3QMSA

Crystal structure of the mutant t159v,v182a,y206f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIFLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qmsA00
4UR7A 1LORA 3C4UA 1VS1A 5DXYA 1I2OA 4S2BA 4HSNA 1S5TA 2XFWA 4HNNA 4PL1A 4DQWA 1B3OA 1TMHA 4JY8A 3W1NA 1ZHAA 2C3ZA 3RF9A 3W1QA 5AFDA 3TCEA 4GUFA 4WY0A 4AHQA 1ALDA 3IVUA 3VNDA 1DJQA 3L0GA 4FNSA 1K02A 4X3ZA 5C54A 4DELA 2V2DA 4RKAA 2PC4A 2ZRYA 3SGZA 1GVFA 3NQ7A 4LOCA 3R5EA 3ABSA 5AC8A 4RX0A 2JKAA 4NUWA 4ADSA 1K8YA 2P0OA 4AWTA 3BV4A 1J4EA 4LS0A 1IIHA 2B0MA 3QEZA 1AW2A 1L2UA 5I3KA 3SY5A 1G69A 4M6VA 3BGGA 5BOOA 3OVPA 2C16A 2RHGA 3EWYA 3SSJA 5HWNA 3TK7A 1YYAA 2X16A 3U6WA 4NJIA 1SUXA 4NJJA 4N6FA 3HOJA 1NEYA 1IXPA 4EIVA 4ZL1A 1GZGA 5K9DA 1UASA 4FO4A 4OU1A 4PCFA 5A5WA 3KRZA 5DBUA 2V9DA 1FWWA 4RXFA 3TAOA 3OVRA 1JJKA 4NXSA 4PTNA 4HNVA 3W84A 3W1MA 5AB3A 4KFOA 1ZNNA 4ZVJA 1GYLA 4OV9A 3HBLA 2ZZ2A 2A7PA 2RH9A 4AH7A 4OWGA 4MOZA 1BWKA 1QPOA 4FNPA 1DQWA 3LOTA 2Z2UA 1RQHA 5D2XA 1Q6QA 2CLHA 2LLEA 2ZA3A 2CLLA 1OVDA 4PC8A 5FEZA 2Q8ZA 1VYPX 1R30A 1OJXA 3RMJA 4EF8A 3BPWA 3C61A 3GAKA 1X1OA 3I65A 4LS2A 4QAIA 2DZUA 3MHFA 1Y0EA 3CWNA 3W73A 1TV8A 4ZQPA 3G1FA 3LXAA 4E2DA 2PRMA 4LVAA 3IGUA 4CQ8A 4RV8A 4Y9AA 4UCGA 2NX9A 1TTJA 3C3NA 4RZ5A 1DOSA 3DGRA 5HR6A 4OGZA 5I3FA 2C18A 3QMSA 3W1PA 4ML9A 4MFDA 1ZAIA 1IXOA 2WNNA 2DZPA 4ZQRA 3LCIA 4MPQA 4UTWA 3BG9A 1QNVA 4NX5A 4O57A 2DZSA 3LX9A 4FXRA 4JICA 1S3HA 3K30A 1WV2A 2A2IA 3CC1A 2ZCGA 3P84A 5CZJA 2BZNA 3W1XA 3E9AA 2V5BA 1PHWA 3W85A 3NVTA 3W1TA 3G1HA 4HPXA 1QPRA 3EXSA 3HB9A 4UTIA 5KZEA 1GVQA 4TX9A 3ZFHA 1DORA 3BG5A 3VFLA 5H91A 3TIMA 1Z48A 1FWNA 3WK0A 1CI1A 3MJYA 1F7BA 3CIXA 4NJGA 1VYRA 1XL9A 1M5WA 4NZJA 4ZQOA 1K3UA 1MEIA 4I7VA 1WYIA 1HL2A 4M7TA 4LNYA 1DJNA 3NQ2A 4MJMA 3S1VA 1KTCA 3NAVA 4JTSA 2EHHA 2E68A 3I7SA 1TJPA 2QUVA 4BI5A 4UTKA 2NXGA 4O1BA 2ZRVA 4IOTA 3P62A 3L5MA 3M5YA 4GE8A 1P0KA 3TROA 2Y61A 1W56A 4AXKA 4UMBA 1LRQA 2DJXA 4RJEA 5L6UA 4AWSA 3INPA 1R2TA 1FCVA 2X1UA 1HFBA 4IUOA 4HN4A 1K7EA 1VGAA 3M0ZA 3NNTA 1SZFA 3LTSA 1Q6RA 4DF1A 4U4MA 4I9AA 2VENA 2VXNA 1LM1A 1X6UA 1H7OA 1TO3A 4Z0SA 1RZMA 3MYOA 1DHPA 4UMAA 2A4AA 3QMRA 5FF4A 3I6RA 4UMCA 1TPB1 4Y8FA 3MI3A 3A5FA 5DN1A 4GFSA 2EF9A 2FPVA 3LM7A 2ZZ4A 1PE1A 2YSWA 3LCFA 3L67A 5IBXA 3C52A 4DPPA 1OX6A 4RLIA 2VEKA 1D3HA 1YPIA 3G1XA 2GQ9A 4DO5A 3I7RA 3HPZA 6TIMA 5AHLA 4IMGA 5K9XA 1H7WA 2E6FA 3NQ6A 3MUXA 4IX0A 4QIUA 2H6RA 3GXPA 2NUWA 3L0NA 2YPIA 3E12A 4JYFA 1U5JA 4UTWC 3P8JA 2G96A 3M9YA 4GUIA 1JCXA 3H54A 3O6DA 2PE4A 3GK0A 2GVJA 1OX5A 4TR9A 4JNMA 3DI1A 1IXQA 1QPQA 2FQIA 2ISSA 3G3DA 4C1LA 1NSJA 3C2VA 4H6KA 1LP6A 2VOMA 2CU0A 2A7NA 3GZ3A 3O6YX 4KWWA 5HMSA 4OT7A 1LLZA 3HJZA 2UV8G 1Z41A 1W3IA 2NV1A 5FF0A 5HULA 3TU9A 3E02A 1ICQA 1J5TA 1EUNA 3YPIA 1GYNA 3FIGA 4J9JA 4JTTA 1DKWA 3QPZA 4JIQA 5G4EA 4GWEA 3ZWSA 1SFJA 3PSVA 5DCDA 2C6QA 4MKNA 1K8ZA 1KFKA 2ZBTA 3QYQA 4GUJA 3IIXA 3PBVA 2Y7GA 4QSHA 1XBYA 2JGQA 3G3MA 3B0PA 1VZWA 3TV8A 1QR7A 1T99A 4YCOA 5AHNA 5KTLA 3L66A 5FESA 1G4SA 2ZRZA 4QQ3A 1OYAA 3P82A 3HG3A 4XZ9A 3TXZA 1LRTA 1JCNA 3PBWA 3N2XA 3KX6A 4UIOA 3USBA 1LBFA 1XUUA 3DAQA 1I2RA 1WOBA 3PR2A 4A2SA 3TJLA 3G1AA 1QMLA 4FF7A 3C2RA 5D05A 3BW2A 4I7UA 1JQXA 2DZXA 4O0KA 3UQNA 1ME9A 1TTQA 3O1NA 1OFRA 5CPNA 3HMJG 1EA0A 1H7NA 4XUGA 1MO0A 1RQBA 3UWQA 2J6XA 3H55A 1P4CA 4RK8A 4X22A 3W22A 1YDOA 1XI3A 1L6WA 2CZEA 2HS8A 1FWTA 3NQAA 1DV7A 1C29A 1I2NA 2OX1A 2BSLA 5EBUA 2NX3A 4JTKA 4TIMA 1DQXA 1VCGA 1TPH1 5G4WA 3HG2A 4TO8A 4IJBA 3GDKA 4JGDA 2YFOA 3KVLA 1TREA 2Q3RA 3FJLA 3KVKA 3MP5A 5D2YA 2X2GA 1AK5A 3PAJA 3GNDA 1ZAHA 3LGEA 2DZVA 2V0TA 1AW1A 1KM0A 2ZZ6A 5AC7A 3JS3A 1JQVA 1I2PA 3KVMA 3EX6A 2FJKA 5EL1A 2QF7A 3SGUA 4ZQNA 3DI0A 3W7JA 3NGJA 3O15A 1RPXA 4L4LA 1OF6A 3TQVA 2ISVA 3UWVA 3DFTA 4KFPA 3DHDA 3UNDA 3UD6A 5HR7A 4IMFA 3CT7A 3PB2A 4LVBA 1WOAA 4OQVA 5K2ZA 2YR1A 1RVGA 3RFAA 2ZRUA 4UFHA 1L6SA 2YYTA 2CLIA 2D73A 3RLUA 1SO5A 4O50A 2OMAA 2ALDA 3TMLA 1Q3NA 1B9BA 2BXVA 2E77A 3W1LA 1LBLA 2NUXA 3MP4A 1KW1A 1TRIA 2QEZA 2GVGA 4ALDA 1M7OA 1FUYA 3HO8A 3QW4B 3O06A 3L5LA 1TCDA 1QAPA 1EIXA 1WA3A 3ABQA 2W79A 4HPJA 5A8GA 3O05A 2CZ5A 5EY5A 1N8FA 4HNTA 3W2NA 1OFBA 5LZLA 1JCLA 4C1KA 1C9DA 3G0UA 4PA8A 2ZRWA 3GYEA 3S9YA 3S1XA 3UXAA 2QKFA 3QQ0A 3MHGA 3PB0A 1YPFA 2NXIA 1FY6A 4LRSA 3UPWA 5BMWA 2DP3A 1QO5A 3VE7A 3W1UA 4QNEA 5D33A 3QW3A 3RNDA 3V1PA 4KKXA 1LTDA 2DJLA 4AB4A 1FX6A 3FYOA 3UZ5A 3W3OA 4D2JA 3BLIA 2GJLA 3T4CA 3S5ZA 3TA6A 1ONRA 1XC4A 4K37A 1XDLA 3O63A 3KHJA 1KFJA 4LT9A 5AHEA 5D32A 4ZQMA 1XUZA 5FEPA 2VEIA 3NZRA 1WAUA 3BLFA 4BR1A 3LCLA 5D38A 3UWWA 2F84A 4A22A 4DPQA 4N9BA 3W7IA 2ABBA 4K8HA 2YDAA 1SW3A 3B0VC 1TQJA 1OX4B 1W1ZA 2V81A 2GJNA 1A50A 3QH2A 5DXXA 5AYXA 1Z42A 3MMTA 3OIXA 3DFNA 3LERA 4UTLA 4RZ4A 1SO6A 3CQ0A 3PF3A 1JVNA 2WJZA 3VE9A 1TSIA 3G22A 5F2LA 4XTDA 2A0NA 1EP3A 3FA5A 5C6MA 4A29A 3IGXA 2H3BA 1KTBA 3GKAA 1H62A 1JULA 3QMTA 1O4UA 1H7XA 1WQ5A 2Q8LA 3TSBA 4N2YA 3EKLA 3D0CA 1QPNA 3S42A 3PVFA 1XXXA 3R13A 4HSOA 4NVTA 2B4GA 2A1YA 1UBSA 4YCPA 4LRTA 4NNAA 3T78A 2JKPA 3TXVA 1TRDA 3LV5A 2QUUA 3W7EA 1S5VA 3LHTA 4XKYA 1XBXA 2OJPA 2WNZA 2FPTA 2C13A 2C14A 1FWRA 4S1FA 4A21A 3G8RA 3KAOA 3N9SA 4P61A 1BWLA 3W7NA 1PHQA 3SECA 1E51A 2Y7FA 4IGHA 1Q6OA 3A24A 3R2GA 3HPSA 3HGRA 3B06A 4WZHA 3STEA 4ZZ9A 1XFBA 1TV7A 4TMBA 4MZ1A 1VHCA 2JBMA 2FFCA 4LW7A 4A3UA 1H61A 3VI2A 5KITA 3O8AA 1I4NA 2GQAA 1TPWA 5LGXA 3NXFA 3TKFA 2PURA 1ME7A 1VYSX 4L4MA 4NQ1A 4XTIA 2NLIA 1GJPA 4JX4A 2Y7DA 3MHUA 1T8XA 3W7PA 1TB3A 4B5NA 1K7XA 4QM1A 4UTJA 5I3HA 5G1YA 1HG3A 1HTIA 3W7RA 3QC3A 4FX7A 2B7OA 3GAYA 3QFEA 2TSYA 1FCUA 3LI1A 4Q33A 4E0CA 3TW6A 5DCBA 5IBXC 3OEXA 4LV4A 3EKZA 1GEQA 3EX2A 4WOQA 8TIMA 2YZRA 2ZQ0A 4RCXA 2E6YA 3N73A 2V30A 3C8FA 3NQGA 1RR2A 4TU1A 3R12A 5E1QA 3FKRA 3W2KA 1XBZA 3OVQA 1GVSA 4JXCA 2EPHA 2KZHA 3NYZA 1AG1O 3M41A 3HGSA 2RDWA 4MJZA 1V7YA 1PL9A 5EYWA 5KZMA 3PUOA 1YXDA 3LCXA 4WXZA 2J27A 4M6QA 4W9TA 3G0SA 5D09A 5C2XA 1VCFA 5DY2A 1A5AA 2EAWA 4JY9A 4NNBA 3BARA 2AQWA 4UNLA 4WOZA 3STGA 3R89A 4WD0A 2E1DA 1R2RA 4N4QA 5LKYA 1IF2A 1NAL1 2CZDA 2VFIA 1W3TA 2A7RA 4DO4A 5K4ZA 3M6YA 6ALDA 2FDSA 3MBDA 3UY7A 1VC4A 4AVFA 3W1RA 5DBTA 5CPLA 2I1OA 3LHWA 3LHUA 3E49A 3EEGA 4ADTA 4LVGA 1I45A 4XBKA 3PC0A 5F1UA 4H3DA 2H8XA 2Z6JA 3T55A 3WFAA 4N02A 5FEWA 3BW3A 3CTLA 3DFOA 4K36A 4PH6A 1QDSA 3G1SA 4HHPA 1EP1A 3A21A 3RK8A 1TQXA 2VC6A 3EX4A 1JCMP 1JUEA 3W72A 5HJLA 2F7FA 4UTHA 3G18A 2X1SA 3C0JA 4GUHA 1GVRA 3B4UA 4FX8A 4UFLA 2B7QA 4LWWA 2WOQA 2I14A 5F2IA 1W37A 4X9SA 1YLVA 4TMCA 4MLRA 4G1KA 4GUGA 4CQAA 2Z6IA 4K7YA 3BLEA 5D2WA 1X1ZA 2JK2A 3S5YA 2ZTJA 5AHIA 4O15A 3PM6A 4Z1BA 2X30A 4YWIA 4JTGA 1OABA 3EB2A 1FDYA 4XWUA 2J9XA 2DU2A 1SZEA 1SO3A 1YADA 1OFPA 5AOUA 3PY2A 2PRHA 2VKZG 2WSRA 4OHQA 1H63A 3HF3A 4NNCA 4JTFA 3DZ1A 4KWVA 3HPXA 3SI9A 4Z1AA 1V5XA 3M5XA 2DZTA 1TV5A 4JTUA 2R8WA 4LTSA 4CCEA 4O53A 2R91A 3ZS4A 4Q4KA 4JR5A 3PS7A 1PV8A 5HUOA 2QCNA 2I9EA 4Z1CA 1L6YA 3W2JA 3NL6A 2W0UA 1YDNA 5U4NA 3O16A 2WKJA 1MXSA 3HGOA 1DBTA 1A53A 2VFFA 3NL5A 2ATMA 3UXDA 3W7QA 5T26A 1CX9A 3CHVA 3W71A 5F2GA 5FF3A 1QFEA 5F1VA 2YW3A 1LDCA 3CM4A 3LXBA 3O07A 2WQPA 2Y63A 3G8EA 4FIRA 3T7VA 3BW4A 1TTIA 2FIQA 4UNKA 5G5IA 2J88A 4S2CA 4O1CA 4ZQCA 3ABRA 1QCWA 1R2SA 2TMDA 1TPUA 4R33A 2GPTA 3GVGA 4MLJA 5LNSA 1OK6A 3MBFA 2V5LA 4EWND 3QSTA 5AYZA 3TNOA 3PWAA 3NR0A 1NF7A 3PUDA 3WJSA 4JIPA 2J24A 1ZAJA 2RFGA 2ZFAA 4N6EA 2QDGA 2ZYFA 5D2VA 3Q94A 1OYBA 3AJXA 4PEKA 3W2UA 3W7KA 1FCQA 1UUMA 3L9CA 3UWZA 2ATSA 5TIMA 4O16A 4DF0A 2XN0A 1MSSA 1R47A 2Y7EA 4LV9A 1GQNA 3E96A 3WJYA 5LGZA 5CGQA 5AN7A 1M6JA 2E09A 1PS9A 2RDUA 1BEUA 4QNWA 4PFMA 5C55A 4R53A 1KLZA 3W87A 4LC6A 3B03A 4K8EA 5LHFA 4JEQA 3IV3A 3L68A 5TQLA 4AHPA 2WSQA 3THAA 2OT1A 1NVMA 2R94A 2IQTA 3NQMA 1OK4A 5DLCA 5I3IA 3JRKA 3RU6A 1KM4A 3L5AA 3QF0A 5D37A 5D03A 2FB2A 4OE7A 4LVDA 3EWZA 3N14A 3W7OA 3NA8A 3UWYA 1XBVA 3TAKA 1J2WA 5CZTA 3TDFA 1ZFJA 3L65A 1IIGA 1QO2A 2C15A 3GB6A 1SW7A 2GOUA 5AHFA 1GG0A 4LVFA 3LRMA 4H4IA 1TPEA 1VR6A 5D04C 3G0XA 3EXTA 2HMCA 4O52A 1W0MA 2QCDA 3JR2A 3W1AA 3LI0A 3C2EA 2BTMA 3GR7A 5LNRA 4ONVA 3RLVA 3UPBA 1IGSA 3MI2A 2V2CA 3IVSA 1Q45A 1LROA 5LHEA 4YL2A 4O14A 2E5DA 3P5YA 5H2ZA 3FJ6A 2VEPA 1O94A 4YXGA 3T44A 3NL2A 3KXQA 1VPXA 3W2LA 5HNRA 3KRSA 1TPVA 1XM3A 3NPUA 4MY8A 3H53A 5G2HA 1G4PA 2XN2A 3OA3A 1Z44A 3LDVA 1AL8A 1LCOA 3L0KA 3WJXA 1MEWA 5D2TA 3IVTA 5CKSA 5F4XA 4AF0B 2VEMA 3DHFA 4NXKA 5DELA 4NX0A 2A85A 4QISA 5CZSA 3N19B 4MZ8A 7TIMA 4MYAA 2CLFA 4MFEA 3NQEA 2DZWA 3FFSA 3LRKA 1F6PA 3M5ZA 1ZJIA 1VH7A 4WY0B 1ME8A 4UFIA 4E38A 5CSRA 3KRUA 3G24A 4CLMA 5FF2A 3CPRA 1TPFA 3LB0A 2BX7A 1LRNA 4X2RA 1ZY9A 1O5XA 4KFNA 4CNOA 4YMZA 3QM3A 2NUYA 1KM6A 3QPYA 2J9ZA 1LOQA 4QITA 4O8RA 1GTEA 1F76A 3GKFA 2ZZ5A 1FDZA 3FYPA 1H60A 1GPWA 1BTMA 2P1FA 2G97A 1PIIA 1SU5A 3W86A 2TRSA 5F4SA 3NEVA 2C19A 4O12A 4BI7A 3BO9A 4JDBA 2NWSA 1G7UA 4IWWA 3DBPA 1W5OA 3P81A 2ZZ3A 2Q3OA 1KM3A 3L2IA 5BMXA 3W2MA 1LOSA 2FPYA 3UWUA 4UTTA 3W70A 4LC8A 1UJPA 5FEXA 1P0NA 4GXMA 4GJ1A 5AYYA 5ABTA 2QAFA 4WXYA 3NQCA 3S1UA 1B4EA 2Z1BA 1X7FA 3M43A 1LYXA 2G5WA 4WQ6A 5AHMA 3M16A 1G67A 4P2VA 3S1WA 4Y96A 1UCWA 4RZ6A 1T0OA 3SFKA 3ATZA 5LNVA 3G1VA 4UUIA 3U8GA 4K38A 1K7FA 3LV6A 1O95A 2OT0A 4UFKA 3UYCA 4K6AA 3NQ8A 1KV5A 2TPSA 3OG3A 3SZ8A 1XKYA 4E2BA 4MY1A 3NDOA 5DY3A 2ZTKA 2O7SA 1GOXA 3M7WA 5U7SA 3LHVA 2E6DA 3LLFA 3NL3A 3MO7A 3ATYA 2YGYA 5CSSA 1QOPA 3PBUA 1KFBA 4O10A 1OFQA 3GLCA 3LCHA 1PCKA 3B0UX 1KM5A 4Y90A 1ZALA 1FDJA 2GUUA 4FNTA 4IPJA 3KFTA 3DKJA 4MYXA 3B05A 4DF2A 3M5VA 4LUIA 1SO4A 3SR7A 4BF9A 3F1QA 4O17A 4NZFA 1AMKA 1F74A 5CG7A 5C5YA 2QCCA 4WX2A 1GG1A 3M1ZA 2CLOA 5DCEA 1YTDA 1H7RA 3EWWA 2NXHA 3HG4A 3IGSA 2CW6A 1EB3A 1LZOA 1KV8A 1W5PA 4JN6A 4N9DA 1F2JA 3PG8A 3PBYA 3W7HA 1FCBA 1GVOA 3LTYA 2YX0A 3P67A 1KTNA 5BNKA 4K7VA 4ADUA 4UTUA 3NQVA 2E5CA 3FEMA 3S8HA 1OG0A 1AW5A 4U28A 3IEBA 2X1TA 3TFXA 4MUZA 3EX3A 3W9ZA 5HWJA 2JGYA 1W3NA 2VFHA 3TC7A 3CIWA 1KM2A 3TR2A 3F03K 3W88A 3THQA 2WPBA 1KLYA 3TFCA 3C6CA 2CLMA 1H7PA 3O6CA 2E5BA 3IIPA 3N2MA 1H1ZA 1KFEA 4EVZA 2QJGA 3A9IA 2YW4A 1B4KA 3FKKA 3GIYA 2AAMA 3NQFA 4O13A 1I2QA 5I3GA 2ZRXA 4CQ9A 1YTKA 4XBSA 1VHNA 3TQKA 4AWUA 3GDTA 4MIMA 2YCEA 5CZ0A 3LXCA 3NG3A 1OYCA 1QOQA 1AL7A 3FOKA 3T40A 3DU0A 3FS2A 2ZA1A 1H1YA 2B7NA 3TUUA 5D02A 5E0KA 1F73A 2OCZA 3GDRA 3LBMA 3QJAA 1QWGA 4UTTC 3S5NA 1OX4A 2YFNA 1O5KA 2W6RA 1F05A 3S0CA 1P5BA 3OBKA 1SZGA 2Y85A 5J5RA 4FEZA 5G2IA 4UTMA 1O60A 4DBDA 3S6DA 1OFOA 1EWDA 3NPWA 3QQ1A 4DEFA 4XKYB 1OHLA 4NJKA 4QJ1A 2A5HA 1D3GA 5LSMA 2P10A 3ANYA 1C8VA 2NV2A 1GWJA 1H51A 4BK9A 5FF7A 2C1HA 4FNUA 4PODA 5HWMA 1YXCA 1FWSA 1I8JA 1M7PA 2Y88A 1JRBA 3WK3A 4MY9A 4GBUA 4WJEA 5SWUA 4O11A 2ABAA 2Y70A 5LNWA 4XQ6A 1IXNA 3SW6A 2PRLA 5KMYA 4WY0F 4M5PA 2QJIA 5K9CA 3S5OA 2CWNA 3IIZA 1A5BA 1S5WA 4FX6M 4HKPA 1WDWA 3IRDA 2Y6ZA 1FBAA 3STCA 4Q32A 4BFAA 3TX9A 2ZA2A 1RQEA 3DFPA 1G4TA 3KVJA 1PVNA 4ORMA 3TSMA 3PG9A 3I68A 4UFMA 5L9FA 3NPVA 4JDYA 3W7DA 4GNJA 5K7JA 2NWRA 1SFLA 4MVAA 3EWXA 3N3MA 2FB3A 1L9WA 2QDHA 3MWAA 1LOLA 3Q2DA 2V82A 4O1AA 3WK1A 4JYDA 1FXPA 3CU2A 3C2FA 5E93A 1N7KA 4BWLC 1JUKA 3IIOA 1UB3A 2QCFA 3UY8A 4CCCA 3ZWTA 1JR1A 2QCHA 2QCEA 3M44A 5I3JA 4POCA 1W31A 5F2MA 1VLWA 3B04A 3N9RA 1TJRA 3HG5A 4DO6A 4DBEA 3P8IA 5AC6A 3W74A 1W54A 3BG3A 3C56A 3P5ZA 5EMUA 2AGKA 5IM51 3EXRA 4M6PA 4ZMGA 3Q37A 1SW0A 4HNUA 1RD5A 1THFD 2QCMA 1CW2A 3ELFA 1TPC1 5MHBA 2O7QA 1TIMA 3GXNA 1EX5A 3VKJA 1KBJA 2FLIA 3GNNA 3P74A 4FIQA 1K03A 1HO1A 4O18A 1Q6LA 3PSWA 3VCRA 5LNUA 2Z0IA 3KOFA 3TW7A 1GTHA 3M47A 4AAJA 3NOEA 1DL3A 2A21A 2BLEA 1B57A 2H90A 5K3VA 2EGZA 3A5VA 3BVJA 4IMEA 1A5SA 2OZ0A 2J9YA 1TTPA 3GR8A 1HUVA 3LHZA 3P61A 1VJIA 3V75A 4UXDA 3DH7A 3TQ0A 2TYSA 1ML1A 4K39A 3W76A 2QUTA 4OBTA 3SIZA 3AO0A 4NT0A 4LS1A 1RV8A 5HQEA 2CLKA 4R34A 2CZFA 3NZ1A 1NFBA 5TBOA 2HTMA 3DXIA 1NF0A 3LBCA 1KA9F 4IMCA 2YXGA 4GC4A 4ORIA 3HIJA 4R7JA 1G4EA 4JD4A 4JYEA 3NO5A 2BWGA 3P7YA 3B8DA 2QR6A 3TC6A 4O4WA 3QSRA 4Z08A 4JS3A 1OFDA 5KINA 2VELA 4N9EA 3GDMA 5GVJA 5KZDA 2ZZ1A 4O54A 3Q58A 1ICPA 3L21A 4GRSA 1TPDA 4JTEA 4BI6A 3DKLA 2QCDB 3W7CA 2H8ZA 4LY8A 3IIVA 1ZENA 4JTHA 1D9EA 3GDLA 3LRLA 1A5CA 1SSGA 3W7LA 4MZYA 1JCYA 3N34A 4IQLA 2EKCA 4JTLA 4AHOA 1MZHA 3LCWA 4BWLA 4FHAA 4O0ZA 1KFLA 3MI6A 1F5ZA 3STFA 1DVJA 2XN1A 3WJZA 4FXSA 2QCGA 1WBHA 4LUJA 4O1DA 1X8FA 1EWEA 4RR4A 2QCLA 3W23A 3HQ1A 4A2RA 3CB8A 3TE9A 3BK0A 3SJ3A 2YYUA 2ZDRA 3LHYA 4FNRA 5BW6A 3F4NA 3LTPA 1SR9A 5CPMA 3R8RA 4AMAA 1G6CA 1VLIA 3W07A 3W7MA 4AF0A 4DXVA 3W83A 2HS6A 4HT3A 3I7QA 5J5DA 4EOUA 1KM1A 5EKYA 2ISWA 3TJXA 3GXTA 3OHIA 3MW7A 4ICNA 5HUPA 2G95A 3CEUA 2A6LA 1WXJA 3FLUA 3HGJA 1U83A 1ADOA 4HIBA 4OV4A 5EPDA 1OFAA 5KSWA 3A23A 3ZR4A 1FQ0A 2VFDA 3DENA 1VQTA 2GVLA 1OF8A 4PL2A 4UR8A 1WX0A 3F4WA 3BGJA 1T96A 3UZJA 4JX5A 5BRBA 1JRCA 2NX1A 1LBMA 1EUAA 4UFJA 1ICSA 1SPQA 3CEPA 4JTIA 2JKEA 1XDMA 1G7VA 1YXYA 1EEPA 1W5NA 3TSDA 1SSDA 4CCDA 5K4XA 3LLDA 4IXHA 2PCQA 1N55A 4M19A 3A22A 4EF9A 3QZEA 1YTEA 3DFSA 4RXGA 2RDTA 4O28A 3EWUA 3W75A 2NZLA 3GX9A 1W5QA 4O4VA 3P80A 1OFEA 3CLMA 3NM1A 3P60A 4LU0A 4FB7A 1JCJA 5EA9A 3TH6A 2DORA 3G1DA 3W7GA 3PULA 4JTJA 1YDVA 2R14A 3EWBX 4M7SA 2Y62A 4FNQA 2RKXA 2E6AA 5F4WA 3NM3A 5CPOA 1VCVA 3G1YA 3NPXA 1JUBA 4IX2A 2H3DA 3QRHA 2C0AA 4IPIA 4YLWA 2V8ZA 4WUIA 3U2OA 4Y6GA 3E0IA 1PCWA 2WO5A 1EPXA 3EX1A 2VFGA 5G1TA 5D30A 3TMQA 4CNPA 3PUEA 3WJWA 1BKSA 1TYGA 2VFEA 4N4PA 2WSYA 4IMDA 2QJHA 3NQDA 1UUOA 4NJHA 3CWOX 2V2HA 4JX6A 1MEHA 1W8SA 1HO4A 2Y89A 2WNQA 2ZZ7A 4CNNA 1K8XA 1XCFA 1H50A 4I7WA 4AEOA 3MP3A 1EP2A 1KFCA 1SQ7A 4Z0JA 1H5YA 1P1XA 5G2WA 2WV8A 4IXXA 1ZCOA 3MYPA 5HINA 4O19A 1W5MA 4NU7A 2GQ8A 1F6KA 2A6NA 2FTPA 1VRDA 3WK2A 4UC5A 2X1RA 3ABOA 1GT8A 2HSAA 3W6YA 3LCGA 1R46A 3C2OA 1SZNA 4N9CA 2CFFA 1LLWA 5FI8A 3DFQA 1WBJA 1FXQA 2QAPA 4Z1DA 2CLEA 2B7PA 1KBIA
chains in the Genus database with same CATH superfamily
1Z89A 3C4UA 4ZO8A 2XIBA 5DXYA 4S2BA 4HSNA 1S5TA 5LA0A 1Q4WA 1TMHA 4UOZA 1ZB5A 1ZBCA 1HKWA 4D6FA 1CNVA 5HA7A 2C3ZA 1XRFA 3B0YA 3W00A 1ALDA 3IVUA 3VNDA 3A4JA 4DELA 1M65A 4EXBA 1I0DA 4QCFA 4ZOEA 4GIAA 3R5EA 5AC8A 4NG3A 3AHTA 2E67A 1UP0A 2G3FA 2YBVA 2P0OA 3D46A 1E1FA 5I3KA 4J3ZA 5BOOA 2RHGA 3EEZA 1B54A 5HWNA 2X16A 1ONWA 4NJIA 4NJJA 5E09A 3VYLA 4N6FA 3L4WA 4XAYA 1G0CA 1B30A 1LG2A 4Z2HA 4OOZA 3BE7A 4PCFA 5DBUA 4GPNA 3TAOA 1JJKA 1TE1A 3AZSA 4CEXC 1VBGA 1MW0A 4ROQA 4KFOA 4ZVJA 1GYLA 4DBWA 2W91A 4L7ZA 1EJ7L 4LAKA 2RH9A 4AH7A 4D6DA 4ERAA 4LGXA 1QPOA 2WZHA 4FNPA 1BVZA 1UQZA 3WBXA 3QZAA 1AFSA 4NIRA 1UOZA 4AY7A 1OVDA 3A9BA 1R86A 4EF8A 3C61A 3WCZA 2VVNA 2G50A 5EMJA 3N15A 3S2NA 1JPIA 2O56A 4XO6A 3LXAA 1QNRA 4E2DA 1XINA 2PRMA 1DHKA 2NX9A 1TTJA 2IMRA 1DOSA 5I3FA 3LQGA 3W1PA 2HROA 4IGNA 4FOKA 4MFDA 1GOQA 4NI3A 1JGIA 4IQDA 1IE7C 1W1IE 2DSKA 5DT5A 2ZOXA 1S3HA 3WD0A 4ZFMA 2A2IA 1ZQ5A 2VUYA 3W27A 1Y5WA 4CD5A 1X6LA 3K1DA 3ITLA 3TYEA 3NVTA 3L4YA 3W1TA 3CZKA 3G1HA 4WHBA 4UTIA 4DXXA 3TYBA 3COTA 7CGTA 1DORA 2WMIA 1TZ7A 1F7BA 4NF7A 3N11A 3AMGA 1M5WA 4NZJA 4WDTA 1K9EA 4I7VA 1WYIA 1W3JA 2VOTA 2QVNA 3RLGA 4W85A 4M7TA 4CU7A 4MJMA 4Q8TA 3LENA 5LIYX 1LL7A 1EBHA 3WMSA 3NAVA 4U2YA 2E68A 2PS2A 3N4EA 3CUXA 1XLAA 4BI5A 4YVVA 4AFYA 2NXGA 1E40A 2X40A 1HT6A 2ZRVA 2EQDA 3M5YA 4GE8A 1P0KA 3TROA 3OHMB 1R2TA 4CU8A 3B9DA 3WDPP 2WK2A 2FZ9A 4HN4A 1K7EA 1LWJA 3NNTA 1B3YA 1Q6RA 4U4MA 4I9AA 3OIHA 3BH4A 4W8LA 4GFIA 3OLDA 2WHJA 4Z0SA 2JE8A 3VUSA 3ZR6A 3NXLA 2W66A 5FF4A 1JAEA 3I6RA 1Q2RA 1RCOB 4Y8FA 3MI3A 2VWTA 5DN1A 3CZEA 5MKGA 3GRIA 1S2CA 1VFLA 3MTWA 2YSWA 4LF1A 4DPPA 4GH3A 3N6QA 1OX6A 2JEQA 3BV7A 4CKQA 2EO7A 2OEJA 1E9LA 6TIMA 5AHLA 4PTXA 3ZT6A 2E6FA 4I5UA 3M0HA 3LN3A 3NQ6A 4H9UA 3CQIA 4QIUA 4ACYA 4BEUA 1XYLA 2CLPA 5I0DA 3VFCA 2ZX5A 1E6RA 2G96A 1JCXA 4GUIA 3VDCA 4MB4A 3RJYA 3SAZA 2XIMA 3GK0A 2GVJA 2G3MA 3N29A 1OD8A 1QJWA 3G3DA 3GBEA 4AIUA 5AVNA 2I56A 2HE8A 4IICA 2VOMA 3ZVHB 2CU0A 4L6OA 4GYPA 1EOMA 2GLKA 3O2LA 4G9PA 5DFAA 2RJHA 9XIMA 3ABZA 3TEVA 1JZ7A 3K8KA 1NWUA 3M46A 3V0SA 4A3QA 1MWOA 2VR2A 3OB8A 3E02A 1C8QA 1JD7A 4B3LA 1ZL1A 3ZR5A 4QSFA 1Q8JA 1Y65A 3M0JA 1OT2A 3QPZA 3VXGA 4JIQA 1VBUA 4A8RA 1LWHA 3PSVA 5DCDA 4GUJA 2O9TA 3ME3A 3ONBA 3ZLHA 1BQGA 3PANA 3H2AA 3G3MA 3WLNA 1QR7A 1EDQA 4YCOA 5KTLA 1ZP3A 3G6MA 1PWMA 5FESA 2YL8A 3VMPA 4QQ3A 5I2UA 1OYAA 3P82A 1LQAA 4Q8WA 3UZXA 1FRBA 1MQRA 3WQEA 4DJEC 4DJDA 3CHDA 1CZ1A 5BU9A 3IUHA 3PBWA 4A3YA 3SGGA 1FFQA 2D1ZA 1I2RA 1WOBA 3PR2A 4K1WA 1GVEA 3TJLA 1B31A 5D05A 1R3VA 3BW2A 4I7UA 1OZQA 5A2CA 5CEWA 4O0KA 1R3YA 1AJ2A 3AS3A 1K6AA 4XUGA 1MO0A 1RQBA 3HTWA 1P4CA 4Q4OA 4X22A 3W22A 1XLCA 3ITXA 5REQA 2AMXA 2HS8A 3NQAA 1DV7A 1CECA 3WQWA 2OX1A 1W9UA 2DV0A 2BSLA 3T0BA 1C93A 4XVDA 4ZE4A 1DQXA 3MT1A 1VCGA 1VD6A 4DYJA 4IJBA 2F38A 1TREA 5BZAA 3FJLA 3MP5A 3PAJA 3DESA 3TLQA 2QPSA 9RUBA 4HNCA 4AISA 3GXMA 1KM0A 4JN7A 4CD8A 5AC7A 2BS9A 4I90A 4H8VA 1XH2A 1I2PA 1EGVA 3EA2A 3AFBA 2ZIDA 1EL3A 4MG4A 4ZQNA 1H5VA 3W7JA 3LNMA 4QRNA 2ZE0A 3DFTA 4KFPA 2DT1A 4DJFA 3PBGA 3CT7A 1XLLA 4ZOAA 1Q6FA 4LVBA 3BLLA 5K2ZA 1RBAA 3FSUA 1VP5A 3T0DA 3RLUA 4PSPA 2V5CA 4O50A 2J47A 3GYCA 3WSUA 1KR0A 1FH7A 2E77A 4WIWA 3W1LA 4KETA 1EHNA 1TUXA 4D6EA 1IZCA 2DW6A 3SURA 2XFFA 2CYGA 4MGGA 1M7OA 3N2OA 1S46A 3L5LA 1WA3A 7ENLA 3F2CA 5A8GA 4I3GA 3PZVA 3TONA 3SCTA 4RNHA 4EAMA 4R9OA 5DEZA 5EY5A 5ENLA 1SYTA 1OFBA 3N4AA 1JCLA 2RDXA 3APTA 4C1KA 5JVLA 4UB9A 3G0UA 3KS5A 2ZRWA 4LCSA 3UXAA 4HHMA 1YPFA 3LSBA 5LIWX 4LRSA 3UPWA 5BMWA 4J3VA 2DP3A 1O12A 1AJ0A 1Y8BA 2C91A 1VAHA 3HZ3A 3V1PA 4QQUA 4ZENA 1LTDA 2DJLA 2OYLA 4L9ZA 1R9ZA 4Y8EA 2E40A 3T4CA 1PO9A 3SADA 4K37A 4E8DA 2ZKMX 3KHJA 1SM9A 2A3LA 1KFJA 3WFZA 1Y5XA 5AHEA 4DHGA 5D32A 1XUZA 5FEPA 3CPGA 5A6BD 1WDDA 4BR1A 3LCLA 5D38A 4E4UA 4AYSA 4K8HA 4H9MA 3B0VC 1TQJA 2ZXAA 1W1ZA 2OFJA 2GJNA 1A50A 5DXXA 3GY1A 5HNNA 1OT1A 3MMTA 3DFNA 2O9RA 1P7TA 4OUEA 5E6YA 1OQFA 1RA5A 4Q4PA 1XD1A 4RZ4A 1SO6A 1DJXA 3V0UA 3S1GA 2WMKA 4XTDA 4AVNA 1R9XA 1F8IA 2H3BA 2Y4SA 3GKAA 1H62A 1W2PA 4NHVA 4ZSTA 2Q8LA 2FHCA 4DM1A 3APYA 1V6YA 2XGIA 4KT2A 1AH4A 2A1YA 4YCPA 1W1YA 4LBSA 4B2DD 3M0YA 1XISA 1GQIA 1B90A 4PMVA 3W7EA 4LCQA 1S5VA 1XG4A 2OJPA 2PDWA 3KOXA 3M0VA 2C14A 1QWKA 2X41A 2VC5A 4S1FA 4A21A 1BWLA 3W7NA 4BA0A 1PHQA 3H24A 3SECA 4O1FA 4GX9A 4JIIX 2C79A 2PTWA 4TUFA 2DW7A 2GOKA 5I3DA 3IK2A 4MPKA 3BAJA 1XFBA 3JUGA 1VHCA 4A8LA 3POCA 4A3UA 4P7OA 5KITA 3O8AA 3AYRA 3OGVA 4OJYA 2YDSA 2NLIA 2Y7DA 4IP4A 3FDGA 2JALA 3E2RA 4XAZA 3SIMA 5I3HA 5G1YA 1BRLB 3VPLA 1E3XA 1UA7A 5HPCA 4HPHA 1MI3A 1FCUA 3LI1A 4E0CA 4XZHA 5A6MA 3L4VA 5DCBA 4H2HA 3OEXA 4EPKA 1GEQA 1UR4A 3AISA 2XZ9A 3GVQA 3V5OA 3PAOA 3N73A 2V30A 1RR2A 4TU1A 1FP8A 2XVNA 5E1QA 3W2KA 2O4QA 1IT0A 5M3WA 3B8IA 2GK1B 1V02A 3NYZA 2PDFA 4DUWA 1AZ2A 4ILSA 2RDWA 3I6EA 1V7YA 2BXZA 2J27A 4XK2A 4NZ5A 4W9TA 1V8EA 4CNTA 1IWAA 1A5AA 4P7NA 4JY9A 4UNLA 3BARA 2ACQA 2AQWA 4F2UA 4Q4MA 2REQA 2E1DA 1R2RA 1YMYA 1EDTA 2PBOA 5LKYA 4F0MA 2VFIA 1W3TA 4WGHA 3UY7A 3QHOA 1KGWA 2XVKA 4IPPA 3PPCA 3W1RA 4TX8A 4XD3A 4ZGYA 2FVMA 2XH0A 4D9PA 5FOOA 4Q6XA 2CEQA 3GU9A 3WD4A 1N8IA 3MC5A 4HHLA 4JKMA 2QDEA 4N02A 2GWGA 4HU0A 3PTQA 3BW3A 1AUSL 1X39A 2VC6A 2E0PA 4WKAA 1JCMP 3J7HA 3WUBA 5HJLA 4S38A 3MQTA 3B9NA 2X1SA 4GUHA 3TTQA 3QR1A 2I14A 3OU8A 3A3XA 4MLRA 3DHPA 2YJQA 1V6UA 3AROA 4GUGA 2Z6IA 4K7YA 3BLEA 3AAMA 3RILA 2ZTJA 3V1HA 2X30A 1NARA 5E6ZA 3CHEA 3UG4A 4G8TA 3GNXA 4XWUA 2PDPA 3WNMA 2J9XA 5AOUA 3N6HA 3PY2A 3WUGA 1H63A 2WSKA 1O5QA 4QP0A 4Q7BA 4KWVA 3RXZA 3M5XA 1TV5A 3K1GA 4LTSA 3HURA 3PS7A 3CUJA 1KD0A 1G9HA 5HUOA 3FYYA 3AWOA 3W2JA 2XIOA 4LNCA 4S3BA 3M4HA 1PBGA 2W0UA 1MXSA 1GJUA 3HGOA 3V3WA 3NL5A 3KL0A 3GW0A 3W7QA 2D2JA 3CO4A 1AA1B 1X1NA 2TODA 4LXFA 2WQPA 4V33A 3BW4A 3W53A 2J88A 4O1CA 4ZQCA 3VZZA 1QCWA 1R2SA 2TMDA 4ZB0A 1E4NA 1TPUA 3KBSA 4R33A 3WLSA 4AD2A 4MLJA 3II1A 5A2BA 2QMJA 4EWND 1L6FA 5I78A 4AUBA 1XLFA 5XIAA 3HU7A 4B91A 4DWDA 3WJSA 4JIPA 2P5NA 2ZYFA 2PWGA 2V68A 3Q94A 1OB0A 1OYBA 5FSDC 1MDLA 2W67A 1FCQA 1UUMA 3NFUA 4RNFA 1ITXA 3QKZA 2ATSA 5TIMA 1BVNP 4O16A 2DEPA 4DF0A 4XIMA 1CDGA 1P6WA 1R47A 2Y7EA 5LGZA 3MKVA 5CGQA 1UZHA 5J8LA 1UA3A 4QNWA 2VC7A 3VKDA 3GDBA 1EHAA 3B4YA 3EOUA 4JQ1A 1KLZA 1PZ3A 2NQHA 4REQB 3VDBA 1CGTA 4GBDA 2DIEA 1CENA 2OT1A 2ASHA 1NVMA 1M3UA 1XLKA 2J13A 1G01A 3SBFA 5H8UA 1CWYA 3RU6A 1J12A 4GIYA 5D37A 4RE3A 1K1DA 4LVDA 2WLYA 3EWZA 3UWYA 1O68A 1QO2A 3QTPA 1SW7A 5EBAA 2GOUA 1GG0A 1QK2A 4LVFA 1NOUA 2R82A 3E1F1 2ZX7A 3OLIA 3UCQA 3C2EA 1WO2A 2BTMA 4ONVA 4BQ5A 3MI2A 4RDZA 4YL2A 4O14A 3VKAA 4RE2A 1H41A 4E2OA 3BSHA 4NKCA 2J79A 3H21A 4YXGA 4JIHA 4AXNA 3NL2A 1VPXA 3S9IA 3W2LA 4JTAA 3KRSA 3NPUA 1XM3A 4MY8A 4U10A 1G4PA 3VKKA 2W92A 2XN2A 3OA3A 2NQLA 3CS2A 2UY4A 1OG6A 2BV9A 3V4BA 5D2TA 5F4XA 5CKSA 1GKPA 1S2WA 2GYIA 4MB5A 4NXKA 5JBFA 4NX0A 2DFAA 3UJRA 2WBGA 4OUIA 4JBRA 7TIMA 3HFTA 4MYAA 4Q8QA 3NQEA 1I9CB 2V63A 1XLMA 3HM7A 1Y7VA 5C9WA 3GD6A 4ZBCA 2QV5A 2MNRA 4UFIA 5A6SA 3KRUA 3GBDA 1XGEA 2FJUB 2O9PA 3PZNA 2PLJA 4ZO6A 1WDSA 2BX7A 2J78A 4J3TA 1WCGA 3TLLA 4CNOA 3S6OA 3GNOA 3CL7A 1FHLA 5BXRA 4QITA 3W38A 3GKFA 4UQEA 1H60A 3OBAA 5FKYA 2P1FA 4IH3A 1P7TB 4IT1A 4BI7A 1WZLA 3THUA 4D1JA 1MFVA 2PA6A 2HWGA 5H6HA 4IWWA 4EXAA 4MAZA 4H6EA 2WMJA 3IACA 2I57A 1KM3A 3L2IA 1FWFC 4PSRA 3W2MA 4ZFCA 3BZGA 5FEXA 3OJGA 4GJ1A 2QAFA 2JF7A 4ZEPA 3BLPX 3IANA 4MHBA 5BYWA 1GVIA 3NQCA 3S1UA 2VGIA 4PMQA 1EIBA 4NZ1A 1E5JA 1G67A 1GZJA 3S1WA 1V0LA 1UCWA 5LNVA 5CJNA 3A3HA 1AODA 3WQFA 3UYCA 2WZTA 7REQA 3PWIA 3DUGA 2EPKX 4CEUC 3RIKA 3PNUA 1KXQA 2ZTKA 4WEVX 5U7SA 1CXIA 3NL3A 5CSSA 5E9AA 4O10A 3GLCA 3H2MA 1KM5A 4Y90A 3WLJA 1TV3A 3WL1A 3RO8A 2NVCA 4IPJA 1A5LC 4MYXA 5IFTA 2Z1VA 3BQ6A 4Q7IA 3HFYA 3R58A 2ZICA 4B5WA 3T2OA 1W3LA 5CG7A 1WPCA 3SUVA 1KKOA 2QCCA 4MKSA 1J0ZA 1H7RA 3EWWA 1DWIM 1X38A 1ADSA 2CW6A 3KW3A 5FSEC 3M0KA 1W5PA 4GCXA 1JF6A 1F2JA 2VO5A 1RCQA 1RH9A 4RNIA 4K7VA 4ADUA 5D9NA 3NQVA 4XBJA 2X7WA 3RAOA 2PPGA 5CC7A 4B92A 4MUZA 2VURA 1UR3M 4G5DA 4GQQA 4KPLA 3QV6A 4YNGA 3SO7A 1KCLA 3W88A 3C6CA 1O1ZA 4GACA 4GIEA 1H7PA 3O6CA 2E5BA 3E38A 2EJAA 2XVLA 3IIPA 1KFEA 4HOXA 2QJGA 2YW4A 1XRVA 3FKKA 3GIYA 9CGTA 4O13A 5I3GA 3V7PA 4CQ9A 1YTKA 1VHNA 4QE5A 4AWUA 3VOCA 2YCEA 5CZ0A 1NY1A 3LNPA 1QOQA 3A12A 4H9XA 1AL7A 4F9DA 1JIBA 4Q6JA 3T40A 1EDGA 5RUBA 3TUUA 5E0KA 3LBMA 4XAPA 3NEHA 3XINA 1OX4A 4GD0A 2REQB 3WG6A 1DXFA 3D6NA 1CPUA 1P5BA 2WVSA 4CNSA 3VIFA 4JAWA 3IRSA 1EWDA 2YOCA 1XF0A 3NPWA 3QQ1A 1CXFA 2VX6A 1OHLA 3SEPA 5LSMA 1GWJA 1KBBA 2YZ5A 2C1HA 1W3HA 4GKTA 1RXOB 4LAZA 2JQXA 3HV8A 2GJRA 5EB8A 2Y88A 3AIRA 1UQYA 4MY9A 4WJEA 3VNLA 4I5XA 2F8QA 3WH5A 4HSHA 2BY0A 5K9CA 3S5OA 4PTDA 1D7FA 3VD3A 4HKPA 3AS0A 1WDWA 3IRDA 2Z29A 3VD9A 3STCA 4JCLA 2ZA2A 3KVJA 3GO2A 3PG9A 3ONCA 1UWTA 3HJEA 3W7DA 1GQLA 4GNJA 4MVAA 2QW5A 1W9DM 3Q2DA 2E7FA 2FTYA 2V82A 4B4HA 3REQA 1DJIA 1VIWA 1FXPA 3UZWA 5E70A 1LQ0A 1WKFA 1UB3A 3H7RA 4CCCA 3GC4A 3H2FA 3VOFA 1JZ3A 5F2MA 4PCNA 2EKGA 1TJRA 1H11A 4AZ7A 3HG5A 4HA0A 3KUMA 1W54A 3BJTA 1S5MA 5IM51 3KBMA 1KO0A 4FZIA 3N6JA 1E55A 1THFD 5EFFA 1QASA 2QCMA 3WBEA 1XLEA 3BJFA 5MHBA 1GYMA 5HANA 3GG0A 1KBJA 1HO1A 3PSWA 5LIKX 3R0UA 4WJ8A 4J3UA 4OIFA 3MANA 1TA3A 4F66A 3M0XA 3WBWA 4IUGA 2H90A 5K3VA 1HX0A 3A5VA 2ZUSA 4IMEA 2VR5A 2WJFA 3RLHA 3H12A 4B4FA 3P61A 3FSTA 4D6JA 3DH7A 2TYSA 5F7UA 3WDJA 2VRKA 4S3FA 4GMEA 1C92A 4DWSD 1E73M 4YU1A 3CQHA 1R3RA 3T2PA 4RE4A 5REQB 2BGQA 2CZFA 3K8LA 4KESA 3MJMA 3WENA 3NZ1A 1NFBA 5TBOA 4FLSA 1KA9F 2ISFA 4UOJA 4GZJA 4GC3A 2ZADA 4GI4A 2PTYA 1HQTA 5ABHA 4JD4A 4JYEA 1DWGM 1Q4NX 3C86A 3NO5A 2GVYA 3R79A 3WDRA 3B8DA 2G3IA 4IF2A 3QSRA 4L64A 2EPMX 4JS3A 3F7JA 3HMCA 4N9EA 1P6CA 1S2TA 2ZZ1A 1LT7A 1CXKA 5MF5A 3UBPC 1ISWA 3W7CA 2H8ZA 1DQUA 1UR8A 3AMDA 4IHCA 3WQ6A 1D9EA 3EYPA 4MZYA 1JCYA 4AIEA 4IQLA 4AHOA 4PEEA 3MI6A 1F5ZA 3WJZA 2QCGA 3QV7A 1VEPA 2QCLA 3W23A 4JQ2A 4WCJA 3BZJA 3CNYA 4A2RA 3CB8A 1QHZA 3KTSA 3PZQA 1CYGA 3QY8A 1JPDX 1R85A 3LHYA 4AZCB 3RYSA 4RPPA 5BW6A 4OFCA 4JKLA 2BHZA 4JFVA 5FAGA 5T91A 1V51A 2A3CA 3SRHA 1DIEA 3CV6A 3IAPA 1FWEC 4XZWA 3QN3A 4HA4A 4HT3A 1BGGA 3I7QA 5J5DA 3FXYA 1ISYA 1CXLA 3MDWA 5HUPA 2A6LA 5CJ5A 3PJXA 4H00A 5JH1A 2JFEX 1U83A 1ADOA 1J93A 2OKOA 5EPDA 2WWCA 2VFDA 1XLHA 1OF8A 4PL2A 3GE7A 3B8TA 4PRTA 4D8LA 5BRBA 4UFJA 4NSBA 3ZT7A 1NOWA 2FHFA 5GNZA 1XDMA 3VCNA 4D6IA 1TVNA 3RCNA 1W5NA 4GXWA 4DJED 1E9IA 1L0PA 1N55A 1QI2A 1HJVA 2HK1A 4TTGA 4NZCA 3QZEA 4QXIA 1YTEA 4CUCA 4RXGA 1A5UA 4HA1A 2QUNA 1XYBA 2O0TA 4KEMA 2DH3A 2VHLA 3TJIA 1AVAA 1JZ4A 1EOKA 1BG9A 1OFEA 3MKKA 4LU0A 4C7FA 1CLKA 2Q6ZA 2DORA 3W7GA 2J7EA 2Q71A 1YDVA 2R14A 5F4WA 3ARPA 5HMFA 4YTSA 4KS0A 1VCVA 4LF2A 1HKKA 3NPXA 7ODCA 1CLXA 3PZMA 3QRHA 3T9PA 1A3XA 1KCXA 3WLPA 2V8ZA 4YHGA 3SCQA 1EPXA 1SVDA 3EX1A 2W3ZA 3GFYA 2FMOA 1B3ZA 3QY6A 2VFGA 5G1TA 4DO7A 5KEZA 2X1IA 4PB3A 5D30A 1J96A 4CNPA 1BKSA 1TYGA 1S39A 1J10A 2WSYA 2QJHA 3NQDA 3PTKA 3ZJ7A 2PD9A 3CWOX 3UA3A 2V2HA 3N12A 1W8SA 1DXEA 1HO4A 2HK0A 2Y89A 4GIRA 3WMBA 1UWAA 4DLMA 1UC4A 3C5QA 1EP2A 3R94A 1SQ7A 5C7VA 1P1XA 5G2WA 4IXXA 5HINA 3QOKA 3LS9A 1W5MA 4NU7A 1OCBA 1F6KA 1J2BA 3SCPA 4UC5A 1GT8A 2BOGX 3LCGA 4GHRA 1HJQA 5DMMA 3DFYA 3M0LA 4LYRA 1V79A 3MVIA 5BWAA 5IHRA 1DIDA 1SZNA 4N9CA 3MSGA 4U3AA 1XIDA 3SN4A 3TA9A 5JBEA 4B2DA 4F0HA 1FXQA 1QU4A 2CLEA 3T09A 1IR2A 3T0AA 1LORA 4U33A 3FDKA 3R8HA 3U48A 4DNHA 1I2OA 1B3OA 4X61A 1DEDA 3QFWA 3EWCA 1ZHAA 3RF9A 3W1QA 1UKTA 3ITCA 1IWBA 1EKOA 3TCEA 4GUFA 4WY0A 4AHQA 2W27A 3LLXA 1GKRA 4X3ZA 1PSCA 4RKAA 1UH4A 1R87A 2WVUA 4LOCA 4PBEA 4NI8A 3NZPA 4WDUA 5DMYA 5BCAA 2HBVA 3ZZ1A 1LL6A 1AW2A 1L2UA 1G69A 1S5NA 3BGGA 2C16A 6XIMA 3EWYA 2WZMA 4E6MA 1XIFA 4DZAA 4ECLA 1C9WA 4TVCA 1IXPA 2ICSA 1EQCA 3C8NA 4F9JA 4H9VA 3QHNA 1UH2A 1UWUA 4ZL1A 5H8PA 1UD5A 6REQA 1B3VA 4EXQA 1JI1A 4PMDA 1NELA 2DVUA 2EG6A 2NSXA 3KRZA 4Y9MA 2XWDA 2GUYA 3JZUA 5CAHA 3R0KA 3OVRA 4NXSA 2CXGA 2WVVB 4PTNA 1Y5VA 3CMGA 1VFOA 1MXGA 4KRUA 3W84A 3W1MA 2VC9A 5AB3A 3RU8X 3GXFA 4BCEA 1E15A 3K13A 3URBA 5BXPA 1V6XA 4OWGA 1VFUA 1VJZA 5B7YA 1DQWA 2Z2UA 3LU2A 1E0TA 5D2XA 1Q6QA 2LLEA 1J0JA 3OLEA 2YL6A 1AD4A 2WLZA 3ERPA 1VYPX 4Y2WA 3WQ5A 3UPMA 3BPWA 1TR1A 3GAKA 3DIPA 1X1OA 5H8MA 2YB1A 4E4PA 3W73A 1TG7A 1XFCA 1M7JA 3PZUA 3KOYA 3R43A 4I9JA 5CBIA 3WEZA 1XPGA 3DGRA 4OGZA 3FNDA 1RHCA 5EMLA 4UNIA 1I0BA 1EZWA 5BRQA 2WNNA 2DZPA 6TAAA 4MPQA 2X8RA 1EC7A 3R25A 1QNVA 1VPYA 2IKHA 1RVKA 1XIEA 3LX9A 4JICA 1EEXA 1T40A 2FGLA 5EMKA 1RA0A 1UD6A 3CC1A 5H1WA 4XSLA 2V69A 3E9AA 2E25A 3W85A 4H8UA 1YX1A 1XSKA 4DXKA 2Y24A 1G94A 3CO8A 2IUZA 3ZFHA 1NDZA 1UUQA 3MV11 3WK0A 2TAAA 5I6SA 1VYRA 4ZOCA 4ZQOA 1K3UA 5FL1A 4TXEA 4HK5A 3S1VA 4HMNA 2WHLA 1RP8A 3I7SA 1TJPA 1YNPA 2QUVA 1REQB 4YYCA 5A69A 4O1BA 5HJYA 1W56A 4UMBA 2DJXA 4RJEA 5L6UA 3BAYA 1HFBA 4UQDA 1VGAA 1SZFA 3B8VA 3LTSA 2DSUA 1NWSA 2VENA 4HZ6A 1LM1A 1H7OA 3NUKA 1RZMA 1DHPA 2XG9A 3CV7A 2QF8A 2A4AA 1POKA 3V16A 2ZC1A 3KP0A 4PMXA 4RDVA 3MMDA 2I9UA 1A5KC 3VA8A 3LM7A 1PE1A 3LCFA 3L67A 5IBXA 3C52A 1GOIA 4MB3A 4GYJA 1U33A 3OZMA 3CYVA 1YPIA 3AU2A 3G1XA 4FLRA 2GQ9A 2DZAA 2WM0A 4G6CA 4NZ3A 1H7WA 1JPKA 1DWAM 3LM3A 3MUXA 2H6RA 2NUWA 3ARUA 1V0MA 4Q8NA 4JYFA 4EPEC 2GQ3A 4PUDA 3EB4A 1GVYA 5I77A 1GNXA 5FJOA 3ARSA 3M9YA 4QJ4B 1BYAA 1VFMA 2ACRA 1XQLA 1KBKA 2PE4A 3KDNA 1PZ2A 4JNMA 1IXQA 3MZ2A 3SY1A 4IFKA 5GNYA 4C1LA 2A7NA 3ARTA 1Z7AA 3TTSA 4U2ZA 2JIWA 2AL2A 1ZLPA 5KZ6A 1W3IA 2NV1A 1N2VA 3VM7A 5FF0A 1MW1A 4L6DA 4A3RA 2VRQA 4WF7A 5JXQA 1QRQA 2J75A 4PUNA 4F2TA 4PMUA 1FH9A 3A4XA 3AUOA 1S2VA 2XTKA 3WFLA 3VNKA 4GINA 4MKNA 2OGYA 1KFKA 2VUNA 3IIXA 3RG6A 4N7QA 4B3KA 4QSHA 1XBYA 3IUIA 4DM2A 1T99A 1WKEA 1FOBA 2OTDA 3L66A 4IM4A 4V1XA 5A8MA 4MDOA 4MADA 2XVGA 2V5JA 3TXZA 2W62A 1UPPA 5JH2A 1LBFA 2I5GA 1F9CA 1PTDA 3AOFA 3DAQA 1ZPTA 1RY0A 2PI6A 3KZPA 1PYFA 1QMLA 3C2RA 1JQXA 1PX4A 2VRJA 4XD6A 3HMJG 3KCLA 4A3HA 1WDPA 2XISA 3RN6A 3SUUA 3R8GA 1TMQA 2QUMA 3T05A 3WYZA 4PMJA 1KRMA 1TWIA 2WC3A 2CKSA 1KGUA 2PTZA 4TIMA 3ALFA 4MNKA 2DQXA 1PJ9A 1BGAA 2V3DA 3KOWA 1K70A 2Q3RA 3KVKA 3ISIX 5D2YA 3LGEA 1AW1A 2ZZ6A 1YBQB 3WNOA 4AVOA 3KVMA 4CD4A 5EL1A 4W93A 2PZ0A 2HNHA 2GGJA 4HB7A 5BRPA 1R3SA 3NGJA 1V3KA 3O15A 4PRRA 3PHAA 1RCXB 1YRRA 3UWVA 2HBXA 3DHDA 3UD6A 2VJXA 4J1OA 5JUVA 4QG6A 3O7UA 2YR1A 4ZCWA 3RFAA 2PP0A 1SO5A 2OMAA 4L4PA 2X0HA 1Q3NA 1B9BA 3UA4A 3CTTA 1LBLA 4S3EA 3MP4A 1KW1A 1TRIA 3VGBA 1N8WA 1QBAA 4RW3A 3QW4B 3NZQA 1EIXA 3ABQA 2W79A 3DECA 4YVXA 2XPKA 3OPSA 2POTA 2QHAA 1P0EA 1C9DA 2PB1A 4W86A 3ZJ8A 3ARZA 1I60A 1A0CA 2OQYA 2QKFA 3MHGA 1FY6A 3KE0A 3V0TA 4P8WA 3GHSA 3T8LA 3CT2A 5D33A 4DWSA 3D3FA 2PODA 2FYMA 1ZRQA 3AYTA 4KKXA 3VVGA 1E6SM 4AB4A 1ODUA 4CQCA 3UZ5A 4GXPA 1FFRA 3CWHA 5HOSA 3BLIA 2GJLA 2GGGA 1ONRA 1XC4A 3O63A 4LT9A 3WBYA 4ZQMA 2VEIA 1WAUA 3BLFA 4KCWA 2F84A 4A22A 4J3XA 2ABBA 3L4UA 2YDAA 1OX4B 3U2CA 1LL4A 5CGMA 1JDCA 5AYXA 3PWGA 3WY1A 1HN1A 2VR4A 1EJRC 5C8BB 1S3TC 1AJZA 4GZEA 4IIFA 1VRXA 3WMLA 3PF3A 3WF2A 3FHAA 3I3EA 5F2LA 2ZE3A 5C6MA 1CIUA 2CCRA 3QTGA 2UY3A 5A94A 1H7XA 1PX3A 1XPYA 3S42A 3PVFA 1JDDA 1O5RA 2ISDA 2PDQA 3KTCA 1WUFA 4TTUA 4AYGA 1VENA 3LV5A 4BHYA 2QPUA 4H7ZA 3LHTA 1XBXA 3TZFA 3DG7A 2AAAA 2FPTA 4J2MA 2IPWA 3G8RA 4JTRA 1Z9AA 4PUMA 2HXTA 4FALA 3HGRA 2IPGA 1D8WA 5T8GA 3GNPA 3W01A 4ZZ9A 3EDKA 1CGYA 2KX9A 4DN1A 5FJPA 3GXDA 2JBMA 1UR0A 3BCFA 1O6IA 4D6CA 1I4NA 2GQAA 3NXFA 4TV5A 1QHPA 4LCRA 2O92A 1ME7A 4XTIA 1T8XA 2I5IA 3W7PA 4GYKA 3LPGA 1BPLB 2PSNA 1GGOA 1VJSA 1HG3A 4ES4A 2B7OA 2OSWA 4Q33A 3VIKA 3I4EA 5IBXC 3F5JA 3EKZA 1OGSA 1REQA 2PP1A 3CV2A 3T07A 2YZRA 2ZQ0A 4RCXA 5A6JA 2O4MA 3C8FA 1V02E 3S2JA 1RUSA 3OODA 3R12A 3CASA 3FKRA 1Z8AA 2FH8A 4TX6A 2DT2A 2OQHA 4JXCA 2KZHA 4RZBA 1ISXA 3A6OA 4HZ7A 1JZ6A 3M64A 2HISA 1QUMA 1AG1O 3M41A 4P5UA 3HGSA 4MJZA 5KZMA 3PUOA 1TVPA 4M6QA 4QG8A 4WK9A 3G0SA 5D09A 5C2XA 4PUJA 1VCFA 1YNQA 5DY2A 4WOZA 4RL3A 3STGA 4GO9A 5D9PA 2XJ7A 2ESCA 3CAQA 1IF2A 1NAL1 1V6TA 4GK8A 2BOEX 2CZDA 4JFSA 3M6YA 4R3UA 1E6NA 3QYSA 3MBDA 4WSJA 3MS8A 5I5RA 3UXKA 3VK5A 4AVFA 1BYBA 2I1OA 1TELA 1K9DA 2QLYA 4QDPA 4LVGA 1E4LA 3AYVA 4O8AA 1QPKA 3VC6A 3VX0A 3LZ3A 2Z6JA 3T55A 3DN5A 3O0FA 3QXBA 3SCOA 4F40A 2X42A 3CLWA 3CTLA 3DFOA 5DQPA 4B90A 4PH6A 3M0MA 4HHPA 3EX4A 4G2DA 2DY3A 5A8OA 4ACZB 1JUEA 1WZMA 2MANA 3W72A 5GQBA 1L6GA 4UTHA 3UYIA 3M6DA 3DC8A 1GVRA 4FX8A 4UFLA 3ITYA 3IV8A 5A1AA 2WOQA 1I6NA 1FH8A 4JL2A 2PAJA 2OSYA 2BVYA 5AC5A 4Z2IA 1UP2A 3MV01 3QPEA 1X1ZA 2J25A 4G7EB 2JK2A 1DJGA 3NGFA 5CQ1A 3PM6A 1OABA 4PB4A 2YA2A 5M17A 3Q4DA 1AH3A 3MKCA 5HJXA 4U3CA 1SO3A 1YADA 1OFPA 3JZEA 2VKZG 2GFTA 3HF3A 4NNCA 4PUEA 4Z42C 2DZTA 4JTUA 1TWWA 2YCIX 4O53A 1XSJA 1P6BA 1PV8A 4GVIA 4Z1CA 1PKLA 2J7DA 4QBXA 3URNA 1K4HA 3V36A 3O16A 1QHOA 2OOGA 2CIPA 3L12A 1XICA 2NV9A 1V3MA 4LYQA 1Q5MA 3TWBA 3ITVA 3CHVA 1V6VA 5FF3A 1QFEA 1TWZA 4IGMA 1P43A 3AIUA 5IFPA 1V6WA 3O07A 1M53A 3T7VA 4B5VA 3BOFA 4R85A 1W32A 1TVLA 3IJLA 4PMZA 5LNSA 1TR9A 3QSTA 3T0TA 3AJ7A 4C60A 2UY2A 1Q2SA 2GUBA 2XH2A 1KQYA 1UD4A 4YPJA 4PEKA 1L8NA 3URAA 3W2UA 3WN6A 3IARA 1DIOA 4XUYA 1E3ZA 1JFHA 1VF8A 2DH2A 4AD0A 4LV9A 1GQNA 1D8CA 1M6JA 4AIBA 5DX7A 1BEUA 2QMKA 2X0YA 3SCSA 2PWUA 1TZ9A 1LUCB 5CJMA 4R53A 3W87A 3HV9A 1W91A 3B03A 4Z1YA 4JEQA 1U1UA 3QGKC 3VIJA 4UQBA 2EG7A 2WSQA 3FA3A 1GQJA 1CGXA 4IIBA 4KEVA 4D8AA 2R94A 4DJDC 3NQMA 4KGJA 3RGTA 2YXXA 5I3IA 4S39A 2PDNA 4W5ZA 4GKLA 3QF0A 3GWQA 1EFZA 5D03A 5B80A 2YCKX 3N14A 1V0KA 2WWDA 3TDFA 1XGDA 4W4QA 4AEFA 1E56A 4U31A 5AHFA 1KB3A 1XHGA 2E9LA 3GFZA 3VX1A 3PZGA 2HMCA 4O52A 1PKNA 3H2EA 3E0VA 3LG3A 2BNJA 4DBUA 3KBJA 3WEOA 5LNRA 3RLVA 3UPBA 5I7GA 3OQ8A 2HQAA 1Q45A 4CQDA 1KCZA 2E5DA 2BVWA 5I24A 3FJ6A 1FWCC 1UROA 2J7BA 4DB7A 3T44A 1WB0A 3RR4A 1TPVA 3AMKA 2ODOA 4H01A 1ZS2A 5TAOA 3QY7A 4JTDA 3LDVA 3L0KA 1W9XA 5I09A 3HN3A 3IVTA 4Z17A 2OLAA 2VEMA 3TN5A 3DHFA 3WD3A 1XYZA 1HP4A 5CZSA 2P3ZA 2ZUTA 3N19B 4DWSB 2CHNA 2DDXA 2DZWA 3FY1A 1NU5A 3LRKA 3ECQA 3P14A 5XIMA 3GSMA 2VT0A 3M5ZA 1ZJIA 4H9YA 4WY0B 1ME8A 3W6LA 1RLCL 4E38A 3MSYA 3G24A 5FF2A 3CPRA 3VO0A 1J5SA 1IZKA 4XZIA 3LB0A 4AD5A 5CBBA 4X2RA 1E1EA 1O5XA 1ZY9A 5A6AA 2NUYA 3WQDA 1LOQA 1OGBA 2Q8XA 2WCSA 4O8RA 1GTEA 4I8DA 6XIAA 1BTMA 3PUGA 1PIIA 1SU5A 2TRSA 2VCBA 3NEVA 1Q6GA 2QJJA 1Q6CA 1EPVA 4O12A 4D71A 2PDCA 3EZ4A 1SJDA 4X60A 5LIUX 1KWGA 5CXPA 2ZZ3A 3R6IA 5B7ZA 5BMXA 4HNOA 1LOSA 3VC5A 4UTTA 4QX4A 2GSEA 4LC8A 1UJPA 2BBFA 1P0NA 3OYZA 1XG3A 4GXMA 4Y9NA 5AECA 2QJNA 4Q3MA 1B4EA 3EBVA 4WQ6A 5AHMA 1SGJA 3M16A 3KEHA 1JYXA 4JL1A 1Z32X 5HPOA 4NRRA 1T0OA 3G1VA 3ZYZA 2NQJA 4Q8MA 2QYGA 3U8GA 2F61A 3LV6A 4IPNB 1FA2A 1KV5A 1ODZA 1XCXA 4RV3A 1UC5A 3UWEA 1NTHA 3QLDA 2QVHA 3FV9A 3OVGA 2XYLA 2O7SA 1GOXA 1IGWA 3M7WA 4AD1A 2L5HA 4QS5A 3MO7A 1HGWA 3ATYA 1QOPA 5D8ZA 1KFBA 4M0XA 3LCHA 1PCKA 5E9XA 2P76A 3BLKA 3BOLA 1ZALA 1FDJA 2GUUA 1U5VA 3LMZA 1CT5A 1IR1A 2R24A 1HKMA 2OYKA 1GCYA 3RPMA 2DGAA 3SRDA 2CBIA 4AZGA 3N9KA 4LUIA 1EA9C 1UZ1A 3F1QA 4XG1A 1TJ0A 3ZVHA 4WX2A 1K8CA 3EMZA 3HG4A 2NXHA 3PFRA 3S5SA 4ZO7A 2CBUA 3I6TA 4IFOA 2HVOA 1KV8A 4N9DA 2V6AA 3PG8A 3PBYA 1Q63A 3GH4A 4LAOA 1GVOA 2YX0A 3P0WA 2JIEA 4FI4A 3FEMA 7XIMA 1AW5A 3LQLA 1NIUA 3IEBA 2X1TA 1K4GA 3W02A 4DBSA 5HWJA 2VFHA 1OCQA 1ZP4A 3DERA 4BJHA 2WPBA 2JF6A 5AZ1A 4WSHA 4C6JA 4EX4A 1S1RA 2FVLA 1GOKA 4BF5A 4URIA 2Z00A 2ZUVA 3WH9A 4HVXA 4JFUA 4XAGA 1VFHA 1CXEA 1AZ1A 2I17A 4HK6A 3DU0A 4M3PA 2ZA1A 2B7NA 4JQ4A 2WYSA 5D02A 1BF2A 1F73A 3W81A 1FHUA 3U57A 3L7RA 2OU4A 2YFNA 1V7AA 5FACA 1SZGA 3AU6A 5FJIA 1XWYA 4KWSA 1HZYA 1XP3A 4UTMA 3WELA 4J3SA 4YTTA 4FMVA 3ZVIA 4US5A 2A5HA 2P10A 2NV2A 4FF5A 3TYUA 4BK9A 5FF7A 4PODA 3TC3A 5HWMA 1FWSA 1I8JA 1M7PA 3GH7A 5I02A 3AI0A 1JRBA 3S47A 4L5ZA 3WK3A 4DNMA 1XYCA 4IZGA 2ABAA 4ZR8A 4XQ6A 3AIWA 3F4VA 1BFNA 3B8UA 4M5PA 2QJIA 2XM2A 5FAJA 3D47A 1E5NA 2R1LA 2CWNA 3IIZA 5IHSA 3GTXA 3KZSA 3N4FA 4S3JA 4RDYA 4ATLA 3UVAA 2Y6ZA 1BQCA 1FBAA 4R88A 2AGTA 3VIPA 5A8PA 1PVNA 4XKMA 3WF1A 3I68A 4A4AA 1OGGA 4JDYA 3ARRA 2WCAA 1JZ2A 1MMFA 4PULA 1L9WA 4AU0A 1ISZA 8XIAA 2I5QA 4KCVA 3UXLA 1GJWA 1OCJA 3UCCA 3IPWA 1W9BM 2CNCA 3GHTA 3B04A 3DCPA 3N9RA 3TTOA 1KKRA 3ZSTA 1R7OA 3BG3A 3C56A 3BWWA 4IQEA 5EMUA 2AGKA 1D3CA 1M01A 1UG6A 4V2XA 4M6PA 3HQNA 3Q37A 4P7QA 2FZDA 4HNUA 1CW2A 2ON3A 1TPC1 1KCKA 3CUZA 1EX5A 1CTNA 4GQ0A 4FIQA 4C1NA 3VCRA 2Y8UA 3O0KA 4AAJA 2WZIA 2Y8VA 1MNSA 2IS7A 3BICA 2GGHA 3TR9A 3IAQA 3BVJA 4H8HA 4NRSA 3ARVA 4J5NA 2PDYA 2J9YA 3GC5A 1ONEA 4HK7A 5C2GA 4QCEA 1MUCA 1VJIA 5ABGA 2P8BA 4UXDA 3VTRA 4PCPA 4AC1X 3PTMA 1PIFA 1QI5A 4LS1A 1ITUA 4JTCA 1JCTA 5HQEA 4YHEA 4R34A 3BJSA 1NF0A 4CN4A 3K5XA 4GC4A 3CHCA 3HIJA 1UZDA 4R7JA 2IKJA 3KCJA 2Y0FA 1TX0A 1L8PA 2BWGA 2D0GA 3P7YA 2QR6A 3TC6A 3LPPA 3MU7A 5KINA 1XYAA 2VELA 2PDMA 4K8GA 3KDOA 1LUCA 1TPDA 2ZDSA 1VFSA 1S1PA 3NSNA 4AQLA 3UJFA 1ZENA 4FP1A 3VMNA 3WNKA 4YJ5A 2Z28A 2EKCA 1MZHA 3LCWA 3DOPA 4UQAA 4BWLA 4FHAA 4INFA 2ZWZA 1WBHA 4LUJA 1X8FA 3OLGA 1EWEA 4RR4A 3FGCB 4F4RA 3HQ1A 3RX4A 2CERA 3BK0A 1B5TA 1H49A 2YYUA 1RY8A 1KQZA 3QR3A 3F4NA 3H4XA 3LTPA 4I9TA 4AZ6A 3R8RA 1G6CA 1DYSA 3ALGA 1X7IA 3W07A 3W7MA 3W83A 4QROA 3SJNA 1MFUA 3QVQA 4C6CA 4EOUA 4PCSA 4LAUA 3N3TA 4Q7NA 4KRTA 3OHIA 4ICNA 2G95A 3CEUA 5CLTA 1K6WA 2DUXA 4MNJA 1J6OA 3DENA 1VQTA 4C6LA 5IDZA 4UR8A 3BGJA 2H9AB 4JX5A 5AZ0A 1BTCA 1XIJA 1LBMA 3ZMRA 1SPQA 3PZOA 4JTIA 2CETA 5EU9A 1VFFA 1PIGA 1LJYA 3DFHA 3WLRA 4BZYA 4KMQA 2P53A 4CCDA 5K4XA 2PCQA 4ZB2A 3A22A 4EF9A 5G4HC 3DFSA 3GHUA 3VAVA 2VZUA 4K1GA 2VYOA 2NZLA 3GX9A 1Z3NA 3P80A 1JF5A 4HQVA 2VZSA 4UZSA 3UW6A 1JCJA 5EFDA 1NH6A 1BF6A 1YPXA 4MUPA 3CPUA 4ZSUA 1NJJA 2G4FA 4JTJA 3GFXA 1OC6A 4NAFB 4FNQA 2E6AA 2A3BA 2ZVRA 2IXUA 3MVTA 5HQLA 2BHYA 3ARQA 4YLWA 1US3A 3U2OA 2WO5A 3DDMA 2J62A 4IMAA 3THCA 3TMQA 2VFEA 4N4PA 2G37A 4NJHA 4DJDD 4JX6A 4EACA 3DG6A 1MEHA 4NL1A 3EGJA 1P1MA 3MP3A 5LXEA 4CNUA 1UYQA 4M6UA 1IYXA 2OWWA 1QNPA 2PC8A 4EP8C 2CKRA 2FTPA 3WK2A 1VRDA 4D8ZA 2X1RA 3L2MA 2HSAA 3PJWA 3ZM8A 1R46A 2FTWA 4DIAA 3PPFA 3MUAA 3C2OA 3IWPA 1HW6A 3AIVA 4KIEA 1DXIA 4E8GA 2G0WA 3MCNA 5XINA 1DJWA 1ISVA 3DFQA 2HPIA 1WBJA 4R27A 2QAPA 1KBIA 4UR7A 1F4HA 3RMEA 3LGGA 4FK9A 4HNNA 3REQB 3AALA 4IGSA 4JY8A 2WPGA 2XU2A 1C7TA 2PDKA 3VINA 3W25A 3MA8A 2J7GA 1IEIA 4IPLA 5TF0A 3TYZA 3VDAA 1DJQA 3L0GA 4FNSA 1K02A 1GVFA 3NQ7A 3WQ8A 4DUVA 4JHMA 2PEVA 2OEMA 2J8TA 2JKAA 4NUWA 3BC9A 4X9YA 4AWTA 4IP7A 2P0IA 3BV4A 3UERA 1J4EA 4LS0A 1IIHA 2B0MA 3QEZA 4W7VA 3FN9A 4ICCX 3SY5A 2INEA 1S38A 1CB2A 2OWXA 2WHMA 1YYAA 4JHOA 3U6WA 2YBTA 3USZA 4PTWA 1NP2A 3HOJA 1NEYA 4IG2A 4Q4QA 4EIVA 2PLKA 1U5HA 5IRPA 1D2KA 1J01A 1UASA 1TX2A 4FO4A 5A5WA 3SQMA 3RR1A 2V9DA 1E0WA 3AIBA 1CGUA 4QFUA 4OV9A 3HBLA 2ZZ2A 5DMLA 1AQFA 2A7PA 3HPAA 4FA3A 2F9RA 2WXDM 1BXCA 4MOZA 1BWKA 1XC6A 3AZRA 3ZIZA 2X05A 3S3GA 4ERIA 3LOTA 1RQHA 4AWEA 4AIOA 2CLHA 1H2JA 2CLLA 3H7VA 4BY3A 1NM9A 1JG9A 1QBBA 2Q8ZA 1R30A 4GY7A 3RMJA 3SB0A 4B15A 4LS2A 4GOAA 4FXFA 2DZUA 4XD4A 3OQEA 1Y0EA 3CWNA 1TV8A 1TE6A 2P50A 4LVAA 3IGUA 1NDWA 4B5XA 4I6VA 4GGBA 4Y9AA 3W28A 4UCGA 4BKNA 4DVOA 3C3NA 5HR6A 2E9BA 3QMSA 4ML9A 4M51A 4R7OA 5TD4A 4GNVA 4JZ5A 4ZQRA 2AKMA 3LCIA 4UTWA 3BG9A 3B8SA 4NX5A 5CBJA 3WZ0E 3MO4A 8CGTA 1LWIA 4JEJA 3K30A 4AZCA 3FAXA 3P3BA 4DI9A 3SUTA 2ZCGA 3P84A 5CZJA 2BZNA 3W1XA 1PHWA 3SN0A 1H4PA 3EXSA 3HB9A 1JL8A 1IEXA 4TX9A 1UWRA 3BG5A 3AXMA 3TIMA 3WO8A 4LUSB 3EPOA 3MMWA 1CI1A 4NJGA 4LH8A 1EJWC 2D23A 2B81A 5CPQA 1DJNA 3NQ2A 1Q6DA 4LB4A 1KTCA 2EHHA 4YTUA 3TN3A 3WLIA 3MWCA 1GONA 3OZOA 4UTFA 1J0HA 4UTKA 2C7FA 3IJIA 4RNJA 4E2VA 3TOPA 3DYOA 3CZLA 1LRQA 3UR7A 4AWSA 2DQWA 4UOQA 1FCVA 2X1UA 3E0WA 4L1WA 1VBJA 3APGA 4IL0A 3M0ZA 4OVXA 3VKCA 3WH6A 4DF1A 2VXNA 1OEPA 1X6UA 4PTMA 3MYOA 4GYFA 2BY3A 2FZBA 4L56A 4UMAA 3QMRA 1FWBC 1TJ1A 2VZVA 4UMCA 1TPB1 3A5FA 3ANVA 3VMOA 2EF9A 5CC3A 2ZZ4A 1J0KA 3UG3A 4RLIA 1IHIA 5FIPA 3UU0A 4GLEA 4H7VA 4A8IA 5K9XA 5C71A 5GJMA 1F8MA 4IX0A 3ZLGA 1DTUA 3SM0A 3GXPA 3LY0A 4US5D 4HU4A 1NWTA 2YPIA 3IUDA 3BL3A 2OR2A 2NSOA 4UTWC 1ADDA 3EB3A 3RUBL 5BU6A 1UWIA 1PB0A 3O6DA 5CH9A 1QPQA 2FQIA 4WDXA 2C0HA 1X96A 4XVEA 3M0IA 2ISSA 4IP5A 4FSAA 4W89A 1LP6A 3GZ3A 2FHBA 4KWWA 4HHHA 2C71A 3XISA 1LLZA 3HJZA 3VGDA 5M5DA 5DO8A 1XIMA 1XSIA 4WVXA 4BF7A 1E0VA 3AXXA 2QGHA 1ICQA 1J5TA 2GDQA 4H9TA 2NQZA 7REQB 1ZCCA 3FIGA 1NQ6A 8XIMA 4J9JA 5C9ZA 4GWEA 1E72M 5M03A 4DZ5A 1QI0A 3CZGA 2C6QA 5A3HA 1K8ZA 3QYQA 2ZBTA 3AHYA 3PBVA 2Y7GA 1W2VA 2JGQA 1VZWA 3TV8A 2PDLA 2V3EA 1IV8A 5LIXX 3BSGA 3N25A 2ZRZA 2PDGA 4W8BA 3F5LA 5JQ9A 3BAIA 4KWUA 4XZ9A 3SSZA 1LRTA 1W1A1 1JCNA 1M41A 2BY2A 3KX6A 4UIOA 3USBA 1QATA 4BQ2A 4QTGA 2EPOA 1UHVA 1XUUA 4A2SA 4WKFA 3G1AA 4FF7A 1OADA 3RX3A 4UCFA 1AH0A 1FWHC 4WSKA 1OFRA 2BB0A 1Q65A 1H7NA 3QKEA 3VDGA 1WXYA 4Q8VA 3K46A 3UWQA 2J6XA 1XD0A 4RK8A 5D9OA 2INFA 1XI3A 4D6GA 1L6WA 1VKFA 2CHRA 4NAFA 3LEPA 4C6FA 4IISA 1FWTA 2WVVA 4P7RA 2UWFA 1C29A 4GABA 1UWQA 1YKWA 5EBUA 2NX3A 3D5HA 3IJDA 4C6MA 4JTKA 1A3HA 1XRTA 3G2GA 2HEJA 3HG2A 4TQTA 1F4AA 1B2YA 3GDKA 4M1RA 4JFWA 4A8NA 2X2GA 1AK5A 4C6NA 2PLCA 3GNDA 1Z69A 4QGCA 2PDBA 1L2QA 3ARYA 4ZTXA 4HCHA 3QV8A 2BVTA 1R8LA 3DI0A 1TV2A 1OF6A 3TQVA 4H8NA 3WQ4A 4LYKA 3UNDA 4EE9A 5HR7A 3PB2A 1KWKA 4JNYA 1HL9A 1BLIA 1TJ2A 4MAVA 4P8XA 3B40A 1RVGA 4AY8A 2ZRUA 4UFHA 2YYTA 2CLIA 4JCMA 4I6KA 2F6XA 3ENLA 3WEMA 2V3GA 3E0LA 2R1PA 1HJSA 3C0LA 1V3LA 4JQAA 3T08A 2A3EA 5CPTA 4HNLA 4QLLA 5BXTA 5JBDA 5C9XA 2Y5JA 1TCDA 2OODA 1RJQA 2OZ3A 4HPJA 3TNBA 3O05A 1WKYA 4GJIA 2PGEA 4GGHA 1N8FA 3W2NA 2VD9A 5LZLA 3BAXA 1W17A 1XS2A 5BOEA 3S1XA 4BQ3A 3HA1A 2NXIA 5CPSA 5LXXA 3W1UA 2OLSA 4ZA0A 1AQHA 3THDA 3QW3A 4AEEA 3RNDA 2OPJA 1H1NA 2J6VA 1FX6A 4IJCA 1RAKA 2VNCA 2Z7GA 3WF4A 3VOHA 3TA6A 2Z27A 4L1GA 1XDLA 3S2CA 3H4GA 4PN2A 1XH0A 1O66A 3TTYA 4CCZA 1W1TA 2OELA 4ASTA 3UWWA 4DPQA 4N9BA 4XSMA 3LD5A 2EBNA 3I3BA 3GVVA 1SW3A 1CEOA 4N42A 1V08A 2V81A 3VGGA 3GUGA 4HOWA 1Z42A 4AG0A 3CL8A 3L23A 4S3AA 3CUGA 4XZBA 2DT3A 1QK0A 1EYWA 4UTLA 3R11A 2XINA 1JVNA 2WJZA 3G1RA 3H7UA 3G22A 5HK4A 1A47A 1QW9A 2A0NA 3S2LA 1EP3A 4A29A 1H0IA 3IGXA 1KTBA 1KBLA 1O4UA 4GI8A 1WQ5A 3W6MA 4N2YA 3D0CA 4FS9A 1XYFA 3R13A 4HSOA 4NVTA 2PZNA 1BHGA 3KRBA 4LRTA 4NNAA 3T78A 1EJXC 1UR1A 4AZIA 2XFRA 3L4ZA 2WNZA 4J4KA 2C13A 2FDMA 3ZT5A 2AL2B 3KAOA 4P61A 2G41A 1E51A 1PEZA 1Q6EA 2Y7FA 3R0DA 1UKQA 4IGHA 3RM9A 3A24A 3R2GA 3HPSA 4PR4A 1OC7A 8A3HA 6ENLA 3B06A 2VX7A 4M8UA 1JD9A 3HQOA 2NT0A 2YCLA 1UKOA 4B5UA 1UKSA 1TV7A 5ABFA 4LW7A 1V3IA 3IJQA 4TVDA 1H61A 3VI2A 2RUSA 5LGXA 1TPWA 1W1PA 2XIIA 3TKFA 4KCUA 3POHA 1VYSX 2GJXB 4L4MA 4F0SA 2WQDA 4MJ2A 1VIZA 4JX4A 3MHUA 1TB3A 3WNLA 4B5NA 2YA1A 3QQWA 2X09A 4UTJA 3ZO9A 1HTIA 5EMMA 3W7RA 3QC3A 3L4TA 3RPTA 3GAYA 4C6DA 4HU3A 3G77A 2TSYA 1SJBA 3TW6A 2D3NA 1ZJBA 4H9ZA 4LV4A 3EX2A 8TIMA 1UKPA 2E6YA 4HJFA 3GQYA 1R9YA 3LPFA 2HCVA 3DHUA 3GIPA 4F0RA 3OVQA 3W0KA 4IIDA 1MUWA 4DUXA 4HCDA 1OC5A 2EPHA 2HE5A 2ZVIA 5CCZA 1PL9A 5EYWA 4PMRA 1YXDA 1OWQA 7TAAA 5FJUA 3NIYA 1JAKA 2O55A 3B9OA 3WF3A 4GISA 4NNBA 3R89A 4JOMA 4N4QA 4H04A 4OTKA 4DO4A 1IWPA 5K4ZA 1R6WA 2QJMA 6ALDA 2FDSA 1ZJHA 2EXOA 1I75A 1VC4A 5DBTA 2ZX6A 4X0NA 3SUWA 5CPLA 1Q7QA 4GZIA 1H3GA 4NAEB 3LHUA 2W61A 5FD0A 3EEGA