4YTTA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 6-deoxy l-psicose
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 117
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4yttA00
1I6NA 3C0LA 4X61A 1TZ9A 3KCLA 3BDKA 4PFHA 1XLCA 5EMJA 4Q7IA 2GYIA 4YTTA 2QUMA 6XIMA 4ZBCA 1XLDA 2I56A 3UA3A 4EACA 2NQJA 4QE1A 2ZDSA 1XLLA 3IUHA 2J6VA 4HNOA 1XYBA 3KBSA 1QT1A 1XYLA 3KBVA 5H6HA 3UXIA 3IUDA 2G4JA 4X63A 1GW9A 1MUWA 3C0SA 3AYVA 1YX1A 4LNCA 1XYCA 2QW5A 5B7ZA 5FA5A 3VNIA 2HCVA 2Q02A 4OVXA 1XICA 1XIDA 3VNJA 3ITVA 3KBWA 1DXIA 6XIAA 5XINA 2XIMA 9XIMA 3AYTA 3XISA 1XLAA 3ITTA 3L23A 3BWWA 2NQHA 5EMLA 5AVHA 4YTUA 3U3HA 1XP3A 4HGXA 1XIEA 4X60A 5XIAA 2GVEA 3GNXA 4DVOA 3U0HA 1OADA 3ITOA 3M0LA 3KBMA 4HHLA 3VNLA 3UVAA 5EMKA 1I60A 9XIAA 3CQJA 4KW2A 3XINA 3QC0A 3BZJA 3N4AA 4DUOA 3JU2A 1XLIA 3KBNA 3P6LA 5I7GA 1D8WA 5C9ZA 5TNVA 4XIAA 5H1WA 1O1HA 1XIBA 4QDPA 3VNKA 3KCOA 5EMMA 8XIAA 4YTQA 5B80A 1DE6A 1XISA 2I57A 3QXBA 4EAYA 3KCJA 1MNZA 4GJJA 4GLEA 4G56A 3P14A 4GQBA 3M0MA 3QYSA 3TC3A 2QULA 1XLEA 4A8NA 1XYMA 3LMZA 3UU0A 5B7YA 1XYAA 1K77A 4QE5A 2HK0A 4GJIA 1XLMA 4QE4A 4XKMA 1DIDA 8XIMA 2NQ9A 2GUBA 3CWHA 3WQOA 1BXCA 1QUMA 1XLFA 4ZB0A 3QZAA 3CQHA 3TVAA 1XIFA 3VYLA 2GLKA 4XSMA 4XISA 3OBEA 2OU4A 3UA4A 1A0DA 4US6A 4XIMA 1XLHA 3XIMA 2X7WA 3BANA 4ZB2A 3M0YA 1XINA 4PGLA 1S5NA 1XLJA 3IUIA 1S5MA 4ZB5A 1DIEA 3M0VA 7XIMA 1XIJA 4K1GA 3DX5A 3KBJA 4XSLA 1BXBA 3ITXA 1A0EA 4K3ZA 4QDWA 5AVNA 3M0XA 3CQKA 3C0QA 3ITLA 3KTCA 1QTWA 3KWSA 4HHMA 2QUNA 5XIMA 1XLKA 2ZVRA 2XINA 4QEEA 1CLKA 3VNMA 3AALA 1XIMA 2HK1A 3DBNA 3M0HA 3NGFA 1XIIA 1XIHA 1XLBA 5J8LA 4A8IA 3FVMA 3BZGA 3CQIA 4J4KA 1DE5A 4QEHA 1A0CA 4YTRA 1XLGA 4A8RA 4W4QA 3CNYA 2G0WA 2X7VA 3AAMA 4E3VA 4YTSA 1XIGA 4A8LA 3ITYA 2XISA
chains in the Genus database with same CATH superfamily
1EJRC 4FOJA 4W7UA 5AZ0A 3ONCA 2OSXA 4QAIA 4ICNA 4KFOA 2CBIA 2W66A 4ILSA 3R0DA 1CXFA 3LUTA 1R3YA 2J74A 2OQYA 2WMHA 3SCQA 4S23A 2J7GA 4JHZA 3UPMA 3TA9A 2ISFA 2WANA 3F4CA 3A22A 1OX4B 4GKTA 4LNYA 3JR2A 4JTAA 5LA0A 3PBGA 1VR6A 3S2JA 3M0ZA 3DI1A 1GEQA 3ERPA 1FWDC 3TYBA 2QZRA 3TTOA 1SFJA 1RBLA 1DV7A 1VYRA 4OWGA 4NNBA 1HO1A 5B7YA 1V3MA 2VEPA 2B7PA 3FK4A 4P8UA 5CLTA 3RU8X 3TFCA 1UG6A 3ZQ9A 3DHUA 4HZ6A 1OM0A 1L2UA 1O4UA 2OU4A 3DC8A 3FA3A 1M7JA 4L65A 3WENA 1S5NA 2DSWA 4XZIA 1K8ZA 4NI8A 4QEEA 2V3GA 4GGHA 2V67A 1JULA 2WVTA 2PGWA 1UD2A 3PPCA 3WH8A 2XH4A 2GDVA 3BAJA 1U5HA 1JNEA 5D4YA 4B5SA 2DGAA 4L4PA 1TYGA 4KWUA 3LTYA 1C90A 1GKPA 3WN6A 4IZGA 1QAPA 4PMDA 3N11A 4CVWA 1KLZA 2W3ZA 3PG9A 1AH3A 4P8XA 3DGBA 4W5UA 2OYKA 3L7RA 4MNKA 4DF2A 4DZHA 2Z7KA 2INZA 3T0AA 4GIAA 3GXFA 2EJAA 2YX0A 4I7VA 2BHYA 3M44A 4MYAA 3CZ8A 2Y24A 2WSPA 5FF3A 3EX2A 4NI3A 1SR9A 4B5VA 3OQ8A 1PPIA 1R9YA 3NQ8A 2NW0A 1K7EA 2PTDA 1Q6GA 1XPYA 2JGYA 1XYMA 1PKLA 4AEOA 4S2CA 1QOXA 1NP0A 2PCQA 5F2IA 1TV5A 2W63A 3N6HA 3DGRA 1UW9A 4S38A 2NXIA 2OQHA 4YMZA 3W7NA 5TQLA 3EDKA 3VKJA 2D23A 1PCKA 2EAWA 4IWWA 1R47A 4LRSA 3TLQA 2X1UA 4KETA 2PB1A 3F2BA 4HMCA 3A9IA 1WDWA 3VCRA 3VE7A 3PZMA 1XH2A 1JD7A 2GK1B 2BOEX 3K5XA 1V3LA 4XK2A 1NFPA 5HNRA 1DJZA 4A8RA 3OGSA 3CMFA 4YVPA 3E0VA 5M5DA 1SQ7A 2J8FA 2J25A 4D71A 3UA3A 2VRJA 1ADOA 1TE1A 5LGXA 1QT1A 4FOKA 1XYLA 2O56A 4A3RA 2IKJA 2PWHA 5BXPA 2W91A 2D2GA 1A5OC 3RXZA 3LS9A 3UY8A 2DU2A 1KM1A 3ITVA 4B5UA 3H12A 4NNCA 4HD5A 5HWJA 1PB0A 2IS7A 3RLUA 4IMAA 3WNLA 2BS9A 2NVAA 3KBMA 1DJYA 1OC6A 3FEQA 2R6OA 3U2CA 4H4IA 2ACSA 1EL3A 2OEKA 4LVDA 2J9ZA 2UY4A 2GVYA 4HVXA 3LYEA 1UP0A 3LTPA 2YCIX 1SO3A 2ZVIA 1XYFA 3P82A 4PZVA 4HA0A 4ZE4A 3FFSA 4H01A 4I9JA 1E0XA 3WD3A 3ITCA 1RALA 4KRTA 2NX3A 3G0XA 3L68A 1ZHAA 1R0MA 5CPNA 4AC7C 3HQ1A 1JCXA 4ZXOA 5FJOA 3TK7A 1XINA 4CD7A 4C6DA 2HSAA 1A0EA 4W84A 4WGXA 4HHMA 4IMGA 4W85A 2EXOA 1OGGA 4I5XA 1IIGA 4O0QA 3M5YA 3OBKA 1G1YA 2CESA 3DUGA 3QW4B 4RPPA 4Q8TA 3THAA 4E3VA 1E6RA 3OZOA 4XBSA 1X8CA 4A3YA 4UXDA 5DCDA 5IRPA 1H7PA 4O1AA 3AIRA 3AYSA 3W7JA 2ODOA 1WZLA 2Y7GA 3PSVA 1OD0A 1OX5A 1T40A 1YPFA 2J6VA 3P5ZA 5CEWA 4Q8WA 4A4AA 4JTHA 3VM7A 5HR7A 1WOBA 1UB3A 3KOXA 5H8PA 1W1PA 4BI7A 1GYMA 3W7LA 2VFEA 2PD5A 4MTVA 2OPJA 3WBEA 4AIBA 4GGBA 1FTXA 2PRHA 3F1QA 1JDCA 1OADA 3N6JA 4LWWA 5JVLA 4JTGA 1EC7A 3CIWA 4AZHA 3E96A 4PTDA 2QQ6A 2DUZA 1XLIA 4YHEA 1CIUA 4YVVA 1J0IA 1KFCA 3BG9A 1W3JA 3WUFA 1J0YA 2A2IA 1AA1B 3E0WA 3WJWA 5LZLA 2NV1A 4GBDA 1SPQA 4R7OA 1H51A 2NWSA 5HDRA 4XZHA 1NFBA 4D6GA 4XISA 3GNRA 1Q7MA 4B2DD 3FYYA 5J5RA 1ZBCA 1TMLA 2GQ8A 3PM6A 4OFCA 3S1WA 4HB7A 4IMFA 3C3NA 1K1DA 4AVFA 3PAJA 4W7VA 4JICA 3JS3A 1GW1A 1X6LA 4N2YA 3A3XA 1VS1A 4H8UA 4XBKA 2GGJA 3AQUA 5G4HC 1JZ7A 1H09A 1XLCA 2ZX5A 3UWYA 4G7FA 5D04C 1QW7A 1OJXA 3NO1A 2WJZA 2ZWZA 3M07A 2Q71A 1LUCB 3VDHA 4POCA 4O50A 2WJEA 2FMOA 3G3MA 4H9VA 4JNYA 1GK8A 1VIZA 1BG9A 3GR7A 4QROA 1X96A 4PTNA 3URQA 1P6BA 5CGMA 4JTIA 3FLUA 1L2QA 1MQPA 1EP2A 4LQ1A 2ZX8A 1QBAA 1GOMA 2YCLB 3ZWTA 1M7OA 5JIWA 4M6VA 1J12A 4KCTA 4WXZA 1H50A 5HXMA 3ABSA 1H7NA 4GZ7A 2V30A 2TSYA 1K03A 5AC7A 4FA3A 4FR1A 1XL9A 4O19A 2PDWA 2XH7A 1TQJA 5DANA 1W32A 3IJ8A 3UXDA 4GQ0A 3W1UA 3RMJA 2WKGA 2QCGA 3GHTA 3LHYA 2X40A 3SGUA 3WQ8A 2BDQA 4Q6XA 4MWAB 4HU3A 1TWDA 4ERGA 2EKGA 2VEMA 5A6TC 5LHFA 3VOCA 2VOTA 4HSOA 1M03A 1BQGA 2VCAA 4C6BA 1UR9A 5REQB 3AIUA 4AMAA 3AXHA 4JIHA 5CSYA 1RK6A 5BROA 4NUWA 2QR6A 3MMTA 3EWWA 3LXAA 1PZ3A 4S39A 5CGTA 2V5CA 5H6HA 3NPXA 3BXWA 1XQLA 3P5YA 3NDYA 4AVOA 4PCSA 1XS2A 4FLRA 4GMEA 3L0KA 4IIDA 3KBWA 3GTXA 3WZ0E 5TIMA 4IPPA 1DEDA 4Q3MA 4B4FA 2VDIA 4PCPA 3MP5A 4MAZA 3ABOA 4Z2KA 4AHQA 5TNVA 2VFIA 2A79A 3D3FA 3BK0A 4IQEA 3SUTA 4EOUA 3L2LA 4GJJA 3T05A 2ZIDA 5EPDA 1ISWA 1YTEA 3N4FA 3S9YA 1V51A 3F03K 4QE4A 4TVUA 4ES4A 1W1A1 3MO4A 3S5ZA 1R86A 2PDQA 3C4UA 5I3DA 1UWAA 3G6LA 3HMCA 1VPYA 2ZC1A 2ATMA 2OLSA 2JKPA 1Q6FA 5DY3A 2J7EA 1SZFA 1H7WA 3ZWSA 4M8UA 4Z1AA 5FIPA 3UF9A 1P1MA 4O1EA 1YDNA 5CAKA 3T55A 4O8AA 1UD8A 4K39A 2A6LA 4BI6A 2Y1HA 4GI9A 1BYDA 3NL5A 4KGJA 4BK9A 3W38A 3STFA 3LCIA 1SFSA 1ZFJA 4AY7A 3MBDA 5FACA 2ALRA 3UZZA 4L1WA 3TZNA 1BGAA 4HNOA 3W26A 3GFXA 2ZUNA 3TYUA 1EPXA 1UMLA 4KCWA 1Z32X 1D3CA 2PBGA 1H5VA 4GPNA 2W61A 1QNVA 3ITOA 4HK5A 5K9XA 1XWYA 1S5TA 3HV8A 4H1ZA 4IPIA 3W9ZA 4PMUA 1ZJAA 1K6WA 1FWRA 3BMVA 4KWWA 4YWIA 4RUBA 1KM3A 3TW9A 3GYEA 3N12A 4W93A 1O60A 3IJIA 1S3TC 3CZGA 4PTMA 4OOUA 3WLOA 1Q7ZA 4JTKA 3BW4A 1LL7A 2Q3OA 3U7VA 2YDQA 1GHSA 3BJTA 4EP8C 1WZKA 4F0SA 1AODA 4MFEA 2W5FA 3A4XA 1J4EA 3WMSA 1SJDA 4AZ6A 4R3UA 4AWEA 4AEEA 3NM3A 3GUGA 1AW1A 2DZWA 3SUWA 3IJ9A 1J6OA 4O54A 3N9RA 4AZBA 3WIJA 3DG6A 3HPSA 2BX7A 4QEHA 1XRVA 3TW7A 3ARRA 5JBFA 1PEZA 4UQDA 1VCVA 5F2LA 5IDZA 2BWGA 1RZMA 2NT0A 5DFAA 3H8AA 1GOWA 1S39A 3J7HA 2Z1SA 3U5YA 2FFCA 1YXDA 2X30A 4FNRA 3F2DA 3TR9A 3N04A 2QCDB 3A24A 4JHMA 1R6WA 3VD5A 4D6FA 1OB0A 5K7JA 5FEPA 4ZR8A 1JL8A 3S6DA 3AC0A 4BQ5A 4PMJA 4GZIA 5I7GA 1VJZA 4EF8A 1CPUA 1Q45A 2B0MA 4X9YA 4CD6A 4Y90A 1C92A 3RRXA 4GQBA 1VIWA 3FSUA 4OV9A 4DPQA 5T26A 2HK0A 2YL9A 3GH7A 4B9ZA 4B91A 1CGXA 2CEQA 2DT2A 4QSFA 5A8NA 1QPRA 3NSXA 1MQQA 5EY5A 3GG7A 4J2MA 1GOQA 3DAQA 3L12A 5FJRA 3NCOA 3DX5A 2FDSA 4QG8A 4HNLA 3W2LA 4ZZ9A 1JZ3A 2YYTA 2XFRA 4O0KA 1X98A 4DEFA 4DJFC 1W91A 3ZXWA 2WZHA 5H2ZA 2OT1A 2YXXA 2PP1A 4NRSA 5JXQA 1HP5A 1I1WA 5HA7A 1OINA 3NM1A 4ZMGA 5A6BA 1C8XA 3PFMA 4XVEA 3WELA 2C0AA 2VFDA 3GTIA 1VFTA 1EJSC 4HNCA 4RZBA 2WOQA 2X1RA 2HE5A 1JDEA 5KETA 4O57A 1XC6A 2XH0A 4MLRA 5HUOA 2GDUA 4DXKA 1WXYA 3UXAA 1MW3A 3W7KA 1QPQA 4H41A 1ZQ5A 4CD8A 4AZCA 3F2CA 2VD9A 1YTKA 2V63A 1SW7A 4GD0A 3UCQA 1VD6A 4A22A 1JCTA 4CQBA 1VYPX 4TU1A 4O1BA 1R30A 1E0UA 4XG1A 4DXXA 4IPNB 4J3SA 2DVXA 3H55A 4FI4A 5MKGB 4DO4A 4EAYA 4P7OA 2O4MA 3NSNA 4M82A 1Q6DA 1OT2A 4PL1A 4TQTA 5GQBA 1F61A 4H6EA 1LDCA 3W1PA 4M5PA 1A5BA 1EZ2A 1HN1A 2V2DA 1JZ6A 2BODX 3A3HA 4CUCA 4HN8A 5IFPA 3GIPA 3VIIA 3WQDA 3V1HA 3TQPA 3WLSA 3CUJA 4PN2A 3YPIA 4QG6A 3REQA 1W1ZA 4LB4A 3R7MA 3M0HA 4IFKA 5I3KA 1XCWA 1L8PA 2OLAA 5DXYA 4IIGA 3WLTA 5F4SA 3W02A 6XIMA 2PTWA 2NQJA 4OTKA 1KFLA 2WAGA 1GQKA 3GVWA 4DLMA 4UR8A 4W5ZA 3LLXA 4J35A 4X63A 4DN1A 1TPDA 3FXGA 5HUPA 1UR8A 1OY0A 5CBJA 1V08A 3M0KA 2KX9A 3AYTA 1HJQA 2EKCA 3G6MA 2P0IA 4URIA 3BLOA 3LRMA 4EE9A 3HGOA 1SFTA 5BWFA 2PWGA 4XKYB 1EJVC 1VENA 1XIBA 1IIHA 1SZNA 1S3HA 2O55A 3U2ZA 5LGZA 1KBLA 3C86A 4HJWA 5A2AA 1SSGA 3ATYA 3NFUA 4UTLA 3HB9A 3MI6A 2A4AA 2C15A 1OGSA 4QS6A 3WNMA 1XPGA 5AKQA 5A6JA 3S6TA 4BI5A 4Q4PA 2RGMA 3G77A 3QSRA 3VKDA 3KP0A 2EHHA 2ALDA 4Z1BA 1QR7A 1A5LC 3ZJ8A 5I2UA 3EX1A 1LT7A 4UBPC 3EKLA 2ZUWA 3PB0A 2F84A 3S2CA 1TWSA 2X41A 2VI0A 1V77A 1XDLA 3O06A 3VKAA 1IWBA 2R1LA 3M0IA 4F2UA 1OABA 3QPYA 2AOSA 5I78A 5EYWA 1W9PA 4E3TA 1TREA 3E02A 3T6CA 3A5VA 2V5LA 2XG9A 2ZE3A 1B3XA 4DLFA 2Q8LA 3KEHA 2J79A 3DFQA 3N15A 3O05A 4H19A 4PODA 5BU9A 3W7DA 3BLEA 1BXNA 4CD5A 5C9XA 3O07A 1YXCA 3BVJA 3EB3A 7ENLA 1QPOA 2CWXA 3O15A 2E3ZA 3VIKA 3WNNA 4PB4A 2HNEA 5D9NA 1ODZA 1TKKA 2HDJA 1N7KA 5C2GA 4CD4A 5TBOA 3EBVA 3PTDA 5HMSA 1FRBA 4WHBA 1H0GA 3ZZ1A 3M0MA 3O6CA 3EOSA 3DZ1A 4ATDA 2HE8A 4LSBA 1OD8A 3JZUA 3WQFA 5CLWA 2D22A 3QY7A 1B0IA 4KS0A 3JZEA 4REQB 1MYRA 3AU6A 3VGGA 4U3CA 1W9XA 2E6DA 1I0BA 4Q4SA 1K4GA 3R8GA 4DI8A 5HQMA 1R85A 1VH7A 3VX0A 3UJSA 1HJXA 3V16A 1US2A 4I6VA 1ICQA 1SM9A 3W2KA 3ID7A 2C19A 1XRFA 1P6WA 2WHKA 3FJNA 3T4CA 2GGEA 2GJPA 3SGGA 4AMCA 1P0KA 1M1BA 4J2PA 1WNOA 3RMEA 2NXHA 3VIJA 3RHGA 4QJ5B 1DJIA 5D2TA 2D0GA 2CHOA 2V0TA 1DYSA 4WKHA 1Q66A 2OZTA 4Y9OA 4DJDA 1QWGA 1ZSXA 1EIBA 2VEGA 2H90A 4RR4A 4H8VA 4LVGA 3H21A 5D2XA 2NQHA 3VD7A 1HTIA 1HNYA 3VDCA 3CUFA 3WMBA 3MYOA 4U10A 3EEZA 4RW3A 3WBXA 2ZXDA 1ZENA 3V5FA 1PAMA 1DVJA 4LS1A 5KMYA 4JQ3A 3IVTA 3L65A 4KEVA 4MADA 1NWRA 4M51A 1MUCA 1KXHA 3MA8A 3DG7A 1WXZA 4JX4A 5E1QA 1G4SA 3ZFHA 4H04A 3UG4A 4GI4A 3KX6A 3KVLA 2E6YA 4FXSA 2XVLA 5I3JA 5AN7A 3R12A 2Y8UA 4L4MA 3WQVA 4E4UA 3P2VA 1HKWA 1U5VA 3I7RA 3AJXA 1IQ8A 3GAKA 1DJWA 2XUCA 2W79A 3OTRA 3RNDA 3UWEA 3WLNA 5LNSA 1XV8A 3EWBX 2NWRA 1UR0A 1H1NA 2HV5A 1EYWA 4YXGA 1FDYA 1MUMA 4KRUA 3WLLA 3G1HA 5LHEA 2VGBA 5A8OA 2NLIA 1YX1A 1Z41A 3VNIA 5AB3A 1UHVA 2QGHA 1CX9A 2VUNA 2W9MA 5C7HA 4AIOA 5DN1A 3I65A 1MSSA 4Q8VA 5DRIA 2F8QA 4DM2A 2XIMA 2E6AA 1KQZA 1RA5A 3VD3A 1Q6CA 3EPOA 1C29A 3AWOA 4OU1A 2CHNA 2IQDA 1B90A 2EF9A 1P7TA 3F4VA 4JHOA 1FVPA 6A3HA 2DW6A 4DF1A 3G1YA 4DIAA 1CNVA 4LC6A 4CVUA 2HNHA 1GZJA 4P2VA 4AZCB 1ONRA 1XD0A 1WP6A 3E1F1 3EXTA 2VX6A 3Q37A 3THDA 4S3AA 1TX0A 4ADTA 2V3EA 3TROA 2E09A 3OBEA 3WEZA 4GUGA 4ZB2A 1EQPA 1HG3A 1F6YA 3W2UA 3VMPA 1KRCC 3PPGA 3GVQA 4C6KA 4GCAA 1NOUA 4Q8PA 3W1NA 3LSCA 3PJXA 1NM9A 4AWUA 2V5KA 3QTPA 1I4NA 2QVHA 3CQIA 1M68A 1UD6A 3MCNA 3FV9A 3S5SA 1KO0A 1DIKA 1W17A 3W7GA 2JBMA 2EPKX 4JY8A 3MUXA 3WLMA 3W85A 3CLMA 3IGHX 2J7DA 3VIFA 2HPMA 2VQTA 1FKXA 4ERAA 3AHZA 4LF1A 4YU1A 1NP2A 1KBKA 4D8LA 1F4AA 3MUCA 3BG5A 3MT1A 3MZNA 2ZRYA 1UWTA 2W4XA 3JW7A 3A47A 1J0JA 4HU0A 2AQOA 2IPGA 3G5EA 5EMKA 1DL3A 3USZA 4LYKA 1WB0A 2R91A 4J3VA 3W4RA 3NEVA 4QS5A 3LHWA 3P14A 2YB4A 2HQAA 1RUSA 4LAKA 3ZYZA 4AZGA 4DYJA 2VMFA 3B8WA 4V1YA 3TR2A 3BV4A 2O9TA 3S83A 3OVRA 3G24A 4Z2LA 1PDYA 4UTIA 4AY8A 2FH6A 3E9AA 3TXVA 3C56A 1BWLA 2PWVA 1RSCA 4CU6A 1FH8A 3HJEA 4JXCA 3NURA 2FPVA 1UCWA 2YYUA 3P8IA 4E8DA 2C71A 3WF3A 3TN6A 3UP8A 1QPKA 5CBIA 4N6EA 3T7VA 4K8HA 4UOQA 4JCLA 2Q3RA 3KTXA 5HNTA 4J40A 4V33A 1I2QA 4CQ8A 4HMDA 4ICCX 3W83A 3IUHA 3ZJKA 2NV2A 1XYBA 2ZA1A 5C0QA 3NQVA 2HJPA 3C0SA 2REQA 3PR2A 1VYSX 2VWTA 4FNPA 4RV8A 2VDHA 4JFTA 4RZ5A 6CGTA 5KZMA 3KLLA 5FF7A 3R94A 5DT7A 3LPOA 1AVAA 2ZZ2A 4LUSB 4WDTA 3VMNA 5DEZA 4OQVA 1NWUA 1K4HA 2ZOXA 4H9XA 1UKQA 3IIZA 2FGZA 4KESA 4GXPA 1LOQA 3RCMA 1V0LA 2WVVB 3GM8A 3EGJA 1UP2A 3ZMRA 1H7XA 4F48A 3G1XA 2VFFA 4WZHA 5D8WA 4FIQA 2CBVA 4YIWA 2Z6JA 2ZZ3A 1JF5A 3GHSA 2P5NA 3L0NA 3T08A 2ASHA 2GJNA 3CB3A 4MB1A 1I2OA 4R5EA 4OGZA 1P4CA 4S2BA 4K1GA 3OPSA 5FEWA 3OQEA 2XGZA 1W9BM 3N9KA 3R0KA 5AHMA 3W07A 3F5JA 1Z42A 1LZOA 2PWDA 3AAMA 1KM4A 1LTDA 2WPGA 3R4IA 3T44A 3PJUA 2OZ3A 1AQMA 3VCCA 1AD1A 1XBYA 5C55A 2X1SA 3CPRA 3EMCA 1M41A 1ZCOA 1UIPA 5HJLA 5LNUA 5FSEC 4HCDA 1KKRA 1W2VA 3RLHA 3K13A 1T5AA 5LA2A 2QEZA 4EX4A 3CV6A 1DHKA 3MV11 3RUBL 1XP3A 4C6PA 3LI1A 3MW7A 2D69A 3UPBA 3DFSA 1LLZA 3CYJA 1BRLA 3UR7A 2DV0A 4KH2A 5BXRA 2AQVA 4AB4A 3GRIA 3PZTA 5TAOA 3MHGA 3NO3A 3C8NA 2G3IA 4GG9A 7TAAA 4GX9A 1IWPA 1GQJA 3BLPX 3GHUA 2WSKA 4P5UA 2Y7FA 4QCFA 4XVDA 4U33A 2QIWA 1WQ5A 1EA9C 4GZJA 2WNZA 2DW7A 5EKYA 4GVGA 3D5HA 2ZZ4A 2ABBA 2HWGA 4TTUA 1J10A 4CQDA 4RE4A 5G4EA 1J18A 4E4PA 1NWTA 3VNMA 1FFQA 4IICA 3MTWA 3W24A 4HSNA 1JAKA 4NXSA 1B3ZA 4ZTYA 1JPIA 4GQRA 2WSQA 5K4XA 3LPGA 1UH4A 3WFAA 4BEUA 2Y88A 1QNOA 1JRBA 1V3KA 4AD5A 3VZZA 1R7AA 2EPOA 2OOGA 1YYAA 2INEA 2XIOA 3FS2A 4BKNA 2E1DA 3B0PA 4GYPC 4QM1A 1FWJC 3EX6A 4Q4MA 4PE8A 1W0MA 3MBFA 1J93A 2IPFA 4RDYA 3T81A 1CDGA 2WCGA 2QT3A 1M53A 1P1XA 3THQA 3WF1A 1VCGA 4I8YA 1UH2A 2POZA 2CNCA 2CBUA 1F7BA 1BWVA 4Y8FA 3UG8A 1V0KA 3LQLA 3AUOA 1E1FA 2VDGA 1JZ4A 4L61A 1PKNA 5HJXA 4Y9PA 2BXZA 3FW6A 1JXKA 1TFVA 4A8NA 4OUEA 1UJQA 2XN1A 3ZR4A 4LUTA 1SZEA 5AHLA 1P7TB 2DZBA 2OX1A 3WDIA 2VO5A 3CHEA 5EMUA 2G8ZA 5GVJA 3L4UA 4ZOAA 1S1PA 1E55A 4QNEA 8RUCA 2PS2A 2XN0A 1OG6A 4KRZA 2F6XA 2XYLA 2GSJA 2RJHA 4HOWA 4PEEA 2C6QA 5BCAA 1ICSA 1XYZA 5G1YA 1TWWA 3B4UA 3PUGA 1GHRA 3ALGA 2Z0IA 1VFMA 1W31A 2WBKA 3A4WA 4CNUA 1TPFA 3GBDA 1UD3A 1EO7A 3NYZA 4D2JA 3R6IA 4RZ6A 1XSKA 1ZGDA 1RQHA 1YNYA 4P7RA 1IR1A 2WWDA 4GH3A 2PRMA 2PD9A 3PZNA 4KFPA 1IT8A 1ECQA 3S2LA 3T8LA 2FZ8A 2HXUA 4M81A 2ZZ6A 4XAYA 3CHDA 3E2RA 1GZGA 1KBIA 2I5QA 1J5SA 3A5FA 1E9IA 2QNEA 3QYQA 3CAKA 4LUJA 4IQDA 2QCCA 2DEPA 4PCTA 5E0CA 5EMLA 4MJ2A 1K8CA 4WD0A 2ZCGA 2VVNA 3APYA 3VKKA 2CLKA 1VEPA 1W3NA 3GIYA 1MNSA 3RJYA 5C8BB 2I57A 3EXSA 3NL6A 1EF2A 2ADAA 4D6IA 1A53A 3QH2A 5IOBA 3K30A 3W7EA 3S2MA 4UQBA 5GNXA 2PU1A 1G9HA 2FIQA 2R1MA 3T0CA 1Q7QA 1IF2A 5I03A 4UTFA 1LOLA 1KR1A 1CBGA 1EJWC 3R10A 1TZ7A 4WOZA 4WOQA 3SCVA 4JIRA 2A7NA 1EGVA 3QHMA 3CK5A 3N6QA 4O10A 4UTMA 3VD9A 2ZUTA 4IP5A 2YB1A 1F6KA 4IMCA 3RGTA 4C1KA 1M5WA 1L8NA 1QHPA 1BF2A 8CGTA 3GNPA 1X38A 5BRPA 2Z00A 3BAYA 3GKFA 2E8ZA 5BRQA 4CN1A 3SURA 4PTXA 2X7VA 2NVCA 4GYFA 1E73M 4I9AA 3ITYA 3RJXA 1TZ9A 1E0VA 1PS9A 4WJXA 5K9CA 3N3TA 2B7NA 3AIQA 4WGHA 3DFNA 3O6DA 3DG3A 1GW9A 4FXJA 1GZ1A 1WKFA 2VZUA 4S3GA 4DBSA 2ESCA 3VIPA 1NDWA 1WDDA 5A6KA 1KWKA 4E2VA 4DYKA 3HA1A 3TC6A 1KCLA 4LPCA 3N3MA 1E40A 3RLVA 3QC3A 4BEQA 1C8VA 4Q8QA 2ZRWA 3DCPA 3GKAA 3T2OA 1CGVA 3BPWA 2F9RA 3EOLA 4JTQA 1BTCA 1VF8A 2BV9A 1PDZA 3TYCA 4DWDA 3H2OA 1W1B1 3L0GA 2PDYA 1DBTA 1NOWA 2W92A 4MF4A 5JH1A 4GUIA 4J27A 5CJMA 3AMGA 3QRHA 1U22A 1X6UA 4HA1A 3SGZA 2CBJA 4M19A 2X7WA 1NSJA 1E0TA 1KFWA 3MSDA 3IWPA 3P84A 4PGLA 2D73A 4GIEA 3M0VA 4KKXA 3HQNA 3SCRA 4IQLA 2A5HA 1FWNA 4C6OA 2DIEA 1EJ7L 1Q6LA 4L4OA 3FDGA 4NAFB 1H49A 5H8UA 1E9YB 5AHFA 1ZS2A 3E5PA 2QAFA 3LEPA 2YBVA 2DH2A 3E74A 5HR6A 1CW2A 4MDPA 2X0YA 2ZZ1A 3PTKA 2F6UA 2DZVA 3DYMA 4O4WA 1J79A 1C8YA 3QOKA 3MDWA 1EX1A 3H24A 2CLOA 4KQNA 3UVIA 4RPQA 1BYBA 3NXFA 4IIHA 1SGJA 2XGBA 4MZ8A 1XGEA 2H9AA 1ADSA 4KCUA 4NYYA 4Q6JA 2VR2A 1WA3A 3VGDA 3SRFA 1TCDA 3GG8A 1KCXA 2W6RA 3HPXA 3GBEA 3GU9A 4RDWA 2ISVA 2HROA 1AJ0A 5FD0A 3CASA 4JPGA 4QQ3A 3AZTA 3G1RA 4UTKA 3WD2A 4N4PA 4LCQA 1R46A 1BWKA 3VI2A 2BNJA 1U33A 1TVNA 2YL8A 3BJSA 3TOPA 2YLLA 3WMLA 5K9DA 1FHLA 2JE8A 1VP5A 3E3HA 5BOEA 5A6AA 3BLFA 2GQ9A 4DBDA 1IGSA 1TJ1A 3UNDA 4QTGA 1LYXA 3FHAA 3BMWA 2J75A 3SO7A 5A95A 5LKYA 4IL0A 3CWNA 1BG4A 1F3TA 1OCNA 2VGGA 4DJDC 4XZ9A 3IIVA 2J9YA 3V0TA 4JKMA 2E6FA 2ICSA 2VFHA 4JQ2A 1I75A 1Z9AA 1REQA 1M7PA 4LJ3A 4QLKA 5DT5A 1WUEA 1WXJA 1XLKA 3N2XA 1R9ZA 1XG3A 3W2MA 5AC6A 4FS9A 4NZ4A 4PB3A 4FB7A 4PMNA 4DUWA 2P10A 3S6OA 4IIFA 3OLEA 2I5GA 2DT0A 4BQ4A 2ON3A 2GYIA 1QW8A 3VILA 2AAMA 3A9BA 1KCZA 1E3ZA 1V7AA 1PKMA 4IP4A 4FOUA 3SCWA 2E1WA 1CXLA 3BW3A 4X0NA 3NG3A 2V38A 1ONWA 2QPSA 4NVTA 3V36A 3LZ3A 3V18A 3PBMA 5A8MA 3UEQA 4H6RA 3LCLA 1XI3A 4IM4A 2FMNA 2UY2A 3WNOA 1SFLA 1TJ2A 3HG3A 1FQ0A 3CQJA 3SFKA 1V3JA 1YMYA 4CEXC 4GY0A 4CQAA 3H54A 5A2BA 1W56A 1KTCA 3LPFA 2YGYA 3R0UA 1MDRA 3H6OA 3VOHA 1GVRA 1HKIA 1XYAA 4ASTA 5KTLA 3QZAA 3ARPA 1TRIA 1P0DA 1W9DM 2I14A 2PSNA 1MRAA 1AZ1A 1EGZA 3VO0A 5DBTA 5I6SA 3IPWA 1T99A 3WO8A 1JYXA 3G8EA 4HU8A 1UZ4A 3KXQA 3PANA 1WKEA 1EIXA 1TSIA 2JFEX 1TUFA 5I0DA 3RG6A 3SRDA 1B3VA 1SVDA 5CZJA 2BOGX 3I6EA 4WDUA 1UQYA 1I2PA 3H2EA 3NUKA 4FLQA 2G4FA 4L4LA 3GU1A 1OC7A 1TTJA 3G22A 4DRSA 5BXTA 1OYBA 4FX8A 4R34A 3IIPA 3VTRA 4X61A 3L67A 4EACA 3WLIA 5HANA 1O68A 4GVIA 4MB5A 3H7RA 1N8IA 1BPLB 5JU6A 3G18A 1VBHA 1US0A 1XUZA 1UWRA 1HUVA 1CTNA 1O12A 1ZLPA 3QQWA 3WFLA 1SU5A 1DXIA 1TPEA 3OZPA 4YTUA 3W81A 1XIEA 3IVUA 4JX6A 1ZPTA 3G0SA 4QITA 3PJTA 2VP8A 5FF0A 2WXDM 1W54A 1MMFA 1K8XA 4HMEA 4RZ4A 5DELA 4IQJA 1MEIA 1DJNA 5ABFA 5EBAA 4QNWA 4DJFD 1D8CA 2QGYA 3PP7A 1NH6A 1KB3A 4GLEA 4L80A 2BMBA 1B30A 1CZ1A 4WY0A 2VZTA 2ZUUA 4XKMA 1P48A 4PMVA 3FDKA 2A7PA 1FWHC 2TMDA 1GG0A 4WSKA 3DKJA 4K6AA 4M29A 1Q63A 2DVTA 2VX4A 4TVCA 2BZNA 3WMCA 4CNOA 4GO9A 2C7FA 1QBBA 1UC4A 5A8PA 3RN6A 3CC1A 4K3ZA 4I9TA 2WK2A 1FCBA 5CC7A 5CPOA 3C5QA 3MVTA 1QFEA 3BGGA 2MNRA 2XDFA 3II1A 3TZFA 3TA6A 4ROQA 1M7XA 1QWKA 1DJXA 3L4YA 3DN5A 5HOSA 4XUGA 1XLDA 4TO8A 2H3BA 1CGUA 3CUHA 3LXBA 3TV8A 1QNPA 1XYCA 1Q6OA 3BSMA 3W28A 4MAVA 4A05A 5E09A 4M80A 5AYYA 4IJCA 5D9PA 2DSKA 1A5KC 1RJRA 2VD8A 2GVEA 1GJUA 1OFEA 3WJZA 4V1XA 4G8TA 1GNXA 1LQAA 1I60A 4LALA 4JNZA 3KOYA 2CZFA 2D20A 3UWQA 3GVRA 1Z69A 2V5DA 3QBUA 3TH6A 1O6IA 3CAVA 1RA0A 1RJPA 1HVXA 1QI2A 5HMFA 4NIRA 4S3EA 4K2SA 2ZX6A 1VHCA 1LL6A 3NJ3A 4MPQA 3K2GA 1UR4A 1DPMA 4JTJA 1IT0A 5D05A 4MJZA 4NZ1A 2DUAA 3VX1A 1RY8A 1ZJBA 2GUUA 1LBLA 3OGVA 3TTSA 3GDKA 1J0HA 3IUIA 4NAEB 5CZ0A 4AW7A 1AW5A 3ZS4A 5D03A 1YRRA 4JS3A 3T0DA 2QUNA 5FJUA 3MCOA 4ADSA 3E2QA 5BNKA 4U2ZA 1EEXA 4W8AA 2GWNA 2GUYA 4UWMA 4HA3A 1DIOA 4S3JA 3U5UA 3S5YA 1XIGA 1O5XA 1C93A 1J01A 2NSOA 4LY4A 1W1IE 2GQAA 4KIEA 1XX1A 3NIYA 5HAOA 3TN5A 1OYCA 3UWVA 4PUJA 1T6MA 1Q13A 1XC4A 2HBXA 4WXYA 3H2FA 3ICJA 3HF3A 2ZUMA 4DHGA 1Z48A 3L23A 1DHPA 3H7VA 4ERIA 4ZFCA 1HXJA 1JG9A 1BD0A 4LH8A 1AD4A 4PCFA 2BGSA 1GVYA 5LNVA 2YL5A 2HMCA 3NPVA 4C91A 3C61A 2E25A 1P6CA 1VJSA 2YW3A 1PX8A 1PBGA 4GIYA 4DNHA 5IM51 5A2CA 5A1AA 2C1IA 1V3HA 4QLJA 3LXCA 4PCNA 5C6MA 3BTNA 4JD4A 3NVTA 3R8RA 3KDNA 4LAMA 4AWTA 3BOXA 3MY9A 1PZ1A 3PUDA 3TKFA 1QASA 4M6PA 2IQTA 3KWSA 1OZMA 1ML1A 2RDWA 3GB6A 3W75A 3LCXA 3LX9A 1GKQA 3V0UA 4QAWA 1UOZA 4I90A 3V4BA 4LS2A 5CPLA 1E1CA 1TJ0A 2EPMX 3C0LA 3GO2A 1PL9A 5DQPA 4YTTA 3I7SA 5PTDA 1VFSA 4M24A 4ICMA 1WKDA 2FZMA 5D38A 4CQ9A 2O7QA 2DVUA 4ZXLA 1RP8A 3AMKA 2I9EA 3IARA 4WY0F 2ZKMX 4F66A 3TW6A 3EKZA 4X60A 1BVZA 1O1ZA 2DY3A 3KOWA 2RAGA 2NX1A 1RCXB 1IYXA 2CHRA 3L5AA 1YNPA 3IJLA 1WE5A 1G0CA 2D0FA 5G2WA 2OO0A 4Z1DA 2VM8A 3MCMA 3L2IA 2PDUA 3QMSA 4FPSA 2EPLX 1YBQA 4MFDA 4JYFA 5HQEA 1QJWA 3FKRA 1RR2A 2UY5A 2JGQA 2PE4A 1FCUA 5GNZA 1W5NA 2MANA 2FZDA 3PBWA 2CLPA 3OIXA 3OLIA 3VGBA 1F8IA 2OSWA 4AZ5A 3O63A 5LXEA 3M0XA 1J96A 1FXPA 5XIMA 3W29A 1U1JA 5FKYA 4DAFA 3ABXA 1FX6A 3TMQA 3D0CA 3NVDA 4FF7A 5BMXA 3URAA 3PN8A 2R1KA 3W0KA 4QISA 4WLCA 1JI2A 3LRKA 5DMYA 2OSYA 4QFUA 2XFWA 3R5EA 4K1WA 2OVLA 3HZ3A 3MV01 4N0RA 3WLHA 5IHRA 3CTLA 1XIDA 2A1YA 2BASA 2GGHA 4FEZA 1MXSA 3Q67A 3GTFA 4O0ZA 1XDJA 2WHLA 1IHIA 4D1IA 4GA8A 2J78A 3K8KA 3UVAA 1YPIA 2YKKA 3P6LA 4JAWA 5I02A 4QDPA 2O4QA 4MLJA 2NQZA 4O17A 3EEGA 1B4EA 3ZVHA 4AZ7A 4GE8A 1D3GA 1F4HA 1PTAA 2ZTJA 4OUIA 2A3HA 4G5DA 2QJGA 1QCWA 1LWIA 4E6MA 1TTIA 4QE5A 3PS7A 3CIVA 3FHQA 3W7PA 3CZKA 4N9DA 3TJLA 3QN3A 3W1RA 1D7FA 1W8GA 3VYLA 2BVTA 2OR2A 3NSMA 3CGTA 4GY1A 5DMNA 1M9HA 4RJEA 3PF3A 1J0KA 2QCFA 1WOAA 4WY0B 1E6QM 1KFEA 2PDBA 1HKMA 2Y70A 1KGUA 1Z7AA 4LYRA 2CIPA 2GVJA 3TSBA 1E0WA 4A21A 4H00A 2ZA2A 4PUMA 3VIHA 4MIMA 3GAYA 2XFYA 2DZPA 4LRTA 4CU8A 3BDKA 4Q4KA 2WMKA 4BY3A 1DP0A 4EAMA 2OGYA 4QP0A 2FVMA 2I17A 5F7UA 4XAFA 1GOXA 2B81A 4NHVA 1ME7A 3LD5A 4NJIA 1EPVA 2YDRA 3CZLA 3TDFA 1AUSL 1E6SM 4A29A 3ARYA 3NQAA 3UG3A 4R9XA 2WSYA 1ZY9A 1TJPA 3ANYA 4HSHA 2E5CA 4RE3A 2WWCA 1C7TA 2B7QA 2YBUA 1F6PA 3SB0A 3UZXA 4AF0B 2GL5A 3IAQA 2XZ9A 1SR0A 4GNVA 1WDPA 4CEUC 2TYSA 1B57A 4EPEC 3BOLA 3GHRA 1R3VA 1A0DA 1PCWA 1TPUA 4O12A 3W25A 1XLJA 3POCA 1X6NA 1RD5A 3BC9A 2E68A 3UXLA 3TX9A 3G1AA 3NDOA 3CLWA 3W37A 4KPLA 2GOKA 2PC8A 2WM1A 2DSUA 3IIXA 3DBNA 4NZCA 4GFSA 2X05A 3EDJA 5ENLA 3EWCA 3KHJA 4HNNA 2J62A 3TLLA 1S2TA 4YWSA 1W1YA 3LHZA 1AMKA 4Q8MA 3R89A 4UNKA 4H3DA 2VR4A 3OVGA 4JCMA 5HMEA 2XWEA 5CPMA 2OLHA 2WKLA 3K8LA 3VMOA 1FY6A 5E9XA 1QMLA 1JI1A 4LCRA 5G4WA 5D9MA 3S42A 3NQ7A 3PZGA 3ZSTA 1QPNA 3QZ6A 4YS1A 4A6GA 3IAPA 3CWOX 2HTMA 1H63A 4WJEA 5J5DA 2OEMA 1N8WA 3O9NA 5L9FA 3GXIA 3LGDA 3MHFA 2E0PA 4A3QA 3S47A 1V6YA 3KRBA 2GSHA 1E3XA 2YLAA 3LM7A 3F4NA 5E0KA 2UWFA 4WRHA 3WUBA 4I8DA 3BMXA 2YFNA 3CHVA 1ZJIA 4LTSA 5I00A 1GYLA 2BHZA 5L6UA 2QF8A 1XRSA 3QLDA 2DUXA 3EWUA 3LMYA 4JTRA 2QLYA 1ECEA 1XHGA 4GQQA 3WF0A 5AYXA 3TYEA 5I77A 1LORA 2RH9A 4LCSA 3TN3A 3ITXA 2YA1A 2O92A 5EB8A 2J9XA 2Y7DA 5D2WA 3A12A 4AYGA 6PTDA 1PWMA 4AG0A 3BL3A 4H9ZA 1U2YA 3UXKA 4JN7A 1PV8A 3P81A 3IJDA 3DENA 1F74A 5JQ9A 4D8AA 4DYEA 4P7QA 1DWGM 2Z1KA 3H2CA 2R9RA 4C6NA 3QQ1A 5CPSA 3BLDA 1JGIA 3RPTA 5A69A 4O8RA 3ISIX 4P8WA 2FQIA 4P7NA 1GVIA 3WK3A 1B5TA 1CXIA 4F4RA 3V5OA 1E1CB 4XZMX 3W1AA 2GWGA 4JGDA 3M6YA 1NDZA 2PLJA 3O1NA 2PTZA 4LY8A 4HZ7A 4MZ1A 3OG3A 2IPWA 5CC6A 3O16A 2GJXA 1MZRA 4AYSA 3BUVA 3W00A 3L4ZA 1K3UA 3AXMA 1F2JA 1V4YA 1RP9A 2C79A 4KBXA 4E0CA 3SZ8A 4JN6A 5JBEA 5BOOA 1XBXA 4X22A 5E9AA 1BXCA 1CCWB 1FH9A 2PC4A 1JCNA 2WLYA 3OG2A 2QPXA 5CPTA 3SIZA 1XLHA 2P3ZA 4PUDA 4NY2A 3L4TA 2CLLA 4R33A 1DWHM 3QV8A 4OBTA 1CT5A 5FESA 4O13A 4BR1A 4CGTA 4YVXA 1HGYA 4HMNA 1EJTC 3S1XA 3FVMA 3W53A 3T2QA 3RDKA 3FA5A 2PLKA 2ZICA 4MUZA 5KZEA 4ML9A 4PL2A 1O7AA 2X1IA 3NZGA 2QUMA 2Z29A 4UFJA 3UETA 4N02A 2WC4A 3PZQA 1E6PA 1BFNA 4J1OA 1LQ2A 3H53A 1NIUA 2JK2A 3R13A 4JTLA 2DPEA 3VNJA 1GG1A 1CXHA 3SR7A 2Z7GA 1YDOA 4HKPA 3VIOA 4DVOA 4FXFA 6TIMA 1HL2A 2E8YA 5C9ZA 2CPUA 3I4KA 3IACA 2QYGA 1LRNA 3P3BA 1D9EA 4D9PA 4MSSA 2ZE0A 3P80A 3KUMA 4Y7EA 2BGQA 2Y8KA 2BG5A 3TNBA 1QUMA 3QGVA 4TMBA 4MY8A 3MUIA 4XV0A 2GLKA 2HZGA 1IXOA 3PULA 1PVNA 3R2GA 1EC9A 3NXLA 3QF0A 3M0YA 1OQFA 1UJPA 3T0TA 1F3EA 1UASA 2QDGA 4AC1X 1Q6RA 1F07A 4I6KA 3QLLA 4XQ6A 1VBUA 4UOZA 1OYAA 1SZRA 3W7CA 3V75A 5I09A 3H22A 5HINA 3B3DA 1KR0A 4BWLA 1QATA 2BLEA 2QMJA 3S1UA 4JQAA 3FYPA 3SCPA 4AIUA 4FF5A 3D3AA 2E7FA 5JH2A 1V0MA 4OE7A 4U4MA 2CKSA 5M17A 3W82A 3VKBA 5E6YA 3Q94A 2FTWA 3WUEA 3OLDA 1F3XA 3I3EA 3PZ9A 4GVHA 3OU8A 1Q3NA 3B8DA 2X0SA 1YKWA 5A6BD 1JYVA 1OIMA 1UR1A 1TTQA 4DWSA 1EP1A 4OJYA 3RIKA 1KW1A 3CQ0A 1SJAA 1SZGA 2XIJA 3NL2A 2Y6ZA 5FOOA 4W8LA 2E77A 3CAQA 2NVDA 1FWCC 2XFFA 3E49A 5E5CA 3AUJA 1KA9F 2CKRA 2ZTKA 2YZ5A 4NRRA 2ISDA 4XD5A 3URNA 3PB2A 1H1YA 4TVDA 5F4XA 1MI3A 4NZ5A 2NT1A 3CU2A 2HVNA 4MZYA 5ECUA 3AS3A 3QPEA 2BP1A 1EUAA 2HVOA 3STEA 1PSCA 3W2JA 1VKFA 3CIXA 2QAPA 3PWIA 1GVQA 1SO4A 4D8ZA 1S5WA 1Q85A 4F8XA 4JIQA 2IKHA 1LBFA 2G3JA 4IX2A 1VAHA 1XIHA 3AHTA 4LBRA 3WDJA 1HZYA 3Q2DA 1KM2A 3AYRA 4U5KA 4V2XA 3ZT5A 1FWTA 1S2VA 4F0LA 3CS2A 5HULA 1WBHA 4UR9A 4NL1A 4E8CA 3WSUA 4D6DA 2JKAA 5EMJA 2OWWA 3POHA 4KT2A 4ACZA 2WVUA 1GYNA 2EBNA 1QI5A 2PGEA 1GT8A 2O9PA 1NQKA 4Z17A 3CL8A 2Q02A 1FXQA 1TE6A 1RVKA 3A64A 3U7BA 4NSBA 5DMLA 1BSLA 1R7OA 5DF0A 3E6EA 3GNXA 2JKEA 1BSIA 2FDMA 3SN4A 4Q33A 3IV8A 3H2NA 3LZ5A 3GR4A 3PUEA 1F5ZA 3GVGA 4C6IA 3FVDA 1AFSA 1LWJA 5D9OA 4GIRA 3B9NA 1H1ZA 1FOBA 3S1VA 3M5XA 1V03A 1KRBC 3TP4A 3HV9A 1UUMA 4X2PA 3NQ6A 2VVSA 3M9YA 2PDPA 3IJQA 2DIKA 2O7SA 4ONVA 2Y7EA 3MMUA 2TAAA 2PF0A 2Y4SA 4GXWA 4YN5A 2R14A 1YE6A 4IG2A 3RF9A 5A6SA 2HK1A 1HGWA 4LGXA 3R8HA 3NZRA 4KWOA 2YDAA 4US5A 4WJ8A 3DFTA 1KTBA 2J24A 3LHVA 3ABRA 3N29A 2BFGA 2W0UA 3MQTA 3W74A 3A4AA 4XZNX 1KXTA 4L6DA 5CJ5A 4S3BA 4C6LA 4B9YA 2Y2WA 2DIJA 2X42A 1F3WA 3FSTA 4LEFA 3EOUA 1MW1A 1XICA 4WQ6A 3N17A 4GNKB 2CU0A 3CL6A 2YBTA 4DO7A 3W6MA 1HIZA 3NZPA 1PIFA 1HL8A 4NXKA 2DJXA 3W27A 3E0FA 1FHDA 3GNOA 1EXBA 4JFSA 2WMIA 4WDWA 1VGAA 2ZZ7A 4CCDA 2IUZA 2PZ0A 7ODCA 1DWAM 3QYSA 1OK6A 3TC3A 3TYZA 4CU7A 4MKSA 4RDZA 4QCEA 3R79A 5CBBA 3LB0A 2CETA 4YPJA 4D1JA 3SW6A 5BXSA 3ARZA 1BEUA 1EJXC 1TTPA 4IFRA 1SO6A 4PH6A 4UCFA 4W86A 2WHJA 4IUOA 3G8RA 3H23A 1XDMA 2CW6A 3A23A 1X7FA 3ZSSA 4GXMA 4RCXA 4LYQA 1ME8A 1HJWA 2FPYA 1PIGA 5EGRA 1KC7A 2Y5JA 1AL7A 5CPQA 2WQDA 1JFHA 6ENLA 3I3DA 3LNPA 2XISA 4RNIA 3LQGA 4LBSA 3RO8A 4Q7IA 3UR5A 1PZ2A 2Y62A 4A2RA 3VDAA 5HBFA 2DZUA 3SUUA 4LV4A 4XTDA 4Z2GA 2WMFA 1Z8AA 3M5VA 1EP3A 2WW5A 1IGWA 3AZRA 1KV8A 3WUGA 3SM0A 3HU7A 3ITTA 4HGXA 4MY9A 1OX4A 1E6ZA 2F7FA 4DJDD 1VQTA 4IF2A 1GORA 3G2GA 3JU2A 3T40A 4E2OA 3NQDA 1AW2A 1Q4NX 4ZO8A 1S2CA 1MEHA 3EOOA 2P50A 1XLEA 4KCVA 4LW7A 1G69A 1C9DA 3VOGA 1DWJM 3RLGA 1WUFA 4JYDA 1TIWA 1KCKA 1YW1A 3OHIA 1LRQA 4HNVA 2BXYA 2GJRA 1FP9A 2I16A 2ZXQA 1H2JA 1JR1A 5DCEA 3WL1A 1K9TA 3KVKA 4FIRA 3B9OA 1V3IA 4ZL1A 3P0WA 3BAKA 1Y0EA 3K4WA 4G2DA 2IW0A 1KGXA 4ZODA 3SCNA 3VOFA 4YYFA 4QBXA 3MWAA 2PEVA 4DXVA 2WO5A 5H91A 1JPMA 1L6WA 1UZDA 2H8ZA 4ZQPA 4DJEC 4HPNA 5CAHA 3GYCA 3EA3A 1TV3A 1NARA 4ROPA 2E67A 4DBWA 3HPZA 4Q4OA 2DQWA 3STPA 3HO8A 1LWHA 4QXIA 2PU0A 4GYPA 4UFHA 1I9CB 4ATLA 4GINA 4UQAA 1CYGA 1OHLA 1Y5WA 4XO7A 5I06A 1VJIA 3CEUA 4F2BA 1K7FA 1XBVA 2H6RA 1UP3A 3MKVA 4J28A 4DZIA 1K8YA 1B54A 1N8FA 3GXTA 4B5WA 2BGNE 3LM3A 3KCJA 1OT1A 4UB9A 3C2EA 4R53A 3PBUA 2KAUC 3ABZA 5AC5A 1S5VA 4NZFA 4Y2WA 4F0MA 1JRCA 4AWSA 3UGVA 4MG4A 4QJ3B 5DO8A 3PUOA 1E5NA 1GPWA 1IEIA 3QR3A 1DKWA 1OCQA 2YFOA 3TIMA 1H11A 1K70A 1KM6A 2PURA 3QHNA 2OCZA 1CLKA 2XPKA 2VEKA 3CH9A 3OO2A 4A8IA 2GK1A 1KLYA 1LCOA 2HBVA 3LCHA 3QY6A 4MHBA 5BU6A 4H9TA 4FX7A 4C5YA 2Y85A 4ALDA 1WO2A 1OFPA 3QMTA 1JYNA 3O8AA 1TV4A 4X3ZA 3P60A 4MY1A 5HNNA 1SJBA 1YXYA 3AZSA 3FAXA 3OYXA 1Z6KA 5FJJA 4E38A 4H7ZA 1V6TA 4WK9A 1RH9A 1YNQA 4RNHA 1VB9A 3ES8A 4UFMA 4ZVJA 1S46A 3OIHA 3OEXA 4QLLA 2J7BA 3VNLA 1A5AA 3HN3A 3EOEA 4WVXA 3IRSA 3N2CA 1R9XA 2YXGA 1NELA 1N2VA 1A5UA 1UWUA 1IWAA 3T1GA 4AAJA 1A3WA 3LCWA 4XTIA 1OCJA 3AIVA 1Q6QA 1QU4A 2P88A 5E93A 3E38A 3H7UA 1ZAHA 4ZSTA 3B97A 2TRSA 2JIWA 2VZOA 8XIMA 2WBGA 2UY3A 1RPXA 3ES7A 1P43A 2WB5A 3JRKA 3T2PA 1OF6A 3FCPA 1JPKA 4XSLA 3FX4A 3HFYA 4LVBA 3D47A 3S46A 4NJJA 2VC6A 2PDGA 3UZJA 1EJUC 4JKKA 4HIBA 2J27A 3S1GA 1OGBA 1TMQA 2G97A 1VPXA 3EDEA 3WLJA 1JPHA 5AHEA 2PRLA 4AX6A 1LBMA 1DXFA 4GY7A 5FL0A 1G4TA 3VZXA 5D02A 3TCEA 3AMCA 4IG2B 1J2BA 4LS0A 3G1SA 2Y63A 4DBEA 3UPWA 4JTCA 4GO8A 4N42A 3ZT7A 4PMQA 1A50A 4BFAA 3EDDA 3KOZA 3CV7A 4J3TA 1X8FA 1EEPA 4MVAA 2GVGA 1QO5A 3U3HA 2WM0A 4MYXA 2IPJA 1CLXA 2C3ZA 1D7KA 4GABA 2PWEA 4JEJA 4UQCA 9XIAA 2XZ7A 1AG1O 1J5TA 4C90A 4Q22A 4DZAA 5FL1A 1XISA 5F1UA 1WPCA 3N9SA 1T41A 2YXOA 2D3NA 2DSZA 5CZSA 1QDSA 3HGRA 1FBAA 1XH1A 4RV3A 4AFYA 4HPJA 4XSMA 2F2KA 3EA2A 1WZAA 2E9LA 3RITA 1R3SA 3G1FA 2WMIB 2BY3A 5IXEA 3ITGA 3WQWA 3U8GA 1ZP3A 4G9PA 4FXRA 4K37A 4JZ5A 3CUIA 4RW5A 3WQCA 4OBRA 5AHNA 1P0EA 1XBZA 1CENA 1KBBA 4C60A 5CC5A 1OSEA 3MKKA 2XWDA 4W7WA 3GU2A 1XH0A 1CEOA 1E9LA 5A6LA 4ZEPA 3R58A 2DZAA 1F73A 3TAOA 3CBWA 3WH7A 5BRBA 1QOQA 4IFOA 3CL7A 3QKEA 4Q7BA 4NG3A 3QR0A 4OV4A 1EA0A 1VLIA 3LBCA 2VJXA 1JCLA 2CLFA 3LDVA 4NJGA 3SAZA 2ZRVA 3NQMA 5FF2A 1OCBA 4BJHA 1P5BA 2QV4A 4P7LA 3TOYA 1JUBA 3OVPA 5LIXX 2FFIA 3TJ4A 1QK0A 4UTHA 4IJBA 5FJPA 4AXKA 4KEUA 4HNTA 1NAL1 2YCLA 4Z2IA 2A6NA 5AYIA 3MO7A 5AZ1A 2HISA 1TVLA 1H3GA 2FH8A 1A4MA 3S8HA 2WZEA 2GGGA 2VEFA 2ZA3A 2FJKA 4AHOA 5AHIA 2NQ5A 4B16A 2A7RA 3W2NA 3OB8A 3CO4A 4IT1A 4ENLA 5F1VA 4FLSA 1RV8A 2BXVA 3Q65A 1XD1A 3QGAC 1W1VA 5DRCA 4R9OA 3BLLA 2L5HA 5KSWA 4QIUA 5HMDA 2VELA 3M6DA 3VA8A 1PJ9A 3ZT6A 3CJPA 5DY2A 2GFTA 4MWAA 5K3VA 4O1CA 1ENUA 5C9UA 4XB3A 3BICA 4MUPA 5REQA 2A85A 1GOKA 3CNYA 3VE9A 1W6TA 4YTSA 1UR2A 3AI0A 4QX4A 2OJPA 3MDUA 2H3DA 3H70A 5G2IA 1MW0A 3EX4A 1T8XA 1DXEA 4NF7A 2ACUA 3GD6A 1FWIC 4L7ZA 2V81A 1MZHA 4A2SA 4DELA 3GDLA 2Q09A 2KZHA 1H60A 4NX0A 7REQA 2WSRA 3OA5A 3HFTA 3N1AA 3RPDA 2BB0A 1QVBA 1ZAJA 3EYPA 2JQXA 1RAKA 3KBNA 5H1WA 2AQWA 1YDVA 4GACA 8XIAA 3VM5A 1PO9A 2OTDA 2BOFX 3ANVA 3W7RA 1UA7A 4UZSA 4BWLC 3VABA 3UWZA 3TWBA 4H6QA 1GQIA 1E71M 1HX0A 3VDBA 5GJMA 3EXRA 1YDYA 2V69A 3XIMA 3M43A 3B0YA 3DDMA 4BCEA 2VGFA 2E5BA 1EF3A 3W86A 1N55A 4Y8EA 3TQ0A 3KHDA 3SN1A 1V0NA 3KTCA 4FNSA 1TO3A 3BH4A 3GW0A 2VTFA 1EFZA 3E12A 2VURA 4DWSC 2CLEA 1W9VA 4ZA0A 1TWZA 1I1XA 2OWCA 1TB3A 3D6NA 4L5ZA 4C7DA 2FTPA 3IIOA 1ITUA 4JIIX 2WQPA 1WDQA 1QNSA 2ZXAA 1M3UA 3ELFA 4IIEA 3KBVA 1DTNA 1PYFA 2ISSA 4LNCA 1J0ZA 3B9AA 4JOMA 3GSMA 3AXXA 5XINA 1V6UA 9XIMA 2FTYA 2PF8A 2YCEA 1A5MC 2AMGA 3QV7A 4PUKA 2FGLA 1H61A 1ODUA 1ZL1A 4LOCA 3OOQA 1OZQA 3CUGA 2PP3A 5AC8A 4GNJA 3MI2A 2VFGA 1ZCCA 4EPKA 4B5TA 2PP0A 4AZIA 3F4DA 2GOUA 3FN9A 3AJ7A 5ABGA 1QI4A 4FZIA 4GI8A 4RK8A 1TPH1 1C91A 4H7VA 1RBOB 3HQOA 1JUKA 3LSBA 2AKZA 5KINA 2R8WA 3GIQA 3SQMA 9RUBA 3MJMA 6ALDA 4I5RA 1J8VA 4HA4A 1ZBVA 1E1EA 3WDQA 3EWDA 1QW9A 2FZ9A 1S5MA 3N2TA 3KZSA 2XVNA 3PK7A 5SWUA 2VZSA 5C7VA 5DMMA 1EC8A 3F5KA 5FEZA 3AMLA 3B9EA 3EMQA 1M01A 3REQB 1E51A 5LNRA 4IFKB 2CCRA 3B0VC 3GR8A 3C2RA 3TXZA 1W3TA 4ZO6A 1R3TA 1YLVA 1NVMA 4E8GA 3B9DA 2O0TA 4OBSA 1ISVA 2J88A 3PHAA 3S5NA 1YE4A 2Y89A 1L6FA 1GVFA 1QNQA 1XCXA 4H8HA 2QCDA 3A6OA 1JZ5A 4PB5A 3VXGA 5M03A 3RR1A 4HNUA 1UBPC 3BG3A 1CGWA 4CCEA 3HPAA 5CC3A 3ANUA 3TSMA 1DWFM 3HGSA 2Z26A 3LHUA 3N14A 4J9JA 3TQVA 3SIMA 3B0UX 3UBPC 2WCAA 4DF0A 4U5IA 2BY0A 1J6PA 3QW3A 3COTA 5BYWA 5CSUA 3NR0A 3UNTA 4DAIA 1XLMA 1L6SA 1UROA 3CWHA 3BO9A 4HPHA 2QJNA 3ZOAA 2VOMA 1NF7A 4ZOEA 4OOZA 1VEMA 2OX4A 2JEPA 4US6A 3NQGA 3M7WA 1EHNA 4Q7NA 3WK0A 3ORWA 4BQ2A 4LV9A 3KBJA 1Y5VA 3HJZA 3G1VA 1W37A 1WAWA 3T0BA 2G5WA 2CLHA 1NY1A 1JAEA 1HT6A 4YHGA 4M6UA 2EQDA 5M2FX 1WYIA 1RLDA 3AALA 3GY1A 4LVFA 1XLBA 1DORA 3OBAA 4UCGA 1TR9A 4JDBA 1K9EA 5I3FA 3DHFA 2QUVA 4HYVA 1TWIA 4XBJA 3BLKA 3WL0A 1OFRA 5CH9A 2C91A 4C65A 1ZALA 1X1OA 4GWEA 2V2HA 2G4JA 5U4NA 3KE0A 3O0FA 1G01A 3WX7A 1XW8A 3RFAA 3NO5A 3GDRA 3DU0A 3ABQA 3H4GA 3L2MA 4OZOA 4KEMA 3LENA 3QR1A 2AMXA 4C1NA 4FLOA 4ECLA 5CCZA 5MKGA 1U30A 2DSVA 1HO4A 4V28A 4CN4A 2E40A 1PKYA 1UKTA 4G56A 1ZB5A 3IJ6A 2XN2A 4JTSA 3L5MA 3LBOA 5A8GA 4LBUA 5C9WA 3HG5A 2YZRA 2C14A 3BGJA 3TYAA 3STCA 1CECA 5C71A 2OOFA 4G6CA 1MXDA 4ZB5A 4GUHA 3DESA 4PSPA 4HN4A 1LL4A 1Y8BA 3WLKX 2VXNA 3ITLA 4EPBC 2PDMA 1E15A 2Z2AA 3UG5A 1G7VA 3MUAA 3IANA 3GFZA 1FWEC 1GEHA 3BZGA 5FEXA 3CV1A 3UWWA 2WNNA 1RQBA 4J5NA 5E0FA 4L1XA 4O16A 1Z89A 2PWFA 1TPB1 3NPUA 2OMAA 4HCHA 3T4WA 3W23A 2OYMA 1DJGA 4IL2A 1UWQA 4ZGYA 2PUZA 5JUVA 2P1FA 2J4GA 3VIMA 1ME9A 1W5QA 1BAGA 2GQ3A 2GJLA 2Z28A 1FWBC 1CXKA 1E4LA 3PWGA 1MXGA 1PZ0A 5T9BG 3XINA 4KW2A 1JD9A 4XKYA 1D8WA 3WJSA 4DUVA 3AIWA 1LG2A 2A21A 1F05A 3I7QA 7REQB 1NOFA 3PBVA 1TQXA 3NA8A 2AAAA 4DO5A 5RUBA 1FWFC 1DIDA 4UFLA 2JF7A 1CGTA 3EA1A 9CGTA 2XVKA 4EXBA 2Z1VA 3URBA 3W6YA 3OJGA 3VGHA 4ZQOA 3GQYA 4R85A 1SYTA 4V27A 2ZVRA 3W72A 2A3AA 3TCSA 4JFWA 4M56A 2WHMA 4KFNA 4PYSA 1V02A 4MB3A 5CQ1A 1FDZA 2XTKA 3GUWA 3KCLA 4UMCA 2QVNA 3SDOA 2EG7A 3CH0A 1CB2A 3MZ2A 2J13A 3KBSA 3W76A 2V9DA 1AZ2A 3C3UA 1A4LA 6TAAA 1OF8A 3SQLA 2OZ8A 5C2XA 4TR9A 2G3NA 3TUUA 1XGDA 3H2MA 2X2YA 2P0OA 4QJ4B 5EBUA 4N4QA 3N2MA 3UJ2A 3UZYA 4OHQA 7TIMA 1EUNA 5I79A 2JALA 3EPMA 3BAWA 2Y8VA 4O1FA 4WDXA 2OKTA 1PHQA 1YIXA 3VNYA 4NJKA 1BYAA 4GH1A 1O5QA 4BA0A 2XVPA 1JEZA 4REQA 3GXPA 1EGMA 1XIFA 3CUZA 4LEQA 1HL9A 2Q6ZA 2RFGA 5CG7A 3RRAA 4AEFA 2PPGA 3WF2A 3QTGA 3EZ4A 4LAUA 1JJKA 2DDXA 1ZAIA 4Z1CA 3THUA 1ZZMA 2WNQA 1ALDA 5HATA 3QMRA 3ZR5A 4BZYA 5I3IA 4K36A 2PMQA 2B7OA 3CTTA 1W5PA 2PDJA 1EH9A 2G0WA 3HURA 2VWSA 3PNZA 3AISA 3WY1A 2POTA 4HCLA 1Y7VA 3E0LA 1JZ8A 1SW3A 3GZAA 2NUXA 4S1FA 1E6XM 4N9BA 4UMBA 1TV7A 4W89A 3U6WA 4KEZA 5CG0A 4Z2JA 4JTEA 1FUYA 4EWND 4OVXA 5G5IA 5I3HA 1VBRA 1E70M 1TIMA 2XIQA 4CQCA 5GPRA 3TEVA 2NZLA 3P61A 2E5DA 1K7XA 4JIEA 4R27A 1PX4A 2YW4A 2C1HA 3ONBA 2WJDA 4OIFA 1XSIA 5DXXA 2QCEA 1VFLA 1OFBA 3K4DA 3WBYA 4QQUA 4BF7A 5LIUX 4JTTA 1QK2A 2RDXA 1E43A 3K1DA 3W7QA 4K8EA 1CWYA 3P74A 1JZ2A 1RD6A 4TX6A 4WEVX 4MNJA 3CEPA 2A3CA 2XSBA 4ZO7A 2B4GA 4K8GA 1GVSA 1H7RA 1D3HA 1ITQA 3ARSA 1JFXA 2PDKA 4UTWA 1TVPA 3NQBA 2QJIA 4WSJA 2VENA 2NUWA 3W1XA 3GH5A 4H9UA 3LG3A 3NTYA 5D37A 1OVDA 3CHCA 2HRWA 4Q8OA 3TTEA 1IEVA 3N4EA 2QCNA 1U1UA 3AO0A 3B8VA 4IPLA 2I9UA 1GTHA 4Z42C 3KW3A 3WCZA 3KDOA 5ABEA 3SFWA 3WK1A 5M3WA 4M1RA 3WH5A 1BQCA 1UQZA 2VGIA 4N9CA 3FNDA 4XZBA 1XJBA 3N25A 4CNNA 1RK5A 3KZPA 4UOJA 3MS8A 3BV7A 3OP2A 4LUIA 3QGKC 3BGAA 2C18A 4ZQNA 4LX4A 4ZENA 2REQB 1ONEA 1DQXA 3IGUA 5B7ZA 3SJNA 3UD6A 1YADA 3BE7A 2E28A 1W5OA 2D2JA 5AVHA 4S3CA 5LYRA 3W7MA 2NUYA 1L6GA 3MKCA 2X16A 4JIPA 2YIHA 4TUFA 4L9XA 2W27A 1FWSA 5E70A 1QO2A 2QXWA 4LF2A 4WKAA 3DERA 4U31A 1R2RA 1VC4A 2XU2A 2WMJA 3C6CA 3H4WA 3MUY1 5HPCA 3MSGA 3W7IA 4B2DA 2E9MA 3QXBA 1I8JA 5BWAA 4MNMA 2OT0A 4MGGA 4UFKA 4B4HA 5TF0A 3RPMA 2TODA 3GXNA 1IEXA 2UV8G 3RU6A 5EU9A 2A3BA 2P76A 4H9MA 5DX7A 1SUXA 1XLFA 3UERA 3KOFA 2OKOA 3DFHA 5GNYA 3WG6A 4C1NB 3SRKA 4HJFA 3UZ5A 1JNDA 4FR6A 5MHBA 1UZ1A 2JIEA 3LN3A 2DT1A 4EKJA 3OW1A 1PUDA 2CERA 3ZIZA 3C0QA 2C13A 3FA4A 5CSRA 1JUEA 3LRLA 1WBJA 1L9WA 4GBUA 4J4KA 1G94A 4Z2HA 3LPPA 3CHFA 1KV5A 1RCQA 4J7RA 4GYKA 3DHDA 2CYGA 4IGNA 3SBFA 1R2TA 1EDGA 3UJFA 2OEJA 3MI3A 1EBGA 3F7JA 1XFCA 3QFEA 4H6KA 5I5RA 1LT8A 1B2YA 4O14A 2QW5A 4J3XA 4M0XA 2D2OA 3L4XA 2ZRUA 2PCEA 4F3HA 2GDQA 4P8VA 3GS6A 3K8MA 3RM8A 3NEHA 1PTDA 4JTFA 4AD4A 2PLMA 1BRLB 1OK4A 4MPKA 4PRTA 4XUYA 3MB9A 3GK0A 7A3HA 4BS0A 1IR2A 3P67A 1JPDX 3CT2A 2DZXA 2ANUA 4LAOA 2VL4A 3A13A 3BAXA 2AL2A 3UWUA 2BVDA 3UYCA 2ACRA 4MWAC 4NNAA 4ZCWA 3VOIA 3DOPA 3G1DA 1PXGA 1KM0A 3C2YA 3APTA 5A3HA 2QDDA 1GQLA 4ZB0A 4S3FA 2IXVA 5HWMA 3A3WA 1ISZA 2SFPA 3CZJA 4QG9A 1OFQA 1ZNNA 4KF1A 3BOFA 4AQLA 1POKA 1W1TA 1OBAA 1F9CA 2ZUSA 2R94A 2VNCA 3WD0A 2QIIA 1AJ2A 1XIMA 1TA3A 3LGGA 4E2BA 1EDQA 3RILA 3HQPA 3UY7A 4O1DA 3NQCA 3LK6A 3SRHA 4GJ1A 1TG7A 2O9RA 3S3GA 5BMWA 3KAOA 3DC0A 4ZOBA 4HTBA 3E2VA 5EFDA 3I3BA 2AL1A 3GDMA 4D6EA 3A21A 5FSDC 1JQVA 4PUUA 3BARA 3R11A 3WQ5A 4CNSA 3U0HA 2QMKA 5CZTA 1EZWA 1JIBA 3IS4A 3CT7A 2PA6A 4LUSA 4BQ3A 4C1LA 2Y5EA 1YHTA 3TONA 1NDVA 1GTEA 1S38A 2YJQA 4JYEA 2WVVA 2G41A 4C6QA 1UKSA 1FWGC 3EWXA 4FO4A 3UESA 3FJLA 4DJED 4LUTB 2VZVA 3NL3A 4GQGA 1H5YA 3RX3A 1ZUAX 4ML4A 3SY1A 3QOMA 1QI0A 2F2HA 5KZDA 3TJIA 3FOKA 4C7GA 1QRQA 2RKXA 4PC8A 1FHVA 4AD0A 4IUGA 3HOJA 1X7IA 2EEXA 3THCA 3SEPA 4K7YA 2P8BA 1MRQA 4C6EA 5I3GA 1WX0A 5ABHA 3SCTA 1NQ6A 1X39A 4PULA 3CZEA 3UCCA 4XD3A 1XLGA 4F9DA 5C2CA 2C1GA 1VLWA 4YJ5A 2I5IA 3CMJA 5T91A 3WBWA 4HOZA 1QXLA 3VKCA 4RKAA 3ENLA 1TMHA 1C8QA 1ZP4A 3ARVA 1GVOA 1B9ZA 3GDTA 1FP8A 4D6CA 5C9RA 1WAUA 3AWNA 2JEQA 1ZRQA 3BCDA 3SQSA 3XISA 1XLAA 1L0PA 2VX5A 3HIJA 3PZOA 1AQHA 4HPXA 2XM1A 3W6LA 4Y96A 2UBPC 3HG4A 2DQXA 2QJHA 4C6FA 4R88A 5CXPA 1K9DA 3WFZA 2YCJA 4QSHA 1IZCA 3I68A 3B03A 4ACYA 2DT3A 4L9ZA 1XRTA 1EQCA 2Q01A 4PUNA 2FHBA 2XSAA 3UW6A 4HBKA 3C2FA 2ZZ5A 3DYPA 3VUSA 1H0IA 1FH7A 3NQEA 3GVVA 4O52A 4W88A 2NV9A 4HU4A 4IX0A 4AHPA 2H8XA 3M47A 3S4TA 4UNIA 2X1TA 2OYLA 3LU2A 1JVNA 1LF1A 4NX5A 5KITA 2ACQA 3LGEA 4KERA 4PBGA 4IHCA 5I23A 4U28A 1EX5A 1JCYA 2P53A 2IMRA 1A0CA 5T9CE 3EWYA 1NFGA 4YLWA 4JQ4A 4U2YA 5D30A 4PTWA 2F61A 4FP1A 3AS1A 4PUEA 3OZYA 1W5MA 3B8TA 5A94A 4DPPA 3K46A 4M6QA 3KL0A 2XVGA 3PZUA 2WV8A 4NKCA 4PTVA 3GG1A 2HEJA 5FJTA 1NJJA 4B92A 4BF5A 1K9FA 3BWWA 1TPWA 1QOPA 2ABAA 1MO0A 1XXXA 3RCYA 3GXMA 4DZ5A 1EKOA 5U7SA 2OQLA 3U57A 4M1BA 4UNLA 4UUIA 4P61A 3IK4A 3TWAA 4ORIA 1JQXA 1UC5A 3T07A 3O2LA 3EX3A 3TU9A 4AUBA 2XSXA 4Y9MA 1E56A 5HPOA 2G95A 1HW6A 1UWSA 4HOXA 2PDHA 1T7LA 2WC3A 3N2OA 5D2VA 3CUXA 3K1GA 3WQ4A 3SJ3A 3U9IA 2R24A 5EL1A 5AECA 1HFBA 3CQKA 2INFA 3EPNA 4DBUA 4E2DA 4MWAE 1KTNA 2G37A 1IXPA 2FYMA 5EFFA 3W84A 3SECA 1BLIA 2DFAA 3WNPA 1K02A 5LIKX 2P8CA 3IEBA 3I6TA 3V1PA 3KS5A 2PDIA 3PG8A 1CLVA 1EYEA 4GC4A 5F4WA 2G3FA 3H2AA 2EJ1A 1RPKA 2Q8ZA 4A35A 4LB3A 5D32A 1KKOA 1LP6A 1PWLA 2NX9A 3NOEA 2H9AB 4GRSA 1VFFA 4I7WA 4LAZA 4DNMA 3QSTA 2OG9A 3LY0A 1E6NA 1RXOB 3PSWA 4W87A 1FCQA 4M3PA 3T9PA 2BY1A 3DFPA 1H7OA 3ARXA 2PTXA 4HZMA 3W7OA 1EWDA 4X0VA 4Q4RA 3WK2A 4JX5A 3UQNA 4IGMA 1TR1A 1ZBWA 4FX6M 4XZLX 4AVNA 2X2GA 3LMZA 3UU0A 1N82A 3CM4A 4GJIA 3DEQA 4D72A 4RX0A 3N2BA 1EOMA 2CZDA 3P93A 3L4WA 4PMYA 2OGJA 1QHZA 3NQFA 3KL5A 5FAGA 1XKYA 4C5ZA 1TCMA 2PLCA 3AHYA 3ME3A 2PDXA 4PRWA 2AL2B 3R1ZA 3T42A 3WLQA 4LU0A 4IPJA 2CLIA 1REQB 4RDVA 3V35A 3QY8A 3GC4A 1GONA 4L1GA 1VBGA 1MFVA 3OZMA 1B1YA 3CPUA 2R1NA 1IV8A 4YTRA 1BF6A 3VCNA 4O11A 5LSMA 2I1OA 2QJMA 3UR8A 4RXGA 1I6NA 1MVYA 2ZBTA 3LLFA 3PZVA 4CKQA 4DQWA 1UH3A 2I56A 3VIGA 2EG8A 3EWZA 2HS6A 1TA3B 4O53A 3AYVA 5CZKA 4WSHA 4J3ZA 3WNKA 1MQRA 1JDFA 1UYQA 2WPBA 3WF4A 2J7FA 4L6HA 3DECA 1ICPA 2VEIA 4JY9A 2V8ZA 4IISA 3VUPA 1A47A 4DX3A 1MFUA 2WC7A 3VC5A 4HHLA 3RX4A 1C9WA 1CGYA 1NTHA 4CNTA 5AFDA 4W9TA 1HP4A 4LC8A 3VD4A 3W1MA 2CXEA 3KTSA 3KCOA 4YTQA 4XD4A 1UZHA 3VNDA 1IZKA 3Q45A 1JF6A 4DY1A 2RJGA 2R82A 2VYOA 5LIWX 1GOOA 3N18A 3S2NA 1LRTA 4JL1A 3ARUA 3GNNA 4TX9A 3DIPA 1BGGA 3C2OA 3UJEA 5IBXA 4F0KA 2RHGA 2YA2A 3GG0A 3ECQA 4YNGA 5ABTA 4HP5A 4NAFA 5D8ZA 4YCOA 1EO5A 4PMZA 4EXQA 3QZEA 1US3A 1UPPA 3QFWA 2C16A 1MWOA 1TELA 3E5BA 3OA3A 2DJLA 4DJEA 1P0NA 1IXNA 3AS2A 1XLLA 3ZM8A 3IRDA 4GZEA 1JDAA 4CNPA 3HMJG 2VC9A 3WD1A 5FA5A 2FZNA 2Y5SA 3ZO9A 2A3LA 5G1TA 3UFYA 3TQKA 3AOFA 3B05A 2BVWA 5A5WA 2OO6A 3PBYA 3BZJA 3UZWA 5CJNA 2CFFA 3NZ1A 4IH3A 1A3XA 4AD2A 4UTTA 5ABFB 3VNKA 3SY5A 4L9YA 1KXQA 5JBDA 4RLIA 3AFBA 3ARQA 3UGRA 3LOTA 3UJRA 1OFAA 3HM7A 3PAOA 3CV2A 4DWSD 2V3DA 1UKPA 4ZTXA 4K38A 3KS6A 4LVAA 2OELA 3L4VA 3NOYA 3KLKA 2ISWA 3WDHA 4IIBA 3TN4A 1HJVA 4JFUA 1SMAA 2PDCA 2QDEA 1YEYA 2D24A 1FFRA 3QV9A 5AC4A 3W71A 3PNUA 5F2MA 3DFYA 1BXBA 1AJZA 1UIOA 1M04A 3SI9A 3LBMA 2VRQA 3BJFA 1HJUA 3PTQA 4IXXA 3MPGA 1EXPA 3IV3A 4AH7A 1FCVA 1ESWA 1XIIA 3B4YA 2F38A 3NZQA 4QR6A 3VC6A 2GVLA 1IE7C 4HYRA 1RVGA 3MVIA 5AOUA 1CI1A 4QJ1A 5FI8A 4PFHA 2FB3A 4ZBCA 3PTMA 2CXGA 4DM1A 3TC7A 4GVFA 1KNWA 1QNRA 2XGIA 4FMVA 2CZ5A 4UTUA 4Q8NA 5JMUA 2W67A 2VX7A 4C6CA 2WVSA 3B8IA 1Q2SA 4AIEA 6XIAA 4F79A 4O15A 2FHCA 4EWJA 3SSJA 2VCBA 3I4EA 2IXUA 1POJA 2YR1A 2FVLA 1RBAA 4UTWC 4Y6GA 1M6JA 2YDSA 4IGSA 3QPZA 4PMXA 3QC0A 3DYOA 5IDIA 3S5OA 5EMMA 1O66A 3QHOA 4FHAA 3MMDA 1U5JA 4N6FA 4O28A 3N19B 1GUVA 1BHGA 2FPTA 1M65A 3W7HA 3IK2A 4Z08A 3W3OA 1Q5MA 5K4ZA 2VQUA 4W8BA 3CQHA 3GE7A 4EVZA 3BAIA 2BVYA 3KM8A 3IJ7A 3M0JA 2X8RA 3M1ZA 4WUIA 1FHUA 4LXFA 2YCKX 1R8LA 2HVMA 3FGCA 3FJ4A 4X9SA 3BLIA 2CWNA 4PMOA 4WCJA 1HF6A 5LA1A 3GZ3A 1EHAA 5FCZA 3CB8A 2WZMA 3RYSA 1B3YA 4C6MA 2PGFA 2Z1WA 1GPFA 3WJXA 1E72M 1UUOA 3GTHA 1O5RA 1SSDA 4MKVA 4N7QA 3BSGA 2AGTA 4ZO9A 2LLEA 7CGTA 1FWAC 5HQLA 1NF0A 5HK4A 3LV5A 1TX2A 1HQTA 8TIMA 4F40A 2Z25A 3CPGA 4Y9NA 1EBHA 1GCYA 1B9BA 5EMYA 3RX2A 4H8NA 4US5D 1F8MA 2D2HA 1DJHA 1XM3A 1DQWA 2RGLA 3MUZ1 1BKSA 3H4XA 3OYZA 4XIAA 1VRDA 1VRXA 1AMYA 1A49A 4IGHA 1XR2A 4A3HA 1FKWA 3WQ6A 1MNZA 1I2NA 3UR2A 4CCCA 2CZVA 3W1LA 3ARTA 2D1ZA 1HKVA 3U4AA 1VFOA 1W9UA 1SO5A 1ZJHA 3ALFA 4JTUA 3W1TA 1TRDA 3K4AA 1KXVA 5LIYX 1TPVA 3FXYA 2RDTA 4RE0A 3M4HA 1C7SA 3UA4A 4EIVA 3MP3A 3VNZA 3GC2A 3GWQA 3VGFA 5BOFA 1KWGA 3DBPA 1BVWA 2PTYA 3FIGA 3WQGA 4B3ZA 3TAKA 3WD4A 4WX2A 1B3WA 4NZ3A 4KWVA 2GZXA 5HNUA 4AISA 3QQ0A 1CB7B 3EB2A 3HG2A 1V02E 1VBJA 3NWRA 2ZQ0A 2ZXBA 1DQUA 1VCFA 5GJNA 2HXTA 4FK9A 2Z1XA 4HQVA 2PWUA 3S9ZA 1XKJA 3SCOA 1Y65A 1UD4A 4S3DA 2C0HA 1MDLA 1MUWA 3T78A 3N73A 1ZTVA 2YL6A 3NNTA 4Q4QA 1B31A 4AD1A 2FKPA 1Z3NA 3LERA 3MSYA 5C5YA 1YPXA 4PFMA 1FDJA 3W88A 2QPUA 1J2WA 3GXDA 3R43A 3UYIA 1NDYA 2GSEA 1WDSA 4XX6A 3AXIA 1SMDA 2Z2UA 4CLMA 4PEKA 4EK7A 5D2YA 3T09A 3VAVA 3CYVA 4Z0JA 2Z4GA 1JGMA 4M7TA 1PYMA 2UZ9A 3FY1A 5DCBA 1YBQB 3B40A 1LM1A 3MMWA 1K6AA 3BQ5A 4BF9A 1MW2A 4D6HA 1GKRA 1O95A 3N34A 4JFVA 5DLCA 1DOSA 4MJ4A 2FJUB 3O0KA 3LNMA 3PC0A 1NEYA 4JTDA 3UCDA 4PMRA 1DTUA 1EDTA 3VDGA 1UMYA 3B04A 4B90A 4NAEA 2XIIA 3NQ2A 1HKKA 1RY0A 3V7PA 2NXGA 1QTWA 2DZSA 3O7UA 2V68A 1BVNP 4B5NA 3KVJA 4GKLA 2OFJA 1R38A 3QKZA 4HYWA 3SUVA 1GOIA 1Q4WA 2DORA 1WKYA 4FNTA 2WYSA 4ATWA 2ZDSA 2MUCA 1AH4A 4AXNA 3AIEA 3ZJ7A 5BW6A 1CXEA 3MU7A 3KP1A 4GX8A 1V6VA 2X0HA 4F0RA 3WEOA 3A4JA 3MSRA 4ZFMA 2AKMA 4H7CA 3ZLHA 2DZTA 4UTJA 3M0LA 4G1KA 3BCJA 4JL2A 4DUOA 3ZLFA 1THFD 1O1HA 2ZX7A 1IEQA 4JR5A 3ZVHB 4RE2A 3U2OA 2FGBA 2QV5A 3R25A 3RK8A 1MEWA 4L56A 1LG1A 2BSLA 1K77A 2QHAA 3AROA 4O18A 2E9BA 1JCJA 1UPMB 1Q6EA 3UT0A 5D09A 4ZQMA 3TVAA 4GHRA 2XHYA 1IZJA 3QJAA 3WH9A 2QCLA 3TTQA 3AICA 1KRAC 1T8QA 1R3QA 1BYCA 1UR3M 3MANA 3WLRA 4E4FA 1X1NA 1FWWA 3BCFA 4IOTA 1ITCA 4NQ1A 4AY1A 2J6XA 5KEZA 3WJYA 3NDZA 1A5SA 4GUJA 2YPIA 2J7HA 3E0IA 3FKKA 1R87A 3L5LA 5D33A 1OX6A 3FYOA 1SJCA 2A0NA 4G7EA 2EO7A 3JUGA 4WF7A 3VGEA 5CGQA 1HJSA 4S3KA 2QS8A 5A8QA 3BQ6A 3WQPA 1G5AA 3ZJ6A 1WCGA 2O9OA 4NASA 5A6MA 4B5XA 1EB3A 4X2RA 1TUXA 4F9JA 3ZR6A 1ONXA 3GNDA 1E5JA 3B0XA 3M16A 3MP4A 2V5JA 3RM4A 3DFOA 3AMDA 6REQA 1LOSA 4KWSA 8A3HA 1ISXA 3CO8A