3VNDA

Crystal structure of tryptophan synthase alpha-subunit from the psychrophile shewanella frigidimarina k14-2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
259
Chain Sequence
MSNRYQAKFAALKAQDKGAFVPFVTIGDPSPELSLKIIQTLVDNGADALELGFPFSDPLADGPVIQGANLRSLAAGTTSSDCFDIITKVRAQHPDMPIGLLLYANLVFANGIDEFYTKAQAAGVDSVLIADVPVEESAPFSKAAKAHGIAPIFIAPPNADADTLKMVSEQGEGYTYLLSRAGVTPIENILTQLAEFNAPPPLLGFGIAEPEQVRAAIKAGAAGAISGSAVVKIIEAHQHDEATLLAKLAEFTTAMKAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Strategy for cold adaptation of the tryptophan synthase alpha subunit from the psychrophile Shewanella frigidimarina K14-2: crystal structure and physicochemical properties
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 94
structure length 259
sequence length 267
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3vndA00
1LLWA 1Z41A 4AMAA 5F2LA 1KFCA 3VE7A 3UPBA 3K30A 3W1UA 5HUOA 1L6SA 4E0CA 1PE1A 5CKSA 2G95A 3G3DA 2YW4A 1K7EA 2FPTA 2ZRVA 2RDWA 3LBCA 1CI1A 3LCGA 1LRQA 4Z1CA 1P1XA 1SPQA 4JTJA 1JQXA 4CQ9A 1F6KA 1ONRA 3MI6A 1KM2A 1LBLA 3STCA 4ZMGA 4WOZA 1G7VA 4O52A 3DI1A 1N55A 2A6LA 1SR9A 2VELA 4WUIA 8TIMA 3THAA 3DH7A 2YDAA 4UCGA 2C3ZA 4Y90A 6ALDA 1F7BA 4XWUA 1WOBA 2F84A 3S5OA 5FI8A 2YR1A 2V81A 3NQVA 4LRTA 3W1XA 3W7LA 1DQWA 1IXOA 3WK0A 3GZ3A 2HS8A 3W1TA 3M43A 3NPXA 3MP3A 1OF8A 3H55A 4QSHA 1QOPA 4ML9A 3DKJA 4AAJA 2GQ9A 4LOCA 1ZCOA 2Z1BA 3WJWA 2Z6JA 2OCZA 1IF2A 3DI0A 3P67A 4XZ9A 2QCMA 4S2CA 4OV9A 3GR8A 3C0JA 1QO2A 4IJBA 3Q58A 2GPTA 1KM6A 1VLWA 2EF9A 5K9DA 3GIYA 1GYNA 3GAYA 2FB3A 4UTHA 5KZDA 4JTHA 3N34A 3INPA 4GRSA 2YYUA 1VYSX 3PG8A 1SSGA 3L0NA 3SGZA 4ZZ9A 3W72A 3L5MA 3L0GA 1K02A 3TROA 2QCGA 4MUZA 1I2QA 4O14A 5LSMA 2NLIA 3P81A 3GK0A 1YLVA 3W7CA 1EB3A 4UIOA 3STGA 4BI6A 4LUIA 3DENA 3B0VC 4K8HA 3V1PA 1KBIA 3W2NA 5D32A 1TJRA 3NA8A 3O6YX 4MIMA 3LERA 3BW2A 1W3IA 4UXDA 5HNRA 3W2UA 4JTIA 2OMAA 2VFDA 2TSYA 4N02A 5A8GA 2DZPA 3NM3A 3DFSA 1JCJA 4K7VA 3HO8A 4CCDA 3W7HA 2C16A 4AWUA 3M16A 4GWEA 3GDKA 2BSLA 3PBYA 3NQCA 3P5ZA 2E6YA 4DPQA 2EKCA 4S1FA 4XBSA 3LCWA 3N14A 3NO5A 5D03A 5D30A 4K8EA 1X8FA 1W3TA 3ANYA 4QNEA 2KZHA 3HG5A 3EX6A 3WJZA 1EUNA 3G0XA 1QWGA 5ABTA 4FO4A 3H54A 2NXHA 4O12A 1TPDA 3W22A 4OT7A 1S3HA 5I3IA 5I3KA 4WOQA 3PWAA 2P0OA 1XBZA 2XN1A 4CCCA 4MVAA 3NQ8A 3QW4B 2WQPA 5D2TA 1SO3A 3KRSA 3NZ1A 1H7WA 3NL3A 3FA5A 4FNTA 4LW7A 1P5BA 1L6WA 4Q33A 4JD4A 1AL7A 1AG1O 1ALDA 3KVJA 3MYOA 2QDHA 2ZZ1A 4JDBA 3S5YA 4JYFA 5KZEA 5C6MA 2E6DA 4YMZA 2A4AA 3DAQA 1OFBA 2A1YA 1TV8A 1NVMA 4LU0A 4ZVJA 5LGXA 4GUIA 5AC8A 1RQEA 1JUEA 1QPNA 3AJXA 3SZ8A 3NPVA 4MFEA 3NXFA 3EWZA 3TU9A 4UTLA 4IQLA 3A24A 4AVFA 5HWMA 3F03K 3LI1A 1Q6LA 1X1OA 3LHUA 4WJEA 3P84A 4Z1BA 4KFPA 4FX8A 2WNQA 3M9YA 1WV2A 2W79A 3NEVA 1TPFA 2FPVA 5F2MA 3T78A 2B4GA 3MYPA 4U28A 3VE9A 3EWXA 3UWVA 2J9YA 1ZJIA 5K3VA 1OFDA 1RZMA 1H7XA 4JTEA 3B4UA 3GNNA 4RKAA 3U2OA 1MZHA 3WFAA 4M7TA 3B05A 4IXHA 1RR2A 3F4NA 1O94A 3MHUA 1RQBA 1V5XA 1M7PA 3OEXA 2NXIA 5AOUA 1YXYA 3SIZA 3L5AA 3UWUA 4BFAA 4M19A 2Q8LA 1XI3A 3PB2A 4M6QA 2A2IA 2BWGA 4N2YA 2FDSA 3FEMA 1KM3A 1LTDA 3W23A 4FXSA 2EGZA 1DJQA 2VEIA 4TO8A 3CT7A 4EVZA 2RDTA 1HUVA 3G3MA 4Z08A 1OFOA 1H7PA 1GTHA 2WJZA 5HUPA 3TSBA 4XTIA 3OBKA 4HPXA 2QCNA 4LVBA 3W70A 3M7WA 5LNRA 5C5YA 5F1VA 1OF6A 1G67A 5D38A 3NDOA 3ATYA 4S2BA 4Z0JA 1QR7A 1R47A 1TPVA 1KV8A 4CQAA 3M6YA 3SJ3A 1KTCA 1ICSA 1RVGA 4NNCA 3FLUA 4WXZA 1JCXA 3QPYA 3S1UA 4UNLA 1WA3A 3ZS4A 2Y89A 4BK9A 2G97A 1GVFA 3S5NA 4C1LA 4QIUA 3W74A 1SFJA 3CHVA 3GDMA 2WO5A 1FCUA 1LCOA 3CIWA 1DOSA 1TTIA 3M0ZA 5D2XA 3UWZA 3GNDA 1SW3A 3IVUA 3GDTA 2RDUA 4EIVA 2E5DA 1DBTA 2V8ZA 3USBA 2BZNA 3N9SA 3QH2A 1FWRA 4TR9A 4QQ3A 3G1DA 3N2MA 1IIGA 2PRMA 5AHNA 1JRCA 2E68A 2CLOA 4H6KA 3A9IA 1K8YA 2DZWA 1H62A 1H60A 3C6CA 4JIPA 3G1HA 3LX9A 1M7OA 3RNDA 3U8GA 1I2NA 3UZJA 3MUXA 2A7NA 4Q4KA 4HNNA 5F4WA 1NSJA 2DZSA 3O1NA 4KKXA 2X1RA 3LB0A 3I7RA 3M5VA 5KZMA 3THQA 3TAOA 2RKXA 3HG3A 5D37A 2PRLA 3N2XA 3S42A 4OGZA 1ADOA 3IGSA 2QUVA 3CLMA 4N9DA 2ZZ7A 2QCDB 1IGSA 3EX2A 4IPJA 2X1UA 1PVNA 2QUTA 2Z0IA 3LTYA 1JRBA 3LTSA 5KTLA 3HF3A 3ZWSA 3T4CA 5FF0A 4JNMA 1AK5A 1JCNA 5DXYA 7TIMA 3L21A 4YWIA 3G1YA 5G4EA 1Z42A 2IQTA 5TIMA 3OVQA 1L6YA 2C19A 3FKKA 1LOSA 4XKYA 1OYCA 5AN7A 3W7JA 4IX0A 4PH6A 4QJ1A 3GKFA 5DY3A 2ATSA 3PSVA 1VYPX 3MI3A 1TV5A 3NGJA 4TU1A 2JK2A 5K2ZA 2OX1A 3LHYA 4O18A 4AB4A 1O5KA 2WNNA 3SSJA 4NZJA 1VRDA 3FFSA 1TIMA 3W75A 1VYRA 3G1XA 1FWNA 4XQ6A 2ZA2A 4OV4A 2W6RA 1GJPA 3B03A 1THFD 1S5WA 4KFNA 4UTJA 1VHNA 2A85A 2Y7DA 3EKLA 4HPJA 3MHFA 3DXIA 3FYPA 2ABAA 4UTMA 1BEUA 3NQGA 2FPYA 3SR7A 4RR4A 3RFAA 3L0KA 1AL8A 2B7QA 3CEPA 2CZDA 2QEZA 3NG3A 2PE4A 1W1ZA 1DJNA 5CZJA 4LVAA 1ZAJA 4GBUA 3W7RA 1W31A 3L67A 1EA0A 4ZQNA 2HMCA 5G2HA 5AC7A 3TUUA 1YTKA 1KA9F 4MFDA 4ONVA 1TRDA 4LS1A 2J9ZA 1G4SA 1VHCA 2A5HA 1G4EA 1Q6RA 3KAOA 1UB3A 3ABSA 3C61A 2ZYFA 1KBJA 3RF9A 3TAKA 3NQEA 3JR2A 3UD6A 3W83A 2J9XA 3IRDA 4IX2A 2JBMA 4O57A 1QOQA 3PR2A 3VNDA 1XL9A 3TNOA 4JICA 4I7VA 5LZLA 2JKPA 2E77A 5G2IA 1ZENA 3C56A 2CZFA 2ZRWA 5G4WA 1VJIA 3DFOA 4PODA 5KSWA 3S1WA 3PVFA 1DQXA 4NX5A 4JTLA 5C2XA 5LNUA 1ICQA 2DZTA 4WY0F 5FF4A 1X6UA 1KLYA 4O11A 4EWND 1ME8A 4O1AA 4HIBA 2WSQA 1C29A 1W56A 3S5ZA 4FNPA 5D05A 1K03A 3LTPA 5LHFA 3IVSA 3CB8A 1GEQA 1VCGA 1WYIA 2VC6A 5DBTA 1OFRA 1SZFA 2O7SA 2GQ8A 1TJPA 2PURA 3WK2A 3PULA 3NQ6A 1SZEA 2VENA 4IMEA 5HJLA 3T7VA 1MXSA 3L9CA 5F1UA 1GZGA 2I1OA 3PB0A 1QNVA 4JTUA 1YXCA 2X30A 2H3DA 4FX7A 1PS9A 3NR0A 1PHQA 3B0PA 5CPMA 3IIZA 4YCOA 1JULA 2CLKA 4BWLA 3HQ1A 3LXBA 2Y85A 5CZ0A 2Y62A 2V2HA 3W7DA 1GG0A 2GQAA 3FYOA 4FNQA 4DF0A 4UFJA 2QCCA 2V9DA 3P8JA 5IBXC 3ABQA 1FCBA 3P61A 1IXNA 3PAJA 1TPWA 4N9CA 5CZTA 2BX7A 2VXNA 1GVRA 3CWNA 4Q32A 3S1VA 1I45A 1GPWA 1U83A 1ME9A 1EIXA 3GDLA 5AFDA 2C13A 1I4NA 5EMUA 5J5RA 2F7FA 2CLFA 4I7WA 4OHQA 2CFFA 5G2WA 2AGKA 2R8WA 3W87A 1RV8A 2QCLA 3NPUA 5CG7A 5BNKA 3TIMA 3LRMA 4IPIA 4FF7A 5BMXA 1MO0A 2GJLA 2YCEA 1C8VA 4PEKA 3WK3A 2ISSA 3G18A 4JIQA 3SY5A 1GVQA 3UQNA 3TJXA 1GTEA 2V0TA 4PFMA 1A5AA 5I3HA 3I68A 2FQIA 4NUWA 2DZXA 4WX2A 3KVKA 3M5ZA 1UUMA 1D9EA 2AAMA 1JCLA 5LHEA 3BW4A 3TQKA 1UCWA 5F2IA 4DBDA 2NWSA 1SO4A 1YYAA 3PY2A 1H50A 1KTBA 1RQHA 4OBTA 4GE8A 2WPBA 4RK8A 3BLFA 1R2RA 5CGQA 2A7PA 1OFEA 1W5QA 4O1CA 2E09A 3H53A 2QAPA 2V2DA 4TX9A 4IXXA 4MLRA 5I3JA 4NJHA 2Y7FA 4HN4A 1F5ZA 3WJSA 3NYZA 3DKLA 3RU6A 3NAVA 1KFLA 3FIGA 2Y63A 2PCQA 3DFPA 2ZRZA 3W84A 1G7UA 4QM1A 4Z0SA 4M7SA 1SW0A 4UTWA 5G1YA 4B5NA 1JUBA 5BOOA 1QMLA 4FNUA 5DLCA 1JR1A 4IGHA 3EKZA 2QR6A 3KXQA 3O63A 1IIHA 2JKAA 5D02A 2QDGA 3LM7A 5HQEA 1GT8A 3BLEA 4NNAA 2VFGA 4MPQA 2H3BA 3W7IA 1FDJA 1G6CA 3PG9A 1KLZA 1HTIA 4BWLC 3LLDA 1QFEA 3W9ZA 1VH7A 2E5CA 1FBAA 2R14A 3PBVA 3AO0A 1KW1A 1SFLA 3PUDA 2G96A 2YFOA 3IIXA 4AF0A 4G1KA 4WQ6A 3R8RA 2GVJA 1YDNA 4LV9A 2Y61A 2W0UA 2WV8A 2B7OA 3LCIA 1Z48A 2ISVA 4UFKA 3KHJA 4HKPA 2VFHA 3GX9A 1XUUA 3O06A 5BRBA 3HGJA 2TYSA 4O54A 5D04C 2CLIA 1JQVA 3MMTA 1H7OA 3W1LA 4N9BA 3TW7A 2FB2A 4NXKA 1HO1A 4MY1A 3KVLA 5U7SA 1FWTA 2VEPA 5L9FA 4CNNA 1FY6A 5EL1A 1T8XA 1PHWA 5EPDA 1AW5A 1LORA 1KFBA 2C1HA 3BG9A 2E1DA 3BGGA 3TC6A 1ICPA 3W07A 3DFNA 3IIPA 4A2SA 4Y9AA 3C8FA 3BV4A 1PIIA 3CEUA 3FJLA 4N6EA 3W71A 3OVRA 2YGYA 5DY2A 2ZRYA 2ABBA 3DFQA 4YLWA 1ZAHA 2A0NA 3M41A 3G8EA 4ZQCA 1I2PA 1IXQA 3BO9A 1F2JA 1LBMA 4MOZA 2CW6A 2YXGA 4POCA 1O60A 1WXJA 1VGAA 4AWTA 3N19B 4K6AA 4RCXA 4LNYA 2CLLA 3P82A 4XKYB 1T99A 3A5FA 1VR6A 1WAUA 1FQ0A 1OABA 2TRSA 4TIMA 3LHTA 3ATZA 3GXPA 3JRKA 5K9XA 3HGOA 5D2VA 1F05A 2TPSA 2YPIA 3P80A 3SFKA 3O15A 1RPXA 2CWNA 4MZYA 4DF1A 4JTFA 4PC8A 1TTJA 1EX5A 2R94A 3MBFA 3G1FA 1FWWA 4R7JA 1W37A 3W7KA 3MP4A 3S6DA 1K8ZA 1G4PA 3Q2DA 4FIQA 1F6PA 3UPWA 4OU1A 3LV5A 4X2RA 3NOEA 5EYWA 1FWSA 5D33A 2NV1A 3PC0A 1A53A 3UWWA 1SUXA 1J2WA 5K4XA 2ZQ0A 3RMJA 3Q37A 1FDZA 3UY7A 3QJAA 2NUWA 1G69A 3I65A 1TCDA 1SU5A 1ZHAA 1B4EA 3D0CA 5I3FA 3NVTA 1XBYA 4RJEA 5LNSA 5HR7A 1XC4A 1AW1A 1KTNA 1XBXA 1QPOA 2ZFAA 3QQ1A 4FIRA 4LWWA 4LC6A 1K3UA 3PM6A 5T26A 3IIOA 5LNWA 3TV8A 3W7EA 3L68A 2GJNA 2RH9A 4AEOA 3KVMA 4XTDA 2ZTKA 3QC3A 1TQXA 3N73A 1LP6A 1D3GA 1UJPA 5KITA 3TJLA 3GLCA 2NXGA 2XFWA 3NQFA 4C1KA 4FB7A 3P5YA 2Q3OA 2VEMA 1GG1A 5CZSA 1T0OA 2BTMA 2NUXA 2NZLA 3B8DA 3BLIA 1R2TA 4YXGA 3QYQA 5E1QA 1KM0A 3GXTA 2CLHA 3C4UA 4KFOA 1QDSA 4O4WA 2FFCA 3OIXA 4NJKA 5AHLA 2P10A 3C2FA 4GFSA 3PSWA 1P0KA 4NJGA 5SWUA 1ME7A 2QCDA 3UXAA 5G5IA 1O4UA 4O53A 1WX0A 3W2JA 4E2DA 4FXRA 1KFEA 1KFKA 1VLIA 4O19A 3DHFA 4LC8A 3ZWTA 2PC4A 4HT3A 3HPXA 5E93A 3UZ5A 2X1TA 1H63A 3TSDA 1EWDA 2ZZ6A 5IBXA 3Q94A 3E0IA 4O0KA 4LTSA 4BI5A 1O95A 1GQNA 5KINA 3TSMA 3HJZA 5FEPA 1B57A 4GC4A 3O16A 1L2UA 3RK8A 2QJHA 2JGQA 5K4ZA 4QAIA 1P4CA 1M6JA 4LUJA 4IWWA 5DCBA 5BMWA 5C54A 1F76A 1LBFA 2P1FA 4PL1A 4HSNA 1Z44A 2E6FA 2HSAA 5FEZA 3EWUA 4M5PA 4DBEA 1CX9A 1KM4A 1A5SA 3CWOX 2C15A 3MHGA 1N8FA 3O6CA 2QJIA 5G1TA 3N9RA 4NVTA 5AYZA 4UFLA 3SECA 2AQWA 1TPB1 5AB3A 5GVJA 3NQDA 3OA3A 4BR1A 4MY9A 4Y8FA 5AHFA 1H1ZA 4JX6A 1MEHA 3M44A 3HG4A 4UNKA 3PBUA 4NJIA 2TMDA 5AHIA 4HNTA 5D2WA 4P61A 3P62A 2B7PA 5J5DA 3S8HA 2VFFA 4QITA 1O5XA 4NNBA 2X1SA 3W1AA 4ADUA 1ZY9A 2FTPA 2O7QA 3HGRA 3TXVA 4QISA 1W5OA 3WJYA 4GUGA 3PS7A 3G22A 3CTLA 1FCQA 1XCFA 3UXDA 2ZDRA 3L66A 4MYXA 4NU7A 2HTMA 1Q6QA 3KRUA 5CPLA 2ALDA 3TQ0A 4ALDA 4UMAA 3TMLA 1KM1A 2C0AA 3B06A 3NZRA 2B7NA 4WZHA 4IUOA 4UTTC 3ZR4A 3GKAA 4ZQRA 1VQTA 4OWGA 4TMBA 4WD0A 3NQ2A 3W2MA 1SW7A 5FEXA 5EA9A 3EWBX 2A7RA 3TX9A 4FHAA 3O05A 3FOKA 1H51A 1NF0A 4DQWA 1EPXA 3MJYA 4JYDA 3M5YA 3I7SA 1EP1A 3TFXA 2D73A 1I8JA 1HL2A 2GVGA 4UTUA 2A21A 4A2RA 1ZNNA 4H3DA 4TMCA 5AHMA 3NL2A 3HMJG 2YZRA 1Q6OA 4XUGA 3CC1A 1TB3A 4AHPA 1XDLA 1HO4A 3NNTA 1BKSA 1E51A 5K9CA 1C9DA 3BK0A 4UMBA 2CZEA 2DJXA 1TPH1 2Z6IA 4MJZA 4QNWA 4LVDA 3EXRA 4RZ4A 4ZQPA 5CPOA 3FKRA 2R91A 3EX3A 1TV7A 4UTIA 2V82A 1K7FA 3W86A 2GOUA 2ISWA 3SGUA 3W2KA 1PCKA 4EF9A 3DGRA 1NF7A 3T55A 5FF2A 4UFIA 1R46A 4JX5A 3YPIA 3EEGA 3RLVA 2V5BA 4P2VA 3T40A 4KWWA 4CNOA 1B4KA 2QCHA 2GUUA 3UWYA 4DELA 2Y6ZA 1W5PA 1LROA 1W5NA 1NEYA 1MEIA 4MZ8A 2Q8ZA 3C2VA 3LCFA 3GDRA 3E9AA 4JTGA 3KOFA 1FUYA 2PRHA 1MSSA 1KM5A 1LDCA 1LLZA 4JS3A 1GYLA 3BVJA 3LRLA 4AXKA 4JYEA 3KRZA 1P0NA 3ELFA 4NZFA 5I3GA 2OT1A 3ABRA 3QMRA 1A5BA 2ZA3A 4A3UA 3LCHA 2J27A 2X16A 4H4IA 2B0MA 1W54A 4O4VA 1DVJA 4ZQOA 3ABOA 4YL2A 3R12A 1QO5A 6TIMA 2DP3A 4GJ1A 1OFAA 2V2CA 4N6FA 5EKYA 1PL9A 2YSWA 2QJGA 4UUIA 1FX6A 1TREA 5U4NA 3QFEA 1WBHA 1WBJA 3G24A 4M6VA 1OG0A 1F74A 3BG5A 3NL5A 3L2IA 4UMCA 5K7JA 3LGEA 2NV2A 1XKYA 2CU0A 3HPZA 4JTTA 4UC5A 5AYYA 5F4XA 3P8IA 1I2OA 1H1YA 5A5WA 3VFLA 3LCXA 1T96A 2G5WA 4HSOA 1WOAA 1RD5A 1MEWA 3A21A 3UWQA 1CW2A 1I2RA 1YPIA 2H8XA 2Y70A 1JCMP 1YADA 2WNZA 3C2RA 4HNUA 3GXNA 5FF3A 5H91A 3S1XA 1HG3A 2VFIA 3KX6A 1OX6A 1EP2A 1Y0EA 2V30A 2NX9A 3A23A 3R13A 1W3NA 4O13A 4NT0A 1GOXA 4CCEA 3P60A 3PUEA 3GR7A 1QCWA 1FCVA 4LT9A 3LI0A 2J24A 3SI9A 4LS2A 4MJMA 1VCFA 1LRNA 1BWLA 4EF8A 3G0UA 1LM1A 1HFBA 3QW3A 3IV3A 4MKNA 5HINA 1QAPA 1WDWA 1YDVA 3TFCA 1DV7A 2I9EA 3TDFA 4PA8A 1FXPA 3HPSA 4MYAA 4DO6A 3W7OA 2JGYA 2ZRUA 1JCYA 1UUOA 3TH6A 1TPEA 1NAL1 5EBUA 2ZZ2A 3BG3A 4JEQA 2H6RA 3IVTA 1DKWA 3O07A 4O17A 1TO3A 2BXVA 3HG2A 4AWSA 3OG3A 2HS6A 5AC6A 3IEBA 4LVGA 1OX5A 2DORA 4I9AA 4O1BA 4W9TA 3LDVA 2QAFA 4GUJA 2Y88A 3QM3A 4R34A 4ZL1A 5AYXA 3PUOA 1TQJA 3SW6A 2BLEA 3ZFHA 3QMSA 3LBMA 1OVDA 5HWJA 3LLFA 3U6WA 4YCPA 3EWWA 4KWVA 4NJJA 4PCFA 3B0UX 4JR5A 5F2GA 2OT0A 1KFJA 1LZOA 4E38A 5HULA 3F1QA 3CM4A 3MP5A 1YDOA 3F4WA 3IGXA 3C3NA 3QEZA 5DCDA 3LXAA 1K7XA 1AW2A 2RHGA 3CQ0A 1A5CA 2C6QA 4U4MA 2NX3A 3TQVA 1YXDA 5IM51 3M47A 2QCFA 4O50A 4PTNA 5TBOA 1BTMA 1TYGA 3DU0A 3C2OA 3PBWA 3E96A 5MHBA 4K38A 4A22A 5DXXA 4FNRA 4D2JA 3UY8A 5FEWA 3EX4A 3NM1A 3QMTA 1TPUA 2YW3A 3W76A 4JGDA 3IGUA 2WOQA 3RLUA 1UASA 2CLEA 4PL2A 4GNJA 5AHEA 1LOLA 2EAWA 3GVGA 4FEZA 2H8ZA 4NX0A 5TQLA 4X3ZA 5H2ZA 1SSDA 5D09A 3MI2A 3G1SA 1KV5A 3DZ1A 3JS3A 2Y7EA 3O6DA 2VKZG 3KFTA 2DU2A 4O28A 3TA6A 4ORMA 4ADTA 4IMGA 3W7MA 4IOTA 1JVNA 4AH7A 4DEFA 1XBVA 5C55A 2VFEA 4MY8A 2EPHA 1J4EA 1XM3A 5L6UA 3QSTA 3LV6A 4IMCA 1H5YA 4X9SA 3R5EA 4ORIA 4O15A 5LNVA 1OK4A 4RXGA 4UTTA 3EX1A 2QF7A 5HMSA 2YFNA 3OVPA 3I7QA 3E49A 1WQ5A 1V7YA 4JTKA 3STFA 3W1NA 3W85A 1SO5A 5EY5A 4L4LA 2I14A 3G1VA 4OE7A 5LGZA 3C2EA 3G0SA 3UNDA 1PV8A 1OJXA 3BW3A 1OK6A 1ZALA 2YYTA 5DCEA 4JXCA 4IMFA 2FJKA 1TTQA 3W7GA 2NUYA 1N7KA 1PCWA 1F73A 4MLJA 2VOMA 4AF0B 1M5WA 3CU2A 1Q45A 3P7YA 1EP3A 2QCEA 3O8AA 2H90A 4N4PA 3TCEA 1ZFJA 3TMQA 3W73A 4WXYA 1UBSA 3W1QA 3LHVA 4NXSA 2ZA1A 4UR7A 4Z1DA 1YTEA 1K8XA 5E0KA 1FDYA 1JJKA 1LRTA 3NPWA 1LYXA 3E12A 2FLIA 3BPWA 2GVLA 4UR8A 4XBKA 1ML1A 4GUFA 1NFBA 3HBLA 5KMYA 3A22A 1SZNA 3HIJA 4JX4A 3W7NA 2ZZ4A 3N3MA 4HNVA 4JDYA 1VCVA 3MO7A 4LRSA 2ATMA 4LVFA 3GAKA 1XUZA 3R2GA 4AHOA 3TW6A 3W6YA 4A21A 4AHQA 4DO4A 1GVOA 1VPXA 2VEKA 1XXXA 5HWNA 1GVSA 4BI7A 2DZUA 1OFPA 3LRKA 2UV8G 4JY9A 4UFHA 4IMDA 3LOTA 3DHDA 3W7QA 5DN1A 1AMKA 1VS1A 2Q3RA 2Z2UA 2QKFA 1DHPA 3CPRA 4DPPA 2A6NA 2C18A 4DO5A 3OHIA 1OYAA 3W3OA 5BW6A 4CNPA 3EXSA 1IXPA 3MW7A 2EHHA 2C14A 4Y6GA 5F4SA 4K7YA 1XDMA 4ADSA 1R30A 1OX4A 3NQMA 1G4TA 4JTSA 3LCLA 3W88A 2J88A 2V5LA 2CLMA 4A29A 4UTWC 5FESA 3W7PA 2OZ0A 2JKEA 2CZ5A 3VCRA 1OFQA 3GYEA 4LS0A 3CIXA 1OYBA 3QZEA 3TXZA 1SZGA 2Y7GA 5CSRA 3PF3A 3T44A 1S5VA 1U5JA 2OJPA 2FIQA 4DF2A 1W8SA 2NX1A 3TE9A 4EOUA 3LXCA 3W1RA 1EWEA 2WSRA 1OX4B 4RXFA 2J6XA 3S9YA 3FS2A 4Y96A 3C52A 4UFMA 4RZ5A 4J9JA 4DXVA 1W5MA 2WSYA 3V75A 3HOJA 3DBPA 1J5TA 5DELA 1TTPA 3P74A 2QUUA 1VC4A 1OHLA 3TC7A 2ZRXA 4Z1AA 1SQ7A 4FNSA 3M5XA 1A50A 2LLEA 4K37A 3MWAA 4JN6A 2X2GA 3DFTA 1H7NA 3HB9A 4K39A 4WY0A 2WKJA 3MBDA 3LHZA 1FXQA 4RLIA 3STEA 3QQ0A 5CPNA 1TSIA 4M6PA 2NWRA 1YPFA 3S0CA 4R53A 1H7RA 4GUHA 1EUAA 2ZZ5A 3G1AA 4NQ1A 1SO6A 1YTDA 1LOQA 1W0MA 4RZ6A 5CSSA 5DBUA 3WK1A 3L5LA 4WY0B 1JUKA 3R89A 4BF9A 2ZZ3A 3G8RA 3M1ZA 3E02A 4X22A 4ZQMA 3TKFA 1H61A 3W1PA 3VKJA 1X1ZA 4N4QA 4CLMA 4O0ZA 3W1MA 3A5VA 2ZTJA 4L4MA 1L9WA 2YX0A 4O16A 1R2SA 3NL6A 3L65A 5D2YA 2ZCGA 3BGJA 3HGSA 4ICNA 4JY8A 1Q3NA 3GB6A 4RX0A 2DZVA 1TMHA 4LV4A 1TRIA 3QPZA 4O10A 2XN2A 3NQAA 3QF0A 1D3HA 3QRHA 4MZ1A 3BARA 2XN0A 1B3OA 4HHPA 4K36A 5HR6A 4I7UA 3FJ6A 1S5TA 4LY8A 4UTKA 3UYCA 4O8RA 2E6AA 3EXTA 1GWJA 3WJXA 1QPRA 1ZAIA 4OQVA 3IIVA 3I6RA 1XFBA 3EB2A 4R33A 3EWYA 3W2LA 4N9EA 4E2BA 4O1DA 3VI2A 1VZWA 4RV8A 4FX6M 3B04A 3QSRA 1B9BA 2RFGA 1BWKA 4CQ8A 3TK7A 2ZBTA 1DL3A 2DJLA 1QPQA 5FF7A 1EEPA 1TPC1 4GXMA 1X7FA 3NQ7A 2E5BA 3LHWA 1DORA 3TR2A 5LKYA
chains in the Genus database with same CATH superfamily
3M0VA 3IJQA 1Z41A 1KFCA 2Z7KA 3VE7A 4PUEA 3S46A 3DECA 4GHRA 4E0CA 3N2TA 5AZ1A 1O5QA 1K7EA 5M3WA 1CI1A 4Z1CA 1P1XA 2XGIA 1C92A 5HNUA 4JHZA 1VD6A 1F6KA 3STCA 1GOIA 4ZO8A 4GKLA 4DZ5A 4CU7A 4H04A 4O52A 3U2ZA 2V3DA 4I9JA 3OLEA 4WUIA 5IOBA 2GGGA 1XIDA 1A3XA 4B15A 1UWRA 2YDAA 2FVKA 7TAAA 1F7BA 4XWUA 1G1YA 3WBWA 2QIWA 3LBOA 2UY2A 3NQVA 4LRTA 4WSJA 3WLTA 3WUFA 4LCQA 3WK0A 3OU8A 3PJUA 3K4WA 3WF4A 3CMJA 2REQB 2V69A 4QSHA 1EHAA 2YLLA 4HHMA 2CLPA 1EFZA 2GQ9A 5A94A 2Z1BA 3QKZA 4XZ9A 1IF2A 3DI0A 4YJ5A 4ZOEA 3C0JA 1HNYA 4OUIA 1KM6A 2EF9A 4W87A 4KCWA 3GAYA 3I3EA 3AJ7A 4UTHA 2A3BA 4JTHA 4GRSA 4B9YA 1E6SM 2YYUA 4PUUA 3L0NA 3L0GA 1K02A 3TROA 1VP5A 3PZTA 2NLIA 2ACQA 3P81A 3ITOA 5B7ZA 1YLVA 4CKQA 3W7CA 4M6UA 3STGA 2YZ5A 4HD5A 3VA8A 1OWQA 4K8HA 4RNIA 4H00A 3VGDA 3USZA 1UWAA 1W3IA 1S2VA 4UXDA 3VIPA 3EZ4A 2OMAA 4N02A 4CNSA 1ISYA 3FEQA 3N9KA 4BZYA 4HMEA 1JCJA 3PN8A 4H8HA 1AFSA 1FHUA 4BQ5A 4NAFA 4CCDA 5M2FX 3M16A 2ISFA 1VEPA 2NQJA 4M82A 4DPQA 3AMGA 3LCWA 3NO5A 1W3TA 4PUDA 3GXDA 1CLVA 2YL9A 3MVIA 4JHMA 3G0XA 5FJPA 3W22A 4GVFA 3AXKA 3SRFA 2XN1A 4DY1A 3ZQ9A 4JFWA 4IQDA 3POCA 4L56A 1S39A 2WVTA 1SO3A 2VURA 3KRSA 1CBGA 3NZ1A 3VXGA 1RLCL 1FKWA 3AYTA 4FNTA 1AG1O 4DXKA 3UVAA 2ZZ1A 3RAOA 5A2CA 2G37A 4US6A 5C6MA 5BXSA 5HPOA 3VGGA 1WB0A 1TV8A 3GU2A 1NVMA 1IV8A 4LU0A 1ZPTA 5CCZA 4DBSA 2WM0A 5LA2A 3S9IA 1JUEA 1Q7ZA 1QPNA 1W3HA 3S6OA 2VP8A 3SZ8A 3NXFA 3EWZA 4D6FA 4IQLA 1D8CA 1X1NA 3F03K 3DEQA 1Q6LA 4UZSA 3VFCA 4WJEA 3P84A 3K8MA 3PZNA 2X0YA 1ZRQA 1QHOA 5F2MA 5HPCA 3VE9A 4JTEA 1XLHA 3GNNA 4J5NA 1CT5A 1W1A1 4LYRA 1ADDA 4M7TA 2FGBA 1Z69A 1M7PA 5I0DA 1YXYA 4W8BA 3SIZA 2HWGA 4H9TA 3F5LA 3UYIA 3WLRA 1XI3A 3PB2A 5EFFA 3HMCA 1LTDA 3C3UA 3AIRA 3W23A 2CHNA 4FXSA 2EGZA 2WQDA 1SM9A 4EVZA 4J27A 4HN8A 3KDOA 4LBUA 2P8CA 5HUPA 3QGKC 4HPXA 4LVBA 3WQ6A 3M7WA 4AZ6A 1D8WA 5F1VA 1RJQA 1KBLA 3VIIA 1G67A 2E9MA 3ATYA 3W53A 1UBPC 1UC4A 1M03A 1UKPA 3SJ3A 4NNCA 3FLUA 4XAZA 1JCXA 3H2EA 3OGVA 4HMNA 4UNLA 1R3SA 3CQKA 1OCNA 2Y89A 3ZS4A 4AVOA 4JQ2A 1HJUA 3S5NA 4IGSA 4LF2A 3W74A 3IJDA 3LMZA 2WO5A 3AIVA 1DOSA 2OLSA 5D2XA 2WZMA 4LCRA 3RCMA 2RDUA 2E5DA 2V8ZA 3USBA 3V35A 3IPWA 1EBHA 1RK6A 4TR9A 4MNMA 2WVVA 2GGJA 2AAAA 1RUSA 2CNCA 3GXMA 1IWAA 4UQAA 4H6KA 1PUDA 3A9IA 3CMFA 3QR1A 1ZS2A 1QHZA 4ICCX 1R9ZA 4GYPA 1H60A 4JIPA 3G1HA 2CBVA 5LIKX 3RLHA 4CVUA 3GDBA 3ZT6A 5F4WA 3O1NA 2DZSA 2OTDA 1CXKA 2RDXA 4MNJA 5KZMA 4E5TA 3BQ5A 1KFWA 5HAOA 1JDFA 4DZIA 5D37A 4HJWA 4OGZA 1ADOA 3KZPA 1JNDA 1XLIA 2Z0IA 4WJ8A 1JRBA 1UD4A 5FJIA 5C9ZA 5KTLA 2HBXA 1SJAA 2DPEA 4I5XA 2YDQA 3T4CA 1U1UA 4KIRA 1JXKA 4PCTA 4GG9A 7TIMA 2PGEA 5C70A 5CLWA 2PBOA 2C19A 1LOSA 3BMVA 3W7JA 1ZLPA 4PH6A 3PSVA 1TV5A 3GBEA 3LHYA 2WNNA 3GG1A 2CEQA 2NQ9A 3EOLA 2GGHA 4OV4A 4NRSA 3EMZA 1TX2A 1GQIA 1THFD 3QHNA 4ATLA 1JCTA 1UH3A 3FW6A 1GOWA 3WNNA 1UP3A 1W3LA 4HPJA 4L64A 1BVNP 3RJYA 1XPGA 2P76A 3S2JA 3IJIA 4RV3A 3NQGA 2FPYA 3SR7A 3PPFA 3W38A 3RFAA 3CEPA 4PMRA 2DUZA 2PE4A 1LQ2A 1W1ZA 1S1PA 1V3HA 1W9DM 3PBGA 3L23A 3VUPA 1UKSA 4H9UA 2WJEA 4GBUA 3L67A 1EA0A 5KEZA 1YTKA 2NSXA 1KA9F 4MFDA 2E8ZA 4LS1A 3F7JA 4KERA 4AYSA 1G4EA 3GG7A 1UB3A 3ABSA 1KBJA 3BH4A 1E6RA 5ENLA 3L2LA 4QLKA 3TAKA 3BSMA 3UD6A 1UKOA 3W83A 2J9XA 4IX2A 2JBMA 1QI5A 2EPLX 2QV4A 3R7MA 1QOQA 1ITXA 4OBRA 3VNDA 5D9PA 2HVMA 3VAVA 2DFAA 1ZJAA 5A8PA 2JKPA 2E77A 4Q8OA 4ZENA 3SY1A 2CZFA 1JYWA 3MKKA 1WZLA 1Q6GA 3DFOA 1HL9A 1JI2A 3WLKX 4NX5A 1DXEA 4JTLA 5LNUA 1H09A 3MUY1 3LS9A 1ICQA 1BGGA 4JIRA 3ZJKA 4EWND 4C6MA 4DO7A 2R82A 1E0TA 4FNPA 4IP4A 3GWQA 4O1EA 1ZBKA 1K03A 1F8MA 5LHFA 3IVSA 1VCGA 2VC6A 5DBTA 1ADSA 2ZC1A 2A79A 3T6CA 4GKTA 1XIMA 3E0WA 1PKLA 3KOWA 3PB0A 1QNVA 4S3JA 4ZA0A 1KGWA 3NR0A 4JFVA 1AH3A 1V93A 3B0PA 4GQGA 3LXBA 4AUBA 1XIBA 1TE6A 3W7DA 4CD4A 4IFKB 1FWAC 5JIWA 1A5LC 2V9DA 3JU2A 1TZZA 3WLNA 3C5QA 3ABQA 2QMKA 4NG3A 3PAJA 3Q45A 3M07A 3PZUA 1F3XA 4N9CA 5CZTA 2BX7A 2VXNA 3S1VA 1R9YA 2C13A 1UPPA 3MCMA 1F6YA 1U1HA 4I7WA 4PTWA 3ZT5A 4OHQA 4A3YA 5G2WA 1IWPA 1VJZA 4F0RA 3W87A 2Q02A 1K8CA 1PX4A 3TIMA 1M68A 1BYAA 3TN4A 2DW6A 5FSDC 5BMXA 3JZEA 3TYCA 4JTCA 2YCEA 4PEKA 1Q5MA 3WK3A 1GKQA 2ISSA 3CGTA 1GVQA 3VNYA 2WMGA 1UZHA 3TJXA 4PEEA 1MDLA 4PFMA 4MAVA 1QNSA 5I3HA 3I68A 4EPEC 4HU3A 2QT3A 5A6LA 3M5ZA 3ANVA 2AAMA 3WLMA 2XZ7A 1GK8A 4A8IA 3E2QA 4IQEA 2ICSA 5LHEA 3IJ8A 4DBDA 2NWSA 4EACA 5CBBA 4U5IA 4HU0A 3AQUA 2VNCA 1QNRA 1D7FA 2A7PA 1EPVA 1W5QA 4QS6A 5LXXA 3H53A 2QAPA 2FH8A 4XZNX 1Q4WA 4IXXA 4HN4A 3WLQA 3ICJA 3WEOA 3WJSA 3DKLA 1B3YA 3GG0A 5HMDA 3RU6A 2O9TA 3V16A 2E8YA 3QLLA 1SW0A 3KBNA 5G1YA 3F5KA 3OLIA 1QMLA 4FNUA 4IGHA 2QR6A 2I17A 1Y7VA 1O68A 3P6LA 1FVPA 5HQEA 3OYZA 3TYDA 4H41A 4D6EA 4NNAA 3W81A 1FDJA 1ZBWA 3VNJA 1G6CA 3WQPA 3RG6A 3GNRA 3VVGA 4F0KA 3GH7A 4FI4A 1QFEA 2XVKA 3FV9A 3GQYA 1AVAA 3PBVA 1OEPA 4IT1A 1SFLA 3PUDA 2O9PA 2GVJA 4PUWA 3GD6A 4B3LA 2Y8VA 4HZ8A 1J79A 2ISVA 2QPUA 3KHJA 1U33A 3RYSA 5BRBA 1LL7A 1FWBC 4O54A 3VDBA 3UPMA 1KGXA 1H7OA 1I6NA 4IIHA 1XP3A 9XIAA 3TW7A 1QRQA 5H8PA 2XYLA 3VMPA 3BAWA 4IP5A 4C6FA 3BGAA 4GJIA 1KWGA 4JL1A 3T05A 1FY6A 3B8TA 1PHWA 5EGRA 3EA3A 2C1HA 2GQ3A 3VIGA 1R9XA 4Q7BA 1F4AA 1Z3NA 4Y9AA 3D5HA 3AZRA 4AZIA 3CEUA 2W63A 3FJLA 3OVRA 3B8VA 3H2MA 4V27A 2ZRYA 2ABBA 2FMOA 1ZJBA 4O8AA 1F61A 3M41A 1K9FA 3KS5A 4S3KA 3L4ZA 1IXQA 3H4WA 2YXGA 5I00A 2Z28A 3HTWA 1VGAA 1J2BA 4L1XA 4K6AA 3EPMA 4XKYB 1RK5A 1VR6A 1FQ0A 3RJXA 4HP5A 4C7FA 3ITVA 3AS1A 3JRKA 1B30A 1DWJM 1GJUA 4H6EA 1I60A 2TPSA 3NIYA 4BKNA 3L4YA 3P80A 1OGBA 3A3XA 1RPXA 5DRCA 1IYXA 5DANA 4DF1A 1SR0A 1FKXA 4TVDA 4QXIA 4RW3A 4GFIA 4M81A 3MBFA 1OT2A 2PDCA 3OGRA 1PDYA 2XVGA 1W37A 1UWUA 2VGBA 2BY3A 4FIQA 2O92A 4J3UA 3LGGA 1E4MM 1MRQA 4X2RA 3NOEA 1FWSA 3FHAA 2NV1A 4R3UA 3MUAA 3UWWA 3GHRA 3KTSA 5HQLA 4NL1A 2NVAA 3N11A 3WLJA 2NUWA 4AY1A 1ZHAA 1PXGA 5LIUX 1EHNA 1ONWA 1XQKA 3C0LA 4I8DA 1Q2SA 3SCNA 1FHVA 3KS6A 1AW1A 4DZAA 1XBXA 4IUGA 1QPOA 2ZUSA 4LWWA 1XLKA 1K3UA 3PM6A 1ITQA 3W7EA 1FTXA 4U2ZA 2D0FA 2Z1WA 4AEOA 1TIWA 3ZSSA 4XTDA 1VBUA 1JDAA 3BLDA 3UEQA 5KITA 3GY1A 2NXGA 4HNLA 4TV6A 3UXIA 1EJ7L 1UQYA 4UOZA 1UD2A 1Q6CA 2VEMA 4QLLA 1SZRA 3FHQA 4DI9A 3VDHA 2NUXA 4V33A 1IZCA 5E1QA 1ESWA 3EMCA 4KFOA 2WHJA 3TYEA 1TFVA 3M0XA 5AHLA 1SYTA 3T08A 3VM5A 5BXPA 4XV0A 2I56A 2QCDA 3UXAA 3N18A 2Z25A 4GNVA 1PB0A 3W2JA 2J8FA 3ORWA 1VLIA 5FL0A 3SO7A 3IV8A 2WM1A 3DHFA 4A3HA 1KCKA 4FP1A 3MCOA 3L2MA 3E0IA 1LUCB 4ZXOA 1YKWA 2CKRA 1O95A 2CITA 5FEPA 1B57A 3GIQA 1JZ2A 2XH7A 4QAIA 4DNMA 5D8WA 4J3ZA 5C9RA 1OQFA 3E2VA 3GUWA 2DY3A 2P1FA 2IW0A 3DG3A 1Z44A 2HSAA 4BA0A 2OLAA 4KEVA 2J8TA 4QSFA 5EMMA 4DBEA 1JG9A 3E5BA 1CX9A 1UR9A 1KM4A 5EU9A 2BY1A 4Y9MA 2WCAA 3R0DA 5I2UA 1N8IA 3H12A 3BAIA 5MKGA 2NLYA 1VAHA 1TX0A 1UJQA 1NQKA 4WEVX 1G01A 1TPB1 5AB3A 3OA3A 2YCIX 3TWAA 1BYCA 1CCWB 1B3VA 3BQ6A 3CK5A 3UCQA 2ZUUA 5AHFA 1H1ZA 4H8NA 3FYYA 3N6JA 3DGBA 3I3DA 1B3WA 4P8UA 5A6MA 3UR2A 2TMDA 2PDBA 3DC8A 1I0DA 3CBWA 2VFFA 1A49A 1V0KA 4AX7A 1ZY9A 3HGRA 2QGHA 3EDEA 4QISA 2MANA 3UZXA 3G22A 3CTLA 1XCFA 2F9RA 3L66A 4CN6A 1VPYA 1Q6QA 3HM7A 4NI8A 1KM1A 3NZRA 2YOCA 2NQ5A 4WZHA 1G9HA 3ZR4A 4OWGA 4XG1A 4MMWA 3NQ2A 4XISA 3MPGA 3UP8A 2WMKA 3TX9A 1MFUA 3NO3A 3MJYA 3M5YA 1EP1A 3WD3A 1I8JA 1HL2A 1DWIM 2Q8XA 3BZGA 8XIMA 4A2RA 4H3DA 1CZ1A 2SFPA 1Q6OA 4YHEA 1TB3A 3RM8A 1O7AA 2E7FA 1E51A 1U1JA 4M3PA 4I5RA 2DJXA 1J0JA 2GVEA 2Z6IA 4GMEA 1GVIA 4F66A 4LVDA 3AS3A 1E0WA 2OYLA 3GTHA 2R91A 1JD7A 3EX3A 4MWAE 4UZUA 3PZ9A 3BMXA 4A8RA 1RALA 2PU1A 3SGUA 3VD4A 1UH4A 1DJXA 3ZR5A 3LY0A 1VFHA 4HCDA 3LZ3A 1RP9A 4KWWA 3HV8A 2R1PA 4WHBA 3UA3A 1HKJA 3CIVA 4QTGA 2OSXA 4BJHA 3ALFA 5T9CE 5A6SA 3FAXA 4NSBA 5FA5A 4J2MA 3GDRA 1JGIA 3WQ8A 2NQZA 4JS3A 4XSLA 1SJDA 3BVJA 3N4FA 1Q7QA 4AXKA 3KRZA 2F6KA 1R87A 3QV8A 3T2QA 1A5BA 4ZE5A 2J27A 2WPGA 4G7EA 1WDPA 4ASTA 4O4VA 4QR6A 4IPLA 4BF7A 3A12A 1XLLA 1A5UA 3R12A 3WDRA 4DX3A 2V2CA 1LF1A 3D46A 3VIHA 1P6BA 5D9NA 1Z32X 2AMXA 1AD1A 3QFEA 4AZCB 3REQB 1OG0A 1OINA 4UMCA 2NV2A 3UJ2A 3AHZA 1H1YA 4HU4A 1QI3A 2VCCA 5FKYA 2G5WA 4HSOA 1WOAA 1MEWA 3UWQA 1CW2A 1I2RA 4HK7A 4C1NA 3AYVA 3C2RA 3NCOA 2C71A 4RDZA 3WUBA 3VGEA 5EMJA 4F48A 2DVUA 2VFIA 4PMJA 3KX6A 2QDDA 1EP2A 3A23A 1W3NA 3A64A 4CCEA 4ZGYA 3N15A 1H5VA 3VKCA 5CJNA 4LAMA 3M6DA 1FCVA 4IIGA 1LRNA 4DJFC 1BWLA 3G0UA 1HFBA 3V0SA 2CXEA 3L12A 5CJMA 5RUBA 3TFCA 4C5YA 3ZR6A 3HPSA 3FK4A 3KOXA 3BLLA 4DO6A 4YWSA 3CMGA 3W7OA 3MSRA 4LYPA 3WF0A 2ACUA 4LEQA 1JCYA 1UUOA 1BWVA 5EBUA 2ZZ2A 4JEQA 1SVDA 1SMAA 3O07A 5CBJA 3BL3A 1BRLA 3HG2A 4JNZA 1W2VA 2WZEA 2W91A 1XCXA 1R6WA 2HS6A 4AVNA 2EJ1A 5CBIA 3IEBA 4LVGA 2PDGA 1BPLB 2XFYA 4O1BA 4I9AA 3RUBL 1B3ZA 5D8ZA 3P93A 3QM3A 5AYIA 4R34A 1GKRA 3UZZA 5AYXA 3UNTA 3PUOA 2XVPA 3V3WA 3LPFA 3HQNA 3T4WA 3DYPA 3VK5A 3APTA 4J4KA 2JIWA 4NJJA 2I7GA 3B0UX 4JR5A 4LBRA 3WLHA 3AIWA 2OT0A 4W86A 4G6CA 5HULA 3CM4A 1CENA 3F4WA 3C3NA 3QEZA 3VDCA 4D8ZA 3LXAA 4JTDA 1K7XA 2RHGA 4AZBA 1A5CA 3SDOA 3U2EA 4XAFA 2OODA 3A3WA 2WLYA 2HISA 2NX3A 3GH4A 2ESCA 4MDOA 3S4TA 2J6VA 1V3MA 1V79A 3C2OA 3H2CA 3PBWA 2PU0A 4MG4A 1PWLA 4D2JA 2AKZA 3QXBA 1TPUA 4YVVA 1DTUA 2YW3A 4ENLA 1I1XA 3RLUA 4Z2HA 2FMNA 2V6AA 2EAWA 2R24A 5FJTA 4NX0A 5CZKA 3WENA 5D09A 3DZ1A 3JS3A 3RITA 2VKZG 1ZBVA 1FFQA 1C8XA 4IOTA 3IAPA 4AH7A 5C55A 4BEUA 3V4BA 1XM3A 5L6UA 4CD5A 3LPGA 3MSGA 4ORIA 3EPNA 5LNVA 1OK4A 1WUFA 2FZDA 2NW0A 3S2LA 1QOXA 5HMSA 2YFNA 1DE5A 3E49A 4XZMX 4JTKA 2IKGA 1W9UA 4TX6A 3CAWA 1SO5A 1J5SA 4M51A 3OQEA 4L4LA 1DXIA 1E73M 3VYLA 2Y1HA 1MW0A 5GJMA 1PV8A 1OJXA 5DCEA 2VRQA 4QRNA 4IMFA 3QY6A 1A0DA 3OP2A 1TCMA 1N7KA 1E4IA 1PCWA 3GU1A 2OYMA 4H7CA 1EP3A 1CGWA 3O8AA 2VMFA 1UIOA 2GJPA 2YCLA 2YBTA 4WXYA 3W73A 3W1QA 4NXSA 3EOEA 2HPIA 2P3ZA 1EJXC 1R3VA 4TX8A 3SBFA 3NPWA 4LAKA 4C6DA 1EYWA 1PAMA 2GVLA 2UY4A 4UR8A 3WNLA 1V02A 2ZUWA 4JX4A 4PSPA 4Y9NA 3N3MA 3MO7A 4EPKA 2ATMA 5BRPA 2OZ3A 4N42A 3R2GA 3WDJA 3CH9A 3SCWA 3UFYA 3TW6A 4A21A 3GTIA 4F0HA 3EMQA 3GFZA 2DZUA 3LRKA 2DZAA 4UFHA 4IMDA 4L1WA 3LOTA 2J8GA 3DHDA 3W7QA 1AMKA 4MKVA 2Z2UA 3GNPA 1XYBA 1LWHA 3OHIA 4EAMA 2ZWYA 5BYWA 3EXSA 2EHHA 1OM0A 4D1IA 2GDQA 4K7YA 1XDMA 3EA1A 4GGHA 1R30A 1OX4A 1K4GA 1G4TA 1JAEA 3LCLA 3W88A 2V5LA 4A29A 1DJWA 4Y8EA 3MMUA 3I6TA 2OZ0A 4GYKA 4AISA 4NP7A 1QXLA 3GYEA 2GYIA 4F40A 3CIXA 1B9ZA 2Y7GA 4R7WA 3T44A 1IE7C 5A6AA 1AQ0A 5HATA 3N12A 4I6KA 4IFRA 4EXBA 2NX1A 1YMYA 1AQHA 3WBEA 5F7UA 3QGVA 3VNMA 3S9YA 2OQHA 3FS2A 4Y96A 1TVNA 1CGYA 1KXHA 4L6OA 3V0TA 3HOJA 3AS2A 2HK1A 3DBPA 3ZVHA 1J5TA 4JKMA 1EC8A 1V3JA 3P74A 1IHIA 4AEEA 1VC4A 4JAWA 4GY1A 1M01A 5E5CA 4MDPA 2ZRXA 4FNSA 4B2DA 2X2GA 3DFTA 4K39A 5A2AA 3MBDA 3U5YA 3H21A 3QQ0A 4UQEA 1V8EA 1YPFA 4R53A 3U4FA 1FH8A 3SQMA 2VC7A 4LYKA 1H7RA 1EUAA 3MUCA 1W32A 1W0MA 1PEZA 4RZ6A 4J3VA 2GFTA 4RZBA 3QZAA 5IHRA 1VF8A 3GFYA 4WY0B 4ZFCA 1LT8A 3M1ZA 3WO8A 3VKJA 1X1ZA 1XIIA 1EGZA 3ENLA 1XJBA 2VRKA 1E0XA 2WBGA 3CUZA 2IMRA 5GNZA 3QTGA 4JY8A 1HVXA 1Q3NA 4BEQA 1TMHA 4LV4A 1TV2A 1P1MA 3BJFA 2GJXB 2BVYA 1AQFA 4O10A 1XF0A 3QRHA 4MZ1A 3BARA 3EAUA 4L4PA 1TJ0A 5HR6A 1S5TA 1A5MC 4O8RA 3WD4A 1C7TA 3A9BA 4KPLA 1A47A 1Y5XA 3I6RA 3OG2A 4XB3A 2OKTA 2PDQA 1CB7B 4IPNB 3EWYA 4N9EA 1PPIA 1QUMA 1VZWA 2GVYA 3N2CA 1EZ2A 5HANA 4E4UA 3B04A 3TW9A 4XZWA 2RFGA 3TK7A 4K68A 4FALA 3AXIA 3GUGA 2ZBTA 1C8QA 1DL3A 2DJLA 1QPQA 5H8UA 4XSMA 2YL8A 1X7FA 3G5EA 2E5BA 3TR2A 2ODOA 1EC7A 5LKYA 4KMQA 1FWGC 2X8RA 4AMAA 2GWGA 4NZ5A 4ACYA 3HQPA 3W1UA 8A3HA 4XVDA 2WC7A 4IIDA 3PWGA 1PE1A 5CKSA 2YW4A 4NKCA 4B5WA 3LBCA 1TA3B 3WF1A 4JTJA 3P0WA 4CQ9A 4WKAA 1LBLA 1V0LA 3VMOA 2JALA 3DI1A 3IRSA 2A6LA 1SR9A 2VELA 5FIPA 2CKSA 8TIMA 3CHFA 4H83A 4B3ZA 1XICA 3HFYA 2YCLB 1UC5A 4UCGA 4F2TA 3RRXA 4DM2A 1CTNA 1QW9A 2YR1A 2V81A 1W1B1 3CV6A 2YDRA 3BURA 2BV9A 3GZ3A 2HS8A 3IANA 3SURA 4ZFMA 3M43A 1K6WA 3MP3A 1OF8A 3LNMA 4G5DA 1REQB 5CAKA 4AAJA 3H23A 1EC9A 4L4OA 4QE4A 4Z42C 2PSNA 1DWAM 2Z6JA 2OCZA 3TTYA 2QCMA 3VD7A 1J12A 2OG9A 3Q58A 2PP3A 2GPTA 1D2KA 4E6MA 2XSBA 1GYNA 2EXOA 4PFHA 3THDA 5KZDA 1JDCA 3N34A 3PG8A 3F2BA 4IISA 4V2XA 5DT7A 3SGZA 4ZZ9A 1HJWA 3W72A 3MWCA 4HJFA 2O4MA 4X0NA 3CZ8A 4E2OA 1I2QA 2OEMA 1PJ9A 4GCAA 3SRDA 3GK0A 4JL2A 4XAGA 4H9YA 4N7QA 3CQHA 4Q8QA 3B0VC 2RJGA 4PCPA 1P0EA 3QBUA 5D32A 2G50A 5C71A 3O6YX 3T0BA 4P7LA 3R0KA 5HNRA 1KWKA 3W2UA 5EMKA 3QGAC 3P0XA 4Y2WA 3NM3A 1JZ6A 3M0MA 3F4DA 4K7VA 3RIKA 3HO8A 1IEQA 3E2SA 3WNPA 4G1NA 2Z7GA 4PULA 3MQTA 3CPUA 4Q4PA 2BSLA 3O7UA 2WK2A 2YCKX 4GZIA 4S1FA 4A8NA 1QW8A 4P8WA 5D30A 3SGGA 4QNEA 2G3NA 2YL5A 4H6QA 3WJZA 3C8NA 5BZAA 3B8UA 4HTBA 5ABTA 3EDDA 4FO4A 2ZX8A 1Q66A 2OX4A 2CERA 2NXHA 2VR5A 4O12A 1TPDA 4OT7A 1UKQA 3TTOA 3SB0A 4ZOAA 4WOQA 4AWEA 1XBZA 4ACZB 4IFKA 5A2BA 3CAQA 3QW4B 1Z7AA 2WQPA 3BCJA 3PUGA 1H7WA 4YIWA 3FA5A 1L6WA 2EG7A 4Q33A 1AL7A 3RM9A 4BQ2A 3MYOA 3UG3A 3S5YA 5M03A 4JYFA 5KZEA 3QVQA 2A4AA 2ONEA 1OFBA 3A3HA 1XH0A 2A1YA 8CGTA 1UWQA 3VKDA 1WP6A 1OY0A 5LGXA 2WMFA 4GUIA 3EDJA 3OZPA 4FAMA 3A6OA 3TU9A 4AVFA 5HWMA 1TZ9A 1WXYA 1H1NA 1IR1A 2VM8A 1F3TA 4FX8A 1WV2A 1OCBA 3NEVA 4Q7IA 4S3GA 2CESA 3LPPA 3XISA 1TPFA 2FPVA 3MYPA 4U28A 1S2AA 3EWXA 1ZJIA 1K9DA 1OFDA 4PRWA 2FZNA 2OELA 3WFAA 2OO0A 3B05A 4P7QA 3F4NA 2INEA 5BWAA 3NTYA 1KR1A 4JPGA 4NYYA 5FAGA 2HROA 2BWGA 4OKDA 1KM3A 2FVMA 4F9JA 4LB3A 2DQWA 3M0HA 3OZYA 1Z89A 1DJQA 4TO8A 3ZSTA 2RDTA 1FWIC 1WDRA 3G3MA 3SCUA 4P8VA 4WIWA 4C6IA 1H49A 2ZXQA 2DT0A 4JN8A 3TSBA 4XTIA 1IZJA 5LNRA 5C5YA 4GO9A 4HPGA 5D38A 1UUQA 4S2BA 4Z0JA 1QR7A 4ERAA 4M80A 2J79A 1R47A 2W92A 1ICSA 1RJPA 4C5ZA 3S1UA 1US3A 2Q01A 1EBGA 2G97A 1NDZA 4U3CA 5GJPA 3K8LA 3Q65A 4QIUA 1CPUA 3KTCA 4PMQA 3NJ3A 3CHVA 3SM0A 1PTDA 1FCUA 3QY8A 1LCOA 3ZLFA 3CIWA 4AU0A 3M0ZA 1OSEA 1KCXA 1SW3A 3GDTA 4IIFA 3U7VA 5XINA 1DBTA 3TLQA 2X7VA 3N9SA 1FWRA 4QQ3A 1IIGA 5TAOA 2CLOA 3H7RA 3R8HA 4YNGA 4PE8A 2O9OA 1B31A 1QK2A 3U8GA 3VIOA 1BYBA 1GNXA 3W27A 3WH8A 4QCFA 2CPUA 4Q4KA 3VKAA 4RL3A 1NSJA 4KKXA 2X1RA 3LB0A 3TAOA 3RR1A 3IACA 2HE5A 3DYOA 1A4MA 1HKVA 3IGSA 3CLMA 4N9DA 2ZZ7A 3BE7A 4QLJA 4GISA 2QUTA 4B4FA 2VVSA 2JEPA 3KL5A 3HF3A 3BXWA 4HK6A 1W2PA 4ZBCA 2X0SA 2EQDA 1BF6A 5G4EA 1Z42A 2IQTA 4OOZA 4ZO9A 1OYCA 4LUTB 4GD0A 4QJ1A 3IUDA 2C91A 5DY3A 4DJFD 4D8LA 1GKPA 1DIKA 5TF0A 4DYEA 2JK2A 5K2ZA 2BXYA 2OX1A 4UNIA 2PUZA 1K4HA 2DIKA 4NZJA 3VINA 1VRDA 3P14A 2XZ9A 1Y8BA 4HA4A 1C8YA 2IKIA 4DUOA 1C3FA 4CCZA 1VHNA 5CC7A 2Z27A 1LG1A 2Y7DA 3EKLA 1XW8A 4GIYA 3SCOA 3LQGA 3FYPA 4DBWA 2ABAA 4UTMA 3CUJA 3XINA 4Z2JA 1EJTC 5IRPA 1RBAA 3BLPX 3VKKA 2CZDA 1HJSA 4IH3A 2AL1A 3SQSA 4LVAA 1Q65A 3WDPP 4RW5A 2JQXA 1W31A 3TONA 2FZ8A 2HMCA 3V0UA 4B16A 2WKLA 2C1IA 2J7CA 4ONVA 1N82A 3TYBA 3C2YA 1VHCA 1LLOA 4RNFA 1ISZA 3C61A 2ZYFA 3RF9A 1BHGA 2GLKA 3JR2A 1VRXA 2Y5SA 3DFHA 2PD9A 3FA4A 1VFTA 3S83A 3SCTA 4L5ZA 3MKVA 4KEUA 3TNOA 4JICA 4NAEB 4OFCA 4REQA 5I02A 1HX0A 1XLMA 3PFRA 4PB3A 1Q13A 1DJGA 1JYXA 2RGLA 5KSWA 3VNLA 3PVFA 3WDQA 1JAKA 2ZUVA 5C2XA 1Q85A 4U33A 2IKHA 4WY0F 5FF4A 4O11A 4O1AA 1W56A 4GK8A 4QJ3B 4TUFA 1B2YA 3CTTA 1N8WA 4EE9A 3CB8A 1J96A 4YTTA 2G41A 1WYIA 2PC8A 3CV1A 1OFRA 2GQ8A 3PULA 1HGWA 3NQ6A 1SZEA 4IMEA 5HJLA 3T7VA 1M7XA 3APGA 5F1UA 4BCEA 1TELA 2YXOA 4MHBA 5H6HA 1PS9A 3F4CA 1PHQA 4JBRA 2CLKA 2VQTA 1E40A 3CS2A 4ZODA 1D3CA 3NFUA 4XK2A 2VRJA 2OGYA 3GXIA 4JTQA 5GQBA 5IDIA 3GXFA 3KBMA 3QV7A 5HOSA 1M04A 3VD3A 2CBIA 3BAKA 2QV5A 1IXNA 4MJ4A 1E0UA 2DUXA 1VBHA 3CWNA 1EIXA 3GDLA 1I4NA 5EMUA 4S3FA 2VEFA 3WD1A 5DFAA 2AGKA 3NPUA 5CG7A 4AMCA 5BNKA 2RUSA 4FF7A 3QTPA 1C8VA 4JIQA 3SY5A 3UCCA 4ACZA 2PS2A 1A5AA 4ATDA 1FWFC 1G0CA 3OLGA 2VYOA 2PI6A 2FQIA 1JNEA 4OUEA 4U10A 2W61A 4IFOA 4FK9A 1D9EA 4C6EA 1WDSA 4J3TA 3CZJA 2YL6A 1O6IA 3TQKA 3LA4A 5F2IA 2D3NA 5E09A 1YYAA 1RQHA 1AUSL 4GE8A 1EOKA 1R2RA 5CGQA 3G6MA 4FA3A 1OFEA 1U5HA 3ZZ1A 1UR8A 1E5NA 2PZNA 5C7HA 2V2DA 2GJXA 4TX9A 3SUWA 5I3JA 5D4YA 2Y7FA 1AD4A 3SIMA 1F5ZA 1X8CA 3AIEA 1EX1A 3NYZA 4W89A 3VC6A 3WD2A 1UWIA 4UOQA 3FIGA 5HBFA 2Y63A 1W1PA 1PZ3A 4S23A 4M7SA 4F2BA 4UTWA 3GTFA 1ZCCA 1DIDA 1KRCC 5BOOA 3TC3A 3EBVA 1JR1A 2H9AA 3O63A 4KWSA 1IR2A 1GT8A 4MPQA 1KD0A 4BWLC 1CGXA 2E5CA 4Z2GA 1FBAA 1P48A 1BD0A 1KW1A 1RCXB 3UU0A 4G1KA 4LV9A 2DZBA 2Y61A 1FA2A 1BRLB 3LCIA 4UFKA 3GX9A 2PLJA 4XBJA 1E9LA 3O06A 1ZP3A 3F2CA 2ASHA 4LFYA 1WKYA 2TYSA 2VOTA 1P7TB 3U57A 3W1LA 1A3WA 1BVWA 5FJRA 4NXKA 4MY1A 5E6ZA 4F0MA 5BU6A 3R25A 2PTWA 3S2CA 2VEPA 2Z24A 1T8XA 2I57A 3CXOA 5JMUA 3BG9A 1ICPA 3R0UA 3VIFA 4A2SA 4TVCA 3C8FA 3BV4A 1Q6EA 4N6EA 3K13A 4LYQA 5DY2A 4U31A 1E15A 3CZGA 2WHKA 2QMJA 3G8EA 5A3HA 3Q67A 1LBMA 4MOZA 5FSEC 3RPMA 1AJ2A 2OKOA 2XTKA 3M64A 4AWTA 4TTGA 3MS8A 4I9MA 4LNYA 2CLLA 1T99A 1OD0A 2UBPC 2TRSA 5ECUA 3ATZA 3TLLA 3EB3A 5K9XA 4XZHA 3HGOA 5D2VA 1RA0A 4JQ4A 4UQCA 3KE0A 3UBPC 3AC0A 3TEVA 1OIFA 2R94A 5C9UA 5C9XA 1SJCA 5XIMA 4AY8A 4R7JA 1X6LA 1MQRA 3BUVA 5ABFA 3QV9A 3Q2DA 1GZ1A 1F6PA 5EYWA 2R9RA 5I78A 1NTHA 1GOQA 3PC0A 4WVXA 1A53A 1ECQA 1ZSXA 1CEOA 3TOYA 1J2WA 5K4XA 1ISXA 3H7VA 3I65A 3CLWA 3SCPA 2BS9A 3ZVIA 3ITCA 3AHVA 4MB4A 4C6PA 3D0CA 3QOMA 4DVOA 3ZT7A 3VUSA 1XPYA 3T0CA 4CD6A 3W6LA 2ZFAA 3QQ1A 4GINA 3HPAA 4LAUA 3FY1A 4QDMA 2GJNA 4J3WA 3KOZA 3PP7A 2XM2A 4ZE4A 2QIIA 2JE8A 1VB9A 1MUMA 5KETA 2ZTKA 3N73A 4AD1A 5LA0A 1XSKA 2E9BA 4HB7A 4MWAD 2DIEA 3NQFA 2X41A 1XRVA 1M3UA 4JOMA 3WFZA 2ZUMA 5T91A 1DP0A 4MNKA 2QDEA 3AHYA 1T0OA 4Z1YA 1KM0A 3GXTA 2VL4A 3C4UA 3RCYA 3HA1A 4DJDD 3VO0A 2CIPA 3C0SA 4O4WA 3OIXA 4HYVA 2BOEX 2BNJA 4DWDA 3LMYA 2FH6A 1WX0A 4US5D 1ZBCA 4FXRA 4O19A 1GOKA 4HA0A 4LC8A 3RU8X 3ZWTA 1E1CB 1R3YA 5IBXA 1YE4A 1AODA 4CUCA 4O0KA 2QVNA 1GQNA 5KINA 3TSMA 1XKJA 4LGXA 1R0MA 4QROA 1XRFA 2VX5A 2X2YA 1BXBA 2JGQA 3KCOA 1WPCA 2OYKA 2WZHA 1P4CA 2XIMA 3H2OA 1GOOA 5DCBA 4IWWA 2HVNA 4WR3A 3B8WA 2WJFA 2GDVA 4PL1A 3IJ6A 4HSNA 1WCGA 1POKA 3S2NA 3EWUA 4XVEA 1XGEA 2GL5A 1XLEA 2C15A 3KUMA 5G1TA 3N9RA 4NVTA 1KO0A 4UFLA 4RDWA 5FOOA 4RE2A 1BG4A 2AQWA 3CUFA 4IIBA 5GVJA 3NQDA 1XYFA 2FTYA 4NRRA 2OSYA 1V6XA 4MY9A 1QASA 3MMWA 3M44A 4UNKA 2J62A 2QS8A 5I06A 4NJIA 5AHIA 4HNTA 4D6IA 1PIGA 4P61A 3EOSA 2XFRA 1S5MA 4AW7A 1BAGA 4QITA 3ARQA 3W1AA 5EMYA 4G7EB 3WJYA 4GUGA 3T0DA 1JPMA 3WQWA 1MW1A 2HTMA 3KLKA 2ALDA 2E4TA 4ZSUA 3RGTA 3TQ0A 4UMAA 2WVVB 3TMLA 2PD5A 4QE1A 4PRRA 3ARSA 4UTTC 1PZ0A 3GKAA 3B9NA 3MA8A 4WD0A 3W2MA 3M0IA 3HURA 2NT1A 2WCGA 3H22A 4HMDA 5JQ9A 1F4HA 3UVIA 1PX3A 1JPHA 1H51A 2VCAA 2VCBA 4JYDA 3I7SA 1DXFA 3AHXA 4M0XA 1MQQA 5A8MA 5AHMA 3NL2A 4AHPA 1XDLA 2F6XA 3KP1A 3NNTA 3I4EA 3WUGA 4Q8UA 2BHZA 2PB1A 1EYEA 3KTXA 5A6KA 4PMXA 3OTRA 4MJZA 3FKRA 2J7GA 3ZLGA 5C8BB 1H0GA 3FCPA 4UTIA 3BOFA 1K7FA 1AH4A 3W86A 1QI2A 1RHCA 2GOUA 4IL2A 2FFIA 2VGIA 1PCKA 3KDNA 4V1XA 3VIKA 2VWSA 1X38A 3EEGA 1EA9C 4P2VA 3T40A 3OGSA 1WDDA 2QCHA 4FOJA 2F61A 2GUUA 1K9TA 3EYPA 1UD8A 2XINA 4MZ8A 2Q8ZA 2E9LA 3WQFA 3C2VA 2Y5EA 3LCFA 2QPSA 2ZX9A 4JTGA 3H2FA 4WDTA 3R94A 3V18A 2OWCA 1LLZA 3UXKA 3SCSA 2POTA 2DGAA 3LRLA 1CXLA 4JYEA 1X97A 4AX6A 3ELFA 2D2GA 4LH8A 2PDHA 3QMRA 3OOQA 2ZA3A 4AZCA 4LJ3A 2B0MA 4JQ3A 3TN5A 1RA5A 4GJ1A 5I79A 4CNTA 4KWOA 3MKCA 2QQ6A 2TAAA 2QJGA 4QAWA 1TREA 3O2LA 4JKLA 5U4NA 4HOXA 3GTXA 3G24A 3OZMA 3ARXA 3BG5A 4F2UA 3LGEA 2CU0A 3R43A 2R1KA 5AYYA 4WF7A 1I2OA 4G2DA 4LPCA 4Q4OA 5A5WA 3W37A 3VFLA 4WKHA 2BY2A 2WJDA 2CCRA 1RD5A 4Y9OA 4C6BA 1BF2A 4PMOA 3UT0A 3GXNA 1JDDA 4GBDA 2IS7A 4PSRA 1WUEA 1Y0EA 4O13A 4R9XA 4FPSA 3QLDA 1J0IA 5CJ5A 3RPDA 3GR7A 1E71M 1HN1A 1QCWA 2QNEA 5LXEA 3TR9A 1XYCA 4MJMA 4HHLA 1EDGA 1LM1A 3QW3A 3IV3A 4AY7A 5HINA 1YDVA 3TDFA 1CNVA 2PFHA 3TJ4A 1MWOA 3PPGA 4ZTXA 4GNKB 3SN4A 2OO6A 2WKGA 2JGYA 2WBKA 2OGJA 2ZKMX 1ENUA 1FWDC 2H6RA 1QWKA 4E8CA 3IVTA 1DKWA 3A4JA 1TO3A 2PWUA 3OG3A 1KCLA 4W9TA 3AHTA 1OBAA 1R3RA 4GUJA 1Y5WA 2V5KA 2Y88A 9XIMA 2QF8A 3OO2A 5E9AA 1YBQB 5C2CA 4WLCA 1ODZA 1XYAA 3V5FA 2HV5A 2PGRA 3VGHA 5HWJA 3GRIA 1QBAA 5AY7A 3K5XA 2Z2AA 3ITLA 3CL6A 1KFJA 1R7OA 3SAZA 4DRSA 3U5UA 1K1DA 2Z2BA 4OVXA 3UR7A 2Y2WA 2ZC8A 2A3EA 1X96A 1YXDA 3M47A 3CZEA 3VCNA 1BTMA 3E96A 2XHYA 5MHBA 1E6NA 4K38A 3WEMA 4A22A 5DXXA 4Z17A 4UTFA 5BOEA 3EX4A 3QMTA 4V15A 3BJSA 4JGDA 3IGUA 1TJ1A 2Y24A 5JBFA 4KESA 5AHEA 1UQZA 3SSZA 5AC4A 1B5TA 2JIEA 2YA0A 4WDXA 1XRSA 3O6AA 4X3ZA 4C65A 1SSDA 4C90A 3G1SA 3MV01 1OCJA 4FOUA 4NAFB 2DT3A 1XLFA 3TA6A 4ML4A 4ORMA 4IMGA 3AIBA 4WKFA 3XIMA 1BGAA 1XSJA 3W01A 1NOUA 1J4EA 2TODA 1NJJA 3LV6A 2PWGA 5HDRA 3R5EA 5LYRA 4RNJA 4RXGA 1PKNA 2ISDA 3B8SA 2B81A 4TOQA 4JQ1A 2VZUA 3KCLA 5T9BG 1ZP4A 3B40A 1UIPA 3C2EA 5HK4A 3G0SA 2OWWA 2X0HA 2YYTA 3CV2A 3VU2A 2XSXA 2AMGA 2NUYA 1F73A 4MLJA 2VOMA 3NO1A 4DHGA 1V0NA 1M5WA 3VPLA 3CU2A 2BG5A 2QCEA 2H90A 1ITUA 1NDYA 3TCEA 1ZFJA 1BXNA 1UBSA 3LHVA 2PODA 1XG3A 2ZA1A 4UR7A 5E0KA 1FDYA 1WKEA 1JJKA 4HTYA 3VDAA 1LYXA 5DMLA 5HMFA 1IEXA 1ML1A 4GUFA 3HBLA 4JN7A 1Z6KA 3RDKA 2O9RA 3HIJA 4PUNA 3W7NA 2ZZ4A 4JDYA 1VCVA 2OQLA 3QOKA 4LVFA 3N04A 5CGMA 4AHOA 1M53A 3W6YA 3EKGA 2Z4GA 1IEWA 3OVGA 2VEKA 5HWNA 4BI7A 3T1GA 4FLRA 1V03A 4JY9A 4R85A 5DN1A 1VS1A 5LIYX 3GC2A 3GVVA 2QKFA 2C18A 4DO5A 3PTMA 4HPNA 3HV9A 4MPKA 1IXPA 4HK5A 1L6GA 4Y6GA 3WELA 4ADSA 3ZYZA 1RD6A 1J6PA 3TTSA 4H2CA 3H4GA 5DQPA 4KW2A 2J88A 3BTNA 4UTWC 5FESA 2Z1VA 4IJCA 1OGSA 1SFTA 3VCRA 1OFQA 2VI0A 5C9WA 1HL8A 4JCMA 1SZGA 2XM1A 5CSRA 4OTKA 1S5VA 2DVTA 5I7GA 3EPOA 1U5JA 2XGZA 1FH9A 3BCDA 2FIQA 1IT7A 4S3EA 4EOUA 3LXCA 3W1RA 1WE5A 3NUKA 1CYGA 1M9HA 3C52A 1EJRC 4RZ5A 2WSYA 3V75A 2QGYA 4E3TA 1TTPA 2IUZA 4EANA 1VKFA 1OHLA 3SCVA 3W4RA 4K1GA 1SQ7A 4HCHA 3M5XA 4AZ7A 5M17A 4EXQA 2QUNA 4JN6A 3GBDA 3HB9A 4GXWA 3LHZA 4GACA 1TSIA 3TZFA 3IARA 1V02E 1S2CA 4PTXA 4NQ1A 2HXTA 4Q3MA 3AYSA 1V6VA 2Y8UA 1YDYA 2XUCA 5A6TC 3T07A 1HXJA 2PBGA 1V6TA 4GQBA 3PTQA 3BSHA 4UOJA 3AISA 5JBDA 5GNYA 4ZQMA 1H61A 3G2GA 2CC0A 4N4QA 2D0GA 1RJRA 4Q6XA 2ZXAA 4KCVA 1TV3A 4O0ZA 3A5VA 4PR4A 1T7LA 4L4MA 1L9WA 3VNZA 2IQDA 2OXNA 3MU7A 2VX4A 4ICNA 1YNYA 3DDMA 1OC5A 2PF8A 3WLLA 4LNCA 4RX0A 4B2DD 3SUUA 3WL0A 2DZVA 1UZ4A 3QPZA 4Q4MA 3NQAA 3QF0A 1DJIA 5CQ1A 1OG6A 3BMWA 4I7UA 3DIPA 3FGCB 4LY8A 4UTKA 2Y8KA 4EAYA 2B31A 6XIMA 1ZU8A 2DSKA 1QPRA 1ZAIA 4OQVA 4KF1A 3TZNA 2YA1A 1NELA 2OPJA 3PBMA 2O55A 1GCYA 3U3HA 4C1NB 2KX9A 2XJ7A 4LX4A 1L0PA 3EB2A 5FAJA 1J01A 1QJWA 4O1DA 4FLOA 2DEPA 3F5JA 3QSRA 1B9BA 1BWKA 3N3TA 2ANUA 2E25A 3S3GA 3VGFA 2G3FA 3N1AA 5FF7A 1TPC1 1JZ4A 1JXJA 3H2AA 4EPBC 2IKJA 1QHPA 3T8LA 5HQMA 1TG7A 1NWSA 3RILA 5HNTA 4LANA 3UPBA 3SADA 1L6SA 1DWHM 3WSUA 2PTZA 3G3DA 4DJED 4YYFA 2G8ZA 2ZRVA 2RDWA 1BQGA 4D6JA 3LCGA 4IPPA 2QULA 3IJLA 3ONCA 1JQXA 1F3WA 3K4DA 1AA1B 4EPDC 1ONRA 1MXDA 3VMNA 2V68A 5JH2A 4WOZA 4F8XA 1ONEA 1ODUA 1BSLA 1EJSC 4M1BA 3T2PA 3RX2A 3CASA 3DH7A 3PZVA 2C3ZA 2VVNA 4Y90A 3S5OA 1WOBA 5FI8A 1B90A 1EF2A 3W1XA 3W7LA 5DEZA 3ZMRA 3VX1A 5I23A 3W1TA 1J6OA 3PZOA 3NSXA 3H55A 1QOPA 4Q4RA 1Q63A 3DKJA 1F3EA 3KZSA 3WJWA 2WANA 3P67A 4S2CA 3GR8A 4HGXA 4AD3A 4X2PA 4W7UA 1QO2A 4IJBA 2ZE0A 1VLWA 4S3AA 1TR1A 1LUCA 2HQAA 3INPA 3SN0A 4CGTA 3DFYA 1GONA 1VYSX 1SSGA 3E0LA 1MRAA 4MUZA 1KXQA 3EWCA 1MI3A 1A3HA 2WMHA 1C91A 2J66A 5LSMA 2D2HA 4N0RA 2WSKA 4XZLX 3BLOA 3WEZA 3L4WA 3UCDA 4CD7A 4D6GA 7ENLA 4BI6A 4MB3A 4LUIA 2QUMA 4LUYA 3RPTA 1JF5A 3AAMA 1TJRA 4HPHA 2X7WA 4MIMA 3VZYA 5ABFB 1OZQA 3IWPA 1Q8JA 1QI0A 4JTIA 1UMYA 4HVXA 2VFDA 3VZXA 1S2UA 2DZPA 2XU2A 2CBJA 3B9DA 4A6GA 2HXUA 2JFEX 4US5A 1EF3A 3W7HA 3UZWA 1XWYA 4C91A 5A95A 4GWEA 3GDKA 5I24A 4PB5A 2AGTA 2YXXA 2EKCA 4XBSA 3N14A 1HJXA 4JTAA 4K8EA 1B54A 1NOFA 3T0AA 1JF6A 3HG5A 1ZZMA 3EX6A 5AZ0A 4H7ZA 4UBPC 1QNPA 3WQCA 4DYJA 3VCCA 1QWGA 1J10A 2HK0A 2PWHA 4J28A 3H54A 2ALRA 4E3VA 4NASA 3KBWA 1E6XM 5I3KA 2FKPA 3ANUA 3PWAA 1JGMA 4MWAA 4H01A 4D71A 4CCCA 4MVAA 3NQ8A 1UHVA 4P7OA 3THCA 5D2TA 1EKOA 3NL3A 4NY2A 1ALDA 3KVJA 2QDHA 4FR1A 1QTWA 3IAQA 2E6DA 4YMZA 3DAQA 3GE7A 1KKOA 3GNOA 2PDNA 4X9YA 1J0KA 2F2HA 2NT0A 3CWHA 1RQEA 3LD5A 3AJXA 2YKKA 4DUXA 4MFEA 2VD8A 4UTLA 3A24A 2OQYA 3LI1A 4KIEA 1BQCA 3LHUA 4Z1BA 4KFPA 4PYSA 2OR2A 4KQNA 4WDUA 3CHEA 3M0YA 4XD6A 2DDXA 1P6CA 1IT8A 5EB8A 3UWVA 5K3VA 3WQVA 4URIA 1H7XA 2V5JA 3GW3A 3B4UA 3U9IA 1J0HA 2HBVA 3WCZA 1MZHA 1I9CB 1LT7A 1R8LA 4IXHA 1RR2A 2DIJA 1O94A 4ZSTA 1RQBA 1V5XA 3MHUA 4BF5A 2DT2A 3PZQA 3SY8A 3OEXA 5AOUA 3UWUA 2PDIA 4IMAA 1U30A 3KBJA 4M19A 4BFAA 4JHOA 2Q8LA 4M6QA 3FEMA 1UD5A 3DESA 3UGVA 3WF3A 3WBYA 3CT7A 3ALGA 1HUVA 5G4HC 1A5OC 1OFOA 1H7PA 2GJRA 2WJZA 3OBKA 2QCNA 3ARTA 1OF6A 4L6HA 5REQB 2XIOA 5TNVA 3NDOA 1HW6A 3DUGA 5DX7A 5ABHA 4DUWA 4HZ7A 1KGUA 3HJEA 1RCOB 5IDZA 1JD9A 4S38A 1MW2A 2HE8A 2I5GA 4A05A 4WXZA 3QPYA 1QU4A 5JIPA 4R7OA 5E6YA 1JFHA 1Y5VA 5A69A 3AALA 4BK9A 1X7IA 1SFJA 4ES4A 1R3TA 4I8YA 4CN4A 1E1FA 1JIBA 1C93A 1TTIA 3UWZA 5H1WA 2R1LA 3IVUA 5FCZA 4EIVA 3OHMB 2WMJA 3GVWA 3ITGA 3G1DA 3N2MA 3B0YA 3URQA 3LLXA 5AHNA 1JRCA 2DZWA 3IUHA 1H62A 3WMBA 1M7OA 3RNDA 1I2NA 1KRMA 4UB9A 4EP8C 1D7KA 4HNNA 1O1HA 4C6OA 4HQVA 5A8NA 1AJ0A 1I1WA 2PMQA 3I7RA 3M5VA 3ERPA 3THQA 2WC3A 3HG3A 2PRLA 1DHKA 4G56A 2FHFA 2QCDB 2PTXA 1IGSA 4IPJA 1PVNA 3RX3A 1RAKA 4QDPA 3LTSA 2G4FA 1I75A 3CO4A 4JNMA 1JCNA 2X1IA 5DXYA 3UXLA 3L21A 4L80A 1L6YA 3FKKA 4RE4A 2EG8A 1TWSA 2HDJA 3GKFA 2ATSA 3MI3A 4TU1A 4CEUC 1JDEA 4L7ZA 4MNLA 1DQUA 4O18A 5REQA 4AB4A 1O5KA 3HPFA 3SSJA 3FFSA 1TIMA 1VYRA 3G1XA 4HYRA 2HRWA 4XQ6A 5JBEA 4BQ3A 2ZA2A 5CXPA 2FTWA 3FVDA 2W6RA 2P50A 4UTJA 3URNA 3WH7A 7XIMA 1EIBA 4GVIA 1ZUAX 4GQ0A 3MHFA 3UG8A 3DXIA 4K1WA 4IF2A 2FHBA 1BEUA 1EJUC 3S9ZA 3CZLA 3L0KA 4W8AA 4XO6A 3CV7A 3F2DA 2QEZA 4C7DA 3NG3A 1CXHA 2PGFA 3LPOA 2ZX6A 1DJNA 5CZJA 2DW7A 1RH9A 1G5AA 3W7RA 3R79A 5FL1A 4MJ2A 1Z8AA 2A3LA 5AECA 4PMZA 4H9ZA 4ZQNA 1TRDA 4Q8NA 3W29A 2J9ZA 1G4SA 5FJOA 2GGEA 3KAOA 1PYMA 1EDTA 1VIZA 4J2PA 1RSCA 4IP7A 3FDGA 3T9PA 4FLQA 4PUKA 3PR2A 2RJHA 3WL1A 1XL9A 1XFCA 4YN5A 4I7VA 5LZLA 1F8IA 5G2IA 3C56A 3N2BA 4LXFA 2VUNA 1JZ8A 1R3QA 1VJIA 4PODA 4MADA 1RBOB 3S1WA 2PDWA 1DQXA 4IICA 2E40A 1X6UA 1KLYA 2UY3A 2AL2A 1ME8A 2F2KA 4HIBA 2DH2A 1L8PA 3S5ZA 3GHTA 4MF4A 2PDKA 2O0TA 4ZB5A 4DB7A 2BFGA 4C60A 4QCEA 1LL4A 2O7SA 2J7BA 1EQCA 4NILA 4A3RA 4WRHA 3AXHA 2VENA 3A4AA 3L9CA 1GZGA 2I1OA 3DN5A 3DHPA 4OIFA 2XISA 3CT2A 2MUCA 2X30A 1VEOA 2H3DA 4FZIA 2PP1A 3EDKA 4HYWA 2R6OA 5CPMA 4ZXLA 4YVPA 1IEVA 4BWLA 2Y85A 5CZ0A 1V3IA 2Y62A 1NH6A 4KETA 5I03A 4YTUA 1GG0A 5AVHA 1JYNA 4FNQA 1TA3A 2MNRA 1X39A 4H9XA 4UFJA 4KGJA 2VJXA 2NQLA 5CPSA 5IBXC 3P61A 3MDWA 3NXLA 1POJA 2BHUA 1PTAA 3MB9A 1GVRA 4Q32A 2ZVIA 1ME9A 4C6KA 4AC7C 1CIUA 4FOKA 4RDVA 1HF6A 5ABGA 5J5RA 2F7FA 2CLFA 1JFXA 1LQ0A 3FAWA 2XPKA 2R8WA 2ZICA 3LRMA 1EGMA 4ERGA 2XSAA 3UQNA 2OFJA 2V0TA 3MSDA 5CG0A 3GU9A 4NUWA 4WX2A 2EPOA 3KVKA 2J7HA 1UUMA 2WNWA 4C6LA 3L7RA 5HJXA 1JCLA 2VGGA 3BW4A 1TWDA 4ZCWA 3BC9A 1HP5A 4MTVA 1H50A 1KTBA 4G7FA 4RK8A 4CU6A 4GIEA 4OOUA 4C6NA 3WQDA 4O1CA 3MSYA 2FYMA 2RAGA 4JFSA 1ECEA 2W3ZA 2GSEA 3EA2A 1GEHA 3FSTA 1KFLA 6TAAA 4JCLA 4NF7A 2PCQA 4XD5A 1PZ2A 1HKWA 1G7UA 4S3DA 1X98A 4Z0SA 1S38A 1VEMA 4B5NA 4I90A 1FFRA 3D3AA 5CPTA 3KXQA 1B1YA 2JKAA 3BOXA 4AC1X 5A1AA 3LM7A 4PMVA 3BLEA 2VFGA 1KRAC 1FHDA 3PG9A 1HTIA 4DWSB 1VH7A 2R14A 3QQWA 4JIEA 2BODX 3WMCA 2G96A 2YFOA 3S6TA 2WCSA 1LJYA 3WKZA 4RDYA 1V6UA 2WV8A 1Z48A 2FDMA 5C0QA 2VFHA 4XD4A 3G1RA 3E2RA 1XUUA 5JUVA 2IXUA 2ZX7A