1BQCA

Beta-mannanase from thermomonospora fusca
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
302
structure length
302
Chain Sequence
ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHDHSDGNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (BETA-MANNANASE)
total genus 134
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1bqcA00
2C7FA 2GDVA 3F5JA 3CHCA 1GOMA 4PTXA 2ZOXA 3SUVA 1R86A 3FHAA 1IZJA 2PI6A 4QAWA 2W62A 1UD8A 1OGSA 3AOFA 2Y4SA 4OZOA 5EBAA 3U7BA 3RJYA 4D6JA 4U2ZA 5CXPA 1W9XA 4ZFMA 1TG7A 5IFPA 2WMHA 3OLEA 4PMXA 3VIKA 4U2YA 2ZXAA 4DWSB 2EO7A 4U3CA 1X1NA 1XCWA 1H5VA 1DTUA 3UR8A 1EXPA 3AI0A 2X0YA 3WH8A 2E3ZA 1LLOA 1TZ7A 2CITA 4MB5A 4OKDA 1JG9A 2NW0A 1ITXA 3GH7A 1QPKA 2XIBA 2E8ZA 2W91A 4OJYA 3EMZA 3N11A 4KRTA 3VGGA 1BYBA 3IK2A 3AQUA 5A8PA 1KXHA 2IUZA 2J74A 3GYCA 2WNWA 4HU0A 1J01A 5AC5A 4RE2A 4GZEA 4MDOA 1GONA 4ATDA 1GJWA 4S3KA 1HJXA 3LPGA 2DSWA 3UEQA 2V38A 4KGLA 1TVNA 3I3DA 3N18A 4WKAA 1IT0A 1FHLA 3AHXA 1DWGM 3ZR5A 2V3GA 4HU8A 3S2CA 2YL8A 2VNCA 1AMYA 3F5LA 1JFXA 1J10A 4MJ4A 1QI4A 1W9DM 4MNMA 3ARTA 1KFWA 3GH4A 4PMZA 1ZBCA 4YHEA 5ABGA 4D6EA 3SCVA 3AZRA 1UWUA 5HPOA 3PZ9A 3VOCA 2YA0A 5AC4A 2WYSA 3AS2A 1QI5A 3MSDA 5FOOA 5JIPA 4GINA 2QV4A 2BS9A 3CO4A 1UZ4A 1L0PA 1JYNA 2ZX6A 3TTSA 1PPIA 1VEOA 1PZ3A 4N42A 4EE9A 1JYVA 1NOUA 2ZUSA 1M03A 1U30A 1CNVA 2XFYA 1H0GA 4IM4A 2OYKA 5A3HA 3VGEA 4HOXA 1VJSA 3DYMA 1BGGA 1HJWA 3SUSA 1TCMA 1V03A 4HZ6A 5FKYA 3CGTA 4J3SA 3WD1A 4IPLA 1NOWA 1JD7A 4RE4A 5A94A 5HNNA 1CTNA 3M46A 1EA9C 4XZBA 3RCNA 1JYXA 2XVPA 3WNNA 4H7VA 2YOCA 5GNZA 3WNKA 4QLLA 2A3EA 2TAAA 3HU7A 4LYRA 3IANA 4AZ6A 1PJ9A 4YPJA 2OWXA 3BSGA 1EQPA 5TD4A 3WF0A 2WC7A 2GVYA 1XHGA 4AEEA 3VGHA 2NT0A 2CHNA 3FHQA 4OIFA 2EPKX 1BHGA 4DM1A 1E40A 3MMUA 3MV11 3SEPA 3ALGA 1PX3A 4HMDA 1ZBKA 5D9MA 3THCA 3FN9A 2IXUA 3AJ7A 4Q7NA 1NQ6A 2VQTA 1FP9A 1G1YA 4H04A 1ZBWA 1KWKA 3TTYA 1UH3A 2CBJA 4WIWA 3TP4A 3VIOA 3ZJ8A 4XV0A 1EIBA 2OYMA 3SCWA 2VX6A 3CUIA 3EDJA 1CWYA 5CQ1A 4ACYA 3HJEA 1EGZA 1VF8A 2AOSA 2X05A 3W82A 3FY1A 4JHOA 2D0GA 4UR9A 3UG5A 1V0MA 4M56A 1M7XA 2NT1A 1M04A 3KL5A 4ZXOA 1TMQA 3AXIA 3PZUA 2YKKA 4CN6A 4MAVA 3RO8A 4YN5A 1E5NA 3K4DA 3WQ6A 1UR9A 1XD0A 2WLYA 3MKKA 1MW1A 1JZ7A 3SCTA 1FA2A 4AZCB 3CZKA 3CZ8A 3RM9A 1UR1A 2XG9A 1QW9A 1DWJM 1V0LA 4H8HA 1WDQA 3NYDA 5C71A 2VCAA 1WP6A 4AZGA 1C93A 4MB1A 2J7FA 1V3MA 2WMFA 3GDBA 4CCCA 2J4GA 1ECEA 4JFWA 3WD3A 2CPUA 1KWGA 1EOKA 1GQKA 1CIUA 1ZS2A 1DWHM 2DQXA 4BA0A 5I78A 4JIEA 3EMCA 1E6SM 1EDQA 2BNJA 5I79A 2W92A 3WD2A 2EPOA 3WD0A 1V6VA 2CXGA 3WDHA 3WENA 5IFTA 2QHAA 3GH5A 5CLWA 3WUEA 3EDDA 4KH2A 3VGFA 1U33A 3MMWA 1JZ3A 5CLTA 2WSKA 3BAWA 1E72M 1VBUA 1DWAM 2G41A 2J47A 3PN8A 3ECQA 4H41A 1V6WA 3DYOA 1MW3A 3VO0A 3APGA 3OA5A 1UKSA 3OB8A 4AZIA 4U5KA 4PMOA 3VMNA 4NZCA 4MAZA 3ZJKA 2J78A 3SCNA 1GOWA 2WZIA 3MMDA 1CEOA 3OIHA 3ZIZA 1CXLA 2DT3A 2V3FA 2W67A 5EFFA 4M1RA 1E9LA 2YA1A 4DUXA 3W53A 3CIVA 4ZE4A 3ALFA 3W24A 1B3VA 2XYLA 1W9BM 4JCLA 4NSBA 1BVNP 1CGUA 2WBKA 4PMDA 4UOQA 1QI2A 3N04A 4M29A 5CSYA 5I0DA 1W2VA 4TTUA 2DSVA 3WEOA 1HNYA 1OD0A 2E0PA 1TVPA 3VINA 1KR0A 1QBAA 3W37A 1CXHA 2ZXQA 4CUCA 3ARUA 4J28A 3UR7A 4J3WA 4AEFA 1B0IA 4UFKA 2UWFA 2PF0A 1GQJA 1K9TA 3VIGA 1HF6A 1B3ZA 1RP9A 4AYSA 1MVYA 4CD6A 3BH4A 3VDAA 4HP5A 2WAGA 3ARPA 5A2AA 1C8XA 1JXJA 1WNOA 1XC6A 3ZJ6A 1HKJA 2D2OA 1W1TA 1XRVA 1FOBA 2VX7A 3W0KA 1CDGA 5I24A 1QOXA 2XWEA 1UH2A 3PZNA 1I1XA 1S46A 7CGTA 2WSPA 5E6ZA 4OOUA 2CBUA 3CTTA 1HP5A 3CHFA 3POCA 4JKKA 3PZTA 2GSJA 2XGBA 1VENA 2E8YA 3ZT7A 2F8QA 4PMVA 1M01A 3LMYA 1E6ZA 1HX0A 1SMAA 3AICA 1H3GA 4FLSA 4OBSA 4LYPA 1B9ZA 5CGTA 4D71A 4D6GA 2D3NA 4F79A 3JUGA 2ZX7A 1CXFA 4URIA 4UQDA 1WAWA 4K68A 5LYRA 4PBGA 4KWUA 3AIRA 4B16A 1FFQA 2J7EA 3BGAA 1BF2A 1WB0A 2WVTA 1QHPA 4X0NA 1XH1A 4P8XA 1MQRA 1GCYA 2EBNA 1MXDA 3WN6A 4UOZA 5DF0A 4FMVA 1J9YA 1J0ZA 4HA1A 1W3JA 1FH9A 3NJ3A 4F9JA 1UQYA 3RPMA 3EDEA 4H2CA 1UR4A 2ZWYA 5M03A 3GBDA 3EBVA 2WWDA 5D4YA 3VUPA 2JALA 4AXNA 4WK9A 1KCLA 3AHTA 3OLGA 4GO8A 1N82A 4JL2A 4PTVA 4W5UA 5IHSA 3ARVA 2GJXA 5GPRA 4FLQA 1LF1A 3N13A 3PZOA 2YL9A 4AZBA 1PIFA 1HT6A 4U3AA 1ISYA 2CESA 2XTKA 1HL8A 2D23A 1E3XA 1VFUA 2QMKA 2B31A 2NSXA 3CBWA 2VRQA 2JF6A 1X6LA 2WB5A 2G3JA 1AQMA 3OZOA 4OOZA 3B9DA 4UFJA 3VM7A 1EH9A 4PN2A 5ECUA 2E4TA 4AZ5A 3GXIA 4B9ZA 1JZ8A 2V3DA 1KXVA 3AIBA 3L4TA 3WDJA 1C92A 4NRSA 4OUEA 2VO5A 1NWTA 3B9EA 2OSWA 2WHLA 1EDGA 3WDIA 1JNDA 4IPNB 1VFOA 1WDSA 2J77A 3L4UA 4F66A 1ISVA 4U5IA 2WK2A 3UCQA 3A6OA 3EDKA 3NDZA 2X1IA 1TUXA 3SCPA 1DHKA 2PWDA 2WZHA 2XVNA 4J7RA 2PB1A 3WL0A 3QR3A 4W5ZA 3BCFA 2WC3A 2A3BA 5A6KA 2ZWZA 4ZE5A 1E0WA 1NP2A 3WSUA 3F5KA 4MDPA 2WCAA 3AROA 1LJYA 1ZB5A 3ARYA 4AZ7A 1B31A 1PIGA 2GDUA 2J62A 3WF2A 1XCXA 1QNRA 3AZTA 2FHFA 1ZJAA 2W66A 2FH6A 3QOMA 2E9LA 4B15A 1JF6A 5FCZA 3LPFA 2DGAA 4E4PA 1MXGA 1ITCA 4FLRA 3PHAA 4R5EA 4D1JA 4HZ7A 2BFGA 5A6BD 3WEMA 1UKTA 4AIEA 2WM0A 4Z2KA 4JKMA 5BXRA 4JFVA 2CBVA 4MNJA 5HPCA 1MFVA 4WSJA 3DYPA 1LL7A 2J7GA 3MV01 1YHTA 2HISA 1PBGA 3N9KA 1GW1A 3O9NA 2J7CA 1CXEA 3VD5A 1WO2A 3AS3A 1D3CA 3QGVA 1LWJA 1EOMA 4MPKA 1JFHA 4GZJA 4CD4A 1CXIA 1C3FA 2D1ZA 4JFTA 5HBFA 3MUIA 4DUWA 3VTRA 4EK7A 1UD2A 5A6LA 2V5CA 1AQHA 3WNMA 1ZL1A 2VZUA 3BC9A 5CG0A 3K1DA 3OGRA 2YL6A 2WHMA 2GFTA 4DWSC 3PZQA 3OGSA 3WIJA 1UR2A 3WUGA 1L8NA 2WKGA 2WMIA 4P8UA 5A1AA 1BPLB 2J7BA 1JI1A 4UFMA 1K9EA 1E6PA 3ARQA 3CZJA 2G4FA 3W25A 2VZTA 3TONA 1KBKA 1BGAA 1FH8A 5ABEA 2YDRA 4CD8A 2XWDA 4EANA 4ZEPA 1G01A 3T0AA 5A2CA 3N12A 2ZXDA 3M6DA 3WELA 1H4PA 5FL0A 4S3JA 6A3HA 1JGIA 1W91A 2RGLA 2XVGA 5C70A 2OSYA 5CGMA 1Q6EA 3IAPA 3VX1A 3TTOA 4ACZB 1B3XA 2WVUA 3QHMA 3VIJA 1HJVA 3N17A 1V6UA 2BXYA 2D0FA 1OIMA 4IISA 1XYZA 4WSKA 1UHVA 1NP0A 1CYGA 4M80A 1W2PA 4Z2LA 3TOPA 1QI0A 5HDRA 1NWUA 3A4XA 4P7RA 3WF3A 3WMBA 2YDSA 1F4AA 2D24A 4TX6A 3AIWA 1CLXA 1OD8A 1W3KA 4MJ2A 3F4VA 4L4OA 2XUCA 4HTYA 5I5RA 4C7GA 4UTFA 4P7NA 2YJQA 3K8MA 2D0HA 3UERA 1UKOA 1D2KA 5A6MA 4Q22A 1HJUA 2ZX8A 5DFAA 3IJ8A 4MB3A 4MB4A 1V0NA 3BCDA 3II1A 3VIHA 1RH9A 2WBGA 7TAAA 2D3LA 1XYFA 1RD6A 4R27A 4CN1A 3W38A 3OGVA 3CZLA 1GORA 1R85A 1UYQA 3W29A 1C8YA 1MWOA 2JE8A 5AYIA 3AIUA 3AMGA 3SCUA 1V0KA 1UKPA 2XVKA 2VL4A 3VD9A 1OWQA 2J8GA 2XHYA 1V08A 2YDQA 1V6XA 1QBBA 5AYBA 1EHNA 3L4ZA 1XSJA 3ZT5A 3L2MA 3ZSTA 2XJ7A 1J18A 3VU2A 2VOTA 4WKFA 2J79A 4PMRA 1ESWA 3KWXA 2W5FA 3GNRA 3W28A 4F9DA 2VI0A 7A3HA 2ZUUA 2VTFA 3NSXA 1VEPA 1E5JA 2BHZA 2FGZA 5GNXA 4W7WA 2BY0A 1US3A 1CZ1A 6TAAA 1A47A 2Y24A 4M81A 2WLZA 2YBUA 1J0HA 4Z2JA 4W85A 2BVDA 5I2UA 3NSMA 3VDHA 2DSKA 4TVDA 1OT2A 2ZUNA 2QPSA 1YQ2A 4UFIA 3FAWA 2CERA 4W8BA 2DH2A 3AMKA 1RPKA 1B1YA 1CLVA 4ACZA 3ZOAA 1JYWA 4P8VA 3BMVA 5A8OA 1WZAA 2FDMA 1UZ1A 1X6NA 3I3BA 5KEZA 2YIHA 1E4IA 2VRJA 2QLYA 5BROA 1V3KA 1ZU8A 4MNKA 1H11A 4BQ2A 2WCGA 5BXPA 1J12A 2VJXA 3W6MA 1VFFA 2O9TA 3VX0A 1ISZA 5EFDA 1A3HA 4U31A 3T09A 1OIFA 2DIEA 3AIVA 3RIKA 2RGMA 4CD7A 3MUAA 2X0HA 2XFFA 3N15A 3K8LA 1XH0A 4JFSA 5GNYA 3WNPA 4CVUA 2VX5A 1LG2A 4ATLA 3T2OA 1EO5A 3IJ7A 3WQ8A 3WMCA 3ZMRA 4J3XA 4PMQA 3WBAA 5A8QA 3A3HA 3PTKA 3L4WA 4UOJA 3WF1A 3G6MA 3AYSA 4B3LA 2UY3A 2XM1A 1UWTA 3VDCA 3NUKA 5FD0A 1VFMA 3AFBA 4LPCA 2BHYA 3IJ9A 2JEQA 1R7OA 2BY1A 3FNDA 3PTQA 2CHOA 1CXKA 1EQCA 3WQVA 4DM2A 3FAXA 1WDPA 2WVVB 3W26A 4W7UA 1HP4A 4U33A 4AWEA 3CMGA 3BXWA 3OBAA 1QHZA 2VVNA 2DT0A 4W84A 4DUVA 4BQ3A 4QP0A 4V2XA 3SCRA 1E3ZA 2ZUMA 1H49A 4KRUA 2CKRA 1H09A 2JIEA 2VUYA 1GJUA 2WC4A 4UQAA 3L4XA 1HJSA 1LQ0A 3U5YA 4B9YA 3D5HA 2DPEA 3PZVA 3W6LA 5BWFA 2ZUTA 2J8FA 1QHOA 3T2QA 2CYGA 3ZO9A 5ABFA 2OWCA 1GZJA 3K46A 1TA3B 3MUZ1 1G9HA 3AHVA 1HJQA 3DHPA 3VIPA 1PAMA 4QCEA 3OG2A 2OWWA 4HOWA 3RJXA 3WUBA 5AY7A 1BYAA 4CCDA 4AISA 4UCFA 1GOKA 2EXOA 1V3HA 3UESA 2XSAA 1BG4A 4B3KA 1KR1A 1V02A 3GXMA 1HIZA 3ZR6A 5HOSA 4BZYA 1Z32X 5M17A 4E8CA 1CGVA 3M7SA 3CLWA 1B3WA 1V3IA 1VIWA 3NCOA 2D22A 3HMCA 4GO9A 1EDTA 1UWQA 2UY5A 2YA2A 1JNEA 1H2JA 1PX4A 3ARRA 5A8MA 3SUUA 1FFRA 2GJRA 4GQQA 4P8WA 3A4AA 5D9OA 1H0IA 4A3HA 3VVGA 3AS0A 4GI9A 4JAWA 1CGWA 4BS0A 3THDA 4KMQA 4TUFA 4H8VA 3WH7A 3WQ4A 2PWHA 1GOOA 5M3WA 1GOQA 3PBGA 1W1VA 1E4LA 1US2A 3IAQA 4PCSA 1E1FA 4JL1A 4BQ5A 4XZWA 5CZKA 2G3MA 2WMJA 1K6AA 3VKKA 4QLJA 2PBGA 3VILA 4GI6A 1XSKA 1W1YA 1G0CA 2XGIA 1E15A 5I6SA 4LX4A 4PSRA 4UZSA 2PC8A 2J7DA 3G6LA 3WNLA 2XIIA 1JAKA 3AMCA 3KZSA 2BXZA 3MO4A 8CGTA 3VIMA 4QCFA 4NF7A 3CUJA 4PMNA 2EJ1A 4C7DA 4XB3A 4TTGA 1WCGA 2FHBA 1HKIA 1GQIA 4W8LA 2C8NA 5D9PA 1UD3A 1UA7A 2OLHA 2YBTA 5JUVA 1GNXA 1BSIA 1UD5A 2XPKA 1WKYA 4TVUA 4GI8A 1KXTA 4W7VA 2E40A 2Y8VA 1GQLA 1CECA 5A6SA 1AVAA 4W87A 5CSUA 2V3EA 3RILA 3GNOA 3RM8A 1R87A 1NH6A 1Y7VA 1E1EA 3WH9A 2WHKA 2ZXBA 1KQYA 1IZKA 3BAJA 1E43A 2GK1B 1ODZA 2VR4A 1Q6FA 4RE3A 3W81A 4CVWA 1TA3A 2FHCA 5BXTA 3A47A 5E0CA 2O9RA 4CGTA 3T2PA 4AIOA 4NRRA 2CCRA 3DC0A 4AD0A 3WY1A 1JZ2A 3ZT6A 1AQ0A 2BVYA 1E6XM 1JD9A 1MYRA 1XV8A 5I77A 3L4YA 4AMCA 3ARWA 3WUFA 4UFHA 4WLCA 4W89A 1E73M 3LPPA 2AAAA 3BAKA 3SCOA 4RL3A 3BMWA 1C7SA 3OLIA 3WH5A 5ABHA 4ML4A 1J0YA 2JF7A 3QHOA 1W3HA 1KGUA 3NIYA 2Y2WA 4Y7EA 3VDBA 3ARXA 2CETA 1KCKA 5EMYA 1UH4A 4N0RA 1VBRA 2BY2A 1WZMA 1JZ6A 1NM9A 2VRKA 2ZE0A 4XUYA 1SMDA 1MQPA 3SUTA 5LA0A 4H8UA 4ZXLA 4MTVA 4TOQA 2EPLX 1Q6DA 2DT1A 4PUDA 1PZ2A 2VX4A 5GQBA 4GXPA 3GTNA 1UA3A 4FLOA 2A3CA 4L4PA 2PWEA 1GVYA 3MU7A 2HVMA 3ARSA 1HKKA 1LL4A 4JCMA 1JDCA 2CNCA 2AMGA 1MQQA 2ZUWA 3TA9A 1HVXA 2Y8KA 2J75A 3CH9A 3WF4A 2BV9A 2F2HA 4OBRA 3VMPA 1EO7A 3VNYA 1UQZA 1BFNA 5D9NA 1EHAA 4E2OA 3ARZA 3VD7A 3K4AA 2EPNA 1E56A 3CUFA 3SURA 2PWGA 1UR0A 3EMQA 2PBOA 3WEZA 1OM0A 3CPUA 2YLAA 4AZCA 3WNOA 1OINA 1E6NA 5E9AA 1XH2A 1SFSA 4J27A 1JDAA 4UQCA 1FH7A 3BAYA 4W88A 3BLKA 1J0KA 2JEPA 1BQCA 2WMIB 5ABFB 1TFVA 3FXYA 1H41A 4BCEA 1K9FA 1B3YA 1DWIM 3CZGA 4J3TA 1HXJA 2DSZA 4FF5A 2WPGA 3E1F1 5D8ZA 1W9UA 3WH6A 3SCSA 4BQ4A 4D6DA 4TXEA 4JHZA 1GPFA 1KBBA 4W93A 5M5DA 6CGTA 2OYLA 1VB9A 3AYRA 1OGGA 1HL9A 3HN3A 4CCEA 1QNQA 3EYPA 5CPTA 1ODUA 1UWIA 3KE0A 4W86A 9CGTA 2V5DA 1OCQA 3MS8A 3T0BA 2JFEX 1C91A 1NWRA 1VEMA 3AMDA 4AIUA 1CGXA 2X8RA 5A95A 2VT0A 1NARA 4LQ1A 3B9AA 2FH8A 4CKQA 1C8QA 2QF8A 3A4WA 2EQDA 3VIFA 4HOZA 1H1NA 4AC1X 4Z2GA 3W4RA 3D3AA 1OT1A 2C0HA 3VD3A 1UR8A 3DECA 1OSEA 3VPLA 5BRPA 2DT2A 4J3UA 2WKLA 2WMKA 2YLLA 1UUQA 1B90A 2J25A 1FHDA 5F7UA 1OB0A 3WDRA 1ZBVA 1VRXA 3VNZA 1CBGA 1E55A 3WFLA 4AZHA 1D7FA 2A3AA 3SCQA 1IV8A 2WCSA 1R7AA 1UD4A 1W9VA 5JBFA 5JBDA 5LA2A 4AY1A 1P6WA 1JAEA 1U2YA 4GIAA 3MUY1 1QNPA 2G3IA 1HKMA 1QVBA 1KB3A 4WKHA 1F4HA 3CMJA 5I3DA 2WW5A 2O9PA 4D72A 2DSUA 5A6AA 2QMJA 4P7OA 3GXDA 1RP8A 2DDXA 1MFUA 3WFZA 1JF5A 3GZAA 1GUVA 2VR5A 3NSNA 5DT5A 2VCCA 1QW8A 4KGJA 3AMLA 3WMSA 1BAGA 2O9OA 4JFUA 3U7VA 3VIIA 1K9DA 3WQWA 3CUHA 3L2LA 4NI3A 4ATWA 1LL6A 1JZ5A 3KL0A 3AZSA 2ZX9A 2CKSA 4UNIA 1PEZA 4HMEA 1OBAA 1I1WA 1B30A 4GPNA 2G8ZA 1E0XA 1UD6A 5C8BB 5FL1A 3AIEA 1E71M 4W8AA 2CEQA 4AD5A 2FGLA 1O7AA 4UQBA 1V3LA 4X0VA 4XX6A 3VGBA 4Z2IA 3POHA 3U5UA 4A3YA 4V27A 1HVQA 4C7FA 3VD4A 3QHNA 1UG6A 3RM4A 4D6FA 3VMOA 4HPHA 2BY3A 3ZQ9A 4GKLA 2BVTA 4EAMA 4YHGA 3ZSSA 5IXEA 5LA1A 1WDRA 2O92A 3WKZA 5A6JA 5I23A 2Z1KA 3AHYA 2A3HA 1CENA 4D1IA 2D20A 2VC9A 1C7TA 1GHSA 1XGZA 2VQUA 4HZ8A 5BCAA 3S6TA 3KEHA 4PMUA 4BF7A 4LXFA 5DO8A 2ZX5A 1CGTA 1J0IA 3CZEA 5D8WA 1W9PA 3AIQA 3BAXA 1MW0A 1Q4NX 3NDYA 3PTMA 5FIPA 5BYWA 3U57A 1W1PA 1GHRA 3AXXA 3WDPP 4EKJA 1UOKA 2EEXA 1WE5A 2WANA 5CPQA 2ZIDA 1XSIA 4UQ9A 3UETA 4MADA 3ZM8A 5E09A 1TR1A 4WJXA 4AD4A 5A2BA 3BLPX 3TTQA 4IUGA 3CUGA 5JIWA 4UFLA 3ZJ7A 5A6BA 1E70M 3AISA 3QOKA 4D6IA 2X2YA 4D6CA 1GOIA 4UQEA 5JBEA 4DWSD 2EPMX 3UG4A 2GK1A 1CGYA 1O6IA 2WHJA 4HPGA 4FK9A 3WL1A 4D6HA 4CU7A 1M53A 1CPUA 4HA4A 3VM5A 1KXQA 4GQRA 2DH3A 3VGDA 2GJPA 2VZSA 1DEDA 5DMYA 4V28A 2VZVA 1JDDA 3PZIA 1Q6GA 4PMYA 2CIPA 1VAHA 2F61A 1JI2A 1PX8A 3MSGA 1BLIA 1Q6CA 2VVSA 1JZ4A 1I75A 2E9BA 3BAIA 4UZUA 3GM8A 4A4AA 4JKLA 1HN1A 1GVIA 1MW2A 2VURA 4PYSA 4M82A 3WBEA 1V02E 4HMCA 5HXMA 4TVCA 4PCTA 4PUEA 1WZLA 4LYQA 2Z1SA 3J7HA 1QI3A 3L4VA 5E0FA 2WXDM 3GNPA 3AS1A 2DIJA 1R8LA 4LGXA 1WPCA 2ESCA 3MANA 1C90A 4X9YA 2W61A 1BYDA 1W32A 3CHDA 4CN4A 1E4NA 4Z2HA 2WMGA 1NOFA 2DEPA 5DT7A 4QLKA 1BYCA 5CPSA 4GZIA 3T08A 3O2LA 3B8SA 1E0VA 3CHEA 5IDIA 4QDMA 3SIMA 4DWSA 5BRQA 3PZGA 2J7HA 1G5AA 4PSPA 1E4MM 3RMEA 1KGXA 4P7LA 5CJ5A 2VZOA 3UG3A 1ISXA 2ZUVA 1E6RA 1QNOA 4CU8A 1ZJBA 4M24A 1XD1A 2JIWA 5KZ6A 1G94A 3RDKA 1KQZA 3M07A 5E6YA 1LG1A 4PRWA 5EB8A 1V6YA 1OGBA 2X09A 1NWSA 5DEZA 2W4XA 4ZENA 3I3EA 3LPOA 3O6AA 4TX8A 4M8UA 3T0DA 1BG9A 4PTWA 5E70A 4CD5A 2GJXB 2OSXA 3GBEA 2UY2A 4JZ5A 2VMFA 1UWSA 2BHUA 2GUYA 2XFRA 1J11A 4AD3A 2XVLA 3GXFA 1BTCA 3AHZA 1ISWA 3WDQA 1WZKA 2E9MA 1E6QM 2WWCA 3FW6A 1DWFM 1B2YA 4HA3A 2PWFA 1SR0A 2XSBA 1JL8A 1TE1A 4AW7A 5BXSA 3AXHA 4P7QA 2ZICA 3DHUA 2WVVA 3N1AA 3EDFA 3OLDA 1KGWA 2W63A 1QNSA 2YL5A 1JXKA 4MNLA 4F8XA 1UKQA 2UY4A 2Y5EA 1J0JA 3W27A 1W3LA 5A69A 4PEEA 2XM2A 1FP8A 1V3JA 4E8DA 8A3HA 2WVSA 1UWRA 1SYTA 4AD2A 4WF7A 3SUWA 2VCBA 3WD4A 2CBIA 3PZMA 5IHRA 1JIBA 3OZPA 2WZEA 3K8KA 4PTMA 4CU6A 4QFUA 2MANA 3KL3A 1DP0A 1VJZA 4J3VA 2IXVA 1BVZA 4AD1A 1LWHA 5A8NA 3WQ5A 2G3NA 2QPUA 3BSHA 2Q8XA
chains in the Genus database with same CATH superfamily
2C7FA 4C1KA 1A53A 3ZWTA 1IZJA 3GLCA 2BB0A 5HMSA 3WQGA 1JRCA 4B5WA 2WSYA 3EX6A 3URNA 2C91A 4MHBA 8RUCA 3W6YA 2OGYA 2IW0A 3PBMA 5G2HA 3ME3A 4HIBA 1TG7A 5H6HA 1EB3A 5LZLA 2RJHA 3BARA 5AHEA 2BVWA 1LLOA 1ZSXA 1TIWA 4FOJA 1SSDA 1ITXA 4QQUA 5FAGA 3PF3A 3PC0A 4HMNA 3N11A 4KRTA 3IK2A 1XM3A 4WY0A 1KXHA 4NZ3A 2F6KA 2IUZA 2J74A 1AW1A 4HU0A 2YGYA 1J01A 1SW3A 4R88A 4GZEA 4FEZA 3G1FA 1VH7A 4JYDA 4ATDA 2QJNA 3GC2A 2O7SA 2G4JA 2DSWA 3UEQA 3RLUA 2V38A 1IEWA 3DOPA 3GFYA 4C6IA 3AHXA 2PDFA 2QJJA 1JPDX 4GE8A 3WLIA 2V3GA 1PYFA 1GKPA 4LSBA 1QASA 2VNCA 2YL8A 5I09A 3F5LA 5D2YA 2P8CA 4PTDA 4AIBA 1IEQA 2NV2A 4KQNA 1ALDA 3P0XA 1QI4A 2VFHA 1KFWA 4B3ZA 4GUGA 4L80A 3WLTA 2NQLA 4PMZA 1ZBCA 4TO8A 4BWLC 3H53A 5ABGA 5AC6A 2BSLA 4HNCA 3SCVA 2ASHA 3AZRA 1UWUA 1GVRA 2DU2A 2WYSA 2GWGA 4F0KA 3AS2A 4WDWA 2E5BA 4JDYA 2PWVA 3GB6A 4MFEA 3B0XA 5J8LA 4GINA 3ID7A 3WYZA 1Q6OA 1AH3A 1L0PA 4OTKA 3TTSA 1PPIA 4N42A 4X2PA 3D46A 1U30A 5C2CA 3OOQA 1EL3A 4H83A 2FZBA 5CJMA 3PBYA 4DVOA 5A3HA 1QR7A 3VGEA 4HOXA 1R38A 3LRLA 3DYMA 3IK4A 3SUSA 1HFBA 1TCMA 4CQDA 5DCBA 1V03A 4GG9A 1W1B1 3I4EA 4O13A 3T42A 4KKXA 3WD1A 2INEA 3TV8A 1A5KC 2OX4A 2E28A 4KFPA 3V16A 3SJ3A 2C15A 1JD7A 3ZLHA 3OVGA 4HCDA 4PBEA 1NAL1 3M46A 3E5PA 4DIAA 3FDGA 1S1PA 4DZ5A 1S3TC 3WNNA 4H7VA 1V7AA 4IQJA 2YOCA 3WNKA 4B5UA 4DZIA 2TAAA 5H1WA 1PWMA 1PJ9A 3AALA 4M7TA 4KETA 3MW7A 1XIFA 1U1HA 3R12A 1A5MC 1UJQA 2ANUA 2EPKX 3SEPA 1ZBKA 2Q8ZA 4FXJA 3THCA 2IXUA 3AJ7A 1Z48A 4IQEA 3CJPA 4H04A 3DFTA 1UH3A 3TP4A 2JKAA 4BI7A 2NLYA 3LGDA 1EIBA 1AW5A 1AH4A 4DB7A 3EDJA 4LW7A 2R1NA 1VF8A 4AB4A 3DFHA 2EAWA 3FKRA 4MKSA 2GGGA 1I2OA 3ITYA 4JTLA 3TIMA 4HBKA 1SZFA 4M56A 5C7VA 1M7XA 2NT1A 3KL5A 4ZXOA 3AXIA 3PZUA 2YKKA 1US0A 1EJUC 4O18A 3PUOA 3WQ6A 3MKKA 4WJ8A 4LVDA 2FVKA 3CZKA 4I7VA 1RUSA 1XLEA 3M0XA 1AG1O 5C71A 2PTYA 1GVQA 4AZGA 4ZSUA 3QSRA 4Z17A 1C93A 3B03A 2C19A 2QT3A 4H9ZA 4CCCA 4UR7A 1GOXA 5CBJA 3T55A 1P6BA 1QTWA 3KBWA 3ATYA 1DWHM 2DQXA 3EMCA 1E6SM 4YMZA 1DJQA 5I79A 5F4XA 5K7JA 4PTNA 1FWBC 4ROQA 5IFTA 3VNIA 3HGOA 3PPCA 4RZBA 2QHAA 1V7YA 4A29A 3U48A 2OT1A 2FYMA 2J47A 4F2BA 3PN8A 3ECQA 4H41A 1MW3A 3APGA 4AZIA 4U5KA 4PMOA 4C6OA 4DUOA 4ZR8A 3SCNA 1GOWA 3TCEA 2WZIA 3MMDA 2OO6A 4NG3A 1CXLA 1KKRA 4GVIA 2PU0A 3VCRA 4Y9PA 1ZTVA 4ZE4A 3PM6A 4MUPA 3ALFA 4JN7A 5LSMA 5U4NA 4CLMA 3PBUA 1PDZA 3CV6A 1CGUA 4PMDA 1QI2A 2FB2A 2DSVA 3WEOA 2GGIA 1MSSA 3VINA 3P7YA 3W37A 1B57A 4LUYA 3S2JA 5C9XA 1IXQA 3ARUA 3LZ5A 1S2VA 3VNJA 3C3UA 1B0IA 2UWFA 1GQJA 1OZMA 3VIGA 4XTIA 5D2VA 3S9IA 1HF6A 1B3ZA 1RP9A 2PDQA 3DFNA 4KWWA 3VDAA 4HP5A 2NXGA 3ARPA 1X7IA 1HKJA 4X60A 4KIEA 1XRVA 5H8UA 5JMUA 3W23A 1I4NA 5I24A 2A7NA 1ZGDA 3PZNA 1S46A 3LHUA 3AYTA 2CBUA 2QDGA 3KZPA 3GU2A 3C8NA 4PR4A 1VENA 1HG3A 3TQVA 1OF6A 2ON3A 1E6ZA 1HX0A 3TOYA 4LYPA 2R14A 1B9ZA 1KW1A 2E6AA 3U2ZA 3FJNA 4D71A 2YPIA 2OU4A 2D3NA 5HATA 3CV7A 1IF2A 2ZX7A 1XYBA 4JNYA 4UQDA 3M7WA 3W7CA 3GC5A 3G3MA 5LYRA 1V77A 4PUUA 1XLLA 4FX7A 4O54A 4KCUA 1UCWA 3QMTA 2OO0A 1RVGA 4BI6A 3AO0A 3WN6A 1YLVA 4FMVA 5AYZA 1W3JA 1A5BA 1XC4A 3NJ3A 4MY8A 3EDEA 4H2CA 3LI0A 3T4CA 3GBDA 3EBVA 4S23A 1X39A 3VA8A 1DV7A 3PWIA 3M1ZA 1UASA 3BJSA 1N82A 5KSWA 4PTVA 3ERPA 5IHSA 3ANVA 4I6VA 4FLQA 3TSDA 4Q4KA 3ITCA 2YL9A 3I68A 4AZBA 1UROA 4ENLA 1MEWA 1HT6A 1YE6A 1IT7A 4FF7A 1DVJA 4OV4A 1ISYA 1HL8A 1DHPA 2D23A 1NDYA 2ZDRA 2B31A 2NSXA 2V2DA 3CBWA 3EWUA 5C9WA 2JF6A 4TV5A 3C2VA 1AQMA 2PDIA 4RUBA 1DIOA 1Q63A 2Z2UA 2NQHA 1TB3A 4PN2A 4NZFA 2ACQA 4GYJA 3R4IA 3AXMA 1JZ8A 5C6MA 2VOMA 3H2EA 5LNUA 1C92A 1W1A1 2GQ9A 1XISA 4OUEA 1OABA 1NWTA 4O1DA 4P61A 3VKCA 3WDIA 4N6FA 4C6LA 2G3FA 4TV6A 1YDNA 1WDSA 3CM4A 2WV8A 4F66A 3AYVA 3VE9A 3Q67A 5BWAA 4UWMA 1KFBA 3QMRA 1XDMA 2WZHA 3WL0A 2FIQA 2BLEA 3WLPA 3B97A 1EZWA 4W4QA 1E0WA 4QSHA 4MDPA 1XG3A 3VKBA 3CL7A 1VYRA 1R9XA 4B92A 1LJYA 1O5RA 3VI2A 3ARYA 3RF9A 3H2FA 4ADSA 3PP7A 1XWYA 4BFAA 1XINA 1JPMA 1TWZA 4O1EA 1ZJAA 2PODA 3ORWA 1R3YA 4ZODA 1JF6A 5FCZA 1OHLA 2PDPA 3QZAA 2Y8UA 1ITCA 4PL1A 4DJDA 4JN6A 3FSTA 1DIEA 5A6BD 4DF2A 2TRSA 9XIMA 1MEIA 2IPWA 3W76A 4Z2KA 1KFCA 4FNPA 4JKMA 3VDGA 4XD6A 5BXRA 4JFVA 3UF9A 2CBVA 4S3FA 1ITQA 4WSJA 3DYPA 2YXXA 3MV01 2PMQA 2FZDA 4L6OA 3O9NA 2J7CA 2OEMA 3VD5A 3VZXA 3QV9A 1YPXA 4E4FA 3EA2A 3UPBA 4LS0A 1CXIA 3SI9A 2D1ZA 2I9EA 3EOLA 1K8CA 1FCQA 3W00A 4DUWA 3VTRA 5A6LA 3VNLA 2RJGA 1ZL1A 2VZUA 3OQEA 3SAZA 3OGRA 2JK2A 5LXXA 2VGIA 4PZVA 2GFTA 2CU0A 2XDFA 2CLOA 1KKOA 5K9XA 5KINA 1ZRQA 3PZQA 1L6YA 4PRRA 1XIIA 3WUGA 2WKGA 4P8UA 1EUAA 4JPGA 3SFWA 4R7JA 1E6PA 1VD6A 3ARQA 1YDYA 3GVWA 1IT8A 2NXHA 1X8CA 4MM1A 5ABEA 1F3XA 2XWDA 3GHSA 3W2KA 1G01A 3N12A 1FWSA 5I07A 4ZTXA 4B5SA 1H4PA 4QR6A 5FL0A 1W3TA 6A3HA 3ANYA 1JGIA 1S2CA 4Q7IA 1TV7A 2XVGA 1A5LC 4IL2A 2FTWA 4WGXA 3TTOA 4CQCA 2WVUA 3QHMA 1PUDA 2P76A 1KM5A 3B8TA 4AC7C 4I5XA 1R3SA 1X6UA 1XYZA 4XISA 3LCXA 4F0MA 3EPMA 5HDRA 3EPNA 5K2ZA 4NYYA 3OODA 3EXTA 4JHMA 3BW2A 3HQPA 1P7TB 3AIWA 1CLXA 4UTIA 5D2TA 1H7PA 1PHWA 3F4VA 1Q2RA 1TCDA 2XUCA 4KWSA 1DBTA 4I3GA 4ZO9A 5I5RA 1I2QA 3AJXA 4C7GA 4P7NA 2PDNA 1LBFA 3NA8A 1UUOA 5A6MA 3KRSA 5DFAA 4NT0A 1L9WA 3MMTA 4MB3A 4L9XA 1GORA 4IJBA 3W1MA 3FGCA 5L6UA 4XSMA 1RJQA 1O1HA 3KM8A 3UZJA 4O17A 3OU8A 4IOTA 1OWQA 3IPWA 3R7MA 4Z1CA 4NP7A 1R3WA 2YDQA 1U5HA 2PLKA 5AYBA 3BGJA 5CJNA 3MHUA 3NNTA 3RX4A 3NQGA 2NQ5A 3UXLA 5FEXA 3NFUA 2HXUA 2XJ7A 1J18A 4Y9MA 4K38A 5KZEA 3KCOA 5D32A 4PMRA 3LMZA 2BZNA 3W28A 4F9DA 7A3HA 2VTFA 3QVQA 3NSXA 3AWOA 3UWZA 3P82A 3GIYA 4IGNA 3R0KA 3JR2A 3UBPC 4LWWA 2Y7FA 3NWRA 3QW4B 3V0UA 5FSDC 6TAAA 1A47A 2TODA 1XYMA 4GH3A 4M81A 1W5MA 2WLZA 4TX9A 3PULA 1ZJHA 1AZ1A 5I2UA 3VDHA 2DSKA 2HZGA 4TVDA 1OT2A 1NSJA 1KCZA 3FAWA 2MUCA 2DH2A 3KBVA 3AMKA 1RPKA 1B1YA 1JYWA 5REQA 4P8VA 2P8BA 5A8OA 3P6LA 1WZAA 1UZ1A 3I3BA 2RAGA 1ELSA 4O4VA 1ZU8A 3AWNA 1VCGA 1OFRA 4IIGA 1H11A 4AY8A 4O0QA 4ZQOA 4DJFD 3WJSA 4FR6A 4M0XA 2V0TA 5EFDA 1KFJA 2V30A 4U31A 5TQLA 2DIEA 5FEZA 3C4UA 1A49A 2OQLA 2P0IA 3N15A 4HSOA 4Y9NA 1LG2A 2ZZ3A 1EO5A 1YADA 4Q8OA 4ICNA 1ZCOA 1PZ1A 2PWUA 4PMQA 1BWLA 3KBSA 4EXQA 3HGRA 4IICA 2JEQA 2H9AA 1C9WA 2NZLA 3PTQA 4NL1A 2VFEA 3LYEA 4AF0B 4BF9A 1EQCA 4HN8A 3WQVA 3DG7A 7TIMA 1ZAJA 2WVVB 3W26A 4JYEA 4LH8A 1HP4A 1V5XA 3CMGA 1EJRC 3B0UX 1FWAC 4FP1A 2GZXA 3MHFA 4DUVA 3FJ4A 4FNQA 3ZFHA 2WJFA 5K3VA 1VBGA 3LCFA 3WLSA 4UQAA 2GSHA 2NVAA 4YCPA 2PA6A 4B9YA 4BF5A 3DFQA 2DPEA 2REQB 2PDBA 3U0HA 1MRAA 3G8EA 3PVFA 2CLHA 3QFWA 5A6TC 1UP2A 3N14A 2C6QA 2OWCA 1GZGA 1TA3B 2QUTA 3MUZ1 1HJQA 4QCEA 3OG2A 4XZMX 3RJXA 1TPH1 3KOZA 3WUBA 3EXRA 3RO6A 4AQLA 4AISA 3KCJA 4UCFA 2NWRA 1GOKA 1ZFJA 2VFGA 3UESA 3W7OA 1XIBA 1BG4A 5I3FA 2BASA 4MZ1A 4YTSA 5HOSA 4BZYA 1AUSL 4K36A 4ZB0A 1Z32X 4HVXA 4LAMA 4XAGA 1W5PA 3EX1A 3S1UA 3TAOA 4M6PA 3NCOA 5H8MA 4GO9A 3Q65A 3DIPA 3C0JA 2WKJA 5A8MA 4JEJA 3NXFA 2VDIA 4KESA 4A3HA 4GI9A 4JAWA 1JQXA 3THDA 4E5TA 4H8VA 3VKJA 3WH7A 3WQ4A 1XIGA 3PG8A 1L6WA 2X1SA 2P3EA 4J40A 5M3WA 3PBGA 3I7SA 4IP7A 3V1HA 3RGTA 4ES4A 4JTRA 4XZWA 1LM1A 1YPIA 3LBMA 2HS8A 2QULA 4QRNA 4S2BA 3P60A 1F3EA 2OKOA 4GFSA 4QLJA 1CCWB 2WOQA 5I3GA 1KM3A 1NQKA 3LRMA 3S5SA 4UZSA 1JAKA 3GD6A 3KZSA 1LZOA 1EC9A 3G22A 3VIMA 1XLAA 1KFLA 4NF7A 2EJ1A 3BTNA 2CC0A 1AK5A 4GJJA 1RAKA 3STFA 2ZRUA 3OHIA 3GDLA 4W8LA 4LNYA 1UD3A 2IPFA 2YW3A 1TWIA 4L6DA 3U4AA 2XPKA 1Q3NA 1WKYA 4W7VA 2E40A 2NWSA 3BK0A 2A0NA 5A6SA 4W87A 2NUXA 5K9CA 2GVEA 1R87A 2WHKA 2ALDA 3I10A 2P0OA 3BO9A 1U83A 2GK1B 4MKNA 2ADAA 2QZRA 3W81A 1VKFA 2I14A 5BXTA 1GG1A 2R94A 5AC7A 2O9RA 2HXTA 2RHGA 3T2PA 2FMOA 3NZQA 4HHMA 1MYRA 5I77A 3L4YA 4IF2A 1DJZA 4O1BA 1F7BA 3LPPA 1TV5A 1WBHA 4N9EA 1S2TA 3UXDA 1FDYA 3SCOA 3VC6A 4H6EA 1TYGA 1XLMA 2DVUA 2OR2A 4IMFA 2D2JA 3TYDA 4Y7EA 5EMYA 1XRTA 1VBRA 3GAKA 3EKZA 4XTDA 1G6CA 1D9EA 1B3OA 1SMDA 2ZRYA 1LP6A 4H8UA 4TOQA 1ZAIA 1VYSX 2DT1A 1R0MA 2VX4A 5GQBA 3PFMA 4GXPA 4N9DA 1RHCA 1GVYA 3MU7A 2HVMA 1LL4A 1JDCA 1HVXA 1WOBA 2Y8KA 4DNHA 2BP1A 4OFCA 4N9CA 4NXSA 2F2HA 3NQDA 3VMPA 1EO7A 2HVNA 2Y85A 1SO4A 5EMKA 1IWPA 5BNKA 5D9NA 3UJ2A 1EHAA 3H24A 5A8GA 3K4AA 3NQMA 2EPNA 3DKLA 3ONBA 3CUFA 3EMQA 3I65A 3VE7A 1UPPA 4LEFA 1DJWA 4NAEB 1OINA 2JQXA 3CQ0A 1E6NA 4GYKA 2ATMA 1OFEA 1SFSA 1K4HA 3VABA 1Z3NA 1J0KA 2WMIB 1IIHA 5D05A 1TFVA 4BCEA 1DWIM 5CC7A 3K13A 3CZGA 3V4BA 2GQ3A 1Z41A 1O5QA 1VHCA 1EZ2A 1KBBA 3DI1A 5M5DA 4NVTA 4XO6A 3E5BA 4CCEA 2QUUA 4Q4QA 4IFKA 1QNQA 3W86A 3KOXA 1UWIA 2E6DA 4NYUA 5BW6A 1OCQA 2JFEX 2C16A 1C91A 3N2MA 5JU6A 3M0JA 4XAZA 3P62A 3B9AA 4Q4OA 2OT0A 2Z6IA 2PLCA 3WBXA 4OGZA 1OT1A 2C0HA 3TSMA 1OSEA 2D2HA 3B0YA 4C6PA 3VPLA 4F0HA 2X7WA 3NQ2A 5PTDA 3RN6A 1BF6A 3H70A 1FHDA 1KM2A 4FIQA 5J5DA 1VRXA 1E55A 4AZHA 4NZ1A 3HG5A 2UZ9A 2XISA 3G1VA 1F76A 5D30A 4K8HA 4AY1A 3EZ4A 3COTA 1P6WA 1U2YA 2XZ9A 4WKHA 1F4HA 4LVAA 3TW9A 3INPA 2QNEA 4D72A 2DSUA 4GWEA 3VNMA 1BXBA 4JQ4A 2QMJA 4P7OA 2Z1WA 5HUPA 1XL9A 1MFUA 3R89A 5LIWX 3QLDA 3E0VA 1GUVA 3NXLA 3NSNA 5DT5A 3HQOA 4JNZA 1XG4A 4ZQRA 3W7KA 5CSSA 1M65A 5FF4A 3U7VA 3WQWA 5G2IA 1MDRA 3L2LA 2Z28A 4L61A 3G18A 4JX4A 2CLKA 4DI8A 3A23A 5C2XA 4UNIA 5LIXX 2MNRA 4AMAA 1B30A 2Q01A 1RY0A 3P8IA 4PB5A 1VCVA 1BWKA 4W8AA 3TN3A 1P0KA 4HNTA 5CCZA 3LCWA 3NOYA 1WXZA 2O7QA 2QGHA 3DN5A 4V27A 1P7TA 3M5XA 3LGGA 1O1ZA 3OYXA 4C7FA 1V51A 3VD4A 3RM4A 5BOOA 1OG6A 1TX0A 1IEIA 4O1AA 2REQA 5IXEA 3LBCA 3WKZA 3NZ1A 3BE7A 3TYZA 2PURA 1CENA 1W1IE 2D20A 4NNAA 1K8YA 1XGZA 2VQUA 5F1VA 2R1PA 3S6TA 3KEHA 5DO8A 1YRRA 4ZQCA 3EEZA 4G1KA 1CGTA 1J0IA 3CZEA 1QFEA 1DXFA 4G5DA 3PTMA 5BYWA 4PBFA 4GYFA 4BJHA 3FV9A 3TQ0A 1W1PA 1KTNA 3L7RA 1WE5A 5CPQA 2ZIDA 4O53A 4H6RA 3NAVA 2YFNA 5E09A 1QPOA 2F38A 3SY1A 4L4MA 3ZJ7A 1E70M 4D6IA 2X2YA 1VCFA 2ZA1A 4UQEA 3UG4A 5HMFA 1CGYA 4HPGA 1WDDA 4CU7A 1RVKA 4HA4A 1KXQA 2FKPA 4GQRA 2DH3A 1A3XA 1DEDA 2WSQA 4V28A 4C5YA 2WJZA 1G4PA 3GTHA 2CIPA 2OX1A 3FDKA 1VAHA 4ZBCA 4Z1DA 2QCFA 3HFYA 3MSGA 3WQPA 1BLIA 1I75A 1KM0A 2E9BA 3BAIA 4X63A 4A4AA 3HG2A 1YW1A 4GA8A 1MW2A 2VURA 1I6NA 3IIXA 3N6QA 3WJZA 1MNZA 4CNOA 4PUEA 1A3WA 1WZLA 3LN3A 2Z1SA 3GZ3A 5BZAA 2JKPA 1R2RA 2Y70A 5LNWA 2DIJA 3PUDA 3W83A 3OZYA 2GQAA 3LHWA 2W61A 1BYDA 4WRHA 1W32A 1ECQA 4IP5A 4QLKA 1BYCA 1FTXA 1S5TA 2GPTA 3JZEA 4E2BA 3W1TA 3O2LA 3WQDA 4B4FA 4R3UA 2RDXA 3CHEA 4QDMA 3PZGA 3KRBA 4O4WA 3KWSA 4WHBA 1G4EA 1HGWA 4NJJA 4P7LA 5CJ5A 1BRLA 3C0LA 1Z6KA 1ISXA 3N73A 1E6RA 3G1XA 3FEQA 4WDUA 4CU8A 2QVNA 2JIWA 1R6WA 5IOBA 2Y63A 1LRTA 4LC8A 1V6YA 4IIDA 2X09A 1FKXA 1AD4A 3KW3A 4J1OA 4U28A 4GOAA 2A4AA 2ZTKA 1BG9A 1PS9A 4ORMA 3HPSA 3G0UA 5TIMA 3CT2A 4YTRA 3B0VC 2VMFA 2DZVA 2GUYA 1J11A 3L65A 3FS2A 1WZKA 4KWVA 2J13A 4GUIA 5CSRA 4RZ4A 2DIKA 2GUUA 1F07A 4MZYA 1PCKA 1JL8A 3KCLA 4AW7A 4DWDA 1ONRA 5BXSA 3AXHA 1YYAA 1OF8A 3N1AA 4IZGA 4XZ9A 2A7RA 2V6AA 5C2GA 4G1NA 4PGLA 1KCXA 4KERA 3CMFA 8A3HA 3B9NA 2WVSA 4QIUA 3UR5A 3R58A 1WUEA 4WX2A 1SM9A 1TJ1A 2VGBA 3MKCA 5FACA 1EJVC 1X8FA 3OZPA 2WZEA 1X1ZA 3K8KA 4LVBA 1VPYA 2QGYA 2X40A 2GWNA 1YDVA 3KLLA 4QQ3A 1VJZA 1BVZA 1LWHA 5A8NA 1T5AA 2G3NA 3ZVIA 2Q8XA 2GDVA 4DELA 3EA3A 2NX9A 4PUKA 3CHCA 1GOMA 4PTXA 2ZOXA 4KFOA 5FF3A 2PI6A 1DKWA 2W62A 2EKGA 1VFSA 2HE5A 1MZRA 3TC7A 4HPNA 5EBAA 3U7BA 3W1RA 3RJYA 3TYAA 1XKJA 3H21A 2J9XA 1RPXA 4ZFMA 5IFPA 3OLEA 4PMXA 3VIKA 3PBVA 2GSEA 5D03A 4DWSB 2EO7A 4U3CA 1X1NA 4PMJA 1H5VA 1DTUA 3R0UA 3MC5A 2J9ZA 3H7RA 1BTMA 1XGDA 2E3ZA 1TZ7A 2CITA 4AVFA 5KTLA 4OKDA 1JG9A 2OEKA 3EMZA 4ICCX 3VGGA 5A8PA 3EOOA 2WNWA 3QC3A 4E3TA 5AC5A 3UG8A 3SY8A 1EPXA 2ZRWA 1XLFA 3M0MA 1OFBA 3OBEA 1DTNA 3LUTA 4S3KA 3LPGA 4E6MA 5HMDA 4PA8A 3ICJA 2ZA2A 1RCXB 4WKAA 1EA0A 3SRHA 5J5RA 3KOWA 1DWGM 3QRHA 4MYAA 2J6XA 3O05A 4JGDA 2WJEA 5DLCA 3GC4A 1JFXA 1J10A 4XAFA 1WDWA 1W9DM 2ATSA 3A22A 3ARTA 2PDXA 3O0KA 3P5ZA 2X30A 4YHEA 3MBDA 2VC7A 5DXYA 3NQBA 1EP1A 4H7CA 2Y61A 3PZ9A 3QYSA 3MO7A 1IHIA 5JIPA 3A4JA 3L2IA 1TIMA 1OCNA 1VEOA 1D3GA 4LV4A 1JYVA 2ZUSA 1ZY9A 1UP0A 4FXSA 4IJCA 1JCTA 3W2UA 5CBIA 1HJWA 1OX4B 3TZFA 4LBSA 4ZSTA 3TFXA 3RUBL 2ZDSA 5AZ0A 3W7JA 1UOZA 4OQVA 4PEKA 4GYPC 4JIQA 4JOMA 4RE4A 5A94A 3EB4A 4ICMA 3VOHA 1CTNA 1EA9C 3RCNA 2Z29A 5GNZA 3NM3A 2A3EA 1TZ9A 1XQKA 3HU7A 3IANA 3KDOA 4Q6XA 4YPJA 2Z4GA 3UZWA 4FO4A 1IXOA 3BSGA 3WF0A 2GVYA 4AEEA 2ISDA 3D3FA 4WGHA 3CPRA 3GDMA 4DM1A 3MV11 3GWQA 1F5ZA 1CX9A 3W2LA 1PX3A 4OECA 4GXWA 4Q8VA 3L67A 2WNZA 3A9BA 3U9IA 3F03K 3NR0A 3W2NA 3C2OA 5C9RA 1QOPA 1K7XA 4RK8A 1NQ6A 2VQTA 3FLUA 5AVHA 1G1YA 4DY1A 2CBJA 4RNJA 3VIOA 1I2NA 2DJXA 1FXPA 5C5YA 5HWJA 3UCDA 2ODOA 4ZOCA 3CT7A 2C18A 2AOSA 2X05A 1AFSA 1Z9AA 3FY1A 4LUTA 3IJQA 1RSCA 1ONXA 1EEXA 4F3HA 1S5MA 4NZ4A 3L21A 1JCLA 2O4MA 2POZA 1QATA 1XD0A 2WLYA 1MW1A 1FA2A 2V82A 3CZ8A 3TVAA 5AB3A 2XG9A 1QW9A 1DWJM 5D37A 3GTXA 2QUMA 3NYDA 4LOCA 2GOUA 3TK7A 5I3JA 1W5OA 2QUNA 3GTIA 2J7FA 1V3MA 2WMFA 3LEPA 1Q66A 2J4GA 4DBEA 4H9VA 3W7DA 3CNYA 5AHLA 1I0BA 1LQAA 3SADA 1EDQA 4LUTB 2W92A 1C9DA 3B4UA 3M47A 2EPOA 3WD0A 3L0GA 4IX2A 1RBLA 5DXXA 1SFLA 3U2CA 2EG6A 2XIMA 3WUEA 4C6DA 2C14A 4ZL1A 4KH2A 4XSLA 1EF3A 4XQ6A 1DWAM 3Q45A 3GNNA 2IMRA 4QNWA 4ZVJA 1TQJA 3NQ6A 4NZCA 2J78A 4KW2A 2YB4A 3OIHA 1SFTA 2W67A 3H2MA 3KVJA 1GZ1A 1KTCA 1SPQA 3KDNA 4K1GA 2I16A 2FDSA 3SO7A 3W24A 4LS1A 3IV3A 4HQVA 1B3VA 2XYLA 5MKGA 4M7SA 1G4SA 4JCLA 1BVNP 3BLEA 2WSRA 5CSYA 1W17A 5I0DA 1W2VA 3WLNA 1HNYA 2ZXQA 1TMLA 4IFKB 2X16A 5LNRA 4AEFA 4UFKA 2BTMA 2VDGA 3E0FA 3TN4A 5ECVA 3KTSA 3N25A 2AQOA 4MJZA 1IWAA 4CD6A 2A6LA 1UUMA 2PE4A 2WAGA 5A2AA 2C71A 1XC6A 5B7YA 1LROA 2D2OA 1W1TA 3MBFA 1FOBA 2VX7A 1CDGA 1QOXA 1UH2A 4Q6JA 2QW5A 2XH0A 4PH6A 2BMBA 3CTTA 4IX0A 1PCWA 3CHFA 3CQJA 3VOFA 3PPHA 4IIEA 4JKKA 3WBYA 2GSJA 4JIRA 1FWJC 1S2WA 4YTTA 4NAFB 3ZT7A 1SR9A 3NPXA 4GUFA 3ZVHA 4MLRA 3C86A 3N9SA 2OZ8A 3LMYA 3UA3A 1DL3A 1H3GA 4FLSA 4OBSA 3MDWA 2PC4A 3LQGA 4NJGA 5MHBA 4D6GA 4LANA 1CXFA 2YXOA 1WAWA 2QS8A 4PC8A 2HDJA 1FRBA 4GUHA 4B16A 1FFQA 3R43A 3CB3A 1SZRA 1NVMA 2WVTA 1QHPA 3OJGA 3DCPA 2DUZA 4P8XA 2C0AA 3STCA 2CLPA 1MMFA 3EX4A 4HA1A 1LOSA 3O16A 4Y96A 4IXXA 1UR4A 2ZWYA 3V35A 4J4KA 4ECLA 3UZ5A 3VUPA 1K7FA 4GO8A 3N6HA 3VOGA 4GNJA 3WO8A 1LF1A 3N13A 3PZOA 1V79A 3UGRA 2VELA 1Q4WA 2OOFA 1E3XA 1VFUA 2QMKA 3PR2A 1RXOB 3QV7A 4NU7A 4AG0A 3TUUA 3VXGA 2V5JA 1XPYA 5DMNA 3TEVA 5FF2A 4OOZA 4E4UA 2VC5A 3B9DA 1EH9A 5ECUA 4R53A 2E4TA 1POJA 4AZ5A 4HCLA 3TJLA 1KXVA 3AIBA 3L4TA 4C91A 3LGEA 1JUEA 2Y1HA 4E38A 2VO5A 3B9EA 2WHLA 1QCWA 1PVNA 1WQ5A 3T40A 1E0UA 3L4UA 4G9PA 4U5IA 3USZA 3A6OA 3CHVA 3NDZA 4DPQA 3KP0A 3QZEA 4NILA 1TUXA 3CL6A 4NQ1A 3RPTA 1HL2A 4XBKA 4ERAA 1DHKA 1PYMA 2WJDA 4UB9A 4J7RA 2PB1A 3BCFA 2WC3A 3QY8A 4DBWA 1JDEA 1XW8A 3K1GA 2PTWA 2WQPA 3AROA 3NL5A 5U7SA 3K30A 1B31A 4WR3A 2GYIA 1D3HA 2AGKA 2J62A 4FZIA 3WF2A 4WOQA 3ZS4A 3AZTA 1UPMB 2W66A 2ACUA 3QOMA 2QDDA 4B15A 2Z1XA 5H91A 3B8DA 3SRFA 1FWRA 3N2CA 1XFCA 3UP8A 3HV8A 3UZXA 4WQ6A 3KBJA 3PHAA 4R5EA 2XH7A 4D1JA 2BFGA 2IPGA 3WEMA 3QQWA 1W5QA 1S2AA 1Y0EA 3P2VA 1SQ7A 4MNJA 5HPCA 4WUIA 3NQEA 1RD5A 2XIJA 3N9KA 3APTA 1GW1A 4RZ6A 3KBNA 2WO5A 3CB8A 1I2PA 3KHJA 3AS3A 2Z7GA 3HPFA 1D3CA 3A3WA 4JICA 3QGVA 2Q8LA 1EOMA 4BY3A 3L5MA 4U4MA 3TLLA 5CPMA 1C3FA 3RR4A 2OCZA 5HBFA 4YLWA 3H2AA 3B9OA 2HQAA 1V8EA 1H62A 2D73A 1EPVA 4ADUA 3DU0A 3P0WA 1WXJA 2FB3A 3IJLA 5BMXA 1PE1A 3OGSA 1UR2A 3ZYZA 3CQKA 3VUSA 1L8NA 1BPLB 2PDHA 3BOLA 1Z7AA 1JI1A 1AL8A 4L6HA 3CZJA 1Z44A 4N2YA 2DW6A 3SQLA 4EANA 1MEHA 2V5KA 1VR6A 4O0ZA 3PWGA 1EP2A 2G96A 5HQLA 3MI6A 4S38A 5HQEA 3IS4A 4NZ5A 4V1YA 3M5VA 2DORA 2OSYA 3SQSA 5CGMA 3IAPA 3VX1A 4ACZB 1JPKA 2PD9A 3MP5A 1HJVA 1OX5A 1V6UA 3N17A 2BXYA 1LCOA 3CK5A 4LYKA 2D0FA 1OIMA 2G97A 3UWWA 2IKHA 4H8NA 2VGFA 3W1LA 3IGUA 3RX3A 3TOPA 3LV6A 1QI0A 2BXVA 4EVZA 2Z27A 4RDYA 3WF3A 2H6RA 3QMSA 3WMBA 2YDSA 3H2CA 4ADTA 2D24A 2JKEA 5FF0A 5EYWA 6XIMA 1A5AA 1DQWA 2NUWA 3O6YX 4I90A 3CUXA 3QC0A 4L1XA 2QUVA 3G3DA 4QE4A 2YJQA 4GD0A 3MDUA 3TMLA 3UERA 3W1UA 1D2KA 1LUCA 4Q22A 3UXKA 2BWGA 3IJ8A 3TQKA 4MB4A 1V0NA 3SSJA 2HMCA 1RH9A 2WBGA 4HGXA 1A4MA 3OGVA 1Q8JA 3E02A 1C8YA 2KAUC 4PB4A 2JE8A 3GUWA 1BD0A 1GJPA 4IPJA 1P1MA 1UKPA 3GFZA 2XVKA 2Y0FA 2VL4A 3THQA 3VD9A 2Q71A 1UZDA 1V08A 1V6XA 1J96A 3R11A 3ZT5A 1TV2A 1MDLA 1RA5A 5AYXA 3W3OA 4QDWA 3LBOA 3BDKA 1XBZA 3WLKX 2VOTA 4FS9A 4WKFA 3HPAA 3KWXA 2W5FA 1ZENA 2ZUUA 4JYFA 4GNVA 4A8LA 3FK4A 4A3RA 1E5JA 3LXBA 3LLFA 5L9FA 5GNXA 2PTZA 1XF0A 3BZGA 5KETA 4IUOA 1CZ1A 2A3LA 2E09A 2FTYA 4FXFA 2YBUA 1J0HA 3WMLA 1T40A 4Z2JA 4JD4A 3NSMA 1TO3A 1UJPA 2ZUNA 1YQ2A 3DHDA 2CERA 4W8BA 3RPDA 1DE6A 3IIPA 5TAOA 4ACZA 3N2TA 1ITUA 2FJKA 2QLYA 1V3KA 1QPRA 3R25A 2PD5A 5BXPA 1J12A 3NL2A 3PJTA 3W6MA 2O9TA 1ISZA 1K77A 1HUVA 1A3HA 1R2TA 3HB9A 3T09A 1OIFA 4JN8A 4ZCWA 3ABRA 3MUAA 3DG6A 2X0HA 3K8LA 3W22A 2VX5A 4ATLA 4XZNX 4DYEA 1RJRA 2V69A 1XLBA 3WQ8A 3WMCA 3QLLA 1BSLA 3L4WA 4UTWC 3LZ3A 3N2BA 3AYSA 3GNXA 3O07A 3P93A 2XM1A 1KFKA 3IVUA 5FD0A 2OZTA 4JBRA 2BHYA 4LPCA 1SUXA 4H9UA 2KX9A 2BY1A 3FNDA 4US5D 3DAQA 3UZZA 2CHOA 1CXKA 3FAXA 1DXEA 3CO8A 1J2WA 3SJNA 4U33A 4HN4A 2PLMA 1DJHA 3BXWA 5FEPA 4O12A 1UMLA 3YPIA 4KF1A 4W84A 2VWSA 3MP4A 3EPOA 4V2XA 4O28A 4ONVA 3SCRA 1FWEC 3QSTA 3A5FA 1E3ZA 4O16A 1H49A 2CKRA 4QITA 4A3UA 4MIMA 2VUYA 3UWQA 1R9ZA 5IBXA 3L4XA 5C54A 4QROA 3W6LA 5BWFA 1NF0A 2DZXA 4UBPC 3WQOA 2RDUA 1F3WA 2PCQA 3ZO9A 4PULA 4LCQA 1GYLA 4C6NA 4JTHA 2QJHA 1RQHA 4HOWA 4CCDA 2ZVRA 1V3HA 1Q8AA 1KR1A 5FJOA 4DJEA 4C6QA 5M17A 4E8CA 1CGVA 3M7SA 3TX9A 3CLWA 5HJYA 3RAOA 1B3WA 3FXGA 1W0MA 3TMQA 3CPGA 2V8ZA 2D22A 3HMCA 4MFDA 1KNWA 1EDTA 1UWQA 2UY5A 3BLLA 1NFBA 2F7FA 1H2JA 3SUUA 1FFRA 3I6RA 3A4AA 1DQXA 3EKGA 3GVVA 3MSYA 5HQMA 4K39A 1QMLA 1FDJA 3PJXA 1CGWA 3EWDA 2TSYA 4Q4SA 4LTSA 4TUFA 3CXOA 3DDMA 5KMYA 4IMCA 1W56A 1GOOA 5LNSA 1J6PA 2PLJA 1OFPA 1W1VA 3IAQA 1Q85A 3TA6A 1E1FA 3PSVA 2W79A 4BQ5A 5CZKA 3F2CA 3R5EA 4GGBA 4O1FA 1H60A 1OYBA 2PBGA 1XSKA 3WK3A 3BGGA 1W1YA 3T44A 3HJZA 4DBDA 3GNDA 3E0IA 5I6SA 1NJJA 2PC8A 2J7DA 3G6LA 1RBOB 3QGAC 3WNLA 3W7GA 4QCFA 1LRQA 3CUJA 4PMNA 3IJIA 1M1BA 3MCNA 5CZ0A 5DMLA 1LRNA 1TPB1 4BKNA 2X1UA 5D9PA 2VP8A 1GNXA 1OK6A 1FHVA 1P0DA 1UD5A 5G4WA 4Z1BA 3M5ZA 3GAYA 2DZSA 1XYAA 2Y8VA 1CECA 1AVAA 5CSUA 3O63A 3SBFA 3GNOA 3RM8A 3QH2A 1Y65A 1E1EA 1Y7VA 3LHTA 3MP3A 2ZXBA 2HBXA 1IZKA 3EWWA 1TVLA 1ODZA 3NGJA 4RE3A 4CVWA 1CLKA 4I9MA 3TWAA 3A47A 3FA5A 4ZQPA 1SW7A 5E0CA 3GHTA 2VM8A 4NRRA 3CQHA 2CCRA 3DC0A 4H00A 1JZ2A 1YTEA 1H63A 5F2MA 2BVYA 4RW3A 1NU5A 1H7OA 1JD9A 1XV8A 2TPSA 1O4UA 4AMCA 4ZZ9A 4WLCA 5I3IA 3IRSA 1E73M 3M43A 2AAAA 2H8XA 5EGRA 4RL3A 3BMWA 5CEWA 3CAWA 1K8ZA 3OLIA 4A2SA 1O68A 1OADA 2HSAA 2JF7A 4QG9A 3QHOA 3S9ZA 4LS2A 3TTEA 4CQ8A 3C56A 3UYCA 3S1XA 4N0RA 4GCXA 3O0FA 3DFPA 5AHIA 1NM9A 3WJXA 4IGHA 1MQPA 1QXLA 3FVDA 2QQ6A 5LA0A 2GGHA 4WD0A 4ZO6A 4UMCA 1I8JA 3GIQA 1UA3A 2R1KA 2A3CA 4FLOA 3NVTA 3PSWA 2QCNA 3U6WA 4L4PA 4UXDA 5D09A 3P74A 4L1WA 4JCMA 2CNCA 2HWGA 1MQQA 2ZUWA 3TA9A 5CC3A 2E7FA 4POCA 3CH9A 3DFOA 4OWGA 5F4WA 3LM7A 3SURA 1XBXA 2XZ7A 1PO9A 3S5OA 3MWAA 3CPUA 4E0CA 4LAOA 4O10A 5E9AA 1XH2A 4J27A 1FH7A 4W88A 3M0ZA 5G1YA 1H41A 4JQ1A 3JVAA 4L4LA 4EAYA 1SO5A 1N55A 3DG3A 4WY0F 5D8ZA 1R46A 4REQA 4BQ4A 1MUCA 1F3TA 4JHZA 2PDJA 3N6JA 2GJNA 2OYLA 1VB9A 2BG5A 3H22A 3N4EA 2P10A 3G1DA 1N8FA 1AMKA 3EYPA 1IXNA 1ODUA 4X3ZA 2INFA 2RDTA 3KE0A 2I5GA 9CGTA 2V5DA 4WXYA 1PV8A 1VEMA 2BGQA 2IS7A 4AIUA 3F2BA 3WJYA 3OW1A 1T7LA 1SJAA 1Q7ZA 3A4WA 4WOZA 3VIFA 2YZ5A 2FVLA 3BVJA 3W4RA 5LXEA 4GGHA 3LENA 4RE0A 2DT2A 6ENLA 4MLJA 4J3UA 2WKLA 3TR2A 2YLLA 3GY1A 2J25A 2ZCGA 1ZBVA 3UYIA 3VNZA 1CBGA 3LOTA 1O12A 1YPFA 3IUIA 3OA3A 3SCQA 3UXAA 2HV5A 3R1ZA 3CLMA 1NFPA 5JBDA 1PSCA 4RDVA 1JAEA 3V1PA 1QNPA 1HKMA 1QVBA 3CMJA 1EWEA 1F6KA 5A6AA 2QVHA 2VFIA 2HROA 3FJLA 4B90A 3GXDA 3WFZA 1WKEA 3C5QA 4GI4A 6TIMA 2VCCA 4NKCA 2VGGA 2BX7A 3AMLA 3LHZA 5F1UA 3K2GA 1E51A 3VIIA 4GC4A 1K9DA 1XLHA 5AN7A 4LB4A 1R30A 1JZ5A 1YNYA 4DLFA 3KL0A 4LCRA 3AZSA 2ZA3A 1O95A 3IEBA 4EIVA 1AODA 3Q4DA 2ZVIA 2G8ZA 3UXIA 2F6UA 3IIVA 1OJXA 3AIEA 2CLLA 2F84A 1C29A 2CEQA 4C6BA 4AD5A 3SRKA 3GW3A 4X0VA 4Z2IA 3CWNA 4IG2A 1OC6A 4MF4A 3U5UA 4A3YA 2B7OA 2YYTA 3CC1A 3HQNA 5CZSA 1D8WA 3S47A 3ZQ9A 3W2MA 3ZSSA 1G4TA 4JQAA 5LA1A 3RNDA 3W7LA 3R13A 2A3HA 4D1IA 2VC9A 3KVKA 2XFWA 1S1RA 3U2OA 2OQHA 5BMWA 1XDJA 3QKZA 1Q4NX 3LCGA 3U57A 3JRKA 1CT5A 3AXXA 3WDPP 4EKJA 1UOKA 3TYCA 3UETA 1RCQA 3R94A 1TR1A 1FXQA 3BLPX 3TSBA 5FESA 5JIWA 5A6BA 5D02A 3VC5A 4F0LA 3E9AA 4D6CA 5C0QA 4Y9AA 1QT1A 5J04A 5JBEA 4B5XA 4N7QA 2Z6JA 3PAJA 4RKAA 1R9YA 4HPXA 4FK9A 1O5XA 4MG4A 1WAUA 2J27A 2WM1A 3RLHA 1M5WA 2VZSA 2YFOA 3TCSA 3PZIA 1X7FA 2F61A 9XIAA 3R8GA 4XVDA 1XRSA 5AHFA 4NNCA 4ERIA 3ZVHB 1XFBA 5I02A 3UJFA 2HS6A 3DUGA 4M6QA 4I6KA 2GGEA 4HMCA 3CV1A 4PCTA 4PUWA 3S5ZA 2YCKX 1XPGA 4LYQA 3K4WA 1DJYA 4Y8EA 4IGSA 2YCEA 3WJWA 4LC6A 3UA4A 5E0FA 4MWAD 1QWKA 3GNPA 3AS1A 4H9XA 3G8RA 4JDBA 1WPCA 3W7RA 4X9YA 1C90A 5DX7A 2Y5JA 4TMCA 3E96A 4Z2HA 2DEPA 5DT7A 1BRLB 3CWOX 3UY8A 5CPSA 4O1CA 1E0VA 4DWSA 1H1ZA 4TIMA 2ISVA 5BRQA 4A2RA 5B80A 4IHCA 2AL2B 1N7KA 3S9YA 2WPBA 3PANA 4NJHA 2X2GA 4KWOA 3D0CA 4FX6M 4ML9A 3UG3A 5MF5A 7REQB 2ZUVA 4GABA 1ZJBA 1XXXA 2I7GA 1U1JA 2NLIA 1KV5A 3TROA 5KITA 2EG7A 3L0NA 1FWHC 1KQZA 5DCEA 2QDEA 1GPWA 5E6YA 5EB8A 4JX6A 4PRWA 3MSRA 2OB3A 2W4XA 3QW3A 4DF0A 4Z1AA 3DH7A 1Z42A 8TIMA 4CD5A 2OSXA 3GBEA 2UY2A 4B5VA 4O57A 3M5YA 4GQGA 3CAKA 3AXKA 2XFRA 4B5NA 1AA1B 3NVDA 3CH0A 1ISWA 2E9MA 1B2YA 1PKLA 3DKJA 3IV8A 2B81A 1SR0A 1VIZA 3E12A 5G2WA 2OKTA 3GG1A 4GXMA 3FJ6A 3EDFA 4IFOA 3NZGA 1MO0A 3VNKA 4CQ9A 2W63A 3KS5A 4MNLA 1HW6A 1UKQA 2UY4A 1TWWA 4LUIA 1W3LA 4LRTA 3VOIA 2XM2A 1FP8A 5A69A 3LCLA 2DVXA 3EB2A 2OVLA 4WF7A 3UT0A 1YMYA 1EXBA 1EBGA 1JIBA 1DPMA 3C2EA 2WNNA 5G1TA 4QJ3B 1DP0A 3O1NA 1EP3A 4AD1A 5D33A 4GLEA 2PGWA 2X42A 1XP3A 1IE7C 3F5JA 1PKYA 3T8QA 1R86A 4HYRA 2GLKA 4QAWA 5AYYA 4RNHA 3C6CA 1OGSA 2Y4SA 4UNLA 2A85A 1YBQA 4NNBA 4G7EB 2XN2A 4YWIA 1RCOB 2V67A 3LSBA 4N02A 4V15A 4CEXC 3OPSA 4U2YA 2ZXAA 4AHQA 2CWNA 1Q2SA 5AHMA 3NYZA 3M0IA 4FSAA 3UR8A 1T6MA 2VENA 2VEGA 1JCNA 4MB5A 3GH7A 1QPKA 4QG8A 2E8ZA 4QGCA 2W91A 2DUXA 2Z24A 2E6YA 3MUCA 1BYBA 3AQUA 3M6YA 4IFRA 3BLOA 5CPOA 1KRAC 3GYCA 4H01A 1PXGA 4B4HA 1GW9A 1O60A 3GG7A 4MDOA 4IIBA 4GJIA 4LVFA 1GKRA 1GJWA 4YIWA 3SN0A 1TPFA 4IIHA 1TPEA 1M9HA 1NDWA 1Y5VA 4EPEC 4FI4A 1I9CB 4KGLA 3BV7A 2PDCA 4H6KA 1JDFA 4OUIA 4ZTYA 1IT0A 1F6YA 3A24A 4N4QA 1FHLA 2Q09A 3CTLA 2R9RA 1EC7A 2QYGA 4MWAA 4Q33A 3GH4A 1J2BA 3NM1A 4XD5A 2OEJA 1N8IA 4GBDA 3H4XA 4KBXA 3KHDA 4NI8A 3LHYA 3KRZA 5AFDA 5HPOA 3VOCA 1RBAA 2YA0A 4K2SA 5AC4A 2YXGA 5BOFA 2G37A 4G8TA 5FJJA 3PS7A 5FOOA 3Q37A 2QV4A 3CO4A 2PSNA 1F8IA 3BOXA 2ZX6A 3CV2A 1PZ3A 2E5DA 1NOUA 3WK0A 2HCVA 4C60A 1M03A 3OO2A 1K8XA 1HQTA 3GO2A 3N29A 1H0GA 4IM4A 2OYKA 2YB1A 1JCXA 3HMJG 1VJSA 4YYCA 4LT9A 5AECA 4Q3MA 2NQJA 2RFGA 4A8RA 5C9ZA 1SGJA 3R0DA 3DENA 4PCFA 5DN1A 1OK4A 4F4RA 4PCPA 3CGTA 2PS2A 4J3SA 2QIIA 3W07A 1NOWA 4C65A 3T9PA 1LTDA 2I17A 5HNNA 3V0TA 1FWCC 4HYVA 1JYXA 2CHRA 2XVPA 3GXPA 1NIUA 1X97A 4U10A 1XIEA 4QLLA 2QCCA 4C6JA 4MJMA 1A0EA 4AZ6A 1XLIA 4FNRA 5ABTA 4XIMA 1P43A 1THFD 1IZCA 2WC7A 2ZZ5A 4MKVA 2NT0A 4Y2WA 2CHNA 4OIFA 5KZMA 1TMHA 1E40A 3MMUA 3MPGA 1Q6RA 3ALGA 2UBPC 5D9MA 4UTHA 3FN9A 1S39A 3E6EA 4Q7NA 3UR2A 1FP9A 3QGKC 4A3QA 3GU1A 1ZBWA 1KWKA 1XYCA 4WIWA 1PWLA 2PDMA 4DAIA 1YTKA 2OYMA 2HK1A 3SCWA 2VX6A 3CUIA 5H2ZA 5CQ1A 3OVPA 4C6FA 4MYXA 4ACYA 4L9ZA 1QK2A 5C9UA 3ABXA 1EGZA 2PRHA 4O8RA 1XIJA 4GMEA 3U4FA 1SU5A 3W82A 4DX3A 1LDCA 4JHOA 3WK1A 2ZYFA 4UR9A 4OU1A 3EWBX 1QPQA 4NAEA 3QPEA 4CN6A 4MAVA 3FGCB 3CYJA 1QU4A 3RO8A 4YN5A 3K4DA 1UR9A 1ADSA 4GISA 1JZ7A 3BJFA 7PTDA 3RM9A 1O94A 3O6DA 2Q3RA 3SIZA 1V0LA 1WDQA 4H8HA 4XVEA 3TH6A 3QR1A 2DZBA 4MB1A 3GU9A 1CI1A 1BWVA 3WD3A 4XAPA 2CPUA 1KWGA 1EOKA 3GVQA 1GQKA 1CIUA 1ZS2A 3V18A 4EF9A 5I78A 3H6OA 2P3ZA 4D8AA 1TPVA 3RX2A 4UTUA 3WD2A 1V6VA 2CXGA 3WDHA 3WENA 1Q6LA 3HG3A 3G1SA 4J3ZA 3O06A 5CLWA 3EDDA 2G5WA 1U33A 3SSZA 5DBUA 2WSKA 3BAWA 2G41A 1VBUA 3HURA 1ICSA 3NZPA 5AC8A 1TSIA 1GK8A 4DQWA 3V5FA 1AH0A 1V6WA 4IGMA 2QCHA 3M0LA 3OB8A 3AU6A 3TYEA 3VMNA 2DP3A 3NO3A 4MAZA 3ZJKA 5M1TA 2HPMA 1CEOA 4YTQA 3ZIZA 2DT3A 2V3FA 4OBTA 1FWWA 4M1RA 4FB7A 1DJNA 4Y6GA 2TYSA 3P14A 1E9LA 2YA1A 4DUXA 3CIVA 2I5QA 1R5YA 4RPPA 1EJWC 1GWJA 3O15A 4JY8A 1W9BM 3IACA 1G67A 2WBKA 3N04A 3M0KA 5BRBA 4DXKA 2PP0A 2BOEX 1OD0A 4LAZA 2E0PA 1TVPA 4NAFA 1TTQA 1KR0A 1EF2A 5D2XA 5EMJA 3T0CA 4J35A 1CXHA 5CPLA 4CUCA 3ZR4A 4J28A 4TR9A 4FR1A 3W9ZA 1TV4A 3NEHA 4KEZA 1EJ7L 5FF7A 5DANA 1K9TA 3H4GA 5FJTA 2BGSA 4GFIA 2QAFA 4IIFA 1MVYA 3BH4A 2F6XA 1C8XA 1JXJA 1WNOA 3WX7A 2ZBTA 4HJFA 3RFAA 1K6WA 2LLEA 4F2TA 1TJRA 3GDRA 3ITTA 1EGMA 3VK5A 2VEPA 1K3UA 1I1XA 7CGTA 2WSPA 5G4HC 5E6ZA 4OOUA 3POCA 1ZCCA 3MI3A 3PWAA 3BL3A 1FUYA 2ISWA 4GVGA 1XYLA 1GVFA 2V9DA 4KFNA 1A5OC 1XUUA 4QBXA 4LCSA 5CGTA 1W1ZA 2GJLA 1TPWA 4GQBA 2IQDA 4CQBA 3W72A 4YU1A 3GHUA 3STEA 1ZJIA 1YXCA 2CW6A 3JUGA 4NASA 5CC5A 2VEIA 4K68A 4PBGA 3TNBA 3AIRA 1ZQ5A 1BF2A 4H4IA 1XH1A 1XI3A 5KZDA 1MQRA 1GCYA 3DGRA 5DELA 4UOZA 1J9YA 3FX4A 1J0ZA 1FH9A 4F9JA 1UQYA 3UWYA 1PZ0A 5TBOA 5M03A 3KTCA 4L1GA 5D4YA 3LTSA 2OLAA 2JALA 2OTDA 4GIYA 1KCLA 5HULA 3AHTA 3OLGA 3UD6A 5DY2A 6REQB 4JL2A 4W5UA 3MZNA 5GPRA 1ME8A 4QNEA 1W37A 2OODA 4I7WA 3CU2A 1WA3A 2CESA 1OZQA 4HJWA 2A1YA 3EOUA 4J9JA 2XTKA 1MUMA 1FX6A 4LUSA 2VRQA 1Q6QA 4JIIX 4LNCA 1KC7A 4UNKA 3LB0A 4MGGA 1RQEA 5FI8A 4Z08A 3N3MA 4WDXA 4J2PA 2OMAA 4PUNA 4B9ZA 2V3DA 3HM7A 6PTDA 3WDJA 3AU2A 5EBUA 1NELA 4ORIA 3IJDA 1RY8A 1EDGA 4DPPA 1JNDA 2IPJA 2E67A 4IPNB 4GC3A 4HTBA 1VFOA 4B2DA 2J77A 3BURA 3EDKA 2X1IA 3U8GA 4C1NA 3PK7A 4Q8NA 3XINA 3GFXA 2Y88A 1Z69A 2XVNA 5A6KA 3ENLA 5D2WA 3V75A 3MYPA 3WSUA 4DJDC 3F5KA 4GVFA 5REQB 4A35A 3OHMB 1MZHA 3E0LA 1Y5WA 4B91A 2O4QA 1R2SA 1IR1A 1QNRA 3S4TA 5RUBA 2VDHA 4GK8A 2FHFA 4O15A 1J5SA 2FH6A 2E9LA 3NQCA 1WBJA 1HO1A 2INZA 3LPFA 2DGAA 4E4PA 2VC6A 4QE1A 1MXGA 2V5BA 2I9UA 3HGJA 3LQLA 3GQYA 3U3HA 5LKYA 2NV1A 3W70A 3QZ6A 2WM0A 1D7KA 1S5WA 3AUJA 2VFDA 3TN5A 1BKSA 3PUEA 2C13A 1MFVA 1W8SA 3UVAA 2SFPA 4A22A 1LL7A 2J7GA 3TAKA 1YHTA 4IMEA 2HISA 1PBGA 1DYSA 4X22A 3PNZA 1WO2A 4RR4A 3LX9A 1JFHA 3OG3A 3H55A 4QJ1A 4JFTA 2OJPA 4AX7A 3L12A 4EK7A 3T78A 4ZO7A 1K02A 2V5CA 1AQHA 3WNMA 4B5TA 3K1DA 2YL6A 3E2SA 1VC4A 2WHMA 2AKZA 4US6A 4DWSC 3TJXA 3JW7A 3W7HA 3CUZA 2TMDA 2WMIA 5A1AA 4IPIA 2Y62A 6ALDA 3HFTA 2H90A 4UFMA 1K9EA 3TU9A 3UWUA 2G4FA 1XCFA 4ZOAA 2VZTA 3O6CA 3TONA 1KBKA 1BGAA 1FH8A 5AZ1A 2YDRA 1W3IA 1AZ2A 3N9RA 3W73A 3M6DA 3WELA 1F6PA 3LA4A 3LS9A 4S3JA 2PUZA 1W91A 2X0SA 2RGLA 1L6FA 5C70A 1Z8AA 4LJ3A 2ZFAA 2RUSA 3VIJA 1EUNA 2X1RA 4H9MA 4ZMGA 2E25A 4IISA 2NVDA 4KIRA 1UHVA 1NP0A 4IXHA 1W2PA 2DY3A 1OFOA 1GVOA 4FXRA 1ME9A 1NWUA 4P2VA 3A4XA 4P7RA 1REQB 1E9YB 3ZZ1A 4M19A 4UUIA 4QTGA 1F4AA 5F2GA 3MCMA 3RU8X 1OD8A 3S5NA 1T8XA 1EIXA 4HTYA 4UTFA 4I9TA 4K3ZA 1U5JA 1LT8A 1E1CA 2ZX8A 1QJWA 3C0QA 5GJNA 1OYAA 3BCDA 2PFHA 7TAAA 1GYMA 2FFCA 1XYFA 1GGOA 1RD6A 1SSGA 1DIDA 3GXNA 2F9RA 1ZPTA 3CIWA 1R85A 1MWOA 4QDPA 3N19B 3AMGA 1TREA 3GSMA 3UZYA 3SCUA 1V0KA 4R9XA 3B3DA 3WLQA 2YBVA 4KS0A 1LT7A 2J8GA 2XHYA 3VKAA 2ZRVA 3V5CA 4C5ZA 5CAHA 1G7UA 3L4ZA 4ZFCA 5XIMA 3TC6A 1U1UA 3L2MA 3REQB 1P48A 1LYXA 1YIXA 1FWGC 3VU2A 2CLMA 1LLZA 1OCBA 3ABQA 4IP4A 1ESWA 3L9CA 3MI2A 4DYKA 4XIAA 2A7PA 4O50A 4BHYA 2ABBA 4AUBA 3ABOA 2Y6ZA 1XS2A 4UTTC 2FGZA 3R8RA 3GKFA 1US3A 2G95A 2Y24A 4H9YA 4DO4A 2WZMA 4W85A 2BVDA 3SY5A 3CWHA 3GR8A 4MY1A 3R2GA 4XBSA 2V63A 2KZHA 4HT3A 4YTUA 3UFYA 1CLVA 3ZOAA 5HR6A 1QRQA 3T05A 1X6NA 3DX5A 1E4IA 2VRJA 2PRLA 4JTDA 1K03A 4BQ2A 2EJAA 3BANA 4MVAA 3NURA 2VJXA 4XZHA 3HPZA 1FCVA 3A21A 3I6TA 3TJ4A 3E38A 3AIVA 3GHRA 3SGGA 3RIKA 3TKFA 2QXWA 2XFFA 4QX4A 1XH0A 3TW6A 5GNYA 3WNPA 2QKFA 4CVUA 5LHFA 1YNQA 7ODCA 3T2OA 4S3EA 1XUZA 3ZMRA 4J3XA 5A8QA 3PTKA 3QQ1A 3RK8A 4UOJA 2ABAA 2C3ZA 3H4WA 2NQZA 1YXYA 3G6MA 1GEQA 1R3TA 1RK6A 1VFMA 3AFBA 4S3BA 4NUWA 2FJUB 3IJ9A 5LNVA 4S3GA 5BU9A 4AHPA 4CNPA 2Z1VA 2IKIA 4DM2A 1REQA 2NX1A 3IUDA 2QJGA 1ZZMA 5HNUA 5EL1A 4WVXA 2GUBA 3OBAA 1QHZA 2VEMA 1NFGA 1X98A 1IWBA 2CLFA 1PB0A 2HBVA 4IH3A 3TNOA 2NVCA