3QMSA

Crystal structure of the mutant t159v,v182a,y206f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIFLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qmsA00
3KXQA 1KFJA 3IEBA 4NZJA 5GVJA 1M5WA 1XKYA 3G1DA 4UTUA 4FNUA 4N02A 1O95A 2E6YA 3KAOA 1XXXA 2G96A 2G5WA 3GK0A 3VCRA 2XN0A 3PBVA 3IVUA 1IXNA 4O10A 3DFPA 1H7RA 1QMLA 1X1ZA 4PA8A 3DI0A 3IIZA 1H7PA 5E93A 1OFBA 1G4TA 2G95A 3G8EA 1Z42A 1FX6A 1M7OA 2A6NA 2RFGA 4FIRA 3NZRA 2JKPA 4AF0B 1I2PA 1SO3A 4QIUA 4JTGA 5LHFA 5DXYA 4UCGA 3PY2A 3PBUA 3LCHA 3O15A 1H1ZA 4K7YA 3GDMA 1NF7A 5F1UA 1FXPA 1AL8A 1JCXA 2A6LA 4N9BA 2FPTA 3WJSA 2WSYA 5HR7A 4POCA 2GVGA 4JGDA 1KFEA 2CZEA 1ML1A 1QO5A 3B04A 4O18A 3CB8A 3L21A 3NOEA 5D33A 5FEZA 4Q4KA 2VEKA 1I45A 4K8HA 4MYAA 5G1TA 4EOUA 3EWXA 4AWSA 5AHEA 3W2MA 1FBAA 3INPA 1SSGA 1UUOA 3I7SA 1J5TA 4OE7A 3M1ZA 3KX6A 1GQNA 4HNUA 3NQGA 2C3ZA 3IGXA 4UR8A 4LRTA 3I7QA 2JKAA 4YMZA 3UWQA 3W7RA 4DPPA 4LS1A 2J9YA 2ZZ1A 3NL3A 2R94A 4I7UA 1NAL1 5D02A 5CG7A 3LCXA 4HNNA 1WAUA 4DF0A 1FDYA 2X1RA 1QOPA 4LC8A 2FFCA 1QPNA 3IIPA 1DQWA 3GZ3A 2JGYA 3CC1A 5D30A 3RK8A 2AAMA 3M6YA 2RDTA 5G4WA 3PR2A 3W3OA 4LVBA 4IMEA 1JCMP 4ZZ9A 2IQTA 5L6UA 2QCDA 5LNRA 4OU1A 2A21A 3VE7A 3P7YA 1F73A 3T44A 2C6QA 2CFFA 3H55A 5CZTA 1IIHA 2QF7A 1YTDA 4O11A 3R2GA 4Z1BA 5AHFA 1VHCA 4O15A 3O6YX 4JICA 1SO4A 1VS1A 2Y85A 3TV8A 3W7EA 4UR7A 4JTJA 2ATSA 3DGRA 3FYOA 3THAA 2NXHA 1JRCA 3BG9A 3OA3A 4UC5A 1TQJA 3PF3A 3T55A 4S1FA 1SZNA 1TIMA 1N8FA 4IX2A 4JIQA 4LY8A 3G1VA 1F6PA 5AHNA 4O12A 3HQ1A 2VOMA 2GVJA 1LLWA 1WBJA 5G1YA 4IQLA 3USBA 1FXQA 1Q6QA 1A5CA 3OEXA 1TTQA 4JX5A 1EWEA 4HKPA 2Y7EA 3W9ZA 1TRIA 5G2HA 1EP2A 2CWNA 4RV8A 2NX9A 3UPWA 1KBIA 5KINA 2RKXA 2DJLA 4ZQMA 3THQA 4KFPA 1TO3A 4UTMA 4Z0SA 2QCHA 1KM1A 4YXGA 3N14A 3GIYA 2DZXA 3STEA 1XC4A 3NQ6A 2NV1A 3CWNA 4N4PA 3HGJA 3PVFA 3S6DA 1QWGA 3TA6A 2X2GA 1ONRA 3QQ0A 2DJXA 3IGSA 3KRUA 4RX0A 4NJGA 3H54A 5EMUA 1VCGA 3QQ1A 1O94A 1YXDA 3W7PA 1T99A 3BG3A 3V75A 1W31A 1QPQA 2E5CA 3KRSA 3G1AA 1OK6A 3W7CA 1P4CA 2ABBA 4O14A 1W8SA 3GXTA 1H1YA 1KM5A 1VQTA 4H6KA 4TU1A 1UCWA 2NWSA 5F2MA 4UNLA 2WNNA 2CZDA 4DELA 4XWUA 1ZAHA 2DORA 3PUOA 4RKAA 4AWTA 3LTYA 3M43A 4A29A 1TREA 1K7XA 4BR1A 1SR9A 4A2SA 1U83A 4IMGA 2ZZ2A 1FDZA 3GYEA 4MIMA 3CEUA 3FKKA 2WKJA 3W2NA 5K3VA 2NLIA 4I9AA 4NNCA 1HL2A 3P67A 4NU7A 4M6VA 3W87A 4QQ3A 5AYZA 4BI6A 3C8FA 3TDFA 1VCFA 1GVRA 4AHOA 3IIVA 1PL9A 1TYGA 2NX3A 4IJBA 3KVLA 4OBTA 2X16A 1JR1A 1XFBA 5C5YA 1VYSX 4R34A 2J9XA 3O07A 1XBVA 3MYOA 1W5NA 3CTLA 4IXHA 3EB2A 2DU2A 2C14A 3R13A 5K2ZA 3SJ3A 1F2JA 4MY8A 1Q3NA 2GQ8A 1FWSA 1Q6LA 1PS9A 3A24A 3MJYA 3YPIA 1HO4A 4FHAA 2YR1A 2J24A 3ATZA 2FDSA 3V1PA 2ISWA 3DKJA 4HNVA 2PE4A 4LRSA 3FA5A 1R2SA 3LHYA 2EHHA 3G0SA 3G18A 1FCBA 1P1XA 3G8RA 4LC6A 5EKYA 2BXVA 2C18A 1YADA 4OQVA 4QJ1A 5CZJA 3RNDA 1LROA 5G2IA 3M44A 2OX1A 3FLUA 2C13A 4K36A 1RR2A 3LV5A 2BWGA 1EA0A 3FJLA 5K9DA 1TTPA 5FF7A 3O6CA 1SW7A 3T78A 4O13A 3DHDA 1TQXA 4GXMA 4GWEA 4CCEA 1F5ZA 1M6JA 1CI1A 1KTBA 4HN4A 4NQ1A 3UWVA 5HQEA 1OYAA 5C2XA 1V5XA 4N9DA 4LV4A 4LTSA 1W5QA 4FNSA 3IVSA 4XBSA 2CLLA 5FEXA 3W72A 1SUXA 3Q94A 4TO8A 1UBSA 5CGQA 3CU2A 3TE9A 3F4WA 3Q58A 1QO2A 2Z1BA 1LORA 3ATYA 1ADOA 3MI3A 5LNUA 5BNKA 1RQEA 3QW4B 1XM3A 5HINA 3TJXA 4M7TA 2VFHA 1G4SA 3SY5A 4WQ6A 4WXYA 1WA3A 3N19B 3QFEA 4Y6GA 2Q3RA 1J2WA 4XUGA 1AW1A 3LRMA 3MWAA 4KWVA 4S2BA 3IGUA 1PE1A 1IGSA 3SGUA 5HJLA 3LRKA 1OX6A 1ZAJA 3B06A 1VLIA 5AYYA 4JXCA 3MUXA 2YYTA 4HIBA 1XDLA 4LOCA 3W2LA 3W2UA 3NQFA 1JULA 5DXXA 5CPOA 3KVKA 4O1AA 1T96A 5F2GA 3C4UA 4NXKA 2GOUA 1LZOA 2V82A 1LRNA 1IIGA 2J6XA 3DBPA 3QH2A 3ABQA 4Z0JA 4WZHA 3DFTA 2Y7GA 3BW2A 3EWWA 2WJZA 4NNBA 3R12A 4K37A 4K38A 1G6CA 3DU0A 5KZDA 1OFOA 4JTIA 2VXNA 3E12A 3MBFA 1JVNA 3RF9A 3NPWA 1LDCA 5F1VA 1KM6A 2E6FA 1N7KA 1Q45A 3S9YA 1KTCA 2BZNA 3W7OA 5HWMA 4X22A 3HPZA 3NXFA 2W0UA 1FY6A 1JUEA 4FNQA 3LCLA 2KZHA 1IXPA 4AHPA 3A23A 3B4UA 4GNJA 3GNDA 5D2VA 3W85A 3TJLA 4WXZA 3KHJA 1DORA 2EF9A 3S5YA 4W9TA 4IOTA 3UY8A 4K6AA 3BV4A 3W1TA 2E5DA 3W7JA 5KMYA 1G7UA 4O54A 3ZS4A 5FEPA 3EX3A 4Z08A 4WD0A 3W7KA 3ANYA 2VFFA 3QPYA 4DXVA 4N9EA 3R89A 2QCDB 4XQ6A 4ZQRA 4NVTA 3S5OA 3M0ZA 4JYDA 4M5PA 4LW7A 2VENA 5I3HA 1G7VA 3DFOA 3M5VA 3FIGA 1PCKA 3DFSA 2PC4A 1FCQA 3EWYA 1I2QA 3O63A 1OFQA 1TPFA 3U6WA 4IPIA 4MZYA 4O4WA 3C2RA 1H7OA 1QAPA 3PWAA 2ZZ3A 1JCLA 4NX5A 4N4QA 4HSNA 1XBZA 4QM1A 1W3TA 2QKFA 2WNZA 3W71A 3AO0A 4X2RA 3W7LA 2CLIA 1ICQA 4GJ1A 4NT0A 1LRQA 4UTWA 1KFKA 3LXCA 4MOZA 1MO0A 3C56A 3UWUA 5K4ZA 2WNQA 3C6CA 3C2FA 4RJEA 3I7RA 4GUJA 1TPVA 4WJEA 2G97A 4G1KA 3DENA 3HG5A 3M16A 4Y90A 7TIMA 2CLKA 1ZJIA 1S5TA 2V2HA 5CPNA 2NXGA 4MPQA 3I68A 5D04C 3NZ1A 3NVTA 1JCNA 3JRKA 4PL2A 4D2JA 4JTTA 4NXSA 5AN7A 3GKFA 4QITA 3QM3A 3PSVA 2WPBA 3NQ7A 3C0JA 3EX2A 3NDOA 4GBUA 4XKYA 4JNMA 4MJMA 4DPQA 3W1NA 1GPWA 2WQPA 3GR8A 3U8GA 5HMSA 2NXIA 2PRMA 3EXRA 5E1QA 1GVFA 1Q6RA 2E09A 5BRBA 4KWWA 4GC4A 1R46A 1K8YA 1X7FA 2ZFAA 3HPSA 1TPB1 3IIXA 3GDRA 3BW3A 1F76A 3VNDA 2Y70A 4FNPA 1LTDA 3NG3A 3PC0A 3QPZA 2GVLA 3W1PA 2V0TA 1T8XA 4K7VA 3PG8A 1TPDA 3WJYA 4LWWA 3KOFA 3GNNA 3G1FA 4JYFA 2QAFA 1TTIA 5A5WA 1OJXA 1MSSA 3G24A 2FLIA 3W07A 4UFKA 1AW5A 5K7JA 1LOQA 3FS2A 2YFNA 1LBMA 2ZZ6A 2YXGA 3CQ0A 3N2MA 5KSWA 3DKLA 1OX4B 1SW3A 1WOAA 2O7SA 3K30A 3MMTA 2BTMA 1D3HA 1Z48A 5HWNA 3VI2A 4UMCA 4CQ9A 4EWND 1DVJA 3U2OA 1TRDA 3W7DA 1JUKA 2A7NA 2P1FA 5LGXA 3OIXA 3VE9A 4MZ8A 1EUNA 2Q3OA 1VYRA 4FO4A 2TSYA 1HTIA 3NQVA 3GDTA 1B4KA 4JX6A 3LI1A 5DLCA 1OFRA 2NWRA 3O05A 3QRHA 1KFCA 2FQIA 3N34A 1PV8A 4ZQPA 1W0MA 1M7PA 1S3HA 4FXSA 3Q2DA 2ZRVA 2VKZG 4N2YA 3GXPA 1UUMA 3NM3A 2A1YA 3M5YA 3PBYA 5KITA 3PG9A 4OV4A 5EA9A 1YXYA 2EPHA 4AAJA 1JCYA 2HS6A 1PHWA 5EPDA 2QJHA 1EX5A 2ZZ5A 2DZUA 3TXVA 3T4CA 3GB6A 3EKLA 4MY1A 2E68A 4QISA 5LNSA 3OVPA 4O53A 3TCEA 3N9SA 2GJLA 1OFDA 3MBDA 4UTIA 4YWIA 3P74A 5EL1A 3L0NA 2QUTA 3O16A 2QCEA 3SECA 1NFBA 2E6DA 4MVAA 1KM0A 2QEZA 3GXNA 2P0OA 3TSBA 3TX9A 4MZ1A 2JGQA 5K9CA 2A85A 4NUWA 4N9CA 4AVFA 1PVNA 3GR7A 1UASA 3UZ5A 2Y7DA 1SFLA 4RZ5A 1DBTA 1ME8A 4ZQCA 5TIMA 3W7GA 4LU0A 3TU9A 5K4XA 1L6YA 4O28A 3RMJA 5A8GA 5D2YA 3LM7A 3M7WA 4HPXA 4N6EA 1N55A 2NV2A 2X1SA 5J5DA 1KV5A 1P0NA 1LCOA 1G69A 1P0KA 2VC6A 3TH6A 1MEHA 3HJZA 4UTTA 1YDNA 1RPXA 3LB0A 4UTJA 1L6SA 3F03K 3L5MA 3N3MA 1EIXA 5CKSA 1YDOA 4L4LA 3HG3A 3F1QA 2FB3A 3P61A 3CHVA 2A7PA 1A50A 3SI9A 1JQXA 5DN1A 5D2WA 1GVSA 2A5HA 4BF9A 2C0AA 4WY0F 2NX1A 2CLOA 3B0PA 2B7NA 3A22A 5H91A 2H90A 2X30A 3OG3A 3W76A 4LNYA 3W74A 4IMCA 5LZLA 1SZGA 1Y0EA 5LSMA 3W86A 1GWJA 3LHZA 3W1LA 2TRSA 3B8DA 1W3IA 2HS8A 3UXDA 3PUEA 3W2JA 3GX9A 3G1YA 5C6MA 4EF8A 5D05A 3S1XA 1GOXA 1AW2A 4KKXA 3EX6A 4PC8A 3LCIA 1OABA 3QMSA 2ZBTA 5AHLA 4ZMGA 1FWNA 3L9CA 1GEQA 2BSLA 3ZFHA 3HBLA 2V81A 3GDLA 5FF2A 1UJPA 4QNWA 3PS7A 3C2EA 2F7FA 1KLYA 3LCGA 4U28A 5DCBA 3R5EA 1DL3A 4XBKA 3S1VA 1DHPA 5G4EA 2ISVA 4LVDA 4U4MA 1BWLA 3P82A 3CM4A 4WOQA 5IBXA 1LBLA 4O57A 1TV5A 3BG5A 2J27A 1MEWA 4CLMA 1V7YA 1KBJA 1GG0A 1AL7A 1L6WA 2EGZA 3S5NA 2H3BA 3PULA 1QCWA 5ABTA 3LLFA 1VZWA 1WDWA 1W5OA 3W7QA 1G4PA 1GZGA 4CCDA 2B7OA 3W7NA 5EBUA 3PB0A 4TIMA 3QSTA 4OT7A 1XI3A 3UQNA 5LNVA 5MHBA 1FQ0A 1Z44A 5EYWA 5U7SA 3B05A 2WOQA 3HG2A 1KA9F 2Z6JA 3G3DA 3TMQA 3NQAA 3WJWA 1F6KA 1TV7A 4O0ZA 1ICPA 1C9DA 3UPBA 2W79A 3EEGA 1AMKA 4UTKA 3GDKA 3WK0A 3LRLA 3M41A 1DKWA 1XDMA 1GT8A 4ZL1A 2X1UA 1R30A 2CLHA 2A2IA 3TAOA 1L2UA 3VFLA 4GUHA 1TJRA 1G67A 4CNPA 4FEZA 3L68A 2V5BA 3QEZA 3TXZA 3NNTA 3TC7A 4B5NA 3E0IA 1MXSA 3EX4A 3P62A 5HNRA 3P5ZA 1TMHA 4DO6A 2CLEA 2WV8A 1RZMA 4JS3A 1K3UA 2ATMA 1YPIA 3S0CA 2Z2UA 3TQ0A 1I2RA 1W5MA 3TW6A 4XTDA 4R33A 4HSOA 4AB4A 1R2RA 5LHEA 3NQEA 5D03A 4E38A 3FOKA 3KVMA 2LLEA 2V30A 4UFJA 3ELFA 2F84A 1W1ZA 4O16A 5DELA 4ORIA 2ZTJA 3NO5A 1OFEA 3W6YA 2XN1A 5I3FA 2VFGA 4PTNA 2WSRA 2Y88A 1RQBA 1WBHA 3W75A 1K02A 3PBWA 3W1AA 1SQ7A 2VFIA 4M6QA 3SGZA 3EKZA 3SIZA 1IXOA 1XBYA 3G1SA 4CNNA 4GFSA 3ABOA 3TK7A 2GQAA 3NR0A 4ADTA 1SSDA 4K39A 2JK2A 4GE8A 2VEMA 1TV8A 3LHUA 1W54A 2TPSA 3L5LA 3W22A 2GQ9A 3L5AA 3E49A 4MLJA 4EF9A 1P5BA 5CZSA 5HR6A 3IV3A 3NL5A 4S2CA 1NVMA 4DEFA 4XKYB 1B4EA 4WY0A 1NF0A 1SU5A 4AEOA 4C1KA 5HUPA 4ML9A 1H61A 1W37A 3QYQA 4R7JA 4RZ4A 2DZPA 1EWDA 4MFDA 1PCWA 4PCFA 4RCXA 2QJGA 4A3UA 2ZYFA 5AC7A 4RK8A 1OYBA 5AHIA 4JTEA 3VKJA 3WK2A 1B9BA 4NJIA 4J9JA 3LBMA 2NUXA 3N73A 2DP3A 3NQCA 3BARA 1DJNA 1SFJA 5E0KA 5AFDA 3SR7A 1H7NA 3MP3A 4RR4A 3S42A 2J88A 5I3IA 1H63A 1VH7A 4UTTC 3UXAA 3DFQA 4AWUA 1TPUA 1D3GA 2BLEA 4MYXA 1JUBA 2TMDA 3QW3A 4FIQA 4UIOA 1EUAA 3CWOX 1H51A 4P61A 3RU6A 3LV6A 3CT7A 3UWYA 3NPXA 3ZWSA 3P81A 4IXXA 2RDWA 2Y89A 1OK4A 1XUZA 1GJPA 2ZRXA 4LVAA 4XTIA 5I3GA 4UNKA 4FNRA 3LHWA 1QR7A 4HHPA 4ADSA 4CQ8A 1I2NA 5F2LA 1KLZA 3F4NA 4IWWA 3MO7A 1DV7A 1CW2A 2NUWA 3DFNA 3EXTA 5J5RA 2QJIA 3RFAA 4NJKA 1VRDA 3KRZA 1U5JA 5F4SA 1WOBA 1GTHA 3EXSA 1QDSA 3OVRA 3G1HA 5FESA 1C8VA 2V2DA 3MYPA 3O1NA 3O6DA 8TIMA 4M7SA 2X1TA 3FYPA 1LOLA 3FJ6A 4HT3A 1W5PA 3UWZA 1GYNA 1K03A 1LM1A 3HB9A 3QJAA 4Z1CA 2GUUA 4RXGA 2E1DA 3UYCA 2YDAA 3BVJA 3L66A 2QUUA 3W88A 4E2BA 3W1UA 4UUIA 3NQ2A 3W83A 5IBXC 2JBMA 2Q8ZA 3UZJA 2EAWA 5BMXA 2XFWA 1D9EA 3BLFA 4O50A 3NL6A 2CLFA 3QMRA 1BWKA 2C1HA 1NEYA 3HGSA 1TPH1 2FPYA 5AOUA 3L0KA 4QNEA 3W1XA 4ZQNA 5FF0A 5G2WA 3NA8A 5TBOA 4CCCA 4UFIA 3C3NA 4O8RA 1RVGA 1SO6A 4RXFA 3W84A 4OV9A 4BFAA 1ZFJA 2ALDA 4NJJA 3M5XA 3NGJA 4FNTA 2A7RA 4GUIA 5TQLA 3UNDA 2V2CA 4O19A 3SSJA 1LOSA 4M6PA 4DQWA 2HSAA 3E96A 2DZTA 2WO5A 3PM6A 3M9YA 2UV8G 1B57A 4YLWA 2YYUA 2YX0A 3OBKA 4CNOA 4TMBA 1OF6A 3WJZA 1MZHA 2BX7A 1S5WA 4IMDA 3EWUA 1WX0A 3W7IA 5BOOA 5H2ZA 3LHTA 5D2TA 1HFBA 1YDVA 1OYCA 4BWLA 2XN2A 3IVTA 2C15A 3MHUA 2ZCGA 1LP6A 2HMCA 3W1MA 2YCEA 3IIOA 3NM1A 3NPUA 3BPWA 4IX0A 1SZFA 3I6RA 5D09A 3GAKA 4PH6A 1VC4A 2Y6ZA 3LX9A 3P8JA 3W1RA 1W56A 4HNTA 4I7VA 1PIIA 1XBXA 4JEQA 1ME9A 3UD6A 3NL2A 5BW6A 4TMCA 1WQ5A 4IUOA 2QAPA 1UB3A 3LERA 3NYZA 4EVZA 3C2VA 2ZRYA 4P2VA 3GLCA 3G0UA 4LV9A 2A4AA 5KTLA 5L9FA 3S1WA 2RDUA 1EB3A 3DAQA 5DBTA 2FIQA 1OHLA 4JX4A 3WK3A 1TB3A 3N9RA 1WV2A 3OVQA 3TC6A 3HIJA 2ISSA 4UTLA 4NX0A 1ZENA 4LVFA 4UFMA 1S5VA 1GYLA 1JJKA 1FCUA 4YL2A 1LYXA 1ZY9A 4JTLA 3R8RA 4QAIA 1FWWA 1R2TA 2VELA 1H5YA 3P5YA 3BGGA 4TX9A 1DQXA 1I4NA 1KM2A 1TTJA 3WFAA 4PL1A 4Y9AA 5KZEA 2CZ5A 3PSWA 1GVQA 4DBEA 2PCQA 5C55A 1J4EA 5AYXA 1HG3A 1RV8A 2H6RA 2I9EA 3UY7A 2RH9A 5KZMA 3LXBA 2OMAA 2VEIA 4OHQA 4JDYA 3HG4A 3PUDA 5CZ0A 3LGEA 2H3DA 1Z41A 2R14A 3G22A 2OCZA 1FDJA 5CPLA 3S1UA 4RLIA 5D38A 3EWZA 1KV8A 3MHFA 1WXJA 1JQVA 1TPC1 2V5LA 5D32A 4Y8FA 1ICSA 3N2XA 1LLZA 1TPEA 2HTMA 1ZNNA 1IXQA 2R8WA 2GPTA 3KFTA 2Z6IA 5HULA 4R53A 2CZFA 4YCPA 2JKEA 3NQDA 1EP3A 3L67A 3STFA 2C16A 3E9AA 4JY8A 3UWWA 4OGZA 2VFEA 3MI2A 4JTSA 4AF0A 3BO9A 5LNWA 2YSWA 4ADUA 2RHGA 1T0OA 4MUZA 3DXIA 2ZQ0A 1LRTA 3TW7A 5I3KA 3A5VA 4PEKA 5DY2A 1F05A 3TAKA 2O7QA 3O06A 1A53A 3QF0A 3CIXA 2NUYA 3C2OA 1KFBA 1OFAA 3LHVA 2ABAA 1HO1A 4YCOA 3TKFA 3T40A 4JYEA 1VPXA 2QCCA 1O5XA 1R47A 3PAJA 3NQMA 4O52A 3TSDA 3HMJG 4H4IA 1YPFA 2GJNA 2QCFA 2B7PA 2VEPA 1DJQA 2P10A 2V8ZA 4WUIA 1TSIA 2QDHA 4MJZA 1MEIA 3LOTA 3EWBX 3P84A 3W73A 3CIWA 2ZRZA 2I1OA 3MHGA 3WK1A 4UTWC 1EP1A 1H7XA 4FX7A 2ZRUA 2PRHA 3QZEA 5DCDA 1ZAIA 5DY3A 1KFLA 3P80A 5HWJA 2Z0IA 1PHQA 1IF2A 1VGAA 5IM51 2YGYA 3MW7A 1VR6A 1XL9A 1YXCA 4MY9A 4A22A 2E5BA 1ZCOA 1BTMA 3B0UX 1EEPA 2W6RA 4JTFA 1L9WA 3HO8A 1I8JA 4A21A 2CU0A 2TYSA 3LCWA 4UMAA 5EY5A 1BKSA 1WYIA 3T7VA 1XUUA 4O4VA 3KVJA 3CLMA 2VFDA 5F4WA 1OX4A 3BK0A 4WY0B 5CSRA 5D2XA 3DZ1A 1JCJA 3W23A 2E6AA 5FF4A 1F74A 3SFKA 2C19A 3NAVA 1SZEA 4HPJA 3A9IA 3CPRA 3FKRA 4FX6M 2WSQA 3MP5A 2OJPA 1B3OA 1QPRA 1KM4A 1ZHAA 3L0GA 3JR2A 1VYPX 3TQVA 2QUVA 4NNAA 4PFMA 2FB2A 4JN6A 3RLVA 4Q33A 4BWLC 1OFPA 4Y96A 1OX5A 2V9DA 3TFXA 1ALDA 3P8IA 2ZDRA 3DHFA 2FPVA 1QFEA 2OT1A 4K8EA 3ZWTA 1H60A 3E02A 5AC8A 3FFSA 4JD4A 4I7WA 1VJIA 3MI6A 3SW6A 4N6FA 3M5ZA 3QC3A 1GG1A 4GRSA 3BW4A 2EKCA 3B0VC 2B4GA 1W3NA 4AXKA 4CQAA 4LUJA 3LTSA 3Q37A 1LBFA 5FF3A 4O17A 4ZQOA 1GTEA 1KW1A 2QCGA 4X3ZA 5HUOA 3W70A 1OVDA 4WOZA 3EX1A 3CEPA 2ZA1A 3AJXA 4Z1DA 3LI0A 2E77A 3RLUA 4MLRA 3W7HA 4KFNA 1NSJA 2H8ZA 3S5ZA 1FCVA 4DO5A 3LCFA 3LXAA 4DO4A 4OWGA 4UMBA 1QPOA 2ZA2A 2ZTKA 5DBUA 3A5FA 4BI7A 1X6UA 4C1LA 1SW0A 1OF8A 4FXRA 4LVGA 2CW6A 3TNOA 2QCNA 1AK5A 1X8FA 1YTEA 2D73A 3STGA 1O5KA 2FTPA 3PB2A 6TIMA 1HUVA 3W1QA 1EPXA 4JR5A 3LLDA 4NZFA 1SO5A 5U4NA 3HGOA 1AG1O 4DBDA 2PURA 1THFD 2OZ0A 1KM3A 3C61A 3L2IA 4JIPA 3I65A 4L4MA 3TFCA 1C29A 2CLMA 3TQKA 3QSRA 3HGRA 4ICNA 3G1XA 5D37A 4O0KA 5AHMA 2FJKA 3A21A 5AB3A 2ZRWA 4ZVJA 3W2KA 1H62A 1Q6OA 4BI5A 1DOSA 1TPWA 2A0NA 3HPXA 3DH7A 1KTNA 1I2OA 4LUIA 4GUGA 5I3JA 4DF1A 1H50A 2AQWA 3G3MA 1YTKA 4PODA 2ZA3A 2H8XA 4ALDA 3H53A 4Z1AA 3ABSA 4O1DA 4JTUA 3LTPA 2Y63A 1K8ZA 3STCA 1K7EA 5K9XA 4UFLA 4JTKA 1A5SA 4AHQA 4JY9A 1VCVA 4X9SA 5F2IA 2NZLA 1OG0A 2Y62A 4E2DA 1GVOA 4ORMA 1RQHA 4E0CA 2DZWA 4WX2A 3DI1A 1VLWA 4M19A 3TSMA 3S8HA 4EIVA 2J9ZA 1X1OA 2AGKA 2OT0A 3IRDA 5DCEA 3FEMA 5CSSA 4TR9A 1H7WA 4IPJA 5SWUA 3NEVA 1YYAA 3NPVA 4O1BA 2I14A 4BK9A 3P60A 4MFEA 5LKYA 3QMTA 2QDGA 4NJHA 4A2RA 2ZZ4A 3C52A 3G0XA 3OHIA 4Q32A 2YW3A 2YPIA 2ZZ7A 3LDVA 3O8AA 1CX9A 3B03A 5CPMA 3L65A 1TJPA 3SZ8A 5BMWA 1F7BA 3W7MA 1XCFA 1RD5A 1A5AA 2DZSA 4FX8A 4RZ6A 1A5BA 3D0CA 1E51A 1QNVA 4QSHA 1O60A 1BEUA 1K7FA 3GAYA 3ZR4A 3BLEA 1ME7A 2B0MA 4UFHA 3MP4A 2QCLA 5T26A 2B7QA 5FEWA 1K8XA 4LS0A 1FUYA 3M47A 4UTHA 2Y61A 2QCMA 3TROA 5G5IA 1YLVA 3TUUA 3TIMA 2YW4A 4ONVA 3JS3A 1O4UA 1FWTA 4UXDA 3LBCA 3BGJA 4MKNA 6ALDA 1ZALA 3GKAA 3WJXA 4FF7A 3ABRA 1FWRA 3HOJA 4JTHA 4LS2A 2PRLA 4KFOA 4LT9A 2Y7FA 2R91A 3BLIA 3TR2A 1TCDA 2YFOA 2QR6A 1QOQA 4GUFA 4IGHA 4DF2A 2YZRA 4O1CA 5F4XA 1G4EA 4H3DA 4FB7A 1SPQA 4IMFA 2DZVA 3HF3A 4XZ9A 3TMLA 1VHNA 3GVGA 5LGZA 4AH7A 5C54A 2Q8LA 4AMAA 4JDBA 5FI8A 3NQ8A 5AC6A 1JRBA
chains in the Genus database with same CATH superfamily
1KFJA 4NKCA 4ML4A 3E2RA 1H1NA 1M5WA 1XKYA 4UCFA 4MNMA 2G5WA 1A47A 3GK0A 3VOFA 4QFUA 3MB9A 3PBVA 5CJ5A 3RIKA 1IXNA 1QMLA 5CAHA 4PA8A 4MWAE 3IIZA 3VKCA 1OFBA 3OA5A 4DO7A 3GXMA 2J7BA 1FX6A 2A6NA 2RFGA 2ZX9A 2JKPA 4AF0B 1EYEA 4JTGA 3ABZA 4KRUA 3LCHA 3VA8A 3LM3A 4UQBA 3O15A 1H1ZA 1Y5WA 3KS5A 4K7YA 3GDMA 2YA0A 1XJBA 2A6LA 4BF7A 3CL8A 3FW6A 3WD4A 4YYCA 1FWEC 4O18A 4M3PA 4Q8MA 4O1FA 4Q4KA 5G1TA 5AHEA 4HK5A 3LU2A 3S2CA 3INPA 1C7TA 1UUOA 3M1ZA 3OBEA 4ZBCA 4QBXA 4V28A 3M0YA 3F5JA 1B9ZA 3EB3A 3NQGA 1AJ0A 1KFWA 4G8TA 1PTDA 3CJPA 2ZZ1A 3NL3A 4JTAA 3TYDA 2GGEA 1XX1A 4ZEPA 1VBGA 5D02A 2QYGA 2G0WA 3LCXA 1WAUA 4DF0A 3DG7A 1AD1A 3LK6A 1QOPA 1UKOA 2FFCA 4GG9A 1KQZA 3GZ3A 2JGYA 3A6OA 2OWXA 2AAMA 1QASA 3M6YA 4PRRA 5G4WA 5A8MA 4I5XA 1E6RA 3W3OA 1W2VA 4OU1A 3VE7A 4GXPA 1PX3A 3P7YA 4FLSA 1F73A 4TVCA 4MB1A 2C6QA 5EMYA 3H55A 1RPKA 2QF7A 3WKZA 3AHXA 3ARSA 1E40A 1UYQA 1E73M 4O15A 3O6YX 4P8VA 2Y85A 2CBIA 3TV8A 2FGLA 4UR7A 4JTJA 1EJXC 1PB0A 4KS0A 3THAA 4IIDA 4XK2A 1OC7A 2R82A 1LL7A 2CHRA 1E0XA 4W85A 4MTVA 3T55A 3PJWA 1E0WA 2G50A 1SZNA 1TWDA 1N8FA 5A6BA 2SFPA 2DY3A 4GH3A 1X98A 3HQ1A 3KWSA 1I1XA 1JYVA 3R79A 2F6KA 2ISFA 2F6UA 1EXBA 1EP2A 2XFYA 3I10A 3G77A 2NX9A 1Y8BA 3SN4A 4IG2B 1PTAA 4LAOA 2RKXA 2E7FA 4ZQMA 3THQA 2XFFA 4Z0SA 4KEVA 2OYKA 3GD6A 4QSFA 3GR4A 2DZXA 2YKKA 4AD3A 1Z32X 1W9VA 1QHZA 3UCQA 4HK6A 2J7GA 1XC4A 5C9XA 1TX0A 2YL5A 4N4PA 3SO7A 2G3JA 1WDDA 1ONRA 3QQ0A 3M0KA 3H54A 2VHLA 1KCZA 2XIQA 1O94A 2GFTA 4MWAA 3UZWA 4LUTA 2P0IA 2XUCA 1DE6A 1DE5A 3KRSA 3W7CA 5J8LA 2ABBA 2QMKA 1W8SA 3CB3A 4IPNB 4BQ2A 4A3QA 1V6UA 1NM9A 4H6KA 4TU1A 5F2MA 1EGMA 5IDZA 2CZDA 1A0DA 4XWUA 4AWTA 4BR1A 5FKYA 3WF0A 1U83A 1O1ZA 3LYEA 4ROPA 2AQVA 1HL8A 3W2NA 1EGZA 2GJPA 1YE4A 4NU7A 1TZZA 3ZO9A 4DJEA 3VVGA 4W7VA 4BI6A 3TYAA 1NP2A 1QJWA 3KZSA 2CBJA 3BH4A 2BG5A 5FIPA 1CTNA 4IJBA 3BAKA 5C5YA 4W93A 1XD0A 2WKLA 1IZJA 1Y7VA 3H7RA 6XIAA 1MWOA 2J9XA 5EFFA 2F2KA 2PI6A 1MW0A 3CNYA 4Q7BA 1XRTA 1OBAA 3PUGA 3EB2A 5A2BA 5DMYA 1R85A 2C14A 5D8ZA 3VNJA 3K2GA 1F2JA 1Q3NA 2PDLA 1Q6LA 3VD9A 1P1MA 1UWAA 4AZCA 4ASTA 3MJYA 3YPIA 2FDSA 3BSMA 3V1PA 4HNVA 2PE4A 2QZRA 1F6YA 4LRSA 1EHNA 1ZTVA 3LHYA 3K4AA 2ZX7A 1FCBA 1RA5A 1JF5A 3UBPC 4CUCA 5CZJA 1LROA 4HMDA 3PTQA 1Q7QA 4M81A 5DRIA 2AL1A 1RR2A 5K9DA 1ZB5A 5FF7A 3E5BA 1V3JA 3SURA 3O6CA 3DN5A 3T78A 4GXMA 2OQYA 4CCEA 1F5ZA 1CI1A 1BF6A 3UWVA 5HQEA 2R1PA 3PZNA 4XIMA 2ZADA 4BQ5A 4FNSA 4Y8EA 4NAEA 3NXLA 5FEXA 4H9TA 1SUXA 2DPEA 1V0KA 2O56A 2XSXA 3VM5A 3K1DA 3F4WA 3QV8A 2WMFA 2PD5A 4WIWA 3SQSA 4REQB 2OQHA 1LL4A 3SCQA 5LNUA 4Y9PA 2VR4A 4WLCA 1HQTA 4W89A 3FHAA 3CV7A 4A4AA 1E0TA 3M0XA 1TWIA 3WMLA 3TW9A 1C92A 1J2WA 1Z3NA 3LRMA 1YMYA 4L4OA 1OX6A 1CDGA 3ZXWA 3WLOA 1VLIA 5AYYA 2YA1A 4JXCA 2YYTA 3GG8A 4HIBA 4IMAA 5JIPA 3QV6A 3W2LA 3URAA 3KVKA 3WF3A 3N15A 4L6OA 4NXKA 3B8TA 1LZOA 3AMCA 3DBPA 3KL0A 3QH2A 4WZHA 1BQCA 5CGTA 4J3XA 1NIUA 2VOTA 4L6HA 2D23A 2GJXB 4RE0A 5C7VA 3R10A 2WVTA 2VXNA 3ARRA 3E12A 3MBFA 4H83A 1W9PA 4H9XA 3KCOA 1MUWA 5F1VA 2PU1A 2OKTA 4E2OA 3BTNA 4AWEA 1KTCA 2PDPA 1XINA 4W86A 3WCZA 3NXFA 3VO0A 5FA5A 7ODCA 3S46A 2EO7A 5CAKA 4D8ZA 2WMJA 2P76A 3BMWA 1W9BM 3A23A 3DOPA 4G1NA 3B4UA 5GQBA 3GNDA 5D2VA 2EG8A 1Q65A 3KS6A 3VMNA 1I60A 3CV6A 3KHJA 1DORA 4WXZA 2CNCA 5GNXA 3AXKA 2TODA 4K6AA 4HMNA 3W1TA 3VNKA 1NP0A 1G7UA 4RNIA 1A4LA 5FEPA 4FF5A 4YVVA 2XGBA 1XV8A 1B3WA 4PMXA 4GK8A 4R7OA 4XQ6A 4ZQRA 3RN6A 1DTUA 4OIFA 4BCEA 1UR8A 1D8CA 5AC4A 1P0DA 2VENA 3GTFA 3HQNA 2VT0A 3FA3A 1JDEA 4PCPA 4YNGA 3WNMA 1M41A 3O63A 1OFQA 3U6WA 4HZMA 2ZUSA 3APGA 4BJHA 1W3HA 1H7OA 2ZZ3A 4NX5A 2BVTA 2EBNA 4XZIA 1W3TA 2QKFA 3KCLA 2BFGA 2WWDA 3UA4A 1F61A 3CV2A 1V8EA 2CLIA 2HVNA 1LRQA 3KUMA 2YL6A 5CPQA 5ECUA 1C91A 3L4TA 3VCCA 3O6AA 3WUGA 4GUJA 1CB7B 3NGFA 3ZJ6A 2G97A 2V6AA 3PZIA 5C0QA 3UESA 3HG5A 4Y90A 3SADA 1J2BA 7TIMA 1E1CB 3B9EA 2G3NA 4ECLA 2CLKA 3WQ6A 3V5FA 3AIWA 4DX3A 3PTKA 1AJZA 3NVTA 1KRMA 1JCNA 4D2JA 4QR6A 3EDJA 5CC6A 1J0HA 3NDOA 4GBUA 3W53A 3DEQA 3NURA 3B8WA 3VC6A 4MJMA 3VKAA 1H0IA 2FJUB 3W1NA 1EH9A 3NSMA 4C6IA 3S3GA 5E70A 3NYDA 1XYZA 1ZU8A 5E1QA 2F61A 1NQKA 3C5QA 2QPUA 1R46A 3HPSA 3LA4A 3HMCA 3GRIA 3HZ3A 3PJUA 1F76A 3LMZA 2DUXA 4J7RA 4MNJA 3PC0A 4FPSA 3QPZA 2GVLA 4JTDA 3W1PA 2PWDA 1ENUA 2DFAA 1TPDA 4PB4A 3KOFA 1RA0A 4JYFA 2QAFA 5EGRA 1IHIA 5A5WA 4QJ4B 5FL0A 3TJIA 5A6KA 5EMJA 2FLIA 5CLWA 5K7JA 4M51A 4JFTA 2ACUA 3CMFA 2YXGA 3V3WA 4R3UA 2P53A 4Z42C 3KLLA 3VI2A 2ZX8A 1YNPA 1J6OA 3SRHA 1JZ3A 4ZOCA 2PLKA 3U2OA 1FHVA 4C6QA 1IE7C 2XIIA 1EL3A 1K6AA 2P1FA 1J9YA 4QDWA 5LGXA 1EUNA 4LYPA 3VU2A 2HE5A 4H2HA 2HCVA 4JX6A 5DLCA 1OFRA 3O05A 1ZRQA 2YDRA 3N34A 1PV8A 5ABFA 2WC7A 1VFTA 3AXMA 3Q2DA 4GLEA 3NIYA 1X6LA 3NM3A 2G3MA 2PODA 3NDZA 3M64A 3PG9A 4OV4A 2QIWA 1PHWA 4JTCA 3M46A 2QJHA 4QS6A 5LA2A 3GB6A 5FJOA 3T0TA 4QISA 5LNSA 4R5EA 1PX8A 5M1TA 3U2CA 2E9BA 2Z4GA 3TCEA 1UZHA 4B90A 3PZGA 2GJLA 3IUIA 2BNJA 4UTIA 3WQGA 3CK5A 5IDIA 1NFBA 5T9BG 7ENLA 4MKVA 3V18A 2P0OA 3HV8A 5K9CA 1X39A 2WZHA 1PVNA 3CHDA 5TD4A 4PBGA 2P3ZA 5TIMA 1I6NA 4LU0A 4PB3A 3N9KA 3QHOA 5D2YA 4CQCA 4CQDA 4N6EA 2NV2A 1G69A 3HJZA 3L2LA 4K1GA 3ZT7A 2NQHA 3PTMA 3C8NA 3F1QA 1X6NA 3CHVA 2A5HA 3R7MA 4BF9A 4XVDA 3WIJA 3ARQA 2B7NA 5H91A 2H90A 4DLFA 3UJRA 1JCTA 3W76A 4LNYA 3LQGA 3N2TA 3PTDA 3W74A 2KAUC 3WEZA 5LZLA 1SZGA 1Y0EA 1GWJA 3LHZA 2RGLA 2TRSA 3RYSA 3S1GA 2HS8A 3GX9A 3VGHA 4RUBA 1G1YA 5E9XA 4KKXA 5T9CE 3HPFA 4J2MA 2C8NA 3QFWA 4H04A 3IJIA 3QMSA 2ZBTA 4Q8TA 1R7OA 4Z2GA 5JVLA 3L9CA 1HF6A 3N25A 1GEQA 2BSLA 3HBLA 3I4EA 2E1WA 2NW0A 3PAOA 5MKGB 4U28A 5DCBA 3SUUA 2XGZA 4PBEA 4F0SA 2VX7A 4E8GA 2ISVA 4LVDA 2JFEX 4Q8VA 3P82A 3CM4A 1JAEA 4UTFA 5IHSA 1YE6A 2PZ0A 5IBXA 1OGGA 3CWHA 4AD5A 4G56A 1TMQA 1ZJHA 3PZQA 1F3TA 3CIVA 3EMQA 5G4HC 2WHLA 2H3BA 2FFIA 3QPEA 5ABTA 1VZWA 1WDWA 2YCLB 4CN6A 3W7NA 2Q09A 1P6BA 1XLDA 5EBUA 4TIMA 3FHQA 1S2TA 3QSTA 4OT7A 3PN8A 5MHBA 4DUXA 5EYWA 1YNQA 2DT0A 3G3DA 3WJWA 5M2FX 1F6KA 1KB3A 2X2YA 4O0ZA 2V38A 1C9DA 3MMDA 1CIUA 3EEGA 1X1NA 3RJYA 3GDKA 3PJTA 4RDVA 3LRLA 3WDRA 4ZL1A 3WUBA 2X1UA 1R30A 4PB5A 3TAOA 1L2UA 4GUHA 4HU0A 1XIIA 1W91A 3QEZA 5H8UA 4QLLA 1XYLA 1HVXA 3VIPA 3EX4A 3P5ZA 2YL9A 1TMHA 1MQPA 4J3TA 5CJNA 1RZMA 5IFPA 1WDRA 3WLLA 2HISA 4L56A 2ATMA 3TQ0A 1T8QA 1I2RA 4EKJA 3DG3A 3TW6A 2E28A 1NELA 4E38A 3GG7A 5ABGA 2NQJA 1W1ZA 2OTDA 4Q8OA 2P8BA 5DELA 3OLDA 1OFEA 2XN1A 1GHRA 2VYOA 4PTNA 4Z2KA 2XWDA 3F2DA 1MXDA 1R7AA 4JHMA 3W75A 1EIBA 3VIOA 3AXIA 3ALGA 3SGZA 1EFZA 3UF9A 3UW6A 3OGRA 2NV9A 4CNNA 2Y4SA 4F40A 3TZFA 3NR0A 3SEPA 3R0UA 1SSDA 4K39A 1A0EA 2VEMA 3BAYA 1TV8A 3LHUA 3E1F1 4LB3A 1NFPA 2TPSA 4L61A 3W22A 2GQ9A 3L5AA 3E49A 3H8AA 4EF9A 3NQBA 1XSKA 4NP7A 1NVMA 1US0A 4WY0A 3WLPA 1NF0A 1RAKA 3WLIA 4XAFA 5B7YA 2IUZA 3QYQA 1J8VA 4PCFA 5AC7A 2DP3A 1DJNA 1TVLA 5E0KA 4ZO6A 1NDWA 3MP3A 4RR4A 2J88A 1ZCCA 3K4WA 4GX9A 3K4DA 4E8CA 1H63A 1VH7A 4UTTC 4Q4SA 3D46A 4AWUA 4Q8NA 4H6RA 1D3GA 2BLEA 4MYXA 1HW6A 4D71A 1WKEA 3G6LA 1UC5A 3IJ8A 3R0KA 4TOQA 5I6SA 2TMDA 4UIOA 1RP9A 2GQ3A 4GXWA 4HHHA 5EFDA 2OZ8A 1FWJC 2OLSA 1RUSA 4H7ZA 2IPFA 4GYKA 2Z28A 4IXXA 4ZO7A 3XINA 4LVAA 4XTIA 5A94A 1D7KA 4JEJA 4UNKA 3W81A 3LHWA 4LCSA 3RRAA 4OZOA 4CCZA 5F2LA 2YCJA 2PDUA 4NIRA 2KX9A 3SQLA 2FDMA 3MO7A 3RM9A 4DJEC 3MQTA 2YLAA 2NUWA 3ANUA 1POKA 3IRSA 3ITTA 2QJIA 3RFAA 2I16A 5F4SA 2P3EA 3EXSA 2V3EA 5B7ZA 4HCDA 1C8VA 1Y65A 2V2DA 2GSEA 3MYPA 4WGXA 8TIMA 2X1TA 4Q6XA 1E55A 4DZHA 4MJ4A 3QJAA 4Z1CA 3M6DA 2PDWA 1HJWA 4RXGA 2YDAA 3BVJA 3L66A 3U2EA 2QUUA 4GQRA 3W1UA 3BSGA 3NQ2A 5CQ1A 3W83A 3AOFA 3DFYA 1KWKA 1ITXA 3BLFA 1XLEA 1UD4A 4G5DA 4O50A 4EPKA 3NL6A 5BYWA 4IH3A 1BWKA 5FJUA 1NEYA 3N2BA 4IFOA 3LSBA 2XISA 1GQIA 4E3VA 2QPXA 5G2WA 3EDFA 3M7SA 4YTRA 5TBOA 1UG6A 2BDQA 1FFRA 4UFIA 4F0LA 4O8RA 3W84A 1E4NA 4BFAA 1ZFJA 2VCBA 3L12A 5TQLA 1UIOA 3SSJA 3R1ZA 2ANUA 2HSAA 3IK4A 3MZNA 5LA0A 3CUHA 2WO5A 3PM6A 1JPIA 4LEQA 5G1MA 3PFMA 3PPHA 2REQA 2PS2A 3IANA 4YYFA 3GVQA 4GKTA 4JHOA 1V6VA 3L4WA 3EWUA 4AZIA 1VD6A 1HFBA 3KM8A 5HXMA 4BWLA 4LUTB 4S38A 4GI9A 1LP6A 2YCEA 2WNWA 3IIOA 5I7GA 1IZCA 2QNEA 3U48A 5D9MA 4I7VA 1PIIA 1XBXA 1Q2SA 4JFSA 4GQQA 3GU9A 2PTZA 4TMCA 1HP4A 1JXKA 1WQ5A 1RK6A 4O8AA 3NYZA 4R27A 1QT1A 4DB7A 1ZBWA 4P2VA 4AD1A 3GLCA 3AHTA 2DGAA 5L9FA 3S1WA 1R9YA 2GZXA 1EB3A 3DAQA 1HKJA 5D9PA 3B8UA 1OHLA 1TB3A 3N9RA 3H7VA 1EOMA 1UH3A 4U2YA 4F0MA 3UVIA 2OELA 4R85A 4OUIA 1ZY9A 4JTLA 5I78A 1R2TA 4C6NA 3UR5A 3P5YA 4AISA 4LH8A 1KGUA 1VPQA 1DQXA 1KM2A 3N4EA 3P2VA 4JL2A 3MJMA 4Y9AA 1CNVA 5KZEA 3W26A 1JAKA 3KZPA 3BZJA 7CGTA 3BGAA 5CLTA 4DBEA 4CD7A 5AYXA 1B0IA 6TAAA 5JIWA 1BAGA 3PWGA 1U5VA 2RH9A 5KZMA 1CXEA 2IS7A 3A3HA 2WBKA 4WGHA 4FS9A 3HG4A 3PUDA 3DYOA 4UQAA 4U33A 1PZ1A 4YHGA 5CBIA 3LGEA 3BJSA 2OCZA 3GC2A 2Z29A 4GMEA 1KV8A 1XRFA 1WXJA 4BY3A 3LSCA 1ICSA 3B9DA 3A4XA 1SFSA 1GVEA 1TPEA 3ENLA 2R8WA 3GXFA 5HULA 1VAHA 2WLZA 4LNCA 1FVPA 2HZGA 1MZRA 4JY8A 3UWWA 1UWSA 4M80A 3AUJA 1AH3A 3R11A 4ADUA 1FH8A 1T0OA 3DXIA 3LY0A 1F07A 3A5VA 5DY2A 1VBRA 4GVGA 3O06A 2CWXA 1EBHA 3C2OA 1GVYA 3ITXA 4CEUC 4WSHA 2ABAA 1ADDA 3MWCA 2OO0A 4JYEA 3WLTA 5XIMA 1JI2A 2D0HA 1O5XA 3TSDA 3HMJG 2ZUVA 1TR9A 3CUZA 4M6UA 2VEPA 4FOUA 2V8ZA 1W8GA 3RCMA 2YBTA 4I90A 1UD2A 3MHGA 3TP4A 3U9IA 3MSYA 5DCDA 3WQOA 1M01A 4JPGA 4DJDA 4HHMA 5EMMA 1J0ZA 1IF2A 3WG6A 1HJUA 3UEQA 1YXCA 4MY9A 3SRDA 3N17A 1R6WA 3QGKC 3H4XA 2FHBA 1XSJA 3CLMA 2ZE3A 2VFDA 2V5KA 5C71A 1CCWB 3UXLA 3BK0A 1QRQA 1TELA 1JCJA 3AMGA 1MRQA 5FACA 3NAVA 4UZSA 1SZEA 5DO8A 5BWFA 1HGWA 2E4TA 2OJPA 1QPRA 3IPWA 4M0XA 2QUVA 1P7TA 5M03A 2R1LA 3CAQA 3T2QA 3SN0A 3AHVA 1OX5A 2V9DA 2GWGA 3ZR6A 1ALDA 3P8IA 2ZDRA 1E3XA 4D8LA 2G41A 1OT1A 3NFUA 3M5ZA 4GRSA 3RCNA 3TR9A 2EKCA 2WMIB 2B4GA 4HTBA 4LUJA 2QCGA 5HUOA 1VJSA 2XPKA 2BHUA 3U7BA 3AWOA 4WOZA 3EX1A 3CEPA 4DM2A 3PNUA 4ZB5A 5D9OA 3AJXA 3SCTA 2E77A 3AC0A 1NSJA 2H8ZA 3M0LA 4CD4A 4OWGA 1HJVA 3E2SA 2ZA2A 4BI7A 4TTUA 3I3EA 2DW6A 4PMZA 1B3YA 3TNOA 5MF5A 3SCNA 1YTEA 1B3ZA 4BHYA 2D73A 1CGXA 2D2JA 9CGTA 2FTPA 3PB2A 1BRLA 3WEMA 3W1QA 4MMWA 5U4NA 3HGOA 3HQPA 1AG1O 4DBDA 1BHGA 2OZ0A 2JIWA 3ZZ1A 3QSRA 1K9EA 2OODA 2GDVA 5AVHA 1RY0A 5AB3A 3O0FA 3W2KA 4FI4A 3GFXA 5JBFA 3GXIA 3F7JA 4PGLA 1TPWA 4L9XA 4LUIA 5BROA 1F8MA 2F38A 4UQDA 2Y5SA 3GG1A 1XLMA 3SCUA 4PE8A 3AMKA 2IW0A 4L9YA 4ALDA 3SCWA 4LB4A 4GO9A 5FJPA 4O1DA 4QLKA 5HOSA 1TZ9A 3B40A 2WAGA 3AHZA 1K7EA 4JY9A 3H6OA 4F0HA 4G6CA 1SMAA 2NZLA 4GZJA 1OG0A 4S3CA 4JCLA 4E2DA 7PTDA 4ORMA 3BJTA 1RQHA 3FV9A 1OIFA 3DI1A 2ZWZA 1B1YA 4QQUA 4H9UA 1VLWA 2J9ZA 1X1OA 3WD0A 5DMLA 3VIHA 5CSSA 3ITOA 3NEVA 1YYAA 3WNOA 4O1BA 3FJNA 3FGCA 3LQLA 5A8QA 3BL3A 4TTGA 2EXOA 4NJHA 4NRRA 1R3RA 5DMNA 4MKSA 3O8AA 5CPMA 1TJPA 4JQ1A 3JZUA 3VPLA 1DQUA 5CCZA 3UJFA 4KIEA 5BRPA 3MU7A 5M3WA 4FX8A 4ZE5A 4RZ6A 3L4UA 3WQVA 1RLCL 4I8DA 3BLEA 3PJXA 2B0MA 1JDCA 3MP4A 3UR7A 2B7QA 3AFBA 1S2CA 4YVPA 2Y8UA 1NDVA 3C0QA 1RXOB 1JPDX 2V68A 3GE7A 1T40A 4ONVA 2ACSA 1MI3A 1O4UA 2Y1HA 3BGJA 4FXFA 3AYVA 1WAWA 3WH9A 3ZVHA 4JFVA 3AWNA 3W27A 1XPGA 3IK2A 5ABFB 3ABRA 4N7QA 1E1FA 4H8VA 3HOJA 4JTHA 4J1OA 3WZ0E 2ZUMA 3TR2A 3WLMA 5B80A 1UMLA 2QR6A 2VWSA 1S1RA 1Q63A 4P5UA 2DSZA 2YZRA 4W7WA 4H3DA 2IMRA 5JXQA 1VHNA 4AH7A 3TONA 4LAKA 1YBQA 5I24A 4GJJA 1W1PA 2XVKA 4E6MA 4QTGA 3NQ8A 5T91A 1JRBA 1RSCA 4NZJA 3G1DA 4UTUA 5A1AA 1O95A 3KAOA 1XXXA 3TOYA 5GNZA 3ARZA 4P8WA 3UGRA 4FOKA 3IVUA 4HU3A 5LIUX 3WX7A 1H7RA 3RPDA 3URQA 1H41A 1Z6KA 1G4TA 4CNUA 2G95A 2WVVA 1TMLA 1M7OA 4FIRA 4ZSTA 3VD4A 1O12A 3P3BA 3ITLA 5DXYA 1S46A 1TFVA 4CD6A 3WDIA 4X0NA 2FPTA 1HT6A 3VD3A 4PUJA 3R25A 1GW1A 3UWEA 4ZSUA 1BYCA 2XDFA 5BWAA 3B04A 1DXFA 3T05A 2P88A 3NOEA 1I45A 2BY3A 4I5RA 4K8HA 4MYAA 4EOUA 3EWXA 4AWSA 1FBAA 3WBYA 1TA3B 4OE7A 3QOKA 5BXPA 2ZIDA 3KX6A 2DZAA 5HBFA 4DUWA 2WZIA 3IGXA 4LRTA 1DWHM 3W7RA 3TZNA 2NT1A 1RK5A 3TJ4A 4AD4A 2AL2A 1NAL1 3GNPA 3ALFA 3A47A 2DSWA 4QHRA 3KWXA 1FDYA 3V1HA 1GONA 4TV5A 4I5UA 4LCQA 1UR9A 1DQWA 3F5LA 1L6GA 3CC1A 2RDTA 1FHUA 3HTWA 4ZZ9A 4GPNA 1CGVA 5L6UA 4RNFA 2QCDA 5LNRA 2A21A 4NASA 3ZLHA 1MXGA 4DJFA 1YTDA 3TC3A 1FA2A 4WDXA 2FVMA 5AHFA 1GOMA 4HA1A 1PDYA 3CZLA 4LANA 3NEHA 1EDTA 3APTA 3DGRA 3FYOA 3A4JA 4HK7A 8XIAA 2E40A 1EBGA 3BG9A 4IZGA 2BGNE 1T41A 1WE5A 2CCRA 5LIWX 4ZENA 3F2CA 2DT3A 5AHNA 6REQA 5G1YA 1LLWA 1EJWC 1WXYA 3CHFA 1Q6QA 3WQ5A 4C6CA 3OEXA 4HKPA 5HPOA 2W63A 4RPPA 2CWNA 3MMUA 2YCIX 4HA4A 2GDQA 3I6TA 1KBIA 5KINA 4GISA 1BVWA 2CEQA 4KFPA 1XGDA 3MMWA 4M1BA 2Y24A 3GIYA 4L1XA 4DBWA 3T4WA 1QWKA 1TV2A 4N42A 1D7FA 2GL5A 4ATDA 1BXBA 3HGJA 3PVFA 3RLHA 3TA6A 4GA8A 3T9PA 4DAFA 4ERIA 5EMUA 4V15A 4W5ZA 3CPGA 1DJIA 3QQ1A 4F9DA 3UT0A 2D20A 2DT1A 3CUGA 1YXDA 2QXWA 1DWGM 1V7AA 3W7PA 3BG3A 4UNIA 1W31A 1OQFA 3EWDA 3P93A 1P4CA 1F8IA 1KCLA 1H1YA 1CZ1A 3F4VA 4HA3A 2R1NA 2X41A 1ZAHA 2DORA 3PUOA 3N29A 1PEZA 4RKAA 3LTYA 3M43A 4A29A 3FDGA 3KBSA 5A6BD 2DDXA 2ZZ2A 2VJXA 3FKKA 1LL6A 4PMOA 4I9AA 2WHMA 2XWEA 2HWGA 3M4HA 1HL2A 4K2SA 2QUNA 3BLPX 3VNYA 3A3WA 4M6VA 1QVBA 1KXQA 3D47A 3IS4A 1VCFA 4AIEA 1Q2RA 4AHOA 3GHSA 5BCAA 2FHFA 4KIRA 5AYIA 1PL9A 1TYGA 4HCHA 4IL0A 2X16A 1JR1A 2EPLX 1XFBA 4TX6A 2CITA 3MO4A 3OOQA 1VYSX 4R34A 3S6OA 1XBVA 1B3XA 5CBBA 1ISXA 2YDSA 5FCZA 4AZ6A 3GTNA 1XC6A 4GQ0A 2DU2A 4O0QA 3SCSA 2GSJA 4RNJA 3R13A 3B0XA 2VUYA 3A24A 3KCJA 2J24A 3IUDA 4Q8UA 2ISWA 3DKJA 3FA5A 3SFWA 3DCPA 1JYXA 3RHGA 2OGYA 3G0SA 1PKNA 1QUMA 3G8RA 4RW3A 4EACA 2BXVA 1YADA 4OQVA 1BXCA 1P6CA 5JBDA 2BVDA 3M44A 2OX1A 3S83A 2D3NA 4WDTA 5E9AA 4K36A 2BWGA 3FJLA 2BHZA 1ONEA 4E4PA 4DJED 1TQXA 3NOYA 4FLOA 4ZA0A 6XIMA 4HN4A 3WQPA 2DV0A 3AMDA 3AIEA 4LV4A 4GACA 3BAJA 1A3XA 3RPTA 3QV9A 1R3VA 3W72A 1U1UA 3MUCA 1VFSA 3Q94A 3GBDA 4D6DA 2V5CA 1UBSA 2XU2A 3CU2A 4JIIX 1LORA 2QMJA 3WQCA 3VILA 1I0BA 3MI3A 5I07A 5GNYA 3ARTA 4WR3A 2WYSA 3QZAA 3QW4B 5HINA 3TJXA 4DYJA 1NTHA 3POCA 1E70M 3N13A 3SY5A 4WXYA 3OVGA 1WA3A 3N19B 4XUGA 3SY1A 3MWAA 1MFUA 4N0RA 3QLDA 5AKQA 3SGUA 1W1YA 1UKTA 4X61A 2Q02A 3BCJA 3GVVA 1OCNA 4AEFA 3B06A 1EC9A 4LXFA 4PTVA 3NQFA 5DXXA 1W17A 4O1AA 2ZOXA 3ITVA 1EQCA 2J6XA 2WM0A 3ABQA 2Z1WA 1XIDA 3VYLA 4NNBA 4DVOA 4C5ZA 4K37A 2WM1A 4JZ5A 3FVDA 3N2OA 3EOEA 4ENLA 1JVNA 1LDCA 4YTSA 2RDXA 1KM6A 1N7KA 1SM9A 1Q45A 3W7OA 1C3FA 4PRTA 2XSBA 1KCXA 3A64A 4X22A 3HPZA 1SVDA 1DXIA 1JUEA 3UCDA 4FNQA 4GNVA 2KZHA 1IXPA 3KOXA 2YA2A 1R87A 4GNJA 2OYLA 3W85A 3LZ5A 1V6XA 4W9TA 4YWSA 2PWVA 2OVLA 3HU7A 4W4QA 2BOEX 1LQAA 1CGYA 4FALA 5KMYA 5JMUA 4O54A 3ZS4A 1UOZA 4WD0A 3W7KA 1KKOA 1TJ0A 2VFFA 3VC5A 1DEDA 5LXXA 2PD9A 3R89A 4D6JA 3DESA 1US3A 3PK7A 3ZT5A 4ATWA 2HK0A 4M5PA 4LW7A 5I3HA 1G7VA 1UWRA 3M5VA 3DFSA 2NQZA 2VR2A 4H6EA 1TPFA 4IPIA 4YVXA 3PWAA 1QAPA 4JNYA 3WO8A 4B5WA 2ALRA 4KF1A 3LGDA 3DHPA 4IPPA 2WNZA 2WMKA 3IGHX 3AO0A 4IHCA 4X2RA 3RPMA 4AYSA 3WDJA 3OGSA 3AZSA 4UTWA 1NDZA 5CJMA 3C56A 2XGIA 4IQEA 4Q22A 1CXIA 2X40A 3SUTA 1EJUC 7TAAA 3M16A 5E0FA 3EMCA 4ATLA 1ZJIA 5CPNA 1EHAA 3I68A 5REQA 5C8BB 1R0MA 4IIFA 3JRKA 1O5RA 4JTTA 4NXSA 5GJNA 3UFYA 1XYFA 3W6LA 2HJPA 4QITA 3QM3A 3PSVA 2BMBA 1FKWA 3V7PA 2OLHA 4PBFA 4XKYA 4PMQA 1O68A 4XAPA 3AAMA 2WMHA 4GHRA 3EPOA 3KBWA 2CETA 1V03A 3QTPA 3EXRA 4B91A 1AQFA 1GVFA 1Q6RA 4J28A 4ZXOA 4KWWA 5CC5A 4GCXA 1TPB1 3QV7A 3VNDA 1H3GA 3NG3A 4YU1A 2PDGA 4NAFB 1CXLA 4NL1A 4S3FA 4PCNA 4XUYA 3MTWA 4LWWA 1F3XA 5BU6A 3VM7A 3G24A 3F4CA 4UFKA 4AFYA 2YFNA 1LBMA 2WSPA 3CQ0A 3N2MA 5KSWA 3HJEA 1ISWA 2HVOA 2WWCA 3VDCA 1H5VA 3JUGA 2O7SA 2W3ZA 3K30A 3MMTA 2BTMA 1D3HA 3CYJA 4IUGA 4AVNA 3WD3A 1DVJA 4AU0A 3RDKA 3W7DA 4OBRA 2WZEA 1EX1A 1VYRA 4C6KA 4QCEA 3B3DA 2A79A 3U5UA 4GKLA 3WLNA 1B4KA 4QEEA 4E3TA 3CUFA 2NWRA 2V5DA 3OGVA 3UZZA 5HNNA 1ADSA 1KRBC 3KW3A 2Y5EA 2VX4A 1W0MA 3K46A 4N2YA 3GXPA 1UUMA 2A1YA 4FP1A 3M0VA 5KITA 4GIAA 5A6AA 1YXYA 1UP3A 3CAWA 5AYBA 4JIHA 4MSSA 3BUVA 1BPLB 3CBWA 1L0PA 3EKLA 2E68A 1M3UA 2QVHA 4EX4A 3PZ9A 4B5TA 3VINA 1I75A 3K13A 3CLWA 3GBEA 3P74A 5EL1A 3L0NA 4J40A 2E6DA 4MVAA 4H19A 2QEZA 8RUCA 3TSBA 1IWAA 3LPOA 4GVIA 2JGQA 3AYSA 2A85A 3KL3A 3GR7A 3BICA 3UZ5A 2G4FA 2Y7DA 1MW3A 1W3JA 5FAJA 1ME8A 4ZQCA 6A3HA 3DX5A 3W7GA 3AIQA 1L6YA 3RMJA 4GIYA 5A8GA 2ZC1A 3QLLA 5A2AA 1MNZA 1OCQA 4Y9NA 5J5DA 1KV5A 4RDYA 1P0NA 3UP8A 4H9ZA 1LCOA 1MEHA 1YDNA 1RPXA 1L6SA 1WDQA 1XLLA 4AC1X 1ZL1A 1VIWA 1EIXA 1NDYA 1YDOA 3APYA 4L4LA 4V1XA 2FB3A 1BLIA 3NZQA 3S9ZA 2A7PA 3SI9A 1JQXA 1S2AA 5D2WA 3S2NA 1JDAA 1XIJA 1AVAA 4DY1A 2NX1A 3NTYA 3A22A 4PUNA 1VJZA 3GNRA 1EGVA 2UZ9A 3RX4A 1HGYA 3OG3A 1JFXA 3NO3A 3U2ZA 2D69A 2NLYA 4A8LA 2IPGA 1M9HA 3G1YA 1C93A 3WLRA 4GY0A 2J4GA 3EX6A 3QKEA 1OABA 3CT2A 5AHLA 2FH8A 4ZMGA 3H70A 4IQDA 2VCCA 4W87A 4U2ZA 3ZFHA 1EEXA 1CLVA 5FF2A 3WMCA 2BP1A 1V77A 1GORA 2YZ5A 4QNWA 3PS7A 2C91A 4H9YA 1QW8A 3QY6A 1XYBA 3N6QA 1Z89A 3BXWA 4U3AA 3AALA 1DJWA 3BANA 1BWLA 2PDHA 4MPKA 1V6TA 2J66A 4O57A 1GJUA 3CQKA 1D2KA 2J27A 2UY4A 2HXUA 1TZ7A 2AMGA 1XLBA 1KBJA 1GG0A 4EAMA 2I9UA 2PDYA 1QCWA 1OCJA 3WL0A 3TWAA 4YIWA 1ITCA 2OQLA 3SRKA 2CIPA 4XZBA 3UQNA 1LJYA 1FQ0A 3B05A 2WOQA 3UETA 3UXIA 3TMQA 3NQAA 1TV7A 1TWZA 3BE7A 4XO7A 1AMKA 1DJHA 4UTKA 3TWBA 4OTKA 3RO8A 1L6FA 2VZTA 5C2GA 1DKWA 1W1A1 7REQA 3GTIA 2A2IA 4HA0A 4GBDA 1TJRA 4BKNA 2V5BA 1ECEA 1XIFA 3N11A 3ZVIA 4Q7NA 3NNTA 3A3XA 5E09A 3TC7A 4B5NA 1LUCB 1M03A 1HJQA 1Z8AA 4G2DA 1BQGA 3E0IA 3SCRA 3AHYA 3D5HA 5HPCA 3ZJKA 4MAVA 2QGYA 5M17A 4DO6A 2CLEA 2WV8A 1LWHA 4JS3A 1FRBA 4XVEA 1Q6EA 3S0CA 2Z2UA 4PUKA 5I09A 1FOBA 4IL2A 2O4QA 5LHEA 4AY8A 2R24A 3ELFA 2F84A 4Q8QA 1A5UA 2CHOA 4ORIA 1XIEA 3SGGA 4C6JA 2BOGX 1K8CA 4FLQA 2PAJA 5AVNA 3QR1A 2Y88A 1XKJA 3SRFA 1HKWA 3W1AA 2GGHA 3BCFA 4M6QA 3EYPA 2OLAA 3SIZA 1IXOA 1XBYA 3G1SA 4HPGA 4ERGA 1POJA 4ADTA 1T7LA 2A3EA 1TUXA 3E5PA 2WK2A 2W27A 3OLGA 3NZGA 3LD5A 3ZOAA 2WANA 3CUXA 3GVWA 2XVGA 3IV3A 1CLXA 1E15A 3NO1A 3HN3A 5HUPA 4JTRA 1ECQA 4ML9A 4R7JA 3GW0A 4RZ4A 3T42A 2DZPA 4MFDA 1GKPA 1QBBA 4CU7A 2QJGA 4B3ZA 1OYBA 1XRVA 2OFJA 5AHIA 3WK2A 1D3CA 2NUXA 3N73A 2NQLA 3ZJ7A 3BARA 3R43A 1SFJA 4AQLA 1WKDA 2PP1A 3QQWA 4C1NB 2QDEA 1BTCA 3WLSA 3H26A 1X96A 4I3GA 5JU6A 3UXAA 3DFQA 4D72A 4GD0A 1IR1A 1JUBA 3WD1A 3QW3A 4QJ5B 1HIZA 4FIQA 1XCWA 1RJQA 3AICA 1E72M 3K8LA 1S39A 2VQTA 3LV6A 3CT7A 3WN6A 1XWYA 3NDYA 5LXEA 1OK4A 1E5JA 4C7GA 3IJ7A 1JZ7A 4FNRA 1GOKA 2VZUA 2BVYA 1HKMA 3CASA 2GGGA 4RPQA 3CO8A 4LY4A 4XAGA 1E9ZB 5CC7A 1JF6A 1KLZA 1N8IA 3F4NA 3MKKA 3W82A 1RCOB 1DV7A 1CW2A 2VZVA 1QNQA 4WHBA 4TV6A 3DFNA 4D1JA 1J11A 5J5RA 1PZ2A 2PDCA 1U5JA 3OB8A 2GSHA 4QE5A 3VK5A 1GTHA 4LF1A 3DDMA 3WH6A 1FWFC 3G1HA 5FESA 5ABEA 4JKKA 3O1NA 3BLKA 1J10A 1LOLA 3FJ6A 4HT3A 4DYEA 1GYNA 1Q6GA 2F2HA 1K03A 1LM1A 1KR0A 1BSLA 1WKYA 2GUUA 4PUUA 2E1DA 3UYCA 2FVKA 4A8IA 3RX3A 1PYFA 2TAAA 5HMDA 3OHMB 3W88A 4UUIA 5LIXX 3U57A 2CXGA 3UZJA 2EAWA 2XFWA 1D9EA 2EKGA 3ARXA 2J6VA 4KWUA 4BA0A 3URNA 3VGBA 2YCKX 2J74A 2CLFA 5EB8A 2HRWA 2OEMA 3HGSA 5AOUA 3W1XA 4ZQNA 2AAAA 5FF0A 4GQGA 2VC9A 3EOUA 4OV9A 4Q6JA 1XYAA 2ALDA 3VGDA 2A7RA 1UQYA 3AIBA 1LOSA 2DZTA 1DIOA 4HNCA 4OVXA 1AQMA 3M9YA 2E3ZA 4A3YA 1B57A 4YLWA 2YYUA 5FL1A 3OBKA 4U5IA 3FNDA 2Y2WA 4Y9OA 1MZHA 3OYZA 1TG7A 4PULA 2FZ9A 2H9AA 2RGMA 4S3EA 3W7IA 5BOOA 4L1GA 1J6PA 1Q5MA 3IVTA 3MHUA 3ZQ9A 3W1MA 1XLGA 1XYCA 3NPUA 3BPWA 2HQAA 1SZFA 2AGTA 5D09A 3GAKA 1K9TA 1RH9A 4XD4A 1Q4NX 2Y6ZA 2ZX6A 3W1RA 4YJ5A 4HNTA 4JEQA 4H00A 3UD6A 3NL2A 1QXLA 4ES4A 2QAPA 3LERA 4EVZA 2AKMA 2PU0A 4LJ3A 1UD5A 2P5NA 5A2CA 5KTLA 3WUEA 4BS0A 4IJCA 5DBTA 2FIQA 1W3LA 2C79A 1WV2A 1YHTA 3TC6A 1IR2A 3HIJA 4C6MA 4NX0A 4LVFA 4UFMA 1DWFM 1S5VA 3S5SA 1Q66A 3U4AA 1GYLA 3H2CA 1BFNA 3HPAA 1E43A 1LYXA 1ZS2A 2X8RA 3R8RA 1IT8A 1FWWA 3VNMA 3ZR5A 4JIRA 3BGGA 4TX9A 3VOCA 3EOSA 2V3FA 1TTJA 2MNRA 3OZMA 3WFAA 4C60A 4UBPC 1X38A 1XW8A 4Q4PA 1SGJA 4H1ZA 4QRNA 2CZ5A 3C86A 3PSWA 2J8TA 1GVQA 2IKJA 1A3HA 2A3BA 4LALA 2PCQA 1LWIA 2XVLA 3R6IA 3ERPA 4GABA 4UQCA 4IIEA 3W38A 3H2AA 1HN1A 3EAUA 5HAOA 2QLYA 1MQRA 3LXBA 2WBGA 1OCBA 1EZ2A 3MCNA 4FZIA 1F4AA 3RCYA 4FA3A 2WCAA 4L65A 1Z41A 2ZE0A 3TTOA 2GK1B 2VEGA 1GK8A 3ISIX 3OQEA 2PWGA 5CPLA 3EWZA 4US5D 1JQVA 1VEMA 5D32A 4Y8FA 1M7JA 2YB4A 3LPGA 3OG2A 2WW5A 2GUYA 1LQ2A 3UA3A 1IXQA 3UVAA 3V4BA 3KL5A 2DSVA 3UZXA 1XGEA 4C7DA 3STFA 3IJ9A 3GU2A 3V0TA 2BVWA 4JTSA 2WSKA 4AF0A 2RHGA 3WBAA 3ARWA 3MV01 3AUOA 1KBBA 1LRTA 3NWRA 1MRAA 4KGLA 4B16A 1J5SA 2NUYA 3VIMA 4GI6A 4XD6A 1UP0A 1HO1A 4YCOA 3T40A 3AI0A 1R47A 5A6MA 2GJNA 3WLQA 2QDHA 1S3TC 3LOTA 3P84A 2XFRA 2YLLA 2XIOA 2ZICA 2I1OA 2J7FA 4UTWC 2A3AA 1H7XA 4YN5A 2PRHA 1ZAIA 1QATA 1KFLA 1PHQA 2W61A 4R9XA 5IM51 2YGYA 1ZCOA 1PKMA 3UYIA 1RVKA 8CGTA 1YQ2A 3DBNA 1JPKA 1N8WA 1I8JA 4KRTA 1NY1A 3E6EA 3IAPA 4A21A 3LCWA 5EY5A 1WYIA 3ARVA 1XUUA 4MG4A 3SUWA 3KVJA 4YHEA 1OX4A 2CKSA 5D2XA 3DZ1A 3BAIA 4JIEA 3T0AA 1LG1A 3BOFA 1XR2A 4HPJA 1AQ0A 5HK4A 3CQIA 4RDZA 1ZHAA 3V35A 4EPBC 5A95A 1VYPX 4PTMA 5CPSA 4GC3A 3RR1A 4JFUA 2YXOA 4GYJA 3BOXA 2FPVA 1A5KC 2OT1A 3ZWTA 5AC8A 4S3KA 2UY2A 2QQ6A 1W1TA 1XLHA 4I7WA 1VB9A 4PUWA 4D6IA 3SW6A 5AC5A 3WNPA 3UR2A 3QC3A 1GG1A 1MW1A 3OZOA 3B0VC 4LEFA 1W3NA 4AXKA 4JL1A 3LTSA 3QVQA 1XYMA 3Q37A 4C7FA 5BXSA 1UZDA 1ZBVA 4GNKB 2ZA1A 2C0HA 3WLJA 3S2LA 4A05A 3LI0A 1TVPA 1KCKA 4KCVA 3W7HA 2NQ9A 4KFNA 4F4RA 4IG2A 1QTWA 5BXTA 4L1WA 3V0UA 1FCVA 4DHGA 2IXVA 5DBUA 4JQ2A 4C1LA 5CSUA 4FXRA 5HQLA 3MC5A 4J35A 2BY2A 4GJIA 1IWBA 4S3DA 3QOMA 3DHUA 3REQB 3P0WA 3LLDA 3GW3A 3WFLA 4G7EA 1THFD 3ZT6A 4X9YA 3C61A 2X09A 2OSWA 3OZYA 4RW5A 1NWTA 1KXHA 3HGRA 2FTYA 3LS9A 5AHMA 1GOIA 3A21A 2ZRWA 1ZQ5A 4ZVJA 1H62A 1Q6OA 3SN1A 3M0HA 1DHKA 3DH7A 1RBAA 4GUGA 4B5XA 4DF1A 1H50A 1UIPA 3G3MA 1UMYA 1CEOA 4DZIA 4C6BA 2ZA3A 5FOOA 1Y5VA 4JTUA 3LEPA 1E3ZA 2Y63A 1K8ZA 3STCA 1GZ1A 1AZ1A 1E4LA 4UFLA 2IPJA 1Q6CA 1A5SA 1U33A 4AHQA 1CWYA 1VCVA 4X9SA 5F2IA 1K9DA 4PSPA 1G94A 2DZWA 1SFTA 1MNSA 2XM1A 2PA6A 3VKKA 3PPCA 5D4YA 3IRDA 5JH2A 2Q8XA 1Q8AA 3FK4A 4UQEA 1V3LA 5AECA 1J93A 4XIAA 4YTQA 3W28A 4JQAA 4BK9A 3P60A 4MFEA 1UD3A 2QDGA 4A2RA 1AQHA 4J3SA 1V02E 3OHIA 3WBWA 2YPIA 5DX7A 1QHPA 3B03A 3L65A 1OGBA 4NZ5A 3SZ8A 4EANA 2FTWA 5BMWA 3S2MA 4DIAA 3W7MA 2PDJA 4QG8A 3DFHA 2Z25A 1QNVA 4QSHA 3LG3A 4IT1A 3GAYA 1PZ3A 3ES8A 1AODA 3WDQA 1G0CA 1IZKA 3UR8A 1K8XA 2WJFA 1YLVA 5C9WA 3TUUA 1JNEA 4AX7A 3SBFA 3LBCA 3QZ6A 3CQHA 2VZOA 2G3IA 3GG0A 3GKAA 4H9VA 4JKLA 1FWRA 2PDXA 4HOWA 2PRLA 4KFOA 2IXUA 2Y7FA 3C3UA 1Z9AA 4PSRA 5HQMA 3TTSA 1QOQA 1LQ0A 3TQPA 4UB9A 1CPUA 4IGHA 4QE1A 5F4XA 1G4EA 3O0KA 2RJHA 4DXXA 1SPQA 1V0NA 3TMLA 3RR4A 1Q7ZA 1XIHA 5C54A 4REQA 5AZ0A 3P14A 3C0SA 3IEBA 2J7EA 2E6YA 2G96A 3MDUA 5PTDA 3VCRA 1ZZMA 2PWHA 3PBGA 1PAMA 2VZSA 1X1ZA 4LUSB 2DIEA 3DI0A 4MM1A 1H7PA 3C2YA 3RM4A 3G8EA 4HMCA 4XZHA 3MSGA 3SUVA 1I2PA 2RAGA 4QXIA 2PF0A 1IYXA 4GZ7A 2IPWA 1AL8A 2PGEA 3WJSA 2WSYA 5HR7A 1MFVA 3GTXA 3RLGA 4JGDA 3S6TA 1KFEA 2CZEA 1ML1A 1QO5A 4C90A 2GJXA 6PTDA 3NJ3A 1JPHA 1U1JA 3CB8A 5D33A 5FEZA 2VEKA 4C6EA 2ZXAA 4KESA 3VMOA 4LBRA 2VRJA 1OEPA 3V36A 1SSGA 3I7SA 2CHNA 4DWDA 3GIQA 3GH4A 4HNUA 3OTRA 2AQOA 1JZ2A 4UR8A 4M29A 1CBGA 2JKAA 4YMZA 2VGIA 2HE8A 4DPPA 5C9RA 4QS5A 2J9YA 3VOIA 3FXGA 2R94A 2PTDA 4I7UA 1ONXA 3JZEA 5CH9A 2ONEA 4PMUA 2PBGA 1D8WA 3CO4A 1WZKA 1QPNA 2YJQA 3IIPA 1V02A 3RK8A 3MA8A 2BOFX 4YS1A 1PIGA 3V5CA 2VQUA 4IMEA 3KOYA 1C8YA 3BAXA 4QAWA 3T44A 1W3KA 4P7QA 1IIHA 4O11A 2PDMA 3R2GA 4Z1BA 3O2LA 3M0MA 1VHCA 4JICA 4F79A 3W7EA 3H2OA 3H2EA 1Q7MA 1OT2A 4KH2A 5FJJA 1P0BA 1A4MA 3MSRA 2VRQA 4AVOA 2GDUA 2NXHA 2XYLA 3S4TA 1U1HA 1O5QA 4UC5A 1TQJA 1UBPC 3PF3A 4DBSA 3H4GA 1TIMA 4IFKB 4JIQA 4LY8A 3PZVA 3G1VA 1FP9A 4CGTA 3F4DA 2VOMA 1H2JA 1WBJA 4IQLA 1FXQA 4CN4A 4J3ZA 1TTQA 4JX5A 3WNKA 4UQ9A 3AXHA 3MKVA 3W9ZA 1TRIA 3MVIA 2X1IA 2CESA 1DWAM 3MCMA 5RUBA 1GKQA 3UPWA 1E1CA 1FWGC 2WQDA 3Q67A 2DJLA 1B90A 1TO3A 1TCMA 4UTMA 3E38A 4FR6A 2QCHA 4XBJA 1N2VA 1CENA 4ZTYA 3AZRA 2VWTA 1IEQA 4LX4A 1EO7A 1QWGA 2X2GA 2DJXA 3IGSA 2PDFA 3KRUA 2NSOA 4A3RA 4NJGA 3F2BA 1VCGA 4S3AA 3W0KA 4ACZB 2Y8VA 2JEPA 2IKIA 5C9ZA 9XIMA 3V75A 2E5CA 3PWIA 4Q8WA 1OK6A 4NZ3A 1UKQA 4B3LA 3GXTA 4Q4QA 1VQTA 4LQ1A 1UCWA 4LAUA 4UNLA 1E4IA 2WNNA 1EDQA 3WEOA 2W66A 3SDOA 2QJJA 1SR9A 3GYEA 3GH7A 1ZP4A 3CEUA 2J25A 5K3VA 2NLIA 3VOHA 1EF3A 3B9NA 1LF1A 4NNCA 4CQBA 3WNLA 3MZ2A 3MKCA 1NWUA 1REQB 2W4XA 3W87A 4A8NA 3LNPA 3ZMRA 1J79A 1G01A 1BSIA 3AS3A 4IM4A 2Z24A 1EC7A 2JF6A 3KVLA 4OBTA 1QI5A 3SY8A 1DP0A 3GFYA 3AU6A 1VFHA 2EPNA 3UG5A 4KETA 4OFCA 1HP5A 1IGWA 4K1WA 3B9OA 3O07A 3MCOA 1NFGA 4IIGA 3OU8A 1W5NA 3CTLA 4IXHA 3VAVA 4X60A 2VURA 3GNOA 4GGHA 2EPOA 1DXEA 3SJ3A 4EXBA 3OLIA 1PS9A 4EPDC 1OM0A 4L7ZA 4XV0A 3LMYA 1E9LA 1HO4A 4ILSA 3PZOA 4QDPA 4B92A 3AS1A 4HPNA 1B5TA 2EHHA 3EOLA 1VP5A 4LGXA 5EKYA 1TUFA 3W29A 2C18A 3VABA 4WSJA 1NU5A 4QJ1A 3KP1A 5G2IA 1WXZA 3W25A 1GOQA 4C5YA 3H22A 1UR2A 3FLUA 1KXVA 3LV5A 1EA0A 1OZMA 3RG6A 3JVAA 4HYRA 1SW7A 3BLLA 1XGZA 2I5IA 3DHDA 3T08A 3UU0A 1OG6A 1M6JA 3VD7A 4LF2A 3LENA 4H01A 5BZAA 1V5XA 4HYVA 4N9DA 4S23A 3H7UA 4LTSA 4S39A 1W5QA 2FVLA 5I3DA 2VDGA 4PUEA 3SJNA 4JQ4A 3TE9A 5GJPA 1E1EA 3Q58A 1DYSA 2Z1BA 4G9PA 3ATYA 1ADOA 2A3HA 1KBKA 1A5LC 1RQEA 1XM3A 2GUBA 3FA4A 4MAZA 4Z2HA 3QHMA 4WQ6A 4J3VA 1IEIA 4Y6GA 1UHVA 3T81A 3S47A 4S2BA 3IGUA 4AIUA 5HJLA 3LRKA 4OBSA 2OOGA 4F66A 1XH1A 3BAWA 3VZXA 3WF2A 3MUXA 4JCMA 4LOCA 3W2UA 4HNOA 1UR0A 5CPOA 1PIFA 4UOJA 2GOUA 1LRNA 1IIGA 2VGBA 5HMEA 4LFYA 4Z0JA 3DFTA 2Y7GA 3BW2A 1K77A 3GHUA 3MSDA 4PYSA 3R12A 4K38A 1G6CA 3DU0A 2W91A 1BVNP 1OFOA 2E25A 3ABXA 4JTIA 4EE9A 3TYBA 4KEZA 1IEXA 1JPMA 2V5JA 2ZUNA 2E6FA 4MWAC 1C8QA 3M07A 3S9YA 2BZNA 5HWMA 2EPKX 4INFA 2W0UA 3VNZA 3LCLA 2YCLA 1JZ5A 3ONBA 2DQXA 3EBVA 2JEQA 2O0TA 2PB1A 5DEZA 3S5YA 2EQDA 2HK1A 4IOTA 3BV4A 1VEPA 3W7JA 4MB3A 3EX3A 5AY7A 4F8XA 3AXXA 1JDDA 2OYMA 1KGXA 4DXVA 4N9EA 1M65A 3VIGA 4NVTA 3M0ZA 2DH3A 3DFOA 1BYDA 4IPLA 2PC4A 1FCQA 2F8QA 4V2XA 4MZYA 4O4WA 3C2RA 1E6QM 2VM8A 4AG0A 1JCLA 4N4QA 2DT2A 1XBZA 4QM1A 4JHZA 4ZO8A 2W5FA 1BWVA 4DUVA 2DIKA 1ICQA 2XTKA 1XLAA 4GJ1A 4NT0A 3CZGA 5T8GA 1KFKA 1MO0A 4MNLA 2WNQA 4ICMA 3C6CA 2OOFA 4FOJA 3VUSA 4HTYA 4RJEA 3I7RA 2FZMA 3FYYA 1TPVA 1TJ2A 3DENA 5DANA 4NHVA 3U7VA 2V2HA 2NXGA 4I9TA 3ORWA 4P8UA 1XS2A 1R3TA 4IGSA 1XCXA 4DBUA 3IV8A 2A3CA 2HVMA 4UOZA 4QDMA 2WPBA 3C0JA 1CLKA 3EX2A 1TE1A 1IQ8A 3VDAA 1E6SM 3STPA 2QULA 2BBFA 4DPQA 5EMLA 1GPWA 2WQPA 3GR8A 3WLHA 3VX0A 3U8GA 4MWAB 3N3TA 5IHRA 2NXIA 2PRMA 4ZOBA 1QI3A 5BRBA 1E6XM 4AY1A 2ZFAA 3CUJA 3DUGA 4FNPA 1KO0A 3UGVA 1GZJA 3IJDA 2HNHA 2WVUA 3ZIZA 4GQBA 4WDUA 4WF7A 1V3MA 3KDOA 1EJ7L 2P8CA 1T8XA 3ZYZA 4K7VA 2PF8A 2Y0FA 1W6TA 1Z69A 4ICCX 4PUMA 2VC7A 1TTIA 1MSSA 3W07A 4XZWA 4AMCA 3FS2A 2WPGA 1X8CA 1SMDA 2HPMA 1OX4B 1SW3A 1WOAA 3RO6A 4QX4A 4I6KA 4H9MA 2YIHA 3OLEA 2YBVA 3O7UA 4CQ9A 4EWND 1TRDA 2C7FA 4GI8A 3PPFA 5JH1A 3MUY1 3BC9A 2TSYA 1HTIA 3NSNA 1LWJA 5LIYX 1WO2A 5C7HA 4DZAA 4KEMA 3WQWA 4ACYA 4IGMA 1FHLA 1KFCA 5I23A 1NJJA 4ZQPA 3B9AA 1M7PA 1S3HA 3TOPA 4HJWA 2ZRVA 2VKZG 1IWPA 2GGJA 1S2WA 3TN6A 5EA9A 2EPHA 4AAJA 1J01A 2HS6A 1R3QA 4AZCB 3GHTA 4PMJA 4B5VA 1EX5A 1V6WA 3T4CA 4MY1A 3LPPA 3OVPA 3M0JA 4QGCA 4EWJA 4L6DA 4O53A 1XQLA 3N9SA 4U10A 2CKRA 1VFLA 1OFDA 4Q4OA 4RNHA 3MANA 2QUTA 3CH9A 2D2HA 2PTYA 3O16A 3SECA 3GXNA 2DEPA