3QC3A

Crystal structure of a d-ribulose-5-phosphate-3-epimerase (np_954699) from homo sapiens at 2.20 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
225
structure length
225
Chain Sequence
GMASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ribulose-5-phosphate-3-epimerase
publication title Crystal structure of a D-ribulose-5-phosphate-3-epimerase (NP_954699) from HOMO SAPIENS at 2.20 A resolution
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 60
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qc3A00
3BVJA 1X1ZA 4O12A 2UV8G 3SIZA 1ZJIA 2NX3A 2GUUA 1VRDA 1IXNA 3QPZA 2BZNA 4FEZA 1DJQA 2RDUA 3NQFA 3W84A 3WJXA 4EOUA 1L2UA 3SR7A 5CZJA 3TFCA 4QQ3A 3TQ0A 4E38A 1M7PA 5BRBA 4BFAA 3UPBA 1EEPA 2HSAA 2GJNA 1TPUA 4N4PA 4UTIA 2HTMA 4FB7A 5AC7A 1F7BA 1ZFJA 2OMAA 4DF2A 2ZZ5A 4LC8A 2GQ9A 2FLIA 4N9CA 3FLUA 2J9ZA 1FCUA 3S6DA 3DFOA 2YXGA 1ME7A 2DZSA 1WBHA 5AHMA 2YSWA 2CLMA 4AXKA 4O10A 1KW1A 5KMYA 4ZQRA 1OYCA 4JTHA 3E0IA 3LTSA 4NU7A 3W86A 5KZDA 4TO8A 3SW6A 3G1VA 4ZZ9A 3MI3A 4O1BA 1XDMA 3SGUA 4UR8A 1AL8A 2A5HA 3TE9A 3G0XA 2HMCA 2R94A 3S5YA 3TSBA 1OFDA 8TIMA 4NJJA 3MBDA 5DCBA 5D04C 3W07A 4K8HA 4KFPA 4RZ4A 3BG3A 3PC0A 3S1WA 4ZMGA 4MOZA 2ZRVA 3I7QA 3GIYA 1V7YA 1UJPA 5DXYA 3PR2A 1WOBA 2G96A 2NWRA 3TC7A 3RLVA 3P67A 3TH6A 1Q6OA 1KTBA 2A2IA 3TKFA 3NR0A 1JCMP 4OBTA 3W9ZA 1SW3A 3W7RA 1ALDA 1A5CA 4HSOA 2X16A 1GEQA 3DI0A 3CIXA 3PG9A 1X6UA 2VKZG 3RK8A 2QJHA 2E5DA 3R89A 2E68A 1L9WA 3LGEA 1P1XA 4JTUA 1HFBA 2I9EA 5D2YA 1GTHA 1W5NA 5LNSA 3B8DA 3TK7A 4IOTA 2YYUA 4HNTA 1JCXA 1I45A 2B7NA 3DKLA 1XDLA 1KFKA 2X1SA 2VFDA 3PF3A 3TUUA 4N4QA 3ZR4A 1EP3A 2TYSA 4FNQA 3F4WA 3CM4A 4MY1A 3A22A 2CZFA 3G24A 5DLCA 3NGJA 3G8EA 5HINA 5I3FA 1F5ZA 1KBJA 4JR5A 3S5OA 5HWJA 1H60A 4LUJA 2QCDA 1DHPA 2GVLA 2ZRZA 4NNCA 1TIMA 5FEPA 1KM0A 5IBXA 3HG5A 5D33A 2VEPA 5E93A 3QW3A 3DBPA 1A5SA 3EXSA 3JS3A 3W1UA 3W71A 3EXTA 2EHHA 1IXPA 2Y63A 5AHEA 3QSRA 4A21A 4A29A 5H2ZA 1G7VA 1MSSA 2OZ0A 4MFDA 2PRLA 1XFBA 3FS2A 1H7OA 3O6CA 3QMTA 1LRTA 4FNSA 4K36A 4O13A 4RZ5A 4UTUA 3AJXA 4N9DA 4OQVA 3U2OA 1WA3A 1JRBA 1YXYA 3F03K 3W7KA 4NJGA 1JCYA 2JBMA 1O4UA 4OV9A 2RFGA 3LCFA 1O94A 2FPVA 1VHCA 2PRMA 4ICNA 1KFCA 3M5VA 1OFEA 2E5CA 5I3KA 3O06A 1ML1A 4J9JA 3A5FA 1UCWA 4Y6GA 2VXNA 3VE9A 1I2QA 5I3HA 1SSDA 3LM7A 5EYWA 5F4SA 3MMTA 3W76A 3W7GA 2G97A 4HNVA 4GUGA 3TX9A 1ME8A 1NF0A 3W2MA 2GQAA 1KM1A 3C3NA 1IF2A 2B7PA 3QW4B 4OT7A 2QCGA 1FWSA 5HJLA 3NZRA 5CPNA 1M5WA 3W85A 4WQ6A 4DF1A 1HG3A 3TW7A 5HMSA 3NPUA 1TPEA 1J2WA 1DQXA 1ZNNA 4JYFA 3LRMA 1PV8A 5CPMA 3DH7A 3RFAA 3EX2A 1N55A 3LHYA 3LXBA 4QIUA 5C5YA 1ZAJA 3W2NA 5J5DA 3ANYA 3P5YA 1TCDA 3NPWA 4FIQA 4LS0A 3ABSA 2ZZ2A 3FEMA 2GJLA 3H54A 5A8GA 5K3VA 4MLRA 3GX9A 1DV7A 1GYLA 1FDZA 4UNKA 4WJEA 4MYAA 1BEUA 2GQ8A 2ZDRA 5FI8A 4EF8A 3W1MA 4O57A 3GXTA 3HPSA 3ABQA 3TQKA 1J5TA 4JXCA 1B4KA 4WOZA 2A0NA 1KTNA 1VCGA 4TIMA 1XXXA 2Z6JA 3BGJA 4LC6A 3W1PA 4AHOA 2DZUA 2XN2A 4O53A 1VHNA 4MJMA 1S5WA 1WV2A 3PWAA 4IUOA 3D0CA 5AYZA 3MHFA 3GKFA 4O19A 4FXSA 1KFEA 3P62A 1IIGA 5KZEA 3LHZA 2ZA1A 2DZXA 2J9XA 2E1DA 2C3ZA 3TC6A 3C4UA 4NT0A 2VFGA 3PAJA 5SWUA 1WYIA 5LGXA 4BI5A 3LDVA 4L4MA 3YPIA 2YCEA 5HR7A 3HO8A 4FX6M 3PVFA 1EUNA 1SW0A 3G8RA 1H63A 3P81A 3VCRA 1UBSA 3B06A 4P61A 1DBTA 4EF9A 2F84A 1GG1A 4EWND 2ZYFA 4H3DA 3LCGA 3DZ1A 3SSJA 2QEZA 3PUOA 3UWUA 4CCEA 3HPZA 3M44A 4OGZA 3G1SA 1A5BA 2E77A 2C18A 2YZRA 2GVJA 3C2RA 4JICA 2C6QA 2V0TA 3LXCA 2ISWA 5G1TA 2NUXA 2NX1A 3P8IA 3HG4A 5K4XA 2V5BA 4PTNA 3PBUA 3G0SA 3W2JA 3NQ2A 4O15A 3ZWTA 3KRSA 1Q6LA 3GR8A 4NXKA 3DFPA 5K9DA 2Y7DA 4WXZA 3W7EA 4UFJA 2ZBTA 3GKAA 1DJNA 4IGHA 4WX2A 4WZHA 3BW3A 3N9RA 2ZTJA 2O7SA 3RMJA 3CHVA 4Q4KA 1SO5A 4IJBA 1IGSA 4TMCA 5CPOA 3NQMA 1S5VA 3SGZA 3KVJA 1O60A 2QCEA 3QF0A 3NPVA 2NUWA 3HIJA 1H7NA 1PHWA 2DZTA 3KRZA 3GVGA 2FQIA 5AHLA 5D37A 4JD4A 4RXFA 3VE7A 1DORA 1ONRA 4GC4A 4GNJA 4RR4A 1K8ZA 3L5LA 2NXHA 2VFIA 1EA0A 4MJZA 2XFWA 4WY0A 4IXXA 3GNNA 4Z1BA 1H1ZA 3QPYA 5L6UA 5TQLA 5HR6A 4Q32A 1QDSA 1G4EA 2WSRA 4JTGA 2YFNA 4RXGA 2H8ZA 3CEPA 3O16A 4BK9A 3WJZA 1W37A 2HS8A 1XBXA 3I6RA 4H4IA 4WXYA 1FWWA 4LWWA 1YPFA 1Q45A 1YDOA 3N9SA 3TDFA 4WD0A 3TU9A 1M6JA 3GXNA 1R2TA 5CZSA 3LHUA 3GDMA 3KRUA 3DKJA 3HGRA 2Y7FA 4JTIA 5FEXA 3C2OA 4LU0A 3S9YA 2YX0A 4P2VA 2WOQA 1FY6A 3TA6A 1OF8A 5HWNA 5KZMA 1BWKA 2PRHA 3TMLA 1K7EA 4O11A 4O4WA 2G95A 2XN1A 5ABTA 1W8SA 2ISSA 3W2UA 2NUYA 3DAQA 3KAOA 5HUOA 3L66A 4AEOA 1YADA 2O7QA 2NXIA 5G4EA 1DOSA 3MHGA 2PE4A 1LDCA 5F2LA 4DF0A 4YWIA 3STCA 5LGZA 3NM1A 2QCNA 5KITA 1FUYA 2VEIA 5BMXA 1EX5A 3LOTA 3SI9A 1TB3A 1T0OA 3KVMA 3I65A 5DELA 2QDHA 5IM51 3W22A 4UUIA 3B03A 4GUJA 3W7PA 2RDTA 1MO0A 2BWGA 2TRSA 3QC3A 3PUDA 2H3DA 3O63A 4YL2A 5MHBA 5EPDA 1Q6QA 5FEWA 4NJKA 4UR7A 1LOQA 3NQDA 3QEZA 2CLLA 3W7IA 1XKYA 2OX1A 3LX9A 1KTCA 4I9AA 1F74A 1FCVA 3NDOA 1ICQA 3TNOA 3IIPA 3LI1A 3KFTA 2VFFA 4CQ9A 2Y88A 4XZ9A 4WY0F 1JUKA 3I7RA 2YDAA 4MY9A 2EGZA 3NPXA 5G4WA 1HO1A 1K8YA 1R2RA 3UWQA 1JR1A 4X3ZA 2YPIA 4A22A 4AWTA 4K7VA 4S1FA 3G3DA 2VFEA 2BTMA 3W74A 1VH7A 3SJ3A 1OG0A 3NQ8A 3M43A 3UPWA 4AF0A 4X22A 1TTPA 5LNRA 5D32A 2Y89A 2X2GA 4GJ1A 4Z1AA 1LLWA 1G4SA 3NQ7A 4AHQA 4R7JA 1G69A 2Q3OA 2C1HA 4UTTC 4YCOA 4H6KA 3FKRA 4O1CA 3TJXA 2GOUA 3C2FA 2FB3A 2R14A 3AO0A 3P80A 3PY2A 2WNQA 1JCJA 1FQ0A 1P4CA 3E9AA 3W88A 3GLCA 3NL3A 2Y7GA 3OEXA 4LNYA 3LCIA 4MLJA 5L9FA 5F4WA 3FOKA 3THAA 4N6EA 3HF3A 3EWWA 3MP4A 1KM2A 1O5XA 1D9EA 3UWZA 1JVNA 1GQNA 1KM4A 2DJXA 3DI1A 4Z08A 1VLIA 1LBLA 3S42A 1XM3A 4L4LA 1TPFA 1F76A 3R12A 5AC8A 3B0UX 3W7LA 1Z41A 2V5LA 3E49A 3BLFA 1DKWA 2P10A 4GE8A 3NNTA 4IPIA 4CNOA 2CFFA 5DXXA 3PUEA 5DBUA 5BMWA 3W1LA 5CSRA 1XCFA 3PS7A 2ZCGA 3TV8A 4OE7A 3T40A 3ZFHA 1BWLA 5K7JA 1J4EA 3M5XA 2BLEA 3BARA 3L67A 2QCMA 1NSJA 1M7OA 3BLEA 2PCQA 4NUWA 5D09A 5CG7A 1SFLA 5DCDA 3W1QA 5HQEA 1ZALA 5CKSA 3G1HA 3N2XA 5D05A 3TR2A 2FPTA 4UTMA 4X2RA 3W6YA 2F7FA 3S0CA 2V8ZA 1JQXA 3VKJA 5LNWA 3NQ6A 3LTPA 3BV4A 4NZFA 3LV5A 1TPVA 3KHJA 1VQTA 4O0KA 2OJPA 5DN1A 1VZWA 4ZQPA 3STFA 4Y8FA 4RX0A 1UB3A 3QZEA 2QCCA 4UTTA 5U7SA 2B4GA 3L21A 4S2CA 2DJLA 2J27A 3B04A 1KFJA 1SW7A 2H3BA 5G2HA 1PL9A 1U83A 5LNUA 1QPNA 4DBDA 5C55A 3TW6A 3EKLA 4XTDA 1RR2A 2WO5A 2ZA2A 4JNMA 3IIVA 3OA3A 1KLZA 1G4TA 1WAUA 2A7NA 1PIIA 4OWGA 1KLYA 2R8WA 3IIZA 4JTKA 4IXHA 4QSHA 3UY8A 3TSMA 2NV2A 4IWWA 1AW2A 3UZJA 3FJ6A 5CGQA 2X1TA 3L65A 3VFLA 5FESA 4I7UA 3G1YA 5EL1A 2RH9A 4OHQA 3L2IA 3R2GA 4CLMA 1TPWA 1UASA 1W5PA 3G0UA 6TIMA 1W5MA 3GNDA 3IVUA 2FIQA 3NO5A 2PURA 2ZZ6A 4JY8A 4DPPA 1PS9A 1NAL1 3C2EA 3NQAA 3MI2A 4KWWA 3WJYA 4KKXA 1LM1A 3TROA 4LY8A 1H50A 5D2WA 1C9DA 1JJKA 1LLZA 4X9SA 1AW5A 5AYYA 2DZPA 4NZJA 4IPJA 2CLHA 4M7SA 3W83A 3B05A 1H62A 3EB2A 2QUUA 1OFOA 1EWDA 4NXSA 2DP3A 2H8XA 3BPWA 2IQTA 1MEWA 3TIMA 3BLIA 4RZ6A 3GAKA 3LCWA 3K30A 5F4XA 4ZVJA 1SO4A 1TTJA 3CB8A 4IMFA 4MVAA 3ELFA 4NJHA 1FWRA 1OK4A 3MO7A 2J6XA 3IGSA 3WFAA 1W31A 5AN7A 1VR6A 4A2SA 3A24A 1TQXA 1OJXA 2EF9A 3DXIA 3QJAA 3A9IA 1CI1A 3W7MA 2BX7A 4S2BA 1ZCOA 3M7WA 4ZQCA 4I7WA 2W0UA 1JCLA 1WX0A 4A3UA 4DQWA 3CTLA 1PCWA 1W3TA 2ABAA 3VNDA 3CWNA 3C61A 4LVFA 1LYXA 3R8RA 1RD5A 5AHIA 3LV6A 1TMHA 2QJIA 5HNRA 4DXVA 3M47A 4YXGA 2C0AA 7TIMA 4O1AA 4UTJA 1N7KA 3TFXA 3ABOA 4FHAA 3W7QA 1QO2A 3NL6A 5AC6A 1RZMA 3GAYA 2EKCA 1SUXA 3L68A 3GK0A 4AVFA 4LV4A 1HL2A 4XQ6A 3KVLA 4QITA 1SO6A 3TAKA 2H90A 2Y61A 2E5BA 2RKXA 1X8FA 1W56A 4EIVA 1TSIA 1NFBA 3LERA 3P60A 2AAMA 4Y9AA 4WOQA 4DO6A 3CIWA 2A7RA 1EUAA 5A5WA 2V9DA 4PH6A 1OYBA 4LS2A 4AHPA 3NYZA 1OFRA 3L0GA 2ZA3A 4ORIA 3TXVA 4BF9A 4M5PA 1DQWA 2ZRXA 3JR2A 1YTEA 5BW6A 3QQ0A 4LVDA 5FEZA 4GFSA 4QM1A 5C54A 1P5BA 3DENA 4E0CA 3L0NA 3FYOA 4IX2A 2FPYA 3LCXA 3UXDA 4DEFA 4GUFA 3FJLA 3U6WA 2X1RA 3FKKA 4I7VA 3NEVA 3RNDA 1O5KA 4C1LA 3UZ5A 5LZLA 2CZEA 3PSVA 5LHFA 3V1PA 4JTLA 4XKYB 3UQNA 1QOPA 1Y0EA 5K2ZA 1H61A 3O1NA 3DHDA 3C52A 3GDRA 1V5XA 4AH7A 4BI6A 3M41A 3EX6A 4QISA 5F2MA 4Z0JA 1MZHA 2V30A 3A21A 4ZQOA 1FCQA 1OVDA 3UXAA 2AQWA 4W9TA 1I4NA 1KV5A 1VCFA 2YW4A 5FF3A 2ABBA 3W70A 4JIPA 5D03A 5AHFA 4R33A 1F6PA 3F4NA 3BW4A 1BKSA 1WBJA 1AW1A 4RKAA 4FF7A 3SZ8A 1W5QA 3Q37A 1OHLA 1ZY9A 1IXOA 2B7OA 4ZQMA 1QNVA 1ADOA 5KSWA 3HMJG 3IIOA 3M5YA 2PC4A 2Q3RA 2NZLA 2QCFA 3N3MA 3NXFA 3PSWA 1TTQA 4HSNA 3LRKA 1TO3A 3M9YA 3W2LA 1GWJA 4AMAA 3NA8A 3NM3A 1EB3A 4U28A 4GUIA 3C0JA 3S5ZA 2I1OA 4DBEA 3N34A 5I3JA 3NQGA 1LBMA 4GUHA 3W7CA 1W3NA 1L6WA 3IVTA 1MXSA 3LBCA 3EXRA 3O6DA 4N9EA 5J5RA 3EX1A 1EPXA 2P1FA 4NQ1A 1FDJA 4XKYA 4BR1A 1P0KA 3PBVA 1G6CA 2VC6A 4NX0A 4UXDA 3QRHA 4KFNA 4PODA 1B9BA 1PVNA 1W54A 5KINA 2CZ5A 1C29A 1SR9A 4NNBA 5EMUA 4UTHA 1YPIA 5CPLA 1YDVA 3OVQA 3MP5A 4JTJA 3HB9A 2GVGA 3W7DA 1K7XA 1QWGA 4IQLA 1OX6A 1TRDA 2WNNA 5F1UA 3KOFA 4TR9A 1RQBA 4CQ8A 3G1DA 4O28A 1LTDA 2JKAA 1TPB1 4M6PA 2JGYA 3A5VA 5AHNA 4POCA 3O8AA 2YFOA 2XN0A 1OFPA 4AAJA 4ADUA 1SZGA 3FA5A 4RV8A 3IRDA 2QCLA 2E6AA 4DO5A 1I2RA 1XBZA 2QKFA 4BWLC 3NAVA 3QH2A 1L6SA 3WK2A 4DELA 3G22A 2C15A 1GPWA 4ZL1A 2Y70A 1QR7A 2ZRYA 3HG2A 4YMZA 5D30A 3R13A 1ZAHA 3TQVA 3KX6A 5GVJA 3L0KA 1OFQA 4FX7A 2TPSA 3NVTA 4UC5A 5AOUA 4D2JA 1K7FA 1F6KA 1EWEA 4K7YA 1EIXA 1PE1A 3C6CA 3MJYA 5BOOA 1YYAA 3UYCA 2QR6A 3EKZA 4FNPA 3MW7A 1IXQA 3P82A 2OT0A 3Q94A 3EWZA 2Z0IA 3ATYA 1UUOA 1A5AA 1OFBA 4UMBA 4DO4A 3L5MA 3STGA 1W3IA 3S8HA 3IGUA 1QPRA 3W7HA 3W23A 3A23A 2QF7A 1LOLA 1QMLA 1E51A 2CWNA 5D38A 5FF7A 4QJ1A 3G3MA 2QCHA 2J9YA 1TJRA 5HUPA 5LKYA 1ME9A 4N6FA 1K03A 4KFOA 2EAWA 4CQAA 3CPRA 4KWVA 5H91A 3GDTA 4R53A 3QFEA 4M6QA 4UTKA 3P8JA 5F1VA 3HBLA 3N2MA 1SU5A 2FB2A 3B0PA 3PBWA 3B4UA 4N9BA 1OABA 2OT1A 2YGYA 4MZ1A 1XC4A 1H7XA 1KM3A 2ZTKA 2A85A 4K8EA 4IMCA 1TV7A 3HGOA 4WUIA 3WK3A 4XUGA 2NXGA 5D2XA 1XBVA 4AWUA 5EA9A 4E2BA 3MHUA 4IMDA 3LTYA 4ZQNA 1QO5A 3O6YX 4K38A 1S3HA 3SECA 3BG5A 4LTSA 2FJKA 1XI3A 4UFKA 3T7VA 4MY8A 4XBKA 1FBAA 5DY2A 4R34A 1K3UA 4C1KA 1DVJA 1OX4B 4BWLA 4M6VA 1I2NA 4FNTA 1YXCA 2C13A 5G2IA 2BXVA 1YLVA 4PL2A 1KV8A 1AG1O 1PHQA 1SFJA 3EWUA 3EWYA 1H5YA 2J24A 5T26A 3O05A 3L9CA 1F73A 2JKPA 3IV3A 1NVMA 1VC4A 1H7WA 1HTIA 4PA8A 2QAFA 4NJIA 2DU2A 1VPXA 3UWVA 1G67A 4O8RA 1W5OA 3CC1A 3EEGA 4E2DA 4UNLA 2BSLA 4DPQA 5HULA 1LCOA 4HPJA 2QUTA 1YXDA 4O52A 5E0KA 3SFKA 2W79A 4ALDA 5IBXC 1G7UA 3RLUA 1VS1A 3WK0A 2VOMA 2H6RA 3ZWSA 5CZ0A 5C6MA 3O07A 5DCEA 3O15A 4B5NA 1Z42A 1TV8A 4TX9A 1JUEA 4UMCA 3LXAA 1D3HA 3GDLA 2RHGA 3M0ZA 4LVGA 3G1FA 1W1ZA 3M1ZA 1H7RA 1OX4A 3MYOA 6ALDA 4A2RA 1VYSX 3TMQA 1QOQA 3KXQA 4M19A 3NQEA 2VEMA 5EKYA 1QCWA 3GB6A 4U4MA 3CU2A 2QCDB 4N2YA 4Z0SA 2OCZA 3WK1A 4O17A 2DZVA 3DU0A 1Z44A 1R30A 5D2TA 3LLFA 2I14A 3GYEA 4FXRA 3LI0A 1R46A 2B0MA 4O1DA 3TXZA 2A6LA 1KM5A 3NQCA 1I2PA 1LZOA 1B57A 2ATSA 3EX3A 1F05A 3IIXA 1EP2A 2CLKA 3W72A 2JKEA 2ZZ3A 3R5EA 4QNWA 3ZS4A 1AMKA 3CT7A 4MPQA 3QMRA 4K6AA 3BGGA 4JTSA 5EBUA 3QQ1A 4PL1A 4RCXA 1YTDA 1FWNA 4JDYA 1Q6RA 1FXPA 5F2IA 1C8VA 1TV5A 1D3GA 5E1QA 3PB2A 4OV4A 1S5TA 4IX0A 3UWYA 3TJLA 4M7TA 2Z6IA 2NWSA 1KBIA 3F1QA 3T78A 1QFEA 2J88A 3IGXA 3E96A 1P0NA 3DFTA 1GYNA 4AWSA 5CSSA 3SY5A 2JGQA 2VEKA 3I68A 5I3GA 3USBA 4YCPA 4JIQA 1WOAA 3HGJA 3IVSA 3M16A 3E12A 2Y7EA 3W1RA 2D73A 5LHEA 2E6FA 3KVKA 3W1TA 2YYTA 1EP1A 2ISVA 4K37A 4OU1A 4UFIA 2NV1A 5G5IA 3JRKA 2X30A 3CQ0A 4JTTA 1JRCA 1T8XA 2CLOA 3V75A 1OX5A 5HWMA 3W3OA 3MWAA 4Z1DA 3WJSA 4UFLA 5FF4A 4ONVA 2WNZA 1UUMA 3BO9A 3QYQA 4PC8A 5G1YA 5TIMA 2QDGA 2V81A 1OF6A 3EWXA 2ALDA 3TSDA 2Q8LA 4FO4A 3DFNA 5D02A 1ICPA 3STEA 5C2XA 3U8GA 3P74A 1H7PA 4LT9A 3C8FA 1A50A 4CCCA 1PCKA 4RLIA 2CW6A 1MEIA 4ORMA 4UIOA 3TCEA 4MUZA 2ZRUA 1KA9F 4MYXA 1WQ5A 2YR1A 2R91A 3W7OA 2CU0A 3UD6A 3BG9A 3W1AA 2C16A 1SPQA 3N14A 1GT8A 4EVZA 4CNPA 1TRIA 4MZ8A 5FF0A 1TYGA 2X1UA 4LVAA 3DHFA 1TJPA 3HQ1A 3MYPA 1IIHA 2JK2A 1LP6A 3UNDA 4LOCA 2DORA 1GVOA 2HS6A 4JTFA 4UFHA 4Q33A 5LSMA 3GZ3A 3HGSA 3PBYA 3LCHA 1OFAA 3W87A 4HNUA 1RV8A 2CLFA 4HPXA 3DFQA 2E6DA 2ZZ7A 5G2WA 3C56A 4MZYA 4O16A 1Z48A 2A4AA 1SZNA 1KFLA 1JUBA 4NVTA 2V2DA 4O4VA 1SZFA 4RJEA 4FX8A 1O95A 3GXPA 2ATMA 4JEQA 1GVSA 1TPC1 3BW2A 1ZAIA 3FYPA 3TAOA 4LUIA 1CW2A 2FTPA 3NL5A 4ADSA 4CNNA 1KFBA 1XUZA 2WQPA 4MKNA 4HKPA 3HG3A 3PULA 4HNNA 4LRSA 1RQEA 4JX6A 3W1NA 4QAIA 1A53A 3NG3A 3NQVA 4GXMA 4JTEA 4AB4A 4LS1A 3LBMA 3H53A 2B7QA 4Y96A 3UWWA 3P61A 3LRLA 2C19A 4ADTA 1K8XA 2A1YA 4LRTA 3N19B 1HO4A 1DL3A 3T44A 5DY3A 2Q8ZA 4MIMA 3LCLA 1LOSA 1FDYA 3W7NA 1JCNA 3N73A 1X7FA 3S1XA 2RDWA 4NX5A 3INPA 3W2KA 1Q3NA 2CLIA 2CLEA 1YDNA 3NL2A 3S5NA 1QAPA 2VELA 4N02A 1LRQA 2A21A 1G4PA 3OBKA 3P5ZA 5CZTA 4Z1CA 1TPH1 1F2JA 1MEHA 4O50A 4UCGA 1OK6A 2C14A 3W7JA 4PEKA 1WXJA 1ZENA 3EWBX 4Y90A 4HHPA 2EPHA 5TBOA 4UTWC 1JQVA 3OG3A 3MI6A 1X1OA 3ATZA 3W75A 4O14A 1GVFA 4HIBA 4O54A 1RQHA 1KM6A 4QNEA 3LHVA 3LHWA 3OHIA 2QJGA 3CLMA 1B4EA 1TPDA 5K4ZA 1XUUA 3OVPA 4WY0B 2WKJA 3M5ZA 3GDKA 2Y85A 2DZWA 3LLDA 3VI2A 5FF2A 1CX9A 3W73A 1SO3A 2Y62A 4TMBA 4IMGA 1TTIA 5KTLA 3PB0A 3FFSA 1GJPA 4LV9A 1I8JA 1FWTA 1VGAA 2WPBA 3NOEA 4LW7A 3MUXA 2Y6ZA 1AL7A 4G1KA 4UFMA 3FIGA 3RU6A 2V82A 4JX4A 3B0VC 2ZZ4A 4PCFA 3RF9A 2E09A 3QM3A 2ZFAA 4JYDA 2WJZA 4JDBA 4HN4A 2V2HA 1GVQA 5LNVA 3E02A 3L5AA 1YTKA 5K9CA 3T55A 1H1YA 2KZHA 3WJWA 1AK5A 4IMEA 4XTIA 3OVRA 5F2GA 2W6RA 3H55A 5AB3A 1WDWA 4JX5A 3Q2DA 1R47A 1XBYA 5K9XA 4NNAA 1ICSA 1ZHAA 4UMAA 1BTMA 4O18A 5U4NA 3P7YA 3T4CA 4HT3A 4RK8A 2LLEA 1QPQA 1THFD 3HJZA 1VYRA 4XWUA 4O0ZA 1GZGA 3LHTA 4TU1A 4CCDA 1W0MA 2QAPA 4MFEA 1TREA 4PFMA 2WV8A 3UY7A 4YLWA 3HOJA 1FX6A 3EX4A 5AYXA 1SQ7A 2P0OA 1VLWA 1RPXA 3HPXA 5DBTA 3NZ1A 1JULA 3QMSA 1VCVA 1H51A 2NX9A 3LB0A 4GBUA 4JS3A 3G1AA 5BNKA 1QPOA 4UTWA 2WSYA 2ZQ0A 3I7SA 3IEBA 1LORA 2VENA 3M6YA 4ML9A 2NLIA 3C2VA 4LVBA 2CZDA 2ZZ1A 1N8FA 2FDSA 1HUVA 2G5WA 1GVRA 4GWEA 4JYEA 1RVGA 3CWOX 3GR7A 4FNRA 1LROA 1TQJA 4JN6A 1SZEA 2A7PA 1LBFA 3PG8A 3P84A 3PM6A 2A6NA 1U5JA 1NF7A 5I3IA 3W1XA 1XL9A 1GG0A 3S1UA 4AF0B 5AFDA 1T96A 3BK0A 1LRNA 1VYPX 3G1XA 3DFSA 2WSQA 1T99A 2TSYA 3CEUA 1GTEA 2ZRWA 4FIRA 2YW3A 2AGKA 1I2OA 2GPTA 4BI7A 3G18A 2VFHA 5EY5A 3ABRA 2QUVA 3QSTA 1VJIA 2E6YA 1FCBA 4JGDA 2Z1BA 1K02A 1B3OA 4K39A 3DGRA 1GOXA 3MBFA 1OYAA 1SSGA 3Q58A 2Z2UA 3MP3A 3THQA 2TMDA 4JY9A 4GRSA 5D2VA 4UTLA 3S1VA 1L6YA 2FFCA 1NEYA 4FNUA 4XBSA 1R2SA 2V2CA 1FXQA 3OIXA
chains in the Genus database with same CATH superfamily
3NXLA 5XIMA 1U5HA 1VRDA 1IXNA 3IARA 1TWZA 1DJQA 2RDUA 4E3TA 3WJXA 4V28A 4AC7C 3TFCA 3TQ0A 1O5RA 4PRTA 1CPUA 4M29A 3H70A 4P7QA 4N4PA 1TPUA 3EOLA 1KR1A 3QY7A 4QCEA 1F7BA 1ZFJA 4W87A 3P2VA 2ZZ5A 4LC8A 1UP3A 2FLIA 3AIVA 2ZC8A 3S6DA 4H7CA 2FZMA 2YXGA 4C1NA 1ME7A 4P8XA 2CCRA 1RCOB 1W3HA 1XLGA 4MPKA 1HKJA 4AXKA 5KETA 1EDTA 4EANA 4IPNB 2P8BA 5I3DA 2R1KA 3JU2A 3W01A 2BHYA 3G6LA 3NTYA 4F9DA 5KZDA 5T9BG 3G1VA 2PI6A 4UR8A 2A5HA 1W9UA 3G0XA 4GKLA 2GLKA 2FMOA 1H11A 1OFDA 1VBRA 4NJJA 3LM3A 5DCBA 3WNOA 4K8HA 2Y5EA 2DQXA 1KD0A 3E0WA 3S1WA 3BQ6A 2ZRVA 3I7QA 2GJPA 1CIUA 3FA3A 3A4JA 3TC7A 3P67A 3UCQA 2Z1VA 1Q6OA 3M0HA 3PTMA 2OG9A 5MF5A 1SW3A 3WF3A 2RDXA 3W7RA 2X16A 4G6CA 3RK8A 3VIJA 2E5DA 2DIEA 1P1XA 4JTUA 5AZ0A 5D2YA 1GTHA 1XYBA 5F7UA 4FAMA 5LNSA 3WYZA 4IOTA 2YYUA 1IYXA 5A1AA 4QX4A 1XDLA 1KFKA 2X1SA 1E55A 2VFDA 5EMYA 4N4QA 1EP3A 4BQ5A 1EJRC 1RY8A 2TYSA 4FNQA 1LJYA 1QXLA 3ZM8A 4WKHA 3XIMA 3NGJA 4Q8NA 1XGZA 3UR5A 3G8EA 2FYMA 4OTKA 3B8IA 2FHFA 3BANA 3T8LA 4Y9OA 1V6UA 1UWTA 1YMYA 1HIZA 3GZAA 2I57A 2Y0FA 5HWJA 4ACYA 5CPQA 2ZRZA 4Q4RA 2WKGA 5FEPA 3R4IA 3F4VA 2BY1A 3HG5A 2VEPA 3QW3A 5DMNA 3W71A 1UH4A 2FZ8A 3EXTA 2EHHA 2HVMA 1RJRA 4MFDA 1E5NA 2ZKMX 3FS2A 3O6CA 2IPFA 2O4QA 3WD3A 4JKKA 1DIDA 1WO2A 7CGTA 3WQDA 5CJMA 4N9DA 3U2OA 4CQBA 4E4FA 4QJ4B 1JCYA 1JPDX 1BSIA 3QHOA 1PDYA 3BCDA 3M5VA 2MNRA 3FAWA 1OFEA 3WLNA 3KS5A 3O06A 4QSFA 3CH0A 4DWSB 2VXNA 1I2QA 4JKLA 3WLSA 2GUBA 5F4SA 2XM1A 1M9HA 3AYRA 1EPVA 2G97A 1K6AA 1UUQA 3W2MA 1NF0A 2E7FA 3WQEA 2YLLA 1DIOA 1WP6A 1Q2RA 2FVMA 3W81A 4WQ6A 1W6TA 4W8BA 4DF1A 4IISA 1EFZA 1Q66A 2BDQA 2PDLA 4JYFA 1I6NA 5CPMA 1MYRA 2VRKA 3DH7A 3RFAA 1N55A 2WJDA 1K4GA 3LHYA 3LXBA 3I3EA 4QIUA 3RX3A 1PO9A 4HZ6A 1JPIA 2UZ9A 1BSLA 1WCGA 2Z00A 5E9AA 1TCDA 2YB4A 4H9YA 2ZZ2A 2GJLA 3H54A 1DHKA 1UKTA 4DZIA 1PDZA 4WJEA 4MYAA 1T5AA 1RA5A 3GRIA 1RAKA 3GXTA 2XWDA 4KCTA 3TQKA 4H8HA 2PU1A 4JXCA 1GONA 2OYKA 2DDXA 1RBAA 1VCGA 4TIMA 2WAGA 2Z6JA 3BGJA 4AHOA 3KL3A 2Y5SA 3OTRA 4O53A 3F5JA 1X1NA 3WDIA 1WV2A 1G0CA 3VIIA 1U1HA 1X39A 4ZOAA 1VFHA 3GTHA 5M17A 1QNOA 5AYZA 4AZCA 3OW1A 2JIWA 4FXSA 3W4RA 2J8FA 1IIGA 4QDPA 3LHZA 3TC6A 1GK8A 5FOOA 3CYJA 2VFGA 5SWUA 3DYPA 4S3AA 2WJFA 5LGXA 2HJPA 1R3QA 4DJEA 3SJNA 2WW5A 3PVFA 1EUNA 5J8LA 2VRQA 1H63A 3VCRA 4DBSA 1ITCA 1UBSA 4AZ7A 1K9TA 4HYRA 3EA3A 4PMDA 1O66A 3H2MA 4EWND 4H3DA 3BMVA 3LCGA 4P7OA 3SSJA 3VMOA 5E0CA 4CCEA 1LT7A 3V18A 3G1SA 4C6CA 2CKSA 4BKNA 2C18A 2J77A 2Z1XA 4IPPA 3C2RA 3MKCA 4JICA 4INFA 2WZEA 3APYA 2NX1A 3K5XA 3P8IA 1SJCA 1F4HA 4YHGA 3PBUA 2G4JA 3ZWTA 1V79A 3GR8A 2ZBTA 3GKAA 1A5KC 4IGHA 4J27A 3M0MA 4WZHA 3N9RA 2ACSA 3RMJA 1HNYA 4TMCA 1SJAA 1XH0A 3Q67A 4M24A 3NPVA 1H7NA 3AMLA 2FQIA 2XVKA 4PYSA 4JD4A 5BCAA 2EPNA 3L5LA 4IHCA 4I5RA 2NXHA 3TQPA 2C1GA 1Z6KA 1EJUC 1RUSA 2EPOA 4ZENA 3GW0A 3V5FA 2WSRA 5E9XA 4RXGA 2H8ZA 3N2OA 1UD4A 3GTNA 3VO0A 2WSKA 4BK9A 1W37A 4AEEA 2FJUB 4LUTA 1J0KA 4MUPA 4TVCA 1YPFA 3CUHA 3SN4A 4J3SA 2PEVA 3TDFA 3GWQA 4IG2A 2OQHA 4H9TA 2AMGA 3QY8A 4TX6A 4ENLA 2YBVA 4DZ5A 2HCVA 4S3JA 2X05A 5FEXA 3C2OA 1TMQA 4H8UA 4P2VA 3VGBA 3WNMA 3G2GA 3F5KA 1RSCA 1E73M 4O11A 3WDHA 1SM9A 3WMLA 3DAQA 7REQB 1RJPA 4OIFA 2H9AA 4J7RA 1DQUA 1YADA 4URIA 5G4EA 1DOSA 2PE4A 3AYTA 3NSXA 2FH8A 4S3FA 2ANUA 1EX5A 3LOTA 3SI9A 1EDQA 3GVRA 4A6GA 2W4XA 1KXQA 2J75A 1XYMA 4WJXA 3I65A 1L6FA 3ARXA 5IM51 3WL0A 2J62A 4UUIA 3W22A 1E1FA 1AZ1A 4IGNA 2BWGA 1C90A 3QC3A 3PUDA 3MUY1 4L7ZA 3R6IA 4KPLA 1EC9A 4NJKA 1JYVA 3HV8A 1UKPA 3N25A 2POTA 3WG6A 2CLLA 4JQ1A 3W7IA 3VNMA 3QXBA 2OX1A 4XD6A 3IIPA 4Q6XA 4ZCWA 3KFTA 4EPDC 1YNQA 3WN6A 2FVLA 4NILA 4B5XA 3TYAA 1V3MA 1XGDA 4GZ7A 4Z2KA 2QPXA 4WY0F 1JUKA 4K68A 4PBFA 5G4WA 2AAAA 8RUCA 1OC5A 4S1FA 3G3DA 3KUMA 2VFEA 3VPLA 4WLCA 3SCSA 3M46A 1ZS2A 3B9DA 4YYFA 4AF0A 1H49A 4DJDD 1X6LA 5LNRA 2XSBA 3AZSA 2G41A 4AHQA 4R7JA 1Q6GA 1G69A 1DXIA 1V0NA 2Q3OA 3IJ8A 3SADA 3VGDA 2VGBA 1JGIA 2HBXA 1S2WA 2OOGA 5CC7A 2IXVA 3AO0A 2C71A 4TTUA 3PY2A 2JFEX 3SURA 5GNZA 3VOGA 3OEXA 4LNYA 3LCIA 4DJDC 3L4XA 4GIRA 4UB9A 4YNGA 1KRMA 2GK1A 4LEQA 3APGA 2XFFA 1D9EA 1O5XA 4G8TA 1JVNA 3DI1A 5TD4A 4REQA 1VLIA 3S42A 3C86A 1VFFA 3G5EA 5HMEA 1U2YA 3GO2A 3B0UX 4W8LA 3GY1A 5FJOA 3UVIA 3W02A 3GFYA 4KCVA 2CFFA 3GNPA 1VBHA 1VF8A 1IEXA 2PTYA 3W1LA 5FCZA 5CSRA 3CHCA 4DUXA 2UY2A 1F3TA 1JIBA 1ADDA 3VOJA 1HL9A 1J4EA 3M5XA 5LIXX 1OGSA 2PPGA 1TJ0A 3QHMA 3F2DA 3AXMA 1UWUA 5C7VA 4TXEA 1DE5A 2HVOA 5DCDA 1MUMA 5CKSA 1V3HA 3N2XA 2VWTA 1MWOA 2ZX5A 4UTMA 3PNUA 3DHUA 2F7FA 4PB4A 1ZQ5A 3WFLA 4A3QA 2YKKA 3VKJA 3V0SA 1XSIA 4I9TA 5BRQA 1E6QM 4BCEA 1U30A 5DN1A 3BXWA 4YYCA 1NH6A 3KTXA 3QZEA 2HE8A 2QCCA 4UTTA 3SUSA 3B04A 4TVDA 1U83A 5CBJA 3WBWA 1M04A 5D8ZA 2AQVA 5C55A 3EKLA 4HYWA 4PULA 1RR2A 4PCSA 1O7AA 1XPYA 2WO5A 1MI3A 4JNMA 1P0EA 1KLZA 2VHLA 2A7NA 1W91A 3IIZA 5H8MA 1BXBA 3GC5A 3OPSA 3PZUA 4EK7A 3UY8A 1HGWA 4FLOA 4IWWA 1AW2A 3IJ9A 5CGQA 2X1TA 2Z26A 1QHZA 2RH9A 4OHQA 3R2GA 4CLMA 4UWMA 1ESWA 3IVUA 4JN8A 2YXXA 1TMLA 4H04A 3M7SA 2WPGA 1NAL1 2VP8A 1R38A 1N2VA 4MMWA 4KKXA 5CPSA 4L65A 5JUVA 4LY8A 3ZLFA 4QJ3B 4X9SA 3TLLA 4KEUA 4D6GA 4NZJA 4MWAB 3W83A 5A2CA 1OADA 4LJ3A 3EB2A 2OPJA 2QUUA 4OOUA 1J0IA 2UBPC 2ON3A 2H8XA 5I0DA 2IQTA 4XAYA 3BLIA 4RZ6A 1FWGC 1BKHA 3GAKA 4AU0A 3C2YA 1ONEA 2XINA 4E2OA 3UR8A 3UG8A 1W17A 4C6JA 3B8SA 1SMAA 1H5VA 4ACZB 3URNA 3BAIA 1BXNA 1CI1A 4S2BA 1H3GA 1B31A 2W0UA 2BFGA 1WX0A 1XLBA 1XYZA 1PXGA 1W3TA 4D6CA 4LVFA 4LUYA 3R8RA 5AHIA 1TMHA 4DXVA 1M41A 4I9MA 3GHTA 1FOBA 4YTQA 4YXGA 2C0AA 4O1AA 3N6JA 1XIHA 1JF5A 4HCLA 1AQHA 3ANUA 1W1YA 4FA3A 2EKCA 1UH3A 1UZ4A 4DYKA 5C9WA 1V7AA 1NFBA 1D8CA 1Z7AA 3P60A 3ZIZA 4W84A 4C6MA 2WMKA 1EUAA 2V9DA 3K1DA 1HP4A 1R6WA 1OYBA 3S46A 4LS2A 1PZ1A 4AHPA 3NYZA 3BSGA 1RP9A 5BW6A 3W37A 4TTGA 3UZWA 2J7HA 4LCSA 4B5SA 1LWJA 3KTCA 3RO6A 4C90A 1UWIA 6PTDA 3FJLA 3BAYA 3FKKA 2PZ0A 2HPIA 5LZLA 5LHFA 3KBVA 5K2ZA 1H61A 3GDRA 4BI6A 3M41A 1UD5A 2WMFA 4QISA 2OYMA 1MZHA 1WXZA 1FCQA 2GOKA 5AC5A 1I4NA 1WNOA 3L23A 5A6MA 5AHFA 2WVTA 4PTVA 2VUYA 3N2BA 5ECUA 1BKSA 1UR8A 5CC3A 1AW1A 1Y8BA 1W5QA 4PE8A 4M80A 1K8CA 4CU8A 1ZY9A 3OO2A 3BSHA 1NJJA 3M5YA 3PBMA 5TF0A 1Y5VA 1X8CA 4R88A 3VNZA 3M9YA 4JL2A 3W2LA 4AMAA 3ARUA 3NA8A 3C0JA 4Z2IA 1DXEA 3NQGA 1NDVA 1W3NA 1L6WA 1M53A 1O5QA 1MXSA 2NV9A 3LBCA 3EXRA 1JPKA 4N9EA 3EX1A 4YVPA 2ZUSA 4NAFA 1P0KA 3PBVA 4JN7A 2VC6A 4NX0A 1V0MA 3B97A 1PVNA 2WVVA 2DQWA 1HKVA 5ABFB 1SR9A 1C29A 3MUCA 4UTHA 3E38A 5CPLA 3OVQA 1XYCA 3OZOA 1SJBA 4WRHA 2IMRA 1QWGA 1XRVA 4LF2A 1OX6A 1TRDA 5JQ9A 1BG4A 2RGLA 2J78A 1OB0A 3WQOA 4CQ8A 3LUTA 3EYPA 4HD5A 1D7KA 4M6PA 4Y9PA 2YL6A 4C6KA 1XKJA 3OOQA 2GFTA 4D9PA 2GSHA 1Q65A 2G8ZA 2QCLA 1O12A 3FDGA 1I2RA 1KBKA 1JZ2A 3R25A 3UJRA 3WK2A 3PK7A 1KR0A 1UR4A 1GPWA 3EMZA 4ZL1A 3P3BA 2ZRYA 4YMZA 4AIUA 3JZEA 3KBMA 5CJ5A 1W3LA 5HNNA 1OZMA 3H22A 3S5SA 3L4WA 2ISDA 2CYGA 4D2JA 4QLLA 4K7YA 3MJYA 1XDJA 3BLOA 2UY3A 1Q4NX 3MY9A 3UYCA 1V6TA 5EFFA 3Q94A 3N1AA 2Z0IA 1A5AA 4UMBA 3K2GA 1XLAA 3LEPA 1PYMA 3AIWA 4DBWA 1DJHA 3BLKA 4HA0A 3A23A 4D6EA 1E15A 1E51A 3OGSA 5D38A 1IE7C 1J01A 3PPHA 1LF1A 1QJWA 2VD8A 2J13A 1TJRA 3CO8A 3GXIA 3N9KA 3QZ6A 4KWVA 5H91A 1FFRA 5DRCA 3P8JA 3AHTA 3HBLA 1C7TA 1G5AA 1SU5A 1EJWC 4PUUA 3B0PA 5EGRA 4I6KA 4MZ1A 2ZTKA 4YTSA 2WCGA 5A6TC 4IMCA 4OUIA 2VOTA 3WK3A 4BQ4A 2NXGA 3EOUA 3MHUA 1BAGA 2PLCA 5I7GA 4ZQNA 4B5UA 4J4KA 3SECA 4H6EA 1OC6A 1XI3A 4UFKA 4XBKA 5DY2A 1E70M 1ZBCA 1OX4B 4BWLA 1YXCA 4DXKA 1GVYA 4Z2LA 3ITCA 5CG0A 1KV8A 1SFJA 3EOOA 1WKDA 1H5YA 1GNXA 3O05A 4LAOA 3JW7A 1F73A 2D2GA 2JKPA 1NVMA 1VC4A 3MSRA 4E3VA 1G67A 3EPMA 4UNLA 2BSLA 3CZLA 3SCUA 1FTXA 1B3ZA 3QOMA 4AX7A 4F79A 2QUTA 1V4YA 4LPCA 5E0KA 2W79A 1VS1A 3P93A 1PUDA 1S2TA 4IIHA 4H7ZA 5CZ0A 4P5UA 3NDYA 4YJ5A 2DSZA 4B5NA 1TWIA 2J8GA 2HQAA 3ZZ1A 1D3HA 4FR1A 3M0ZA 1IZKA 4GNVA 1US2A 1VKFA 3M1ZA 1B3XA 3KBWA 3DBNA 6ALDA 2GJXA 1VYSX 1VENA 1DJWA 4J2PA 4KW2A 1QATA 1JF6A 2C91A 1P43A 3V1HA 4C5YA 4ZOBA 3VXGA 2WC7A 4Y9MA 4H9MA 3MTWA 4Z0SA 2OCZA 3APTA 1O1HA 3O9NA 4J35A 3DU0A 1Z44A 4G7EB 5D2TA 2QGHA 3GYEA 1GHSA 5G1MA 1I2PA 1LZOA 3IIXA 1B57A 1BF6A 1R8LA 3AIRA 3B40A 1F6YA 1UZHA 2CLKA 4K3ZA 1JAEA 3R5EA 4LCQA 3M0VA 4MPQA 2YZ5A 1ITUA 4JTSA 5EBUA 3QQ1A 4RCXA 1L0PA 1DJZA 4PR4A 3CHFA 4ATDA 5F2IA 1FH7A 3MMDA 1C8VA 3U4FA 5E1QA 3WDRA 4CCZA 1RP8A 4IX0A 4N0RA 2PDXA 3U7BA 4S39A 3TN4A 1KBIA 3PJTA 5XIAA 4HOXA 4KETA 3IGXA 1P0NA 3DFTA 2C1IA 4DN1A 2JGQA 3I68A 5HJYA 2BVDA 2ZXAA 4IP5A 1FWJC 4IFRA 2OEMA 3RR1A 4HSHA 4GXPA 4B15A 1PZ3A 4KRTA 2Y7EA 2E6FA 1XG4A 3VUSA 5CXPA 1OY0A 2XIOA 1JZ8A 3PUGA 1XLEA 4A8IA 3XINA 3MB9A 1PWLA 1PX4A 1RLDA 3LYEA 1MVYA 3F7JA 3RRXA 4XG1A 1ZTVA 3R0DA 1A49A 4WSJA 1GOMA 1EYWA 4DJED 1J9YA 3PZIA 4AXNA 1GOQA 5BXPA 5G1YA 2V81A 4GK8A 3MCMA 4US5A 4P7RA 2NQZA 2OKOA 5D02A 3P74A 2E9MA 1H7PA 2QV4A 4CCCA 3K4DA 1PCKA 3TYZA 1CXKA 4MUZA 1T8QA 2JEPA 3W7OA 2Z7GA 4U31A 3UD6A 3W1AA 2D0FA 1GT8A 1JZ4A 3SCQA 1TYGA 2VC7A 2X1UA 4LYPA 4FXFA 1IIHA 2QDDA 3H7UA 1DJGA 4C6BA 1A3XA 1GVOA 2HS6A 3S47A 3DIPA 4Q33A 3PBYA 4F2TA 4F0SA 1MQQA 2XFRA 4HPXA 3DFQA 2OO6A 4A3HA 4GOAA 1G94A 1SZNA 1KFLA 1JUBA 4O4VA 1SZFA 3AHXA 4FX8A 3WQ5A 2HXTA 3R79A 1QK2A 2GGHA 3TAOA 1YKWA 4LUIA 4XIAA 1EC7A 1B2YA 2WQPA 1UZ1A 1MRQA 3GG1A 3PULA 4HNNA 3CUXA 4QAIA 3S6TA 1SFTA 1NARA 3FGCA 3H53A 2WK2A 1I60A 4PB5A 2G3JA 2YL9A 4LRTA 1T40A 4AW7A 3VNKA 2F6UA 2Q8ZA 4GH1A 3W38A 1IEVA 1JCNA 2RDWA 4NX5A 2ACQA 3ABZA 4DVOA 4B5TA 3W2KA 2CLEA 3UCDA 2GGJA 3AYVA 5CH9A 4AD2A 1WZAA 3OBKA 3P5ZA 5CZTA 4Z1CA 1YBQA 2VQUA 4CU6A 1BYCA 1OK6A 1S2AA 1OD0A 2OZ8A 2XGZA 5CGMA 1E0XA 1XF0A 4HHPA 3VNLA 3MI6A 6A3HA 4U2YA 1TR1A 1ZL1A 5DEZA 3VCNA 1TE1A 4O54A 1KM6A 4QNEA 1RCQA 4IFKA 3CLMA 1B4EA 4ZXOA 1TPDA 3MU7A 2DFAA 1XUUA 1Q7ZA 2DSUA 1XCWA 4J3VA 2DZWA 2QW5A 4GI9A 3VI2A 3W73A 4MADA 4IMGA 5J04A 3K8LA 1JI1A 2WVUA 2EQDA 1U5VA 4LW7A 2Y6ZA 1LL4A 1DPMA 3VKDA 2V82A 1FVPA 3QKEA 2VC5A 4DIAA 2Q6ZA 3ARZA 3LA4A 4XO7A 2V2HA 1WUEA 1GVQA 3E02A 4DUOA 1PKLA 3G77A 2I5IA 1RVKA 3OVRA 1PKNA 5AB3A 4GIYA 1JDEA 4O0QA 3R94A 4JX5A 3QV9A 1R47A 6XIMA 3EMCA 4HTYA 1ZHAA 4JIEA 2VZTA 3O3RA 1EO5A 1A4LA 5LXXA 1FHLA 3ZXWA 2LLEA 1THFD 3HJZA 4AVNA 3STPA 4OOZA 1VYRA 3FY1A 4IGSA 5JIPA 4O0ZA 1Z9AA 2PZNA 3RRAA 2Z28A 1XW8A 4YLWA 1WDPA 3RMEA 2BXYA 4BZYA 1SQ7A 4HU4A 3SCVA 1RPXA 1CLXA 2WHMA 2XSXA 2IKHA 1JULA 1TFVA 1VCVA 3AI0A 3LB0A 2W61A 3PN8A 1VRXA 4L6DA 1QPOA 2ZQ0A 2YA0A 3AS0A 1LORA 4JTRA 6XIAA 5CEWA 1H41A 5I5RA 4QP0A 2NLIA 4AYGA 1WZKA 2ZZ1A 2FDSA 3H21A 2G5WA 4PUJA 4QBXA 3TR9A 4CN4A 3AMGA 3NZPA 3UCCA 4JN6A 4XAZA 4A8RA 4B16A 1SZEA 3PG8A 3FDKA 4IT1A 2NQLA 1CGVA 5I3IA 1GQLA 2BG5A 4PMYA 3RN6A 4CNTA 4B2DD 3R8GA 2PDUA 3DFSA 2TSYA 3W24A 2YW3A 1B30A 2X8RA 1VJIA 4HOZA 1FCBA 3FSUA 5CC6A 4Q22A 2OX4A 1LG1A 1OYAA 1AFSA 3Q58A 3MP3A 3THQA 4GRSA 5D2VA 2Z2BA 3H4XA 3S1VA 1NEYA 4XBSA 2CHOA 2F9RA 4ICCX 2NVAA 3WEOA 4C65A 1F3WA 1X1ZA 3WNPA 1XLCA 2UV8G 3GBEA 1JZ7A 2NX3A 6REQA 3FNDA 3AOFA 3QPZA 3TTQA 5E5CA 4EXAA 4NASA 3W84A 4F0HA 1MUWA 2DPEA 3ARPA 2R1MA 3UU0A 3WQ8A 2CNCA 2AMXA 3H4WA 3CAKA 4BFAA 3T8QA 4UTIA 1NM9A 4EKJA 2XIJA 1JAKA 2W63A 4N9CA 1R9XA 3CUJA 4MB1A 3MS8A 8XIAA 3T05A 3KCJA 2DZSA 5AHMA 2YSWA 1QTWA 4V33A 3O2LA 4R9XA 1OYCA 5IRPA 1CB2A 3E0IA 3FSTA 3MI3A 4O1BA 1Z32X 2WANA 5FIPA 1AL8A 4DNHA 3NSMA 3PZNA 2WC4A 3B9EA 2HMCA 3D46A 5H6HA 4DYEA 4PUMA 4ZOEA 2D0HA 4J28A 4HZMA 1CZ1A 3E2SA 4GVIA 3WDPP 4RZ4A 3PJXA 3R7MA 3REQA 3VIOA 2ZX6A 3S2JA 3BG3A 3PC0A 1G9HA 4MOZA 3HU7A 4E8DA 3CZEA 1UJPA 4MSSA 4HMCA 3QPEA 4J2MA 3RM9A 5HPCA 2NWRA 3SQLA 4GZEA 1UOKA 3TH6A 1E5JA 1Q5MA 2J7DA 2A2IA 3TKFA 5CSYA 2J7CA 3NR0A 2PBOA 3T4WA 3W9ZA 1RPKA 1HVXA 1DWAM 1I1XA 2E3ZA 3DI0A 3CIXA 1X6UA 3KWSA 3LGEA 4IPLA 3TTOA 4AFYA 1QVBA 1CXFA 4RE0A 1CGXA 1VEPA 3VKKA 4MWAE 5A2AA 4HNTA 4JCLA 3T6CA 4C6EA 3EDFA 3PF3A 3BJFA 3BSMA 4MY1A 3F4WA 4YIWA 1BPLB 3RILA 3F4CA 3EB3A 5DLCA 5DT7A 2V3FA 3B3DA 4KWOA 2HV5A 2WM0A 4ZODA 3TN5A 4JR5A 1QW9A 3V0UA 3S5OA 4S3GA 4LUJA 1UP2A 1DHPA 2GVLA 1TIMA 1PEZA 2I9UA 2QIIA 5D33A 4AZBA 3EXSA 3JS3A 1EBGA 1R7AA 3DG7A 3KOWA 1R9ZA 5AHEA 2G3FA 2OFJA 4A29A 5H2ZA 1MSSA 2OZ0A 1H7OA 1LRTA 2ASHA 4K36A 4B91A 2F8QA 2TAAA 3AJXA 3JVAA 3LSBA 3VIMA 1NDWA 4CVUA 2KAUC 1WA3A 3F03K 1GPFA 1YXYA 4H7VA 1ZRQA 2XGIA 4YPJA 1V02A 4OV9A 2RFGA 3LCFA 3PTKA 4V2XA 2FPVA 1VHCA 5CLTA 4TQTA 3VILA 1KFWA 5I3KA 3M4HA 2FHCA 2VX7A 4J9JA 5EB8A 3A5FA 5LA2A 3VE9A 3HFTA 4MNKA 2AQOA 3MMTA 3VDHA 3W7GA 1UP0A 3RX2A 4GUGA 3II1A 1S3TC 3VIFA 3WUFA 3QW4B 2QCGA 5HJLA 1FWBC 3EDDA 1M5WA 4U3CA 2R6OA 4YU1A 5DO8A 3QQWA 3KOYA 3TW7A 3IANA 1NWTA 3I6TA 3H2AA 4L1XA 4CQCA 3ITLA 5BRPA 3LRMA 1PV8A 4AZCB 3AS2A 4I90A 1I1WA 3VNIA 2E4TA 4WDXA 5C5YA 4IIDA 3W2NA 1Y5WA 2X0SA 3ANYA 4JFVA 3NPWA 4MB5A 4LS0A 3R1ZA 5I07A 4KGJA 3F2BA 2PDYA 1T7LA 4C6NA 1BEUA 3BQ5A 4EF8A 1N8IA 2PDFA 5XINA 4D6JA 3ABQA 1XYAA 1J5TA 5BXSA 4CD7A 4WOZA 3WLRA 3SSZA 2PF8A 2AOSA 1XXXA 2WZHA 4LC6A 1EGZA 5BYWA 5EU9A 4JNZA 3T81A 3QYSA 4Q8OA 4MJMA 5D9OA 3QFWA 4GLEA 4IUOA 3KLKA 5E6ZA 1MW3A 3GKFA 3MZ2A 4ZGYA 1TUFA 1M7XA 3P62A 3PP7A 1CXHA 4EX4A 1IR2A 3PAJA 3HM7A 1WYIA 3BAWA 1E6PA 4PTDA 4BJHA 4BI5A 4AQLA 3KBNA 3YPIA 3RXZA 3VDCA 4U33A 3G8RA 4IQEA 4UCFA 3B06A 3IJ6A 4XZWA 5IDZA 1J18A 2VVNA 4IQJA 4S3CA 4ZSUA 1VFMA 2DUZA 2JEQA 3T9PA 3L12A 3FXGA 3UWUA 2YLAA 4OGZA 3ZYZA 1A5BA 2BHZA 3GNOA 4L80A 4WEVX 2GJRA 2EBNA 2P3ZA 1C8XA 4HK6A 4IIEA 2ZX8A 3UJFA 2NUXA 3CV6A 4LUTB 2ZUVA 3UJSA 5LA1A 4O15A 3B0YA 3KRSA 4DB7A 1Q6LA 4PCNA 1J79A 2DSWA 4C7DA 5K9DA 3FV9A 4CN6A 1AZ2A 3W7EA 5LYRA 4UFJA 1DJNA 4F9JA 2O7SA 3CHVA 1QRQA 1SO5A 1IGSA 3SGZA 1XLKA 2WZMA 3HQPA 2PAJA 2I56A 2NUWA 2DZTA 3E0LA 5D8WA 4MB3A 5AHLA 3VE7A 2H9AB 1DORA 4EE9A 4D71A 1IT0A 4RR4A 1K8ZA 3OB8A 4ZE4A 1UD8A 3QOKA 2VFIA 1EA0A 6ENLA 2DH3A 3LPOA 4WY0A 3MANA 3QPYA 2QS8A 3OZPA 5TQLA 2J4GA 1QDSA 4JTGA 3T0BA 1QT1A 1QNQA 3WJZA 5I09A 4PB3A 2HS8A 1XBXA 4D6HA 2EPMX 1EF3A 1YDOA 3UZYA 4C6PA 3VGHA 1M6JA 3GC2A 2SFPA 3GDMA 3CL6A 3CMGA 4HPHA 3DKJA 3JZUA 5C2GA 2Y7FA 3BDKA 4S3DA 4LSBA 3OGRA 4RE3A 2VGIA 4KRZA 2YX0A 2QF8A 2REQB 3IUHA 3TA6A 4GJJA 5HWNA 4G9PA 4EP8C 5ABTA 4QE5A 2ZX9A 3KAOA 3OJGA 3CAQA 1QHOA 4PUEA 1ISYA 1S1PA 3BLLA 2O7QA 2NXIA 1LDCA 4YWIA 3NM1A 2QCNA 3CH9A 1FUYA 1X96A 3RU8X 1HGYA 2V5CA 1TB3A 3SY8A 1T0OA 4LFYA 4D8LA 1UWAA 3LPPA 4GUJA 3ALGA 1MO0A 2TRSA 3OA5A 1IHIA 1OCQA 3U3HA 2E40A 5MHBA 2GDVA 3NO3A 2RJHA 1OIMA 3PPFA 4A05A 4IL2A 4XZNX 4GY0A 3QEZA 4NAEA 2VNCA 2G3NA 5E09A 1TV4A 1JG9A 1WZMA 2WLYA 1XKYA 9XIMA 3LX9A 7A3HA 4I9AA 2XVLA 4TV5A 1F74A 1FCVA 3TNOA 3LI1A 2BHUA 5FAJA 3NCOA 2VFFA 4REQB 1BG9A 2VDHA 1M01A 1JDCA 1PWMA 4MY9A 1Y7VA 4XIMA 3NPXA 4HQVA 3GH7A 3TYBA 1B54A 1M68A 4ROQA 3ENLA 2WNWA 2NVDA 3S3GA 3UYIA 1OG0A 4M0XA 4PSPA 3QV6A 1TTPA 3MT1A 3N4AA 1W8GA 3TYCA 5IXEA 4YCOA 2P3EA 3GM8A 1NQKA 2WCSA 1XRFA 3C2FA 3P80A 1FQ0A 3MQTA 3CT2A 3NL3A 4IZGA 4RZBA 4XZMX 5L9FA 3AUOA 5F4WA 3MCOA 7ODCA 2Y4SA 1YQ2A 2VO5A 3MP4A 2D1ZA 3GTIA 1GQNA 1R5YA 3AWNA 4EAMA 1XM3A 1TPFA 4ERGA 3GS6A 5AC8A 3PZ9A 4QS5A 3RYSA 5C9XA 3TVAA 1UA7A 1UG6A 3T2PA 3PUEA 2QGYA 3N29A 1S39A 3C0QA 3WZ0E 1XCFA 2VD9A 3PS7A 2ZCGA 3TV8A 2YBTA 2DUXA 2DZAA 4HOWA 3OLDA 1FWCC 4XSLA 3VOCA 3KCOA 1BYBA 1M7OA 3VD5A 5D09A 1AH4A 1J10A 2BBFA 2OSWA 1TR9A 2FPTA 4ZSTA 2V8ZA 3WEMA 3NOYA 4GQQA 4KGLA 1A5UA 2G37A 3THCA 2ODOA 2Q71A 4W7VA 2CBIA 2GWNA 1VQTA 4O0KA 2OJPA 1VZWA 4ZQPA 3VCCA 2PODA 2BXZA 4Y8FA 3WD0A 3A64A 1PSCA 2B4GA 4OZOA 3L4ZA 2DJLA 5C70A 1ADSA 3IUDA 4HMEA 4DBDA 1GKQA 1GOOA 3C0LA 5JVLA 1G4TA 3I4EA 1PIIA 2OWXA 1W1A1 4GH3A 4YVVA 2TODA 3N3TA 3TSMA 3T0TA 1KGXA 4I6VA 5B80A 1EZ2A 4WIWA 3FJ6A 1BVWA 4I7UA 3G1YA 3CIVA 1V6VA 5LIYX 2V63A 1IT8A 1QI0A 2BOGX 4GBDA 5M5DA 4XSMA 3GNDA 1MXDA 4JY8A 2GGIA 3C2EA 3KOZA 2X7WA 4AZ5A 1W1PA 3ICJA 2FMNA 4GX8A 5AYYA 1BXCA 3MSGA 2DZPA 1RA0A 2VYOA 1H62A 4H6RA 1UA3A 2XUCA 1OFOA 1BWVA 3PTQA 1EWDA 4GQBA 4NXSA 1ZCCA 2DP3A 4O1EA 4UQEA 3BPWA 1MEWA 3TIMA 1NWSA 3CB8A 4CD6A 3ELFA 1FWRA 2A3BA 2ZOXA 1XD0A 3WFAA 1W31A 3DC0A 5AN7A 4RUBA 4Z2JA 1OJXA 3DXIA 4GJIA 4HN8A 3QJAA 4G5DA 5M3WA 3LMZA 3W7MA 2BX7A 3M7WA 4I7WA 5HBFA 1S1RA 2XIBA 5C7HA 1E6XM 4X2PA 2XHYA 5E0FA 3M07A 3CWNA 2OOFA 1LYXA 4S3BA 4E2VA 4WHBA 5HNRA 1O68A 3TWAA 2D3LA 2ONEA 4UTJA 1N7KA 3RAOA 1QPKA 3W7QA 3W0KA 2CZVA 4NRRA 5AC6A 4XB3A 1RZMA 3GAYA 1D7FA 3VDBA 3TAKA 2DSKA 2H90A 3DG3A 3WD1A 4WDWA 2E5BA 3WF1A 3EKGA 1W56A 4EIVA 1TSIA 3LERA 4HA3A 4EAYA 3RPTA 2AAMA 4AUBA 5FJPA 3S9ZA 2EPKX 2OXNA 1EO7A 3L0GA 1CB7B 2CHRA 2CXGA 4ORIA 3TXVA 3LQGA 1DQWA 3JR2A 3U2ZA 1YTEA 1CXEA 4LVDA 4KWSA 3NSNA 1JYXA 2XZ9A 4HZ7A 3M0XA 4IX2A 2FPYA 4GISA 3UXDA 1V3JA 2D20A 2BASA 2YCKX 3RNDA 1O5KA 3UZ5A 5JU6A 2R1LA 3PSVA 1VEOA 4WF7A 1Y0EA 2QT3A 2ZWZA 2QZRA 3C52A 2NT0A 3GNXA 2WMGA 1QBAA 4Z0JA 2WVVB 2PWHA 2V30A 1XIEA 2ZVRA 1OVDA 1KV5A 2GSEA 2YW4A 4EACA 1UIOA 1FFQA 1VPYA 2UWFA 4W88A 3FJ4A 3BW4A 4JTQA 1WBJA 1Q6EA 1S2UA 5I03A 3ZSSA 1G01A 1IXOA 2KX9A 4ZQMA 1QNVA 1ADOA 2BOFX 1XIDA 5KSWA 3IIOA 2ZE3A 3ZLGA 2PC4A 4Y8EA 4GYPC 3SCRA 2NZLA 1BFNA 4L6OA 3N3MA 4HSNA 3DFHA 3GTFA 1TO3A 4FLQA 2OGJA 3ZR5A 4U28A 3E2VA 2I1OA 4DI8A 1EH9A 4DAIA 1R3RA 4GUHA 4JFWA 4PMQA 1ECQA 1TA3B 4H1ZA 1KCKA 3IVTA 3NO1A 3O6DA 3RO8A 5IHRA 4QROA 3GG0A 3C5QA 4BR1A 4YVXA 1G6CA 3V5CA 4UXDA 4PRWA 1TELA 1S38A 3B0XA 5KINA 1GKPA 1DJIA 4TUFA 2NT1A 3SAZA 3BLDA 2GVGA 4LAKA 3W7DA 1K7XA 3FX4A 4IQLA 3HJEA 3C0SA 4TR9A 4HPGA 4LCRA 3G1DA 4O28A 4XKMA 4ASTA 1PBGA 1E56A 4AAJA 1SZGA 5FKYA 5A3HA 3FA5A 2WKLA 1ZJBA 4DO5A 4P8UA 2JALA 1FP9A 3PAOA 5DX7A 1CWYA 1L6SA 4IL0A 3QGAC 4IJRA 3R13A 5GPRA 3L0KA 3GHUA 4LAUA 3BZJA 1ZJAA 3RIKA 1EIXA 1PE1A 3VGFA 3H2CA 1IV8A 1XLIA 2J8TA 3MW7A 1IXQA 4WSHA 1AUSL 4Q8QA 5C9ZA 4IP4A 4NL1A 5HA7A 1NOWA 3VZZA 4DO4A 5MKGA 3B8UA 2P0IA 3STGA 1QPRA 3W23A 1XX1A 4M1BA 1LOLA 2D23A 5CAKA 3G3MA 2V5DA 3VABA 1PAMA 4NY2A 5HUPA 1TUXA 3NUKA 2BS9A 5BWFA 1K03A 3V35A 3LZ3A 4CQAA 2MANA 4L9YA 3QFEA 2PDGA 2PTZA 5ABHA 3W27A 5F1VA 1BD0A 1PB0A 1XH2A 4JFSA 4ZFMA 4N9BA 2OT1A 2YGYA 1POJA 3GC4A 3O0FA 5A6JA 4ZO6A 2DIJA 3VINA 4E2BA 4IMDA 3EDJA 3LTYA 4WGHA 1QO5A 3P14A 4R5EA 1MFVA 4DYJA 1RLCL 2OKTA 1ISVA 3BG5A 4D8ZA 2FJKA 3DOPA 3BICA 3T7VA 3BTNA 1K3UA 1B9ZA 1XIIA 1DVJA 1E0TA 3DESA 4MJ2A 4M6VA 5HATA 2C13A 2GGEA 2BXVA 1YLVA 4PL2A 2G4FA 4AISA 1JNEA 1AG1O 4Q4OA 5GQBA 5FACA 1HTIA 2DU2A 5I77A 3PZOA 1W5OA 3LS9A 1DWJM 4E2DA 1KWGA 5HULA 2AKMA 4ROPA 1MXGA 1YXDA 2XFYA 1G7UA 1MQRA 2H6RA 4CD5A 3LBOA 1U22A 3O07A 1BYAA 4GMEA 5TNVA 4F2UA 1Z42A 3CUFA 4TX9A 1JUEA 2GVYA 4UMCA 1TCMA 4FLRA 4LVGA 1PTGA 3G1FA 2PDBA 4L5ZA 2V3DA 5A8MA 1TZ9A 1XP3A 3AWOA 3TMQA 3KXQA 3WD4A 2ZVIA 1QCWA 4PMUA 2ZUMA 4P7NA 2QCDB 4O17A 3CYVA 1UJQA 3U4AA 3OIHA 4RDVA 4M8UA 3I6EA 2YDRA 4U5IA 1LG2A 4AD1A 2F6XA 3N04A 2VCAA 2YIHA 1ISWA 3ZVHA 1DYSA 3EX3A 3LNMA 2ATSA 4LXFA 2ZUWA 3T09A 3OLIA 1EP2A 3VOIA 1WDQA 2ZZ3A 3C3UA 1IR1A 4RDYA 4K6AA 1EDGA 4PL1A 4JDYA 1FXPA 2FTWA 2IKGA 4OV4A 2CERA 4AD0A 3V7PA 3UPMA 1OGGA 3UWYA 3B9AA 4WGXA 1A0CA 4XISA 2DH2A 4W7WA 4WK9A 3E96A 4C60A 4AWSA 4GVHA 2QPUA 2EG7A 3USBA 1XIMA 2DT2A 2O55A 1Q6FA 5HDRA 3KTSA 3W1RA 1QUMA 3PTDA 3W1TA 3SCOA 1TWWA 4K37A 1BGAA 4BQ3A 4UFIA 2DT3A 5G5IA 1UPMB 1X7IA 3JRKA 1J8VA 1A0DA 1FKWA 4Z1YA 1T8XA 1JDDA 1UZDA 3P0WA 4J3XA 1XJBA 5HWMA 1F3XA 3F5LA 3MWAA 5FF4A 3MDWA 1GKRA 3PANA 4NP7A 4DJFD 1U1UA 2WNZA 2EG8A 4PC8A 3QYQA 4Q8MA 5TIMA 1MW2A 1OF6A 3EWXA 1UR2A 2PD5A 3FJNA 4YHEA 1XSJA 1MQPA 1YDYA 2F2KA 5C2XA 2QIWA 3RDKA 4KWUA 4RDWA 2YA1A 3C8FA 1A50A 1TV3A 5E70A 3QGVA 4ORMA 4DJFC 3FGCB 1ISXA 3HPAA 3FAXA 2R91A 2CU0A 3CZKA 2C16A 4EVZA 3KRBA 4MZ8A 3ZVIA 1Q4WA 4OVXA 3DHFA 3HQ1A 5AECA 4CQDA 2DORA 4JTFA 1UC5A 3WLMA 2E67A 4HNUA 1RV8A 3ONCA 4Q8TA 2E6DA 4MZYA 4JNYA 3DGBA 5A6LA 4RJEA 1FA2A 1YBQB 1TIWA 4MG4A 1V6WA 1AVAA 3EOEA 1PX8A 3FYPA 1ZAIA 3N6HA 3NL5A 3UT0A 2CHNA 3D6NA 3IK4A 4MB4A 1PX3A 1EOKA 3SUWA 2OU4A 3GR4A 3N6QA 1RQEA 5DQPA 3IJLA 1TJ1A 4JX6A 4ACZA 1HKIA 1C8QA 4GXMA 1QHPA 2B7QA 4Y96A 1KB3A 3LRLA 4IFKB 1BLIA 2VR5A 4I3GA 1BGGA 1XSKA 2OODA 1SZRA 4B5WA 2OWWA 3LSCA 1FDYA 3BCFA 3N73A 3BGAA 2IS7A 3S1XA 5B7YA 1MDLA 4ZB2A 5A8NA 1Q3NA 2XIMA 5C9RA 2D2HA 3NURA 1QAPA 1UROA 2HISA 2A21A 1G4PA 3VKAA 1CLVA 1F2JA 4IIFA 3HQNA 1MEHA 4O50A 1H0IA 1E9LA 1NQ6A 4HVXA 2EJAA 2C14A 1M03A 2PWVA 2O9TA 8A3HA 1WXJA 1RY0A 3ISIX 3KZPA 3CV1A 1VFTA 2RJGA 3EWBX 4QG8A 4Y90A 3TJ4A 3GD6A 1JQVA 4HA1A 4PGLA 5CQ1A 1E4LA 1RBOB 3ATZA 1EYEA 1JCTA 1GVFA 1V51A 4JHOA 3PPGA 3FVDA 5FJTA 3D3FA 5K4ZA 5HQLA 3OVPA 3OODA 3M5ZA 1FH9A 4QEEA 2XZ7A 2Y85A 1FHDA 3LLDA 3NYDA 5FF2A 1CX9A 5KTLA 1TTIA 1XLFA 3PB0A 4UQDA 1NWRA 5REQB 4E4UA 2CIPA 2WC3A 4LV9A 1I8JA 1HF6A 3GIQA 5HJXA 1FWTA 4MTVA 1T6MA 4UFMA 3RU6A 3ZR6A 1ZB5A 2ISFA 4H2CA 3WQPA 3RF9A 2VDIA 4IJCA 4NG3A 3UEQA 3GH4A 1K70A 1C9WA 3R11A 1KBLA 5K9CA 4Q6JA 1LT8A 3CQHA 1R85A 2KZHA 1AK5A 2BOEX 2W6RA 1WDWA 3UG3A 4GVGA 3Q2DA 1Q7MA 1XBYA 5LIKX 4U10A 3WQ4A 4GY7A 4GCXA 1TVNA 3RITA 2D0GA 4H41A 1JPHA 4RK8A 4HK7A 4I5XA 1QPQA 3ZT7A 1F9CA 1GQIA 4TU1A 2QAPA 4AEFA 3QGKC 2EXOA 2Y8UA 4PFMA 5M2FX 3ARYA 4NYUA 2WHLA 4GYJA 3IAPA 5DBTA 3VDGA 4C6LA 3LLXA 3WQVA 1TWDA 1YE6A 1CT5A 2I5QA 1H51A 2YDSA 4AIEA 4N7QA 2ZE0A 3G1AA 3WUGA 5BNKA 2V5JA 2AL2A 2IKJA 1TV2A 1B3WA 1YIXA 2OEJA 2PWUA 4ML9A 4WSKA 3PZQA 4BQ2A 5A8QA 2QPSA 1E72M 1HUVA 1T41A 3G1RA 4GWEA 6REQB 3RHGA 4JYEA 1QOXA 3I10A 1M7JA 1F3EA 4FNRA 1J6PA 3M0IA 2WCAA 1U5JA 2J7GA 1IWAA 4F0LA 1OEPA 2OTDA 4Y7EA 4HTBA 4D1JA 1T96A 1WKEA 5LA0A 3SUTA 4AY7A 3W26A 2WSQA 1E9YB 2FKPA 4XBJA 3PJWA 3N18A 3VAVA 1C3FA 3WENA 3OYXA 4QLKA 4BI7A 3G18A 2VFHA 2QUVA 3WLHA 2NQ5A 4JGDA 4DLFA 1K02A 1B3OA 3TA9A 1Q6DA 3ZOAA 4B92A 3DGRA 4ERIA 4ZO7A 1XD1A 4QS6A 2YL5A 3WD2A 1UC4A 2TMDA 4H00A 1EHNA 1L6YA 1P7TB 2V2CA 1VAHA 1RK6A 3BVJA 4IP7A 4O12A 2DEPA 3ZT6A 3SIZA 1ZJIA 2GUUA 1SVDA 3REQB 2PLMA 4EOUA 2VQTA 4GZIA 3SR7A 3MUIA 5C0QA 4A8NA 3S6OA 2HSAA 2IUZA 2GJNA 5AC7A 4NIRA 1AH0A 4DF2A 1VFOA 2PDWA 2J9ZA 1FCUA 3DFOA 3SDOA 1IZCA 2PDHA 1WBHA 2CLMA 1KW1A 2ZX7A 4Q3MA 3OQ8A 4OECA 4JTHA 4NU7A 1UKSA 3W86A 1N82A 2VI0A 3SW6A 4ZZ9A 3SGUA 3L4VA 3IAQA 4FOJA 3VVGA 1W3JA 3E5BA 3S5YA 4ZE5A 2V68A 8TIMA 3MBDA 5D04C 3W07A 2X09A 4KFPA 5DMMA 4PUNA 5DANA 2VWSA 4ZMGA 1E0VA 3A3XA 3H23A 1V7YA 4NSBA 3PR2A 1EBHA 2G96A 1FWDC 5A6BD 1KTBA 4W4QA 1MNSA 1VPQA 1SFSA 3N17A 4OBTA 2PS2A 3VTRA 1A5CA 1GEQA 2OEKA 3PG9A 4L1GA 3QY6A 3P0XA 4B2DA 3TW9A 3R89A 2E68A 2PP3A 4KQNA 4IMAA 1HFBA 3EPNA 1FP8A 2CKRA 1W5NA 3OLEA 3TK7A 1JCXA 2B7NA 3NJ3A 3O7UA 1J2BA 2E8YA 3DKLA 4H83A 1I75A 3IK2A 3SCPA 4HNOA 2HK0A 5GNYA 3CM4A 2WZIA 1PIGA 3A22A 3CBWA 3W6LA 4WKAA 2C79A 5DMYA 2CZFA 2VX4A 2DZBA 2WQDA 5IHSA 2BY2A 1GORA 4DUVA 4DWSD 5I3FA 1VJZA 1I0DA 1H60A 1QBBA 2EO7A 3ITVA 5E93A 3GDBA 3DBPA 1A5SA 1ZGDA 4DWSC 5IFPA 5JH2A 1UR0A 1HJQA 3QSRA 4GIAA 4A21A 2FTYA 1G7VA 2CEQA 3ME3A 1XPGA 2P8CA 3S2CA 1RCXB 4BF7A 1XQLA 4O13A 4RZ5A 3SCWA 3MJMA 4BEUA 2NQ9A 3GVVA 4X0VA 1R86A 1E6ZA 4OQVA 1JRBA 2W92A 4NJGA 2JBMA 1O4UA 1C92A 1O94A 1XG3A 2PRMA 4MKVA 3WDQA 3UXIA 1TJ2A 2CESA 4J3UA 3CASA 1PKYA 2E5CA 4HBKA 5T9CE 2OLSA 1WDRA 1ML1A 3M0LA 1UCWA 4NYYA 3WF0A 5I3HA 2BVYA 1GHRA 1J11A 5EYWA 4HNVA 3TX9A 1ME8A 2GQAA 1KM1A 3AMKA 3C3NA 1IF2A 2IKIA 3OVGA 5CCZA 2B7PA 1DEDA 3PZTA 2I16A 3BC9A 1HG3A 5HMSA 1TPEA 2NQJA 4TV6A 1J2WA 1DQXA 1ZNNA 3ZJ7A 1AQ0A 4HHHA 4UZUA 3H8AA 2WMIB 4LQ1A 2PDKA 2XDFA 4FIQA 1W1TA 4Q7BA 3KWXA 4LALA 4UNKA 4D1IA 1YNYA 4FR6A 2ZDRA 4WVXA 1Q85A 5FI8A 1CDGA 2INZA 2D69A 1P0BA 3HPSA 3OQEA 4PUKA 1B4KA 3NQBA 4PZVA 3WNNA 2JE8A 1JNDA 3PWGA 1WUFA 3W1PA 2Z2AA 4QLJA 1R3SA 1VHNA 5AVNA 1S5WA 3SQMA 2VGGA 3PWAA 3WKZA 4B3LA 1D8WA 3D0CA 3CV2A 2I17A 3CZ8A 4LUSB 3WLKX 3W82A 3SRFA 3UXLA 1KFEA 2PMQA 2ZA1A 2DZXA 4I5UA 4FF5A 2J9XA 3T2QA 3GHRA 1YRRA 2XGBA 4RPQA 3LDVA 2J74A 4JTAA 5HR7A 4FX6M 4R27A 2QVHA 3MC5A 1CECA 1XICA 3KM8A 2FGLA 2OGYA 3P81A 4NKCA 1XLHA 4P61A 4EF9A 3EEZA 2F84A 3VX0A 3CK5A 3AXHA 4D72A 1KXHA 3M6DA 3RR4A 3DZ1A 2QVNA 4PMNA 1VB9A 3PFMA 1R7OA 4UQ9A 1HX0A 3WLJA 1QI3A 4GYKA 2GVJA 2HWGA 3IPWA 1HJXA 2C6QA 2V0TA 3UJ2A 1XC6A 3UR2A 5HAOA 4NZ3A 5G1TA 4QFUA 1OZQA 4PUWA 1JPMA 5K4XA 2V5BA 3GW3A 4JHMA 4PTNA 4ZB5A 2G50A 3G0SA 4PMZA 3AALA 1EJ7L 1JDFA 3NWRA 3DFPA 4WXZA 1J96A 4WX2A 3HA1A 4IJBA 5CPOA 2WHKA 3KVJA 2DV0A 3TNBA 3QF0A 4HPNA 3GVGA 2GYIA 5D37A 2W62A 2WYSA 4GC4A 2GL5A 4HU3A 5A94A 4MJZA 2XFWA 4IXXA 3GNNA 3UG5A 4Z1BA 2Y8VA 3V5OA 3ZMRA 5L6UA 4Q32A 5HANA 1XRSA 3VKCA 3O16A 3H12A 3A13A 4B4HA 2HK1A 1UKOA 3I6RA 4WXYA 4LWWA 2D24A 4ECLA 3N9SA 4TVUA 4WD0A 4XVEA 2FGZA 4NZ5A 3MPGA 3M0KA 1R2TA 1UMLA 2V6AA 3LHUA 2J79A 3KRUA 1J0JA 1SR0A 2C0HA 1DJYA 4Y9NA 3S9YA 4X9YA 2J47A 5CBIA 2WOQA 1FY6A 2DW7A 3VDAA 5DRIA 4ZTYA 4O4WA 3A6OA 2XN1A 1W8SA 3W2UA 3GXDA 2NUYA 2QJNA 3L66A 4CVWA 4ZR8A 4FP1A 1E40A 4DF0A 3FW6A 3STCA 1V03A 4C7FA 1TVLA 1K9EA 4GKTA 2VEIA 4HZ8A 4L56A 1J0HA 1K9DA 5BMXA 3KVMA 5DFAA 2HZGA 3GG8A 5DELA 4DM1A 2QDHA 4EWJA 2Z1WA 2OELA 3B03A 3TWBA 2OWCA 3WFZA 3W7PA 1KCXA 1QI4A 2CBUA 1OT1A 2EG6A 2J6VA 3G6MA 3OLGA 3WMCA 4YL2A 2GWGA 3EPOA 1WDDA 3URBA 5FEWA 3RJXA 3H2EA 3FN9A 1LOQA 3NQDA 4WDTA 4QHRA 1KTCA 3NDOA 4U5KA 1ICQA 1KC7A 1RXOB 4CQ9A 7XIMA 3AXKA 3NFUA 4OFCA 2YDAA 4F66A 4GI8A 2VCBA 3QN3A 4X3ZA 4A22A 1VBJA 5CSUA 1YW1A 2HEJA 3PBGA 2BTMA 1VH7A 4R3UA 2Y24A 4X22A 1TVPA 2X2GA 4GJ1A 4AMCA 1LLWA 4Z1AA 3NQ7A 4QAWA 4Q8VA 3B9OA 2C1HA 4JFTA 3A9BA 4H6KA 3QV7A 4F40A 2GOUA 2CXEA 4Q4MA 2PGEA 4Z2HA 5C9UA 1MW1A 2R14A 5CC5A 1E71M 4PRRA 2WNQA 1JCJA 1P4CA 3E9AA 4C91A 3W88A 4RNJA 2Y7GA 4MLJA 3FOKA 3THAA 3IJIA 4N6EA 3HF3A 1DWFM 3CQJA 2W91A 3UWZA 5LXEA 1TZZA 4YN5A 3N13A 3CGTA 2DJXA 1JDAA 3BCJA 4L4LA 1A80A 4B3ZA 2YJQA 3R12A 4CEUC 1Z41A 2V5LA 2P10A 4GPNA 2PWGA 3O6AA 4BY3A 4GE8A 4IPIA 4CNOA 4YTRA 4IIGA 1ZPTA 3EWDA 3URAA 3CQIA 4AZGA 5DBUA 1KKOA 2EJ1A 5BMWA 2UY5A 1K9FA 1UH2A 2QHAA 1ITQA 3VIPA 1HZYA 3W25A 1XLLA 4OE7A 3BMWA 3T40A 3ZFHA 1BWLA 5K7JA 4ZXLA 2CWXA 4LBUA 2A3LA 2WBGA 3SBFA 1M65A 1NSJA 3B8VA 1EQCA 3BLEA 1QI5A 4J3ZA 3EDKA 5CG7A 1AQMA 1SFLA 3UGVA 2W27A 3W1QA 3SUVA 1NOFA 3WY1A 5HQEA 5ECVA 1ZALA 2G0WA 3G1HA 5D05A 3TR2A 2NLYA 1IWBA 4X2RA 3W6YA 4GQRA 3M0YA 3S0CA 5H8UA 1JQXA 1EC8A 4DUWA 1Z3NA 3BOFA 1H0GA 3AICA 3BV4A 4NZFA 3WBEA 3LV5A 3VM7A 1PTDA 3EMQA 1TPVA 3KHJA 3W53A 3EOSA 1XIBA 4MWAD 1UB3A 4JIHA 3GQYA 4M6UA 3L21A 3U48A 1KFJA 2H3BA 5G2HA 1PL9A 4JCMA 5LNUA 1QPNA 3WSUA 4PMJA 2CC0A 3IWPA 4XTDA 2IPWA 2ZA2A 2W5FA 3IIVA 2Z1SA 1WAUA 4L4PA 3AISA 4MWAC 4OKDA 1KLYA 4DLMA 1YHTA 4JTKA 1TG7A 4QSHA 2X0YA 2NV2A 1LUCA 3EWCA 1US3A 2Q09A 3VFLA 5FESA 1OINA 1XRTA 5EL1A 2Q8XA 1W5PA 3DX5A 4F2BA 3NO5A 4PFHA 2ZZ6A 4DPPA 1PS9A 4ZOCA 1L2QA 3MI2A 3WJYA 1LM1A 3TROA 2R1NA 3L2LA 2ZXQA 1H50A 2DY3A 2YDQA 4YWSA 1JJKA 1GGOA 1LLZA 3HZ3A 2VR2A 4IPJA 1KKRA 2CLHA 4M7SA 4Q4SA 4A3RA 1ZZMA 5D9NA 1MRAA 4JOMA 2VEFA 3M64A 3UETA 3LCWA 3K30A 5I6SA 4ZVJA 4AIBA 1SO4A 4HB7A 4IMFA 4NJHA 3CMJA 4OBRA 3LY0A 3MO7A 2J6XA 3IGSA 2WSPA 4KCUA 4PMRA 4DZHA 2W67A 2YCJA 1VR6A 4A2SA 3A24A 1TQXA 1EGMA 3A9IA 4QTGA 1ZCOA 4ZQCA 1KXVA 3ES7A 4A3UA 1LQAA 4UQAA 1QI2A 3KDNA 2ABAA 3VNDA 1E1CB 2PC8A 1RD5A 1XS2A 3LV6A 5DF0A 7TIMA 1MMFA 3SN0A 3GVWA 3ABOA 4FHAA 1QO2A 3KS6A 2XH2A 2O56A 3EA1A 3QTPA 2JQXA 3EBVA 3L68A 1SUXA 3GK0A 4LV4A 1HL2A 1E43A 3ERPA 3KVLA <