1BQCA

Beta-mannanase from thermomonospora fusca
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
302
structure length
302
Chain Sequence
b'ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHDHSDGNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-MANNANASE)
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
molecule tags Hydrolase
total genus 134
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1bqcA00
1UWRA 3GYCA 1X6LA 3RIKA 3T08A 5I23A 1V3MA 3GM8A 4U33A 1CLVA 2O9PA 3I3EA 4H7VA 3N11A 1K9TA 3AXHA 2QMJA 1H5VA 1NARA 3OB8A 3WEOA 1DWFM 3AS3A 4WF7A 1FP8A 1G94A 3CZGA 3ZQ9A 4JL1A 5ECUA 3PZOA 3RCNA 1GQJA 3NUKA 1ITCA 3WD1A 2OWWA 4B9YA 2UY2A 5A8NA 1G1YA 3UEQA 4PCSA 3VDBA 2ZXDA 1PX8A 3PTMA 1FA2A 3HJEA 3AMCA 3WNLA 4RL3A 1JXKA 1VRXA 3CUFA 2CEQA 2QPSA 2VQUA 3AHXA 4WKFA 5JIWA 1E55A 4WKAA 3OZOA 4GINA 2VRJA 3TTSA 2BY1A 3IAPA 1V08A 3T09A 3WH6A 5A8QA 1JZ2A 2XPKA 5FIPA 5IDIA 3WD2A 3PZGA 4U5IA 5A2BA 5I78A 3N12A 1E73M 1EDTA 2RGMA 1ITXA 3N15A 2ZE0A 1C90A 1OGSA 1EHNA 3AYRA 1I1XA 3ALGA 3SCRA 1EH9A 1D7FA 2YL6A 2CPUA 1AQHA 2VTFA 3VD5A 1M03A 1E9LA 1W3JA 3CTTA 4UFJA 4P7QA 1M01A 3W0KA 1R7OA 3N04A 4V28A 1LF1A 3VIGA 2V3DA 4W8AA 1IT0A 2VL4A 2WSPA 2BS9A 2A3HA 2Z1SA 1AMYA 1GW1A 1WDQA 2YA0A 1TZ7A 4MDPA 1HVQA 4WSKA 3D5HA 4MNKA 4GKLA 2E4TA 3LMYA 4HA1A 1BYAA 1D2KA 3QGVA 3CMJA 1UKSA 4W88A 5IHSA 2WZIA 1QBBA 3SCQA 3AS2A 3WDRA 3NSXA 3WF3A 5KEZA 3SUSA 4MPKA 2ZX5A 4HZ7A 4P8UA 3W81A 3CUGA 4PEEA 3WEZA 1UA3A 2OYMA 3VGFA 2CCRA 3WF1A 2J74A 1OSEA 1QW9A 1RP8A 5AYIA 5CGMA 5FCZA 1MFVA 1W1VA 1W32A 4AZCB 1WNOA 2W4XA 3T2QA 1X6NA 1OCQA 5D4YA 4EE9A 4GQQA 1CGUA 4ATWA 4UQEA 3OGSA 1QOXA 2YDRA 3AMLA 3MSGA 2GVYA 5CLTA 1BHGA 4P8XA 3GXMA 2NSXA 3WH9A 4CGTA 3W6LA 1FH9A 2V3GA 1QHPA 1GOOA 1GHSA 2GJXB 1QNQA 5EFDA 3VD9A 1D3CA 4H2CA 3BGAA 3NCOA 3G6MA 3IJ8A 4GZJA 4AIEA 2Y24A 3B9AA 3AIRA 4HPGA 1E6RA 4D6DA 1W9BM 3GNRA 1O7AA 2XVKA 2WMGA 1B30A 2D3NA 2J8GA 1ISVA 2BY3A 2WM0A 1UD8A 1LG2A 1JYNA 3WDPP 2AAAA 3NDZA 1EO7A 2ZXBA 2G3IA 1UR9A 1CPUA 2QMKA 1BGAA 1HKMA 1LWJA 1JZ3A 3F5JA 3WUGA 1CIUA 3F4VA 2XVPA 4BS0A 1OIMA 4PRWA 2W91A 4HMCA 3VKKA 4DWSA 5GNYA 4XV0A 1JYVA 3BMWA 5C70A 3AMKA 2J47A 3QR3A 3WMCA 4GO8A 1QHZA 2Q8XA 3LPGA 4H41A 1RH9A 3SUVA 4D6IA 5BRPA 3AISA 1ODZA 3RMEA 4P8VA 2YL8A 5E6ZA 3ARSA 2J79A 5A2AA 5IXEA 4HA4A 3MO4A 3UCQA 5IFTA 2A3EA 2J77A 3AZTA 1UWQA 1SMDA 1UQZA 1LG1A 3WFLA 2WC4A 1Q6FA 1J0YA 1E6ZA 5JBFA 1H09A 3W24A 3S6TA 1KCLA 1UH2A 3ZMRA 2WANA 2WLZA 3MV11 1MVYA 1UWUA 1UG6A 1V02A 4MJ2A 3WF0A 1H0GA 3GXIA 5I0DA 4AIUA 1XYFA 1TCMA 2D24A 2WKGA 2QPUA 2EPNA 1BAGA 3PHAA 3ARWA 1PZ3A 1QW8A 2VMFA 1XSJA 4W7VA 4TXEA 1V6UA 2D1ZA 1FH8A 4JKKA 4KWUA 4H8UA 3CPUA 4PMVA 5GPRA 4J7RA 2DIJA 1J11A 5I5RA 3WQVA 2VOTA 4XB3A 1OWQA 2OYKA 1JD9A 4MJ4A 3A47A 4U5KA 1K9FA 1B9ZA 5KZ6A 4AC1X 3GDBA 5E09A 1LWHA 1CYGA 1FHDA 1MW1A 1EO5A 5A69A 8CGTA 5A94A 1ZBWA 5AYBA 1LL4A 4UZSA 4ZENA 1HJQA 2VT0A 5D9NA 4CD6A 4KMQA 2BVDA 5DEZA 1EQPA 3AMDA 4AD3A 2CERA 2DT3A 4L4OA 4JFUA 1VJSA 1E70M 3MMUA 2FHCA 1EOKA 3NSNA 3T0BA 1BVZA 3AS1A 3RJXA 3U57A 2GUYA 1B1YA 4OJYA 3VNZA 5I6SA 2VC9A 1EDGA 1HN1A 1BYBA 1E15A 3ARXA 2WC3A 1MWOA 1GHRA 2G3NA 4PMXA 1N82A 2XIIA 2J7CA 1HJVA 3CHFA 5D8ZA 1UWSA 1L8NA 1I1WA 4FF5A 1GUVA 3BAYA 4JFSA 4JCMA 4CUCA 5I2UA 1UH3A 4KGJA 4D71A 4W85A 1W2PA 2YBUA 2ZUMA 1CXEA 2VVNA 3EMQA 1E4NA 3RM4A 4K68A 1E3XA 4MAZA 2ZUVA 3T2OA 3UG3A 1A47A 2HVMA 1XCXA 1JFXA 5GNZA 3EYPA 2EPKX 1HT6A 3VTRA 1C8QA 1VBUA 4D6GA 1XSIA 2FH6A 1DHKA 4TOQA 1OM0A 2WBKA 5BCAA 3QHMA 4BCEA 2WVVA 3WUFA 5GQBA 1JXJA 1V0NA 3ECQA 1E6NA 1W9PA 2PWGA 3L4UA 2XM1A 1R87A 4JHOA 1GNXA 1RP9A 1Y7VA 1VIWA 3RJYA 1HJSA 3J7HA 2BHUA 1WP6A 5D8WA 1K6AA 3CHEA 5BYWA 3WQ5A 1CBGA 4JIEA 4WIWA 4ACYA 4C7FA 4IM4A 3WH7A 5M5DA 3PZTA 5FL0A 3W26A 1E72M 3POHA 1JG9A 4DUVA 3CUIA 1VFFA 1H11A 3AIQA 2W5FA 1QI5A 3PZIA 1G01A 2D0GA 2GK1B 2WHKA 3O2LA 3GH7A 2TAAA 3APGA 7TAAA 1M04A 3GBDA 5ABFA 1MW2A 4AD1A 2WK2A 3LPFA 1ZU8A 4HTYA 1UR4A 1VEPA 1HKKA 1JYXA 4JL2A 2EPOA 1OGGA 2CKSA 2XYLA 1NOUA 3ZR6A 3BMVA 5EMYA 4PMUA 3QOMA 4ATDA 3WMSA 3QHOA 1VB9A 1UD3A 3VUPA 2BVTA 4IISA 1WKYA 3WD0A 3K4DA 2BNJA 2ZX7A 1E4LA 4LYQA 3BXWA 2WHJA 3SCTA 1OGBA 1DWIM 2OWCA 2D2OA 5CXPA 3MV01 3PTQA 3K4AA 1UZ1A 2FH8A 3SCUA 1CZ1A 4ZE5A 4UFKA 1E0WA 1KR0A 2XM2A 2WMHA 4AWEA 2VX6A 1EOMA 3L4YA 1C7SA 3I3DA 1UR1A 4PYSA 2XVNA 1GQIA 4MADA 2VZOA 2Y2WA 3OLDA 2OYLA 3DYPA 1UD4A 2EQDA 1GOKA 3N1AA 4DUWA 4QLKA 1J10A 3SCPA 1FFRA 1KR1A 3CHDA 2AMGA 4JCLA 4PTMA 1HKIA 1C7TA 3EDFA 1C92A 1E6SM 5F7UA 1GONA 2D3LA 3WN6A 2BXZA 2A3CA 4F9JA 4ACZB 2BHZA 1B3YA 3A3HA 3VIIA 1OT1A 2ZUSA 3CLWA 4M81A 1OD8A 6A3HA 1W2VA 4CD7A 4HP5A 4TVUA 4WK9A 4PBGA 1LL7A 4RE3A 4RE4A 1BYCA 3M6DA 1AQ0A 3EDJA 4CU8A 4JZ5A 1A3HA 3K8LA 3W82A 5M03A 4J3WA 4U2ZA 1XD1A 2ZXQA 4AIOA 1GQLA 2VX4A 3L4WA 3TTOA 5EFFA 4CN4A 4HOZA 1GJWA 1B3ZA 3W38A 2D0HA 4W7UA 3M46A 4PMZA 1EHAA 4BQ3A 3MUAA 1GCYA 2WW5A 1UZ4A 2J7DA 1ZBKA 1E6PA 1V03A 4YHGA 4AD5A 5ABEA 4HOXA 5A6JA 4UOZA 3VDAA 1V0MA 3VD7A 1HNYA 2O92A 3W53A 1H49A 1CGWA 1UKTA 5CPSA 3TP4A 2VRQA 1TR1A 3PBGA 2CETA 1B0IA 3ZJKA 3WUEA 4MDOA 1AQMA 2GDUA 4W5UA 1JIBA 2JALA 1JNEA 1U2YA 1QNPA 2E9BA 1TMQA 4D6EA 4PMQA 4Z2GA 2DH3A 2D0FA 2CITA 4UFMA 4KH2A 2E9MA 5E6YA 5LYRA 2FHBA 3ARRA 2W92A 5E0CA 1M7XA 2EPLX 3WIJA 1R86A 3DYMA 3MANA 4URIA 1PAMA 4HZ8A 1H41A 4CVUA 1HJUA 1Q6DA 2VJXA 4ZXLA 4IPLA 5LA0A 4NZCA 3PZVA 3UG4A 4WSJA 1GOMA 2Y8KA 1QNRA 4YN5A 1V0KA 4EANA 2JF7A 1XHGA 3OGVA 1UKQA 5A6BD 3RM9A 1VF8A 1CGVA 2VX5A 1NWSA 4CD5A 1J0ZA 1J18A 3WQ4A 1HXJA 3AIUA 3T0DA 2XSAA 2W62A 4OZOA 5ABGA 2PWEA 2J8FA 5A95A 2ZICA 1C91A 4PSRA 2WCAA 2QHAA 3HN3A 2EXOA 4D6JA 4AEFA 4J28A 3WDQA 2VZVA 4Q22A 4LX4A 1BFNA 3K8KA 2XG9A 2WHMA 5DT5A 3MMDA 1CGTA 4C7DA 5JBEA 4YPJA 5IHRA 1JAKA 1HX0A 3T2PA 5AC5A 1DP0A 5HXMA 1CXFA 4OKDA 2J7BA 2YA2A 4MB5A 1VFUA 2GJRA 1QBAA 8A3HA 1XH0A 1ZJAA 1BGGA 1CXHA 4CKQA 2V38A 1TVNA 2YDSA 3G6LA 3CZJA 3VM5A 4MB4A 3U7VA 5D9PA 1WB0A 4MB1A 2W61A 1UWIA 3AYSA 1Z32X 2WCSA 3O6AA 4ML4A 1KGWA 3IAQA 1BSIA 4AXNA 2CBVA 3SUWA 3B9EA 5ABHA 1ODUA 1KXVA 4U3CA 4W86A 3FAWA 3ARPA 4GPNA 5A6MA 3MMWA 1V0LA 5CSUA 2XFFA 1LLOA 4PTXA 5A2CA 4XUYA 2PWHA 2YL5A 1KQYA 2VZUA 4W87A 1VFMA 4E4PA 3ARYA 2WC7A 4AZHA 5IFPA 4OBSA 2ZX9A 1EIBA 2ZUTA 1B3WA 2ZX8A 1XGZA 4D1IA 3BSGA 2JE8A 2CKRA 4X0VA 3ZT7A 5DMYA 2A3BA 2WSKA 1KB3A 2YBTA 3VINA 1VFOA 4DM2A 3WDJA 5HPOA 3O9NA 4UFIA 1V02E 4OUEA 4MTVA 1UOKA 1ECEA 2DT2A 3OZPA 5BRQA 3WL0A 3TTYA 3SUTA 1FHLA 1WO2A 4CU6A 1EQCA 4D6HA 2CHNA 3MSDA 3CUJA 3ARUA 1BVNP 1LL6A 2JIEA 2O9TA 1IZJA 1NOWA 4U31A 5EBAA 1UR8A 3KEHA 2YDQA 2WZEA 9CGTA 1E0VA 4KRUA 3M07A 3WH8A 4BA0A 1KXHA 2ZUUA 3U7BA 2W63A 3SURA 5CPQA 1G5AA 5BROA 1J9YA 4HZ6A 1H3GA 1BPLB 1BQCA 1PZ2A 1UR0A 2WCGA 1TUXA 2E40A 1YQ2A 4DWSC 3VIFA 4HPHA 1HL9A 2J7GA 3IJ9A 4N42A 1HIZA 4NF7A 5I77A 2O9OA 2CHOA 2EPMX 2FHFA 3AHYA 4XX6A 1S46A 4HOWA 3NJ3A 3OG2A 1QPKA 3A4AA 1V3HA 2BXYA 3VMOA 1ZB5A 1Q6GA 2DT1A 1E6QM 1KCKA 3W6MA 4HU0A 3AHZA 3AZSA 1R8LA 3MU7A 5E70A 3ZR5A 3WSUA 2WXDM 5I79A 3AXIA 2ZX6A 4H8HA 2ZWZA 2UY5A 3K1DA 2HISA 2IXUA 1GVIA 2XGIA 4GZIA 2WMIA 1B3XA 5D9MA 1ISXA 3BLKA 3WL1A 2XJ7A 4V27A 3MUIA 4PMNA 1C93A 1XSKA 2E8ZA 4LPCA 2DT0A 4PUDA 5CJ5A 3K46A 3WENA 1DEDA 2X0YA 3L2LA 2VR4A 4QCFA 5BXSA 4LXFA 1BF2A 2PBOA 1PJ9A 2X09A 3VILA 1HP4A 3TTQA 4M82A 3WBAA 3THCA 4WLCA 4ATLA 1V6WA 3OLIA 4W89A 1W3LA 1UWTA 1BTCA 1B90A 3VIKA 5FL1A 3ZOAA 4GO9A 1MW3A 2X1IA 4PMYA 3AQUA 3L4ZA 3B9DA 3M7SA 3TA9A 3GTNA 2VURA 2YJQA 2DPEA 2F2HA 3EBVA 3N13A 5A6AA 2C0HA 1E43A 1J0IA 5AC4A 3SEPA 4E2OA 4J3SA 4JFWA 4ZFMA 1UYQA 3DYOA 3VVGA 4NI3A 1FH7A 1WZKA 2Y8VA 4IUGA 2DH2A 3IANA 2BVYA 1B3VA 3WNKA 3UR8A 2YKKA 2ESCA 1WDSA 1ZJBA 2J7FA 2YL9A 4LYRA 4OBRA 1KXTA 1C8XA 2JEQA 4FLSA 3VIJA 4Z2LA 2EBNA 2WNWA 2VQTA 4ACZA 4LGXA 2E3ZA 2OSYA 2QF8A 1JDAA 4PCTA 4QLLA 2PI6A 1E71M 5FD0A 3QHNA 1QNOA 2ZOXA 1V3KA 4GI8A 2YIHA 5A6KA 3WEMA 3U5UA 1NOFA 1TA3A 3PZNA 2ZXAA 1OIFA 2X8RA 3FY1A 4X0NA 2VZSA 1G0CA 4CD4A 1JAEA 1NH6A 3AIEA 1VENA 1W1TA 4DWSD 4UFHA 3U5YA 2D20A 4D1JA 1IZKA 2V3FA 2CXGA 1XYZA 4H04A 4AY1A 3WNMA 1HJWA 1UHVA 2WMKA 2GFTA 3PZMA 4DM1A 1JZ4A 3SIMA 2V5CA 4W8LA 1B2YA 4AD4A 3KE0A 4Z2JA 1UKPA 3T0AA 3CHCA 3HU7A 2WWDA 4Y7EA 1XV8A 3HMCA 4HA3A 1XC6A 4CCEA 1HL8A 2EEXA 4L4PA 4PN2A 5CPTA 2XWEA 3CZ8A 2J7EA 1C8YA 3BCFA 3ZT5A 3AHVA 4YHEA 4JHZA 4W7WA 2GJPA 2VCCA 2WZHA 5DO8A 3ZSTA 1F4AA 3BLPX 2DSVA 1JI1A 3WQ8A 3ZSSA 3JUGA 2PBGA 2G3MA 3EMCA 1CEOA 1ZL1A 1WDRA 1V6YA 2JIWA 1MQQA 2UWFA 2BHYA 2J4GA 2WVVB 3EMZA 4NRRA 3KZSA 3VGDA 1NQ6A 4M1RA 2FGLA 3KL3A 1BG9A 1E56A 1GOIA 3OGRA 4FLRA 4R27A 1E6XM 1MXDA 3PN8A 5DF0A 2WLYA 4W8BA 3AZRA 1K9DA 1CECA 4M29A 1WZMA 5A8MA 1HF6A 3VIMA 1J12A 2DSWA 3FW6A 1WZLA 1CTNA 1M53A 3ZJ8A 3ARVA 2Y5EA 5HOSA 2GSJA 2C7FA 2E0PA 4UQBA 2E9LA 4M56A 2WAGA 2XVLA 3W27A 1J0KA 2W66A 4CN1A 1RD6A 3TOPA 5ABFB 3GH5A 4N0RA 3VO0A 4Z2HA 4AZGA 5CG0A 4MNMA 4JKMA 3FN9A 4UCFA 2QLYA 5A6SA 2V5DA 4NRSA 1KGXA 2J62A 4FK9A 1JDCA 4U3AA 4JAWA 4EK7A 1US3A 3AHTA 3VIOA 4AEEA 2PWDA 1DWHM 3VGBA 2VCAA 2ZUWA 4Q7NA 4AD2A 3NSMA 4E8CA 1ISYA 1JZ5A 1TFVA 2WMJA 4Z2KA 1J0HA 4UQCA 1NWRA 3OLGA 5BXPA 3WNPA 4UZUA 3WQ6A 3WKZA 1UR2A 4ZE4A 1GORA 2VCBA 1WPCA 1W9XA 3BC9A 1KWGA 4M24A 4AZCA 1ZBVA 3UESA 1E1FA 3AIBA 2XHYA 4GI6A 2VUYA 3VU2A 5A1AA 3W25A 2XFYA 1W1PA 3ZIZA 3B8SA 5D9OA 1ISWA 4BF7A 3S2CA 5FOOA 1MQPA 1LQ0A 3WD3A 1UA7A 3MUZ1 1CNVA 2GJXA 4B9ZA 3D3AA 3UR7A 2J78A 1JD7A 3WF2A 4AZIA 5LA2A 2JFEX 3IK2A 3FHAA 2XUCA 5TD4A 1XH1A 4C7GA 1JNDA 1W9VA 2BFGA 3A4XA 2A3AA 3NYDA 4MB3A 4PUEA 3VIPA 2JEPA 4HU8A 2DSUA 3L4VA 1OT2A 1JDDA 4GIAA 4CU7A 3N17A 2VVSA 2BV9A 3N18A 3MUY1 3EDEA 5CSYA 1CGYA 3ZJ6A 1QI0A 4QFUA 3EDKA 5I3DA 1E3ZA 2CNCA 3RILA 1E4MM 1OBAA 2DIEA 3VD4A 3DC0A 2X2YA 1EXPA 3WF4A 1ISZA 3K8MA 1QHOA 3CZKA 1CXIA 4MNLA 3WMBA 5HPCA 3WELA 3RPMA 1SFSA 1W1YA 1CGXA 5JIPA 1PX3A 3LPOA 4P7NA 1NWTA 2CBJA 2PWFA 5CQ1A 1TVPA 1HP5A 4OOUA 1AVAA 1K9EA 4TX8A 5FKYA 3VGGA 1PEZA 1R7AA 1QI2A 1QI3A 2ZWYA 4LQ1A 1JFHA 4PSPA 1NP0A 1Q6CA 2CYGA 4W5ZA 1XCWA 4P7RA 4B3LA 1XH2A 1IV8A 1BYDA 4UR9A 2OLHA 4S3JA 1KGUA 1E1EA 7CGTA 1H4PA 2WBGA 1W3HA 3ARQA 1SMAA 1ESWA 2GDVA 2F61A 4M80A 3A4WA 1W9UA 1SYTA 4CCDA 3F5KA 2G41A 4F8XA 4AYSA 1HKJA 1V3IA 2DGAA 4LYPA 4NSBA 1UD5A 1QI4A 4TUFA 3N9KA 3SCNA 3PTKA 4EAMA 2RGLA 4BQ2A 1DWAM 4S3KA 4AISA 1JZ6A 1JZ7A 3AOFA 1ZS2A 3AI0A 4M8UA 3PZUA 1BG4A 1QVBA 4UQDA 1L0PA 5HBFA 4AZ6A 1CWYA 1J01A 4F79A 3FXYA 2D22A 2YA1A 3W28A 1JF6A 3CGTA 3SCVA 4CN6A 3OA5A 2FDMA 4A3HA 2VR5A 5M3WA 1XD0A 1UQYA 2VRKA 3UERA 1E5NA 4OIFA 5A3HA 1E0XA 1W3KA 2WHLA 1W91A 2WPGA 4KGLA 4B16A 4JKLA 3THDA 2WWCA 3GNOA 1NP2A 2DDXA 4F9DA 1LJYA 1NWUA 1KQZA 1O6IA 3AROA 2G3JA 4GZEA 2O9RA 2D23A 3AMGA 1H2JA 2JF6A 4J3XA 3VNYA 4PTWA 1E5JA 1KWKA 1KFWA 2XFRA 2YLAA 2X05A 5I24A 3FHQA 4AZ5A 4QLJA 1WCGA 3SCWA 3ALFA 5JBDA 2B31A 2XVGA 1OB0A 1UD6A 2VNCA 3VOCA 3UG5A 1F4HA 1GJUA 2XWDA 2Y4SA 4AW7A 2XGBA 1UH4A 1GZJA 3UETA 5A8PA 3WY1A 3CUHA 2CESA 1GVYA 1FFQA 4J27A 5A6LA 3BAKA 4B15A 4FLQA 3VGEA 3BAWA 5EB8A 3CH9A 1DWGM 5AY7A 5A8OA 1MFUA 4U2YA 3CO4A 2AOSA 1VBRA 1JZ8A 2XIBA 3VD3A 5M17A 4BZYA 3CIVA 1H1NA 3II1A 3BAXA 1U30A 1WDPA 4AZBA 4BQ4A 4DUXA 5DFAA 3WD4A 3KL5A 3MS8A 3RDKA 1OINA 3SUUA 3VDHA 4A3YA 2DEPA 5E9AA 5JUVA 1X1NA 2J75A 2XSBA 3E1F1 2BY2A 1KBBA 1MW0A 3ZJ7A 4UOJA 4QAWA 2VO5A 3GNPA 1CXKA 1C3FA 2GK1A 1JGIA 3BAJA 1Q4NX 2W67A 1B31A 3FAXA 3PZQA 2WVSA 3BH4A 2YLLA 2J7HA 2C8NA 1I75A 4TX6A 1CENA 3POCA 3WBEA 5HNNA 4DWSB 3SCSA 1HJXA 3FNDA 4D6FA 1VAHA 4PMDA 2DQXA 1QNSA 4ZEPA 3CZLA 4TTUA 4A4AA 1EDQA 7A3HA 1E4IA 3NDYA 5LA1A 4EKJA 3L4XA 2PB1A 3WH5A 3W37A 1BLIA 3KL0A 1R85A 5BXRA 4J3UA 3GZAA 4IPNB 3EDDA 3AJ7A 3AXXA 1SR0A 2UY3A 4V2XA 1J0JA 4GQRA 3AFBA 3OIHA 3TONA 1VEOA 5CLWA 2EJ1A 2OSXA 2XTKA 3CBWA 3ZT6A 1KXQA 4CVWA 2YOCA 1H0IA 2NT0A 2IUZA 1GOQA 2Z1KA 1VJZA 3NIYA 2DSZA 3WDHA 3MKKA 4R5EA 1FOBA 4GXPA 3ARTA 1JF5A 4WJXA 3CMGA 1TE1A 4MNJA 3QOKA 3GBEA 5C71A 4AZ7A 5HDRA 3W4RA 4F66A 4JFVA 1DTUA 2VZTA 5E0FA 2VX7A 4JFTA 4OOZA 1Q6EA 1UD2A 3VGHA 4KRTA 3GH4A 1EA9C 1EGZA 4XZWA 1RPKA 2WVTA 5A6BA 5CZKA 4QCEA 2CBUA 5DT7A 3GXFA 1JYWA 1UKOA 3A6OA 4AMCA 1JI2A 1V3LA 2EO7A 2FGZA 2MANA 4TVCA 3KWXA 4UNIA 4HMDA 3F5LA 2NW0A 2NT1A 3I3BA 1MXGA 3VPLA 2WMIB 1ZBCA 2G8ZA 2DSKA 4TTGA 4CD8A 3VIHA 1PBGA 4J3VA 2CIPA 4MAVA 1V6VA 3AIWA 3BAIA 2OSWA 3SCOA 4QP0A 3IJ7A 4QDMA 3VX0A 3OLEA 1WAWA 1CLXA 3WFZA 3L4TA 3VX1A 3RM8A 4X9YA 4HMEA 1NM9A 4UOQA 2CBIA 1V6XA 3BSHA 4WKHA 5GNXA 1GQKA 1GOWA 1PIGA 4FMVA 2PC8A 4D6CA 3BCDA 1XRVA 1VEMA 2WMFA 4AD0A 3ZO9A 3AIVA 1WE5A 3OBAA 4RE2A 3RO8A 4UQAA 1CDGA 1UUQA 4J3TA 2E8YA 5BWFA 4FLOA 4CCCA 4PMRA 1P6WA 2VI0A 4P7LA 3DHUA 3ZM8A 2J25A 5C8BB 1KBKA 1FP9A 1JL8A 4UFLA 1V3JA 3PZ9A 2WVUA 4GI9A 1U33A 2V3EA 4P7OA 6TAAA 4XZBA 3CZEA 3VM7A 3GXDA 3DHPA 2ZUNA 2G4FA 6CGTA 1DWJM 5CGTA 2X0HA 4D72A 3ARZA 1W9DM 4BQ5A 2WKLA 1MYRA 4W93A 4UQ9A 2F8QA 1US2A 4E8DA 3DECA 4TVDA 2UY4A 1WZAA 4W84A 4P8WA 2ZIDA 3WNOA 2WYSA 3AICA 3AS0A 4PMOA 3VMNA 3VDCA 4ZXOA 1OD0A 4H8VA 2OWXA 2WB5A 3WNNA 3L2MA 3WUBA 1PX4A 1PPIA 1E40A 1TG7A 1MQRA 1GPFA 1HVXA 4PTVA 5BXTA 4B3KA 4Z2IA 1TA3B 2QV4A 2PF0A 1G9HA 1CXLA 1PIFA 3LPPA 4UTFA 1YHTA 3WDIA 3VMPA 2IXVA 3WQWA 2BY0A 3W29A
chains in the Genus database with same CATH superfamily
4ZQMA 2IKIA 4Y9PA 4EPEC 3T08A 3ANVA 1WXJA 2PFHA 1V3MA 2GQ8A 4U33A 4RNFA 1ZFJA 3I3EA 3SSJA 3SW6A 1WKDA 1K9TA 2QMJA 4D8AA 4Q8TA 3S9IA 1ZY9A 3AS3A 1FP8A 3CZGA 2D2GA 4H7CA 3ZQ9A 3AU6A 3PZOA 2AQOA 1J79A 3NUKA 4S3FA 4F3HA 3WYZA 4Q33A 3B8IA 2UY2A 1G1YA 2IQDA 4PCSA 3S6OA 3VDBA 4NUWA 1TQJA 3GDLA 5LNUA 5I3FA 1IR2A 1QASA 1FA2A 5EMMA 3MMTA 3AMCA 2FPVA 4N7QA 1JXKA 3PFRA 3AHXA 1KM2A 1I4NA 1E55A 4WKAA 4FNRA 2A2IA 4FXSA 1VFHA 3T8LA 1QWGA 2ZC1A 3T09A 1JZ2A 3G1FA 4QJ1A 5FIPA 5IDIA 3WD2A 4DZIA 3B0YA 3M47A 2C1HA 5I78A 1EDTA 2PD5A 3KLKA 2ZC8A 1LQ2A 1OGSA 1D7FA 2YL6A 3N3TA 1KLYA 5IBXA 4QG6A 1VP5A 3UCCA 2NVDA 3CTTA 3REQB 1QFEA 5HMEA 1M01A 3NQAA 5G1TA 3KP1A 4C5ZA 1IZCA 3LQGA 3LTPA 4AX7A 2BS9A 3W2LA 3UP8A 1AMYA 1GW1A 2YA0A 2GSHA 3RR4A 4MNKA 4GKLA 4LANA 2BX7A 1LBMA 1UCWA 4HA1A 4GUIA 1CT5A 1EJSC 3QGVA 3VOHA 4LF1A 3U2EA 5HWMA 1QBBA 5A8GA 4XKYA 1R3QA 3WDRA 3WF3A 4JHMA 4MPKA 2ODOA 3SSZA 2QT3A 4P8UA 4UUIA 3S6DA 1KFLA 2C13A 2QS8A 4FSAA 3WEZA 4TX9A 3TMQA 2OYMA 5G5IA 4LVBA 1X38A 1RP8A 1OFQA 1W1VA 3ABQA 3LV5A 5DCEA 1N2VA 4AZCB 1RQHA 2W4XA 1X8CA 4JIIX 2CZFA 3I4KA 4EE9A 1DJGA 3MA8A 4C6IA 2I5GA 4YS1A 1BHGA 4CGTA 3DFTA 1QJWA 1UC4A 1F74A 5K9DA 1XQLA 1GOOA 3MCOA 5EFDA 5MKGA 4H9TA 4C5YA 3BGAA 4GZJA 1SM9A 4AIEA 1WYIA 2FZMA 5TNVA 1E6RA 1KTCA 1ZHAA 3SRFA 5G1MA 1EYEA 2XVKA 1B30A 3DX5A 5G2IA 3RLHA 1ELSA 5HQMA 5JQ9A 2WM0A 5I3IA 3T0TA 4MWAA 5LIYX 3BO9A 3EPOA 3SY1A 4ZO9A 2QMKA 1BGAA 1HKMA 5KTLA 1LWJA 1MEIA 1AFSA 3SADA 3NVTA 3F5JA 1NJJA 1L9WA 3F4VA 3I10A 3KP0A 4BS0A 1OIMA 1LZOA 2Z24A 1A5SA 3V1HA 4IQLA 4DWSA 5GNYA 1TPDA 1JYVA 3BMWA 5C70A 2RDUA 3CQKA 5F2GA 4IIBA 2X7WA 2GGGA 4GO8A 2UBPC 3FYPA 1QMLA 2RUSA 3NPUA 5J8LA 4AYGA 1ODZA 5GJPA 4WRHA 3DERA 1TPVA 3N4FA 1VGAA 2CLFA 4QM1A 3A21A 4HA4A 3HPXA 2INFA 4IIDA 2A3EA 3AZTA 3WLOA 1UWQA 3A13A 1UQZA 1VIZA 2WC4A 5DX7A 4H1ZA 3SB0A 2V67A 4DI9A 3K4WA 1UG6A 4BEUA 3T78A 3WF0A 1H0GA 4CNTA 3LXCA 5I0DA 1DTNA 2D24A 2WKGA 4GCXA 3ARWA 1QW8A 1S2UA 4HNOA 4RDWA 4H8UA 4J7RA 3KBNA 3W7NA 1OWQA 4JQ4A 3A47A 4U5KA 1K9FA 3KLLA 2CZEA 4JY8A 5LIUX 1CYGA 4R53A 1FHDA 1MW1A 3UZJA 4GUFA 1TV5A 8CGTA 5A94A 1P48A 4DZAA 1O95A 4ZENA 1YNQA 2CLMA 1F73A 3GQYA 4QQUA 3ABXA 5L9FA 4L4OA 4L9ZA 3ITYA 1E70M 1P0EA 2FHCA 1EOKA 3T0BA 4C6JA 4GWEA 3AS1A 3RJXA 2GUYA 5I6SA 1EDGA 3MCMA 3QMRA 4PZVA 1FWNA 4FOUA 2I1OA 3KW3A 3CUZA 2Q8ZA 1OADA 2XIIA 3O1NA 2VD8A 2J7CA 3A3XA 3CHFA 3KBSA 3CQHA 1QPNA 5D8ZA 3RLVA 4BY3A 3M4HA 1GUVA 3BAYA 4LALA 1V4YA 3JVAA 3O15A 4DXVA 1UH3A 5I2UA 4D71A 2Q09A 2C6QA 1CXEA 1RQBA 1MDRA 2C0AA 3T2OA 1JFXA 5GNZA 3LBMA 3CEPA 4HYRA 3YPIA 1HT6A 1TWZA 5DXXA 4AX6A 4OU1A 2D2HA 1MRAA 3T55A 4D6GA 3B3DA 1UROA 5T9CE 3MWCA 2VEGA 1XDLA 3ME3A 3F1QA 3BG3A 3B05A 1AA1B 5REQB 2WVVA 5GQBA 1W5PA 2NV9A 1I45A 2WZTA 3NQDA 4LF2A 1V0NA 1N7KA 1E6NA 1XLEA 3L4UA 2XM1A 1XX1A 4HPXA 3CIXA 1GNXA 4AUBA 1OFRA 3TEVA 1IF2A 2BHUA 4DLMA 2CWNA 4FHAA 1YXDA 1VQTA 3M0KA 4WIWA 5M5DA 4DJFD 1KV8A 5HA7A 1JG9A 1X97A 3N3MA 1TJ0A 4QR6A 1G01A 5F1VA 4H9UA 3ORWA 4M0XA 3PC0A 1T0OA 5ABFA 2HNHA 1KFCA 4AD1A 4BWLA 2PDUA 4YCOA 4CQDA 5K4ZA 1U1JA 4JL2A 1W56A 8RUCA 1NOUA 3ZR6A 4Q8VA 3BMVA 1Z44A 4PMUA 3QOMA 2QCDA 4DEFA 3LBCA 1AUSL 5DMNA 3QGAC 3WD0A 3OJGA 3B04A 3MQTA 3HQOA 2ZX7A 1X98A 1NTHA 1FUYA 1T99A 3SCTA 1OGBA 4NAEA 4EXQA 3P81A 3K4AA 1V6TA 4WDUA 4O1BA 2YXGA 4UFKA 2WJZA 1XLAA 4JIPA 1Y5XA 4NNAA 3H12A 3I3DA 1UR1A 2XVNA 4LNCA 3W00A 2EQDA 3BDKA 5F2MA 3FKKA 1J10A 4M5PA 4K6AA 3B4YA 3M41A 4UMBA 2ZA2A 1C7TA 2Z2AA 4YU1A 5F7UA 2PP1A 1GONA 2D3LA 3B0XA 2A3CA 4F9JA 2BHZA 4IMEA 3A3HA 3QR1A 3VIIA 3C86A 2D69A 2ZUSA 3CLWA 3RHGA 1ADSA 2PTWA 1W2VA 3LLFA 2PCQA 3BLOA 1SZRA 2OB3A 4TVUA 4WK9A 2FIQA 4RE4A 1BYCA 1AQ0A 3EDJA 2YSWA 4LVAA 1HKWA 4IQJA 1XD1A 2ZXQA 4AIOA 5LXXA 3TTOA 1B54A 4CN4A 2B0MA 5HUOA 4F48A 4HOZA 1GJWA 3WLKX 1PHWA 1RCQA 4PMZA 3MUAA 1GCYA 3BJSA 4I7WA 4L5ZA 4DUOA 3OG3A 3LGEA 4KESA 1ZBKA 1A4LA 3P7YA 1V03A 5ECVA 3ZLFA 1XM3A 3IUHA 1WBJA 2NX1A 4NASA 1CGWA 1UKTA 2IKJA 3USBA 4G2DA 2HE5A 1WA3A 3PBGA 4AVFA 4RZ5A 3E2SA 3MJYA 3RITA 1EEXA 1P1MA 3ZJKA 4EPKA 1EC9A 1AQMA 5IM51 1JNEA 4GC4A 4LY8A 1U2YA 1O5RA 3QQ0A 1QNPA 3LRLA 2YBVA 1XRTA 3GU1A 4PMQA 4XO7A 1A4MA 1SO3A 4FO4A 4KH2A 1A0CA 5LYRA 5K4XA 5BMXA 5CC5A 3LCLA 5KZDA 1X39A 2PP0A 4I6KA 3WK0A 1PAMA 4A22A 2XIJA 4I90A 3IIXA 1HJUA 2VJXA 5CG7A 3VNIA 5C7VA 4NZCA 3F4NA 2BOFX 3UG4A 2E6DA 5DXYA 4GQ0A 2OLAA 2Z29A 2JK2A 2JF7A 4JTQA 1XQKA 1UKQA 4I8DA 3XINA 2VX5A 2R1MA 1UMLA 1BKSA 1G6CA 3TUUA 4S2CA 3WQ4A 3GO2A 1SU5A 4A29A 2A79A 3DG6A 2XSAA 4XAYA 3RNDA 1K4HA 4L7ZA 3HG3A 2E1WA 4PSRA 1XIIA 2ZZ6A 3ZXWA 3UZXA 4QJ4B 1YXCA 5CBBA 4J28A 3GXNA 4R88A 3ISIX 3TDFA 4Q22A 2XG9A 2E68A 4Q4MA 4ZOBA 1TJPA 1R3WA 4HNLA 4C7DA 2PDBA 4NNBA 4ZODA 3E0LA 2VGIA 5EL1A 4RV8A 5AC5A 1O12A 3BQ6A 3UZZA 5HXMA 4OKDA 4MB5A 4YWSA 1QBAA 2EGZA 1OCBA 2PURA 1ZJAA 1CXHA 1TX0A 2Z1WA 4GVHA 3G6LA 2PWVA 4E2DA 3MTWA 4LS0A 4AVOA 3V18A 3QZ6A 2R24A 3NL5A 1DOSA 3KCOA 3B4UA 4O1AA 4ZQNA 3O6AA 5HR6A 4L4MA 4ML4A 2P10A 1O5QA 3K5XA 4AXNA 2V63A 3SUWA 2MUCA 4UTMA 4KFOA 1YADA 1ODUA 3DXIA 3WK3A 3IS4A 3FV9A 4KERA 5A6MA 1XKJA 3MMWA 3V1PA 3FDKA 3UWWA 1X7IA 1LLOA 3R10A 3BLIA 3AAMA 4W87A 3LG3A 3D6NA 4Q4QA 2WC7A 5C9UA 3M0ZA 2NQLA 3N9SA 3S83A 3LHTA 1DIEA 2ZX9A 3LY0A 4X0VA 1KRAC 1YDOA 2WSKA 1KB3A 4TV6A 4MKVA 2IPFA 3DHFA 3TZNA 1TWIA 4XKYB 3V4BA 1KLZA 1UOKA 1UIPA 3NR0A 1LORA 3WL0A 4O52A 3T07A 3TTYA 3L7RA 1EXBA 2QUVA 4PUUA 3SQLA 1F07A 4D6HA 1VKFA 3SECA 4ZFCA 5DELA 3G8EA 4C6EA 1IZJA 4HJFA 4MWAC 4U31A 3EA1A 3RU8X 3W7RA 1Z7AA 1UR8A 3KEHA 4ZR8A 1RJPA 2HVNA 1Y5VA 3BJFA 1OZMA 4LT9A 4E38A 3NVDA 1UZHA 1V51A 4OHQA 1G5AA 1J9YA 4XUGA 1H3GA 1BPLB 2WCGA 1YQ2A 4DWSC 1Z69A 3PVFA 1J8VA 1J5SA 1GKPA 4CNNA 5FEWA 2FHFA 4R7WA 5MKGB 1S46A 3NEHA 3OG2A 2WV8A 4ORMA 4NZJA 2FDSA 1K70A 1VYSX 1ECQA 3PAJA 1E6QM 3AHZA 1VH7A 1ZALA 4MWAB 3WSUA 3GIYA 3AXIA 4JNZA 3W7KA 5AHNA 5HMDA 1GVIA 3CT7A 1ZUAX 1XYCA 1EC7A 3PP7A 3QV6A 1AZ2A 2XJ7A 1C93A 6XIMA 4GY0A 3LGGA 2NZLA 3BJTA 1AK5A 1M5WA 1Q63A 4IOTA 1DEDA 3KRBA 3ZVIA 3L0KA 1RR2A 5H2ZA 2WSRA 4QCFA 4LXFA 3VFLA 4LAKA 1HP4A 3TTQA 4M82A 3WBAA 1ONRA 2GVLA 5CKSA 3AUJA 3OLIA 1W3LA 2H9AA 3N6QA 4AEOA 1DIDA 5FL1A 3BICA 4EXBA 4XK2A 3GU9A 3AQUA 4I5XA 2Y85A 4FNPA 5C9RA 1Q3NA 2YJQA 3EBVA 7REQA 3GVRA 4OBTA 2PDHA 3U2CA 2YYUA 3GR7A 1G4TA 3WLHA 4V1YA 4RJEA 4E2OA 1J2WA 3G1SA 4J3SA 1SFJA 3VVGA 4NI3A 1WZKA 3G1DA 1A5NC 1UIOA 2OKTA 4O1CA 4HGXA 4DXXA 4NQ1A 4I5RA 2YKKA 3LV6A 1NAL1 1YDYA 1EYWA 1WDSA 4KWOA 4O16A 2YL9A 2QULA 4HHPA 3VIJA 3R0DA 2FYMA 3C0LA 1M7PA 2VQTA 2PTZA 4J2MA 1EX1A 3N9RA 4US5A 1POJA 1Z8AA 2QF8A 1PE1A 1E71M 5FD0A 1M6JA 4RLIA 1I2QA 3VKJA 2FPTA 2PF8A 5C9WA 2YIHA 3WEMA 3U5UA 4N4QA 4J1OA 1WUEA 3R6IA 3BVJA 3PZNA 1VCFA 1TTQA 4UTHA 1R3VA 2VZSA 3DZ1A 1G0CA 4O1EA 1TREA 1KW1A 3M5YA 4LUTA 3EOEA 1H63A 1MO0A 3U5YA 2HDJA 3FJ6A 3BUVA 3UY8A 1XYZA 3K30A 2WMKA 3OHMB 2GFTA 1NQKA 3TC7A 4H8NA 2E25A 2V5CA 2FVMA 3NFUA 4Z2JA 1E0UA 1UKPA 4HA3A 4HKPA 4GGHA 3GTHA 3MZNA 4M19A 5CPTA 3DFSA 2XWEA 1DYSA 2J7EA 2L5HA 4YHEA 4GGBA 1AH0A 2WZHA 4XG1A 1G69A 1F4AA 2NX3A 3ZSSA 3JUGA 2PBGA 2G3MA 1WDRA 4YJ5A 1XIFA 2WVVB 3EMZA 3VOIA 2J66A 3FIGA 1EWDA 1NQ6A 4N6FA 1GOIA 3T9PA 4FLRA 4R27A 2IKHA 4W8BA 4DBUA 4C6KA 4H2HA 3TE9A 3CUXA 2Y7FA 1WZLA 3IJQA 4DNHA 3VOFA 2Y5EA 4YWIA 1FCQA 3THAA 1Q2RA 5H91A 5HOSA 2QIIA 4JR5A 4ZO8A 1PWLA 2X40A 2XVLA 3W27A 1MDLA 3DENA 1GVSA 3TOPA 4OV4A 5ABFB 5AC7A 3GH5A 1TTPA 4RZBA 3W7JA 3L2IA 4N2YA 2O7SA 4JKMA 4Q8WA 4UCFA 3R13A 2EJAA 3MYOA 3I7SA 3N4EA 4WY0A 3GG7A 4YYFA 3EXSA 4EK7A 4RXFA 1BRLA 4C6PA 3U6WA 4Q7NA 2QCDB 3VNDA 1Q85A 3R0KA 4NNCA 2CLIA 3FXGA 1ISYA 1JZ5A 3G1YA 1KM0A 3OLGA 1XIBA 2C1GA 3H2NA 5BXPA 1IGSA 1XP3A 4INFA 3WNPA 2V5LA 3WKZA 5BWAA 1UR2A 3P8IA 1WPCA 3LLDA 4GMEA 4NAEB 1KWGA 4M24A 2PMQA 1OYAA 2OZTA 1FBAA 2XHYA 3W25A 2XFYA 3GAYA 3ANYA 1CI1A 5I02A 1ISWA 2PU1A 4HJWA 4ZO7A 4HB7A 3LN3A 3TJLA 4XBKA 4HSNA 3LEPA 1EZWA 5LKYA 1LQ0A 3WD3A 1CX9A 5AN7A 4Y8FA 1MZRA 2VR2A 3D3AA 1JPDX 4HPJA 1WBHA 4P5UA 5EPDA 1FX6A 3N2XA 4NKCA 1N8FA 1XH1A 3O0FA 4C7GA 3MP4A 4S3BA 2FQIA 3GB6A 3GHTA 4IQEA 1W5NA 1TO3A 2VEKA 3NO5A 1PTAA 2DSUA 1LRTA 3E9AA 1QATA 3C52A 2VGBA 5HWJA 2HJPA 2HCVA 2ISVA 1F2JA 2BV9A 2RDWA 2ISFA 2NWRA 3T44A 5CSYA 1CGYA 4BHYA 4GNVA 2YDAA 1QI0A 3U2OA 2PDIA 3CL6A 3EDKA 1E3ZA 2CNCA 3LA4A 3RILA 4QROA 3LENA 4GH3A 2QAPA 3DC0A 1ME7A 1A80A 3TSBA 4WDXA 2X2YA 4M6QA 3V16A 3WF4A 1F5ZA 1QHOA 1BXBA 4MNLA 3WMBA 4DHGA 5HPCA 3WELA 5K3VA 1CGXA 4WZHA 3LPOA 4P7NA 4ZBCA 5CQ1A 4IUOA 4TX8A 1W37A 4FPSA 4LQ1A 4HSHA 1TV7A 1BXNA 1DJHA 4W5ZA 3FA5A 1FWCC 3KVMA 3PSVA 1XH2A 3N4AA 4KWWA 1BYDA 5CEWA 4GYPA 4KIEA 1SMAA 4LVDA 4HSOA 1M9HA 4CCDA 1SYTA 4LRTA 2G41A 2V69A 4AYSA 4LYPA 4NSBA 1UD5A 3N9KA 5KZMA 3R0UA 5CPMA 4BQ2A 3TROA 3SJNA 4S3KA 4AISA 5LIKX 3NM3A 1ZS2A 3UYIA 2ISSA 4UQDA 1L0PA 1JULA 4AZ6A 2H8ZA 1CWYA 1SZGA 2W6RA 1ENUA 3W28A 1JF6A 3MWAA 3SAZA 4CNUA 2XIOA 3V5FA 1UQYA 2X0SA 3UERA 1E5NA 1Q7ZA 5A3HA 2ONEA 2WM1A 3T05A 4W4QA 3Q45A 3HV9A 5KETA 5EU9A 3TJXA 4J35A 4UNKA 3GNOA 3U9IA 1I2NA 1NWUA 1H5YA 1O6IA 1TRIA 2QNEA 2JF6A 4IGMA 4DYJA 2BASA 2F7FA 2XFRA 2YLAA 3L5AA 5I24A 3FHQA 4Y96A 2ZRUA 4A6GA 5ENLA 1OB0A 3SRHA 3MHFA 4JTGA 1TPFA 1UH4A 3QZEA 5A8PA 4E2BA 4XIAA 4IMCA 4L64A 1KFBA 1FFQA 4J27A 2IPGA 3BAKA 1H1YA 3ZS4A 4FLQA 3WLJA 3VGEA 4EX4A 4Y2WA 1PZ0A 4S3AA 3L0GA 3BOXA 1VLIA 3S2NA 4HHLA 4Q32A 1PWMA 1IGWA 4ZB2A 6ENLA 3UW6A 1FDJA 1Y5WA 1EF2A 1JZ8A 3STFA 4KEVA 4FOKA 4NX0A 4ZO6A 4HD5A 4AZBA 5DFAA 5FEXA 3WD4A 3KL5A 6TIMA 1EC8A 1XYMA 3RDKA 4LOCA 1OINA 3WJZA 4A3YA 2DFAA 2DEPA 5E9AA 3M1ZA 2X1UA 3EOSA 1L2QA 1RHCA 3BZGA 3CV2A 2GK1A 2W67A 1B31A 3FAXA 3BOFA 4UBPC 2TRSA 5BU6A 3WBEA 1JUBA 3W1MA 4D6FA 1VAHA 2DQXA 4DAIA 4TTUA 1EDQA 7A3HA 3GU2A 4PEKA 4EKJA 3EOOA 1A5MC 4K8EA 3H21A 1PKYA 4NXKA 3VNJA 3AJ7A 4XTIA 1RVKA 1J0JA 4L1GA 2CWXA 3SN0A 4H6RA 4G8TA 1VEOA 3G2GA 1FWHC 2KAUC 5BW6A 3ZT6A 4RW3A 4CVWA 2YOCA 3IVTA 1VJZA 1ZJHA 2DSZA 3URQA 4UWMA 4R5EA 3PPFA 1Q6OA 4FA3A 4WJXA 1SR9A 2R82A 1MUMA 2NX9A 4NZFA 2D73A 1GVRA 4JFTA 4OOZA 2PTYA 3OEXA 3VGHA 1LUCA 4XZWA 1RPKA 2OODA 2WVTA 1EJUC 5A6BA 1NVMA 3BZJA 5AZ0A 5DT7A 2GVJA 3GXFA 3OIXA 4R7OA 1V3LA 2YB1A 2ZADA 1Q4WA 2MANA 6PTDA 4CQCA 3R8HA 2FTWA 4HMDA 3F5LA 4NYYA 2G8ZA 3MPGA 1F05A 4PR4A 3QTPA 1OFBA 3IJIA 3VIHA 1PBGA 4GX9A 4NJIA 1S2TA 2RDXA 3AIWA 3W22A 3SCOA 3W6YA 2P0OA 3L4TA 3RM8A 4X9YA 1XLBA 1YE6A 4DVOA 5GNXA 3GK0A 1D3HA 1GQKA 4FMVA 1OFDA 3MO7A 2PC8A 3TNOA 4ES4A 2A21A 1XRVA 2RJGA 4XO6A 1ICQA 3AIVA 3ZO9A 5HK4A 2H9AB 3DHDA 5D33A 3RO8A 2P88A 4CNOA 3B9OA 4UQAA 1CDGA 1P6BA 2GQ9A 2IPJA 1XG4A 3LU2A 1P6WA 4K1GA 1T8QA 2PD9A 2J25A 2GPTA 5C8BB 4YXGA 7REQB 1FP9A 1JL8A 1V3JA 3PZ9A 5D32A 4HVXA 6TAAA 4ZQPA 3NDOA 3ZWSA 1DQUA 2AL2A 3WMLA 3RRAA 2ZRXA 2Y62A 1BVWA 1S3HA 4ZOEA 1LLWA 4Y9AA 2VP8A 1MYRA 4W93A 4L61A 3TYZA 4E8DA 1V77A 3WNOA 3AS0A 3MY9A 3P80A 3MI3A 3M64A 5A5WA 3HJZA 1WXYA 3ITLA 3USZA 1UZDA 3S5OA 1Z48A 3BLEA 1J93A 3UZWA 4K37A 3RLGA 3TSDA 5G2HA 4NXSA 2P8CA 2ICSA 1HL2A 3IUDA 4G56A 4JTFA 2I5QA 4GIRA 1G9HA 2I56A 5KINA 3UJRA 3VC5A 4LUTB 3W29A 1UWRA 3GYCA 2YW4A 1EGMA 4IIHA 5I23A 1FWIC 5H8UA 3GM8A 2WQDA 2V2HA 4GFIA 4BI7A 3AXHA 3OB8A 4WHBA 3LHWA 1DWFM 4WF7A 4JIRA 3PPHA 2DZTA 3CMFA 1EJWC 3EXRA 1OYCA 1DJZA 1GQJA 1ITCA 2XIQA 2QAFA 5A8NA 3PTDA 4PFMA 2PSNA 4N4PA 2OEMA 5E0KA 4XQ6A 4DZHA 1TQXA 2C1IA 1YNPA 2V2CA 4Q4KA 3CC1A 2QPSA 3NOEA 2POTA 4Q6XA 2X41A 5JIWA 2POZA 2V9DA 2CC0A 3E2RA 1FWAC 1XUZA 4KWSA 4IICA 3OU8A 2XPKA 3KDOA 4N9DA 4U5IA 2Z1VA 1C29A 2OX1A 5A2BA 1ITXA 4F4RA 3N15A 2ZE0A 5H8PA 4XD5A 3SCRA 1DORA 1QOPA 3GNDA 2CPUA 1S3TC 2VTFA 3MBDA 4V15A 4MJZA 4IJRA 1D8WA 2ABAA 3W0KA 3N04A 3A22A 1LCOA 3EKZA 4W8AA 5HQLA 1IT0A 4IXXA 1DHPA 2EAWA 2WSPA 3FK4A 4DI8A 2Z1SA 4PA8A 1TZ7A 4MDPA 3D5HA 1TCDA 2H3DA 3U8GA 4Y9MA 4WY0B 2FZ8A 3NXFA 3WCZA 3G3DA 1MXSA 3CMJA 1BRLB 1K6WA 1PCKA 3SCQA 5BU9A 5KEZA 3SUSA 1H61A 3S5NA 2BSLA 3BWWA 4JN6A 2YZ5A 4JXCA 1NIUA 5C0QA 1MSSA 1UA3A 3WF1A 4IP4A 4FX6M 1V7YA 1QW9A 1MFVA 2Y89A 3T2QA 2PWUA 1X6NA 1H7XA 5D4YA 4Q4RA 1L6FA 4GQQA 1CGUA 4AXKA 3O6DA 4IIGA 4AHQA 3WH9A 2V3GA 3QW4B 2QV5A 2V81A 1QNQA 3VD9A 3AU2A 3KTXA 3AIRA 1TX2A 5LZLA 3VI2A 1DJYA 2YX0A 4D6DA 4JBRA 1C9WA 1GWJA 1JCLA 2D3NA 2PGWA 2J8GA 4UXDA 1ISVA 5CZSA 2BY3A 1TPH1 4IL0A 1R9ZA 2QJHA 4MGGA 1NDWA 4EAYA 2IKGA 3SN4A 4EP8C 3MHGA 2G3IA 1CPUA 1XPYA 4R3UA 1X7FA 3WUGA 2XINA 3FJLA 3V0TA 3NTYA 2XDFA 3S0CA 5BMWA 2A4AA 2VFDA 4GHRA 1UASA 2W91A 4XISA 3ZYZA 4XV0A 3SM0A 3Q65A 1JCYA 4GVGA 4E4FA 3NZPA 3QKZA 1RH9A 2Y5JA 2OO0A 1YDNA 3C5QA 3AISA 4ECLA 3RMEA 9RUBA 4WQ6A 1S5TA 2J79A 5A2AA 3CS2A 1VBHA 2X1RA 2BDQA 1QNVA 1LG1A 3G77A 1BKHA 1RA5A 1VFTA 1J0YA 3LNMA 5JBFA 2P1FA 3H2OA 1DXFA 3W7CA 1UH2A 3T1GA 1PVNA 3TR2A 1A0EA 4UTTA 4E2VA 3KWSA 3QC0A 3URAA 5AHEA 3GXIA 3BPWA 2J9YA 1W31A 1XYFA 2QPUA 2EPNA 3IVSA 1GZ1A 1ZENA 1PZ3A 3CQIA 1V6UA 3CYVA 4GQGA 1KV5A 3EX2A 3S2MA 2OOGA 3LZ5A 1J11A 5I5RA 3WQVA 3DIPA 3KX6A 5KZ6A 5E09A 5JU6A 1EO5A 5A69A 1ZP4A 4K3ZA 1ZBWA 5AYBA 1LL4A 3ZVHA 3IEBA 1O68A 4K39A 4WJEA 2JGQA 4CD6A 3SDOA 2GWGA 2BVDA 1EQPA 2WSYA 4AD3A 2DT3A 2P8BA 4JFUA 1VJSA 3MMUA 1PTGA 2GZXA 3QM3A 4O57A 5LNVA 5K9CA 1IWAA 3F2BA 1SO6A 2B4GA 2MNRA 1G4PA 4QTGA 2F9RA 3CWOX 3ARXA 2O0TA 4DF1A 1JCMP 2G3NA 3CPRA 2JKAA 1TE6A 4MYXA 1R46A 3QQWA 3LCIA 4CCZA 2EHHA 1UWSA 1H7OA 1I1WA 5LHEA 2PPGA 4ZTYA 2XFWA 3P14A 1W2PA 2YBUA 3L12A 3RM4A 4UIOA 2ATSA 2BGSA 3QSTA 4O8RA 3UA3A 2EPKX 2NUYA 2O4QA 2Y88A 3UGVA 1C8QA 3KBWA 3CH0A 3L23A 3PR2A 2FH6A 1TELA 1DHKA 1AW1A 1QPOA 2A5HA 3MVTA 4O54A 1RY0A 3E5BA 4H9VA 4F0HA 1W9PA 4GH1A 1RP9A 2O55A 3AJXA 1HJSA 2ISDA 1QWKA 5D8WA 4JIHA 3WBXA 1SUXA 1JGMA 3M5XA 4K8HA 4WUIA 1TMLA 4NG3A 2PCEA 2VFIA 3R2GA 1CBGA 2J24A 1Q6QA 7PTDA 2OQYA 3LCXA 1QI5A 3HO8A 2GK1B 2TAAA 3APGA 4YVVA 7TAAA 3BK0A 5G2WA 2WK2A 1Q5MA 5AZ1A 1XIEA 1FWTA 1ZU8A 4HTYA 3QPZA 4JTRA 2GGJA 1JYXA 3SI9A 2DVUA 2A7RA 1CLKA 1OGGA 3DU0A 3HV8A 3GKAA 4PC8A 3WMSA 3H8AA 3GDTA 4LUYA 3TYEA 5HJXA 3UPBA 4B91A 4UC5A 2LLEA 3TZFA 3K4DA 2YCIX 4YVPA 1IWPA 1G7UA 1OFOA 1TV8A 2Z25A 4JICA 3ABSA 3H26A 4LV9A 4E6MA 3I6EA 5CXPA 2X30A 4C6MA 3PTQA 1MEWA 1Y0EA 1CZ1A 1SVDA 1GVFA 3TQ0A 3G3MA 2NQHA 1KR0A 4UMAA 4AWEA 1L6WA 3L4YA 1LQAA 4PYSA 3R4IA 3G18A 1KRMA 1GQIA 1RK6A 2VZOA 2XN1A 3OLDA 5AHFA 2OYLA 5AC6A 5G4EA 2DUZA 4QLKA 1UR3M 2YCKX 3UXLA 3H6OA 3TR9A 3IRDA 4JCLA 4XZLX 2PS2A 2QXWA 3EDFA 1EGVA 5LNSA 1C92A 1E6SM 3QW3A 1S1PA 2BXZA 4O13A 4B5TA 4ACZB 1B3YA 1B3OA 1LUCB 1OT1A 2QCGA 3VOJA 4XD6A 6A3HA 4PTNA 3W01A 3OQ8A 1H51A 1A3HA 2H6RA 3NQGA 4JQAA 4EWJA 4U2ZA 3LHZA 4XZNX 3W1XA 5EFFA 1TZ9A 2H3BA 4FNTA 5GVJA 4G7FA 3UXKA 3HGOA 3TSMA 3CB8A 1EHAA 1UZ4A 4DPPA 1E6PA 2X16A 4YHGA 3C2RA 5A6JA 4FB7A 3HGRA 1V0MA 3VD7A 1HNYA 2O92A 4IHCA 3W53A 5CPSA 4X9SA 5C2GA 4RX0A 2GOUA 1AZ1A 1NDYA 4DO7A 4W5UA 2JALA 3QVQA 4DO6A 5I03A 2E9BA 4D6EA 3QC3A 3WJSA 3I7RA 2OO6A 4DELA 2QJMA 2EG6A 3ARRA 2W92A 3RLUA 5I00A 1A5CA 1GKQA 5BZAA 3HM7A 2AL2B 1GEQA 4MUZA 3ZWTA 1R86A 1SJDA 3DYMA 3UQNA 1KCXA 4GYFA 5LA0A 3P62A 4O0ZA 1KNWA 4WSJA 2NQ9A 4Q6JA 1T6MA 4FOJA 3GYEA 1DXEA 4MY9A 3NQBA 1I0DA 1TIMA 5TQLA 1WAUA 1J18A 3LRMA 2TODA 1HXJA 2W62A 1SJBA 2CLOA 5ABGA 6ALDA 3QN3A 1QK0A 3GRIA 2QDGA 4ADUA 2GYIA 2J8FA 3VKAA 1C91A 4IX0A 2QHAA 3K1GA 4MPQA 4NJGA 6REQA 3HN3A 3OHIA 4D6JA 4C6FA 2VZVA 4O50A 4LNYA 4LX4A 3DC8A 3FVMA 2X1TA 3TK7A 1IIHA 1W3TA 4LBUA 4QG8A 3MMDA 4X3ZA 4DF0A 3MI2A 3URBA 3QV9A 4YPJA 4JPGA 1HX0A 2B81A 4G9PA 1CXFA 4MM1A 5F2IA 4A05A 3P0XA 3DGBA 3EEZA 2YA2A 4J3ZA 2GJRA 5EMUA 4YCPA 3LUTA 1LRQA 1M41A 2YDSA 3QSRA 1OK4A 1A5LC 1UMYA 3S9YA 1DV7A 3VM5A 5AB3A 2OZ3A 2ZQ0A 1WB0A 3CL7A 3AYSA 3ZR4A 4YVXA 3OOQA 2DQWA 4Q3MA 4C1NA 2REQA 1JJKA 4AWUA 4YLWA 1BSIA 5ABHA 1KXVA 1PB0A 4MFEA 4GLEA 3WK2A 3S9ZA 4GPNA 3HIJA 3LHUA 3NPWA 4KKXA 2Q6ZA 4XUYA 4D2JA 2VZUA 3LCWA 4E4PA 3O8AA 3N73A 3ANUA 5D03A 4AZHA 1QXLA 5IFPA 4OBSA 2QJNA 4MVAA 4LVFA 3SO7A 1U5VA 1XBYA 3WLNA 3ZT7A 3IIPA 4S3DA 3VINA 4DB7A 5CZTA 1VFOA 4DM2A 4AY8A 3O9NA 4ROPA 4UFIA 1V02E 1AH3A 1OK6A 3BGGA 4MTVA 4OUEA 4DAFA 3OZPA 5I07A 4CU6A 2FZDA 4UMCA 2CHNA 3MSDA 1ICSA 1VYPX 1BVNP 1JPIA 5CC7A 2O9TA 4JD4A 5XINA 2I14A 5DCBA 5EBAA 2YDQA 2WZEA 1XL9A 3EWUA 4KRUA 5D04C 3M07A 1KXHA 3MYPA 2J13A 4ZB0A 4L6OA 5CPQA 1GZGA 4LRSA 5FEZA 4X2PA 1YW1A 4IL2A 4NY2A 3KS6A 1W1IE 1BQCA 1UR0A 4KEZA 5KSWA 1TUXA 2E40A 1HL9A 3V0SA 5F1UA 2FJKA 1TRDA 4XAGA 8XIMA 4N42A 4NF7A 1XXXA 2O9OA 3AHYA 5I3JA 1JCXA 1YKWA 3NJ3A 2XZ9A 1V3HA 3DKLA 2BXYA 2BWGA 2OOFA 2GQAA 1S39A 2A6LA 2Z2UA 1EWEA 1QU4A 2GL5A 4XVDA 2ZVRA 1DQWA 1XGDA 3CU2A 3W3OA 4C6LA 3ABRA 5D2XA 2OTDA 3CK5A 1R8LA 1LRNA 3TLQA 2OT0A 3V5OA 3W2JA 4JGDA 3ZR5A 3RAOA 4QE1A 2ZWZA 4B90A 2OELA 2AMXA 1AL8A 2F6KA 2IXUA 3GE7A 4PE8A 2PDQA 1AG1O 2WMIA 3KRZA 2HXUA 1O94A 3CXOA 3WL1A 2NUXA 1O1ZA 4PMNA 3HFYA 2DW6A 2DT0A 5CJ5A 3C2EA 3K46A 4M7SA 4LB3A 4O15A 4H6EA 1R3SA 2VR4A 3S5ZA 3E02A 3N6HA 2PBOA 4B5UA 3VILA 5EMJA 3H53A 1YMYA 4ATLA 4W89A 3DFHA 1A50A 1B90A 3RYSA 1K7FA 4PMYA 2Z1XA 1C9DA 3B9DA 3GY1A 3M7SA 3GTNA 3E38A 4WOQA 2F2HA 2YFNA 3N13A 4M6VA 4DJDD 1F3EA 1RQEA 3TV8A 1J0IA 3CQ0A 3SEPA 4G1KA 4PTDA 4JFWA 4ZFMA 3OODA 3N2OA 3DYOA 2OPJA 1QW7A 1FH7A 1O1HA 2A3LA 2DH2A 3JS3A 1R2TA 1U22A 5HWNA 1AW2A 4ZOAA 3DKJA 4OBRA 2J7FA 2YXOA 3P93A 1B4KA 1S5WA 3M44A 2FPYA 4KEUA 4DJED 1WXZA 1IHIA 3GXPA 1XRSA 1TR9A 2Y5SA 1M68A 1Q6LA 3W2UA 4B4HA 3NGFA 2ON3A 2C16A 1RA0A 4RCXA 3ZVHB 2ZOXA 1V3KA 1LWIA 1YLVA 5D02A 3GS6A 5A6KA 1K1DA 4FXFA 1XIMA 1LM1A 2E7FA 2ZXAA 1T96A 2NQ5A 5TAOA 4JX6A 3FY1A 4IFRA 2YB4A 1JAEA 2RFGA 3DFOA 1NH6A 3AIEA 1VENA 1RZMA 4UFHA 4D1JA 1IZKA 2V3FA 1FDZA 1GKRA 5FF3A 3RFAA 3KOWA 4TMCA 1XRFA 3E0FA 4E0CA 1B2YA 3KE0A 1F3XA 2WWDA 4UB9A 4Y7EA 1XV8A 3HMCA 4HCHA 2Y7DA 2DZAA 4FP1A 4L4PA 1V7AA 3UPWA 1V93A 4BR1A 4BKNA 4I8YA 1C8YA 3W7HA 1GK8A 3CHVA 3FS2A 3AHVA 2FZ9A 2GJPA 2VCCA 3P5ZA 3ZSTA 2EG7A 3VCCA 1F6YA 1PXGA 1F76A 2VC6A 4JNMA 4JS3A 4K2SA 4LUIA 4LBSA 3UFYA 2QCHA 4C1LA 1CEOA 3P61A 4NRRA 3KZSA 3N25A 2FGLA 1TWSA 3KL3A 3PWAA 1MXDA 4GNKB 5DF0A 2WLYA 2V5JA 4N02A 3AZRA 1CECA 3MB9A 4M29A 5A8MA 2BGNE 4HCDA 4BI5A 5JVLA 3LTYA 4ZQOA 4GVIA 4CLMA 4JY9A 4V33A 1M53A 3ZJ8A 3ARVA 3GW0A 2PU0A 1XBVA 2C7FA 5CAKA 3GX9A 2IS7A 4ENLA 3UXIA 4UQBA 4MOZA 2GQ3A 4M56A 2FGBA 2WAGA 1RD6A 3VO0A 2FLIA 2V5KA 4AZGA 3N2BA 1ZAHA 4MNMA 3NL6A 3LERA 2QLYA 4DQWA 1XLFA 4FK9A 1JCTA 1AD1A 5DY2A 1JDCA 1OFPA 3GW3A 3B0VC 2PWDA 1DWHM 2AKMA 1W1B1 2W3ZA 3HQNA 5FF4A 3W1TA 4AD2A 2VGFA 1R2SA 2XH2A 3S4TA 3VNKA 2ZZ2A 5BNKA 4HYVA 4UZUA 4JTCA 2INZA 2I57A 4ZE4A 3FYYA 1ZBVA 3UESA 3HQ1A 3E0IA 4ZSUA 2PDXA 1W1PA 3ZIZA 5D9OA 3HPAA 2HXTA 4RKAA 4ADSA 1DKWA 1CNVA 1O4UA 4WDTA 1TTJA 2OXNA 3UR7A 1K02A 3B06A 1JD7A 3TVAA 4AZIA 4L56A 2XUCA 2QJGA 5TD4A 2VUNA 1R38A 4PUEA 3VIPA 3W1PA 2IPWA 5MHBA 3B40A 4NU7A 3NQ7A 1OG6A 3W2MA 1DJNA 2PTDA 3MUY1 4H9MA 4Q8MA 3T0CA 3MI6A 1QO5A 3TQVA 2HQAA 1OFEA 2DIEA 5E93A 4HNUA 3DOPA 3CWHA 5LIWX 1O5KA 2EKGA 4JN8A 3CZKA 5H8MA 1SFSA 3PPGA 1W1YA 1PX3A 4TMBA 2QCMA 1NWTA 2CBJA 3V3WA 2VXNA 4OOUA 1AVAA 5FKYA 5MF5A 4MLJA 2A7NA 2PC4A 4PSPA 3FEMA 3PJWA 5JH2A 4BI6A 4B3LA 3WLTA 5EA9A 4I9TA 4IGHA 3V75A 2GLKA 1NF7A 2HEJA 1JEZA 1KGUA 2GWNA 2VC7A 3GC5A 3ITGA 1Z42A 3ARQA 1ESWA 5LNRA 3UT0A 4F8XA 1OCNA 1Q7MA 3TQKA 1V3IA 2CZ5A 4EAMA 1N8WA 2CU0A 2RGLA 2OMAA 1VC4A 1WOAA 1DWAM 3BLFA 4RUBA 3ZFHA 1ZJIA 3AI0A 4M8UA 1P4CA 2ZE3A 3E0VA 3GG0A 3PZUA 4P61A 1BG4A 5FF0A 2EKCA 1O5XA 3CGTA 1TJ2A 1X1ZA 4AAJA 4CN6A 4DJFA 4A8IA 1B5TA 2VRKA 3F4DA 1ZP3A 2VKZG 5F4WA 3N2TA 3MHUA 4O18A 1W3KA 1LBFA 1W91A 3NQEA 4JKLA 3THDA 4A8RA 3KRUA 3PJTA 2B7PA 1SFTA 2UZ9A 2DDXA 3A9BA 1AH4A 4JTJA 4PUKA 6REQB 5CC3A 2DJXA 2G3JA 3AMGA 4JQ3A 3R8RA 3T40A 4Z42C 1KWKA 1PS9A 1VBGA 1T8XA 4ZL1A 3A12A 1XLCA 2VEMA 3RG6A 3SCWA 3HPSA 3Q37A 1UD6A 3MUXA 2VNCA 5AHMA 1F4HA 4X2RA 1GJUA 3TTEA 1XF0A 2CESA 5HNUA 2Q3OA 1HGWA 3CLMA 4KBXA 5B7YA 2Y70A 3BAWA 5FJPA 5AY7A 4DBDA 4IMFA 3U3HA 3WJWA 3CO4A 3QJAA 2FTPA 4LFYA 2AOSA 4EF8A 4C1NB 2REQB 2XIBA 4BZYA 1H1NA 3BAXA 2CLPA 4DY1A 2J8TA 5D05A 1AD4A 5FJRA 2PDPA 1QOQA 5J04A 4ERIA 1X1NA 5T9BG 2J75A 2XSBA 1MW0A 4R33A 3ZJ7A 4XAZA 1F6KA 2C15A 2QR6A 5DBUA 3GVWA 1CXKA 1R5YA 1TV3A 4EACA 3BAJA 4QEEA 2WVSA 3BH4A 3UU0A 2OU4A 2J7HA 5B7ZA 3PPCA 2VOMA 1CENA 5I3KA 4NI8A 3LNPA 1PIIA 3MKVA 1QNSA 4ZEPA 3CZLA 1L6GA 4A4AA 1DE5A 3NZRA 4LVGA 4WGHA 3L4XA 2Y8UA 3GZAA 1LYXA 1SR0A 3SN1A 4QG9A 2UY3A 4KPLA 1F8MA 4K38A 1BWLA 5F2LA 3GTIA 3O6CA 4H4IA 1K7XA 2PDYA 1VPYA 1RK5A 2EJ1A 3WO8A 2OSXA 2GGEA 2XTKA 3DCPA 2Q71A 2C18A 3CBWA 1KXQA 1R3RA 1OX4B 3C2FA 5DN1A 1GOQA 2Z1KA 2FTYA 3WDHA 3MKKA 2XH0A 3A5FA 3NQCA 3VKCA 3VFCA 3ARTA 2ZKMX 2WZMA 3CMGA 1TE1A 3GWQA 4HHMA 3TW6A 3P5YA 3OVPA 1NDVA 4S3EA 2PRLA 4C6QA 1UD2A 4KRTA 3H4XA 3N19B 2QCCA 3OVGA 4AF0A 5CZKA 4GC3A 2IMRA 1UKOA 4QS5A 3A6OA 2EO7A 5M2FX 5I7GA 1LOSA 3THUA 2X7VA 4GBUA 4UNIA 4M7TA 4YL2A 3C61A 1E9IA 2NT1A 1MXGA 1FVPA 2WMIB 1GJPA 3P0WA 4H9ZA 3STCA 2HTMA 3M9YA 3O6YX 3NPXA 2IW0A 3NPVA 4TR9A 3SRKA 3GTXA 2OSWA 1VBJA 4QDMA 3WFZA 3DFQA 4FNSA 3VX1A 1T5AA 4WD0A 4LH8A 3CPGA 3KZPA 2CBIA 3ITTA 1V6XA 3OP2A 4Z1CA 4BF5A 2VYOA 4D6CA 3M0IA 4DWDA 4QS6A 1WE5A 5C5YA 4RE2A 1NFGA 3BV7A 1IT7A 4Z1DA 4J3TA 2E8YA 5BWFA 3V0UA 3TN6A 4GJJA 5XIAA 2VI0A 4P7LA 2F84A 2G95A 5EMLA 4UFLA 4WR3A 2JKPA 2V3EA 3R25A 3P82A 3GXDA 4KT2A 1VR6A 2ZUNA 4IQDA 5CGTA 3IARA 2YCEA 2I17A 4D72A 3E2QA 4XTDA 3VUSA 1H7WA 2X42A 2F8QA 4TVDA 3R58A 1WZAA 4P8WA 2ZIDA 1GOXA 5CGQA 2AQWA 1K77A 3VDCA 3HOJA 4HK6A 4ZXOA 1OD0A 4H8VA 2WB5A 2J9ZA 3TW9A 1PYMA 4UTUA 1PX4A 3EA3A 2DZPA 4FR6A 4L4LA 1E40A 1RPXA 3L66A 4Z1BA 3OW1A 1MQRA 3N34A 4LU0A 4PTVA 4H83A 4E4UA 1DJWA 4ZZ9A 2E6AA 4Z2IA 3VXGA 3E6EA 1J2BA 1I8JA 1DXIA 1CXLA 2AGKA 3LPPA 4UTFA 1YHTA 3WDIA 2OKOA 1JRCA 2IXVA 1PSCA 3BURA 3WQWA 4GCAA 3A9IA 5AVHA 1X6LA 2HBVA 3KBVA 1OJXA 3GIPA 3R7MA 2O9PA 4H7VA 3N11A 4C1KA 3VAVA 4E3VA 4FXJA 3PBVA 3LXAA 2DJLA 4JL1A 5ECUA 4IG2A 3RCNA 3HPZA 4GFSA 3TYAA 3WD1A 2OWWA 3MP3A 4B9YA 1UJQA 2CLHA 2ZXDA 1QAPA 1KBLA 1VFLA 2Q3RA 1EIXA 1NFPA 4QE5A 1XLDA 4Z0SA 4GZ7A 3WNLA 4XBSA 3VDGA 4RL3A 3CUFA 2CEQA 2VQUA 2RH9A 3WLRA 3E5PA 3OZOA 4GINA 3M7WA 2VRJA 4EIVA 1K8YA 3C8FA 3TC3A 1KRBC 3M5VA 4PH6A 3N12A 4L6DA 2RGMA 2NUWA 3BTNA 1EHNA 3SGZA 2BG5A 3AYRA 1I1XA 3QXBA 1EH9A 3AO0A 4H7ZA 2R14A 1AQHA 2DP3A 1M03A 1E9LA 1G4EA 4P7QA 1R7OA 3GVQA 3CV1A 1LF1A 2X2GA 4LS1A 3CIWA 4RW5A 3UGRA 1VLWA 1RCXB 3ABOA 5E5CA 1OCJA 2BGQA 3QQ1A 1FKXA 1TMHA 3AXMA 2HRWA 2E4TA 2ZTJA 3LMYA 2VC5A 3FA3A 3KVJA 1Q13A 1MNZA 3HG4A 5H6HA 5IHSA 4W88A 3TMLA 4RPQA 4ORIA 2GSEA 2ZX5A 2G37A 3VKDA 1BQGA 3W81A 4M51A 5K2ZA 2VHLA 3CUGA 3CYJA 5IBXC 2CCRA 2PAJA 1VCVA 2PA6A 1KFJA 2J74A 1OSEA 3EGJA 2WJEA 5HANA 5AYIA 4JEQA 5I3HA 1DE6A 1W32A 4GUGA 3IIZA 1UP3A 5D09A 4A8LA 4WOZA 4ALDA 2E1DA 1BTMA 3LX9A 3Q4DA 4ATWA 3OGSA 1QOXA 3KOXA 3AMLA 5AKQA 5CLTA 3QKEA 3W73A 4P8XA 3GXMA 3QFWA 4QISA 2NSXA 2CZVA 3PNZA 2TSYA 1OF6A 1QHPA 1KFKA 2ZRYA 2Q8LA 1W17A 3RX2A 1GHSA 4UTJA 1D3CA 1EBHA 4H2CA 3GTFA 4B5NA 1HGYA 3NCOA 3G6MA 3IJ8A 2Y24A 3B9AA 3IIVA 4UR8A 4O0QA 4HPGA 2GUBA 3UWYA 4AU0A 1O7AA 3GKFA 3HZ3A 2P50A 1EJVC 2INEA 3WDPP 3TA6A 3NDZA 2ZXBA 3PG9A 1JZ3A 4BEQA 1EP3A 2XVPA 2DIKA 3GG8A 1SO5A 1RSCA 1LLZA 2R6OA 3AMKA 3XIMA 2J47A 2DZXA 3QR3A 1HW6A 1QHZA 1UP0A 3LPGA 4H41A 4FS9A 2GVEA 1KM3A 4RDYA 5IRPA 5DRCA 4DJFC 4D6IA 4Q4PA 3AWOA 4NILA 5BRPA 1BSLA 1KTBA 4K8GA 4HYWA 1XUUA 3W70A 5E6ZA 1OYBA 5IXEA 4PRTA 4OFCA 3DI0A 4LWWA 2J77A 1ITQA 3CO8A 2BB0A 1Q6FA 4IFOA 4CQ9A 2Z4GA 3W24A 2OJPA 2FVKA 2OQLA 3GFXA 1GYMA 1YTDA 3ZMRA 1UPPA 3CJPA 1EUNA 2VD9A 3MV11 1UWUA 4FX8A 1V02A 1XI3A 1YYAA 2QJIA 3G1RA 2R1PA 4AIUA 4U28A 1OC7A 1BAGA 3PHAA 4FR1A 1P43A 1XSJA 2ZA1A 4TXEA 2D1ZA 1FH8A 3V35A 3OBKA 4JKKA 4KWUA 4PMVA 3P60A 1LTDA 2DIJA 2VFHA 3QR0A 2NWSA 4GIEA 4XB3A 4K7YA 1CB2A 9XIMA 3GDBA 4I6VA 1ZCOA 2YCLA 3KFTA 4UZSA 3JZEA 1KM1A 2VT0A 5D9NA 4KMQA 2YCJA 3H2EA 4DYEA 2HZGA 5DEZA 1CCWB 2CERA 3NM1A 3NSNA 4MLRA 1BVZA 2C14A 4V1XA 4LCRA 5CCZA 1B1YA 3VNZA 2VC9A 2ACRA 3RCMA 3RXZA 1XPGA 3H2FA 4PMXA 3FSUA 4QSFA 1SZEA 3OVRA 2Y61A 4MG4A 1A3WA 3EOLA 1HJVA 1L8NA 3S1WA 3RMJA 1WKFA 3E49A 1QPQA 4JFSA 4CUCA 3G0SA 2HK1A 5AHLA 2ZTKA 1I0BA 1E4NA 3PBUA 4FALA 1E3XA 4MAZA 2A85A 3KTSA 4LC8A 3EKGA 4KW2A 1A47A 2HVMA 2QCFA 5CSSA 4LC6A 1XCXA 1FQ0A 3EYPA 4OUIA 1VBUA 4L9XA 1VRDA 1XSIA 3A3WA 4TOQA 5IDZA 1OM0A 2WBKA 5BCAA 4I7VA 3DEQA 1Q65A 5FJOA 3WUFA 4JTLA 3C2YA 3N29A 5HINA 5K9XA 2PWGA 4G7EA 4JHOA 3EWWA 3MSRA 1UW9A 4H6QA 1SPQA 1VIWA 4ICMA 3RJYA 2RJHA 2NV1A 3UXDA 1J5TA 2E67A 5TF0A 1K6AA 2XGZA 3CHEA 1S38A 3GHSA 3VA8A 4JIEA 4ACYA 4IM4A 3PZTA 3EWDA 3PWIA 4DUVA 1VFFA 3KM8A 3AIQA 4JTUA 4A3UA 4FIQA 1WV2A 3PZIA 1ONWA 2D0GA 3O2LA 3GH7A 2PDGA 3O3RA 4NJKA 3GBDA 3QGKC 4C65A 5C2XA 1EZ2A 5AVNA 2QUNA 3WLPA 1IR1A 2WQPA 2ZRZA 2YPIA 2EPOA 4OQVA 3DAQA 3NO1A 5EMYA 1VD6A 5C55A 3EOUA 3EB3A 5JXQA 1VB9A 4IGSA 1UD3A 4WX2A 2YYTA 4EPDC 2BVTA 2YZRA 4IISA 1W54A 1OABA 1WKYA 7XIMA 3STPA 2TYSA 4GUJA 1E4LA 2GDQA 1YRRA 4LYQA 5CZJA 2QDDA 2HSAA 4Q8OA 1XLLA 1UBSA 4QDWA 3BXWA 1ADOA 5I09A 2OWCA 2D2OA 1G67A 4RZ6A 1UZ1A 2FH8A 3SCUA 4Q4SA 4ZE5A 4KCWA 1E0WA 2DUXA 3TN5A 1POKA 2VDIA 2WMHA 4BWLC 2VX6A 3IJDA 4MADA 2Y2WA 1HFBA 4E5TA 1GOKA 3N1AA 1K8CA 3W9ZA 1XIGA 1R9YA 2G5WA 1U5HA 1KR1A 2HBXA 4S3CA 3JR2A 3CHDA 2AMGA 4GRSA 1HKIA 5DMMA 3DG7A 3VOGA 1JCJA 2PDWA 5G1YA 4XZ9A 3L68A 3PAOA 3R43A 1XFBA 3GUWA 4AF0B 1TPB1 4LSBA 3DESA 3LCFA 1NFBA 3OZYA 2PEVA 3PF3A 4C6BA 4RE3A 4CU8A 1JRBA 3E2VA 3W82A 4YTRA 1TWWA 4ERAA 1SZFA 1TSIA 3BSMA 3L4WA 1TPC1 1E1CA 3BOLA 1JPHA 2GGHA 3IWPA 2FFIA 5JH1A 3CWNA 3LBOA 3W38A 1BF6A 4DZ5A 3UZYA 4BQ3A 1XS2A 2J7DA 4IIFA 4L1XA 5ABEA 4HOXA 1PDYA 4UOZA 1OX6A 1XLIA 1T7LA 4AC7C 1TR1A 1X6UA 1XCFA 2IQTA 3GHUA 4UTLA 4MDOA 5J5RA 4KCVA 1JIBA 4YIWA 1WUFA 3IV3A 1EJTC 3ES8A 3H22A 3HTWA 1A5OC 3O05A 3UWQA 5KZEA 4Z2GA 2CITA 4UFMA 2Y1HA 2FHBA 5F4XA 1DBTA 3QTGA 3BLDA 2ZRWA 2F38A 1M7XA 1U5JA 2W27A 3KTCA 1G4SA 3N6JA 2XZ7A 3RX3A 1SJCA 1RAKA 2YGYA 2OQHA 4PUMA 4CVUA 2PGEA 2OLSA 3HGSA 1IXPA 4IPLA 2QIWA 2P5NA 1YBQA 3PZVA 4Y6GA 1D7KA 4AHOA 2Y8KA 3M5ZA 1IEIA 1V0KA 1EBGA 1XHGA 2O4MA 3OGVA 3RM9A 4GYKA 1VF8A 4ZMGA 3GDKA 3TYCA 1NWSA 3TAOA 4CD5A 1TKKA 5CBIA 2XSXA 4LAUA 3AIUA 4HMNA 2A7PA 3NNTA 3C8NA 4OZOA 4GD0A 2PRHA 2PWEA 4AIBA 5A95A 2ZICA 4DYKA 2EXOA 4Q8PA 3WDQA 1OG0A 1BFNA 3PBMA 4MZ1A 1Q7QA 2Y0FA 2WHMA 5DT5A 1CGTA 3C3UA 4PB4A 1FWWA 5JBEA 2OZ8A 3T2PA 3TYDA 3AUOA 2NQZA 1DIKA 1FWBC 2J7BA 3UVIA 4KEMA 1VFUA 1ZQ5A 3P2VA 4JNYA 4IG2B 4LCSA 4QDPA 1S2AA 2V38A 1RJQA 1TVNA 2ADAA 2G3FA 3KBMA 3QEZA 1FCVA 3IK4A 3U7VA 5D9PA 1AL7A 1ZTVA 2GGIA 4MB1A 4UNLA 4O1DA 2Z28A 1Z32X 2NQJA 1M3UA 4XKMA 2WCSA 3C0QA 1SW7A 1KGWA 3BG9A 5HMSA 4AWTA 2CBVA 3B9EA 2ABBA 5AYZA 2E6FA 1NSJA 3A4JA 3CAVA 4U3CA 4W86A 5HJYA 4ERGA 2W79A 3STEA 4DO5A 2XFFA 4QGCA 1WDDA 3MT1A 3QZAA 1JQVA 2PWHA 2V5BA 2YL5A 1KQYA 4US6A 1VFMA 1JCNA 3RO6A 3ARYA 2E09A 5EKYA 3P8JA 4ZGYA 4KF1A 3KUMA 4WCJA 3KXQA 3G0XA 1OFAA 3NZQA 4HTBA 3WLSA 1KFEA 4O14A 2ZX8A 4RPPA 2CKRA 5DMYA 1W5QA 1DJIA 3G0UA 3WDJA 5HPOA 2WSQA 4QXIA 4S38A 1ECEA 2KX9A 2XH4A 3OVQA 5DMLA 2FZNA 3H7VA 1WO2A 2HROA 1OHLA 1EQCA 3DFYA 3CUJA 3HB9A 2JIEA 4B5XA 5C9ZA 2OG9A 3PY2A 4EOUA 3I65A 4I9MA 2QEZA 2ZDSA 2GUUA 4O10A 2BXVA 9CGTA 1E0VA 1VPXA 5CPLA 3WH8A 3KCJA 3LI1A 4O11A 3U7BA 1RALA 4RNJA 2FKPA 3GDMA 3GIQA 3NL3A 4NZ1A 2BVWA 1PZ2A 1XW8A 3O0KA 4HPHA 2YW3A 1ZAJA 1T41A 1VJIA 2FJUB 3L5LA 3W85A 5I77A 2CHOA 4NZ5A 3S1VA 1F7BA 3D47A 4C6OA 5FF2A 4E3TA 5DQPA 3S5YA 2PDKA 3NG3A 3RCYA 1SZNA 5G4WA 3PS7A 1DJXA 3NQVA 1ZB5A 2DT1A 2NSOA 5FSEC 4CQBA 3JU2A 4YYCA 3W2NA 3F7JA 3MU7A 1PKLA 2PTXA 2QYGA 3FX4A 4PGLA 4PCPA 2QZRA 1HZYA 2ISWA 5I79A 4JX5A 4PULA 2UY5A 3R8GA 3K1DA 2HISA 2NXGA 1RLDA 3EAUA 1B3XA 5D9MA 3IJLA 3BLKA 1HUVA 4EXAA 3PANA 3AXKA 1KM6A 2X0YA 7ENLA 4JTKA 5BXSA 1BF2A 3S42A 1PJ9A 1EEPA 1HTIA 4L6HA 3THCA 4WLCA 3ITCA 4G1NA 1V6WA 3GUGA 4RK8A 1H7NA 3CT2A 4B4FA 5LNWA 4GYJA 1Y65A 1RBOB 3HQPA 2Z6IA 4MFDA 5JMUA 3TA9A 2VURA 2DPEA 3TFXA 5RUBA 2G0WA 1PCWA 2C0HA 3IIOA 1JQXA 3XISA 1J4EA 3Q58A 3C2OA 3SQSA 3VC6A 1KTNA 3CL8A 1UWAA 1XISA 2NXIA <