2QJIA

M. jannaschii adh synthase complexed with dihydroxyacetone phosphate and glycerol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPIKGLIDIRKTVNDVAEGGANAVLLHKGIVRHGHRGYGKDVGLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELVAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVVGITRAVCKIVHENADVEEALKEIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid synthase, a catalyst in the archaeal pathway for the biosynthesis of aromatic amino acids.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
molecule keywords Putative aldolase MJ0400
total genus 91
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.2.1.10: 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qjiA00
2DZWA 1VLIA 1WXJA 1VYPX 4KFPA 3O63A 4LS2A 1G67A 3HPZA 1FCQA 4MJZA 4JX6A 3PC0A 4FIRA 2Q3OA 3KRSA 4UTKA 1EP1A 1B3OA 5BW6A 3NQ7A 2QJHA 3NPUA 4NZJA 3LCWA 4UFKA 2PCQA 5D2TA 1ZAJA 1FXQA 5D02A 1OX4B 4IMFA 4IX0A 1PV8A 3MHGA 4RZ4A 1VPXA 5H2ZA 3HG3A 4ICNA 3LHZA 1KFEA 3M9YA 1KLYA 3GIYA 2JGYA 2CW6A 3W7RA 1J5TA 2QCLA 1TPC1 3MP3A 3G0SA 1DJNA 1PCKA 1YXCA 2BZNA 2EAWA 2VFHA 2ZZ1A 2NUWA 3TV8A 4IJBA 5L6UA 1DKWA 1OK4A 1XUUA 5D2VA 5L9FA 5AHNA 3CWNA 3W07A 1JRCA 4QSHA 1LBLA 3W23A 3S1VA 2DZVA 5LSMA 4LNYA 5E1QA 3EWZA 3NVTA 4GUJA 3UWYA 4QAIA 2A6LA 2Z2UA 3F4WA 1H5YA 2ZDRA 1HFBA 4H4IA 4KFOA 5CZTA 3TC7A 3PAJA 3GDKA 1OFPA 1SO5A 3ATZA 4DF1A 4K39A 3UY7A 3S1WA 3BV4A 4H6KA 5J5RA 3UWZA 5K7JA 3MBDA 3A5FA 4EF9A 4UXDA 5F4XA 3PG9A 1KM6A 1JR1A 3TW6A 1ML1A 3Q58A 2YXGA 4JTLA 4K6AA 2XN2A 3PUOA 3N19B 4S2CA 2R94A 1YTDA 3ABOA 3GVGA 5D05A 1H61A 3S42A 2V81A 3D0CA 2YW4A 4OV4A 4OHQA 4JYFA 1G69A 4NJIA 5TBOA 1P1XA 2CLOA 3FJ6A 3S5ZA 3T78A 3QM3A 4NZFA 1F5ZA 1UB3A 3GAKA 4C1KA 2QJIA 2A7NA 2E1DA 3W83A 2NZLA 2VFFA 2A21A 4Q4KA 3LXCA 2YYUA 2V9DA 1TPUA 2B7NA 2B7OA 4HSNA 3TXVA 4JY9A 4GNJA 2X1UA 3WJZA 3GDMA 3O6CA 3TC6A 2GVJA 5KZDA 3HB9A 4HIBA 3C3NA 3NL3A 1VYSX 3L21A 1FDYA 4HN4A 3W1TA 4DELA 3GR7A 3QZEA 4AHPA 2DZUA 3QQ0A 3UYCA 4TX9A 1S5VA 1ZHAA 3LBCA 1HO4A 1W3NA 1KFJA 3UWQA 1W31A 3EXSA 3B05A 3NOEA 4PODA 5FESA 3P8IA 4WXYA 5BRBA 1VHCA 3WK3A 2DJLA 2A6NA 3ELFA 4MZ8A 2X1SA 3WJYA 1MXSA 3TCEA 5D37A 3LERA 2X1TA 1QOPA 2ISVA 5LNWA 1CW2A 3HGJA 3W1MA 1YXYA 3TXZA 1G4SA 3CU2A 3CIXA 4U4MA 2QCCA 1H7NA 3FIGA 1OX4A 5TQLA 1NFBA 1N55A 3MHFA 1XUZA 4FO4A 3EKZA 1Q6RA 3N14A 2YR1A 1OK6A 2UV8G 3UY8A 3G8EA 3S1UA 5U7SA 3MI6A 5G2WA 5F4WA 4K36A 1K7XA 3T44A 2WNNA 3I6RA 5F4SA 4IMCA 4JNMA 5EL1A 1SW0A 3W75A 4Q33A 3HOJA 3M5XA 2I9EA 1SZGA 3CEPA 2H90A 3EX1A 4JTFA 1F05A 2VEMA 1W8SA 3W7MA 5GVJA 1KTNA 4N9BA 5C5YA 3CT7A 4NJJA 4K37A 4NQ1A 2QAPA 4DO4A 3PB0A 5CPOA 3W2JA 1QDSA 1XDMA 4UMCA 4Y6GA 3DH7A 4JTEA 3BARA 5D2XA 2ZTKA 4N6EA 2A7RA 5D09A 4ZQRA 3UWWA 4AWUA 1WV2A 1NAL1 4ZQPA 1VH7A 5AHIA 2J27A 4XUGA 4NU7A 4DF0A 3HJZA 2EGZA 3QMSA 1DBTA 3RFAA 1LOLA 3E96A 3SIZA 1GJPA 3GX9A 3IGXA 1LCOA 5K4XA 4IQLA 2FPTA 3L2IA 1FY6A 1YTKA 4JX4A 1NF7A 2RDUA 3O05A 2QUUA 1AL8A 3TX9A 1I2QA 2ZRYA 1DVJA 3TFCA 2E77A 3O06A 3FFSA 1EEPA 1SFJA 5HWNA 1ZAIA 4Y96A 2RH9A 4MOZA 4G1KA 1DOSA 2E6YA 4IPJA 3N9RA 5FF3A 4AF0B 3LHYA 3G8RA 1SO3A 1TTJA 3UZ5A 4LWWA 4EF8A 3TMLA 1KLZA 3CM4A 2F84A 2J9XA 4LRTA 3HO8A 4UUIA 4Z1CA 3BG5A 2ATMA 3QQ1A 1TRDA 2DZTA 1OG0A 1QPRA 4MUZA 4N6FA 4MIMA 1QPQA 3IIVA 1F2JA 1K8ZA 4IOTA 2J24A 4ZQOA 3CHVA 1EP3A 1P5BA 5I3GA 3KXQA 3UPWA 2NX3A 2Q3RA 4QM1A 1KFLA 2QUTA 3DHFA 2A5HA 1H7OA 1YXDA 1L2UA 4WZHA 1YYAA 3L9CA 3NGJA 3W1AA 1MSSA 3LI0A 3QEZA 3GZ3A 3CC1A 4JTTA 4UMBA 1LRQA 3HBLA 3UXDA 1QAPA 3R89A 4FNQA 1RR2A 1FXPA 1WA3A 4E38A 1KBIA 3HF3A 3TR2A 3HGSA 4RR4A 1UASA 4AWTA 3OA3A 1WDWA 3NQCA 3OEXA 3EX2A 1ONRA 1GPWA 1XDLA 3NR0A 3C2RA 4MKNA 5F2IA 1K7FA 3LCFA 5MHBA 2CLKA 4QISA 2Y88A 3IIPA 2VFEA 3DI1A 3TSDA 5FEXA 3A9IA 3GR8A 4R53A 3DU0A 5BMWA 2GOUA 3GK0A 3P81A 2E5BA 3W76A 3R8RA 3TIMA 1RQBA 2GVGA 3HGOA 2OZ0A 1ZFJA 4AF0A 1LBFA 2VFIA 2VELA 3MO7A 3W2MA 1R46A 3LXBA 4PL1A 3A22A 1W5QA 3W9ZA 1XL9A 2DZXA 3RLVA 3VE9A 1HUVA 3C8FA 3W1NA 1W5OA 2E68A 3PG8A 1GVQA 3P67A 2YFOA 3MP4A 5CZSA 4DBEA 5EYWA 2DZSA 3W7OA 3KVLA 4HNUA 3SSJA 3LCHA 2A1YA 2NX9A 3LRKA 2BLEA 1KTBA 1FCBA 2OJPA 2QCDB 3G22A 2TMDA 1NSJA 3LTSA 2BSLA 4Z1BA 1XBXA 2H8ZA 3W1PA 4AEOA 3JRKA 4MFEA 3UWUA 4BWLC 5AYYA 1B9BA 1G7UA 2C0AA 1FWSA 1KA9F 4QJ1A 5K9XA 1H7WA 3MW7A 2TSYA 1SZNA 5LNVA 3C0JA 4UTUA 5AC7A 4JYEA 1QR7A 2QCFA 3M16A 1JCXA 2GPTA 5CGQA 3TQVA 1S3HA 1TIMA 3SY5A 1WX0A 4RJEA 1LZOA 4UTLA 3OIXA 1YPIA 3QSRA 1ADOA 1I2PA 4U28A 4UR8A 3LCXA 3MI2A 4LVGA 4TU1A 3EX4A 3P80A 2Y7DA 2QDHA 5EPDA 1KM5A 2E6FA 2QCGA 5I3KA 1FWTA 2J9ZA 2VC6A 5HR7A 1R30A 3VCRA 3IGUA 5D30A 2ZA1A 3VNDA 3BLFA 3NQ6A 3W7EA 4R33A 5U4NA 2DORA 5FI8A 4YMZA 3NA8A 1G6CA 4IX2A 3TUUA 3CEUA 1EIXA 3SR7A 4OV9A 1O60A 3DAQA 3ZR4A 1JCNA 1B4EA 4I7VA 3R12A 4O0ZA 3TROA 3WJXA 4IMDA 1SR9A 5A5WA 4JEQA 2JK2A 3SI9A 3FLUA 1EA0A 1TPB1 2VFDA 3GNNA 3O8AA 5LKYA 4NJKA 2Y6ZA 5G5IA 4GUIA 4PH6A 3LV5A 1KFKA 1MO0A 4M5PA 1SSDA 2GVLA 1IF2A 1FUYA 4K7VA 1PL9A 3T55A 1CX9A 4LU0A 2GJLA 5KITA 1P0KA 4GRSA 1A5SA 1T99A 3QSTA 4FF7A 1OFQA 1ME7A 2YFNA 1LOQA 4ADTA 2CU0A 2JKEA 1LLWA 3LV6A 3M1ZA 3NL5A 2BXVA 5BOOA 2YYTA 5HINA 1WOBA 3A24A 1OHLA 2NXHA 4QNWA 4FB7A 2XN1A 1FCVA 2BX7A 4WY0F 1TRIA 2JGQA 4UTHA 2HS8A 2NV1A 1Q45A 5CPLA 1BKSA 5EBUA 1JCMP 1TPVA 4CCCA 1RQHA 4EWND 4JXCA 1T0OA 1SO4A 1B4KA 2EF9A 3HGRA 3N2XA 4AWSA 3SECA 3W2NA 5LGZA 2D73A 5AOUA 5CG7A 3P82A 4JGDA 2RKXA 4GE8A 5HUOA 3W1UA 1K3UA 2OMAA 2WNZA 1OYCA 1LOSA 3LRLA 4FNSA 4JR5A 2G97A 2CLIA 2WJZA 1TPDA 2CLFA 2QCNA 3UPBA 3DFQA 2O7QA 2R8WA 3DHDA 1VCFA 3SW6A 3T4CA 3NQ2A 5IBXC 3UQNA 1MZHA 2Y7FA 2NUYA 3PUDA 3RLUA 4EIVA 1TSIA 5DY3A 1GG0A 1KV5A 1SZFA 5G2IA 1VZWA 3FYPA 1PE1A 1PHWA 1OFDA 5T26A 3SZ8A 4ZMGA 3L0GA 5DCEA 4OQVA 1QO5A 3NM3A 3M5VA 4FNTA 3ABSA 3WK1A 3C2OA 5TIMA 2Y89A 1RV8A 5AHMA 1QFEA 3PBUA 2V8ZA 2ABAA 3W7CA 1SW3A 4XTDA 2OT0A 1KW1A 3B4UA 3CLMA 3C2VA 3OG3A 1NF0A 2QEZA 4O1AA 1SUXA 4DPQA 4Q32A 2FPVA 1TJPA 3QYQA 3W70A 3G1AA 3B0UX 3M44A 4PA8A 3C61A 3QFEA 1JUBA 5D33A 1GEQA 2WPBA 1W5PA 3NM1A 2ZRXA 4MYAA 3G1DA 5FF7A 5IM51 1XBYA 1UBSA 3SGUA 2HS6A 3WFAA 2C3ZA 3P5YA 3LHTA 8TIMA 2BWGA 1S5WA 5G4WA 2ZBTA 4N9CA 4ZQMA 1KM4A 2EPHA 3BW3A 3W1LA 1ICPA 1FDJA 1OFAA 3KRZA 3F4NA 3WJWA 3ZFHA 3PM6A 4MPQA 4XBKA 4I9AA 1Z44A 3QMTA 4P61A 5LHEA 1OFEA 2GJNA 1SZEA 3PVFA 4M19A 4OE7A 2ZYFA 1BWKA 3W7PA 3N9SA 2WSYA 4XTIA 2Y70A 4O1CA 3QH2A 5HJLA 5HWMA 3O16A 4PL2A 1R47A 4H3DA 4LVBA 1GT8A 3S9YA 5CSSA 1KFCA 4PTNA 3NQMA 3W2KA 4JTJA 1DORA 4A21A 2VKZG 2C16A 4LC8A 2ZTJA 3FS2A 1GZGA 1OJXA 2QF7A 3UNDA 1G4TA 3CIWA 1XKYA 3O15A 1EWEA 1THFD 3S5NA 4MLJA 2G5WA 1LLZA 3PF3A 4LV4A 2X1RA 1ICQA 2AQWA 1AK5A 4O1BA 4I7WA 3MMTA 4OBTA 1WBHA 4XBSA 1EPXA 3IIXA 4HNTA 5KZEA 3DENA 5F2LA 1VQTA 2W0UA 3OVPA 4JY8A 4NVTA 5AFDA 4HKPA 4WX2A 1ZNNA 5FEZA 2ZCGA 4CNOA 1OFRA 4CQ9A 5DCBA 3HPSA 3W73A 1OFOA 1TQXA 4TMBA 1GG1A 1RPXA 3DI0A 2NLIA 3BG9A 3MJYA 3DGRA 4LC6A 1VLWA 1WYIA 4O12A 3E12A 3DBPA 1GTEA 2NUXA 2V2DA 4D2JA 4R7JA 4DBDA 3LBMA 2W6RA 2CLLA 1A53A 4E2BA 4O54A 5E0KA 4E0CA 5DY2A 1OX6A 2CZEA 2QR6A 2ZFAA 1A5BA 3L5LA 1TB3A 3W6YA 2DZPA 3H53A 1JJKA 5LHFA 1WOAA 2R91A 1TV8A 2Q8LA 3RNDA 3LHWA 1YDNA 4N02A 3BVJA 2ZRWA 3HIJA 3U2OA 1C9DA 4NJHA 4RKAA 4NNAA 3G1FA 3TH6A 3MYPA 7TIMA 3AJXA 1AW2A 2JBMA 1O5KA 1ZJIA 2J9YA 2NXGA 1H1ZA 2QAFA 1JUKA 4WXZA 2C18A 1MEIA 3KVMA 3B0PA 3TSBA 4M7SA 3R2GA 3P62A 3R13A 2CWNA 1L6SA 3GLCA 1S5TA 2Y7GA 3V75A 4N2YA 3NQFA 1GVOA 1IXOA 4M7TA 5G1TA 3G3DA 1K02A 1ZALA 4O18A 3EWUA 3WK0A 2VEPA 1H50A 1QCWA 3P7YA 4XWUA 4TR9A 5DBUA 1VGAA 4TIMA 3PY2A 4BI6A 2X16A 2Y63A 5AHEA 3BW4A 1GVRA 4HHPA 1JQXA 1JULA 2A2IA 3PSVA 3KAOA 3W3OA 4MYXA 1K8XA 2YZRA 1KV8A 1H60A 1Y0EA 4OU1A 4UFIA 1EX5A 2B0MA 4HPXA 3P8JA 5KTLA 2QCEA 3MI3A 3TK7A 3HG4A 2ZRUA 1F7BA 3P60A 4WJEA 4N9DA 1G4PA 1NEYA 2C19A 3GDRA 3Q2DA 1UUOA 1W3TA 1SPQA 2GQAA 4HNVA 5I3JA 4MLRA 4Z0SA 4LT9A 3TAOA 1UCWA 2FB2A 5HMSA 3A21A 1FBAA 4M6QA 3GAYA 1VCVA 3HQ1A 1DJQA 3G3MA 4Z1AA 5K3VA 2Y85A 5AYXA 3PB2A 3CQ0A 1Q6QA 4E2DA 1TPFA 2YCEA 3S0CA 4GC4A 2I1OA 2HMCA 3NO5A 5AHLA 3ZS4A 5F1VA 3QW3A 1M6JA 2DP3A 1H1YA 3DFOA 1QWGA 1G4EA 5I3HA 5I3FA 3HG2A 3NL2A 4YLWA 4YWIA 2Y62A 1BEUA 3TE9A 3M5ZA 1OF8A 3W2UA 4WY0A 3CWOX 2RFGA 4QIUA 4LOCA 3S8HA 1KM0A 3UD6A 5AC8A 4YL2A 3TKFA 1R2TA 4EOUA 5F2MA 3PBWA 3DFTA 4FNRA 4IXXA 4RX0A 4BFAA 3L67A 1YTEA 1JCJA 1TJRA 3GNDA 1LTDA 2QJGA 2VENA 4UTMA 1F6KA 5KMYA 2DU2A 5DN1A 4NT0A 5FF4A 3OHIA 4UTTA 3PBVA 2LLEA 3VKJA 3DZ1A 1C29A 3IEBA 1OX5A 1ICSA 2B7PA 1V5XA 4JX5A 3S5OA 4FHAA 1P0NA 3CB8A 3ATYA 3W2LA 4S1FA 4YXGA 3EXTA 2CLEA 1LRTA 2QKFA 1DQXA 2FB3A 3TDFA 1F73A 5BMXA 3KOFA 4UFLA 3F1QA 1VC4A 3DKJA 3L65A 1GYNA 3EXRA 2CZFA 4NXSA 1DV7A 5EY5A 1LDCA 3E02A 4NNCA 3M5YA 3NDOA 1PHQA 1XFBA 4ORMA 3LB0A 4QQ3A 3LRMA 3LLFA 3GDLA 4KFNA 3NXFA 4WD0A 1F76A 3LTYA 2C14A 1HO1A 2X2GA 3W74A 4UTTC 4IWWA 4JICA 3EX3A 4P2VA 1SSGA 2FJKA 3K30A 1Z42A 2IQTA 1T96A 1TV5A 3A5VA 3RF9A 1XBVA 4FIQA 5FF2A 4M6PA 1MEWA 3WJSA 3PULA 3EWYA 1P4CA 3B04A 1ZENA 3NQVA 2GQ8A 3IGSA 3TJLA 4ALDA 3C4UA 3FJLA 5C6MA 5HULA 3M43A 3BPWA 3L66A 4N4QA 5CZJA 2Y61A 4NXKA 4TO8A 1TQJA 3H55A 4O4WA 2WOQA 3N34A 3NL6A 4FXSA 4JYDA 2P0OA 2ZQ0A 1I2RA 1VYRA 2ZZ3A 4JTSA 1IIHA 4WOQA 2C1HA 3GKAA 1J2WA 1N7KA 3B03A 3OVRA 3W7GA 1D3GA 1W56A 2RHGA 4K7YA 3C52A 2PC4A 2CLHA 3NPVA 1OYAA 3STEA 1VCGA 3G1HA 2FFCA 2Z6JA 2NWRA 1EWDA 4UC5A 2ZRZA 5HNRA 3PBYA 3SFKA 1X1ZA 4JDYA 1RZMA 4GWEA 4LV9A 5CPNA 3INPA 4HT3A 1ZAHA 1YDVA 3ZWSA 1QMLA 4FX8A 5KSWA 3WK2A 3BLEA 2QDGA 3IVTA 1IXQA 4RLIA 3GDTA 3B06A 2Y7EA 3N3MA 2CZDA 1XCFA 3QMRA 3LX9A 1H62A 1Q6OA 2JKPA 3STGA 3E0IA 3NPXA 4N4PA 2PURA 2BTMA 1SO6A 5D32A 1EUNA 3HG5A 3A23A 3MP5A 3V1PA 4Y8FA 1GYLA 3W84A 3NQAA 3L0NA 5F2GA 3OBKA 1O4UA 4O0KA 3NPWA 4W9TA 3GB6A 3G0XA 1VHNA 1TTIA 4LUIA 3TAKA 1TMHA 3THQA 3BO9A 3W7QA 2E09A 3MHUA 4CNNA 2Z0IA 5G1YA 1K03A 4X9SA 4CNPA 1H63A 1ME9A 4O19A 2P10A 3QRHA 1JQVA 2V2CA 4Z0JA 1ZY9A 1H51A 5G4EA 1TO3A 4ADSA 1OYBA 2G96A 1PS9A 3E49A 4ONVA 5CPMA 3YPIA 4LVFA 5EMUA 2H8XA 1R2SA 3FYOA 2ATSA 1FWNA 1Z41A 3EKLA 2Z6IA 1IXNA 3KVKA 3I68A 3TMQA 2H6RA 5H91A 2HSAA 2E5DA 2VEIA 1F6PA 5LNSA 1HL2A 3W7DA 1VR6A 1W5NA 1Q3NA 3T40A 3G1VA 3W7LA 4O1DA 3LTPA 1IGSA 3L5AA 3F03K 1TV7A 3I7SA 1RVGA 4AHOA 1U83A 4A2RA 2XFWA 2WSQA 3TU9A 2RDWA 4UTJA 3GXPA 4BF9A 2X30A 3NG3A 3QJAA 4O15A 3W87A 4ZQNA 1KM3A 3W22A 2WSRA 5KZMA 3GXTA 1WQ5A 1TREA 1YLVA 5CZ0A 3L0KA 5C2XA 2YSWA 2J6XA 4POCA 2PRLA 1GOXA 1FWWA 1I2NA 6ALDA 3C6CA 2XN0A 5DELA 1FX6A 4A22A 2JKAA 1O5XA 2FDSA 3B8DA 4QNEA 1CI1A 3I65A 4IGHA 2E6AA 5SWUA 3E9AA 2A7PA 2ISWA 1D3HA 4GUHA 1KTCA 3GKFA 1AG1O 1K7EA 4N9EA 1OABA 1TPH1 4NNBA 1TTPA 3TQ0A 3BK0A 4L4LA 3BW2A 2RDTA 5K2ZA 3SJ3A 4X3ZA 3TQKA 2CLMA 3B0VC 1GVFA 1AW5A 4KWVA 3W72A 3ZWTA 5FEPA 3C2FA 4GJ1A 5G2HA 4UMAA 1RQEA 3G1SA 1UUMA 1H7XA 4UTWA 4BR1A 3FOKA 2V0TA 3T7VA 5AC6A 1AL7A 2GUUA 3BGJA 1EB3A 1QPNA 3P5ZA 1PIIA 1FWRA 4AVFA 3BG3A 2V5LA 3G0UA 4UTWC 5D2YA 1O95A 2EKCA 5ABTA 3VE7A 1GQNA 4GFSA 1W1ZA 2VOMA 4UFJA 1W3IA 3LGEA 3NNTA 3PWAA 4LTSA 2ZZ6A 3N73A 3IVUA 1L9WA 1OFBA 5LNUA 4OGZA 2NWSA 5LGXA 4JN6A 4DPPA 1H7RA 1WAUA 4O8RA 1QNVA 4XKYB 5FF0A 5HUPA 3G24A 5K4ZA 2DJXA 3PSWA 4I7UA 4K8HA 3MUXA 4EVZA 4PCFA 4O57A 2A0NA 2ZRVA 3O6YX 1GTHA 5D03A 5KINA 4PEKA 1K8YA 4O4VA 3EWWA 3NQ8A 3W86A 3P61A 4NX0A 4RK8A 3KFTA 1KM2A 1EP2A 1YADA 2E6DA 3TSMA 2V82A 4FXRA 4K8EA 3KHJA 2QUVA 4O50A 3NEVA 5K9DA 2C15A 4WUIA 3P84A 1VS1A 3L68A 3W85A 5DCDA 3KVJA 3UXAA 3MWAA 4ORIA 4ZZ9A 1LBMA 4XKYA 3U6WA 3G18A 1KFBA 5D2WA 2I14A 2OT1A 3ANYA 4RXFA 2YW3A 3QW4B 1DHPA 1A5AA 1Q6LA 3EX6A 1BTMA 3DKLA 1O94A 4JTGA 1JCLA 4ML9A 2TPSA 3TFXA 4TMCA 3RMJA 1QPOA 5DLCA 4FX7A 3PUEA 4XZ9A 3O07A 1JVNA 1JRBA 3SGZA 1TTQA 5I3IA 4OWGA 4CQAA 3LDVA 3QF0A 1I2OA 2CZ5A 4A2SA 3DFPA 4DQWA 4O11A 3KX6A 4AH7A 4MY1A 1M5WA 4GUGA 2VEKA 3STCA 3LLDA 4Y9AA 4O16A 5C55A 2FIQA 3EB2A 4JDBA 3W7KA 3VI2A 2TYSA 3M7WA 3IIZA 3GXNA 3PS7A 4JTHA 3TW7A 3I7RA 1HG3A 4LUJA 1RD5A 4FNUA 4O14A 4AB4A 5IBXA 2C13A 4ZQCA 4GUFA 1XI3A 2WQPA 1TPEA 1ZCOA 2GQ9A 2WNQA 1JCYA 1V7YA 4L4MA 2QCHA 3ABRA 5BNKA 2PRHA 1YPFA 5D38A 3NQDA 4UCGA 5HWJA 1D9EA 4KKXA 4MZ1A 1W37A 1TPWA 3CTLA 4CCDA 1DL3A 4B5NA 3Q37A 3LXAA 1X1OA 1R2RA 4JD4A 1PCWA 4DO6A 3FKRA 1IXPA 5A8GA 4X2RA 1ME8A 2H3BA 4YCPA 4JIQA 2TRSA 1MEHA 4JIPA 3KRUA 4R34A 3S1XA 2NV2A 3HMJG 4HSOA 2EHHA 2ZZ7A 4LRSA 3M47A 3L5MA 5HR6A 2VXNA 4RXGA 4UNLA 2AGKA 1YDOA 1M7PA 1KM1A 3HPXA 3FA5A 3VFLA 1X8FA 2A85A 2CFFA 5J5DA 5DXXA 4DXVA 4O52A 4JTUA 1FDZA 5CSRA 1PVNA 3CPRA 5FEWA 4LVAA 2R14A 4YCOA 1GWJA 3OVQA 2KZHA 4DO5A 3LCIA 2W79A 4C1LA 2ZA2A 4O53A 1QOQA 1U5JA 1I4NA 5DXYA 4KWWA 2WKJA 3NZ1A 2ISSA 1XXXA 4K38A 3S5YA 4BI7A 2WV8A 2YPIA 2FLIA 4PFMA 1Z48A 1T8XA 4WY0B 5C54A 4A3UA 3THAA 2ZZ4A 2B7QA 2OX1A 2PRMA 1B57A 1FQ0A 5AHFA 2NX1A 1A5CA 1JUEA 4AMAA 3W7HA 1VRDA 4CQ8A 3W1RA 3JR2A 4O28A 3EEGA 2Q8ZA 1EUAA 3DFNA 2ZZ2A 3RU6A 5D04C 2A4AA 2C6QA 3LM7A 1LYXA 4ZVJA 4MJMA 3PR2A 4UIOA 1C8VA 5HQEA 4JTKA 3USBA 4IPIA 3G1YA 3G1XA 3EWBX 4WQ6A 4FNPA 4LS1A 1A50A 3UWVA 1G7VA 3EWXA 3U8GA 1AMKA 4AXKA 3AO0A 4Z1DA 1J4EA 1FCUA 4M6VA 4LY8A 1X7FA 3MBFA 3UZJA 3Q94A 3W88A 4JS3A 2VFGA 2F7FA 3IIOA 3MYOA 4MVAA 1N8FA 1M7OA 3FKKA 4LW7A 4LVDA 1F74A 2H3DA 4X22A 3STFA 1BWLA 1KBJA 4HNNA 5CKSA 2J88A 4GXMA 3DFSA 5LNRA 3LHUA 5E93A 2HTMA 4UTIA 3TA6A 3LI1A 4PC8A 4IUOA 2FPYA 3IVSA 3LCGA 3W1QA 3W7NA 5LZLA 5AN7A 5AYZA 4WOZA 3N2MA 2AAMA 3BGGA 1NVMA 1LORA 2V2HA 1UJPA 4MY8A 2PE4A 3LOTA 4O17A 4XQ6A 4RCXA 3I7QA 3W71A 4DF2A 1XC4A 1W5MA 1TYGA 3IV3A 4JTIA 5AB3A 4O10A 4CLMA 1LRNA 2B4GA 1I45A 4MFDA 1OF6A 4MY9A 2P1FA 3GYEA 1QO2A 3TJXA 4BWLA 1VJIA 1W0MA 1XM3A 2Z1BA 3C2EA 4OT7A 4DEFA 1SFLA 2V30A 2ZZ5A 3LCLA 3M0ZA 2NXIA 4LS0A 3ABQA 2V5BA 5EA9A 4IXHA 1H7PA 2ALDA 1X6UA 2QCMA 5F1UA 3IRDA 3NQEA 4UR7A 1IIGA 2O7SA 1TCDA 1SQ7A 3FEMA 3QC3A 3QPZA 1DQWA 4FEZA 3RK8A 3W1XA 5K9CA 4NJGA 4BK9A 1E51A 1SU5A 2YGYA 1L6WA 1SW7A 4RV8A 4HPJA 3O6DA 4UFHA 3TNOA 1LP6A 4NUWA 2WO5A 1W54A 2G95A 6TIMA 4RZ5A 5DBTA 1HTIA 2YDAA 3BLIA 4RZ6A 4A29A 3NQGA 4Z08A 4NX5A 4GBUA 2ABBA 3M41A 1L6YA 4UNKA 3W7IA 2OCZA 1OVDA 1LROA 1I8JA 1LM1A 3R5EA 4QITA 4Y90A 1XBZA 3NZRA 3M6YA 4IMEA 4IMGA 3O1NA 3H54A 4FX6M 4ADUA 4UFMA 2E5CA 3P74A 1ALDA 2FTPA 4S2BA 3LHVA 4MZYA 2ZA3A 3JS3A 4O13A 3C56A 4AHQA 4BI5A 4J9JA 2YX0A 1WBJA 5EKYA 4CCEA 3S6DA 1AW1A 3W7JA 3NAVA 2QCDA 3NYZA 4AAJA 4ZL1A 2FQIA 3DXIA 3QPYA 1GVSA
chains in the Genus database with same CATH superfamily
1IT7A 4KFPA 1EO5A 1FCQA 1CDGA 4RDYA 3PC0A 3R0DA 2Q3OA 4UTKA 1B3OA 2QJHA 4NZJA 5D2TA 4RW3A 1ZAJA 3T42A 5D02A 4GK8A 4RZ4A 2ONEA 2VCAA 1ZJAA 1WZAA 1Z89A 2D2OA 3CJPA 2ZC8A 3C0SA 2QCLA 3WO8A 3ZIZA 1PCKA 2BZNA 2EAWA 2NUWA 5L6UA 1DKWA 3QYSA 3NOYA 4J3TA 5D2VA 3EMQA 5AHNA 3UA4A 1D7FA 1UQYA 2FVKA 3W23A 2DZVA 4GUJA 3UWYA 1XLMA 1H5YA 3UCDA 2ZDRA 4H41A 4AD1A 1RJPA 1D2KA 2PTZA 4KFOA 3FA4A 4PTDA 3GDKA 2QF8A 3GZAA 3UY7A 3S1WA 4H6KA 1SGJA 1XIHA 4GCXA 3A5FA 2UBPC 3KP0A 5F4XA 2E28A 4W7WA 3WD1A 4YIWA 4M3PA 1TR9A 3B9DA 1RD6A 3GD6A 3QV9A 5F7UA 1UKPA 3GNPA 3N19B 1GCYA 4V1YA 4S2CA 1GK8A 1NOUA 1YTDA 3ABOA 3GXFA 2Z29A 3AWNA 1JFXA 1BQCA 3CBWA 3D0CA 1GQIA 4LCSA 5LXEA 2XVPA 4ZEPA 1BXCA 1G69A 1O68A 4IFOA 3E1F1 5TBOA 4KCWA 1Q85A 5A95A 1LL7A 3QY6A 2QJIA 1RLCL 3LSBA 3VD7A 2VFFA 4QSFA 2ZX7A 1FWJC 5EMJA 2YYUA 4US5A 4JHZA 3CXOA 2B7NA 1BSLA 3GDMA 5GQBA 1Y65A 4YTSA 2I5GA 3HB9A 2NQZA 1KGWA 3ITGA 1LQAA 3L21A 3NSXA 2GVYA 4S3FA 3GW0A 3POCA 5E70A 1V77A 3GR7A 4Z2IA 3PJXA 2PP1A 4H6EA 4PYSA 3QQ0A 1KFJA 1UMYA 1W31A 3B05A 5FESA 1UZHA 1E6XM 4ACZB 4UB9A 3WJYA 1MXSA 3TCEA 4JCLA 2YCLA 1CW2A 2HISA 4IL0A 2ZC1A 1YXYA 4L6OA 3CL8A 3LSCA 3MV01 2ZADA 4U4MA 3ZMRA 1XIGA 6CGTA 1EJ7L 3FIGA 3JVAA 1P43A 4Q4QA 3OBAA 3WMBA 5A2CA 3WNMA 1XUZA 3OTRA 3EKZA 2I7GA 2YR1A 2NW0A 1OK6A 3PNUA 3UY8A 2P5NA 3CMGA 3S1UA 3C86A 2ZE0A 4J3XA 5G2WA 4K36A 2QNEA 5LA0A 1V03A 2Z28A 2WNNA 3I6RA 3EDKA 3UG8A 4IF2A 5EL1A 3W75A 3QFWA 3CEPA 4JTFA 1L6GA 1GHSA 4IGNA 1KTNA 3KBNA 4Q7IA 4RL3A 2V3GA 4K37A 1VJSA 4J3VA 1F8IA 1RK6A 1XDMA 2BBFA 5D9NA 1CLKA 5I6SA 1K6AA 5CGMA 2A7RA 2WANA 1B3VA 4AWUA 1WV2A 1NAL1 1V79A 2BG5A 1VH7A 3KP1A 4AC1X 1XYFA 4DF0A 4M29A 2OKTA 3KCJA 1DBTA 2PP3A 4AVOA 1GJPA 2YB4A 3BCJA 2XH7A 5E9AA 1F4AA 2FPTA 1FY6A 1YTKA 3GS6A 1OADA 3CWHA 1NF7A 3QGVA 2RDUA 2WVTA 4HU4A 2QUUA 1OB0A 4AEFA 2ZRYA 1DVJA 4AZ6A 4R5EA 1RUSA 1S46A 3FFSA 3N6HA 1E6SM 1OGBA 1RCOB 2RH9A 3N9RA 3B9AA 4CVUA 1JD9A 1TWIA 1JXKA 2F84A 4LRTA 3SN4A 4Z1CA 3BG5A 2ATMA 1OG0A 1CGTA 1EQPA 4MIMA 1QPQA 6XIAA 3IIVA 1K8ZA 1H0GA 2OTDA 2J24A 3CHVA 3RCYA 3UPWA 2NX3A 1KFLA 1OIMA 2Z1KA 5EMMA 1PKLA 1IWAA 1CGXA 3COTA 1YYAA 3L9CA 4JPGA 3F2DA 1OT1A 2XIMA 4JTTA 3CC1A 4UMBA 4G56A 4US6A 1LRQA 5IHSA 1XLHA 3UXDA 4FSAA 2PBGA 4F0SA 1RR2A 2VNCA 1O5RA 4ATLA 4E38A 3UT0A 4JFSA 3OA3A 3NQCA 3EX2A 1F8MA 1FWIC 5F2IA 2CLKA 4EAYA 2Y88A 1I9CB 5HJXA 3NCOA 2VGBA 4L7ZA 1EL3A 2GOUA 3WEMA 1HKVA 1MDLA 4NHVA 4C6OA 5FACA 3TIMA 2GVGA 3HGOA 2OZ0A 4J3SA 1LBFA 3SQSA 2VELA 1TE1A 3MO7A 1R46A 4RDVA 4PL1A 3A22A 4WVXA 1J6OA 2DZXA 3FXYA 1X6NA 4J7RA 3C8FA 1GOKA 3W1NA 3ALGA 4WSHA 2E68A 1RY0A 3HV9A 1Y5WA 3BAYA 3MP4A 4DBEA 2WZIA 2DZSA 1QNQA 4BQ4A 3SSJA 1NIUA 3V18A 2V69A 1V6TA 2BLEA 4ENLA 1QT1A 3MO4A 2WVSA 4PMJA 3NSMA 3G6LA 3LTSA 4DBSA 3IK4A 3W1PA 4AEOA 5E09A 4CU6A 1GQLA 3D47A 2C0AA 1KA9F 1ITQA 4QJ5B 1A3WA 1TUFA 1Z8AA 4ZO8A 1GVYA 1SZNA 4MTVA 3EA1A 5FAGA 4DYEA 3M16A 1GEHA 3SY5A 4F8XA 3G1RA 1YPIA 1I2PA 3L4XA 3PZGA 3S1GA 3W29A 3DIPA 3LCXA 4LVGA 2XDFA 4TU1A 2GLKA 2Y7DA 3L23A 2BGSA 5A6KA 2E6FA 5ABGA 1BG9A 2X0SA 3VCRA 3P2VA 4RPQA 4PMVA 2VM8A 2FJUB 3KUMA 2GSEA 5C9XA 5CC5A 3H7VA 1XCXA 3ZJKA 3NA8A 1G6CA 2GDQA 4I6KA 3FNDA 1EIXA 3SR7A 1RBAA 4H2CA 4I7VA 4YHGA 2PWDA 4KCVA 4GZEA 4UR9A 5FL0A 3TROA 1IEWA 4JEQA 3SI9A 3CAWA 2V3DA 1X6LA 3O8AA 5LKYA 5IXEA 4WF7A 4PH6A 4M5PA 1SSDA 1IF2A 4K7VA 4V2XA 2OLAA 4XB3A 3BCFA 4LU0A 5KITA 4GRSA 3BMWA 1A5SA 1T99A 2WZTA 4FF7A 4RE2A 4Q6XA 4O0QA 1ONWA 1A0CA 2CU0A 2XVKA 4HD5A 6REQB 3SRKA 3EMZA 3NL5A 2WVUA 3ITCA 1UA7A 1LWJA 1UR3M 2WC3A 3M0JA 4P8UA 5M1TA 3UZWA 1OHLA 2NXHA 4QNWA 4FB7A 2XN1A 3GHSA 2BX7A 2JGQA 3EWDA 2VOTA 1M41A 2NQLA 2HS8A 5HMDA 4CCCA 5DRIA 2GUYA 4JXCA 5DFAA 1S2AA 1NDWA 1T0OA 2NT1A 1HP5A 4WK9A 1VPYA 2Y8VA 5AYIA 5LGZA 2OG9A 5AOUA 4QLLA 4HU0A 3NSNA 1A49A 1Y5XA 2XGZA 2OMAA 3RX4A 4A3QA 1JZ6A 3UPBA 3KL3A 2GZXA 4S3EA 1MZHA 3UF9A 4IQJA 1MW0A 3ZQ9A 1FWDC 2Y7FA 3RLUA 4EIVA 1TKKA 5DANA 1SZFA 2IXUA 4W8AA 4FK9A 1PHWA 2X8RA 5T26A 3AROA 3HA1A 5DCEA 3PUGA 1WZMA 2BVWA 1QO5A 5A8MA 4FNTA 1DEDA 2OLHA 1EFZA 2Y89A 1QFEA 4OVXA 3HMCA 2ABAA 3WCZA 4QE5A 4KBXA 2OT0A 4QP0A 4X63A 3K2GA 3B4UA 3CLMA 1TJ0A 4QTGA 4QX4A 2FPVA 4I5UA 3W70A 4W8BA 2XVNA 3BUVA 3AU6A 4NL1A 3USZA 2ZRXA 3G1DA 2NQ5A 1A3HA 5CBBA 1UBSA 3SGUA 4E3TA 3WFAA 1V6YA 2Q8XA 4B5UA 5I24A 2BY1A 2ZBTA 4ZQMA 5T91A 1KM4A 2EPHA 3BW3A 2R1NA 1ICPA 4HPHA 3JUGA 2D69A 2VP8A 3WQ4A 3KRZA 3WJWA 1SZRA 3A4JA 5A6SA 4M19A 2VQTA 4OE7A 3O9NA 1BWKA 5XINA 1EQCA 2GQ3A 1Q8JA 3N9SA 4GD0A 2WSYA 3CQHA 2Y70A 1NH6A 2OSWA 3PZQA 1B3ZA 3W6LA 4LVBA 2EXOA 3FJNA 3S9YA 3VDAA 3CYJA 1PUDA 2C79A 1KFCA 2MUCA 4PRRA 2VKZG 2C16A 3GR4A 3JU2A 2UY3A 1G4TA 4HCDA 1TCMA 1TA3A 3CIWA 1TJ2A 1BPLB 3O15A 5ABFB 3S5NA 1GZJA 3VNKA 4CEXC 2D0FA 2J66A 4LV4A 1ICQA 2JF7A 1P48A 1TWWA 1KR0A 4G5DA 4QJ4B 2J25A 1TELA 1VQTA 2HPIA 3OLEA 3OVPA 4NVTA 1F6YA 5FEZA 2ZCGA 1OFRA 5DCBA 3HPSA 1U2YA 3W73A 1OFOA 1RPXA 3DI0A 3MJYA 5BZAA 2PBOA 4DIAA 3URQA 3B9NA 1X98A 1RY8A 3EYPA 5CXPA 4E0CA 5DY2A 1XLAA 3VZYA 2QR6A 4YPJA 3T0AA 4OBRA 4XAYA 1TB3A 5LHFA 3R0UA 4DLFA 3RNDA 1LG1A 3KE0A 1R7AA 4JL1A 3E6EA 4H19A 5C71A 2G50A 3U2OA 1C9DA 2CHNA 3AJXA 1AW2A 1O5KA 1XSIA 1XISA 4DUXA 1H1ZA 4WXZA 2C0HA 3UXKA 3B0PA 3R2GA 4DJDA 3K8MA 4DUVA 2D3NA 2Y7GA 3ORWA 3BDKA 1GVOA 1IXOA 3DECA 1K02A 2OZTA 3MS8A 1QBAA 1MNSA 4BCEA 3P7YA 9XIMA 2J4GA 2JE8A 1QW9A 5IOBA 4TIMA 5JXQA 1Y8BA 5AHEA 2CXEA 4Y9MA 1GVRA 1JQXA 3PZVA 3PSVA 1BF2A 3DX5A 1KV8A 2V38A 3VCCA 5KTLA 1H41A 1X8CA 1XYZA 2VVNA 3ANVA 3HG4A 4E6MA 3LGDA 3GXIA 4WKFA 1W3TA 1SPQA 3VIKA 1AH3A 2BXYA 3UW6A 2HVOA 2PTYA 3E38A 4I9MA 5HMSA 1CECA 3QXBA 2HNHA 4F0RA 1ZUAX 4M6QA 3RDKA 3WD3A 4NRSA 3HQ1A 2GWNA 4Q4OA 2Q01A 3GBEA 4U33A 1QRQA 1AZ2A 5K3VA 1DQUA 3OA5A 2PGFA 4G7EA 4ZODA 5CPTA 3AXXA 4N0RA 1IR2A 1E4MM 4GC4A 2I1OA 4XVEA 4LUSB 4LAMA 5AHLA 3ZS4A 5FJTA 3LD5A 3VX0A 2Y62A 3TE9A 2V5DA 4KCTA 4PMOA 3L2MA 3C0LA 4WY0A 3ARVA 4KEVA 4MWAE 1J5SA 2TODA 1GNXA 1A5NC 2OWWA 2PDBA 1R2TA 3DFTA 4MWAA 4GYJA 2OVLA 4Q8PA 3UVIA 1GKPA 1LTDA 1TX0A 4XIMA 4WKAA 3B9EA 3VCNA 1FWGC 4I9TA 3PBVA 4AZIA 2A79A 2QPUA 2PWUA 2B7PA 1V5XA 2J78A 2DVTA 3OLIA 3ATYA 4TTUA 3LMYA 4GVGA 1RBOB 5JBEA 3BSMA 1JPHA 4F0MA 1OM0A 3EXRA 3IK2A 5D8WA 3PAOA 2HCVA 4ORMA 1QNPA 1V3LA 3H24A 1BVWA 5FJJA 3T0TA 1BFNA 3NXFA 1CNVA 1F76A 1HO1A 3W74A 4CU7A 2F8QA 2X41A 4P2VA 2FJKA 3O2LA 2IQTA 3RF9A 1RJQA 1XIBA 3EPMA 4PFHA 3OB8A 2WVVA 1WDQA 5FF2A 1JGIA 3WJSA 3PULA 3WH8A 3S5SA 1R3RA 2GQ8A 4M8UA 1HGYA 1C93A 3DG6A 2I56A 4K1GA 2CKRA 2Y61A 4NXKA 2F61A 1TQJA 4O4WA 2P0OA 3VNIA 3BJSA 1I2RA 3OG2A 3QLLA 5LIUX 1V02A 4F48A 4AD5A 4JHOA 4WOQA 3VK5A 2C1HA 3GKAA 1J2WA 2J13A 1CB2A 3ZVHB 3OVRA 1D3GA 3REQA 1J0HA 1E0VA 3FN9A 3STEA 4PBFA 3H2AA 3FW6A 2V5CA 4PR4A 4UZSA 2Z27A 1PTGA 2FFCA 4RDZA 1ZU8A 4W86A 1JF5A 3KZSA 4M24A 2P8BA 4PTMA 1J0IA 4EXBA 1B54A 4LV9A 1JZ8A 4MJ2A 2EPOA 4C6KA 2FVLA 1EOKA 4IFKA 4YTTA 3MSGA 1JPDX 5CG0A 2VR5A 2RJHA 3B06A 4MPKA 4NKCA 1XCFA 1IWPA 2CBIA 2YLLA 2JKPA 3WEOA 5IFPA 3RN6A 4D8LA 1XKJA 3NPXA 1LL6A 1UC4A 2BTMA 2PB1A 1J11A 3QGKC 4F79A 2J77A 4M6UA 3MP5A 2WAGA 3W84A 1M7XA 3WG6A 1AZ1A 5F2GA 3P6LA 3ZR6A 5GPRA 3LZ5A 3NO1A 2QS8A 4LUIA 3TAKA 2F6KA 1TMHA 3BXWA 3THQA 5G1YA 1K03A 4X9SA 1ME9A 1JYXA 4G7FA 1ZY9A 2DEPA 3BAJA 3BC9A 3E49A 2E9BA 2R1KA 4JTQA 4ONVA 2WYSA 5CPMA 5DT5A 3YPIA 2H8XA 3GG0A 3HJEA 2PZ0A 1R2SA 4HQVA 1FWNA 4L9XA 3SQLA 2H6RA 1XH1A 1V7AA 3ARTA 4MUPA 1YE6A 5EBAA 1HIZA 1IHIA 3WEZA 1W9VA 1QHZA 3T40A 3LTPA 4KRZA 1VFFA 3FXGA 3F03K 3QZ6A 3CO8A 4LAUA 2CBJA 3I7SA 1RVGA 1J2BA 3CZGA 3EOSA 3FY1A 3ES7A 5I06A 1DYSA 4YWSA 2BHZA 3P93A 4ZSUA 3II1A 2VDIA 1Q66A 3U48A 1OWQA 4O15A 4ERGA 3PTDA 4AY1A 4PMYA 4OOUA 3LK6A 5CZ0A 2VRKA 1ODUA 2EG7A 2PRLA 3ZLFA 3P0XA 2PWFA 1RPKA 2VR4A 4S3JA 4A3YA 4RUBA 3AYTA 1CLXA 3D6NA 2CEQA 4C7FA 1D3HA 3OBEA 4GUHA 4LYRA 1JYNA 3GKFA 5BXPA 3DFHA 1K7EA 4N9EA 1OABA 1MW2A 1YDYA 1JDCA 4E8DA 1W1A1 1XLDA 4L4LA 2RDTA 1UKTA 3QVQA 4X3ZA 5AY7A 3V7PA 3W72A 4MKVA 1RHCA 1PXGA 3R25A 3O6AA 4PMUA 1T6MA 3RAOA 3T7VA 4UQ9A 4S23A 3RITA 1EB3A 2VC5A 3H8AA 1Q6EA 2BHYA 3BG3A 1EO7A 3G0UA 4P7QA 5ABTA 2PTXA 4IHCA 1W1ZA 3PZOA 4GHRA 3LGEA 1A5LC 3NNTA 5DMMA 4LTSA 3N73A 4NZ1A 2XISA 1EC8A 4OGZA 4A8IA 4LPCA 4LBSA 1U1UA 4LGXA 4JNYA 1VIZA 1X96A 2PPGA 1CPUA 4O57A 2A0NA 2I16A 1V02E 3O6YX 2DW7A 1GTHA 5KINA 4PEKA 5PTDA 3ZLHA 2P53A 3IJ6A 2R82A 4WHBA 3W86A 4E4PA 4RE3A 4GIEA 1BHGA 2HDJA 3P61A 3T1GA 3V5CA 3VDGA 2OGYA 4RK8A 1FWAC 1KM2A 1YADA 2FZNA 4RE4A 1HKJA 2V82A 4FXRA 3TSMA 3KHJA 4O50A 3EB4A 4W4QA 1KNWA 4R3UA 1VS1A 1VP5A 4L4OA 2VRQA 4MWAD 4CNSA 3KVJA 1UH2A 4ZO6A 3MWAA 1LBMA 4XKYA 2VDHA 1MWOA 4HZ8A 3S6OA 4GQQA 3XINA 1JNDA 3ANYA 1DE5A 2YW3A 3QW4B 1DHPA 2VX6A 4UWMA 5BRPA 5ABFA 1JCLA 4H6RA 3TFXA 1SJCA 5H6HA 5DLCA 4GYFA 3MTWA 4EX4A 4FX7A 3O07A 3SGZA 3CMFA 1XGDA 4CQAA 3WLIA 2G3MA 1BYAA 3QF0A 3UR2A 2OSXA 2AL2B 3B40A 4R85A 4GUGA 3LLDA 5C55A 2FIQA 3W7KA 3VI2A 2VGIA 1VEOA 1OY0A 1Z9AA 4Q8QA 5A2AA 3U9IA 1XYBA 3A13A 4FNUA 4IPLA 2VUNA 1OZQA 5IBXA 1E5JA 4Q8TA 2JEPA 2WQPA 1TPEA 1V7YA 4DRSA 3E74A 1CEOA 3ABRA 4DHGA 4GX8A 2OPJA 4RDWA 3GNXA 4XZNX 4UCGA 2ZUWA 1QTWA 4JQ2A 3U2CA 4KKXA 4UNIA 4MZ1A 3CTLA 3RLGA 3Q37A 4XBJA 1X1OA 4P7RA 1V3HA 1CYGA 1PCWA 4DO6A 2Q71A 1W1YA 4X2RA 1SJDA 1MI3A 4GYPA 3UR8A 2QPSA 4AZCA 3KRUA 3S1XA 2NV2A 3KCOA 3HMJG 2BDQA 2EHHA 3ZSSA 2AKMA 4LFYA 1J93A 2PI6A 1X8FA 3MB9A 1JYWA 4B5XA 3QOKA 3WN6A 4O52A 3VIIA 4JTUA 5D9PA 1FDZA 3CPRA 3AMKA 5FEWA 4LVAA 1KRMA 4YCOA 4XZIA 1GWJA 1V6WA 4Z2KA 3AHVA 4DO5A 5DXYA 2I5QA 3ENLA 1DIKA 2WKJA 2ISSA 1XXXA 2FLIA 5DMLA 1KCZA 2C71A 4XAZA 4BF5A 1ELSA 1T8XA 4WY0B 5C54A 4A3UA 3IGHX 3TYBA 3WQVA 2ZZ4A 2OX1A 1B57A 3WLPA 2OZ8A 3KRBA 3PTKA 1V4YA 1XLKA 4D6CA 1ITCA 4C6JA 1B3WA 2QQ6A 4CQ8A 1V93A 4EAMA 1GONA 3JR2A 4M0XA 1EUAA 4IP7A 4PBEA 3DYMA 3RU6A 2A4AA 4LUSA 3FEQA 4ZVJA 5I02A 3PR2A 4UIOA 1C8VA 2P50A 1YBQB 3G1XA 2DUXA 1XYAA 4C6QA 4WQ6A 4W84A 1WZKA 4QG6A 1VAHA 5IDZA 4DZ5A 1OCBA 1G7VA 1TMLA 3U8GA 2DSUA 3UWVA 4F0LA 1FCUA 1BYBA 5BWFA 4LY8A 1CENA 3AMCA 1NWTA 2WSPA 1N8FA 3S2LA 6A3HA 4AISA 1BWLA 1KBJA 3FSTA 1UYQA 3DFSA 4J3UA 1I0DA 2WMGA 3DHUA 4UTIA 5BU6A 2EG8A 4PC8A 4IUOA 4I3GA 1FFQA 4S38A 4WDTA 2FZDA 4AZBA 4IPNB 5AYZA 4WOZA 3BGGA 2FZMA 1NVMA 1LORA 3T6CA 3SIMA 2V2HA 1JZ4A 1UJPA 4B9YA 4XQ6A 1KBBA 1K6WA 4RCXA 3I7QA 2XGIA 4JAWA 1XC4A 4DF2A 1U1HA 5I7GA 2V3EA 2J7DA 4JTIA 1NDYA 1OF6A 4MY9A 3SUWA 4BWLA 1VJIA 4YTQA 2VRJA 3E0VA 4OT7A 2F6XA 1YRRA 2Z1BA 4DEFA 1SFLA 2V30A 2Z1VA 3M0ZA 5LA1A 4D8ZA 3EOLA 5EA9A 1X6UA 2DT0A 2QCMA 5F1UA 4M56A 3LU2A 2YDSA 4UR7A 1IIGA 1DWGM 2O7SA 1SQ7A 5LYRA 3QC3A 4FEZA 4G1NA 2VDGA 4NJGA 4IPPA 4G9PA 2YGYA 3BAIA 4INFA 2PWGA 4Q4SA 1ISVA 2IPFA 3L2LA 4LUTB 3ARYA 1HTIA 3N12A 1UZ4A 1TFVA 4IG2A 3M41A 2GSJA 3PWIA 3M64A 2EKGA 2CHRA 3JZUA 1R38A 1IT8A 1OVDA 2PWEA 3MUY1 4IMEA 4GIRA 3MVIA 4QR6A 4FX6M 1MVYA 1VENA 4UFMA 5IDIA 3NYDA 3VOFA 1FH7A 3GH5A 5I23A 4CKQA 3PPHA 2NVCA 2DGAA 2ISDA 1PB0A 2PDXA 3AQUA 2YX0A 4HMEA 4CCEA 3S6DA 4H9MA 4PULA 3FDKA 4ZL1A 2FQIA 3S2NA 2DZWA 3PZIA 1VLIA 1WXJA 1VYPX 4KWUA 3HFYA 1V0KA 4REQB 3O63A 1HKWA 3HPZA 3NJ3A 4JX6A 1MW1A 5M17A 3NQ7A 3NPUA 5LIWX 4UFKA 4IM4A 4XZHA 1PSCA 3KL0A 4IMFA 2OWCA 1VPXA 4AD3A 4ZE5A 3WDQA 1LQ0A 4NZ5A 2XU2A 1KLYA 2JGYA 1DJHA 5AECA 3W7RA 3ZM8A 3PZUA 3W81A 3WNPA 3N2BA 2GOKA 3N4EA 1XPYA 4MKSA 5XIAA 2HNEA 2IQ0A 3OQ8A 1OK4A 1XUUA 3SCUA 3I6EA 1TV2A 1R6WA 1J6PA 1XCWA 1PWLA 1ZP4A 1OCJA 5LSMA 3NVTA 2J7FA 2NVAA 1NOWA 3RPTA 7ENLA 3WBEA 2IW0A 1W9UA 1FH9A 3AXHA 4K39A 3ITLA 1N8IA 5K7JA 3MBDA 4HTYA 2ZXAA 3APGA 4JKLA 2PGEA 2Y5EA 5HQLA 3MSRA 4JEJA 3LPFA 3WD4A 3TW6A 1ML1A 1YE4A 3Q58A 3PZNA 3W26A 5M5DA 4CNTA 3PUOA 3DEQA 4HMCA 2R94A 4OBSA 1XF0A 1R5YA 1OC5A 4GY7A 1IEXA 3AYRA 2FDMA 1BYDA 3FJ6A 3RXZA 3S5ZA 3ZSTA 3QM3A 1VFTA 2A7NA 4ACZA 3SGGA 3DYOA 4V1XA 3VKCA 1EHNA 3BURA 1TPUA 4ZOBA 3DUGA 4JY9A 3N25A 3WJZA 2GJXB 3O6CA 5HPCA 2GDUA 5KZDA 3RUBL 5BCAA 3TZNA 4HK7A 3C3NA 4PTVA 3BZJA 1KBKA 1FDYA 4H00A 4BQ2A 4HN4A 4DELA 3QKEA 2ACRA 2DZUA 3QKZA 4JN7A 1S5VA 4TX9A 1HO4A 1FKWA 3R8HA 3EXSA 4Q8VA 1XIDA 1OEPA 4WXYA 4JTDA 1UC5A 2F6UA 1W17A 2D22A 2A6NA 4MZ8A 4NZ3A 3LERA 3S3GA 1QOPA 3KBMA 4KIRA 2OB3A 3MZNA 2NLYA 4PUEA 2QCCA 4TOQA 1LL4A 1QI0A 4XZWA 3AI0A 1OX4A 1UA3A 4B4HA 1JD7A 1TX2A 1W1B1 3VIFA 3BGAA 2I57A 3VOHA 2OQHA 1Q6RA 1OD8A 4O1EA 2UV8G 2CESA 1HVXA 4DZHA 3UCQA 1W1IE 1XRVA 1QW8A 3SQMA 2D3LA 3T44A 5F4SA 2ZX6A 3MU7A 1SW0A 4MB4A 3K46A 2I9EA 1SZGA 3G5EA 1OBAA 2H90A 4XD3A 4IH3A 1W8SA 2ZUNA 5GVJA 2XH0A 1XRTA 1DTUA 1X38A 3THDA 4DO4A 5JU6A 1TVPA 3AIBA 3W2JA 1BRLB 3R0KA 2ZVIA 4UMCA 7A3HA 4JTEA 3L12A 3UR5A 1IZCA 5ABEA 2ZTKA 4H83A 4QLJA 3KHDA 3AS2A 4ZQPA 3GU1A 3RPDA 3NURA 1FWCC 1NU5A 3HJZA 2WWCA 5JUVA 3RFAA 3E96A 3GX9A 1GW1A 3TN6A 2YL8A 3IGXA 4M81A 5EGRA 4DJFD 1DIEA 3L2IA 1E5NA 4JX4A 4ECLA 2OEJA 5FCZA 3O05A 3UVAA 1AL8A 1I2QA 2BGNE 1QUMA 4TQTA 5CZKA 1N8WA 2E77A 4HSHA 4C7GA 1EEPA 5HWNA 4MOZA 4G1KA 1DOSA 1Q8AA 4RNIA 4F2BA 3LA4A 4QROA 5GJPA 3UZ5A 1BD0A 4FOJA 3CM4A 2GK1A 4TUFA 3RHGA 1GJUA 1TRDA 1QPRA 5H8UA 3KCLA 2A3CA 3M4HA 3U5UA 4JNZA 2H9AA 1J18A 3GUGA 1TR1A 1P5BA 4PCPA 3POHA 2FYMA 1JAEA 3EAUA 4KWOA 3QEZA 2E40A 2PDHA 3HBLA 1QAPA 3S4TA 3VNYA 3K1GA 2Y2WA 3QHOA 3EOOA 1KB3A 1KKRA 2IKHA 1KBIA 4BJHA 4AWTA 3OEXA 1UBPC 3IS4A 1DJIA 2J7BA 3PTMA 3LCFA 4GBDA 3IIPA 1D8CA 3O0FA 2IMRA 3URAA 2WJEA 5AZ1A 5FEXA 4Y2WA 1M03A 3A6OA 4CU8A 2OOFA 2E5BA 3TYDA 3VGHA 3WQ5A 3B8SA 3MVTA 3MQTA 1P6BA 4PUDA 1ZFJA 5AC5A 4AF0A 3A9BA 2VFIA 4UQCA 5HMFA 4KPLA 5RUBA 1LJYA 1W5QA 4H04A 3QTGA 1XL9A 3UG4A 3RLVA 3VE9A 1FP8A 1HUVA 3F5KA 1RXOB 3H2MA 3HM7A 1KWKA 2YFOA 3R6IA 4GIYA 4A3HA 2PF0A 2WHJA 2A1YA 2NX9A 3LRKA 3TR9A 1KTBA 3GNRA 4GXWA 3C2YA 3G22A 2XIIA 1EBHA 1HJSA 5JH2A 4Z1BA 1XBXA 3KDOA 3H22A 5A6JA 4MFEA 2IKGA 3SEPA 4JQ4A 3NGFA 1S5MA 5AYYA 1B9BA 1G7UA 2YL5A 1W1VA 3A3XA 3R58A 1JNEA 3WLLA 1PZ2A 3H4WA 1CLVA 4P7LA 4OFCA 3MW7A 2FMOA 4KEUA 4UTUA 4JYEA 1UP0A 5E6YA 2R9RA 2PDCA 5CGQA 3TQVA 2XIBA 1S3HA 1TIMA 4OECA 1WX0A 4UTLA 3H70A 3XISA 3QSRA 2WM1A 1ADOA 4U28A 3HN3A 3P80A 4H8UA 4U10A 2X1IA 4DWSB 4LAKA 5EPDA 3GHRA 1GGOA 5HR7A 1L0PA 3UJEA 4GABA 2ZA1A 3QHMA 3WDRA 3WH5A 3IANA 1GQKA 1A5OC 3W7EA 4CD5A 3KBWA 4MNJA 2DORA 5FI8A 4YMZA 2WC4A 2PU1A 3TUUA 2BVDA 1M3UA 1M68A 4ZGYA 2D23A 1JCNA 1B4EA 4NP7A 3OPSA 3AXKA 3WJXA 1WKFA 3FLUA 1EA0A 3GTFA 3WDPP 1TPB1 2VFDA 4JN8A 5LXXA 2Y6ZA 4KT2A 4QCFA 4HOZA 4GUIA 3PJWA 5TNVA 3UERA 1FUYA 3J7HA 1B2YA 3EGJA 3T55A 1CX9A 2GJLA 3ITTA 3QSTA 2QMJA 5C7HA 3CZLA 4H6QA 2EJ1A 1OFQA 1ME7A 4JZ5A 3LPGA 2PLKA 1ZZMA 2XTKA 3SBFA 4TX8A 2DZBA 1OC7A 4X9YA 1SVDA 2BXVA 3VMNA 3AFBA 1AJZA 3A24A 1TRIA 3R4IA 4B5WA 4UTHA 1Q45A 1BKSA 3A4XA 1V3JA 4F3HA 1K1DA 3W24A 5EFFA 1KRCC 1B4KA 3DHPA 3HGRA 3N2XA 4JFWA 1DJZA 4Q4RA 3UETA 2D73A 5CG7A 4R88A 4JGDA 1TZZA 2G3NA 4F0KA 4DJFA 1L8NA 1S2VA 5AC4A 4X61A 1OYCA 3BOXA 1UH4A 5LIYX 4JR5A 2ACSA 2WJZA 1TPDA 2CLFA 2QCNA 1XLCA 2R8WA 3DHDA 3KEHA 5IBXC 1UROA 1J10A 3TTSA 2VD9A 4MM1A 4ROQA 4GJIA 1BGAA 3GY1A 2RJGA 1G01A 1VZWA 2BVTA 1E9LA 3B4YA 3MWCA 2EPNA 4IIGA 4UQEA 1B31A 3SZ8A 3TEVA 1B3YA 1KGXA 4P8WA 2DDXA 5D4YA 4JQAA 3NM3A 3C2OA 4KMQA 1RV8A 1UD2A 3G77A 4JBRA 3PBUA 2V8ZA 3W7CA 1SW3A 3GIQA 3E5PA 1TIWA 1CBGA 4B3LA 1EZ2A 2QEZA 1SUXA 3NQBA 4Q32A 1US2A 2OSYA 3G1AA 3B0UX 2PODA 4NRRA 3M44A 3QFEA 1JUBA 2SFPA 3NM1A 2XH4A 4GLEA 4MYAA 4Y7EA 1XBYA 3BL3A 4PSPA 3ZXWA 3P5YA 4Z17A 3LHTA 1EJTC 2BWGA 4KESA 3O7UA 2HPMA 4HN8A 2FTWA 3NIYA 3VVGA 1MRQA 1WXZA 2PDMA 2ZUSA 1XLIA 1FDJA 1OFAA 1E3XA 4NSBA 5I79A 1ODZA 4ZFCA 1F3XA 3KOXA 1XIJA 3V0UA 4HU8A 1R3SA 4I9AA 4XBKA 4HYRA 4A8NA 1NDVA 3QMTA 4PMZA 4NG3A 4EPEC 2GJNA 5JIPA 1SZEA 3PVFA 6TAAA 3GRIA 5HQMA 2Z26A 3O16A 4P7NA 1KO0A 3WLSA 2P3ZA 3M6DA 1GT8A 3VMOA 4XV0A 1DORA 4PUKA 4D1JA 1VJZA 4ZO9A 2ZTJA 4D9PA 2F2HA 1OJXA 3UNDA 5EFDA 4RNFA 3P14A 1XKYA 1OINA 4S3AA 3T0BA 4MLJA 1JI1A 4GI9A 2G5WA 2BB0A 3WF3A 1LLZA 1W3KA 5M03A 2HEJA 3PF3A 1IWBA 4O1BA 2OOGA 4PMNA 2GJRA 2P0IA 3KLLA 4I7WA 4DO7A 1S3TC 1M9HA 2Y0FA 3IIXA 3ZVHA 3KZPA 5F2LA 3QN3A 5AFDA 4X2PA 4WX2A 4GO8A 4L1WA 1IQ8A 1TQXA 2PWVA 3BG9A 5BOFA 1GVIA 3E12A 4R7JA 3AC0A 4DY1A 3M0KA 1OX6A 4I8DA 2WPGA 2DZPA 1FWHC 4EK7A 2R91A 4CVWA 2OEKA 5HMEA 2PDLA 4GVHA 4UOQA 3MCMA 4Q8OA 2QGHA 3HTWA 2HZGA 4KETA 3TH6A 2WBGA 4Q8NA 2JBMA 1DIOA 1ZJIA 1UOKA 1V51A 2X7WA 1MEIA 3TSBA 2O56A 5FKYA 5HNTA 3TYUA 3Q4DA 4LJ3A 3DN5A 3V75A 3G3DA 1KCLA 1R85A 1ZALA 2EO7A 3EWUA 2VEPA 1UJQA 4GKTA 1QI4A 4IJCA 3CUFA 4CD7A 5DBUA 1RBLA 4PEEA 2X16A 2Y63A 5FA5A 1OGGA 3GWQA 4HHPA 2ZXDA 2XG9A 3VINA 3GO2A 3W3OA 4MYXA 1K9FA 4OU1A 4UFIA 1RK5A 4N42A 4HPXA 3P8JA 4GQRA 4HCLA 2R1LA 3MI3A 1E43A 4WJEA 1WPCA 2EPLX 4N9DA 1PZ1A 3GIPA 2C19A 2WZHA 2GQAA 1ZPTA 2NQJA 5I3JA 4MLRA 4LT9A 1PYFA 3OZPA 4DBUA 4GY0A 1R3YA 4UQBA 3F7JA 3VTRA 3VD3A 2GDVA 2YL9A 1DJQA 1MUMA 2Y85A 3M46A 4GCAA 1S2TA 1JF6A 3PB2A 4OTKA 4H01A 4E2DA 5H8PA 2VZUA 2YCEA 1CT5A 1JZ3A 3NO5A 2X09A 4MMWA 5F1VA 1ZB5A 1M6JA 1H1YA 3RJXA 2AGTA 3NL2A 4YWIA 4RZBA 1CXIA 3UYIA 3M5ZA 3W2UA 4PMRA 2CCRA 4LOCA 3RJYA 3UD6A 1EYWA 5AC8A 5FJRA 4XAPA 2O4MA 4YL2A 3TKFA 2BOEX 1MXDA 4D8AA 4GH1A 3L67A 1TJRA 2XM1A 4Z42C 5KMYA 5C7VA 2DU2A 2EPMX 4NT0A 1QK0A 4QDPA 4U3CA 3CB8A 2PDQA 3W2LA 2W4XA 3IAQA 4L9ZA 4S1FA 1BF6A 3M0HA 4L80A 5A6BD 4UFLA 4LNCA 3L65A 3DKJA 3VU2A 1GYNA 3AALA 5E0CA 1R9ZA 4NXSA 1LDCA 4QG9A 4MWAC 3NDOA 1XFBA 1M04A 3GDLA 3W28A 3NDZA 3LBOA 1E6ZA 2C14A 1OG6A 1VD6A 2XZ9A 4IWWA 3EX3A 1SSGA 3KM8A 1Z42A 3QBUA 3TYEA 1E1CA 3ME3A 1TV5A 1S38A 2HBVA 3AHZA 2BGQA 4FIQA 2RDXA 4DAFA 3EWYA 4H9ZA 3UZXA 3B04A 4AC7C 1IYXA 4QJ3B 4ALDA 1C7SA 4LAZA 4EE9A 4JFUA 1P6CA 3M0MA 3AXIA 4CCZA 5CZJA 1ZCCA 1V6VA 4YVPA 3NL6A 1R9XA 2ZQ0A 4V15A 4J3ZA 1ZJBA 2G4FA 1VYRA 4CGTA 2YL6A 2VGGA 5E9XA 3AYVA 4JTSA 3MV11 1A0EA 3KWXA 4OJYA 1V6XA 3CQIA 3EZ4A 4K7YA 2C8NA 4B15A 4ERAA 2CLHA 4ZR8A 1OYAA 4RNJA 4J3WA 1OC6A 3WQFA 1T41A 1WXYA 1XH0A 3G1HA 1OT2A 2NWRA 4UC5A 2ZRZA 2EPKX 3PJTA 1HKIA 1W32A 1RAKA 4WDWA 3M7SA 1Q5MA 1CGUA 4HK5A 4BY3A 1WDSA 5DRCA 1PEZA 3ZWSA 3LZ3A 4C6FA 5KSWA 3WK2A 2QIIA 4CQDA 4L6HA 2QDGA 2VX5A 1IXQA 3GDTA 4Q8UA 1Q7ZA 3LX9A 1Q6OA 2QZRA 3MC5A 3STGA 5FJIA 2E7FA 3V4BA 3EA2A 3E0IA 4N4PA 2F2KA 2I9UA 2PURA 2CETA 1V3KA 4D6JA 1CWYA 3A23A 1EGMA 1QNOA 1EXPA 4Y8FA 2QV5A 2FGZA 3NQAA 1TWDA 2I17A 1R87A 1MQQA 3MKCA 3OBKA 1O4UA 8XIMA 2R24A 4L64A 4TTGA 2HRWA 1VHNA 3MHUA 4DN1A 5CEWA 3L4ZA 4UZUA 4O19A 3QRHA 2QT3A 3TWBA 3VM5A 1TO3A 2VC9A 3RR1A 4U3AA 4DLMA 4I5XA 1PS9A 3N2TA 1BVZA 3TZFA 1F9CA 2E67A 3FYOA 4JKMA 2VZVA 1PDZA 1HJVA 3LQGA 3CASA 3WD2A 3K4AA 4J5NA 3A4WA 3VC6A 3OJGA 4AIOA 3CT2A 3L5AA 3MUZ1 1MNZA 1AH4A 3WLHA 4HHHA 2O9RA 1U83A 2XFWA 2WSQA 3TU9A 1ONEA 1XINA 2G8ZA 3EWCA 2OKOA 4UTJA 4BF9A 2X30A 2WXDM 1PYMA 3NG3A 1MW3A 3LEPA 4YJ5A 1JZ7A 3OGVA 4YS1A 1SMDA 1LQ2A 4XZMX 4XISA 4HJWA 3W22A 5CJMA 5A2BA 3CK5A 5JVLA 3MDWA 4POCA 6ALDA 3C6CA 4JKKA 1Q63A 5DELA 4J40A 2CERA 2OQYA 1HNYA 2FDSA 3B8DA 3I65A 1PKMA 3IARA 4FR6A 4IGHA 2E6AA 5A8OA 2A7PA 4C6LA 2XJ7A 3AMLA 2PTDA 1AG1O 1TPH1 4GINA 4NNBA 1K9TA 1TTPA 3U2ZA 5CLWA 3TQ0A 2E4TA 3T4WA 5K2ZA 3T05A 4WGHA 6REQA 1AW5A 3ZWTA 2HJPA 4AVNA 3C2FA 1YEYA 4GJ1A 5G2HA 1E9YB 1RQEA 3G1SA 2ACUA 2WZEA 1Q4WA 4UTWA 5GNXA 5FOOA 2GUUA 3BGJA 1QPNA 5TF0A 4WR3A 4Q4MA 4AVFA 2V5LA 1OD0A 5DX7A 4UTWC 5EMYA 1UIOA 2ZE3A 1DXIA 3GHTA 3SN1A 1RCQA 3PWAA 3SCQA 4YNGA 1L9WA 1OFBA 1XP3A 3L4WA 4JN6A 3NDYA 4ZA0A 4XKYB 1QNVA 4MDPA 5FF0A 1PKYA 2DJXA 2FKPA 4EVZA 3MUXA 2ZXQA 4PCFA 5FJPA 3GUWA 2DW6A 1UR8A 1X7IA 1J12A 1K8YA 3EWWA 1ITUA 4MWAB 1UKQA 4RE0A 3HQNA 1EP2A 1C9WA 4IQDA 2AQVA 4QHRA 2C15A 1FP9A 2YXXA 4JQ1A 4ORIA 3HU7A 1NQ6A 1GOMA 1XIIA 4C6CA 3G18A 5D2WA 2I14A 3IUHA 4JCMA 1XYLA 1VBGA 1K9EA 3DKLA 4ML9A 5JMUA 2W66A 2NQHA 1O66A 3SADA 3RMJA 3VABA 3GC4A 3TNBA 5XIMA 1LG2A 4XZ9A 2XSAA 2XFYA 3LDVA 2GUBA 2YCKX 2E3ZA 4AH7A 4URIA 2VEKA 2RGLA 3C8NA 3EB2A 3LNMA 2PLMA 2R1PA 3XIMA 3I7RA 2XGBA 3MMWA 4QDWA 4O14A 3R1ZA 5CJNA 3SO7A 2YDRA 2Q6ZA 4D6DA 4PBGA 3FVMA 3WLQA 3PFMA 2GQ9A 2WNQA 4AY7A 1JCYA 5E0FA 1YNQA 2OELA 1J0JA 3WH9A 4A6GA 2PRHA 5HWJA 3DGBA 1D9EA 3UA3A 1DL3A 3DDMA 1XICA 1R2RA 4JD4A 4HA1A 3F2CA 3WMSA 4DAIA 2CITA 4MB1A 5HPOA 2YBUA 1ME8A 5HXMA 3W00A 2XVGA 1E4LA 5DT7A 3WUBA 1VFOA 5C2GA 2VO5A 4C90A 4HSOA 2ZZ7A 4KEMA 1S1PA 3L5MA 2VXNA 5HA7A 3TC3A 1YDOA 2CIPA 1KM1A 1ECQA 3FA5A 5J5DA 3CL7A 3GVWA 3GH7A 4AUBA 3RX3A 2KZHA 3LCIA 2ZA2A 1I4NA 1Q4NX 3SN0A 4KWWA 1YX1A 2DSZA 2PTWA 3IJIA 1NWUA 1O1HA 2E1WA 4BI7A 2PDFA 1QASA 2WV8A 3CL6A 4PFMA 2WMIA 4EPKA 1XQLA 3TYAA 5JH1A 1NELA 3THAA 3ZZ1A 1IR1A 4K8GA 3AMGA 2NX1A 3T2OA 3CPGA 1AODA 1A5CA 1JZ5A 2Q8ZA 2ZZ2A 2VTFA 3OOQA 2C6QA 4F2UA 4JTKA 3USBA 3URNA 4FNPA 4M80A 3SRHA 1BTCA 5BROA 4Z1DA 3SDOA 2GYIA 3QGAC 2D0GA 1AQ0A 1X7FA 1TV3A 3UZJA 1EX1A 4JS3A 1P6WA 3R43A 1M7OA 4LW7A 4HA4A 1F74A 4DWSC 4L1XA 3GE7A 2VEGA 3STFA 5A1AA 3ITXA 4ZOAA 1KCKA 5LNRA 1PDYA 1GORA 3TA6A 3LG3A 1EBGA 4HZ7A 4GYKA 3LCGA 2JIWA 3QY7A 3W1QA 1W9BM 2WSKA 5AN7A 3NFUA 2WVVB 2XSXA 4BF7A 3N2MA 2AAMA 1YQ2A 4LCQA 3CV6A 3RPMA 4GQBA 3R94A 4MY8A 4O17A 2OODA 3LOTA 3FAWA 3S2MA 4FLSA 4DM2A 4O8AA 5JIWA 3WFLA 2AAAA 1W5MA 2C91A 3GBDA 1ECEA 5CC3A 5AB3A 3V36A 1AQMA 1LRNA 1I45A 1M7JA 4XZBA 3OIHA 2P1FA 2CXGA 4LYQA 4DJEA 3C2EA 3PZTA 1W9DM 1YHTA 2ZZ5A 3AZTA 3VGDA 3GXDA 1PBGA 3CHFA 2WC7A 1LLOA 1J79A 3T2QA 3NUKA 4HBKA 2PS2A 2D2JA 3V16A 3URBA 5K9CA 1DE6A 4BK9A 1E51A 3RX2A 1SU5A 3O6DA 4A4AA 5A3HA 1LP6A 1MRAA 3EPNA 3VOJA 1W54A 4RZ5A 5DBTA 3C5QA 4RZ6A 4A29A 3E2RA 3SCVA 2W92A 4NX5A 4PB5A 1NTHA 1W6TA 2DH3A 3SRFA 3S9ZA 2V5JA 4X0VA 3R5EA 1LROA 1JPKA 3KTXA 1UWRA 3FDGA 4H7VA 3WBWA 3LUTA 4BQ5A 5EMLA 4IMGA 3O1NA 4I9JA 4L4PA 3HV8A 1M01A 2E5CA 3BJTA 3P74A 1V6UA 1ZTVA 5FL1A 2PA6A 3BAKA 2D2GA 5G4HC 3VIPA 4U5KA 1OIFA 3C56A 3I10A 5EKYA 3V1HA 1KXTA 2WB5A 2BY3A 3FV9A 2PLCA 1E73M 4Q8WA 4AAJA 1NY1A 5BXSA 4C5ZA 4JTAA 1XIMA 4E3VA 1QI2A 1XGEA 1RVKA 4LS2A 2NQ9A 4FIRA 1EP1A 3LENA 4LXFA 4HHMA 4KERA 3MKKA 2AMGA 5BW6A 3ZJ8A 2FH8A 4L9YA 3MY9A 3LCWA 3VO0A 2PCQA 4ZXOA 1OX4B 1PV8A 4EXAA 1CIUA 3B3DA 5H2ZA 3HG3A 4GVIA 3VD4A 1GPFA 3LHZA 3N15A 3NWRA 4GGBA 3SURA 4A8RA 3PWGA 2CW6A 1J5TA 3ZO9A 1TPC1 1BYCA 3G0SA 1DJNA 1YXCA 4E8GA 3LS9A 1RLDA 4IJBA 3QZAA 2ZVRA 3B0YA 1P7TB 3RRXA 4B2DD 5KZ6A 3GU9A 5L9FA 3CWNA 4GFIA 3CUGA 1X1NA 1HKMA 2YBVA 5E1QA 3LYEA 4QAIA 3GC2A 3F4WA 5ENLA 1HFBA 3QV8A 4H4IA 1AA1B 5G1MA 3MCNA 5CZTA 1KC7A 3VGBA 4IMAA 1VFSA 3ATZA 2W3ZA 2F9RA 3C0QA 5J5RA 2TAAA 3H7UA 1PAMA 1V3MA 3PG9A 2WQDA 1B5TA 4KS0A 2YCLB 3WD0A 1UR4A 4K6AA 3BLDA 3CHCA 3NO3A 4JHMA 1H61A 3S42A 2V81A 2PGRA 2YW4A 3BAWA 4OV4A 1B0IA 2GL5A 4NJIA 1P1XA 5LA2A 1BLIA 4GZ7A 4NZFA 3UESA 1F5ZA 1UB3A 2YXOA 2WLZA 3W83A 4AQLA 4PRWA 2A21A 4Q4KA 3V5OA 3ZT6A 3VD9A 1ESWA 2B7OA 2P3EA 3TXVA 8XIAA 3MUIA 4GNJA 3VUPA 4GX9A 1YNPA 3VUSA 3SSZA 3B97A 3NL3A 2F38A 2BXZA 2HQAA 1UD5A 4DWSD 3QZEA 4EACA 4BA0A 3UYCA 1ITXA 3CUHA 1ZHAA 1W3NA 4PUNA 3UWQA 3NOEA 4PODA 2W61A 4DB7A 4IGMA 3E2QA 3AYSA 5BRBA 1VHCA 2BS9A 3AU2A 3WLMA 4XIAA 3WK3A 3NZPA 4D1IA 5A6LA 1XGZA 5M3WA 4DJEC 5HANA 1Q65A 5LNWA 2HVMA 3VGEA 3W1MA 5M2FX 2A3HA 4HNCA 3TXZA 3RU8X 3GVRA 5E5CA 4IFKB 3CIXA 3V0SA 4GPNA 2D24A 3M0YA 1HKKA 3B8WA 1GW9A 4LEFA 3G2GA 4AIBA 1Z6KA 2XPKA 4FO4A 1R3TA 1ZBKA 4AX6A 2WBKA 4RW5A 5HNNA 1JPIA 3WQPA 3G8EA 3MANA 4Y9NA 1RA5A 2AQOA 5U7SA 1ZGDA 5F4WA 3L7RA 2WNWA 4IMCA 4Q33A 3M5XA 2AMXA 4UOZA 2XIJA 3GFYA 1F05A 1Q6FA 1FHUA 2PDPA 2VEMA 3W7MA 4N9BA 5C5YA 3RGTA 1QWKA 5CC7A 4AD2A 3DCPA 3WNNA 4Y6GA 3BARA 4QDMA 4N6EA 2GGEA 5D09A 4ZQRA 3UWWA 3WLTA 3T09A 2Z7GA 5AHIA 1F3EA 3BH4A 2J27A 3B8UA 4NU7A 1J9YA 2EGZA 1QVBA 3CUXA 1XYCA 1C90A 3SIZA 1UWSA 4IQLA 2GFTA 3N4AA 3TX9A 1TMQA 5DMNA 3SCWA 3TFCA 4HA0A 4UQAA 2REQB 5CQ1A 1SFJA 4Y96A 3KOZA 3RR4A 2E6YA 4IPJA 5FF3A 4AF0B 4Q4PA 1SO3A 4CNUA 5CBJA 4IUGA 2J7CA 3F4VA 2O0TA 4XO6A 4LWWA 4EF8A 4M1RA 1KLZA 2WCSA 4NI8A 5IRPA 2J9XA 1EJUC 3HO8A 4MUZA 4N6FA 4WJXA 3AWOA 4IOTA 3KOYA 4ZQOA 3WLJA 1EP3A 1Z3NA 1A0DA 3QTPA 1XLGA 3WF0A 4PUJA 2Q3RA 4QM1A 2QUTA 2WKLA 2A5HA 4WZHA 3P3BA 3NGJA 4PSRA 1CB7B 3GZ3A 4LANA 3E3HA 5T9BG 4FNQA 1ZBCA 4AYGA 1E6PA 3NXLA 1ADSA 3HQPA 3ANUA 3TR2A 2W9MA 4RR4A 3H21A 4I6VA 1WDWA 4QS6A 3B0XA 1XDLA 1ZQ5A 4NI3A 3C2RA 2PCEA 4QISA 4REQA 2DSKA 1EF2A 3DI1A 3W38A 3A9IA 4R53A 3IPWA 4P7OA 3DU0A 1JCTA 4B5TA 5BMWA 4E8CA 1XSKA 3GK0A 1RALA 1HGWA 1PIFA 1H3GA 3UJRA 4PMDA 3W76A 4PGLA 3R8RA 4LQ1A 5A94A 4G2DA 3UGRA 5J8LA 1PWMA 3LXBA 4HCHA 4EXQA 4FPSA 3PG8A 3R79A 4W7VA 3P67A 1UW9A 5CZSA 3W7OA 3FVDA 3WQ6A 1CCWB 3LCHA 2J7EA 2EG6A 3BOFA 1TG7A 2TMDA 1NSJA 2BSLA 4B16A 4H9TA 2H8ZA 4X60A 3UZZA 3WL1A 2ZKMX 4BWLC 2XIQA 1FWSA 2VX7A 4PUWA 4ZSTA 4QJ1A 5B7ZA 5K9XA 1XD1A 1H7WA 4PCNA 5LNVA 4UTFA 1QR7A 1JCXA 2NSOA 3VOGA 4MNMA 3MMDA 4RJEA 3BV7A 3RIKA 2QJNA 4IGSA 1KM5A 1ZLPA 4QG8A 3GYCA 3W0KA 5I3KA 1FWTA 2J9ZA 2VC6A 4C1NB 3WNKA 3VNDA 1AD1A 2BHUA 3NQ6A 4HK6A 1A4LA 2J7GA 1WKYA 4R33A 5CBIA 2J7HA 5FD0A 4IX2A 4MJ4A 3DFYA 5C0QA 3WKZA 1F3WA 1O60A 4S3CA 3R12A 4O0ZA 4HMNA 4CN4A 4KRTA 1FWBC 4IMDA 4C6NA 3GNNA 1GHRA 2DVXA 4E5TA 4FMVA 5G5IA 2PD5A 3VDBA 4CQCA 3GTNA 3LV5A 2Z1SA 1MO0A 1PL9A 2MANA 3VZZA 2GWGA 2OFJA 1P0KA 2QJMA 3MDUA 4PTWA 1DWHM 4AXNA 5CCZA 2WCGA 3KLKA 4LBRA 1LOQA 5LIKX 4ADTA 2JKEA 4DNMA 3LV6A 3JZEA 1O6IA 5BOOA 1WB0A 5C70A 2D20A 5ECVA 1FCVA 4XVDA 5DEZA 4WY0F 4XSMA 3AJ7A 5CPLA 5EBUA 1TPVA 3PN8A 2IXVA 3F5LA 2ODOA 4GMEA 4AWSA 1AJ2A 1E0TA 2ZX5A 3IJQA 3SCOA 1EXBA 3P82A 3WELA 2RKXA 3FK4A 3W1UA 2ICSA 2PDKA 3K8KA 2HXTA 3MUCA 3LRLA 3UJSA 3BAXA 3SW6A 2X0HA 3T4CA 5BXTA 4GY1A 1JPMA 2NVDA 4LAOA 1KFWA 3LGGA 4D6IA 1TSIA 1HJQA 5DY3A 1GG0A 3W4RA 1KV5A 3BANA 2IPWA 2CLPA 3FYPA 1PE1A 4LF2A 3R7MA 3IWPA 1OFDA 4ZMGA 2XIOA 3L0GA 4IJRA 4JFTA 4OQVA 4W85A 2QVNA 2ADAA 3WK1A 3UZYA 3ARWA 2ZX8A 2DIJA 4ILSA 3QV6A 1TA3B 4XTDA 3CS2A 1KW1A 3OG3A 1NF0A 4O1AA 4AD0A 2HV5A 1UMLA 2FMNA 3QYQA 3MPGA 1TZ7A 3ARQA 4PA8A 3C61A 1WO2A 1GEQA 1W5PA 1VBHA 5FF7A 2J8TA 1XHGA 2HS6A 2AOSA 3TN3A 1AVAA 3NZQA 2C3ZA 5C9UA 1XC6A 1E72M 1S5WA 1WKEA 4B3ZA 5G4WA 4N9CA 1XX1A 4S3KA 3W1LA 5HNUA 1EH9A 5HAOA 3F4NA 3MCOA 1N82A 3ZFHA 3PM6A 4MPQA 3VNJA 1EC7A 3KTCA 1I6NA 3FHAA 4P61A 5LHEA 3DC8A 1OFEA 3WX7A 2E8YA 3GFZA 4PMQA 3W7PA 1QNSA 1XD0A 2QXWA 1DWAM 5HJLA 5HWMA 2W62A 4PL2A 1R47A 3SM0A 1I1WA 2DVUA 1ISWA 3PPCA 4AEEA 4AD4A 3WLKX 1FKXA 2CKSA 4LC8A 2PGWA 2V6AA 1GZGA 3MSDA 3E0LA 1EHAA 5T8GA 5A6BA 1THFD 2G3IA 2IKIA 7CGTA 1HZYA 1W91A 3W25A 2X1RA 4DUWA 2AQWA 1XSJA 3WZ0E 1EJVC 4OBTA 1CXKA 3WLNA 1QU4A 4BHYA 1JDEA 1W3HA 3Q67A 3QHNA 5KZEA 3SY1A 5AKQA 2W0UA 4JY8A 3GTXA 2BP1A 4JL2A 3PP7A 1VIWA 1ZNNA 5BXRA 4XD5A 4TMBA 3ZJ6A 1GG1A 2NLIA 2B81A 4LC6A 4O12A 5GJMA 4D2JA 2OO6A 2DPEA 3LBMA 2W6RA 2CLLA 4E2BA 4O54A 5E0KA 4HPGA 2CZEA 3MA8A 2ZFAA 3L5LA 3VKKA 3H53A 1YDNA 3BVJA 3HIJA 3D46A 5AZ0A 4RKAA 1YKWA 7TIMA 4TVDA 4H7CA 4B91A 1K9DA 3N6QA 4U5IA 3LPOA 1Y5VA 2PDNA 2PDGA 5A6AA 2J9YA 2QAFA 1UPPA 1JUKA 3BMXA 3IJ9A 3KVMA 4PCTA 4E4FA 3VAVA 2PEVA 2ISFA 3P62A 1L6SA 1S5TA 4N2YA 3EDFA 2VQUA 5I78A 1VFMA 3W01A 3CYVA 1H50A 4XWUA 1MUWA 3VPLA 4TR9A 3BQ6A 4QRNA 2FZBA 4ZOCA 3WQOA 1UWTA 3EKGA 1JULA 2PDWA 3KAOA 5MF5A 2DQXA 2WK2A 2CHOA 4AIEA 3P0WA 2B0MA 3FAXA 3KBSA