZAJA 5CJNA 3CHCA 2G3IA 5E1QA 3LBMA 3U3HA 1WX0A 3NL3A 1N8FA 2R91A 4G1NA 3TTSA 1FCUA 2G0WA 2C3ZA 1I60A 4O0ZA 1SFSA 3RLUA 4X61A 1QNVA 1HQTA 3LTSA 3I4KA 3VCRA 3W7HA 2ESCA 4JHOA 5EMLA 5I79A 1ELSA 2OXNA 3N17A 4ZO6A 1TVPA 1RCXB 2ANUA 4C6IA 2W27A 3HPSA 2PGRA 4AX7A 4DO6A 1FCVA 5D2XA 4N9EA 1W2VA 2G4FA 1YLVA 3LENA 4F2BA 3BVJA 3UWEA 4IPLA 3HIJA 4HKPA 1JXKA 3RX2A 1XIEA 1QO5A 5AB3A 3BO9A 2RDUA 2YBVA 3AMLA 2HCVA 4KBXA 1XIIA 3VD5A 2OSYA 2P10A 1F3EA 4Q4MA 3QR1A 5FCZA 5J5DA 3ORWA 1JPMA 4LCRA 3UJSA 2CIPA 3CAKA 3C0JA 3DFQA 2CETA 3LB0A 1NDYA 2VGBA 4KEVA 2FJUB 3S2LA 4CQCA 2O55A 5FESA 3EA3A 4UFMA 2YIHA 5JIPA 4R34A 1XFCA 2G41A 2XZ9A 2VT0A 2EG7A 3F1QA 3DERA 4LXFA 3VZZA 3CL6A 3AWNA 4ZEPA 5FEZA 4QE4A 4NAEB 4AAJA 3RGTA 1V6XA 1VGAA 1V3MA 1TR9A 4IPNB 5DLCA 2PEVA 1IEWA 1F4AA 2P5NA 2ZTJA 2ZX6A 4I3GA 1GPWA 1DPMA 3IANA 1UD8A 3GVWA 4FNTA 3HG4A 1VR6A 1N7KA 1UH3A 4CD7A 2HK1A 2P8BA 1FRBA 1PKNA 3C2FA 5M5DA 3KLLA 3H21A 4TVUA 1JFHA 3DFTA 4ZSTA 3KRZA 2WZIA 2QT3A 5REQA 3PJWA 2VEPA 2ZWZA 1CPUA 2ZTKA 4GA8A 3WELA 4C6BA 1S1PA 1XIDA 3OEXA 4KEUA 5CPOA 4B15A 5BU6A 1J0HA 1IYXA 4NSBA 2ODOA 3N4AA 1D9EA 1W54A 1I2QA 4RPPA 4DJFC 3UXAA 2YBTA 4V2XA 1P6WA 2YYTA 4AZHA 4R9XA 3AOFA 1KV5A 2BASA 4ZCWA 2REQB 3WF0A 2GDVA 3CUFA 1ITQA 3EOUA 2C79A 1XJBA 3EDJA 3KBNA 3SZ8A 1US3A 1GNXA 2Q3RA 1OEPA 2PDNA 3TMLA 2MUCA 1I9CB 3WK0A 1WZLA 3GKFA 3T8QA 3JU2A 3LPPA 2C19A 1DJQA 1ITXA 2DH3A 4JKMA 5XIMA 3IJ8A 4ATLA 3OU8A 3WH8A 5FI8A 3NCOA 1V3JA 2PWVA 3EA1A 1A0DA 7XIMA 3U6WA 5CJMA 2Z24A 3PZNA 4J7RA 2JKEA 4K3ZA 5F7UA 1FP8A 3MSYA 1SZEA 3G1HA 3HJZA 2E3ZA 1ENUA 1R46A 2DSKA 2J66A 2R8WA 2FHBA 4HTYA 2J8TA 3WQ6A 5BOEA 2FHCA 1I2OA 3DKLA 3NQEA 4HZMA 3GU2A 1AQHA 4FNPA 4MY8A 3R7MA 3LCXA 4QS5A 3ANUA 4N9CA 2BGSA 3I68A 2XM2A 5T8GA 1E3ZA 3WEMA 1ZQ5A 3KBMA 1E15A 1T7LA 2HRWA 1H50A 3WDHA