2QJIA

M. jannaschii adh synthase complexed with dihydroxyacetone phosphate and glycerol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPIKGLIDIRKTVNDVAEGGANAVLLHKGIVRHGHRGYGKDVGLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELVAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVVGITRAVCKIVHENADVEEALKEIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative aldolase MJ0400
publication title Structure of 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid synthase, a catalyst in the archaeal pathway for the biosynthesis of aromatic amino acids.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 91
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.2.1.10: 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qjiA00
3B03A 2QR6A 3FA5A 4QIUA 3W7JA 1KTNA 1SW7A 3TXZA 3TSBA 3A23A 4MYAA 2V82A 3NO5A 3PG9A 1SZEA 1MO0A 1SO3A 4U4MA 4NUWA 4R53A 4LUIA 2DZWA 3I68A 2HS8A 5AB3A 3Q37A 4ZZ9A 2HSAA 2CWNA 1KTBA 5EBUA 5FF3A 3MBFA 1EP2A 2WJZA 3W86A 3B0UX 5AYYA 3W84A 1KM1A 4K38A 4NX0A 1L6YA 2C3ZA 3DHDA 4IPIA 1HUVA 1LLWA 3O05A 3FLUA 2YZRA 4BK9A 1DBTA 3MI2A 2ABBA 3NPVA 2J9ZA 2BLEA 5LZLA 5FESA 3NVTA 4H4IA 2YDAA 2QCMA 4K7YA 1SR9A 5E0KA 3P60A 5G2HA 4CCEA 4UMBA 3LHWA 3W7PA 2C6QA 2XN1A 4WD0A 1K8XA 4X9SA 4R7JA 1AG1O 2YGYA 4UTWC 1G4PA 5KZDA 4EWND 1ME9A 2V30A 1LTDA 4ZQNA 2QJIA 1GVRA 4BI7A 3EEGA 3MBDA 2WNZA 2A0NA 4JYEA 1THFD 1YXYA 3HOJA 3TV8A 1FWTA 4UTJA 3E02A 3TNOA 2AGKA 4E38A 3JS3A 2OT0A 1MEHA 5IBXA 4LY8A 3LOTA 4W9TA 4JS3A 4IQLA 3TE9A 1MZHA 2ZCGA 1JULA 4IX0A 2CLFA 2VEMA 3M44A 2JKEA 2EAWA 4Z0SA 1TRDA 3S5ZA 4WXZA 3OEXA 5TQLA 2TYSA 4IOTA 1W31A 3GAKA 3GIYA 3PAJA 4OQVA 2J27A 1LLZA 3STCA 4UFJA 3BARA 3BG5A 3TC7A 2X30A 3W75A 1RV8A 2E6FA 1DQWA 1RD5A 5LHEA 1FXQA 1I2QA 2Q3OA 2DZUA 2E68A 3U8GA 1SO5A 5AHMA 3G0SA 1KA9F 1MEWA 1TSIA 3C2VA 3CQ0A 5DELA 3QMTA 3L0NA 4AXKA 1LYXA 1K8YA 2A6LA 1EEPA 4N9DA 4NZJA 5LGZA 3W1RA 4PODA 2QDGA 1GPWA 3NL3A 4QITA 2QCLA 3M5VA 2RDUA 2GVJA 2QCDA 4LNYA 1LRTA 4TMBA 3O6DA 1S5VA 4FF7A 3W7EA 4A29A 4C1KA 4TO8A 4O14A 1ML1A 1DJNA 3MUXA 1GVSA 4KFNA 1UCWA 4JY9A 4QNEA 3RFAA 3G1DA 1KV8A 4LC8A 5KINA 4O8RA 3TQKA 4XWUA 4IJBA 2GPTA 4S1FA 1RPXA 3PVFA 3BVJA 1IIGA 2C14A 1WDWA 1TO3A 2ZRZA 1EX5A 3WJWA 3G1FA 3BK0A 1KM5A 3FEMA 4UNLA 3DKJA 3MW7A 2CLIA 2GQ9A 1R2SA 5G4EA 3PY2A 2NLIA 2ZZ3A 3P84A 3GK0A 1A53A 4EF9A 1CI1A 3W7OA 2VC6A 4OU1A 3M0ZA 3W2UA 3W87A 3QQ1A 3LXAA 1JUEA 1KFKA 1UB3A 4FNSA 3EKZA 3G0XA 3QQ0A 2ZZ4A 2ABAA 3NDOA 3DHFA 3PBWA 2ISSA 2R14A 3IIVA 3W2LA 5HJLA 2YW3A 4LV9A 3FJ6A 1EP1A 3GR8A 4O1DA 1TRIA 2DZVA 2ZRUA 4OBTA 5DCBA 2Y88A 4GRSA 3A22A 2ZA2A 3CU2A 3NEVA 5BOOA 1LDCA 1Q3NA 4JTUA 1LRNA 1QCWA 1O95A 2LLEA 4FB7A 2RHGA 1OJXA 4LVDA 1I4NA 3GZ3A 1XDLA 2CLHA 1OX4A 3P5ZA 2B7NA 3W1QA 2J9XA 4N4QA 2DZPA 3LX9A 1XI3A 3P5YA 3S1XA 3UWYA 2E6DA 2QCHA 3LXCA 3MP4A 5G1YA 4GUJA 3W1NA 1P0KA 4UUIA 5FF2A 3WJXA 4MZ1A 4M6QA 5D09A 1OFEA 2J88A 1QPOA 4JR5A 1JQVA 3M5ZA 4DELA 4PL2A 4ZVJA 1W56A 3HQ1A 4MPQA 1F74A 4ZMGA 1FDZA 4IMCA 3EX6A 3P80A 2P1FA 3F4NA 3G1AA 5KTLA 4TR9A 3FYOA 2V0TA 1FUYA 1OG0A 3TQVA 4DEFA 3RNDA 2FFCA 1TPDA 2CLEA 4RZ6A 2QAFA 2TSYA 1JCXA 1F7BA 2G97A 4RJEA 3V75A 1FCQA 3L66A 4O28A 4EVZA 2E5BA 3RLVA 1EUNA 1SW3A 3LI1A 3SFKA 3W3OA 3TW7A 3DFNA 5K9CA 1XBZA 1LBMA 4HT3A 5I3KA 2ZDRA 4IMDA 3ELFA 1WQ5A 1ZHAA 1BWLA 2YR1A 3HMJG 2WSYA 2OZ0A 1WA3A 1YTEA 2VKZG 3N14A 3O1NA 1GTEA 4FNUA 4WY0A 5K4ZA 4WXYA 4H3DA 4PFMA 2B7QA 3DZ1A 1AL7A 3H53A 4YXGA 2ZZ6A 2ZZ2A 1M7PA 5DXYA 2F84A 1RQEA 1WV2A 1WBJA 5C6MA 1W3TA 1PVNA 1SO4A 5K9XA 1OK6A 1X1ZA 3NL6A 3CB8A 1TTPA 4FXRA 2VENA 3WFAA 3OVPA 4GBUA 3P7YA 3PG8A 5D37A 2HTMA 1HO4A 4JTHA 1XKYA 3M5YA 1F2JA 5F1VA 1HFBA 2ZA1A 1TB3A 1YADA 4FO4A 5LNWA 1VCVA 1JRBA 1Q6RA 4LRSA 2NWSA 1H5YA 4LV4A 3SJ3A 1L6WA 4B5NA 4JD4A 3P61A 1VZWA 4YLWA 1GT8A 1IGSA 1G6CA 3HGJA 1ICSA 1OK4A 4A2RA 3UWUA 1T8XA 2YX0A 4HKPA 4HNVA 3EX3A 4QQ3A 2GJNA 3CIXA 1NF7A 3AJXA 1MSSA 3L2IA 1EUAA 4UFMA 3M16A 3TCEA 2FLIA 5E1QA 2QCDB 4RXFA 3TMLA 4O18A 1K02A 1KM0A 3ABOA 4Z1BA 5KMYA 1K7EA 4NXSA 4WY0F 4O11A 3W71A 1LCOA 3UXAA 3MHUA 1QPNA 2AAMA 1LM1A 3IVTA 3MO7A 1PCKA 3W76A 4E2BA 5U4NA 2ZRVA 3NQAA 4RXGA 3OBKA 1KFLA 4JDYA 1VYPX 5AN7A 4CNPA 4JTTA 3LCFA 1T0OA 4FNTA 1HTIA 4UXDA 5BMWA 3GDLA 1KFEA 2A1YA 3ZFHA 3MYOA 4PA8A 4Q4KA 3H54A 2EPHA 4NNAA 4YMZA 1SZNA 2YSWA 2Y89A 3L5MA 3LM7A 4LS2A 1KFBA 1J2WA 3USBA 3QPYA 3L0KA 4MIMA 4N6FA 2C15A 2FDSA 1NF0A 3PULA 1H7WA 1L9WA 4JYFA 3N19B 1FCVA 3N9SA 3IIPA 3GDMA 1OFPA 4LT9A 4DO5A 1SZFA 1KW1A 3C2FA 5LKYA 3MI3A 3W2NA 2E5DA 3NQMA 3LCIA 5AHFA 2R8WA 3HB9A 1WOAA 4GUGA 1JCMP 4JTEA 1VLIA 1A50A 1GYLA 2H8ZA 4K37A 4UTHA 1VYSX 3HO8A 4AH7A 3T40A 3NQDA 4GNJA 1YTDA 4KWVA 2VFEA 3HBLA 3FIGA 3TFXA 1O94A 3FFSA 3N2MA 4O50A 3NPWA 3P74A 3QEZA 1OFQA 4AEOA 1XDMA 4ALDA 3S1VA 2QUUA 4TX9A 3HG5A 2CZDA 3JRKA 2V81A 5CZJA 1YDNA 2Y62A 2JKAA 2Z1BA 1RVGA 2XN2A 1Y0EA 1OX4B 2XN0A 2A6NA 1G69A 3W1XA 3SY5A 3UQNA 1ME7A 4MZYA 2WQPA 2ZZ7A 4MY1A 1WYIA 1TJRA 4AAJA 3QSRA 3I7SA 2ALDA 3S5NA 5K4XA 2CZ5A 1FWSA 1F73A 4I7WA 2HMCA 5F1UA 3WJZA 3B06A 4ZQPA 3TU9A 1QDSA 5DXXA 3PR2A 3TQ0A 1QPQA 4NJJA 5FF0A 3W1AA 4CLMA 4RZ4A 1IF2A 3A24A 3OVQA 4R33A 4YWIA 3W1LA 3SIZA 2H6RA 3QMRA 3LCHA 5CSRA 3LBMA 3DXIA 5DCDA 4WJEA 4FIQA 5CKSA 4ONVA 3GDTA 1OFOA 2NV1A 5EMUA 1VYRA 4FX6M 2FJKA 2DZTA 3M5XA 1EB3A 1O5KA 2YYTA 2G96A 3NQ2A 1N55A 3UWVA 3UPBA 1FDYA 2Y61A 1H1YA 3FJLA 4JIQA 1TMHA 4AF0A 1JR1A 4P61A 1TJPA 2CFFA 4XTDA 4JN6A 4JX4A 3G3MA 1TV8A 2ISVA 3I7QA 3TH6A 1OX6A 1H62A 1SO6A 4NJHA 1C29A 2ZTJA 4PCFA 5G5IA 2V8ZA 1W1ZA 5G1TA 1K7FA 1XCFA 3LRMA 4WY0B 1Q45A 3ANYA 3NNTA 1XBYA 1G67A 1XM3A 5GVJA 4NQ1A 5AHEA 4I9AA 4HPJA 4K6AA 5DN1A 5HMSA 4IXHA 2Y70A 3STFA 5AC6A 4WX2A 5G4WA 5HWJA 5FEXA 1F5ZA 3RMJA 3QH2A 4N9EA 3W9ZA 1WBHA 4BFAA 1XFBA 2GQ8A 1P0NA 4OV9A 5DBTA 3PWAA 3IGXA 2W6RA 1EP3A 1I2OA 4EIVA 4O0ZA 3DI1A 1FWRA 2YPIA 1PIIA 1N7KA 3C2RA 4POCA 1TPH1 3P8IA 2TRSA 4MLJA 2NX9A 4O10A 1AW1A 3KVMA 3MJYA 3EWYA 4FHAA 1VC4A 4Z08A 4GUHA 1A5SA 3O07A 4O57A 3W7CA 1W5NA 1KTCA 5MHBA 1OYCA 3NQCA 4K8EA 2V2DA 2WSRA 4PL1A 1SPQA 2JGQA 3NQVA 5AFDA 1G4SA 4JYDA 2PCQA 1JCJA 4D2JA 3NA8A 4GWEA 3QYQA 2F7FA 2X1SA 1W5PA 5AHNA 2EHHA 1EPXA 2IQTA 2X1RA 4Y6GA 3A21A 1DOSA 2QCFA 3VNDA 3IIZA 1UUOA 3G8EA 3TR2A 3WK0A 4EF8A 3VE7A 5DCEA 2JBMA 2WOQA 4DXVA 3TFCA 3GXTA 2B4GA 4O16A 1YXDA 1OFBA 3MP3A 5EYWA 3HIJA 3HG3A 3W72A 4QM1A 1GJPA 4ADUA 1GYNA 1VH7A 3KX6A 1SSGA 4Q33A 5FEPA 2DP3A 1SQ7A 5BRBA 4ORMA 2Y7DA 3ABSA 1R47A 4WUIA 3BGGA 3EWBX 1SUXA 2WO5A 2H3BA 4UC5A 3QRHA 4K7VA 5L6UA 5F2GA 1D3HA 1LOSA 1LROA 1MXSA 4JDBA 5TIMA 4XBSA 2V5BA 2BTMA 3RU6A 4U28A 5CZSA 5EY5A 2QCNA 1I8JA 2DJXA 4RKAA 4A2SA 3N2XA 4IX2A 3IGUA 2I14A 4ZQMA 3GAYA 3TUUA 4NT0A 3DH7A 4AWTA 5KSWA 3PM6A 4Z0JA 5ABTA 4N9CA 3R89A 2DJLA 5FEWA 4LWWA 2RKXA 3W88A 4Z1AA 5BNKA 3W7GA 3ZS4A 3LRKA 4UFHA 3G8RA 2ATMA 3HF3A 3C4UA 3BPWA 5DBUA 4XUGA 3W83A 1S3HA 2G95A 4YCOA 3S9YA 3O15A 2FPTA 1PHQA 3L5LA 3S1UA 5AC7A 2I9EA 1K3UA 1W54A 1TYGA 1X8FA 4RV8A 2WV8A 3BGJA 1TCDA 2RH9A 4AHPA 4JX6A 3M1ZA 1HO1A 4LVAA 2V2CA 3CEUA 4MZ8A 1XXXA 4PC8A 4AHQA 5K3VA 4DBEA 3EXSA 5D2TA 4OE7A 2QJGA 2GUUA 4MLRA 1H7RA 5HUOA 1DL3A 5FF4A 2O7QA 5EPDA 4JICA 2NXGA 3LRLA 3OA3A 3W7LA 5EL1A 1GZGA 1KV5A 1EIXA 4Y9AA 1H1ZA 2YYUA 3BLIA 6TIMA 3C8FA 3NQ7A 4HN4A 1VPXA 2V5LA 2OCZA 4JTKA 3SECA 1TREA 1ZAHA 4O54A 3U2OA 3DKLA 1TQXA 1W3IA 2FTPA 1ME8A 6ALDA 3GKFA 2QF7A 2ZFAA 4AF0B 3B0PA 3G1SA 5D02A 4HNUA 3G3DA 4O1CA 1ZAJA 2A4AA 1ADOA 3T78A 4FX7A 3GXPA 3N73A 1D9EA 4Y8FA 1K7XA 1FWWA 5LNVA 2ZYFA 2UV8G 1F76A 4ICNA 3KVJA 5CGQA 2VOMA 1QOQA 2BX7A 2QDHA 2CLKA 1LZOA 3F4WA 4HSOA 1A5BA 4JTFA 2CLMA 2PRMA 2P10A 1ICPA 3W2JA 1B4KA 3PBVA 3CTLA 3EXTA 5C54A 1VCGA 3R5EA 2G5WA 3O6CA 5K7JA 3LERA 4QSHA 3W1PA 3NQGA 4IMEA 3IIOA 3BLEA 4R34A 1TPB1 4FIRA 1H7XA 3QSTA 2Y7GA 1JQXA 4NJKA 2FPVA 3TKFA 4NVTA 5AYXA 3HGRA 5TBOA 4FNRA 3NGJA 3WJSA 2Z6IA 3UZ5A 3W7NA 3M41A 1PE1A 1YPIA 2ZRWA 5F2MA 2V9DA 5F2LA 1PS9A 1AK5A 3L67A 3THAA 4IXXA 4I7VA 2XFWA 2BWGA 1FCBA 2HS6A 2A7NA 2C16A 3T55A 1D3GA 3QW4B 3WK2A 5LNUA 4Y90A 5I3GA 1OYBA 2P0OA 4O1BA 2QUVA 4JTJA 3IVSA 1TPVA 4O1AA 1FDJA 3W2MA 4HIBA 3P8JA 3LCGA 3KRZA 1H50A 4LUJA 1Z42A 4FX8A 2Y63A 2QUTA 3IGSA 5CPOA 5CG7A 2A7RA 2C13A 1TPC1 1PHWA 3O06A 1DHPA 1GVFA 3NZ1A 4G1KA 5D30A 1SSDA 3W1MA 3KVLA 8TIMA 5CPMA 4ADTA 2Q3RA 5SWUA 3G1YA 4FNPA 4CNOA 1H7OA 1LP6A 4OGZA 4WQ6A 2YFNA 5D2VA 4JEQA 4GUIA 5G2WA 2VELA 4IUOA 4XBKA 4JY8A 3EX4A 2NX3A 4MFDA 1AL8A 2ZBTA 2X16A 4M5PA 1PV8A 4BI6A 4KFPA 1EA0A 3P82A 2VFFA 1T99A 1IXNA 4UTLA 2ISWA 2WNQA 4PEKA 5KZMA 4N2YA 3PB0A 3TDFA 4I7UA 4BR1A 2QCCA 4JTLA 2A21A 4O12A 3R12A 4DQWA 3PS7A 2H3DA 4O4VA 5CPLA 3NPUA 4BWLC 2Y85A 1CW2A 4MJMA 3IEBA 2EKCA 1QPRA 2AQWA 2J9YA 1ZALA 2ZZ5A 2B7OA 1Z48A 3TSDA 3NQ8A 1ALDA 3NQ6A 4O53A 3W7KA 2PRLA 4JXCA 5A8GA 3S0CA 4N02A 1YYAA 3PBUA 3UD6A 3C2EA 1VHNA 1YDOA 3DI0A 4IPJA 2DZXA 2X1UA 3TJXA 3C61A 3KHJA 4DF2A 1LRQA 1JVNA 3PSWA 5HR6A 1H63A 3LBCA 2RFGA 1GTHA 1OF8A 3Q58A 2ZTKA 4Z1DA 1OFDA 2CZFA 1K03A 2J24A 3OG3A 4O13A 3LCWA 3HGOA 3LGEA 4E0CA 3B0VC 2FPYA 1R30A 3DFQA 5EKYA 4N9BA 3E9AA 3W22A 3W7IA 2B7PA 1SFJA 3HPSA 4DO4A 4H6KA 3F03K 1C8VA 5I3FA 1H7PA 4OHQA 1GG0A 3G24A 2H90A 1V7YA 4UTTA 3LHVA 3C52A 4GC4A 4NJGA 4DBDA 5J5DA 3RF9A 3DFPA 2C19A 3LHYA 2D73A 5CPNA 1Q6OA 1UASA 3P67A 3TAOA 3Q2DA 5AHLA 3DENA 1KBJA 5HR7A 4UR8A 4ZQRA 4YCPA 1R2RA 2GVLA 3R13A 4IGHA 2Z0IA 3ATZA 4NJIA 2A2IA 3W85A 3F1QA 1VJIA 3B05A 4X22A 4AB4A 3WK3A 3QZEA 1Q6LA 4C1LA 1WOBA 1R46A 4DPPA 2Q8LA 1QO2A 1ZY9A 2NV2A 3DU0A 4M7TA 3ABRA 1V5XA 1R2TA 1X7FA 3C6CA 3GNNA 1I2NA 4AMAA 2QCEA 1CX9A 4M6VA 5C2XA 1M7OA 5F2IA 3S5YA 3MHGA 4A22A 4BI5A 3UNDA 4GE8A 1KFJA 2DU2A 3M6YA 3CHVA 1NEYA 3NM1A 1QFEA 3W7RA 2BXVA 3HPZA 4AHOA 3SI9A 2EGZA 2GJLA 4KFOA 5D38A 4QJ1A 5LNSA 4UMCA 4K39A 2TMDA 3C56A 5DY2A 2QCGA 1OFAA 3KFTA 4L4LA 3T7VA 3VE9A 4O4WA 1G4EA 1JCNA 1F6PA 5I3JA 3LCLA 3TX9A 1SZGA 1H60A 1FBAA 3C0JA 2JKPA 2Z6JA 5LGXA 1S5WA 2QAPA 1DQXA 3TA6A 1OVDA 3W7HA 3KXQA 4HHPA 1NAL1 4RZ5A 1RR2A 4IWWA 5G2IA 2E1DA 2C1HA 1TIMA 4CQAA 4KWWA 2QJHA 1TPFA 1XBXA 1JUBA 1KLZA 5FEZA 1TPUA 1XBVA 3QJAA 4O0KA 1HL2A 5E93A 3S42A 3QW3A 3G18A 4Z1CA 1J5TA 1DKWA 3LV5A 4K36A 4IMGA 2W79A 3GXNA 3UXDA 3EWZA 4N4PA 5HUPA 4MKNA 3HJZA 1KM6A 3GX9A 1A5CA 3N34A 1QAPA 3EWUA 4LRTA 4M7SA 5L9FA 5IM51 3O16A 4X3ZA 2CLOA 2X2GA 1B57A 1VHCA 4NXKA 3I65A 3GVGA 4E2DA 2ZRYA 3UWWA 1O60A 2C0AA 3E49A 3DGRA 1ZNNA 3LHTA 3PSVA 4O19A 2JGYA 3DBPA 3GDKA 3HPXA 3VFLA 3SW6A 1E51A 1ZFJA 3N9RA 3WJYA 1LBFA 3LV6A 2ZZ1A 5F4XA 1Z44A 4A3UA 5C5YA 3KVKA 2ZRXA 3EXRA 1VCFA 2J6XA 3YPIA 1T96A 2PC4A 5K2ZA 3MHFA 3TROA 1LOQA 4CNNA 3M43A 2CW6A 4BF9A 5HQEA 1FX6A 1NVMA 2WNNA 2CZEA 1FQ0A 4LU0A 1SU5A 3BO9A 1ONRA 3V1PA 3FOKA 3W7MA 4DF1A 1TPWA 4MFEA 3EWXA 3HG2A 4LVGA 4QISA 4RLIA 1DV7A 3FS2A 2E09A 3NYZA 5FF7A 5D2XA 1H7NA 1W37A 1XC4A 3R8RA 2W0UA 4UTTC 1A5AA 4QNWA 1P4CA 5BW6A 1IIHA 4Q32A 1VGAA 4XTIA 3LHUA 4M6PA 4MY9A 3TJLA 5KZEA 1TPEA 1Q6QA 3LTSA 1F05A 4O52A 3SR7A 4UTIA 3STGA 3TSMA 1W5QA 3SGZA 1H61A 1I2PA 1O4UA 1P1XA 2NZLA 3G1HA 1NFBA 1KM3A 3DAQA 3NL2A 5LNRA 3E12A 4MVAA 3O6YX 3LLDA 3TMQA 2R91A 3UPWA 2Y6ZA 3CIWA 4NNBA 4CQ9A 5LHFA 1N8FA 3W7DA 3GB6A 3WK1A 4OWGA 3S6DA 2VFHA 3E96A 3VKJA 2ZA3A 1AW2A 1ZCOA 4TIMA 4HNTA 4JIPA 2PE4A 2FIQA 4S2BA 1AW5A 2E77A 2E6YA 1RQBA 1QNVA 2FQIA 4CQ8A 4L4MA 3BW2A 1JJKA 3DFSA 3W23A 3TIMA 3BG9A 3KAOA 4UR7A 4XKYB 3GDRA 4UTKA 3W2KA 3G22A 3CC1A 1XUZA 3L65A 1GEQA 3M9YA 4LC6A 3ZR4A 2GVGA 4GXMA 5D32A 1YPFA 2Y7EA 1LOLA 3BW3A 3I6RA 1P5BA 1TTQA 1K8ZA 1YDVA 1I2RA 1FXPA 3KOFA 3S8HA 1OYAA 3C2OA 1QMLA 4S2CA 4MUZA 1GVOA 3QFEA 4JGDA 1GG1A 4UFIA 2BZNA 4P2VA 3W07A 2NXHA 1ZAIA 5AOUA 5A5WA 4BWLA 4WZHA 4MOZA 4TU1A 4WOQA 1U5JA 5H91A 4TMCA 1GWJA 5LSMA 3L21A 3R2GA 3CT7A 1YLVA 2O7SA 4DF0A 4UFKA 1TV7A 3EB2A 4MJZA 1OX5A 3LTPA 4HPXA 4K8HA 5K9DA 3OHIA 2C18A 1BKSA 4NNCA 1TTJA 3M47A 2X1TA 3D0CA 2V2HA 4UFLA 2DORA 3T4CA 3NZRA 3PUOA 2I1OA 1FY6A 2QEZA 4RCXA 2A85A 1UUMA 3MYPA 4UCGA 3PUDA 5C55A 5CZTA 3NM3A 3BG3A 3MWAA 3C3NA 3NOEA 4LOCA 3QMSA 3I7RA 5D2WA 1OFRA 1MEIA 1TTIA 1M5WA 3DFTA 1F6KA 4UIOA 5D33A 3IVUA 3EX1A 1B4EA 5IBXC 1Z41A 1FCUA 3GR7A 1YTKA 3G1VA 2WSQA 3ATYA 1ZJIA 2JK2A 1G7UA 1W3NA 3L5AA 3EX2A 5DLCA 4O15A 1X6UA 3INPA 3JR2A 1IXOA 3HGSA 3CEPA 3IRDA 1QOPA 3W6YA 3LB0A 4JTGA 3SZ8A 4GJ1A 2TPSA 4NU7A 4ZQOA 2PRHA 3QF0A 3KRUA 1G7VA 3NAVA 3P81A 3GYEA 4IMFA 1BEUA 3QPZA 2QKFA 5F4WA 3ZWSA 3TW6A 1SW0A 3L0GA 5H2ZA 2DZSA 4UTMA 2PURA 4PH6A 1B9BA 5HINA 1OABA 2WKJA 1PL9A 1SFLA 3CWOX 2VEKA 3PB2A 7TIMA 4FNQA 5F4SA 4X2RA 3FKKA 5FI8A 1VQTA 1AMKA 2OJPA 1KM4A 1PCWA 2Q8ZA 2VFIA 1L6SA 3B4UA 1VR6A 1WAUA 3T44A 2YFOA 1GOXA 1VRDA 1LBLA 4XQ6A 3MI6A 2A7PA 2ATSA 3W1TA 1TQJA 5CZ0A 3HG4A 4LW7A 1KM2A 1UJPA 3O8AA 1JUKA 2NX1A 1B3OA 3RLUA 3PF3A 3GKAA 2Z2UA 1VLWA 3K30A 3QC3A 1OHLA 1C9DA 2FB2A 4OT7A 4UTUA 1EWEA 3CM4A 3A9IA 5AYZA 3ZWTA 5D05A 1GVQA 3W70A 3NR0A 1LORA 4O17A 1KFCA 3GLCA 5D2YA 5KITA 1W5OA 3TXVA 1KLYA 1DJQA 1ICQA 1M6JA 4UNKA 1BWKA 1BTMA 3LCXA 5HULA 4A21A 3Q94A 4PTNA 3EWWA 5BMXA 3UY8A 1L2UA 1WX0A 2KZHA 3BLFA 2VEPA 5I3IA 4AVFA 4JX5A 3M7WA 1DVJA 4N6EA 2YW4A 3LLFA 1W0MA 1FWNA 3OIXA 4ADSA 2NUXA 2E6AA 1I45A 3UWQA 2OX1A 4XZ9A 1KBIA 1TV5A 2A5HA 3NG3A 1WXJA 4J9JA 4UMAA 2VFDA 1W8SA 2VFGA 1NSJA 3VI2A 3H55A 2OMAA 1QWGA 2CU0A 4QAIA 2FB3A 5D04C 4RR4A 1J4EA 3QM3A 3FYPA 2WPBA 1EWDA 4UTWA 4ZQCA 5AC8A 4RX0A 3NQFA 4FXSA 3SSJA 3S5OA 4OV4A 5U7SA 3G0UA 3PUEA 2E5CA 2EF9A 1XUUA 1HG3A 3LDVA 3W1UA 3S1WA 4LTSA 3O63A 5T26A 3LI0A 4RK8A 3THQA 5I3HA 2RDTA 3TAKA 3L9CA 3UWZA 3UY7A 2R94A 2VXNA 4Y96A 2BSLA 2B0MA 2NXIA 3DFOA 4EOUA 4LS0A 4AWUA 3NL5A 4KKXA 3LXBA 4CCCA 4JTIA 1H51A 1O5XA 3W74A 3BW4A 4NZFA 1G4TA 3OVRA 3VCRA 1RZMA 1W5MA 3IIXA 4FEZA 5AHIA 3N3MA 4XKYA 3TK7A 3KRSA 1IXQA 3RK8A 3IV3A 4LVBA 4JTSA 2RDWA 4DO6A 3NPXA 2H8XA 1QR7A 4HSNA 4M19A 3A5VA 3LTYA 1QO5A 4ORIA 3TC6A 4ZL1A 2GOUA 3ABQA 1X1OA 2Y7FA 4NX5A 2YXGA 4DPQA 3CLMA 3B04A 3LHZA 3SGUA 3FKRA 3STEA 3G1XA 5HWNA 3PC0A 3UZJA 1UBSA 2OT1A 5CSSA 3PBYA 3NXFA 2YCEA 1JRCA 2NUWA 4YL2A 3MP5A 3NQEA 4AWSA 4ML9A 3AO0A 1DORA 5EA9A 3U6WA 3B8DA 4HNNA 2CLLA 4LS1A 4CCDA 3CWNA 1IXPA 2VEIA 4LVFA 1YXCA 1GQNA 4JNMA 3W73A 3UYCA 5HWMA 3GNDA 2GQAA 1ZENA 2NWRA 1XL9A 3EKLA 2NUYA 3W7QA 1JCLA 4WOZA 3MMTA 2ZQ0A 1VS1A 3L68A 1OF6A 4MYXA 5DY3A 1U83A 3P62A 3E0IA 4GFSA 5D03A 1RQHA 4GUFA 3BV4A 1JCYA 1S5TA 4MY8A 3CPRA 3A5FA 5J5RA 5HNRA
chains in the Genus database with same CATH superfamily
2QR6A 2WW5A 3AJ7A 3FA5A 3W7JA 3TSBA 3A23A 3F4DA 3NO5A 4QE4A 3KZPA 4E2VA 1PDYA 3OPSA 4LUIA 2EJ1A 2HNEA 1DPMA 4ZZ9A 1KCXA 2CWNA 2R6OA 3MBFA 1EP2A 5AYYA 3W84A 1AQFA 4PRTA 3ZVHA 2C3ZA 2YZRA 4BK9A 4U10A 3RN6A 3MI2A 3WENA 4KERA 1Z9AA 2C91A 3NVTA 1E6XM 3HJEA 3RAOA 2QCMA 1XH1A 1SR9A 3VUSA 4UMBA 3W7PA 2XN1A 5C9ZA 1J0HA 2OZ3A 4UQCA 3WD1A 5BOEA 4X9SA 3DG3A 4H8VA 4BHYA 4R7JA 1DJXA 4M6UA 4UTWC 4PUJA 3O6AA 5C9RA 4WHBA 3VD4A 1AJ2A 4ZQNA 2QJIA 4YIWA 3OB8A 3ANVA 3GG0A 5CJNA 3BUVA 1YXYA 3HOJA 3TV8A 4UTJA 3VOJA 1MEHA 1H0IA 1TV4A 3LOTA 2MANA 4GFIA 2AGTA 1R9YA 2JKEA 3VOIA 2EAWA 4Z0SA 3H24A 3LLXA 3QZAA 2F6UA 2TYSA 5I0DA 4IOTA 3SCRA 2YXXA 3CUZA 3KDNA 1P6WA 1E6SM 1JNDA 1W31A 4OQVA 2XWDA 1LLZA 3STCA 3TC7A 3BG5A 4ERAA 3T2PA 4ACZB 3IJLA 5FACA 4QR6A 1I2QA 4W86A 1V08A 2A3AA 3DECA 4XZMX 2O4QA 1BYDA 2ACQA 3B97A 2ACSA 3ZJ6A 1MEWA 1TSIA 4EXBA 5FJIA 2WM1A 1R3YA 4FLQA 3V1HA 2IS7A 1EEPA 2PP1A 4HQVA 5LGZA 4GNVA 2QF8A 3NL3A 5A69A 4Q7BA 2VZTA 2F38A 1RAKA 3K4DA 4CN4A 5FJTA 3UA3A 4TMBA 3O6DA 4P7OA 1JGMA 3PJUA 3W7EA 4A29A 1OCBA 3THUA 4E3TA 4WDTA 7ENLA 1HKVA 4TO8A 3MUXA 4EP8C 1UCWA 3RFAA 4X0NA 1XLJA 3IUHA 3LSBA 3TQKA 4S39A 1R9ZA 5FAGA 1RPXA 1IIGA 3RRAA 5HDRA 3CV2A 4KS0A 3QVQA 4I90A 2ZRZA 1XISA 3AWOA 3THDA 2PU0A 1KM5A 1UUQA 4UNLA 1O1HA 1JG9A 1ONEA 3URNA 5XINA 2ZUNA 4GIEA 5ABGA 4KBXA 2HPIA 1EDGA 1A53A 3WQ6A 1L6GA 2VC6A 4MJ4A 6REQA 2DQWA 5PTDA 1KFKA 2E0PA 3AOFA 4LSBA 4D6EA 3GTFA 3G0XA 4BS0A 4XISA 3ZMRA 5FKYA 3NDOA 3DHFA 3PBWA 5TF0A 3W2LA 1EP1A 3WNLA 4OBTA 4PUNA 1T8QA 1Q63A 3H23A 1S46A 5DCBA 4DWSC 3A22A 1QOXA 1N2VA 1LDCA 3SCPA 1S1RA 4XD4A 1WUEA 1TA3A 2CBJA 2RHGA 1XV8A 2V3FA 3E0FA 1I4NA 5H8MA 3GZ3A 1XDLA 2CLHA 1OX4A 3SCWA 3CUIA 3VOGA 3N04A 3AXIA 3PWGA 3AALA 3DFYA 3OGRA 3LX9A 3S1XA 3UWYA 2E6DA 3LXCA 3MP4A 1SJCA 2FZ8A 4KRTA 4OECA 4UUIA 4MNJA 3WQDA 3I3DA 3MTWA 1RCOB 3AUOA 4FOKA 2DT2A 4MZ1A 3UGRA 4BQ3A 1OFEA 2J88A 2VTFA 1I9CB 1JQVA 2UWFA 4PL2A 4HJWA 4H7ZA 3CZEA 4AWEA 1E72M 4EE9A 3F4NA 1FUYA 3RNDA 2FFCA 5EFFA 3IRSA 1XYBA 2CLEA 1YX1A 4B15A 3ANUA 4DWSB 1EZ2A 1JCXA 2QGHA 4ZSTA 2G97A 4Q7NA 1CECA 3V75A 1UG6A 4O28A 4EVZA 2E5BA 1HX0A 1RXOB 4NHVA 3ZIZA 1SW3A 4RDVA 1JZ8A 2WSKA 3LI1A 1HW6A 3IJ7A 1PB0A 3A4AA 4HT3A 2ZDRA 4GK8A 4IP5A 1FKXA 2OZ0A 4G7FA 2FHFA 3QOMA 2YBVA 3LMYA 1GEHA 3KEHA 5A6MA 1RK5A 2WMKA 4LAZA 2DY3A 2B7QA 1H1NA 3GU2A 1GK8A 4YXGA 2Z25A 3SCNA 1M7PA 1NDZA 4ATLA 3S2NA 5HNNA 1W3TA 1OK6A 3W00A 4J3TA 1SFTA 3TYUA 3P7YA 3AU6A 4W5UA 5CPTA 5D37A 1ZQ5A 3H7VA 3MSGA 4JTHA 1PZ0A 1XKYA 5HBFA 1HFBA 1TB3A 1YADA 1XGDA 4V28A 4ZTYA 5LNWA 1TWIA 2ZKMX 1H5YA 3QR1A 2YLLA 2ZUTA 4LV4A 1BWVA 3S3GA 1L6WA 3P61A 1XGZA 3GU1A 1XP3A 4LXFA 2BHYA 2XYLA 3H26A 1FWGC 3GDBA 4MM1A 5FJPA 3PJTA 1KKOA 3CIXA 3AJXA 1UR9A 1HKKA 4UFMA 3CO4A 3M16A 4QG8A 4L9XA 3WLIA 3WEMA 2QDDA 1K02A 4Z1BA 7ODCA 3FVMA 4NAFA 1IT7A 2D3LA 3UXAA 3K8KA 1CGYA 2Q6ZA 4AXNA 4B91A 1QPNA 4H9VA 1GONA 3IVTA 3MO7A 3ALGA 1PCKA 4E2BA 5U4NA 2V68A 3NQAA 5BXPA 1UWAA 3KBSA 4C6BA 3EB3A 4JDYA 5AN7A 1Q65A 2VCBA 5A94A 2VX4A 4HN8A 4FNTA 4UXDA 5BMWA 2ADAA 2A1YA 3MYOA 5CPQA 1XSIA 4YMZA 3H6OA 1XSKA 4C6CA 3O0FA 3USBA 2I7GA 2NQLA 5KZ6A 3KS6A 3R10A 1P43A 4MIMA 2VNCA 2C15A 2GDUA 4JYFA 3LY0A 2HK0A 4C1NA 3TYZA 1OFPA 4HZMA 4H9MA 5B80A 3D3AA 3CV6A 4L56A 2Q01A 3LCIA 2R8WA 1WOAA 4GUGA 1JCMP 1VLIA 3A13A 2WHKA 2DT3A 3UW6A 4W4QA 1MW1A 3KCJA 3KP0A 1CLKA 4KWVA 1O94A 3FFSA 4LAMA 1WO2A 2OR2A 3CV7A 3B8TA 3RITA 4A8LA 3JRKA 2V81A 3ARPA 3HFTA 4W7VA 3THCA 1AD4A 4CVUA 3SY5A 3ZVIA 2ZICA 3UG5A 2WQPA 1WYIA 1TJRA 4QDWA 2Z1WA 3GHRA 5LIYX 3H22A 3ES8A 1QDSA 3PR2A 4ATWA 4RZ4A 4AIUA 3WBXA 3OVQA 3C3UA 4CD5A 3TTQA 3SIZA 4OOZA 3ES7A 3LBMA 2EG7A 4Q6XA 4ECLA 1T40A 5BOFA 3KLLA 1ZUAX 5C7VA 2DZTA 1KGUA 3BH4A 3CAKA 2PWHA 3FY1A 1N55A 1CB7B 3GE7A 1MDRA 1FDYA 2Y61A 2DSKA 4RDYA 3TYBA 4GVIA 4AF0A 1JR1A 4P61A 4YU1A 4US5D 4S3AA 1BPLB 1V6YA 5C71A 3W81A 3WMLA 1J10A 1MUWA 2I5IA 2VZOA 3DDMA 1TV8A 4YN5A 1GORA 3C0QA 1H62A 1SO6A 3WMCA 1C29A 2ZTJA 4MB4A 4PCFA 5G5IA 1ADDA 1W1ZA 4EXAA 4WY0B 4XIMA 5AY7A 4I9AA 5AKQA 2VRKA 1NJJA 4B90A 1XG4A 5HMSA 2FMOA 3V35A 3STFA 5AC6A 1EGVA 2EXOA 2JALA 4D6DA 2ZUWA 3V0TA 4C6IA 1D8WA 2OB3A 3L7RA 2NQHA 2Q8XA 1XRFA 4KT2A 5DBTA 1EP3A 4EIVA 2J78A 1FWRA 3C2RA 1LL7A 1VF8A 1TPH1 4AUBA 1C8YA 3CHDA 2YB4A 1M03A 2TRSA 4MLJA 3GWQA 2NX9A 3MJYA 4WGXA 3HV9A 4M8UA 3Q4DA 3EWYA 3WEZA 1A5SA 3FAXA 1OD0A 1NOWA 2V67A 4Y8EA 5MHBA 1OYCA 3QKEA 1W2PA 1K70A 2V2DA 4Z2JA 2R1KA 1SPQA 4ACYA 2X41A 3COTA 3QYSA 2VJXA 3GH7A 2G0WA 2EPOA 1Q2RA 2EHHA 1EPXA 2IQTA 1IEIA 3A21A 2XSXA 3EWCA 1KBKA 2QCFA 4FI4A 4IISA 2PLCA 5LIWX 1UR0A 1X39A 4IH3A 1W9XA 1A47A 3WK0A 4DIAA 3VE7A 2JBMA 2WOQA 5A6BA 2B4GA 1QI0A 3MA8A 3MP3A 3TOPA 2OEJA 3HIJA 3IV8A 3W72A 1J6OA 2ZX8A 4D6JA 1SSGA 4XK2A 5BRBA 3ZOAA 4CQDA 4Q8OA 3ABSA 1R47A 1TVLA 3U7BA 2IUZA 1SUXA 2J7HA 2H3BA 4CEXC 4UC5A 3QRHA 4IG2A 1E6PA 3CUXA 3QOKA 4H04A 5L6UA 5F2GA 2JIEA 4LBRA 4F9JA 4W7UA 4IIFA 1I8JA 1N82A 2WBGA 1V6WA 4IPLA 4DJED 3MV11 4L6DA 3N2XA 4YTSA 1KR0A 3VKAA 1QTWA 3AHYA 4IMAA 4GY0A 3W37A 4LWWA 4DUOA 2WWCA 4DBWA 4Z1AA 2IMRA 3CBWA 3CAQA 2ATMA 1QK0A 3HF3A 3CXOA 3TC3A 4XUGA 2BODX 4Q8MA 2FPTA 1J12A 3TN3A 1PHQA 3GW0A 1TZZA 1X8FA 3NJ3A 2VX6A 2ZUVA 4KCTA 2VCAA 3O0KA 2V2CA 1AZ1A 4XAFA 4PC8A 4AHQA 1IGWA 1XG3A 3RX3A 3EXSA 3LPPA 4OE7A 2Y2WA 4MLRA 1XIJA 3CUJA 5HMEA 1JPIA 2O7QA 5EPDA 4PSPA 4JICA 4F48A 1E4NA 1PUDA 3W7LA 5FAJA 2ZXDA 4Y9AA 1H1ZA 2YYUA 3NCOA 1J0JA 2D22A 1VPXA 2G41A 2OCZA 2QJNA 3MMUA 4O54A 3WQCA 5A8MA 2HXUA 2RJHA 2FZ9A 1TQXA 3NSMA 4J40A 5DEZA 3SSZA 4AX6A 4NRSA 4QG6A 2ZFAA 4QLJA 5E0FA 6XIMA 4HNUA 3G3DA 1ZAJA 2NW0A 5B7ZA 2A4AA 2HE8A 3N73A 5G1MA 3GZAA 4QEHA 2UV8G 3IANA 1F76A 5D9NA 1PX8A 1JGIA 5C2CA 4O8AA 4CU8A 1LZOA 3XISA 3F4WA 2P10A 3W2JA 3GBDA 5E09A 1CNVA 3PBVA 1V0NA 2DSWA 3R5EA 4QHRA 3W25A 3IS4A 2PA6A 4S23A 3W1PA 4YJ5A 4IMEA 4WEVX 2ZX7A 4FIRA 3QSTA 3AROA 3WF3A 1WCGA 2FPVA 4C6DA 2IKHA 2JF7A 4HMNA 5AYXA 1GOWA 3HGRA 1HGYA 3CUGA 4FNRA 3NGJA 3WJSA 1AH0A 1V51A 1E0VA 5T91A 3RILA 2V9DA 5F2LA 4ZXLA 3A4WA 2XFWA 3OLIA 2TODA 1D3GA 2VEFA 2YIHA 2WJFA 2XM1A 2Z7KA 1OYBA 3EOOA 1R38A 3WLRA 3L4TA 1SJBA 4JTJA 3IVSA 4D8AA 5CCZA 2YKKA 1GOOA 3P8JA 3KBVA 1JAKA 3NEHA 4FX8A 4LUJA 2Y0FA 2OVLA 1YKWA 2WZIA 3EGJA 1HJVA 1TPC1 3KL5A 1Z7AA 1DHPA 3W82A 5DMNA 4JTQA 3A4JA 4NL1A 4OGZA 4DUWA 1W1YA 4IUOA 4XBKA 1MXDA 1XIBA 1JNEA 1ZJBA 1EA0A 2VFFA 4B4HA 4KCWA 3KBNA 3PB0A 4Y9PA 2BFGA 4BKNA 4JTLA 1WZMA 2A21A 4O12A 3RLGA 1D2KA 2V5JA 1UZ1A 4MJMA 1M3UA 1J0ZA 2CYGA 4HHMA 3N18A 4HOXA 2AQWA 4S38A 3W7KA 1EJTC 2PRLA 3WZ0E 3S0CA 4PMVA 5JIWA 4QSFA 4F79A 4DF2A 3TN4A 2XGZA 1EOMA 2GJXB 3OODA 1GTHA 2FZMA 4Z1DA 2ZTKA 2HRWA 4GYPA 2R1LA 1PIFA 4O13A 4Q8QA 2VGBA 5BRQA 3WLJA 4PUWA 1DE6A 4E0CA 2UY2A 3QHOA 3ZLHA 3GVQA 2Q09A 4L5ZA 4TUFA 1OB0A 3HPSA 4H6KA 3F03K 1C8VA 2VURA 2OOGA 1H7PA 3OA5A 4GH3A 4OHQA 5BZAA 2PUZA 1S2UA 4E4FA 4UB9A 4K1WA 2ZWZA 1L2QA 3RF9A 5C9WA 3LHYA 3P67A 3TAOA 3Q2DA 4GQBA 4HK6A 1RBLA 2AL2A 3DENA 4H9YA 3JUGA 3VIIA 3MMDA 4ILSA 4UOQA 5I07A 3I3BA 5DMYA 4PN2A 3WK3A 1OZQA 3VGDA 1WOBA 2OKTA 3OBAA 1ZY9A 2NV2A 4F4RA 2WCAA 3BSMA 4PZVA 4DNHA 4LF2A 4WSKA 1CX9A 4M6VA 3R7MA 5C2XA 3SUSA 4M56A 3S5YA 3UNTA 1MNSA 3CK5A 4Z2HA 2PF8A 3UNDA 4GE8A 4E8GA 2DU2A 4XBJA 1DWIM 4F2BA 3GH5A 4V15A 1E6QM 3OU8A 1GJWA 4A8IA 5LNSA 3OG2A 3GC4A 2W63A 2TMDA 5DY2A 4L4LA 1XYAA 4O4WA 1G4EA 5A2AA 5I3JA 1SZGA 1YBQA 3OLGA 1FBAA 3TP4A 4YS1A 5A1AA 2OLSA 3C0LA 2Z6JA 1CGWA 4PR4A 1XPYA 4RZ5A 2RDXA 1XR2A 3OYZA 2E1DA 4EWJA 2HZGA 1SJDA 3GXFA 2VX7A 3RXZA 3NSNA 4CD8A 4WJ8A 2OEKA 2D0GA 4P8XA 5E93A 5C2GA 3N12A 1TJ1A 2PTDA 3S42A 4IMGA 3GXNA 3WDIA 5IXEA 1X98A 5L9FA 3O16A 4X3ZA 5I03A 1JEZA 4Q6JA 1ODUA 1FHVA 3SN4A 3GVGA 4E2DA 1X7IA 1S2AA 2ZRYA 1OIMA 4AIEA 1ZNNA 4C5ZA 2FZNA 4M82A 2VP8A 2JGYA 3DBPA 3E0LA 3BCDA 1E6RA 4DWSD 1E51A 4V27A 3WJYA 2WVVA 1DIDA 4JHZA 3GTXA 1TJ2A 2F6KA 2H9AA 3KVKA 3VOHA 3HPAA 4A6GA 4RE0A 3TZFA 4QFUA 5IRPA 1PZ2A 1XLFA 3T07A 5K2ZA 1EO7A 5H8PA 3FHQA 3BURA 4CNNA 1JDDA 4BF9A 4LX4A 2C1IA 4NYUA 4L9YA 4LU0A 2WNNA 2CZEA 2J6VA 3BC9A 3VGGA 5M1TA 4HYRA 2RJGA 3W7MA 1C3FA 2XIIA 1HKJA 5B7YA 4MJ2A 1I1WA 4Q4OA 2V6AA 1EJ7L 4LVGA 4QISA 1HP5A 1XC4A 5GJNA 5HPCA 2W0UA 4ML4A 3UR7A 2GGEA 2VWSA 4Q22A 4HPNA 1W1TA 3WQGA 5A2BA 4MY9A 3CHEA 1Q6QA 8RUCA 1LG1A 3LTSA 1F05A 3FXGA 2OWCA 4B3ZA 4C6JA 3TSMA 2FYMA 1DQUA 1I2PA 4KF1A 1P1XA 1DJHA 3AXKA 3LZ3A 3DAQA 3E12A 4L1XA 3URAA 3CIWA 3BQ6A 1UC4A 2CC0A 1MQRA 1YIXA 1BSIA 3WNNA 3WK1A 3GB6A 4OWGA 4ZTXA 3E96A 1ZJHA 1E6ZA 3PFRA 3TNBA 4R27A 1AW2A 1VBGA 3EOEA 1C8QA 3VNYA 3H2MA 4AVOA 9CGTA 2FQIA 3VX1A 2Z27A 4L4MA 3E5PA 4Q4MA 3BG9A 1BXNA 3JU2A 1OIFA 3W2KA 2YA1A 4IFRA 4CN6A 1B3WA 3G22A 1XUZA 3QXBA 1GEQA 3OOQA 1H09A 4LC6A 3K4WA 5TNVA 1HIZA 4AFYA 3K13A 5D32A 3FYYA 4XAZA 3I6RA 4F0KA 3GTIA 1I2RA 4O0QA 4CUCA 3WMBA 4MKSA 3W07A 5D4YA 1V6VA 3DG7A 4BWLA 4MOZA 1QWKA 3TN5A 4ERGA 4TU1A 3S2CA 5DX7A 3VINA 2Z29A 3R0KA 3ARWA 4RW3A 3FJNA 1H2JA 1YLVA 3BSHA 4DF0A 3SIMA 2Z26A 1CXHA 1GOMA 3EB2A 2CHRA 1OX5A 1EYWA 4HPXA 4K8HA 5ENLA 3VYLA 4KWOA 4JKLA 3A64A 3D0CA 2DORA 4LYRA 4QJ4B 3NZRA 4MAVA 2QEZA 4RCXA 3MY9A 3HFYA 2QV5A 3MWAA 3HQNA 3C3NA 2GL5A 1AMYA 1UP0A 5D2WA 3QY7A 4TVUA 3ARZA 3DFTA 1BKHA 3VUPA 5D33A 3CB3A 1CGVA 1FCUA 1YTKA 3ATYA 4LBUA 1NDYA 3EX2A 3KLKA 3ARSA 3INPA 1IXOA 4GI6A 1TX2A 4AG0A 4NU7A 4ZQOA 3NAVA 2CXEA 1D8CA 1JFHA 1BD0A 5AC5A 1BEUA 5HATA 3P3BA 5H2ZA 3LMZA 4GH1A 2PURA 4TX8A 1B9BA 2QPSA 4KCVA 5HINA 1PL9A 1EHAA 1REQB 2CHNA 2QNEA 3L23A 5C0QA 4FNQA 4H41A 2JE8A 7TIMA 2X0SA 2XFFA 1PCWA 1XC6A 3AWNA 3T05A 2QS8A 2XH0A 3B4UA 1VR6A 2YFOA 1V0MA 2A7PA 4K3ZA 4QLKA 1BG4A 1ITCA 1UJPA 4FR6A 2NX1A 4JEJA 2HVNA 4J3ZA 2Z2UA 1OHLA 2FB2A 3OGVA 3N15A 3ISIX 5JH1A 4FPSA 5REQA 1GVQA 4Q3MA 4MAZA 2DSVA 2PDIA 3GLCA 1Q7QA 3WH5A 1Q8JA 3S9IA 4LUSB 4UNKA 3LNPA 1FA2A 2WMIB 4Z1YA 1BTMA 5HULA 5I77A 5IHSA 2WMJA 5BMXA 1DJYA 2YCLA 4IFKB 5A6AA 3JZEA 3EDEA 4DI9A 4AY7A 4AVFA 4UCFA 3M7WA 1DVJA 4XX6A 4N6EA 2YW4A 3GG7A 1W0MA 2OO6A 3EPOA 1EXBA 3TVAA 3M0KA 3RU8X 2J7GA 1I45A 2OX1A 3VGEA 1UR8A 2ZUUA 3OZMA 1IZCA 1TV5A 1SM9A 2VFGA 2GGGA 3QN3A 2W3ZA 2XDFA 1RSCA 2D2GA 1J4EA 3MCNA 3FYPA 1EWDA 1VFMA 3BLKA 5FL0A 4F0RA 4PMUA 2ALRA 3MCOA 1KRAC 3OVGA 3S5OA 3SSJA 5U7SA 3K4AA 3PUEA 4YHEA 1HG3A 4W8LA 3S1WA 1V6TA 2P8BA 4U5KA 1TFVA 2DW7A 3PANA 4X0VA 5I3HA 3TLQA 2BOGX 4QG9A 2RDTA 3CZLA 1UKSA 4GYJA 4Y96A 3HZ3A 3BQ5A 4W89A 2B0MA 4DVOA 4M51A 4JZ5A 4LS0A 4XAPA 3GM8A 5CXPA 3ITXA 4JTIA 2PDWA 4HZ7A 1O5XA 2CEQA 3WFLA 3UJFA 3LBOA 3QGAC 2E8ZA 3VCRA 1GOQA 4IJRA 1DWHM 1YRRA 4QQUA 3IV3A 1RJRA 4F8XA 2BP1A 2RDWA 3PNUA 4DO6A 5XIAA 3ITLA 1J0KA 3A5VA 3LTYA 4I5RA 4ZL1A 4F0HA 5CH9A 3CLMA 3CPUA 3LHZA 1HXJA 3T08A 1ENUA 5DMMA 1E0TA 4G8TA 5H6HA 1A5NC 1ZP3A 5CSSA 3PBYA 5JU6A 4NAEB 1LUCB 2NUWA 1JZ4A 4GLEA 1B30A 3MP5A 4IM4A 4BQ2A 4ML9A 4FA3A 3N29A 3GHTA 4X63A 3RDKA 3VIMA 2DVTA 4US5A 1S5MA 2VEIA 2WBKA 4LVFA 4MDOA 1VFLA 2Y5JA 4B92A 2YJQA 5HWMA 3GNDA 1ZENA 2R24A 3WH9A 2NWRA 3EKLA 3W7QA 2W91A 3KDOA 2QDEA 4IGNA 1HL9A 3E0IA 1YNPA 1ZL1A 1UWQA 1RQHA 4GUFA 1E4IA 3BV4A 3SQLA 1XWYA 1S5TA 4A35A 4P8WA 2POZA 3CZJA 3A5FA 3T0BA 1ZJAA 3VD3A 2VCCA 1KTNA 3TXZA 4A05A 2V82A 4HU8A 1QI3A 1MMFA 3AZTA 1J18A 1AFSA 1HZYA 3ZQ9A 3MQTA 1NARA 4PCSA 1MO0A 4R53A 3G6MA 4H83A 2DZWA 3I68A 3BZGA 4HHHA 2HSAA 3ZT5A 5EBUA 2WJZA 2PFHA 3PFMA 3GO2A 3ITGA 4K38A 4NX0A 1IEVA 3HM7A 3O05A 4XD5A 3WIJA 2V5KA 1QJWA 2ABBA 3NPVA 1I75A 2J9ZA 1FWIC 5FESA 1DWAM 4TXEA 4K7YA 5E0KA 3P60A 3FJ4A 4HU4A 1GQLA 4OJYA 1JI2A 1K8XA 2OZTA 1XIFA 2XSAA 1AG1O 2PEVA 2V38A 5I2UA 3Q67A 5KZDA 1ECEA 1ME9A 2V30A 4GO8A 3WQWA 3EEGA 3VO0A 2A0NA 2PBGA 4GQQA 3W0KA 1THFD 2VC9A 1RA5A 2PDBA 3E02A 4AMCA 1OGGA 3JS3A 4S3FA 3GFYA 3SUWA 1V3KA 4IQLA 5GNXA 3TE9A 1MZHA 2ZCGA 1YHTA 2YLAA 5C8BB 3TONA 2VEMA 2PDPA 1KO0A 4I5UA 4WXZA 4XZBA 3OEXA 4P8VA 1EDTA 4C6FA 4NZCA 1OWQA 3GIYA 1UA7A 3PAJA 2X30A 3W75A 3FX4A 1RV8A 3IARA 1FXQA 2E68A 4DX3A 5AHMA 3G0SA 4C6QA 4V1XA 3CQ0A 2WVSA 1XIDA 3VABA 1O68A 2FKPA 3L0NA 2DDXA 5CSYA 4DJEA 1UWRA 1K8YA 2A6LA 1EXPA 2J4GA 3W1RA 2QIIA 4JIIX 2QDGA 1GPWA 4OVXA 4QITA 2RDUA 3AQUA 2QCDA 1V3JA 3USZA 1GVSA 4ZO6A 1WKEA 3UEQA 4JY9A 4QNEA 3G1DA 1KV8A 2G3JA 4LC8A 3J7HA 1NY1A 4O8RA 1M9HA 5HA7A 5I23A 2GPTA 4S1FA 1IHIA 4F9DA 1J93A 3BAYA 3P6LA 3BLOA 1OG6A 3QTPA 3DKJA 3MW7A 3UERA 3AC0A 2PWDA 2NLIA 2ZXBA 4YVVA 4C6PA 2OG9A 3ZJKA 1X96A 2I16A 1MDLA 4OU1A 4RW5A 1JPDX 3W2UA 3QQ1A 3N13A 1VAHA 3LXAA 1JUEA 4INFA 1A4LA 3EKZA 3GUWA 2ZX5A 4IQEA 2ZZ4A 5ABFA 2D69A 3PTDA 2R14A 1ZBKA 5HJLA 2YW3A 3UR2A 3FJ6A 3GR8A 4HA4A 4O1DA 2YL6A 4MHBA 2Y88A 4GRSA 4S3DA 4RE3A 5BOOA 4JTUA 1MZRA 3LYEA 1UKPA 2HJPA 1Y8BA 2L5HA 4LVDA 2HDJA 3GNRA 3OBEA 4JHOA 1Q13A 2B7NA 4KEUA 2J9XA 4EACA 4N4QA 2DZPA 2PB1A 1XI3A 2QCHA 5TAOA 4GNKB 4UR9A 5FF2A 2X0HA 4M6QA 3RCMA 4DELA 4ZVJA 3HQ1A 4MPQA 4AISA 4B2DA 1FDZA 4IMCA 1VIWA 4J35A 3QHMA 3GXIA 1DIEA 4TR9A 1K9DA 2V0TA 1OG0A 4JKKA 1KCZA 3EBVA 4AEFA 3ZVHB 3BLLA 1TPDA 3E0VA 3ECQA 1S2TA 3VD9A 3VCCA 5CC6A 3L66A 3MVTA 2PGRA 3ITYA 1CIUA 3JW7A 3RLVA 3E2QA 5BWFA 4A8RA 4MF4A 1A0CA 2Q71A 3TW7A 3A3WA 1U5HA 3SGGA 1UPMB 3BOXA 1WQ5A 1UYQA 1ZHAA 3B8VA 5A8QA 1W17A 2I5QA 1V77A 3N4EA 1CPUA 2GVEA 3PBMA 5I5RA 1YTEA 3N14A 3O1NA 2AOSA 3T0TA 3F5KA 3SQSA 2ZVRA 3DZ1A 1XSJA 3BAJA 1AL7A 4H19A 2ZZ2A 1PJ9A 1GVEA 1RQEA 1WV2A 1VFTA 5C6MA 3SCQA 1JXKA 1EC7A 7TAAA 1PVNA 4MWAC 1VEPA 4RDWA 3T6CA 1X1ZA 2VZUA 3NL6A 4W87A 4FXRA 4V1YA 4PMOA 3WFAA 3OVPA 4PCTA 4CQBA 2HTMA 1HO4A 1EBHA 1X97A 1IV8A 3G6LA 4CNTA 4AZ6A 4WCJA 1JRBA 1Q6RA 4S3KA 4GI8A 2NWSA 4RNHA 1EGMA 1B3YA 3CL8A 3SJ3A 4B5NA 4JD4A 3NO3A 1VZWA 4YLWA 3VDBA 1IGSA 4ACZA 1G6CA 4A8NA 3HTWA 3HGJA 1ICSA 2XINA 2Z00A 4KIRA 5HMDA 1OK4A 4BCEA 4HKPA 5BWAA 4QQ3A 1UBPC 1B0IA 3R8HA 1GHRA 3NSXA 3VNJA 3ZJ8A 2DZAA 3QV6A 3TJ4A 1F8IA 2VVSA 3E74A 3L2IA 1XLIA 5E1QA 4DN1A 3WYZA 5KMYA 1T6MA 4NXSA 1SMAA 2D0HA 1KWGA 2DPEA 3MHUA 4MWAB 1R0MA 1GQIA 1W9DM 3W76A 4BEUA 3LEPA 1KC7A 3BLDA 1TG7A 4JTTA 3LCFA 5DF0A 1HTIA 4I5XA 3GDLA 1KFEA 2DUAA 1QW8A 3ZFHA 4PA8A 2PF0A 5IHRA 2IPGA 1BYAA 4NNAA 4NILA 4HB7A 4CCZA 1XIMA 3L5MA 4G1NA 1KFBA 4Q4RA 4OUIA 1ADSA 3QPYA 3UR5A 4N6FA 1S39A 2O9OA 1OC5A 3WD0A 4Q4SA 3GNXA 1XHGA 1TJ0A 1W2VA 3HURA 4PCPA 1O1ZA 3N9SA 1UWUA 3GDMA 4HNCA 4LT9A 2Z1VA 5G4HC 4DO5A 1BHGA 2C79A 5LKYA 2E5DA 3SRHA 5I78A 4KQNA 5AHFA 1R85A 4QRNA 2H8ZA 3HO8A 4AH7A 3VAVA 4B5XA 1F3EA 2OLHA 4G9PA 3WUFA 2BGQA 4MB3A 3EEZA 4GNJA 3HBLA 3TFXA 1Q8AA 4P7NA 4O50A 3NPWA 3TA9A 1TA3B 1Y65A 2J7CA 4AIOA 4D6IA 4PMDA 1YDNA 3NZPA 3WQPA 1YMYA 3BCJA 5CC5A 1RVGA 2XN2A 1Y0EA 4WSJA 1OX4B 3IJ8A 4GQRA 2G3MA 3W1XA 1E15A 3UQNA 2Y24A 4MZYA 1C7TA 1MXGA 2GOKA 4GIAA 1A80A 4AAJA 1Q6GA 3FDGA 3R58A 3PK7A 1F73A 4PUMA 2Y5SA 1Z3NA 3B06A 2PODA 3TU9A 1NQ6A 4L64A 3TQ0A 3VD7A 1IF2A 3SN1A 4YWIA 3VGBA 1W1PA 5EGRA 2H6RA 4XZIA 5AECA 5CSRA 3AISA 4GMEA 2E8YA 3N3TA 2WZHA 4ONVA 2NV1A 5EMUA 1VYRA 3LU2A 2WZMA 3M5XA 4J3UA 1XH0A 4AIBA 3NQ2A 2O9TA 1U1JA 3CL7A 1PYMA 2W4XA 4DJDC 2BB0A 1H1YA 1QHZA 1BYCA 3NWRA 4L80A 5DANA 1OZMA 1FH7A 4FXFA 4JN6A 1NDWA 3G3MA 1BGAA 5I09A 2PS2A 2TAAA 1I60A 3UVAA 1OX6A 3SCSA 4LPCA 2Z2AA 3RIKA 4NJHA 3WH7A 4B9ZA 4GYKA 2ACRA 5GJMA 3WNPA 1JDCA 3LRMA 1XBYA 3L2LA 1MQQA 4ZENA 2GSJA 1IR1A 4CNSA 2HVOA 2ZX9A 1XQLA 5DN1A 4Z2IA 1TE1A 5JUVA 4WLCA 1TMLA 4GX8A 5G4WA 3ARVA 3VKBA 5HOSA 3MB9A 4ZO8A 4ZCWA 3FSTA 1NOFA 3QH2A 4N9EA 2YZ5A 2YBUA 4Q4PA 4LBSA 3VIFA 4HMEA 2JFEX 2G8ZA 2YPIA 1PIIA 3DYOA 1RUSA 4JQ3A 4POCA 1JDEA 4EXQA 2QMKA 4PBGA 3KVMA 3WFZA 1C90A 3CZ8A 4IP4A 5CZKA 2WC3A 3WNMA 3W7CA 2D2HA 3ZO9A 1Y7VA 3NQCA 2WSRA 4KIEA 5HMFA 4GY1A 4PL1A 3W28A 2JGQA 3NQVA 2PCQA 1JCJA 4NAFB 2X1SA 2FTYA 2X1RA 3VNDA 5A8NA 5LIXX 4WKFA 2WLYA 2FGZA 3W27A 1G9HA 4LYPA 6CGTA 4O16A 4JFSA 4A4AA 2QVHA 4QM1A 4HD5A 4ADUA 4MNKA 4G7EB 4Q33A 1V3IA 4IIBA 4LEFA 1E0WA 1SQ7A 1YDYA 1XIHA 2Y7DA 4CVWA 1RK6A 1UH4A 3R79A 5I06A 2WO5A 1DP0A 4E8DA 5ABHA 1ZS2A 2P53A 2OYMA 3KWSA 4U2ZA 3VMPA 4C1NB 1Q66A 3VNLA 2EKGA 4CQCA 4B5VA 4JNYA 4XSMA 4XBSA 4YTUA 5TIMA 5HJXA 4XD3A 5CZSA 2QCNA 1US0A 1HKWA 2OSWA 3M0HA 1JL8A 4L4OA 4DY1A 4IX2A 4PTXA 3DH7A 2F2KA 2WNWA 5KSWA 1JAEA 5FEWA 1W3HA 1ZP4A 2RKXA 3W88A 5BNKA 3DC0A 4UFHA 5JIPA 1HN1A 1JDFA 3BICA 3C4UA 3BPWA 5DBUA 3PHAA 3NUKA 2G95A 3O15A 5EU9A 1B3XA 3GD6A 3S1UA 5AC7A 1O5RA 2I9EA 1TYGA 1VRXA 4JX6A 3M1ZA 4LVAA 3M0MA 1EBGA 1OT2A 4DBEA 1PX3A 4W84A 1C9WA 4NF7A 2YDSA 1DL3A 1R8LA 1B5TA 3L4ZA 3M7SA 1QNOA 1GQJA 4LB3A 3HV8A 1WKFA 4UZSA 1ZBVA 1EIXA 3ALFA 1QNQA 2VUNA 6TIMA 3NQ7A 4HN4A 2F6XA 3SECA 2EPLX 1KRBC 3QKZA 3U2OA 1HJWA 4QCFA 2J74A 5GQBA 6ALDA 3GKFA 2QF7A 2VEGA 4AF0B 3N25A 3G1SA 5D02A 1WKDA 4O1CA 3CASA 3UGVA 3WUBA 1GVIA 3LENA 5D8ZA 1PTDA 3OTRA 3KVJA 2VOMA 3K2GA 4JTFA 4HSOA 3CTLA 4WKAA 3T8QA 1VCGA 3SCTA 5IDIA 2P5NA 1AQHA 4QSHA 3NQGA 3IIOA 4B5UA 2Y8VA 4R34A 5LIUX 1A3HA 2QV4A 3MU7A 2Y7GA 1JQXA 4DM2A 4NJKA 4YPJA 3VOFA 2OQHA 4DJFA 5TBOA 3WLQA 1V93A 1IWBA 1UR4A 3EYPA 2Z6IA 3A47A 3UZ5A 3W7NA 1RVKA 3M41A 1PE1A 1YPIA 4URIA 5F2MA 2AQVA 4NKCA 3L67A 4H00A 4L7ZA 4I7VA 4Q8WA 3UVIA 1ZBCA 3WUGA 4PBFA 3W29A 2C16A 3QW4B 1UMLA 1P1MA 4FOJA 2RUSA 4O1BA 4OUEA 2PWGA 1Y5VA 3W2MA 3LCGA 1V4YA 3KRZA 4AC7C 5M3WA 2QUTA 1Q85A 4HCHA 1UIOA 2A7RA 2C13A 5AYIA 3C5QA 4FLRA 4Y9MA 1PHWA 3S47A 4DM1A 4LCSA 4PB5A 5D30A 3W1MA 8TIMA 5EMYA 2CLPA 4MTVA 4CNOA 4K68A 1H7OA 3UU0A 3F2BA 5D2VA 3ZLGA 3H21A 2NSXA 2VELA 4N42A 3A4XA 4UQBA 2VR2A 4W88A 4M5PA 4KFPA 2W62A 3P82A 3SB0A 1T99A 2WNQA 1BF6A 3UJSA 3KRBA 4BQ4A 3R12A 4O4VA 2CKRA 2VOTA 1GHSA 3POCA 4B5WA 2EKCA 1QPRA 3AICA 4D6GA 1QBAA 2J9YA 1ZALA 3TSDA 2BGNE 3NQ8A 1ALDA 4HYWA 3T42A 4HVXA 4JXCA 3XINA 1YYAA 2RGMA 3PBUA 3JZUA 2VR5A 4YTRA 1E0XA 4PMYA 2WCGA 4IPJA 4AZGA 2DZXA 3S6TA 3KHJA 4AX7A 3PSWA 3T9PA 2Y8KA 1OF8A 3RJXA 3Q58A 4HA0A 1DXFA 1HJUA 3QBUA 3V4BA 3OG3A 3EAUA 2DUZA 3HGOA 1T7LA 3N4FA 2FPYA 3DFQA 4N9BA 3E9AA 1OCQA 1YE6A 2YOCA 4IQDA 4PMRA 3OO2A 4DO4A 1QI4A 1D7KA 1ELSA 4XSLA 4CD4A 3V16A 3OZPA 4K1GA 4XVEA 3G24A 2H90A 1HT6A 1BLIA 4UTTA 1E5NA 4HGXA 4DBDA 2VQTA 1B9ZA 1ZCCA 2DIJA 3CMGA 2D73A 5CPNA 1Q6OA 3UETA 4RL3A 5AHLA 1KBJA 4Q8NA 5HR7A 4ZQRA 4L6HA 1J0YA 4HZ8A 2F2HA 2GVLA 3WF0A 2ZVIA 4UQEA 4NJIA 2PDLA 3B05A 2IKIA 1EJUC 4C1LA 2SFPA 1EF2A 4DPPA 4W5ZA 3ABRA 3KBMA 2PSNA 1M7OA 2XH2A 4TTGA 4HTBA 3UBPC 5FSDC 4A22A 4CNUA 3BAXA 3CHVA 3Q65A 2BXVA 1AZ2A 3SI9A 4XB3A 2EGZA 4E5TA 2I56A 1JD7A 7REQA 2VO5A 2C0HA 4K39A 1V3MA 3C56A 3KFTA 3T7VA 1F6PA 1GW9A 3K46A 1KGWA 3C0JA 2QULA 3NQBA 3DGBA 3ARUA 1S5WA 2QAPA 1DQXA 1MNZA 2VDHA 3KXQA 1RR2A 5G2IA 4XO7A 1VPYA 2PWUA 1LT8A 2C1HA 1XF0A 4JN8A 2QJHA 4XG1A 1JUBA 1KLZA 2PDQA 5EMLA 1TPUA 1XBVA 3QJAA 1R3SA 4M29A 3VZZA 1GCYA 4DUXA 1VPQA 1UD8A 1S2WA 4DBSA 3SO7A 1WZAA 1UKOA 3DERA 3G18A 4ZOEA 3UCQA 1EJVC 4LAUA 1C91A 2PDFA 2W79A 3EWZA 6ENLA 2DQXA 5HUPA 4MKNA 3HJZA 1KM6A 1FHLA 4ZEPA 1KD0A 4HYVA 3GX9A 2PTXA 1LG2A 4LRTA 5IM51 4AZCA 5H8UA 1B57A 2WK2A 1O60A 5TD4A 3KOYA 1S3TC 3B9EA 3PSVA 4O19A 3VIHA 3GDKA 3HPXA 4GZIA 4EPDC 3B9AA 3SW6A 1ZFJA 2NQ9A 3II1A 2VD8A 4XZHA 3UJ2A 3LV6A 3AHTA 4A3UA 4ASTA 4NASA 2ZRXA 3YPIA 1T96A 4DO7A 1JD9A 2WMFA 1UD2A 1DIOA 4XZLX 5HQEA 1FX6A 3I4KA 1FQ0A 1R3RA 3VNMA 1SU5A 1JPKA 1IT8A 2PPGA 1FWHC 2WPGA 3IK2A 1OM0A 1WKYA 4MFEA 3EWXA 3HG2A 4GOAA 5CAHA 1DV7A 1EJWC 2E09A 1EFZA 5D2XA 1H7NA 1W37A 1FWBC 1AQ0A 3ME3A 1IIHA 4Q4QA 2VZVA 4Q32A 3LHUA 1KWKA 1TPEA 3N2OA 3ZSTA 3SR7A 1H61A 4PB4A 3WH6A 3RM8A 2NZLA 3ERPA 4AW7A 1NFBA 3SEPA 1CXIA 1TUXA 3VOCA 2Y6ZA 3WO8A 4H01A 3MSYA 3FCPA 3KM8A 4CQ9A 1UQYA 3QGVA 3S6DA 2VFHA 3B9NA 4DLFA 4JIPA 2FIQA 1AW5A 2E77A 2E6YA 3ARQA 3WQ8A 1JZ3A 2GJXA 1ZBWA 3W23A 3QY6A 2OX4A 3TIMA 9RUBA 3CUHA 3R8GA 3SDOA 4GGBA 8XIMA 3XIMA 3L65A 3M9YA 2FFIA 2GVGA 2XIJA 3TTOA 1YPFA 1P5BA 2QJMA 1CDGA 1TTQA 3S8HA 4MWAD 2E28A 3NZGA 3C2OA 2W9MA 1K9FA 3QFEA 4JGDA 2P3EA 1E3ZA 1UC5A 4UFIA 2BZNA 4P2VA 2NXHA 1ZAIA 3TYAA 2WZEA 3RR1A 2HBXA 4JOMA 1GWJA 1FOBA 3B40A 4XO6A 3DCPA 3CT7A 3GC5A 1TV7A 2CWXA 4U2YA 2BY2A 3LTPA 3TYEA 6PTDA 3OHIA 4NNCA 4AYSA 2HVMA 1J0IA 3M47A 2X1TA 4LAKA 1G0CA 4FAMA 4LAOA 4N0RA 5CAKA 1QHPA 1W1A1 2ANUA 1UPPA 1ISYA 3R11A 1EX1A 1NFPA 1UUMA 3CZGA 3PUDA 5C55A 2BXZA 3NYDA 5CZTA 4H7CA 4BA0A 3NM3A 4QJ3B 3B3DA 3NOEA 3S4TA 3I7RA 5BRPA 1DYSA 1F6KA 1K6WA 1AA1B 3IVUA 1VBHA 1FWEC 3EX1A 2EPNA 5IBXC 1ZJIA 1W3NA 5DLCA 1NFGA 1YBQB 1X6UA 2WVUA 1GYMA 2GSEA 2G4JA 1C8XA 4GKLA 3HGSA 1QOPA 1SVDA 7CGTA 4GA8A 4GJ1A 2TPSA 1IWAA 3JVAA 1A0EA 3P81A 3F5LA 1CLXA 4JCMA 5M03A 1KQYA 1UOZA 3SBFA 3QV8A 3N6JA 3H4WA 5RUBA 3QHNA 4UTMA 3PZMA 2CETA 4ICMA 2NT1A 1J8VA 3PZNA 1DWJM 1AMKA 4R5EA 1WDDA 2PDNA 2XGIA 1OEPA 1WAUA 3T44A 2J8GA 3WQFA 3CT2A 2D20A 2XIOA 2ATSA 1TQJA 1EEXA 4GKTA 5CZ0A 3HG4A 1KM2A 2IPWA 3O8AA 1Q4NX 2XZ9A 4QJ5B 3RLUA 3PF3A 3GKAA 4GABA 4JFTA 3K30A 3QC3A 4OT7A 1C9DA 3UPMA 2WVVB 4V33A 5AYZA 3AYSA 3V5CA 3NR0A 2H9AB 1EL3A 3TEVA 1S1PA 3SCVA 5CBJA 3H12A 3U3HA 3MZ2A 5KITA 3T1GA 1DJQA 1LJYA 3RPDA 1Q2SA 1CCWB 2PDCA 3AMGA 1OBAA 4KGLA 4H9UA 3EWWA 3AIUA 3TCSA 4IIGA 1WX0A 1G5AA 4JX5A 4DBUA 2O0TA 4ES4A 1FWNA 3PTQA 4KEZA 5JH2A 3OIXA 4ADSA 2NUXA 5GJPA 2E6AA 3GSMA 3UWQA 3FXYA 4XZ9A 1KBIA 3S2MA 4A3QA 2VMFA 3NG3A 4J9JA 3F4VA 1WDRA 5BXRA 1W8SA 3RCYA 2OMAA 1BYBA 3AIEA 5FSEC 3W24A 3CMJA 5D04C 2PDXA 4RR4A 1E1FA 1E9ZB 1NU5A 4ZQCA 2VDGA 3V18A 2NVAA 4RX0A 3NQFA 5EBAA 4OV4A 3G0UA 3CLWA 2E5CA 2EF9A 1M68A 4DJDD 1PWMA 4LTSA 3O63A 4FZIA 5A3HA 1TVNA 5LXXA 4IIHA 2J13A 4RK8A 3THQA 4B4FA 1TELA 3UWZA 3B8IA 4KEMA 1GKRA 4AY1A 1B31A 4GCAA 4R9OA 3UXKA 2WC4A 2FDMA 3W74A 3FGCB 4EANA 5JBFA 4NZFA 1G4TA 3ZLFA 3OVRA 1XDJA 2XWEA 3TZNA 4DYEA 3IIXA 1S2VA 4FEZA 1ISVA 3N3MA 3KRSA 1IXQA 4PEEA 3WX7A 4JTSA 2QXWA 3HQPA 3F2DA 3MKKA 1RP9A 3RCNA 2H8XA 3L2MA 2W67A 2OOFA 2EEXA 2QUMA 3AS0A 3ORWA 4QROA 5LIKX 3ABQA 4G56A 2OU4A 2YXGA 2ZXAA 3SGUA 1GJUA 2EBNA 4OOUA 2R1NA 3GG8A 4HHLA 2IXVA 4PSRA 2OSXA 2I5GA 1X8CA 5CBIA 3AHVA 3NXFA 1JRCA 3NQEA 5EA9A 4GXWA 1E1CA 3U6WA 3I10A 3CGTA 3IJQA 2CLLA 4PBEA 4LS1A 1IXPA 1UD5A 3PZIA 4JNMA 1JPHA 4NI3A 1XD1A 3GH4A 1M53A 1VB9A 3WLNA 1V6UA 2GQAA 1XL9A 5BCAA 1D3CA 4HNOA 3PNZA 1JCLA 4WOZA 1S38A 1MFUA 2BY3A 3MMTA 4B5TA 3L68A 1OF6A 4MYXA 2G3FA 4OKDA 2V63A 2VM8A 3T2QA 3VDHA 1MWOA 5J5RA 5HNRA 1R86A 4QIUA 4H2HA 4MYAA 5A6TC 4IP7A 3FA3A 3PG9A 1UZDA 2CBIA 3QLLA 1BQCA 2V3GA 1SZEA 1PPIA 4PTVA 4E4PA 1W91A 3Q37A 1KTBA 3M0XA 3ITVA 3W86A 3B0UX 3F4CA 2Y1HA 1FH9A 1KM1A 3AYVA 3BAIA 1YPXA 3VZXA 1F6YA 2XU2A 1KB3A 2UY3A 1LLWA 1W9VA 1JCTA 2ZWYA 2WSPA 4Y9NA 4UNIA 1LF1A 1KRCC 2YDAA 2BHZA 4XZWA 5G2HA 4ZBCA 3LHWA 3T81A 1LWIA 3V36A 1ZGDA 5M17A 4WD0A 4WDXA 1RLCL 1LWJA 5BXTA 4GXPA 3D46A 2AMGA 8XIAA 3NDYA 2QUNA 1G4PA 1LTDA 1O66A 1Q6EA 1UP2A 3CTTA 5FL1A 1JI1A 1FWTA 3KCLA 5E5CA 3QFWA 3TNOA 2AGKA 3L4UA 2OT0A 2XGBA 4C6NA 1CT5A 1LLOA 4PMZA 3ARRA 1JULA 3MO4A 4IL2A 2CLFA 3BLPX 4D71A 3BMWA 3M44A 4EAMA 1RH9A 1EA9C 1DXEA 3KTCA 4MKVA 1XLAA 5CG0A 4D6CA 1U2YA 4DB7A 1XIIA 2J27A 3OQ8A 4UFJA 4AD0A 2NQ5A 2E6FA 2OPJA 2C7FA 4IFKA 4Z42C 4MNLA 1RD5A 5LHEA 2NSOA 3VMOA 1QBBA 4WSHA 2C1GA 2Q3OA 3N2CA 4QBXA 2DZUA 3U8GA 1SO5A 4M0XA 2DZBA 1XLBA 3D5HA 1L8NA 1W32A 5DELA 3BANA 3GFZA 3AUJA 4TQTA 3RPTA 2IPFA 1LYXA 3MCMA 4N9DA 4D8ZA 3U4FA 2P50A 4AEEA 3A6OA 3V0UA 4GD0A 2GVJA 3U4AA 1TX0A 3V5FA 1LRTA 4GZEA 2PI6A 3EWDA 4XIAA 2WANA 1WB0A 1DJNA 3LQGA 3E3HA 1L0PA 5D8WA 3TQPA 1ISXA 3CO8A 5KINA 4GIRA 2PDMA 4XWUA 2I57A 4IJBA 1C92A 3NVDA 5MKGA 3BVJA 2C14A 4JQAA 1WDWA 1GKPA 2WB5A 1KXHA 3WJWA 3RRXA 5LXEA 1NWTA 4JCLA 3R1ZA 1AH4A 1LL6A 3LPGA 4KEVA 3PY2A 4RPQA 1OD8A 2ZZ3A 5A2CA 3P84A 3DEQA 2X05A 3GK0A 1JPMA 3RX4A 4EF9A 2HISA 5A6BD 2FZBA 4GI4A 1CXFA 1J11A 3H2CA 1W9BM 3QC0A 3W87A 2GJPA 4CD7A 2P88A 3K8MA 4C6LA 3QQ0A 3A3HA 1B54A 1US3A 1JFXA 4WVXA 3TW9A 2ABAA 4NZ4A 3G1RA 3SFWA 2ISSA 4I9TA 3GBEA 4WGHA 5FJJA 3ZXWA 4AQLA 2DZVA 2ZRUA 3ABZA 4W7WA 4IHCA 2DH3A 3NEVA 3SY8A 4UTFA 3BCFA 1Q3NA 3NTYA 1O95A 4FB7A 1QASA 4H9TA 3UG4A 4W8BA 2V3DA 2ONEA 3P5ZA 5E9XA 2A79A 3W1QA 1IEXA 1OCJA 1MFVA 3W1NA 1GVYA 1P0KA 3PZ9A 2XFYA 4ZGYA 3EDFA 1AJZA 2J8TA 4DXKA 2FGBA 4AU0A 4ZOCA 2Z7GA 4JR5A 2KX9A 1Q7ZA 1J9YA 1W56A 4QE5A 1F74A 3R0UA 2P1FA 3G1AA 5KTLA 1QT1A 2X2YA 2Z28A 4L4PA 5CQ1A 3MSDA 1P0DA 3AIQA 4RZ6A 2TSYA 5AC4A 2EO7A 4RJEA 1MRQA 1FWAC 1WDQA 5C9XA 5HPOA 4UBPC 3BSGA 2ON3A 4LB4A 3S2LA 9XIAA 3ZSSA 4AZHA 3HU7A 4YHGA 3SFKA 3KHDA 3VU2A 3BAKA 3DFNA 5CC3A 5K9CA 4EAYA 1KR1A 1OSEA 1LBMA 5I3KA 5KEZA 3ELFA 1B3ZA 1DXIA 1TWDA 2YR1A 3CH0A 1O12A 2VL4A 2WSYA 2XVLA 3D6NA 1GTEA 3RJYA 4FNUA 5K4ZA 4WXYA 3PPHA 4HU0A 1WP6A 2ZZ6A 1NWRA 1X6LA 5DXYA 1A5UA 1WPCA 1JZ2A 2DVXA 3GVVA 4DZ5A 1SO4A 2E4TA 1VKFA 2D2JA 2VENA 1EO5A 4GBUA 2GGIA 3ICJA 2Z1KA 3VVGA 1F2JA 4C7DA 2HNHA 1VCVA 3URQA 1P7TA 3MC5A 4LRSA 1UWSA 2G37A 1V02E 4PUUA 1KXTA 1HKIA 1GT8A 3WD3A 4DHGA 2OTDA 4JTRA 1W1IE 3UWUA 1T8XA 2YX0A 4Y9OA 1ZTVA 1G01A 3VIOA 2GJNA 1R7OA 3IAPA 1JYXA 2Y8UA 1NF7A 4NP7A 1MSSA 1EUAA 3SRFA 3TCEA 4AD3A 3KE0A 4BY3A 2QCDB 4RXFA 3TMLA 4LUTA 2XG9A 1H4PA 2NV9A 3HA1A 5HNUA 3EDKA 7XIMA 5HNTA 1YW1A 1UD3A 3VGHA 1EQPA 2X42A 1A5LC 1A0DA 4AZBA 3IPWA 1SJAA 4P8UA 3H7RA 3B9OA 4RNJA 4BZYA 2ZRVA 3OBKA 3MZNA 1MUCA 2JEPA 1KFLA 1VYPX 1IT0A 2YA0A 4CNPA 3IJ9A 3U0HA 1LQ0A 3ONBA 3VILA 3SQMA 4I9MA 4Q4KA 3H54A 2EPHA 1SZNA 2MNRA 3H4XA 3WUEA 3V7PA 2YSWA 4LALA 3RGTA 1J2WA 4FOUA 3L0KA 1RP8A 1MRAA 2FDSA 1NF0A 1P0EA 1H7WA 3GXMA 3E6EA 3ZZ1A 3PP7A 1Q4WA 3IIPA 4OBSA 3ZJ7A 1SZFA 1KW1A 1QHOA 4WR3A 3W2NA 3F5JA 3NQMA 1UZ4A 1UH2A 3HB9A 4JTEA 1U22A 4LH8A 1A50A 1GYLA 4K37A 1E4LA 3EA3A 3R94A 3VZYA 3ITOA 1A3XA 2WHLA 1YTDA 2VFEA 1XLDA 3FIGA 5AVHA 4R3UA 3N2MA 1M7JA 3EOSA 3P74A 3QEZA 2BVWA 1XDMA 3S1VA 3U2EA 2PGFA 3HG5A 5CZJA 2Y62A 2Z1BA 5E70A 4QP0A 2XN0A 4LCRA 2CITA 1ME7A 3LS9A 2PCEA 4FK9A 1DWGM 3QSRA 3I7SA 2ALDA 3SUTA 5K4XA 2HMCA 2OYLA 3KL3A 3AXMA 5DXXA 4QAWA 3K1DA 4PTDA 2R9RA 1QPQA 4NJJA 3GXDA 4CLMA 3L4WA 3A24A 4R33A 5FOOA 3U57A 3QMRA 1Z6KA 2BBFA 1ITQA 4H6RA 3V3WA 2BDQA 3M4HA 4YTQA 4FIQA 2PDUA 2QMJA 4AY8A 1EB3A 4WIWA 2YYTA 3WL0A 1KGXA 1MW3A 3UWVA 2PP3A 1HNYA 1Y5XA 3UPBA 1FP8A 3FJLA 4JIQA 1UA3A 1KBBA 1CGUA 1TMHA 4HSHA 2I9UA 4CU6A 4GJIA 3SCUA 1TJPA 2CFFA 1H11A 1R87A 3MJMA 1WXZA 2NLYA 2OLAA 1U33A 5D9MA 2ISVA 3OJGA 3I7QA 3TH6A 2PAJA 5A8PA 2BVTA 2QZRA 4UQ9A 4X9YA 2V8ZA 1K7FA 1XCFA 2WZTA 3EDDA 3NNTA 3AMKA 2DW6A 1G67A 5GVJA 5AHEA 4CGTA 4K6AA 3M0IA 4IXHA 2Y70A 2EQDA 3N2TA 5HWJA 5FEXA 3FSUA 1E5JA 1F5ZA 1K9TA 1I6NA 3RMJA 3LUTA 3W9ZA 1M1BA 4NI8A 1R9XA 1WBHA 4F3HA 4X61A 1S5NA 2GQ8A 1P0NA 3PWAA 3IGXA 5I24A 2X0YA 1I2OA 3WD2A 2J77A 1QI5A 3DI1A 4JL1A 3WNKA 3VD5A 4C7GA 2FHBA 4J5NA 4PUKA 4HU3A 4E8CA 4O10A 4XD6A 1AW1A 3SURA 4LFYA 3S1GA 3N11A 4FHAA 4BQ5A 2O55A 3NDZA 4Z08A 3SUUA 1UD6A 4GUHA 2FTWA 2CNCA 3QTGA 1JIBA 3TOYA 1UKQA 4O57A 1GQKA 1W5NA 1JYNA 4FS9A 1KTCA 3KCOA 4CEUC 1EC9A 4J3XA 3B4YA 2BY0A 2Y4SA 5AFDA 1HJQA 1G4SA 3NA8A 1HVQA 1W5PA 2XTKA 3VIJA 1DOSA 4RE2A 3CQIA 3IIZA 3WL1A 2ZIDA 5CLTA 3TR2A 4AD4A 5DT7A 5DCEA 1HJSA 3WBWA 4MWAA 2CCRA 2BY1A 1OFBA 5EYWA 4ZFCA 3KTXA 4QS6A 1XCXA 1F4AA 4OBRA 1GJPA 2FVMA 1GYNA 1IEQA 1VH7A 1TUFA 1V02A 3CS2A 2DP3A 4JTDA 4ORMA 5LYRA 1Z8AA 1CXKA 1PKMA 3BGGA 4R85A 2Z1SA 2Z1XA 3F7JA 1D3HA 1LOSA 2PLKA