3QMSA

Crystal structure of the mutant t159v,v182a,y206f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIFLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qmsA00
1A50A 3ABQA 4JIPA 1QPQA 3W86A 2CWNA 3DKJA 3W6YA 4LC6A 1ZAIA 3P62A 2V5LA 5TBOA 5DXYA 1I2PA 2GQ9A 3LDVA 4KFNA 2FDSA 1TO3A 5DXXA 1KM2A 2FLIA 3LCGA 3G1AA 4JTJA 5F4XA 1S5WA 2Y85A 1GVQA 1CW2A 1TV5A 3R2GA 3MI2A 3STCA 4OV9A 1ICSA 3C2OA 3PUEA 5LZLA 2HTMA 1WV2A 3MHUA 2A4AA 2YR1A 4XZ9A 3K30A 1V7YA 3W2LA 5LNVA 1FWNA 1H5YA 3NQVA 1KM6A 2C15A 1F73A 3TH6A 1DV7A 3NXFA 4PL2A 3UY8A 3VE9A 4IPJA 5G2HA 4UFKA 3S5YA 2VFEA 1AW5A 4J9JA 3CB8A 4HSOA 4MYAA 3TQVA 4CQ8A 5EMUA 3L0GA 4TIMA 2ATSA 3I65A 3W83A 4L4LA 3FOKA 1ZAHA 3HF3A 4CNOA 3LCHA 4JN6A 1NAL1 1TTQA 2CLIA 2QJIA 1LRNA 1H7NA 3OVPA 1OFOA 2E5CA 2VFHA 1GPWA 4E0CA 3OVQA 3SFKA 3PR2A 5DBUA 4YXGA 2JGYA 3EEGA 3UWVA 1TRIA 4JIQA 3TJLA 2ZBTA 4JYFA 3EB2A 3FKKA 3PS7A 4Z1CA 1TMHA 2GVLA 4UTUA 3O16A 2VXNA 3H54A 3STEA 1HUVA 2B7OA 1A5BA 2FB3A 2XN2A 3GXTA 4UMAA 5F2LA 2DZSA 3GK0A 4DO5A 4MPQA 1IXOA 2ZTKA 3W72A 2ZZ4A 1Z42A 4O8RA 1LOSA 5DCBA 1DORA 3LOTA 1F5ZA 4MYXA 2Q8LA 3EWZA 1IIGA 3C0JA 3W7LA 3PBWA 1J5TA 5EYWA 4ZQCA 5AC7A 3M5XA 1OFQA 2ZZ2A 4K7VA 4LWWA 3PBUA 4YCPA 2YPIA 3HGSA 2VKZG 4X2RA 3LXAA 1SZGA 3TSBA 2G96A 1W8SA 1EPXA 3IGXA 4BI7A 3DAQA 1Y0EA 3TX9A 4EOUA 4JEQA 2EAWA 3ZR4A 3QMSA 4E2BA 1DQWA 4HIBA 3C2VA 2ZZ6A 4JDBA 3P74A 4GC4A 2H3DA 4JYEA 4HNVA 1AMKA 2ZRYA 3KXQA 4GE8A 5HMSA 3PC0A 3BVJA 4R7JA 4RKAA 2QR6A 4H6KA 3MP3A 4LT9A 3KHJA 5HNRA 1A5CA 2A7RA 3P80A 4ZMGA 1MEIA 1O60A 4Z0JA 4JTHA 3TV8A 3EX2A 1JCMP 1MO0A 4K8EA 3R13A 1EP1A 4LRTA 3PVFA 4O1CA 2D73A 4LY8A 4JTSA 4JYDA 2E5BA 3PM6A 3TW7A 4A29A 5LNWA 4TR9A 3G0SA 2OT1A 3UXAA 4AHPA 4RK8A 3N19B 4UTTA 1KW1A 1QMLA 5DBTA 2QEZA 4FNRA 1W5OA 4LOCA 3TAKA 3OG3A 3GAKA 4WXYA 2E09A 1YPIA 2B4GA 3BO9A 3S5OA 1CI1A 3E02A 3FLUA 3N2MA 1GWJA 2YYTA 4K38A 3NQ7A 3LI0A 5KTLA 3GNDA 2BXVA 5HUOA 3KRSA 1Q3NA 2WNZA 1Q6LA 4UTWA 4NX0A 1K7FA 3DU0A 3NL2A 1NFBA 3W7PA 2CZDA 3HB9A 3W3OA 3W2MA 4N4QA 1W37A 4WX2A 2A85A 3LBMA 4K37A 2PC4A 4UR8A 3SR7A 4N2YA 5IM51 1IXPA 2BLEA 5AHLA 3RU6A 1LCOA 3NEVA 4NNAA 2FJKA 5CZTA 5CGQA 5CPLA 3TFXA 1KM0A 1OF8A 2VEPA 4I7VA 4LW7A 1VR6A 1LBFA 3BPWA 4O18A 1S5VA 4TU1A 3SW6A 1VCFA 1SZEA 4Y6GA 1XCFA 4HSNA 3UWUA 5HUPA 2OJPA 2X1SA 2QDGA 4QIUA 3G1DA 3BGGA 1GYNA 4POCA 4MLRA 3TK7A 2V2DA 1DVJA 1T96A 1IXNA 2WSRA 4O13A 1CX9A 4Z1BA 5BRBA 1OF6A 4YL2A 1WOBA 3MP5A 3MYPA 2BZNA 4FXRA 5EPDA 3F03K 3RLVA 1NVMA 5G1TA 3NQFA 3NDOA 2GOUA 5F2IA 3CLMA 1WQ5A 1XFBA 2DZPA 4TO8A 5J5RA 1EB3A 1TSIA 4OHQA 1H7WA 2W79A 2CZEA 2FPVA 2DU2A 2FIQA 3EX4A 5F1VA 4RX0A 1P0NA 4MFEA 2V0TA 3B8DA 4O16A 3E12A 4PTNA 5D2XA 4GFSA 4NJKA 1RR2A 4QNEA 4O1DA 5KZEA 4Q32A 5G4EA 3N14A 2KZHA 1VHCA 4A22A 1R47A 3CPRA 1ME9A 4XWUA 1SPQA 3L65A 3QYQA 4MUZA 4ZQPA 4YWIA 5HWNA 4CNNA 3NQAA 4ZQMA 1LYXA 3W7NA 3TE9A 5G2WA 3UPBA 1SU5A 1BTMA 4JY9A 1L6WA 4IUOA 1S5TA 2CLKA 4DPPA 1Q45A 4UNKA 4K7YA 1ME7A 2E68A 5CZSA 3QF0A 4IMCA 3M5ZA 5FF2A 1HO1A 3GVGA 1YXYA 5FF0A 1QFEA 1HG3A 1TQJA 1EUAA 1R2RA 3W1NA 1PCWA 2QCDA 3UZJA 4ADUA 4NQ1A 4QAIA 4CCEA 1ZJIA 3MHGA 4O1BA 2QCLA 4YCOA 2YZRA 3DHFA 2NXHA 1KM5A 2CU0A 4DELA 2ZCGA 2ZRVA 3KX6A 3T7VA 3M16A 4BI6A 4O53A 5GVJA 4ZQOA 2VFDA 3DXIA 2HMCA 2QAPA 1HFBA 2WV8A 3GR8A 3OEXA 5C55A 5LKYA 3D0CA 1FWWA 1KFCA 1EWEA 1XUUA 3OIXA 3VI2A 5LGZA 2OZ0A 1JCNA 3MI3A 1X6UA 3LGEA 3TFCA 4A3UA 3TCEA 2X1UA 1ADOA 3B03A 3EKLA 5I3HA 1H60A 3S1UA 1JCYA 2Z2UA 3V75A 3F1QA 3LHVA 2CLEA 1DL3A 2E5DA 4MZ8A 4HNTA 1XL9A 3DFNA 3HQ1A 3GDRA 4ZQRA 4JS3A 3W1TA 3C2EA 4WXZA 1XKYA 5BNKA 1M5WA 1R2TA 5BMXA 1VPXA 4O15A 4OV4A 5FEXA 2YCEA 1TPH1 2VENA 5TIMA 3R12A 1JRBA 3PB2A 4LUJA 1I4NA 3DHDA 3P67A 3W7EA 2GQ8A 3TJXA 3ABOA 2QCMA 4ML9A 5CPOA 3TC7A 1FY6A 2Y88A 3IIPA 5G4WA 3W70A 1WBJA 1DBTA 4UFJA 3GB6A 3NQDA 5F4WA 4MLJA 4A2RA 2BWGA 5BMWA 4FNUA 3NQMA 3O05A 4WJEA 1WOAA 3L2IA 4OGZA 1JCJA 5I3JA 1VCVA 1PIIA 2DZTA 4N6FA 1TTJA 5BW6A 3MO7A 4OE7A 3W71A 3PBYA 1AW1A 3PUOA 3NG3A 3NYZA 2G95A 4JTIA 1IIHA 2VEIA 1YYAA 4GUFA 3BW2A 1KFJA 3TW6A 3HMJG 1G6CA 3SY5A 1RQHA 1EIXA 4LRSA 4ZQNA 3OA3A 4XTDA 1OFBA 2J88A 3NL6A 4OQVA 4RXFA 2QUTA 5DLCA 2C18A 3TQ0A 1HTIA 1A5AA 1LORA 4LTSA 3TMLA 3S1WA 1JUEA 4ALDA 4N4PA 3N34A 1SFJA 4O14A 3OVRA 3W7GA 3NNTA 4GUHA 3KVLA 1OJXA 2ZFAA 2RFGA 1EP2A 4NZFA 5HINA 3NOEA 4FX6M 4UNLA 2CLHA 3MW7A 5LHFA 3NZRA 4O10A 4BFAA 3E0IA 3L9CA 4RCXA 4AHOA 1SO4A 1UCWA 4IJBA 1S3HA 4S1FA 3QMRA 3KRUA 1KLYA 4UMBA 3NM3A 2DORA 3QSTA 1KBIA 3G1HA 1KTNA 1TJRA 4Z08A 4RLIA 1P4CA 3GZ3A 1HL2A 2Y70A 3CQ0A 4IQLA 4H3DA 4UFIA 2ZRZA 5AHMA 5ABTA 1QAPA 3QM3A 3GYEA 3HJZA 2H8ZA 4LC8A 3G24A 3HGOA 4BI5A 3EXRA 1DKWA 4AB4A 3DKLA 5L6UA 3LRLA 4EF9A 3EWBX 4O11A 1YXDA 4JD4A 3NL5A 4WOZA 4GWEA 4R33A 5FEWA 2J24A 1OX5A 3P60A 2DZWA 2QJGA 3W73A 4KFPA 2FFCA 3QW4B 3LHUA 5J5DA 3CWNA 1KM3A 3MMTA 2FTPA 1JUKA 3IIZA 1WXJA 5C2XA 3BW3A 4NNBA 4A2SA 4MJZA 4TMBA 2ZZ3A 1JJKA 1LOQA 2FPYA 4I7WA 1O5KA 4XKYB 3W1QA 2OX1A 3MBDA 1TCDA 3NR0A 1E51A 3N2XA 5LNUA 4NJIA 1KA9F 3UWWA 5EY5A 2RDTA 1KBJA 2R94A 4LUIA 1I45A 3GDMA 3TQKA 4QJ1A 2Y62A 4UTHA 1VH7A 3BV4A 3LCIA 1LP6A 2NZLA 3SZ8A 3QPZA 3HG4A 2C1HA 4JDYA 2V30A 1M6JA 3EXTA 1VYRA 4N9BA 3JR2A 2AQWA 4M7SA 3LV5A 4PCFA 4JTKA 4FNQA 4NZJA 3DGRA 1B9BA 4DBEA 4B5NA 1VLIA 4Q33A 3W7MA 3PBVA 1SW3A 3LLFA 3A5FA 4I7UA 2G5WA 1DOSA 2B7QA 1GYLA 1K02A 1G7UA 5EKYA 4JTEA 1SQ7A 4GJ1A 3W2NA 4RJEA 1K03A 3NQEA 5D32A 2P0OA 3OBKA 1TYGA 2QCHA 1O4UA 2Y7GA 4BF9A 3S1VA 3IV3A 3P5YA 2Y7EA 2XFWA 2TMDA 4DQWA 4P2VA 1WBHA 2LLEA 1N7KA 1OFRA 3ZWSA 4YMZA 1MXSA 1SSGA 1H7RA 3BG9A 1SO3A 3ZS4A 3S9YA 3TDFA 1I2OA 3CEUA 4DF2A 4WY0F 5K2ZA 3THAA 1G4EA 3QH2A 1Q6RA 1X1ZA 1FXQA 5AHFA 5CSRA 3C2RA 3E49A 5DY2A 4IWWA 5MHBA 1QWGA 2WKJA 5I3GA 1D3GA 5AC8A 5K9CA 3W2UA 1SR9A 2NXIA 3N3MA 1J2WA 4ZZ9A 3DFSA 3PY2A 1VZWA 4Y8FA 3O07A 4QSHA 1JCXA 1OX4A 3W7OA 3QRHA 1AW2A 5D03A 4BWLA 1LM1A 1U83A 3W1RA 2J6XA 3E96A 4CCCA 3T44A 4RZ4A 4MOZA 5KSWA 3Q2DA 2NX1A 5FF4A 1QOQA 1FCBA 1KTCA 1EA0A 3GR7A 4NJJA 4JY8A 2VOMA 4GRSA 4PODA 4EWND 3KVMA 3B0PA 3M6YA 2RH9A 3U6WA 3M1ZA 3NPVA 3MWAA 5I3KA 1LTDA 1WX0A 1RVGA 1B3OA 2Z6IA 5AYYA 2ZZ7A 1G4TA 1KM4A 3S5ZA 4AF0B 2OT0A 4WY0B 4O12A 3S5NA 1KV5A 2YDAA 5D2WA 3CT7A 5IBXC 3VNDA 3LM7A 1FCVA 2C14A 4I9AA 1R2SA 2B0MA 4UTIA 2QCFA 2TRSA 2YGYA 3G8RA 3STGA 4DPQA 5SWUA 1M7PA 3TMQA 4JTFA 1LLZA 3QJAA 1B4EA 2ZQ0A 3C2FA 3G1VA 1UUOA 3W9ZA 1GZGA 2QAFA 4O57A 3TA6A 4AEOA 1I2RA 2HSAA 4RZ6A 3WK1A 1IXQA 1YDOA 3B05A 3LRKA 2TYSA 3LHZA 3KOFA 3S6DA 2CZFA 4AH7A 2V2CA 2NUYA 2R14A 3GDTA 3LCLA 1LROA 3N9RA 1G7VA 3BARA 1YXCA 1PE1A 2VELA 2W0UA 3O15A 2Q8ZA 3FKRA 4GBUA 4NU7A 2ZA2A 2X30A 3WK0A 3G18A 3HPXA 4MIMA 3QEZA 3NGJA 1OVDA 1TB3A 1W3TA 2NUWA 1K7EA 4LS0A 1QPOA 4ONVA 4LVFA 3W7JA 1OG0A 1H7XA 4X22A 1TRDA 2EHHA 1KFKA 3DFQA 1TV7A 3VCRA 3G22A 2C6QA 1ZY9A 1T0OA 3LCXA 1KFEA 1OYAA 3C4UA 4CCDA 5CKSA 3FS2A 3H53A 3UY7A 1G67A 4KKXA 4IMGA 2DZVA 3P8IA 4EVZA 2WSQA 3GLCA 1OHLA 1U5JA 4HNNA 1VJIA 3T4CA 4OT7A 4HN4A 2NLIA 4FO4A 3NQ2A 3O6DA 4U4MA 4NXSA 1FCUA 3L5LA 2C19A 3M9YA 3UPWA 1ZALA 2B7NA 3L5AA 1C29A 4HT3A 1ZNNA 1F05A 4N9DA 5DCDA 2ABAA 1TREA 5FF7A 2QCEA 1ML1A 2H6RA 4EIVA 5AB3A 1R30A 3W7HA 3W23A 3P8JA 3UWZA 4JTUA 4FNPA 3SGZA 3LLDA 3DH7A 5KITA 4MZ1A 3G1XA 5HWJA 3CM4A 1OFDA 1H1YA 5CPNA 1YTEA 3A24A 4FIQA 4FB7A 3CU2A 5E0KA 1JULA 1NF7A 1MEHA 1RV8A 4AVFA 3G1SA 1MZHA 1XDMA 3C56A 3O06A 4JX4A 2YFNA 4KFOA 4LV4A 1C8VA 3UXDA 1L6YA 4TMCA 1VS1A 1W56A 5AOUA 2HS8A 1JQXA 4XQ6A 1W31A 3FIGA 1BWKA 4Q4KA 3NQ8A 1Z41A 2Z1BA 5HR6A 4E38A 3W75A 1N8FA 1LLWA 2Y7DA 4W9TA 4RXGA 1TTIA 1TPUA 2EGZA 1JR1A 2R8WA 3KVKA 3M5YA 1X1OA 5LGXA 1T99A 2NWSA 1DQXA 2A21A 3INPA 4O4WA 5EBUA 3S0CA 3W7KA 2DJLA 2A7NA 4DO4A 3EX6A 1OYBA 2O7SA 1W5MA 1G69A 4AMAA 2YX0A 1FWSA 2E6FA 2OCZA 3ZWTA 3CC1A 4Y9AA 1ME8A 2WJZA 4M6VA 2UV8G 3MI6A 3T78A 4R34A 2Z6JA 3PULA 3Q37A 3MHFA 1W0MA 4DBDA 2FB2A 5FESA 4IGHA 3W7DA 5HR7A 4R53A 3DFPA 2WQPA 5DY3A 1F2JA 4O28A 2E77A 3G1YA 4AHQA 3T55A 1NEYA 3M47A 2RKXA 1LBLA 2G97A 3O63A 3L66A 3HGRA 3WK3A 2J9YA 5D2VA 4JXCA 2A2IA 1ALDA 4O4VA 5K9DA 1YDNA 3P7YA 1ICQA 3G8EA 3S42A 1GTHA 1TTPA 3ATYA 3LX9A 2YSWA 1SW0A 3PG8A 4NX5A 3LTSA 4OWGA 2QUVA 1PVNA 2BTMA 3GKFA 1OX4B 3M7WA 2VFFA 1MSSA 4Z0SA 4LNYA 4S2BA 1WAUA 3W22A 1ZENA 4OU1A 4K6AA 3GNNA 1F7BA 1QCWA 3JS3A 2GUUA 4UFHA 5D05A 4HPXA 1QO5A 3I7QA 5CPMA 1GG1A 2JGQA 2V82A 5G1YA 3A5VA 4BWLC 1D3HA 1NSJA 1UJPA 3SI9A 1R46A 3M43A 1QPNA 3M41A 2WPBA 3PSVA 4M6PA 5D2YA 2J27A 3CHVA 2PRHA 3OHIA 1I2NA 2A1YA 1P1XA 3W1AA 1JQVA 1YLVA 3RLUA 2RDWA 5D02A 3RF9A 1FDZA 4FF7A 1VCGA 3LCWA 4UTTC 1F76A 6TIMA 3EX3A 4HNUA 5D30A 2E6YA 5AN7A 4FNSA 3YPIA 5F2MA 4LVDA 3W7IA 3NO5A 3EWXA 2C0AA 5FEZA 2DP3A 3BGJA 4MFDA 4NUWA 5TQLA 4NJGA 3C8FA 3WJYA 3T40A 1TQXA 5D33A 1UB3A 3EKZA 2ZRUA 1RD5A 3A23A 3HG2A 3DZ1A 2NV2A 4XUGA 5DN1A 2H3BA 2Y6ZA 3LTYA 4UMCA 4HHPA 4MKNA 3QQ0A 4UTWC 4JTGA 2QUUA 4BK9A 1GVOA 4AWSA 1YPFA 1KTBA 1YDVA 2QCNA 4O1AA 2VFIA 1KM1A 3W88A 1QPRA 3WJZA 3FYPA 3EWUA 1LBMA 1VYPX 5AFDA 4O0KA 3B4UA 3NM1A 2GJNA 5CG7A 2B7PA 3C6CA 1W3NA 3NQ6A 3NPUA 3WJXA 1SSDA 2A0NA 2CLOA 1TPFA 3W2KA 4X9SA 3IEBA 3I7RA 2WNNA 1W1ZA 3HIJA 4ORIA 5L9FA 1TPC1 4UTKA 2JBMA 2V2HA 2GVGA 4QISA 3DFOA 4MZYA 3THQA 1XBXA 3QQ1A 3HBLA 4S2CA 1XM3A 2WSYA 5C5YA 2DJXA 1OFPA 2V9DA 1UASA 1B57A 1PHWA 3AO0A 1F6PA 4QQ3A 2FQIA 2WO5A 1PHQA 3W7QA 3KAOA 4U28A 3UYCA 3PAJA 2JKAA 1VYSX 2WOQA 4LVGA 1FBAA 2I14A 3W1UA 3BK0A 1UBSA 5EL1A 1LZOA 5H2ZA 1Q6QA 1OK4A 1FX6A 2A7PA 3B04A 1K7XA 1G4SA 4LU0A 5H91A 4CQ9A 1YTKA 3SSJA 1PS9A 3L5MA 4XBKA 1ZHAA 3LTPA 4JX5A 5CZJA 3WJWA 3NVTA 1XI3A 4O54A 2PURA 5C54A 3QC3A 1EWDA 4NJHA 1LDCA 3G1FA 1W5NA 3ZFHA 3N9SA 4MVAA 2JKPA 3NQGA 3A22A 5K4ZA 2YW4A 3PWAA 2ISWA 3S8HA 5F4SA 3NL3A 2J9XA 3CEPA 1AL7A 1KV8A 3LBCA 5G2IA 3LCFA 3MYOA 3PF3A 3LI1A 4H4IA 2QCDB 1TPWA 3BG3A 3FFSA 3R8RA 1HO4A 3LERA 1TIMA 4MJMA 3WJSA 1J4EA 1W5QA 1EEPA 3LV6A 2V8ZA 1KLZA 1DJNA 3QZEA 5AC6A 2ZA3A 3TROA 2NX3A 3L0KA 1F6KA 4ORMA 1SUXA 1QOPA 3RNDA 1OFEA 1TPDA 2F84A 3G0XA 1ICPA 3I7SA 4N02A 4UR7A 3BLIA 1GJPA 1EUNA 1SZFA 3FEMA 3G3DA 5I3IA 5AHIA 1VHNA 1GTEA 3W87A 3UNDA 3B0UX 4DO6A 5DELA 4IMEA 2X1RA 4MY8A 4K36A 5F2GA 2VEKA 3W84A 3BG5A 2A5HA 2ABBA 2YYUA 4UCGA 4A21A 2F7FA 3LHTA 3L21A 3LXCA 5C6MA 1C9DA 1B4KA 1DHPA 3MP4A 1WA3A 5D04C 3CTLA 3STFA 1IGSA 2YXGA 3BW4A 3MBFA 1SFLA 3Q94A 1VGAA 3PUDA 1V5XA 3ABSA 3HPSA 3WK2A 4FXSA 3USBA 5FF3A 4ADSA 5KZMA 3I6RA 2QJHA 4DEFA 5HULA 1JCLA 2Q3OA 4LS2A 3IIXA 2VEMA 3P61A 4O52A 1O95A 1SO5A 4PH6A 4K39A 1AG1O 1H61A 1LRQA 2GQAA 2QF7A 4WD0A 4LVAA 3TSDA 1X7FA 1QO2A 1XDLA 2CLMA 4GNJA 3F4WA 3HG5A 3GAYA 1XBYA 4PA8A 1W3IA 4FHAA 4FX8A 1JVNA 5AYXA 4N9CA 1FWTA 4PEKA 4C1LA 1TPB1 3VE7A 3UWYA 2ALDA 2I9EA 3GXNA 5KMYA 1F74A 3O6YX 2ZZ5A 3GXPA 2ZZ1A 2CFFA 4JTLA 2QKFA 4JGDA 3LHWA 2NWRA 1QNVA 3RFAA 3DENA 4MY1A 1XXXA 1FUYA 3B0VC 1T8XA 1FDJA 3GDLA 4LVBA 5U4NA 1K8ZA 3IVUA 1LRTA 2DZXA 3QW3A 5D38A 4UXDA 3N73A 5I3FA 4ICNA 4UTMA 1LOLA 2W6RA 4FEZA 1NF0A 1TPVA 3HPZA 3U2OA 5HJLA 2PE4A 2Y63A 2VFGA 2Z0IA 2PRLA 2E1DA 4TX9A 3ELFA 5A5WA 2CLLA 3CIWA 5K4XA 1L9WA 2YFOA 1GG0A 1PL9A 1ONRA 1XBVA 4IX2A 2ZTJA 3NPWA 4L4MA 3BLEA 4M5PA 5U7SA 1EX5A 2DZUA 3I68A 5T26A 2Y7FA 4XTIA 5AYZA 3SJ3A 1TJPA 3C3NA 1D9EA 4JTTA 1Z44A 3NPXA 4M6QA 1WDWA 1PV8A 1M7OA 2ZYFA 1H7OA 4UC5A 5CSSA 2E6AA 1RQEA 1OABA 3GIYA 4QITA 3DI1A 3HG3A 3IVSA 5K9XA 4AWUA 3H55A 1WYIA 2XN0A 3IIVA 2C13A 1K8YA 4WUIA 1W5PA 1BKSA 3ABRA 4PC8A 2EPHA 4NVTA 1UUMA 2R91A 5BOOA 4UFLA 4DXVA 4HKPA 4NNCA 1X8FA 3M44A 3U8GA 4BR1A 3A9IA 4PL1A 3QFEA 3UD6A 3P82A 1RZMA 3E9AA 1IF2A 2X16A 3L68A 2EKCA 4GXMA 2PCQA 4K8HA 1QDSA 4AXKA 2BX7A 1AL8A 4XKYA 2X1TA 3Q58A 4Z1AA 2RDUA 4UIOA 3KFTA 3FYOA 4M19A 1H62A 4E2DA 5D09A 3W76A 1P0KA 3P81A 5LNRA 8TIMA 4O17A 4IPIA 3FJLA 3FJ6A 1THFD 5AHNA 4Z1DA 1FDYA 2Y89A 1TPEA 1A5SA 1VRDA 1XUZA 1PCKA 2CLFA 2EF9A 2C16A 5E93A 4LS1A 2TPSA 4YLWA 2ZRWA 4FIRA 2ISSA 1GVFA 3EWYA 4WOQA 3VFLA 5FEPA 3FA5A 4IXXA 3LB0A 5HQEA 4N6EA 2O7QA 3TIMA 1H51A 4CNPA 4JX6A 2V81A 3IGUA 2J9ZA 3R5EA 5AHEA 5LSMA 1MEWA 1AK5A 5FI8A 5A8GA 3F4NA 1A53A 3A21A 4CQAA 2V5BA 3RMJA 3HO8A 4GUGA 1ZCOA 5K3VA 1GVSA 3SGUA 3B06A 4JNMA 2P10A 4IMDA 3GDKA 4UUIA 3L67A 2ZRXA 2TSYA 3HOJA 3MUXA 4QM1A 2AGKA 4ADTA 3C61A 3O6CA 1O94A 1GT8A 3IIOA 3C52A 2XN1A 1OFAA 1FWRA 4KWVA 4LV9A 1FCQA 4ZVJA 4IMFA 4M7TA 4UTLA 5F1UA 3VKJA 1SZNA 4RZ5A 4UFMA 3W1PA 1GQNA 3EWWA 3P5ZA 4NT0A 1FXPA 3V1PA 1RQBA 3EXSA 4QNWA 3WFAA 3GX9A 2C3ZA 3QSRA 2IQTA 1VC4A 3G3MA 3M0ZA 3UWQA 3IGSA 5KZDA 2BSLA 4IXHA 3CIXA 3W1MA 1K3UA 3W85A 1H50A 3O8AA 1KFBA 4G1KA 2A6NA 3TC6A 3HGJA 5HWMA 4Y96A 2E6DA 1N55A 2RHGA 6ALDA 3BLFA 1FQ0A 3PSWA 3UQNA 2ATMA 2CW6A 3MJYA 3W1XA 3JRKA 1RPXA 3KRZA 2HS6A 3G0UA 3RK8A 5LHEA 3UZ5A 3W07A 4IX0A 4EF8A 1BWLA 5K7JA 2FPTA 3QPYA 2Q3RA 1I2QA 4N9EA 3IRDA 4X3ZA 5IBXA 3QMTA 5CZ0A 3W1LA 3LXBA 4O50A 4IOTA 1ZAJA 4JICA 4ZL1A 1VLWA 4FNTA 4AF0A 4WY0A 3TAOA 4WQ6A 3PB0A 2OMAA 1L2UA 3ATZA 4AWTA 1SW7A 1XC4A 4RV8A 4DF1A 1SO6A 3NQCA 4JR5A 4RR4A 3TUUA 2QCGA 4HPJA 4O19A 4PFMA 2YW3A 4Y90A 3W7RA 3TU9A 2X2GA 2QCCA 2AAMA 2GJLA 1H7PA 5E1QA 4MY9A 2I1OA 3TXVA 2VC6A 1EP3A 1Q6OA 2P1FA 4WZHA 4D2JA 3NA8A 3TXZA 3DI0A 3PG9A 1GEQA 3AJXA 7TIMA 2ZA1A 1YADA 4O0ZA 5LNSA 1L6SA 1JRCA 4C1KA 3TSMA 3W2JA 5EA9A 3GKAA 4UTJA 3IVTA 1JUBA 1I8JA 3R89A 1GVRA 1TV8A 4OBTA 3NZ1A 3M5VA 2GPTA 1H63A 5D2TA 1H1ZA 3DFTA 4XBSA 3O1NA 1K8XA 2Y61A 2A6LA 4AAJA 1BEUA 3TNOA 1OK6A 3LRMA 2H90A 2NX9A 2ISVA 1DJQA 3TKFA 3SIZA 1QR7A 1OX6A 3CWOX 5G5IA 2CZ5A 3S1XA 3P84A 5D37A 3ANYA 2QDHA 2JK2A 2ZDRA 2JKEA 5KINA 1Z48A 1KFLA 4GUJA 4CLMA 3DBPA 4KWWA 5DCEA 3NAVA 2NV1A 4P61A 3KVJA 4GUIA 2GVJA 2NXGA 1GOXA 1ZFJA 4DF0A 1VQTA 1W54A 1OYCA 4FX7A 2PRMA 1G4PA 1P5BA 1O5XA 1XBZA 3EX1A 3W7CA 3LHYA 3SECA 3W74A 2NUXA 2H8XA 2WNQA 3TR2A 4NXKA 3L0NA 1YTDA
chains in the Genus database with same CATH superfamily
1B90A 3FDGA 3QV7A 5I07A 1YRRA 4JIPA 3W86A 5DT7A 3RJXA 2CWNA 1ZAIA 2PWDA 5DXYA 2Y5EA 3QTGA 1TO3A 2EG8A 1KM2A 1EA9C 4JTJA 5F4XA 3ITLA 1GVQA 1DWFM 1TV5A 4P7RA 4O1FA 4BEUA 3PTQA 2GDVA 1RVKA 1WV2A 2YR1A 4QQUA 4HMDA 1ZP3A 3W2LA 3AS1A 4PCTA 4MB1A 1T6MA 1K6WA 1DV7A 1QHPA 3E38A 4Q7NA 4B5SA 2GFTA 3U4AA 4S38A 3R0KA 2O56A 5JU6A 3S5YA 2VRJA 3GTHA 1AW5A 2WM0A 4HN8A 4MYAA 5EMUA 2WMGA 1P6CA 3LCHA 1EJSC 4ZB0A 4ACZB 2PLKA 2A3BA 2PGFA 3L4ZA 3VD3A 1E9ZB 1OFOA 5D4YA 4JFTA 1W3JA 3EMQA 3OVQA 4YXGA 2JGYA 5DFAA 4JIQA 1B54A 1HGYA 3FKKA 2PDWA 3B8WA 4Y9OA 3ITOA 3PBMA 3VD7A 3H54A 1A5BA 2SFPA 2FB3A 1UD5A 3V3WA 2W3ZA 3GXTA 3HPAA 4C6PA 4B90A 2ZZ4A 1Z42A 2BASA 5DCBA 4KEZA 1F5ZA 4NAFA 1E3ZA 1IIGA 3W7LA 1AJ0A 4J3TA 4YTSA 4ZR8A 3PBWA 1J5TA 3BOLA 3N9KA 3W6MA 3WN6A 3M5XA 2ZZ2A 4DBWA 2BODX 2IPFA 3W28A 2VKZG 4X2RA 3RX2A 4DWSA 3WQVA 3ZQ9A 3ZSSA 1Y0EA 4EOUA 1OC7A 5C9UA 2W92A 3ZR4A 4WSKA 4X9YA 4HIBA 4JDBA 1RSCA 3P74A 1MYRA 3IJ8A 2V6AA 3KXQA 4HPGA 5HMSA 4HNVA 4ERGA 2XIJA 4M1RA 3UEQA 1E0WA 3GG8A 4NHVA 3BVJA 2XFRA 4R7JA 2QR6A 1DYSA 4UQCA 1UC5A 3KHJA 1A5CA 3VOIA 4ZMGA 1MEIA 1W3KA 4MUPA 4RDYA 3CPUA 1NP2A 1TR1A 4LY8A 3QGAC 1MUMA 1VBUA 1M9HA 3G0SA 4YTRA 3KBNA 1KW1A 2XM2A 4ZOAA 3SURA 3JVAA 4ERIA 2QEZA 3VGEA 3TAKA 6A3HA 1RXOB 1M3UA 2XVPA 1EJRC 3OG3A 2ACRA 4WXYA 2B4GA 2CBUA 3FLUA 3N2MA 1GWJA 3TCSA 5KTLA 5E70A 5HUOA 3PPCA 1TX2A 3KL3A 4UTWA 1X38A 3DU0A 2VJXA 1QRQA 3WLIA 3A64A 2Z1VA 1MZRA 2CZDA 3W2MA 2IQ0A 4N4QA 5DMMA 3LBMA 4UR8A 3SR7A 3ZVHA 4RPPA 1C3FA 5EMLA 3N3TA 1ITUA 3N25A 3T2QA 3NEVA 4NNAA 2FJKA 5CGQA 3CJPA 3GD6A 5CPLA 5B80A 3LG3A 1L8PA 1OF8A 3BE7A 3UW6A 4O18A 1S5VA 3SW6A 1XCFA 3UWUA 3TN4A 1JF6A 5HUPA 2X1SA 1PZ1A 1X96A 3BGGA 3VXGA 3TK7A 4FPSA 1UWAA 1ODZA 2V68A 1T96A 1IXNA 1CDGA 3RM9A 3M0KA 1UR2A 4H6EA 5BRBA 3WNLA 1OF6A 1KXHA 3TLQA 3SRHA 3GVWA 5JH1A 4MDPA 3UBPC 4GYJA 1GJUA 3NDOA 1W9BM 4F0LA 2RUSA 2PP0A 2INFA 3N4AA 4LB4A 4L64A 5BYWA 3ERPA 5CGMA 5CG0A 3LPFA 2OXNA 2FIQA 5F1VA 3WF3A 1X6NA 4RX0A 3H4WA 1WB0A 2O9RA 3CO8A 2VEFA 4O16A 2CERA 4Q4RA 4PTNA 3MKCA 2J4GA 4PRWA 4C6BA 5CEWA 4O1DA 4M29A 4EPBC 2KZHA 1VHCA 1PKNA 4ZQPA 3TQPA 3CUZA 4OTKA 1BTMA 3AIBA 1EJWC 3C86A 1Y7VA 2JIWA 4K7YA 3AXIA 4M80A 4Z2KA 2DH3A 1BFNA 3QF0A 3VOCA 3M5ZA 1HO1A 4J3SA 4H9ZA 2GJRA 1MNSA 3E5PA 1HG3A 1RK6A 4J27A 3AHXA 2XH0A 3H4XA 2Z26A 5JH2A 4ADUA 3FVDA 4O1BA 5E0FA 2XHYA 2OEKA 1CGUA 4EKJA 1EO7A 2ZRVA 3T7VA 3M16A 4KWOA 2QAPA 3GR8A 2XPKA 1KRAC 5LKYA 1E6PA 1BYDA 1FWWA 1KFCA 4EXQA 3VI2A 3MI3A 1AQ0A 1X7IA 2Y2WA 2O92A 5HNNA 1X6UA 3LGEA 1W6TA 3GNOA 4Q7IA 3LLXA 3S1UA 4U10A 2J7EA 2Z2UA 3DG6A 3SCOA 3OLEA 2HXUA 4PUMA 2XYLA 3U48A 4HNTA 2ZOXA 3DFNA 5E6ZA 4AY8A 2WLYA 4ZQRA 3KBWA 4O15A 4OV4A 1BGAA 1ENUA 2VENA 5GJNA 3RM8A 3AS3A 3DFYA 1JRBA 3PB2A 4R88A 4MSSA 3DHDA 4U5KA 3EA3A 1BLIA 3THUA 3TJXA 3ABOA 4S3CA 1JFHA 1Q2SA 1FY6A 1LG2A 1LT7A 4HNLA 2PGEA 4HHMA 4GZJA 4DXXA 3W70A 3UVAA 2V67A 3RJYA 1HX0A 3GB6A 3NQDA 4Z2JA 3W81A 3IJDA 4C6KA 2WKLA 1FTXA 1VAHA 4B3LA 4NYUA 3O05A 2VGIA 4WJEA 4AZCA 4OECA 5F7UA 2PDUA 1QBBA 3LEPA 2ZXQA 4OE7A 1K9FA 1XGEA 1HKIA 1TR9A 4M3PA 3AZSA 1POKA 1F4AA 2HE8A 4JTIA 2VEIA 3JW7A 3BW2A 3VZXA 2OSWA 2W91A 3IRSA 3B8VA 4ZQNA 1EIXA 4LRSA 2PDHA 3OA3A 3QPEA 3E2SA 5DLCA 1J12A 3LENA 1LORA 3CQIA 1FWCC 1ISVA 3CTTA 3XINA 3WLTA 5FCZA 4C5ZA 4HYVA 1P6BA 4PRRA 1XIHA 4NYYA 1XQLA 4NZFA 3EDKA 1UR3M 4JL2A 2G50A 5LHFA 3NZRA 3VPLA 3L9CA 1SO4A 4Q4OA 1UCWA 4IGSA 1S3HA 3A6OA 3FAXA 1JGMA 2Y0FA 1KLYA 1NOFA 4UMBA 5HXMA 4PE8A 4MWAD 3GTFA 1DTNA 4PSPA 4QS5A 1E0VA 4LEFA 5G4HC 3CV2A 2I5QA 2X8RA 4OOUA 4IQLA 3G2GA 4H3DA 2ZRZA 4G1NA 4YHEA 1QAPA 3QM3A 3GYEA 3HJZA 3ANVA 3MV11 3G24A 4AUBA 4IFKA 1KR1A 4LBUA 4EF9A 3EWBX 1YHTA 3NL5A 4ZGYA 4WOZA 2WCGA 3OO2A 5DX7A 1ZUAX 2VC5A 2C8NA 1RK5A 1HZYA 1ZL1A 3SIMA 3IUIA 4I9JA 3WQ8A 3LHUA 1LG1A 3DERA 3CWNA 1R86A 3KBMA 3MMTA 3SUVA 1U5HA 4NNBA 4E4FA 1TELA 1WZAA 3U3HA 2OX1A 1A0CA 1TCDA 3NR0A 5FJOA 3N2XA 4HNCA 1LUCA 1KA9F 5EY5A 1YNYA 4LUIA 2CKSA 1G9HA 3ITVA 1I45A 3FSTA 3TQKA 4UTHA 3BV4A 1EF2A 4LUTA 1UYQA 3FDKA 3HG4A 1P1MA 1FFQA 3EXTA 1GQJA 4L1GA 4M7SA 3W26A 2CC0A 2DZAA 1TE6A 3MZNA 4DBEA 4B5NA 3CV6A 1E73M 3R4IA 3MMUA 3HV9A 1TIWA 3LLFA 3A5FA 2G5WA 2B7QA 2XH2A 5EKYA 1J9YA 4JTEA 3WDPP 4US5A 2WK2A 1R7OA 3IV3A 2XFWA 4P2VA 3H2AA 5D8ZA 2F61A 1VPQA 1OFRA 4YMZA 1SSGA 4DJFC 3TDFA 2DSVA 3GXFA 4AVNA 1G4EA 3QH2A 3TOYA 3CAWA 4FOJA 1D8WA 3ONCA 1YQ2A 3GFZA 2WKJA 4Q6JA 1XYZA 3FK4A 2I9UA 3R7MA 2DSZA 1XLGA 1WDSA 4ZZ9A 4KEUA 4Y8FA 3NVDA 4XIAA 4QSHA 1E1FA 1PX8A 1F61A 4X63A 3UPMA 3QRHA 5E09A 1AW2A 3UJEA 5D03A 3VNMA 4BWLA 2EKGA 3K46A 4CCCA 2BVWA 4RZ4A 4LX4A 4AZ6A 2HBVA 1KBKA 2DPEA 1HJSA 2UY5A 2XGIA 2ZC8A 2OVLA 3V7PA 4GRSA 3VA8A 3B0PA 3U6WA 3PFRA 2ACUA 3REQA 1B3XA 4YVXA 1B3OA 4FI4A 2PTWA 1G4TA 4AYSA 5HOSA 2DV0A 2FTYA 4WY0B 4GYKA 3KCOA 2YOCA 2D1ZA 3D6NA 2X09A 1FCVA 1UQZA 4UTIA 1UA7A 1S2AA 2AKMA 2QCFA 4AD2A 1E70M 3STGA 4IL2A 5SWUA 4Z42C 1F3WA 1Q65A 1VBHA 4V1YA 1CEOA 4C5YA 4PMRA 1JIBA 2QAFA 3U7BA 4H00A 1JCTA 4AEOA 1I2RA 2HSAA 3FNDA 3WK1A 3WQ5A 3FY1A 2NQ9A 3CAQA 1H4PA 3IJ9A 3LRKA 3E0LA 5E5CA 5DRIA 3S6DA 1E56A 4W8BA 4S3DA 3BOFA 1TMQA 4JPGA 4PFHA 4EXAA 2VELA 2HPIA 2W0UA 1RJRA 4CVUA 3FKRA 1XYCA 4NU7A 3P6LA 3WK0A 3QEZA 3NGJA 3WQ4A 3ZXWA 4X22A 4H6RA 3OOQA 1QOXA 2I7GA 3LCXA 1KFEA 3C4UA 4CCDA 3FS2A 1OD0A 1KCLA 3MUZ1 3H7RA 4GCXA 2A3HA 1ZJAA 4FLQA 2ESCA 4R85A 3SRKA 1NIUA 3WEMA 1U5JA 4OT7A 3NQ2A 3OTRA 4NI3A 3G6MA 3QOMA 2MNRA 2C19A 1FOBA 1A3WA 2I57A 1ZNNA 4LYKA 1F05A 4W88A 2VWSA 1EXBA 1TREA 3ABXA 5FF7A 3KTSA 2OZ3A 2WNWA 4A3RA 3P8JA 1S38A 4HA3A 1CZ1A 4XKMA 4JQ1A 5FA5A 1G1YA 4FNPA 4GYFA 4PMZA 5KITA 4XUYA 3G1XA 2O9TA 1F8MA 3S2CA 2PB1A 4GZEA 3A24A 4FIQA 3CMFA 3ZJKA 3ID7A 4JL1A 3RUBL 4XD3A 2PLMA 3MMWA 1RV8A 5A2BA 5A6AA 3NDZA 3C56A 2BGQA 1E4LA 3V36A 3ABZA 4GOAA 2RAGA 4DN1A 2QDDA 3WLHA 1US2A 4XQ6A 5BOFA 1GNXA 3NQ8A 1V3KA 2JF6A 4P7LA 2R1LA 4Y9MA 4O1EA 3W75A 4RE2A 4HZ8A 2R8WA 2BGSA 3SQSA 3VCCA 1X1OA 4XZBA 2HPMA 3N15A 2NWSA 5E9XA 1TV3A 5EBAA 3AIEA 2CPUA 4DO4A 3AXKA 3RPMA 1E40A 4AMAA 1W5MA 1G69A 1OBAA 2YX0A 2E6FA 5I3DA 1XSKA 3B3DA 3CC1A 3FHAA 1LQAA 3TN5A 1NDWA 4M6VA 4G9PA 5AYIA 3T78A 4R34A 4GACA 1ONEA 3PULA 4DBDA 5CPQA 3KLKA 3W00A 5HR7A 1W17A 1VRXA 1K70A 3LU2A 1NEYA 4HVXA 2RKXA 1LBLA 4R9XA 3L66A 2EBNA 3H2EA 3DX5A 4JXCA 4O4VA 2W63A 4UQDA 3P7YA 3OYZA 5EFFA 4QR6A 2YSWA 3AMKA 4S3AA 4OWGA 2NQZA 2BTMA 2QF8A 1OX4B 2DEPA 4S2BA 1BSIA 2ZXBA 3EZ4A 4HA0A 1XSIA 2D69A 4DZHA 1VFSA 2YKKA 2R24A 1QCWA 2ZUTA 3W25A 2HXTA 3AYRA 4GIYA 4XAZA 1ZU8A 3CQKA 2CXEA 1QO5A 1ODUA 3I7QA 2QQ6A 1GG1A 2WBGA 5G1YA 4NZ5A 1D3HA 3K2GA 5FL0A 2J7HA 1QPNA 4DO7A 2WPBA 5FJRA 1RUSA 5D2YA 2J27A 2PRHA 2VD9A 3ZSTA 3BSHA 1XLJA 1H0GA 1NQKA 3RF9A 1AJ2A 2XFFA 1DJHA 1F76A 5D30A 2E6YA 3H4GA 3GSMA 3VCNA 4C7GA 3DYOA 5F2MA 2OO6A 1RALA 1OZMA 3EWXA 3UG8A 3BGJA 4NUWA 2GGHA 1UJQA 4UZUA 1R38A 3UR2A 3T40A 3EKZA 2ZRUA 3A23A 3ZLFA 3AU6A 3ARZA 1QNOA 3LTYA 1HL8A 4MKSA 4AIBA 1FRBA 1A4MA 1TKKA 3BCJA 3WUEA 1OINA 1J0HA 4JNZA 1U1HA 1KTBA 4CN6A 2WQDA 1UD3A 1KM1A 4XVEA 1ISWA 4YVPA 4Z2IA 1LBMA 5AFDA 2VP8A 2FGBA 5CG7A 1EBGA 3KTCA 4LBRA 4LNCA 1IT8A 1SSDA 3BXWA 1YKWA 2GGIA 2ODOA 3THCA 1QK2A 2JEPA 2ZVIA 1U5VA 3EWDA 1TPC1 3SEPA 4UTKA 2JBMA 3DC0A 4ENLA 4MZYA 1XBXA 3RPDA 3HBLA 3CUHA 4KCWA 3AIVA 3WQEA 3WNOA 2DJXA 4U33A 2V3DA 1QHZA 3B0XA 3CXOA 2V9DA 4A8NA 1B57A 3AO0A 3VKCA 4U28A 2DW6A 3UYCA 1VYSX 2WOQA 2R1MA 5MKGB 2ZXDA 2WSKA 5T91A 2I14A 3KOYA 4JOMA 1UBSA 4NG3A 1LZOA 4PMJA 2AL2B 2A7PA 4OFCA 2FMOA 1PTGA 1G4SA 3CPGA 3EA1A 4LU0A 1CBGA 3F7JA 4OVXA 3VIOA 3T8LA 1B0IA 4E8CA 1KWKA 5AKQA 3LTPA 1JF5A 3NVTA 3EA2A 2BMBA 1CCWB 1EJXC 1XJBA 4Q6XA 1TJ0A 3AWOA 3OP2A 3G1FA 4MVAA 3UCQA 4H2HA 4JIHA 2WHLA 3ARRA 1AL7A 3LCFA 2C0HA 2P50A 4N7QA 2QCDB 1BPLB 2DIEA 3PTDA 1QW8A 2VUYA 3BLPX 4G56A 2OQYA 3GC2A 4NRRA 4MJMA 5HANA 1W5QA 3LV6A 4P8WA 3LPGA 2V8ZA 1KLZA 4DJED 1DIEA 1GOIA 3UESA 3TROA 1MMFA 1TZZA 3L0KA 3SY8A 2EQDA 3V35A 4KEVA 3RNDA 4UB9A 1TPDA 4MNKA 5CZKA 4WCJA 1EUNA 3VAVA 3MSDA 1SZFA 4LANA 1VHNA 4NAEA 4FOUA 3B0UX 2GVYA 2VQUA 3HQOA 4B4FA 3LHTA 1VFMA 1XD1A 2WMFA 1WA3A 5D04C 2YXGA 5ABHA 3MBFA 3Q94A 1VGAA 1DQUA 3ZJ8A 1LF1A 3PUDA 2W4XA 1YIXA 1CTNA 3HPSA 1PIGA 4HTYA 4Q8UA 3BAWA 4ZE4A 1Q6CA 4FXSA 3USBA 3SCRA 4L9YA 4DEFA 9CGTA 3CL8A 2J7CA 1E1CB 1NY1A 2VURA 3NSNA 2DY3A 4Q8WA 6TAAA 1XGZA 1AG1O 4WD0A 3UYIA 3TSDA 3F4WA 1Q13A 4FOKA 1OADA 5LXEA 1W3IA 4FHAA 4FX8A 1JVNA 1FWTA 4C1LA 4LCSA 1L6FA 2ALDA 2VCCA 3VIFA 4U5IA 3GXPA 3VOFA 1WZKA 3ECQA 2CFFA 1UP0A 2WBKA 8CGTA 4X60A 1V0KA 4ATWA 4DWSD 3DENA 4WLCA 1XXXA 3B0VC 4MGGA 3GDLA 4LVBA 4J40A 1OT1A 3QW3A 3TOPA 4ICNA 2D20A 1LOLA 1NF0A 4NZ1A 3WQDA 3VZYA 1K9EA 5HJLA 5HMFA 4TX9A 1RD6A 3TNBA 5DF0A 1S2VA 3CIWA 3WDRA 5K4XA 2YB4A 3IV8A 1ONRA 3UP8A 3S5SA 3W02A 1QI5A 2WC7A 3NPWA 4L4MA 1XKJA 3BLEA 2E8ZA 4UOZA 4F9JA 3CH0A 3WQCA 1E0XA 1EX5A 5H8PA 3I68A 3IJQA 2AOSA 4PMXA 1XS2A 3AYTA 1O1HA 1US3A 1D9EA 3C3NA 5C9WA 2A79A 2VTFA 1WDWA 1PV8A 3PZUA 2OGYA 4AIEA 4PTDA 4UC5A 2W67A 2E6AA 5A1AA 1FWAC 4PYSA 3HG3A 4AWUA 3ME3A 3IIVA 4RE3A 1BKSA 3ABRA 4PC8A 2EPHA 1XPYA 1R87A 4UFLA 2QXWA 3M44A 3GH7A 1W3HA 2HDJA 1FKWA 3R0DA 1VBJA 4PL1A 3UD6A 1RZMA 3E9AA 3VKBA 2X2YA 2X16A 2YA2A 3OZYA 3S2JA 2DSUA 2RGMA 2JF7A 2PC8A 4M81A 4IF2A 2HRWA 1IWAA 1CXEA 4NP7A 2QV5A 4Q4MA 3PP7A 3FYOA 1J10A 3DIPA 4QJ3B 5JBFA 1P0KA 3ES8A 3QR3A 1KBLA 3RO8A 1EQCA 1THFD 2D24A 1FDYA 2Y89A 2CLFA 1VRDA 4PUJA 1PCKA 3RYSA 4IIFA 2C16A 4IG2B 2TPSA 5AECA 3KCLA 2ZRWA 4UZSA 1S1RA 3RGTA 1CGYA 1WNOA 4RNFA 2IPWA 3K13A 2O7QA 3TIMA 4DVOA 3RIKA 2PZNA 3R5EA 1NU5A 2NT0A 3MDWA 2CHOA 3HFYA 1AK5A 3F4NA 1A53A 4CQAA 1EKOA 3AQUA 4KF1A 3B06A 5CBIA 3F4CA 4YPJA 2ZRXA 3MUXA 5JQ9A 2QNEA 4ADTA 3C61A 3O6CA 4WDUA 1VF8A 4PTMA 1W1PA 1AA1B 1YDYA 4LB3A 4M7TA 1KBBA 5ABFB 2PGWA 1HW6A 3RDKA 2J62A 4NT0A 1FXPA 3GE7A 3V1PA 3UCCA 1B2YA 2WZEA 4KIEA 2C3ZA 3WDIA 3QSRA 3G3MA 4HJWA 1J96A 4PUKA 4JKLA 4D6FA 4PBFA 4ZO9A 4TQTA 3IGSA 1BRLA 4I90A 4JIEA 1ZPTA 1K3UA 2WSPA 5FJPA 3O8AA 2ONEA 4Y96A 4KW2A 2E6DA 6ALDA 3BLFA 2PF8A 4O0QA 1FQ0A 2NQHA 2CW6A 1D8CA 1HJUA 3JRKA 3HTWA 3WUFA 1V7AA 1JD7A 5A8MA 1RH9A 3G0UA 3RK8A 4EF8A 1BWLA 2C1IA 1V93A 3KHDA 4J3WA 3IRDA 2EJAA 3OB8A 5CJMA 1REQB 1VP5A 1CXHA 4JICA 1Q6EA 1VLWA 5DEZA 4B5TA 4NILA 4WY0A 3TAOA 4AIUA 2EG6A 2OMAA 3ATZA 3FW6A 4AWTA 1JYXA 4RV8A 1MRAA 4DB7A 1B3VA 4JR5A 2Z29A 4HCHA 3TUUA 2WW5A 4H9TA 4GD0A 2FHFA 3TU9A 2J7GA 5DQPA 3A3WA 2I1OA 3TXVA 2VR2A 1E4MM 4D6DA 1H41A 3VMPA 3TXZA 1C91A 3AJXA 3VNZA 4BHYA 4WJXA 3WL0A 1YADA 2CBJA 1QNSA 4QBXA 4C1KA 2X1IA 4HZ6A 3GKAA 3T8QA 1OIMA 1W9UA 4B3ZA 1MFVA 1I8JA 1A0DA 1TV8A 2F6UA 5JBEA 2Y8UA 2X0HA 1EFZA 3NO1A 4AAJA 4C60A 1ESWA 2NX9A 3R8GA 1K9TA 1A3HA 5REQB 4KBXA 1GHSA 2DW7A 1EXPA 1OX6A 5ABEA 5G5IA 3S1XA 3ANYA 2JK2A 4DJDC 4GMEA 2FHCA 1Z48A 3N13A 3T9PA 3JUGA 3B8UA 2NV1A 4QEHA 1GOXA 1PO9A 3OA5A 1G4PA 1K8CA 3NDYA 4LCQA 3W7CA 1ZZMA 3SECA 4XD5A 2WNQA 3TR2A 1NJJA 4FR1A 1Q7ZA 1DE5A 1XG3A 6ENLA 1KWGA 4DHGA 4FXFA 3DKJA 1M7JA 3P62A 4WJ8A 2BXZA 3LCGA 1S5WA 1WDRA 1CW2A 4PTXA 4HYRA 1JDAA 4PUUA 3MI2A 3STCA 4XBJA 4OV9A 3PUEA 5LZLA 3MHUA 3SCQA 4QG6A 1UKTA 1PKLA 1HJWA 2F38A 1GPFA 2VZTA 4W8LA 5IDZA 2C15A 3WQ6A 3H7VA 4M82A 1F73A 3NXFA 3UY8A 2ZX8A 1F8IA 4K1WA 4IPJA 3PTKA 1HVQA 4UFKA 5HA7A 1DXEA 4J9JA 1F3TA 2O0TA 3MANA 3TQVA 3L0GA 4CKQA 2ATSA 3M0XA 1S2UA 1NAL1 2BVYA 2CLIA 4ZFMA 2QJIA 3OVPA 4MB3A 2VFHA 3B0YA 5H8MA 3QHMA 1GPWA 4BQ3A 4MADA 4E0CA 4XD6A 1ISYA 3PR2A 6REQB 2ZADA 1BYAA 3EEGA 4QLKA 3TZNA 3TJLA 2ZBTA 4JYFA 3EB2A 3PS7A 2HK0A 1U1JA 1SJBA 4WSHA 4F0MA 4TTGA 3VINA 3GXIA 3EDFA 3T2PA 2CKRA 4F2BA 5F2LA 4DO5A 4MPQA 2ZTKA 3W72A 2GWNA 3BTNA 1FHLA 1DORA 1ZRQA 3VUSA 2DZBA 3CV1A 2XINA 1B1YA 4DRSA 5EYWA 4K1GA 4LWWA 4YYFA 3IARA 2QT3A 3CK5A 1TWWA 1DPMA 1W8SA 1EPXA 4BI7A 3DAQA 4IM4A 3WH5A 1PX4A 1G5AA 1KXVA 1UD6A 2EAWA 3AIRA 3QMSA 5CPSA 4E2BA 4F4RA 1DQWA 3C2VA 3VD4A 1EGVA 3T05A 1UZDA 2ZRYA 3NSMA 2ZUVA 1TG7A 3BCDA 3R43A 3M7SA 1X1NA 4H04A 3EPOA 2A7RA 5HJXA 1O60A 4ZODA 4Z0JA 1CGVA 1N8WA 1EJVC 5CJNA 4LRTA 3PVFA 1GOMA 4E3VA 2D73A 4QX4A 5JBDA 1I1XA 4JTSA 2E5BA 4HOXA 4US5D 3PM6A 2AMXA 2PCEA 4GBDA 3UXAA 4AHPA 4RK8A 4IPNB 2KX9A 2WYSA 1R8LA 1QMLA 5DBTA 2GJXB 2VCBA 4KCUA 2IMRA 3ZZ1A 1SFSA 3B97A 2E09A 5M2FX 1YPIA 5LIUX 2J75A 3BO9A 5C9XA 5FSDC 1C8QA 4K38A 2XSBA 1O5RA 5E9AA 4QCEA 4A05A 4E2VA 2IKGA 1AZ1A 4PCSA 1Z8AA 4CNSA 1NFBA 1JZ5A 3HB9A 4ZO7A 3W3OA 4GYPC 4WX2A 1GQKA 2A85A 4HBKA 2PC4A 2GK1A 4N2YA 5IM51 1IXPA 4GQ0A 5AHLA 4GI8A 3RU6A 2E8YA 5CZTA 4F2TA 1XICA 1Y5XA 4PN2A 1JXJA 2PWFA 3SCPA 1UH2A 2VEPA 5FACA 1EX1A 1VR6A 4A3HA 2ACSA 1VCFA 3OZOA 2OJPA 3CIVA 4YTTA 2OPJA 2V2DA 1DVJA 4LGXA 4L61A 2MANA 4MJ2A 2ADAA 4YL2A 1W1IE 4V33A 5BRQA 4FXRA 5EPDA 3F03K 3EPMA 1NVMA 1MI3A 4QCFA 3AZRA 2GOUA 1WQ5A 1XFBA 3L4YA 5J5RA 1EB3A 4S3GA 1TSIA 4GX9A 1WZLA 3UZXA 3SRDA 2FPVA 3EDJA 3N1AA 3CHDA 4CD8A 5MKGA 3AYVA 3VIKA 3SO7A 1EHAA 5CSYA 3ARTA 4GI9A 2AL2A 5CC6A 3BL3A 1Z9AA 4I9TA 3H2FA 2Z1SA 4F40A 4HCLA 3N14A 4B9ZA 3FYYA 1ME9A 1C9WA 2VX7A 3L65A 3QYQA 4XZLX 4ZQMA 1UR9A 3W7NA 3TE9A 2GYIA 3OQEA 1S5TA 3V5CA 1B3WA 2CLKA 2BY3A 3QY6A 3F2DA 3UXIA 4DI9A 1E6SM 2VO5A 5CZSA 2PDCA 3VKDA 3M4HA 1MUCA 1CXLA 2QCDA 5GNYA 3UZJA 4QAIA 4CCEA 1ZJIA 5FD0A 1J93A 4YCOA 2YZRA 2ZCGA 2CHNA 1MVYA 3KX6A 2BP1A 4HYWA 4JQAA 3FA3A 1EYWA 3TTQA 1EZ2A 2WVTA 1HFBA 2WV8A 4QDWA 1A0EA 2OKOA 5C55A 1SZRA 1XLMA 3E3HA 5J8LA 1PX3A 2OZ0A 2EPKX 4RNJA 4PUNA 2WHJA 2L5HA 3TFCA 2VZOA 1V8EA 2X1UA 3EKLA 1LQ0A 4E3TA 3IPWA 1JCYA 3L4WA 3LHVA 5EU9A 3RRAA 2CLEA 4XAFA 3IGHX 2RJHA 3V16A 3VGHA 4JS3A 3W1TA 3AXMA 3WFZA 5FEXA 5HPOA 3SY1A 1FH9A 4QHRA 2PAJA 3N6JA 3V18A 1I4NA 1ELSA 4RL3A 1KO0A 5JUVA 1UPMB 2QCMA 4ML9A 3TC7A 2Y88A 2J47A 1H49A 3OVGA 1HGWA 1ADDA 2J79A 5C7HA 5E6YA 3ZT6A 3LNPA 4KWUA 3GFXA 1XRTA 4YHGA 4A2RA 3CAKA 3N4FA 1Z69A 1ZJBA 3N2OA 3NQMA 1WOAA 4OGZA 1VCVA 2WZHA 2W5FA 3UZZA 4DNHA 4D72A 2YXOA 3MO7A 3W71A 5HPCA 1VJZA 1AW1A 1RA5A 3NG3A 3NYZA 3SCSA 4AZHA 1UG6A 1IIHA 1NWUA 2PU0A 1O7AA 8XIAA 3TW6A 2IS7A 3KS5A 1LL6A 4W84A 4PBGA 2X0YA 3N6HA 5A6BD 3TQ0A 1HTIA 4LTSA 3ZMRA 1JUEA 4GVGA 1HIZA 4KGLA 2WMJA 1E6ZA 5CC3A 4PSRA 3NNTA 2V5KA 4L4OA 2EPNA 2ASHA 2FZNA 5BWAA 2OX4A 3Q4DA 1XLIA 2PUZA 3VFCA 3SCVA 4BFAA 1ISXA 5M3WA 3SUTA 4AHOA 2P8BA 1V0MA 4IJBA 5BCAA 3KRUA 2DORA 3QSTA 3G1HA 3AUOA 4RLIA 2EPOA 1HL2A 2G3JA 2Y70A 4UFIA 5ECUA 2VDHA 5ABTA 4C65A 4AY7A 1BVWA 4PCPA 1DJIA 3EXRA 3WDHA 3T0DA 4D9PA 4B16A 2PP1A 3EBVA 3QOKA 1OC6A 1YXDA 4I5RA 4R33A 5FEWA 2J24A 1OX5A 3P60A 5GJMA 1Q6DA 5CC5A 2DZWA 1E43A 1UZHA 3D46A 3V5FA 1JD9A 3AI0A 3OZMA 3R6IA 1KM3A 4CU6A 4QG9A 1SMAA 1A5KC 4L1XA 1WAWA 3VTRA 3BW3A 2EPMX 1KCZA 5MF5A 4IG2A 4MAZA 4PEEA 3KTXA 3OGRA 4AYGA 2ZE3A 3TONA 3MBDA 1BVZA 3KLLA 1PUDA 5FKYA 4NJIA 4RDVA 3UWWA 2RDTA 1A5MC 2NQ5A 3WH6A 3IACA 1VH7A 2NZLA 3SZ8A 3QPZA 3IUDA 2V30A 4N9BA 1UWUA 5CC7A 3TJIA 4V15A 3JR2A 1AODA 1V3JA 3AXXA 3GUGA 4Z17A 4NZJA 3DUGA 2WCSA 1B9BA 1MQRA 1CXIA 4Q33A 3L12A 3BOXA 4Y2WA 1DOSA 3CZJA 5ABFA 1JNEA 4WHBA 4RJEA 3NQEA 3V4BA 1H0IA 1TYGA 2BHZA 2Y7GA 4C7DA 4JFUA 2OWXA 2GJPA 3WD1A 3M0IA 1O12A 2TMDA 3KBJA 3B40A 1RLDA 3ZWSA 1H2JA 2VHLA 4XZNX 3ZS4A 4GH3A 5DMNA 1UH3A 1I2OA 3CEUA 2BB0A 2XSAA 1TX0A 3DYPA 1V6TA 3C2RA 4IWWA 3PWGA 5AC8A 1VFOA 3B8IA 4JZ5A 4YN5A 1PDYA 1SR9A 3E2VA 1FWFC 3VUPA 3OZPA 2AAAA 1MDRA 2D3NA 4IGNA 2YIHA 3L4XA 3O07A 4H2CA 4CGTA 1V0NA 2OZTA 1HKKA 3PZOA 3BMWA 1U83A 1REQA 2PI6A 2J6XA 4NASA 1IEIA 4C6NA 1E3XA 3F4VA 4NZ4A 4ICMA 1PIFA 1QOQA 2VNCA 1XIBA 4MAVA 2PDMA 3TP4A 2DUXA 3S4TA 3M6YA 3M1ZA 3NPVA 3MWAA 1WX0A 4AD3A 2CIPA 1RPKA 5AYYA 2GSEA 4E8DA 4AVOA 3GFYA 1R0MA 1GOQA 3CO4A 4LF2A 5D2WA 3CT7A 1C92A 3VNDA 1CECA 5C9RA 1A5OC 2TRSA 3G8RA 2ZX6A 3VM5A 4PRTA 3MSRA 1M7PA 3TMQA 3L4TA 4IIDA 2ZVRA 3M6DA 5CQ1A 5JVLA 4AWEA 1B4EA 2ZQ0A 5D8WA 1UUOA 3W9ZA 4O57A 5A3HA 4ZFCA 1YDOA 2TYSA 3LHZA 1S3TC 4H6QA 5IHRA 1IQ8A 1EDTA 1FVPA 2UZ9A 3KOFA 2CZFA 1ZLPA 2V2CA 1AMYA 1Q8AA 2NUYA 3OQ8A 4HSHA 1V6XA 4AC7C 1YXCA 1MDLA 3T2OA 2XFYA 3O15A 2Q8ZA 4GIAA 1A5UA 3HPXA 4RNIA 1XRVA 1OVDA 1TB3A 1W3TA 4K68A 4DY1A 2H9AB 1XD0A 1HKMA 3E2RA 4ONVA 4LVFA 1PTAA 3VD5A 3TZFA 2X40A 1TRDA 2EHHA 3PZMA 3UZWA 3FX4A 3VCRA 1T0OA 3H53A 5DO8A 1G67A 3N11A 5I78A 4FAMA 4LYPA 3M0HA 3GR4A 1XISA 4LPCA 4HNNA 1HT6A 1BTCA 2NLIA 5I79A 3KZSA 2JE8A 3LGGA 3KWXA 3QV9A 3N18A 3M9YA 1ZALA 3VOHA 3CHFA 4V2XA 1AD4A 3EOUA 3U5UA 4AX7A 1V02A 4PMDA 1XYLA 4PB5A 4EIVA 2JFEX 2Z2BA 3QLDA 3HURA 3T07A 4MZ1A 5H8UA 1IEQA 5HWJA 1OFDA 5CPNA 1E4NA 4FB7A 4B3KA 1JEZA 5E0KA 2XSXA 2HJPA 1FWJC 4G7FA 1DTUA 3G1SA 1P0DA 3KS6A 4B92A 1PYMA 4N0RA 4KFOA 3AICA 4LV4A 1C8VA 2YB1A 3TTOA 3V5OA 1W56A 1H11A 2HS8A 5KEZA 1PDZA 1JQXA 1GCYA 4H9XA 1W31A 4EP8C 3FIGA 1UWSA 5A6LA 4LUTB 1Z41A 2CCRA 2Z1BA 1C90A 4JEJA 4H01A 4W87A 2XGZA 5HR6A 4KERA 2VQTA 1MXDA 1LLWA 1TTIA 3CYVA 4CD4A 2EGZA 2OODA 4B5VA 1A4LA 3I10A 1ZQ5A 3MB9A 4NF7A 8RUCA 1CGXA 3AMCA 3C8NA 3A13A 1HJQA 1R3SA 1T99A 4P5UA 1O1ZA 5A8QA 5EBUA 3APTA 2YL5A 3W7KA 2DJLA 1L2QA 3ISIX 3EKGA 1UIPA 2A7NA 3EX6A 2VZSA 2GZXA 2J7FA 3VILA 3ZWTA 2XM1A 5AYBA 4Y9AA 2HZGA 4W7VA 1VEOA 4C6FA 1MW0A 3Q37A 3MHFA 2RJGA 1BXNA 1TWIA 3GC4A 2DQWA 5DY3A 1XIIA 4O28A 3BAJA 3G1YA 4AHQA 3T55A 2YL6A 3M47A 2G97A 3O63A 4D6JA 1EDQA 3MUIA 1KR0A 2YLAA 3HGRA 3WK3A 5D2VA 1QTWA 2VR4A 2XIIA 4LUSB 3AS0A 5K9DA 3KDOA 3G8EA 4NSBA 1GTHA 2XJ7A 3LX9A 1V08A 4NX5A 3LTSA 3QXBA 3GKFA 2EEXA 1OCQA 2NSOA 4Y9PA 2GJXA 1ZENA 1J0JA 4TTUA 5LIWX 4KS0A 4LAMA 2GUUA 3T81A 4UFHA 5D05A 4GYPA 4BWLC 3SI9A 4G2DA 4IUGA 3M43A 3NO3A 4L6HA 4BQ4A 3I4EA 3CHVA 3BV7A 4QGCA 1TWDA 3W1AA 1JQVA 1R5YA 1YLVA 3RLUA 1ECEA 2RDWA 5D02A 1VFUA 1OCNA 2GWGA 5E0CA 3LCWA 3EX3A 4IJRA 3QY8A 3VIGA 2ZKMX 4QS6A 3YPIA 3CZKA 4LVDA 1J8VA 3OIHA 3W7IA 4YS1A 3NO5A 1AJZA 1XHGA 3AHYA 1Q66A 1TQXA 1W8GA 5FJTA 1WDDA 4V27A 2NV2A 5KZ6A 1BHGA 2F2HA 4F9DA 1W3LA 4UMCA 3L4UA 4MKNA 2OU4A 4AWSA 2HVOA 3WEZA 2NLYA 4AD5A 2QCNA 4O1AA 4R27A 1QPRA 3WJZA 3FYPA 4J7RA 3EWUA 1Q6FA 4LYRA 4EWJA 4DLFA 3B4UA 4GPNA 3NQ6A 2POZA 3NPUA 3WF1A 1J0ZA 2QS8A 3WJXA 1IT7A 2CLOA 4X9SA 4W4QA 4XSMA 1WPCA 5L9FA 2PDYA 3KP0A 2GVGA 2ICSA 4UBPC 1PPIA 1WDQA 2FZ8A 2Z28A 4AISA 2AKZA 3EMCA 4ES4A 4M1BA 3G77A 2NT1A 1OFPA 1PHWA 1F6PA 4QQ3A 2FQIA 2WO5A 2DSKA 1GORA 1MW2A 1QATA 1VIWA 4DAIA 1AQFA 4HTBA 2WHKA 3L2LA 1BG9A 1BG4A 1PB0A 3DEQA 2VM8A 3BDKA 2ZX7A 4UQAA 3PZ9A 1YTKA 3SSJA 1PS9A 3L5MA 6XIMA 3NTYA 3WF2A 1GHRA 1U22A 3WJWA 1CYGA 4O54A 1MRQA 3QC3A 4NJHA 1V02E 1NDYA 3PJTA 5IRPA 4CU8A 3N9SA 4XO7A 1AQHA 5LXXA 4IL0A 3NL3A 2J9XA 1M1BA 4GGBA 3G5EA 3AAMA 1KV8A 3LBCA 5G2IA 2DT1A 3FVMA 1W91A 2V63A 1L6GA 2AQVA 3PF3A 3LI1A 1GZJA 1QXLA 2O9OA 3V0TA 3BSGA 3LERA 2OFJA 3NJ3A 1J4EA 3QVQA 1XDJA 3BMXA 5AC6A 1E4IA 2ZA3A 1I75A 2NX3A 4ORMA 1SUXA 2F84A 3G0XA 1ICPA 1ZTVA 1M01A 3S2MA 2XH4A 3UXKA 1GJPA 4GNVA 3FEMA 1DJGA 3AS2A 2J6VA 1A49A 1O6IA 1GTEA 4TVCA 1CLXA 3AALA 3W87A 4JNYA 3VIHA 1UKQA 4IMEA 4MY8A 4K36A 2VEKA 2VC7A 1ITCA 2D0HA 3DECA 3OBAA 4A21A 2F7FA 3L21A 4OIFA 3E0WA 2HWGA 1DJXA 3ARVA 3BW4A 3WYZA 1SFLA 3KP1A 3R8HA 2Y1HA 4R7WA 4X2PA 3B9OA 4EK7A 5IDIA 4GCAA 1NOUA 3PZIA 1H09A 1Q4WA 3ITYA 5KZMA 3S9IA 2R9RA 1BD0A 4HQVA 1CIUA 4D8ZA 1JCLA 2Q3OA 3CGTA 1KC7A 3P61A 2IXUA 3QZ6A 4H8HA 1HP4A 1EHNA 4GQGA 1H61A 1LRQA 2GQAA 2QF7A 3GY1A 4FR6A 1EQPA 4LVAA 4LFYA 2XDFA 4CCZA 3MCOA 3ZLGA 1YNPA 4MTVA 1IZJA 1XIDA 1XBYA 4HU8A 3POCA 4V1XA 5AY7A 5AYXA 3VE7A 2J13A 3HPFA 2V38A 4JTLA 3QZAA 3WMBA 2NWRA 4Q8QA 2V5JA 4R9OA 1EGZA 1ZBKA 2WM1A 3EOSA 4YTQA 3MS8A 1UR4A 1ZGDA 3UA4A 1EOMA 3WCZA 1XIGA 3UVIA 4UXDA 1UOKA 1AH3A 1HXJA 3WNKA 3HPZA 5M03A 2Y63A 5LA1A 1YPXA 5T8GA 5FJUA 3ELFA 4F3HA 4Q7BA 3IJ6A 2PD5A 1UKSA 3B9AA 1GG0A 3D47A 1EPVA 4KMQA 3VNYA 4UQ9A 4RW5A 5GPRA 3WF4A 2VVSA 4XTIA 5AYZA 2FZBA 3AJ7A 1VJSA 1PXGA 2E25A 3EAUA 4DIAA 2DQXA 3NPXA 4M6QA 2VWTA 2CYGA 5XIMA 2I5IA 1M7OA 1H7OA 3CS2A 2FKPA 3GTIA 3GIYA 1OABA 1XYMA 3DI1A 3AMLA 3W27A 4PCNA 3NFUA 1B3YA 1V51A 1WYIA 4WUIA 1EJTC 1K8YA 1V77A 3CUXA 3NOYA 3ITCA 1DEDA 4HKPA 5PTDA 1JXKA 5BXTA 3AC0A 3QFEA 1IF2A 4DM2A 4ML4A 3EOOA 2ZICA 3Q58A 1ECQA 3R79A 3LMYA 1TZ9A 2RDUA 4UIOA 2XZ9A 2FH6A 4XZMX 1EEXA 1H62A 3WF0A 5LIYX 4R5EA 4INFA 5LIXX 4AQLA 5LNRA 3H6OA 3FJLA 3FJ6A 2DFAA 3RU8X 2G3IA 1A5SA 1Z32X 1FHUA 4B5UA 4JQ3A 4FIRA 2WWCA 4CQCA 1JDCA 1WO2A 5FEPA 3FA5A 4IXXA 1E6NA 3LB0A 5HQEA 3WNNA 3S2LA 1XH0A 1B3ZA 1UOZA 1FP8A 1OC5A 3IGUA 2HBXA 4DWDA 4M0XA 3KBSA 4TVDA 1TA3B 4TXEA 5FI8A 3T42A 2OQHA 1V6VA 4H7VA 3HO8A 5I5RA 5K3VA 1GVSA 3SGUA 2NVDA 2Q6ZA 2P10A 3MQTA 4JTCA 3HOJA 4IP5A 2HVNA 1P43A 1WZMA 4C6IA 2P5NA 2XN1A 1OFAA 1NH6A 1P48A 3U2ZA 1FWRA 1B9ZA 4KWVA 4CNTA 1FCQA 2GOKA 3OLIA 2VRKA 4UTLA 2PDXA 5DRCA 4H9MA 1N82A 2PDLA 3EWWA 3U7VA 3WFAA 3SB0A 1E0TA 5BXRA 4LH8A 3I3BA 1VC4A 3RN6A 1UR1A 3IUHA 3M0ZA 3BQ6A 1GONA 3CZ8A 3VIIA 2OLSA 5KZDA 1ONXA 3CIXA 3W1MA 4H9UA 5C70A 3BQ5A 3W85A 2A6NA 3HGJA 5A2CA 1OM0A 5D9MA 2RHGA 1N55A 3VGDA 5IFPA 3PSWA 3MJYA 4NAEB 1TWZA 1V3IA 2OYLA 3SQMA 4KWSA 1RPXA 3AYSA 3KRZA 3VOJA 4IMAA 4PMNA 5LHEA 4IX0A 3GIQA 3NZPA 4IH3A 4WKFA 5K7JA 2Q3RA 1NWSA 4JTRA 5BU6A 4MWAA 2HV5A 1OGSA 1FH8A 3VNJA 1QBAA 1AD1A 4WQ6A 3PB0A 1L2UA 3SFWA 2PDGA 3NQCA 2E9MA 4GH1A 1E1EA 3GXDA 2PBGA 4O19A 2C7FA 1DHKA 2YW3A 1OZQA 2GJLA 4LAOA 4MY9A 1F4HA 3GH4A 1PZ2A 1QW9A 3PN8A 4D2JA 3MVIA 5AVNA 7TIMA 2ZA1A 4O0ZA 4ZE5A 4ZXOA 4AZ7A 3VD9A 3W2JA 2XGBA 1XLBA 3QFWA 3UA3A 5JIPA 4LY4A 4OBTA 4FZIA 4L7ZA 2Q8XA 5ABGA 2W62A 3M5VA 2GPTA 1H63A 1RBLA 3LGDA 2E0PA 2PDNA 3TNOA 3HV8A 3TR9A 1DJQA 3TKFA 4Y7EA 3UJRA 2H9AA 2EPLX 4RDZA 4MJ4A 2ZDRA 3RO6A 2XIOA 1KFLA 1MWOA 3DYMA 4GUJA 5CPTA 3NAVA 1NQ6A 4P61A 4KESA 1W9DM 2GVJA 1XQKA 1SFTA 1E9LA 1D7KA 5J04A 1UWRA 1P5BA 3EX1A 1XBZA 3LHYA 4MNMA 1SGJA 2H8XA 4D1JA 4NXKA 1SM9A 3L0NA 3UG4A 4GY0A 5HJYA 1YTDA 1A50A 3PJXA 1QPQA 3BLOA 1FHVA 4LC6A 5TBOA 3GC5A 4KFNA 2BOEX 2FDSA 1K1DA 2Y85A 2J25A 3LK6A 4PGLA 3R2GA 4Q4QA 1QNRA 2ZX9A 2HTMA 4ZBCA 1JDDA 5IXEA 4E2OA 3C0LA 3GVRA 3K30A 5LNVA 1FWNA 1H5YA 2PA6A 3NQVA 1KM6A 2BOGX 1QPKA 3URQA 3TH6A 1R3QA 4PL2A 3UETA 2A3CA 3LS9A 3WSUA 5DMYA 1OD8A 2GDQA 4JN8A 2VFEA 3AIQA 2DGAA 1RY0A 4CQ8A 4ASTA 3CV7A 4TIMA 1DWGM 1A47A 1YW1A 2VX6A 1ZAHA 1IEXA 2OELA 2OLHA 3HF3A 4JN6A 4CNOA 1TTQA 3WENA 4QG8A 2OEMA 2QVNA 2E5CA 2ZIDA 2WC3A 3DGBA 4H19A 3LN3A 4OUEA 3BGAA 1R3RA 4OOZA 5DBUA 4Q3MA 3L2MA 1M04A 3GNXA 3UWVA 4W7WA 3PZGA 2G41A 4RE4A 3FJNA 4Z1CA 1TMHA 2GVLA 3CWHA 4UTUA 3SSZA 4UR9A 3GH5A 2VXNA 1HUVA 3TJ4A 2Q02A 2ON3A 4M8UA 4GABA 3ZO9A 2I16A 1ZSXA 4JN7A 4UMAA 3GK0A 1IXOA 1XINA 2YL9A 2PPGA 4O8RA 3CH9A 3LOTA 2Q8LA 5CCZA 2NVCA 1TVLA 3C0JA 4QEEA 3EB4A 3D3AA 5I03A 1Q85A 3VDHA 4P7QA 5AC7A 1FA2A 1VD6A 3CAVA 4YCPA 2YPIA 4ZXLA 3WD0A 4GZIA 3HGSA 5IFTA 3LXAA 2PF0A 1SZGA 1XR2A 3TSBA 2G96A 3PUGA 3WBAA 3IGXA 3UZYA 4ZO8A 3TX9A 2BV9A 4JEQA 4L6OA 2AL1A 4LUSA 2GDUA 1HKVA 4QE1A 3QTPA 1CGWA 3BSMA 4UQBA 4RKAA 3TYEA 4H6KA 3MP3A 3S1GA 1BRLB 4WVXA 4PMQA 5HNRA 4NL1A 3P80A 4WR3A 4HGXA 3EX2A 1JCMP 4HNOA 3R13A 3CQJA 4I5UA 4W89A 4O1CA 4ZSUA 7PTDA 3ZJ6A 4JYDA 3RILA 3TW7A 1ZS2A 4A29A 3WLMA 4TR9A 3N19B 2PEVA 3W38A 3TYCA 3VMNA 3HMCA 3E0FA 4FNRA 1W5OA 4LOCA 4BJHA 2WLZA 3UCDA 3LUTA 3GAKA 3ITXA 4Q8NA 3IJIA 2VD8A 1W1VA 3A47A 1T5AA 3S5OA 3VO0A 3TYDA 1CI1A 1J6PA 1EC9A 4MWAE 5LA2A 3NQ7A 4W5UA 2FTWA 3ARYA 1FWDC 1Q3NA 5A6JA 4MM1A 4GIEA 2WNZA 4Q8PA 1V6YA 1Q6LA 2JALA 3E5BA 1QASA 5IHSA 3SCWA 3W7PA 2YCIX 4QSFA 2Z1WA 3MT1A 3T09A 4K37A 1T8QA 3MSYA 2BLEA 1WXYA 1QUMA 2INZA 2QV4A 4P8XA 4YIWA 1TJ2A 5BRPA 2C91A 1OY0A 3TFXA 1KM0A 1UBPC 2WJDA 1XLDA 1SZEA 4Y6GA 1PZ3A 2QDGA 4QIUA 2BGNE 4POCA 1GYNA 1QI0A 4MLRA 3QLLA 4LBSA 2RDXA 5A8PA 2WSRA 1OQFA 1GUVA 2QLYA 4Z1BA 1WOBA 3MP5A 5A94A 3MYPA 1EJ7L 2PWEA 1F3EA 4C6DA 3GG0A 2QW5A 5G1TA 3NQFA 5FIPA 3LY0A 2DZPA 2ANUA 3WBWA 4TOQA 4DJDD 3QHOA 1JZ3A 4OHQA 1H7WA 2W79A 3NGFA 2CZEA 3GW3A 1GW9A 2DU2A 3EX4A 4H41A 3ZM8A 4GKLA 1P0NA 4MFEA 2V0TA 4L65A 3B8DA 4B91A 2DT2A 4DUWA 1FWEC 1ZB5A 3E12A 1D7FA 4XZHA 1HF6A 3GXMA 5B7YA 3AMDA 1XFCA 3LA4A 4YWSA 4GFSA 1RR2A 3MSGA 3J7HA 1WUEA 5G4EA 4KRUA 3KCJA 4A22A 3CPRA 2QJJA 4XWUA 1SPQA 4WDTA 4CNNA 3NQAA 1PKYA 1LYXA 5C9ZA 1NWTA 1E6QM 3UPBA 1SU5A 4JY9A 1KRBC 3URNA 4IUOA 4DPPA 1Q45A 4UNKA 4ZCWA 4ERAA 1ME7A 1QI4A 4D6CA 4K8GA 3M0LA 5FF2A 3GVGA 1YXYA 5FF0A 1QFEA 3PANA 2DDXA 2QZRA 1R2RA 3T0BA 4NQ1A 3ES7A 3MHGA 4A4AA 4PUDA 3DHFA 1KM5A 1US0A 2DVUA 4IIHA 2D2GA 4IPPA 4BI6A 4O53A 3NIYA 5GVJA 4ZQOA 2TODA 2VFDA 3QR1A 2HMCA 2XVNA 4Q4SA 4L6DA 3OEXA 1JPMA 3D0CA 7ODCA 1EWEA 1XUUA 3PZNA 3W01A 3FSUA 1JCNA 2ZUNA 5XIAA 3GTNA 4A3UA 2BBFA 2Z2AA 1ADOA 5HATA 3PK7A 4U2ZA 1GGOA 2YJQA 2QMKA 2IKHA 2ZX5A 3V75A 3S2NA 2IXVA 4FLSA 1DL3A 2IPJA 1XL9A 1DJZA 3GDRA 4BY3A 1HN1A 4P8VA 3A4XA 5BNKA 1MQPA 1M5WA 1R2TA 1EJUC 3TC3A 1S39A 1WUFA 3R12A 3ONBA 4IFOA 3P67A 3W7EA 2GQ8A 1KCKA 1POJA 2XG9A 3TLLA 5G4WA 2YXXA 4H8VA 1WBJA 3OU8A 4GQBA 2VYOA 3A4JA 3UR8A 1VFTA 1S5MA 1UKPA 3AOFA 3IANA 3TWBA 4ZTXA 1W1YA 4FNUA 1UP3A 1JCJA 3LZ3A 4GVIA 4N6FA 1TMLA 5BW6A 3PBYA 3ZLHA 3PZTA 4IIBA 2G95A 4ILSA 3P0XA 3KUMA 3QGKC 1R9ZA 3HMJG 3CT2A 1G6CA 3B9DA 4U3CA 1RQHA 2FVLA 4XTDA 2J88A 3NL6A 1L0PA 3WLOA 4RXFA 1DJWA 3TMLA 4ALDA 1SFJA 4CQBA 2D23A 3O7UA 2EG7A 3WMCA 3W7GA 2ZUMA 3ARXA 5B7ZA 2J66A 4EAYA 1RCXB 3PFMA 3KVLA 4AZIA 1OJXA 2ZFAA 4DNMA 4A6GA 2RFGA 4JQ2A 4U31A 5HINA 3L7RA 3PBGA 4FX6M 4XSLA 5EMYA 3MW7A 3NYDA 1W2VA 1PWLA 1ZP4A 2REQA 3M46A 2X0SA 3QMRA 4ICCX 4EX4A 2VT0A 1KBIA 3GIPA 4UNIA 2GK1B 1TJRA 4HZ7A 4Z08A 1P4CA 3GZ3A 3LPOA 4AU0A 1LWJA 5D9NA 2XU2A 5BZAA 3LQLA 2H8ZA 2OYMA 3HGOA 2VX5A 4CEUC 1DKWA 4AB4A 5L6UA 3LRLA 3H2CA 4O11A 2WANA 4GWEA 3TW9A 3S6TA 3R58A 4C6EA 1SJCA 2MUCA 4Z1YA 4KFPA 1ZBWA 2R1PA 5J5DA 2WVVB 3PPFA 4DJEA 2WWDA 2CBVA 1PBGA 3U57A 1WXJA 5C2XA 1R7AA 3VIPA 4A2SA 4E8GA 4TMBA 2VMFA 4IFRA 1LOQA 2FPYA 1J0KA 4HU0A 4I7WA 3H2NA 1O5KA 4XKYB 3W1QA 3VNIA 1JZ7A 2YCLA 1E51A 1TJ1A 1KKRA 2J7BA 1KBJA 2R94A 2UY2A 1J0IA 2QHAA 1XIJA 3DFHA 3I6TA 1TA3A 4ACYA 4B5WA 1LP6A 1LQ2A 2PTDA 5C71A 4JDYA 1M6JA 1VYRA 3GS6A 1U33A 2AQWA 3LV5A 2WVSA 4DLMA 1OCJA 3MDUA 3K8KA 1VFHA 4FNQA 3SN1A 3P14A 1XP3A 3W7MA 4I6KA 3VDAA 3SQLA 4I7UA 3GG7A 1K02A 5AC4A 1GOWA 1DWHM 4JIIX 1CB7B 1SQ7A 3W37A 4I8YA 1RLCL 3W2NA 5D32A 1VKFA 2P0OA 3OBKA 1XLAA 3CUIA 2QCHA 4ATDA 1K4GA 3SUWA 3WMLA 3P5YA 1U1UA 5D9PA 3WO8A 4KPLA 1WBHA 3CNYA 2LLEA 3S6OA 1MXSA 3S9YA 4XIMA 1SO3A 4E6MA 4WY0F 2OR2A 4DYKA 1IWBA 1X1ZA 1RBOB 1FXQA 4L80A 1FWGC 3GRIA 1QWGA 1D3GA 4WF7A 5K9CA 2I5GA 4M6UA 1RBAA 2NXIA 3N3MA 3NURA 3DFSA 3GU1A 3LYEA 3PY2A 1Y5WA 1WXZA 1XCXA 1W9VA 1V6UA 1JCXA 1DP0A 2PODA 3ORWA 3WQFA 1AUSL 2YBVA 2FH8A 4LF1A 1LM1A 3W1RA 2NX1A 3WH7A 4IIEA 1KTCA 1MFUA 2CBIA 3TEVA 4TVUA 3WLKX 3ZIZA 4H9VA 1MUWA 2GSJA 4PODA 1ZCCA 5HAOA 3TVAA 4Q4PA 1OG6A 4M24A 3MMDA 5I3KA 4F66A 4TX6A 2Z6IA 2ZZ7A 3VIMA 1XLEA 1JG9A 1PYFA 1KM4A 4AF0B 2ZWZA 4GFIA 4MNJA 4D6GA 2YDAA 1FP9A 3QQWA 5IBXC 2C14A 2B0MA 2YGYA 4DPQA 5EMKA 1U2YA 4ROQA 4ZSTA 3QJAA 3UF9A 2ZDSA 2PD9A 1PSCA 4W7UA 1CGTA 3C2FA 3G1VA 3LSBA 4JCLA 6PTDA 3OODA 2E40A 4RW3A 4RZ6A 4GJIA 1IXQA 2VEGA 5CH9A 4P8UA 3ZT7A 5AZ0A 4I6VA 4WKHA 1GYMA 2R14A 1R85A 1LROA 3N9RA 3BARA 3RMEA 1CENA 4GBUA 3BAYA 4P7NA