3VNDA

Crystal structure of tryptophan synthase alpha-subunit from the psychrophile shewanella frigidimarina k14-2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
259
Chain Sequence
MSNRYQAKFAALKAQDKGAFVPFVTIGDPSPELSLKIIQTLVDNGADALELGFPFSDPLADGPVIQGANLRSLAAGTTSSDCFDIITKVRAQHPDMPIGLLLYANLVFANGIDEFYTKAQAAGVDSVLIADVPVEESAPFSKAAKAHGIAPIFIAPPNADADTLKMVSEQGEGYTYLLSRAGVTPIENILTQLAEFNAPPPLLGFGIAEPEQVRAAIKAGAAGAISGSAVVKIIEAHQHDEATLLAKLAEFTTAMKAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
publication title Strategy for cold adaptation of the tryptophan synthase alpha subunit from the psychrophile Shewanella frigidimarina K14-2: crystal structure and physicochemical properties
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 94
structure length 259
sequence length 267
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3vndA00
1S5VA 2I1OA 3PY2A 3MI3A 4GRSA 4NVTA 4EOUA 3GDTA 4QNEA 4Y9AA 3O06A 2Y6ZA 3P7YA 1Q6LA 5AFDA 3IIOA 3BARA 4IMGA 3NQDA 2DJLA 2QDHA 3OVRA 4ZQMA 2ATSA 5K9DA 3QMSA 3FKRA 3GDLA 2KZHA 5D09A 4UTWA 1H50A 1HUVA 3IEBA 4O17A 1VR6A 4XBKA 5F4XA 2H3BA 4NJKA 2RDWA 1JJKA 4DEFA 3FJLA 4UTWC 4ADSA 3IGXA 3HGSA 4UFLA 1OYAA 1VCGA 1K7FA 2XFWA 1PL9A 2CZDA 1OX6A 3N2XA 3C2RA 5IM51 3KVLA 2NLIA 1YXCA 5I3KA 4O10A 1OHLA 1FX6A 1KBJA 2ISWA 2V2HA 1TJRA 5LNSA 1R2SA 4Z0JA 1TIMA 1SUXA 5A5WA 4A2RA 1SU5A 3GAKA 3P82A 1LM1A 2DJXA 3N14A 3S1UA 1TQJA 5CSSA 4HNUA 3W7RA 4S1FA 3SGZA 4S2BA 3B04A 5I3GA 1WQ5A 2XN0A 3GB6A 1VH7A 3EWZA 1DJQA 3R13A 4PA8A 1AL7A 1WOAA 4UNKA 2QUVA 5K4ZA 5F4WA 5G5IA 3DFPA 3TR2A 1OK6A 2OZ0A 3A5VA 3LCXA 3PS7A 1R47A 1SZNA 1L6YA 5FEPA 2V5BA 5DBTA 3OIXA 4HNNA 2X1RA 1I2PA 3PUEA 4GXMA 4O54A 1W5MA 4GUGA 2HS6A 3CHVA 2CZ5A 4JX5A 1QPQA 2EF9A 3LRKA 1TPH1 1UASA 2Y85A 4RX0A 1G4TA 2ZA3A 1L2UA 3DAQA 2V30A 4YCOA 1OFQA 1WXJA 4OHQA 1T96A 4RZ5A 3TE9A 1FDYA 2Z1BA 2ZRWA 4QQ3A 4XTDA 4JN6A 1RV8A 3UWWA 1SW7A 1JQXA 3T4CA 1A5SA 3N2MA 4CCEA 1GYNA 1C8VA 1KLZA 4K6AA 3TMLA 3UD6A 2V5LA 2FJKA 1YYAA 2ZCGA 2GVLA 3F1QA 2Y7FA 4JDYA 3N3MA 2BX7A 4YLWA 4G1KA 2ZYFA 4UTMA 1W8SA 3GZ3A 1QO5A 2JBMA 1Q6RA 1C29A 4O28A 5I3JA 2J6XA 2ZBTA 3H54A 4WQ6A 5T26A 4WX2A 4GNJA 4UXDA 3G24A 4KWVA 2NX3A 4NXKA 3VKJA 1ME8A 5F2LA 3NQMA 4A22A 1RQHA 2R8WA 3HOJA 3CEPA 5D2WA 1KFCA 3UPWA 4LWWA 4O50A 4UTJA 2QF7A 2A0NA 2DU2A 2QEZA 1KLYA 4LT9A 2A2IA 4CCDA 3P74A 4O13A 5BOOA 5D30A 3LHUA 3NAVA 1TQXA 4RXGA 4ML9A 5G4EA 1KM6A 1H1ZA 2QUTA 2AAMA 3T78A 1PIIA 4GC4A 1H7WA 3PVFA 1F05A 4IX0A 2CW6A 4MZ1A 4PL1A 4WJEA 1D9EA 4LRTA 2DZVA 4Z0SA 2ZRYA 3NQFA 4ZVJA 4UFIA 4AWTA 3LCFA 1LBMA 4DO6A 5CSRA 1QOPA 1RR2A 3MMTA 1PHQA 2Z0IA 2NV1A 4PFMA 5AHMA 2GQ9A 4IX2A 5DY3A 3LX9A 2XN2A 1WYIA 1SO5A 2TSYA 4NNAA 3NQCA 1HTIA 1JCYA 3S42A 3LTYA 1RD5A 2YYUA 3LV5A 2J88A 3LXAA 5IBXA 3NPWA 4AAJA 3C56A 1SO3A 4ZQOA 4EVZA 1H7RA 1FCQA 3I7QA 2B4GA 3PAJA 1LYXA 2NUYA 5IBXC 3ZS4A 3O1NA 3DGRA 1B4KA 1XBVA 2H90A 5EA9A 3NQ7A 5KZEA 3GKAA 2E1DA 2GQ8A 4OGZA 3DBPA 3DKLA 4JR5A 4UIOA 4UTKA 1TMHA 3AO0A 3NQVA 1G4EA 1UB3A 2I9EA 3P62A 1O5XA 2YCEA 1GT8A 3TH6A 1F2JA 2Y63A 3RMJA 1D3GA 1GPWA 3W23A 2DZSA 1JQVA 3BG9A 1EP2A 4AWUA 1OK4A 2V2DA 4CQ8A 3NL3A 3PF3A 3IIVA 1HFBA 2VC6A 3EEGA 3EKZA 3SY5A 1H7PA 5H91A 1HG3A 3C8FA 1AW5A 4QM1A 4KFPA 5GVJA 3B05A 4WXYA 2RDTA 5HJLA 3SIZA 1P0NA 3G3DA 2RKXA 3QC3A 3UXAA 5BRBA 1SFLA 4N6FA 4LS2A 2A6NA 3STGA 4ORMA 3MI2A 1OG0A 3B4UA 4Y90A 2QAPA 3BG3A 3W1QA 4WXZA 4TMCA 3DZ1A 3YPIA 1X6UA 2BXVA 2EHHA 5E1QA 1DBTA 1LP6A 4ZQCA 2G97A 3IIPA 3PB0A 5CPMA 2Y89A 3L0KA 3TW6A 1M7PA 1OF6A 3QZEA 4IJBA 3TCEA 2HTMA 3QMTA 1ADOA 3O07A 3CIWA 4UTTA 2WO5A 4ORIA 2QDGA 3F4WA 3N19B 4A2SA 1TCDA 1KFLA 3TNOA 4L4LA 4CNOA 5LHEA 1TPFA 3W7IA 3LTSA 3W7EA 3M41A 3SZ8A 1K7XA 1QO2A 3W2MA 5D32A 2QCCA 4UTTC 1W3TA 4LOCA 2GVJA 4HT3A 1DJNA 5CZTA 1I8JA 2V2CA 1IXOA 4JTSA 3D0CA 5J5DA 2QR6A 3A21A 3TAKA 3IIZA 2EAWA 5F2MA 1IIHA 4WD0A 5HWNA 3LHWA 4OT7A 3A22A 1TPDA 3ATYA 5LNVA 4JTTA 4JX4A 3W2UA 1Q45A 1QWGA 4XKYA 1W5OA 3F03K 3WJSA 4MFEA 3Q94A 3LB0A 1XFBA 5G1YA 5C6MA 2EPHA 2ZFAA 4E0CA 3C52A 1F73A 1QPRA 3FEMA 3G8RA 3G1VA 3DI0A 3MJYA 3NXFA 3UXDA 4ICNA 4JX6A 3PBVA 3TQKA 3TUUA 1F5ZA 3I68A 4AB4A 1QFEA 3W7KA 5HR7A 3LI1A 3W83A 6TIMA 2Y88A 4P2VA 4WY0F 2WV8A 3N73A 3L5MA 1NEYA 3QRHA 4O12A 3MO7A 3TFCA 4J9JA 2WJZA 1WBHA 3KHJA 4MY1A 2EGZA 4RXFA 1XDLA 5DXXA 1ZY9A 3G1XA 4HNVA 1AL8A 4AVFA 1H7XA 1QNVA 3W7HA 5LNWA 4YL2A 3CB8A 1NVMA 1OFAA 1UBSA 2A7RA 2E68A 3RFAA 1JVNA 4TU1A 3HG2A 2PE4A 4FX8A 3NEVA 2YFNA 2ZZ7A 2VFGA 4CNNA 5HQEA 1VZWA 5CPOA 4GE8A 4FXRA 3BPWA 3NPXA 3TKFA 3I6RA 4Z08A 4K38A 4PC8A 2QAFA 5H2ZA 2ZZ6A 3TSDA 5LNRA 1TSIA 2BSLA 3NPVA 4S2CA 1T99A 3B0UX 3L21A 3BO9A 4RCXA 2GJNA 3DFQA 2YDAA 3KX6A 3PG9A 3TJLA 4MPQA 1MO0A 1EX5A 3UWVA 3RLUA 5D02A 3G22A 4UTHA 3TXVA 2WQPA 2E09A 4ZZ9A 4N9EA 3KRZA 2F84A 4IWWA 2NZLA 4EF9A 4MZYA 3HGRA 1GVFA 3G1FA 1XDMA 4JY9A 1R46A 3S6DA 4DELA 1LOQA 4LVDA 1VCFA 3M44A 1KV5A 2DZXA 4K7VA 2Y7GA 2ZTKA 3H53A 1YPFA 4JIQA 1KA9F 4A29A 3N9RA 3SSJA 1U83A 4NU7A 1GVQA 3W7LA 1RZMA 2CLMA 3CLMA 1Z41A 4LVAA 1FUYA 3O6YX 3HF3A 2X2GA 1X1OA 2VFHA 3GKFA 2J9YA 3L66A 3UZ5A 3BGGA 4E38A 1EB3A 4XTIA 1OABA 3KOFA 3W1AA 3MWAA 2C14A 4Q33A 4CQAA 2VEPA 1FQ0A 2ATMA 4MLJA 3W86A 3U8GA 3L5LA 4MJZA 3W7MA 1JCXA 3S5ZA 5TBOA 5DBUA 3BK0A 3GXNA 3QW3A 1GTHA 5K9XA 4LUJA 1VRDA 2DZUA 4MKNA 1YTDA 4X2RA 1FXPA 5E0KA 2Y7EA 4FX7A 1ICSA 4MYAA 2BWGA 4PL2A 2VFFA 1WOBA 5I3HA 3BLEA 2W0UA 5D38A 5BMWA 1KM3A 4K36A 3BV4A 4M5PA 1VS1A 1QDSA 1T8XA 5A8GA 2VXNA 1TV8A 3R2GA 3LI0A 3HG5A 4D2JA 3W71A 1EUAA 1H7OA 3NO5A 3NQGA 3DHDA 2ZRVA 1GVRA 4YMZA 3W1LA 5F2IA 4DO5A 1L6SA 4RV8A 1A5CA 1Q3NA 1QR7A 3WK3A 5AHNA 3O63A 1M7OA 4ONVA 2YX0A 3C2VA 1CX9A 1H51A 3LERA 4JTHA 3EWBX 2JGQA 3M5XA 2HS8A 4UMCA 5TQLA 3OG3A 2QCGA 2QCDB 3QPYA 2QJGA 5FF3A 5DCDA 4UUIA 5FF7A 3CT7A 4XBSA 3NM1A 3HPXA 3EX4A 3M9YA 1ZNNA 2B7OA 5KZDA 1I2OA 2A7NA 1ZALA 3G0UA 1LBLA 1R2TA 4HSOA 1W1ZA 5CZ0A 4LC8A 1ZFJA 4M6VA 3I65A 2NXHA 1MSSA 1G69A 2A1YA 1I4NA 2VFIA 3FOKA 3M47A 1SO4A 4BR1A 2V82A 3NQAA 1LTDA 1GG0A 2G5WA 2OT0A 4C1KA 5FI8A 4O11A 4OQVA 1H61A 3UWZA 3R89A 4FO4A 1XKYA 5E93A 4BFAA 5D37A 3MI6A 1ONRA 3EKLA 1GEQA 1JCMP 3L0NA 1JULA 3IIXA 3BW2A 5HWMA 2G96A 2TYSA 3W74A 2FIQA 1OFBA 3NOEA 4IPIA 1U5JA 1XUUA 3W07A 3HGOA 2CLEA 1ZAHA 1OFRA 3U6WA 2VENA 3CU2A 3LCIA 5EMUA 1LRQA 1OFOA 4JTKA 3GX9A 2JGYA 3NR0A 5K3VA 2VEIA 3W3OA 3LHZA 3NL2A 3W1TA 3G1SA 1GYLA 4U28A 3SW6A 3CTLA 1ME7A 3DU0A 4PODA 1YDOA 3P5YA 3L5AA 2GVGA 1FCVA 4YWIA 3FJ6A 3RLVA 4I7VA 2Y70A 4N6EA 1FWSA 1XBXA 5L6UA 2CWNA 1P5BA 3WJXA 3UQNA 3W9ZA 2YZRA 3BGJA 1OFEA 2Q3OA 3P81A 2FPVA 3PG8A 2OMAA 3TFXA 2QCDA 3U2OA 5F1VA 3EWUA 4ALDA 4IMCA 1NF7A 1T0OA 4GUHA 4L4MA 3GXPA 2E6AA 5MHBA 4KFOA 5AYXA 1JCLA 2V9DA 1G67A 4PCFA 1GVSA 5D04C 3VI2A 4ZMGA 2R14A 2ZA2A 1WBJA 5G2HA 3DFSA 4K8HA 3GNDA 3NGJA 2JKPA 2A6LA 5DLCA 4WUIA 3THQA 3V1PA 4MJMA 1YTKA 1OFDA 3STEA 3W75A 1VGAA 4FNUA 2NWRA 1I2NA 3PBYA 2E5CA 3KVMA 3E12A 3SJ3A 4UFJA 4A3UA 5DELA 3QFEA 4A21A 4AH7A 4Y96A 1XI3A 4M6PA 2B7PA 2ZZ5A 3EXRA 3NL5A 3B06A 5CG7A 2FDSA 4FHAA 3O15A 1JUBA 2WSQA 1SZGA 5EKYA 3VE9A 1AW2A 1M5WA 3QSRA 3FKKA 4NJGA 4CQ9A 3DHFA 1J2WA 1VLIA 4NZJA 2A7PA 1XBYA 4OBTA 2RDUA 3C2EA 3SFKA 2YPIA 4UNLA 2AQWA 5L9FA 1L6WA 1XUZA 1P4CA 4MYXA 1TO3A 3GAYA 5BMXA 1LRTA 4FNTA 4Z1CA 2JK2A 1UUOA 5D33A 4LVBA 3QW4B 2WNZA 3C61A 2A85A 5HMSA 3Q37A 1A5BA 3INPA 2FFCA 4NJJA 5K9CA 2ZA1A 1TREA 1DQWA 2C3ZA 2QJHA 1JCNA 4MLRA 1IXPA 3NPUA 4N9BA 1KTCA 3LM7A 1WV2A 4R53A 3CC1A 5AYYA 3L68A 3DXIA 3E9AA 4ADTA 3NZ1A 1FY6A 2QCLA 3GK0A 5EPDA 2IQTA 3OHIA 1W5NA 3L65A 5BW6A 4EIVA 5C2XA 2CU0A 2ZRUA 3ZWSA 2X1SA 4XZ9A 4N4PA 1B9BA 2GPTA 3THAA 2NXIA 3PB2A 1EIXA 1L9WA 3M0ZA 3UWQA 1JRBA 1W3NA 3W7DA 5CPLA 3W73A 3HJZA 1AMKA 3H55A 4TX9A 1ML1A 4RJEA 5TIMA 3W1XA 1LLWA 3DFNA 1O94A 3LHYA 1JUKA 3W1MA 1R2RA 5FF4A 2GQAA 4QIUA 3C2OA 3LV6A 4FB7A 1KFJA 3ZFHA 4NQ1A 5HULA 3CQ0A 3HO8A 4LC6A 5HINA 4ADUA 3G8EA 4JTUA 3E49A 3QF0A 4JTFA 4BI6A 3V75A 1X8FA 3DH7A 3G18A 1G4PA 4UMBA 4HNTA 1TTJA 1C9DA 4O4VA 4O0ZA 2RFGA 3TXZA 4MUZA 4DF0A 3QQ0A 1TPWA 1N8FA 5HNRA 1BEUA 1PV8A 2C0AA 3ZR4A 1G7VA 1KTNA 1ZJIA 4P61A 7TIMA 1PS9A 3NA8A 3CPRA 2JKEA 2LLEA 3EB2A 3O05A 1ZAIA 4XKYB 3KVJA 2OJPA 1EEPA 1MXSA 2C18A 2OCZA 5CGQA 4IMFA 3M5VA 4JDBA 4TIMA 3WJZA 2YXGA 4HSNA 2VEMA 3MP4A 2OX1A 3JS3A 5LNUA 1W54A 3OEXA 2H3DA 3M1ZA 2P0OA 2PCQA 1I2RA 1FWTA 1OX4A 2PC4A 3T44A 1GWJA 5LZLA 4LV4A 1TPEA 4UCGA 2H6RA 2H8ZA 1TTIA 3ATZA 3G3MA 4X9SA 1OYCA 2ISVA 1VHCA 3I7SA 4H3DA 2ISSA 3W2JA 5EL1A 2GUUA 5ABTA 5I3IA 2A5HA 3HBLA 3QMRA 4UMAA 4FIRA 4RLIA 3W88A 3IV3A 5AC7A 2E6DA 3G1HA 3PC0A 4LS1A 2QCHA 3GIYA 1OJXA 2VKZG 3GNNA 4BI7A 5FEWA 4GUJA 3QSTA 3HG4A 2J9ZA 3STCA 4ZQNA 5LSMA 1B3OA 1QAPA 3G0XA 4JTJA 2Z2UA 4JEQA 4FEZA 3GDRA 4IMDA 4Y6GA 5HWJA 3I7RA 2ZZ3A 3OA3A 1TTQA 3HB9A 2V81A 3EWWA 4QISA 2YFOA 1GJPA 3LGEA 1N55A 1LOLA 3L67A 3KRSA 5LGZA 3QQ1A 3FYPA 4KWWA 3TAOA 3VE7A 4BF9A 4CLMA 4N02A 1LZOA 1JUEA 2CFFA 2YGYA 3S5YA 3C4UA 4UTUA 2CLFA 4R7JA 1RQEA 5K2ZA 2NUWA 3BW4A 3S5OA 3GXTA 2EKCA 1KM1A 4B5NA 1X7FA 1VLWA 3C6CA 3TROA 2QUUA 3DENA 5FEXA 5KTLA 5U7SA 2QCFA 3S8HA 4LTSA 4M7TA 3LOTA 4UFKA 3T7VA 2Z6IA 3LDVA 3P60A 5FEZA 1P0KA 4JTEA 3RNDA 4HHPA 4W9TA 4MY8A 2J27A 4ZQRA 1IXNA 1DHPA 4JS3A 1K3UA 4K37A 1WX0A 3E96A 3BW3A 4O4WA 1ME9A 2ZDRA 3UY7A 4AHQA 2GJLA 2G95A 1EWEA 3WJYA 4O53A 1VJIA 2VFDA 3PWAA 1SR9A 2X16A 5G4WA 4X22A 3MHGA 4O16A 2PRLA 4XUGA 1KFKA 5EY5A 3KVKA 3NVTA 1DV7A 4NZFA 4FIQA 2DORA 1O95A 3TC6A 1K8XA 1YDNA 4JNMA 4RK8A 4RZ4A 1TYGA 5KITA 4QSHA 1VC4A 3W1PA 1B57A 4O1CA 2FPTA 5KSWA 3MBFA 4XWUA 3ABOA 1GZGA 3PUDA 3E0IA 3UWUA 4TR9A 5KZMA 5DY2A 1W31A 3BG5A 3O6CA 4GUIA 3ABRA 1KW1A 5F4SA 4AMAA 4K39A 3TX9A 3S0CA 3KFTA 2C15A 3M5YA 1YTEA 5KMYA 2C13A 3BVJA 3SECA 5EYWA 1EUNA 1ICQA 1BKSA 2CLHA 4MOZA 1ZAJA 2E77A 4JXCA 4GJ1A 3GYEA 4C1LA 1KFEA 2ZZ2A 4Z1DA 1W37A 2FB2A 3C2FA 2ZRZA 3HQ1A 2W79A 1ZHAA 1GVOA 1FWWA 2X1UA 1O4UA 3R5EA 3S9YA 3CWOX 2NWSA 3O16A 5G1TA 4O1BA 4JTLA 4GWEA 5HUPA 1I45A 1AW1A 3MYOA 2Q3RA 4Z1BA 1XXXA 3UY8A 2WPBA 1D3HA 5AC8A 3SI9A 3NDOA 1PE1A 3RF9A 1SSDA 3W72A 4K8EA 2YYTA 3IVTA 1HO4A 3B0PA 4O14A 1X1ZA 2ZRXA 5FF2A 3PSWA 5C5YA 3ELFA 4K7YA 4IUOA 4UR7A 4LVFA 3NM3A 2QCEA 2RHGA 4DF1A 4DQWA 3TU9A 1H1YA 2X30A 1KV8A 4O15A 4OV9A 4M6QA 2TPSA 2B0MA 4I9AA 4KFNA 4BK9A 3EX2A 4WZHA 3KXQA 3GDKA 3VCRA 4BWLA 1FCBA 4MVAA 4HN4A 1DKWA 3L0GA 1IXQA 1PCWA 3P84A 1SZEA 2O7QA 2CLLA 2C6QA 4NX5A 4CCCA 3G1AA 3F4NA 1TPVA 3IRDA 4O19A 1LLZA 4BWLC 4IXHA 4FX6M 4HKPA 4NJIA 4UFHA 5G2WA 4LNYA 2DZTA 3S1XA 4BI5A 5AHEA 2GOUA 3LHTA 4JD4A 4N9CA 1ZCOA 2A4AA 5EBUA 2VELA 3EX1A 4PH6A 3STFA 1H5YA 1YPIA 2WSRA 2C1HA 1DORA 3W87A 3S1VA 4JIPA 3WJWA 1K7EA 3LRMA 3JRKA 5DCEA 1GOXA 5F2GA 3UZJA 3LLDA 1XL9A 1SQ7A 4WY0A 4NUWA 4EWND 4FF7A 3R8RA 8TIMA 1W0MA 2BTMA 2DP3A 3TW7A 4GBUA 3DFTA 5AYZA 4AF0A 3GR8A 4ZQPA 1QCWA 2R91A 3Q58A 4IXXA 3BLFA 4DO4A 2J24A 1A53A 2CLOA 4NNBA 4O18A 2FLIA 3WK1A 1FDZA 3LBCA 4N4QA 2NX1A 4TO8A 1JR1A 1KTBA 3P8IA 3HPSA 3W6YA 3MHUA 1YDVA 4E2BA 3HGJA 3TC7A 2V8ZA 4LV9A 1J4EA 4NXSA 2E6YA 3MBDA 4IQLA 3ZWTA 3HPZA 2B7QA 1K02A 4PEKA 4YXGA 1XM3A 3B03A 4DPPA 1H62A 2VEKA 2YW4A 3NNTA 4OV4A 1TJPA 1AG1O 3W2LA 1ALDA 2FB3A 5KINA 4QNWA 1V5XA 3VNDA 3IVUA 3CIXA 5AHLA 2RH9A 1EP1A 3NQ8A 1VQTA 4AWSA 4O0KA 3TV8A 4YCPA 1F6KA 1F7BA 4Q32A 3NYZA 3EXSA 2WSYA 1WAUA 3FLUA 3W85A 3PBUA 1Z44A 3P67A 2E5BA 3VFLA 6ALDA 3G0SA 2TMDA 3K30A 2H8XA 4UTLA 3BLIA 3N34A 3WK2A 4MY9A 1JRCA 2QKFA 2ALDA 3W7GA 3LCHA 3W70A 1PHWA 1K8YA 4M7SA 3RU6A 5G2IA 1TV5A 1MEIA 1N7KA 1Z42A 2CLIA 4AXKA 1SZFA 3HIJA 1DVJA 3TK7A 2C19A 3T40A 3P61A 3HG3A 3OVQA 3TQVA 1XC4A 2TRSA 2HMCA 5U4NA 4O8RA 4MFDA 3EXTA 4PTNA 4Z1AA 3IVSA 3QM3A 1G4SA 3W84A 3AJXA 3W2NA 3NQEA 3EWXA 3IGUA 2FPYA 2WNNA 4IMEA 4DBDA 1W3IA 4XQ6A 2E5DA 5AHIA 1IGSA 4CNPA 1SFJA 1S5WA 2VFEA 2ZZ4A 3LCLA 4U4MA 4GUFA 1NSJA 1YXYA 2VOMA 3OBKA 3FS2A 4AHOA 3W2KA 4AEOA 2FQIA 3TDFA 3M43A 1SW0A 5CPNA 3LHVA 3LRLA 4O1AA 2ZTJA 1KFBA 1YXDA 3O6DA 1WDWA 3TSMA 4QITA 3KAOA 3S1WA 3A9IA 1HL2A 5D2YA 1IF2A 1Q6OA 1KM5A 3L2IA 1B4EA 4LRSA 2CZEA 3M5ZA 2WNQA 4FNSA 2PURA 1BTMA 3NL6A 1QMLA 3CWNA 3MW7A 3FA5A 1MEWA 1VCVA 2ZZ1A 1FBAA 4RZ6A 4JYFA 2YW3A 1FCUA 3SGUA 5HUOA 3FFSA 3NQ6A 1OX4B 4FNPA 1VYRA 3IGSA 3PM6A 4QJ1A 1TB3A 1VPXA 3LCGA 3GDMA 3M16A 1FXQA 3P5ZA 1G6CA 4LW7A 4DF2A 2WOQA 3T55A 4EF8A 5BNKA 4TMBA 3A23A 4X3ZA 3B8DA 5D03A 1KM0A 1SPQA 4HPXA 3L9CA 1W5PA 1QPOA 5DXYA 3TJXA 2A21A 3QPZA 1MEHA 1WA3A 2C16A 3G1YA 1FWRA 4IOTA 3MP5A 4MIMA 3CM4A 5D2TA 1NF0A 1W5QA 5D2XA 4LS0A 1UCWA 1QPNA 1Z48A 5FF0A 4NT0A 4LU0A 5K7JA 1VYSX 3PSVA 4UTIA 2ZQ0A 1EP3A 4Q4KA 3Q2DA 2BLEA 3W7CA 4FXSA 1UUMA 2X1TA 1SW3A 2AGKA 1F76A 4LY8A 5HR6A 4MZ8A 4POCA 2JKAA 3UNDA 1LROA 3P80A 1RQBA 1F6PA 2PRMA 1OFPA 1ZENA 2XN1A 1EPXA 3ANYA 3PBWA 4M19A 1GTEA 1TRIA 3MYPA 3TIMA 4JTGA 1Y0EA 1LRNA 3C0JA 2NV2A 5D05A 3DI1A 3NG3A 3LLFA 3C3NA 3PULA 4DXVA 5D2VA 5AHFA 1LBFA 3GR7A 4JICA 1Q6QA 1O5KA 4HPJA 1TPC1 1GQNA 3DFOA 2R94A 1EWDA 2HSAA 4O57A 3G1DA 2QJIA 1KM2A 1GG1A 3UYCA 1KM4A 3NZRA 3W7QA 1OX5A 3W7PA 3UPBA 2CZFA 5C54A 4RR4A 1XCFA 4OU1A 1OYBA 4OE7A 3DKJA 3LBMA 4FNRA 1K8ZA 2OT1A 5I3FA 2DZWA 5DCBA 1A5AA 4LUIA 2W6RA 5AB3A 3B0VC 4R34A 3UWYA 4KKXA 3W76A 1VHNA 3W7OA 5LHFA 1H7NA 3FYOA 1DL3A 1IIGA 4JYEA 3LCWA 1S5TA 3QH2A 5AOUA 3TSBA 2BZNA 3MUXA 3A24A 1E51A 3W7NA 5FESA 1RPXA 1H60A 2V0TA 3M7WA 1YLVA 4NX0A 5CZJA 2NUXA 1TRDA 3USBA 1OVDA 2I14A 4Y8FA 4WOZA 2NX9A 3M6YA 4NNCA 3GLCA 2Y62A 4QAIA 2B7NA 4IGHA 3W22A 4N9DA 1EA0A 1VYPX 4HIBA 1O60A 2DZPA 1FDJA 4JGDA 1I2QA 4IPJA 1RVGA 3QYQA 2UV8G 3P8JA 3R12A 1NAL1 4H4IA 2Q8ZA 4N2YA 3KRUA 1LCOA 2WKJA 4NJHA 3ABSA 2J9XA 5DN1A 1FWNA 2QCMA 1DOSA 2CLKA 3JR2A 1XBZA 4E2DA 4FNQA 1BWKA 2P1FA 3QJAA 3S5NA 3PUOA 2YSWA 1LDCA 4LVGA 2Q8LA 3W7JA 1S3HA 1AK5A 1A50A 1DQXA 2F7FA 3OVPA 5J5RA 4DPQA 4H6KA 2D73A 3SR7A 3TQ0A 2ABAA 1CI1A 2O7SA 3WK0A 4UC5A 1TPB1 3EWYA 1V7YA 5SWUA 1J5TA 1R30A 2Y61A 3TMQA 1F74A 2QCNA 4WOQA 1HO1A 4AHPA 5AC6A 1PCKA 2E6FA 3GVGA 1PVNA 3QEZA 4O52A 4UR8A 3LXCA 3E02A 1G7UA 5LKYA 3LXBA 3ABQA 2PRHA 1TV7A 1M6JA 3RK8A 2FTPA 1SSGA 5K4XA 3A5FA 1LOSA 3LTPA 5C55A 3MP3A 2YR1A 3W1RA 4O1DA 4R33A 4OWGA 1THFD 1KBIA 4DBEA 1H63A 1NFBA 5CZSA 3CEUA 5F1UA 3FIGA 3HMJG 1LORA 3W1NA 1QOQA 1SO6A 4UFMA 4ZL1A 2NXGA 1JCJA 1OF8A 1YADA 3EX6A 1BWLA 2Z6JA 4I7UA 3WFAA 3TA6A 1P1XA 1ICPA 1TTPA 5LGXA 1MZHA 3EX3A 4WY0B 3MHFA 3N9SA 2P10A 5CKSA 1CW2A 3W1UA 4JY8A 5AN7A 1TPUA 4RKAA 2Y7DA 4I7WA 1K03A 4GFSA 1UJPA 3O8AA 4AF0B 4JYDA 1W56A 3NQ2A 3PR2A 4JTIA 2ABBA
chains in the Genus database with same CATH superfamily
5C2CA 3PY2A 2OYLA 4GRSA 9XIAA 4NVTA 3O06A 2Y6ZA 3P7YA 2GFTA 2DJLA 2XFFA 2QHAA 2ATSA 3QMSA 3PJWA 3U48A 4AZCA 3WLNA 5D09A 4GOAA 2FH6A 4IG2B 3RDKA 1I60A 1JXJA 3WH5A 2XHYA 2H3BA 5FAGA 2NQ5A 4J3SA 5IDZA 2WMGA 4ADSA 4DWSA 1ZBWA 3K4WA 1K7FA 3NFUA 1PL9A 4NAFB 3N2XA 5IM51 3M0YA 1PZ1A 1F61A 1FX6A 1KBJA 4M3PA 2NSOA 5JQ9A 4Z0JA 1TIMA 1KFWA 4R27A 3UZWA 2BY3A 1P6BA 2DJXA 2BHUA 3S1UA 1TQJA 4YNGA 7XIMA 4AUBA 5BYWA 3B9DA 1OC6A 1W1PA 3OQ8A 3RN6A 1VH7A 1R9XA 2OO6A 1AL7A 5DT5A 1WOAA 2QUVA 5K4ZA 1XJBA 1I0DA 3TR2A 3PS7A 1R47A 3ANUA 1SZNA 3TOPA 5DBTA 3GG7A 2DSUA 4HNNA 5T91A 2X1RA 3UP8A 1W5MA 5E6ZA 4H1ZA 4GUGA 2HS6A 1Z9AA 2E0PA 5FJTA 3LRKA 3H21A 4UR9A 2WLZA 3FGCB 4ZO9A 3GU1A 2Y85A 4D6FA 2DVXA 3DAQA 2V30A 5FIPA 3LPOA 1VIWA 2OOFA 1WXJA 3URAA 3KBWA 4RZ5A 3TE9A 1TELA 4QQ3A 5A8PA 1RV8A 4AVNA 4OOUA 1SW7A 1V6VA 3N2MA 4CCEA 3AHZA 5HMEA 1KLZA 4K6AA 3F4VA 3AXIA 2C79A 5HA7A 2GVLA 3F1QA 4W85A 3MKCA 2PBOA 1OG6A 3TYEA 1F3TA 4BZYA 1QO5A 1WCGA 1YNYA 3H2MA 5D9MA 4Z17A 1Q6RA 1C29A 5I3JA 3CASA 2ZBTA 2Q71A 4PTXA 4WX2A 3KOXA 4QS6A 1MUCA 5F2LA 1LWIA 4A22A 2R8WA 4DWSD 3CEPA 5D2WA 1KFCA 2YCLB 3UPWA 4LYRA 1FKWA 4W8LA 2DU2A 2QEZA 4S3GA 1A80A 2ZXBA 1Z8AA 1L8NA 3NAVA 4RXGA 3IK2A 3QBUA 5G4EA 2QUTA 8XIAA 3F2DA 4H83A 4LEFA 4K1GA 1OCNA 1E6SM 3E2QA 4IX0A 2VYOA 2CW6A 4JQ4A 3WLIA 1TWZA 1T7LA 1DWHM 2J77A 3NQFA 2ONEA 1F6YA 4UFIA 4FLOA 3N3TA 4F0LA 1EH9A 1XH1A 3LCFA 3R8GA 4GQRA 2G50A 1LBMA 1MQRA 3WUGA 5CSRA 3MMTA 1PHQA 1MRAA 3GH4A 4JIIX 4IX2A 3LX9A 1US3A 1R86A 1EGZA 3SCVA 3AYRA 4CU6A 4HNLA 3BAJA 3WBXA 3GO2A 3NQCA 3CUFA 1OINA 3LTYA 1LL4A 1A3WA 4IIBA 3LV5A 4DUWA 3ZJ8A 2J88A 1BXBA 1ZJAA 4BCEA 3C56A 1SO3A 4ZQOA 2TODA 4DNMA 2MNRA 2DZAA 2C91A 3O1NA 1JYXA 2C1IA 1AJ2A 3TYUA 2ZXQA 2WAGA 5KZEA 4LF1A 2VP8A 2E1DA 3IJ9A 3VGGA 3GW0A 3ZMRA 4PBGA 4AW7A 1PPIA 1V0NA 4XVDA 3AO0A 1UZDA 3TWAA 1UB3A 3MZNA 2D20A 3ITTA 2FZMA 2Y63A 2YCKX 2QMJA 1KQZA 3RMJA 3S3GA 1UKSA 2DZSA 3S9ZA 4JFUA 4U5KA 3CWHA 5AZ1A 4RW3A 3B0YA 4KWUA 1DYSA 3M0IA 3LQLA 4MB5A 5H91A 1HG3A 3SCRA 4JTAA 2F6KA 1K77A 1AW5A 3CV1A 4KFPA 4KCTA 3B05A 6TAAA 3HFTA 4HZMA 3VNMA 2P50A 3THUA 3UXAA 4OOZA 3MI2A 4NIRA 2DUAA 3B4UA 4Y90A 3RCMA 2QAPA 1ZQ5A 1Q63A 1CGXA 4TMCA 4ZTXA 3DZ1A 1X6UA 1M01A 4NI3A 2IXUA 3CQKA 1DBTA 1XCXA 4P7OA 1OADA 1UP2A 5EU9A 3OBEA 1YMYA 4XZIA 1ONXA 4JTQA 3LBOA 3TCEA 4IPNB 3QMTA 3RCYA 1ADOA 4A2SA 1TCDA 2DIEA 3WH6A 1R87A 1ZLPA 3R7MA 4PTVA 2F2HA 3XINA 2XVPA 3COTA 3BL3A 1JPIA 5D32A 1E9ZB 3XIMA 4UTTC 1LL7A 1W3TA 2GYIA 3KBJA 3VZYA 5E0CA 4HT3A 1I8JA 5BU9A 3VXGA 1IXOA 3M0JA 5J5DA 2QR6A 5BWAA 3KCOA 2EAWA 1XYAA 5F2MA 3T0AA 3RJYA 1GGOA 1JD7A 3SIMA 4AXNA 1JPDX 3LHWA 2EPLX 2BODX 2XISA 1Q45A 4HOXA 3F03K 3WJSA 3CQJA 1CYGA 3Q94A 2DFAA 1B3YA 5I2UA 4HTBA 5KZ6A 2GLKA 2WM0A 5C6MA 2BHZA 1QPRA 5HATA 4ICNA 2XIQA 4JX6A 1RK6A 1P0EA 1J2BA 4TVDA 1QFEA 4Y9NA 3LI1A 2BDQA 6TIMA 2Y88A 2QLYA 4P2VA 2OPJA 3NZQA 3GIPA 5KEZA 2F8QA 3L5MA 3MO7A 3TFCA 3V5CA 5DXXA 1ZY9A 5EMKA 4HNVA 1AL8A 1PWLA 1Y5XA 4A3YA 1Q7MA 2DDXA 1H7XA 1UH3A 3BV7A 3NWRA 4WSJA 1W9VA 1NVMA 1OFAA 1V6YA 2W4XA 3KTSA 4JKMA 2YFNA 4ROPA 4GI9A 1VZWA 1E4LA 4L9XA 2ASHA 3VGBA 2V3DA 2PWFA 3TYAA 3I6RA 3B97A 2QAFA 4IPPA 2YLAA 1UMYA 4UQDA 5H2ZA 4PUJA 3DESA 3BC9A 3TSDA 3BUVA 1TSIA 1A4MA 4X2PA 1BG9A 4PMXA 3BO9A 3DFQA 1KWKA 3THDA 3KX6A 3AHYA 2CZVA 3PZNA 2CBJA 5JMUA 3T0CA 3RLUA 4KWOA 4YYFA 4Z2JA 4G7FA 3IGHX 2E09A 3KRZA 4IWWA 3L7RA 4EF9A 3M64A 3UXIA 4C6EA 3HGRA 2J66A 4LAZA 3CXOA 1KV5A 2Y7GA 3WFLA 4H8UA 1KA9F 3N9RA 1Y8BA 1GVQA 4RZBA 4ZOAA 1OT1A 3O6YX 3HF3A 2C0HA 2VFHA 1ZTVA 4H2CA 3VOHA 4NAEB 4ZTYA 1OABA 4Q4OA 1FWBC 3NURA 2PDKA 3AOFA 3W86A 3LNPA 2QDEA 5FJPA 2INFA 3W7MA 1JCXA 3S5ZA 3QW3A 4MKNA 1JIBA 4ZXOA 3VABA 2Y7EA 3URQA 5I3HA 4D6GA 5D38A 5BMWA 1EPVA 3POHA 4M5PA 1QDSA 1EYEA 1T8XA 1JGIA 3JW7A 2VXNA 2G4FA 2QIWA 1EUAA 3NO5A 3NQGA 3OGRA 1R3SA 1V08A 1VFTA 5E5CA 1GVRA 3KLKA 2X1IA 3C0QA 4RV8A 3A12A 3WK3A 4EAMA 3WNMA 3R79A 3BCJA 2RGLA 4ONVA 3BJSA 2YX0A 3K8KA 3C2VA 4U10A 1CX9A 4U33A 1OC5A 2QCDB 4UUIA 3K1DA 4XBSA 2Z27A 1ZNNA 1T41A 5KZDA 1ZALA 3QR0A 1DPMA 1R2TA 4H41A 2Q09A 3KTXA 3M47A 4BR1A 2V82A 3NQAA 3W82A 4CQDA 1TWWA 3EA1A 1NFGA 1XKYA 4HB7A 5E93A 3DEQA 1Q6EA 1M04A 4BFAA 2WZHA 5A2CA 2P53A 3NOEA 3VIJA 4Q4RA 4XAGA 2HBXA 4AD2A 5IHRA 2AKMA 4JTKA 3GX9A 3W3OA 2EPNA 2PWGA 4C60A 1E0VA 2CBIA 3W1TA 4DJEC 1GYLA 3KWSA 3PNUA 1ME7A 2OXNA 4P5UA 4YTUA 2GVGA 1XIGA 3FJ6A 3TOYA 1FWSA 1B3WA 5L6UA 3W27A 3WLLA 1M41A 3E3HA 3W9ZA 2WMIA 3P81A 2Q3OA 1K4GA 3TFXA 2OMAA 1EXBA 3U2OA 3TZNA 2IUZA 4HZ8A 1WXZA 4JKKA 3ZZ1A 2QVHA 4F79A 5CZKA 3ARTA 3NGJA 3V4BA 3V1PA 2JQXA 1OFDA 2VMFA 4IF2A 5A6JA 4FNUA 1WZMA 2E5CA 4IFOA 2IKGA 3LZ5A 4UFJA 3CTTA 3WQGA 1AD1A 3N4AA 3QFEA 3GU2A 4JTCA 3WNPA 3FXGA 7TAAA 4EPKA 1XI3A 2B7PA 2ZZ5A 5CG7A 1GZJA 3FW6A 5CLWA 3M4HA 2J7CA 5EKYA 3QSRA 4JAWA 3UR8A 4HQVA 2A7PA 1XBYA 4OBTA 2RDUA 2YBVA 3C2EA 1XGEA 4IISA 5A2BA 1KO0A 3BURA 3KLLA 4MYXA 1TO3A 3WL1A 3HU7A 2A85A 1GUVA 1TWSA 2W62A 1OD8A 5K9CA 3RAOA 1DQWA 3GXIA 2Y5SA 4BQ5A 3E0LA 4LSBA 4RE2A 4N9BA 2WHMA 4F0KA 4B4HA 5FKYA 2PD5A 4JNYA 2QCLA 5EPDA 1AODA 1M03A 1BGAA 1W5NA 5BW6A 5C2XA 4D71A 2DZBA 1ITUA 2GPTA 1PIGA 1L9WA 3OO2A 3BH4A 1JRBA 3TR9A 4A3RA 3HJZA 1AMKA 3H55A 4EACA 4TX9A 2WZMA 2ZDSA 2X0YA 2Z29A 1O94A 3LHYA 1JF6A 3H23A 5FF4A 4WSKA 1XIBA 2OTDA 1V6WA 3U7VA 3U4FA 5BXSA 3QV8A 3NDZA 3G8EA 3UYIA 3QR1A 4JTFA 2OWCA 5A6MA 4BI6A 3V75A 1O5RA 1SGJA 4I6KA 8CGTA 3APTA 3QLDA 1C9DA 4O4VA 3EMZA 2RFGA 5A8QA 3TXZA 4DF0A 6ENLA 4HMEA 1G7VA 4QE4A 1H1NA 1PDZA 2G3MA 3CPRA 5M5DA 1CB2A 2JKEA 4ZODA 5AZ0A 2WSPA 3O05A 3WQ5A 1I9CB 4XKYB 4C65A 3WD3A 4HSNA 2ZVRA 1PAMA 1W54A 2H3DA 4LBSA 1P6CA 1I2RA 2PC4A 4PMVA 1ECQA 4UCGA 1TPEA 3GW3A 2H8ZA 1TTIA 4REQB 3LM3A 3AYSA 3VDGA 1PYFA 4QJ5B 5C8BB 4G56A 5EL1A 5ABTA 3HQNA 2UZ9A 3QPEA 4RLIA 3LYEA 3G1HA 3GC2A 3HJEA 1CTNA 2EG7A 4LS1A 2QCHA 4AIOA 1RBAA 3NGFA 4FI4A 4UCFA 3FSUA 5RUBA 2XFYA 3G0XA 2DQXA 1VEPA 4M8UA 3NO3A 5AVHA 1C9WA 3OZPA 4IMDA 4Y6GA 2F9RA 3OA3A 4L9YA 4HMDA 2V81A 4L4OA 4QISA 1LOLA 4Q8NA 3VIGA 3S6OA 1QUMA 3T6CA 2UBPC 4KWWA 3TAOA 3VE7A 4CLMA 4KRTA 5DF0A 1LZOA 2YA2A 3DUGA 1YHTA 3VIOA 4D6HA 2VX6A 4D72A 4GXPA 1XLGA 1FH8A 2NUWA 2J13A 3S5OA 2DY3A 1UQZA 2PDMA 4MKVA 2HVNA 1KM1A 4XSLA 4DAFA 5A8NA 3DENA 5FEXA 4UNIA 1XD1A 1GVYA 4B15A 3VZZA 3SCQA 4OECA 1OC7A 3U5YA 3PK7A 3F4CA 1POJA 1IXNA 3MSGA 3UR2A 3R94A 3BW3A 4XD3A 2ZDRA 3BMWA 3CAQA 3DOPA 1XLEA 1SR9A 3PBGA 2PFHA 4X22A 3VNIA 5EY5A 4LH8A 3KVKA 4NZFA 1CECA 4RK8A 4ICMA 4RZ4A 4F40A 1PWMA 1D8WA 5GNXA 1GHSA 2HCVA 1XINA 3HV9A 1R7OA 1LQ2A 1VC4A 4O1CA 1G0CA 2P76A 3V7PA 1MXGA 1GZGA 4IHCA 2FFIA 4AU0A 1IT8A 3PUDA 1VJSA 5DY2A 1W31A 4EE9A 3O6CA 3TN4A 5F4SA 4AMAA 3TX9A 3MVIA 2C15A 2C13A 1ICQA 3M0LA 2R9RA 4MOZA 1ZAJA 2E77A 3M07A 2VUNA 2FB2A 3C2FA 3W0KA 3NZGA 3AAMA 3N6JA 2QJMA 1GVOA 1O4UA 1Z32X 3R5EA 2GK1A 2NWSA 4W5ZA 4GWEA 4HYRA 1I45A 1RLDA 3BOFA 1XXXA 4CN4A 5I23A 5BWFA 1H49A 4LAOA 2WPBA 1RJRA 3E74A 4DLMA 2P88A 1QATA 1QHOA 5BOFA 3B0PA 4DLFA 3CZ8A 7CGTA 2CKRA 4HK6A 3E5BA 4LVFA 5G4HC 4O15A 2B0MA 2EKGA 4WZHA 2PLKA 3DC0A 4RNJA 4BWLA 1FCBA 1OCJA 3ZLHA 1DKWA 3D5HA 3L0GA 3WF0A 1IZJA 3TJ4A 2O7QA 4KPLA 4CCCA 1E1CB 2G3JA 3KE0A 2WHJA 3F4NA 3N25A 3UCQA 5G2WA 1MFVA 5AHEA 3B0XA 3SRKA 4PBEA 3V16A 3L4YA 2FZ9A 2WSRA 5H8MA 2XVGA 1POKA 4MB4A 3WJWA 1VPYA 4FR1A 3VMPA 5F2GA 3LLDA 4H19A 1B9ZA 4XD6A 1LT7A 4FF7A 3F2CA 1ISWA 3KRBA 8TIMA 2E9BA 2QV5A 3DFTA 1LG2A 5AYZA 4O1EA 1W2PA 4C91A 3GR8A 1QCWA 2R91A 3QV6A 3T42A 4WCJA 3WLPA 4IXXA 4DJDC 2FLIA 3ITYA 4I5UA 1H11A 4KIEA 2NX1A 3ITGA 3W28A 4FMVA 3BSHA 3LEPA 3KOZA 3GYCA 3KM8A 3TC7A 1XICA 2V8ZA 3UVIA 4LV9A 4NXSA 3KBNA 4EK7A 4W87A 3BMXA 3UJSA 1EQPA 1H62A 3OVGA 3ICJA 1XWYA 3PWGA 2D3NA 1AG1O 2VEFA 5KINA 3VU2A 1TJ0A 1FWFC 1EP1A 3WF3A 4HU3A 3TV8A 4YCPA 2WSYA 2WK2A 2HQAA 3TYBA 5C9WA 3VMOA 2Z1KA 1Z44A 3T2QA 2FMOA 4B92A 1LL6A 3G0SA 4UTLA 3N34A 3WK2A 3UF9A 2QKFA 1NELA 2ALDA 3W7GA 4JIEA 3MSYA 1GVIA 4GVIA 4NILA 5CCZA 3PZOA 1DTUA 1MEIA 1JPKA 1UKOA 1WO2A 2J6VA 4PUNA 2EJAA 3PJXA 4AXKA 1SZFA 3WMSA 2PZ0A 3WELA 1DVJA 4KIRA 3PFMA 3DFHA 4HHLA 3AC0A 2YDSA 2UY2A 1G4SA 4GBDA 4BQ2A 3W2NA 3NQEA 2FPYA 1XYZA 1RSCA 1RALA 3H70A 3FSTA 1IGSA 4R9OA 4RDZA 3LCLA 1TX2A 1NQ6A 4J5NA 1R38A 3FS2A 3GE7A 5CPNA 3LRLA 3RUBL 1E1EA 2ZTJA 1HKWA 3O6DA 2GGGA 3KAOA 2WC4A 4A3HA 1HL2A 4MNMA 3N6HA 1IF2A 1W2VA 5BU6A 3KUMA 2ZKMX 1PSCA 4FNSA 1BTMA 2QZRA 1QMLA 4DWDA 4DZHA 2ZZ1A 4D6EA 4JYFA 2XH4A 4ATWA 1U1HA 3NQ6A 1OX4B 3PZIA 1VYRA 3PM6A 3ZT6A 1TB3A 1VPXA 3LCGA 1UOKA 3ARUA 3GDMA 4JZ5A 3M16A 4HGXA 1FXQA 3P5ZA 2Z25A 2WHKA 4EWJA 2Z2BA 1O66A 4DF2A 4EF8A 5BNKA 3AHVA 3RO8A 4TMBA 3A23A 3MT1A 3OBAA 3B8DA 5D03A 1AUSL 2PTZA 1E0XA 1MWOA 1W5PA 3AIVA 5DXYA 3TJXA 3QPZA 1W1B1 3GUWA 4DB7A 3WLTA 2VX4A 1LF1A 4TTGA 4Z42C 3TTQA 1NF0A 1W5QA 4LS0A 3WF2A 1Z48A 3SUWA 2AQOA 5K7JA 1TA3B 2ZQ0A 3HZ3A 4Q4KA 4EX4A 1PTDA 1BF2A 3QOMA 3W7CA 2AMGA 4UQCA 2VOTA 4WVXA 3SB0A 3C86A 1HL8A 4MZ8A 4POCA 3Q4DA 1LROA 4HNOA 3KBVA 1RQBA 3T81A 1OFPA 4J1OA 1FFQA 3UZZA 3MYPA 2J47A 1LRNA 5D05A 2VDGA 3CQIA 3WBYA 3PULA 5JU6A 1V3LA 5D2VA 5AHFA 5HK4A 1PKMA 4R9XA 2ZUMA 4ACZA 1RP9A 1E6NA 1V6UA 2I57A 4MDPA 3G1DA 3EB4A 1KM2A 3UXKA 3QR3A 2QJJA 1KM4A 3VDHA 1TWIA 1OX5A 4ZFCA 2CZFA 1TUXA 2VJXA 5C71A 3VGEA 4FAMA 1WKEA 1K8ZA 5I3FA 4Y9PA 2DZWA 1A5AA 4Z2LA 2W6RA 4F0RA 4JTRA 3B0VC 1CWYA 4L4PA 3W7OA 4P8XA 4ZFMA 3LCWA 3VIKA 3FV9A 4NHVA 4XAYA 1LLOA 3H2EA 5HJYA 2PUZA 4GIYA 3MUXA 1TZ9A 1H60A 1C8YA 3ARXA 3P0WA 1YLVA 3U7BA 2INZA 1TRDA 3USBA 1BQGA 1OVDA 4Y8FA 4WOZA 6XIAA 3R58A 5IHSA 4KEMA 2Y62A 1VYPX 3P0XA 2EG6A 3KTCA 1FHUA 1I2QA 4IPJA 4ATLA 3QYQA 3CZJA 3QYSA 2Q8ZA 3GHUA 2JF6A 2PDFA 4QG6A 1LCOA 4PFHA 4WDTA 1BHGA 4AMCA 5A8OA 2J9XA 3GY1A 1FWNA 2QCMA 5HQLA 3K4AA 1BLIA 2VO5A 2BXZA 1PO9A 3ZIZA 4CU8A 1N8WA 1G01A 4Z1YA 1LDCA 3WQ6A 4MPKA 1DQXA 3BAXA 2CPUA 4C6BA 5J5RA 4DPQA 3L2MA 1TE1A 3SR7A 2E1WA 2BY0A 4PMDA 1CI1A 3EWYA 3L4ZA 4C6JA 1J5TA 3FCPA 2Y61A 2CBUA 4IQDA 9CGTA 2QCNA 4GYJA 2E6FA 1Y65A 3QEZA 3QGAC 1EFZA 1C8QA 4NF7A 4H8NA 1GOOA 2E67A 4HA1A 3T1GA 3VD5A 1UWRA 4AEFA 2PBGA 2DGAA 5K4XA 4QLJA 1LOSA 3T0BA 2Y1HA 5IXEA 5IFTA 4OWGA 5EMJA 1KBIA 5IFPA 4DBEA 1UWTA 4OBRA 1H63A 2BNJA 3CEUA 3RLGA 3DDMA 4O8AA 4DWSB 1SO6A 4I8DA 3LENA 1JCJA 1VJZA 3EX6A 2Z6JA 1W9DM 1LJYA 3WQVA 2HNEA 2E9LA 1ICPA 2R24A 1HGYA 3BAIA 2BVTA 3W37A 3E2SA 3DN5A 4FSAA 2P10A 4Y7EA 4M82A 1WE5A 4GFSA 1QI2A 4OJYA 3J7HA 4AF0B 4AIBA 4XUYA 3MY9A 3BTNA 1W56A 3KP0A 3NQ2A 1ZUAX 3NDYA 5HUPA 3MI3A 4KWSA 4CEXC 2XIMA 4EOUA 1GQIA 3EOUA 4Y9AA 4LCRA 5I09A 3WLKX 3SUSA 4IMGA 2QDHA 2PF8A 4CD5A 1E5NA 2Z1SA 3I4KA 1F07A 3PZUA 4CNUA 2QW5A 2I16A 4B16A 4GPNA 2KZHA 3UCDA 3KZPA 3OB8A 4UTWA 2W3ZA 3TWBA 4I90A 3DG7A 3IJQA 4NJKA 1CIUA 1JJKA 2FVLA 3QXBA 3K46A 4YIWA 1WNOA 3ME3A 1EJVC 5CBBA 4FS9A 1X1NA 3T08A 2XFWA 2CZDA 2O0TA 1E6PA 3EZ4A 1EJUC 4J27A 2ISWA 4DWSC 4K68A 4UZUA 1SUXA 2XGZA 4AWEA 4A2RA 3P82A 2CYGA 2J62A 2OG9A 1LM1A 3E38A 4NAEA 4P7RA 5BXPA 1JPMA 1QNOA 3IJLA 1G94A 3OYZA 4S2BA 3B04A 3GB6A 1DJQA 3TN3A 2XSBA 3KHDA 4QJ3B 3UU0A 2WBKA 2QULA 5M3WA 4RE4A 5BOEA 2X42A 2OKTA 1OK6A 2OZ0A 4F9JA 5C9RA 3EPMA 3GSMA 4QS5A 5C70A 2E8ZA 2V5BA 1BGGA 2FGZA 4ZOCA 1RCQA 3GS6A 1LWHA 5HQMA 2FKPA 2VCCA 4IZGA 4F3HA 4NG3A 1UASA 3V5OA 4E8DA 1E15A 1G4TA 2XIBA 1ZCCA 4YCOA 2YBUA 2ZRWA 1OWQA 3LGDA 1DWAM 4JN6A 2DIKA 4GKTA 2PI6A 3AI0A 4A8IA 1JQXA 1A5SA 4BJHA 3IUHA 1C8VA 2C7FA 2V5LA 1UD5A 1YYAA 3PPHA 2ZCGA 3V0TA 3N3MA 4G1KA 3G6LA 1EOKA 1US2A 1RY8A 3ZR6A 3GC4A 3H54A 5J04A 4YHEA 1DE6A 2H9AB 5H1WA 1EO5A 3VKJA 2CXGA 4CEUC 2YDRA 4GC3A 2YL5A 4D8ZA 3JVAA 4JIRA 4DHGA 4L1WA 4WK9A 4LWWA 2POTA 2PLMA 1R3QA 1HL9A 4XK2A 3EOSA 3ECQA 3P74A 4O13A 4AFYA 3LHUA 4GK8A 1DIOA 1PIIA 1PX3A 1FH9A 3MJMA 2GUBA 1EJRC 4D9PA 4MZ1A 4WJEA 1EA9C 4LRTA 3R1ZA 4RDVA 4Z0SA 3PTDA 4J35A 4WJ8A 4Z2IA 1IT0A 4DO6A 2WNWA 2D0GA 2J78A 1NP2A 4QR6A 4B2DA 1NOUA 2Z0IA 1KNWA 5CBJA 3WX7A 2NV1A 4KGLA 4IICA 1PZ3A 5DY3A 1W91A 1XYCA 1SO5A 3E2RA 4PCTA 3VC5A 1VFHA 2TSYA 4NNAA 3WEZA 1OY0A 3BZJA 4QEEA 3R6IA 1U1JA 4H00A 3NPWA 4AAJA 4N42A 3I7QA 2YA1A 3P3BA 1XYMA 2B4GA 1LYXA 1N2VA 1QK2A 1E9IA 3U57A 3G2GA 4IGMA 3D3AA 2XGIA 5A94A 5EA9A 3NQ7A 3AIRA 1B5TA 1QU4A 4BF7A 4JR5A 2ZX9A 4CD7A 4UIOA 1RVKA 2OSXA 1O5XA 1NDYA 2GZXA 4B3KA 1XPGA 1GT8A 2ISFA 3DYMA 2E28A 4WF7A 4S3BA 1D3GA 5AY7A 2NW0A 3VKCA 1R3TA 1RCXB 4HCHA 1EP2A 4AWUA 1OK4A 4CQ8A 1DIEA 3NL3A 3PF3A 3IIVA 1OEPA 4B9YA 1HFBA 4HA3A 1H7PA 3AWOA 1OM0A 1QW9A 3UA4A 4Z2KA 4DYEA 2XZ7A 3AZRA 3HFYA 4MADA 5HJLA 5H8UA 2BGNE 3QC3A 5BRBA 3TLQA 1XLKA 1XIEA 4WHBA 1OG0A 3W1QA 4WXZA 1GKPA 4W84A 3YPIA 4RL3A 2BXVA 2EHHA 3H24A 5AKQA 1TJ1A 3LD5A 4AD4A 4B5VA 4DAIA 3EPNA 1VD6A 2PWVA 5CAHA 3FXYA 4B2DD 4LJ3A 2Y89A 3TW6A 2WMHA 1LUCB 2PPGA 3I4EA 2GSHA 3AROA 3PZTA 3O07A 1V0MA 1UR1A 2QDGA 2XH2A 3F4WA 3RM9A 1MRQA 1KFLA 4L4LA 4CNOA 2FH8A 3CAWA 1TPFA 3AZSA 3W7IA 3LTSA 3M41A 4LAKA 1S2CA 2NLYA 4LOCA 3TVAA 4GVFA 1DJNA 2VD8A 3IPWA 1CGWA 2VC7A 2YKKA 1XP3A 3UG4A 3EDKA 2BG5A 3VNKA 4DX3A 3FN9A 3B8VA 4H8HA 1JDFA 1ESWA 4KS0A 4CNSA 3PZQA 1VF8A 4Q8VA 1R3YA 5HWNA 1RBLA 4OT7A 2VTFA 3B8TA 3U0HA 1C3FA 1XG4A 4XKYA 3LB0A 2DUZA 3P14A 4E0CA 1F73A 1J0HA 3FEMA 1FP9A 3DC8A 3TQKA 4E3TA 1QJWA 4AB4A 1C7SA 3W24A 3M46A 1OZMA 3W83A 3CO8A 4WY0F 1NH6A 2RJGA 1XDJA 3FVDA 4O12A 3EA2A 3NQBA 4J9JA 2ZADA 2WJZA 1WBHA 5H6HA 2EGZA 2FYMA 4RXFA 4AX6A 3IAQA 2ESCA 3G1XA 1BTCA 3N4EA 6CGTA 4RW5A 5A69A 1GW9A 4M24A 3HG2A 2PE4A 3NEVA 3PNZA 2VFGA 1RA0A 3CYJA 4CNNA 5HJXA 1HGWA 2OYKA 2QF8A 4GH1A 4K38A 4PC8A 1ODZA 1UBPC 4QCFA 5LNRA 2ISDA 3NPVA 1EJWC 4S2CA 2VR4A 1UG6A 1HKIA 3FHAA 3H6OA 4RCXA 2Z1XA 4FXFA 2QVNA 3WLRA 4KGJA 2DSKA 3PG9A 3R0UA 1MO0A 2ZICA 1V8EA 2F84A 1SM9A 2NZLA 4UB9A 2Z7KA 1ZB5A 4GIEA 1WUFA 2ZX6A 1E56A 2Z28A 3E0FA 1VCFA 3M44A 4MWAA 3IV8A 5LXEA 1MNSA 1OGGA 1C90A 3VNYA 3SSJA 4NU7A 3VD4A 3HPFA 1Z41A 1EGVA 4D6CA 3BJTA 3BGGA 4QJ4B 2IS7A 3BLDA 3W1AA 4E2VA 4EAYA 3RM8A 3QOKA 4PGLA 3SQLA 1O12A 5TBOA 1M1BA 5DBUA 2GDUA 5K9XA 1MQQA 2HXUA 2XSAA 1PTAA 2ACUA 3ALGA 3WD0A 4C6QA 1JNDA 4NYUA 4FX7A 1ICSA 4MYAA 2BWGA 2VFFA 3BLEA 2W0UA 1KM3A 1U2YA 4D8LA 3WEOA 4JFSA 5A8GA 3K5XA 1TV8A 3R2GA 3HG5A 1A5UA 3NSXA 1J0JA 1O6IA 3WNLA 1H7OA 4KF1A 4FZIA 1CGUA 2ZRVA 4ES4A 3WDRA 4DO5A 3MVTA 3T8LA 1L6SA 2PP0A 5CQ1A 1Q3NA 1QR7A 1DWFM 3A4JA 4NSBA 3AXMA 3W6LA 4EXAA 1HT6A 3N1AA 3ARRA 1HJSA 1H51A 1OIMA 1HN1A 1PX4A 4JTHA 4URIA 5TQLA 3OG3A 1H4PA 2QJGA 3QPYA 5DCDA 5HDRA 1A0DA 2X0HA 2DV0A 1WDSA 3M9YA 6XIMA 4LC8A 1ZFJA 4M6VA 4H04A 1MSSA 2VFIA 1I4NA 3FOKA 1SO4A 4JL1A 1LTDA 1GG0A 1B0IA 2OYMA 1X7IA 3POCA 4C6CA 5JIWA 3TZFA 2IQDA 4WKHA 1MDLA 1ISZA 3L0NA 3IIXA 4MWAD 1P43A 4P7QA 5HWMA 2TYSA 2Q8XA 2CLEA 1OFRA 3KW3A 2OOGA 4JQ1A 1H0IA 3AALA 3LCIA 1JDCA 2OEMA 3ITVA 5K3VA 2GJXA 2VEIA 3LHZA 1C91A 1BXCA 3CTLA 4GYKA 3DU0A 1Q2RA 1A3XA 2YJQA 3P5YA 3GRIA 4YWIA 3FYYA 3REQA 2FPVA 5JVLA 1GJWA 3IACA 5F1VA 1NF7A 2G4JA 4PMRA 2D2GA 5MHBA 3VGDA 3CZKA 3GVVA 2IMRA 2I7GA 2HROA 1MFUA 2PTXA 4KETA 1YW1A 4FALA 3DFSA 4K8HA 2AQVA 2WVUA 4OTKA 4Q6XA 2DQWA 3TN6A 3W38A 5DLCA 4CU7A 1RLCL 1CLVA 4NZCA 1I2NA 3SJ3A 3MUIA 3VYLA 5D8WA 5DELA 3H4GA 5CC7A 1EL3A 3ZLFA 2WJEA 3NL5A 2FDSA 3O15A 1JUBA 3N15A 1U30A 3JZUA 4XAFA 1K6AA 1AW2A 4NJGA 3DHFA 1F8MA 4F9DA 4NZJA 1DTNA 3AFBA 3SFKA 2YPIA 4PUUA 4UQ9A 3MV11 2V5DA 4F0MA 3GAYA 4FNTA 5AYIA 2JK2A 3GVQA 5D33A 5I02A 4NL1A 1UPMB 5HMSA 4QLLA 4EPEC 3INPA 4MJ4A 4NJJA 3LSBA 2X7WA 2C3ZA 3WDPP 3B4YA 2YDQA 4MLRA 1XW8A 3OPSA 3AU2A 3D6NA 1IV8A 1A4LA 4R53A 3CC1A 5A6TC 3L68A 1JG9A 1X6LA 4LB3A 2IQTA 3AIQA 5A95A 2I9UA 4GCAA 2CU0A 3ZWSA 1FOBA 2BVWA 2X1SA 2EXOA 3IJDA 3T4WA 4ZA0A 4N4PA 1B9BA 3THAA 2F6XA 3S1GA 3CHDA 4WGXA 2DUXA 3R11A 3W73A 1UR4A 2FHCA 1EJ7L 2Z1WA 4JCLA 5TIMA 4X0NA 1R2RA 2GQAA 4QIUA 4FB7A 3ZFHA 1O7AA 1UZ4A 4HSHA 4NQ1A 2DIJA 2UY5A 4YVPA 1OQFA 1CEOA 8A3HA 1KCKA 4M29A 3RR4A 3OYXA 4PB3A 2ZX5A 4UMBA 1GKQA 3BXWA 2FZ8A 2WMKA 3B8IA 1N8FA 4PRTA 4PSRA 4ZSTA 4E8GA 4JBRA 1JEZA 4AD1A 1PV8A 4J3TA 3ZR4A 4PTDA 4B91A 3KDNA 1WKYA 3SURA 1PS9A 3MMUA 1IEWA 3WENA 3ERPA 3MCOA 3EB2A 3MMWA 1KC7A 1M3UA 3WQDA 2C18A 3B3DA 5C9ZA 1LG1A 5A8MA 3LQGA 2J4GA 4CN6A 1OT2A 4FA3A 4K8GA 1SJCA 4GINA 2P0OA 1OX4A 1RA5A 4LV4A 4ML4A 4DNHA 3ATZA 3G3MA 2PODA 1UD4A 4ATDA 1MXDA 1VHCA 1CLKA 3OIHA 1HZYA 1Y5WA 1Q65A 2WCSA 5I3IA 4UMAA 4FIRA 1JAKA 3IUDA 1PKLA 3II1A 3GIYA 1IGWA 3SGGA 4GUJA 4GZEA 1TZZA 3KS5A 3T05A 4R85A 4X61A 3NZPA 2J9ZA 4PEEA 1B31A 5A1AA 5LSMA 1B3OA 1XYFA 3PPCA 1TA3A 3CUGA 4GYFA 4JEQA 2J7EA 4FEZA 3GDRA 4UQEA 3I7RA 1KWGA 1X97A 4Z2GA 2QUNA 3HB9A 3R10A 2A3HA 3LGEA 3L67A 3PWIA 1HP5A 3TYDA 3QQ1A 1Q6FA 2OZ3A 4AY8A 4N02A 4UOZA 2I5QA 3SEPA 2CLFA 3ARQA 3TLLA 1RQEA 5K2ZA 1W3JA 5I77A 1TR1A 3GXTA 4R5EA 1X96A 3BLLA 1X7FA 1XS2A 4OFCA 4R88A 5KTLA 4M7TA 1AZ2A 3LOTA 4UFKA 3T7VA 2Z6IA 3P60A 4HMCA 5FEZA 5CXPA 3RNDA 3QTPA 2GK1B 2J27A 3RRXA 4ZQRA 1ZL1A 1J96A 1A5NC 1CENA 1GOIA 1AVAA 4JIHA 3AQUA 3MQTA 4WR3A 3U2EA 1Q6CA 1K3UA 1UWSA 3WQCA 4AHQA 4WKFA 2O9RA 2ZC1A 4EPBC 3IARA 1JI2A 3UG3A 2FMNA 3ITXA 2X16A 3E1F1 3MHGA 4O16A 3NVTA 3USZA 2G37A 5GQBA 3TC6A 4XX6A 1TYGA 4GNVA 5FD0A 3N17A 5KITA 3RM4A 1B57A 5KSWA 3VKBA 4HYWA 3C8NA 3HA1A 4ZR8A 4HD5A 4IL0A 3UG8A 3BG5A 4L9ZA 4D6DA 3ABRA 2Y24A 1QBBA 2F6UA 3KFTA 3M5YA 5KMYA 1HJVA 4AYGA 1M65A 4DJFA 5D9OA 1BXNA 4JXCA 3F7JA 4F66A 3GYEA 1KFEA 2ZZ2A 4Z1DA 2ZRZA 4P7LA 5GJMA 3WQPA 1WZLA 1SFSA 2X1UA 2VZUA 3S9YA 2VVNA 1CBGA 2YB4A 3O16A 4O1BA 4PZVA 4JTLA 3ZVIA 1NOFA 4JOMA 3PANA 2JF7A 3V35A 3MYOA 4Z1BA 3WH7A 2W91A 3L23A 2PDLA 5CGTA 3R43A 2EJ1A 1SSDA 4K8EA 1VPQA 3IVTA 1HO4A 1DP0A 4O14A 1H5VA 5JIPA 5FF2A 2XDFA 3ELFA 3N9KA 1AFSA 5LA0A 3S9IA 2PMQA 1EGMA 1WZAA 2X30A 2X8RA 1KV8A 1EDQA 4M6QA 5FAJA 3EX2A 1PZ0A 3KXQA 5DEZA 1FWEC 3GDKA 4LX4A 3VCRA 2PDQA 2HXTA 5H8PA 3N2OA 4L7ZA 1PJ9A 5CJMA 1LT8A 1HP4A 3CUZA 1IEIA 3U3HA 2PTYA 4BWLC 4TV5A 4NJIA 2F38A 5ECVA 2GOUA 2A4AA 5EBUA 3GNOA 3LNMA 3U2ZA 3GUGA 4ZO7A 2D3LA 3STFA 3MUZ1 1H5YA 4AISA 2YB1A 5D8ZA 1KBLA 4UQBA 3S1VA 4GISA 2RJHA 2WKGA 1H3GA 5DCEA 4NYYA 3NSNA 4M51A 5E09A 1W0MA 2DP3A 3GTIA 1E4IA 1BF6A 3UERA 3W53A 4AF0A 1SJDA 4ZQPA 3Q58A 3BLFA 1A53A 4GI6A 3RGTA 3WK1A 4DJFD 4TO8A 3HPSA 4OKDA 2Y2WA 3H2FA 4C5ZA 4AY7A 4E2BA 1VFLA 2BV9A 2ZUVA 3LN3A 2V63A 4GACA 3SM0A 3N4FA 4IQLA 1Q8JA 3SCWA 3OLIA 3VD7A 2PP3A 3M0VA 4YXGA 1XM3A 3B03A 2CERA 2VEKA 3JZEA 2YW4A 4OV4A 1TJPA 2PAJA 4H9UA 3RG6A 5XIMA 2FB3A 3B8SA 1V5XA 3CIXA 3CV2A 4DZIA 1I1WA 2RH9A 2V6AA 4AWSA 4O0KA 4CUCA 1F6KA 5HMFA 4C6LA 3CBWA 1KXVA 1JFXA 3LMZA 4F2BA 4ERIA 3QV9A 4MDOA 3P67A 3SCUA 2E5BA 3QV7A 3GTNA 4MM1A 2IPJA 1CT5A 2OQHA 1K1DA 3LK6A 3WMBA 1BRLA 1Z89A 3MCMA 3LCHA 1E5JA 2ON3A 1PHWA 1K8YA 2A3LA 2EPOA 1TCMA 3D3FA 1N7KA 5LYRA 2CLIA 4DXKA 2C19A 4ZE5A 3WQ8A 4PTWA 3T0TA 3TQVA 3BAWA 5U4NA 4O8RA 3VCNA 3EXTA 3N12A 3IVSA 3ZSTA 5I3DA 3E2VA 3EWXA 1HVQA 1X6NA 1JYVA 4HU0A 2WNNA 5E6YA 4AIEA 3IRSA 4XQ6A 1ISVA 3BCFA 1SFJA 1V6TA 5HPOA 4U4MA 2ZUNA 4GUFA 4C6KA 2VOMA 5JUVA 1UZ1A 3W2KA 2FQIA 4UWMA 2Y8VA 3NIYA 1B3ZA 2GSJA 3LHVA 3MUAA 4RDWA 1QXLA 1WDWA 3TSMA 3GC5A 3VIHA 3WUFA 3A9IA 1OD0A 4XSMA 5D2YA 2PGRA 5CEWA 1HXJA 3L2IA 2W9MA 2I56A 2BY2A 2PURA 3NL6A 4GMEA 4Q7BA 1VCVA 3CUXA 4JNZA 4GO9A 3I6EA 1FBAA 3ZYZA 4Q8QA 2H9AA 2E9MA 2YW3A 1HJXA 1TWDA 2NVAA 5HUOA 1JNEA 1V3KA 4DN1A 4QJ1A 1W1VA 3WMLA 2VRJA 3MC5A 3MS8A 3WQWA 1XLCA 2Q01A 4ACZB 1IZCA 1I0BA 5FJOA 1G6CA 1HNYA 4I8YA 3OGVA 3TYZA 2ZUSA 3T55A 2GWNA 3I3BA 4S3KA 5T9CE 1KM0A 1SPQA 1XLJA 3LG3A 1UR0A 1T40A 1QPOA 1R7AA 2A21A 4NASA 1MEHA 1WA3A 2C16A 3G1YA 1FWRA 4IOTA 3MP5A 4MF4A 1ZJBA 4MIMA 5D2TA 1WDRA 1RY0A 1B30A 5CGMA 4HTYA 1K70A 1QNQA 4NY2A 4L56A 4Y2WA 1VYSX 3PSVA 2GUYA 2XJ7A 1EP3A 1QW7A 1E4MM 3Q2DA 2IW0A 4FXSA 3KOYA 2E7FA 4H6RA 1HKVA 4XKMA 5DT7A 1P7TB 4S23A 4H9XA 1F6PA 1FHVA 1Q85A 2PRMA 1EC7A 5PTDA 4M19A 3TIMA 4QHRA 3BLOA 3LLFA 4DXVA 3B40A 1EO7A 4JICA 4XZLX 3WD2A 1ITXA 1Q6QA 3MCNA 3PP7A 4HPJA 4C1NA 3DFOA 2OEKA 3FDKA 3A6OA 4HK5A 3AXHA 4IT1A 1NP0A 2QJIA 1GG1A 2OEJA 3UYCA 5I00A 3FVMA 3ISIX 2XSXA 4JHZA 4RR4A 1OYBA 1TVPA 4FNRA 4CD8A 3WQOA 2PC8A 3EYPA 4LUIA 3QHMA 5AB3A 2EEXA 3GG0A 3DFYA 2VGIA 3UWYA 2VZSA 1VHNA 3WQ4A 2VR2A 2A3AA 1S5TA 3QH2A 4S3AA 2HE5A 1VBHA 1OGBA 2PWHA 2BASA 3U2CA 5BROA 3W7NA 3L12A 4AEEA 3FA4A 1RPXA 2V0TA 3M7WA 3ZLGA 1LQ0A 4NX0A 1V3JA 4ROQA 2I14A 5LIKX 5FACA 1O1ZA 4H9VA 1FFRA 4YYCA 4NNCA 5DANA 2VI0A 3GLCA 4IGHA 3ZVHA 1R0MA 2PA6A 3WQFA 4UOJA 2VVSA 4YWSA 3TC3A 3AS3A 4UZSA 1O60A 5FCZA 4H9ZA 4JGDA 4ACYA 1NAL1 4H4IA 4E4FA 4N2YA 5A2AA 3TJIA 3KRUA 1H2JA 2WKJA 2XM1A 3G6MA 2AMXA 5DN1A 1NU5A 1XBZA 4E2DA 1KRCC 3O7UA 3WH9A 1LUCA 1E73M 3H22A 3S5NA 2ZWYA 3PUOA 3QN3A 1BD0A 2YSWA 4LVGA 4PCPA 3W7JA 4H6KA 3PJTA 3ZT5A 4QBXA 1WDDA 1G9HA 3TQ0A 2ABAA 4DRSA 2O7SA 4HHMA 3WK0A 1TPB1 1V7YA 3UEQA 1F74A 1EDGA 3O3RA 4DUOA 1CXKA 1E71M 1PCKA 4ZCWA 3BMVA 3F4DA 1PVNA 1UR3M 2DSVA 1XD0A 3E02A 1G7UA 1WXYA 4J3ZA 1JF5A 5LKYA 1XLBA 1TX0A 3ABQA 4AYSA 1HW6A 2ZUWA 1R9ZA 1SSGA 2WXDM 2YIHA 3EOOA 1QW8A 3SJNA 1E70M 1THFD 4XIMA 1REQB 1QI0A 5F1UA 3FIGA 4ZL1A 1UKTA 4I7UA 1GCYA 1IZKA 1DJGA 2QMKA 2X41A 1UOZA 3N2TA 4W8BA 1MZHA 1UR9A 1HKJA 3ES8A 3MHFA 3N9SA 5CKSA 1XQLA 2YL9A 1EZWA 2L5HA 4RNIA 3NTYA 5HXMA 1GW1A 1S5VA 1GKRA 2NQZA 4PRWA 1O1HA 1UHVA 4GJJA 4QNEA 3PZVA 2OELA 3AMGA 3PAOA 2QPUA 1Q6LA 3IIOA 3NQDA 3CQHA 3OVRA 3PPFA 1JGMA 1RCOB 3C0LA 4ZQMA 1LWJA 3FKRA 3OLEA 4GY0A 5C9UA 1KD0A 1H50A 2Z24A 1HKKA 1HUVA 4O17A 4XBKA 2IPWA 4W88A 2E25A 2OB3A 2RDWA 4XB3A 4JHMA 3FJLA 4UTWC 3A47A 3IGXA 4C7GA 3KEHA 3GBEA 2CXEA 2WCGA 3K1GA 1OX6A 2JE8A 3C2RA 4K3ZA 5EFDA 1IEVA 1TJ2A 4JKLA 4D8AA 1DIKA 2V2HA 1GORA 3M0MA 1R2SA 4XBJA 1QT1A 3V1HA 1SU5A 2OWWA 2VGGA 1M68A 1Z3NA 5CSSA 1XRFA 3VNJA 3W7RA 3V5FA 4S1FA 2QNEA 3VIMA 4JQ3A 4UNKA 1CGVA 4N7QA 5F4WA 3A3HA 3DFPA 4G8TA 4ASTA 4HPHA 4J2PA 3S6TA 4YN5A 1KGXA 5FEPA 3B9AA 2CBVA 1V0LA 1I2PA 2FTYA 1DHKA 4O54A 1GYMA 1J0YA 2D1ZA 3WDQA 4S3JA 4S3EA 4XO6A 4JX5A 1QPQA 1TPH1 4RE0A 4RX0A 3VD3A 1J8VA 2ZA3A 7REQB 1L2UA 3SBFA 3UA3A 1OFQA 1S5NA 2QDDA 2YBTA 3EOLA 3UWWA 3OTRA 3IJ6A 1E9YB 5B7ZA 4L80A 5E9AA 3URNA 3TMLA 3CH9A 3SAZA 1UP0A 3T0DA 2HWGA 4RUBA 2G0WA 4AD5A 2BX7A 1AH3A 4YLWA 4V27A 3GZ3A 2JBMA 4F0HA 2WC3A 1QI5A 3MWCA 4O28A 2J6XA 4WQ6A 5T26A 4UXDA 2FDMA 1QNPA 2NX3A 4B5UA 2VL4A 4PBFA 1ME8A 3NQMA 4LXFA 4RDYA 3H2OA 4L5ZA 3HOJA 4MB1A 1IE7C 4UTJA 1VFFA 2A0NA 4JFWA 1RXOB 3SCSA 4CCDA 3OHMB 3AS2A 5BOOA 1GZ1A 5D30A 1HKMA 1TQXA 1WKDA 4ML9A 3AISA 2V5JA 1ITCA 1KM6A 1TV4A 4DJDD 3T78A 3TN5A 4G5DA 5HBFA 1FHDA 4FPSA 2DW6A 2X05A 1H7WA 3PVFA 1F05A 2Q6ZA 4PL1A 2ZUUA 4ECLA 2DZVA 4AWTA 4BHYA 1VFMA 3VOJA 4LYPA 1UH4A 1RR2A 2GL5A 4W86A 2VRKA 4FF5A 1EXPA 2PEVA 1WYIA 4RNHA 1DJXA 4PMUA 3S42A 3AIUA 4C7FA 7PTDA 4GNKB 3LPFA 1YPXA 4QCEA 1AQHA 1XLMA 5IBXA 1E43A 2HISA 1TV3A 1FCQA 3GXFA 4A8NA 4A4AA 2PGEA 3E5PA 3VOCA 5TF0A 3A3WA 1JZ7A 4JQAA 5LA2A 4EKJA 2OQLA 4M80A 4F48A 5I6SA 5DMLA 1S2TA 1FWJC 1FWAC 4I5XA 4E2OA 3DGRA 1Z6KA 3Q45A 1XBVA 2H90A 4IQEA 4OGZA 3DBPA 3DKLA 4KERA 4QAWA 2QGHA 4Q8PA 3VNZA 1Q7QA 1DXEA 4KEVA 1C92A 3HQPA 4U31A 3KP1A 2YCEA 1CXHA 4LFYA 4GIAA 1MW2A 3TH6A 1F2JA 4S38A 1QRQA 3PZMA 3P93A 2D22A 1IWBA 1RD6A 1GPWA 4YTQA 3ZR5A 3RRAA 4U2YA 2V2DA 3BGAA 2AOSA 3EEGA 3EKZA 3SY5A 2NVCA 1V3MA 1JD9A 2R1LA 3MDUA 4WXYA 2HNHA 2RDTA 4C6FA 3SIZA 1YRRA 5MKGA 2RKXA 1Q2SA 1NM9A 3WUBA 3UZXA 1SFLA 4LS2A 2A6NA 3STGA 4ORMA 3PTQA 4HNCA 4GXWA 3BG3A 4PR4A 3WLQA 3H4XA 3RU8X 4OUEA 1LQAA 2ZWZA 4ZQCA 2G97A 3PB0A 3G5EA 3L0KA 3MV01 4KBXA 1M7PA 1OF6A 3QZEA 2HZGA 2CITA 4DI8A 4L1XA 2WO5A 4ORIA 2VZOA 3SZ8A 3MSDA 1K7XA 4MNJA 3WG6A 3W2MA 2QCCA 5CZTA 1S46A 2V2CA 2PGWA 3NVDA 4JTSA 4TOQA 3D0CA 1K9TA 1KGUA 2XIOA 4JHOA 2VC9A 3A21A 1U5HA 1XIDA 4XVEA 1IIHA 1KRAC 1E6XM 1XRTA 1ZP3A 3GH7A 3W2UA 1QWGA 1W5OA 3IK4A 2VZTA 1XFBA 3O0KA 5G1YA 3OLDA 2EPHA 3NXFA 3UXDA 4ERAA 3TUUA 4LEQA 3T2OA 1F5ZA 1Y5VA 4ZXLA 5T9BG 2VWSA 4QEHA 2WJFA 3GNXA 4R7WA 2WYSA 4IGSA 3SUVA 2WV8A 3N73A 1E4NA 3QRHA 4MWAB 1NDVA 1YE4A 3HMCA 3CHFA 3A3XA 3I3EA 4FP1A 3W7HA 1V02A 1Q66A 4LBRA 1Z69A 4XZWA 1KXQA 1UBSA 3K8MA 4TU1A 1OGSA 3RIKA 4WLCA 2WVSA 2ZZ7A 3HURA 1XGZA 2J7HA 5CPOA 4GE8A 3BPWA 3NPXA 5M17A 2R1NA 1XSKA 4C6PA 4HP5A 4PMOA 3WDIA 1QHZA 4DZAA 1RBOB 1T99A 3AMCA 3C2YA 2GVEA 3B0UX 1TR9A 1ZZMA 2GJNA 4GJIA 2BB0A 4Q8TA 3DECA 1MI3A 4LYKA 2W63A 3UGVA 1BVWA 3UWEA 3ARWA 1EX5A 2V38A 4J3WA 4V2XA 5D02A 2VGFA 1XSIA 1L2QA 3G22A 4UTHA 3GD6A 3SDOA 4XAZA 1KBBA 4ZZ9A 4JQ2A 1BPLB 4YPJA 2X7VA 4MZYA 2D0FA 3K8LA 1GVFA 3G1FA 1S1RA 3WBAA 2WANA 1XDMA 4JY9A 3S6DA 4DELA 4LVDA 2DZXA 3H53A 3EPOA 4JIQA 1HJQA 3MPGA 1U83A 2GOKA 1L6FA 2CLMA 3CLMA 4LVAA 1D7FA 1X1OA 3GKFA 2GJPA 4IIEA 1FH7A 2R1PA 4MWAC 3WDHA 1AJ0A 3QKEA 2EQDA 1C7TA 1A5LC 5EB8A 5I78A 3MWAA 2C14A 4Q33A 4OZOA 4P8UA 2IPGA 1XYLA 4IFRA 1NDZA 4MJZA 2UWFA 2ZVIA 5GNZA 1XR2A 1B3VA 2DZUA 1YTDA 2V68A 1SJAA 3QTGA 4X2RA 3B9NA 1WOBA 2ACSA 4K36A 3GQYA 4LB4A 1VS1A 4HVXA 3LI0A 4D2JA 4PRRA 5TNVA 1P48A 5C7HA 4TUFA 3SFWA 3DHDA 4QGCA 4YMZA 3W1LA 5F2IA 3OG2A 1QI3A 1A5CA 4GZ7A 2GJXB 3I3DA 1FA2A 1ZPTA 3WNKA 5FL1A 5AHNA 2WVTA 3BCDA 3O63A 1QNSA 3WEMA 5JBFA 3REQB 1W8GA 2XPKA 3LERA 3BE7A 1GQJA 3EWBX 4TQTA 3M5XA 3WLHA 5CG0A 4H6QA 2FZNA 3GHTA 5FF3A 3NYDA 3CT7A 5CBIA 4RPQA 2B7OA 2A7NA 3H26A 3G0UA 4HSOA 1G69A 2A1YA 4IP5A 1MW1A 3L4TA 1UQYA 3WL0A 3RPTA 2W67A 2G5WA 2OT0A 1KXHA 1K6WA 4AVOA 4I9TA 4OQVA 3T9PA 3NEHA 1VFUA 4FO4A 3CB3A 3T07A 1NQKA 1V93A 4Y9OA 3R0DA 3MI6A 1ONRA 3EKLA 1GEQA 3WZ0E 1JCMP 3PBMA 4D6IA 4P8VA 2G96A 2NSXA 3W74A 1OFBA 2I17A 4GCXA 4IPIA 3W07A 3OOQA 1ZAHA 2OFJA 1E40A 3U6WA 3CU2A 3WCZA 4A3QA 1UMLA 1CXIA 2JGYA 3NR0A 3CPUA 3G1SA 4U28A 3SW6A 4PODA 1YDOA 3EEZA 5FJJA 3L5AA 1FCVA 3RLVA 2NQHA 1S39A 4I7VA 4N6EA 1XBXA 1VAHA 4IGNA 1SZRA 4P8WA 4AG0A 4MJ2A 3WJXA 3BGJA 1OFEA 3SY8A 4KESA 3EWUA 4BEQA 2DVTA 4IMCA 3ZSSA 3GXPA 2A3EA 2E6AA 2IKHA 1FWHC 4KFOA 5AYXA 2V9DA 4PCFA 1G67A 1GVSA 5D04C 1CB7B 3VI2A 2PCEA 2V5KA 4HYVA 4ZMGA 1W32A 4HA4A 2ZA2A 3QHNA 1WBJA 5G2HA 3GNDA 1XG3A 3KL3A 1YE6A 1A49A 2A6LA 1NWTA 4PUWA 2GQ3A 4TXEA 4WUIA 4ZBCA 3THQA 4CNTA 4MJMA 1YTKA 1FWCC 1KBKA 4HJWA 4PB5A 1V7AA 3STEA 2R1KA 3FA3A 2NV9A 1W1A1 3CJPA 3SCTA 1CGTA 3VK5A 3CHEA 4Y8EA 3VOFA 1VP5A 4A3UA 1V02E 3GTXA 3E0VA 4TVCA 4I3GA 3WNNA 3EXRA 3B06A 4FHAA 4GGBA 1SZGA 6A3HA 7ODCA 3S2JA 1M5WA 2XWDA 4EP8C 1CXLA 2W92A 1NFPA 3ID7A 2GGEA 5LA1A 1W1YA 2AQWA 5L9FA 4X0VA 4L6HA 1XUZA 1LRTA 4JCMA 4LVBA 2WNZA 4IIFA 3OZOA 3Q37A 1A5BA 1K9DA 1FWGC 2ZA1A 3RPDA 2VCBA 4HJFA 2QJHA 4FLRA 1TG7A 1YDYA 3ZOAA 3NPUA 4O0QA 4GYPA 3DXIA 3E9AA 5B80A 4ADTA 1FY6A 4ZOEA 4LUYA 3UJ2A 4C6OA 2Y8KA 5IDIA 1B2YA 3OHIA 2PDUA 2XFRA 3L65A 4QRNA 3EMCA 4EIVA 3H12A 4W93A 3EWDA 3C0SA 3S2NA 1V4YA 2VT0A 4BQ3A 1NWRA 1XSJA 3M0ZA 4GLEA 1W3NA 3W7DA 1VBGA 5CPLA 4E5TA 5LIYX 3L4WA 1ML1A 4RJEA 3W1XA 4RE3A 1LLWA 5G1MA 2HBVA 4F0SA 2O56A 3CQ0A 3HO8A 1YBQB 4LC6A 4HU4A 4ADUA 3QF0A 1X98A 4NRRA 1XLHA 1L0PA 3G18A 2W27A 2P8CA 1G4PA 3STPA 2W5FA 4W5UA 1TTJA 2AL2B 5TAOA 4O0ZA 1E1FA 2Y5JA 3SSZA 2QIIA 1DJHA 1F3EA 2C0AA 4K2SA 3WBWA 2NQJA 1ZJIA 5GJNA 2LLEA 4NZ4A 4KEUA 3UPMA 3KVJA 2OJPA 1EEPA 1MXSA 4ZGYA 3WD4A 2OCZA 5CGQA 4IMFA 3IUIA 2ZE3A 2FGBA 4TIMA 3GVWA