4YTTA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 6-deoxy l-psicose
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
total genus 117
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4yttA00
4Q7IA 1DE5A 4GLEA 4QEHA 4QE5A 3C0SA 1XLCA 1XIJA 3CQIA 4US6A 3ITTA 1XLHA 4X61A 1TZ9A 2J6VA 3P14A 4HHLA 1MUWA 1XIIA 3KCJA 3AYVA 3QC0A 4OVXA 3VNKA 4DVOA 4YTQA 4XSLA 3KTCA 8XIMA 3UXIA 4XIAA 4E3VA 6XIMA 3BZGA 4LNCA 3M0YA 4YTRA 3XISA 3GNXA 2QW5A 4X60A 1BXCA 3NGFA 3CQJA 2NQ9A 1GW9A 1DXIA 1XLMA 3BANA 5XIMA 3M0VA 3IUIA 2GUBA 1QTWA 4W4QA 4HNOA 1XYCA 3KBWA 3M0XA 3TC3A 4G56A 3XINA 4DUOA 3U3HA 2QUMA 1XYLA 5B7ZA 1XISA 2Q02A 3P6LA 3FVMA 1XICA 5XIAA 2NQJA 9XIMA 1I6NA 1XLIA 3KBMA 4HHMA 4K1GA 4ZBCA 1S5NA 4KW2A 5B7YA 2XISA 1XLJA 1XIFA 3UA4A 3BZJA 5FA5A 1XLDA 1QUMA 3U0HA 2GLKA 1A0DA 3ITLA 5I7GA 3CQKA 1A0CA 4XKMA 1YX1A 1S5MA 3QXBA 4QE4A 1XIDA 2GYIA 4PFHA 4ZB5A 1XYAA 3L23A 1XLFA 3DBNA 1CLKA 1DIDA 3OBEA 4GQBA 2QULA 4K3ZA 1XIHA 3VNIA 3KCLA 3M0LA 4A8IA 4GJJA 4EACA 1XIEA 1XIBA 1XIGA 1XINA 1I60A 1QT1A 4QE1A 4PGLA 1XYBA 5H1WA 3VNJA 3CNYA 4QDPA 1XYMA 2NQHA 3VNLA 5EMLA 3KWSA 3AYTA 4XIMA 3KBJA 3XIMA 4YTSA 3N4AA 2HK1A 3QYSA 3BDKA 2XIMA 3DX5A 3KCOA 8XIAA 3C0LA 3IUHA 5EMMA 3CWHA 2HCVA 5TNVA 4A8NA 1XLKA 3TVAA 2G0WA 2ZDSA 5AVHA 6XIAA 1XLBA 2I56A 3LMZA 3KBNA 3AALA 1OADA 4XSMA 2X7VA 1O1HA 3M0HA 4XISA 5EMKA 5EMJA 3KBSA 2OU4A 1DE6A 3QZAA 4EAYA 1XLGA 3KBVA 3CQHA 5C9ZA 3VYLA 3ITVA 3WQOA 1XIMA 4A8RA 5J8LA 1D8WA 2G4JA 3UA3A 5H6HA 3M0MA 1BXBA 4J4KA 3BWWA 4QDWA 4HGXA 3C0QA 3VNMA 5XINA 1MNZA 3AAMA 3JU2A 7XIMA 4ZB2A 1XP3A 2QUNA 4YTUA 1K77A 9XIAA 2ZVRA 2HK0A 3UVAA 4ZB0A 2XINA 4GJIA 1XLEA 1XLLA 1DIEA 3ITXA 4YTTA 4QEEA 2GVEA 1A0EA 4A8LA 4X63A 5AVNA 2X7WA 2I57A 3ITYA 3IUDA 3ITOA 1XLAA 5B80A 3UU0A
chains in the Genus database with same CATH superfamily
3ARYA 4BI5A 4JDYA 3LCGA 1G7UA 2DZPA 3DI0A 3QV8A 3VM7A 3KS6A 2F9RA 2Y61A 5LSMA 4WSJA 5DRCA 4MIMA 2YFOA 3GNNA 4NNBA 4S3EA 2WBKA 1R2RA 3W7JA 2ATMA 3RRAA 4NVTA 1OFDA 4AD3A 4F79A 4LRTA 3HG5A 3VGGA 3WJWA 4E4UA 4KEVA 1EJUC 3M5ZA 3W7NA 5DT7A 5ABGA 3DESA 1RBLA 3DDMA 4N02A 1ZAJA 3CZ8A 4H7CA 4DF2A 1KTNA 4ZENA 2Z7GA 4Y90A 3HOJA 2X1IA 1DTNA 4QSHA 1FP8A 2AMXA 3W2NA 3CT7A 2J9XA 1N55A 1L8PA 2NX1A 3BQ5A 1XCFA 3K8LA 2GVLA 4Y2WA 3TSBA 2QJHA 3WQOA 1UP2A 1K03A 3BICA 1F3WA 3P67A 1SZNA 3QSRA 2TMDA 2Z2UA 4AIBA 3WY1A 5FSEC 3S47A 5GQBA 1ISXA 2C71A 1EHNA 1YIXA 3E74A 3O9NA 4L1GA 3W1LA 1QI5A 3BXWA 5LNRA 2DZUA 3GVVA 1GUVA 4YS1A 1MVYA 1CTNA 3D3AA 5A6KA 1W1IE 3C2FA 3E38A 1MZHA 1S3TC 2E5CA 4GXMA 3ZR5A 2QKFA 1X7IA 1QAPA 4WKAA 1ITUA 3D46A 2ZUVA 1FX6A 3QPEA 5DRIA 1V93A 1UD4A 2QVNA 3CT2A 1VP5A 1QW8A 4K7VA 4D71A 2ABBA 2D73A 4L9XA 1OM0A 1O5QA 3VD5A 1KM5A 2XFFA 3NO1A 3TJXA 3FJ4A 3VOCA 3CC1A 3TZFA 4B15A 1QASA 5M03A 5K4XA 3GDTA 2X42A 4XIMA 1WZAA 2ZYFA 3LM7A 3RUBL 1NFPA 2ON3A 5C2CA 4AH7A 1BYAA 3DZ1A 5FL0A 2PTWA 5EMKA 2W91A 3WQ5A 1WKDA 2OSWA 3LRKA 3EKGA 2YCLB 2VEGA 1ZNNA 1HVXA 3GS6A 5D09A 1Z41A 4KF1A 3WNOA 4UTLA 2W61A 1EUAA 1FWJC 3UJ2A 1BLIA 2KX9A 2D69A 2D3NA 2QUNA 4A22A 4S38A 6REQB 3GLCA 1WX0A 4XZWA 3SRFA 5KEZA 1F74A 1FWDC 4NXSA 4UIOA 2NV9A 3A9BA 1W1PA 2INEA 2PODA 3MMDA 1NWRA 1QI4A 1V08A 3BVJA 3SBFA 3DG7A 2D20A 3LCFA 4HK7A 4JNMA 4Q4KA 1QNVA 1I2RA 4LTSA 4MB4A 3G24A 2RDXA 3LA4A 4F2UA 2RAGA 4A4AA 3M5YA 3UFYA 2W27A 1KM0A 1OT1A 4LB4A 1BSLA 1OK6A 3PVFA 3KZSA 2PWGA 5HDRA 4S1FA 3MCMA 2NV1A 4JTCA 5E6YA 2VQTA 4W8LA 5HNRA 3H22A 4AAJA 3PJXA 1C9WA 3LCHA 1CLVA 2WJEA 3W2KA 3A5FA 3IK4A 3DBPA 1LRNA 1V3MA 2IKIA 2CZFA 3KCLA 3EWDA 2BGNE 3FSUA 2CNCA 1XIEA 2Z00A 3T81A 3BJTA 4MB5A 1RK5A 4J2PA 2YCJA 4UMCA 1DIKA 3CIVA 3UPBA 3WEOA 1SJAA 3LS9A 1FVPA 4FK9A 3W26A 4M80A 3BSMA 4K1WA 4PMQA 3GYEA 2EG8A 5G4EA 4H2HA 2PDHA 3GIPA 1EJRC 1J6OA 1OF8A 3W7KA 2OWXA 1DJWA 3DC0A 5BROA 3E2QA 2I1OA 4NAFB 4ZCWA 3BGJA 3CIWA 3ITOA 3QW3A 4I9JA 4IPPA 3H7RA 3R0UA 2C19A 2XU2A 5CPLA 1DE5A 1WNOA 1XFCA 1F07A 3AXHA 4IMDA 4MZ8A 4WIWA 2R1PA 4MYXA 1UASA 2ZRWA 4PMXA 2UY2A 3LGDA 1J5TA 3CYJA 4EF9A 5M1TA 4RDYA 3LU2A 2ZTJA 1TVLA 3CUJA 3HV9A 3KBMA 1K6AA 1GYNA 3ZO9A 2GPTA 1GPWA 3ATYA 3THCA 3LN3A 2ZTKA 1UP3A 3NYZA 1EX5A 4DN1A 2CXGA 1NDZA 3WSUA 3BAIA 4UNIA 3N14A 4W7UA 3UJSA 3GHSA 2EPNA 3FHQA 2QDGA 4JTKA 3WMLA 4LVBA 3BDKA 3W6LA 3AS3A 1ECQA 3GIQA 2HWGA 1KWKA 4Z2JA 2DUZA 4YLWA 3S0CA 3CH0A 3BG9A 3FK4A 2PTDA 4UNKA 3VUPA 4JX4A 1V6UA 1JPKA 3WDIA 1VAHA 3CUIA 3TNBA 4UOZA 4EOUA 4AW7A 5EMUA 3APTA 2V67A 2E68A 4GVIA 1V5XA 2XPKA 1T8XA 4MJ2A 2X7WA 2FPTA 3O05A 4C6JA 3DFOA 4UMAA 3BUVA 3NQFA 1MUWA 3NL5A 5LIUX 1VQTA 3AXKA 1O94A 5HNNA 3VO0A 1TWSA 2SFPA 2QV4A 4C91A 4PL1A 4IMAA 1TMQA 5FIPA 3IPWA 4YCOA 4MWAC 4UCFA 2OOGA 3U7BA 3SI9A 5AHNA 1BGAA 3BH4A 1ZALA 1DWIM 1JAKA 3PULA 1DEDA 7REQB 1OVDA 4PUWA 3E5BA 3BLIA 2PDQA 3QZEA 1FXQA 4AC1X 1H49A 2VZOA 2VQUA 2X1SA 3VIFA 3F7JA 3N2OA 2BXZA 3TXZA 3G5EA 4PMZA 3GTHA 3S2LA 1TUFA 4QJ5B 3EEZA 2MANA 4AFYA 1TO3A 4TMBA 4QXIA 2ZX6A 2F6XA 5LNUA 1XJBA 2A1YA 2OKOA 4FLSA 2UZ9A 3UXDA 1V3JA 3LB0A 3T78A 4C6DA 1ZP3A 4UTWA 3FJLA 5D38A 1J5SA 1E3XA 4DBEA 1XGDA 3IIXA 4XAYA 3OU8A 4IJRA 3UBPC 5JQ9A 5DY2A 4J9JA 1KLZA 1M01A 4PUDA 4L1WA 4PB4A 2BXYA 1VEMA 1V6VA 4W89A 1XLHA 4J3XA 2IMRA 2Q8XA 2ONEA 4B9YA 2WSRA 3OYZA 3N4EA 3WLRA 3DYMA 4X60A 2JEPA 4ZFCA 5A5WA 1FWEC 1V3IA 2VVNA 2J9YA 2PWHA 3S2JA 2EHHA 2QT3A 1NWUA 4I5UA 1Q6LA 3DN5A 2ZRZA 1KCXA 1Z69A 3FA5A 4B3LA 4NSBA 1H1YA 1ZSXA 1IXPA 2J4GA 2VMFA 2WKGA 2ALDA 3F1QA 1GYMA 1Q66A 4BF5A 1H5YA 3FYPA 4ZTYA 4PUUA 2A3LA 2QJNA 2V82A 4IMCA 3O2LA 4WJXA 4MDOA 1E70M 4ZQCA 2RH9A 1E1FA 4DJEA 3PWGA 4MWAB 2V5LA 5FF2A 1K4HA 3LI0A 2HS6A 4E8GA 3GYCA 1EWEA 1HP5A 1J0JA 3PTDA 3DX5A 4NAFA 4Q4SA 1P48A 2BFGA 4MMWA 4PEKA 3SJNA 1EUNA 4U5IA 1FDYA 2VWSA 3ZWSA 3W1TA 1TV3A 4IWWA 4PR4A 5DCEA 2CBVA 2DSZA 4DJEC 1UD8A 2PFHA 1C91A 3ZT7A 1EPXA 3QF0A 2FH6A 2YBTA 4M6QA 4BI6A 1PPIA 3AAMA 2CLOA 4ZR8A 3LK6A 1GYLA 3H2AA 4S3BA 2V38A 3S1XA 4NILA 2ZX5A 1R7OA 4UWMA 3B9OA 4EIVA 4R5EA 1E6ZA 1YPFA 3L4XA 4H83A 5AYBA 1QBBA 2EPOA 1A4MA 3HJEA 3WUGA 3KDNA 3ISIX 2ODOA 3TQVA 3C0JA 4DO4A 1TPH1 3B06A 2NLIA 2BGQA 5LHEA 1ZJIA 1FKXA 4JCLA 3QKEA 2GQ9A 1JZ4A 3CHCA 2VGFA 5HK4A 2XJ7A 3T09A 3DFSA 5AC6A 2XIJA 3A64A 1VYRA 1YXCA 1JAEA 4LSBA 1WYIA 2YXOA 3NZQA 4FOUA 1V0LA 3GU9A 4U33A 3R5EA 1GJPA 2D0FA 3OG2A 3V5FA 4DO5A 5JBDA 4HNUA 2WMKA 4HVXA 3UR8A 3R1ZA 2W0UA 2NQ5A 4W8BA 2E6YA 3GHRA 1VEOA 3N18A 4M56A 2HVMA 5ABTA 5HOSA 2INZA 2Y63A 1XQLA 2R6OA 2XFRA 2PP3A 2EKGA 2BY3A 4AY8A 2UY3A 3G1YA 4S2BA 4IIEA 3GVWA 4ATLA 1MRAA 3F03K 4CCDA 1S2UA 3L2IA 5JIPA 3S42A 3VDAA 1AJZA 3MO4A 3AIBA 1V0KA 1IWBA 5A2BA 4KQNA 1FWIC 2CLEA 4N4PA 4DUXA 3EA2A 1R2SA 4XBSA 4EPEC 1YBQA 2V5BA 3BSGA 1E71M 3NSMA 1TUXA 2J47A 4M1BA 3WD2A 1OYCA 1XG4A 2ISFA 4LNCA 2VFEA 5RUBA 2FLIA 1AL8A 3V4BA 2JGQA 1GVSA 3NZGA 2CFFA 3KBWA 1RALA 2PAJA 3TH6A 2C0AA 5FEPA 4MDPA 3W7HA 3BARA 1CLXA 3PJTA 4M6VA 3L65A 4GIAA 4NQ1A 3P8IA 3PZMA 3HMJG 5EPDA 2ZUWA 3W86A 1K9FA 4GABA 1UA7A 4X0VA 3ZFHA 3WQEA 3V35A 3ZSTA 2R1MA 1RQHA 2X1RA 2OO6A 4DZ5A 5HXMA 3SN4A 4M0XA 4ACYA 3GW0A 4ACZB 4DPQA 3GRIA 2EPKX 1TMLA 3BOFA 2TSYA 1ESWA 4YU1A 2QNEA 1OX6A 2O9RA 4IOTA 6XIAA 4DNMA 1S39A 3MDWA 1BG9A 4LNYA 4MLRA 4Q8NA 1E0UA 1LORA 4HCHA 2GSHA 5E0CA 2DT3A 1FWAC 2OEMA 3OW1A 4YHGA 3DU0A 1UOKA 1LLWA 3W7CA 4Q8OA 1VHNA 2V5JA 4DBWA 1GK8A 4IM4A 2A85A 2E6AA 3LRMA 3VPLA 3WEMA 1VIZA 1PO9A 4QTGA 3WNNA 2Z29A 4XAZA 5IM51 6XIMA 1VPQA 1NY1A 2PUZA 4OOZA 4J28A 4YMZA 3H21A 3BMWA 2HXUA 2WC7A 3NVDA 3BCJA 1QPOA 4W7WA 2FQIA 2ZZ7A 3KOXA 4UR9A 1RP9A 1EYWA 3OLEA 2VDHA 1QWGA 5A6TC 3AZTA 1KW1A 3QR1A 5CPNA 4GYPC 4C6KA 1T0OA 5I07A 3S3GA 1M7PA 3DIPA 4KGLA 4LUYA 3VIHA 4DF1A 1BF2A 2OYMA 3O6DA 4HN8A 3CWOX 5C8BB 5GJNA 5GNXA 2C3ZA 2QIWA 3ANVA 1GGOA 5JU6A 4GZEA 1JEZA 4EWND 3LV5A 4Z1BA 3TC6A 4AZ6A 3GR7A 1TE6A 1CI1A 3B9EA 3NNTA 1A5AA 3KM8A 4N9BA 1BF6A 3UCCA 1G9HA 3UG8A 3C2OA 4JHZA 1Y5VA 2WZTA 2Z4GA 3NOYA 4PMVA 4JQ1A 1G0CA 2HE8A 1WKYA 2GJRA 1Q3NA 1SZFA 1XUUA 4JTJA 2GGHA 3W25A 3PZUA 3MS8A 2CHOA 1TQXA 1J93A 5HPOA 5BWFA 3U9IA 3PY2A 4M7SA 2AQOA 1GKQA 1V3KA 4ONVA 4AU0A 5DCBA 5JMUA 2OZ8A 3QOKA 4ILSA 4R9OA 3JUGA 1VEPA 2BG5A 1I9CB 5I3KA 1XLIA 1WBJA 2X2YA 3P81A 4QM1A 3MO7A 1TRIA 1BQCA 1C92A 3ITLA 1YXYA 3M41A 2AGTA 4J3SA 2YCIX 4RJEA 2VJXA 4UQEA 5DFAA 4K68A 1W17A 3LDVA 3W07A 3JRKA 4ICNA 3CZLA 1A5KC 4JN8A 4LH8A 2REQA 5E0FA 1XYBA 3Q37A 5CCZA 3TTOA 1NWSA 3UWEA 3UWQA 1TJ2A 1Q65A 3KLLA 1LM1A 3JR2A 4GQQA 5D2YA 1AW2A 2YDQA 5D2TA 3UERA 4R9XA 1MMFA 3QHNA 1UH3A 5F2IA 5FJJA 4RK8A 3GB6A 1JZ5A 3BTNA 4MGGA 2Z6JA 3EA1A 1XC4A 2PP0A 4JOMA 1VLWA 4AVOA 3SCQA 3AHXA 1XXXA 3HIJA 1FWWA 3UG4A 2DY3A 2XN2A 4OU1A 4QBXA 5T9CE 4L9ZA 1MUMA 1F4AA 3SFKA 1C29A 2J8GA 4HMCA 5H91A 1KV5A 4X61A 3KX6A 3LHWA 4Y9AA 3VINA 1PHWA 3ZIZA 1UWTA 1BXCA 2GDQA 1AODA 2BOEX 3PFRA 1V8EA 3N19B 4JD4A 2C13A 2F2HA 3V1HA 3M0XA 2VEFA 3KUMA 4MM1A 1PIGA 4FNPA 2XFWA 1J9YA 3TYZA 5HQMA 2Q3OA 4E0CA 4R7WA 1F73A 4ZBCA 1SJDA 1ZUAX 5D8ZA 2FGBA 3T40A 3GTFA 1VRXA 3CQKA 3ZVHB 2HBVA 1GHRA 3T2PA 5CZJA 1SZRA 3MC5A 4ZGYA 3W1PA 1XF0A 5IXEA 3H55A 1A5CA 3KWSA 1G4TA 1YE4A 2PLJA 1YTEA 1R9YA 4FP1A 1NDYA 1ONRA 3AXIA 4WSKA 3CO4A 4GZJA 3E12A 3HTWA 3EKLA 3MUZ1 1V3LA 1OCQA 4O1BA 3WFZA 1AJ2A 3U4AA 5BXRA 5CPMA 4JPGA 3W7EA 4ZQPA 3WCZA 3RLGA 4K8EA 4W88A 2HV5A 2ZUNA 2A7PA 3OVRA 5I23A 2CBJA 2DJLA 3I3DA 3T1GA 2VENA 1ZY9A 3R12A 1CXIA 2INFA 3NQ8A 4KESA 2OZ0A 4PUNA 3R0KA 1SVDA 3PF3A 1ZAIA 3NQ2A 4DM2A 5I77A 4WD0A 3VC6A 1TELA 2OEJA 3C0SA 1PCWA 1LF1A 4LPCA 3AQUA 3H70A 1O5RA 2HDJA 3IRDA 4Z1CA 1RA5A 2EXOA 3WL0A 4CU8A 2O56A 3C2RA 3DYOA 1OX4B 4GY0A 4G56A 3GQYA 3P6LA 2YB1A 4XV0A 5C55A 5B7YA 3WD3A 5SWUA 4Q6XA 3OLGA 4HSOA 4A29A 2DDXA 3GTIA 2CLPA 4S3GA 3NSNA 3VD4A 1S5MA 3FDKA 4TV6A 4D9PA 2IPJA 3K8MA 2FKPA 2YL9A 4K3ZA 3KLKA 1UC5A 3UXLA 1Z9AA 3P7YA 1F6KA 2FGZA 3ARWA 3CTLA 1F2JA 2ZRXA 3OVPA 1EDQA 3IVUA 3O6CA 1UD3A 3BGAA 3LMZA 1W8SA 3MV11 4D1IA 1CXKA 4CQ8A 1Q13A 5CQ1A 1A80A 5HANA 3PBWA 1IIHA 2YZ5A 3THAA 4QDWA 3UD6A 2WSYA 1V6XA 2WANA 1JZ7A 1TFVA 4KWSA 3VUSA 4Z0SA 1T99A 1CGTA 3OYXA 1JCLA 4HNNA 5LGXA 4AZCB 3ENLA 1GHSA 1MUCA 2VC9A 3IJQA 3P61A 3QRHA 3EDDA 3MMTA 3QHOA 3WO8A 1VYSX 2B4GA 3MKVA 3CXOA 1D7KA 4GKLA 1SZEA 1HVQA 4W5UA 4WJEA 2NQZA 4PN2A 4KCUA 1DHPA 2PSNA 3WLTA 1KGUA 5EGRA 1VFFA 3AFBA 4IGNA 1LYXA 4MB1A 4NXKA 3V7PA 3A4XA 2XUCA 2GWGA 5EL1A 4Y9NA 4S3DA 1PBGA 3TAOA 2V30A 1FFRA 3H8AA 4HJWA 4YYCA 2GUUA 1S2CA 5CAKA 5M3WA 3B9DA 2NWSA 1T6MA 1Z8AA 3N9SA 4AXNA 4EPBC 2YA0A 2VR4A 3W1XA 3QV7A 3HF3A 1O5KA 1OIFA 3PZTA 3UJRA 1OD0A 3NDOA 2G97A 4QNWA 1SMAA 2Z0IA 1CGXA 4DX3A 4G7EB 3TW7A 1LZOA 4JTTA 1EPVA 2OZ3A 5LNWA 2FZDA 4HOZA 1OADA 2V5KA 2G8ZA 4MPKA 1XLGA 2EKCA 3EEGA 1LQ2A 3M0MA 2PRMA 2NVCA 5AB3A 3CAQA 2GJNA 4JS3A 3EB4A 5JH1A 1AH3A 3E2RA 5HBFA 1R3WA 4YL2A 1ZBWA 4HYVA 4F40A 5HINA 3SN0A 3WMBA 3NPWA 3O8AA 3P14A 3G6LA 2VELA 2FFCA 4MNKA 4HPHA 1MQQA 3WQPA 4W84A 3KTSA 5T8GA 1RUSA 5HWJA 3C52A 4PL2A 4QGCA 4A05A 3F2BA 3L21A 5REQA 3VKJA 3M5XA 3TXVA 4EKJA 5K2ZA 1DJHA 1R3QA 3FJ6A 4FR6A 2X0SA 2XZ7A 2FIQA 3EWXA 4GY1A 4RZ6A 4D6CA 2XHYA 3BZJA 4WGHA 2MNRA 4F2TA 3VKBA 3WUEA 3FKKA 2BP1A 4MUPA 1ZFJA 3O6AA 3R8RA 4AD4A 3VGHA 4IL0A 1JULA 2WMJA 4MOZA 4XZNX 5D33A 3LXAA 3MZ2A 4GC4A 1KBBA 4W93A 2B7QA 3O0KA 1PV8A 3TYDA 1QATA 4XSMA 4BEQA 2FGLA 2OQLA 4XG1A 3VYLA 1TA3A 4LGXA 1UZHA 2VZSA 1VFUA 1FWRA 2Y5JA 3TKFA 1MNZA 3F5LA 4PCFA 3GVRA 3SSJA 2C1IA 3CQ0A 4C7FA 3H4XA 2V6AA 3P0XA 4M6PA 3SADA 4J35A 2YZRA 4ASTA 3TAKA 1X6NA 3B8TA 4IGHA 4JY8A 5L9FA 2P0IA 4HZ6A 3GWQA 3MBFA 3E5PA 3KL0A 4JTFA 3R89A 4ORIA 3W02A 3GZAA 1ECEA 1N82A 5HJYA 5CPQA 3SB0A 1PS9A 1QHZA 3KHJA 3EWYA 3W70A 3UCDA 4IQLA 3IGUA 2QCFA 2GGEA 3NL2A 1MW1A 1NOUA 4U31A 3GTNA 4P8WA 4FEZA 1I1WA 1YW1A 4CN6A 5T9BG 4IPNB 3QR0A 3TFXA 1W37A 1E6XM 4QE4A 3UY7A 1VR6A 3PNUA 4L6OA 3RMJA 3CB8A 1WKFA 4GJJA 3YPIA 4QX4A 2R82A 3QR3A 5JBFA 4DZAA 4Q6JA 2VGGA 3ANYA 2VCCA 3T4WA 3DHUA 3NPUA 1SJBA 4INFA 1HTIA 1U30A 4UOQA 2NZLA 2WHJA 4AIEA 3OPSA 4D6DA 5C2XA 3KP0A 2X0YA 2TAAA 1XSJA 4IX0A 1PTGA 1GZ1A 4TVCA 2NW0A 3PR2A 1V02E 1KXQA 1Q8JA 3E02A 4OBSA 4DI9A 2O9OA 3GVQA 3L4WA 4I7UA 2QJGA 1UJQA 1DORA 1P7TA 1W5MA 3KFTA 3T8QA 5I02A 4DXXA 3MP4A 4ES4A 1Q85A 3KVJA 1LT8A 3ES8A 4LYPA 4C6LA 1UYQA 2WXDM 4PMRA 1XYLA 3W7IA 4B3KA 3O7UA 5XIAA 1XYZA 3CAVA 3PPGA 4A3YA 3RX3A 3S5YA 4FX7A 4Z2GA 3CTTA 2ZOXA 1GNXA 3WD4A 4ZTXA 2WHMA 3WFLA 2J74A 4FF5A 4ZB5A 5A3HA 3DOPA 3F4WA 4MFEA 5G1TA 4AQLA 5ENLA 4NJGA 4IGMA 3AXMA 1MW0A 4Q7NA 2DZAA 4NJIA 2QDEA 1SR0A 3AS1A 2YDSA 4O13A 3FAWA 3KZPA 2ZCGA 4DWSC 4Z42C 2PDNA 5LA0A 1AQHA 2EPHA 4CGTA 3T07A 3O6YX 3WLPA 1JF5A 5MF5A 1KXTA 3R79A 3EX2A 4A2RA 4DAIA 1S3HA 2J6XA 5A8GA 1DKWA 3NAVA 3G1AA 5M17A 4UQ9A 1YNPA 4C1KA 4GLEA 4TX9A 5IBXC 1ODUA 1PEZA 2TRSA 4JN7A 2V5DA 3THDA 4FHAA 7CGTA 2V5CA 4AD1A 1S2TA 3TONA 1R3RA 4MYAA 2WW5A 5LA2A 1QFEA 4Z1YA 1G6CA 1TV5A 1TZ7A 1XPYA 1LJYA 2HEJA 1RCQA 2FYMA 4WLCA 3MVIA 2A3HA 1S5WA 3PBGA 1UUOA 4B5XA 4XZIA 1PAMA 2WWCA 3FXYA 2ZZ3A 1YE6A 2PLKA 2PWEA 3N3TA 1FH7A 2CCRA 1VHCA 3B9AA 4KFPA 4L1XA 3CNYA 1TR9A 1U1HA 5DANA 1BWVA 4KEUA 1A5LC 4UBPC 2OO0A 3VK5A 1LL4A 3NO3A 3MDUA 4UUIA 3HPSA 2IPFA 1GVIA 1HG3A 1VBUA 5HULA 3WLOA 4O14A 4PCNA 5E5CA 1KRBC 1VCFA 3BMVA 1OWQA 5BU6A 3RO6A 1UR1A 2VXNA 2CYGA 4YTUA 3M0IA 3VGBA 4M5PA 1OSEA 3CL6A 4J3WA 3WQCA 3A13A 5BW6A 1BRLA 3EX3A 2PDIA 1FKWA 3MTWA 1J2BA 3A4AA 2Z2BA 4JIRA 4NU7A 3KL3A 4IXXA 3WUBA 1JYVA 4B2DA 5AC7A 1BHGA 1FWSA 4D8ZA 4GIEA 3OHIA 1ALDA 2NT0A 4IMEA 4V2XA 2DORA 3D6NA 1OJXA 1J0ZA 1MXSA 3HPXA 4L61A 1E56A 1QTWA 4RXFA 3GHUA 3TZNA 3PZGA 3W1UA 2ANUA 2V3FA 3K1GA 1L0PA 3UYCA 3EWBX 1H7OA 5CXPA 3KRBA 2ALRA 2AQWA 3T2QA 1TTJA 1O5XA 1LL6A 4HK5A 2WMGA 5CSRA 1Q6DA 1I0DA 4R7OA 5T91A 2ZZ2A 4RR4A 3SQSA 2NVAA 4PRTA 4XX6A 2FHBA 1Z89A 1AQ0A 1P7TB 1ZL1A 4M81A 4NZCA 5EMLA 3VDGA 3M7SA 3RF9A 1W1B1 3R11A 2C1GA 4NX5A 3WQ8A 4DJDA 1HO1A 2ZDSA 1ZQ5A 1PVNA 4B16A 2HE5A 3PZOA 4J3ZA 2DSUA 3SUTA 3G8EA 1B30A 3USBA 2VC7A 3VI2A 1PZ0A 1WDRA 2HTMA 3Q58A 1MEIA 1K1DA 4GACA 4JIIX 1OC7A 4ZMGA 3RM4A 1G69A 3CU2A 4RX0A 4TU1A 4Q4RA 1LL7A 3DG6A 1XPGA 1OFAA 1AH4A 1I2PA 3G8RA 3TCEA 2G4FA 2JK2A 2WAGA 4GX8A 4LJ3A 2XIQA 4QEHA 4XUGA 4PYSA 3QYQA 2G3MA 1M6JA 1E6RA 4K7YA 3GZ3A 4XVDA 2XSXA 4AZCA 1DWJM 3AROA 2DUAA 5A6BD 2JF6A 4HZMA 4Z1AA 1BSIA 3R7MA 1JPMA 3U48A 3GUWA 1W1ZA 3TC3A 1MRQA 3W29A 3QPZA 1H11A 2P88A 3SZ8A 4XAGA 3TOYA 3PSWA 1NEYA 1WDQA 2HS8A 4Z2HA 2Q6ZA 4MSSA 3BOLA 2CZEA 2ZC1A 3ZJKA 1WUFA 2R94A 4O8RA 9RUBA 1KFJA 1IZJA 3GC2A 4QCEA 2CWXA 3UGVA 4JL2A 4LFYA 5FD0A 1EO7A 1RP8A 4S3AA 4UQAA 1CGYA 2W4XA 2PGWA 3N73A 1SR9A 4ATWA 1XRFA 2DT0A 3AOFA 4XAPA 3C2YA 4PTWA 3G1FA 1ZTVA 3CMGA 3U57A 3SCVA 4E4FA 3IIVA 5G2IA 5TQLA 2AKZA 2OMAA 5F4WA 2QMJA 4HU8A 3VX0A 3PPHA 2E09A 5JUVA 1JPIA 2FJUB 3AHVA 1XCWA 1GORA 1ZAHA 1LWJA 2H3DA 3MT1A 1KR0A 4NX0A 3VZYA 3M16A 1DQWA 3WF2A 1KRMA 4RNIA 2GJXB 3GM8A 3A3HA 4EVZA 5D9OA 3SCNA 3GH7A 4I8DA 2BZNA 1EWDA 3P74A 3II1A 3ZM8A 3M0VA 5DQPA 3UP8A 4CD7A 4K6AA 3KOWA 1K8CA 1K02A 1W3LA 3UW6A 5D32A 4AEEA 1S5NA 1QOXA 3MCOA 1UUMA 3UJEA 4Z2LA 4IF2A 4IFRA 3RGTA 2VKZG 4IPLA 3WLLA 2CBUA 4DJFA 4IFOA 3PBMA 1AFSA 1BYDA 3SQMA 3RPDA 4NHVA 2YPIA 1K7FA 3HQPA 4D1JA 4AWSA 1GVQA 1MI3A 1VC4A 2WCAA 6REQA 3UY8A 1L2UA 2CETA 3MP5A 4JYFA 1GJUA 2QCCA 2VL4A 4OWGA 3LTYA 1R47A 3QMTA 2GQ3A 4N9EA 3SJ3A 4KRTA 4XBKA 3IANA 4O57A 5PTDA 4X3ZA 2WMFA 4FXRA 1FWFC 4JR5A 4KWVA 1BXBA 3KTXA 4CD4A 3TE9A 4HSNA 3HPFA 3N11A 5AYZA 2DGAA 1CECA 3QH2A 3W83A 3OA3A 3BLLA 3E0FA 2EQDA 1KO0A 1DIEA 4TX6A 3FJNA 3UZ5A 1SO6A 2W63A 4WXZA 1JDCA 4J3VA 1MSSA 1GJWA 3DFNA 2Z1BA 4DJDC 2ZZ4A 1JIBA 4AZHA 3WH7A 1KBJA 3WLIA 3N2TA 2X09A 5ECUA 3HG2A 1EJ7L 3ECQA 4FO4A 3WJYA 3E9AA 1MFVA 1J8VA 4LXFA 3TROA 1Z6KA 4MZYA 2DSKA 3WQFA 4ENLA 4ICMA 3O06A 1DHKA 2CZVA 1TPC1 3MSYA 4JTDA 3URAA 3DFYA 2FZBA 2BOFX 1U33A 3E6EA 5LKYA 3UCQA 4XVEA 1VCVA 4WY0B 2JE8A 1A0DA 5M2FX 1WDWA 4I6VA 4WJ8A 1XSKA 1P0BA 3FYYA 4GI6A 3N29A 1CT5A 1YXDA 5KZEA 4H8NA 4V1XA 4XB3A 2A7NA 3H7VA 1EZWA 4BEUA 2NSOA 4F8XA 1O1HA 3WDQA 4LUSA 1F6PA 1GONA 3AJ7A 5CG7A 3PBUA 1A5UA 3SR7A 4RCXA 5AN7A 3A47A 2HMCA 2NXHA 4ORMA 5DMLA 1EA0A 4AXKA 3HGOA 3HV8A 4PRRA 1IV8A 3STCA 4E2DA 2VCBA 3GXMA 4QQ3A 1BYCA 3GXIA 2FMNA 4PUMA 3GR8A 1NTHA 3AYVA 3U5UA 3VNKA 3LUTA 3WD1A 4RNFA 2VFDA 1V03A 3UZJA 2EO7A 1UKSA 3VIIA 1DXFA 2PD9A 5AYXA 2P10A 3SCSA 1FCVA 4O1EA 3QOMA 5B7ZA 5JH2A 1DL3A 1XICA 4ZQOA 1F5ZA 2DIJA 3GFYA 3Q65A 4WDWA 4KWUA 2V9DA 4KWWA 2FB2A 2D3LA 4RXGA 3SUWA 1DJIA 2VGIA 3N6QA 3QW4B 3UWYA 5E9XA 1SM9A 4IIHA 2ZX9A 3ZYZA 4H9YA 3EDFA 3KBJA 1PCKA 3GC5A 4Q4OA 3VFCA 2E77A 4WX2A 2HCVA 1C3FA 4PE8A 4QRNA 3IJ6A 1FWNA 4IIFA 3TW9A 1LROA 4RDWA 1JJKA 3VD9A 5REQB 1DWAM 4GWEA 1Q4WA 1JUKA 1W5NA 2XVLA 4FI4A 2R8WA 4N6FA 5MKGA 1R0MA 3KRSA 4FX6M 1I1XA 4I9MA 5XINA 3UR2A 2XVKA 4M8UA 4JZ5A 1ZB5A 1FCBA 3WN6A 1K77A 9XIAA 4GPNA 1X98A 2ZQ0A 2PF8A 1DVJA 3GXPA 5AVNA 3WUFA 1B3OA 1T7LA 4BR1A 2C8NA 3RPTA 2QQ6A 1HL9A 5F4XA 4GO8A 4KETA 4V33A 4CVWA 3K4AA 2A2IA 1WB0A 1JD7A 2WHLA 4AIUA 3W27A 1GW1A 1XDJA 3MYPA 3CUGA 1VRDA 4YVXA 1NIUA 1KM4A 3IIZA 1UKTA 4Z08A 1SZGA 3IJ7A 2WSKA 1XRVA 2OR2A 3WD0A 5CAHA 4ADTA 2GLKA 3TTYA 3GXTA 3CAKA 5DN1A 1PX3A 4LX4A 4DRSA 6TAAA 4E2BA 1X97A 3DGRA 3NUKA 1QO5A 4HTBA 3BE7A 4NT0A 1EGMA 1FHDA 2YJQA 3P60A 2VEMA 4I7WA 2RKXA 1OC6A 3UVIA 3TV8A 2YLAA 1PZ1A 3PPFA 4JKLA 4K38A 4NI3A 4HBKA 1V6WA 2VEKA 2QF8A 4R3UA 4TR9A 2PDLA 2J7DA 3PNZA 3VIOA 1E0VA 3DFPA 4RNJA 3U8GA 4QIUA 3NXFA 2PDKA 3C8NA 4Q8PA 4Y8FA 2P3EA 3ITXA 3L5AA 3VE7A 1CGUA 3R8GA 1H63A 3WLSA 3PUDA 1LCOA 3PWAA 2IQ0A 5E70A 2CERA 2DZXA 3ONCA 4NRRA 2V69A 4NRSA 1DXIA 2P8CA 3TMQA 4A35A 3CZKA 3W1QA 1KA9F 1R8LA 2CLLA 2B7NA 4M6UA 1NWTA 2AQVA 4F66A 3CGTA 1K9DA 5C9WA 1VYPX 3HG3A 2QCNA 4FOJA 3CAWA 1GQNA 3BLPX 2Y70A 5FA5A 3T6CA 4O0KA 4B4HA 4F48A 1LBLA 4IMFA 4GE8A 3AWOA 3VMOA 2EG7A 3HFYA 1Q63A 4H04A 4K36A 4WDTA 5HMDA 4DNHA 1Q6FA 4EXAA 1R2TA 1H5VA 3IJDA 3GK0A 2XIMA 3A5VA 4H6RA 1SQ7A 2O7QA 4NZFA 3KWXA 3L4TA 2MUCA 1FUYA 3EPOA 3LBMA 1HJXA 4ECLA 1GT8A 1PIFA 1FHUA 2WC4A 4EE9A 4UTKA 1PL9A 3TFCA 3VKCA 3UA3A 5D2WA 4QLJA 3W01A 1AD4A 1S5VA 3I4EA 1B9BA 3CUHA 2OX1A 1BTMA 2V63A 4QNEA 4QG8A 3QMSA 5C5YA 2VP8A 4GNKB 3UNDA 4ZE4A 1PDZA 5C54A 3REQA 4M1RA 4Q7IA 4J5NA 2JGYA 3EXTA 5BWAA 3W7PA 3B8VA 2ISWA 3STFA 3UZYA 3EX1A 3GNOA 2P0OA 1EGVA 4I9AA 1C90A 4G7FA 4O50A 2W9MA 8XIMA 4JTEA 4PMOA 2GDVA 3GNXA 2V81A 3ALGA 4A3RA 4D6HA 4ZL1A 3WDJA 2I5GA 7ODCA 2DZVA 2FJKA 4BI7A 4E3TA 1IT8A 4NZJA 3FGCB 2X05A 3W1AA 4QLKA 3AC0A 2HPIA 1XLJA 4E4PA 3SDOA 3NIYA 3RU8X 2VWTA 4JAWA 2OWWA 4QAIA 3QY6A 1A4LA 3HM7A 4FR1A 1D2KA 1O66A 5H1WA 1O68A 3ABOA 1J01A 1US2A 1QU4A 4Y9MA 4TMCA 1VBRA 3FKRA 3TYCA 4HPNA 1CEOA 2ICSA 3AIUA 4EWJA 2XVPA 2FMOA 3IIPA 3KBSA 5DBTA 3PUGA 3PUOA 4F3HA 2B81A 1REQA 3K1DA 1D8WA 3WNLA 2RUSA 1KGWA 4PC8A 2ADAA 4C90A 3FYOA 4QLLA 3ME3A 1EL3A 2ACUA 3L2MA 1Q7QA 2J7FA 1N8FA 4RW3A 1XLEA 2VFHA 2QXWA 8TIMA 1JF6A 2ZXQA 3LNPA 5LIKX 3ABSA 1KFKA 1BVWA 3W38A 4O18A 5AECA 2E25A 4KCTA 1AZ1A 1V6TA 1NELA 3SY1A 4Y9OA 3MKCA 2V2HA 3URNA 3K5XA 1H60A 2P5NA 3LTPA 4KRZA 2QCEA 5CPSA 5I5RA 1EF2A 1GW9A 2E67A 3AMKA 3AZRA 1H0GA 3NQAA 5A8MA 5CGMA 3VZXA 2DVXA 1I6NA 2NQLA 4QQUA 4LYKA 2BV9A 4P8XA 1M53A 2QPXA 1VGAA 4E2VA 1PTAA 5U7SA 1R87A 4IPIA 2ISDA 5CZTA 2ZWZA 3IV8A 3RM8A 4PFHA 5LHFA 4NF7A 5CBBA 5K9DA 4LAKA 2W79A 3NDYA 2CWNA 2A3AA 4PULA 5CBJA 5EA9A 1UG6A 1XH1A 1IE7C 3DUGA 3GH4A 3SO7A 2GK1A 2X41A 2YYTA 3CUZA 3PTKA 4JKMA 1A5BA 4AZBA 1VFOA 1GQLA 3ZLHA 4G8TA 2D0GA 1OYBA 3S9ZA 2W3ZA 2F61A 4Z0JA 2ZUTA 1TRDA 3E1F1 4LCQA 1TPDA 4PH6A 1FCQA 4GKTA 1IXNA 3WQWA 1JDEA 4I5RA 3RLUA 3SGZA 1HJQA 5G1MA 1NM9A 1B0IA 3RXZA 1XLCA 3D0CA 3NQBA 3P3BA 4AG0A 3TK7A 4KEMA 2VYOA 1FQ0A 3ZOAA 5CJNA 2Y5EA 1TKKA 1ADDA 4KFNA 1ME7A 3GW3A 3EB3A 2FTYA 2CLKA 1LLOA 3TQ0A 2ZFAA 2WVTA 4RLIA 2O9TA 1I4NA 1JXKA 2AKMA 4HJFA 1W0MA 1E9ZB 3FLUA 4LYRA 4BK9A 4PRWA 3DFTA 4DUVA 1XYAA 3UT0A 3GTXA 1JQXA 4AZGA 4WVXA 1T40A 4RPPA 2IXUA 3V0SA 1AW5A 3L5MA 3TNOA 2DP3A 3EOLA 2YGYA 2XM2A 1CX9A 4LBRA 3S6TA 3B8SA 4BQ5A 4LC8A 4RE3A 4RNHA 2PDXA 4MY1A 3A6OA 3HGJA 4C6CA 1WDSA 1GEQA 4YVPA 2RDWA 2V68A 5TD4A 1KM3A 3P5YA 2BSLA 2V3DA 2W62A 3AI0A 1W9PA 2Y85A 4KBXA 4R27A 3GU1A 4WSHA 1SUXA 1DWHM 3WK1A 1FWBC 4ZB0A 1VPXA 3TJIA 2JFEX 1Q6RA 5HWMA 2I57A 4B5NA 1VH7A 4W5ZA 3RR4A 3LQGA 1L8NA 2Y1HA 4CQBA 2YXXA 1WA3A 1CW2A 1VS1A 2Z28A 1AH0A 3EMQA 5AHFA 1E9LA 2HQAA 1NF7A 4GJ1A 5XIMA 5C2GA 4J7RA 3RMEA 1C8YA 2IQDA 1Q45A 5EB8A 1XISA 4H2CA 1I2QA 1HP4A 2QAFA 3L0NA 2NUWA 2HVOA 3H2CA 1N7KA 3SRHA 5TF0A 3VGFA 4JXCA 4JFVA 3O16A 1OX4A 5DMMA 1K9TA 1OB0A 4GRSA 4A8IA 1XIBA 4MUZA 1D3HA 3H4GA 1ELSA 2GJPA 4AZ7A 1K3UA 3RN6A 1JCJA 2D2HA 8XIAA 4AISA 2IQTA 1XGZA 1OHLA 3EYPA 3S1UA 1OZMA 2UV8G 2VRJA 4U2ZA 2PGRA 3H2MA 4DZHA 1VFSA 2V2DA 4LB3A 5D04C 4WY0F 5C7VA 1JDAA 2EAWA 2CESA 4KCVA 4O28A 2YW3A 3NZPA 4GYPA 5C7HA 2ZKMX 2Z1VA 3BC9A 1M68A 1ISWA 1D3CA 1BG4A 1QPKA 4OIFA 5IHSA 2RJHA 1QNQA 1Y0EA 8RUCA 2NXGA 4DJFD 4PA8A 1A5MC 3TYAA 3S8HA 5I0DA 1ISYA 4TIMA 2UWFA 4S3FA 5G2HA 1TIWA 2WNQA 3EAUA 2QF7A 4BQ3A 2NUXA 6A3HA 3C4UA 3GAKA 1RD5A 3NDZA 5H2ZA 3SECA 4IUOA 3WDRA 1UWRA 2QYGA 1FY6A 3W1NA 3FY1A 5GJMA 3W84A 7REQA 1PKMA 4FIQA 2FHCA 3S5ZA 1JZ6A 5CH9A 2C1HA 3M6DA 4DI8A 1QUMA 2G95A 4TO8A 5TIMA 1U1JA 4FOKA 3AYSA 2I5QA 4HNLA 2A3EA 4JEQA 5LNVA 2ASHA 3O3RA 1CXLA 2R1LA 1WAWA 3H53A 3L4VA 3W74A 4OUIA 4H01A 1QNRA 3M4HA 1VCGA 2YXGA 4FNUA 2G0WA 2FZMA 3DKJA 1YRRA 4JFUA 4R53A 3EMZA 4LUIA 4LOCA 1E6PA 2QHAA 3ZJ8A 1EXPA 3UETA 1WXYA 4DWSB 3W82A 5K7JA 2C15A 4OV9A 1Y5WA 3SCWA 1CB7B 1NOFA 3EXSA 3F4VA 1KM2A 3S46A 4H00A 4PTVA 3UWZA 5HR6A 1NP2A 1A3XA 1FBAA 1UKPA 3BLEA 1HW6A 1SW0A 4WCJA 3LHTA 3Q4DA 2G41A 1HL2A 4LY4A 3GXFA 1H51A 4KIRA 3WF0A 4ZVJA 2XN1A 1YBQB 1TJ1A 5CGQA 2VCAA 3NM1A 2Z6IA 3WF4A 1WAUA 4WGXA 5IHRA 3W28A 2OSXA 2CHNA 1S2WA 3DG3A 4ZQMA 3N25A 1W32A 3W81A 1CBGA 2OB3A 2QR6A 4L6HA 2DJXA 3SY8A 1A0CA 4LYQA 4HPJA 3CB3A 4XZBA 5CJ5A 4XO7A 1P0EA 1AD1A 4PEEA 3LPFA 3NVTA 4JTQA 1MQPA 3UQNA 5CPOA 4F9JA 4UFJA 4JIHA 3HZ3A 3WLHA 5KSWA 5DCDA 2OYKA 4PMDA 1UD6A 2XDFA 4ZSUA 3WMSA 1W2PA 5DXYA 5EMMA 2PRHA 3RLHA 1MXDA 3OTRA 1FWGC 4HT3A 4MVAA 4D6JA 5HATA 4DQWA 1EC7A 4O8AA 2QPUA 5HA7A 4CEUC 2DUXA 3GNDA 5FJPA 4ML4A 2O9PA 1Q6GA 1GTEA 2ZVRA 1B3VA 3LX9A 3WF3A 1W5OA 4PMNA 4YPJA 1R3VA 5DMNA 4PCSA 1ONWA 2JEQA 2GVEA 4XUYA 1DQXA 4AZ5A 1US3A 1KBKA 3STEA 1TPUA 3DHFA 4P7QA 3S2NA 1PYFA 4PBEA 3OZPA 2EG6A 4FZIA 4JQ2A 5AKQA 4HA0A 3TTEA 1MEHA 2PDWA 4XZLX 3UWWA 4Q8MA 4MY9A 2WZHA 3ZLFA 3BMXA 4H6EA 4W8AA 4ZQNA 1EB3A 1FFQA 1H09A 1U5JA 3VM5A 3FVMA 2KAUC 3E0LA 1H7RA 3KHDA 2DT1A 2QJJA 1Z32X 3ZT5A 3C5QA 3WX7A 2WM1A 2NX3A 1HKJA 1AG1O 3LOTA 3MBDA 1WCGA 1XINA 3WBAA 1TJRA 4P7RA 3I7SA 4I8YA 3M0JA 2YDRA 5LXEA 1TV4A 4GOAA 3MANA 2ZXDA 2A7RA 4L65A 1RPXA 2ZE0A 3L4UA 2W6RA 4FLRA 5F1VA 3WBYA 3Q45A 3L5LA 1OFEA 1N2VA 2OPJA 1XUZA 3ITVA 1GOQA 4WF7A 2NUYA 3DHDA 3SUVA 3QGKC 1SFJA 3L7RA 3UESA 2Q09A 1V0MA 4E8DA 1L2QA 3JU2A 1YNQA 4LT9A 2VD8A 2CC0A 3KVKA 4ZO8A 3SCRA 5ABEA 1UPPA 3P82A 3TWAA 3SGGA 2D22A 2IW0A 3V0TA 4ZO7A 4LVAA 4RE2A 1FHLA 4UMBA 1R85A 1U1UA 2X8RA 1J4EA 3LPPA 1GG1A 1K8ZA 1S2AA 3IAPA 2DVTA 3V36A 1W3JA 3WQDA 5A2CA 1VD6A 4YTRA 1LRTA 2PURA 3H2NA 5LYRA 1Q4NX 4I9TA 4IGSA 3APGA 3EWZA 1UD5A 4OFCA 4C1NB 3OJGA 3EX6A 1VFTA 1X6LA 2WSQA 2C7FA 4I3GA 3A23A 2OVLA 2XH4A 1MWOA 2E1DA 3OODA 3G0XA 1ADSA 4FIRA 4GCXA 1HKKA 3W00A 4U3CA 4Q8TA 2J7HA 4EACA 1Y5XA 3TCSA 3LV6A 4DPPA 1XRTA 5EKYA 3LPOA 3M46A 1SO3A 4C6NA 1JZ2A 2G3IA 5IRPA 1KM1A 2WPGA 4G9PA 2HBXA 3POCA 3ITCA 3QQ1A 3R25A 1FP9A 4IMGA 1B2YA 4I5XA 1PSCA 2I9UA 1UIOA 4QHRA 4F4RA 3NQVA 5E1QA 4NYUA 3BWWA 2ISSA 4LQ1A 3PP7A 1YHTA 4UB9A 3T0CA 2E9BA 3N04A 4QP0A 4P7NA 4JHMA 1C8QA 2FB3A 2FDMA 4PBGA 2BDQA 4UTJA 3GXDA 3LM3A 1CGWA 3TSMA 1RCOB 2I9EA 2JIEA 3Q2DA 1ITXA 1XIIA 4XK2A 1IEIA 1KB3A 1J0KA 2YKKA 2Z7KA 4OUEA 3TJ4A 5CPTA 1VFMA 4QROA 1K8YA 3BANA 4ML9A 3WLMA 3CLMA 1DOSA 3M5VA 2WPBA 2VFFA 2YIHA 3MPGA 4PSPA 4GQGA 2PWVA 3GR4A 3IVSA 2NQJA 3VE9A 5HAOA 4L4MA 1YDNA 3PZVA 2H8ZA 4HP5A 1OIMA 3TYUA 3CV1A 4C6PA 2ABAA 1Q2SA 3R13A 4KS0A 3CLWA 3L0KA 4JTHA 4LAZA 1NF0A 1O4UA 3H26A 3LCWA 3W7RA 3RNDA 1B3WA 2HK1A 4P8VA 3N6HA 1P43A 1W1VA 4PSRA 2BHYA 3IUHA 2OQHA 3H6OA 1MQRA 1TREA 2GVJA 3QGAC 2QCHA 3UPMA 2XFYA 1XC6A 2WZMA 5I6SA 1LT7A 2OX4A 3CV7A 3D3FA 1CCWB 1L6YA 4A8RA 3VOFA 4JFWA 1QPQA 4JGDA 4MAVA 3NEVA 4CD8A 3CL8A 3GIYA 5EY5A 1XCXA 4DM1A 4LF2A 4P7LA 4CD5A 4O10A 4GVFA 1KTBA 3IGXA 3SCPA 1UH4A 4UTFA 2BY1A 4HU3A 4YN5A 3WH6A 4NKCA 5I09A 2E6DA 3NG3A 1G1YA 2DV0A 1TVPA 4O4WA 1OG0A 1UWUA 3L9CA 2J79A 2VZTA 3I7QA 1H7WA 1QVBA 4XD5A 5BYWA 3KS5A 3CZGA 3B3DA 4CCCA 5FEXA 3VDHA 1Q7ZA 1CDGA 1UKQA 5HUOA 1VFHA 5K4ZA 2X0HA 1PKNA 4Q32A 1WZMA 3ARUA 4XD4A 1IR1A 4ZODA 3UWUA 2H9AB 3T0BA 2PCEA 1YX1A 5HUPA 3WFAA 3HMCA 2H8XA 3PPCA 1GOXA 1L6GA 4CKQA 3VGDA 3M07A 3N2MA 3LMYA 3CWHA 3WK2A 1HJSA 5C9UA 2J77A 4Y8EA 3MV01 1UA3A 4AD0A 2CKRA 4S3CA 4UXDA 4S39A 4CN1A 3TX9A 3MWCA 1EC8A 2DVUA 1LQAA 1SSGA 3VTRA 1PIIA 3TP4A 4F0RA 5HJLA 1DYSA 1JUEA 3MSRA 1OT2A 4FNQA 4UTTC 3S9YA 1J11A 3SGUA 3MI6A 4F2BA 1R30A 3MSGA 3FEMA 3CQIA 1ADOA 1OQFA 4HHLA 3CV6A 2FVLA 3VU2A 2C79A 5FJOA 5E93A 1UZ1A 1B5TA 4FA3A 2QZRA 1RD6A 4RL3A 1FH8A 3B05A 2V0TA 5KITA 3NFUA 2CIPA 4JTRA 4FMVA 4NY2A 2ZX7A 1AMYA 4DJFC 1REQB 3N1AA 3LG3A 1JZ8A 1XQKA 3OG3A 2GJXA 4NIRA 5K3VA 2GSJA 1CWYA 2GZXA 3OP2A 3I68A 4RUBA 5AZ0A 3PS7A 3I3BA 2VNCA 3VIPA 2VOMA 1UKOA 5HNTA 4B3ZA 1E0XA 1UMYA 5FL1A 4K37A 3LRLA 2VURA 3DBNA 5IFTA 4P61A 3HURA 2OZTA 3RCMA 1CXHA 1KFLA 2NVDA 1DJNA 2AL2A 3F4CA 1MXGA 4DBSA 3RLVA 3TTQA 1XLBA 4JTIA 1HKIA 1JVNA 4V15A 4UQBA 4WRHA 1PX4A 2Q01A 3TQPA 3QC3A 2GOKA 1CYGA 4XQ6A 3GD6A 4GINA 7ENLA 1QR7A 3GVGA 2PPGA 3BGGA 2PD5A 3QJAA 1Z48A 1Q6QA 4HHPA 3VIKA 1SU5A 4G2DA 4HYWA 5BNKA 2XH2A 4E5TA 1KWGA 1XLAA 5B80A 3AIWA 4OOUA 3QLDA 4A3QA 4NJHA 4AD5A 3CM4A 5ECVA 1IT7A 1AZ2A 4HD5A 2GQAA 1ZZMA 2FZ9A 3MY9A 4YCPA 3V75A 1MW3A 3U3HA 1ZPTA 1WUEA 1JRBA 4HHMA 3CJPA 3S1WA 1UP0A 1E5JA 2VDIA 2I5IA 3F2CA 1ME8A 1LUCB 3NQGA 5CLTA 4M3PA 4OECA 2Y7EA 1T96A 3HFTA 3OZMA 3UPWA 4MKVA 2PU1A 4REQA 4YJ5A 1GCYA 1J10A 2QPSA 4LS2A 1H62A 4DZIA 2WLZA 5A6SA 2GL5A 5U4NA 3GDKA 3EOUA 1EIBA 2EJ1A 1UQYA 3OA5A 1TCMA 4CNUA 1MDRA 1M3UA 2XTKA 4HPXA 4C1LA 7XIMA 1JXJA 5GJPA 3PK7A 1J79A 1E9IA 1RV8A 3URQA 4DWSD 1KTCA 4QJ1A 4IH3A 3GG7A 4MF4A 1RAKA 3A22A 1PWLA 4ICCX 4AMAA 1UR0A 1ODZA 1B4KA 2ZICA 4D72A 5JIWA 4UTWC 3NGFA 3CQJA 1TX2A 5C9XA 3W24A 1O60A 2YOCA 4HNOA 4EPDC 1ZJAA 3VKKA 2XM1A 1QRQA 3REQB 1RY8A 3L2LA 4L80A 2PMQA 1P5BA 3T05A 3LSBA 3VIJA 1US0A 4KMQA 1UWIA 4JN6A 4ADSA 4L64A 5KZ6A 3PSVA 2J8FA 2G96A 1HF6A 3VCRA 4A3UA 4GYKA 4Q8WA 3KOZA 4UTTA 1JYWA 4QS6A 2GSEA 4UFMA 1W2VA 3M0LA 1TJ0A 3AHYA 2RGMA 1QNPA 4NNAA 3RCYA 3XIMA 2IKHA 4AF0B 3JW7A 3G2GA 4GQRA 1FA2A 3LPGA 3K46A 3GFZA 1EBGA 4XZ9A 1B31A 3IJ8A 1XX1A 4E38A 4ERAA 4R85A 1KXVA 1E55A 4IQEA 1GVRA 4Z17A 3IJIA 2PGEA 4WOQA 4Q8QA 3AO0A 3V5OA 1WDDA 5FJIA 2C14A 3MW7A 3N34A 3LBOA 2PEVA 4F9DA 1NFBA 4RDZA 1NARA 5ABHA 3GDMA 1L6FA 4M29A 4M24A 5F2GA 1F6YA 3M44A 3WH8A 4GG9A 3H4WA 3CIXA 1TPWA 2QVHA 2F8QA 3QC0A 4E3VA 1JNEA 2W5FA 1TPVA 6ALDA 3ZJ7A 4M7TA 3S4TA 2ATSA 1QCWA 1JDDA 4DYEA 1EYEA 4MLJA 1HKMA 4LEQA 4BY3A 1M7JA 4O4VA 3CPGA 3SCTA 4ACZA 5D2XA 3L66A 1TTPA 3CV2A 3RHGA 2B7OA 3FNDA 2FPVA 1F61A 1SFTA 3ORWA 3B0XA 4R33A 3K8KA 4OT7A 1XIDA 3IEBA 2LLEA 4N6EA 4IP4A 1XIGA 1WQ5A 1W54A 5CG0A 1K9EA 3FHAA 2CU0A 4IXHA 1BGGA 1FDJA 3C3NA 5I03A 4B2DD 5FOOA 1IQ8A 5HPCA 3MUY1 3CHEA 4GIYA 4ZOBA 1BAGA 2WNWA 4C5YA 4WQ6A 1EZ2A 3AYRA 1QOPA 5LZLA 1UC4A 1OC5A 2HXTA 2GVYA 1M03A 3TJLA 2VX6A 3NQDA 5AHLA 4RE0A 5KMYA 1S1PA 4HGXA 3IGSA 4M82A 2EF9A 5A8PA 1RSCA 4BF7A 1XH2A 1QJWA 1F8IA 3BLFA 3DFHA 4NNCA 2WQDA 4OKDA 1BEUA 4FLQA 4MJMA 2CKSA 1VZWA 1XWYA 2FDSA 5E09A 1M7OA 4WY0A 3NM3A 2QCLA 1VJSA 2WMIA 4H3DA 1P0KA 2PP1A 3U2ZA 1RQEA 4C7GA 1H7XA 2HZGA 2CLIA 1X38A 3LTSA 3NQEA 4D2JA 1TZ9A 1GZJA 4NZ5A 1LG2A 3H24A 2PC8A 2E4TA 1BTCA 1XS2A 4Q4PA 2PB1A 4LEFA 1HO4A 3VZZA 4LS1A 1EJSC 1JCMP 3HQ1A 2HRWA 4GX9A 3E0IA 2P76A 3WJSA 2F6UA 2VR5A 1ONXA 4NZ1A 1RY0A 5IFPA 2Y8VA 2PDJA 2PI6A 1H4PA 2BMBA 3FS2A 3FFSA 1K6WA 1D9EA 3BW4A 5KETA 2F84A 2YSWA 3WLKX 4GQBA 4BQ2A 2Q71A 1UROA 4AEOA 1YDVA 3EGJA 1X8FA 3IRSA 1VBHA 2GDUA 3QYSA 4UNLA 2DQWA 4DEFA 4UQCA 3IARA 3C0LA 3GHTA 4U4MA 1RVGA 2WO5A 1KQYA 1HQTA 1IHIA 1RLDA 5A6BA 1IEWA 3GDBA 4LUJA 4GUJA 3QM3A 4LUTB 4IQJA 1YKWA 4GBUA 1X1ZA 3N9KA 2DIKA 2PWDA 2ZX8A 5CSUA 3RFAA 2ZZ1A 2J25A 1EP3A 5LNSA 3R58A 1UB3A 3GY1A 3LCLA 1RJRA 3QSTA 3VVGA 1EP1A 1H2JA 3WL1A 1A0EA 4PUEA 1OY0A 2DIEA 4A6GA 5CZSA 4NZ3A 1A50A 1QW9A 1EJXC 3SQLA 2VRKA 2YL8A 3OGRA 4PUKA 3FGCA 3E49A 3WDPP 1LOQA 4H6QA 1WZLA 4CQCA 1Q6EA 2QLYA 2YLLA 4LC6A 4CQDA 4WDUA 2DZBA 4O11A 2R1NA 3RRXA 3N4FA 1XBZA 5E9AA 4DF0A 3N9RA 3LLXA 2NSXA 4AZIA 2DFAA 1NVMA 5G5IA 2XISA 4U3AA 4O1AA 5LIWX 3TDFA 1B3YA 3GSMA 1CGVA 4YYFA 5I00A 1POKA 3WH5A 3VIMA 2BHZA 2NX9A 4QDMA 4ROPA 3AHZA 4DAFA 1ZCCA 1FTXA 1UZ4A 4D6FA 2NQHA 2WQPA 4X22A 2B31A 7PTDA 3MHUA 2ZDRA 1W8GA 4AB4A 4JQ3A 5AHIA 2HJPA 5HWNA 2VUYA 1GPFA 3LCIA 1TPEA 5EMJA 2ZUSA 3R6IA 2J7BA 2JKPA 1XD0A 1SGJA 4UFIA 4O15A 4LS0A 4FALA 2GFTA 1RVKA 2JQXA 1TIMA 2JBMA 2CITA 5I3DA 2IPWA 1IGWA 1O95A 4S23A 1TQJA 4GA8A 3PAJA 5FF3A 1PZ3A 2P8BA 3ZQ9A 2ACQA 2DH3A 4AUBA 1UR3M 2QUTA 2RDUA 1AJ0A 1BXNA 1HJWA 4UTMA 4MADA 4U2YA 3KL5A 3K4WA 4N9CA 2DSWA 4DVOA 5A6JA 2J62A 3TN6A 2O4MA 3BZGA 1P6BA 3MMWA 3ABQA 4LY8A 3ICJA 3NPVA 3AMCA 4HK6A 4ZO6A 2Y7GA 1YNYA 1Z7AA 4F0KA 1X39A 1LQ0A 2EGZA 4A2SA 4LVGA 4W7VA 1ME9A 5BU9A 5BRPA 3AIEA 3WJZA 3DHPA 3CMFA 4RZ4A 2ZRUA 4L4PA 5CZ0A 3D5HA 4YNGA 2FFIA 2XIBA 3T7VA 3ABZA 5C70A 3VXGA 4XBJA 1R3TA 4NJKA 3O63A 3T42A 3NYDA 4US5A 1CXEA 4GI4A 3QN3A 1QT1A 1K70A 1S2VA 1JCXA 5D9PA 1NAL1 3SCOA 1QI3A 2G3FA 2CEQA 5GVJA 3S83A 3W88A 3WBXA 2UY5A 3ZWTA 3OLDA 2WVUA 2YFNA 3SIMA 2AAAA 3NSXA 2D0HA 4AIOA 1SSDA 1J0YA 3RDKA 2UY4A 3S5OA 1TYGA 2HVNA 2G4JA 1QDSA 2OFJA 5EMYA 4ZB2A 1ZCOA 2R1KA 1EEXA 2V8ZA 3G1SA 3PG9A 2VO5A 1KCLA 2DT2A 1B3ZA 1W3IA 1TSIA 5AY7A 1B3XA 3RO8A 4JX5A 1UH2A 2HNHA 2AL1A 2VI0A 3RAOA 2BLEA 3DI1A 1KQZA 2Q8LA 4FB7A 3G0UA 4AYGA 4GFIA 4HSHA 2KZHA 3ARTA 3F5KA 3IUIA 4ZXOA 2VX5A 4HZ7A 3CK5A 3WQGA 2GQ8A 2YCLA 3OVQA 2ZBTA 1OZQA 3W7MA 4HKPA 2OWCA 1XIFA 2PDPA 4PMUA 3GG1A 4ALDA 2WM0A 3GO2A 4US5D 4B4FA 3EZ4A 2ISVA 5D05A 3ZZ1A 5LA1A 5I78A 1CLKA 5FESA 2GWNA 3CASA 4PGLA 3UWVA 4I6KA 4EXQA 3KOYA 3CYVA 1DJQA 3G1VA 1OGGA 1BVNP 4UFLA 4WKFA 5DX7A 3U2CA 2X7VA 1FHVA 1DJZA 2H6RA 4FSAA 5CC5A 3VAVA 4FNSA 2UBPC 3VNDA 1IZKA 3G77A 4XZMX 5CKSA 2QDDA 4H19A 3UF9A 3PG8A 2PTYA 3GNPA 4REQB 4DXVA 3B97A 4PMJA 3I4KA 1E3ZA 5G2WA 3HGRA 3B0UX 3APYA 3TEVA 2XWDA 1U5HA 1RLCL 4LBUA 1C9DA 3VABA 5BXSA 1BFNA 4YXGA 5A94A 1E4MM 3UYIA 3WLJA 3MJYA 1XIJA 4UFKA 1XBYA 4B9ZA 4XSLA 3RR1A 3VOIA 3Q94A 3AMLA 5D9MA 4IISA 5CEWA 3DERA 1HL8A 4F0LA 4W4QA 3P84A 4KCWA 1UR2A 3M6YA 3BJFA 1E1CB 2RHGA 3B8WA 2X1UA 9XIMA 1GVYA 4L7ZA 1XFBA 1C93A 1F3XA 3EOEA 3B4UA 3URBA 3NL6A 4TX8A 1ZHAA 4Q3MA 4FAMA 3IIOA 3ZMRA 1S1RA 4NASA 1XLFA 2OEKA 4QJ3B 3G0SA 3OIXA 2G50A 3N13A 4C60A 2PZNA 2VRQA 1GZGA 1AVAA 1R46A 3UEQA 1G67A 3BV7A 2Y4SA 3IJLA 1TG7A 1W9XA 3W6MA 2WVSA 3B03A 1RJQA 3OBAA 4MWAD 2BASA 4XISA 1SFLA 1QMLA 3CS2A 3RCNA 4H6KA 1QHPA 1XIMA 2TYSA 3UXAA 2VM8A 3WQ6A 1U5VA 4N4QA 3W22A 4FXJA 1LTDA 3SURA 4Q8VA 1DXEA 1O12A 2EEXA 4MAZA 2Z25A 1ZU8A 2H3BA 3COTA 1VBGA 3C8FA 2PTZA 3LNMA 4LUTA 4DBUA 4BKNA 2TODA 3KTCA 1LBFA 4FNTA 4MKNA 3HPAA 3LGEA 3M64A 3VD7A 3N6JA 1EC9A 5A8NA 3V18A 3RITA 4ZOAA 3HA1A 1AQMA 1TJPA 4JTAA 4GGHA 4ZQRA 4JYDA 4QITA 3I6RA 2PBGA 4AY7A 2A6NA 4GNJA 2I16A 3BLKA 2ZIDA 2O0TA 4KH2A 4Y9PA 2WKJA 3PUEA 4QFUA 3LLFA 1TZZA 3I3EA 2POZA 1GTHA 3FCPA 1DPMA 1QI2A 3QVQA 3CMJA 3MYOA 2VEPA 3OZYA 1M65A 3W7GA 1AK5A 3B8DA 4OHQA 4ZE5A 3V5CA 3RX2A 1C7SA 5A2AA 2X30A 3KXQA 3ES7A 3ZR4A 2R9RA 5IDIA 2XIIA 3OGVA 1V0NA 4JTUA 4P2VA 3WYZA 1UWQA 3HQNA 2VFIA 4HIBA 5DLCA 1XP3A 2REQB 1F4HA 2G3NA 2DEPA 3UGRA 2FTPA 4C6BA 1DBTA 4MHBA 1OBAA 4HMEA 4UR7A 1GOMA 1FWTA 1QBAA 3GG8A 3HJZA 1D3GA 4HNVA 1BVZA 2BX7A 2QCDB 3L4YA 3PZNA 2AL2B 2A3BA 4ZEPA 1K4GA 3ARPA 4AEFA 2YDAA 4B91A 4B90A 3W2JA 2JALA 1EH9A 4UTHA 2WVVB 1BWLA 3TN4A 5DT5A 4GUFA 1YADA 4JKKA 4DUOA 4LU0A 3W1RA 2WJZA 2CZ5A 4TVUA 1GG0A 2VR2A 4O1FA 3UG5A 4KGJA 5HJXA 1XW8A 5FF4A 1IEQA 2QCGA 3E96A 2HISA 1AQFA 1EHAA 3K2GA 4OJYA 3VX1A 1QNSA 4BCEA 2PRLA 4CQAA 3G22A 3H2OA 3JZUA 3NA8A 1ZS2A 5FAGA 3D47A 1WZKA 4JIQA 2ZXAA 4C6QA 2A79A 1FCUA 3T0DA 2OGYA 3DC8A 2VEIA 5AYYA 5G4HC 5I3HA 3SW6A 4HMNA 3WLQA 4NAEB 3V16A 4Y96A 1OFPA 1PWMA 3LZ3A 1HN1A 4XKYB 3WZ0E 5FCZA 2WKLA 3M9YA 1MDLA 4H41A 1R3SA 1PHQA 3P62A 2XINA 5F2LA 4YVVA 4RZBA 2WJDA 2Y24A 3FAXA 3W87A 4IIDA 1E40A 3T44A 3RJXA 4DWSA 1O7AA 3BLOA 3MHGA 2ZXBA 5GNZA 8A3HA 1GVOA 2XIOA 2Y6ZA 4XZHA 2AMGA 5CGTA 1K7EA 2DZTA 4FXSA 1QK0A 1NU5A 3B8IA 2WBGA 3KDOA 2YBUA 2A6LA 3VDCA 3E0VA 3SUUA 3S5NA 2ZA3A 3EOOA 1UWAA 5CC6A 2WB5A 3WELA 1E4LA 1SPQA 4XWUA 1UW9A 1HXJA 4KIEA 3FXGA 1E73M 4CNTA 2VC5A 4BS0A 4O53A 5A6AA 1IWAA 5EFFA 3I10A 3BURA 4K8GA 3STPA 2NLYA 2OU4A 4GMEA 3QMRA 2CLFA 4IICA 1NJJA 1TTQA 3ZS4A 3W4RA 1YPIA 2I14A 1AW1A 3FSTA 5A6LA 4JIPA 3U2OA 4QJ4B 4URIA 4TQTA 2PDGA 2J7EA 3J7HA 3IAQA 1VJIA 3HPZA 4U28A 1XLLA 5CC7A 1TWWA 1J2WA 1C7TA 3ZSSA 2VVSA 3GXNA 5ABFA 3THUA 3U2EA 4XTDA 5F4SA 3RJYA 3PB0A 4LAUA 2C18A 4ZOCA 4YIWA 3WKZA 2J9ZA 3KRUA 1UR8A 2J66A 3ALFA 3LXBA 3B9NA 3T4CA 2D24A 4D6IA 3NXLA 3BG5A 4GC3A 4GVGA 1HZYA 4RV3A 2DPEA 3B4YA 1JI2A 3LHUA 3TTSA 4TV5A 1F3EA 4UZSA 3L68A 4D6GA 2XGZA 3DYPA 1ONEA 2XZ9A 4IP7A 1KD0A 1RZMA 5GNYA 4H7VA 4BZYA 4RDVA 2YYUA 4HPGA 1Z3NA 3QQ0A 1SW3A 3NCOA 4NYYA 1J18A 3AJXA 1W3KA 1RH9A 2WHKA 3OLIA 3LI1A 1WBHA 3SN1A 1S46A 5HMSA 1TTIA 4HCDA 1IT0A 1P1XA 4C7DA 3W3OA 3EPNA 4R7JA 1TVNA 3TVAA 5HQLA 4JNZA 3IVTA 3AIRA 4WOZA 5JXQA 3INPA 3MUAA 4O52A 3CHVA 1ZBVA 3GNRA 2E9LA 2XSBA 5TBOA 5A69A 1SMDA 1TPFA 1A53A 4PUJA 1IF2A 1T5AA 3T8LA 5HMEA 1DTUA 2WVVA 3VILA 1I75A 4PCTA 4IHCA 2GK1B 2VZVA 1POJA 4EPKA 3JZEA 4U5KA 2ACRA 5FI8A 4LF1A 1ZP4A 1W91A 1WDPA 1R9XA 4MPQA 1PXGA 1GKPA 3VC5A 1HKWA 3ANUA 2QEZA 2OXNA 5CSSA 1IXQA 1E72M 4U10A 3SCUA 5T26A 4JTSA 1E4NA 2OKTA 2E3ZA 4GISA 3GKFA 4AY1A 4B5TA 1XLMA 1J0IA 2VZUA 1GEHA 1UIPA 1HX0A 3JVAA 1PTDA 5F7UA 2OG9A 1V4YA 1EJWC 4B92A 2TPSA 1KNWA 2I17A 5IOBA 5G4WA 5FSDC 1JGIA 4DYJA 3FX4A 3FVDA 3VNIA 3MUIA 4V27A 2ZRVA 2CHRA 4JCMA 3A4WA 4XTIA 3PZIA 1J6PA 2QV5A 2X40A 3LHVA 3UZXA 2YB4A 2JKAA 3F4NA 3MA8A 4Z2KA 2P50A 1B90A 1KFCA 3LD5A 3MVTA 4FF7A 4CQ9A 3UZZA 3MI3A 4HTYA 3OHMB 1TX0A 1X1NA 3THQA 4K39A 3AIQA 4N42A 3W75A 1RJPA 1XGEA 3LEPA 4BWLC 1NSJA 3ITYA 1H61A 1CXFA 3ERPA 3ZVIA 4WZHA 4WKHA 3PBVA 4YHEA 2A4AA 4OV4A 1DWGM 2YW4A 1EP2A 5HNUA 3NPXA 1JQVA 2IKJA 2XVGA 3NQ6A 3QTGA 1M7XA 4J40A 3QY8A 3W23A 1ZJHA 2XG9A 4UFHA 3W72A 1UMLA 2QUMA 1DV7A 5F1UA 3MUXA 3CH9A 2CBIA 2XVNA 2Y5SA 1XI3A 4GI9A 1NFGA 2C16A 3CPRA 5LIXX 2CZDA 1THFD 3GE7A 4KFOA 2QGHA 3LXCA 4QS5A 1XBVA 3G1XA 2WZEA 1GKRA 1LLZA 4N0RA 4W87A 1A5SA 1U83A 2Y88A 2XYLA 4HB7A 2WMHA 5FEWA 4NZ4A 3SRKA 3MSDA 5D2VA 1OFRA 2YL6A 5AVHA 1JL8A 2PTXA 2VC6A 3MWAA 4HU4A 2BVWA 1HGYA 3ARSA 2J27A 2IXVA 2J88A 3KOFA 2G3JA 1F8MA 3W6YA 1BYBA 5KTLA 3BK0A 9CGTA 5FF7A 4J4KA 3VIGA 4NI8A 4OTKA 4AF0A 2PC4A 2GOUA 1X96A 1ITQA 4GNVA 3ARXA 1V7YA 5I79A 4V1YA 5DF0A 1OYAA 4WXYA 3UG3A 5AC5A 1RBAA 4H9TA 4JTGA 2O7SA 1FH9A 1OF6A 2DH2A 4S2CA 3RPMA 4HOXA 3W2LA 4QE5A 4GK8A 1KRCC 3RG6A 4QR6A 2HPMA 3S1VA 1NOWA 3L12A 3LERA 4XIAA 1WO2A 3ABRA 3BJSA 4TUFA 4MB3A 3A4JA 4IPJA 3W37A 3H2EA 5A1AA 2L5HA 4UOJA 4EAMA 1HT6A 1IR2A 2VT0A 2OQYA 4CVUA 3C6CA 2AGKA 2EBNA 2QGYA 4B5SA 2QJMA 1M9HA 1UOZA 1QPNA 3MQTA 4H9UA 3C56A 4O1DA 4ATDA 2E0PA 1W9UA 4ZZ9A 1K8XA 3CBWA 4PFMA 4GVHA 4N9DA 1TA3B 3PAOA 2Y7FA 1HUVA 3R94A 2PDCA 2Q8ZA 3VNLA 1XYMA 4MWAE 1A3HA 4JFTA 3BCFA 3KCOA 2E5DA 4LANA 3U4FA 5TNVA 1VJZA 3LGGA 1RQBA 3KBNA 1OGSA 1I2OA 2QUUA 4E6MA 1V7AA 1B1YA 2BGSA 3LBCA 1CB2A 2BOGX 2HNEA 2C91A 3QEZA 3TN3A 5H8UA 3W73A 4PTNA 1ISZA 5DMYA 2HK0A 3LCXA 2BVTA 4W9TA 3TW6A 3NURA 3AICA 1GOIA 3NQ7A 1PE1A 3MMUA 4E8CA 2E8YA 2Y8UA 1F7BA 4LCSA 1VLIA 2ZZ5A 2J6VA 1JPDX 3FN9A 1S38A 4MNLA 2WV8A 1U22A 6PTDA 5LXXA 1V6YA 3NR0A 3R8HA 1LOSA 1A47A 1KCZA 1H0IA 1EDTA 4L4LA 1UR4A 3OO2A 8CGTA 4JBRA 1XYCA 1TB3A 7A3HA 1VIWA 4RE4A 2FTWA 4H4IA 3LSCA 4OGZA 1V3HA 5JVLA 1IYXA 3VOHA 2AOSA 2Z24A 1XSIA 3HBLA 4BWLA 4MZ1A 3ARZA 4A21A 4ERIA 3RM9A 1BD0A 3M47A 3EX4A 3TLLA 1R6WA 4MFDA 2WCGA 4LAOA 3BV4A 4AMCA 4JY9A 3EPMA 4IFKA 4H1ZA 3PZ9A 1WXJA 1RBOB 3N2CA 1T8QA 4H9XA 3U6WA 4J3UA 2BB0A 3QFEA 3VGEA 1E6QM 4GD0A 1EBHA 4LW7A 4WK9A 5I2UA 1EQCA 1EOKA 1MNSA 3EDKA 3IGHX 5IBXA 2WZIA 1JI1A 1PZ2A 3BCDA 1FWCC 2G5WA 2Y7DA 5J5DA 4WHBA 1LG1A 3PB2A 2ACSA 3RYSA 4YWSA 4H8VA 4A8LA 3QY7A 3RX4A 1MW2A 4D8AA 3PJWA 1IIGA 4ZA0A 4WUIA 3UZWA 1RHCA 3TWBA 3FEQA 2Z27A 2WWDA 4L56A 3TQKA 1VBJA 1QXLA 2WMIB 3AU6A 2OSYA 3C3UA 4ADUA 3QFWA 3OOQA 1Q6OA 2DW6A 1FDZA 1FXPA 1ZGDA 1ZBKA 1E9YB 4HHHA 1GQJA 2J24A 1QOQA 4H8UA 2PDBA 5CBIA 3BAKA 1BRLB 4AHOA 4X0NA 4UTUA 3I7RA 1X8CA 3UJFA 5MKGB 5BZAA 1UQZA 3IV3A 4H7ZA 5C9RA 3OBEA 1ZRQA 3A9IA 1EFZA 4E2OA 1LWIA 1E1EA 4QDPA 4HOWA 3EDEA 3H12A 4NJJA 2VUNA 3FDGA 3W7DA 1SO5A 3ABXA 2PE4A 4RV8A 1XM3A 4ZSTA 4DHGA 1R7AA 3DENA 4JNYA 1W1A1 3BG3A 7TAAA 1E1CA 4JFSA 2WJFA 2GGJA 1VPYA 4JYEA 3W7QA 2YA2A 2FPYA 4ERGA 1UR9A 2E6FA 2F7FA 4A3HA 4L6DA 3SFWA 1OFBA 4O19A 1VFLA 1W3HA 3U7VA 2DZSA 3H2FA 3NJ3A 3W85A 1F76A 3TUUA 3QKZA 2E28A 1YDYA 3B0YA 3DH7A 3BW2A 4OVXA 4LVFA 3K4DA 1O1ZA 3SRDA 3XISA 2E7FA 3HGSA 1KM6A 1SFSA 3PTQA 2PF0A 1D7FA 1KC7A 2ESCA 1HJVA 3PBYA 5GPRA 2Q02A 3QZ6A 1Y8BA 4H9VA 5H8PA 5H8MA 2A3CA 2QCMA 1Y7VA 1UPMB 2AAMA 2PCQA 1D8CA 4UC5A 1SYTA 1KKRA 4TVDA 2Y2WA 4WEVX 4Q22A 3DKLA 2QCDA 3BAJA 4W85A 1TWDA 4ZFMA 5L6UA 2C6QA 1BKSA 3BAWA 5A95A 3ZLGA 1OCNA 1OCBA 1HFBA 3A12A 3TA9A 1JPHA 1W9VA 4O0ZA 5D30A 3RK8A 4N2YA 1LDCA 5H6HA 3S2MA 3P80A 4JTLA 1F05A 1F3TA 4JEJA 3ZXWA 4GUHA 3OZOA 2FVKA 3N15A 3KVLA 5BXTA 3W1MA 2R91A 4Q33A 1KLYA 2VOTA 3KVMA 3VDBA 1XDMA 4HZ8A 3STGA 3LENA 4QG6A 4G5DA 2WSPA 2PU0A 3F2DA 1H3GA 3EWWA 3O0FA 3KRZA 3VNYA 3OB8A 4J3TA 3LY0A 3DFQA 3FA4A 3USZA 4W86A 3M0YA 1W9DM 2B7PA 1Q7MA 3H54A 3ID7A 2H90A 3KEHA 1RXOB 4CN4A 4S3KA 3M0KA 3GAYA 4LRSA 4ZOEA 3EOSA 3ITGA 3M7WA 1TV2A 1Z42A 5AHMA 4IFKB 1WOBA 5AFDA 5KZMA 1XYFA 4PTDA 3WEZA 3GG0A 1UZDA 2A5HA 3VD3A 1EA9C 4UQDA 1R5YA 3I6TA 1AL7A 4UTIA 4MY8A 3DEQA 3NTYA 4MWAA 2VX7A 1NQKA 2D2GA 3WK0A 4GY7A 5CZKA 4DXKA 3L23A 1EO5A 3QGVA 1UWSA 4CLMA 3C61A 1I60A 4CEXC 4LAMA 3TN5A 5EU9A 4YTSA 4PCPA 3GBEA 3W9ZA 5J04A 4CU7A 2HROA 2P53A 4B5VA 3N2BA 1DE6A 3CQHA 3GU2A 3MB9A 1B9ZA 1KFWA 1SW7A 4Z1DA 2J7CA 1MFUA 1BQGA 3T0TA 1RR2A 2OGJA 5J5RA 4DIAA 1JGMA 3IS4A 1O6IA 1YLVA 4M51A 2DW7A 2JIWA 2WCSA 1FOBA 2IPGA 1GOOA 1XKJA 3AISA 2ZUUA 1XRSA 4PODA 3V3WA 3ITTA 3UXKA 3QBUA 4GYFA 3R2GA 4YTQA 2DQXA 3UXIA 1FRBA 1K7XA 1EF3A 1QK2A 3O07A 2OT0A 1IEXA 4NAEA 1W5PA 1G94A 3P8JA 1OFQA 1EQPA 2VFGA 1TWZA 4KW2A 1VF8A 2BVDA 4L9YA 1IXOA 2Y8KA 3U0HA 1XDLA 1YYAA 2PWFA 3WBEA 4HCLA 3T0AA 4FS9A 4IG2B 1W9BM 1WXZA 4POCA 3OIHA 2D2JA 5D02A 4Y7EA 2XH7A 1UCWA 1IEVA 2CLHA 3KE0A 5CSYA 1TPB1 4XO6A 4PBFA 3TU9A 2FZ8A 3EMCA 2ZRYA 3F5JA 3NWRA 1BWKA 2Z2AA 1OGBA 5HQEA 1EOMA 2W67A 4EF8A 3O1NA 3KBVA 4GZIA 4GIRA 3A3XA 3GUGA 5CC3A 4XKYA 5IDZA 1JYXA 1J12A 4L4OA 3VNMA 1P4CA 4J2MA 2J13A 4IX2A 4HYRA 4ZXLA 1SJCA 4MJZA 1QHOA 4I90A 4L5ZA 5EBAA 4X63A 3NZ1A 4CUCA 1NP0A 3IUDA 1P1MA 3UU0A 4C5ZA 2R24A 3TC7A 4OE7A 1ISVA 2VDGA 1V79A 4FNRA 3UR7A 3V1PA 1MEWA 1CENA 2GVGA 2BXVA 1OK4A 1OABA 3ELFA 3OGSA 4QCFA 5C0QA 1ZJBA 1CPUA 1JCTA 3DXIA 4BFAA 5BOOA 2YCEA 3PN8A 1UJPA 4AC7C 1IGSA 1W56A 4AHPA 1KR1A 2J78A 3S2CA 2OTDA 2EPLX 1W1TA 3CWNA 2FH8A 2OODA 1WV2A 3QV9A 4C6FA 1XLDA 4B5WA 1TCDA 3BL3A 3G3MA 3GX9A 1HIZA 4GFSA 4Y6GA 3AXXA 3ARQA 5AHEA 4IL2A 1IZCA 1GWJA 5KINA 3FA3A 1UBSA 1H50A 3CEUA 3UNTA 3CPUA 4P5UA 4ZO9A 5BCAA 1LOLA 3KW3A 2QUVA 2D2OA 4MNJA 3WMCA 4H9MA 4Q4QA 4OZOA 3AALA 2BBFA 3BW3A 3CZJA 2XGIA 2F2KA 5C9ZA 3AMGA 3P2VA 1TR1A 4DELA 5DELA 1A5OC 3SAZA 3FV9A 4HN4A 2GGGA 1W1YA 4HA4A 1YDOA 1KBIA 3TIMA 1B4EA 1KFBA 1RPKA 4X2RA 5BRQA 3L67A 4O54A 3AUJA 1M41A 1WP6A 5LGZA 4JQAA 2OT1A 4AVNA 5CJMA 1W3TA 4BA0A 3CUFA 1A5NC 1R38A 5C6MA 2E5BA 5FACA 1DJGA 4JHOA 3QQWA 2Y62A 4FPSA 3NO5A 4BJHA 1YMYA 1E0TA 2WOQA 3P93A 4GYJA 1I0BA 1PUDA 4EK7A 1C8VA 3A3WA 1PJ9A 2OLHA 2X16A 4EP8C 3XINA 2WNZA 2EPMX 1S5TA 3R4IA 1H1ZA 1TV8A 5FAJA 3JS3A 5K9XA 1M04A 4LV4A 2V2CA 3CZEA 4QSFA 4AWTA 4C6EA 1L6WA 1Q6CA 1YTDA 3QXBA 3VOJA 2WNNA 4BQ4A 1E4IA 2OOFA 3NGJA 1DIDA 5BXPA 2ZC8A 4K8HA 5FJRA 1UHVA 4CNPA 3AS0A 2PLMA 5C71A 5I3GA 3N4AA 2Y0FA 2FZNA 3M0ZA 4KRUA 4XAFA 2P1FA 1KCKA 3KAOA 1VKFA 3M0HA 4PZVA 3O15A 3B0VC 4IJCA 3EDJA 1G7VA 1JRCA 3S5SA 2J7GA 3Q67A 1JUBA 3C0QA 3W71A 1ML1A 1TE1A 2QAPA 4H9ZA 4KERA 2O55A 4C6OA 1KRAC 1QW7A 2VX4A 1NH6A 1XL9A 2CLMA 4RKAA 4PTMA 3ZT6A 6ENLA 3PHAA 3VNZA 2QW5A 1M1BA 4PTXA 1JD9A 4HMDA 1XV8A 1Z44A 1E15A 4O17A 3WIJA 4AWEA 4MJ4A 1E51A 3ZVHA 3AS2A 3W76A 2PWUA 4DJDD 5BMXA 3LLDA 2E9MA 4DYKA 7TIMA 4DUWA 2GUYA