3QC3A

Crystal structure of a d-ribulose-5-phosphate-3-epimerase (np_954699) from homo sapiens at 2.20 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
225
structure length
225
Chain Sequence
GMASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-ribulose-5-phosphate-3-epimerase
publication title Crystal structure of a D-ribulose-5-phosphate-3-epimerase (NP_954699) from HOMO SAPIENS at 2.20 A resolution
rcsb
source organism Homo sapiens
total genus 60
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qc3A00
2NZLA 4ADSA 3USBA 3V1PA 3OIXA 2X30A 4YMZA 2YR1A 2JK2A 1DHPA 3DXIA 3W3OA 2HTMA 4JYEA 3L5MA 4IMGA 1ALDA 1TJPA 4WXYA 4QITA 1VYSX 3UPWA 1WXJA 3GDRA 1A5SA 1JCJA 3LM7A 2BZNA 3M9YA 3L66A 4RZ4A 4S2BA 1OK6A 1PL9A 3OHIA 4LVAA 4M6PA 2VEPA 1VLIA 3S1VA 2A4AA 3A23A 5D38A 4M19A 2B7OA 2JKPA 2O7SA 4UIOA 4UNKA 3L0NA 3W1XA 3NQFA 2YX0A 5AHEA 3SJ3A 2QCCA 1W5MA 4IQLA 4FNUA 1SO3A 4Z1AA 3IVTA 2H3DA 1KW1A 4S1FA 3QPYA 1TQXA 3PC0A 4UNLA 3BG5A 4ZQNA 3S8HA 1G4PA 2GVLA 5EL1A 2ZRVA 4PL1A 1V7YA 4KWVA 3LTPA 1W3NA 2GVJA 3PWAA 4XUGA 4NZFA 3P7YA 3KXQA 3GB6A 1TV7A 3N73A 4NVTA 5CSSA 5EA9A 1C8VA 3PULA 2ZRYA 2GQAA 1LDCA 1MZHA 1J4EA 4DXVA 4LTSA 4FX8A 5D2WA 5TQLA 3GR8A 2Y7EA 4CLMA 3FFSA 1THFD 4LC6A 4O12A 4UFMA 3MHUA 3CB8A 1TPWA 5KZEA 4OU1A 3C52A 3DFOA 3HF3A 2GQ8A 3QMRA 1B4KA 4X9SA 4Z1BA 1DKWA 1P1XA 3M7WA 1ME8A 4HSOA 3TX9A 1K8XA 2E6FA 4MIMA 1FDYA 4O13A 2QCEA 3S1XA 3EKLA 1YDOA 4TIMA 3KHJA 1X1OA 3TDFA 1I2QA 3C61A 1YADA 4JICA 4UFIA 2FB2A 2GVGA 1K7XA 4HPJA 3BG9A 3BO9A 5AHMA 4IX0A 5EBUA 5BW6A 1W54A 1SZGA 1KM4A 3W2UA 3N14A 4EF9A 3CQ0A 2ZA1A 4O52A 4DELA 5HWNA 4N4QA 2DJXA 1H51A 5LGXA 4XQ6A 4BF9A 4WZHA 4KWWA 4BR1A 1W3TA 1FCVA 1GYLA 4LS1A 3NL3A 3ZWTA 3O06A 1TV5A 1G4TA 3GXNA 4PC8A 1K3UA 1Q6QA 1ADOA 4JR5A 3S5YA 3VFLA 1YYAA 3TW7A 4KFNA 2J9XA 3CTLA 1O95A 1G6CA 5J5RA 4EIVA 1GVQA 1W8SA 3F4NA 4FIRA 3QQ1A 1K7FA 4R53A 4O1AA 3G1HA 3NM3A 2NV1A 1PV8A 1WAUA 1WV2A 2BSLA 3QM3A 4JTUA 5LHEA 3IGUA 3TC6A 2RKXA 1BTMA 3TXVA 3WK2A 4AF0A 2Y62A 2ZRUA 3O07A 2G95A 3C4UA 1ZFJA 2DZWA 1DV7A 4J9JA 4K7YA 1TO3A 3MYPA 4AAJA 2CZEA 4N6FA 3HBLA 3YPIA 1JQXA 5FF2A 1RVGA 1RQEA 5HMSA 2KZHA 5LZLA 2FDSA 3MMTA 3KVLA 3LOTA 3NPUA 3IIVA 3ZWSA 1TRIA 3GAYA 1VLWA 5FF4A 4UMCA 3L68A 1G7VA 2ATSA 4MJZA 1Y0EA 3BLEA 3TFCA 3T55A 4JYFA 2IQTA 2JKEA 3GDKA 1R2RA 2OJPA 3MI6A 2PCQA 4AH7A 1FCBA 3EB2A 3G3DA 3DGRA 3TK7A 2HMCA 1KM2A 1WA3A 4O1DA 1VCVA 1GYNA 4DEFA 5FEZA 3WK0A 1JCXA 1VPXA 4CNOA 4QIUA 3B05A 3FOKA 5J5DA 3EX3A 5D2YA 2UV8G 1MEHA 4HNUA 1PCWA 3P74A 4MLJA 4O16A 3R2GA 4MYAA 2Y7DA 2ZA2A 5HUPA 1GWJA 1W5NA 4QJ1A 1O94A 1FWWA 3TSMA 1LRTA 2R94A 3LCXA 1VYPX 3QRHA 1VH7A 5DELA 1K8ZA 3T78A 1I2NA 1KM3A 2YXGA 3GVGA 3M16A 1TPUA 1SFLA 1WQ5A 3UWWA 4UTTA 2TPSA 3H55A 3TR2A 3P62A 4NJGA 1L6YA 2DJLA 3MWAA 3E49A 1ICPA 3ATZA 4UFHA 5DY2A 1OFRA 3G1YA 3W2NA 3I68A 3PUEA 3TJXA 2RH9A 4DBEA 4CCDA 1TJRA 2V9DA 1XUUA 2ZRZA 3F03K 1YLVA 3G18A 1IXOA 5U7SA 1FCQA 2NUXA 3NL2A 1Q6LA 1X1ZA 3W87A 4NXSA 3LV5A 1LLZA 2WPBA 4AF0B 1EP1A 1LTDA 4MZ8A 2X1UA 2B7NA 3FS2A 3TAKA 1AG1O 3LTYA 5TBOA 3QQ0A 3LCLA 4JS3A 3P5ZA 3S5ZA 5C2XA 3GZ3A 3WJZA 1TTQA 3QMSA 1EWDA 1F2JA 3P67A 1UB3A 4O17A 1OFBA 1DJQA 4QSHA 5I3FA 1ZENA 2YYUA 1T8XA 4K8HA 1JR1A 5G2WA 3C2OA 4A22A 4IGHA 2Z6JA 4XTIA 1EUAA 4WOZA 4ONVA 1RD5A 2RDWA 2E1DA 1JUEA 5G4EA 4RX0A 4N4PA 2QUTA 1JCLA 4GJ1A 2VFEA 2Y61A 3MUXA 3NL5A 1M7PA 1TRDA 4UTUA 2Y7FA 2F84A 2E6YA 3W86A 3IGXA 3RLVA 1FX6A 1QOQA 4CCEA 3W7CA 1L6WA 3N9SA 1QO5A 4NX0A 2TRSA 4GUIA 4QNWA 1L9WA 3N19B 4GC4A 4HN4A 3IVUA 1YTKA 4MFDA 5FF0A 1GVSA 2XFWA 1QNVA 4K36A 2Q3RA 3N9RA 2WNQA 1HO1A 2NX3A 3OVQA 3UZJA 6ALDA 5DBTA 5DBUA 3UWZA 1H1YA 2Y89A 3P5YA 3C0JA 5AHLA 2HSAA 1UJPA 2H8XA 4GUGA 2A2IA 1EX5A 3OVPA 4PFMA 5F1VA 3TROA 2NV2A 3DHDA 2G5WA 1NSJA 3GKAA 4EWND 4ZQPA 1N8FA 1Z41A 4YCPA 2ZZ2A 1G67A 1UASA 3I6RA 5DCEA 4UFKA 2FIQA 2NXIA 5D37A 3FJLA 3E9AA 4LVBA 5HR7A 3KX6A 2ZFAA 5CGQA 4IWWA 4MY9A 4RZ6A 1K02A 1D9EA 4E2DA 3Q37A 1P4CA 3G0UA 3C8FA 1OX6A 2CLLA 1K03A 4PODA 4FNRA 4AWTA 1M5WA 3STCA 4H6KA 2F7FA 3TJLA 2DORA 2I9EA 2VFHA 2V2DA 1UUMA 1OF6A 4N9BA 5KZMA 1O4UA 5CPMA 3W2LA 3VNDA 1A5CA 4O50A 1SZEA 3DFTA 1SPQA 3M5VA 2TYSA 3M41A 1LLWA 2J27A 3QF0A 2ISWA 3EXTA 1M6JA 2WKJA 2X2GA 3AO0A 3B0VC 5EKYA 3STEA 1SZFA 3HG4A 1KM5A 5A5WA 3W85A 3M44A 1OFOA 4OE7A 5C5YA 4CNPA 2R8WA 4RXFA 1XBVA 3QC3A 1QMLA 3LV6A 3HMJG 1RV8A 3C2VA 3O6CA 4W9TA 1GOXA 3RF9A 5CZJA 2YDAA 2EHHA 1K8YA 2PURA 5EY5A 3BV4A 3UWUA 1TPFA 1KTCA 4KFOA 1VHNA 2G96A 3NPWA 3QSRA 4JY9A 4DF0A 1HUVA 3BW2A 5F2LA 4R34A 3A9IA 4JTIA 3S1UA 1UBSA 3UZ5A 1P5BA 4HKPA 4TMBA 2TMDA 5KZDA 3S1WA 1H62A 1TB3A 5EPDA 2HS8A 2ISVA 2YGYA 2WJZA 3DH7A 6TIMA 2EGZA 1B3OA 1F5ZA 3WK1A 1ZAHA 4M5PA 1G4EA 3O05A 2GJNA 3KOFA 1TPVA 4QISA 3LXBA 4Z0SA 3W1AA 3SSJA 1W5PA 3NQDA 3Q94A 1SO5A 1ICQA 4JTGA 4OQVA 1HTIA 3PY2A 3TQ0A 1JRBA 3ZR4A 5BMWA 3W7MA 4DO4A 4ORIA 2Z6IA 2VEIA 1F6KA 3SY5A 4YWIA 2QAPA 3EEGA 3DKLA 1I2OA 1OFQA 2R91A 4S2CA 4IMEA 2OX1A 2BWGA 2NWSA 3QW3A 3HGSA 3GXPA 3CWOX 3L9CA 5F4WA 2QJGA 3SGZA 5IBXC 1WDWA 1LZOA 4IPIA 1TIMA 2ABAA 4UFJA 1QWGA 1LROA 3W1PA 5EYWA 3N3MA 4FB7A 2B0MA 1GPWA 2V8ZA 4TR9A 4Y8FA 3DZ1A 3MW7A 1F7BA 3D0CA 2AAMA 3EWUA 3SGUA 2EAWA 4P61A 3EWYA 5SWUA 2FB3A 3G8RA 1NAL1 1OX4B 2FTPA 4RZ5A 3W2MA 1QO2A 3W7NA 1P0KA 4X22A 3MP4A 1G4SA 1KM6A 2FJKA 3PBUA 2Y70A 2NXGA 1DBTA 4JNMA 3NYZA 3EWWA 4FIQA 4BK9A 4O18A 3A21A 1FDZA 4PH6A 2CLFA 2ZZ7A 4GRSA 1YDVA 1F6PA 1H7RA 3NXFA 5FESA 1WX0A 4IXHA 3EX4A 3HGRA 3ZS4A 2AGKA 3G3MA 3I7RA 2NUYA 4TU1A 3NGJA 5CZSA 5AC8A 3UPBA 2V30A 5FEPA 3TSBA 4JTHA 1R2TA 4ZL1A 4M6QA 2V2HA 1W5QA 2CLOA 1DQXA 4OWGA 2CFFA 5KITA 4O1CA 4POCA 1EA0A 4UTWC 1EIXA 4DO5A 2FPVA 2A7PA 4UUIA 4N6EA 3W6YA 1KLZA 4HIBA 1AL7A 2DZUA 3LCGA 3L65A 3STGA 3TMLA 1FWRA 1ZHAA 5G1TA 4HNVA 1KV5A 3UWVA 1EP3A 3L21A 3PF3A 5CZTA 2E68A 4WY0A 4EVZA 3HGJA 2P0OA 3A5VA 3VE9A 3W75A 4JTKA 4FNQA 3W9ZA 1H50A 4UR7A 1GVRA 1T96A 2G97A 2OT1A 1LBLA 3BGJA 4Q32A 1SSDA 2BX7A 1G69A 2ZA3A 2FQIA 4UTIA 5LNVA 4KFPA 1LRNA 3OEXA 1ML1A 1U5JA 3B0PA 4LV9A 2Q3OA 5H91A 2YSWA 4A29A 4HHPA 3LHUA 2H6RA 4NNAA 4XBSA 2ISSA 4OV4A 4XBKA 5CPLA 3U2OA 1GG0A 5CPOA 3LCIA 4LRSA 3B4UA 3CWNA 3O16A 5KMYA 1AW1A 3WK3A 3NNTA 1LBFA 4UXDA 4CQAA 2ZZ3A 3NQCA 4K39A 3TIMA 3R12A 2C13A 4AHQA 1ICSA 3FKRA 2ATMA 1L6SA 2VOMA 3PB0A 3LBCA 4Q4KA 5KINA 5L9FA 3IVSA 3W73A 4LVDA 4O10A 4OT7A 3NQGA 4RXGA 3RNDA 3OG3A 1MEIA 4BFAA 2YYTA 3BGGA 3PBWA 2DZVA 3W1NA 5I3HA 2ALDA 2QUVA 5DY3A 4MOZA 5K4XA 1SW3A 4JTEA 5D02A 4MY1A 5F2MA 4K38A 2Q8LA 4E0CA 5AHNA 1VGAA 1QCWA 1CX9A 1W37A 2XN2A 3MP5A 5DXYA 3C56A 2QJIA 3WJYA 1JVNA 1IIHA 3LCFA 2ZZ5A 3OBKA 3JR2A 4WUIA 4WD0A 1YDNA 4O28A 3GXTA 1WOBA 3TE9A 4MZ1A 1TTIA 1L2UA 3LLFA 2ZRWA 1H7WA 2A85A 2A7NA 3GX9A 3M0ZA 4RJEA 2PRMA 4GUHA 1PCKA 5K9CA 3G8EA 3B06A 3HB9A 3IV3A 4HNNA 1B4EA 3SFKA 1Q3NA 3WJXA 1BWKA 3G1FA 4M7SA 4D2JA 1FXQA 5D32A 3LGEA 3MJYA 1ZNNA 3OVRA 3W71A 1P0NA 4DO6A 4WY0B 2WOQA 3TH6A 3FEMA 4NZJA 3LLDA 3DFPA 1JUBA 1KFEA 4JIQA 3GNNA 2E6AA 4TO8A 1TTJA 4M7TA 2VC6A 3THQA 1S5WA 5CKSA 2B7PA 1TTPA 3WJSA 4N2YA 5F1UA 3UYCA 3A22A 4ZQCA 1Q6RA 3ELFA 4I7VA 3ZFHA 3F4WA 1XDLA 4X3ZA 2PE4A 2B7QA 4OHQA 4HT3A 3AJXA 4EF8A 4UTTC 3W1MA 1H61A 4I9AA 2Y85A 1K7EA 1VZWA 5E0KA 3SIZA 3FIGA 4FX7A 3TAOA 3P81A 3IRDA 1QAPA 1OFPA 3DU0A 1KTBA 2VFDA 4DBDA 1H7OA 2I14A 3EWBX 4JTJA 3PBVA 3NEVA 1OFAA 1OVDA 3EXSA 3I7QA 3GKFA 4IOTA 4RR4A 3G24A 2QJHA 4WX2A 3HPZA 1QFEA 4GFSA 4IMDA 1PHWA 3DENA 3THAA 4CNNA 3HOJA 4UCGA 3B0UX 2VFIA 3P8JA 5AYZA 5HNRA 3NOEA 1S5TA 4YCOA 3UXDA 1OHLA 2H90A 5D30A 1N7KA 3H53A 3I7SA 4FHAA 1XBXA 2C3ZA 1XXXA 3ABSA 4JXCA 5BRBA 3LI0A 5DXXA 3NDOA 1ZAIA 1GVOA 1LCOA 1XC4A 3L0GA 3R8RA 3CU2A 1VJIA 4XKYA 5HJLA 4FO4A 3W72A 5E1QA 5F4SA 1PE1A 4K6AA 1UUOA 5AB3A 1SO4A 1VCFA 2V82A 2Y6ZA 2YFOA 5D2TA 4CQ9A 4RKAA 3ABQA 1A5AA 3HG5A 1Z44A 2E09A 1OYAA 4NX5A 2OZ0A 1IXNA 2PRLA 4IUOA 1LOLA 4QAIA 1TQJA 3M5YA 1Z48A 1EB3A 2J88A 4K7VA 1S3HA 5K9DA 3PSVA 2C19A 4NT0A 3T7VA 2W6RA 4UMBA 2WSYA 4QQ3A 1PIIA 1Z42A 3VCRA 4HSNA 2QF7A 2WNZA 5DN1A 1JCYA 5LHFA 5CG7A 1HFBA 3KRSA 1IXQA 4ADUA 4Y9AA 1NFBA 4PA8A 4H4IA 1QDSA 3DKJA 1KTNA 2V2CA 5I3IA 4XTDA 3KFTA 4O11A 3S0CA 2OMAA 4LS2A 4PCFA 3TQKA 2V5LA 1YPIA 4U28A 3DFSA 1O60A 1TMHA 2Y63A 4JD4A 2ZZ1A 4QNEA 1IF2A 5C55A 4RLIA 1E51A 2TSYA 4NJHA 5LNSA 2XN0A 4FF7A 2VXNA 1VRDA 3BW4A 3W74A 3NQAA 3DBPA 3STFA 2VEMA 3TQVA 3NG3A 4WY0F 5CSRA 3C2FA 1RR2A 1H1ZA 1GTEA 2RFGA 2DZPA 4MY8A 1FWNA 2C16A 5I3GA 2D73A 2QEZA 3TMQA 4BWLC 1OX5A 3GK0A 1GEQA 3TU9A 1O5XA 1VYRA 2QCHA 1BKSA 4FEZA 1OK4A 4LUJA 1OFEA 4ORMA 2YCEA 2JGYA 1H5YA 1H7NA 3KVKA 2GQ9A 4GE8A 4XKYB 5BNKA 3G1DA 3ABOA 3IIOA 3A5FA 3FYPA 3GDTA 4H3DA 4LS0A 2V5BA 1NF0A 5MHBA 1EEPA 3IIPA 3L2IA 3UWQA 4XZ9A 4YXGA 1J2WA 2CW6A 1F73A 4HNTA 2V0TA 3W1UA 5D2VA 3DI1A 2C0AA 3QYQA 2C1HA 1OX4A 3GIYA 1PVNA 4TMCA 4N9DA 2RDTA 1I4NA 4NJIA 1LORA 4AMAA 3NPXA 2ZQ0A 1AK5A 3P80A 2FFCA 1GTHA 4RK8A 1V5XA 2GJLA 2GPTA 1VC4A 4FXRA 4Y90A 5LSMA 3NQ2A 1SW0A 4ZQMA 3W7KA 1YXCA 4MVAA 3G0XA 5G5IA 3MHGA 1SSGA 2QCFA 4O14A 3NR0A 3LCWA 1F76A 4ML9A 4OV9A 5FF7A 3HG2A 2NLIA 1JQVA 4JTFA 1FBAA 3DFQA 1IGSA 1ZCOA 4MFEA 3G1XA 4O54A 1ONRA 3W23A 4FNTA 4JDYA 3U6WA 1GQNA 1BEUA 3DAQA 3RU6A 4UTKA 3R5EA 5LGZA 1EPXA 2Y7GA 1I45A 2EPHA 3E12A 2NXHA 1PS9A 1TYGA 3TC7A 4QM1A 4GBUA 1AW2A 1LOSA 5HQEA 1W1ZA 3VI2A 2QDGA 1C29A 1FWSA 3W7QA 4LVGA 2CLIA 3LB0A 4MYXA 3G0SA 3HG3A 5D33A 2JKAA 5K4ZA 3V75A 1KA9F 3UNDA 1LRQA 2Q8ZA 4IJBA 4NU7A 5DLCA 4O0KA 4O0ZA 1FUYA 2VELA 5HINA 3UY7A 1I8JA 1YTDA 3PG8A 5G4WA 1DJNA 4Z0JA 3Q58A 1GVFA 2A6NA 2YW4A 1KV8A 5A8GA 4IMCA 3W84A 2J6XA 1JRCA 2CLMA 1T0OA 3BK0A 4NXKA 1KM1A 4ZZ9A 3ABRA 4ZMGA 1MEWA 3PSWA 4JTTA 2ABBA 1XL9A 3BVJA 4JDBA 2ZCGA 2ZZ6A 1DVJA 3NQEA 1C9DA 3PR2A 3NQMA 1MXSA 2Z1BA 3EX6A 2YZRA 3WJWA 4UR8A 1XCFA 4O1BA 2QCGA 4IXXA 4AB4A 3EKZA 2X16A 3H54A 3CT7A 3EXRA 2GOUA 2QAFA 3HPSA 1GZGA 1I2RA 1MSSA 3CC1A 2HS6A 3ANYA 2GUUA 4O4VA 1U83A 5HWMA 3TNOA 3S6DA 3QW4B 2E5DA 2OCZA 3E0IA 2NX1A 4M6VA 5IBXA 4R7JA 4UTHA 3RK8A 4DQWA 3DHFA 3HGOA 3PAJA 4GXMA 1YTEA 3U8GA 1H60A 4IMFA 1T99A 3RMJA 3FA5A 1XM3A 2ZRXA 1GG1A 2CLHA 4JX5A 4Z1DA 3NO5A 4NNBA 3WFAA 4FNSA 5G2HA 3M1ZA 1Q45A 1VQTA 3QZEA 3L5AA 2ZDRA 3QPZA 3RLUA 3NZ1A 4JIPA 4CCCA 3M5ZA 3G1VA 3W22A 3PBYA 4N02A 5G2IA 2C15A 3NQ8A 2WSRA 2WV8A 4Y96A 4GNJA 4UTJA 3P60A 4LOCA 4GUFA 3P8IA 5HR6A 4O19A 2Z2UA 1KM0A 2W79A 1RQHA 1IXPA 3C6CA 3LHVA 3P84A 3PB2A 3W7JA 1F05A 3NQ7A 3O6DA 1KFCA 4TX9A 3CIXA 2CZ5A 2DZSA 4B5NA 4NNCA 3W7RA 3HPXA 4Y6GA 3LX9A 1LM1A 4JTLA 1ZY9A 3NVTA 3W2KA 3HQ1A 1WBJA 1JCNA 1QR7A 3LRLA 3W1TA 5HUOA 2C6QA 2WO5A 3PM6A 3MP3A 3TFXA 4I7WA 5ABTA 2FLIA 4UTWA 1QOPA 3B8DA 5AHFA 2O7QA 1SW7A 2E77A 4N9EA 4UTMA 2A7RA 2VEKA 4NUWA 2CZDA 2H3BA 5F2GA 3KVJA 1R46A 3CEUA 3O6YX 2QDHA 2ZTJA 1H7XA 2W0UA 4MKNA 3LHTA 3SI9A 3OA3A 2XN1A 4I7UA 2X1TA 1VS1A 2A21A 1JULA 3NA8A 3S5NA 1F74A 4EOUA 3W70A 4L4LA 5BMXA 4OGZA 4LY8A 3F1QA 3MI2A 4AWSA 3EWZA 3W7GA 3QSTA 3T4CA 1W0MA 4FXSA 2FPTA 4X2RA 1SZNA 3MBDA 1DOSA 3TXZA 2YPIA 4UMAA 2VKZG 1DORA 1PHQA 2QR6A 5AHIA 1LYXA 3W1QA 1WOAA 5KSWA 2J24A 4GUJA 3SZ8A 3G22A 3PG9A 4BI6A 1A53A 4L4MA 1EUNA 4KKXA 1AMKA 1SFJA 3IEBA 1OF8A 4E38A 5AC7A 5E93A 2Y88A 2DZXA 1ZJIA 3GLCA 4BI5A 1EWEA 1AW5A 4AHOA 2ZYFA 4ZQOA 1G7UA 3T44A 4A3UA 1S5VA 2WSQA 4ADTA 1X7FA 2WQPA 5D04C 2CLEA 4WQ6A 3TKFA 3PUDA 4RV8A 1FDJA 2CZFA 3PVFA 2QCMA 3L0KA 5AOUA 1FQ0A 1R47A 3O1NA 5FI8A 3CPRA 3LDVA 1RZMA 3BPWA 1TPH1 3CIWA 1LBMA 1N55A 2I1OA 1GJPA 4PTNA 3MHFA 3MO7A 3W1LA 3TSDA 3NQ6A 2C14A 5I3JA 1KLYA 2Z0IA 3ATYA 5HWJA 5AYXA 3QMTA 2QUUA 1XBZA 3EX1A 3CEPA 4IPJA 4E2BA 4AVFA 1DQWA 3NZRA 3M5XA 1JUKA 5IM51 1KBJA 1RQBA 3DFNA 1KBIA 5F2IA 1TREA 3C2EA 2E5CA 3IIZA 1W56A 1SUXA 2QCDA 3HO8A 5H2ZA 4FX6M 1B57A 3LHZA 5GVJA 3GYEA 1VCGA 1XI3A 5K7JA 1CW2A 3G1SA 2QCNA 1ME9A 1XBYA 4MPQA 1NEYA 2ZBTA 4O4WA 4IX2A 5AFDA 3W07A 1TV8A 2H8ZA 1A50A 3KAOA 4C1KA 4WXZA 1OG0A 3KRUA 1J5TA 3MYOA 4P2VA 5D05A 8TIMA 1SU5A 3TA6A 3LXAA 3CLMA 4JEQA 2VENA 2A1YA 5DCBA 3QEZA 3QJAA 2A5HA 3G1AA 3BARA 3N34A 1OFDA 3GDMA 2A6LA 3W7PA 4ICNA 1OABA 5D2XA 3M47A 4AWUA 4K8EA 2FPYA 4Z08A 3B03A 3L67A 3B04A 1XFBA 3SR7A 3LXCA 3NAVA 2EKCA 3NPVA 2WNNA 5AYYA 5FEWA 5LNUA 2EF9A 4DF2A 2CLKA 4LWWA 1VHCA 2RDUA 5I3KA 4A21A 3P82A 5FEXA 2X1SA 3VKJA 3BLFA 5D03A 5LNRA 3R13A 1NF7A 1JCMP 1SR9A 4UTLA 5BOOA 4JY8A 3UWYA 3NL6A 4LW7A 3GDLA 4AEOA 2PRHA 1B9BA 5LNWA 3IGSA 1QPRA 4O15A 4LUIA 3LRMA 3LTSA 5FF3A 5AC6A 4HPXA 1TPDA 3W76A 4ZQRA 1X6UA 2P10A 1KFJA 3E02A 3S9YA 3W7DA 3W7EA 1ZAJA 2RHGA 2VFGA 3LERA 2VFFA 1EP2A 2C18A 3L5LA 3QFEA 4YL2A 1OYBA 4AXKA 4MZYA 1IIGA 4DPQA 5C6MA 4WOQA 3UY8A 2QCDB 1JJKA 1YPFA 5CZ0A 3EX2A 5K2ZA 3GNDA 1VR6A 2ZTKA 3A24A 5KTLA 1TSIA 3PUOA 1TPC1 2NUWA 4N9CA 3UD6A 3EWXA 2YW3A 3CM4A 5T26A 4CQ8A 5TIMA 4O57A 4OBTA 2QCLA 1M7OA 4JX4A 2NX9A 3C3NA 3P61A 3GAKA 4LC8A 4BI7A 2AQWA 1O5KA 3W7HA 3CHVA 4C1LA 2YFNA 5K3VA 1X8FA 1FCUA 4O53A 4A2RA 3R89A 2CWNA 1H63A 3BW3A 4LU0A 4PL2A 3TCEA 1Q6OA 1W3IA 5HULA 3HIJA 4JN6A 1KFBA 2DZTA 1AL8A 4JX6A 2DP3A 3W7LA 4RCXA 2PC4A 4NQ1A 4U4MA 4LV4A 3HJZA 3DI0A 1I2PA 3K30A 5EMUA 3I65A 4FNPA 4LT9A 1SQ7A 3W7OA 1TCDA 1OYCA 3LRKA 2V81A 4JGDA 1HL2A 2CU0A 3N2MA 4K37A 5U4NA 3UQNA 1R30A 3W7IA 1D3HA 4NJJA 2J9ZA 3LBMA 2ZZ4A 3SW6A 3SECA 3JRKA 3W2JA 3O8AA 1XDMA 3BG3A 3Q2DA 4Q33A 3LHWA 5CPNA 1LP6A 5F4XA 4LVFA 3LCHA 2J9YA 4BWLA 2B4GA 3KVMA 1QPQA 4ZVJA 1KFLA 1SO6A 2DU2A 4WJEA 2X1RA 5LKYA 4DPPA 3KRZA 3O63A 3UXAA 1W5OA 3MI3A 4GWEA 1CI1A 4G1KA 4YLWA 1QPOA 2JGQA 1UCWA 1YXYA 4MJMA 5D09A 1R2SA 3FKKA 5G1YA 4UC5A 3LI1A 3IIXA 1WBHA 3FJ6A 1YXDA 3BLIA 5K9XA 2BTMA 1XKYA 3N2XA 3TW6A 4ALDA 2BLEA 1MO0A 4PEKA 2E5BA 3W1RA 5C54A 3W83A 4DF1A 4AHPA 1KFKA 1FWTA 4NJKA 4XWUA 3E96A 2JBMA 3O15A 3JS3A 4A2SA 1H7PA 1WYIA 3TV8A 1HO4A 3S42A 4LNYA 2A0NA 3S5OA 4UFLA 3M6YA 1NVMA 2P1FA 4MUZA 1W31A 1A5BA 2BXVA 3QH2A 1QPNA 2NWRA 1ZALA 1BWLA 1D3GA 3VE7A 3M43A 1LOQA 3FYOA 4R33A 1DL3A 2OT0A 7TIMA 3MBFA 4Z1CA 3GR7A 5L6UA 3T40A 3TUUA 1ME7A 2E6DA 2LLEA 3PS7A 1XUZA 3C2RA 5DCDA 4LRTA 1RPXA 1FY6A 1HG3A 3RFAA 1OJXA 1GT8A 3LHYA 3INPA 4JYDA 4JTSA 2QKFA 2R14A 3NM1A 3NQVA 1TPEA 1TPB1 3W88A 3FLUA 1FXPA 4O8RA 5AN7A 4MLRA
chains in the Genus database with same CATH superfamily
2ZDSA 5J8LA 4UQBA 3QV7A 2JK2A 3P0XA 2HTMA 1ZTVA 4HVXA 4MDPA 5FACA 4IMGA 4WXYA 5CC7A 1A5SA 1JCJA 4WKAA 2WW5A 3M9YA 4RZ4A 5DF0A 1PL9A 1U5HA 3DOPA 4M6PA 3S1VA 3A23A 4NF7A 4UIOA 2GSEA 4KW2A 3L0NA 3W1XA 2QCCA 4IQLA 1SO3A 4Z1AA 3IVTA 1KW1A 4UNLA 3BG5A 2OPJA 4N0RA 3S8HA 1MNSA 4H6EA 3QGKC 1V7YA 1AQ0A 2CESA 4KWVA 3NDZA 5I06A 3ZXWA 3VCNA 1M04A 2YCLA 3PWAA 4CQCA 1J93A 3GB6A 4PUNA 4NVTA 4Q8PA 3BJFA 1C8VA 4MTVA 2GQAA 4AUBA 1J4EA 4DXVA 3FFSA 4OFCA 3WUGA 1ZSXA 3KE0A 4O12A 2OB3A 4GQRA 4L56A 4OU1A 3C52A 5AECA 4K68A 2GQ8A 5BXTA 4O8AA 1H0IA 4O1FA 3W4RA 4PR4A 3V5CA 3TX9A 1K8XA 5DFAA 1X1OA 2FHBA 2OSWA 3MMUA 1A47A 2JIEA 3SIMA 2FB2A 2GVGA 5E6YA 1UQYA 3EBVA 3MTWA 4IX0A 3BSGA 3ZT7A 2NT0A 1NOFA 3K4WA 2PLMA 3C86A 2W9MA 1LT7A 2XTKA 4DELA 2DJXA 1H51A 2WMGA 4G5DA 4BF9A 4WZHA 3H6OA 4L7ZA 1W3TA 1FCVA 1GYLA 3NL3A 5BRQA 1UKQA 4RDWA 3GXNA 4IP7A 3VKDA 3AS0A 1ADOA 3CJPA 4JR5A 3S5YA 1VBRA 3LNMA 2NW0A 1Z6KA 3IJ8A 3J7HA 3TWBA 1CYGA 2AQOA 2WCAA 1YRRA 1FWDC 1YNQA 3R0KA 2G4FA 1HZYA 3GU9A 4F4RA 1LQ0A 2FVLA 4O1AA 2YBVA 3G1HA 1I0DA 1WZLA 4IZGA 4UCFA 1WV2A 2BSLA 2JF7A 4JTUA 1P6CA 5LHEA 4EPDC 3TC6A 3T0TA 1ITXA 1R3VA 3TXVA 3WK2A 4AF0A 4AY8A 1JYNA 1T8QA 2Y62A 2ZRUA 2WXDM 4J9JA 4K7YA 1TO3A 1NWRA 4N6FA 3HBLA 3S4TA 1JQXA 5FF2A 1RVGA 3KOXA 5HMSA 1PUDA 1V6WA 2FDSA 2G50A 3LOTA 3NPUA 4LB3A 1TRIA 4WGHA 1VLWA 2VC9A 3ZQ9A 3GVVA 1FHVA 5JBEA 2BHYA 3K8MA 3T05A 2ATSA 3BLEA 1TV3A 1GNXA 2OJPA 1M03A 4AX6A 1PBGA 1E40A 4J5NA 3AISA 3AYVA 1CDGA 1X39A 4ZB0A 4IL0A 1DJWA 1OSEA 5D2YA 1MEHA 1PCWA 3P74A 4MLJA 2ZX8A 3VIJA 4JFUA 1HF6A 1F3EA 3WQPA 4MYAA 2Y7DA 2ZA2A 5JMUA 5HUPA 1OG6A 3CV6A 3OLGA 1LRTA 1ELSA 2W63A 1ADSA 1CGXA 5DELA 2VDIA 1DYSA 5B7YA 4JHOA 1I2NA 3M16A 3GVGA 1SFLA 4K8GA 1GOWA 5CAKA 4UTTA 3H55A 3LN3A 1Z7AA 1US0A 4WLCA 3WF4A 1NU5A 3RGTA 5DY2A 3WNOA 3G1YA 2XU2A 1EX1A 4KCTA 3UBPC 2CNCA 4CCDA 3WQ8A 2ZRZA 3F03K 4HNLA 1YLVA 1XIIA 1KO0A 3AZTA 2XZ9A 2F9RA 1EP1A 3PN8A 4KERA 3TAKA 2Z7GA 1BYBA 4AZ5A 2GJPA 3SY8A 3P5ZA 4IUGA 2DIKA 4H1ZA 4HCDA 5C2XA 3GZ3A 1PZ1A 3WJZA 2O55A 5AZ0A 4O17A 3W6LA 4HK5A 4QSHA 3AU2A 1KC7A 2E8YA 2XJ7A 4PTXA 4Q8TA 3FVDA 2NVAA 5HBFA 3R58A 1GHRA 4Z2HA 3JVAA 4P8VA 2GK1B 4XTIA 1EUAA 3AS1A 1EQCA 4ONVA 3NSNA 2VZOA 2RDWA 5G4EA 2QJJA 2OTDA 3WDPP 3MUXA 4HN8A 5JBFA 2HEJA 4UTUA 2VZTA 3W86A 2E6YA 4D71A 1FX6A 5CPQA 3LSCA 1QOQA 1QNPA 4NYUA 4WJXA 1QO5A 4NX0A 4PB3A 2VR2A 2TRSA 4QNWA 1W1B1 3ITOA 1L9WA 3N19B 4CQBA 3IVUA 5FF0A 4IMAA 2DH2A 4U33A 1H41A 3OVQA 3UZJA 1E6NA 3C0JA 4AXNA 4L1WA 1EX5A 2WMFA 4N42A 3VTRA 2NV2A 1A0DA 3GKAA 4EWND 4X2PA 4YCPA 3R0DA 1UASA 3I6RA 4UFKA 3FJLA 5HR7A 5CGQA 4GINA 1ZJAA 2WVSA 4E2DA 3Q37A 2V68A 2BDQA 1DWGM 3C8FA 5JUVA 2PDBA 5CC6A 1K03A 4PODA 4FNRA 4TV6A 1W2PA 3STCA 4UBPC 4RW3A 3TJLA 2VFHA 1OF6A 5KZMA 3CBWA 3JU2A 1O4UA 3W2LA 1XSIA 2Z28A 2MUCA 1GZJA 4ZGYA 3NURA 1SPQA 3H4GA 4F2TA 3QF0A 1IEVA 5D9MA 1G0CA 2WKJA 2X2GA 2XWEA 3GR4A 1A5MC 2J25A 5EKYA 1JIBA 4JTAA 1GW9A 1FH7A 3M7SA 3OOQA 3H2CA 1TKKA 3ARXA 4GJJA 1RV8A 3COTA 2OO0A 3KP0A 4MWAE 3RF9A 5CZJA 2EQDA 5EGRA 3UWUA 1EZ2A 1PZ0A 4DF0A 1HUVA 4WIWA 4R34A 3AQUA 5M2FX 2PLCA 3HQNA 1CB7B 2XIQA 3WBAA 2TMDA 4E2OA 1QPKA 5EPDA 3WDHA 3STPA 3PJWA 3KUMA 2YGYA 3LGGA 5DT5A 3EDKA 2EGZA 1Q4WA 3PANA 1EHNA 3A64A 2WMHA 3AIBA 2GJXA 3RX3A 1O7AA 3KOFA 4QISA 1E3ZA 2IW0A 5HJXA 1ZRQA 1TE1A 1W5PA 3NQDA 2XGZA 4HYVA 1ICQA 3T1GA 3WIJA 3TQ0A 1HJXA 3BAJA 1H49A 3TLQA 2Z6IA 4XD4A 3SAZA 3VIKA 1E6QM 3UXLA 2Y5EA 1P48A 4PCTA 4FALA 8XIAA 2R91A 2C91A 3EA2A 2OX1A 3LQGA 3AHYA 1KBKA 1MDRA 1R9YA 1KD0A 3L9CA 3CWOX 4W5UA 3OLEA 4O0QA 3VKKA 1D7FA 5IBXC 4A3RA 1Q2SA 4AD0A 3NUKA 3FGCA 5A6BA 1LZOA 1KWKA 4IPIA 1A3HA 3AMCA 3CYVA 2B0MA 3PFMA 2P88A 4TR9A 4Y8FA 1UD3A 1X97A 1MW2A 3D0CA 3K8LA 4AC7C 1LUCB 2EAWA 1XIGA 2YZ5A 4H8NA 4KIEA 4P61A 3E5PA 2FTPA 4RZ5A 4CGTA 3LY0A 4IJCA 4PBGA 1QO2A 3W7NA 3MP4A 4DBSA 2FJKA 3T42A 1HIZA 2Y70A 5G1MA 4QTGA 1DBTA 3BAKA 3S2LA 4GH1A 3KWXA 4BK9A 5T8GA 5I79A 2CLFA 2ZZ7A 3KHDA 4IXHA 2HNHA 4KRZA 2AGKA 3I7RA 2NUYA 4TU1A 3BURA 5JH2A 5FEPA 2CYGA 1FP8A 4JTHA 4C1NA 3EPOA 1W5QA 1TWZA 4RDVA 3MUIA 4IGSA 1EIXA 4UWMA 3WQGA 4UUIA 4I5UA 1AL7A 2DZUA 4XK2A 3STGA 2PLJA 1FWRA 3SUTA 3Q65A 3L7RA 4PUDA 3N11A 3ARRA 3FCPA 4WY0A 1BYDA 1EGZA 3A5VA 4ZO6A 3W75A 2XH7A 4EP8C 4OJYA 1S2VA 2I5QA 3WLKX 2BY0A 3EB4A 3FJNA 4ML4A 3TJ4A 4ZENA 5JQ9A 2G97A 4AZBA 1P7TB 2XSXA 3FW6A 1OGSA 1BG9A 3MDUA 3P2VA 5LA0A 1J96A 1UUQA 2ZA3A 4UTIA 4DX3A 5LNVA 1I75A 1UR9A 1LRNA 1V3LA 2Q3OA 2YSWA 3ONCA 3LHUA 3T4WA 2H6RA 2ISSA 4WRHA 1XIHA 1GG0A 3B97A 4QGCA 2WSKA 3O16A 3HFTA 4KGJA 1C7SA 4M51A 3NNTA 1LBFA 4UXDA 2VR5A 4CQAA 5I24A 4K39A 1XLEA 3R12A 2C13A 3E3HA 1ICSA 5C71A 3GC4A 3PB0A 1KCLA 3S9ZA 3VMNA 4LYKA 4Q4KA 5L9FA 3IVSA 4LVDA 4RXGA 3RITA 2YYTA 3ZJ8A 1KQYA 3W1NA 2ALDA 5EMJA 2PGRA 1RBOB 1U1UA 4OOUA 1BLIA 3CAKA 3UPMA 3UA3A 3BLLA 3GHTA 5I78A 2REQB 1VGAA 1W37A 2XPKA 1JVNA 3UR2A 3ZT5A 3GSMA 3G77A 4MZ1A 3ABXA 1TTIA 2ZRWA 1QVBA 3F2DA 2PP3A 2OGYA 9CGTA 4GUHA 1Q5MA 4ICMA 1MUCA 3IV3A 3SFKA 4R27A 5CBIA 4WR3A 3H2NA 4UOZA 3LGEA 4AY1A 3PBGA 3QGVA 1XRVA 1JDAA 4REQB 3FEMA 2GJRA 1JUBA 5MKGA 1NFPA 3MKCA 3IPWA 4HPNA 4GK8A 3THQA 1S5WA 3H4WA 1NDVA 2JEQA 3WJSA 1M3UA 3W01A 5F1UA 4ZQCA 2OKTA 3ZFHA 3F4WA 1XDLA 4JL2A 4C91A 3ZZ1A 4JPGA 4HT3A 3UETA 3W81A 4JQ1A 4V2XA 4I9AA 2BV9A 3WQCA 1K7EA 4L64A 2AMGA 1E1CB 1M68A 1NOUA 5GPRA 2FMOA 2QPUA 3SIZA 3L4YA 3WZ0E 1LT8A 2GGHA 1KTBA 3UZZA 1ZBCA 4RE0A 3BWWA 3CLWA 4NP7A 4WX2A 1FWHC 4GFSA 3URNA 4HHHA 1AZ1A 2VURA 4AISA 5AYZA 5HNRA 4HA3A 3UXDA 2DSWA 1OHLA 2BNJA 5E09A 4Q4SA 5FCZA 3OVGA 4L4OA 1AH0A 4JXCA 5C9ZA 4NAEB 3LI0A 1E5NA 3AAMA 2EPOA 1GVOA 4GH3A 2PPGA 3L0GA 1U2YA 2CHRA 4L6HA 1V3HA 3BSMA 4IGNA 2NVCA 5E1QA 1PE1A 3MCNA 1SO4A 4CU6A 1TUXA 1A5AA 4F0MA 4DJEC 1MUMA 5TAOA 3EMQA 4NRRA 2WANA 3PAOA 1LOLA 3CH0A 5B7ZA 1E0UA 1R86A 1Z48A 1EB3A 2VZSA 3W25A 3H7VA 5A8OA 3APGA 2W6RA 3VCRA 4H83A 2WM1A 5LHFA 2EPKX 4QDPA 4DRSA 1GW1A 4ADUA 4PA8A 3DKJA 3NFUA 5A2BA 4LB4A 5I3IA 4PUEA 2WMIA 1W9VA 2DSZA 3GD6A 4O11A 5EFDA 1ITCA 4V15A 4LS2A 3TQKA 3VOHA 1ZLPA 4IT1A 2HJPA 2BVWA 4D8AA 3KP1A 3V4BA 1REQB 2AAAA 2XSAA 1E51A 5A6SA 3UGRA 4PTMA 5LNSA 2QUNA 4K3ZA 4FF7A 2VXNA 3AMLA 1PPIA 3W74A 3STFA 3DBPA 4J28A 4TX8A 4MWAD 3GIQA 3BMXA 1GTEA 4R5EA 5FL1A 2EO7A 2BP1A 1FWNA 2PU0A 5I3GA 2D73A 4NAFB 4BWLC 3GBDA 2IQ0A 3GH4A 3SRHA 3TU9A 1Q6EA 1O5XA 4X61A 2PWHA 4HB7A 4EXAA 2QCHA 7ODCA 1BKSA 4FEZA 4LUJA 2Y0FA 4EXBA 1UKSA 4ORMA 3SADA 4LPCA 2FJUB 4GIRA 3UGVA 3TYDA 3O2LA 1B54A 3KVKA 3IAPA 5FJRA 3A5FA 3NIYA 4GLEA 3AMDA 4AW7A 5MHBA 4Y9MA 4YXGA 4OOZA 1F73A 3WF2A 4F0SA 4HNTA 3WQOA 2V0TA 4U10A 3DI1A 1RCXB 2C0AA 5A2CA 2V5JA 4TMCA 4N9DA 1TWSA 4P8UA 2JQXA 3FYYA 3UP8A 1TX2A 5D9OA 1VC4A 4FXRA 1SW0A 4ZQMA 4MVAA 1PB0A 1RP9A 2YJQA 3G0XA 5FOOA 2PWFA 4MKVA 3ANUA 1RY0A 5FF7A 1DIDA 3HG2A 2WWCA 3MZNA 4PYSA 1ZCOA 4O54A 4WCJA 3AXHA 4XUYA 2X1IA 1GQNA 3R5EA 1ZJHA 5LGZA 1EPXA 2Y7GA 1MXGA 3FX4A 4GY0A 1LOSA 3P14A 4M24A 3BLKA 4AIEA 2GGIA 2FDMA 3VDHA 3LB0A 1JF5A 5IDIA 1E6SM 1WUEA 3JW7A 5K4ZA 3F2CA 4LNCA 4AZCB 2Q8ZA 1XIEA 5DLCA 5CH9A 4CNUA 4O0KA 1HXJA 4OIFA 1A5OC 3I3BA 1YTDA 3PG8A 5CC3A 3R11A 3Q58A 3GDBA 1W1TA 1Q6DA 1XYCA 1ZBWA 1OQFA 4QAWA 2ABBA 4DLFA 1DVJA 1UWRA 1TA3A 4O1BA 4GZ7A 4BHYA 3LBOA 2DQWA 4XZMX 1AMYA 3HPSA 1MSSA 4YJ5A 2HS6A 4QLLA 1VFTA 3UFYA 1XINA 2D0GA 3LGDA 2OCZA 1XF0A 2W92A 4M6VA 3ICJA 2IPJA 4CD4A 2Z1WA 4DQWA 2XIOA 1YTEA 5M3WA 1H60A 1W9UA 3FA5A 1XM3A 2ZRXA 3DC8A 2CLHA 4G2DA 1E6XM 3WFAA 3DFYA 3SEPA 2PP1A 3W28A 1D8WA 3TCSA 4HU4A 1UA7A 1RXOB 2CERA 1FWCC 2ZDRA 1US2A 3QPZA 5DRIA 3RLUA 3AALA 1KRMA 3S5SA 4BZYA 1UIOA 1RA5A 1MQRA 3WELA 4UR9A 3WD0A 3W22A 3I3DA 3VAVA 4N02A 5IDZA 9XIMA 3NQ8A 4YYCA 2VWSA 4UTJA 4M6UA 1JF6A 1BTCA 1CTNA 4D6EA 1KM0A 1RQHA 2NVDA 3P84A 3MS8A 3PB2A 1RBLA 3NQ7A 5EMYA 2AL1A 2GYIA 3FV9A 4B5NA 2NQLA 3I4EA 2J7FA 3GVRA 1DEDA 3RR4A 1EF2A 4JTLA 4F2BA 1LWIA 3GC2A 1SJCA 2FTWA 1G1YA 2ZWYA 3ZO9A 2C6QA 4I7WA 2HZGA 3CAQA 2FLIA 2VL4A 2OODA 1QOPA 3B8DA 4QS5A 2O7QA 2P8CA 5AHFA 4IIBA 5EB8A 4YPJA 4UTMA 5I03A 2VEKA 2D2GA 2H3BA 2XHYA 4QEHA 1R46A 3CEUA 3RMEA 4J7RA 2Y1HA 3GXDA 2WCSA 4KS0A 4QLKA 1FWAC 4I7UA 1AD1A 3TONA 4WHBA 1XLMA 2X1TA 1GONA 3MDWA 3S5NA 4EOUA 4LSBA 3F1QA 3VC5A 4XZHA 3CUGA 3TJIA 4QJ4B 3QSTA 4BQ4A 1W0MA 1HNYA 5HNNA 2FPTA 3RM4A 3F5JA 4H7CA 1J12A 2VKZG 1OIMA 4LCQA 3TEVA 4PB5A 1V02A 3O3RA 1LYXA 1H0GA 3W1QA 2WVTA 4W88A 1EJSC 3PG9A 4BI6A 1AMKA 4GY1A 3RM9A 3N15A 1MW1A 2Y88A 4PMJA 3VX1A 2QS8A 1VB9A 1SFTA 1MMFA 4BI5A 3TNBA 5JVLA 1AW5A 4AHOA 1A5UA 1AJ0A 4A3UA 1M01A 2WZTA 3A3HA 3VNKA 2WQPA 3ARWA 3S2NA 2O4QA 3N04A 1W3LA 3W24A 2CZFA 3PVFA 2QCMA 1R47A 3AXMA 1E55A 3LDVA 1TPH1 2HXUA 2I1OA 1GJPA 3AFBA 3W02A 3W1LA 3UCQA 1E9LA 2C14A 1KLYA 4H9XA 3V5OA 2CBJA 5HWJA 5AYXA 4JNYA 4HOWA 1EKOA 1AFSA 4H9TA 3NTYA 6REQB 3NZRA 3KBWA 3M5XA 3HMCA 2X0HA 2PEVA 1UG6A 1CENA 1SUXA 1E6PA 3GYEA 1W3KA 1CW2A 4JKLA 6A3HA 3T81A 1G94A 4MPQA 3F5LA 3WKZA 3W07A 1P0EA 2GUYA 2QMJA 1CGVA 4WXZA 3KBJA 1E4IA 4FSAA 3BAWA 2YA1A 3TA6A 4MNLA 1ISXA 3QEZA 1CXIA 3BARA 4DWSB 4QG8A 4QJ5B 3GDMA 2A6LA 3B8TA 4MDOA 5D2XA 1CLKA 4AWUA 4K8EA 2J8FA 3OTRA 2V3EA 4DB7A 1JZ7A 1XFBA 4GC3A 4ZXLA 1KFWA 3LXCA 1QK2A 2Z2BA 2WHKA 3SCRA 5LNUA 2EF9A 4UZSA 4DZIA 2RDUA 3AOFA 3H2AA 4CNSA 3VD5A 4I9TA 1E1EA 1E9IA 3VKJA 3IJQA 3OQ8A 5LNRA 1F4AA 1NF7A 1BGAA 4K1WA 1J0YA 3WLPA 1HP5A 3UWYA 1R38A 2PRHA 4FR1A 5FF3A 3GTXA 5AY7A 5AC6A 3WH5A 3WDRA 2ICSA 2P10A 3TTEA 3WLHA 5JU6A 2OG9A 4W93A 3RILA 3LERA 3CUIA 2VFFA 3CUZA 1EP2A 3B4YA 4GIEA 3PNUA 2OX4A 4MZYA 2YCJA 3ECQA 1POKA 4M1BA 1JJKA 3VXGA 4E4UA 3EX2A 2PTWA 2G0WA 3GNDA 3QTGA 1DIEA 3PUOA 4KWSA 2OQYA 3EWXA 5T26A 3EOSA 1J0JA 4LC8A 5CG0A 4L5ZA 1O5KA 2YLLA 4JTQA 1U5VA 5K3VA 2ZIDA 4FOKA 4IIFA 4O53A 1ZUAX 3A6OA 1XPYA 3R89A 4KRUA 4MJ2A 2GWGA 4RV3A 5F7UA 1KFBA 3W7LA 4IF2A 4RCXA 5CGTA 4DVOA 3UCDA 2UY3A 2CHOA 4FLSA 2H9AA 1UD6A 4HU0A 3V7PA 2QHAA 1QK0A 3WLMA 1OYCA 3IACA 1E0WA 2V81A 2ZX7A 3LRKA 4B9ZA 4Z2IA 1R30A 1RJQA 2ZXQA 1I1WA 1V3JA 1ZBKA 3SECA 3VKBA 3W2JA 4ROQA 3O8AA 1ECEA 2BS9A 1QWKA 4N7QA 3ZM8A 2XFYA 3N29A 4FS9A 1XGEA 1XH2A 4Z2JA 2BBFA 1FP9A 8RUCA 1V6XA 4ASTA 3AUOA 4JIRA 1HJQA 4WJEA 5CAHA 3LD5A 3KRZA 3UXAA 3UJFA 1SVDA 3U0HA 3H70A 1TWWA 1CI1A 4G1KA 4NY2A 2AL2A 3Q67A 2J13A 2XH0A 1XISA 1QPOA 1PYMA 2G41A 1PX8A 4TTGA 3I4KA 3SCSA 3R94A 5G1YA 4UC5A 3OJGA 2XFFA 4GXWA 1MO0A 1PEZA 1G5AA 1XLIA 3VKCA 2TODA 1S39A 4HA0A 3E96A 2OELA 1R0MA 8A3HA 3JS3A 4RNHA 2DVUA 3DYOA 5LIKX 1HO4A 3S42A 3WLNA 1NVMA 3NYDA 1P6BA 4K2SA 4U2YA 2PDGA 3OPSA 1IEXA 3RG6A 1ZALA 1PIFA 2VEFA 1BWLA 3MSGA 3VE7A 3M43A 5FD0A 4GJIA 4R7OA 2OT0A 4US5D 3GM8A 4Z1CA 7REQB 4DY1A 2FGZA 5L6UA 1AUSL 3I10A 5LIYX 2E6DA 2WLZA 3MVIA 2VVNA 1VIWA 4LRTA 2ZXBA 4IJRA 1UA3A 4H6QA 1YBQB 3LNPA 2QKFA 2R14A 3NM1A 1V3KA 2DT1A 4NRSA 3R8GA 3W88A 3FLUA 5AN7A 2G37A 2NZLA 4ADSA 4HMEA 4GXPA 2E7FA 2PWDA 3DXIA 4ACZB 1HKIA 2V3GA 3VM5A 2CLPA 3HQOA 3L5MA 1ALDA 3BCFA 2PGWA 3APYA 4W85A 2PP0A 4KPLA 3H8AA 2PDYA 2WQDA 1KXQA 4CD6A 2VEPA 4ATLA 4YU1A 2B7OA 2JKPA 1AQFA 2IKJA 1EFZA 2JFEX 3NQFA 2YX0A 3SJ3A 2QLYA 3MQTA 3EB3A 3H4XA 3CGTA 4S1FA 3QPYA 3EDJA 1A80A 3SRKA 5I00A 3NJ3A 4S39A 1B90A 1G4PA 3GRIA 5EMMA 1W3JA 4QG6A 3UG3A 3LTPA 1DTNA 3EDFA 4S3KA 3CUFA 4DJFA 4ECLA 4HQVA 4W4QA 1TV7A 3N73A 4I90A 4XG1A 1LL6A 4FX8A 5D2WA 5TQLA 3TN3A 4WDWA 5HMEA 1YQ2A 4JN7A 3K4AA 4ZOEA 3MHUA 2XIIA 3DFOA 3LENA 2QNEA 1RA0A 1ME8A 1EJUC 3MB9A 1OCQA 1MZRA 1FDYA 4JZ5A 3SRFA 7TAAA 5D8WA 1YDOA 2E1WA 4TIMA 3KHJA 3SCPA 3TDFA 3KW3A 3C61A 1YADA 4QQUA 3KDNA 4PMNA 3BG9A 3C2YA 5AHMA 1GZ1A 5EBUA 3A13A 5BW6A 1WZMA 1SZGA 6XIMA 2DSKA 5HAOA 1NWTA 4PCPA 1X1NA 1CBGA 4N4QA 2INFA 1R3RA 3RUBL 1ZU8A 1X6NA 1K9DA 1X38A 4KWWA 5GNZA 4BR1A 4H9ZA 2BOGX 5E0FA 2EJAA 1BG4A 2W66A 1E9ZB 1EJTC 2QIWA 2A3BA 3SQLA 2NLYA 2YKKA 1Q6QA 4QDWA 4AYSA 3VZXA 3TW7A 3UXIA 2J79A 4NZ3A 4LAKA 1OZMA 3CTLA 3GFYA 3TTQA 1E72M 2BGQA 5J5RA 1GUVA 4EIVA 1W8SA 2RAGA 1JDFA 1XIFA 1XRFA 3NM3A 1GCYA 4I6KA 1PV8A 1WAUA 2YCLB 3V36A 2D2OA 2FTYA 1BTMA 3IJ7A 3OZMA 2OZTA 4W8LA 5A94A 3OB8A 4PRTA 3C4UA 3RJXA 5JIPA 2E25A 4WJ8A 4Y9NA 2CZEA 4ICCX 1GOQA 4UNIA 2KZHA 2R1MA 3KVLA 3ZWSA 3K4DA 4UMCA 3L68A 1G7VA 1UOZA 2XH2A 5HATA 4PMUA 3PWIA 1K8CA 3MI6A 1XYZA 1FCBA 3D3FA 1D3CA 3UZXA 2QGHA 2HMCA 1KM2A 3GHRA 4O1DA 3AWOA 1GYNA 4AY7A 4YS1A 1E15A 2W61A 3B05A 1WDPA 3FN9A 5HQLA 2UY2A 4Y9OA 3THDA 3DN5A 4JKKA 4MB1A 3NQBA 3XIMA 3CQIA 4AD2A 1LL7A 3G6MA 3PWGA 2WVVA 3WN6A 1GWJA 4QJ1A 3HPFA 2PMQA 4F79A 1KM3A 4BF7A 3WF0A 3MSYA 1WP6A 3TR2A 3E2VA 4D6HA 3TTOA 4NJGA 2VX5A 2GGEA 1XSKA 3BOLA 3MWAA 3E49A 2QF8A 2DIEA 2ZOXA 4UFHA 4EPBC 5CC5A 1VJZA 1OIFA 3IK4A 5A6AA 3W2NA 3TJXA 3PUEA 3K1DA 3TVAA 2ACRA 4UQCA 1TZ7A 1TJRA 2V9DA 3AIVA 5U7SA 2NUXA 2JIWA 5AZ1A 3B9OA 1Q6LA 3W87A 4NXSA 1PKLA 4AF0B 4MWAA 2QV5A 1LTDA 2B7NA 3KZPA 1FWEC 3LTYA 1XIBA 4W7WA 4JS3A 1OC5A 3S5ZA 3WMCA 1ESWA 4JTDA 3VM7A 1XLHA 1SGJA 4HP5A 3EDDA 3WLQA 2F6XA 2HK1A 5G2WA 4S23A 2QT3A 4IGHA 2Z6JA 4NKCA 4WOZA 1XKJA 4OUEA 4DJEA 2ZX6A 1UMYA 1RD5A 4RX0A 1JCLA 4GJ1A 2VFEA 3NL5A 1SJBA 3QTPA 2L5HA 2Y7FA 2F84A 3IGXA 2Q71A 4LAZA 1JFXA 3W7CA 4AFYA 1L6WA 3RCMA 3DHUA 3N9SA 2J62A 2CKSA 4GUIA 4S3CA 1BSLA 3V0SA 1QNVA 4K36A 3G6LA 3C3UA 4MSSA 2DIJA 5DBUA 3CZLA 1H1YA 2Y89A 3P5YA 4MJ4A 4V1XA 5AHLA 2HSAA 1UJPA 2A2IA 3OVPA 4NG3A 5F1VA 1ZZMA 2PA6A 4PUWA 5HMDA 1NSJA 3GXMA 3VIIA 1N8FA 3VZYA 4UTFA 3CZKA 1LLOA 1UP2A 3TW9A 2FIQA 4QX4A 1MW3A 2NXIA 2BFGA 3IANA 4RPPA 1V6YA 3KX6A 2ZFAA 4MY9A 2XM1A 1A3WA 1QI0A 2WSPA 2A3EA 2DSUA 3G0UA 4XBJA 1Q6FA 2PDJA 3U9IA 2DORA 1VEOA 3CMJA 4DHGA 2V2DA 5CPMA 3RM8A 3VNDA 3ZSTA 2F6KA 1YDYA 2D24A 1BHGA 4O50A 2ZUTA 3DFTA 4PBEA 2TYSA 1LLWA 2C79A 2J27A 2ISWA 3LK6A 5LIWX 4YTUA 3ES8A 2VCCA 3AO0A 3B0VC 4H6RA 3N2CA 3BC9A 1M53A 5IOBA 3NSXA 3M44A 1OFOA 2R8WA 1DJHA 1XBVA 3W82A 3TYCA 4W9TA 4EK7A 2VRJA 2WYSA 2YDAA 1BD0A 2EHHA 3ZR6A 1K8YA 3GNRA 5EY5A 3BV4A 3GVQA 4KFOA 2G96A 3QSRA 2P53A 3BW2A 2A3HA 4LGXA 4JTIA 3QHMA 1UBSA 1UQZA 3AYTA 2X2YA 1ITUA 3S1WA 2X42A 1H62A 2HS8A 1B3OA 1F5ZA 3HM7A 4C6NA 1ZAHA 4Z0SA 3W1AA 1J5SA 1C90A 3SSJA 1B3ZA 1JAKA 4JTGA 3PY2A 4XAGA 4GI8A 3ZR4A 4MM1A 1KB3A 3BE7A 4CNTA 1TVNA 1F6KA 3SY5A 3DC0A 5I02A 2Y4SA 4JQ2A 4H8HA 2PBOA 1UPPA 4IMEA 2OYLA 3VNYA 3D3AA 2BWGA 3QW3A 1JZ2A 3ABZA 1BAGA 1P1MA 2XVGA 4H2HA 4HZ8A 2HVNA 2OYMA 4LXFA 3T9PA 2VVSA 1KR1A 3WNLA 2G4JA 3T6CA 1ADDA 4DO7A 3T08A 1XQKA 1B5TA 4WF7A 4HYRA 3A9BA 8CGTA 2ABAA 1Y65A 3UZYA 3VYLA 2BB0A 4BEUA 5EYWA 3E1F1 1VP5A 4GOAA 1J0KA 3MW7A 4AMCA 1F7BA 1XD0A 3ZYZA 2AAMA 3ZJ6A 1LL4A 4M56A 3SGUA 1DWAM 2FFIA 4KEVA 1BVNP 1S1PA 5JH1A 2J75A 2DT0A 3RJYA 1VFMA 1JDEA 1U1HA 3UVAA 3W38A 4HOZA 2CXGA 4DM2A 2I5IA 3CZJA 3WY1A 4JNMA 2HNEA 3TOPA 4GGBA 1DJYA 3EWWA 3K2GA 4FIQA 3LPPA 3A21A 1JL8A 2WWDA 2WAGA 1E9YB 3GQYA 3JUGA 1YDVA 4KWOA 5C9XA 2QMKA 4GZJA 1NP2A 2B81A 2DZBA 3G3MA 5AC8A 1K4HA 3HFYA 1B3XA 2CBVA 2V30A 3H26A 1WZAA 1K1DA 2Y8VA 1XYLA 5T91A 4FK9A 4OWGA 2CFFA 1Q6GA 4POCA 2GJXB 1QUMA 4DO5A 2FPVA 4Q8OA 2WB5A 4PUJA 1ZHAA 4LUYA 2DPEA 3W00A 1IZCA 3RLHA 3W29A 2CXEA 1CXFA 2IKIA 4EVZA 1AZ2A 3H2OA 3HGJA 2J8TA 1PJ9A 2QDDA 1XICA 4JTKA 2X0YA 4FNQA 3S47A 3W9ZA 3UZWA 1SJAA 1XLGA 1GQLA 5A6BD 2A3CA 3VIFA 1JI2A 3URQA 4PFHA 1EXBA 1LBLA 3BGJA 1SSDA 2BX7A 4DIAA 3FGCB 2C7FA 2Z00A 3EOEA 4DWSC 4UOQA 4WEVX 3TYBA 1U5JA 2QJMA 3WFZA 1PAMA 3AXIA 4A29A 4HHPA 4D1JA 1E0VA 3LM3A 4XBSA 1QASA 4ZFMA 3A4JA 5CPLA 2V38A 3LCIA 5KMYA 3WBEA 3B9EA 3WK3A 3BLDA 3E6EA 1E70M 3TIMA 1C91A 1NWUA 1NDWA 3MA8A 7CGTA 1GKRA 4GYPC 3CQKA 3EMZA 1X98A 3W73A 3VDCA 3OG3A 1MEIA 3BGGA 4MG4A 2E28A 2DZVA 5I0DA 5DY3A 1S1RA 5D02A 4MY1A 3KL5A 4J27A 5F2MA 2W91A 4E0CA 2WKGA 1CX9A 2XN2A 3MP5A 3OBEA 4KT2A 1ISZA 2ACSA 1RALA 1CGYA 3AIWA 2ZZ5A 4WD0A 2F2KA 2J77A 3GU1A 4O28A 4GPNA 4C1NB 1H7WA 2A85A 4J2PA 3M0ZA 1VBHA 3VMOA 1AQMA 1K6WA 5K9CA 1JEZA 3B06A 4L65A 3F4DA 3HB9A 4HNNA 2W27A 1B4EA 3S1GA 1Q3NA 2VNCA 3WJXA 2X7WA 3G1FA 4IFKA 1FXQA 4DXKA 3H7UA 2BODX 5D32A 3WFLA 4I8YA 3MC5A 3OVRA 4RDZA 4DO6A 3QHNA 4WY0B 3N4AA 4NZJA 4W5ZA 3DFPA 4TVUA 1VIZA 3T2OA 1QBAA 1UC5A 3GNNA 2FVMA 2R1KA 5LA2A 1TTJA 3L4VA 1GGOA 4Q3MA 4IIGA 3WL1A 5A6TC 5CKSA 3T8LA 4BQ2A 2GL5A 2G3IA 3UYCA 1ONEA 3QY7A 3SSZA 4X3ZA 3B3DA 4OHQA 3U4AA 1ITQA 5I23A 2XM2A 4LALA 1L8PA 2GSJA 1H61A 3VD7A 1XCWA 4AZIA 4GA8A 3IJDA 3FIGA 1U22A 4QE1A 3TAOA 1EXPA 3IRDA 1OFPA 2R1PA 2VFDA 1H7OA 3FJ4A 3LQLA 3NEVA 2IKGA 9XIAA 3I7QA 4UQDA 4RR4A 1OC6A 4AQLA 3FHQA 4XSMA 1I0BA 4C6KA 4A35A 3CMGA 1JXJA 4CNNA 3HOJA 3EWCA 2VFIA 3LUTA 3L4UA 3P8JA 3R43A 1YHTA 1S5TA 5EFFA 5D30A 1GQKA 3QHOA 4X63A 1EPVA 2C3ZA 3MSRA 3A3XA 3SUSA 1XXXA 1V0KA 2HE5A 1Q63A 1ZAIA 2VD9A 1XC4A 1RJRA 3R8RA 1UD5A 4Z2GA 5BXSA 2VR4A 5HJLA 3W72A 1UKOA 3SDOA 1VCFA 2Y6ZA 2YFOA 1EDGA 4MF4A 3ABQA 3CASA 3HG5A 4PMOA 2AKZA 2HK0A 1OYAA 1V02E 3UJEA 1JYXA 2OZ0A 3D5HA 1IXNA 1BRLA 2PRLA 4KMQA 5A8MA 1WDQA 3ZLFA 1A5NC 2J88A 3UR5A 4K7VA 3V5FA 1S3HA 4MB4A 2C19A 3T7VA 1PIIA 1Z42A 1Z69A 2YL5A 2WNZA 3R25A 5DN1A 1N8IA 2ODOA 1JDCA 3VINA 3RHGA 1XG4A 1K9TA 1NFBA 5DQPA 1B30A 4E4FA 4H4IA 1QDSA 2NSXA 3WUEA 4E6MA 3KFTA 4BY3A 4W87A 4RE2A 4PCFA 4L1XA 2ACUA 3DFSA 4CU8A 2Y63A 1IHIA 1Q7ZA 3T0CA 1EBGA 4GIAA 3O7UA 4QEEA 2XN0A 2P50A 2PWGA 4GCAA 3NQAA 4TUFA 1DWFM 3NG3A 3WQWA 3CZ8A 4WY0F 2DW7A 1H3GA 3P6LA 2RFGA 1PDZA 5T9BG 1BVWA 2CITA 5EU9A 1OX5A 4JHMA 1V93A 4HBKA 1OC7A 2WJFA 3RR1A 3OO2A 2FZNA 4PZVA 1FHLA 4FP1A 3ZOAA 2WJDA 4US5A 2JGYA 1V08A 2GQ9A 4GE8A 3HA1A 4KEZA 2E8ZA 1UROA 4H3DA 3LPFA 1NF0A 1EEPA 4PMQA 1J2WA 3R7MA 5D2VA 1NDYA 2DY3A 3UF9A 3QYQA 3OQEA 1XHGA 1JPMA 2RDTA 4AMAA 1LORA 3NPXA 1AK5A 1WPCA 4MNKA 1QNOA 1V5XA 2GJLA 2GPTA 4Y90A 2DUAA 5LSMA 3UEQA 3FAWA 3GG1A 2NV9A 1YXCA 3MUY1 3WDQA 3MHGA 1SSGA 2QCFA 2WMIB 1F76A 2EPLX 1FBAA 4FPSA 1IGSA 4DYJA 4Z1YA 1L6FA 4JDYA 3U6WA 1R9XA 1BEUA 2V63A 3E12A 4OTKA 3WH8A 3TC7A 3EOLA 1C29A 3KWSA 2Y5SA 3SCTA 2BY1A 4MYXA 2D1ZA 3HG3A 3HU7A 2JKAA 1CLVA 2NT1A 4J2MA 2W62A 1EYEA 4HPGA 4YTSA 4PCNA 6CGTA 3WLSA 4Q4PA 1T40A 1VRXA 4B2DD 2EBNA 1R87A 4FAMA 5G4WA 3TLLA 1V03A 4Z0JA 2A6NA 1KV8A 3N2OA 5A8GA 3WSUA 1T0OA 4JTCA 4NXKA 3VIPA 4HMDA 3ABRA 3CPUA 5E6ZA 2YL8A 4JDBA 2ZZ6A 3PUGA 3SFWA 2Z1BA 3RN6A 3GUGA 2CBUA 1DE6A 1V6TA 3EKZA 5GJPA 2X16A 5ENLA 1FHUA 3WNPA 4O1EA 1LWJA 1ZP4A 3ANYA 2GUUA 1U83A 3TNOA 3QW4B 3E0IA 2NX1A 1DJGA 4IIHA 3KM8A 3WNKA 4F66A 4RNFA 3HGOA 3PAJA 4JL1A 2WPGA 1TG7A 4IMFA 1T99A 1FH9A 4Z1DA 4UQEA 4FNSA 5G2HA 3M1ZA 4NHVA 1VQTA 2ANUA 4B15A 3QZEA 3L5AA 5CGMA 4EPEC 3NZ1A 2WC7A 4JIPA 3NSMA 3VNZA 5FA5A 2GQ3A 2WV8A 1Q2RA 4BF5A 2PC8A 4GNJA 4IHCA 3P60A 4LOCA 4GUFA 4KWUA 4P5UA 1QW9A 3T0DA 2W79A 3WQEA 1YW1A 3L2MA 3WF3A 3CQJA 3GTFA 3L23A 3DCPA 4J3ZA 1VEPA 4TX9A 3M64A 3UT0A 3W7RA 3HPXA 1W3HA 1LG1A 4MPKA 2OGJA 1J79A 3N4FA 4XAPA 3SCQA 4QCEA 1IQ8A 5E70A 3W2KA 3HQ1A 3PZOA 1WBJA 3SCOA 3W1TA 4W7UA 1RUSA 3OU8A 1S2AA 2WJEA 1JPKA 4LAMA 4UTWA 1SW7A 2E77A 1E1FA 2A7RA 2CZDA 3KVJA 1TA3B 1H7XA 1K6AA 4C6MA 4NIRA 3SI9A 4KCVA 1E1CA 1D7KA 5HPCA 1J0IA 1VS1A 2A21A 4I9JA 2ZE0A 5CJMA 4OGZA 4LJ3A 4J1OA 3LSBA 1T6MA 3T4CA 5AVNA 4FXSA 1NDZA 2Q8XA 1SZNA 2ZC8A 4TX6A 3S9IA 4Q4QA 3R8HA 4LX4A 4IISA 4CN4A 2QYGA 3EKGA 1UR4A 1WOAA 2J24A 3KRBA 3FAXA 1GYMA 4GUJA 3SZ8A 6XIAA 3G22A 4QJ3B 2NSOA 2J66A 2V3DA 4E38A 4EACA 1CXHA 4KEUA 1BQCA 2EJ1A 1VFHA 1KRCC 3VUSA 4ZQOA 4PULA 4ENLA 3T44A 4FLRA 4NAEA 4TV5A 1QU4A 1E3XA 5D04C 2FGBA 2OWWA 2V69A 1FDJA 2G8ZA 4GZIA 2NQJA 4HHLA 3O1NA 2BVYA 3QPEA 4A6GA 4ERIA 3DERA 1JGMA 1LBMA 1N55A 1P6WA 4DM1A 3QR1A 3TN6A 3MHFA 3MO7A 2VQTA 3OZPA 1BYCA 3NQ6A 2Z0IA 2PDFA 3K46A 5HNUA 3MV11 5A8NA 4XZNX 2VYOA 4G8TA 1JUKA 2YBTA 3PHAA 5F2IA 1KRBC 1ZCCA 3DGBA 1TREA 1WAWA 3C2EA 5IFTA 5HPOA 5GVJA 4X60A 1PKNA 2I9UA 1VCGA 1XI3A 2PTZA 2YB4A 3G1SA 5IRPA 8XIMA 1GOOA 3T8QA 4L61A 1XBYA 1DXEA 1A5KC 2ZBTA 5AFDA 2HPMA 3KAOA 3N2TA 3TR9A 3MYOA 1J5TA 4B91A 1CGTA 3VO0A 2PDQA 3LXAA 2OSYA 4JEJA 4FOUA 4MKSA 1ISYA 3ARTA 1EA9C 4QROA 5GNYA 4ICNA 1JYWA 3U3HA 3RIKA 2P0IA 3F4CA 3B03A 3B04A 3AROA 3R79A 3KLKA 3MSDA 3NAVA 4R9OA 1UR1A 1GVEA 3LPOA 4GQQA 3T07A 4A21A 4GKTA 5H8PA 5FEXA 4EAYA 4DUOA 3G1RA 3IJ6A 3BLFA 2GZXA 5D03A 3R13A 2QGYA 2PDWA 1JCMP 2P5NA 3UJ2A 1RCOB 5BOOA 4JY8A 2BOFX 1QW7A 4AEOA 3GDLA 3IGSA 2XIBA 4AZGA 2RJHA 5H8UA 3WQFA 1Z32X 3LTSA 4JHZA 3RO8A 4HPXA 3SO7A 2JF6A 5XIMA 2VZUA 1XWYA 1ZAJA 2RHGA 4YL2A 3PZTA 5BCAA 5C9UA 2IMRA 2QIIA 3P3BA 2BY2A 4WOQA 2J7HA 3ITTA 1AH3A 1EYWA 1YPFA 4XKMA 5ABGA 2ZUWA 5KTLA 4Q8WA 1EC7A 2PTYA 3M0KA 3UD6A 3BAXA 2DQXA 3NZGA 3CM4A 4CQ8A 4O57A 2QVHA 4GG9A 5HK4A 3WEZA 3WNMA 4V27A 3P61A 3GAKA 2PODA 1ENUA 4Q6XA 2QVNA 3W7HA 3OZYA 2EPMX 1X8FA 3WQ6A 1KGWA 2IKHA 2IUZA 2CWNA 1XYFA 3BW3A 4PSRA 2YCIX 5HULA 2HBVA 3HIJA 4JN6A 3WENA 4LF1A 4ZTXA 1CEOA 1M65A 3HJZA 3DI0A 3QY8A 4LT9A 3IUIA 1SQ7A 3VOGA 1HKKA 1HL2A 2I57A 3AIQA 5EMKA 3EWDA 3H23A 5A6MA 4U5KA 5B80A 1D3HA 4NJJA 1F8MA 1HKVA 1W1PA 3SW6A 1WDRA 1XC6A 4LUSA 4E3VA 3JZEA 3B8IA 5E9AA 1JD9A 1DIOA 2VHLA 2E40A 3Q2DA 5CPNA 3VGFA 3E38A 4HA4A 3HV8A 3CUXA 2JALA 1D8CA 4LVFA 3DG3A 4ATWA 2B4GA 1CCWB 1DWHM 2PDPA 3EA3A 2BG5A 3CHEA 3AHVA 4TQTA 4NYYA 4DPPA 4PSPA 1YNPA 3O63A 3MI3A 2VTFA 3QFWA 5DMLA 3N17A 4F9DA 4GWEA 4YLWA 3ITYA 1OGBA 1N82A 2WHLA 5D09A 4AD5A 3FKKA 5BYWA 3MWCA 3LI1A 3NWRA 1WBHA 1HJVA 2PF8A 1XKYA 4AX7A 2PD5A 5LXEA 3GC5A 3GFZA 3M0YA 1AD4A 2VP8A 4M0XA 3W83A 3FNDA 4S38A 3GG8A 4XWUA 7ENLA 2JBMA 5I77A 4A2SA 1H7PA 5I09A 4URIA 3TV8A 3HJEA 2VGFA 3M6YA 1PX3A 3GTHA 4F8XA 2BOEX 3O6AA 3AZRA 4MB3A 1UOKA 2BGSA 5DANA 3DUGA 3ZVHA 3MBFA 4F0RA 1O5RA 2H9AB 3GR7A 2BHUA 5I3DA 1JD7A 1CIUA 2LLEA 1XUZA 1J2BA 1RPXA 1FY6A 2RDXA 4ROPA 3NQVA 3QBUA 4EXQA 1UWUA 2PLKA 3GZAA 4I5XA 3DFHA 2E9MA 3USBA 3V1PA 3OIXA 2X30A 2PDIA 4YMZA 2YR1A 1DHPA 4JYEA 1NY1A 3WYZA 1TJPA 4QITA 1VYSX 3UPWA 3RU8X 3LM7A 2BZNA 3L66A 2VGGA 4S2BA 3OHIA 1VLIA 3POHA 5D38A 3U7BA 3CO8A 1GPFA 4UNKA 2AL2B 4MMWA 3M0XA 2J7EA 1A4MA 5AHEA 3CV7A 1W5MA 3VIMA 1U30A 7A3HA 2H3DA 3MKVA 2E4TA 3U4FA 3TN4A 1IGWA 1OCBA 4ZQNA 4B4FA 3CQHA 4PL1A 5CQ1A 5FAJA 2OR2A 4DAFA 3L4ZA 1W3NA 3VMPA 4G6CA 3ARUA 3SB0A 3P7YA 4L9ZA 5CSSA 2CCRA 3MCMA 3SN0A 3PULA 2ZRYA 4E8CA 1MZHA 4LTSA 4J40A 2Y7EA 1MXDA 4DZAA 2XGBA 1TPWA 5KZEA 4DBUA 4OKDA 3QMRA 1Y7VA 4X9SA 2B31A 1K9FA 2YCKX 2G3JA 4Z1BA 2ZUUA 4H19A 1P1XA 3RAOA 3REQA 4JQAA 4HSOA 2E6FA 4O13A 3S1XA 1CGWA 3EKLA 1ZJBA 2KAUC 2POZA 2DT3A 3R4IA 1NQ6A 3OZOA 4GVHA 4J3VA 4JICA 1TJ1A 3BO9A 3N13A 4YNGA 5A6LA 4E3TA 1KM4A 3ISIX 3W2UA 4EF9A 3CQ0A 2ZA1A 4O52A 5HWNA 4C6BA 5D9PA 3AIUA 3IS4A 2IS7A 1ISVA 5C70A 4LS1A 1RCQA 4PN2A 3O06A 3SUVA 3AIRA 1TV5A 3QR0A 4YTQA 4PC8A 1ZBVA 3OLDA 4Q8QA 3MT1A 4GYKA 4JTRA 3VFLA 1F3XA 3PZIA 3VCCA 3CAVA 4KFNA 2DT2A 4UQ9A 3P0WA 1G6CA 1JPHA 1OT2A 4DJFD 1GVQA 1XR2A 1GOMA 3A4XA 2QXWA 4R53A 4TVCA 2NV1A 3QM3A 3IGUA 3LLXA 4P7NA 2D0HA 1V4YA 2G95A 4ZBCA 4ZXOA 3SUUA 4ZO8A 5KZ6A 1M7XA 3MYPA 4DJDA 4AAJA 4B3LA 2OOGA 3IUDA 4H00A 1RQEA 5LZLA 4CEUC 4IFRA 3IIVA 3GAYA 1WKFA 3VDAA 4BQ3A 1OCNA 4C6OA 1Q66A 1Y0EA 3WD3A 5HANA 4ZE5A 3I6TA 1QW8A 2IQTA 4HA1A 4AH7A 3EB2A 3DGRA 3BZJA 3CMFA 1WA3A 2CPUA 4D6GA 5FEZA 3WK0A 1VPXA 4CNOA 2PFHA 2XVPA 3KBSA 4ERGA 3FOKA 3VU2A 2UV8G 4HNUA 4Y7EA 3A47A 1RY8A 3R2GA 2ZUNA 2V5CA 1A3XA 3TSMA 1O94A 1FWWA 1HKWA 3LCXA 3U48A 3DX5A 1U1JA 1QNRA 1K8ZA 3RXZA 2CZVA 2YXGA 3T78A 1BXBA 4M80A 1TPUA 1WQ5A 3UA4A 3UWWA 3P62A 3E2QA 5I5RA 4HYWA 2OSXA 3RCNA 2FHFA 4R85A 1W9BM 4B92A 1L6YA 1Y5XA 2ZUSA 2DJLA 2HCVA 5REQB 1ICPA 1AJ2A 1R5YA 1I6NA 2TAAA 3I68A 2RH9A 4RZBA 4LAUA 4DBEA 3M4HA 1IXOA 2OKOA 1K70A 1X1ZA 1LLZA 2WPBA 3VD3A 4MZ8A 4PMZA 3FS2A 4H9YA 5EMLA 5TBOA 1C8YA 1NJJA 3E0WA 3QQ0A 2DVXA 3AHTA 3ITGA 1R7AA 3CHFA 1F2JA 3DYMA 3P67A 3MKKA 2XH4A 3F7JA 4PEEA 1ZENA 2YYUA 2I5GA 1XG3A 4K8HA 1JR1A 3L4TA 4A22A 3WLLA 4LANA 1E4MM 1X7IA 4LY4A 1VD6A 4Q6JA 3GXIA 1IZKA 5DT7A 5FJIA 5CXPA 1XGDA 3K5XA 4BS0A 1VFSA 1CZ1A 3DECA 4GD0A 1W6TA 1VBGA 4GFIA 2WVVB 4M29A 1BXNA 1UWAA 1YTKA 4MFDA 2XFWA 1DWJM 4AC1X 2Q3RA 3GTIA 3N9RA 2WNQA 1HO1A 6ALDA 4GO8A 3ARVA 4WKFA 3UWZA 5BU9A 4PMDA 3TROA 3DHDA 1ECQA 2GDUA 2G5WA 1OT1A 3VVGA 1OGGA 4ZQPA 7REQA 4C5YA 3ID7A 4B5VA 5ABFA 5DCEA 4CN6A 5D37A 4LVBA 4LYPA 1OADA 4IWWA 2FGLA 3ALFA 1PTGA 4RZ6A 1D9EA 1P4CA 1RLCL 1OX6A 1OY0A 4MWAB 1EF3A 3E2RA 3L12A 4LBRA 1M5WA 1FFQA 2DUXA 2F7FA 3VGGA 4B2DA 3QN3A 4PTDA 5A8PA 5HOSA 3N6JA 1A5CA 1FTXA 4A3YA 3M5VA 3GH7A 1AODA 3M41A 2Q09A 4AZ7A 4XD3A 3V3WA 3EXTA 1J0ZA 3VUPA 4W7VA 3DBNA 4DJED 3AU6A 3STEA 3HG4A 5M5DA 1KM5A 2O0TA 3W85A 4OE7A 3S2CA 1HJSA 4CNPA 3M0HA 3QC3A 3HMJG 4P7OA 3BMVA 3O6CA 3PZ9A 1V6VA 3HURA 3BOFA 2PURA 2W5FA 4XSLA 1L2QA 4XIAA 1VHNA 3NPWA 5F2LA 3POCA 1AQHA 1WXYA 3WD4A 1P5BA 4HKPA 5KZDA 1H09A 1S46A 4E2VA 1TB3A 4GACA 4FF5A 3A4WA 3S3GA 6TIMA 3VGHA 1KRAC 3URAA 5IFPA 4M5PA 1G4EA 3O05A 2GJNA 1TPVA 2CKRA 3LXBA 3Q45A 3VOIA 2HROA 1DIKA 1EEXA 3Q94A 3GHUA 1SO5A 1HTIA 4KIRA 3QLDA 5BMWA 4DO4A 4ORIA 2ASHA 1YIXA 1PYFA 3LG3A 3LMYA 4YWIA 2QAPA 4Y8EA 4JIEA 5ECUA 3DKLA 1I2OA 1RK6A 1J8VA 1LQAA 1MDLA 1OFQA 2ESCA 3I6EA 4ZOCA 5HNTA 5BXPA 2NWSA 3HGSA 4P8XA 4C6CA 2QJGA 1B3WA 1YKWA 1JNEA 3QR3A 1H2JA 2WKLA 4ZB5A 1UIPA 1AJZA 1QWGA 3W1PA 3N3MA 2V8ZA 1R7OA 4UOJA 1C8QA 1XLBA 3VGEA 3EWUA 3ZVIA 4D6JA 2G3NA 3EWYA 2PWUA 5SWUA 2FB3A 2XWDA 1XIJA 3G8RA 4HMNA 1OX4B 1DHKA 3ERPA 3THCA 3W2MA 3UG8A 5A3HA 1P0KA 1XV8A 4X22A 3CUHA 3PBUA 3APTA 5HQMA 1AA1B 4DI9A 4AIUA 4X0VA 1FDZA 3PZQA 3H21A 4GRSA 1F6PA 1GOIA 3NXFA 4A8RA 2O9PA 3EX4A 1SR0A 4F0HA 3ZS4A 1MFVA 3NGJA 5CZSA 3UPBA 1EJRC 3TSBA 2XVLA 4XVEA 4FLQA 3ZLGA 3M0IA 4M6QA 1DQXA 5LIUX 2EXOA 2WBGA 1XLLA 3KOYA 3B9DA 3VOCA 1TUFA 2A7PA 3N3TA 2ZVIA 1BPLB 4HIBA 4MNJA 3L65A 3TMLA 1TELA 5G1TA 4HNVA 1W1IE 1EL3A 3AMGA 4J3WA 1Q85A 2YB1A 1EP3A 3L21A 3UWVA 3PF3A 5CZTA 2E68A 4ZR8A 3PFRA 3UVIA 2P0OA 2WC4A 2EG6A 5FJOA 5AKQA 3AIEA 3VE9A 3RYSA 3QV8A 1GQJA 3MCOA 4UR7A 1GVRA 1T96A 4ZOBA 3KTSA 1RJPA 5C9WA 3FDGA 3VOFA 1G69A 3QOKA 4GISA 4KFPA 4EKJA 1WE5A 3OEXA 1ML1A 1Q7MA 2IPGA 4LV9A 1UH2A 3E0VA 5H91A 4D1IA 1WB0A 5DO8A 4PMYA 4I8DA 4OV4A 3M46A 4XBKA 3U2OA 5CPOA 4LRSA 3B4UA 1AW1A 1UR0A 2ONEA 3NCOA 1CXEA 3UG4A 1OINA 4JIHA 4Q7NA 4AHQA 1SYTA 3GHSA 1L6SA 3PPFA 3PZVA 2VOMA 3LBCA 1EJ7L 4Q4RA 1XLFA 4O10A 3RNDA 1O68A 1EQPA 3PBWA 5I3HA 2QUVA 3EYPA 4D8ZA 1RH9A 1SW3A 3UR8A 4JTEA 4B3KA 4K38A 2Q8LA 1RPKA 3HQPA 2QJIA 2ZUMA 1IIHA 3LCFA 3OBKA 3JR2A 4WUIA 3S2JA 1YDNA 2ZC1A 2WBKA 2RUSA 5H6HA 2UBPC 3V16A 1L2UA 4JFWA 4OBSA 4AVOA 3GX9A 3KCOA 4QDMA 4EX4A 4RJEA 2VUYA 4RPQA 4RE3A 1PCKA 3WQVA 4AZ6A 3G8EA 3WMBA 2VO5A 4WSJA 4Q8VA 3T2PA 1BWKA 2R1LA 4M7SA 4RDYA 3CH9A 2P3ZA 3MJYA 3W71A 1P0NA 2C71A 3TH6A 2PI6A 1KFEA 4JIQA 1W8GA 2PCEA 2E6AA 4TO8A 1QI5A 6TAAA 4M7TA 2AQVA 1FVPA 3ZMRA 1TE6A 1TTPA 2OYKA 4LUTB 1KNWA 1UR2A 4P7LA 3A22A 3KOZA 2PSNA 2PE4A 1RLDA 3BTNA 3M07A 3GNXA 5HA7A 1CB2A 4EF8A 4PUMA 1R9ZA 4CCZA 3TZFA 3GXFA 4I9MA 1VZWA 5E0KA 1DP0A 4IQEA 3RRXA 4XVDA 1UJQA 2XZ7A 4UZUA 4KGLA 3DU0A 5M1TA 2J7GA 3ARQA 4DBDA 3VD9A 1QJWA 3ES7A 1TR9A 3PBVA 1OVDA 4PRRA 3U5UA 4DXXA 3EXSA 3T0BA 3KL0A 4IIEA 3GKFA 4XAFA 2UWFA 3PNZA 2QJHA 2A3LA 3HPZA 1QFEA 3DENA 2WZMA 4Y2WA 4UCGA 3B0UX 3OA5A 4GGHA 3CZEA 3N6HA 3D47A 3KBNA 2H90A 1JGIA 1N7KA 2XIMA 3H53A 4C7DA 4FHAA 3VNJA