2QJIA

M. jannaschii adh synthase complexed with dihydroxyacetone phosphate and glycerol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
b'ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPIKGLIDIRKTVNDVAEGGANAVLLHKGIVRHGHRGYGKDVGLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELVAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVVGITRAVCKIVHENADVEEALKEIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aldolase MJ0400
publication title Structure of 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid synthase, a catalyst in the archaeal pathway for the biosynthesis of aromatic amino acids.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 91
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.2.1.10: 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qjiA00
1F05A 1I2RA 4TU1A 4OBTA 1F7BA 3UWYA 1H7RA 3P61A 3W1LA 3NL3A 2C13A 4O52A 4GUGA 1OX4B 3LB0A 3PC0A 1NVMA 5MHBA 3W3OA 3NQFA 2DJLA 4UXDA 3TMLA 5IBXA 3O16A 3A9IA 1T8XA 3RMJA 2W79A 3GB6A 4AWSA 4LVAA 3HGOA 1TPDA 2G5WA 1GPWA 1G4SA 3SI9A 1MEIA 2QJHA 5DBUA 2FB2A 2RH9A 4N6FA 1O60A 5C2XA 1PL9A 5HWMA 3HGRA 1PIIA 4B5NA 1SO4A 3QRHA 1DHPA 2Q8ZA 1G67A 5LNVA 2Z2UA 4KWWA 2E6YA 5TQLA 5D09A 4CQAA 2VEMA 2PURA 3MHUA 4DELA 1G6CA 3ABRA 2HS8A 4WQ6A 3IVUA 3N2MA 5LNRA 1JCLA 1H50A 4ZZ9A 2H8ZA 4Y8FA 1KW1A 2HSAA 3CIXA 3E02A 4M6QA 1M7OA 5LNUA 3EXTA 2GPTA 3G8EA 3S5OA 3PBUA 3TC7A 1Q6LA 5CPMA 1RPXA 1KV5A 3HF3A 1O5XA 4CNNA 4GBUA 3GAKA 5D2TA 3KVMA 2Y7FA 4Y96A 2QUUA 3DKLA 1LRQA 3P80A 1AG1O 3MBFA 2WNZA 8TIMA 2A6LA 4N4QA 2ZA2A 2JKEA 4BWLC 2WO5A 5K3VA 3E96A 4DBEA 1BKSA 3DKJA 2ZZ6A 1Z44A 2ISWA 3EKZA 2ZZ4A 3E49A 1UJPA 5HMSA 1K7EA 1DQWA 5A5WA 3A23A 2NXHA 3EXSA 3MHFA 1I2OA 3FEMA 3NO5A 3G0UA 4H6KA 3JS3A 3G1VA 3NL6A 1Q45A 1KA9F 3W7HA 1VGAA 3RF9A 2CLEA 3P5YA 3TCEA 1M5WA 4IMCA 1F73A 1FWNA 3M9YA 3HG2A 4DQWA 2NX9A 4JYDA 4MYAA 4E0CA 4DO6A 3FA5A 3NAVA 3C61A 1UASA 5CPNA 3Q94A 1XXXA 3DGRA 3DFSA 2F84A 3C4UA 1KFLA 3L5AA 2Q8LA 1ICPA 1BWKA 4FX8A 4UTTC 3B8DA 1I2QA 2ZCGA 4N2YA 2R94A 3HOJA 3LERA 3TW6A 4NQ1A 1TYGA 4UTLA 3N73A 2B7PA 1TREA 2E68A 1GQNA 5F2GA 3BGGA 4WY0A 1FUYA 4O12A 2H6RA 4LS1A 3MWAA 2GQAA 3V75A 1K03A 4JTLA 3L2IA 4BI5A 2C14A 3H54A 1PHQA 1KTBA 1VHCA 4JN6A 4XUGA 1G7UA 4S2BA 4BK9A 2P0OA 3W1PA 4NX0A 1B9BA 5C55A 4O1BA 1TTJA 2CLMA 4G1KA 3L66A 2ABAA 1RR2A 2BTMA 1KFEA 3B05A 1VH7A 4IQLA 3W70A 3PG9A 1XM3A 4OWGA 4A2SA 1Z48A 4K8EA 4ZQRA 2C3ZA 4LT9A 1MEWA 1I8JA 5FEWA 2QCNA 4LUIA 3HPXA 3UY7A 4DF2A 4IMFA 1EP2A 5F1VA 2X2GA 3DFNA 3V1PA 1TPWA 1ZAHA 5CG7A 1AW1A 4RKAA 3HPSA 4AEOA 3G1XA 1H51A 4XWUA 3B0PA 1KM3A 3NQGA 1FXQA 4O4WA 1W3IA 5AYYA 1FDJA 3G1AA 3LTSA 1GT8A 5F1UA 1F74A 1F2JA 4WXYA 2QEZA 3NQ7A 3DBPA 1SFLA 4WJEA 1XKYA 3G1FA 3LTPA 3UZ5A 2J6XA 3W2NA 1TCDA 1YDNA 2X1RA 5DY2A 3K30A 5KTLA 3LHWA 3W2KA 3LXBA 2YW4A 2Y7GA 5FF4A 4NX5A 1OVDA 2PRMA 5HR7A 5D37A 3UNDA 3VI2A 3GDLA 5CZSA 5E0KA 4EWND 1FCQA 1VYPX 4I9AA 3O6YX 3LI1A 2A2IA 1G4PA 2VOMA 4X3ZA 3DH7A 3NR0A 2YDAA 5HR6A 3M16A 1H1YA 4NJGA 4LOCA 4O19A 4A22A 2VFIA 3MI2A 3ZR4A 4O0ZA 1GG1A 1IF2A 2DJXA 4PTNA 5AHMA 4UIOA 2RDTA 3LBCA 1XL9A 1F6PA 3MYPA 1SR9A 3QH2A 1P0KA 4P2VA 4AWUA 1RQBA 3T55A 4ZVJA 2OZ0A 3VE7A 2YCEA 5DLCA 3YPIA 5IM51 2GVLA 3L5MA 1IGSA 1QMLA 5HUPA 3NL5A 5D02A 4DF0A 3RLVA 3UQNA 4ICNA 3TDFA 1N8FA 1OYBA 3WJZA 2VKZG 3FYPA 3W6YA 5DCDA 3TSDA 3LGEA 3O15A 2QCLA 1TRDA 1VLIA 4QAIA 1GVFA 1TPB1 5F4WA 4IUOA 3W7KA 4N9EA 4QNWA 1GOXA 4ORIA 4M5PA 4ADTA 3PBWA 3W22A 4EOUA 1AMKA 1IXQA 2QCEA 2VFGA 3LX9A 2NV2A 4UFJA 3WK1A 3G1YA 3GDKA 1VCGA 2NLIA 5K9CA 2NX1A 4POCA 3LM7A 3TFCA 5CPLA 3GLCA 4JDBA 2ATMA 3TJLA 4RZ5A 3S1WA 1OK6A 3C2VA 4O57A 3EKLA 1RV8A 4FNPA 2NZLA 2GJLA 3UWVA 3L65A 2A6NA 1IXPA 2XFWA 2Q3RA 1G69A 1T96A 3M6YA 3C2RA 3M47A 4CCDA 4ZL1A 3IIVA 4K37A 4UFHA 1TTPA 1MO0A 4BI6A 2WKJA 3WK0A 4M19A 1VPXA 3G1DA 2QCFA 5KZEA 3USBA 4BI7A 2GVGA 1FWTA 1R2SA 3NA8A 4XKYA 3B0VC 2DZSA 2CLIA 3W7JA 4RLIA 4OT7A 5D2XA 3THAA 2W0UA 1R46A 5F2IA 1N7KA 3LRLA 2VEIA 1TV8A 1OABA 1H63A 5HULA 3R8RA 3W1QA 4O54A 1L2UA 3PY2A 3MUXA 5EYWA 1A50A 1H1ZA 3IGUA 3O8AA 5BRBA 4FNUA 3MP4A 4MLJA 2ZRYA 1W5PA 3MYOA 1KBIA 3BVJA 4MJZA 2JK2A 1X1ZA 3EWWA 3Q58A 1KM0A 3W7OA 5C6MA 4MZ8A 3CWOX 3U2OA 4LV9A 4JX6A 2V30A 4QJ1A 2HS6A 3AO0A 3JR2A 5AYXA 3LV6A 3W07A 2G95A 2P1FA 1VCVA 4FHAA 3OHIA 4S1FA 3RFAA 3HIJA 5DELA 3WK3A 5AYZA 1JCNA 4I7UA 2HMCA 1KM6A 5D30A 1JCMP 4FF7A 1SZEA 2NWRA 2QAPA 3TW7A 3NOEA 3P84A 1YXCA 2Y61A 4ADUA 5KZMA 4K7YA 4YCOA 3STGA 3A5VA 2A5HA 5FI8A 3SFKA 3SIZA 1A53A 5AC8A 3P8JA 3TAOA 2Y88A 2VFDA 5K4ZA 3NQMA 4IMGA 4K8HA 4JIQA 3IIZA 2C1HA 1XCFA 4Q4KA 3IIOA 2ZFAA 1B3OA 4RJEA 1Q6RA 3NPUA 3L9CA 1A5BA 2QAFA 4U4MA 4O17A 3BV4A 1S5WA 3W7IA 4UTHA 2ZBTA 4O1AA 3THQA 2DZTA 3LLDA 3DI0A 1P5BA 1Z42A 4YL2A 1XDLA 2Q3OA 5FF2A 5AHEA 2OJPA 2Z6IA 3GAYA 3R5EA 2ZZ2A 1QPOA 5CSRA 5J5DA 2AQWA 1OX6A 2EPHA 3P62A 3IIPA 4AXKA 5G1TA 1S5TA 3WJXA 2YW3A 2TYSA 1J4EA 4H4IA 3NM1A 3CT7A 2TPSA 1A5AA 1IIHA 2EHHA 3DFPA 1KM1A 2OT1A 4TMBA 5SWUA 1NF7A 3CB8A 3KX6A 3WK2A 4TMCA 3C2FA 3G0XA 1R30A 2BLEA 2AGKA 4MZ1A 3CIWA 4PL2A 3P67A 4DO4A 3MBDA 3TROA 4NNAA 1PCKA 2ZRUA 1YTKA 4HPXA 4UTWA 3L67A 1SZFA 1MZHA 1W0MA 4Z1CA 5KITA 2RFGA 4Z08A 5H2ZA 1MEHA 3HPZA 4QIUA 3OVPA 2EGZA 1OF6A 2G96A 1W5OA 3BLIA 5FESA 4FEZA 1YXDA 4YMZA 3TXVA 2NWSA 4NNBA 2CLFA 1E51A 4E2DA 2O7SA 4HSNA 2E5CA 3TUUA 4FNRA 6TIMA 3LRKA 5KSWA 4XZ9A 5AHLA 2B7QA 2NV1A 2B4GA 3SR7A 3BW2A 3CU2A 3TNOA 3C2OA 1X1OA 2CZDA 4XTDA 1S3HA 4P61A 1Z41A 4RX0A 3EWYA 4HNVA 4MIMA 2DU2A 3W9ZA 4IGHA 4KFOA 1HUVA 2ZZ7A 3KXQA 3O05A 1B57A 3LOTA 3QW4B 2GVJA 1VLWA 4MKNA 5I3JA 1OHLA 3HGJA 1JR1A 3WFAA 2NUXA 3I65A 1SPQA 4EIVA 3M7WA 4A3UA 1OFDA 4MZYA 1VR6A 3LHVA 3DI1A 5HUOA 2QCHA 1TRIA 1RVGA 1UBSA 4RXFA 1SW7A 3L0GA 2Y7DA 3IVSA 1C29A 1XFBA 1TPVA 4MJMA 3SZ8A 1ADOA 3NPXA 3TIMA 3U6WA 2VENA 2NUYA 3UWUA 1KV8A 2VEKA 5TIMA 1EEPA 1YDVA 3S0CA 3QMRA 3ELFA 1WA3A 2QCMA 1OG0A 4U28A 4DO5A 2H90A 4TR9A 5CGQA 3C3NA 3TKFA 4HN4A 4OE7A 3BARA 4O53A 1ME9A 2ISVA 3M5XA 5FEZA 3TJXA 3P81A 2W6RA 3EWXA 3KOFA 5D2VA 3W2UA 3SGUA 2ZTKA 4NZFA 3UXAA 1LCOA 1WAUA 3S5YA 1LZOA 4K38A 2YYUA 3BG5A 3M44A 3RNDA 3GX9A 1TPUA 2X1TA 2ZYFA 2E77A 1X8FA 2GQ9A 3O07A 4N9BA 4O18A 3UD6A 3PB0A 5HJLA 3C8FA 4QQ3A 1B4EA 3UWZA 1WYIA 5C5YA 1TPFA 1XI3A 3M1ZA 4IXXA 1W5QA 1HTIA 4UTKA 3W2JA 3LRMA 4FIRA 1KM5A 4RZ6A 4AWTA 2QCGA 3QC3A 1HO4A 4QISA 3W7LA 5LHFA 4FO4A 1Q6QA 2V2DA 1YYAA 2Y63A 1OFEA 4Y90A 4MLRA 5EMUA 3W7GA 4AF0A 3S6DA 4N02A 4ZQCA 3QSTA 1GG0A 2WPBA 4UMAA 3B03A 1R2TA 2LLEA 4MFDA 1H61A 1LLWA 3GKAA 1SW0A 2V81A 5DXYA 4C1LA 5A8GA 5KMYA 1H62A 2QUTA 1KBJA 2QDGA 1V7YA 2A1YA 2FLIA 3N14A 3TA6A 2WSQA 4ZQOA 4EF8A 3DENA 4JTIA 4IPJA 2TMDA 3OEXA 3KRSA 2C18A 2FB3A 5LNWA 4YCPA 4OV4A 3QMSA 1WOBA 1PHWA 2QKFA 3PULA 3BW4A 1SSDA 1UCWA 3IGXA 3TFXA 3L21A 2A7PA 3SJ3A 1TO3A 3S42A 3LV5A 3I7RA 5EY5A 1TQJA 3ABSA 3NQ8A 1KFCA 4JR5A 1RZMA 3TMQA 3W7QA 3GXTA 3DU0A 3JRKA 1LROA 2CW6A 1H7OA 4JTHA 3G3DA 2ZQ0A 3DFOA 4E2BA 3LHYA 1OFAA 3MP3A 1BTMA 4FX6M 1V5XA 3O6CA 3TU9A 4O10A 3TV8A 3N3MA 4O28A 1FBAA 3OG3A 4UMBA 1SZNA 2GUUA 4XQ6A 3LXAA 1JUKA 3E12A 4PH6A 5U4NA 3HB9A 3A24A 1HG3A 2X16A 4OHQA 3KFTA 5EA9A 4MFEA 3EX1A 1LP6A 3GXPA 4M7SA 4PCFA 3H55A 3T7VA 1LBLA 3NYZA 3M5YA 1NFBA 4JYFA 4OGZA 2WNNA 4QM1A 3NQVA 3KVLA 2BXVA 4BWLA 4LC6A 3NEVA 4HT3A 1D3HA 2I9EA 1VC4A 3FYOA 3TAKA 2QJIA 1W5MA 3LXCA 3S1UA 3HG4A 3HO8A 1SSGA 4UTMA 5E93A 1ZAIA 1KLYA 2V9DA 3MMTA 1O4UA 1M6JA 2DORA 1TPC1 3CQ0A 3BO9A 4R7JA 3GVGA 2RHGA 5BMXA 4DBDA 1LBFA 1JCYA 4FXRA 5CSSA 2QF7A 1FX6A 3WJSA 1VQTA 4JTGA 2V5BA 4UCGA 4LVGA 2QJGA 4JY9A 4M7TA 4FNSA 3PWAA 5D05A 4NJJA 3UY8A 1GTEA 4JX5A 3A5FA 4X9SA 3T4CA 1SO6A 4NXSA 5TBOA 1H7NA 3NZRA 1Y0EA 1W3TA 2GQ8A 1XBZA 2NX3A 4UTTA 2E5DA 4HKPA 1GYNA 3UPBA 3S5ZA 3UWQA 3OIXA 2CFFA 3E9AA 1I45A 2B0MA 3SECA 4HIBA 3FJ6A 2WQPA 1QPQA 4LUJA 4AF0B 1EIXA 3O1NA 3QPYA 3Q2DA 3GDRA 3CLMA 4LNYA 3R89A 1DV7A 3W7NA 3PF3A 3BLEA 1LOQA 2FFCA 4RCXA 1QAPA 2JBMA 3C2EA 3GKFA 3HJZA 1J2WA 3QM3A 1W5NA 3TXZA 4LRSA 1DQXA 2DZWA 2CZFA 1DORA 4AHQA 1L6SA 1YDOA 1DBTA 3MP5A 4WY0B 1JVNA 3WJWA 1SU5A 3W7MA 4KWVA 4AHPA 3KVKA 4Z1AA 1TPH1 2Y89A 4CQ9A 2PRHA 3FS2A 2H8XA 2Y6ZA 4Y6GA 3PB2A 1KTNA 3W7EA 2Y70A 4OV9A 5BNKA 5T26A 4LC8A 5U7SA 1DVJA 2QR6A 4UMCA 1O5KA 2G97A 4GFSA 2VEPA 1O95A 3G3MA 3W73A 2C0AA 1CX9A 4AVFA 3STCA 4NT0A 2V8ZA 5K7JA 3PUEA 4MYXA 3PBVA 3UWWA 3SY5A 1YTEA 5EL1A 2ZZ1A 2ISSA 4UFLA 4K7VA 4QITA 3KVJA 2FDSA 4FNQA 4FB7A 5D04C 1OX4A 3LCFA 3PSVA 4RK8A 1W31A 3BG9A 5D03A 1PVNA 2EAWA 2Y7EA 1G4TA 2AAMA 4GWEA 4NZJA 4GJ1A 5F2MA 4BF9A 3TX9A 3LTYA 1FWSA 3E0IA 2J9ZA 3RU6A 5K9DA 3VFLA 5AN7A 4UFKA 3W87A 4HNNA 2ABBA 5IBXC 3QF0A 3QSRA 4GUFA 2ATSA 3F4WA 2PE4A 1HO1A 1ZHAA 4K6AA 3UXDA 1FDYA 1XDMA 1ZJIA 5EPDA 3KHJA 4C1KA 1EWEA 1XUUA 4BFAA 1TV7A 1LRNA 3T40A 3W1AA 1K02A 5FF3A 1S5VA 1JCXA 4Z0JA 2FJKA 3NPVA 3ZWSA 4PEKA 4ONVA 2TRSA 5E1QA 1LBMA 1TPEA 3OA3A 2ZRXA 4DPPA 1PE1A 1U5JA 4LU0A 3CEPA 1J5TA 1R2RA 1Q3NA 1OFBA 5F4SA 4GE8A 3DHFA 1K8YA 4Q32A 1OYAA 4ZMGA 4UTIA 2FIQA 1ICQA 1EB3A 4MUZA 4PFMA 2CLOA 3QPZA 3CPRA 3TC6A 2J9XA 1EA0A 1W1ZA 2NUWA 5C54A 2PRLA 5J5RA 1I2NA 1FDZA 4UTJA 3DZ1A 3VNDA 1JRCA 2ZZ5A 3NXFA 3PVFA 3IGSA 1Q6OA 4N6EA 1CI1A 2YXGA 4D2JA 1TMHA 3DAQA 3TQ0A 4KKXA 4O8RA 3Q37A 1EPXA 1ML1A 1EUNA 1TQXA 5L9FA 4UNKA 5D33A 3W1NA 2XN2A 5EKYA 3W2LA 3LCGA 4JXCA 4AB4A 3A22A 2OX1A 4JS3A 3W7PA 4L4MA 4S2CA 1WX0A 3T78A 1JCJA 2V2HA 2IQTA 4AAJA 3W74A 1K8ZA 3HGSA 4A21A 1LM1A 3L68A 1OYCA 3QYQA 3LHUA 5DBTA 4ZQMA 3TSBA 4I7WA 3M41A 3M5ZA 4KFPA 5LHEA 3INPA 2ZRWA 4O50A 1SW3A 4IXHA 4O16A 3P7YA 5AFDA 5LGZA 4ORMA 3TQKA 4KFNA 4XBSA 1EUAA 2J24A 1PCWA 1K7XA 2QUVA 5HQEA 2YSWA 1WXJA 2WNQA 2A4AA 3UYCA 3W88A 4XKYB 4X22A 1RD5A 1F5ZA 1VCFA 4YLWA 3RLUA 1XBXA 3T44A 3TK7A 1A5CA 2BX7A 1I2PA 1TJPA 1WOAA 3OBKA 1LLZA 3W85A 4JGDA 3M43A 3W7DA 3NNTA 4E38A 3LI0A 2VFEA 1P1XA 4LV4A 3AJXA 3VKJA 3G24A 2YX0A 2EF9A 2ZA3A 5BMWA 3R13A 2Y62A 4WX2A 3ABQA 4WZHA 5LNSA 5BW6A 1XBYA 2A7NA 3I7SA 4JIPA 4NJIA 4CCCA 2JGQA 2CLKA 1M7PA 4LY8A 3WJYA 1ME7A 2CU0A 3VCRA 4NXKA 4WY0F 5KZDA 4NNCA 3KAOA 1KLZA 2B7OA 4L4LA 5LGXA 4K36A 3W23A 1YXYA 4EF9A 4MY8A 5G2WA 4DEFA 1TV5A 2R8WA 3PG8A 4O0KA 1LTDA 1FCVA 1IXNA 5D38A 2VC6A 2OCZA 5CZJA 3STFA 1WBHA 4NJKA 2E6FA 1H7PA 3NQDA 3MI3A 3ZWTA 1U83A 3NM3A 5G4WA 1QFEA 3DHDA 3ATYA 5DXXA 3O06A 2QCDA 4O1CA 3QEZA 3QFEA 3W7RA 1K8XA 4DF1A 4IJBA 3PAJA 3N19B 1AL8A 4GRSA 4FIQA 3KRZA 1FQ0A 4GUJA 3LHTA 3L0KA 4R34A 2BSLA 2YGYA 1GWJA 1LYXA 2ZDRA 4FXSA 2ZRZA 1UB3A 1R47A 4WD0A 1O94A 1FCUA 4UFIA 2CWNA 2BZNA 4O14A 1L6YA 5DCEA 3W1TA 1NAL1 5DCBA 5F4XA 3STEA 5BOOA 1ZY9A 3G22A 4IMEA 1H7XA 1HFBA 5I3IA 3FOKA 3LHZA 3F4NA 3EX6A 4HSOA 4JEQA 4UR8A 3QQ1A 4OQVA 5G4EA 1GVRA 3W76A 1ONRA 4R33A 1QCWA 2E5BA 1GYLA 1QWGA 1KM4A 4I7VA 2YZRA 1GTHA 4IMDA 1VRDA 3FKKA 3C0JA 3L5LA 1N55A 3NGJA 4LRTA 4JDYA 2ZRVA 3A21A 2H3DA 5HINA 5FF0A 1C8VA 4MOZA 3UPWA 2CLLA 4GC4A 1JUEA 3C52A 2J27A 3ABOA 1SUXA 3QMTA 4ALDA 1MSSA 4A2RA 4CQ8A 3GIYA 3GNNA 4HPJA 4WUIA 4RV8A 4LW7A 1KM2A 3CEUA 5DN1A 4UUIA 1I4NA 4O15A 1F6KA 4JTEA 2GOUA 4MY1A 2VXNA 2X30A 4HNUA 1QDSA 4AHOA 4NJHA 4N9CA 5G2IA 5AB3A 1YADA 1GEQA 5G5IA 2F7FA 2E6AA 5AHFA 1TTQA 2RDWA 2YR1A 2Z1BA 1OK4A 3QQ0A 4LS0A 1D3GA 4MPQA 1ALDA 5HWNA 2P10A 4Z0SA 2PCQA 1GJPA 2J88A 3PM6A 1QR7A 1QPRA 4UFMA 5F2LA 3ANYA 1DL3A 3P82A 1VS1A 1CW2A 3NQAA 3SW6A 4RR4A 2RDUA 4Z1DA 2V5LA 1VYRA 1TSIA 4BR1A 1KTCA 3FKRA 2E09A 3C6CA 3TSMA 1VZWA 4NU7A 1BEUA 3BLFA 3B0UX 3NPWA 3N9SA 3W1UA 1W56A 4JD4A 3LCHA 2RKXA 4O4VA 2WOQA 1H5YA 4ZQNA 2FPVA 3QJAA 3GNDA 5K4XA 4N4PA 2UV8G 3O6DA 4LVFA 1KFBA 4GNJA 2A85A 4W9TA 3I6RA 4LVDA 2YPIA 4R53A 4XTIA 3PUOA 3W7CA 2XN0A 1T0OA 4O13A 3U8GA 1KFJA 4Z1BA 2DZPA 3SGZA 1W8SA 1X7FA 1FWWA 3BG3A 4JTJA 4Y9AA 3TH6A 5K9XA 3F03K 1B4KA 1YPFA 3GYEA 4UNLA 4QSHA 2ZZ3A 1G4EA 1OF8A 3TQVA 2CZ5A 3GR7A 5D2WA 1W3NA 2QCDB 3NQ2A 3EWBX 4CCEA 1JRBA 3HG3A 2BWGA 2WSYA 5G1YA 5AHNA 1GVSA 1ZAJA 7TIMA 3GK0A 4O11A 2Z0IA 3S8HA 1LORA 2EKCA 4UR7A 2Y85A 1EWDA 2FTPA 2YFNA 1KFKA 2I14A 2X1SA 3B06A 3EX3A 5CZTA 4CNOA 2KZHA 2XN1A 3SSJA 5KINA 1LRTA 2B7NA 5I3FA 1UUMA 2A7RA 3PSWA 4FNTA 4H3DA 5L6UA 2DZVA 2WJZA 4AH7A 5EBUA 1ME8A 2DZXA 3W72A 4RXGA 3W1MA 1PS9A 2C19A 1ZCOA 1XUZA 5FF7A 5D32A 3I7QA 5CKSA 2C6QA 3NQCA 4N9DA 1L9WA 1EX5A 3OVQA 4IX0A 3G0SA 5ABTA 1H7WA 2VFHA 3W86A 1OFOA 3M0ZA 1AW2A 1WDWA 1SO3A 1L6WA 1P4CA 1XBVA 1AL7A 1X6UA 3EXRA 1JULA 1ZENA 4JICA 1GVQA 4ZQPA 5I3HA 1H60A 3KRUA 2V82A 4JNMA 2VFFA 4UC5A 4XBKA 1OJXA 4MVAA 1K3UA 3VE9A 2VELA 1ZNNA 1VJIA 2QCCA 1QNVA 1C9DA 4HNTA 1D9EA 1EP1A 1RQEA 1TJRA 3IIXA 1EP3A 1YLVA 4OU1A 2ZA1A 4GUHA 2WSRA 4LWWA 3EWZA 4JTUA 4MY9A 4QNEA 1NF0A 2NXIA 2R91A 3GDTA 3W83A 3P74A 3N34A 5HWJA 3ZFHA 3MI6A 3FFSA 4TO8A 2FPTA 3DFQA 3W71A 1VYSX 3IVTA 3DXIA 3FIGA 3G1SA 5G2HA 4PL1A 3G8RA 2O7QA 4WXZA 2ALDA 2FPYA 2A21A 1JQVA 3S9YA 3MHGA 1FY6A 5AC7A 3GR8A 4AMAA 6ALDA 3R12A 4GXMA 1JQXA 5I3KA 1WQ5A 4WOQA 1YPIA 1OX5A 5FEPA 5K2ZA 5D2YA 2A0NA 3NL2A 1TB3A 4TIMA 3LBMA 1OFRA 1T99A 3LDVA 2FQIA 2OT0A 3W1RA 1GVOA 2JKPA 1K7FA 1JJKA 3HBLA 3HG5A 3W1XA 1THFD 1LDCA 1TIMA 1DOSA 1P0NA 1SQ7A 2E1DA 1QOPA 3ATZA 5H91A 4YXGA 1FXPA 5GVJA 3EEGA 2JGYA 2HTMA 4A29A 4UTWC 4PA8A 4ML9A 3FLUA 1FWRA 4IOTA 3QZEA 5AHIA 4GUIA 2GJNA 3BW3A 4CLMA 3P60A 3LCIA 1YTDA 3S5NA 3H53A 5AOUA 4IX2A 3EX4A 4JY8A 3TE9A 3QW3A 2QDHA 4J9JA 4YWIA 3LCXA 3R2GA 2NXGA 3OVRA 3NQEA 1SZGA 1LOSA 2C15A 3NDOA 3O63A 3FJLA 3HQ1A 3W84A 3LCLA 4FX7A 1SO5A 1IXOA 3CWNA 3MJYA 4IWWA 3S1XA 3RK8A 3PBYA 3B4UA 3GXNA 2Z6JA 2C16A 1QPNA 3PUDA 1AK5A 2CZEA 3PR2A 2D73A 3G1HA 1NEYA 3BK0A 3F1QA 4K39A 4Q33A 1OFPA 5AC6A 4JX4A 3NZ1A 1DKWA 3MW7A 1XC4A 1NSJA 2R14A 3ZS4A 4DXVA 2I1OA 2TSYA 3N2XA 4LTSA 3EX2A 5CPOA 3D0CA 3EWUA 4CNPA 4IPIA 3CHVA 3IEBA 4M6PA 3W2MA 3LLFA 2E6DA 2X1UA 3M5VA 3IV3A 4NVTA 1QOQA 4RZ4A 4EVZA 2DZUA 1BWLA 4JTSA 4JTFA 1VHNA 3NVTA 3HMJG 2YYTA 4JYEA 3PS7A 3C56A 2J9YA 3S1VA 3P5ZA 3G18A 4JTTA 1QO5A 2V2CA 1PV8A 1DJQA 2H3BA 1ZALA 4ADSA 4DPQA 2PC4A 1DJNA 5LSMA 1W37A 3NQ6A 4HHPA 1JUBA 4X2RA 1A5SA 3DFTA 5FEXA 1RQHA 4UTUA 5HNRA 1ZFJA 3TR2A 3CC1A 1GZGA 4JTKA 2DP3A 1SFJA 4TX9A 3B04A 3GZ3A 1HL2A 3N9RA 1UUOA 1W54A 3UZJA 1LOLA 4O1DA 2OMAA 3P8IA 2V0TA 2YFOA 2ZTJA 3GDMA 4PC8A 3W75A 4M6VA 5LZLA 5DY3A 1WV2A 3LCWA 3L0NA 3MO7A 3I68A 1MXSA 3EB2A 1G7VA 2CLHA 1AW5A 4NUWA 1IIGA 2JKAA 3CTLA 1TTIA 1OFQA 5CZ0A 3BGJA 4LVBA 3BPWA 1ICSA 3CM4A 5LKYA 4WOZA 5I3GA 3IRDA 1FCBA 1QO2A 1F76A 4PODA 4LS2A 3NG3A 2WV8A 1WBJA
chains in the Genus database with same CATH superfamily
1F7BA 4WDUA 3W1LA 3NL3A 1DIOA 3OG2A 4GUGA 3D3FA 4JNYA 3NQFA 3PJXA 3O16A 5MF5A 3A9IA 1XGEA 4R9XA 2W79A 3AISA 1ZPTA 5M1TA 5XIAA 3HGOA 4B5XA 4H9TA 4PUWA 5DT5A 3CYJA 4QG6A 3LZ3A 1NWUA 3FGCB 4US5D 1G4SA 1JNDA 3WD4A 2QJHA 5DBUA 2PF8A 3HGRA 4LCSA 4B5NA 4DVOA 3QRHA 1PEZA 4XZMX 2ZXAA 1U33A 2Q8ZA 2C79A 1G67A 2D22A 4X63A 2E6YA 5TQLA 4CQAA 3U7BA 4DELA 5FKYA 3IVUA 3WL0A 1W1VA 1JCLA 1H50A 4Z2JA 1O1ZA 4HU8A 2CESA 1PIGA 3WCZA 2GGJA 3CUFA 4PUNA 1VEOA 3CIXA 5FJOA 4DJFD 2PBGA 2G3NA 2QS8A 5CPMA 2I7GA 3UJEA 3ME3A 1ECQA 2PDKA 3ITTA 3E2RA 3CH0A 3KTXA 3NO3A 3GS6A 3MSDA 4HVXA 3MBFA 4L6OA 2WNZA 2A6LA 2WZEA 1B0IA 4N4QA 2GGIA 3AMKA 3E96A 3V0UA 4DBEA 3AYVA 5DF0A 1Z44A 3QR1A 1F4HA 1UP2A 4PSRA 1QUMA 3EKZA 2HNEA 2GVYA 1UYQA 2FGLA 5HMSA 2YKKA 2NXHA 3MHFA 1XH1A 3ITXA 4C6OA 2PD9A 3KS5A 1O66A 3HA1A 4RDZA 1WDPA 2VHLA 1Q45A 3W7HA 4JIIX 1XWYA 4HK7A 3RF9A 4KBXA 4OBSA 2W5FA 3CAWA 3HG2A 3M9YA 4MYAA 1RJQA 3NAVA 3C61A 4C6LA 2QJJA 1VEMA 2XWDA 1XXXA 3C4UA 2OOGA 1ICPA 3VIIA 2WVTA 2FMNA 2XH4A 2BGSA 2PDGA 3KP1A 4BCEA 3LM3A 4NQ1A 1TYGA 1TREA 3H2EA 1YKWA 1GQNA 4FOUA 2UWFA 4WY0A 4O12A 1CEOA 5M03A 4LS1A 1CGXA 2GQAA 3WFZA 1W1TA 3K2GA 5A2AA 3KTSA 3OZPA 3AYRA 4ES4A 2E28A 4WGHA 4S2BA 1TCMA 4NX0A 4C6DA 2VD8A 1TTJA 1ELSA 3H6OA 1KFEA 3B05A 4IQLA 2XVPA 1MMFA 2DT2A 2G50A 4LUTA 4HA1A 4OWGA 1KWGA 4A2SA 3VDAA 4K8EA 2E8YA 1E1EA 1FP8A 4LUIA 2BGQA 3SIMA 3UY7A 5JIWA 3ES8A 1WCGA 4IMFA 1EP2A 2ALRA 3B8UA 3IRSA 2X2GA 3DFNA 1ZAHA 4KH2A 5CG7A 3LU2A 3G1XA 1H51A 2OGJA 4XWUA 3IJ9A 4XVDA 5A6BD 3QTGA 2WANA 3NQGA 2I9UA 3MC5A 5AYYA 4B90A 4DLMA 3G1AA 3LTSA 1GT8A 1DWGM 5F1UA 1F74A 1F2JA 3RJYA 1SFLA 1MW0A 3UZ5A 3W2NA 1YDNA 2MNRA 3U4FA 5DY2A 3K30A 2DFAA 5FOOA 3R8HA 3LXBA 1E6SM 4MNLA 5H6HA 3H21A 2IQ0A 3LBOA 2DSWA 2Z2AA 4LB3A 3VPLA 3CUHA 2AGTA 3O6YX 4ZODA 2PS2A 1F3EA 4DRSA 2A2IA 5DQPA 2YDAA 3SQMA 1ITQA 4UQBA 3H23A 3AHXA 2ASHA 2Z1SA 4QP0A 1IF2A 2DVUA 1W9UA 4QLKA 2RDTA 4Q4OA 2DQXA 3AIRA 1F6PA 3U2CA 3MYPA 1SR9A 1P0KA 3CUXA 4AWUA 1NOWA 3T55A 1EJUC 2Z29A 3NZPA 5JXQA 3YPIA 3L5MA 1P0DA 3RR1A 1IGSA 5MKGA 5HUPA 3P0XA 2WWCA 3NL5A 4DF0A 3RLVA 1KXQA 3VOJA 1CZ1A 1EOKA 2W3ZA 5DCDA 3TSDA 1PWMA 3LGEA 3GSMA 3O15A 3KUMA 4PMQA 1EGMA 3W7KA 3ANUA 4ORIA 5F7UA 4M5PA 3W22A 4EOUA 1LWJA 4DJED 1GQJA 4UFJA 3NSNA 2OYMA 3RAOA 4H9VA 2XDFA 4Y8EA 5CPLA 2PGRA 5E6YA 1HL8A 4G2DA 2NZLA 3L65A 4UOJA 2A6NA 1IXPA 4FI4A 3M6YA 3M47A 4ZL1A 2EEXA 1E72M 1MO0A 4GC3A 4NAEA 2WKJA 3EDJA 1BF2A 1R38A 3G1DA 2XINA 2J25A 5DX7A 4LUTB 1R2SA 3NA8A 4JQ4A 2CLIA 5FL0A 4DIAA 5EU9A 3THAA 3WIJA 2VZOA 5A6TC 2WKGA 2BVTA 3GG7A 4FPSA 2QULA 5BXSA 5LIYX 1L2UA 5EYWA 1A50A 3GRIA 4BQ4A 4FNUA 1JNEA 2D2GA 4CKQA 4MJZA 2JK2A 4GJJA 1Z8AA 4RNFA 5C6MA 1DJXA 5AYIA 2HS6A 3AO0A 3JR2A 3W07A 3TLLA 4AUBA 2G95A 3RM9A 1VCVA 2BV9A 3RFAA 3P6LA 4ZCWA 2ZC1A 4W8BA 1H4PA 4I7UA 4AY1A 5GJPA 4NZ4A 1QI2A 2IW0A 2NWRA 2OFJA 3TW7A 3M64A 3CV1A 4QJ5B 4A3RA 1YXCA 1JFHA 4YCOA 6A3HA 5FI8A 1Q4NX 2XVLA 3IPWA 3P8JA 1GOIA 3WUFA 2PPGA 4PR4A 4EPDC 4FLSA 4JIQA 3IIZA 1XCFA 5FJUA 2ZFAA 1XH0A 4CVUA 3GYCA 3W6MA 1ISZA 3W7IA 2ZBTA 4FXJA 1Z42A 2Q3OA 3DGBA 5FF2A 3VVGA 3B9OA 2ZZ2A 1QPOA 1PYMA 2AQWA 3T1GA 3P62A 1OCJA 5A3HA 3WLIA 2TYSA 5FIPA 1Y5XA 3NM1A 2UBPC 4JN8A 1A5AA 4CVWA 3DFPA 3RX3A 4B5VA 4Z2GA 2X41A 3VXGA 3G0XA 1TR1A 2R24A 3TEVA 2AGKA 2ZKMX 3CIWA 4IQEA 2CHNA 1UWRA 2PDNA 3AMCA 2OVLA 4NNAA 2TAAA 4Z42C 4DXKA 1PCKA 2ZRUA 4NAEB 4HPXA 1DJIA 4KCUA 3NGFA 1V8EA 1XIJA 1MZHA 4Z1CA 3P14A 4XUYA 1MEHA 3HPZA 3F4DA 3CXOA 1GOKA 3C0QA 5C0QA 5FESA 4AD3A 1R3QA 4W7WA 2CLFA 1XYLA 2Z1XA 4U2ZA 3CZ8A 1SYTA 4M82A 1JDDA 5LA2A 1OWQA 3GVVA 3LRKA 1EKOA 3H4XA 4XZ9A 5AHLA 1AH3A 3VD4A 3BW2A 1YBQA 1S2AA 1PKMA 2CZDA 4RX0A 1QU4A 3EWYA 4DO7A 1JZ3A 3V18A 2DU2A 3W9ZA 4IGHA 5TNVA 5E0CA 3KXQA 2O56A 2GVJA 1D3CA 3URQA 3AYSA 3WD1A 3WFAA 3BAYA 3I65A 3AIEA 4GH1A 1OFDA 3VNMA 3WEMA 4GVIA 2P5NA 1XLIA 2QCHA 3KE0A 1TRIA 3OJGA 5AC4A 3BICA 1D7KA 3AUOA 1RVGA 1UBSA 4RXFA 4DWSC 2Y7DA 1TVNA 3PWGA 4ZOAA 3IVSA 3EMQA 1XFBA 1TPVA 3UXKA 3NPXA 2Z7GA 1POJA 4OOUA 3S0CA 2YZ5A 1H0IA 3ELFA 4MMWA 4IIEA 2QCMA 2CHOA 4JPGA 4D6FA 3C3NA 3TKFA 4OE7A 4PULA 1ME9A 2ISVA 2W6RA 3EWXA 4H8VA 3KOFA 4QSFA 4Q7IA 1RVKA 2ZTKA 4NZFA 3EKGA 1NELA 3UXAA 4JKKA 4Z2HA 4BF5A 3BWWA 3W29A 3RRAA 1W9DM 1U1UA 2WMHA 3M44A 3GX9A 1XLHA 2X1TA 2ZYFA 1X8FA 2GQ9A 3PB0A 2CXEA 4QQ3A 1RA0A 4HHLA 1ZS2A 3RLGA 3UWZA 9RUBA 1UR9A 5C5YA 1MQRA 1T6MA 3DG7A 1N8WA 4WSJA 2WC4A 2HPMA 3LRMA 2J7CA 4RZ6A 4MWAE 3WQ6A 3FX4A 3QC3A 5KEZA 4JFUA 3AZSA 4ZE5A 3KCOA 3A4AA 4H6EA 1PO9A 1OFEA 3GE7A 1PB0A 5EMUA 3WENA 3L4VA 3BAKA 3VKBA 1SMAA 4N02A 3EPOA 4ZQCA 3QSTA 3WDJA 3KCJA 2Y5EA 4Q6XA 3GKAA 4KEUA 3VILA 3HQPA 5DMNA 1DXFA 4C1LA 4YTTA 1OC5A 5LXEA 1XIMA 1H62A 2JEPA 1V7YA 2E25A 3GXFA 2QGYA 2WMIB 1O12A 3DENA 2DW7A 4IPJA 2TMDA 3KRSA 2C18A 1QNOA 1S2TA 5LNWA 2CHRA 1ZLPA 3NJ3A 2QKFA 1SR0A 3BW4A 1SSDA 1UCWA 2W91A 3LPFA 3S42A 1DPMA 3URAA 3L4UA 4IJRA 3NQ8A 3GQYA 2ICSA 4IIGA 2PDFA 3TMQA 3DU0A 3JRKA 1EIBA 4D6JA 3SDOA 1GQKA 3G3DA 1B3ZA 1XRFA 3DFOA 3PZMA 4E2BA 1V5XA 4O10A 3TV8A 3PZIA 2DY3A 1RJPA 3AI0A 4UMBA 1XISA 3PFMA 2GUUA 1TX2A 2VRKA 3LXAA 3E0VA 4KETA 1UZHA 5U4NA 1XYFA 3O0KA 3HB9A 2PLCA 3M46A 1I60A 2X16A 4XKMA 2B81A 3KFTA 5EA9A 2J66A 4I6KA 3T09A 3AQUA 1EHNA 2G41A 3NYZA 1W8GA 1C91A 2QIIA 3NQVA 1VBJA 4N7QA 3OLEA 2Z27A 3NEVA 4HT3A 1NIUA 3V3WA 1OC6A 4GQGA 3QR0A 3TAKA 1VJZA 1P48A 2OYLA 4PUDA 3VO0A 3NXLA 3S1UA 2E7FA 3HG4A 4UTMA 5E93A 3RUBL 2PGWA 4G5DA 4ERGA 1O4UA 2DORA 5E5CA 4J3SA 1Q6GA 2QQ6A 4R7JA 1AQHA 1CDGA 3GVGA 4DBDA 1LBFA 4HA0A 1UWTA 1OD0A 3GY1A 4FXRA 1FX6A 1VFMA 2AKZA 4IL2A 1I0BA 4M7TA 2PGEA 1XIHA 4ZBCA 1GTEA 2YA1A 2EG8A 1SO6A 3NZRA 1XBZA 4UTTA 2EKGA 2OLHA 1J12A 4XD5A 2CFFA 1I45A 3ZVHB 3FJ6A 5B7ZA 4QG8A 3WBEA 3AS0A 3KLKA 1AQFA 3LZ5A 5CC7A 3O1NA 3PTMA 2QV5A 3R89A 1DEDA 4GYPA 3PZOA 4LUSB 3CGTA 4ICMA 1X98A 3IWPA 1LOQA 1S5MA 4RCXA 2XYLA 3RU8X 1QAPA 2JBMA 3C2EA 3GKFA 1HJVA 1P7TB 1EGZA 1W5NA 3QM3A 1BD0A 2DZWA 3TXZA 4GY1A 4FLRA 1YDOA 1DBTA 5CC3A 1UR3M 4B4HA 4I8DA 4CQ9A 2PRHA 4HYRA 3NVDA 2Y6ZA 3PB2A 3W7EA 2GDQA 4EWJA 4IHCA 4JIRA 2VUYA 2BODX 3T0CA 3W73A 3ZOAA 3VZXA 4PBGA 3EA1A 3ISIX 1E15A 4U5KA 4LAUA 4LBRA 3STCA 2OQYA 1MFVA 1V3IA 1XW8A 4E4UA 3PBVA 4JEJA 1VFLA 5ABFB 2ZZ1A 5TD4A 3MKVA 3R43A 4C6CA 1VAHA 4QITA 2HV5A 2GFTA 3SBFA 3TP4A 1EBGA 1OX4A 4RK8A 1DP0A 1HKKA 1PVNA 1T41A 3T0BA 2Y7EA 1G4TA 2AAMA 5REQB 3CBWA 2ONEA 1EHAA 3D3AA 2WK2A 5D9MA 1YDYA 3LTYA 3AU6A 1AJ0A 3SO7A 4ENLA 5K9DA 1UR2A 1JPKA 3QQWA 4GIRA 1ZQ5A 4D8AA 3AOFA 3W87A 3QSRA 3N15A 2ATSA 4GZJA 4KIEA 5E70A 1FDYA 3PTDA 2UY3A 3KHJA 2XZ9A 1JZ7A 1TV7A 2XM2A 3NPVA 4QBXA 2R6OA 5C70A 3ZWSA 3N4EA 3IJDA 5I79A 3OA3A 3TA9A 4DPPA 1YIXA 4LU0A 1U5VA 4W5ZA 3BLKA 2Z1VA 4C1NA 2YBVA 3DHFA 1OYAA 1B54A 5LIKX 1ICQA 1EB3A 4MUZA 5EGRA 4E4FA 3CPRA 1L6FA 1EA0A 1JPMA 1P6CA 4FR6A 3KEHA 3BH4A 3KDNA 5J5RA 2E4TA 4UTJA 3HQNA 3PVFA 3NZQA 1CI1A 1UWQA 2QPUA 2X0HA 4KT2A 1W9XA 4GKTA 4ATWA 5L9FA 1E6XM 5D33A 2XN2A 1XX1A 3EOEA 3PZQA 2JF7A 4AB4A 5H8PA 3OYZA 4XAGA 5BWFA 2VR5A 4AD1A 4U3CA 5JIPA 1WX0A 3HV9A 3ITLA 3KLLA 3D46A 3M4HA 1I1XA 2X0SA 1GKRA 3MUIA 4A21A 2YBUA 3QYQA 3LHUA 2YCIX 4KFPA 1RCQA 3M41A 3INPA 3TNBA 4MG4A 3VDCA 1VF8A 2ZX5A 5AFDA 5LGZA 3TQKA 3CZJA 1FH8A 1EUAA 1PCWA 3L4YA 4GK8A 1V02E 2A4AA 3UYCA 4W85A 1NOFA 4XKYB 4CGTA 1F5ZA 1VCFA 4YLWA 3V7PA 1XBXA 3LSBA 1JDCA 2FH8A 4JGDA 3T0TA 1B2YA 3M43A 3CAKA 3QHOA 5BWAA 3LI0A 3CV7A 2RAGA 4K3ZA 3ENLA 1P1XA 3IS4A 4G7FA 5HMEA 1X7IA 2IUZA 3VKJA 3AYTA 2JQXA 2ZA3A 5BMWA 1MRQA 2FGZA 1XBYA 2VUNA 1XCXA 4CCCA 4HD5A 3E6EA 5IOBA 3MDUA 2CLKA 4M56A 3GH4A 1EA9C 1TA3A 3WJYA 1ME7A 4K1WA 3TTOA 4AZGA 2PWGA 2B7OA 1YE6A 1JYVA 5LGXA 3VNZA 1RA5A 1DIEA 1YXYA 4YU1A 4EF9A 5G2WA 1TV5A 2WXDM 4DWDA 3PG8A 3EA2A 4O0KA 1RCXB 2J8GA 1E3XA 2F2KA 4L1GA 3ONBA 1Z6KA 3TWAA 1A0DA 1WBHA 2CXGA 3ARPA 3B0YA 1U1HA 4WDXA 3QOMA 3WMCA 1RK5A 1KXHA 4GGBA 3N25A 1H7PA 1KCZA 3NQDA 3G6MA 3NM3A 1F07A 1K8CA 1RLDA 5HQMA 1GZ1A 3DERA 4DF1A 4KRZA 3PAJA 3TTSA 1UIPA 4ZENA 1V51A 4FIQA 3ZM8A 4GQBA 2CBUA 3MWCA 3F2CA 1RALA 3BDKA 3WKZA 2OZ8A 2WZTA 4FA3A 1GWJA 1LYXA 3GHTA 3EDEA 4Y9OA 1YE4A 1UB3A 1R47A 4MB4A 2X42A 2VX4A 2BZNA 3W1TA 5DCBA 3POCA 4K2SA 1G1YA 5BOOA 1ZZMA 5I3IA 3GW0A 4C6FA 4KCTA 4HSOA 4HU0A 1AMYA 5CJMA 4GCXA 5G4EA 1ONRA 4J4KA 2BOEX 2E5BA 1Q6EA 1QWGA 1KM4A 2YZRA 4IP4A 1S3TC 2YCKX 3WNOA 1FWGC 5HMFA 3FKKA 1N55A 4LRTA 2VZVA 3OGVA 1Q6FA 5A6JA 2ZRVA 3ZYZA 1RPKA 4PCPA 1OM0A 5FF0A 1C8VA 3UPWA 1HJXA 1JUEA 3C52A 2J27A 4R88A 2C1IA 4DNMA 1D8CA 1MSSA 4A2RA 4J3ZA 1KM2A 5DN1A 1EXPA 4F79A 4JTEA 4MY1A 2X30A 3GWQA 4AHOA 4N9CA 5G5IA 1ZBWA 1ISVA 3QQ0A 1D3GA 2JF6A 2WVVB 3OGSA 1QATA 1XICA 4IIBA 2PZNA 1QPRA 3UR2A 4UFMA 5F2LA 1JZ5A 2IQDA 1Z69A 2WQDA 1VS1A 4RNIA 4RR4A 1NY1A 1XD1A 2RDUA 5HPOA 4LY4A 1SFTA 4CCZA 1ODUA 1XQLA 2XSAA 5C9WA 2V6AA 3VIMA 3BLFA 1UA7A 3N9SA 4W8AA 1W56A 4GIEA 2EJ1A 2RKXA 1UWUA 4O4VA 4LFYA 4UOZA 3N6HA 2Y8VA 4X9YA 4P8UA 1BG9A 1TA3B 4G7EA 4GISA 5K4XA 2VR4A 1JEZA 1A0EA 1XP3A 2GSHA 2H9AA 1AD1A 4W9TA 1KO0A 3S47A 4AWEA 3E1F1 1T0OA 3U8GA 3WQEA 1VFOA 1KFJA 3RO6A 4IIFA 1HJSA 4DY1A 4JTJA 1GNXA 3TH6A 4NAFA 1RXOB 2WZMA 4XG1A 1YPFA 2PDYA 4UNLA 4QSHA 1KNWA 1OF8A 2GL5A 3LEPA 3VC5A 2Y0FA 2VRJA 2D0GA 4W89A 4WDWA 3VX1A 3HG3A 5G1YA 1GVSA 3BZJA 3VD5A 3UEQA 3S9IA 2VO5A 4B2DA 3EDKA 5AKQA 4DJDD 2Y85A 2CITA 1KFKA 3EX3A 3QV8A 4GVGA 4J27A 5ECUA 4CNOA 2XN1A 1QT1A 1A4MA 1CT5A 1ZTVA 4FR1A 3AHVA 2DZVA 1LG1A 4O1EA 1KKRA 4RE0A 1UPPA 2MANA 2NQHA 3W1MA 2DQWA 3VKKA 2Z7KA 5IDZA 2WZIA 4I5RA 3UW6A 3QZAA 1L9WA 3LYEA 2CPUA 2O55A 3W81A 3OVQA 3G0SA 3OODA 3TLQA 1OIMA 1L6WA 1IEQA 4R27A 4F40A 1GVQA 2V3DA 4LAZA 1H60A 4AYSA 2V82A 4GD0A 2HPIA 3WF2A 2GYIA 1J0ZA 4MVAA 5A94A 3TN4A 2OELA 1VJIA 1Z7AA 1TE1A 2J78A 4HNTA 3E38A 1RQEA 4G9PA 3IIXA 4GUHA 2WSRA 4LWWA 3EWZA 2DZAA 3P74A 1C3FA 1UKTA 4WKHA 3DFQA 1VYSX 3IVTA 1XF0A 3DXIA 3G1SA 2X0YA 4PL1A 3T9PA 3G8RA 2O7QA 2FPYA 4AIEA 3S9YA 3MCOA 1ECEA 2BY0A 2DEPA 3WLOA 3LPGA 5K2ZA 2GLKA 2A0NA 4PBFA 3CUIA 3NL2A 4JZ5A 2QF8A 3C0SA 4B9ZA 4TIMA 4IGMA 3LDVA 2FQIA 2OT0A 4H7VA 4G7EB 4RPPA 1K7FA 1JJKA 1ESWA 3U2ZA 3HG5A 3TOYA 3W1XA 4XAYA 1GKQA 1ZL1A 1THFD 6ENLA 1CIUA 1QOPA 4F4RA 2PU1A 3ATZA 3U5UA 1R3VA 1OSEA 1FXPA 1TVPA 3V35A 2DSVA 3VUSA 4YXGA 1V6TA 3SADA 1HVXA 3BCDA 4UTWC 4PMRA 4HZMA 1TVLA 4PA8A 4ML9A 2D3NA 1LQAA 3OB8A 5DT7A 5AHIA 4CLMA 2GSEA 3P60A 3FV9A 1HJUA 3BAWA 3GNPA 1ZBVA 4PB4A 2CNCA 4F48A 5DO8A 3EX4A 3IJLA 4JY8A 4XBJA 2QDHA 2V67A 2BMBA 3LCXA 2BXYA 2NXGA 3OVRA 3NQEA 4P7RA 4F0MA 1YW1A 3TYEA 3W84A 3U57A 3RK8A 3M6DA 5CSYA 2CZEA 3AXIA 5M5DA 3G1HA 1JYXA 2XIJA 1H2JA 3UFYA 4GO9A 2E8ZA 3WLPA 3ZS4A 3V5CA 2YB1A 3EX2A 3D0CA 3FDKA 1HJQA 3R4IA 4AZ6A 2EJAA 3IEBA 2YBTA 1D7FA 4Z1YA 2X1UA 4GABA 2I5QA 4IFOA 4ERIA 3H2MA 4DUVA 2EPOA 2PEVA 4JTSA 4LF1A 1VHNA 3NVTA 2YXOA 3QC0A 2YYTA 2J9YA 3S1VA 3P5ZA 1PBGA 1UC5A 2HBXA 4EKJA 4FXFA 5DMYA 1DJQA 1XR2A 3VNIA 3VIHA 4HN8A 1E0WA 3CUJA 5LSMA 3ITYA 5GNXA 1CLKA 1O5RA 3CAQA 5BXTA 1FWBC 3TOPA 3GZ3A 1GONA 3BJFA 3P8IA 4PC8A 1DHKA 3UJ2A 3D5HA 3ARZA 5LZLA 3LCWA 3L0NA 3T2PA 5CBBA 3I68A 1AW5A 4PEEA 2E9MA 3IAQA 3AJ7A 3WQVA 5I3GA 1WDDA 3IRDA 4HOXA 2BDQA 3GH5A 4OBTA 3UWYA 1S1RA 3P61A 4JFSA 3NDYA 1CGVA 5HK4A 4O52A 3H8AA 5AZ1A 3RMJA 1DWHM 3JW7A 2PBOA 1J9YA 4LXFA 1WKEA 4UB9A 3SI9A 5I00A 1KR0A 3THDA 2RH9A 1O60A 3H2AA 1REQA 1PIIA 3QGKC 3KDOA 1LLOA 2VX7A 1DHPA 3FEQA 3MU7A 3GBEA 1NQKA 4J40A 3BOFA 4EK7A 1E6NA 2VEMA 5C9ZA 4NI8A 1G6CA 5CQ1A 4WQ6A 3MCNA 3N2MA 4C6MA 3ALFA 3CL8A 5ABGA 1M7OA 5LNUA 2P88A 1HKVA 3EXTA 4H8NA 4DX3A 1DYSA 3BSMA 2A3BA 3C3UA 3N6QA 4D6GA 3JZEA 1O5XA 4CNNA 3GAKA 3I3DA 4AZCA 4Y96A 2ZUMA 4PCNA 2C91A 1T40A 3P80A 1UZ1A 3NQBA 2RGMA 3Q65A 3ZMRA 4BWLC 2WO5A 5K3VA 3CL7A 4AZ7A 3AU2A 2VCAA 3K13A 1EF3A 1UJPA 1K7EA 1DQWA 5A5WA 1WB0A 3A23A 8RUCA 3EXSA 3QLLA 4ACZA 1FA2A 1I2OA 1ODZA 3D47A 3WL1A 2JALA 2FZBA 2A3CA 2ZICA 1KA9F 5H8MA 1VGAA 1EOMA 3TCEA 3WBYA 4B91A 2INEA 3GUWA 3ARYA 1KKOA 3VOHA 4DQWA 2YL6A 1I0DA 1UASA 4D71A 4LBUA 3OU8A 5CPNA 3Q94A 3DGRA 3O2LA 3SQSA 1KFLA 3GNOA 4FX8A 4N2YA 1M68A 3H22A 5AY7A 4N42A 2P50A 3QV9A 1IT7A 3N73A 2HZGA 3BGGA 4MKSA 2H6RA 3WQGA 2WNWA 3MWAA 2DPEA 5LA1A 1C8YA 3A6OA 2FJUB 1VHCA 1G7UA 3LPPA 4V2XA 1J6OA 4BK9A 4M51A 1B9BA 4ZB0A 3BMVA 3ZT5A 2PF0A 4C5ZA 4INFA 4G1KA 2J79A 1UD3A 1UP3A 2ABAA 2ZUNA 4BF7A 1AH0A 3GXMA 2VEFA 1U2YA 3A12A 1Q8JA 1O68A 3BSHA 4H41A 3FA3A 5LIWX 2C3ZA 2P76A 5EB8A 4IZGA 5HAOA 3OHMB 5FEWA 2QCNA 3QXBA 1EJSC 1IZKA 3WNNA 1RSCA 4XAFA 4O8AA 4ZB2A 3LD5A 3DUGA 2Y5JA 1XLGA 4RKAA 3HPSA 4AEOA 2BXZA 1XIDA 1FXQA 1VIWA 3S1GA 1FDJA 2R1PA 3USZA 4HB7A 2Q09A 3KOWA 3RCNA 2QEZA 4WJEA 3DBPA 1XKYA 3LTPA 3H7VA 3ES7A 3E3HA 3ABXA 3GDBA 3K4WA 4QEHA 1OVDA 3SCPA 2PRMA 5D37A 3UNDA 4EWND 2REQB 5E0KA 2OYKA 4BQ3A 4S38A 2DV0A 3NR0A 2WM1A 2G3JA 1AZ2A 1XGDA 2VFIA 1GJWA 3MI2A 4O0ZA 2DJXA 4PTNA 5AHMA 4H01A 5IHSA 1V0LA 2KAUC 4CU8A 3HFYA 4ACZB 2GJRA 5M2FX 2C71A 1RQBA 5CJ5A 1GORA 3H4WA 3VE7A 5EMYA 2HQAA 1YNQA 5HA7A 3WNMA 2RUSA 4AISA 1XQKA 3HTWA 1QMLA 1S2UA 3GD6A 4ICNA 1OYBA 1JDFA 4KPLA 3FYPA 1KFWA 2C8NA 4EP8C 1TRDA 2NSOA 1VLIA 3VDBA 4N9EA 4QNWA 4UR9A 4H00A 2Z1KA 2BOFX 4V33A 1U30A 4ADTA 1KXVA 1AMKA 2VFGA 3CQJA 4S3DA 1Z9AA 1T8QA 3TFCA 1TR9A 1CGTA 4JDBA 2YDRA 4C7GA 2ATMA 3E0LA 1AVAA 3TJLA 5CSUA 1XKJA 3C2VA 1QVBA 4I9JA 1RV8A 3HURA 2GJLA 3S6TA 3V36A 4HU3A 1G69A 1T96A 4MWAC 4CCDA 1D8WA 1ZSXA 3IIVA 4GO8A 4UFHA 4PZVA 1TTPA 1RBLA 4BI6A 4PTMA 2AL2B 5IFTA 2BHZA 4FS9A 1AD4A 1OGGA 1XLMA 4ROPA 1JPHA 2GVGA 2PU0A 1FWTA 3FY1A 1LQ0A 2FZ8A 2FZNA 4QTGA 1UHVA 4HNLA 1ZP4A 4RLIA 4OT7A 1E55A 3JVAA 3EGJA 3GFYA 1R46A 4YNGA 1N7KA 3UNTA 2VEIA 1OABA 1H63A 3RPDA 3QKEA 5CPQA 1LL6A 1H1ZA 3IGUA 3MP4A 4TOQA 2VGGA 3MYOA 1KBIA 3WLJA 2VC9A 3W7OA 2EPMX 5AVHA 5H1WA 5HNUA 3U2OA 3WMSA 4JX6A 4QJ1A 5AYXA 1CGWA 1DIKA 3OHIA 3QHNA 1JAKA 1AA1B 3LS9A 2JEQA 4EXAA 4LX4A 3WK3A 2VI0A 3SRKA 1JCNA 1XLAA 1HKJA 3PANA 2BBFA 4NG3A 3TONA 1VRXA 2E40A 1C92A 2Q02A 2QAPA 3NOEA 1MW1A 1GK8A 3GM8A 4ADUA 2Y61A 3AXHA 4JQAA 4K7YA 1FH7A 3FXGA 2WAGA 3NEHA 3FVDA 4A8IA 1Q85A 1TWIA 1ZGDA 1BRLA 4UQAA 2Y88A 3NQMA 4FAMA 4IMGA 1XIGA 4AEEA 2G37A 2C1HA 1LL7A 3IIOA 3L9CA 1A5BA 2QAFA 4U4MA 5EMLA 1O1HA 1C93A 1ZJAA 1VFFA 4UTHA 2VC5A 3DG6A 3WEZA 1AZ1A 4NIRA 3EPNA 3THQA 2DZTA 3LLDA 2E1WA 3EMZA 2Y4SA 1XDLA 2VYOA 1KQZA 5AHEA 3PPGA 3T0DA 5T91A 1KCKA 4KWUA 5J5DA 2VNCA 3UPMA 1AODA 3CHCA 1XG4A 3IIPA 1TWZA 1S5TA 5HBFA 2YW3A 2PDLA 4H4IA 1BXBA 1BYAA 1Q66A 2TPSA 2EHHA 1PXGA 1VP5A 5SWUA 1BGGA 1NF7A 3MVIA 3KX6A 3WK2A 2VMFA 3C2FA 3VMOA 2BLEA 4PL2A 3TWBA 7ODCA 3PWIA 5DEZA 4TVUA 3PBGA 5C2CA 1BF6A 4PMUA 1MYRA 1M1BA 4GA8A 3QYSA 2RFGA 4YTQA 4QE1A 4DM1A 2BVDA 1W5OA 1UD2A 2VGIA 4FEZA 3TXVA 4TQTA 4E2DA 3TW9A 2D3LA 4TV5A 4XK2A 3TUUA 6TIMA 2WMGA 5KSWA 1T5AA 2B7QA 2B4GA 1H1NA 4FLQA 2OPJA 3TNOA 3C2OA 1X1OA 3ARQA 4LYPA 1S3HA 4P61A 4HNVA 4AZ5A 5HOSA 2XZ7A 1KBKA 2ZZ7A 1S39A 5A6BA 3HPAA 5I3JA 1OHLA 3HGJA 1OCBA 1K4GA 2XFYA 3RJXA 3I3BA 3FK4A 3VCNA 3BCJA 3QLDA 3TQPA 3M7WA 4MZYA 3DI1A 1E6PA 1I9CB 1B30A 3VYLA 4PMJA 2AQVA 4ZXOA 1SW7A 3L0GA 2G3FA 4MJMA 1ADOA 3TIMA 3U6WA 4GINA 2NUYA 2VQTA 3T4WA 1YDVA 2XUCA 3URBA 2PWFA 4JFWA 3OLIA 5B80A 3VIFA 1WA3A 4U28A 4DO5A 2ZX6A 3WBXA 2WCGA 4M24A 5CGQA 3WZ0E 1FWCC 3BARA 5E6ZA 4NILA 2WHLA 3ARVA 3M5XA 5FEZA 2YL8A 3P81A 1VPYA 1CXEA 2HBVA 3S5YA 5JVLA 3BG5A 2D24A 3RNDA 1TPUA 2E77A 4N9BA 1B5TA 1ZBCA 3HMCA 2WLZA 1W3JA 1ADDA 5J8LA 1TPFA 2F61A 9XIMA 3V5FA 3M1ZA 1W5QA 3NWRA 3RIKA 1KM5A 4AWTA 4QISA 1HO4A 2V2DA 1YYAA 3SUWA 4DJEA 2VGBA 4UMAA 4CNUA 2VGFA 4WCJA 2OWCA 4Z2KA 3ID7A 4MFDA 1SW0A 2HVMA 3BSGA 2V81A 1ZRQA 5DXYA 1W1PA 5A8GA 4QJ3B 1XRTA 3NFUA 2QDGA 3MMDA 2FLIA 4ZQOA 4GGHA 4JTIA 2VC7A 3MJMA 3OEXA 1CLXA 3L4WA 3ORWA 2FB3A 4FK9A 1UPMB 4NI3A 4U31A 1EJRC 4OV4A 3MV01 3PULA 3IGXA 4KWSA 1HQTA 3L21A 2A7PA 4RE3A 1XRVA 1Z3NA 1A5OC 3S83A 3LV5A 1TQJA 4HTYA 5CAHA 4JR5A 2CW6A 4DYJA 1H7OA 4JTHA 1RCOB 4HPGA 3E2QA 2ZQ0A 1J0KA 2Z00A 1OFAA 3AWNA 3MP3A 1BTMA 3TU9A 3N3MA 2J74A 3GNXA 3WQCA 1SZNA 1WE5A 3T2OA 3KM8A 2C1GA 4S3FA 3LGGA 1QOXA 2GSJA 4HP5A 4MFEA 3EX1A 3GXPA 4I5XA 2D2JA 3H55A 5CG0A 1LBLA 2HWGA 1BYDA 3NDZA 3M5YA 3IJIA 4JYFA 2WNNA 4CEXC 3CB3A 5TAOA 3ZR5A 5CAKA 4ZTXA 3DOPA 1VC4A 3FYOA 3B3DA 2ZUWA 4S3GA 1X6NA 1SSGA 4Q6JA 1WUFA 4DBWA 3BLDA 3LPOA 4W4QA 4MDPA 1M6JA 3LMZA 1TPC1 3FDGA 1NDZA 3CQ0A 3BO9A 3A9BA 2RHGA 3M07A 1EGVA 1AUSL 3R25A 4ZR8A 2QF7A 3WJSA 1VQTA 2QJGA 4JY9A 3F7JA 3AXMA 4X9SA 1DXEA 5ABHA 3EOLA 4NXSA 1H7NA 1XLJA 2E0PA 1W3TA 3CHDA 1JPDX 1GYNA 4GZIA 2ADAA 2VOTA 4HCLA 3UWQA 3HU7A 4HIBA 2W63A 1MUMA 1EIXA 4K68A 3QPYA 2QT3A 4RW5A 2WJFA 3OOQA 3R94A 1DV7A 3W7NA 3BLEA 1J0IA 4BS0A 4YTRA 3UERA 2OR2A 4GX9A 3HJZA 1J2WA 5I24A 1DORA 3T08A 4IH3A 1L6SA 1T7LA 2PC8A 1R7OA 3WJWA 1JVNA 1J10A 4S3EA 1SU5A 4AU0A 3KVKA 4BEQA 1B9ZA 5FSEC 4DLFA 3OBAA 2OLAA 4B5SA 3FS2A 3N18A 1W2PA 3WH5A 4Y6GA 3S3GA 2FZMA 2Y70A 5BNKA 3N13A 4IP7A 2ZXQA 2G97A 5BZAA 4GFSA 2CEQA 3MY9A 1IWAA 3VNLA 4XAZA 1LUCA 1IHIA 1CX9A 3AAMA 3CIVA 3GW3A 4AVFA 3CQKA 4HU4A 2VWTA 4NT0A 4PYSA 2V8ZA 2OEMA 3W4RA 3BCFA 2XWEA 4HOWA 1CYGA 1XD0A 3C8NA 4NP7A 1YNPA 4IQDA 4JNZA 4LAOA 3SY5A 1YTEA 5BROA 3GG1A 4UFLA 4NZ3A 4NY2A 1UC4A 1PX8A 4DWSD 3S9ZA 4HA3A 1MI3A 5D04C 3LCFA 2G3MA 3ERPA 4TTUA 1W31A 4Q7NA 1VB9A 2PWEA 1H3GA 5D03A 3POHA 2VT0A 1Y5WA 2JE8A 1W3HA 4NZJA 5F2MA 1QK2A 3RU6A 1KB3A 2J7DA 4HZ6A 2NQLA 4HOZA 4XD6A 4UFKA 4H83A 3SUSA 3F4WA 1BVNP 1ZHAA 4K6AA 3AHYA 5EPDA 2X1IA 2Y24A 4IPPA 2PP0A 1EJTC 1OG6A 3WH6A 3EB3A 1XUUA 3Q45A 1S5VA 1JCXA 2FJKA 4PEKA 2TRSA 5E1QA 8CGTA 3PHAA 2D0HA 1U5JA 4LYRA 1R2RA 1OT2A 4HYVA 5F4SA 5I5RA 1XSJA 1XLEA 3CO8A 4UTIA 1F8MA 3VM5A 4PFMA 5ABEA 1W17A 3I6TA 2HISA 4W7VA 3KL0A 4OECA 3QPZA 1J0YA 3WQDA 3AS1A 4FOJA 1UOZA 2IPFA 3ARUA 1MQQA 1Q13A 1LT8A 1I2NA 1FDZA 2W66A 3WLLA 3DZ1A 4TTGA 2ZZ5A 1UH3A 3IGSA 2YXGA 1QK0A 3PPFA 4KKXA 4NYYA 2GUYA 3KS6A 3BAJA 2EXOA 3ZLGA 1TQXA 1EPVA 1A5KC 1Y8BA 3LCGA 3AIWA 2OX1A 3KHDA 3W7PA 2BG5A 4L4MA 3SCVA 4S2CA 4GVFA 1JCJA 1F8IA 4AAJA 5LXXA 1GJUA 1K8ZA 4BZYA 4ZQMA 4CNSA 3M7SA 3M5ZA 5LHEA 2ZRWA 3DDMA 4O50A 1DXIA 1SW3A 2OSXA 3SQLA 4IXHA 4ORMA 2NQ9A 9XIAA 1LUCB 2QUVA 3M0JA 1XIEA 3W88A 3VC6A 1RD5A 1EJXC 2QDEA 4Q22A 5I09A 5B7YA 1A5CA 2BX7A 1TJPA 1WOAA 3OBKA 2X40A 4NRSA 2VR2A 3W85A 1XPYA 3WQOA 4QE4A 3L12A 1JDEA 4HBKA 3U4AA 3VM7A 4TX8A 4RDYA 4PCTA 1SVDA 2E9LA 1MFUA 3AROA 3K8KA 4REQA 3QV6A 1VBRA 3BXWA 3CT2A 1NWTA 4RDVA 3GU9A 1R0MA 1E70M 4J7RA 2TODA 3AJXA 4WX2A 1V3LA 5LNSA 5BW6A 4V1YA 4DBUA 1B3WA 4DI9A 2YA2A 4J35A 2PMQA 2JGQA 3VD3A 4LY8A 1LWHA 3WD3A 4H8HA 2A3LA 2OB3A 1KLZA 2VX5A 5A8NA 1KRMA 3W23A 4MY8A 4DEFA 2WC7A 1GOQA 3PTQA 1DWAM 2HK0A 3T0AA 4E2VA 4YWSA 2Z24A 2E6FA 1TJ0A 3MI3A 1E3ZA 5G4WA 2PP1A 1V03A 1QFEA 5C71A 2OKOA 2OTDA 1PUDA 3ATYA 4O1CA 4HQVA 3E74A 1NP2A 2PP3A 4RZBA 3RPTA 6TAAA 2XGZA 3LHTA 4R34A 2BSLA 4YTUA 3ZT6A 1OZMA 3SURA 4WD0A 1O94A 2CWNA 5DCEA 2FTYA 5F4XA 1BFNA 1H7XA 2NQZA 3F4NA 4S3JA 2IPJA 4DB7A 4HMCA 3CV2A 4BQ2A 3W76A 3MVTA 2NQ5A 1QCWA 2HVNA 4I7VA 1L2QA 1GTHA 4IMDA 2HK1A 1VRDA 2DT1A 2INZA 4OUIA 2QV4A 3NGJA 1A47A 2O9PA 3MT1A 2WVUA 4KRTA 3OQEA 3OLGA 4GC4A 3ABOA 1FFRA 2OWWA 1TWWA 1A5LC 4CQ8A 3GIYA 4RV8A 2W62A 5A6SA 4O15A 4AEFA 1Y5VA 3DHPA 1MNSA 2GOUA 4HNUA 1TV3A 5AB3A 1YADA 1NFGA 1E4MM 4JCMA 1MRAA 1TTQA 4LS0A 1DTUA 4MAVA 3BAIA 3SRDA 5GQBA 5HWNA 4UQDA 2WHMA 1XCWA 5BYWA 2PCQA 2WHKA 1GJPA 4B3ZA 2FVKA 3ANYA 1DL3A 3P82A 4EACA 4L9YA 2YDSA 1CXLA 3NQAA 3SW6A 4REQB 2V5LA 1Q5MA 4B5WA 2PDHA 2OEJA 1KTCA 3FKRA 2XFFA 1EO5A 1VBUA 3C6CA 5T9CE 1IR2A 3TSMA 1F3WA 4NU7A 3BLOA 1UKOA 3UETA 3K5XA 4JD4A 1QNSA 3LCHA 4D6EA 1VBGA 1RUSA 3II1A 4MM1A 5CPSA 4IQJA 3BUVA 4S3KA 4GACA 3RO8A 4LVFA 4GNJA 2A85A 2WBKA 2DDXA 3SSZA 3T8LA 4R53A 4XTIA 1H49A 5KETA 2XN0A 4O13A 1XDJA 2PTWA 3QPEA 3TJIA 4Z1BA 4HMDA 4JIEA 3E2SA 3AIUA 4QDMA 3SGZA 1X7FA 4Y9AA 5AC5A 3F03K 1K70A 1UKQA 4FF5A 3GYEA 2DSUA 4DYEA 3ZR6A 1X8CA 2IS7A 3GR7A 1CB7B 1UR0A 3WH9A 1CXKA 3EWBX 1TWDA 3W53A 4PRWA 4QLLA 1ZBKA 3O7UA 5FJPA 3UG3A 2Z0IA 2V5DA 3DYPA 4WJ8A 3S8HA 1O6IA 3MPGA 2GK1A 1XYZA 1IZCA 1ITCA 2A7RA 4FNTA 1TZZA 3MMWA 4G56A 3UZXA 4AH7A 4R85A 3SRFA 2DZXA 4C91A 5CZKA 3UJSA 2C19A 3AWOA 3MKKA 5CKSA 3AALA 3NQCA 4N9DA 2J8FA 2KX9A 1KGWA 4QAWA 4CNTA 3T42A 1VBHA 1EX5A 3DCPA 1H7WA 2VFHA 3OLDA 3M0ZA 1WDWA 3CASA 1E1CA 3RG6A 3EXRA 1JULA 1ZENA 5CC6A 4LJ3A 3XIMA 5I3HA 5I03A 4KCVA 4WVXA 5A95A 2VFFA 4UC5A 1K3UA 1L8NA 2V63A 1XYMA 2C7FA 2QCCA 4CD8A 1QNVA 1EP1A 1GGOA 1TJRA 2J13A 1OZQA 4A05A 2P8CA 4OU1A 2ZA1A 3CZLA 4C65A 4JTUA 3H26A 2NXIA 2R91A 3GDTA 1Q6CA 3VIPA 3ZFHA 2DVTA 8XIMA 3FXYA 1EQCA 3FIGA 2VZTA 4H19A 4WXZA 2A21A 4EPBC 3AICA 3MHGA 1FY6A 2PDBA 5AC7A 4Q8QA 5I3KA 2OGYA 1WQ5A 2D1ZA 4TX6A 4D8LA 1TB3A 1OFRA 4GXWA 4QGCA 5EFDA 4J3TA 4NL1A 4U10A 2PLMA 4IGNA 1LDCA 4Z2IA 1TIMA 4JFTA 2E1DA 3UG5A 1DIDA 4ZO6A 3WDQA 3TYZA 4LF2A 2HTMA 2P8BA 3V0TA 3QY8A 2CKSA 3DC0A 4GVHA 1WNOA 5A6MA 4JBRA 3FLUA 1FHLA 1A0CA 4GUIA 4ZFMA 1J0JA 3K8LA 2GJNA 3LCIA 1YTDA 1OEPA 3S5NA 3H53A 1QBAA 4R9OA 5AOUA 4ERAA 3S4TA 4XZHA 2OEKA 5JH1A 4J9JA 2O9TA 4YWIA 1BVWA 2C15A 3NDOA 3HQ1A 2D2OA 2XIQA 4XZIA 1IEXA 4GFIA 1E43A 1SO5A 4GXPA 4Q4PA 2GJXA 5CJNA 2GK1B 3S1XA 3PBYA 3B4UA 3GXNA 2C16A 4AD4A 3GC2A 1K9DA 2D73A 4H2CA 3GTHA 3G1RA 3BK0A 1PKNA 5AC6A 4JX4A 3NZ1A 1YHTA 3MW7A 1XC4A 3BANA 3PFRA 4H8UA 4DXVA 1EZWA 3N2XA 1EF2A 3I6EA 5CPOA 4AD0A 3M0VA 1W9BM 1KCLA 4M80A 2ZVIA 3LLFA 3THUA 3W2MA 3RX2A 1CBGA 2BVWA 4L56A 3IV3A 3K4AA 4NVTA 1QOQA 4RZ4A 3HMJG 4WLCA 1KQYA 1HXJA 3EBVA 4JTTA 6CGTA 1E1CB 1LQ2A 1DJZA 2PSNA 4L4OA 5DANA 2H3BA 4DPQA 4ADSA 3TR9A 5E0FA 3E5PA 5G1MA 1W37A 3NQ6A 4R7OA 4V27A 1JUBA 2NVCA 4UTUA 3LQGA 2VL4A 1OCNA 4PMOA 4TX9A 3VTRA 4F9JA 3N9RA 1UUOA 3ICJA 5GNYA 2V0TA 2ZTJA 3N2OA 4L65A 4C6IA 4M6UA 1HNYA 4QG9A 2L5HA 4QXIA 5HXMA 1FTXA 5BXPA 2CLHA 5CPTA 3CTLA 1M53A 1TTIA 4OBRA 5HJYA 3VINA 4LVBA 9CGTA 2WMIA 2QIWA 1BXNA 2Y1HA 2J7GA 3ZLHA 1H11A 1M7JA 4LS2A 2R1LA 4DYKA 1F05A 1I2RA 3KBJA 4TU1A 1S38A 2W4XA 4MTVA 1E9YB 3RLHA 3FNDA 2C13A 5BU9A 2G4JA 2J4GA 4LSBA 1NVMA 4LPCA 4UXDA 5IBXA 1KXTA 3GO2A 2QDDA 1CGUA 4DHGA 4Q8NA 3GB6A 1SFSA 1TPDA 1QNRA 1F6YA 4NZCA 1GPWA 3PZGA 3ALGA 3UG8A 2HE5A 4GYKA 1CECA 4N6FA 5C2XA 1PL9A 1SO4A 3GTFA 2GQ3A 2J75A 5LNVA 2Q8XA 1FH9A 4B16A 2Z2UA 4KWWA 4IM4A 4OIFA 5D09A 4HPNA 3ABRA 3PBMA 2HS8A 3AC0A 2ZVRA 4ZZ9A 2GJXB 2H8ZA 1RK6A 4ZE4A 3V5OA 2HSAA 4B3LA 3MS8A 3E02A 4C6NA 4WGXA 1V6UA 4Q8VA 2OO0A 2GPTA 3S5OA 3PBUA 4DJDA 1Q6LA 2PAJA 5XINA 2V5KA 1RPXA 1KV5A 3VGBA 4GBUA 2QPXA 1V6XA 1IE7C 3T6CA 3KVMA 2D20A 2Y7FA 3DKLA 1LRQA 2XVNA 1LG2A 4WSHA 4P8VA 3I10A 1QHOA 3GU1A 2ZX8A 7ENLA 3WO8A 2JKEA 3LK6A 4HJFA 2Q01A 1JGIA 3NIYA 2ZZ6A 3WG6A 3O0FA 4D6HA 2XPKA 1WUEA 1TKKA 3WLKX 5GPRA 1AJ2A 2DH2A 3FEMA 3G0UA 3GIQA 1NDWA 3DX5A 2AOSA 3MB9A 2XIOA 1NJJA 4H7ZA 1Q4WA 3ZVHA 2PWVA 4IMCA 1F73A 1XS2A 2NX9A 3PJWA 1ZCCA 3S5SA 4E0CA 4F8XA 1NU5A 3VKCA 4P5UA 3DFSA 4QS5A 2F84A 3IUDA 4CQBA 2OQLA 1YQ2A 2QLYA 1BWKA 4LUSA 4UTTC 3B8DA 1DTNA 1UH4A 1I2QA 3DECA 3HOJA 3LERA 3TW6A 1BQGA 4PSPA 1P7TA 4W5UA 5CBJA 5F2GA 1FUYA 1SJBA 1K77A 4F66A 3QOKA 1K03A 4JTLA 4NYUA 2GGGA 1OCQA 3H54A 4GYPC 1PHQA 1KTBA 3EYPA 4IL0A 4JN6A 4H2HA 4XUGA 1WP6A 1KC7A 4L7ZA 1V08A 1NARA 5C55A 3WLMA 2CLMA 1E9ZB 3L66A 1RR2A 1VH7A 1JF5A 3PG9A 4JHOA 5EMMA 1EC9A 1XM3A 4UQEA 1Z48A 4ZQRA 1HVQA 4LT9A 1MEWA 1I8JA 4WRHA 1WKYA 3E2VA 3HPXA 1GW1A 1AJZA 1EO7A 4DF2A 2DH3A 5F1VA 3V1PA 1TPWA 5ABFA 1AW1A 1CCWB 1W6TA 1FFQA 5BXRA 1KM3A 4O4WA 3FJNA 4GQRA 1W2VA 1J96A 5C9RA 4WXYA 3NQ7A 2CKRA 5REQA 4J5NA 3KL3A 1TCDA 3QN3A 5KTLA 4Y9NA 3LHWA 5XIMA 3W2KA 3SY1A 1CLVA 2WMKA 4PB3A 4QHRA 3CTTA 2YW4A 5FF4A 4Q4QA 2B31A 4Y2WA 5HR7A 2DZBA 1EH9A 3SCNA 3VI2A 1FCQA 1VYPX 2VOMA 1G4PA 3DH7A 3STPA 2GGEA 3M16A 3KRBA 3C5QA 1H1YA 3E0FA 4NJGA 4A22A 1ONEA 1RBAA 5I3DA 5AYBA 1GG1A 3V1HA 3ABZA 3LBCA 4UQCA 4F0LA 1XL9A 3DBNA 3WNPA 5JUVA 1P0BA 2DVXA 1PWLA 2FKPA 3KOYA 2YCEA 5DLCA 2EG6A 2GVLA 1PTDA 1XINA 3LN3A 4PMZA 5D02A 1E40A 1E1FA 3TDFA 1N8FA 3WJZA 3W6YA 1GVYA 1MXDA 2J7HA 2QCLA 4XSLA 1GVFA 4DUWA 1N8IA 5F4WA 4ZOCA 1GOXA 3CZKA 1IXQA 2QCEA 5A6KA 1R3YA 1GOWA 1Z89A 4Q4RA 3LX9A 3WK1A 3G1YA 4EPEC 3NZGA 3GDKA 2NLIA 5K9CA 2PWHA 4DI8A 2NX1A 4PMYA 4POCA 3LM7A 3GHRA 4F0RA 1HT6A 4RZ5A 2PDMA 1UD4A 4FNPA 2GVEA 3UWVA 2XFWA 3C2RA 1BXCA 3R0KA 4K37A 1W1YA 2JIWA 1EX1A 5A2BA 3W82A 3H2OA 4M19A 2QCFA 2CETA 2XSBA 4AIUA 3USBA 4BI7A 4L80A 4XKYA 2WKLA 2OU4A 3B0VC 2DZSA 4GIYA 5I23A 2BGNE 4NF7A 2I56A 5D2XA 4I9MA 4PTWA 2W0UA 5CBIA 1W1IE 3LRLA 1R9ZA 4R7WA 3EA3A 5HULA 4GCAA 3R8RA 3W1QA 3ZQ9A 4O54A 3PY2A 4PMNA 3S2JA 2PDWA 2OZTA 5M17A 3F2DA 5BRBA 1RY8A 1W5PA 3BVJA 4XO6A 3Q58A 1HX0A 4AMCA 1M65A 2IKIA 3CWOX 4YVXA 3FCPA 4LV9A 3IUIA 4WKFA 4AX7A 4C6PA 2P1FA 1R8LA 3MZNA 1QW8A 3XINA 1XYCA 5DELA 1J01A 3BAXA 1FP9A 2HMCA 1HF6A 1JCTA 1A3XA 2F6KA 4FF7A 1SZEA 4MNKA 5KZMA 3STGA 3SIZA 3LUTA 1CTNA 1A53A 5AC8A 1OQFA 5JQ9A 3TAOA 2FHCA 1A49A 1M41A 4XZLX 5K4ZA 3B9DA 2VRQA 4WSKA 4CN4A 4ZTYA 4Q4KA 1EJWC 3F4CA 2GDUA 4RV3A 4A3YA 2Z4GA 3UF9A 4O17A 3BV4A 3A4XA 3IK4A 1GYMA 1DE5A 3DI0A 1P5BA 1D2KA 2OJPA 2Z6IA 3GAYA 1EFZA 4HNOA 2OODA 2GWNA 3H4GA 2ZX9A 1XYBA 3HM7A 5CSRA 2GDVA 5I7GA 3IJ7A 1IT0A 4AXKA 3VGFA 5G1TA 4J2MA 3WJXA 3MA8A 4YVVA 4X60A 4AC1X 1PZ0A 4KESA 1IIHA 3WBWA 4HHHA 3DEQA 2PWUA 5GJNA 3K4DA 5CCZA 4D72A 3GHUA 3AUJA 4PMDA 2VWSA 1LT7A 4TMBA 5IRPA 2OO6A 4TMCA 1FWDC 2DW6A 1R30A 1W9VA 2ZWZA 3W25A 3P67A 3VX0A 2BVYA 3MBDA 4HMNA 3TROA 4PUKA 4W8LA 3UGRA 1NWRA 3G2GA 5IHRA 2HCVA 1R85A 1JI1A 3L67A 1SZFA 1W0MA 2ZE3A 2AKMA 3AS2A 4Z08A 3SCWA 5H2ZA 3V4BA 1TUXA 1UIOA 3OVPA 3WNLA 2V5JA 1Q8AA 3ITOA 3BLIA 2WVVA 1KBLA 1YXDA 4YMZA 1PSCA 3I4EA 4FLOA 1HKMA 2O7SA 3GTIA 3VCCA 3SR7A 3KBNA 3JZUA 3GC5A 4XTDA 1PTGA 1Z41A 3ZO9A 4MIMA 1DE6A 3B8WA 3N3TA 4IISA 2XVKA 3R10A 4KFOA 1MZRA 1AQ0A 4FP1A 2CC0A 3O05A 1B57A 3LOTA 4D6DA 3URNA 4PCSA 1VLWA 4MKNA 3WMLA 1V3MA 1E71M 3VABA 1JR1A 2NUXA 1SPQA 4EIVA 2IPGA 3HV8A 4A3UA 1VR6A 3R0UA 1BYBA 3DG3A 3L7RA 4M1BA 3GH7A 5D9PA 5HUOA 1E0UA 4IPNB 1C90A 2OX4A 4GMEA 3SZ8A 1GZJA 2GWGA 1E0TA 2VENA 3UR7A 2Y8UA 2VEKA 3F5JA 2P3ZA 3OZOA 1EEPA 4I3GA 2C0HA 1XLLA 5AVNA 4KERA 5DFAA 4RNJA 3N11A 2H90A 3GNRA 1WDQA 3RR4A 2J7EA 4HN4A 1FWHC 3CQHA 4AIBA 4J3UA 1Y7VA 3TJXA 1C8XA 1PX3A 5D2VA 4NHVA 3SGUA 2BASA 2E9BA 1JPIA 4K38A 3IJ6A 1ENUA 3LGDA 3UU0A 2YYUA 3B40A 1S46A 4O18A 3O07A 1VFHA 1WYIA 4PGLA 1XI3A 1HTIA 1AQMA 4TV6A 4FIRA 4EXQA 2D2HA 3W7LA 3WQ5A 5LHFA 1Q6QA 1UP0A 1XYAA 4Y7EA 2QZRA 3WNKA 5T8GA 4GZEA 4EPKA 4MWAD 4XV0A 2Y63A 3W6LA 4MKVA 4A8RA 4MLRA 3W7GA 3UP8A 1VFUA 1GG0A 2WPBA 3IK2A 4Y9MA 4UBPC 1UG6A 4OZOA 1RY0A 1H61A 1Q2SA 3A3WA 1VENA 2J7FA 2WC3A 3ZIZA 1KBJA 5RUBA 2A1YA 3TA6A 1B3XA 2VQUA 3BJSA 3EAUA 3UYIA 3QY6A 3MV11 2CERA 3WFLA 2W67A 3IACA 4YCPA 3QMSA 1WOBA 1PHWA 4XIAA 4A6GA 3TFXA 2PFHA 4ATLA 1TO3A 3AZTA 3VOGA 3CJPA 1XGZA 1WAWA 3BC9A 3CAVA 3I7RA 2ZUTA 5EY5A 4LNCA 1KFCA 3VIGA 1RZMA 3W7QA 5JU6A 1MDRA 1A3WA 4LGXA 4W87A 3KCLA 4FX6M 4GBDA 1JFXA 3O6CA 3R6IA 1UMLA 1B3YA 3RITA 1JUKA 2PDJA 1XLBA 2G4FA 1K6WA 4ZFCA 2XISA 1PDZA 4GYFA 4P7NA 4UZUA 4GJIA 4M7SA 2W92A 2BP1A 4PCFA 4AY8A 1V3HA 3IANA