3VNDA

Crystal structure of tryptophan synthase alpha-subunit from the psychrophile shewanella frigidimarina k14-2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
259
Chain Sequence
MSNRYQAKFAALKAQDKGAFVPFVTIGDPSPELSLKIIQTLVDNGADALELGFPFSDPLADGPVIQGANLRSLAAGTTSSDCFDIITKVRAQHPDMPIGLLLYANLVFANGIDEFYTKAQAAGVDSVLIADVPVEESAPFSKAAKAHGIAPIFIAPPNADADTLKMVSEQGEGYTYLLSRAGVTPIENILTQLAEFNAPPPLLGFGIAEPEQVRAAIKAGAAGAISGSAVVKIIEAHQHDEATLLAKLAEFTTAMKAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Strategy for cold adaptation of the tryptophan synthase alpha subunit from the psychrophile Shewanella frigidimarina K14-2: crystal structure and physicochemical properties
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Lyase
total genus 94
structure length 259
sequence length 267
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3vndA00
3NVTA 3GYEA 3PWAA 1GTHA 4OU1A 1WBHA 2V82A 1SO3A 1W3NA 1L6SA 5U4NA 1XDLA 2WV8A 3NXFA 3A23A 1KTNA 2E5CA 4JXCA 5CZJA 3LHWA 4UFMA 2R14A 1XCFA 4CCCA 2R91A 3GAKA 3LBCA 3TQ0A 1G4TA 5FESA 1KFEA 1RQBA 2RDWA 4Y8FA 5BNKA 4BWLA 4IPJA 1LTDA 3G8EA 3RMJA 1FBAA 3NG3A 1KBIA 4K37A 2OX1A 1SPQA 3M5YA 5K4XA 2YW4A 5FI8A 3MYOA 2C3ZA 2Z2UA 4Z08A 1SZGA 3K30A 4JICA 4MZYA 1AL8A 2A85A 3S8HA 1K03A 1W5MA 4X9SA 4Z1DA 1TIMA 3W6YA 3W7CA 1VRDA 1LCOA 3NOEA 4IMEA 3O05A 4HKPA 4O10A 1A5SA 2GQ9A 3BK0A 3V1PA 1TMHA 1DKWA 1KM0A 1N8FA 2E68A 3HPSA 3ANYA 2R94A 3L65A 4EWND 4JDBA 4M6VA 1FWTA 3ATYA 2CWNA 4DF1A 4UFJA 3LV5A 1VLWA 4NJJA 1NSJA 3H55A 4RKAA 1PS9A 1LZOA 4Z1BA 3DKJA 1ZCOA 3T40A 3B8DA 3PULA 3NPVA 3EXTA 2ISWA 4UTIA 4Z1CA 2NUXA 1VLIA 2FB2A 1V5XA 3TMLA 1SFLA 2J9ZA 3G22A 2YFOA 1XFBA 2ALDA 4JX4A 3W3OA 2ZRVA 1TQJA 2XFWA 1K7EA 3MMTA 4UMCA 2QCCA 1LBFA 3ABQA 3GDTA 4O50A 4Q33A 2FIQA 2QDHA 3MP3A 2X16A 1W31A 1A53A 1VQTA 3KVMA 4GRSA 4W9TA 1DOSA 3W83A 4ZQRA 1NF7A 1OVDA 3DFQA 1T8XA 3HGOA 3R13A 3C6CA 1ADOA 4JTEA 3SSJA 5LKYA 2VFFA 3C3NA 4LVAA 1OFBA 5KMYA 1KV5A 3CWOX 1VH7A 3BPWA 3TAKA 1JCMP 1TPDA 5FEXA 4LV9A 4E38A 2E77A 4LC8A 1RVGA 5G1TA 5C55A 3MHUA 1O60A 1RPXA 4K38A 3KXQA 2C0AA 4UFLA 3U8GA 3IVSA 5G5IA 3GDRA 1S3HA 2ZRYA 1SUXA 2H6RA 5D09A 4BWLC 5I3GA 3L2IA 1EWDA 2GUUA 3W2LA 1NVMA 2P10A 4RZ6A 5DELA 2PURA 1QO2A 1P4CA 2CLHA 3Q2DA 5I3IA 4NX5A 5IM51 5CPNA 1LBMA 2C15A 3C2EA 3C2VA 1PCKA 5EY5A 3TE9A 1YADA 2QEZA 4O16A 4DO6A 4RXFA 4LTSA 1R46A 1MZHA 2CLEA 3HB9A 4UMBA 3EWBX 1J2WA 3QSTA 3T44A 4AWTA 4GUIA 1Y0EA 1H63A 1WX0A 2VKZG 1X7FA 2ZRZA 1ZNNA 5AHFA 2GVJA 3QZEA 2QAPA 4PC8A 1D9EA 1WDWA 3PBUA 3CC1A 5F1VA 4JTSA 1XL9A 1N7KA 1JVNA 1H7WA 1H1YA 2ZZ3A 3C2RA 3CB8A 1FCUA 2HTMA 3KAOA 4NXSA 4IX0A 2QCMA 1ZAHA 4RXGA 3OA3A 2TPSA 3RNDA 4PEKA 1Q3NA 4JTHA 1YYAA 2CZ5A 2TRSA 5HR7A 3NNTA 2Q8LA 4I7UA 1TB3A 4NXKA 4TR9A 1H50A 3GKFA 4FO4A 1NAL1 4O1DA 1Q6LA 1VYRA 2VEPA 4O12A 4UTKA 4UTHA 5C6MA 4IXXA 4UR8A 2VENA 4O1CA 4WX2A 2NX1A 4WXYA 3S0CA 3CU2A 2WOQA 2FDSA 1AW5A 4S2CA 1IXQA 3W1QA 3BW2A 3LRKA 4AF0B 4OHQA 3TQVA 1BKSA 2OJPA 4IGHA 3Q58A 3NL5A 4GBUA 4HHPA 1F74A 1UASA 1TTJA 2A0NA 7TIMA 4CNNA 4IMDA 2FJKA 3LHZA 3W7JA 5FF2A 4FNSA 4IXHA 3T78A 4XTDA 3WJWA 5C5YA 3LCHA 4MUZA 5AC6A 5CG7A 5AYXA 4AWUA 1DHPA 1VCVA 5HWMA 4JDYA 4UNLA 1OFOA 4KFPA 2A7PA 3HGSA 3G3MA 1M7PA 3NL6A 5BW6A 3ABOA 1YTEA 1OK4A 3S5NA 4QIUA 2ZTJA 5H2ZA 4ADTA 1ME8A 3CQ0A 4XZ9A 3EKLA 3JR2A 4HT3A 4JX6A 4PL1A 4LVGA 3L5AA 3PS7A 4O13A 3N73A 1QPRA 2QKFA 1ZY9A 4R33A 4FNTA 2RDTA 3G24A 1G6CA 5BMXA 4UFHA 4XTIA 3FOKA 5AYYA 1TYGA 3L66A 3NQ6A 3Q94A 4Z1AA 4MY8A 2GJLA 1X6UA 3S1UA 3ZWSA 3IVTA 3AJXA 2ZRWA 4ADSA 3UWZA 4WQ6A 2F84A 5DXXA 1DJQA 3GX9A 4UNKA 4MJZA 4Z0SA 1FDZA 3W70A 3R12A 2Z0IA 4BFAA 4ZQOA 1XM3A 4MIMA 1L6WA 2BZNA 2C18A 5LNUA 2G95A 2YXGA 4RLIA 3IIVA 5FF7A 1KBJA 4PFMA 2ZTKA 4CLMA 1VZWA 2P0OA 3EX1A 5F2LA 1OFAA 1SZEA 3DAQA 3P5ZA 3LXCA 4JS3A 3M6YA 4XKYA 1ZENA 2DZXA 2ZYFA 1QOPA 2QDGA 4QQ3A 3HBLA 4IMGA 1X8FA 3W1TA 4KFOA 1G7VA 5F2GA 4O52A 3ABRA 1IXOA 3A5FA 4N4PA 6TIMA 3LBMA 3L0GA 3OHIA 4S1FA 4C1KA 1VS1A 2YYTA 1K7FA 5CGQA 3W7KA 2ZA1A 1SW7A 4AH7A 3S42A 5D2VA 2W0UA 3OVPA 3NM3A 3MYPA 3W7GA 5BRBA 1I4NA 3N19B 5CZTA 2HS8A 4ORIA 3UWVA 1XBYA 2TYSA 3SR7A 1Z48A 1QDSA 3TDFA 1PHWA 2VELA 2QCEA 2JGYA 3LX9A 1DVJA 1FXPA 1OFQA 2R8WA 1NF0A 2ZBTA 1KFBA 2VEIA 1TRDA 3I7QA 3E9AA 3W7DA 1WQ5A 4O19A 3UZ5A 4S2BA 3LB0A 1TJPA 3W1AA 1FWRA 3G1SA 3TJXA 1KA9F 4X22A 5HUPA 1JUBA 3QM3A 4HIBA 1SSDA 3M9YA 5EKYA 5G2WA 2FLIA 4Q32A 4LUIA 3NQVA 3GNNA 2QCGA 3FLUA 4MVAA 3OVQA 2EPHA 4EF8A 1TPVA 1MO0A 2QCFA 2B7PA 3M1ZA 3IGXA 4FX7A 4IUOA 5AHLA 1I2RA 2FB3A 4AMAA 4LT9A 1LOLA 1YTDA 4TMBA 4DO4A 2E5BA 2VFDA 1EPXA 4AXKA 4D2JA 4JR5A 2GVLA 2A6NA 3GAYA 4PA8A 4HPXA 3W1PA 3HQ1A 3WK2A 3U2OA 1YXDA 4YMZA 4RJEA 3CIWA 3F4WA 3O6CA 3EEGA 3GKAA 4IWWA 3LHTA 4HNUA 1SZFA 4FEZA 1L9WA 3LHUA 3G0UA 2GOUA 4N02A 1TSIA 3NQMA 2ABAA 3FYOA 3KRUA 3CHVA 1TJRA 1G4PA 3UZJA 2QR6A 3GXNA 3IGSA 1HUVA 5A5WA 3DBPA 4DXVA 2RH9A 4UXDA 3W7MA 3DHDA 4JD4A 1PHQA 1GJPA 4ZQPA 2C19A 3C2OA 5LGXA 4TO8A 3TMQA 3QQ1A 5HNRA 1IIHA 4JTKA 1YPFA 1H7NA 1M5WA 1G4EA 3BW3A 3GLCA 4O17A 3T7VA 4CNPA 1PIIA 3CT7A 3G1AA 2GJNA 3C52A 6ALDA 3W1LA 3VE7A 2YR1A 1XC4A 2PRHA 3TK7A 3E12A 1JUEA 5HMSA 1OHLA 4NNAA 1XXXA 1LBLA 1OX6A 1VPXA 4O54A 5I3FA 1JUKA 3EXRA 3M43A 2C16A 1IF2A 3LGEA 4ICNA 1TV7A 2E09A 1KFLA 1TPWA 1FWSA 1TV8A 5FF0A 2Y7GA 1GVOA 4AHOA 3RU6A 3OVRA 3ZR4A 1I2PA 1P1XA 2A7RA 1KLZA 4AWSA 2V30A 3OEXA 1G69A 3GXPA 1B4KA 5TBOA 3M44A 1G4SA 3L0NA 3GNDA 5F2IA 1H7RA 3N34A 1QR7A 5CZ0A 1RD5A 2E6YA 2WO5A 1KFJA 3NQDA 3MP5A 1GVRA 3NZRA 5LHEA 1FCVA 4NNCA 2ZQ0A 1F7BA 3FJLA 2VFIA 3P81A 4Y9AA 4AAJA 3HJZA 2ATSA 3QQ0A 1F6PA 3N14A 3C4UA 2EGZA 3TU9A 3EXSA 5KZMA 4M6QA 4ONVA 3C2FA 1IGSA 3S5YA 3P5YA 1VHCA 1TQXA 1F73A 4MFDA 3DFOA 4A22A 5C2XA 4LUJA 2ZZ2A 5CPMA 1Q45A 4TX9A 3PM6A 1FCQA 2G96A 4WY0B 2XN1A 5IBXA 3UY8A 4TMCA 3B03A 2EAWA 4QITA 1KTCA 3M5VA 4FNRA 3GXTA 1K7XA 1XBVA 4UUIA 4UTMA 2FPYA 3FFSA 3S5OA 3O6YX 3W22A 3HPXA 2WSQA 3M16A 5D04C 4ML9A 2FFCA 4Y90A 4P61A 4MYXA 1SU5A 5EBUA 1ZAIA 1KV8A 1WOAA 3CWNA 2B0MA 1C9DA 4K8HA 3DKLA 5D30A 4JX5A 3KVLA 4DEFA 2H3DA 2Z6JA 1P0KA 4AHPA 1ICQA 4MZ1A 4O14A 3DFPA 5EA9A 3UNDA 3W86A 2Y70A 4RZ5A 4N9CA 2A5HA 5HUOA 4I9AA 2FPVA 2I9EA 4X2RA 3W2MA 3MO7A 4XWUA 4NUWA 5HINA 3NDOA 1KFCA 3CEUA 3H54A 2RKXA 1LORA 3BGJA 1K3UA 4ZMGA 1U83A 1EUAA 2ABBA 3GIYA 1GQNA 5KTLA 4WUIA 3G1HA 2ISVA 2ZZ5A 4BF9A 5DY3A 4K6AA 3QPYA 4XBKA 1EUNA 3HIJA 4NX0A 3NAVA 1NEYA 3FIGA 3TFXA 3DFTA 4L4MA 3NPXA 3SECA 1F2JA 2DJXA 2NUWA 5AC8A 4CQ9A 3FKKA 1SO5A 4WJEA 3TA6A 5A8GA 3PG9A 4JY8A 1M7OA 2GQAA 4JIQA 4MY1A 5G1YA 3I68A 3M5ZA 4BK9A 2VXNA 1Z41A 1TPFA 2NXGA 1MEIA 2J9YA 4NZJA 1AK5A 4YCOA 1XBXA 2QJIA 2X1TA 3FEMA 4HSNA 3N2XA 3EX4A 3MBFA 5D32A 4HNVA 3SW6A 4A21A 4FHAA 1W5PA 1HFBA 3NZ1A 1FX6A 4IQLA 5L9FA 1KTBA 2P1FA 1OYCA 4KFNA 1DQWA 2EF9A 3CLMA 3TX9A 1XKYA 1JCNA 3DFSA 3LERA 3SGZA 4M7TA 5E1QA 3LCWA 5F4WA 4AEOA 4UTTA 2E6AA 3UY7A 5LNWA 1FWNA 1Q6RA 4WZHA 2DJLA 3QW4B 2O7SA 1ZALA 3IEBA 2QUTA 2QCHA 5AHIA 2BLEA 3WK1A 2Y85A 5DBUA 3HF3A 1A5CA 3P7YA 4GE8A 3W9ZA 3LCXA 4K39A 5K2ZA 2I14A 2YPIA 1XUZA 1W1ZA 4NJKA 3PC0A 4LW7A 1XUUA 1TPH1 2DZPA 3CEPA 3C61A 2ZFAA 3TQKA 1I2QA 2CZFA 1VHNA 4XUGA 2Y7EA 1W5NA 4NVTA 5K9DA 1ONRA 5G2HA 1OFDA 2I1OA 3W84A 5KZDA 3A5VA 1H7OA 1C8VA 2J27A 5FEPA 3STFA 4BR1A 1UBSA 5AN7A 1QPNA 2Y6ZA 4O18A 3QRHA 1TPUA 2YCEA 3CTLA 4FF7A 2O7QA 3VE9A 4A2SA 1KM2A 3EB2A 3W74A 5TIMA 3KRSA 4ZL1A 2NV1A 3BLFA 3DXIA 2H8XA 1WBJA 4N2YA 1KW1A 4O11A 3BVJA 4R7JA 4O15A 1PL9A 1TPB1 2A6LA 2YSWA 3F03K 4OV4A 1CX9A 1AW1A 2NWSA 5I3JA 2VC6A 4UTLA 2NZLA 3W07A 4NJGA 3N3MA 4M19A 3LRLA 2AGKA 3OIXA 1TTQA 3LRMA 3JRKA 3UYCA 1GYLA 2YZRA 2RDUA 1LRTA 3G0XA 1TCDA 2Z1BA 3NQAA 2OT0A 4UTWA 1AL7A 3PB0A 3NQ2A 4E0CA 1CI1A 2WSYA 3PSWA 3W7QA 4M5PA 5DN1A 1H1ZA 4O57A 3EX3A 1KM3A 5TQLA 1EEPA 3LLDA 4LVBA 3CM4A 3W75A 1ZFJA 3MHGA 1YTKA 3W2NA 1T99A 4O1AA 4QNWA 3JS3A 3A9IA 4O1BA 3UWQA 4UMAA 2ZA3A 3PB2A 2H90A 4NNBA 3TNOA 1Q6QA 2PRMA 2EHHA 3VCRA 3GDMA 4ZVJA 2PRLA 3A21A 1W3IA 3G1FA 1SO4A 1O5KA 4JEQA 1ZJIA 1RR2A 3GDLA 2DZWA 4LVFA 3E02A 1WV2A 2QCDA 3O6DA 3BLIA 1OJXA 4GC4A 2TSYA 3BO9A 3WJYA 1I8JA 3DZ1A 2WKJA 3E0IA 4WOQA 5HWJA 3LCLA 3SZ8A 4O53A 2Y7FA 3W7RA 2NXIA 1JRCA 3IRDA 2DP3A 1LRQA 2ZRUA 3O07A 3QC3A 1L2UA 3VI2A 4K36A 1E51A 4JYEA 1H61A 3L0KA 2X1SA 1YXYA 3C56A 3L5MA 3UXAA 2A1YA 5D2WA 5U7SA 1WOBA 4LVDA 2J6XA 5EYWA 2VFEA 1W37A 2PE4A 4OGZA 2QAFA 3DI0A 2C1HA 5E93A 4ZQNA 1GOXA 1LOQA 2V5LA 4A29A 2V2DA 2F7FA 3N9RA 4K8EA 1XDMA 3W23A 1FWWA 1JCYA 2NLIA 4A3UA 3O15A 4N6EA 3T4CA 4QNEA 1MXSA 1H7XA 1TO3A 4AB4A 3INPA 3TCEA 4GXMA 2Y89A 3SY5A 1QPOA 2VOMA 3S5ZA 3F1QA 1VGAA 1Q6OA 3DH7A 4HSOA 1HG3A 1ALDA 3UD6A 5EMUA 1H60A 2FPTA 3UPBA 2YX0A 4ZQMA 2WNNA 4U4MA 1FDYA 1OABA 4ZZ9A 4GUFA 3QH2A 2RHGA 5AFDA 3BLEA 4H3DA 5DCDA 2B7OA 3U6WA 4IMFA 1OX5A 2ZZ7A 5LNRA 1N55A 1WAUA 2C6QA 4KKXA 5F2MA 2J88A 1K02A 3EWXA 5HWNA 1DQXA 1GG1A 3BG3A 1LRNA 3W7OA 5LZLA 4BI7A 2V5BA 2JBMA 3S9YA 1QFEA 1C29A 3RF9A 2WNQA 3TW6A 4LV4A 1EP2A 3TUUA 4PODA 3ZWTA 2CFFA 5FEWA 1TV5A 4H6KA 3SJ3A 1LOSA 1LROA 1TTIA 5E0KA 1U5JA 1YDOA 3TSBA 1OYAA 4FIRA 1ME7A 3NR0A 3LXBA 2VFGA 1DL3A 4LU0A 1LYXA 3L67A 4DELA 2HS6A 1YXCA 5KINA 3BG9A 3FS2A 4BI5A 1QO5A 4RZ4A 4NJIA 4GWEA 3PY2A 4Y96A 3W1MA 1R47A 1VC4A 1M6JA 1OFRA 3STGA 4JTLA 1B9BA 1SO6A 2NX9A 4UFKA 2IQTA 4LOCA 4MOZA 4CQ8A 1QWGA 5EL1A 1K8ZA 1BWKA 1MEHA 1J4EA 4N9BA 3TV8A 5F4XA 1KLYA 3KHJA 1O4UA 4M6PA 1YLVA 3GVGA 3L21A 2WSRA 5F4SA 4QJ1A 2JKPA 3W1NA 4LY8A 3KFTA 2DZUA 3NGJA 2ISSA 1YDNA 3P62A 4NJHA 4WY0A 5DY2A 4MPQA 1R2TA 1QCWA 3NQFA 2NX3A 3FYPA 4IJBA 3N9SA 4MYAA 4O0ZA 4K7VA 3QSRA 1EWEA 5D33A 4MLRA 4JTGA 3RLUA 3P80A 2CLMA 4O0KA 5LHFA 3KVKA 2CW6A 5FF3A 5K3VA 3F4NA 3R2GA 1DORA 5HULA 3R5EA 4POCA 4AHQA 4FNUA 4RK8A 4N6FA 1G7UA 2C13A 4QAIA 5H91A 3LLFA 3LCFA 3NQ8A 3MW7A 1TTPA 2ZZ1A 4O28A 3LDVA 2NXHA 3UWWA 4BI6A 3BV4A 1IXNA 1YDVA 4JTFA 2PCQA 4PTNA 5K9XA 2V0TA 1QMLA 1L6YA 3BG5A 3B05A 1Z42A 3MI3A 3P82A 3G8RA 4DBDA 1EP3A 1S5WA 2YGYA 1R2RA 1D3GA 1UB3A 3EX6A 2E6FA 4KWVA 2AAMA 2QUVA 3HG2A 1I2NA 4HN4A 4LS1A 3TFCA 4MZ8A 1X1OA 3W7PA 3R8RA 3W7NA 1GT8A 1SFJA 4ZQCA 3B0UX 1SW0A 4MLJA 2CU0A 1A50A 5LNSA 3LTSA 4QM1A 2E1DA 2ZZ4A 2VEKA 2DORA 4UTJA 1FDJA 4E2DA 1FXQA 4RX0A 4LS0A 2HSAA 3PR2A 5MHBA 4YLWA 3IIPA 4EOUA 2RFGA 5DBTA 2UV8G 1LP6A 1FCBA 4GFSA 5D2YA 4CQAA 1JQVA 5DLCA 4FNQA 1VR6A 4EVZA 3NPWA 2B7NA 1F6KA 3QJAA 1GPWA 1B4EA 2Q8ZA 1SR9A 3LV6A 2NWRA 4M7SA 2V81A 3GB6A 3I6RA 2CZEA 3G1DA 5D05A 2QJHA 2QCLA 4XBSA 2G97A 3M0ZA 4FX8A 2JK2A 3LI1A 3R89A 4DPPA 2Y63A 1T0OA 1W8SA 3TIMA 1K8YA 4GUJA 4LNYA 2Q3RA 3HO8A 5AHEA 1DV7A 3M47A 3ZFHA 2DZTA 1OX4B 2CLKA 3W73A 4Y6GA 3VKJA 3PUEA 1VCGA 4GUHA 3W7IA 1VCFA 3Q37A 4DF2A 2WNZA 1OFEA 4QISA 2GVGA 2QUUA 3W72A 5LGZA 3MHFA 3I65A 3TXVA 1LLZA 3O06A 2ATMA 1JQXA 3N2MA 4ORMA 2D73A 3NQGA 4QSHA 1RV8A 3M5XA 2V2HA 3VFLA 4DF0A 2BXVA 3GR7A 2QF7A 5G4WA 1JCJA 1IXPA 1PCWA 1V7YA 3TC6A 3LHYA 3THAA 3PG8A 4PH6A 3G0SA 3PVFA 4DO5A 1VYSX 3CPRA 2FTPA 1GVSA 1DBTA 2YDAA 3PSVA 3GK0A 4WXZA 3S1VA 3SIZA 2LLEA 1W3TA 5IBXC 2NV2A 2BTMA 4LS2A 2GPTA 1HO1A 2JKEA 3TH6A 5CKSA 4AF0A 4NQ1A 3ATZA 3TC7A 4O4WA 4JNMA 3O8AA 5AHMA 3WFAA 1FUYA 1RQEA 4HPJA 3D0CA 3A24A 3W1XA 3USBA 1ICSA 1THFD 3V75A 4JN6A 4CCDA 1ICPA 1PE1A 1K8XA 2YFNA 4N4QA 4MKNA 5AYZA 3H53A 3QMRA 1QNVA 3G1XA 4FXSA 3W1UA 1SSGA 5L6UA 1MEWA 3DU0A 4H4IA 3MBDA 3WK0A 3W88A 3B0VC 1UUOA 3BGGA 4G1KA 3HOJA 5DXYA 1GVQA 2H3BA 5D2TA 4HNTA 1HL2A 5J5RA 1SW3A 4X3ZA 1EIXA 1OF8A 1KM4A 2QJGA 4GUGA 3C8FA 2ZZ6A 5BOOA 5KITA 1AG1O 3NA8A 3C0JA 4FB7A 5KSWA 1R2SA 2V8ZA 5CPLA 5GVJA 3UPWA 3W2UA 4U28A 4L4LA 1WYIA 4R34A 1GG0A 3IIOA 4C1LA 5J5DA 2OZ0A 1KM6A 3A22A 5K4ZA 1AMKA 1GWJA 5HJLA 3CIXA 2X1UA 3O63A 3QYQA 4JIPA 1KFKA 1X1ZA 3OG3A 1I45A 4B5NA 1J5TA 2Y61A 3STEA 3HPZA 1SQ7A 3G3DA 1R30A 2BWGA 4MY9A 3STCA 3IGUA 4OV9A 3LXAA 3QPZA 3DFNA 1KM1A 1W0MA 2X1RA 3P67A 2B4GA 1VYPX 1P5BA 3LCIA 1HO4A 3B0PA 1A5BA 2YW3A 2CLOA 4EF9A 2JKAA 4NZFA 2NUYA 4CNOA 3ZS4A 2WQPA 1JCLA 8TIMA 1S5VA 2B7QA 1ME9A 2TMDA 5AOUA 1EB3A 3NQCA 3NM1A 3M41A 1H7PA 2X2GA 1S5TA 3LCGA 2OT1A 1AW2A 4RR4A 1FY6A 4IMCA 1TRIA 3NO5A 3PUOA 1OK6A 1B57A 4YL2A 2YYUA 3I7RA 3TXZA 3QMSA 1GVFA 2V9DA 4WD0A 4UTTC 3NL2A 4TU1A 4IX2A 4WY0F 3TAOA 5D38A 1EA0A 5HR6A 3WJSA 4K7YA 4ALDA 4XQ6A 4J9JA 1VJIA 1DJNA 1ML1A 3MJYA 4JTUA 4Z0JA 4JGDA 3SGUA 1O94A 3QEZA 5K9CA 4LRTA 5AB3A 3EKZA 3QF0A 5EPDA 3HG3A 2W79A 3KX6A 3W85A 4I7WA 3RK8A 3PBYA 1TPEA 3WK3A 3WJXA 1LLWA 5DCEA 3M7WA 3FKRA 5F1UA 3E49A 3VNDA 3P8IA 1F5ZA 1ZAJA 4FX6M 4Q4KA 1GZGA 5CZSA 4FIQA 1CW2A 4DPQA 2CZDA 3RLVA 2GQ8A 1LDCA 1W56A 2E5DA 4UIOA 4JTJA 3KRZA 3W87A 1XI3A 5I3HA 1Z44A 4E2BA 2C14A 4FXRA 5DCBA 3QW3A 4I7VA 4RCXA 3ELFA 4PCFA 4R53A 5CPOA 2Z6IA 1SZNA 3IIXA 3NPUA 3SFKA 5T26A 3B06A 4LC6A 1RZMA 3EWZA 3NQEA 3HGRA 3MI6A 3G1VA 4NT0A 1D3HA 3TJLA 3MP4A 4NU7A 3O16A 2OMAA 1UUMA 2Q3OA 3MWAA 1BTMA 3DI1A 4RV8A 2EKCA 2W6RA 1OG0A 3S6DA 3EWYA 1ZHAA 4LWWA 2J24A 4JY9A 3LM7A 3W1RA 3ABSA 2A4AA 4CCEA 2ZCGA 3P60A 3EWWA 1GEQA 4UTUA 3W7HA 3QFEA 4UTWC 4A2RA 4YCPA 3LOTA 4OT7A 3DHFA 1JCXA 1MSSA 3YPIA 1JULA 1PV8A 1F05A 5K7JA 1EP1A 1H62A 2J9XA 2QCNA 3NYZA 3LTPA 2A21A 1QOQA 2KZHA 1WXJA 3HMJG 3PF3A 3GDKA 3IV3A 2A2IA 2QCDB 1OF6A 4AVFA 1BWLA 4O4VA 4UC5A 3PAJA 4JYFA 5SWUA 4GJ1A 3BARA 3W2KA 3I7SA 3QMTA 3W7EA 1F76A 3P8JA 2DZVA 2VFHA 3MI2A 1XBZA 3HGJA 3TKFA 3W76A 2V2CA 1LM1A 4P2VA 3EWUA 4EIVA 1B3OA 2BX7A 3O1NA 3DENA 3IVUA 3FA5A 2E6DA 1QPQA 2JGQA 2CLFA 2Y88A 2BSLA 1P0NA 3NEVA 2HMCA 3HG5A 3TROA 4TIMA 4XKYB 3L5LA 3DGRA 3KOFA 1TPC1 4PL2A 3EX2A 2DU2A 4GNJA 4MFEA 2A7NA 3LHVA 3LTYA 5D37A 4O8RA 5C54A 5G2IA 1UJPA 5FEZA 4OE7A 3THQA 3E96A 1A5AA 3GZ3A 1W5OA 2DZSA 4OBTA 5D03A 1I2OA 2ZRXA 3W71A 3TW7A 4WOZA 3AO0A 3L9CA 3MUXA 2WJZA 3W2JA 4FNPA 1BEUA 2AQWA 2Y7DA 4JTTA 4OQVA 1UCWA 3TR2A 4KWWA 1JRBA 3LI0A 2FQIA 3PBVA 1O95A 3NL3A 4DQWA 5AC7A 1W5QA 3KVJA 4UR7A 3IIZA 2ZDRA 1TREA 4OWGA 5CSRA 5LSMA 3HG4A 4IPIA 2WPBA 3P61A 4JYDA 3UWYA 1EX5A 3B04A 1KM5A 1O5XA 2ZA2A 4LRSA 3W7LA 3G18A 3RFAA 4IOTA 4YXGA 5LNVA 5AHNA 5KZEA 3WJZA 3FJ6A 4N9EA 3BW4A 5I3KA 2XN2A 4UFIA 1FQ0A 5G4EA 3B4UA 4ADUA 1IIGA 4YWIA 1H51A 3S1WA 1YPIA 1T96A 5BMWA 3OBKA 4DBEA 3GR8A 1NFBA 4UCGA 5D2XA 3L68A 1W54A 2XN0A 2X30A 3T55A 4HNNA 1G67A 2PC4A 3UQNA 2OCZA 1WA3A 1QAPA 3P74A 3UXDA 3NQ7A 1PVNA 3PBWA 3P84A 4N9DA 5CSSA 1HTIA 4MJMA 2CLIA 5FF4A 1OFPA 1JJKA 1GTEA 1GYNA 1H5YA 3TSMA 3SI9A 3S1XA 1OYBA 1OX4A 1RQHA 3G1YA 5D02A 2G5WA 2H8ZA 4JTIA 3UWUA 3TSDA 2VEMA 3PUDA 1JR1A 2CLLA 5HQEA 2Y62A 5ABTA
chains in the Genus database with same CATH superfamily
4WVXA 3GYEA 3PWAA 2OELA 2V82A 2VGFA 1W3NA 5JIPA 2JFEX 1XDLA 2WV8A 4L65A 1LL6A 3SCNA 3WF4A 4IFRA 4XAPA 3S2JA 2R91A 3LBCA 1E40A 4XISA 4RDYA 1L0PA 4Y8FA 1A4MA 3CUFA 3RMJA 1S5MA 3NG3A 4DB7A 1KBIA 2FHBA 3KCLA 4KCTA 3AMCA 4AC7C 1YW1A 3PPCA 4Z08A 1SZGA 3SUSA 3WEMA 2A85A 4AD2A 3VGBA 4E4PA 2AL1A 1VJSA 4UTFA 1GCYA 4JIRA 3GD6A 3W7CA 1LCOA 1YRRA 4HCLA 6CGTA 3LNMA 1A5SA 5D8WA 2GQ9A 3V1PA 3S1GA 1H09A 2WCSA 1TMHA 3ANYA 3WMBA 3L65A 4EWND 5MKGA 1EGMA 3LV5A 2PDUA 3H55A 4RKAA 4Z1BA 2V3EA 3AMGA 2PTDA 4UTIA 1CPUA 2VX5A 2NUXA 5CQ1A 1EO7A 3HMCA 1BSLA 1XIIA 3RJXA 2YFOA 1XFBA 3ZVHA 3H23A 2ZRVA 5DRCA 3MMTA 1S2UA 1UKPA 3ZVIA 2VRKA 4Q33A 3JW7A 3LQGA 1A53A 3CAWA 3GE7A 1GQIA 4ECLA 4W9TA 2DVTA 4IF2A 2J75A 1OVDA 1T8XA 1UH3A 1AA1B 3MJMA 3C6CA 1ADOA 4JTEA 2OSWA 4LVAA 5BROA 1VFSA 2QIWA 3CMJA 4B3KA 1JCMP 2WXDM 1TPDA 2WZEA 2E77A 3IWPA 2IPGA 1O1HA 1CLXA 4PRRA 1SYTA 1RPXA 2QF8A 5JU6A 3U8GA 3DYMA 1QW7A 3NXLA 3GDRA 3UR7A 4KGJA 2HCVA 1S3HA 3TLLA 1J0HA 3L2IA 1EWDA 2GUUA 3W2LA 2OOFA 3WQEA 4C6JA 2QDDA 4DRSA 3CO8A 4JTDA 1PCKA 4DJFD 1MW3A 1FKWA 3L23A 2VCAA 2E9MA 2VC5A 2RAGA 1MZHA 3EWBX 1BSIA 2BHZA 3UZXA 1WX0A 4UZUA 1X7FA 2ZRZA 5AHFA 4C6PA 1DXFA 2GVJA 2HE8A 1XIGA 3PBUA 3ITTA 1XL9A 4K1GA 1N7KA 3VIHA 1QW8A 5A8OA 2QVNA 2HTMA 3KAOA 3WH6A 2W66A 4IX0A 3E0WA 3SFWA 2TPSA 4PRTA 3GVWA 1LG2A 3VTRA 1CXEA 4MNLA 1Q3NA 4JTHA 3LG3A 3ARZA 2CZ5A 3C8NA 3R58A 5HR7A 4LH8A 3IRSA 4H04A 4O1DA 1Q6LA 3DFYA 1VYRA 1C90A 3I6TA 1HKJA 2B81A 5C6MA 1BRLB 4WX2A 1DXEA 3S0CA 1FTXA 4W4QA 1EHAA 5AYBA 3W1QA 3AHXA 4OHQA 3M0VA 4G7EB 2DW7A 2WAGA 4GBUA 4HMNA 4R88A 2VQUA 3GNPA 7TIMA 1T7LA 4H7VA 3EMZA 3LHZA 3QGVA 3GIPA 1VIWA 3WJWA 5C5YA 4NL1A 2ZUVA 5FACA 2OR2A 1UZHA 1CLVA 1OFOA 2A7PA 2PSNA 2NQHA 4I8DA 4HK7A 3EZ4A 4GX9A 3CT2A 4Y8EA 3S5NA 2EXOA 3B0YA 2DVUA 3PZGA 5E9AA 4ADTA 1U33A 4WDUA 2DH2A 1GOWA 2G3MA 3P0WA 4PL1A 2GGGA 1Y5XA 1L8PA 4F8XA 4J4KA 1EYEA 3FVDA 1YEYA 5HPOA 3G24A 1RH9A 4XTIA 3OZMA 2FZNA 1C93A 3S2LA 3VKAA 4MY8A 1OZMA 1Z32X 3ZWSA 3IVTA 4B4HA 3AJXA 2RDXA 1DIOA 4PUJA 2Y2WA 3OPSA 1DJQA 4C7DA 2YA0A 5CLWA 2DSVA 4Z0SA 1FDZA 3W70A 4NZ4A 2WHLA 4BFAA 2BOFX 4ZQOA 4HVXA 1ZLPA 4RL3A 5FF7A 1EBHA 1RCQA 3WSUA 1VZWA 5CH9A 2VMFA 1S3TC 1ZENA 5T9CE 3VUPA 2CITA 2O9TA 2QW5A 1G7VA 1O7AA 4AC1X 1VEPA 2O0TA 1UC5A 5A6MA 3H2MA 6TIMA 2WC7A 2EJ1A 2WWCA 3OHIA 4S1FA 5A69A 2XZ7A 1UWAA 1K7FA 1XV8A 2OEMA 5FAJA 5D2VA 3OVPA 3ZJKA 4LAUA 4ZFMA 5XIMA 1I4NA 3GUWA 3BQ5A 3BAKA 4WKAA 3TDFA 1FWIC 2YDRA 3EDEA 4Q4QA 3SN0A 4PMYA 3EKGA 1FXPA 4JQ4A 1NF0A 2ZBTA 4H9UA 2WANA 3AZRA 1ONWA 1C8QA 1TJPA 3W1AA 3GHSA 1PKYA 3G1SA 2Y8KA 2NLYA 1AVAA 4X22A 2OQHA 1SSDA 5EKYA 5G2WA 3GU9A 4Q32A 3H2AA 4JKLA 1R7AA 4ZA0A 2FGLA 1R3YA 5H8UA 3QZ6A 4H8UA 3BZJA 1V6TA 3VIPA 3B97A 1TPVA 1MO0A 4G2DA 2B7PA 4IUOA 1I2RA 2FB3A 3CQKA 2FVLA 1VPQA 1XYZA 3OBEA 2G37A 1RXOB 5BRPA 3FN9A 3NVDA 4AY1A 4HPXA 1FKXA 1XISA 4QG9A 3IJLA 2GGJA 4YMZA 3U3HA 3F4WA 3EEGA 3KS6A 2PMQA 4IWWA 2HZGA 3LHTA 4DBWA 4AEEA 1QPKA 4FEZA 3AUJA 2GOUA 2BP1A 1FH8A 3NQMA 3ZJ7A 2ABAA 3UZJA 3CV1A 2DUZA 2WLZA 4C1NB 2BY2A 4DLMA 3TN6A 1HUVA 5H8PA 3DHDA 4JD4A 4ZQPA 2C19A 1RJQA 4NILA 1B3WA 5LGXA 4PN2A 2YBVA 1F4HA 1YBQA 1YPFA 1VP5A 1M5WA 2E8ZA 4E8GA 3CUIA 2BMBA 2GJNA 2XHYA 3C52A 3SY1A 2HJPA 1UWUA 3TK7A 2VX7A 3JZEA 1OHLA 4NNAA 4URIA 2PFHA 4ICNA 1KFLA 1ZB5A 3GC2A 1IEQA 5FF0A 4AHOA 3RCNA 3RU6A 3RO6A 2A7RA 1J0JA 2V30A 4A3YA 3OEXA 1NJJA 1EFZA 2J79A 1E6NA 2UY3A 4PMVA 4BQ3A 3GNDA 3NCOA 2AL2B 3R8HA 3PBGA 3KM8A 2YL5A 2YXOA 1L2QA 2YZ5A 1RD5A 2E6YA 4QROA 1V3HA 4RNHA 4RDVA 5HBFA 2IKHA 1GJUA 3NZRA 1FCVA 2CESA 4Y9AA 3P81A 1JDDA 1ZZMA 3MA8A 4JNZA 2ATSA 1F6PA 3N14A 4WJXA 5KZMA 4ONVA 3C2FA 1VHCA 2JF7A 5C2XA 1Q6CA 2OQYA 1JGIA 5CPMA 2HBXA 2Z7GA 1ITCA 3SCVA 4V27A 3ZLGA 2G96A 2BY3A 1VB9A 2D22A 2VCCA 2ZX9A 1EDQA 3LPOA 3VINA 1UR9A 3EWDA 4QITA 2OTDA 4FNRA 1ZP4A 3GXTA 4PSPA 1K7XA 4V1XA 1XBVA 4UUIA 3PANA 4EPDC 3FFSA 5GJMA 3S5OA 2V5CA 3BMWA 3W22A 3WQOA 4Y90A 4H83A 1BYAA 1XIHA 5HAOA 4MYXA 5EBUA 1UQYA 3CWNA 4K8HA 1IZCA 5D30A 4JX5A 1EXPA 3SUUA 2Q09A 1US2A 3DGBA 4DEFA 4LNCA 4GIEA 3LY0A 4O14A 1JI2A 1BTCA 5CZKA 2PBOA 5FKYA 3NSMA 3UNDA 3BJTA 1K4GA 3POHA 1V3JA 1WUEA 2FPVA 3WEOA 2VX4A 4NUWA 5A2CA 2ADAA 1U1JA 3H54A 2VL4A 1LORA 1A4LA 2WHKA 3PK7A 1K1DA 1U83A 2DIEA 2C8NA 3GIYA 3WEZA 5KTLA 4E6MA 2ISVA 2ZZ5A 3ALGA 5DY3A 3QPYA 2PODA 4NX0A 1NEYA 3AS2A 3TYAA 4BA0A 1KD0A 2UZ9A 4QEEA 3BH4A 3NPXA 2UY4A 2DJXA 3L4ZA 5A8PA 4WJEA 2PU1A 2JE8A 3FHAA 2R1NA 3WF0A 3AROA 4MY1A 1FH7A 2OU4A 2WVVB 4C6DA 3M5ZA 5FJRA 3V1HA 4Q6JA 1LUCB 2J9YA 1AK5A 4CNUA 4HA4A 4LAMA 1ODUA 1YMYA 3N2XA 1E0XA 5D32A 4AY7A 5F7UA 2PDBA 1CYGA 3ARYA 7A3HA 5REQA 4F0KA 1JZ8A 1YE6A 1FX6A 3GTNA 4ERIA 3WQDA 3I3DA 1NWTA 1VD6A 1KTBA 1OYCA 2EF9A 4INFA 4HJWA 3S47A 3CLMA 6A3HA 1JCNA 3SGZA 4FLQA 1LF1A 4QEHA 3RXZA 1NFGA 2E6AA 2VEGA 5LNWA 3H4GA 4WZHA 3QW4B 1RJRA 2O7SA 3IEBA 4FI4A 3FK4A 5EBAA 5AHIA 2BLEA 1EL3A 1O12A 1DJZA 4PMJA 1A5CA 5DT5A 4UZSA 1TZ9A 4GE8A 3W9ZA 3LCXA 4K39A 2HNEA 4NJKA 4GPNA 2HEJA 3CEPA 1I2QA 1RA0A 2GL5A 1IEIA 1CEOA 3D6NA 5D9OA 2YA2A 3KP0A 4B5UA 4IPNB 4NVTA 1FWGC 5K9DA 1ONRA 5HDRA 3VABA 1H7OA 3EOOA 5D9PA 3WNMA 4JQ3A 3NYDA 5AN7A 1QPNA 2R1PA 1QRQA 4HYRA 1W8GA 4O18A 2FMOA 3CTLA 3W29A 1F3TA 1KM2A 3EB2A 2ZC1A 3W74A 5TIMA 2WVTA 2GLKA 3AHYA 1WZMA 3I4KA 2H8XA 1QXLA 3BVJA 4R7JA 1TPB1 2GJXA 2YSWA 3F03K 1CX9A 2J66A 3AIBA 1AW1A 3IV8A 2VNCA 1GEHA 3ENLA 4AUBA 4UTLA 3N3MA 1ELSA 3SQLA 2AGKA 1FH9A 3CH0A 3LRMA 1GYLA 4DIAA 3G0XA 4H7CA 2PWDA 3UR5A 1EJSC 2Z1BA 3WD2A 4UTWA 3VILA 2PWUA 1CI1A 3ZJ8A 3VOIA 3VDGA 4W7UA 3BLPX 5C7VA 3OG2A 4XIAA 4O57A 4J2MA 5KETA 3CMFA 5A3HA 3CUXA 1ISVA 3LLDA 2CWXA 3N25A 3MHGA 1YTKA 3W2NA 3JS3A 4O1BA 1Q13A 4GY0A 4UMAA 2G4FA 4UNIA 1E56A 3VCRA 4ZVJA 2D0HA 2PRLA 1Q65A 1J6OA 2W91A 4OOZA 3WY1A 4MPKA 3K4WA 2DZWA 2XSAA 5A6BD 2QCDA 1F3WA 3BAJA 3H4XA 4I3GA 3BLIA 1OJXA 1UWRA 1W3KA 2W9MA 2HNHA 1I8JA 2WKJA 3E0IA 9XIAA 4FSAA 1M3UA 3TNBA 3WMLA 2Y7FA 3W7RA 2X2YA 2J8GA 4LFYA 4MNMA 5GJPA 3TJIA 3O07A 1GOIA 1L2UA 3EPNA 1E51A 4F3HA 4JYEA 1H61A 3SGGA 5AECA 3S46A 1YXYA 3SURA 5H1WA 1IYXA 1YKWA 4TVCA 4JEJA 4OGZA 2E40A 3DI0A 4WKFA 3PTDA 2C1HA 4C6FA 2F7FA 3WLMA 3W23A 1PX3A 1A5NC 1V7AA 1XICA 4XX6A 1KC7A 3SCWA 3A4JA 4U2ZA 1QPOA 2PGFA 1JZ4A 2CXEA 2FH8A 4KIEA 5FD0A 3IAQA 2P76A 2OFJA 1H60A 3UPBA 5A6KA 2YX0A 4CQBA 1I1XA 4I9MA 3AXIA 3MKKA 4WIWA 1XLFA 3NQBA 3U6WA 1ZPTA 5LNRA 1WAUA 2VGGA 1KBKA 5F2MA 3ARXA 4XSMA 5CAKA 1K02A 3U4AA 4NY2A 2GGIA 3WH9A 1DQXA 3W7OA 5LZLA 3S9YA 4OTKA 3ES8A 1ZS2A 1QFEA 1C29A 4L4OA 2WNQA 5EB8A 4IZGA 3TUUA 3IS4A 4NASA 2CFFA 4BQ5A 5DT7A 4F4RA 1ZP3A 1POJA 1LROA 5C0QA 3MTWA 3Q65A 6XIMA 8CGTA 3TSBA 2QJMA 1WDPA 1ADSA 2VFGA 3WZ0E 3N6QA 3HFYA 2VZOA 2HS6A 1S2VA 4M80A 5CC7A 5KINA 3H2FA 3VO0A 1QO5A 3H12A 4NJIA 1R47A 4JTLA 1J79A 1OZQA 4XZBA 3KWXA 1B9BA 1SO6A 1BQCA 3COTA 1V08A 2VTFA 4PMUA 2IQTA 1F8IA 2AGTA 4GZJA 1I60A 1BWKA 5C2CA 2ZDSA 1MEHA 2DSWA 2CXGA 1KLYA 3KHJA 3WDRA 4MTVA 3PZQA 4Z2HA 1O4UA 1T5AA 1OCBA 3UF9A 5CBBA 4RW3A 2WSRA 3O9NA 3UW6A 4LY8A 7PTDA 1P7TA 2DZUA 3NGJA 4U5KA 3T0CA 2FZDA 4IP7A 1UWTA 5DY2A 3N6JA 4IJBA 4AZGA 4H6EA 1UOKA 4XK2A 3VX0A 2Y8UA 3OU8A 4P7LA 3PFMA 5D33A 2NW0A 3SRKA 4MLRA 3WLOA 4JTGA 3RLUA 3P80A 2CLMA 1LQ2A 4O0KA 5FF3A 1UD8A 4E8DA 1CZ1A 1UR0A 1XSIA 1HGYA 3JUGA 2FZBA 3NO1A 4RK8A 3SIMA 2Q6ZA 3E2VA 3V0TA 3IJQA 2C13A 4QAIA 1XCWA 3CB3A 1GVEA 3SN1A 3NQ8A 3APTA 2XGBA 4O1EA 2IS7A 3VZYA 4O28A 1V6YA 1TVPA 2ZZ1A 3CHCA 4BI6A 4PBGA 4L6HA 2C1GA 3T0AA 2PCQA 4C60A 2Z1VA 1XYAA 3DBNA 4H9ZA 4TVDA 2V0TA 4IQDA 1B3ZA 1L6YA 2IXVA 3FY1A 4LB3A 3B05A 1Z42A 1E9LA 1PYFA 3KW3A 3MI3A 4DBDA 4YTQA 1B3VA 1G0CA 1R3SA 5HNNA 5I3DA 3EX6A 3V0SA 1NDZA 1GHSA 2E6FA 4HN4A 4LS1A 3TFCA 4MZ8A 1X1OA 3W7PA 3R8RA 1PBGA 3KRBA 1SFJA 4ZQCA 3GVQA 2CU0A 1CBGA 3TTOA 3TYDA 1OG6A 5LNSA 4K8GA 4GVHA 2OO0A 1H49A 1P6BA 3PFRA 1RJPA 1FXQA 2W4XA 1MVYA 3IIPA 5DBTA 1E55A 2CETA 2QULA 3DG6A 2D2HA 4MG4A 1TCMA 1SGJA 5C9UA 1F6KA 4S3EA 1E9YB 1L8NA 4GINA 4PUEA 3CZJA 2DQXA 4NAEB 4M7SA 1GKRA 1OQFA 4Z2GA 3F5JA 3M0ZA 4UBPC 1E4IA 1GK8A 2JK2A 4ZO6A 4DPPA 3L7RA 1Q7QA 4B91A 1W8SA 5AC5A 1AUSL 2Q3RA 1XIBA 1EPVA 5D4YA 3ZFHA 1J0YA 3FA3A 3QKZA 3W73A 4Y6GA 1HKMA 3HM7A 1NH6A 1NP2A 3NFUA 1Q5MA 4QAWA 4Q8OA 3WUFA 1N8WA 1E0VA 3DC8A 3A3HA 4AX7A 2GDQA 3GXDA 1MQRA 1LL7A 1V0NA 1XIMA 1NOWA 3PZVA 3L4YA 3T8LA 2XM2A 3VFLA 2Z1KA 3AXHA 3VKDA 5E9XA 2QF7A 5G4WA 2D20A 4OBRA 8A3HA 1G9HA 1V7YA 3C5QA 4M82A 3LNPA 1QNQA 3B8IA 4QG8A 2XISA 4PH6A 3PVFA 4MADA 4DO5A 4GQGA 4JQAA 4DJED 1RK6A 3CTTA 3KCJA 4GFIA 1GW9A 1XLIA 3CZLA 1W3TA 2J7BA 4PMDA 3MQTA 4TV5A 1HO1A 4GISA 1NTHA 3STPA 5CKSA 1O68A 5HA7A 3WDJA 2QUNA 2XIBA 3CH9A 3O8AA 5AHMA 3WFAA 3D0CA 4Q8UA 1PTGA 2E4TA 4L1GA 3W0KA 1FWDC 2P53A 2BY1A 1ICPA 1HJQA 2AMXA 1R9YA 2YFNA 3FNDA 3I10A 4DJFA 2WMIB 2PDKA 5L6UA 4GKTA 1JPKA 4JIEA 2Z29A 2BVYA 2HROA 4G1KA 4AG0A 3FJ4A 4XZMX 1Z3NA 2OYKA 1GVQA 2H3BA 1SW3A 4X3ZA 1OF8A 4GUGA 5BOOA 5KITA 1D8WA 1LLOA 2PTYA 2OSYA 1QI2A 3C0JA 5I00A 1TMQA 1TWDA 4L4LA 3KBWA 2OZ0A 1AMKA 1AZ1A 5HJLA 3U5YA 1SMAA 2X1UA 1C8YA 4JIPA 1X1ZA 1DIEA 4XSLA 2P50A 3QY6A 3G3DA 4MY9A 3RR4A 3VNKA 3DFNA 2X1RA 3LBOA 2XIIA 2PBGA 2G3IA 2VUNA 1IE7C 1BF2A 4MKSA 4S3DA 2I56A 2ZUNA 1KCXA 1A47A 3ZS4A 1P6WA 4CN6A 2DY3A 4LUTB 8TIMA 1UWIA 5BOEA 4JHMA 1EB3A 4DWSB 1H7PA 1S5TA 2WHMA 1OGGA 1XP3A 5JBEA 2BODX 5HK4A 4IMCA 3UJEA 3PUOA 3WFZA 1PTDA 1VKFA 4YL2A 3WCZA 3XINA 3V4BA 1GVFA 1JF5A 4IX2A 2OYLA 4WY0F 3QGKC 3ITGA 5D38A 3MU7A 3DUGA 3FGCA 1LQAA 1XPGA 2B31A 4F2TA 3C86A 4K7YA 4ALDA 4NHVA 1DJNA 3MJYA 3SGUA 4Z0JA 2BXYA 3ABXA 5K9CA 4GYKA 4QRNA 1HZYA 3E5BA 3EKZA 1E6SM 1P48A 3VOGA 3W85A 3QHNA 1V02A 3MVIA 1LLWA 2C1IA 1NDWA 5DCEA 3T09A 4BQ4A 3M7WA 1Z9AA 5ECUA 3E49A 1F3EA 4QHRA 1X96A 4J3SA 1W32A 4FK9A 4HOXA 1HVQA 2IKIA 4FIQA 2GYIA 1J9YA 3NIYA 3MDUA 1Q85A 5C70A 4UIOA 3WQPA 5I3HA 3TOYA 4E2BA 5DCBA 3QW3A 3WF3A 4PCFA 3M0IA 3B9OA 4LYKA 3ZM8A 1ISXA 1RZMA 3EWZA 4GQQA 3CPUA 3NQEA 3MI6A 4E3VA 3TJLA 2Y4SA 1DPMA 4NU7A 4Y9PA 4B16A 1BTMA 3KBJA 1TZ7A 2X0HA 3D5HA 1KKOA 4AZIA 3S6DA 3S6OA 2A4AA 1UMYA 5DMMA 2VM8A 7ENLA 1M01A 4A8RA 4NSBA 4WHBA 4AU0A 4UTWC 4H9VA 1H4PA 1E6ZA 4AW7A 3LOTA 1SJBA 4LEQA 3MSRA 1H62A 2J9XA 1GZ1A 3GDKA 1Q7ZA 4NRRA 2A2IA 4GI6A 4O8AA 1BWLA 4L61A 4GJ1A 7REQA 2NQ9A 3VIMA 4C6QA 2DZVA 1XBZA 2V2CA 2GUYA 2QS8A 4P2VA 2VVSA 2F2KA 5MF5A 3IVUA 4TX6A 1QPQA 2CLFA 2Y88A 5GPRA 6REQA 4Y9NA 4LAZA 3TROA 4TIMA 3L5LA 4PL2A 1TPC1 4NP7A 4MFEA 4V33A 3LHVA 3LTYA 1BXCA 4O8RA 1UJPA 5FEZA 4OE7A 3HFTA 1A5AA 3IK4A 4PB3A 3BUVA 4IL2A 3T05A 3GW3A 3TW7A 4WOZA 3MUXA 1PKNA 1KKRA 1J10A 1P0EA 1RAKA 3TA9A 4A8LA 4KWOA 4O0QA 4J3XA 1RBLA 4US5D 2OZ8A 4LANA 1BEUA 2AQWA 3V5CA 4W86A 3WLKX 1JYVA 1UCWA 1JD9A 4PMXA 3NL3A 4DQWA 1A3HA 1W5QA 1OADA 3KVJA 1TREA 4MNKA 2ZWYA 3RPMA 5LSMA 1JXJA 4IPIA 3UWYA 4YVXA 7TAAA 3OBAA 4Q4OA 4J3UA 3ITYA 5DMNA 4IOTA 5I6SA 4N9EA 3UZZA 3QBUA 2WHJA 3UERA 3M0HA 1TJ1A 1XLBA 4AISA 3VKCA 1WE5A 1IIGA 1H51A 1YPIA 2E1WA 4IJRA 3VNZA 2PDJA 3M0JA 2HWGA 1UP0A 2X0SA 1G1YA 2XN0A 5TF0A 2PC4A 4OZOA 5FJPA 4HQVA 3VD5A 1WPCA 3UQNA 1QAPA 1PVNA 3CIVA 4N9DA 5CSSA 1HTIA 4MJMA 3N6HA 1JJKA 2XG9A 5T9BG 3EGJA 1PZ0A 3G1YA 5D02A 2G5WA 4YVVA 3UWUA 4JTQA 4HU3A 4QDWA 1YBQB 1JR1A 4JOMA 3PZ9A 2Y62A 5ABTA 2XPKA 1H5VA 1WBHA 1SO3A 3RILA 1TZZA 2VYOA 3NXFA 3A23A 3BV7A 2XSBA 3LHWA 2PTZA 4LSBA 1XCFA 4CCCA 4DO7A 1XR2A 3TQ0A 1KFEA 1NQKA 1RQBA 2RDWA 3G8EA 1CXHA 3RJYA 1FBAA 3CAKA 5I02A 1KWKA 2OX1A 3M5YA 2YW4A 3NSNA 3WBXA 2D2OA 3MYOA 4RV3A 4P8WA 3DERA 2JF6A 4F0HA 4Z1DA 1TIMA 4IIHA 3SCQA 4E8CA 3O05A 3S2CA 3MSYA 4O10A 3D46A 3BOXA 1L6GA 3BK0A 4X0VA 4AIOA 1DKWA 1KM0A 2QYGA 3H26A 1YE4A 3PNZA 3BDKA 4JDBA 1C91A 4M6VA 5DEZA 3ATYA 2CWNA 3BE7A 4JCLA 2L5HA 1VLWA 2FTYA 2VZUA 1LZOA 2YXXA 3T40A 3B8DA 4DWDA 3UXIA 4G1NA 2BY0A 2FB2A 1OCQA 1V5XA 4XZLX 3TMLA 1DP0A 3H21A 1VBGA 1SFLA 2J9ZA 4IFKA 2Y5SA 3A47A 2J78A 3IJ8A 4JX4A 2XDFA 4RE2A 4UMCA 2QCCA 2WM0A 1IQ8A 3VOCA 4D6FA 3GDTA 3OTRA 1GORA 1EF2A 1NARA 2X16A 3M0XA 3PP7A 3VOHA 3R0KA 1NF7A 3R10A 3EOEA 1JPIA 5HANA 4GG9A 3TAKA 3KBNA 3QVQA 1CGVA 4H41A 4OUEA 4LV9A 4E38A 5A2BA 1BF6A 3NJ3A 5G1TA 4N7QA 1J6PA 4MSSA 2FFIA 1BXNA 5CSUA 4MNJA 1SUXA 5D09A 4BWLC 1RPKA 4DAFA 2PLMA 2WBKA 5DELA 2PURA 3BMVA 2CLHA 4P7QA 3Q2DA 4NX5A 5IM51 5CPNA 3W01A 1LBMA 2C15A 2PGWA 3C2EA 1Y5VA 5EY5A 4ATLA 3RLHA 4B5VA 1XQLA 3AIEA 4DO6A 4RXFA 4LTSA 1R46A 4UMBA 4F9JA 4AWTA 4DM2A 3QSTA 3R94A 1Y0EA 4EPBC 3WUEA 1B30A 4AX6A 2VKZG 2HQAA 2D1ZA 2QAPA 4NKCA 1JYNA 5F1VA 3UBPC 4JTSA 3AHTA 2ZZ3A 1HIZA 3CB8A 3ZLFA 4B3ZA 1ZAHA 4IQJA 1B31A 1B2YA 1E4NA 1TUFA 1YYAA 1AH3A 2TRSA 1ISWA 1E6XM 1XLAA 4NXKA 1IV8A 1UZDA 3O3RA 1H50A 3GKFA 2GDVA 3UXKA 1NAL1 3RDKA 4F40A 1QK2A 2VEPA 4O12A 4UTKA 1KXVA 4C6OA 1XLDA 4UR8A 3WIJA 2G50A 4A35A 3IGHX 3CU2A 2FDSA 4S2CA 1X7IA 1ZJHA 3TC3A 3TQVA 4IGHA 1CB7B 4HHPA 3VIIA 3C0LA 4QDMA 1TTJA 2QZRA 4CNNA 2YOCA 4LUSA 4DXXA 3MSDA 2FJKA 5FF2A 5JIWA 4XTDA 2V3FA 2HXTA 1KQYA 4MUZA 3J7HA 1BHGA 4YHEA 5AC6A 2FJUB 4GGBA 3UR2A 4W8BA 5HWMA 4JDYA 1JG9A 3HGSA 3G3MA 2Z25A 3FHQA 3R8GA 3KTSA 3H8AA 4KF1A 3C3UA 4QIUA 5H2ZA 4DJFC 2GJPA 3CQ0A 4XZ9A 3EKLA 3NWRA 1LWJA 4JX6A 3PS7A 3N73A 1QPRA 2EG8A 2QKFA 4HD5A 1ZY9A 1G6CA 2I7GA 4UFHA 5AYYA 4AXNA 5A6BA 3Q94A 4Z1AA 1ISZA 2GJLA 4IFOA 4KQNA 3S1UA 5BRQA 3TEVA 4E2VA 2F6UA 4ADSA 3AICA 1NY1A 3ARRA 2I9UA 4MJZA 4P7NA 4GIYA 1JDEA 1XLLA 4UNKA 1QUMA 4NYUA 1ITUA 1J5SA 1XM3A 2VP8A 2BZNA 5TD4A 3OODA 2GJXB 4J27A 2G95A 4RLIA 3IJ9A 3GWQA 4GJJA 3S83A 2P0OA 1Z69A 1PZ1A 4C6IA 1Q8JA 1SZEA 3DAQA 4DUWA 3M6YA 4XKYA 1QOPA 1K8CA 3CV7A 3HBLA 3VM7A 2IXUA 2XH7A 2V6AA 4ZOCA 3L0GA 2CBVA 1EGZA 1VS1A 2R1MA 4C1KA 1MUCA 4LGXA 5C8BB 4HPGA 2PDLA 3AFBA 2W0UA 3MYPA 4FLSA 5BRBA 2WJEA 3UJRA 4FF5A 4IIGA 2INFA 3KEHA 1R3RA 3SR7A 1TIWA 3AU6A 4PR4A 2QCEA 1WP6A 5IRPA 1DTUA 3AYVA 4H6RA 2GWNA 1KFBA 2BB0A 4U33A 3E9AA 4QGCA 1WQ5A 4O19A 4D8ZA 1FWRA 4UQDA 5HUPA 3F4DA 3M9YA 5XINA 3E74A 2PEVA 4H1ZA 4LUIA 4LY4A 3GNNA 2QCGA 4IIEA 4V1YA 3OVQA 3FEQA 2EPHA 4PBEA 2QXWA 4G8TA 5TNVA 5C9XA 2IKJA 3M1ZA 4FX7A 1XWYA 1JZ5A 5GNXA 4AMAA 4LT9A 1EKOA 1YTDA 2G3FA 1EPXA 3UA4A 1TWZA 4MDPA 3U2OA 3WQ5A 1RLCL 3O6CA 3GKAA 4HNUA 2XH2A 1SZFA 1CCWB 2NVAA 3G0UA 2DIKA 3U7BA 4KESA 4N02A 4NI3A 2PDYA 3IANA 2QR6A 2QGYA 2W67A 3MDWA 4DXVA 3REQA 2RH9A 1B9ZA 3W82A 1PHQA 1ZRQA 3C2OA 3TMQA 1WZLA 4JTKA 4HZ7A 1H7NA 3MUAA 3R6IA 4LALA 4PUKA 4YYCA 3CL6A 3UG3A 3PZIA 4LPCA 5AVHA 1R0MA 4O17A 1PIIA 3AMKA 1F9CA 3WYZA 1JDFA 3VE7A 2YR1A 5C2GA 1VBHA 3RM9A 4HMCA 2XFFA 2UWFA 3E12A 2GK1A 1DTNA 4C65A 1OX6A 1VPXA 4O54A 4PSRA 1HJUA 5I3FA 3UJSA 3QR0A 1TV7A 2PTXA 2YB4A 1TPWA 1TV8A 1R3WA 5ECVA 3FVMA 3OVRA 2BV9A 4K3ZA 2J77A 3P14A 5I0DA 3HURA 4CQDA 3R1ZA 4HMEA 3M44A 3EAUA 1G4SA 4HNCA 2WJDA 3ZIZA 5F2IA 1UD3A 4L7ZA 1V0LA 5CZ0A 3KL5A 2OXNA 3MP5A 1GVRA 5FJOA 2INZA 2FHCA 5LHEA 4NNCA 1Q4NX 4L9XA 1QBAA 3FJLA 5HMDA 4BY3A 3QQ0A 3NGFA 4IPPA 4JZ5A 2PDPA 1KCKA 3TU9A 1QI0A 3S5YA 4GCAA 1JAKA 3WENA 4HU4A 4MFDA 4A22A 1LWHA 4H8NA 4LUJA 1JZ7A 1FCQA 1AJZA 1P7TB 2XVNA 5M17A 3VIGA 3VMNA 3VD7A 2XN1A 5IBXA 3UY8A 2EAWA 4ZR8A 4KRTA 1KTCA 1E4MM 1IEVA 2FMNA 2FPYA 1S1PA 3CLWA 3FCPA 2WSQA 3SQMA 2FFCA 1AH4A 1BGAA 4TV6A 1SFTA 1ZAIA 1YDYA 2Z1SA 3R25A 1CGYA 4MF4A 1C9DA 2E9BA 3DKLA 3II1A 3QC0A 3BGAA 4Q4RA 4RPPA 1LT7A 1QT1A 1F6YA 4UQAA 1KB3A 4QXIA 4LYQA 1X1NA 2WZHA 4MKVA 3PPGA 2VR4A 3SQSA 3W86A 4QE5A 4JFTA 1SR0A 1MUMA 1NP0A 1RP8A 3PJWA 3KHDA 4XWUA 5HINA 3NDOA 2PGEA 4QCFA 4QLJA 3CEUA 4NG3A 1R86A 2OOGA 4PCSA 3P93A 1OGBA 4HSHA 1QOXA 3ZJ6A 4JHOA 4WUIA 3G1RA 4C6EA 2VX6A 1RBAA 2W63A 5CPTA 3ITXA 3NAVA 4GVIA 3TFXA 3DFTA 2GQ3A 1W9VA 1XGDA 3L4XA 1F2JA 3VZXA 4U31A 4ATWA 4CQ9A 1TVLA 4WR3A 4BEUA 4FS9A 5A8GA 4CD4A 4G56A 3PG9A 4JY8A 4DJEA 2GQAA 1AD4A 4RNJA 3WD3A 1JFXA 2VXNA 1Z41A 3AIRA 2NXGA 1W1YA 3BL3A 4YU1A 4YCOA 1GPFA 2EBNA 3SDOA 3WL0A 4HSNA 3EX4A 1XCXA 3EDFA 4EE9A 4HNVA 2PI6A 4FHAA 3WLHA 2QMKA 1EJXC 5CEWA 2PF8A 3AMLA 5L9FA 2P1FA 3EA3A 1VFLA 3LD5A 3O2LA 3TX9A 1WNOA 2QJNA 3AIWA 3QTGA 4M7TA 4C91A 3LGDA 3GVVA 3UY7A 1CGWA 1FWNA 3AIVA 2NT1A 1QU4A 1T6MA 3EOLA 3UG8A 4XBJA 4KRUA 2QUTA 2V63A 4PTVA 3WNNA 2OLAA 4P5UA 4Q8QA 1RLDA 5DBUA 3DDMA 4FMVA 1ESWA 1V51A 3VIFA 3LPPA 1DWJM 3VNYA 3KP1A 3CYVA 4LJ3A 5IFTA 2POZA 2FTWA 3PC0A 1XUUA 4GABA 1FRBA 1P43A 1VHNA 1KCZA 2NQJA 2WZIA 3AUOA 2Z1XA 5G2HA 3RO8A 3W84A 2CLPA 3A5VA 3W27A 2J27A 1C8VA 3STFA 4BR1A 3DYPA 2PC8A 2C71A 4KETA 2CBIA 3OIHA 3QRHA 4H9XA 3VE9A 4FF7A 3TJ4A 3PAOA 4ZL1A 2HXUA 4GLEA 3SEPA 4TOQA 3KBSA 4O15A 2OGJA 2A6LA 2FH6A 3ICJA 3B9AA 3S3GA 2NWSA 5I3JA 2NZLA 1H1NA 1YNPA 3LRLA 2BVDA 3I3EA 4A3QA 1H0GA 4HU8A 1MDLA 4S3CA 1R5YA 2RDUA 1LRTA 1IEWA 4I5UA 1TCDA 1GZJA 3NQAA 1KBLA 3SUWA 1AL7A 1Q63A 3ZT5A 2PP3A 4YWSA 3W7QA 5DN1A 5IOBA 1GOOA 1DJXA 1EEPA 4W84A 1I9CB 3PWGA 3N15A 4QNWA 1E15A 1ITXA 3DOPA 3N04A 2ZA3A 2H90A 3MUZ1 4WRHA 5LXEA 3TNOA 1O5RA 1Q6QA 2EHHA 2PRMA 4YN5A 1OIMA 3GUGA 3A21A 1W3IA 1O5KA 5FSEC 3E02A 5BYWA 2R1KA 1WZKA 3WJYA 3LK6A 2H9AB 3LCLA 4O53A 3JZUA 3WLLA 3PTMA 3WQWA 3WN6A 1JRCA 1UKQA 4PULA 2WMHA 3BLKA 1MW1A 1N2VA 1LL4A 1XDJA 5A6SA 1A0CA 2A1YA 3E38A 4U10A 1WOBA 4LVDA 5EYWA 2PE4A 3GHTA 4QCEA 4XZIA 1S2TA 2QAFA 2PU0A 3LQLA 3K2GA 2XGIA 3TWBA 5A1AA 1GOXA 1LOQA 3VGGA 2V2DA 3BOLA 4GKLA 3THUA 4JTRA 5FJJA 3BMXA 2NLIA 4N6EA 2EPOA 3QR3A 1H7XA 3W6MA 4AB4A 1UWSA 3FGCB 1E0UA 3S5ZA 1LQ0A 3F1QA 2R9RA 1NDVA 1TWSA 5M2FX 1K9TA 8XIMA 5LIWX 1HG3A 4BEQA 2PB1A 5EMUA 3ITVA 2FPTA 1DJYA 4IUGA 4U4MA 4Z1YA 4EWJA 4ZZ9A 1CECA 4YNGA 4GUFA 2PDNA 1PX8A 5AFDA 3BLEA 1R85A 1JZ2A 2XYLA 2Z24A 4A3HA 2C6QA 2J88A 4CD5A 2DEPA 1SJCA 2W27A 3BG3A 1B54A 3MMUA 2EEXA 2VWSA 3CGTA 3IUDA 3PHAA 1RALA 3MPGA 3PWIA 4M6UA 3VK5A 1CGXA 3RF9A 3TW6A 2A3AA 3TTYA 4PEEA 3ERPA 1LOSA 4KPLA 1PDZA 5E0KA 5JXQA 4KS0A 2GFTA 1IR1A 1ME7A 4XD5A 1XH0A 1BG9A 1UZ1A 4Q8PA 3TOPA 1JFHA 1RVKA 2AQVA 1LYXA 3L67A 1YXCA 4US5A 2E67A 1U1HA 4BI5A 4Y96A 2Y8VA 1VC4A 1M6JA 4D6HA 2V69A 3WLTA 4UFKA 4LOCA 1TV2A 3R0UA 5EL1A 3VDCA 4MHBA 1PUDA 4B90A 1J4EA 1OC5A 5F4XA 3CZEA 4FAMA 1BD0A 4M6PA 4K68A 7REQB 5F4SA 2JKPA 2ISSA 1YDNA 2V67A 4IGNA 4BJHA 3R43A 1Z6KA 4GIAA 1QCWA 1OT2A 2NX3A 3N9SA 4IL0A 4M51A 1EC8A 3ZO9A 4K7VA 3QSRA 4RDWA 3SCSA 3EOSA 3AZSA 3VVGA 3UGRA 3KVKA 5K3VA 1IWAA 1TKKA 3R2GA 1EHNA 1DORA 4HTYA 2E3ZA 3V18A 1IZJA 3R5EA 1EEXA 2VEFA 3UJFA 1G7UA 3KS5A 4HTBA 4D8LA 3AOFA 1UKTA 1TTPA 4IMAA 2PS2A 3LDVA 3S5SA 3UWWA 3ZR5A 1QI5A 1XH2A 1UA3A 5JVLA 4PTNA 1KRMA 2PPGA 4CEXC 1QMLA 4H2HA 4AEFA 4IGMA 4DY1A 4XKMA 3PUGA 3WLQA 2YGYA 1R2RA 1R87A 2AAMA 2QUVA 2X7VA 3HG2A 2XSXA 4NF7A 1I2NA 4LBUA 2HVNA 1EO5A 4JQ2A 3QKEA 2FYMA 3KOZA 1UR4A 3LTSA 3W25A 3QZAA 3W02A 1V6UA 4LS0A 4EACA 1UR8A 4EOUA 3MUIA 4CQAA 2VZSA 2PF0A 3ORWA 1BKHA 1VR6A 2OEKA 3UESA 3NPWA 4JNYA 3LSCA 2G41A 4E3TA 2GOKA 4WGHA 4LF2A 3G1DA 5A94A 3GC5A 2QCLA 1QNSA 4XBSA 5DF0A 4QJ3B 3CV2A 3R89A 2HDJA 1C7SA 4DJDD 4QJ5B 1T0OA 4MB5A 3HO8A 5AHEA 5BXRA 3E2QA 3MS8A 2VRJA 3Q37A 1JZ3A 2WNZA 3MY9A 3RITA 1ISYA 2YCJA 2GVGA 4ZE4A 5LGZA 3GU2A 3ZSTA 2J7CA 3MB9A 3BAYA 4I8YA 1JQXA 2D73A 2KX9A 4QSHA 1UQZA 4HB7A 1RV8A 5EMYA 4L9YA 1JCJA 1PCWA 5DFAA 1F07A 1AQ0A 3VGDA 1OB0A 1WDDA 1PEZA 3PG8A 3G0SA 1VYSX 4DN1A 2D24A 1DBTA 2FVKA 4PZVA 4ZO8A 3UGVA 3ONCA 1UIOA 5EU9A 3O6AA 3WG6A 4DBSA 5IBXC 1V02E 2NV2A 3M7SA 3OOQA 3URQA 2BTMA 3D47A 3TH6A 3M07A 3A3XA 4FP1A 2YCLB 1Q6GA 1I75A 3TC7A 5A6JA 4G7EA 3ID7A 1XRVA 3SB0A 1E6PA 1SJAA 3WLNA 1FUYA 1RQEA 1EYWA 3A24A 4GQBA 2VZTA 4R9OA 3LEPA 4OKDA 2PWFA 3V75A 5CXPA 5BOFA 1UWQA 4JL1A 3ARVA 2ZXAA 1HP5A 3QMRA 2ISDA 2IKGA 3TTEA 4FXSA 3T4WA 4PUMA 3W1UA 1SSGA 2WK2A 4DWSD 3DX5A 4LBSA 4KT2A 2X7WA 4HHLA 2VO5A 3W88A 3B0VC 3BGGA 4B5TA 1MFUA 1R6WA 3HOJA 1UJQA 4HNTA 1HL2A 3BSHA 4HK5A 3VMOA 2QUMA 2QJGA 3C8FA 3WLIA 4EAMA 1XYLA 2ZZ6A 3GQYA 3W26A 1AG1O 1MUWA 2Z1WA 4FB7A 4W89A 1R2SA 2V8ZA 5CPLA 4ZE5A 5GVJA 3BCJA 3UPWA 4YIWA 5DANA 1WYIA 4ZB2A 4R34A 1GG0A 3LMZA 4C1LA 2Z26A 5ABFB 3UCCA 3QLDA 2DT0A 4RE0A 1B5TA 1K6WA 3O63A 1M7XA 1KFKA 1EGVA 2PD9A 2ZIDA 3DIPA 3DG7A 3HPZA 3I4EA 3A4AA 2YDSA 4IPLA 4JN7A 4IP4A 3QPZA 4XAFA 4CNSA 1W0MA 3HV8A 4DJEC 4KWUA 3V0UA 3HPFA 1D7FA 1HO4A 1TJ2A 4PYSA 4RW5A 1A5BA 1A5KC 2YW3A 1UC4A 1DJWA 5FA5A 3TONA 3IJIA 4Q3MA 4GD0A 3OLDA 3ES7A 1S5VA 4XO6A 1KRAC 3U48A 5HQLA 1VRXA 7CGTA 2OT1A 1AW2A 3AJ7A 4NI8A 1FY6A 4GMEA 1EF3A 2JEPA 1OK6A 1J0KA 3I7RA 1R7OA 4H9TA 2V9DA 2QGHA 1SJDA 3AC0A 5EMMA 3GXFA 4XAYA 5FSDC 1SMDA 3K8LA 4RE4A 4D6CA 4J9JA 4M3PA 4JGDA 3OYXA 4GXWA 4LRTA 3QF0A 5EPDA 4K1WA 4J3TA 4R9XA 3RK8A 3WK3A 4DUXA 2QPSA 3C0SA 4M56A 4YS1A 5F1UA 4MAVA 3E0LA 2PWVA 1IEXA 1ZAJA 4HP5A 2CEQA 4EPKA 4Q4KA 5CZSA 1CW2A 3T2PA 2CZDA 2GQ8A 1LDCA 1W56A 5I78A 4L6OA 3W87A 3AHVA 1Z44A 3UVAA 4Q8TA 4HCDA 2C14A 1BFNA 4I7VA 1S2AA 4WF7A 1SZNA 1E6RA 3NPUA 3B06A 3S2NA 4IICA 3PBMA 3CNYA 3G1VA 1J18A 4EXAA 1ZUAX 3TYEA 1X39A 3SCTA 2OMAA 2Q3OA 3MWAA 4BQ2A 2W6RA 4MWAD 3LLXA 4ZO7A 3U2EA 2BHUA 3OLGA 1XYMA 1ZHAA 4F0MA 1S5NA 4FA3A 4A4AA 4JY9A 3LM7A 3MKVA 3W1RA 3BCFA 4CCEA 4UTUA 3AMDA 3EMQA 5CGTA 3W7HA 4DNMA 2WKLA 4AMCA 1K9EA 1VBUA 3SY8A 4GC3A 1JULA 1PV8A 1F05A 3N2BA 1EP1A 2QCNA 3UVIA 1KXTA 2A21A 2WVSA 4H01A 4PUDA 3V7PA 1ENUA 3PF3A 4JTAA 2CERA 4AYGA 1A80A 5LA2A 3BARA 3W2KA 4CU8A 3TKFA 1OGSA 3HGJA 3RPDA 1XX1A 1PIGA 1NIUA 4EIVA 3EWUA 5LIKX 1IZKA 2PP0A 3RCYA 3P2VA 3DENA 1CTNA 3FA5A 2JGQA 3NEHA 1OEPA 3FDGA 1P0NA 3O0FA 3NEVA 3HG5A 4ZBCA 4B5WA 4XKYB 3EX2A 4GVFA 4XVDA 3L2LA 1V3IA 5D37A 4AIUA 2Z2BA 1MNSA 2JIEA 4HBKA 3A9BA 4LEFA 1XYFA 3E96A 3UT0A 3GSMA 3TQPA 1XHGA 1OCNA 3CV6A 3AO0A 1MNZA 1IWBA 3W2JA 3CBWA 3H7UA 2ZUUA 4CNTA 1XIJA 3AXKA 3ZZ1A 2PDQA 1EIBA 1REQB 3BLDA 1TE6A 1DEDA 4J5NA 3LI0A 4U5IA 4KCVA 4ZSUA 3N2CA 2VHLA 3IIZA 2ZDRA 3ITLA 1HJVA 2VURA 4JYDA 3OGRA 1EX5A 4P8XA 4AIEA 2O9PA 2ZXDA 1O5XA 3F2BA 3BQ6A 3MMDA 4U3CA 3RFAA 5LNVA 2VUYA 1X6NA 3QTPA 2DUAA 1U30A 1JD7A 1FQ0A 2QNEA 4QBXA 2XVKA 5G4EA 4Z2JA 4ADUA 5FL1A 3S1WA 3CL7A 1T96A 5BMWA 3OBKA 1NFBA 3WNLA 5D2XA 3MC5A 3WDQA 1W54A 1MI3A 2X30A 5IDIA 1BVNP 1G67A 4M0XA 4U3AA 3UXDA 4XO7A 1EJ7L 1PZ3A 2DPEA 1IT7A 3K8KA 3VA8A 2YBTA 1OFPA 1GONA 1GTEA 1GYNA 3CS2A 4A3RA 4P8UA 1OX4A 2BS9A 3M0LA 1J2BA 3WUGA 5FIPA 4AD5A 4NZ3A 1HKKA 2H8ZA 5FJTA 2OWCA 1W3HA 3A4WA 3TSDA 2CLLA 2BVTA 4HHHA 3I6EA 3NVTA 2OZ3A 4PMNA 4OU1A 3HPAA 1CENA 4Q7IA 4GJIA 5U4NA 2OLHA 2WKGA 4PB5A 2HPIA 2ZOXA 4UFMA 2R14A 3R0DA 2GK1B 3GAKA 2FGZA 3ARTA 3W38A 4IHCA 4FR1A 3AYRA 1A5MC 1EA9C 2CYGA 1JCTA 5FI8A 2QV5A 2J7GA 2HVOA 3N9KA 4PRWA 3N17A 1P6CA 1LT8A 3S8HA 1K03A 1W5MA 4X9SA 4HNOA 3VKBA 5CLTA 2GSHA 3W6YA 3NOEA 3GBDA 3D3AA 2IPWA 4HKPA 4UOQA 1N8FA 2E68A 3HPSA 2R94A 1CGUA 3WH7A 1FWTA 1BYCA 2ZX6A 4DF1A 1EJTC 4NJJA 1NSJA 4JPGA 1XKJA 5T8GA 3DKJA 1RY8A 1ZCOA 2XFYA 3OA5A 3NPVA 2ISWA 4IG2B 3R79A 4GYJA 3FXGA 4ATDA 2PDGA 2BXZA 3W3OA 4AVNA 2XFWA 4HA3A 1K7EA 3F5LA 4F9DA 2QDHA 2VDHA 3MP3A 1W31A 2I57A 1ADDA 1VQTA 1KGUA 2OKTA 3GR4A 1RBOB 1JGMA 2DSUA 1DOSA 3W83A 4ZQRA 3GIQA 4XAZA 3QOMA 3R13A 1XFCA 5LKYA 2VFFA 3C3NA 4ZFCA 5CC6A 4KBXA 3APYA 4H9YA 5KMYA 3CWOX 4GOAA 1UD5A 5FEXA 1CXIA 4LC8A 2PUZA 2D2JA 2Z2AA 1O60A 1PYMA 2IQ0A 1GOMA 3VUSA 2C0AA 1QNPA 1KRCC 3IVSA 5G5IA 9RUBA 3QV7A 1XRSA 5IHSA 3CXOA 5I3GA 4JFSA 4S23A 1NVMA 3JVAA 4RZ6A 3BCDA 5I3IA 3C2VA 4AZCB 3EYPA 3O0KA 3RIKA 3ZLHA 3TE9A 2GSJA 1XQKA 2ZKMX 4PE8A 2CLEA 3T44A 4GUIA 1WXZA 1H63A 1R9XA 2ONEA 3KDNA 3GG8A 1ZNNA 4G7FA 1A5UA 1BWVA 3QZEA 5E5CA 4PC8A 1D9EA 1WDWA 3CC1A 2J7DA 1JVNA 3GTIA 1FCUA 4NXSA 3OA3A 1OD8A 1Q6DA 3PJXA 4MM1A 3T2OA 3SRFA 1I0DA 2Q8LA 4I7UA 3OZOA 2PDXA 4PBFA 2Q02A 1UW9A 2NQ5A 4TR9A 3WF1A 5IDZA 2WCGA 3N4AA 1IT0A 3OZPA 3VGEA 4IXXA 3T8QA 2VENA 3FSTA 4O1CA 4W85A 1QVBA 2A79A 4MGGA 1E9ZB 4AF0B 1BKSA 2OJPA 4S39A 3WBEA 3BJSA 3RRAA 3NL5A 2XJ7A 4IQEA 3VNLA 1MFVA 2PDWA 4D72A 1PXGA 1UASA 1KXQA 2YDQA 2XH0A 4LXFA 4IMDA 4I90A 4NIRA 3W7JA 4GZEA 4V2XA 3LA4A 2VDIA 4RUBA 3U4FA 3LCHA 1UPPA 3VKKA 5BZAA 4IIBA 4XD3A 5AYXA 1PB0A 1DHPA 2E8YA 4UNLA 3ISIX 2V5JA 4EK7A 3H2CA 2C91A 1D3CA 3NL6A 1AJ0A 1WDQA 3E0FA 2W3ZA 5I23A 4Y9MA 2P8CA 3WNOA 4QJ4B 1ME8A 3JR2A 4HT3A 3BLOA 4LVGA 2J62A 4O13A 2F2HA 3RX4A 1FHVA 2YL9A 4R33A 3ITOA 4FNTA 1AQFA 3SADA 2DH3A 3FOKA 1UR3M 3L66A 1JDCA 3AQUA 3NQ6A 2X42A 1C92A 1VFFA 4DYJA 3TYCA 3DCPA 2WZTA 2ZRWA 5CC5A 4WQ6A 2X40A 2F84A 4YJ5A 1PX4A 3WDIA 1HKIA 2WJFA 2X41A 3OHMB 3VM5A 2P88A 3K8MA 1J93A 2YXGA 3IIVA 4PCPA 4PFMA 2ZTKA 3KOYA 2XZ9A 1S46A 4GA8A 3EX1A 5F2LA 4MB4A 1OFAA 3P5ZA 3SBFA 3LXCA 3MO4A 4JS3A 2VRQA 2ZYFA 4QQ3A 2G3NA 2FKPA 3CZKA 4GY7A 2EG7A 4KFOA 3ONBA 4EAYA 2NQZA 5F2GA 1W3JA 5BXTA 1WKDA 2Z27A 3RM4A 2NSOA 3W7KA 1SW7A 4AH7A 3S42A 4S38A 5EMLA 3NM3A 1T8QA 3W7GA 1V8EA 5CZTA 2HS8A 3UWVA 4XIMA 5CG0A 3SM0A 1EJRC 5GNYA 1Z48A 1PHWA 2VELA 1GJWA 4P7RA 1B3XA 1OFQA 3IJDA 1TRDA 3CZ8A 1Y5WA 2XVGA 3W7DA 1MXDA 2BASA 2CKRA 3TJXA 1JUBA 3QM3A 4HIBA 3U0HA 1NU5A 3C2YA 1ZBWA 3NQVA 3GY1A 2HVMA 4ROPA 3FLUA 1B3YA 4FOKA 3WQ6A 3N13A 3LM3A 4C7FA 2AOSA 5AHLA 3IGXA 2IUZA 5EGRA 3OJGA 2X09A 3MVTA 3KL3A 1LOLA 4TMBA 2E5BA 2VFDA 4AD4A 5A6TC 3Q4DA 4AXKA 4D2JA 2WLYA 2GVLA 5AVNA 2A6NA 3GAYA 5XIAA 3HQ1A 3WK2A 1YXDA 3GFXA 4RJEA 1J0ZA 1EX1A 3CIWA 4WGXA 2FDMA 2BDQA 3E5PA 4GI9A 4R27A 2BOGX 1Q7MA 5G1MA 4YTRA 1L9WA 1VBJA 4Q8WA 4JIHA 1AD1A 4JFUA 3KRUA 3FYOA 4OIFA 4P8VA 1TJRA 1WKFA 3VXGA 4KEZA 3GXNA 3IGSA 5I07A 3LENA 1E3ZA 3DBPA 5A5WA 3A12A 3QLLA 1DWHM 4QE4A 1V03A 3TZNA 2BG5A 2G0WA 3KZPA 4TO8A 3QQ1A 5HNRA 1EC9A 2A3BA 1TMLA 3AU2A 1ZL1A 2ZXQA 1G4EA 4Q4MA 2HISA 4JIIX 3T7VA 4OBSA 4CNPA 4DHGA 5GNZA 3ZYZA 4DZIA 2VR2A 3PZUA 6ALDA 3W1LA 1TJ0A 1DXIA 1VEOA 4MB3A 1D7KA 2ALRA 1DIKA 2PRHA 3AYTA 2ANUA 1JUEA 1Z89A 2AAAA 3EXRA 3LGEA 4LYRA 1TA3A 5FOOA 1GOKA 1XS2A 4YYFA 1FWSA 2Y7GA 3WQCA 1GVOA 1V6XA 3ZR4A 1KR0A 1I2PA 1P1XA 3CHFA 4NAEA 1KLZA 2JEQA 1TFVA 4AWSA 3LYEA 3JU2A 5LA0A 1QASA 3M64A 1G69A 3AISA 4HK6A 1A3WA 1B4KA 5TBOA 2I5IA 1R9ZA 3N34A 1QR7A 1X98A 2WO5A 2XVPA 1KFJA 2R24A 2YL6A 4J1OA 5LYRA 4LCQA 3M46A 1E43A 1KQZA 2VFIA 3N3TA 4AZ7A 3HJZA 4PMQA 4HU0A 3BURA 3C4UA 3HN3A 4GYPA 3VIJA 4LAOA 1UPMB 1IGSA 3P5YA 4CD8A 1TR1A 4EX4A 2ZZ2A 5B80A 1Q45A 4A8NA 2F61A 4HA0A 4GZIA 4TMCA 1RSCA 1S1RA 3GTFA 4F0LA 3M5VA 2C7FA 3MSGA 3VDHA 4HOWA 1W1TA 2OX4A 3UJ2A 3UETA 2GJRA 5A8NA 1XLKA 3HPXA 1VJZA 4ML9A 3SCOA 4WSHA 3V16A 4Q8VA 4P61A 2XFRA 1SU5A 4H00A 5CBIA 2B0MA 3AI0A 1CT5A 4XD4A 3W4RA 4QG6A 3FW6A 2Z6JA 4UQCA 1E9IA 3SRHA 4AHPA 4DI8A 4DJDA 1ICQA 3EEZA 1BVZA 3RCMA 2HBVA 4RZ5A 4N9CA 2EO7A 3GVRA 2A5HA 5HUOA 3TVAA 3MO7A 3LPFA 2WMIA 3TN5A 2RKXA 3BGJA 3VD4A 4ZMGA 5M5DA 1EUAA 4QQUA 5J04A 3HQOA 1JL8A 5M3WA 4IGSA 1DYSA 3G1HA 4HZMA 2ZX7A 4FR6A 1QI3A 4K6AA 5HNTA 4CD7A 4L4MA 2J47A 4S3FA 2F8QA 1WAWA 1KXHA 1SO5A 4AZ6A 3TA6A 2E7FA 1M7OA 4JIQA 1F3XA 1EXBA 1HJWA 2VR5A 3I68A 4BK9A 1X6LA 1TPFA 1MEIA 4REQA 3OB8A 3WH8A 1XBXA 3FEMA 1M53A 2O9RA 3MBFA 4A21A 2QVHA 1EJWC 1H3GA 3B9NA 1W1A1 1W5PA 1R3VA 4WDTA 4M81A 4CD6A 1CXLA 4IQLA 1YNYA 4J7RA 4ZOAA 2ZADA 1UHVA 1ODZA 3B9EA 1XKYA 4LUTA 4W7WA 3DFSA 5FL0A 3S9ZA 5C7HA 4KEVA 5MKGB 5EFDA 4AEOA 5F4WA 4EPEC 4U2YA 1Q6RA 2YLAA 4DWSA 3WDHA 1ZALA 3NOYA 1K4HA 2VDGA 4B2DD 3WK1A 4QX4A 1ITQA 4W8LA 4PCTA 1DJHA 3HF3A 1LWIA 3ZVHB 2I16A 5DQPA