4YTTA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 6-deoxy l-psicose
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
total genus 117
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4yttA00
3VNMA 5EMJA 2GVEA 4HGXA 3P14A 4GJIA 5B7YA 4J4KA 8XIMA 1XISA 1XLJA 5TNVA 2I56A 4QE5A 5B80A 1I60A 3QZAA 2XIMA 2NQJA 3KBWA 3BANA 2NQ9A 1XLGA 3BWWA 3TVAA 4DUOA 3P6LA 3XINA 2GUBA 3DBNA 4X60A 3CQHA 4YTUA 3UVAA 5EMMA 2X7WA 1QUMA 2G0WA 5XINA 1XLKA 3C0SA 4A8NA 3OBEA 1S5NA 2J6VA 1XLMA 1XLLA 5EMKA 3KCOA 1DIDA 1XLHA 2XISA 4LNCA 2QW5A 4EACA 3IUHA 5XIMA 3QC0A 9XIMA 3IUIA 2QULA 5H1WA 5C9ZA 5FA5A 6XIMA 4A8LA 1XYMA 3KWSA 3KBJA 3TC3A 2ZDSA 4ZB5A 3M0MA 1XLDA 4OVXA 3AALA 3C0LA 1TZ9A 3VNKA 4X63A 3VNIA 1DXIA 2Q02A 1D8WA 3NGFA 4Q7IA 3BZJA 4QDWA 4DVOA 4YTTA 1BXCA 3UXIA 4PGLA 1YX1A 3IUDA 4XKMA 3JU2A 1QTWA 1XIDA 4GQBA 2NQHA 3L23A 4EAYA 1XIJA 5B7ZA 1XYBA 3UU0A 1I6NA 3KBNA 5H6HA 3CWHA 4HHMA 3DX5A 3AYVA 4ZB2A 3BDKA 4HNOA 3XISA 4PFHA 3KBSA 1XYAA 4QE1A 4A8RA 4G56A 3BZGA 4QE4A 2QUNA 2XINA 1XIGA 2GLKA 3U3HA 4A8IA 3KBMA 1OADA 3ITVA 4GJJA 9XIAA 4QEEA 1A0DA 4K3ZA 1DE5A 4X61A 1XLBA 1A0CA 6XIAA 1MUWA 2I57A 4YTQA 3QYSA 1K77A 1XLCA 3WQOA 3M0LA 3XIMA 3C0QA 3U0HA 2X7VA 3CNYA 3M0HA 4XSMA 2G4JA 2ZVRA 3N4AA 4YTRA 2HK0A 2GYIA 1XP3A 1S5MA 4GLEA 3UA4A 3ITOA 3QXBA 3ITLA 4KW2A 5AVNA 3AYTA 5AVHA 4ZB0A 5EMLA 4K1GA 1DE6A 4HHLA 3VNJA 2HCVA 1XYCA 1XICA 3AAMA 3FVMA 3VNLA 3CQKA 1XIEA 3CQIA 3KTCA 3VYLA 4E3VA 4US6A 3LMZA 4QEHA 3UA3A 4YTSA 3ITYA 1XLAA 4XIAA 1XIIA 3CQJA 8XIAA 3ITXA 1O1HA 5XIAA 1XLEA 4XISA 7XIMA 4XSLA 3ITTA 3M0YA 1XYLA 1CLKA 4QDPA 1XIHA 5J8LA 3M0VA 5I7GA 1QT1A 1DIEA 2OU4A 4ZBCA 1XINA 1XLFA 2HK1A 3M0XA 2QUMA 4XIMA 1MNZA 1XIFA 1BXBA 1A0EA 1XIMA 3GNXA 1XIBA 3KCJA 1GW9A 1XLIA 4W4QA 3KCLA 3KBVA
chains in the Genus database with same CATH superfamily
3W75A 4UFKA 4B91A 3W1XA 4LEFA 1EPVA 2C8NA 3EWWA 3GDMA 2OG9A 3TCEA 1JI2A 4MPKA 2F2KA 4LBRA 2D0FA 4H9YA 4DPPA 1LG2A 1QASA 1NEYA 1AQHA 3G0SA 4LX4A 4XX6A 3ZWTA 3HN3A 4PSPA 4QR6A 2J78A 1BGAA 2P0OA 1KXQA 3E0WA 3QQWA 1UPMB 4GINA 2ZUMA 1MQQA 4GGHA 3IIOA 1K9EA 4AMAA 2WW5A 2OGYA 3SBFA 2ICSA 2RHGA 4DZAA 4IJRA 4UFMA 4C60A 3RLHA 4FIRA 1CDGA 3PTDA 3CL8A 3QVQA 4HPHA 1JDEA 3UPBA 1E4NA 3TN6A 3VIKA 3APGA 3IAQA 4NQ1A 4FLRA 2IKJA 4D6DA 1ITXA 3KDOA 1B3YA 4ZOEA 4NZ3A 4RLIA 2VXNA 1AZ1A 2VUNA 2YCLB 1HJVA 4DN1A 3FFSA 2XN1A 2H90A 4LXFA 2OOFA 3U9IA 2BGNE 1GOMA 1EF3A 1VD6A 3Q58A 3F1QA 1J96A 2VT0A 4PUKA 5HA7A 2ZBTA 3IJIA 3A3WA 5FL1A 1UR4A 3S2LA 1OABA 1YHTA 3BGJA 1OBAA 1XLIA 3B40A 4HJFA 2ZRXA 3T78A 3W25A 3NEHA 4PRTA 3EOUA 1FA2A 3GG0A 4K68A 2ISSA 1Q2RA 4MADA 3LTYA 2G3MA 1R3YA 1VFLA 3SQMA 1OT2A 3EA1A 2B31A 3VGBA 1LBMA 2Q6ZA 3G1SA 4RDYA 4I9AA 4DJEA 3UJ2A 1VJIA 3WENA 1D7KA 2ZX6A 1TIMA 5IOBA 2V3EA 4DEFA 1AL7A 3LHYA 1JYNA 4C6KA 3W22A 5I09A 1N55A 3AXMA 2BGSA 4P7QA 1KLZA 3TU9A 3USZA 1EX1A 2Z6IA 1M7JA 3TXVA 2G5WA 5LIXX 5LSMA 3PFMA 4DQWA 3BXWA 4NZFA 4UQAA 3WQDA 1X96A 4HNOA 4QS6A 4HNNA 4C6MA 1XYAA 3Q65A 3BW3A 4G56A 3TAOA 4K38A 5DXXA 1U1JA 4K3ZA 3EOEA 1ISWA 3TWBA 3ABQA 3E2QA 1IT8A 3V4BA 1VJZA 1ZGDA 4MPQA 4MZ1A 3TMLA 3T0DA 3VGFA 3G24A 1H63A 1GKRA 4LH8A 4FNUA 4KQNA 1NDWA 3A64A 3WQEA 2ZX8A 1TZZA 1UMYA 3KTCA 3NDYA 3W7JA 1QNRA 1UWUA 1XCWA 3LRMA 4GI9A 2C79A 6REQB 3W53A 4H4IA 1VC4A 1TVPA 3NVDA 2CU0A 3G5EA 4MNJA 4DO7A 4JTAA 1TRIA 1GW9A 1BFNA 3MJMA 2XM2A 3L0NA 1T99A 2BHYA 4EE9A 4GYPA 1UIOA 2ZRVA 1H5VA 4U4MA 3U57A 2PC4A 1E4LA 1SM9A 5A1AA 3KS6A 4YN5A 2QCEA 4LW7A 3CQHA 1QDSA 2YCEA 4RZ6A 2G96A 4MUZA 4JX4A 1P0DA 2WZHA 4IIHA 2GSJA 4Y9NA 3A4AA 5DF0A 2ON3A 2ISDA 2RJHA 1K8CA 4DJEC 2YFOA 1D3CA 2YCJA 1UC5A 1TB3A 1ZJIA 2EPKX 1QPOA 2JQXA 1FKXA 3THQA 3WH7A 4ZOAA 4EAYA 3ALFA 2NQHA 4XBKA 2XN2A 3QFWA 4HN4A 2WMFA 5CSRA 2BODX 4C1KA 1HNYA 3NG3A 4AZGA 2ZZ4A 1EC8A 2PDBA 4MVAA 3WF1A 4UOJA 5I02A 2OO6A 3NQGA 1UHVA 3MUXA 4RUBA 1LRNA 1W54A 4EPBC 4XO7A 3OPSA 4NNBA 3SIZA 3SSZA 2EG7A 3VDBA 2GDVA 2ZZ2A 1AQMA 3WLQA 2OEJA 1FCBA 1YQ2A 2VWSA 1VFOA 1EJWC 1UOZA 5KZDA 3FV9A 3TP4A 4GVIA 1TV2A 2D2JA 3T6CA 4GHRA 3SW6A 3A3HA 4DI8A 5A3HA 3O0FA 1G69A 3K4DA 4JQ1A 4DXVA 3FA4A 4M19A 1EP1A 4JR5A 4GYPC 5CPLA 2RDUA 4DNMA 5IM51 4AG0A 4S3JA 3L4ZA 2IKHA 3W37A 1JPKA 1CCWB 4FZIA 3PBWA 3ZJKA 3BURA 1UH4A 3LPFA 3SCSA 3THDA 4FIQA 4L4PA 4WKFA 4H9VA 3N15A 1G67A 3JR2A 5FJOA 5FF0A 1UR9A 1ZENA 1EJXC 4ZO6A 3GUWA 4GVGA 1KFJA 1UYQA 3CQ0A 2OO0A 1UZHA 3ARRA 3HGSA 1Z41A 5BCAA 3WDHA 1PB0A 2J7BA 3CV7A 1JUEA 1A5MC 5E1QA 3WO8A 2J47A 3MUY1 4LS0A 4LUTB 4B3KA 2FFIA 4NAEA 1U30A 5KINA 2TODA 3ITXA 3HB9A 4GZJA 3TYZA 1XIHA 1BEUA 3AIEA 5A8OA 4LANA 3N2MA 3PFRA 1H51A 5KTLA 3LGGA 2C91A 4XTDA 5LGXA 3C52A 1TR1A 3R13A 3VFLA 1R8LA 3EOSA 3QZAA 5DQPA 1R2RA 1TV8A 4JIHA 2QKFA 1PV8A 4D6GA 3F5LA 2DFAA 3B05A 3MMUA 5CJMA 3GXPA 1KCXA 4ZE4A 1XLMA 4HU3A 4L56A 4CQ9A 4DWSD 5D9NA 1XQLA 3S5SA 3ERPA 3IACA 4AZCB 4NAFB 3TDFA 2X09A 2BX7A 3QPEA 1SGJA 4DJFA 3DI1A 3BAIA 1MXSA 2WPGA 3S5ZA 3WQFA 3CWHA 3E12A 2Z2BA 4X9YA 3TA9A 1KFEA 1QWKA 3VOFA 5BYWA 1WAUA 3IVUA 4LCQA 1MO0A 1EWDA 2JKEA 3EOOA 4DIAA 4GCXA 3T0AA 3UG3A 1JPHA 4ICCX 1WPCA 1UKOA 3N1AA 5BXRA 1K9TA 1O68A 4AH7A 1K3UA 4L6OA 2KX9A 4CNNA 1IYXA 1WAWA 1OZMA 3GHUA 3E49A 3ARZA 3P84A 4H8NA 3SN4A 2ZCGA 1GVIA 1UWAA 2C15A 1XXXA 3AIWA 2Z1WA 4HSNA 1WO2A 3F2BA 4KCVA 3TK7A 2YB1A 2A0NA 1U83A 3LSBA 3T1GA 7TIMA 2ZOXA 4UC5A 1PJ9A 1UD2A 4IWWA 1KNWA 1KFBA 4GZIA 4HNLA 3IV8A 1I2QA 5AHFA 1TPH1 5JIWA 5BMWA 1XJBA 4BEQA 3GVVA 2VGFA 4NYUA 2P0IA 3IIVA 5CSYA 2YXOA 1PAMA 3N3MA 1BKSA 5JH1A 2WVUA 3KZSA 3VKDA 4FNSA 1OIMA 4HYWA 3NXFA 3MVIA 3OZYA 4NNAA 3SIMA 3VIHA 4QQUA 2J13A 1PHWA 1QHPA 4FNPA 3KW3A 3QMRA 4W86A 2CEQA 2WMHA 3QC3A 1LP6A 4DJFC 2E8YA 1TREA 4R9OA 3FDKA 1V77A 1KRBC 1ME7A 1VCFA 2BVWA 3VMOA 3WLTA 5I0DA 3B3DA 2D1ZA 1Q8JA 3UR8A 1HXJA 2A7RA 1GQNA 4GZEA 1EGMA 1SZNA 3WH5A 1TMQA 1R38A 2WQDA 4P8VA 3TAKA 4I7WA 1NARA 5A6BA 4QP0A 4CVWA 4D1IA 3TQKA 3WJWA 1ZL1A 2B81A 3OLDA 3MKKA 3VYLA 1HO1A 2QZRA 5FJIA 3GTFA 3OVQA 4F2TA 5FESA 3MSRA 1EA0A 3KWXA 1VHNA 1F05A 3TIMA 2E0PA 1BKHA 4I90A 1QJWA 1SQ7A 2Y1HA 2XVNA 3KCJA 3NSNA 4W4QA 3A12A 1LQ0A 3TX9A 1TPC1 2C0AA 2Y24A 1LQ2A 2WK2A 3HGRA 3IJQA 1M3UA 3DBNA 3QV6A 2E25A 4AD5A 1W1PA 3VUSA 5M17A 5A8PA 4TVCA 2GJXA 5HQEA 5REQB 1F3EA 3MKCA 3VX0A 2ACUA 4O14A 4NIRA 5LA1A 1W3IA 4TX8A 1JZ8A 1TKKA 4I6KA 4LRTA 1AMKA 2QVNA 3QH2A 3HIJA 1OY0A 3GWQA 4HMDA 2HJPA 3W72A 2YOCA 3TSBA 5CBBA 3GKAA 2XINA 5EU9A 3K2GA 4H41A 3CH9A 3KTSA 4I9MA 5C5YA 3CU2A 1AK5A 1CW2A 2D24A 1HKIA 2FTYA 2FHFA 1GVEA 1LT8A 3S4TA 3ID7A 2O7SA 1I45A 3QSRA 5AVNA 4C6EA 3DFTA 2CLEA 4ZB0A 3CIVA 4IMEA 3N2BA 4AIEA 1W8GA 2WSYA 1OCBA 3G6MA 3P81A 4KCUA 3NAVA 1CLKA 4HP5A 3BO9A 5D8ZA 3ARQA 4ACZA 5T9BG 2GJNA 4PZVA 5AKQA 2ZUVA 2C6QA 3VK5A 3AHXA 3APTA 4KEMA 1LLOA 2HS8A 3AFBA 4S3AA 4LAKA 3XINA 2DVTA 5CZKA 3RCMA 3ICJA 3CTLA 4F2BA 4WLCA 4S3CA 3O9NA 2C16A 3PJWA 3DKLA 2VZOA 2OMAA 2Y61A 3ZT5A 4NRSA 1IGSA 3SUTA 1GQIA 4GI4A 2BMBA 3VCRA 1R3QA 4PCPA 1C9DA 4MY8A 4NP7A 4EWND 1F4HA 5IXEA 2J62A 3VD4A 2QLYA 4JTCA 3CYJA 5FACA 5G4EA 1YTEA 4JQAA 4HHMA 1GZ1A 1PKMA 1KXTA 2CZ5A 1PTDA 3KFTA 1HP5A 4V27A 4MF4A 1DE5A 1XD1A 1UPPA 2CWNA 4DJDA 4P61A 1I2NA 2CBUA 4K36A 2WNNA 1XLCA 2I7GA 1LL4A 4ZGYA 3PBMA 3PZMA 4TR9A 5DXYA 4L4MA 2GOUA 5HUOA 1GUVA 3S5YA 4L64A 1FP9A 4QEHA 3UA3A 3PZUA 4JY9A 4PMOA 1QHOA 2VFEA 3W86A 4NF7A 3UERA 2DUZA 5EFFA 3FKRA 4DWSA 2X1SA 5BW6A 2A21A 1KCZA 3R25A 3GH5A 4L4LA 4FO4A 3UQNA 1W9DM 2O0TA 3PC0A 3N6HA 3N18A 3TSMA 4TVDA 4DYJA 2PP1A 1WUEA 5E0CA 4NASA 1JCXA 4CQCA 1GVOA 3G1VA 4Z2KA 4KCWA 3I6RA 1NTHA 2W62A 2XISA 3PF3A 4FX7A 3WDRA 3KOYA 3M0ZA 3K1GA 3RNDA 2FFCA 1LDCA 1Z42A 3TYUA 3V0SA 2FTWA 4FXSA 2FLIA 2FIQA 1OFDA 1OX5A 1CXEA 4BQ2A 3IAPA 3NXLA 4KFOA 3T8LA 2VEKA 2VENA 3KBNA 3E9AA 2X05A 4AIOA 2Y89A 1SZRA 4GXPA 2A5HA 3OLGA 4W8AA 3CIXA 1ALDA 1WBJA 4IPIA 2I57A 3SDOA 2PP0A 3S9ZA 3U0HA 4DJDC 3EMZA 2AMGA 3LHVA 3WMLA 3LA4A 4F40A 4HSHA 3OG2A 5MKGA 1UD4A 4HCHA 3RU8X 1Q8AA 3CQJA 4K6AA 4NILA 4IM4A 2E9LA 4HNCA 5JVLA 2FHBA 1SSDA 4D8LA 3TN4A 2IPWA 1KGUA 2GQ8A 4DWSC 1L8NA 1IXNA 4D6JA 1GPFA 1R46A 3W1PA 4DNHA 5EB8A 4V1YA 4EP8C 2I56A 3B8SA 3VGEA 1WDPA 2PDYA 3ZVIA 2XGIA 3GS6A 3WNKA 2ACQA 2F6KA 1MFVA 3FJ4A 5DT7A 5FKYA 1GPWA 3PZQA 3TYDA 2V38A 5XIMA 1GVSA 4U2YA 4G2DA 2NW0A 4PSRA 2PWGA 1C7TA 1R47A 1QPQA 3J7HA 4GPNA 2FJKA 1VBUA 2GGHA 1Q13A 3EXRA 1Q6CA 3FLUA 4GIRA 5F4WA 1TJRA 3WEMA 2GGIA 3NYDA 3VE7A 4R85A 3CK5A 2WANA 1DL3A 1EJRC 4AX6A 2EKCA 3WL0A 2IKGA 4UFHA 4ZCWA 4ORMA 1L6YA 1JF6A 2AGKA 2QDDA 2JKPA 2HEJA 5I3HA 1OQFA 3JRKA 1TE6A 4BCEA 4EPKA 1OFAA 5DMNA 1MUCA 3M5YA 1QNSA 2EPNA 1LZOA 3CYVA 1LBLA 3U5UA 1RJRA 1ZP4A 5D2WA 3KLKA 5LA0A 1P0KA 3AYSA 1EL3A 3UR2A 2GGJA 3GR4A 1RCXB 1VIWA 4IQLA 1ADSA 5FF7A 5I3IA 3QGVA 5AY7A 4XG1A 1R9ZA 2JKAA 3AROA 1A49A 2BOGX 3RX2A 4BR1A 3UWEA 4H9UA 5FA5A 5FD0A 1ENUA 2YR1A 4OBSA 5E93A 1TQXA 3P93A 3BANA 3MCMA 3U2OA 2QCCA 2H8XA 2B4GA 4F0HA 2PRMA 2P5NA 1PO9A 4L6HA 1PDYA 3VNYA 3IEBA 3V16A 1J79A 3EB2A 4QG6A 3BUVA 3BG5A 2VVSA 4JNZA 2PZ0A 4D8AA 3EDKA 1NELA 2WZMA 4US5D 2VZVA 1IV8A 5CGMA 3LGDA 4HOXA 1TV3A 4MDPA 5F2LA 3OG3A 4JKLA 1OSEA 3A3XA 2DY3A 4POCA 4HNTA 4B4FA 1DJWA 3G1XA 2G4FA 3SCOA 1K4HA 4PR4A 1N8WA 4W7WA 5AZ1A 3THAA 2C7FA 1XIEA 1Y65A 1YPFA 3BAXA 4XIAA 4HYRA 3CZGA 1CGWA 4TIMA 4ROPA 1KQZA 4PMXA 4QJ5B 4QAWA 3ARXA 2FMOA 3GAYA 3AHYA 4JAWA 3SUVA 4UQCA 1M7PA 4E8GA 3W1UA 1Y7VA 1OIFA 2VCBA 3W4RA 1YMYA 2PDGA 1ZAIA 2WYSA 3CHVA 1H1NA 1OYBA 3UBPC 4Q7NA 4K8HA 1OG6A 2Y7DA 1OD0A 2XIBA 3HU7A 5DX7A 3C6CA 3VCCA 4FLSA 4DPQA 1O5KA 3TYEA 1VPYA 1FXPA 1JNDA 4EKJA 5AHEA 3RPMA 3K1DA 3LRKA 4X22A 1L6FA 1X6NA 4RPQA 3B0XA 2XUCA 3GYEA 4E2BA 3BC9A 1G1YA 1G6CA 1LF1A 2BY0A 2ZA1A 1JZ4A 5D9OA 2WVTA 1TTQA 3UZ5A 4WJXA 3OQ8A 2HPIA 3COTA 1QVBA 3QV9A 4CQBA 3QYSA 1WXYA 3DDMA 3C4UA 1GOXA 4C7GA 4L4OA 3WLKX 3UGVA 3W2UA 1Q6QA 3O06A 3H2MA 2P1FA 3NOYA 3SCWA 3UY7A 3HGJA 1CLXA 3LMYA 3I68A 5K2ZA 4K39A 3MI2A 4JTGA 1T0OA 1UWTA 3G6LA 2GVJA 2C18A 1J01A 2VD9A 4EF8A 4Z17A 4ADSA 4A3UA 5A6AA 4NAEB 1EPXA 3GFXA 4JFTA 3LHZA 3VDCA 4LBUA 4ERIA 3MKVA 4LV4A 1CLVA 1YBQA 2D3NA 2R94A 2ZE0A 3CT2A 1PDZA 4PBFA 8XIMA 1GVQA 3W26A 1VLWA 4FEZA 3WD1A 2FB3A 4H2HA 1I1WA 1UWIA 4W84A 5A8QA 3B9AA 2RGMA 4LNCA 3C2EA 4BQ4A 1O5RA 2VJXA 3Q2DA 4C6JA 2FDSA 1QPNA 4B2DA 3UXKA 1R3SA 3TJ4A 1V3LA 5AYZA 3CAKA 3T42A 2DH3A 1X97A 4F4RA 1RLDA 3TTQA 4M1BA 1H5YA 3CB8A 1CWYA 4PMUA 1AW2A 4GG9A 3I3DA 3LM3A 1S46A 4BJHA 4Y8FA 4QEEA 4N6FA 3SB0A 2QIWA 3G1RA 3AMKA 1UA7A 5CEWA 3I7QA 1LTDA 2IPFA 3P0XA 4S23A 4KS0A 5HDRA 1FCVA 4MAZA 1TPFA 2RAGA 4K7VA 4DUVA 5CPNA 4HK5A 4PTWA 1MEIA 3M1ZA 3UWWA 1GQJA 4OBRA 1UCWA 3A13A 4S38A 3G18A 3HMJG 5D2YA 1OK6A 3AWNA 1DIEA 1VB9A 1VZWA 4AIUA 3V75A 2JBMA 4OOZA 4HZ7A 4R33A 1UD8A 3H4XA 3IGXA 1AMYA 1WOAA 3ITCA 3D46A 3RDKA 1JUKA 2J9XA 1RALA 4JTRA 4OECA 1AJ0A 1BAGA 3MW7A 2DU2A 3GAKA 5A6KA 4HKPA 1F5ZA 4FP1A 4GGBA 2WBKA 3RLVA 4ATLA 4RNHA 2DJXA 4XAPA 4Q8WA 3WDIA 2BP1A 1DXIA 3A21A 4YYCA 4WDXA 2QCLA 2R9RA 2V8ZA 3ZJ7A 4RXGA 1RQHA 2QF7A 2VTFA 3AQUA 3T9PA 3DG7A 4UTIA 3IRSA 2AL2A 2B7NA 1XDLA 1TRDA 1H41A 5KETA 4J5NA 1NWRA 4PULA 2ZRYA 1J9YA 1XWYA 4AXNA 3QKEA 4LB3A 1IZJA 5U4NA 4PE8A 3BTNA 2R14A 3DFSA 2GZXA 3NVTA 2UY3A 2G4JA 1ZBWA 4GLEA 3UA4A 4DXXA 3UETA 3LTPA 3LTSA 4LBSA 2WO5A 4XTIA 3ARVA 4JZ5A 2VR5A 4KBXA 3WNPA 3E74A 3WYZA 1YIXA 4DWDA 3NDZA 1ZSXA 1JI1A 1JJKA 3TA6A 2BXVA 2KZHA 2NQZA 2EO7A 1AUSL 4RE2A 3RCYA 4FPSA 2DEPA 2BXZA 6TAAA 1FHVA 4XVEA 3SR7A 2AQVA 1TWZA 2FVLA 2PGEA 4S3GA 4L1XA 2PDIA 3EKZA 1P5BA 2WHMA 4F0RA 4HZMA 1WE5A 4US5A 3VGHA 4ML9A 2PBOA 3VOIA 2Q3RA 4TU1A 4R53A 3W27A 4ORIA 4LCRA 4A8LA 1JPDX 3VNZA 3WH6A 1NFBA 2GJXB 1MDRA 4B3ZA 2OZTA 3KVKA 3UY8A 4ZMGA 4JYFA 2GK1A 3L23A 3WLLA 3HOJA 2I1OA 1HKMA 4JTEA 5AN7A 4IPPA 4DY1A 4H01A 3G0XA 4TV5A 1E0TA 3MBFA 3OA3A 3R43A 4CNOA 1VEOA 2C0HA 3WK3A 2CHOA 4Y9PA 1NFPA 2E5CA 4GIAA 4GH3A 2A6LA 1TV7A 1L0PA 7TAAA 4GD0A 1T6MA 3OBAA 4IGSA 1V7AA 2ZZ6A 5E6YA 1X6LA 5G2HA 2PDKA 4GUGA 3QW3A 3H12A 3N11A 4IIFA 5EBUA 1EQPA 2PB1A 3T0CA 3UVIA 1E70M 4ACZB 6TIMA 2WMKA 3WD2A 3LNPA 3SRHA 2IXVA 4AXKA 1A5SA 1N7KA 2WOQA 4HZ8A 4KT2A 3AZSA 5AC7A 3I4EA 2FZNA 2WSKA 1NP0A 1PX8A 1NOUA 3AWOA 1S5NA 3AZTA 3GVGA 3T2OA 3C61A 5EKYA 1G4SA 2PTZA 4JX5A 4NL1A 1MNSA 3CO4A 1IEWA 3UPMA 1AJZA 3MZNA 4GMEA 1WDDA 2P3EA 3H7VA 3VX1A 3L0GA 2NX1A 1TE1A 3RO8A 5BOOA 4OT7A 1UD5A 4C5YA 2FZDA 1HL8A 4GIEA 2CFFA 4NKCA 1F9CA 5LIUX 4DO5A 1JZ2A 1X8FA 3S1XA 2WQPA 4I9TA 4LS1A 4BKNA 3FOKA 2PDCA 2V3GA 2ZKMX 1ONEA 2PSNA 4RV8A 2XJ7A 4FA3A 2OEKA 4URIA 5A94A 4G9PA 4EPDC 5D2VA 8XIAA 4QSHA 1LROA 2CZDA 4ATWA 3BL3A 3WX7A 1TWDA 2WVSA 1ELSA 4DWSB 3WF3A 4B5XA 1H3GA 5D04C 1XLJA 3VD3A 5I78A 4AY8A 2CKRA 2LLEA 5CBJA 1UQZA 4QCEA 1CTNA 1SJAA 5FEXA 4UR8A 4IMFA 3PP7A 2OKOA 1HJQA 2MUCA 2CCRA 3NYZA 3VM5A 3G8RA 4KWOA 3FNDA 1QU4A 3DFYA 3H2OA 3VDHA 5JMUA 4FNQA 4DZIA 2YX0A 1KXHA 3CIWA 1ODUA 4Z2LA 2RGLA 1YPIA 2VGBA 4O1EA 3S1UA 3NZ1A 1LBFA 1FWGC 3UCCA 3IJ9A 4C6DA 1ONRA 2E09A 1WP6A 1B3ZA 4CNTA 3GYCA 4GE8A 1QCWA 3FEQA 4PUEA 1BYCA 1OX4A 1R30A 1RUSA 3VTRA 4E8CA 3HPXA 4C90A 3NZPA 3BSHA 1IR1A 4O4VA 1XCFA 3QBUA 1F2JA 4MMWA 2HVNA 2FB2A 2QCNA 1N2VA 2QDHA 4PYSA 3OVGA 4YLWA 1TTPA 1FX6A 1J11A 2JK2A 1ISYA 4UZSA 5FI8A 2O56A 1ZCCA 4IFKA 5MKGB 2AKMA 3BV4A 2XIIA 4N7QA 3BLKA 2GJPA 4UQDA 4PA8A 2DUAA 4NJJA 3LCHA 4L9XA 1PIGA 2PCEA 1QPRA 1SYTA 1E72M 4S3FA 4RW5A 5CG7A 1EHAA 1E6SM 1JGMA 4O16A 1EH9A 3TTSA 4MY9A 2D0HA 1FDYA 4X60A 4FAMA 1GQLA 5I00A 2PFHA 1J0ZA 1FWDC 2X0HA 3QSTA 1SUXA 1DEDA 4OE7A 5HNRA 4FOKA 4IZGA 4N2YA 3SECA 3V7PA 2HVOA 4X63A 3VNIA 1Q7MA 2O9PA 3R10A 4YVVA 4YHEA 1TX0A 4Y9AA 2D2OA 4REQB 3BAKA 4UOQA 2G97A 5G5IA 1GEHA 1TR9A 4LAZA 2PTXA 1XIGA 1UD3A 4LUSA 2XVGA 1G7VA 3LB0A 2J9YA 2CYGA 4LV9A 5K4ZA 2EAWA 5F1UA 2WMJA 2CLKA 2HXTA 1GVFA 1PUDA 1HF6A 3QPYA 4W93A 4C65A 1DIOA 2HK0A 4UNIA 1JFHA 1HL2A 2W61A 4GXWA 1M9HA 5JBEA 3BMXA 2PRLA 1GT8A 1PTAA 5C54A 3LV5A 3UR7A 1SU5A 2V9DA 4H2CA 3A5VA 3M0YA 3KOXA 2BXYA 4H00A 3EPMA 4WQ6A 3M43A 3F2CA 4JYDA 2ZX9A 2FHCA 2V67A 3CUHA 3M64A 1XFBA 1U1UA 4DB7A 2PZNA 1FFQA 1K70A 2PWHA 3PUOA 4DXKA 3BLLA 2G3FA 1NF7A 1MI3A 3A22A 5GJNA 4H1ZA 3WELA 4IGNA 2ZDRA 1R87A 1UBPC 1EXBA 3POCA 2NV9A 3C56A 2GQAA 4YWIA 1NP2A 1NVMA 1RK5A 3S8HA 4GQ0A 1A5NC 2X16A 3VZZA 5IDZA 3B8WA 4O0QA 3WL1A 1V3KA 2ZC8A 4GISA 4V33A 1A53A 1HGYA 3NQ8A 1PX3A 3BOLA 4NI3A 1JIBA 4A3RA 5C55A 2JE8A 3W7PA 1UZ1A 2ZFAA 2XSXA 3LNMA 2B0MA 3P61A 1MUWA 5FF2A 1WXJA 2ZRUA 2A3HA 1B4EA 1FWEC 2J7CA 1GZGA 1BPLB 1FWCC 1EYEA 3NIYA 4XVDA 5FSEC 1LJYA 1V93A 1XP3A 3STEA 3PBVA 5CZTA 3W2NA 3CJPA 2WVVA 3GQYA 1LWHA 1OM0A 3WNMA 1H7XA 2CZFA 4KH2A 1IZCA 1GEQA 1CECA 4CNUA 3S83A 4QTGA 4DAIA 1R2TA 2VCCA 2AAMA 3KP0A 1JR1A 1EOKA 3LHWA 5TNVA 2HZGA 1WQ5A 3UWZA 4LALA 2OLHA 2OB3A 3II1A 1OHLA 2P53A 4YVXA 1R0MA 1WDRA 1Q6FA 4OWGA 3LX9A 4J9JA 4JN7A 5LXXA 4JIEA 2HQAA 1JUBA 1JAKA 4PBEA 3LBCA 1X1OA 4Q32A 5HJXA 2PEVA 3B9OA 4UFLA 1QNQA 3TC3A 1ZFJA 3RX3A 5ABGA 1KCKA 5CSUA 1Q6RA 2FQIA 1DJZA 1DHKA 1KA9F 1OGBA 3LG3A 4JTHA 3EDFA 2NLYA 4EWJA 5G4HC 2NXGA 3O15A 4YCOA 4J40A 1QMLA 3B06A 3THCA 4L5ZA 4EF9A 4IXHA 3ZO9A 5FAJA 3UFYA 4XK2A 4HNVA 2OQYA 4E8DA 5E9XA 1PCWA 1V6YA 1XR2A 4UNLA 4IQJA 4ROQA 3S3GA 1OVDA 4PCTA 3N29A 1QRQA 3OA5A 3N4AA 1W31A 2EJ1A 4TTUA 3GZAA 3AHVA 1H7NA 3PWIA 1KW1A 3D5HA 1E6PA 2NVAA 1OEPA 4HOWA 1VS1A 1WZMA 3N4EA 4JY8A 1P4CA 5LXEA 3W2JA 3P0WA 1UR3M 5FEPA 4B15A 2J7HA 2BASA 3ZQ9A 2DSKA 1KM1A 1R3RA 5A69A 3VC6A 3W7GA 1YBQB 1X8CA 2WLZA 4MYXA 1HP4A 2E4TA 4ZA0A 4WDTA 3CEPA 4HPJA 1V3IA 5T8GA 2VDGA 2DIEA 1J6OA 4TV6A 3HO8A 1AD4A 5JH2A 4WJ8A 1UKSA 3R6IA 3V5FA 1DWHM 5F4XA 1HZYA 1XL9A 4ZTYA 4Q8QA 1S3HA 3G22A 3IUDA 2FPTA 3BOFA 3HG5A 3AMGA 4C5ZA 4U33A 2OZ0A 1DKWA 4KPLA 1E0WA 1ZBCA 3WLNA 1KM4A 1MYRA 1B3XA 3LCFA 1M7XA 1EGVA 5AHMA 4MFEA 1MQPA 5E0FA 1EO7A 2X1TA 1SMDA 3L2LA 1VPXA 1EX5A 3FX4A 1R7AA 3RPDA 1E4MM 2DSZA 4Y9MA 2OLSA 3LEPA 1I8JA 4UTHA 3DN5A 1TSIA 1EIXA 4UCGA 4D6EA 2C13A 1YDYA 3ME3A 3RRXA 1ICPA 2V82A 4XKYB 3TMQA 4A3QA 3NM1A 3WDPP 2HK1A 3MSYA 3TROA 2VD8A 3P62A 5D02A 1K7FA 4XAZA 1E4IA 1YTKA 1E56A 4CQDA 2VI0A 3G1YA 5F7UA 4QJ3B 3KM8A 4WK9A 1P7TA 1S2CA 1XLKA 1PVNA 2HDJA 5DCDA 4WSKA 2PTYA 1K1DA 1LOQA 4AWSA 4LUIA 4WXYA 2PTWA 4JL2A 3PAJA 4H9ZA 4P7RA 1PL9A 2YL8A 4AEOA 2R1KA 1H1ZA 3OVRA 4JN6A 2QMKA 2TMDA 5CAKA 4W89A 4HBKA 4XZLX 3QR1A 3VGDA 4IGHA 2QR6A 3GKFA 1D8CA 4V1XA 4AQLA 5M03A 2V30A 2AL2B 3SJ3A 1XCXA 4RPPA 4M6QA 2GGGA 2CETA 3NQVA 1EIBA 3F2DA 1IWPA 1FFRA 2VX7A 1BSIA 2TSYA 2E8ZA 5BZAA 4JQ4A 2DGAA 4US6A 3BCFA 3T09A 3V3WA 4N9DA 2WMIA 1V0MA 3PTMA 2Q8ZA 5CZJA 3WD4A 1RJPA 3QRHA 3R0DA 5AB3A 2WNQA 1W0MA 2DZXA 4IHCA 1J6PA 2WC7A 5A6LA 1KWGA 3M07A 3T44A 2YYUA 1ZAHA 1M41A 3EX6A 1X1NA 2P3ZA 1MXGA 4CCEA 1KGWA 5DELA 1QI2A 5DBTA 1KRCC 2F61A 4WX2A 4F79A 1CB7B 4CLMA 1CXHA 4U5KA 2WXDM 1VH7A 3N14A 3S1VA 4WY0F 4K37A 3N73A 1H7WA 1GGOA 1VFTA 2QJGA 3VNKA 3M16A 4JFWA 3W38A 4IMDA 4UMCA 4GVFA 1QTWA 5AYBA 1K8YA 1MW3A 1XBXA 2D2GA 3KL0A 3JVAA 2GK1B 2ZADA 3IJ6A 4AFYA 4XZWA 4BK9A 1NY1A 4UNKA 3P7YA 2VMFA 4QLLA 1ZPTA 4JN8A 5GNXA 4AZ5A 2QUVA 1B9ZA 1Q7ZA 3ZIZA 4AWUA 3WDJA 4TX9A 3WFAA 4P8WA 4C7DA 5G4WA 2YXGA 4QNWA 3ITOA 1DQUA 3ZS4A 1WKDA 1CX9A 4XUGA 3K13A 4DF0A 2XG9A 5JUVA 3CL7A 2Y70A 3UZZA 4Z0JA 1ITCA 4HU4A 3DCPA 4AIBA 1Q6GA 2PWFA 1GG0A 1XDMA 3UYCA 5E9AA 3PUGA 1FWFC 3W87A 2YXXA 1E6NA 1R9YA 2Z7KA 4LYKA 1TVNA 2Y5JA 3BAWA 5G2IA 3WKZA 1JGIA 2GVLA 3F03K 1AA1B 3PUEA 3UZJA 2VEIA 3K4WA 3SGUA 3LDVA 4BS0A 4PB4A 2OT1A 3APYA 3TJXA 2PDNA 2F7FA 3CWOX 1THFD 2BDQA 5HBFA 4AX7A 4O28A 1C8QA 2PDUA 3CV6A 3BV7A 3RR4A 2PDMA 5FJRA 5IFPA 1UD6A 3GIQA 3L0KA 4QDWA 4DVOA 4ICNA 4OUIA 5HULA 3BGGA 3RUBL 3AOFA 3IVSA 2QQ6A 4HTBA 2J7FA 4JGDA 4C6BA 1M03A 3OU8A 4NJIA 1OX6A 3FJLA 5FIPA 4AD2A 2VRKA 3BPWA 3DAQA 4DBUA 3H26A 1M04A 5BOEA 1O1ZA 3L5LA 4QJ1A 2Z1SA 1KXVA 5DCBA 1KM5A 1C8YA 3GIPA 1XBVA 1O60A 5KZMA 3BAJA 3PHAA 4IUGA 3GC2A 1H7OA 1VF8A 3LERA 4E6MA 4CCDA 1Q6DA 4J3WA 3H2EA 4ZEPA 1M68A 5ABEA 1AG1O 3ZWSA 4DBSA 4GCAA 4GZ7A 2FGZA 1T96A 3WQPA 2ZQ0A 1TCMA 4Q8NA 4YNGA 1JZ5A 3GW3A 2VZUA 4A3HA 1V7YA 4G1KA 3W00A 3PZOA 4MB3A 2VFDA 3UVAA 3L68A 1SW3A 2R24A 2FGLA 4JCMA 1US0A 5DMLA 4CVUA 3QF0A 1IHIA 5HWMA 3DERA 2BSLA 2VZTA 2FJUB 4W85A 2GOKA 1EBHA 5HJYA 2OR2A 4ZB5A 3QV7A 4FOJA 1DXEA 5A2AA 3EB3A 3SJNA 1TTJA 6A3HA 3VFCA 3IV3A 4GABA 3EA2A 3C8NA 5D8WA 5DY3A 2Z4GA 1TUFA 1S39A 8CGTA 1KM6A 3GNDA 1GYNA 3W84A 2B7PA 2ZZ3A 4GBUA 4JYEA 3L4TA 3TC6A 3KLLA 3GSMA 2WC4A 1OX4B 3NM3A 3G1FA 3HQPA 4AVNA 3O6DA 1VFUA 4PC8A 2QV5A 4EXAA 4O13A 2NXIA 3KAOA 3G0UA 3DKJA 2Z29A 3RILA 2PDPA 1C7SA 1XQKA 1CENA 4XSLA 4F3HA 1JRBA 5G1MA 1C8VA 3VU2A 1J0KA 2O9OA 4LEQA 1ESWA 4IFKB 4JD4A 2W79A 1VEPA 3LLFA 4J4KA 1F7BA 5B80A 1F3WA 1DPMA 2AAAA 2NQ5A 4J3VA 2XIJA 4G5DA 1EJSC 3PM6A 2FZMA 2O9TA 3C0SA 3M46A 3IIZA 1EQCA 1JD7A 3Q45A 2J27A 3V5OA 4I7VA 1M1BA 3USBA 6XIMA 1SZFA 4IFOA 2QXWA 4B9YA 4FB7A 1A47A 5D09A 1TELA 2UY5A 4YHGA 2WZIA 1FCQA 3MCOA 2NZLA 4GQQA 5B7ZA 2QEZA 4IIBA 1O5XA 3PS7A 1JYWA 3NCOA 1C92A 1LCOA 1JYXA 1V6TA 3N12A 1SW7A 5HAOA 2R6OA 2Q01A 4KRTA 4WOQA 2F6UA 2Y85A 4LSBA 4C1NB 5EY5A 1ME8A 2ZYFA 4OUEA 3MA8A 2V5CA 2W6RA 1N82A 3ZT6A 4XZMX 1E51A 6CGTA 5AECA 5HATA 4HCLA 1ZCOA 2EG8A 1RBOB 4PMYA 1Q6EA 2QCHA 3FVMA 4I6VA 3AU2A 2J7EA 2VURA 4O1DA 2CITA 3R58A 3V36A 5E6ZA 3U2ZA 1EHNA 4XBJA 2XN0A 3RF9A 1UROA 3FKKA 4GACA 4IP5A 4R9XA 3SY1A 1Q45A 3M5XA 2VOMA 3G8EA 5K9XA 5ECUA 1B9BA 1A80A 3Q67A 3SY8A 2CHRA 3I4KA 2IMRA 4K2SA 4HVXA 1S2VA 2Y6ZA 4J2PA 3OEXA 1VKFA 1FKWA 1NAL1 2VC7A 2HTMA 2WJFA 2GUUA 2EG6A 4ZE5A 2XGZA 1W1ZA 1IIGA 2W5FA 4MFDA 2PS2A 1K6AA 3L9CA 4FF7A 1UJQA 3G1HA 7PTDA 1ADDA 1NJJA 3CPRA 4GQGA 1EZWA 3NZGA 4PGLA 1G4EA 3R89A 4E2OA 2C3ZA 3B0VC 1P6BA 1TPB1 2CKSA 1CGVA 3N2XA 2ZXAA 5LIKX 2NV1A 2GLKA 1TMHA 2OEMA 3E5PA 3KL3A 1RCOB 2YPIA 1BYDA 1Z6KA 1DJNA 3GZ3A 3OO2A 1F3XA 4GJ1A 3FSUA 3DGRA 4LOCA 5HMDA 3VO0A 4JFUA 4M7TA 1ICQA 3R7MA 3URQA 3RFAA 4X0NA 4ZQRA 3BVJA 4BFAA 1GYLA 4QCFA 3E38A 2B7OA 5F2MA 4IFRA 5EPDA 3BLDA 2WVVB 4X3ZA 3SI9A 2DH2A 3ZLFA 4WGXA 1XIFA 4I5XA 3DFNA 5C8BB 5KITA 1FWBC 4BI6A 3MY9A 1S5WA 4C7FA 2AGTA 2OZ3A 7CGTA 2WBGA 1TX2A 4O1CA 4RDWA 4LC8A 1EEXA 2JIWA 2QIIA 3H22A 4HQVA 1KBKA 2XTKA 3OHIA 3WK2A 2XFFA 3S5OA 4ZXLA 4OZOA 2V5DA 1QI0A 4HCDA 2HXUA 4ADTA 3CUGA 1O7AA 1HG3A 3EEGA 3GK0A 2Q02A 3EKLA 5L9FA 5DRCA 3MHGA 1EC7A 3OVPA 1TPUA 3CM4A 3VIMA 3W29A 3W0KA 2V5LA 4FSAA 4Q8PA 4MM1A 2V6AA 5A2BA 2VR4A 3FYOA 3ONBA 1KBBA 4C6CA 4MY1A 3MUAA 2Z28A 1W5PA 4RZ5A 1MW0A 1P6CA 3SM0A 3UCQA 5ABFA 4Z1DA 2DDXA 1V51A 4Z1CA 1DORA 4KFPA 3IANA 1E5NA 2FZ8A 4XBSA 4CN1A 3N9SA 3GY1A 1CXIA 3UNTA 4F0LA 1XD0A 3VOGA 3VZYA 1XLEA 4G7EA 3WQWA 4AD4A 3GXFA 3NJ3A 4TX6A 1K9DA 1MNZA 2F2HA 1RVGA 3PK7A 8TIMA 2DIJA 1UR1A 3SQLA 4WY0A 4HGXA 4CU6A 3JZUA 1I60A 3UZYA 1AL8A 4F48A 4MGGA 5CKSA 2OLAA 3L2IA 2VC5A 2WKGA 3QGKC 1C91A 1SFTA 4LU0A 1CB2A 3TW7A 1XLLA 1Q7QA 4LT9A 5HWNA 4PRRA 3V5CA 1KO0A 3FW6A 1AW5A 2P8CA 3P2VA 4JS3A 2FVKA 2QDEA 4R7OA 4H3DA 1SFSA 1LL6A 3O0KA 2Z00A 4XAFA 2E1WA 3RYSA 4RE3A 1OCNA 5J5RA 1XIJA 2QUUA 1X6UA 2PD5A 3WJYA 4JIRA 1XHGA 2J7DA 3LSCA 1XRVA 3UG4A 3BLIA 3QYQA 1CBGA 2PWVA 3SCNA 1S5VA 3BMVA 4GNKB 4D6CA 3PB0A 1B3VA 4R7WA 1TFVA 3HF3A 3MB9A 3LENA 1XPYA 5FAGA 4D8ZA 5LNRA 3GVWA 2G3JA 4RNIA 2DT0A 3P3BA 2GGEA 5D05A 4RV3A 4JTQA 1V0KA 1GTHA 4KCTA 1SFJA 3TN3A 1KRAC 1VFFA 3GUGA 3RR1A 4EAMA 1LT7A 2JF6A 1XINA 5I3GA 3P80A 2YL6A 2DV0A 3LI0A 3HG2A 2E68A 1Z9AA 3CO8A 5CBIA 4S2CA 4NXSA 3T40A 1W5OA 4Z0SA 3GBDA 4V2XA 1NWTA 2Q3OA 2Z6JA 2JEPA 4C6OA 2DQXA 4MKSA 4ZR8A 3B97A 4F0SA 4IIEA 1B1YA 1TV4A 4GX9A 1XF0A 2VP8A 3M5VA 4EXQA 3CWNA 3T2QA 4ZTXA 1C90A 1TZ9A 3S6OA 4GK8A 2H3DA 2OXNA 5A6JA 1Q6OA 3GD6A 3OZOA 4OTKA 2POZA 4PFHA 3LXBA 3LY0A 2E9BA 3TYAA 3F5KA 1UZDA 5KEZA 3VVGA 4C6NA 1CYGA 2Y8UA 1Q2SA 2J8FA 3B04A 3NQEA 3PZVA 5K7JA 4Q22A 1M6JA 1EA9C 4H9TA 3S2MA 3GFZA 4JCLA 2XVLA 3AAMA 5FOOA 5EFDA 1LUCA 3WLRA 2GWGA 3WF2A 4Z2GA 4N02A 1Z48A 4R5EA 4XB3A 2YL5A 1W9VA 2V5BA 4ZBCA 2HNHA 2WMIB 3L2MA 3DU0A 2PA6A 2XGBA 3VKCA 3PBYA 2QT3A 2IQ0A 1IEVA 1POKA 2Y2WA 4ZO9A 1SO5A 4PUWA 2BY3A 4LTSA 1Z8AA 4YIWA 4S3EA 3AXHA 3C86A 3GC4A 1KTNA 1UP0A 3RITA 2DJLA 2PDLA 4O12A 2Z1VA 2J6VA 2PDJA 3IUHA 1VFSA 3S42A 4IX0A 3MBDA 1FUYA 4S3BA 3LOTA 2Y5SA 2GVYA 2YDAA 4HA0A 5LA2A 3UPWA 3GTIA 2ZDSA 1IEXA 3KXQA 1JZ3A 2NXHA 2J9ZA 3AMDA 2P8BA 2MNRA 1IT0A 1SO3A 3UG8A 1YE4A 4UTTA 4N9BA 4KEVA 5H6HA 1IT7A 1DYSA 3LS9A 1OCJA 4ZQMA 3O07A 4EXBA 1CGUA 1V02E 2QUNA 3NSMA 5DANA 4YYFA 1A0DA 5H91A 2QMJA 2PLCA 3QTPA 3LCWA 5HUPA 3VIFA 2Z25A 4B5SA 3WQOA 2DSUA 1TJ2A 1RPKA 4BI7A 3O6YX 2XPKA 3QHNA 1U5HA 1BVZA 3H2FA 2VELA 4JEJA 2W92A 1T8QA 4NHVA 3W71A 3HPAA 4GYKA 3CQKA 3W2KA 3HV9A 4P7NA 2ISVA 2XZ9A 3FAWA 1BSLA 1EOMA 3R79A 2XFRA 4C6QA 4NX0A 1MZRA 1HKWA 3GG8A 3EXTA 4DUXA 2ZX7A 4M81A 1BYAA 3EWUA 3RHGA 4E4FA 2PAJA 3VNMA 2GVEA 1BLIA 1TPEA 2ZICA 4P2VA 5K9DA 1J8VA 4XZHA 3CASA 5H8MA 2QGHA 3TLLA 1M7OA 2GUBA 3DYMA 4F2UA 1W5NA 2XIOA 1ZHAA 4TXEA 1POJA 3GE7A 3MYOA 4QXIA 5BROA 1A3HA 1JCNA 3RRAA 2YA2A 3L5AA 1KFKA 3EGJA 3W76A 3VNDA 1W1B1 1YW1A 4QJ4B 1X98A 5FL0A 1UMLA 1OFRA 4KIRA 4MNMA 4AU0A 1YNPA 2XH0A 4MNLA 4JIPA 5DMYA 4NG3A 4E2DA 1FOBA 4Q4KA 3AZRA 4XKMA 1P0EA 4GQBA 1QNVA 3UWVA 4EPEC 2PUZA 2GJRA 5CPSA 2X42A 4JDYA 5ENLA 1VBRA 4UTTC 3WLPA 5I3DA 3E96A 3KBMA 1CI1A 4QGCA 3H55A 3AS3A 1QBBA 3HPSA 1F8IA 5GJPA 3SUWA 1Z44A 1D9EA 5CH9A 3W1AA 3R8RA 4JTSA 4F8XA 3FJNA 4JNYA 2ZVRA 2WPBA 4GUJA 3A4XA 3AHZA 4WDUA 3TJIA 1GJPA 2XU2A 3PSVA 4C6PA 1KTCA 3GTNA 3LMZA 1F76A 2YW4A 3C2VA 1YYAA 5FEZA 2YZRA 3PZNA 2BVTA 3EAUA 1IIHA 3VDAA 3PR2A 1J4EA 4H7VA 2YYTA 4LYQA 3C2FA 3V0UA 1MUMA 3W74A 5EMJA 3CUXA 3UZWA 1T41A 1UWQA 2C14A 3N25A 3W1QA 4HA1A 3OIXA 3MWAA 4MUPA 3TVAA 1D7FA 1LL7A 3WFZA 2X7WA 1F74A 4YWSA 3RLGA 3WH9A 3GR7A 3SCRA 1TWSA 1NWUA 1U2YA 4RK8A 3WQ6A 1WX0A 3WZ0E 1E1FA 2E5BA 1GHRA 2R82A 3W1LA 2EQDA 1ITUA 4ZOBA 3BLFA 3BZJA 5C9RA 4WF7A 2PODA 4ALDA 3F4WA 2Z0IA 4Y2WA 4IXXA 4AB4A 2VHLA 3VKAA 1QO2A 3I3EA 1VIZA 2UWFA 1LOSA 4J1OA 5K3VA 3UW6A 1PIIA 1LM1A 4XSMA 1VRDA 3H23A 4Y6GA 3FA3A 1R3WA 1JFXA 4NZ1A 1HN1A 4B90A 3WMSA 1H1YA 1Y5VA 4AY1A 1E3XA 3NZQA 1TQJA 3WD3A 1YEYA 4F0MA 1CGYA 3CEUA 3SO7A 4INFA 1QWGA 1DJYA 1J0YA 3M0XA 3RMJA 4LYRA 3SADA 4AY7A 3EWYA 3TYBA 3BJTA 4JXCA 4U10A 3T05A 1WYIA 2BOEX 1OB0A 3LXCA 4NX5A 3VABA 3E2SA 4XD4A 4H7ZA 2ZXDA 1TJPA 4Q8VA 1MRAA 2A6NA 2JALA 1W32A 2XYLA 9XIMA 3AS0A 4XD3A 1TJ0A 4HPNA 2FZBA 3A23A 4HIBA 3SY5A 1DWFM 1QNOA 3T07A 4M1RA 1VFHA 3CZEA 3GG1A 3OW1A 5T26A 3EMQA 4GVHA 4O8RA 4KGLA 5T9CE 3PWGA 1O94A 1NH6A 4WGHA 3H8AA 3AYVA 4ZB2A 4H6EA 3EWDA 4A8RA 2NSOA 2V3FA 2DVXA 2PGRA 5TQLA 4X61A 3ZM8A 3PJTA 1TA3A 3N13A 3E2RA 3CHDA 4N42A 1CXLA 5AC6A 2VNCA 4UWMA 3XIMA 1R6WA 1ISXA 3ZVHA 4TQTA 3FHQA 1NQKA 1PIFA 5EMLA 1OG0A 3HURA 4LUYA 3OHMB 2QAFA 5I3FA 2C1IA 1UWSA 4ZFMA 1VYSX 2BHZA 1FH9A 4AW7A 2I14A 1BXBA 4Q8MA 1XRSA 3PG8A 3OGRA 5CCZA 4AVOA 5D38A 3NO5A 1R3VA 3CHEA 3OZMA 4PMNA 3P6LA 4A4AA 1D3HA 2IUZA 4Q4OA 1EUAA 3QJAA 2ZUSA 5CAHA 3WUBA 3HQOA 3RMEA 4IPLA 1XGDA 2VEGA 1SZEA 3N2CA 3W6LA 4DZ5A 3C0LA 3CZKA 1KGXA 3FJ6A 1NDZA 3HM7A 1KLYA 2Y63A 2VEPA 2DZVA 3BW4A 3ITGA 3OTRA 1X39A 4U3CA 2X2YA 4UUIA 1F73A 3MO4A 1U5VA 4M5PA 4Y8EA 3AC0A 1C3FA 3M4HA 3NGJA 3IJ8A 3TUUA 1P43A 1R2SA 5DY2A 2W63A 4U31A 2W0UA 4JNMA 1ZJAA 2BV9A 1BG9A 3LZ5A 1BD0A 3TZNA 3SQSA 4M6VA 1XGZA 1PWLA 1BVNP 2WM0A 1G5AA 4H04A 3C0JA 2ZA3A 2XM1A 1PS9A 3MHUA 2GL5A 5DEZA 3SCUA 2V5JA 2XDFA 5M3WA 2V81A 2YDQA 2PRHA 2QS8A 1PKYA 3O6AA 3E1F1 3VIIA 3UG5A 1VBHA 2QVHA 4Q8OA 1LWIA 1RP8A 4PEKA 1TYGA 9RUBA 1W3JA 1W1IE 3AO0A 4Y96A 4PEEA 2E1DA 3WJZA 1AW1A 4G8TA 2GVGA 3W7KA 3YPIA 4XZIA 4J3TA 3QN3A 3SN0A 3I10A 4UFIA 2GPTA 2HWGA 2POTA 2I16A 3QM3A 2VFIA 1AH3A 1SW0A 2BZNA 2ONEA 3LLXA 5DT5A 5TD4A 1RXOB 3EZ4A 2V69A 2OFJA 3NURA 3Q37A 1XIDA 4E2VA 1QI3A 3BSMA 5CPQA 5C2GA 3QOMA 4Q33A 3MMDA 1JRCA 4O54A 3EDEA 3QLLA 1XDJA 4UZUA 2G37A 3BZGA 4PMVA 4JTDA 3R8HA 3B8IA 2QHAA 1FDJA 2V2DA 4B9ZA 1WZAA 4H6RA 4J3ZA 3M0LA 2VYOA 2QPSA 4NZ5A 4RNJA 3GNNA 1Z32X 4DBDA 1GJWA 3SEPA 4AD1A 4Q6JA 3GFYA 4I5RA 1QAPA 5ABFB 3HV8A 3QZEA 3S6DA 2J74A 2WCAA 2CNCA 2PF8A 4MG4A 3LZ3A 1W1VA 2CXEA 3NQ7A 1J2BA 3UXDA 2PF0A 3M0VA 1OGGA 4Z1YA 4JTKA 1BHGA 1E71M 4YL2A 1QO5A 1H7RA 4PMQA 4G7EB 3MTWA 1RV8A 1ZJHA 1UW9A 1Z7AA 1W8SA 4LUJA 3V1PA 4PRWA 2GWNA 3F5JA 1H0GA 4WY0B 1OFPA 5C9XA 3MO7A 2OSWA 3TYCA 1FBAA 4OIFA 3U8GA 4E0CA 3F4VA 4JTFA 3T0TA 4O17A 1V0LA 3PY2A 4CD6A 4HA4A 4PTVA 4YS1A 3IVTA 4DBWA 3S5NA 2R8WA 2HE5A 2DIKA 2OX4A 3Q94A 4CNPA 1XC4A 3NO3A 3OJGA 3B0UX 4X2RA 2NWSA 1LQAA 3V35A 3M44A 3PJXA 3U3HA 4KRZA 3QY6A 1A5UA 4IIGA 2YIHA 3OOQA 3PPFA 3QMSA 3W7DA 3OLIA 3ORWA 1V4YA 2WWCA 2ACRA 4LAMA 4ZOCA 3P60A 5AVHA 2G8ZA 1WV2A 4ZSUA 4IJBA 1KBIA 3LN3A 3ZLGA 2BNJA 4RDVA 4NZJA 1XIIA 1LRQA 3LPPA 1QT1A 1BTCA 4HT3A 1V8EA 3KX6A 3AU6A 4Z2JA 5D9PA 1E9YB 3MP5A 3K5XA 5CXPA 1AQ0A 1HJWA 3E2VA 4IQDA 1U33A 4J35A 2PLJA 3O7UA 2QCDA 2ISWA 1WDSA 2Z7GA 2VO5A 3AUJA 1B0IA 2WNZA 4MB4A 2OSYA 2FGBA 4EACA 3PPCA 4Y9OA 3UXLA 3ZSSA 1UC4A 3NOEA 4AZHA 1E40A 1W9UA 2DW7A 1VEMA 3KRBA 4AWTA 1GVYA 4LJ3A 4UQEA 3KS5A 1UH2A 2QJMA 3VKBA 2BG5A 3OGSA 4W87A 2GDQA 4IIDA 4GNVA 3B03A 3GHRA 4H9MA 3GVQA 3MSDA 4KETA 1G94A 3RIKA 3PBGA 1P1MA 3IS4A 1GCYA 1HUVA 1RD5A 1QI4A 3EX1A 2DW6A 1YNQA 3IWPA 3N2TA 1RLCL 4OOUA 3ZOAA 5HK4A 4JTUA 3T4CA 4MHBA 5D9MA 2J88A 1GONA 1GTEA 5HR7A 1JDFA 2OCZA 1PKLA 2ZVIA 2IS7A 3MWCA 2OYLA 3ZR4A 1F3TA 3AJXA 1LUCB 3AJ7A 3DYPA 4Q7BA 1A50A 4OQVA 4DJFD 3DOPA 3BSGA 3TOYA 1HQTA 1FWTA 5JXQA 3HJZA 3L4VA 1UASA 5I24A 2HV5A 3WUEA 3WNOA 2I17A 4AF0A 4B5NA 4A8NA 2V2CA 1WOBA 1QOXA 1XKJA 3CPUA 1W9BM 2HRWA 1I75A 4CKQA 1EDGA 4QLKA 5E5CA 3NPVA 3I3BA 3OLEA 3M41A 4MKVA 3B4UA 1W9XA 4NJGA 5HMFA 4TVUA 4AEEA 4W5ZA 1J12A 1IWAA 2BS9A 3NEVA 3E0FA 3FDGA 1BGGA 4HU0A 1BVWA 3PAOA 1XI3A 4PFMA 3M6DA 2EKGA 2GDUA 3GDTA 4ASTA 1GORA 2ZX5A 1IZKA 2JGQA 3TONA 2QCMA 3NQMA 4AYGA 3O6CA 5C6MA 5BXPA 3W7MA 3QW4B 3ZSTA 4GRSA 1LRTA 2NUXA 3TC7A 4GX8A 1YXYA 4WHBA 4WKHA 3W2MA 1E0XA 2A2IA 2WCSA 5HANA 2O4QA 5DCEA 3N9KA 1NDVA 2PURA 3A4JA 3MMWA 1ZBKA 4ATDA 1TMLA 3KZPA 2Z1XA 4M0XA 1AFSA 3EDJA 3CB3A 4O10A 1SFLA 4GI8A 5BU6A 3A6OA 4QITA 2D0GA 3IJLA 4MDOA 2E5DA 3PWAA 4GY1A 1NQ6A 5KZEA 2XH7A 3LI1A 3M6YA 1WCGA 3RM4A 2RH9A 3HMCA 3WQVA 2WMGA 3H21A 1XBZA 4AZIA 1UUMA 5AFDA 4DHGA 1LLWA 2Z2UA 3TQVA 5AOUA 3ANVA 5JBDA 2PMQA 1V08A 1RAKA 3N6QA 2E6AA 5K4XA 3LRLA 1W37A 3TJLA 1EDQA 4WXZA 1HT6A 1HL9A 1XYMA 2GJLA 3GU9A 3PZTA 5A6BD 1EWEA 3GDKA 4YTTA 1QW8A 1E9IA 2YJQA 4ZQPA 3RX4A 3TFCA 4GH1A 3CAVA 5C71A 3I6TA 4DI9A 1UA3A 1S5TA 3WBAA 1JG9A 1US2A 4CQAA 4RNFA 1MWOA 2YLLA 1HX0A 3STCA 3R11A 5C2CA 3KOWA 4HK6A 4KFNA 2G50A 4DF2A 1DWIM 4B4HA 4MOZA 2R1PA 2P10A 4BQ3A 4RCXA 4GUFA 2YSWA 2ALRA 3H2NA 3BCJA 3VNLA 5E09A 3CHCA 2YZ5A 3LU2A 2AL1A 1U22A 5BMXA 1C93A 3PZIA 1XFCA 3TQPA 1A3XA 1FWAC 1KFCA 3A47A 3NPUA 3WLOA 2ZC1A 1W5MA 4M8UA 4PL2A 2O9RA 1BRLA 2JF7A 1XLGA 2JFEX 4O15A 4PBGA 1SJCA 5CQ1A 1JZ7A 1TJ1A 2D3LA 1KC7A 3N17A 2HSAA 3SFWA 2H3BA 4MWAE 3PPGA 4MTVA 1XUZA 2A1YA 3TR9A 1RVKA 4JTLA 3NZRA 1Y5XA 4UTWA 4P7LA 1XBYA 3NGFA 2PWEA 3AMCA 1BTMA 1JQXA 5BNKA 5RUBA 4ZZ9A 1ZU8A 5HJLA 4HYVA 4JHMA 3AISA 3RCNA 3NR0A 1UR8A 4KWVA 1XS2A 1P0BA 4JICA 1J93A 2ZWZA 3CUZA 1MDLA 4JTJA 3W24A 4I9JA 2VUYA 4CCCA 2X1UA 1RPXA 3KOZA 4DUWA 3AXIA 4BA0A 4AUBA 2VEMA 4LB4A 3TR2A 4C6IA 3E0LA 5C2XA 4KW2A 5DRIA 2CWXA 2TRSA 2J7GA 5HWJA 3CZ8A 4C6FA 4JIQA 5BRBA 4L1WA 1WB0A 3T0BA 1XLAA 2VR2A 4IISA 2QPUA 1O1HA 1R86A 4XISA 1SO6A 3SGZA 3DHUA 1XYLA 4GIYA 2CLFA 1XG3A 4L1GA 2H6RA 4NZCA 5JU6A 1KR0A 3AXKA 5G2WA 3WSUA 4MYAA 5HMEA 1TZ7A 1TUXA 1TV5A 1ITQA 2XIMA 3DGBA 2Z24A 4G1NA 1ME9A 3VE9A 3KRZA 1XM3A 2G0WA 4OGZA 3RJYA 4YPJA 3SCQA 4GKTA 4QHRA 4DJDD 4A05A 3IUIA 4PN2A 3DESA 1E9ZB 4IICA 2CXGA 1WA3A 3DFOA 1Q4NX 3GM8A 5TAOA 1OK4A 3TN5A 5J04A 1J5TA 3BLEA 1ZQ5A 1B3WA 1CXKA 1ISZA 4UTWC 2ZZ5A 2F84A 3TE9A 1I6NA 5M2FX 1XUUA 3XISA 4HMCA 4Q4QA 3L12A 4BI5A 4YJ5A 4H7CA 4KERA 1GOQA 4NU7A 4RW3A 3NL2A 3RO6A 1IGWA 2WB5A 3ZXWA 3NQDA 1R85A 3U2EA 4HPGA 1TA3B 1V3MA 3CV1A 3VD7A 2UV8G 3K8LA 2XSAA 3MC5A 1HIZA 5MF5A 1J18A 3ZVHB 3WLJA 3FCPA 4JFSA 1B57A 2E40A 1YDOA 4BF5A 3ITYA 1X7FA 3N19B 3QY7A 4HJWA 2RDWA 2VX4A 3ITTA 1OF8A 4M56A 1GW1A 1A3WA 4N9EA 1X38A 2VOTA 3S2JA 2X2GA 4S3KA 4XO6A 1GKPA 2WJEA 4L9ZA 1I0DA 2ZIDA 3C2YA 1E6RA 2CHNA 3BOXA 1IR2A 3IK4A 4E5TA 2XSBA 3NSXA 2G3IA 4PUNA 3OBEA 3TCSA 4I5UA 4PMJA 3DHPA 2ADAA 1JULA 4CU7A 3WBXA 1FHDA 2W67A 3AALA 3MVTA 3NDOA 4RX0A 4WD0A 1KM3A 3G77A 3HFTA 1UZ4A 2PDXA 4MB1A 2PCQA 4Q7IA 3U7BA 3FN9A 2EPLX 3TTOA 4D6HA 3KVJA 1XYBA 3L4YA 2BWGA 2ABAA 4U28A 2J8GA 4LVGA 1ML1A 4QLJA 4O0ZA 2ABBA 3GHSA 3QZ6A 2A3BA 1W3TA 3WNLA 3GTHA 4P7OA 1JYVA 4UXDA 4XWUA 1VQTA 2Q09A 3H4GA 2XWDA 1BWKA 1VFMA 5I06A 1MEHA 5IDIA 1B4KA 3ZR6A 5FJUA 4HHHA 2PDFA 3STGA 3E3HA 1JCJA 3L7RA 1P48A 3MANA 1DE6A 9CGTA 1XYCA 4R27A 3UEQA 2OYMA 1S38A 2D20A 2WCGA 3JW7A 4W8BA 4FI4A 3P5ZA 3BLOA 1W2VA 3D6NA 1OC7A 1RQBA 3CMFA 3EXSA 3UD6A 1XLFA 3GNOA 1PHQA 1DV7A 1KR1A 1R3TA 3BAYA 1IQ8A 4UTLA 4IPJA 4FF5A 1UR0A 3RM8A 1UP2A 4HNUA 1J2WA 4KEZA 3GDLA 4JBRA 1QFEA 1CZ1A 4IGMA 1GVRA 3HQNA 2Z1BA 4MZYA 5EMKA 5D32A 2CLLA 2CIPA 3W7LA 2QULA 1TPDA 5E70A 3KVLA 2OX1A 3KBJA 3LYEA 3NQ2A 4B5VA 3QQ0A 1EBGA 4L61A 1RJQA 1W3HA 1S1PA 3WK0A 3LPOA 5I3KA 5FCZA 1V02A 3ZZ1A 4WUIA 5MHBA 3HGOA 3URAA 2PBGA 2WNWA 4B5WA 4LVBA 4CCZA 1H49A 4L65A 4QE1A 4ILSA 3CPGA 3WEOA 4JTIA 2J66A 5A6TC 4A8IA 4GJJA 2DSWA 1E55A 4ERGA 3OBKA 5GNZA 3SCPA 2TAAA 5EMYA 3P82A 2WHLA 1A5AA 1AZ2A 4JOMA 3CNYA 1GJUA 5IRPA 4TOQA 4BF7A 1YLVA 1KQYA 4O53A 5A6SA 2VFHA 4Z2IA 1K8ZA 3TSDA 3F4NA 4QRNA 1AQFA 1PX4A 4KKXA 3T8QA 3ABSA 1XYFA 1VBGA 1SPQA 1W3KA 2WSRA 4J28A 3BLPX 1UP3A 3IPWA 3C8FA 2E77A 4S39A 3SAZA 4M80A 3GG7A 3WMCA 4ZO8A 3EDDA 3PPHA 1V5XA 4AISA 3EB4A 3IK2A 4W7UA 2CC0A 3QMTA 3BWWA 2EGZA 3W88A 4WVXA 4KRUA 1RR2A 2YA0A 3W1RA 3M9YA 5XINA 2EPMX 2W9MA 4Z2HA 2J24A 1LORA 1RQEA 4ZFCA 5LHEA 4AMCA 4M82A 5DLCA 1JD9A 3GO2A 1BF2A 4LVDA 4EOUA 2VQUA 3AXXA 1J0JA 4LVAA 1YPXA 3MDUA 4GA8A 2NUYA 2YDRA 2EJAA 3FY1A 1M01A 2RDXA 3G3DA 1J5SA 5C0QA 3T81A 3VM7A 3M5ZA 3EPOA 1XRFA 3BMWA 1WXZA 3BDKA 3QY8A 4IH3A 3S6TA 2CLIA 2VWTA 2UY4A 5EA9A 3NL6A 1GOKA 5L6UA 5BOFA 4IP7A 4W88A 4LC6A 4GC3A 3VIOA 5CG0A 4FXFA 2OWXA 2X7VA 2HROA 3F4DA 2GQ9A 2Y8VA 3VILA 3O16A 2C71A 3WIJA 3W70A 3VCNA 2HNEA 3AUOA 3D3AA 4N4PA 1FWWA 3TFXA 5GPRA 3VKJA 5HR6A 1ECEA 3QR3A 3UWYA 1WKYA 4XV0A 1R5YA 3RLUA 5EBAA 3MMTA 4GUHA 3KE0A 5A6MA 1T7LA 2DZUA 3DFPA 5F4SA 3REQA 3GTXA 1JDCA 2IQTA 1JQVA 2E3ZA 3JZEA 4AC1X 2PE4A 1FQ0A 2BBFA 3MP3A 3KOFA 2QPXA 4LY8A 1GYMA 1JDAA 5AHNA 3V0TA 2QCDB 3MV01 3L67A 4OHQA 1M5WA 5LYRA 1PZ2A 3H4WA 1OYAA 3VMPA 1KB3A 1I0BA 1JXKA 2PP3A 4WSHA 5ABTA 4UIOA 5FF3A 4GYJA 3OYXA 3UJRA 2R1NA 5IHRA 1S1RA 3OIHA 3F4CA 3D0CA 1EF2A 3PZ9A 5LNVA 1WKEA 4FMVA 4L7ZA 1IE7C 3QLDA 3AIUA 5F1VA 1BQCA 1EJVC 2O92A 3LCIA 3SCTA 2ZXQA 1O6IA 1OFOA 4QBXA 3M0HA 1ZNNA 4IUOA 4CGTA 1NF0A 3S0CA 3GXDA 1NIUA 3W01A 3IGSA 1SR0A 3QHMA 3QQ1A 3HA1A 3BH4A 2OTDA 2SFPA 3BCDA 5I3JA 2P50A 4ZQNA 2X41A 3FEMA 3L5MA 4O1BA 4B2DD 3VIJA 4NY2A 5I5RA 4P8XA 2W66A 4RL3A 2VDHA 2X1RA 3C3UA 1EB3A 5HOSA 2D22A 4MZ8A 3BG3A 5BRQA 2P76A 2YBVA 4K8GA 3KBWA 4B16A 4PUJA 3ARUA 4LWWA 4OV9A 2BHUA 3QV8A 3SSJA 4DAFA 5E0KA 4JIIX 5I23A 3EBVA 3S2NA 3H24A 2NLIA 3VINA 3DBPA 3ABZA 5LIYX 4AF0B 5LGZA 1RBLA 3DIPA 5U7SA 4MLRA 4Q4SA 1XH0A 3BJFA 3NQ6A 1Q85A 2XWEA 4YCPA 3WNNA 2O7QA 1AVAA 2WJDA 2ZE3A 1Q6LA 1W2PA 4E4UA 1NSJA 1ZRQA 4PTXA 1Z89A 1DIKA 1M65A 3U6WA 4B5UA 3GDBA 6ENLA 3N2OA 1E9LA 4DYKA 4BEUA 2F9RA 1FCUA 1UUQA 1VAHA 3GU1A 3B4YA 4REQA 4CUCA 3M0IA 4WKAA 2HE8A 2J6XA 3NA8A 3ARTA 1RA5A 3VIPA 1QATA 3GIYA 1S3TC 3TNOA 5M1TA 3WDQA 2CZEA 3QXBA 2C1HA 3PB2A 1XGEA 3WLMA 4MJMA 3TW6A 1QPKA 1NFGA 2WSQA 2YBUA 4IMAA 1KRMA 4XD6A 4JQ3A 3MU7A 4XAGA 4A29A 3OYZA 3VD5A 2OPJA 3N3TA 4Q8TA 3LQGA 3KEHA 2VRJA 4UTUA 2F6XA 5JQ9A 1ONXA 4S1FA 3WMBA 5BU9A 4A35A 4U5IA 4FNTA 1A4MA 1JEZA 1K9FA 4DUOA 3E02A 1DBTA 1JAEA 3RAOA 2A4AA 3EMCA 3T2PA 2XH4A 1YNYA 3MCNA 1FTXA 3LHUA 3VAVA 3IARA 5LIWX 5GJMA 4HZ6A 1DIDA 2FPYA 1T40A 1W6TA 3O3RA 3QFEA 4M7SA 3SRKA 4AYSA 3GU2A 5HPOA 5HPCA 2I5QA 3MZ2A 3DH7A 2X40A 1J0IA 2EBNA 1BQGA 3STPA 3HG3A 1ZTVA 1SZGA 1XSIA 4HMNA 4Q4PA 1PTGA 3U5YA 4JX6A 9XIAA 1NU5A 1XLBA 3SFKA 1H62A 1V6UA 3TEVA 1VBJA 4HB7A 5LNUA 4KWSA 2YLAA 3BGAA 4AZ6A 3WUFA 2HPMA 3W02A 4OV4A 5I6SA 1DOSA 2HVMA 3WQ5A 3CAQA 3CGTA 3FSTA 4NI8A 1JCYA 3PUDA 2OZ8A 4Y7EA 3F7JA 4MJZA 5J8LA 4TTGA 1EP3A 5IHSA 3W7NA 2A7NA 1E73M 3T55A 3MUCA 4UTMA 4PL1A 2ACSA 5CGQA 3CH0A 2NQ9A 1BRLB 2V2HA 2DUXA 4MLJA 4GBDA 2OWCA 2VL4A 3VOHA 2CBIA 4IL2A 2EHHA 3EYPA 3ARWA 2ZZ7A 4KMQA 2BVYA 1OC6A 1YDVA 4YXGA 5H8UA 1O95A 3W23A 1IXPA 1A5BA 4WSJA 4OBTA 3FK4A 1LWJA 2WHKA 3BQ6A 2X30A 3VKKA 5D2TA 4H8HA 3TNBA 1RK6A 1TTIA 4J3SA 4WEVX 1KV8A 3WLIA 2VM8A 4M3PA 3CTTA 3WG6A 3DHFA 3TV8A 1RSCA 5CGTA 2ZA2A 3LUTA 5TF0A 4QM1A 2Z2AA 2CBJA 1KKOA 1IF2A 4PB5A 1IXQA 1KBLA 2ISFA 3FXYA 1I2PA 4BWLA 4DO6A 1XSKA 3S1GA 4CD7A 1C9WA 1PZ3A 2CLOA 2OSXA 4ONVA 3CMGA 1Q65A 1FWIC 1PYMA 2NVCA 2PDWA 3MJYA 3SUUA 2Y7GA 2YGYA 4XIMA 2DPEA 1O4UA 2XVKA 3TXZA 4FXRA 1XISA 3AHTA 3GHTA 2BLEA 3EX2A 4JQ2A 1KTBA 4JL1A 5A8NA 1RBAA 3V1HA 3R4IA 1RH9A 1ODZA 3CUJA 3URBA 3I7RA 4UTJA 1TWWA 2TPSA 3PN8A 3LPGA 3GH4A 3GR8A 2QJJA 5H1WA 3ES7A 5C9ZA 3SUSA 1Y5WA 4N9CA 4K8EA 4MJ2A 2BFGA 4C6LA 3MYPA 3UJFA 2DORA 2YW3A 2DZPA 3UXIA 3PSWA 4JKKA 1HO4A 3LV6A 4MWAD 3VXGA 3G1DA 2X0SA 2X0YA 2IPJA 2WSPA 4W7VA 1G9HA 4ADUA 2WZTA 4IOTA 4L80A 1A5LC 4KF1A 3GNRA 1LLZA 3VA8A 4WDWA 2WKJA 3M0KA 1OGSA 3GXTA 1L6SA 1UIPA 1MRQA 4D72A 2G95A 5D33A 4YTRA 4NRRA 2INEA 1E0UA 1SVDA 3CUIA 3UP8A 3CZJA 3VC5A 5G1YA 4OU1A 4BWLC 3BG9A 1UB3A 2QV4A 1IXOA 5HNTA 4O8AA 1S2TA 4FXJA 4RXFA 3WQGA 2OU4A 2A3CA 2V63A 4M6UA 3A5FA 4HK7A 3DFHA 2CPUA 1HVXA 4GO9A 1PBGA 2NUWA 3G2GA 2VEFA 1B30A 1ONWA 1QNPA 1QBAA 2Y7EA 4AVFA 4ACYA 3CS2A 3RG6A 4XKYA 1LYXA 2HMCA 1QUMA 1E1CA 4H6KA 2Y5EA 2ZZ1A 3O05A 1Z69A 4AD3A 1HVQA 2YCKX 3QR0A 5H2ZA 1N8IA 3CLMA 1AJ2A 1L2QA 2WM1A 4FR1A 4MSSA 3K30A 4FS9A 1EDTA 2UY2A 1MQRA 3AMLA 3UU0A 1K4GA 3MDWA 2ZUUA 2D73A 1CT5A 1DHPA 4LF2A 4DRSA 1A0CA 3D47A 3DENA 2VQTA 2Y88A 3TLQA 3DI0A 3O1NA 3W6MA 1I1XA 4XQ6A 1GZJA 5IBXA 3VOJA 3W1NA 1K02A 1HJUA 1BF6A 4CN6A 2WAGA 4ZQOA 5XIAA 1RP9A 2XFYA 4LF1A 1VGAA 3HFYA 2R1LA 3E0VA 3KDNA 1A5KC 1V6VA 4NVTA 4QDMA 5ABHA 1A0EA 1V79A 1Q66A 2P88A 2PI6A 4PH6A 2DZBA 4HHPA 4QE5A 3L66A 3L4XA 1EEPA 2OWWA 4ML4A 1WZLA 3PULA 4YTUA 3IJDA 1CIUA 3GXIA 3MQTA 3ANUA 2WZEA 4O18A 1NOFA 1EXPA 4ZODA 3ABOA 4J2MA 1GK8A 1Y0EA 4O11A 7ENLA 2EXOA 3LQLA 4AAJA 2J75A 4H6QA 4NSBA 1JPIA 3ATZA 4R3UA 3H54A 2VFFA 5D37A 1ZAJA 4FOUA 3KUMA 3R5EA 3W07A 1WUFA 4GQRA 3AICA 3B8VA 3JU2A 1QK0A 2XIQA 2ZWYA 1NDYA 3WJSA 2XH2A 3UF9A 1MFUA 1P0NA 3H53A 2INZA 1RHCA 4CN4A 1ZY9A 2OT0A 1F4AA 2FYMA 4IX2A 1DWGM 3NWRA 4RR4A 1B2YA 3CV2A 1S2WA 3GBEA 2YA1A 3R1ZA 3ARSA 4PODA 2I5GA 4AZBA 1V6WA 2VDIA 2GUYA 5SWUA 4AEFA 1MSSA 1VR6A 3AS1A 3ZYZA 3EKGA 1DTNA 4V15A 4YU1A 4DZHA 3ARPA 3HBLA 3MT1A 1RCQA 4K1GA 4GUIA 4M51A 2DP3A 2W91A 5BXSA 1W9PA 4UQ9A 4IP4A 3W7OA 1XPGA 2OODA 4H19A 5IBXC 3NTYA 2KAUC 3UR5A 2REQA 5CJNA 1G4PA 3U4AA 3HJEA 5CC5A 1UOKA 2RJGA 3N34A 3A9BA 3BARA 2QF8A 3QPZA 4PUDA 3WY1A 2ZRZA 1FWSA 3M7SA 1W1YA 4I8DA 3EEZA 4J7RA 8A3HA 3NQCA 1XYZA 3ABRA 3W9ZA 1XLHA 2G41A 4ECLA 4WOZA 3O8AA 1PYFA 1JZ6A 3UT0A 1AH0A 3KVMA 2YKKA 3ES8A 4O1AA 5EYWA 2J8TA 5K9CA 1NOWA 3NNTA 3AIBA 1UUOA 4UMBA 3UGRA 1E5JA 3CMJA 2PU0A 4LUSB 3PNZA 3TTEA 3L21A 5FJTA 4IT1A 4GC4A 1QR7A 2YFNA 2R1MA 2DZWA 1ZB5A 3UNDA 3ZJ6A 5AYXA 1U5JA 3GVRA 3RN6A 4D6FA 4GFIA 5TBOA 2DZTA 4HPXA 3IIPA 2D2HA 3RGTA 4BZYA 2OOGA 1WDQA 4H9XA 5HNNA 4IMCA 3KL5A 4C91A 3R0UA 4TUFA 2NWRA 1S2UA 6PTDA 1KV5A 3NUKA 3TTYA 3MSGA 4YTSA 1I2RA 3GLCA 4PMDA 2OJPA 3KRUA 3UESA 1JL8A 3MI3A 1AODA 4QG8A 2JEQA 3QTGA 3L4UA 1O12A 5D4YA 3W7IA 3S2CA 2VZSA 4PUUA 1HGWA 4K7YA 2B7QA 4G6CA 2V3DA 4PTMA 2H8ZA 3REQB 3E6EA 4NZ4A 4MWAA 1G7UA 4A6GA 4JHOA 3FA5A 4MKNA 1HJSA 3OODA 1V6XA 4UR7A 8RUCA 3ZMRA 3MS8A 4QG9A 1G4TA 2WLYA 1E0VA 3WCZA 4D6IA 1UWRA 3WQCA 2BY2A 1VRXA 3LHTA 5EMUA 4BY3A 3KWSA 3HZ3A 1ZS2A 2Y7FA 1CXFA 1RY0A 1XLDA 2I5IA 4M29A 2YCIX 4ZENA 1OFEA 2L5HA 3S9YA 1UJPA 3FS2A 2OYKA 1F07A 3OP2A 3LCGA 4FLOA 5AC8A 3MP4A 3EA3A 4NJHA 4L6DA 1XG4A 3IGHX 2VC9A 4TMCA 2QJHA 2PLKA 2V68A 5ECVA 1YADA 3MUZ1 4F9DA 1C8XA 4W8LA 1FWNA 2OGJA 2CZVA 5FSDC 7REQA 5I79A 4RE0A 3B9NA 1P6WA 3PTQA 4U2ZA 3P8IA 3N04A 2ODOA 1E1EA 1VJSA 4JEQA 4YVPA 1QHZA 2Y4SA 5CZSA 4P5UA 3WQ8A 4LYPA 5CPOA 5D2XA 3RM9A 4GWEA 3FAXA 5C9UA 3QEZA 4KWWA 3QOKA 4GYFA 3R12A 2O55A 4IL0A 1YRRA 5C7VA 1D3GA 2W27A 3NQFA 1JPMA 3OZPA 4NXKA 1SJDA 3VD9A 3BJSA 3R0KA 3WBEA 1TIWA 3R8GA 4MWAC 4R7JA 1W3LA 4RE4A 4A2SA 4HA3A 3CC1A 4QAIA 1VP5A 1CGTA 3B8TA 1SO4A 2EPHA 1UKPA 1F61A 4IG2A 4CEUC 3B8UA 3M0MA 4RZ4A 4O19A 2QYGA 3HPFA 1UH3A 4L9YA 3P8JA 1UBSA 1HTIA 4G7FA 1V3HA 2J25A 4FK9A 5KZ6A 3EWBX 4GO8A 1EC9A 2NX9A 1RA0A 1WNOA 1JF5A 2OQHA 1QW7A 3DC0A 1RY8A 4OFCA 3PANA 4LQ1A 3PZGA 3K46A 3VI2A 1J10A 4KIEA 3W7RA 4NUWA 4J3UA 3THUA 1GQKA 4J3XA 3U7VA 4C1NA 1XICA 4O57A 3O63A 3H7UA 3TOPA 2I9EA 1QXLA 2A3AA 2DT3A 1KKRA 3MI6A 1B90A 1FDZA 4UBPC 1PZ1A 1EFZA 1US3A 3UJEA 1CEOA 3VIGA 1ZZMA 5D30A 2PD9A 3KBVA 5CSSA 4FNRA 3AYRA 3H70A 4U3AA 4XAYA 1I4NA 1R7OA 2XZ7A 2ZRWA 3GRIA 3PTKA 4AZ7A 1G01A 1KM0A 3ZLHA 4X0VA 1F8MA 1OCQA 1Q5MA 5CLTA 4M6PA 3CZLA 1KD0A 2H9AA 5HINA 7ODCA 1JNEA 4H8VA 1YKWA 5H8PA 2JGYA 3B0YA 4KEUA 3NFUA 5HQMA 1QK2A 2NV2A 3FYYA 4WIWA 1GWJA 1FHUA 5HNUA 2BB0A 3VOCA 4O4WA 1V3JA 1BXCA 4CQ8A 1REQA 3GNPA 5LNWA 2ESCA 5AYIA 5LKYA 1GOWA 3FGCA 4XD5A 1FH8A 3KBSA 4QX4A 5J5DA 2FMNA 4O1FA 1NM9A 1VENA 3MPGA 4JDBA 2CESA 2PPGA 2D23A 5DMMA 2WC3A 3M7WA 3URNA 2BTMA 1N8FA 4CU8A 2ZUWA 2E7FA 1OF6A 2FH6A 3FVDA 2PTDA 3WBWA 2OVLA 4RZBA 4Z1BA 2FZ9A 1VHCA 4LAUA 2Y0FA 2RUSA 4JHZA 1DWAM 2J79A 4AD0A 4X2PA 3V18A 3H7RA 5I03A 1K7EA 1Y8BA 4CD5A 2VVNA 3EX3A 2C1GA 4WJEA 2GSEA 2E28A 3VZXA 3ONCA 3W1TA 1L2UA 1E15A 1P7TB 2F38A 4GJIA 4S2BA 1F6KA 3EX4A 1H7PA 3HG4A 4Q4MA 3ZJ8A 1P1XA 4D1JA 1KBJA 2QUTA 4HSOA 4A21A 5BWAA 2QDGA 3B0PA 4GI6A 2Y62A 1V03A 1DJGA 1BG4A 1KFWA 3A24A 1SR9A 4JTTA 2CLPA 1UR2A 2VGIA 3PBUA 2WHJA 3LBMA 2E9MA 1HKKA 1GNXA 4R88A 4HN8A 1ZJBA 5AHLA 1VCVA 1YXDA 1WZKA 4PCSA 3FXGA 2PU1A 2A7PA 1JCLA 3CHFA 4ZSTA 2PGFA 6XIAA 2NVDA 3DHDA 2WJZA 2CW6A 1K03A 1K77A 2YCLA 1G0CA 4NT0A 1CPUA 4MIMA 3A9IA 3IRDA 1H4PA 3KHJA 7A3HA 3QKZA 4A2RA 1HKJA 4QDPA 1PEZA 3W1MA 1MW2A 1PZ0A 3G3MA 4N0RA 2A3EA 2PDQA 3WFLA 4CD8A 1FRBA 3MUIA 1ZUAX 3CUFA 3W28A 3UWUA 1JCMP 4Q6XA 2OELA 2Z1KA 4F0KA 4NYYA 1X7IA 4KESA 4DYEA 1GHSA 5JIPA 4M24A 3CL6A 1DP0A 1QOQA 2QW5A 1YXCA 4WR3A 3SZ8A 1PCKA 3EWCA 1ZBVA 1D2KA 1EZ2A 4XZNX 3ANYA 2F8QA 1TO3A 4MNKA 3BE7A 3MV11 4I3GA 1JDDA 4LPCA 1YX1A 4Q4RA 1PPIA 3KP1A 4UTFA 5PTDA 1K8XA 1JVNA 3S47A 4XUYA 4QSFA 3U48A 5CC6A 5JBFA 3GXNA 3DFQA 4EANA 2PLMA 3SGGA 4HD5A 1AD1A 3KRSA 1MVYA 1Q63A 3ITVA 2D69A 4UR9A 2XVPA 3WD0A 3G1AA 1DJIA 4LNYA 3NQAA 3BW2A 5CLWA 1TPVA 2W3ZA 5IFTA 2V0TA 1A4LA 4DLFA 3AS2A 4Z42C 3H6OA 5A95A <