3QC3A

Crystal structure of a d-ribulose-5-phosphate-3-epimerase (np_954699) from homo sapiens at 2.20 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
225
structure length
225
Chain Sequence
GMASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ribulose-5-phosphate-3-epimerase
publication title Crystal structure of a D-ribulose-5-phosphate-3-epimerase (NP_954699) from HOMO SAPIENS at 2.20 A resolution
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 60
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qc3A00
4UNKA 1DJQA 2A1YA 1K8XA 3M16A 1ME7A 5T26A 4C1LA 5LGZA 3NPUA 3QPYA 3W83A 4O14A 1SW3A 4A22A 3MO7A 4KKXA 5CPOA 3P81A 3TQKA 1KLZA 3IVUA 3HGJA 3TAKA 1B57A 3G1YA 3L0NA 1CI1A 1ML1A 1QNVA 3EWZA 5AYYA 3C2FA 2E6FA 4ORIA 2EHHA 5FF7A 3LHYA 2ISWA 1DQXA 3Q58A 3BLEA 2WSYA 5U4NA 3NVTA 1OK4A 1T0OA 3OA3A 4WJEA 2QUUA 1X1ZA 1B4EA 3KXQA 1L6SA 4FIQA 3QM3A 4O16A 5I3JA 5LNUA 2XFWA 3HG3A 4ZQPA 4AAJA 3RNDA 5AHNA 4NJIA 3F1QA 3C0JA 3HJZA 4UNLA 4Y6GA 5C5YA 4LOCA 3QQ1A 2P1FA 3C8FA 1OX6A 1YXDA 4UTKA 5D09A 4N9BA 2QJHA 1FX6A 3TE9A 3UWZA 3MJYA 2C14A 3HIJA 4EF8A 3WK2A 1ZNNA 1FXQA 4N02A 1PHWA 3NQ7A 3S6DA 1SZFA 3C2OA 1S5VA 3TXZA 3VKJA 1H1ZA 4I7WA 2JKAA 4K38A 4CNNA 4UTTC 3O07A 3LBMA 3LDVA 4O53A 5D2XA 5C54A 5KZEA 5G2HA 1K02A 2E09A 2YSWA 4B5NA 1PCKA 3W1MA 3CWOX 5DBUA 3KRUA 1F05A 3BPWA 5L6UA 2FB2A 3G1DA 3FFSA 3GNDA 3RU6A 4UTTA 4UFIA 1TTQA 2FLIA 5FF0A 5K9CA 3S1XA 1FDJA 1OABA 4A3UA 3ABQA 4O0ZA 3G1VA 4O17A 3M0ZA 1EP2A 4AXKA 3LHWA 1UUOA 2ALDA 1MEHA 1H50A 1SR9A 3CM4A 4A2SA 4MZYA 1F73A 1LOSA 1K3UA 1TQXA 3G3DA 4BI6A 2Y6ZA 4U28A 3MI3A 4O1DA 2VFIA 2CU0A 4XBKA 4OWGA 1O5KA 5AHIA 2VFFA 5KINA 3M44A 2QCFA 3O05A 2HSAA 2Y62A 3I7SA 4R7JA 1ZFJA 3N9RA 5AC8A 5BMXA 3RLVA 3UPBA 3ZWSA 2V5BA 1XM3A 3W7GA 4UXDA 2C6QA 3N2MA 5CGQA 5HMSA 2A6LA 3GYEA 3G8EA 4LRTA 1BKSA 3G8RA 3LBCA 5FEPA 1W37A 5LNWA 1H7PA 4HNVA 3EB2A 5EPDA 1EUAA 3ZWTA 2E68A 1AL8A 3C56A 1GVRA 3G22A 3W1PA 4DF0A 2V9DA 3UD6A 1DQWA 2QJIA 4DXVA 3TMQA 3LHUA 3TW6A 4LC6A 1NF0A 3GVGA 4LUJA 3QMTA 2NZLA 3PUEA 5G1YA 4LC8A 2E1DA 2NWRA 4O18A 3VI2A 2OT0A 3LCLA 3OIXA 1TRIA 2C18A 1B9BA 1WBHA 3NL6A 3P8JA 3IIZA 1DKWA 5BOOA 5K3VA 1GVFA 7TIMA 1SSGA 4AF0B 1UCWA 1IXPA 2WSQA 1KFKA 4UR8A 3STFA 2A5HA 2AGKA 3N2XA 4JTJA 4UUIA 3P5ZA 3U6WA 1J4EA 3TU9A 4GBUA 4K6AA 2E6YA 1VZWA 3LM7A 3W7QA 1T96A 4DBDA 5EYWA 4M7SA 4AHPA 3DKLA 1W3IA 4NJJA 3DKJA 3UWVA 3I7RA 3NL2A 5AFDA 2EF9A 3STCA 1XDMA 2HMCA 3LCHA 3AO0A 3GX9A 4M7TA 3HG2A 5G4WA 3TXVA 1O4UA 2R8WA 1FDZA 4XQ6A 2WNQA 3G0XA 1TIMA 2J6XA 5AHMA 4GFSA 4MYXA 1AMKA 1GT8A 4JTGA 1QDSA 3IEBA 2ATMA 3R5EA 4NJGA 5F1VA 2NXHA 3LHZA 1Q3NA 2J24A 2QCDB 2VEPA 1P1XA 2B4GA 2HS8A 4LY8A 4NJKA 3W7JA 4ICNA 1R46A 3EWYA 3M6YA 1TPC1 2LLEA 1ICQA 5EA9A 4FNTA 3PBVA 2J9XA 3SW6A 1A5SA 1VYRA 4DBEA 1KW1A 1AK5A 3HB9A 2P0OA 2H3BA 3CLMA 2YFOA 3N19B 4JTHA 1VHCA 2QUVA 2R94A 2EGZA 3FA5A 3CEPA 3W75A 3R89A 4LVAA 1X8FA 3WJYA 2V2CA 3HMJG 2CFFA 1WXJA 3N9SA 3NQFA 3PB0A 4KWVA 3NM3A 3N3MA 1XBVA 2B7OA 3FYPA 5D30A 3QW4B 3S5ZA 3T55A 3G1XA 1L6YA 5D03A 1P5BA 4CQ9A 4FNPA 3MWAA 4LS2A 4Q4KA 4EWND 4O10A 2C0AA 2ZZ6A 5FEXA 1HG3A 4E2BA 3GB6A 1BWLA 1T8XA 2GUUA 2Q8ZA 1MXSA 5FI8A 3M1ZA 3E49A 1KA9F 4AF0A 3KVKA 2FFCA 1QCWA 4RK8A 3W1TA 4PC8A 2ISSA 1HO1A 4LTSA 2DZPA 1W8SA 2D73A 4AWUA 2GPTA 3ANYA 1I2RA 1LORA 1ME9A 1TSIA 3PBWA 4GUIA 4FX8A 8TIMA 1OFRA 3IGSA 5HR7A 3GXTA 2YGYA 1OG0A 1CX9A 3TJLA 5F4SA 2I14A 2Y70A 3KFTA 4P61A 3S1VA 2JKEA 4NNCA 1H7OA 1GG0A 1N55A 2WV8A 3PF3A 2QCMA 3HPZA 3DFOA 5LNSA 1A50A 5H2ZA 1WX0A 1M7PA 4BI7A 3W2LA 1DHPA 1KM2A 3GDMA 3NQVA 2QEZA 3CQ0A 1O60A 1FWSA 3O63A 5KZMA 3FOKA 3M5XA 3DHDA 4N9EA 3M5YA 4AH7A 1A5BA 2QCDA 4DO4A 3L65A 5CPNA 4H6KA 3BG5A 1F6PA 5LHFA 2E6AA 3NL5A 1G4EA 1YTEA 3FS2A 3VFLA 3T40A 3PG9A 1GEQA 1THFD 5F2LA 1A53A 1Q6LA 1VJIA 2GVGA 2NLIA 2OCZA 3OVQA 1YTDA 1FCBA 4MZ8A 1DORA 3LLDA 3OG3A 1W56A 2WPBA 3L66A 5E0KA 4ZQRA 2ZRXA 3IV3A 3HG5A 1RQHA 1QPRA 3STGA 4TO8A 5D38A 3W7OA 2CLIA 3ABSA 3G3MA 4QQ3A 1C29A 3C6CA 1QOPA 4UR7A 5DY3A 3RK8A 2E5BA 2A2IA 3LB0A 1QWGA 5D2YA 1BWKA 3I6RA 4PL2A 1K7XA 3JR2A 4MLRA 1TMHA 2X1UA 3LXAA 5AOUA 5AYXA 1KFEA 5CKSA 4H4IA 2PRHA 3PC0A 3OBKA 3U2OA 3MHFA 1Q6OA 2C3ZA 4POCA 4X22A 3A5FA 2ZFAA 1FCQA 1HFBA 3HO8A 4ORMA 4A21A 3YPIA 1XI3A 2GVLA 4GWEA 3L5AA 4OV9A 3G0SA 3R2GA 3T7VA 4Z1CA 4IJBA 3BARA 1TTJA 3W1UA 1W5QA 3THAA 3W7EA 2VFDA 2PRLA 5HWMA 3LCXA 1EWEA 3I68A 5I3KA 5CZ0A 3C3NA 2H8XA 1LLZA 1EEPA 3C2EA 3WJSA 3O6YX 3G24A 4FX7A 1YPIA 1SQ7A 1SO5A 2H6RA 2WSRA 4PL1A 4GE8A 4WY0A 3O6CA 4O12A 1FWRA 4TIMA 3FLUA 1I8JA 3P61A 3EEGA 4JD4A 1DV7A 5E1QA 3A23A 4QNEA 5C55A 1JQVA 4XTDA 3W1RA 3LERA 3OHIA 1QMLA 2ZRZA 2A4AA 3P80A 2VOMA 4GUFA 3E9AA 1IIGA 3EXTA 2OT1A 2ZYFA 5G5IA 4C1KA 4RR4A 2V82A 3N34A 4N9CA 4JIPA 5LHEA 1MZHA 1VR6A 1DOSA 1IGSA 1YDNA 1QO5A 4QSHA 4LNYA 4ADSA 3BO9A 3W86A 2CZFA 3QEZA 3BGJA 3NQAA 5CZJA 5K2ZA 5D37A 4Z0JA 5F2GA 3DI1A 5F4WA 1VS1A 3MHGA 4WXYA 4HKPA 3H54A 4BF9A 1S5WA 2OX1A 1U83A 1MSSA 3PS7A 1W3TA 5D04C 3KVLA 3V75A 2Y7DA 4JX5A 4UTLA 4JDYA 2QUTA 3O1NA 3E96A 3LHVA 2C1HA 1YXCA 4ML9A 1KBIA 1WBJA 1Z48A 4O4WA 1RPXA 4E0CA 3B04A 4UMAA 5A5WA 1IXQA 1LZOA 3PAJA 3L2IA 2RH9A 1QFEA 3NDOA 2X1TA 1TRDA 4UIOA 3DBPA 2YXGA 4ALDA 4JGDA 2Y61A 1OHLA 3W2UA 4ONVA 4IXXA 4LV9A 3ABRA 4DO5A 4YL2A 3LI0A 3KX6A 3TFCA 2BLEA 2Z1BA 3MP5A 3UNDA 3B0UX 2JGYA 5MHBA 1TCDA 2Y89A 4DELA 1H51A 2GJLA 3GLCA 3SECA 1YYAA 5G1TA 4CCDA 3BLFA 4LS0A 3RF9A 1UB3A 3W71A 3KOFA 2WNZA 2E5DA 2BXVA 4M19A 1TTPA 5D02A 3FEMA 3SFKA 2VEIA 5D32A 3TNOA 3NYZA 1X6UA 3NQ2A 2E6DA 2J9ZA 3M41A 2H90A 4LVDA 4NU7A 3LX9A 3DH7A 4JX4A 1SW0A 3S1UA 5DY2A 1EB3A 3N73A 3G18A 2ZBTA 4HSNA 1G4SA 2X1RA 4GXMA 1OFAA 3P82A 1VC4A 3V1PA 1GVQA 1R47A 3W3OA 3IVTA 4LV4A 5EY5A 3C61A 3NPWA 4K8EA 1ZCOA 1DJNA 3KHJA 3NQ8A 3QSRA 3S0CA 5BNKA 3NQGA 1C9DA 4QITA 4JTKA 1OF8A 5F2IA 1JCYA 1KLYA 4Y96A 2AAMA 4IMFA 1QOQA 4NNAA 4K8HA 4WZHA 4I7VA 1XCFA 2WKJA 4JTFA 1IF2A 1JUKA 1YTKA 3WJWA 4BK9A 1FWNA 1VHNA 1AW1A 4QJ1A 2V2DA 1VLIA 4PTNA 4UTUA 4HT3A 2ZRWA 3TV8A 3UY8A 4N6FA 3LTSA 3L0GA 3STEA 4Z1BA 2DZTA 1K8YA 2A6NA 2YFNA 2DZWA 4FEZA 4R33A 3R13A 4E2DA 1R2RA 3GIYA 3ZR4A 5EKYA 1MEWA 4S2BA 3M5ZA 2VC6A 1H61A 1H7NA 4LT9A 3FKKA 4WUIA 3EX4A 1O95A 2YYUA 2V5LA 1SZEA 3UY7A 3SY5A 5DCDA 3M5VA 1YADA 1GPWA 3O06A 3EWXA 1GWJA 3W7MA 2ZZ2A 3L67A 3SSJA 4O1AA 2V2HA 3TFXA 1FCVA 3G1SA 4QNWA 4WX2A 3W74A 4K36A 5D2VA 3GR7A 2NUWA 1JQXA 4O4VA 1LM1A 4HNNA 2GVJA 1EP1A 2JBMA 3TR2A 3QMRA 2X2GA 4ZZ9A 1G67A 4PODA 3A22A 1UASA 4LVGA 4W9TA 2Z2UA 1D3HA 1WOAA 3THQA 4JTSA 3QC3A 2NXGA 2VEKA 1I2NA 5IM51 1XKYA 4M6VA 2NX9A 1XBZA 1RR2A 4WQ6A 3UWUA 2A7RA 3PWAA 4XZ9A 4OGZA 3W88A 1IXOA 3T78A 2CZDA 2ZA3A 3NQCA 2ABBA 3MBDA 5CPLA 1T99A 4H3DA 4IPJA 3BW4A 1XFBA 1KM4A 3GDRA 3ATZA 1GZGA 4DEFA 2DJXA 4MY1A 3W2MA 3QQ0A 2Z6JA 3TDFA 2GQAA 2C19A 2VEMA 1EX5A 4FXRA 1W1ZA 3QPZA 3SZ8A 3TROA 4Z1DA 4XKYB 4N6EA 3OVRA 4MKNA 4FIRA 5HUOA 3JS3A 1OFQA 1U5JA 1K7EA 2ZZ3A 3WK3A 1RZMA 2VFHA 1H7WA 4NVTA 5F2MA 3MP4A 3B06A 3NAVA 1KM1A 1GYLA 1YPFA 3E12A 1KFCA 1SO3A 3S5YA 1JCMP 5D2WA 3SIZA 3W76A 5LNVA 1JCXA 3TIMA 4ZMGA 3W22A 3HBLA 4MPQA 5G4EA 3B0VC 4JTTA 4NX5A 4QM1A 1FBAA 3L5MA 4UMBA 3VCRA 4JYDA 5IBXC 1P0KA 4JTEA 2H8ZA 5D2TA 3NQMA 4HSOA 3W72A 1D3GA 2RHGA 5EBUA 4R53A 2G97A 5AYZA 2UV8G 4L4MA 1N8FA 2Q8LA 2I9EA 5I3FA 4FNSA 5IBXA 3W7LA 3KAOA 2E5CA 4CCEA 4Y90A 1M6JA 2TYSA 1YXYA 4IPIA 4G1KA 3NA8A 4DO6A 1LYXA 3NPVA 2Y7FA 1F76A 4N2YA 2EKCA 4TMBA 5AHFA 4GRSA 3EX6A 4RZ5A 3T4CA 2QDHA 5HR6A 5A8GA 4JICA 2WOQA 2VFEA 4GC4A 1P0NA 3CB8A 2QCCA 3NZRA 3TSDA 4CQ8A 1G4PA 1YDOA 1NEYA 1WA3A 1LROA 5KMYA 1LOLA 1UBSA 3FJLA 3PVFA 1IXNA 1H7RA 2QAPA 2A21A 5DELA 5FESA 5K7JA 5HQEA 2CLHA 3DAQA 2CW6A 4FB7A 5KITA 3GKAA 1HO4A 2ATSA 3U8GA 4OBTA 3TW7A 1JVNA 1XUZA 4RCXA 1OFBA 2AQWA 5HWJA 5K4ZA 1F2JA 3BV4A 4WY0F 2A7PA 1F5ZA 4IMDA 4LVBA 2GOUA 1H62A 1WAUA 4XKYA 3SI9A 4IMCA 3ZFHA 4AB4A 5K4XA 1XBYA 2G96A 4WY0B 5AB3A 4O19A 5SWUA 3LHTA 5H91A 3NEVA 4P2VA 1S5TA 3BK0A 1BEUA 4MY9A 5DXYA 3GNNA 1H5YA 3DFNA 4MJMA 4RLIA 5AN7A 3HPXA 3PB2A 1VRDA 2ZZ4A 4S2CA 1TPFA 1UUMA 3MW7A 4EOUA 2B7PA 1W54A 3MMTA 3PM6A 1ICSA 3NQ6A 3HQ1A 5HNRA 5FF3A 1DL3A 4RV8A 5KZDA 3TSMA 2XN0A 1TPEA 3RFAA 5EL1A 2Y88A 3FKRA 4HHPA 2OZ0A 2VFGA 4I9AA 2NX3A 3W1LA 3OVPA 5DCBA 1ICPA 1JJKA 1FCUA 1X7FA 5FEZA 3P8IA 2YPIA 3QF0A 1TB3A 3M43A 2HTMA 5U7SA 3TMLA 1B4KA 3W7HA 4EF9A 2NUXA 1O94A 2V8ZA 3O16A 5AC7A 1SPQA 1TV7A 2ZA1A 3GXPA 5ABTA 2FDSA 2ZRYA 2YYTA 3A24A 2R14A 4BI5A 2CLLA 3TC7A 3W7KA 4JTIA 1WOBA 4AHQA 3W9ZA 1ZENA 1V5XA 4R34A 3PSVA 1TV5A 2ZDRA 5D05A 3W1AA 1WQ5A 4JN6A 4DF1A 1OYAA 4AEOA 3FJ6A 2Y85A 5G2WA 1VCFA 3UPWA 4O0KA 4ADUA 1I4NA 4ZQCA 2ZRVA 1OVDA 3UZJA 2ZRUA 2RKXA 1H63A 5TBOA 2KZHA 4ZVJA 4S1FA 4YCOA 4QIUA 2QCNA 3HPSA 1I2PA 3EWWA 3W1XA 3W6YA 3TUUA 1SFLA 4MIMA 3C2VA 4DF2A 1ALDA 4CNPA 4MZ1A 4ZQNA 1XC4A 2ABAA 4EIVA 5C2XA 4JXCA 3N14A 4N9DA 2VXNA 5AHLA 4UTMA 1KM6A 4FNQA 3S8HA 2J88A 2YCEA 4OQVA 3IIVA 3NO5A 3P5YA 3GAKA 3W7NA 1ZY9A 3NQDA 1W5PA 2NWSA 1A5AA 3BW2A 1QPQA 1ONRA 1OYCA 3TCEA 1W5MA 4LWWA 4UTWC 1OFPA 3BLIA 3S9YA 3FYOA 4DQWA 4UC5A 4OU1A 3EX1A 1LRNA 4HNTA 3O6DA 2OMAA 1TPB1 1K7FA 1TJRA 3P7YA 5DN1A 4RX0A 3SGZA 1QPNA 6ALDA 1KFJA 5I3GA 3B4UA 4LW7A 1W0MA 1VGAA 2X16A 5J5DA 2QR6A 5KTLA 4A29A 3SR7A 4UTWA 1ZAJA 1Z41A 5EMUA 3DENA 3QRHA 2A7NA 4UCGA 2ZZ7A 5AC6A 1O5XA 3RLUA 3DI0A 1GVSA 1S3HA 1VQTA 3L5LA 4IXHA 4L4LA 3W70A 1ZAHA 2QCEA 1KV5A 3D0CA 1TO3A 1TPH1 3TAOA 2RFGA 4PA8A 3LXCA 5F1UA 3BW3A 2YX0A 1G7VA 4KFNA 4RXFA 2ZTJA 4N4PA 4PH6A 3CC1A 4N4QA 4NT0A 5DCEA 3P60A 3NL3A 1KM5A 3PY2A 1IIHA 2WJZA 2ISVA 4MVAA 1OFEA 3W73A 1VLWA 5D33A 4BWLC 4AVFA 2TRSA 2VENA 3P62A 4O8RA 4YMZA 3DXIA 3DHFA 4HNUA 1OK6A 3DU0A 3W87A 5K9XA 2QCLA 3W7RA 3C4UA 2OJPA 2PE4A 4ADTA 2Y7EA 1NAL1 4BWLA 2B7QA 2VELA 2PCQA 5CZTA 1BTMA 2PC4A 5C6MA 2BX7A 3TH6A 2DZVA 4YWIA 1FUYA 2QCHA 3LLFA 4M5PA 3UWWA 2NXIA 3W07A 3LXBA 2CZEA 3QW3A 3CIXA 1G4TA 3G0UA 3LCGA 3C2RA 2J9YA 2XN1A 2ZZ5A 4JY9A 3W1QA 3LI1A 3GZ3A 4NNBA 3PSWA 4KFOA 2YDAA 4CLMA 4MOZA 1QPOA 2NV1A 4BR1A 2JKPA 3LTPA 1ZAIA 4LS1A 1KBJA 3UZ5A 5DXXA 3ABOA 3Q94A 4A2RA 2FPVA 4NZFA 1UJPA 3USBA 2BTMA 2DZXA 4EVZA 1K8ZA 4K39A 3T44A 1OYBA 2JGQA 1EWDA 3GXNA 4I7UA 3P67A 3TSBA 1TYGA 1PE1A 2Y7GA 3S1WA 3IVSA 2VKZG 3W7IA 4NQ1A 5DLCA 2C16A 4GUJA 1PS9A 3UWQA 3S5OA 1MEIA 1PIIA 4Y8FA 3TKFA 3PG8A 3B8DA 4NXSA 3W2KA 2YZRA 4GJ1A 2RDWA 3A9IA 4Z1AA 1JULA 4M6PA 3W7PA 2V0TA 5TQLA 1NF7A 4Y9AA 2ZTKA 4IUOA 3BGGA 1TPVA 2FB3A 3EXRA 1W5OA 3MYPA 1Q45A 4FF7A 3UXAA 3W1NA 2FIQA 4GUGA 3I65A 1L9WA 1NVMA 4RJEA 1HUVA 1KM3A 3CT7A 2BSLA 3L68A 3GDKA 4WOZA 2O7QA 2V30A 4UFHA 1M5WA 2QDGA 4NXKA 1SUXA 1AW2A 4RKAA 4TX9A 3HG4A 3TJXA 4IX2A 4JR5A 1SO4A 1TTIA 1Z42A 2TPSA 1TJPA 4IWWA 3GDTA 5AHEA 2CWNA 4MYAA 3MYOA 2CLMA 1JUEA 2R91A 1OFDA 3MP3A 2C15A 5DBTA 3S42A 1FY6A 4JIQA 1HL2A 3DFQA 3KRZA 4KWWA 3IRDA 2Q3RA 2DU2A 1JR1A 4AWTA 3W2NA 4O54A 1R2TA 1DVJA 3MBFA 2X1SA 4GUHA 2PURA 1L6WA 3QH2A 1LCOA 2B0MA 4GNJA 2V81A 1KFLA 3DFPA 1QO2A 1MO0A 4X9SA 4JTLA 1RVGA 2P10A 5G2IA 3NM1A 3VE9A 1PCWA 3CPRA 2BZNA 3JRKA 1G7UA 4WXZA 3A5VA 5LGXA 1R30A 1W5NA 2WNNA 3B0PA 4FX6M 1TPWA 3E02A 1VYPX 4FHAA 1VPXA 1B3OA 4UFKA 4LUIA 5CZSA 1ZHAA 4HPXA 1VCGA 4AMAA 1TREA 3CU2A 3HF3A 2QJGA 5CG7A 1OFOA 1F6KA 4UFMA 2CZ5A 2CLKA 2NUYA 3EXSA 3Q37A 2W79A 1EPXA 1EIXA 1M7OA 3BG3A 1X1OA 3CIWA 3LRLA 4M6QA 1SZNA 3F4WA 1WYIA 3W84A 2QAFA 1KTBA 3UQNA 4D2JA 2PRMA 3HGRA 2ZZ1A 2JK2A 4MFDA 2TSYA 3IIXA 3SGUA 2A85A 1Y0EA 2Q3OA 4OV4A 4O28A 2G95A 3UXDA 3GKFA 2DZSA 5TIMA 1Q6RA 4O57A 4UMCA 1I45A 4LRSA 3EX3A 5I3IA 2ZA2A 4Z0SA 3UYCA 5HJLA 5KSWA 1AG1O 3LCIA 3TQ0A 1SSDA 1WDWA 2YW4A 3NR0A 3QMSA 3A21A 4YXGA 1EP3A 5LSMA 3PUDA 1OX4B 1XDLA 4E38A 3EKLA 4JNMA 4ZQOA 1J2WA 3KVMA 3S5NA 2EAWA 4WD0A 1FXPA 2H3DA 4O1BA 2RDTA 2FJKA 2TMDA 3WFAA 4PCFA 5L9FA 4AWSA 4JX6A 3PBYA 3TK7A 1TV8A 1GJPA 4O50A 2Y63A 5FF2A 3FIGA 4O13A 1GVOA 3LRKA 1P4CA 2FQIA 1N7KA 3P84A 3B05A 2W6RA 1VYSX 3LGEA 1YDVA 1RQBA 3TA6A 2F7FA 3HOJA 4TR9A 3R12A 3QYQA 4TMCA 4K37A 4TU1A 4ZQMA 3L21A 1LBLA 2DZUA 3INPA 2E77A 5LNRA 2WQPA 2GQ8A 1KV8A 3O15A 1JUBA 4O15A 3M9YA 3VNDA 3LCWA 1LLWA 4QAIA 4MJZA 1FDYA 2C13A 3KVJA 3WJXA 1CW2A 1SU5A 4JS3A 3LV6A 3LTYA 4JDBA 1JRCA 3W23A 1G69A 1AW5A 4K7YA 3NPXA 1TPUA 1LRQA 5CSSA 3EX2A 3W2JA 2NV2A 3G1AA 4PEKA 6TIMA 3W85A 3QZEA 5FF4A 1TPDA 1OJXA 1R2SA 3GAYA 5BMWA 4HPJA 2B7NA 2WO5A 2CLEA 1KTCA 2RDUA 2DP3A 2FPYA 1SFJA 3OEXA 4Z08A 1JCJA 3DZ1A 4ZL1A 3TX9A 2O7SA 1GTHA 1XUUA 4AHOA 4QISA 3WK0A 3BG9A 2G5WA 3GR8A 4XUGA 3C52A 3MHUA 5GVJA 1LDCA 4OE7A 2QCGA 2F84A 4RZ4A 4X3ZA 1LBFA 1NFBA 1QR7A 3HGSA 2BWGA 2YW3A 3TQVA 2YR1A 4MFEA 3G1HA 4IOTA 4Q33A 4X2RA 2IQTA 1JCLA 3DGRA 3AJXA 3ZS4A 3EWUA 1YLVA 1KFBA 1GYNA 3TC6A 3H55A 5HUPA 1PHQA 1JRBA 4WOQA 3L9CA 1L2UA 4K7VA 2Z0IA 3EKZA 1OX4A 1GG1A 1A5CA 4XBSA 5LZLA 4OHQA 4U4MA 3DFSA 1KM0A 2W0UA 4MUZA 3M47A 4UTIA 1H60A 1LRTA 2A0NA 1EUNA 3B03A 3LCFA 4MY8A 4O11A 3HGOA 2DJLA 3NQEA 4PFMA 1J5TA 5CPMA 3WK1A 1H1YA 3NGJA 3GDLA 3VE7A 3WJZA 5HWNA 5K9DA 4CNOA 2Z6IA 4FXSA 1FWWA 4DPQA 1I2OA 2GJNA 1V7YA 3PUOA 4FO4A 2ZCGA 3G1FA 1XBXA 4MLJA 1W3NA 4UTJA 3IGUA 3EWBX 3QJAA 2CLOA 2NX1A 4JY8A 3W7DA 1LTDA 3KRSA 1LBMA 4BFAA 3F4NA 5FEWA 1FWTA 2J27A 3L0KA 3MUXA 5BRBA 5J5RA 1RD5A 3IIOA 1RV8A 1WV2A 4IQLA 3RMJA 3H53A 3NNTA 1F7BA 3DFTA 1E51A 3LOTA 1TQJA 1NSJA 4XWUA 1I2QA 3E0IA 1ME8A 4JEQA 3QFEA 1XL9A 2X30A 4HIBA 3W7CA 1LOQA 5BW6A 1XXXA 4UFJA 4NX0A 3NG3A 1Q6QA 2FTPA 3CHVA 1ADOA 3QSTA 1G6CA 4IMEA 1OF6A 1GTEA 1SZGA 1ZJIA 4JYEA 2XN2A 4J9JA 5CSRA 3F03K 3PBUA 2QKFA 4FNRA 4DPPA 4NUWA 1FQ0A 1ZALA 3CEUA 3P74A 2EPHA 3CTLA 3IGXA 4NJHA 5HINA 1PV8A 3MI2A 3ATYA 1JCNA 3LRMA 4RXGA 1H7XA 2QF7A 1RQEA 4YCPA 3GK0A 4HN4A 1SW7A 1W31A 5F4XA 1VH7A 4CQAA 2ZQ0A 3R8RA 3SJ3A 4Q32A 4KFPA 4CCCA 4IGHA 2FPTA 1GQNA 5I3HA 3M7WA 5LKYA 1QAPA 4UTHA 4LU0A 1Z44A 1LP6A 3NZ1A 3PR2A 1KTNA 3K30A 2HS6A 4FNUA 4LVFA 4NZJA 4IMGA 2CLFA 4OT7A 3O8AA 3NXFA 1SO6A 3IIPA 3BVJA 2GQ9A 3ELFA 2DORA 1PL9A 3LV5A 1DBTA 3PULA 1VCVA 4UFLA 3I7QA 4O52A 3Q2DA 4XTIA 4JTUA 3CWNA 1C8VA 1GOXA 3MI6A 5HULA 1HTIA 4IX0A 1K03A 3UWYA 1PVNA 4RZ6A 1AL7A 4O1CA 4JYFA 4YLWA 5E93A 2I1OA 3NOEA 1D9EA 1EA0A 1F74A 1OX5A
chains in the Genus database with same CATH superfamily
1LL4A 1E56A 3TR9A 1UD4A 1DJQA 2A3AA 5T26A 1OADA 4D6HA 4O14A 1SW3A 1U33A 3W26A 2BGNE 2QULA 4G1NA 2BFGA 3P81A 5E6ZA 3TAKA 3L0NA 1ML1A 4TVDA 2Z1SA 1QNVA 2R9RA 4H04A 4AFYA 4ATWA 1V6WA 2E6FA 1M03A 5A2CA 4PR4A 4M8UA 3WENA 4GI4A 1NU5A 3IUDA 1ISWA 2ISWA 3Q58A 3BLEA 2BOEX 2WZEA 3TTSA 5D4YA 3V35A 1RAKA 1IZCA 2ZUUA 2QUUA 2PDIA 1L6SA 4MNJA 4LUYA 5LNUA 2XFWA 4ZQPA 3IJ7A 3K8LA 3B8VA 4UBPC 5AHNA 4NJIA 3C0JA 3HJZA 4Y6GA 1XCXA 3D6NA 3BOFA 3TJIA 3QQ1A 4PN2A 2P1FA 2PF8A 4KGJA 3RJYA 4N9BA 3V5FA 1FX6A 2DSZA 2G37A 3UA3A 4F4RA 1GKQA 3HIJA 1BG4A 4J1OA 4GQGA 2O55A 1JDEA 3EDDA 4N02A 2UY3A 3NQ7A 3S6DA 4R85A 3HA1A 3C2OA 3VKJA 4CNNA 5D2XA 3PNUA 3E74A 3LNPA 3APGA 3ITTA 1IR1A 4Q4MA 1YMYA 2E09A 1PCKA 2PUZA 3CWOX 1J0JA 2VEFA 1DIEA 3M64A 3VNKA 3OQEA 1XH0A 2DV0A 3RU6A 3ARTA 1Y7VA 4UFIA 3LSBA 3LPFA 1E6RA 4OOZA 2CERA 1UROA 2WVVB 3GNOA 1OABA 4A3UA 3ABQA 4F9JA 3G1VA 3LHWA 3SN0A 3H2OA 2EG8A 4A2SA 2XIOA 4CVUA 3RPMA 2QXWA 1XIDA 3G3DA 4BI6A 2NQ9A 1FTXA 4P8VA 5H6HA 1YHTA 5TF0A 4Z2IA 2CU0A 3R1ZA 1D8WA 4W5ZA 3U0HA 3KRBA 1O5KA 4R7JA 2PBGA 3GNXA 1ZL1A 1ZFJA 3N9RA 4H01A 2V5BA 5M5DA 4JAWA 1VFTA 2A6LA 3ITXA 3WMCA 1K77A 1BKSA 3G8RA 5B80A 1HKIA 4NIRA 1C7TA 4S3EA 1Q85A 4LUTA 3ZWTA 3GU9A 2WXDM 3ES7A 4UQCA 3C56A 1GVRA 4I90A 1QTWA 3F2CA 3SRKA 3TW6A 1NF0A 1TR1A 4ZE5A 2ZXQA 3PBMA 2VHLA 1UWSA 5JQ9A 3UXIA 4D8AA 1AFSA 3LCLA 3OIXA 5CPQA 1IE7C 2C18A 3NL6A 2NQJA 1DKWA 1IWAA 1BG9A 1GVFA 2I9UA 4KIRA 2ACQA 1SSGA 4B2DD 4AF0B 1UCWA 1IXPA 1G1YA 3FGCB 2F6UA 4IIFA 3BLOA 3N2XA 4JTJA 4TUFA 2DW7A 3P5ZA 4GA8A 1ZB5A 4EWJA 1GPFA 5HJYA 4K6AA 4QS5A 3LM7A 3W7QA 4DBDA 5EYWA 4Q8WA 3DKLA 4NJJA 3DKJA 3I7RA 4JL1A 3NL2A 4NY2A 1JGIA 3LCHA 5E09A 3HG2A 1YEYA 1MI3A 3POCA 4H9ZA 4XQ6A 1HKKA 2WNQA 4I9JA 3ITOA 3G0XA 2J6XA 3GYCA 3AMCA 1OGSA 1OY0A 4AIBA 3IEBA 2QPSA 3R5EA 1XSKA 1KCLA 5CPSA 2NXHA 4MB1A 4C6QA 1P1XA 3BOXA 3B0YA 3K13A 4ACYA 3B8WA 4NJKA 3W7JA 1YRRA 1FFQA 2O4QA 4FNTA 3DHPA 2PWVA 2J9XA 1POKA 4RL3A 5CSYA 3SCWA 4PCPA 2XSXA 1KW1A 2NSOA 3N19B 2NT1A 4JTHA 4BS0A 5JMUA 3FV9A 4F66A 3WJYA 3B8TA 2HNEA 3MKCA 1KD0A 3PB0A 4KWVA 1IGWA 2PDFA 3PWGA 1R9YA 3WQPA 1ODZA 3QW4B 3ERPA 2P8CA 2FHBA 4AD1A 4N42A 4Q4KA 4Y9NA 3RPTA 2C0AA 2VJXA 3GB6A 4EAYA 1T8XA 2GUUA 1BQCA 3MUAA 4QXIA 1KA9F 2P88A 3KVKA 3NVDA 1C8QA 3W1TA 1J93A 4PC8A 1SVDA 1LJYA 3W82A 3ANYA 3T42A 1LQ2A 3W00A 3N25A 4LAOA 3SUUA 4FX8A 4E8DA 4GNKB 3GXTA 3RN6A 1SJAA 3TLLA 3GUGA 4OOUA 1TCMA 1LQ0A 3SQMA 3KFTA 4P61A 3WBYA 1E3ZA 3N18A 2JKEA 1GG0A 1WDQA 2QCMA 4ZTYA 3DFOA 3OBAA 1A50A 5A69A 5ABEA 1POJA 4J35A 3B9DA 1M7PA 1DHPA 3GDMA 3CQ0A 2X40A 1O60A 3FXYA 2FGZA 3JZUA 1OCBA 4HU8A 3DHDA 3GTHA 3M5YA 1A5BA 2V69A 1E1EA 4H6KA 3A13A 3GM8A 1H49A 3H2EA 2ZDSA 1G4EA 3N2BA 1GOKA 3VFLA 4BKNA 4PSPA 1P7TB 3T40A 1GEQA 2OSXA 3MZNA 2Z2AA 3TC3A 2J7CA 1FCBA 1E4MM 4QR6A 3MU7A 2GGEA 2WPBA 5BZAA 4HCDA 5E0KA 4DWSB 4ZQRA 1UH2A 3IV3A 4WJ8A 3HG5A 1KQYA 2CLIA 4QQ3A 2OWXA 3CV6A 4ASTA 4P7OA 3BJFA 3N1AA 1HJQA 2V38A 2QZRA 3GQYA 3OB8A 4PL2A 4MLRA 2DFAA 1XIHA 4BY3A 2J7EA 4C6CA 1TMHA 3LXAA 5AOUA 4U10A 2YIHA 5CKSA 1IEVA 2QMJA 1EC8A 1WNOA 2AKZA 2B81A 1Q6OA 1XIGA 2XYLA 3HO8A 4A21A 3R4IA 2BGQA 4OV9A 4E8GA 4IJBA 4FR1A 3T1GA 3LM3A 5EMLA 1EWEA 3I68A 5I3KA 1NJJA 3SCNA 4FX7A 3Q67A 1SQ7A 1SO5A 4HNLA 1HL9A 1DIDA 1XYMA 3SY8A 3EEGA 5E1QA 1DV7A 1PEZA 3A23A 4LF1A 4EXBA 2ZADA 4E2OA 3KOYA 1A5UA 4JQ2A 2ICSA 2DPEA 5XINA 3LERA 1VFSA 3MMUA 3OHIA 4RNFA 3ZLFA 3AXMA 1AQHA 1FHUA 1DPMA 2VOMA 3OO2A 2OT1A 3PZGA 1A0EA 4DVOA 3ECQA 5DRIA 1DOSA 1I6NA 1QO5A 1S1PA 3RLGA 4DNHA 3MSDA 1PPIA 4LNYA 2XINA 2O4MA 3HV9A 5DRCA 1XYZA 5CZJA 3BGJA 3D3FA 4G2DA 5F4WA 2BS9A 4HZ8A 2E4TA 1FWFC 3KOZA 5A8NA 5DT5A 1MSSA 4DNMA 2D2GA 3NO3A 3OZPA 1GKPA 3V75A 2Y7DA 2PGFA 2IQ0A 4UOJA 1Z7AA 4AC1X 5CZKA 3LHVA 3UNTA 1JZ7A 3FY1A 1R8LA 1WBJA 3EWCA 3K4AA 3S2LA 1RPXA 4H2HA 5AY7A 3B04A 1OWQA 2YKKA 3L2IA 5ENLA 4F0LA 1UBPC 1JG9A 7ENLA 3WDRA 2YXGA 1WE5A 1S5NA 3HQOA 4LUTB 4LV9A 4U31A 4DO5A 3AIBA 1U30A 4YL2A 3TFCA 2BLEA 1GJUA 2Z1BA 3UNDA 3B0UX 2JGYA 2Y89A 4DELA 1H51A 4FOKA 1NOUA 3VKAA 3SECA 2GUYA 4GPNA 4AY7A 3RF9A 3KOFA 2PDQA 1QHOA 1MW0A 3ZM8A 3FEMA 2VEIA 3TYBA 4C6FA 1JNDA 2VNCA 2J9ZA 2H90A 4P5UA 2YL9A 3LX9A 3CAQA 4JX4A 1H4PA 4C5YA 5DY2A 4H19A 4Q8PA 4HSNA 2WSPA 3ES8A 2XPKA 4GXMA 1OFAA 4XZLX 5HMFA 1VC4A 4MDPA 1GVQA 3ANVA 1QNRA 5EY5A 1ZCOA 3KUMA 4QCFA 4ZTXA 1U2YA 5EMYA 2BDQA 1EXPA 4JTKA 4XX6A 2NVCA 3N4EA 1JCYA 5TD4A 2AAMA 1UC5A 2GDQA 1EJVC 2ZOXA 2FHFA 3MDWA 3VYLA 4WZHA 1FH8A 5DEZA 1JUKA 1NDWA 5DMNA 3LBOA 1AW1A 4QJ1A 2V2DA 4PTNA 1EJRC 3VX1A 4UTUA 1KC7A 4W89A 3TV8A 3EOOA 3UY8A 3M0KA 1RUSA 3L0GA 4TVUA 4NASA 4R33A 4E2DA 4V15A 1R2RA 3B8UA 3ZR4A 4YTRA 1MEWA 1REQA 1ZTVA 3LQGA 4JFSA 3M5ZA 1UWTA 2Y5SA 3C0LA 2VC6A 3AALA 2MANA 1UR0A 1BVNP 4WUIA 4PB4A 2YYUA 1SZEA 2Q71A 3EWXA 4LY4A 5E0FA 2EJ1A 3L67A 2WPGA 2V2HA 1Q7MA 3TFXA 3G1SA 4QNWA 2NUWA 4O4VA 3PTKA 3BWWA 2Z7GA 1EP1A 5REQB 3V16A 5CC7A 3P14A 2JBMA 3TR2A 3QMRA 2FVMA 4W9TA 4AXNA 1WOAA 2ADAA 3ABZA 3RG6A 2NXGA 2VEKA 1I2NA 4PRRA 5IM51 4M6VA 4NP7A 4IPLA 1XLKA 3CZKA 4V1XA 4NI3A 2A7RA 3IANA 4QE4A 4XIAA 3R11A 2CZDA 5FIPA 2I56A 2ABBA 5I6SA 2XDFA 1T99A 4H3DA 3BW4A 1XFBA 1KM4A 3GDRA 4AYGA 1FHVA 4OUEA 4FI4A 4QBXA 4MGGA 1U5VA 2PGEA 2R1KA 3MUIA 4FXRA 3WLJA 3SZ8A 5BOFA 1QU4A 1T7LA 3JS3A 1QOXA 1K7EA 3WK3A 2PLKA 4L1GA 2VFHA 1T8QA 1OCQA 3DYOA 3MP4A 3AIEA 3CTTA 5A94A 3B06A 1KM1A 3BAYA 1KFCA 4RDYA 3S5YA 3SIZA 4BQ5A 2ZWYA 2O9PA 1JCXA 3TIMA 4AX7A 3QV9A 4ZMGA 3IAQA 1CXHA 4XZNX 3L5MA 4JYDA 1P0KA 1ODUA 5D2TA 3NQMA 2CEQA 4KEVA 3F2DA 2EKGA 3DECA 1ZP3A 2RHGA 5EBUA 2O9OA 2UV8G 2AKMA 1JZ5A 1C9WA 1N8FA 2CWXA 2VVNA 5I3FA 3KAOA 1FWCC 3WQVA 2TYSA 1YXYA 4G1KA 3TN5A 4OUIA 4HA4A 4DO6A 3M0YA 2FH6A 2GJRA 5JXQA 1C91A 4A3HA 2WOQA 4AD4A 2WKLA 1P0NA 3RYSA 1B2YA 4GFIA 1NEYA 5KMYA 3WCZA 1UBSA 3FJLA 3KW3A 4FSAA 3K46A 4L9ZA 5C9ZA 3VMOA 2FMNA 5FESA 2HZGA 4TXEA 5HQEA 4FB7A 1S2UA 1HO4A 3U8GA 3QZAA 1JVNA 1XUZA 1OFBA 1KWKA 5HWJA 3FYYA 1Q4NX 1F2JA 3BV4A 3F5LA 3U2ZA 4NF7A 2A7PA 3IS4A 5IHSA 4XKYA 2I17A 1L8PA 3J7HA 2YBTA 4YTSA 2G96A 3B9OA 3PZQA 3AHXA 4DAIA 4P2VA 3OZMA 4ZA0A 1S5TA 3TWBA 1EJXC 4MY9A 5DXYA 3DFNA 4MJMA 1PKMA 2J7DA 1UUMA 1W2VA 3GFXA 2B7PA 1JPDX 1YPXA 1WZAA 1GUVA 2BVWA 4CGTA 4XBJA 4LNCA 4QAWA 3FN9A 5HNRA 4B15A 4EPKA 2V5KA 3S4TA 1UOZA 1K1DA 3CT2A 3N12A 1UR8A 1TPEA 1W8GA 2Y88A 3FKRA 4KGLA 4Z42C 4LBRA 4J2PA 1V3MA 3EYPA 1X7FA 1E70M 1OIMA 2XG9A 3TOPA 4UZSA 4HNCA 1EBHA 1W1IE 3KCOA 1PIFA 3O16A 2OZTA 4IG2A 4INFA 1E1FA 2YBUA 3WLTA 2FDSA 4HHHA 3A24A 3E0WA 2R14A 5CGMA 3DCPA 4UQAA 3B0XA 4AHQA 3JVAA 3W9ZA 2R82A 4M82A 2BV9A 3UPMA 1KXHA 3CASA 3WEZA 1V5XA 4MJ2A 1TV5A 5D05A 4P7QA 3SCRA 4DF1A 4DLMA 2HXUA 2CXGA 2YCLB 1E6QM 4HA3A 2NV9A 4GY0A 2ZRVA 2KZHA 4YCOA 1QW8A 2QCNA 3MKVA 1I2PA 3WF4A 2VCAA 1RJPA 3W6YA 3KLKA 1RPKA 1ALDA 4M51A 1XINA 4EIVA 3PJUA 4US6A 5C2XA 1PSCA 1UD5A 2DIEA 5JBDA 5AHLA 1PBGA 3FHAA 4FNQA 4OQVA 4XO6A 3UR8A 4W7VA 5IFPA 1OZQA 3QTGA 2CYGA 2Y5EA 2NWSA 1A5AA 1QPQA 1VP5A 1ONRA 4PTDA 1W5MA 4FZIA 5IHRA 4UTWC 3UESA 3VDGA 1K4GA 2G8ZA 3E6EA 2OMAA 1TJRA 5DN1A 3SGZA 3FSUA 4ZODA 1D3CA 4B9ZA 4AIOA 5J5DA 1JZ6A 1SJDA 3H22A 3SR7A 4UTWA 1ZAJA 1Z41A 1EDGA 3VOGA 1F3XA 3ARQA 5EMUA 2XVPA 1EJUC 3HJEA 1S3HA 4WDUA 1ZAHA 3AAMA 3WKZA 3MY9A 1TPH1 2VOTA 2RFGA 1XPGA 5F1UA 3RJXA 3BV7A 4RXFA 2ZTJA 4XVDA 5DCEA 3VVGA 3WQOA 1CGTA 4H7CA 3VC5A 1VLWA 4ZOCA 1XC6A 3T2OA 3CPUA 1E6NA 4JKMA 2VENA 2PAJA 2W67A 2RGMA 4O8RA 3RRXA 4DRSA 4G8TA 1OK6A 3H7VA 2PDWA 3MQTA 3TNBA 3VDCA 2NW0A 3IUIA 1XH2A 1UPMB 2QCLA 1WKEA 3B9EA 4RW3A 5KZ6A 1NAL1 3SM0A 3BDKA 4US5A 4ML4A 4ICMA 2BX7A 4E8CA 1AODA 2BNJA 5HPCA 4EKJA 2J9YA 3ZJ6A 1UWIA 2ZZ5A 3CUFA 4H7ZA 3W1QA 3LI1A 3URBA 6XIMA 1EKOA 3DFHA 4S3AA 1Q6DA 1QPOA 4H9TA 2NV1A 1MDLA 4WJXA 4BR1A 1QASA 3LTPA 4LS1A 1T41A 2PDXA 1BSLA 3PZTA 3P6LA 4GVIA 4GZIA 5RUBA 4A2RA 1UJPA 3USBA 4S38A 5HMEA 1K8ZA 3L4YA 2JGQA 2GLKA 1WZLA 1GGOA 3P67A 3TSBA 2DUAA 5HQMA 1TX2A 3E5BA 4JQ4A 3S1WA 2E8YA 4QDWA 2C79A 2WMKA 3W7IA 2VCCA 2VX7A 1PIIA 3B8DA 1J6PA 4NXSA 3GHUA 3FAWA 4WF7A 4KH2A 2ZWZA 1WO2A 3BE7A 1JULA 4M6PA 3BUVA 1EHAA 5TQLA 2DUXA 2YA2A 3H21A 3EXRA 3MKKA 3W1NA 5C7VA 1CGYA 1L9WA 1RP9A 2AQOA 4WIWA 5JBEA 2BSLA 3L68A 1MXDA 2GGIA 3E3HA 4NXKA 2F6XA 1UA3A 2H9AA 4DBUA 2Q01A 3KWXA 4UZUA 3W25A 1KGUA 5KEZA 1PYFA 1TJPA 1W9UA 3GDTA 2D2JA 5AHEA 3LY0A 1XIBA 3MP3A 4JIQA 1PUDA 3UVAA 5HK4A 3IRDA 2DU2A 3C3UA 1BRLB 1VEPA 4O54A 3SUWA 1PO9A 1B3VA 3R7MA 4C6NA 3GW3A 3MBFA 2X1SA 3UVIA 3WD0A 4GUHA 2J47A 2B0MA 1GZJA 2V81A 3H2NA 1KFLA 3DFPA 4PMQA 3UEQA 1QUMA 1RY0A 1RVGA 4NG3A 2FTWA 3THDA 3NM1A 3ZSSA 1BTCA 2BZNA 4AZBA 5A6LA 1KCZA 1MW1A 1B3YA 4GIRA 5BWFA 5LGXA 5E0CA 4NZ4A 1EHNA 3AWOA 2WNNA 4FALA 4UOQA 2VR4A 3ZT7A 1W2PA 1TPWA 3E02A 3EMZA 2DY3A 1B3OA 4GMEA 3MCOA 1ITXA 5GJNA 3N13A 3URQA 2J25A 1TREA 3MV01 2QJGA 1EZWA 4HMEA 1EEXA 1Y5XA 3R94A 2CZ5A 1JXJA 2CLKA 2NUYA 2PWHA 3WEOA 3HPFA 2D20A 1M7OA 1EIXA 1VFUA 2W79A 1X1OA 2YL6A 4UOZA 4D2JA 3UP8A 3WQ6A 2ZZ1A 1LWHA 4MFDA 3IIXA 3WDHA 2A85A 1Y0EA 4OV4A 2HRWA 4O28A 2G95A 3GKFA 3TN4A 2GGHA 3RUBL 1O5QA 4UMCA 1I45A 1XLJA 4ROQA 1YQ2A 2PTZA 1Q6EA 2PEVA 3QHMA 1S38A 2YW4A 5A6KA 1U1UA 4YXGA 4PMRA 1OX4B 3CLWA 3EKLA 4JOMA 4ZQOA 1R0MA 1CT5A 3A3XA 1IHIA 4MNMA 4WD0A 3ZR6A 3EA3A 3I6EA 3RLHA 4PCFA 3VUSA 1XR2A 4HYRA 1TV8A 5AC5A 4N7QA 3WH8A 2YCJA 1IQ8A 1GVOA 3WD1A 4JTAA 4Q7BA 1C8XA 1N7KA 1XYCA 1QW7A 3LGEA 1YDVA 4NYUA 4TR9A 6ENLA 2WCGA 1CLXA 4DUWA 3WLOA 4MJZA 3MPGA 4GCXA 3KVJA 5GJMA 2D23A 1SU5A 4FS9A 3LV6A 4JDBA 2BY1A 3GVQA 4P8XA 1TPUA 3W2JA 4XSMA 2NQZA 4JTQA 4WEVX 3QXBA 3C5QA 4XAZA 1LL7A 2D1ZA 1X6LA 4HPJA 4U3CA 5E6YA 4US5D 4RW5A 2FPYA 4IM4A 1H11A 3BANA 1A5NC 1GTHA 1GOQA 1VJZA 3WK0A 3BG9A 2G5WA 5CG0A 5GVJA 1BYAA 1KNWA 2QCGA 5AYBA 5FSEC 2F84A 1S2AA 4RZ4A 2BWGA 2Z25A 4JFTA 4LALA 4UQEA 8A3HA 4MFEA 1J10A 3MUZ1 1XD1A 1L8NA 2XH2A 1PZ0A 1JCLA 1YX1A 3ZS4A 4IMAA 5CC6A 4IICA 1ITUA 3NCOA 4L7ZA 3KBVA 4WOQA 3L9CA 2Z0IA 2AL2A 2C71A 4PUEA 4J27A 5LZLA 3GNRA 1KM0A 1HVQA 2ZUNA 4DYEA 3MTWA 3M47A 2EG6A 3LCFA 4O11A 3B03A 5EMMA 4MY8A 2DJLA 1J5TA 2IMRA 5CPMA 2DSUA 3EAUA 2DUZA 1RLCL 3I3BA 3VD5A 1YW1A 3WX7A 2VGGA 3KS5A 3NTYA 1EGZA 3GG1A 5HQLA 4Z2HA 2Z24A 3G1FA 3VIIA 5I00A 2FVLA 3EWBX 5HA7A 4CUCA 4XAPA 4JL2A 2NX1A 1LTDA 3OW1A 4BFAA 3L0KA 5J5RA 1B30A 1BGAA 4MB4A 1VBRA 1WV2A 4IQLA 4W4QA 3BQ5A 4KMQA 1OC7A 2FYMA 3NNTA 1F7BA 3DFTA 1TV2A 3LOTA 1GNXA 4BF5A 3BLKA 3C86A 2YJQA 1NSJA 5I79A 3VIJA 1I2QA 3E0IA 1ME8A 1YBQA 1BVZA 1VFLA 3G5EA 2Q02A 4HIBA 3W7CA 3LS9A 1XXXA 1A3HA 3KLLA 1SJCA 2HXTA 1SZGA 1RJQA 3B8IA 4JYEA 3UGRA 2XN2A 5FSDC 4FNRA 5D9MA 2F2KA 4PTVA 1P6BA 3T0CA 3P74A 2EPHA 1DXEA 2WHKA 3ATYA 5PTDA 3LRMA 2QF7A 3M0IA 4XD3A 3F5JA 4YCPA 3R8RA 1C92A 4KFPA 3VIKA 4IGHA 2FPTA 1GQNA 3B3DA 4OVXA 2XZ9A 5LKYA 3K5XA 3V5CA 2CIPA 4UTHA 3SURA 1Z44A 4MAZA 3PR2A 1KTNA 3K30A 4C6OA 2HS6A 4AZ7A 5E5CA 4IMGA 1U1JA 1Y5VA 2CLFA 4OT7A 1SO6A 3NXFA 1E6SM 2GQ9A 3REQA 4B92A 3LV5A 1DYSA 4UFLA 4O52A 3DFYA 3CHCA 4JTUA 4YVXA 1C8VA 4RDWA 3MI6A 4IX0A 3UWYA 4RZ6A 1AL7A 1R6WA 1AVAA 2FZ9A 4BQ3A 3IJ8A 2BBFA 1F74A 1JZ2A 1UZHA 1XD0A 3CAWA 5JIPA 1YE6A 3EZ4A 1R87A 4K1WA 5AZ1A 2WWDA 3ITVA 3M16A 3V3WA 1YNQA 4GIEA 4C1LA 5LGZA 3QPYA 5M1TA 3MO7A 4FF5A 5A8PA 1KR1A 1KLZA 1B57A 2Z29A 4GQBA 3EWZA 5AYYA 4ZXOA 1ZSXA 3KBNA 3V36A 2EHHA 3URAA 2IKIA 4M1RA 3LHYA 2E7FA 3VCCA 3K4WA 1W9DM 4PBEA 4DJEC 9XIMA 4JPGA 1QBAA 4L6HA 1R3SA 2ZVIA 1OK4A 2ZX6A 2YLAA 3UJFA 1X1ZA 4O16A 4CD8A 1VPYA 4PB5A 4ZOAA 3RNDA 2X2YA 1A5MC 2D0GA 3K4DA 3VMNA 4DJEA 4LOCA 1R3RA 3AYRA 1OX6A 3V0SA 1UA7A 4HA1A 5D09A 2QJHA 4IJCA 2POTA 1UD2A 3N11A 2OEMA 4EF8A 1FXQA 4ATLA 1PHWA 3M0MA 2VI0A 5JU6A 4K38A 1HVXA 4PRWA 4UTTC 3T0TA 5FKYA 4IGSA 5HDRA 4RE3A 2YSWA 2QUNA 1LF1A 3W1MA 2ACUA 4GHRA 3KRUA 1F05A 2ZUVA 3GIPA 2NQHA 4QJ4B 2FB2A 3G1DA 3FFSA 4UTTA 5K9CA 2VD9A 3CQIA 1J5SA 3WBEA 1FDJA 1NM9A 4O17A 1EP2A 4AXKA 5G1MA 1SMAA 1H50A 4MZYA 1LOSA 4ZSTA 1XRSA 3BXWA 1GHSA 3ID7A 1E43A 1S2WA 4GYJA 4PFHA 1GORA 1TQXA 3G6LA 2WBGA 2PMQA 1JD7A 3MI3A 3FDGA 4UB9A 4GC3A 2YB4A 5A6JA 4XBKA 1C7SA 3IACA 5GJPA 4MB5A 3W28A 1B3ZA 5KINA 3M44A 2HSAA 2VR5A 3FJNA 1KXVA 5I3DA 3AS3A 1W91A 3ZWSA 4OBRA 2GWGA 3SCTA 5C9RA 3N2MA 5CGQA 3MANA 4DBSA 3G8EA 5AVNA 3LBCA 5FEPA 3FVDA 1W37A 3EB2A 4H9YA 2VL4A 5EPDA 4XD4A 2G3MA 2RUSA 3W1PA 2V9DA 3UD6A 3TMQA 4MPKA 4YTQA 1R9ZA 3GVGA 3A4JA 3QMTA 2XFFA 5G1YA 2NWRA 4ROPA 4Z2LA 2VDHA 1XRFA 1TRIA 1B9BA 3IIZA 3XINA 5K3VA 7TIMA 4MJ4A 1J79A 2FZMA 5T9CE 2WSQA 3V1HA 1O1ZA 4K68A 2IPWA 1QJWA 3U6WA 3AROA 1J4EA 3TU9A 4GBUA 4MUPA 4IQJA 3QHOA 3K2GA 3S5SA 4H8HA 2IPFA 3L4UA 1W3IA 1KGWA 5AFDA 5BXRA 1BXCA 3AO0A 3TXVA 1JYWA 2R8WA 2YXOA 4M24A 3VIHA 4RE0A 1DWAM 2AL2B 4B5XA 3GZAA 4MYXA 1AMKA 1S46A 2ATMA 3SUTA 4HK7A 4XZBA 4NJGA 4H9UA 3GH4A 1XSIA 5F1VA 3LHZA 2J24A 1E0WA 2QCDB 2FGBA 2HS8A 1NDYA 4LY8A 4GZEA 1UR1A 2LLEA 3M6YA 5EA9A 1A5OC 3I6TA 3W0KA 4Q8UA 1VYRA 4DBEA 2BY2A 1AK5A 2P0OA 4IF2A 1TELA 2H3BA 3RR1A 1ISYA 4WDWA 2DQXA 3UGVA 1VHCA 2QUVA 5A95A 4YHEA 2VUNA 3N17A 1IWPA 3FA5A 4CQCA 4PRTA 3TYEA 3AQUA 2D0HA 4H1ZA 1E72M 1XLAA 4TV5A 2CFFA 5BCAA 3N9SA 3NQFA 5XIMA 3WLNA 3QR1A 2QV4A 2B7OA 4QDPA 4AW7A 2WBKA 3BCDA 5D30A 3AXXA 3G1XA 4R5EA 2OYLA 1L6YA 1GQIA 4CQ9A 4FAMA 3WFZA 1HKJA 4LS2A 3HPAA 5I03A 4E4FA 4LBSA 5FEXA 1HG3A 4FR6A 1JAEA 4AWEA 2WC7A 2Q8ZA 3BURA 1MXSA 5DMLA 4J3VA 5FI8A 3M1ZA 3WZ0E 1M7JA 3VFCA 4V33A 2OSWA 5A2BA 3AXIA 1XG3A 2ISSA 2DZPA 2WK2A 2D73A 4AWUA 3LK6A 2HK1A 4GQ0A 1RHCA 3U4FA 1UPPA 1TSIA 3PBWA 1OFRA 3T09A 4DJED 1QVBA 3TJLA 5F4SA 2I14A 5A3HA 3VKKA 3S1VA 2OZ3A 9CGTA 1N55A 3EMCA 5IDIA 3CZGA 5LNSA 1UIPA 5H2ZA 1PTAA 1PX4A 2VGFA 3WFLA 4BI7A 3NDZA 5IFTA 2QEZA 1QXLA 3O63A 3FOKA 2HNHA 3M6DA 3RM8A 4AH7A 2WMIB 3L65A 3T0AA 2YB1A 3NUKA 3BG5A 1NTHA 1BYCA 3NL5A 4UQBA 6PTDA 1YTEA 3EB3A 3FS2A 3WNNA 2OLSA 1THFD 1A53A 4Q3MA 3VKCA 3OVQA 1W9XA 1YTDA 2I7GA 1HZYA 3DG6A 4MZ8A 4NZ5A 3U7VA 2Y1HA 4MKSA 3OG3A 2XWDA 5T91A 1QWKA 3L66A 3W27A 3LMZA 1QPKA 3IJ9A 3VIMA 4EXQA 3AUJA 3ABSA 2ZX7A 3C6CA 1QOPA 4W8BA 2E5BA 2XVLA 1Q65A 4YYFA 1BWKA 5LA2A 1US3A 4A05A 1I1WA 4L64A 5AYXA 2IXVA 2PRHA 3LNMA 1A47A 4MHBA 3U2OA 1O7AA 4POCA 4KCWA 3ONCA 4X22A 3ZT5A 3YPIA 4PMJA 1M53A 4KRZA 2GVLA 3L5AA 4KT2A 3T7VA 1ITCA 3BARA 1TTJA 3THAA 3GFYA 1JCTA 1RK6A 4RPPA 3W7EA 2PRLA 5HWMA 3LCXA 2G0WA 1OT2A 3GXMA 3NJ3A 5FL1A 1UH3A 3WJSA 3N04A 3KP1A 2WSRA 4GE8A 1TMQA 3O6CA 4WY0A 4O12A 3KTXA 4P7LA 5CAHA 1I8JA 4PUJA 1EJWC 3BJSA 3AICA 4G7EA 4XG1A 4GZ7A 1JQVA 1SFTA 1H0GA 3VNJA 1EOKA 1EQPA 2HVMA 2R1MA 3T08A 3CO8A 1I1XA 6TAAA 2Y4SA 3IPWA 2ZRZA 3KL3A 1A5KC 2NQ5A 4HTBA 2PGWA 4BJHA 3PANA 3U7BA 2P3ZA 1JF5A 3AIRA 4M81A 4N9CA 3WNLA 5LHEA 2EG7A 4LAKA 3BO9A 5ABFB 3QEZA 3GXFA 3VGGA 2DVXA 1R3VA 4AVOA 2P5NA 5F2GA 4WXYA 4HKPA 4Q7IA 3SSZA 3LZ3A 4BF9A 1U83A 1W3TA 2UY4A 1US0A 3VX0A 4JX5A 3WD2A 3ZVHA 2QUTA 3E0VA 3BLDA 2A3EA 5JBFA 1Z48A 3MWCA 1Q5MA 2OYMA 2PLMA 1LZOA 2RH9A 1UR2A 3AS1A 3Q4DA 1QFEA 4DXKA 2X1TA 2VZOA 1FH9A 1OHLA 3ABRA 4B91A 3KX6A 4G56A 1K4HA 1OZMA 3GTNA 2GJLA 1TVLA 3OP2A 3OQ8A 2DSVA 4GY7A 5G1TA 2E5DA 2BXVA 4M19A 4JQAA 3SFKA 3FXGA 3CH9A 5D32A 1EA9C 2ON3A 3TNOA 4XZWA 4PB3A 1JZ3A 1X6UA 2E6DA 4LVDA 3L4XA 2DVTA 3DH7A 2PDHA 3S1UA 2IPJA 1EB3A 4MB3A 4F2BA 5D8WA 5A8OA 1LL6A 4JQ3A 3OBEA 2X1RA 4WR3A 3P82A 4LYKA 3V1PA 1XGEA 3W3OA 3V5OA 1PYMA 1BLIA 4LV4A 3KZPA 1X1NA 5B7ZA 1DJNA 3P3BA 3URNA 1DWHM 5FACA 2F61A 2WVUA 4QITA 1OIFA 4WLCA 1RP8A 4Y96A 4IMFA 4JHZA 1E0XA 3MO4A 4XV0A 1QOQA 5BU9A 4PBGA 3ICJA 1UKTA 2ZVRA 2VGBA 3QYSA 3OLIA 3EKGA 4HOZA 1YTKA 2J78A 1FWNA 3PN8A 1QHZA 2VRJA 9XIAA 1HJWA 2ZRWA 4N6FA 1W1VA 2DZWA 4FEZA 3R13A 4HCLA 1DP0A 3IGHX 2DIJA 2OB3A 5EKYA 1CPUA 4HD5A 3FKKA 3EX4A 2V5LA 3SY5A 1GPWA 3O06A 2ZZ2A 1UMLA 3FVMA 3N2TA 1J0KA 4MSSA 1JQXA 1LM1A 3W6LA 3T8LA 2X2GA 3VDAA 4AZHA 3THQA 3OVGA 1L0PA 3QC3A 5TNVA 3UW6A 3W81A 2ZX8A 1XKYA 2NX9A 3CUIA 1XBZA 1D2KA 3AHVA 1RR2A 4DUOA 3UWUA 5HJXA 4Q4QA 3T78A 2IXUA 2GGGA 2ZA3A 1V3HA 3NQCA 4I6VA 5CPLA 4IPJA 3ATZA 3EOUA 4QJ5B 1DE6A 4AIEA 4DEFA 3CZ8A 4MY1A 4LCSA 4ERGA 3W2MA 3UXLA 3A6OA 3TDFA 1EX5A 1W1ZA 1XQLA 1DJGA 3TROA 4Z1DA 2G3FA 2VDIA 4PMDA 1JNEA 4MKNA 4EXAA 2Y8KA 2ZZ3A 4J3UA 1E1CB 1RZMA 3M4HA 4C7GA 3EGJA 4DJFD 2IS7A 5F2MA 5AC4A 2E67A 3N2OA 3E12A 1O6IA 4L9YA 3T9PA 1JCMP 3QOKA 2V67A 4AZGA 4HYWA 4YIWA 5LNVA 3H4GA 3VMPA 1QW9A 1AH4A 3HBLA 3B0VC 4JTTA 4NX5A 4QM1A 1FWGC 1XICA 3VCRA 1H2JA 3LG3A 2H8ZA 2GK1B 3GVRA 1D3GA 4HPHA 5DT7A 2HROA 5AYZA 1DIKA 1YNYA 4J3SA 2Q8LA 3BSMA 1WPCA 4CCEA 4Y90A 4DHGA 3FEQA 4IPIA 2E40A 2OYKA 2AL1A 1UH4A 2NQLA 2PC8A 3NPVA 3VXGA 4N2YA 4TMBA 4GRSA 2QDHA 4JICA 4YS1A 2VFEA 1DEDA 1OINA 2DVUA 3OZOA 1G4PA 1DTNA 4RDZA 1TIWA 3GUWA 4H6QA 3PVFA 4H6EA 2ZUSA 4TTUA 2PWUA 4X2PA 1UW9A 4H8UA 1IYXA 3DERA 5D9PA 3DAQA 3II1A 2XZ7A 2J8FA 1XLFA 4RCXA 3ISIX 3HZ3A 4IT1A 1P6WA 5JH2A 5K4ZA 3JU2A 3HFTA 1FA2A 4WY0F 1B3XA 4ZO9A 3CNYA 4IMDA 1WAUA 4IMCA 4QEEA 3AYSA 4AB4A 5K4XA 1XBYA 2REQA 3HFYA 4WY0B 5SWUA 4H9MA 2JIEA 3BK0A 1CDGA 1H5YA 4RLIA 5CSUA 5AN7A 1OCNA 4DM1A 3MW7A 5C7HA 1W54A 1E0VA 3EDJA 3PM6A 2ZX9A 1ICSA 3LGDA 1JAKA 1NOWA 4EPBC 5FF3A 1DL3A 1UJQA 4QGCA 4RV8A 1XYLA 1PWMA 3WDQA 2Y24A 2JIWA 1UKQA 4I9AA 3OVPA 4FOJA 1PAMA 1JJKA 1UWQA 3P8IA 4PTWA 2YPIA 4HZMA 3QF0A 4M29A 3TMLA 1M01A 1OT1A 1VBUA 4EF9A 1MWOA 2DEPA 2NUXA 3DIPA 2W92A 5AC7A 4MAVA 1B9ZA 3B4YA 2V3EA 1WDRA 2ZA1A 5ABTA 4AEEA 1A3XA 4IFKA 2CLLA 4GACA 1WXZA 3TC7A 4JFUA 4F9DA 3W7KA 5GPRA 1G9HA 3ARWA 2PTYA 5BWAA 1PX3A 3PSVA 3P2VA 4JN6A 4KWSA 2QLYA 3IARA 1P0BA 1OYAA 4OIFA 4P7NA 3FJ6A 5G2WA 1VCFA 2SFPA 4L56A 3UPWA 3R0KA 1OVDA 3UZJA 2ZRUA 2RKXA 2FZDA 6REQA 3C2YA 4IIGA 3AIUA 3HPSA 4GD0A 3TUUA 1SFLA 1EL3A 4C6LA 3CUJA 4DF2A 4OZOA 3UCCA 4CNPA 4ZQNA 1TE6A 1XC4A 4OKDA 1CGXA 4R88A 3N14A 4GJJA 3PZOA 2I5GA 3WD3A 2NT0A 3S8HA 3SEPA 3IIVA 3P5YA 3W7NA 2BVDA 3RPDA 3AYVA 1PDYA 3BW2A 3W01A 4F0MA 4HB7A 3GH7A 1GOWA 3BLIA 4UC5A 3JZEA 3EX1A 2C0HA 3PZVA 1K7FA 3Q45A 4Q8TA 3DX5A 3M0XA 5AYIA 1KFJA 1JDDA 3GW0A 3HURA 1H09A 1XIEA 4JTCA 3VCNA 3QRHA 2A7NA 1JDCA 1EFZA 1W1PA 2ZZ7A 5AC6A 1O5XA 1MZRA 3RLUA 1FWJC 1ONWA 4YVVA 3IJLA 3POHA 2ESCA 4L4LA 2QCEA 4MM1A 3TAOA 2OPJA 3WEMA 3FA3A 3LXCA 3ARZA 3JUGA 4BEUA 4B90A 4N4PA 3KM8A 4NT0A 3P60A 1KO0A 4DUXA 3PY2A 1HKMA 1IIHA 2WJZA 2ISVA 1OFEA 3VOJA 4BWLC 3SQLA 4AVFA 2P50A 3UXKA 3QVQA 4DUVA 4HNUA 5CPTA 1ZU8A 3DU0A 3FAXA 5K9XA 3W7RA 1EF3A 3C4UA 4IJRA 1CXKA 4ADTA 2PD9A 4BWLA 2B7QA 2VELA 2PCQA 2PC4A 2CBIA 4GX8A 3H24A 1JDAA 1RJRA 1N82A 2L5HA 2J8TA 1CEOA 4YWIA 3QKEA 4PUNA 3LLFA 4Y8EA 3UWWA 2XU2A 3LXBA 3QW3A 1G4TA 3N3TA 4BEQA 5M2FX 3G0UA 2J7BA 3C2RA 4JY9A 4MADA 3VM7A 4UTFA 3LD5A 4CNUA 3S1GA 2AQVA 2A3HA 1NDZA 2PP3A 4HOXA 3BMWA 3ABOA 5MKGA 1V93A 4WSJA 1R9XA 1F3WA 3FK4A 2Z26A 1Z9AA 3WUFA 1LQAA 2PGRA 4AY8A 1V7AA 1EC7A 4NQ1A 1PS9A 3UWQA 3WH7A 1BF2A 2VRQA 3SADA 3AXHA 2GVEA 2BY3A 3TKFA 3PG8A 1R7AA 2VC9A 2YZRA 4GJ1A 1OQFA 2RDWA 3MSYA 2BG5A 1HT6A 3VGDA 3QY6A 2V0TA 1CIUA 2ZTKA 4HZ7A 2WLZA 1DHKA 1W5OA 4DO7A 1Q45A 2JALA 3MYPA 4FF7A 4QS6A 4GUGA 3WD4A 5CAKA 3WF1A 5A8QA 3U2CA 3I65A 4PSRA 3R43A 4XO7A 1FKXA 1HKVA 3DGBA 4WOZA 2O7QA 2XH0A 1EJ7L 3BC9A 2I57A 1OD8A 1SUXA 2G3NA 1M7XA 4H2CA 3HG4A 1PZ1A 3TJXA 4BZYA 1WKDA 4GX9A 1RCQA 1TTIA 1Z42A 2O92A 1GQKA 4IGNA 4IPPA 3QZ6A 4PCSA 2CLMA 4F0KA 3MA8A 1OFDA 2UZ9A 4LSBA 5DBTA 1F61A 2P53A 4PUKA 3V0UA 1FY6A 4MKVA 1XGZA 1MRAA 3DFQA 3KRZA 2O0TA 2Q3RA 4KW2A 2O9RA 1R2TA 1ZP4A 1DVJA 3WH9A 3P93A 2PURA 1AMYA 1L6WA 2HV5A 1H41A 3M46A 3XISA 2F2HA 1CLVA 2HJPA 3PFMA 4QLKA 2P10A 1BYDA 5G2IA 1PCWA 3RX3A 3JRKA 3TYUA 1G7UA 5BYWA 4C6DA 1W32A 3AFBA 3RX4A 2VZUA 3A5VA 4QHRA 2XWEA 5LIYX 4KWUA 1J12A 1CECA 3B0PA 2R1NA 4M56A 4UFKA 4UR9A 3PHAA 3TN6A 5CZSA 4C1NA 1P48A 4LEFA 3CU2A 3HF3A 1AD4A 3FJ4A 1F6KA 3R25A 3EXSA 1TZZA 3Q37A 1EPXA 3LRLA 1EYWA 2WNWA 1Q6FA 1VBHA 3F4WA 4B5UA 1KTBA 3UQNA 2PRMA 3HGRA 1UD6A 1S1RA 3UU0A 4HZ6A 1XLHA 4LANA 3TN3A 4REQA 2E1WA 5TIMA 3S6TA 1HX0A 4LRSA 4L80A 4GIAA 5KSWA 5G4HC 4M3PA 3QY7A 2XSBA 3SAZA 5LSMA 3PUDA 1XDLA 4E38A 3EBVA 1TMLA 4C6PA 2IQDA 3SRDA 3GBEA 3CMJA 1DXFA 1E9LA 2E9LA 3CHDA 2FJKA 3WFAA 4D72A 3AHZA 3LYEA 3PBYA 2J75A 4UNIA 4JKLA 4O50A 4FLRA 2W63A 3W02A 2QS8A 1Q8JA 1Q63A 4S3GA 5FF2A 2BOFX 2FQIA 4ZO7A 1VYSX 4TV6A 1E15A 2ZKMX 3HOJA 1HGYA 3QYQA 1JZ4A 4K37A 4TU1A 3INPA 5LNRA 3UYIA 2WQPA 3OJGA 1RD6A 2VQUA 4O15A 3NIYA 2NVAA 4QAIA 1IEXA 3ARXA 3L2LA 4ZFCA 2C13A 3WJXA 1CW2A 2DT3A 3LTYA 1G69A 3THUA 1AW5A 4K7YA 3GHTA 3NPXA 1LRQA 2QYGA 3EX2A 2NV2A 4C6EA 3G1AA 5F7UA 4PEKA 1RA0A 1KWGA 1JPIA 1J96A 3W85A 4PMOA 1TPDA 4IHCA 3PTQA 1YIXA 1WB0A 3B8SA 1R2SA 3O9NA 4ZB2A 1JD9A 2WO5A 1QI2A 4B4HA 2CLEA 3VABA 2RDUA 2RAGA 3CQJA 3TX9A 4AHOA 4AYSA 1UD8A 3TLQA 3U9IA 4XUGA 3C52A 3MHUA 4FLQA 1LDCA 4WDXA 3BZGA 3WF0A 1VFOA 3GNPA 2BVYA 3TQVA 4IOTA 1E9YB 1OGGA 2WWCA 1QNPA 3MSGA 4X2RA 5HBFA 3AJXA 2X42A 4I9TA 1QATA 4JTRA 3AS2A 1KFBA 2GOKA 4WVXA 4K7VA 1GG1A 4LGXA 4U4MA 2W0UA 3VNLA 4O8AA 4D8ZA 1LRTA 3IWPA 2FFIA 2DSKA 3CH0A 3HGOA 1JZ8A 3NQEA 3OZYA 3WK1A 2CC0A 3WJZA 3WUBA 1FH7A 4CNOA 4FXSA 3ANUA 4EX4A 1FWAC 3UZWA 4H9XA 2OG9A 1W3NA 3QJAA 2HE5A 1TE1A 1W1YA 5LIKX 2V6AA 2XH7A 1V02A 2DT0A 3MVTA 2X7VA 1FKWA 3TVAA 4YYCA 3IIOA 2CXEA 3ARYA 4G7FA 3AMKA 2PP1A 3W24A 1HIZA 3ZZ1A 1C90A 3T81A 3PUGA 3GR4A 1E51A 3BSHA 3BTNA 1EH9A 1KXQA 4HNOA 4XWUA 2OXNA 4FOUA 1KBBA 3M0HA 4N0RA 3WQGA 1YE4A 1Z32X 1FHDA 2AAAA 4GINA 5LXEA 1XL9A 5FD0A 5BW6A 3TJ4A 2WMHA 1MUWA 3NG3A 2FTPA 5FAGA 4LYQA 1T5AA 1MW2A 1OF6A 1ZJIA 4J9JA 2QKFA 2PTDA 2WJDA 4DPPA 1WCGA 1R38A 4NUWA 5EMKA 1ZALA 3OLGA 3IGXA 1U5HA 5HINA 1PV8A 5MKGB 1K9EA 4A3QA 4RXGA 4AD0A 2J4GA 1CXEA 2HPMA 3L4VA 3GK0A 4GK8A 5F4XA 3T2PA 2PDUA 2Z00A 4BCEA 5E70A 3LLXA 5I2UA 1WKYA 3M7WA 1QAPA 2PA6A 4HPNA 4LU0A 4C7DA 3NZ1A 3SBFA 3BLLA 1E73M 4FNUA 1QNQA 1TV4A 4LVFA 4A8IA 3HTWA 4ERIA 4NZJA 3ZYZA 1J8VA 3DYPA 3IIPA 2DORA 1PL9A 1EO5A 1NDVA 3Q2DA 4XTIA 4GOAA 4HMDA 4C60A 3H23A 1K03A 5CC3A 1PVNA 3TZFA 4I6KA 4CU6A 3AHYA 3CL7A 1US2A 4EE9A 4RE2A 2YXXA 4QP0A 4LH8A 2Y5JA 7PTDA 1K6WA 1NQ6A 2Q09A 3KBJA 4KESA 1K8XA 1W3KA 2GJXA 4DY1A 1WKFA 1KKOA 3W83A 1JI2A 3KP0A 4A22A 4KKXA 3TQKA 1TA3A 4CEXC 1CWYA 3HGJA 1P43A 3IVUA 5FOOA 3G1YA 2FHCA 1CI1A 3RHGA 2EPLX 4ORIA 2J7HA 4GISA 5FF7A 2D3NA 3SCVA 1DQXA 1UP0A 2WSYA 2ZIDA 5U4NA 1ZLPA 4A8RA 3NVTA 4TX6A 1T0OA 2HEJA 3OA3A 4WJEA 1IT0A 3KXQA 3PZNA 1NELA 3AC0A 3ARUA 3HG3A 2Z28A 3U2EA 4H83A 5EFDA 4AISA 3F1QA 4UNLA 3BQ6A 5H8PA 3VZXA 3C8FA 1HGWA 4X9YA 4H8NA 3B9NA 3CIVA 3F7JA 3NYDA 4Q8QA 3F4VA 2PI6A 3UWZA 1XIMA 3O6AA 2WHMA 3MJYA 1F9CA 1ZNNA 2A3CA 3ARPA 3DG3A 4FK9A 4JIRA 3A12A 2C8NA 2E9BA 3TXZA 4I7WA 2JKAA 1QBBA 4O53A 4D9PA 5KZEA 5G2HA 4IP7A 1X39A 4ERAA 4I5UA 1XIFA 3BPWA 4JIEA 4EP8C 3GNDA 4XAGA 4Y9PA 1TTQA 2FLIA 3BICA 2OO6A 1V0NA 4J3XA 3WMSA 4GXPA 4S3DA 2WSKA 4H6RA 3M0ZA 4AMCA 1TUFA 5FJOA 1MEHA 3CM4A 4HU3A 1F73A 3KBSA 1EPVA 4I8DA 1K3UA 4X60A 1RY8A 4MF4A 4ZR8A 3IUHA 1GHRA 4U28A 5LA0A 3AIWA 2NSXA 4O1DA 1TV3A 2WZIA 1JFHA 1PKYA 4OWGA 2VFFA 4M0XA 2P8BA 2X09A 3G1RA 2Y62A 1ZRQA 3I7SA 3UG8A 3WL1A 5FJTA 4PMZA 3N6QA 1XLBA 1UYQA 5AC8A 3QBUA 5BMXA 3AHTA 3RX2A 1XM3A 4UXDA 3VK5A 2C6QA 5HMSA 4QG8A 3HM7A 3GYEA 4LRTA 1B0IA 3DOPA 2VCBA 2VQTA 5LNWA 1V6YA 2OQHA 1EUAA 2VEGA 2E68A 3V0TA 2I5IA 3G22A 4LAZA 1FHLA 3WDJA 1HNYA 2BODX 3GC2A 4Q4RA 2QJIA 4DXVA 3NZPA 3E5PA 4LUJA 1W1A1 3PUEA 4OBSA 3H70A 2JE8A 1UWUA 2OT0A 3VI2A 4FXJA 2VO5A 1C3FA 3P8JA 3AMGA 2BMBA 2VT0A 3CUXA 4C6KA 5M17A 2CBVA 4CD4A 2V5DA 4BA0A 2GYIA 1W3HA 3GC5A 4ACZA 2GDVA 4A3RA 3STFA 2AGKA 4UUIA 1EF2A 5CCZA 2E6YA 1VZWA 1T96A 3VGHA 3ITYA 3QGAC 3SFWA 2EF9A 2XJ7A 3UJSA 3STCA 1XDMA 2HMCA 3GX9A 3UG5A 5G4WA 1JYNA 4AZ5A 3NDYA 1FDZA 1WZKA 1TIMA 5AHMA 4Q6JA 3QFWA 3GG8A 4JTGA 3RILA 2OQLA 3ONBA 3VGBA 1Q3NA 2V68A 3QLDA 4ICNA 1R46A 2KX9A 1EBGA 3VOFA 2ZUTA 3UG3A 1YKWA 1J0YA 1A5SA 3H2AA 3ZMRA 3T07A 1ECEA 3HB9A 2FDMA 3WDPP 4JIHA 3WLKX 3CLMA 1NQKA 5I78A 3M07A 1JYVA 5IRPA 3AU2A 3CEPA 3W75A 3R89A 5I23A 3RDKA 2V2CA 4KCTA 4S39A 3PPFA 1XDJA 3NM3A 3N3MA 1EZ2A 1MXGA 1UKPA 5IOBA 3FYPA 3SDOA 3VDBA 3T55A 2P0IA 4DIAA 1ITQA 4FNPA 4KQNA 4XAFA 1J6OA 4EWND 3EWDA 4DYKA 2NLYA 1O5RA 2PD5A 3R8HA 3U5YA 1A3WA 3AU6A 3DBNA 3SB0A 3F2BA 4IQDA 2YOCA 4AF0A 1UKOA 1QCWA 3FGCA 2JEQA 2VX4A 3CK5A 1HO1A 4LTSA 1CBGA 1W8SA 1HQTA 4GIYA 1ZPTA 1ME9A 2G4FA 4GUIA 1OG0A 1CX9A 3OA5A 1CB7B 5C8BB 1ISXA 2Y70A 2V5CA 2E28A 4DX3A 4YU1A 4NNCA 3QPEA 1H7OA 2WV8A 3LPOA 3PF3A 3HPZA 4KEUA 1OC5A 3W2LA 1KM2A 3NQVA 4F0RA 2INEA 1FWSA 7ODCA 3M5XA 4L4PA 5EB8A 2AMGA 4FXFA 2JF7A 1BF6A 2E6AA 4KRTA 2VC7A 3BAKA 3MUCA 3PG9A 5HNTA 5F2LA 1Q6LA 1VJIA 2GVGA 2OCZA 4NAEA 3UCDA 1XKJA 3DC8A 4KEMA 2Z1WA 1AUSL 1K9DA 1DORA 2WANA 3ITGA 3WQDA 4Y2WA 4HK6A 1LWIA 1OM0A 4GH1A 4J3TA 5C70A 2ZRXA 4CVWA 2GJXB 1QPRA 1RSCA 3MMDA 3M7SA 5D38A 3CMFA 4X61A 4UR7A 5DY3A 3BCFA 1TA3B 4ATDA 1MYRA 1KR0A 1UUQA 3LB0A 1QWGA 5D2YA 1AQ0A 4LJ3A 2ONEA 3I6RA 2YL5A 3JR2A 2IKHA 1NARA 1KFEA 2E3ZA 4K2SA 3MHFA 1RBLA 4AG0A 1BFNA 4ORMA 1HFBA 2XSAA 3UBPC 5I0DA 2Q6ZA 1XI3A 4GWEA 3G0SA 3R2GA 3FA4A 1QI3A 4J3WA 1W5QA 4AX6A 2VFDA 7CGTA 2A79A 5CZ0A 4WHBA 3QR3A 3EMQA 3BJTA 3O6YX 4H7VA 3GTIA 4EACA 1XGDA 1YPIA 2H6RA 4CNTA 1BPLB 1MUMA 3AI0A 3FLUA 5H1WA 3T0BA 5E9XA 2BY0A 2POZA 3WN6A 5C55A 3N9KA 3O0KA 1UD3A 4PMXA 1O66A 3L23A 3WDIA 3P80A 5A2AA 1MQRA 3E9AA 1IIGA 3VDHA 2ZYFA 2V82A 4JIPA 2A3LA 4DWSC 1P7TA 1P0DA 1RA5A 2YA0A 3WLIA 5DX7A 3HQPA 1YDNA 4ADSA 3W86A 2E9MA 2CZFA 5K2ZA 3NQAA 4Z0JA 3DI1A 2DZBA 4PUMA 3FNDA 4ZE4A 4DWSA 3H54A 1JPHA 2OX1A 3VD9A 1OC6A 4JHMA 4CD6A 3RCMA 3KVLA 5M3WA 4UTLA 4JDYA 1W1B1 2WM0A 3E96A 2PBOA 3L2MA 1TWIA 2C1HA 2RGLA 4W7UA 2HCVA 4ML9A 5LA1A 2HBVA 2YZ5A 4E0CA 1GCYA 4C90A 2AGTA 2PODA 3NDOA 1REQB 4R9OA 1W3JA 3CBWA 4UIOA 4HP5A 2OVLA 4KWOA 4DZIA 4X0NA 3W2UA 3QC0A 1O68A 2UWFA 4E4PA 1EDQA 2X0HA 3G77A 1GQJA 1ZJAA 3QV6A 2O56A 4C6MA 3MP5A 5MHBA 1TCDA 4AY1A 3MVIA 4CCDA 4LS0A 1UB3A 2X7WA 1ADDA 5D02A 4AD2A 3R0UA 4LAUA 4ZB0A 5I7GA 2EPNA 3ALGA 3SRHA 3NQ2A 3M41A 1MQPA 4FP1A 4ACZB 5EGRA 1E4IA 2HISA 2ZBTA 4GH3A 4R3UA 1Z6KA 3SRFA 1RCXB 3CJPA 4V28A 2OQYA 2VM8A 4C6BA 3NPWA 2Y8VA 4IGMA 4S3BA 4X0VA 1A4LA 2FTYA 3D3AA 2YCKX 3CL8A 4ZB5A 5BNKA 3R0DA 1UR3M 3NQGA 1VF8A 3OODA 3UERA 4EPEC 5F2IA 4D6EA 3KZSA 1KLYA 4C65A 2GDUA 3UR7A 4K8HA 1S3TC 1L2QA 4I7VA 2WKJA 1Y5WA 3E2VA 4DWDA 4KCUA 3GTXA 3CV7A 3WJWA 4W86A 3G6MA 4MTVA 1EJTC 3NXLA 5BXPA 2R24A 1DJWA 3LTSA 3STEA 4Z1BA 4D6FA 2A6NA 2YFNA 1UMYA 3ALFA 4ZEPA 3ARSA 1TZ7A 3ARRA 4S2BA 4R27A 1GW9A 3AZRA 1H61A 3W6MA 3S2MA 3CWHA 3EDFA 2DSWA 3UY7A 5DCDA 3M5VA 1YADA 3ZLHA 1GWJA 3UG4A 3W7MA 2DQWA 4FLSA 1NWUA 4FLOA 4O1AA 5C0QA 1FCVA 4WX2A 3W74A 5D2VA 3UFYA 3GR7A 2BP1A 1SJBA 4I5RA 2PWFA 4A6GA 4Z2JA 3S3GA 1AQMA 4ZZ9A 1G67A 4PODA 4HHLA 3A22A 1UR4A 1SYTA 2DDXA 4CU7A 4JTSA 2P3EA 3TWAA 3SUVA 4UWMA 4WQ6A 3PWAA 4XZ9A 4HJFA 3W88A 1IXOA 1MW3A 2ZXDA 3MBDA 4CN4A 4JEJA 3CL6A 1GZGA 2DJXA 2WMJA 3M0VA 3BGAA 3QQ0A 2Z6JA 3CQHA 3C0QA 3S9ZA 1K9FA 5KETA 4XKYB 4N6EA 4RDVA 4FIRA 1OFQA 4E6MA 1U5JA 3VIGA 3S2NA 3W29A 4PUWA 1H7WA 1YPFA 1ZCCA 3A3HA 2PDGA 4U5KA 1SO3A 5D2WA 3R8GA 3A9BA 3W76A 3PPCA 1PZ2A 3AWNA 1FBAA 1CNVA 4UMBA 3WY1A 5IBXC 2VWTA 1XYFA 2EJAA 2PDMA 2DH2A 4QRNA 3WLSA <