2QJIA

M. jannaschii adh synthase complexed with dihydroxyacetone phosphate and glycerol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
271
structure length
271
Chain Sequence
ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPIKGLIDIRKTVNDVAEGGANAVLLHKGIVRHGHRGYGKDVGLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELVAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVVGITRAVCKIVHENADVEEALKEIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aldolase MJ0400
publication title Structure of 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid synthase, a catalyst in the archaeal pathway for the biosynthesis of aromatic amino acids.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 91
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.2.1.10: 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qjiA00
4IMDA 2ZFAA 1H50A 1FCBA 4LNYA 1N55A 3MO7A 3TDFA 5C5YA 1HO1A 5A8GA 1DVJA 1AMKA 2VFEA 3O15A 2BLEA 4LVBA 5HWMA 3CQ0A 4PEKA 4PTNA 1SPQA 2DORA 2FFCA 3G1HA 3EEGA 3W7OA 3KVKA 5AC8A 1F74A 1L6SA 4XQ6A 1TPEA 3PBWA 2G95A 2ISWA 1GTEA 2OT0A 4JTFA 3T40A 3HGJA 2CLIA 1W54A 3G1DA 2Y89A 4EWND 1NF7A 3LM7A 4CQAA 4FNQA 5FEWA 1YTEA 3HO8A 4MPQA 1OFDA 1W31A 2YCEA 3M6YA 4MZ1A 1NAL1 5AHFA 1KLZA 5HINA 4A29A 5DY3A 1UUMA 2W6RA 2J88A 3JR2A 1ZNNA 4UCGA 3TK7A 2RKXA 3HMJG 3TV8A 2WNQA 1W5OA 2YYUA 4UFKA 1EB3A 1XC4A 1A50A 1RR2A 2G97A 2X1TA 3GAYA 1H1YA 2BZNA 5LSMA 3A23A 4IXXA 2E68A 1ME8A 3HBLA 4MOZA 1TPWA 1VC4A 2Q3OA 3NO5A 4N4QA 3QQ0A 4PCFA 2TPSA 3GXTA 4J9JA 2GVJA 2C3ZA 1L6YA 4K7VA 4Y9AA 4Q4KA 1TPFA 1YDOA 3HJZA 4M5PA 4M7SA 4UTWA 2V81A 4PFMA 5AHEA 4IJBA 1XUZA 2AAMA 4MIMA 1JRBA 3TW7A 2H6RA 3L66A 3LRKA 3KRZA 5BRBA 3TE9A 4MZ8A 4YCPA 3PBUA 1VYRA 2HS8A 1SZGA 2NV2A 1R30A 3CWNA 4N02A 3EWBX 2RFGA 3EXTA 5KSWA 4NU7A 3G3DA 2HS6A 1V7YA 4GRSA 2Y61A 1I2RA 2ZQ0A 1R46A 2E77A 4M6PA 3TQVA 2PC4A 1SZNA 2JGYA 3INPA 2UV8G 3N2XA 3USBA 1SR9A 1DHPA 3TFXA 4Y8FA 5KZEA 3W2MA 4R7JA 3SI9A 3BLFA 3A21A 3GZ3A 2NZLA 3GVGA 4LVAA 4GE8A 4NJJA 2QUUA 1GEQA 4Y90A 1RZMA 1K7EA 4H3DA 1KM6A 3ABRA 5D30A 3G18A 3I68A 2XN2A 4YL2A 2GPTA 4NZJA 4NX0A 4AF0B 3P74A 1TTQA 4I7VA 5F2MA 3TW6A 4LVFA 2F7FA 2QCHA 3EWYA 3NL5A 3O05A 4X2RA 3KRUA 4QM1A 3LXBA 2YXGA 4PODA 1H7NA 1ADOA 4BI7A 1O60A 1JUKA 1QFEA 5C6MA 4IMEA 3W7CA 4FNTA 3V75A 1S5VA 2E6DA 1VCFA 4JN6A 2A85A 2TSYA 4XKYA 3ANYA 3P60A 3LCLA 5F4SA 3WK1A 2WSRA 2ZZ1A 3DXIA 4WY0B 5K4ZA 3SGUA 1UUOA 5TQLA 3EX1A 4ZQMA 3PUDA 1JCYA 2Y63A 3I6RA 1PV8A 2V0TA 2VFGA 1T0OA 4KKXA 3CHVA 4ADTA 5AHMA 2ALDA 1XDLA 4RXGA 5AC6A 1OF8A 4WY0F 4WZHA 1NF0A 3N3MA 1EP3A 3PBVA 3CWOX 5D2WA 1I45A 1Z44A 3IVTA 3EX3A 4RKAA 1MXSA 5IBXA 5LHFA 3UXDA 3W1MA 3DFPA 3C2RA 3PULA 5D2TA 2J6XA 4UFJA 1H62A 5L9FA 3LBCA 4P61A 3L0GA 3UWZA 5HR6A 2OMAA 5T26A 5MHBA 1VZWA 1FWTA 3PG8A 3STCA 1K8XA 2DZPA 1I4NA 3NM1A 4IX2A 3W7HA 3L9CA 3QRHA 2EGZA 3Q37A 5D2VA 2QCMA 3W88A 1T96A 1EWEA 3K30A 3MYOA 3UQNA 1NFBA 1X1ZA 1FBAA 1OYAA 3T78A 2HSAA 3A9IA 2CLKA 4K7YA 1H60A 4ZL1A 3GLCA 5H2ZA 1P0KA 5HWNA 2A7NA 3KXQA 1TTJA 5EL1A 1GQNA 4N4PA 3SGZA 3LHTA 1D3GA 5K7JA 3HGRA 5HR7A 3NQFA 4JGDA 3TU9A 3TA6A 4ONVA 2CU0A 3QF0A 3M5XA 4OT7A 3AJXA 3TROA 1GVSA 3DI0A 1SU5A 1TPVA 1K02A 4JTTA 1VJIA 4HNTA 4UFMA 3PAJA 3W2LA 4GUFA 4R33A 4O15A 2EAWA 4GUGA 5D02A 4HNVA 2GQ9A 2V2CA 4E38A 4C1LA 2ZZ5A 1QOQA 2VFDA 2X30A 3RF9A 1G6CA 3P67A 3TR2A 1VQTA 3NQDA 3UZ5A 4U4MA 4ORIA 3NQ8A 3G0UA 3FEMA 1SO4A 2WPBA 2TYSA 2EKCA 2J9ZA 3QH2A 2NX9A 2QCDB 4UXDA 4H4IA 2ZA2A 1ZAIA 2ZRUA 1YDNA 3LRLA 3L65A 4N9DA 4M19A 1I2NA 1MZHA 1GG0A 4TO8A 1NSJA 4MJMA 4WX2A 2VOMA 2DZVA 3MMTA 1YLVA 3O06A 5U7SA 5LNUA 1GG1A 3DENA 3PC0A 3LCHA 3LTYA 2E6FA 1X6UA 5F2LA 1TV5A 4O18A 3NGJA 3W1PA 3H54A 3HG3A 3HPZA 1ME7A 4OGZA 4JTEA 4KFNA 3ZWTA 3Q94A 4IUOA 3W1LA 3W2NA 1FWWA 3C6CA 4RZ5A 3U6WA 5I3GA 1SW0A 2FB3A 3C2FA 2ZRXA 1WBHA 2V2HA 4XTIA 1VCGA 2OT1A 1A5BA 4HKPA 3FIGA 4S1FA 2OJPA 1OX4B 4IMGA 4NJKA 4WQ6A 3VE7A 3PB2A 3S1UA 4UTWC 4ALDA 3LCFA 3LCIA 1DORA 4JTSA 3DZ1A 4GBUA 3CIWA 5SWUA 1TQXA 2GVLA 4LC6A 3DHFA 1KBIA 5H91A 4PC8A 2YR1A 3MHFA 2Y7DA 2CFFA 5LZLA 4JTHA 4RXFA 2C13A 2JK2A 4ADSA 3UZJA 1G4EA 3BW2A 3L5MA 1Q45A 3C4UA 2PCQA 5D33A 3P62A 3BG5A 3MUXA 3NZ1A 2R94A 4R53A 4DQWA 2A1YA 1EX5A 3ATZA 4JTLA 3QYQA 3PF3A 1W5MA 3LTSA 5IM51 3W7JA 1FXQA 1WV2A 1PL9A 1EUNA 3OG3A 4JR5A 3AO0A 2OZ0A 4MFDA 2I14A 4BK9A 1KM2A 4A21A 1FXPA 3IGXA 3NQGA 4O4VA 2VC6A 2P10A 5F1UA 4MY1A 2WNNA 5FESA 3I7RA 1G4SA 4JTGA 3UD6A 3G1SA 4OBTA 1O5XA 4DPQA 3BV4A 3NZRA 1PS9A 2DP3A 4O4WA 3GXPA 3CB8A 2ZTJA 1B4KA 4Z1AA 1ONRA 3UWUA 1QR7A 3EWWA 2EPHA 2JGQA 4IWWA 4O19A 4TIMA 3ZS4A 3DAQA 3DI1A 1UCWA 1RQBA 5D03A 4QJ1A 3HOJA 3NQVA 3BK0A 4A22A 3L68A 1LOLA 2GQ8A 1MO0A 3O16A 3O6YX 4NNBA 1Z48A 4ZQRA 3T55A 1JCNA 2BTMA 4EF8A 3BLEA 5EMUA 3B03A 5I3KA 4K39A 3A22A 3WJXA 4B5NA 1H7PA 1P1XA 2A4AA 5LGXA 5CKSA 1LRNA 1ICQA 5CZ0A 3W7NA 1GVFA 5DBTA 1THFD 2DU2A 4A2SA 3E02A 4RK8A 1W8SA 4BF9A 4E2BA 4HPJA 3V1PA 4AHQA 1QDSA 1H61A 3WJZA 2WQPA 1ZAJA 2ZZ4A 4LUIA 1LORA 1JUBA 4OU1A 2C14A 5F2IA 4C1KA 1IF2A 4JDYA 3UWVA 2VENA 4JX5A 1OK6A 2VFFA 4N6FA 4MKNA 4CNPA 3ABOA 3QSTA 1TB3A 3B05A 2BX7A 1YXCA 2GUUA 3HPXA 2VEIA 4CLMA 3M41A 3L67A 2H3BA 4IPIA 3RU6A 3BARA 2YSWA 3GXNA 3QJAA 3WJSA 4Z1DA 4UFHA 3VNDA 3PVFA 4JS3A 4FNUA 4QNWA 5FEXA 3UPWA 3NQEA 1TPDA 1OFOA 1KFKA 3KOFA 2Z0IA 5DELA 4IMCA 1KFLA 2Y7FA 1KFJA 3NQ2A 2DZUA 1TYGA 5CPOA 3TH6A 3LRMA 4LVGA 1KV5A 5FF3A 2H8ZA 1TCDA 1QMLA 3MJYA 3W2UA 3TKFA 1LCOA 4FB7A 3TUUA 3P8JA 1A53A 3QMRA 4K6AA 5F1VA 2YGYA 3DFNA 4JIQA 3QPYA 2Y88A 1G7VA 4NNCA 4LOCA 4CQ8A 4XZ9A 2NWSA 3DFOA 1GYLA 3MHGA 1OF6A 1EA0A 2YPIA 1I8JA 5G1YA 4CCEA 3OEXA 1LTDA 4WXZA 5LNSA 3UNDA 1EP2A 3LLFA 3L5AA 3IIXA 3UWQA 1IXNA 4UR7A 3W1RA 3LV6A 4XTDA 2C16A 3N9RA 4UTJA 3BG3A 4NJIA 4O14A 1SSDA 2ZRVA 1FCUA 4BWLC 4X3ZA 4DO5A 1XL9A 3GB6A 4LS0A 4NJGA 4N2YA 1P4CA 1SW7A 3FLUA 3D0CA 4FXSA 1LRQA 1J5TA 2OCZA 2ABBA 5C54A 1QPRA 2X1RA 3P61A 3QSRA 3KRSA 1M5WA 4MY9A 4UIOA 3CEPA 3S9YA 5F2GA 1VR6A 4MLJA 2FIQA 4GFSA 4AH7A 4FNRA 4O1AA 1F6PA 3W72A 4MYXA 1CX9A 1OX6A 1FX6A 2Q8ZA 3WFAA 3R89A 3B4UA 2G96A 3HF3A 4QSHA 2NXHA 4FEZA 5DCBA 4UMBA 1VGAA 2P0OA 3TXZA 4DO4A 1FDZA 4YWIA 1ICPA 1XKYA 4HSOA 4UR8A 2QKFA 2H3DA 2QUTA 4GNJA 3WK0A 1PVNA 8TIMA 3T7VA 2ZRYA 4JY9A 2NX3A 1LOSA 1OJXA 1A5CA 2ZBTA 4HNNA 5DXXA 5CZSA 5EBUA 1K8ZA 1VYSX 2C0AA 5K2ZA 1DQXA 1FCQA 4O52A 2J9YA 3TNOA 5AFDA 5E0KA 3W7LA 3EX2A 1RD5A 4MY8A 3W7PA 4A2RA 3I7QA 3UXAA 4O57A 2QJGA 1BWKA 3G1VA 2CLOA 3CIXA 3M7WA 3NPWA 3GNDA 3WJYA 5AHNA 3KAOA 3ZR4A 2CZ5A 1W3IA 2Q3RA 1GVOA 2WOQA 5G4WA 3W22A 4O50A 4UMCA 5J5DA 4FX6M 1KTNA 2FB2A 2QDHA 3LHVA 3E9AA 1NEYA 1DQWA 1C9DA 4BR1A 2CWNA 4JYEA 4ZQNA 4TR9A 5DLCA 1SZEA 1YXDA 2DZSA 2J24A 1SZFA 3O6DA 3N19B 2TMDA 3LHUA 1G4PA 1DJQA 1K8YA 1JR1A 1M7PA 3S5ZA 2CW6A 2PRHA 3KFTA 1YPFA 5FF2A 5J5RA 3NNTA 3S5OA 1YADA 3QMTA 4FNPA 1BEUA 3KVMA 1RQHA 1E51A 1H7RA 3C61A 4R34A 4ZMGA 3THAA 1F7BA 3L5LA 1RQEA 3W2JA 3NR0A 4UTUA 1A5SA 3MBDA 3MP5A 4EOUA 2ZZ6A 5CPLA 3HG4A 4Q32A 3OA3A 1AL8A 1TRIA 3W71A 4Z0JA 3M5VA 4EF9A 1I2PA 2X1SA 5K4XA 4E2DA 2E09A 1PIIA 1GOXA 4JYFA 3W7DA 2PRLA 1XXXA 1KW1A 3RLUA 1X7FA 2GJLA 2VEMA 4IXHA 1RV8A 3C2OA 1OFQA 3LCWA 1X1OA 2ZRZA 3M5YA 3N14A 3NPVA 4BFAA 1M7OA 4LRSA 4TMCA 2B4GA 3W1XA 4LC8A 1W3TA 3DKJA 4JDBA 2RDWA 4QISA 3BLIA 3NQMA 2QDGA 4AAJA 1LM1A 4O54A 5G2WA 1SO6A 5CPNA 2RDTA 3GX9A 1Q6QA 4AWTA 5D38A 5TBOA 4XKYB 2QJIA 4LT9A 3ZWSA 3GKAA 4ZQCA 4RZ6A 3SFKA 3MWAA 4NX5A 4Y96A 3W3OA 3B0VC 3M16A 1OFBA 2WKJA 1TPUA 3M0ZA 4LRTA 5DN1A 3KVJA 1QPNA 4O16A 2V30A 1TQJA 3R12A 2EHHA 5FF0A 3W7MA 3LOTA 1OFEA 2GOUA 1B9BA 1VCVA 2WV8A 3GYEA 1HL2A 3GDLA 3A24A 1QCWA 4CNOA 4LY8A 3PBYA 1L2UA 4UNKA 5DCEA 3CT7A 3T4CA 1OX5A 3OBKA 2RDUA 2ZDRA 2WSYA 1C8VA 1H63A 4LS2A 4K36A 3W75A 1DL3A 4AHOA 3TSMA 1XUUA 4ZZ9A 3TC6A 2VEKA 3STFA 4IPJA 2QCNA 2A0NA 2CLFA 5AN7A 1EEPA 5KZMA 5HWJA 3R13A 5AYXA 2E1DA 1TRDA 3C2EA 1N8FA 3P8IA 3N9SA 4TMBA 4EVZA 4BWLA 3RFAA 1KM3A 2C18A 3O8AA 5KITA 3UPBA 5D37A 2H8XA 2I1OA 2YYTA 1H7OA 3I65A 1GZGA 1KTBA 3G0XA 1C29A 1ALDA 4POCA 5AHLA 1WYIA 3TSDA 3VE9A 3ZFHA 3W7EA 3W85A 3E96A 3WK3A 2Y62A 4M6QA 4FXRA 5HJLA 4HN4A 2ATMA 2ZTKA 2ZRWA 3DBPA 4DF0A 3W84A 3GDTA 3TSBA 1GJPA 3P80A 4M6VA 2V2DA 5AHIA 1OK4A 1XM3A 1OABA 3QC3A 4AVFA 3SZ8A 3A5VA 4UTIA 3EWUA 1GWJA 2QUVA 4XUGA 2NV1A 3W2KA 1IXOA 2CZEA 1NVMA 3PUEA 3GK0A 2P1FA 2I9EA 4N9BA 3S0CA 1ZCOA 3IIOA 4Z1BA 3M5ZA 5LNWA 4RCXA 3W6YA 2C15A 5G2IA 1CW2A 4FX7A 2Q8LA 2NXGA 1UBSA 5DY2A 4KFOA 1AL7A 4DXVA 3CEUA 1KFCA 2E6YA 2CLLA 3FYPA 3W70A 5G1TA 3MI3A 1Y0EA 3IGSA 5AB3A 3FA5A 4KWWA 4QNEA 2KZHA 3R2GA 4IX0A 4LWWA 1B4EA 4KFPA 3CPRA 2VEPA 4UTHA 2VKZG 3YPIA 3DGRA 4LS1A 1K03A 2JKEA 4I7UA 4AEOA 2C19A 5AC7A 5C2XA 1B3OA 2YFNA 2J9XA 4RZ4A 3W7GA 1IXQA 1K3UA 5BMWA 5K9XA 3PY2A 5D04C 3B04A 1SSGA 1LRTA 3CLMA 1H1ZA 3QMSA 4I9AA 2WNZA 3S1VA 2VFHA 4ORMA 2YZRA 1KM1A 5U4NA 1L9WA 3L2IA 4K8EA 3LERA 4TX9A 1W56A 4PH6A 1XDMA 2ZZ3A 3LBMA 1XBXA 1R2SA 1YYAA 4IOTA 2NUXA 3U8GA 1W0MA 5GVJA 5I3FA 7TIMA 2QF7A 3C56A 3E49A 5CZTA 3C3NA 3G0SA 2R14A 4N6EA 4UFIA 1N7KA 4JNMA 2VXNA 1MEHA 2YW3A 1OYBA 1X8FA 2B7QA 1H7XA 3UWYA 2R91A 3O6CA 3EB2A 3STEA 4MJZA 4BI6A 4JIPA 1W5NA 4LU0A 1S5TA 3MYPA 4LV4A 1VYPX 3BPWA 3JRKA 2DZTA 1DV7A 4ZVJA 1Q3NA 3RMJA 3DHDA 3FKKA 1TIMA 2Z1BA 1OG0A 5EYWA 1GYNA 4NXSA 4YLWA 1BWLA 1EWDA 4W9TA 3FOKA 3SIZA 2HTMA 2GJNA 3F4WA 3S1XA 3ABSA 6TIMA 3ATYA 4O28A 5L6UA 5I3IA 2IQTA 1EIXA 4QITA 5I3JA 1PHWA 1I2QA 3QQ1A 1ME9A 5EPDA 3GR8A 3N2MA 1LROA 1OVDA 4JY8A 3IIPA 1LP6A 4OV4A 3O1NA 4UMAA 3W1NA 4UTMA 2QCEA 3FS2A 1QNVA 1ZHAA 5FF7A 2G5WA 3GAKA 4H6KA 1U5JA 4S2CA 4OQVA 1T99A 2NWRA 3TQKA 3HB9A 1ZJIA 4O1DA 5AOUA 1SQ7A 3GDRA 1VLWA 1TREA 3CTLA 4LV9A 1YDVA 2ISVA 2GVGA 2NUYA 1S3HA 4LTSA 3HGOA 3TMLA 4NJHA 1YTKA 4JXCA 1KBJA 2OX1A 5K9DA 1WOAA 4FIRA 3SSJA 4GUJA 1TMHA 4MUZA 1LOQA 6ALDA 4KWVA 5CPMA 3IIZA 1ZY9A 5DBUA 1SW3A 2BXVA 3MW7A 4I7WA 3PSWA 2JKPA 4JTKA 4HNUA 3TX9A 1WAUA 2BWGA 3FJLA 1XI3A 3W76A 1F73A 1ZAHA 2FLIA 3BVJA 3HIJA 1P0NA 2CLEA 4CCDA 4CCCA 1TPH1 4S2BA 2E5BA 4P2VA 4WD0A 5HQEA 3FYOA 3NQAA 2PURA 1TJPA 3P7YA 3EX4A 1DKWA 4Y6GA 1BTMA 1O95A 3NM3A 1PE1A 3LV5A 3LI0A 3OVQA 4CQ9A 1O4UA 1MEIA 3QZEA 1EP1A 4NUWA 3SJ3A 4FO4A 5AYZA 1TPC1 3BO9A 3S8HA 1LZOA 3C52A 2VFIA 1SFLA 2NXIA 4QQ3A 3TXVA 1KFBA 4OE7A 3IRDA 3HPSA 4DBDA 3VCRA 3G22A 1RVGA 5K3VA 5DXYA 3BW3A 4M7TA 3TC7A 1SO3A 1LLZA 2R8WA 5EY5A 1AW1A 3VFLA 1LBFA 4XWUA 3UYCA 1JVNA 1QPOA 1XBYA 1Z42A 3NL2A 4FIQA 1IIGA 3LB0A 2DZXA 3LCGA 2QAFA 1FDJA 2F84A 1FCVA 1XCFA 3S6DA 1XFBA 1U83A 1UASA 3FJ6A 3QPZA 4WXYA 1I2OA 1O94A 4XBKA 3W7RA 1WBJA 3GDKA 4O1BA 5D32A 4QIUA 2CZFA 3JS3A 1DJNA 5KMYA 5G4EA 1TSIA 2X2GA 1WX0A 1LBMA 2Y7EA 3HG5A 4WUIA 3W07A 5BOOA 2A7RA 4ADUA 4O1CA 1TV8A 2PRMA 3C0JA 2AQWA 3Q2DA 3MHUA 4FNSA 1H51A 1JULA 2QEZA 4AMAA 2FDSA 4JEQA 3W23A 1FUYA 2CLHA 4ML9A 4O8RA 3B0PA 3KX6A 1RPXA 1TTIA 2JBMA 3BGJA 4O13A 1D3HA 3B06A 3HG2A 2ZZ7A 3DKLA 4O0KA 1YPIA 3HQ1A 4AF0A 3W9ZA 3PG9A 1KM0A 4O12A 1OFRA 3R5EA 4GJ1A 4K37A 3QEZA 3UWWA 1QO5A 3IV3A 2NUWA 1HG3A 1JQXA 3H53A 5HUPA 3T44A 5KINA 1Q6LA 4FX8A 5ABTA 2RHGA 5DCDA 3LTPA 2DJXA 2X16A 3MI6A 4Z1CA 2A7PA 2YX0A 3M43A 3TAOA 3NL6A 1TO3A 4IGHA 2GQAA 4K38A 1KLYA 3BW4A 2D73A 2DJLA 2YW4A 3MBFA 2QCGA 3HGSA 1GT8A 2FPTA 3NOEA 2Z6IA 1PCWA 3NDOA 3P84A 4WY0A 1F05A 1HFBA 3L0KA 5HNRA 2NLIA 3UY8A 1J4EA 3H55A 3LXAA 5D05A 4UTLA 1EPXA 2WSQA 4BI5A 5CSRA 1FQ0A 1H7WA 3LLDA 4MYAA 1SUXA 1JCLA 3NAVA 4DPPA 1ML1A 3G1AA 5D2YA 2ATSA 3LCXA 3Q58A 5LKYA 3NQCA 1ZENA 3PSVA 4JD4A 4FHAA 4XBSA 1CI1A 3G8EA 2YFOA 3IVSA 3OIXA 4OHQA 1TTPA 2EF9A 1XBVA 2A2IA 4RV8A 4RX0A 4K8HA 1L6WA 4QAIA 4GWEA 4HSNA 5E93A 5A5WA 2O7SA 1R2RA 2FTPA 1QO2A 3KVLA 4JX6A 4AXKA 4RLIA 1W5PA 3W1UA 3DFQA 5BNKA 2QCCA 4Z0SA 3VKJA 1GVRA 3W87A 2LLEA 3F03K 4UTTC 1FY6A 2YDAA 3OVPA 4X22A 5G2HA 1Q6OA 4O17A 3TFCA 2W0UA 3EX6A 1HTIA 3P81A 4UUIA 5G5IA 4A3UA 2WO5A 3PM6A 4MFEA 2QCLA 2VELA 5KZDA 2A6LA 3F1QA 2FQIA 1K7XA 1ICSA 1TJRA 2NX1A 2XFWA 2XN0A 2HMCA 1WA3A 3NPXA 1MSSA 2ISSA 3L0NA 2E5CA 3N73A 3GIYA 1IGSA 3RLVA 4O10A 1G7UA 3GDMA 3G1FA 4JX4A 3M44A 1OHLA 1F2JA 3DFTA 3IIVA 4IMFA 3EKZA 2E5DA 1HO4A 1B57A 3G1YA 3SW6A 2FJKA 3GKFA 5LNRA 3EXSA 2V9DA 3MP3A 3QW4B 4O11A 3W1QA 1LBLA 3S1WA 3CU2A 1W5QA 4NZFA 3SR7A 2QCFA 5BMXA 3LHZA 1JCMP 4YMZA 5HMSA 4ZQOA 3WK2A 3LGEA 1J2WA 4L4LA 1JQVA 3NVTA 3IGUA 1F76A 1UJPA 5KTLA 1QPQA 3M1ZA 1QWGA 4O53A 2QCDA 3CC1A 3NG3A 4LW7A 4NXKA 1KTCA 4HPXA 2E6AA 2ZA1A 1FWSA 1EUAA 1LDCA 5E1QA 4UC5A 1UB3A 1YTDA 1PHQA 1G69A 1IXPA 2J27A 5LHEA 4RJEA 1OFAA 1TPB1 2B7PA 1PCKA 3NQ6A 2V8ZA 2ZZ2A 1W3NA 4AHPA 1WDWA 3VI2A 3UY7A 2PE4A 5FEPA 2BSLA 3IEBA 3TMQA 5TIMA 4HT3A 5FI8A 1OYCA 3SY5A 4ZQPA 3C8FA 4JYDA 4OWGA 3LDVA 2C6QA 1JUEA 1FDYA 2B7NA 5F4WA 4N9EA 3W7KA 2Z6JA 1GTHA 3NA8A 3W7IA 1JCXA 1M6JA 1JCJA 4DF1A 3TCEA 3KHJA 1OX4A 4DEFA 3PS7A 4LUJA 4YXGA 3P5ZA 1R2TA 1OFPA 1S5WA 3PWAA 1G4TA 1ZFJA 1R47A 3IVUA 3TIMA 5LGZA 4NVTA 3GR7A 3W1TA 1QOPA 4WJEA 3LX9A 1WOBA 3LHYA 3MP4A 3W7QA 1O5KA 4NNAA 1VLIA 2V5LA 1P5BA 4MVAA 3EWZA 3PB0A 1LLWA 2QJHA 3NPUA 3MI2A 3P82A 4PL1A 2Y85A 4JTIA 4N9CA 5AYYA 2Z2UA 3W74A 2C1HA 3G3MA 1WXJA 1KV8A 3ELFA 3NEVA 2JKAA 2O7QA 4UFLA 4NQ1A 5HULA 1DOSA 3G8RA 3FFSA 3TJLA 4DO6A 2A21A 4LVDA 3RNDA 2V82A 3A5FA 1WQ5A 3S5YA 3QW3A 4WOZA 3NL3A 5CG7A 4RR4A 3PUOA 3CM4A 4L4MA 2TRSA 5EKYA 3TAKA 3F4NA 4PL2A 3OVRA 4AB4A 4NT0A 4ICNA 3NYZA 3TQ0A 1GPWA 4JTJA 1V5XA 3RK8A 3C2VA 5CSSA 1SO5A 4HIBA 3DH7A 1QAPA 4GUHA 3L21A 1W1ZA 1KM4A 4JICA 3LI1A 3DFSA 1G67A 4MZYA 1DBTA 2W79A 1KM5A 2ZCGA 2Y6ZA 3B8DA 3THQA 3LHWA 4TU1A 1FWRA 4JTUA 2B0MA 1VHCA 1W37A 1XBZA 1D9EA 1JJKA 1MEWA 4DBEA 4GUIA 4GXMA 2A6NA 2QAPA 2ABAA 2XN1A 2Y7GA 4U28A 1GVQA 3TJXA 4AWSA 3SECA 4Q33A 3P5YA 3G24A 5CGQA 4FF7A 2FPYA 3N34A 1AW5A 2ZA3A 3EXRA 3DU0A 2AGKA 5F4XA 3EKLA 4UTTA 3FKRA 1KA9F 4EIVA 3PR2A 4O0ZA 1KFEA 1Z41A 3WJWA 1VH7A 2WJZA 2A5HA 5D2XA 5LNVA 3U2OA 3W1AA 1AW2A 4DELA 5C55A 3S5NA 1VRDA 4G1KA 4MLRA 3O07A 3NXFA 3OHIA 3E0IA 1AK5A 2CLMA 3QFEA 4X9SA 1BKSA 3ABQA 4UNLA 3W83A 1K7FA 4UTKA 3B0UX 1VHNA 3M47A 1VPXA 4HHPA 4OV9A 3W73A 5HUOA 3I7SA 3W86A 2FPVA 4D2JA 1Q6RA 2B7OA 4E0CA 1FWNA 4PA8A 2RH9A 4WOQA 4CNNA 1HUVA 1AG1O 1VS1A 1F6KA 5IBXC 2X1UA 2V5BA 1A5AA 1SFJA 4YCOA 3BGGA 3LXCA 3M9YA 5I3HA 3STGA 2ZYFA 1T8XA 2DZWA 1H5YA 2H90A 3EWXA 3NQ7A 3G1XA 3O63A 4IQLA 3BG9A 5EA9A 4DF2A 3S42A 2QR6A 3QM3A 2Y70A 4GC4A 2CZDA 3GNNA 1TV7A 4Z08A 5FEZA 3E12A 1YXYA 4AWUA 1ZALA 1LYXA 3R8RA 5FF4A 1JRCA 1F5ZA 5D09A 5K9CA 1IIHA 5CZJA 5BW6A
chains in the Genus database with same CATH superfamily
2ADAA 4QAWA 2ZFAA 2WWDA 1H50A 3Q67A 1FCBA 4RNFA 1N55A 4B3ZA 1V0MA 1HO1A 3IS4A 5C5YA 3O15A 2BLEA 3S5SA 4QLLA 1MQRA 1SPQA 1BXCA 4DJFC 3EEGA 2NQHA 3EGJA 2HE5A 4LUSB 4XQ6A 3HN3A 2CNCA 4QJ4B 3R25A 2G95A 2C79A 1EC7A 4J28A 5AVHA 1EOKA 1VFUA 1E5JA 3LM7A 4CQAA 1ZL1A 4FNQA 5FEWA 4MPQA 3RCNA 3OP2A 4JL1A 1NAL1 3V5FA 3WD4A 4KEMA 3IUDA 4XAFA 2BY1A 3A12A 3EPOA 4ZA0A 4MG4A 2WNQA 4IFOA 2YYUA 3EMZA 4ZSTA 1JEZA 3WZ0E 1XC4A 2G97A 2X1TA 2OZ3A 3WH8A 4PRRA 4JPGA 1WUFA 3A23A 4DLMA 2PDUA 2PTXA 4MOZA 2Q3OA 1UG6A 4QS5A 2C3ZA 1AJZA 5AZ1A 3IJIA 1TPFA 2QXWA 3UWEA 1EDQA 2X0SA 1XUZA 3O0FA 1JRBA 3VIOA 3TW7A 5HANA 1VFSA 1J6OA 3PJWA 2VX4A 1XHGA 1P6CA 2NV2A 2WKLA 2FZDA 1FH7A 4HA4A 1U33A 5ABGA 3SUUA 3EXTA 4NU7A 4NAFB 1BSIA 5A8OA 2HDJA 3UZXA 3USZA 1K77A 1R46A 2PC4A 4HYVA 1DHPA 5KZEA 1F3XA 4R7JA 4C6LA 3FDGA 4G7EA 3NGFA 2NZLA 5H8MA 1I0DA 4AIEA 3CH9A 1GEQA 3UVIA 4Y90A 3ABRA 2PLMA 4OJYA 3G18A 1IWBA 4TX6A 2EPKX 2WSKA 2GPTA 3II1A 1V3IA 5DMYA 1XLCA 4AF0B 1TTQA 4I7VA 5F2MA 2H9AA 4XK2A 4BQ3A 4KEZA 2F7FA 2QCHA 1E9YB 2J7HA 3A4JA 2G3NA 3KRUA 4X2RA 1JUKA 5HQMA 4FNTA 3V75A 1OCJA 1VCFA 4JN6A 2A85A 2RDXA 4KEUA 3WK1A 2ZZ1A 3DXIA 3VM5A 4IZGA 4K2SA 4E4PA 2ZIDA 4GGHA 3SGUA 3QKZA 2ZUMA 3MSGA 1REQB 1XLMA 4HMDA 2XIQA 4PEEA 1XLFA 1NARA 1L8NA 1W3KA 3WQCA 3WQ5A 2D1ZA 5AHMA 3MVIA 1RXOB 1OF8A 4WY0F 4GX8A 4RNJA 1E0VA 4R85A 2C8NA 2IPJA 3N3MA 4BCEA 3U0HA 5D2WA 4HD5A 5GNZA 2OGYA 3UXDA 3ONBA 4F0MA 2WAGA 3C2RA 4C1NA 4O8AA 5ABFB 4UFJA 2PWHA 2X0YA 4XO7A 3NQBA 4AC7C 1MNSA 3WH5A 3MWCA 4PUJA 5A8QA 2BODX 2BNJA 2XTKA 1H11A 3R7MA 3WY1A 3PZMA 3GH4A 1IR2A 3H4XA 4QLKA 5FIPA 1K9DA 1K8XA 1V51A 3W7HA 2VQUA 2VHLA 4NI8A 3SCUA 3WQFA 3W88A 2Z27A 4GKTA 2QV5A 3K30A 1X1NA 2BFGA 1T41A 1FBAA 4S3GA 2HSAA 2G3JA 3GLCA 5ENLA 3N15A 4KERA 3WBEA 4IIEA 1GQNA 2V3DA 2D2JA 1D3GA 5HR7A 1W6TA 4DLFA 2PF8A 3IUIA 2EO7A 4QR6A 1S1PA 1W1PA 1POKA 5I02A 3QF0A 2XDFA 2HROA 1KGUA 1XV8A 3KWSA 1JZ8A 1TPVA 4HNTA 2NQZA 4JHOA 4YU1A 1YRRA 4GUFA 1RVKA 4O15A 1UD4A 4IFKB 4HOZA 3V5OA 3GHTA 3BUVA 2V2CA 2HK0A 4C1LA 1CLKA 4QEHA 2PI6A 3RX3A 1V6UA 3TR2A 3FK4A 4ACYA 3NQ8A 1C9WA 3FEMA 4C6IA 2F8QA 1SO4A 4YVPA 3T08A 1IQ8A 2VTFA 3S1GA 1IEXA 4GZEA 4UXDA 3GNRA 4M8UA 3VNJA 1XD0A 3QTPA 3ERPA 4OIFA 4AX7A 1OBAA 4JFTA 4L9XA 4TO8A 1NSJA 4WX2A 4BKNA 3UJ2A 2DZVA 3O06A 2VD9A 1V3JA 4I3GA 3PC0A 2OVLA 2E6FA 5JUVA 4RE4A 4GG9A 3NGJA 3F2DA 1RCXB 3UEQA 1LWJA 4OGZA 1E56A 1KD0A 1K4GA 4IUOA 3W1LA 2WCSA 3C6CA 4RZ5A 1UP0A 5I3GA 3EA1A 2FB3A 2VZSA 1WBHA 4ZE5A 3GBEA 4HA0A 1WCGA 1JYWA 4J2MA 4S1FA 1OX4B 4WQ6A 2ZXBA 5BXPA 4WJXA 3DFHA 3LCIA 3EPMA 1O7AA 4GBUA 5SWUA 4LC6A 3AIQA 4RV3A 4UZUA 2ZE3A 2YR1A 3BWWA 3MHFA 2Y7DA 3EWDA 3MUIA 4M80A 4NG3A 4C6BA 4RXFA 4XISA 3UZJA 1G4EA 3BW2A 3QGAC 4A8RA 1R6WA 1ZZMA 1YQ2A 1UZHA 3AC0A 3ITLA 2PLJA 5FD0A 4R53A 4DQWA 3ATZA 4XAGA 3CYJA 4IPNB 4JTLA 4K68A 3HQOA 3PF3A 3LTSA 1XSIA 2DVUA 4Q8QA 3W7JA 1B30A 1U22A 1PL9A 3OG3A 1LLOA 4UR9A 4XZIA 4BK9A 3BAWA 1KM2A 4A21A 1AQMA 1FXPA 3BAIA 3IGXA 1V0KA 2P10A 5F1UA 3B9EA 4NL1A 5FESA 3CZJA 3UD6A 3G1SA 4OBTA 4HK7A 5FKYA 3T09A 2XSAA 3BAXA 3NZRA 4ICMA 3CV7A 2DP3A 4O4WA 3U57A 4Z1AA 5LYRA 3GHSA 4PB3A 4AISA 2UZ9A 3M0XA 4LB4A 3F2CA 4IWWA 1F3TA 4WSKA 3U2CA 1V79A 3DI1A 1K6WA 1EL3A 4QJ1A 1CGVA 4A22A 2QHAA 4DWSB 3BAKA 1LOLA 3UZWA 2DT2A 1CDGA 2BVWA 3O6YX 3OGVA 4G7FA 4NNBA 2EBNA 4ZQRA 3T55A 1JCNA 2BTMA 5M2FX 3WIJA 5EMUA 4E8CA 5I3KA 4K39A 3ZT7A 4FLSA 3WJXA 2ICSA 2BBFA 3LSBA 1DIDA 1H7PA 1P1XA 2VO5A 5CKSA 1CWYA 3AYSA 1ITCA 2OLHA 1I6NA 4JIHA 2DU2A 1KXHA 4A2SA 3WUGA 3MY9A 4RK8A 3EEZA 4HPJA 2MUCA 3GWQA 1QHPA 3IAQA 2HISA 6REQB 3WJZA 1IZCA 2OB3A 4HQVA 1CXHA 1ZAJA 2QUNA 4LUIA 1JUBA 2WC7A 1QBAA 4AZ7A 1PX3A 3AMKA 3VIJA 3WNOA 4C1KA 1IF2A 4JDYA 3OLGA 4PSRA 4HTBA 4LSBA 4MKNA 1MYRA 1V6XA 3F5JA 1SJDA 4QDMA 4PUKA 1QW9A 2H3BA 1M04A 4ZTYA 3BARA 2D3NA 2HRWA 2V67A 3TJIA 3T8QA 3LM3A 3VNDA 4J3VA 2FJUB 3AU6A 3L2LA 4U2YA 5CLTA 1SR0A 1UMLA 3UPWA 3ENLA 1MUWA 2WXDM 4LAKA 3A3XA 3NQ2A 2DT0A 1TYGA 3TH6A 4TQTA 1KV5A 2Z1XA 3W2UA 4FB7A 3TUUA 3E0WA 3VDAA 1O12A 3RITA 3I6EA 3VFCA 2Z29A 4C6FA 3N9KA 1KNWA 2YGYA 2B81A 3VIFA 3S2MA 3QBUA 1GYLA 2YPIA 5CJ5A 1EP2A 2DW6A 2OSXA 4U5KA 4GHRA 3UWQA 5REQA 4UR7A 3LV6A 4XTDA 2C16A 2XGZA 3N9RA 4UTJA 5JBFA 2DSZA 4O14A 1SSDA 1JXKA 4X3ZA 2Z1SA 4DO5A 3GB6A 2QPUA 4LS0A 3FA3A 3H24A 1LRQA 1BGAA 4DBUA 2X1RA 5EMLA 4ZBCA 1M5WA 4UIOA 4Y9OA 2YL6A 3RO6A 4A3YA 2NW0A 1K9TA 1F6PA 1W2PA 1FX6A 4KEVA 3P2VA 5HDRA 2G96A 3HF3A 4FEZA 4UMBA 2WKGA 2PDMA 3VINA 1L0PA 1XKYA 3S9IA 2QUMA 2QKFA 5BU9A 1HGWA 1BKHA 1W8GA 4JY9A 1ZCCA 4Z17A 1M1BA 1MWOA 1CGUA 4HNNA 5DXXA 1PZ3A 5CZSA 2YXXA 4HN8A 2PDGA 4OOUA 1UIPA 1FCQA 1S5NA 3GVRA 1X6LA 5AFDA 1VBUA 2VT0A 3KP0A 1L6GA 4IMAA 4S23A 1LUCB 2FZMA 3FGCB 4J4KA 3M7WA 1E4MM 3GNDA 2J7FA 3WNMA 1TWIA 5DMLA 1BQGA 3WMBA 1CGTA 3AIUA 2Q3RA 1KRMA 3BLOA 2VUNA 3E0FA 2WOQA 2GOKA 1WO2A 4QGCA 4WKFA 4FX6M 2FB2A 4U31A 2OWXA 3WNNA 3AUOA 1TKKA 2FH6A 1E4IA 3SIMA 5I78A 4H04A 4ZB5A 4TR9A 2VX7A 1WUEA 5DLCA 2XWDA 3UZYA 1EJTC 1ZSXA 4PSPA 3GDBA 3N19B 3AIEA 3KS6A 1G4PA 1HKJA 1TA3B 3OJGA 2IQDA 5HOSA 4L7ZA 5T9BG 1B3WA 1RQEA 2ZX5A 1J0IA 5CPLA 4QFUA 2YA2A 1TRIA 4AD1A 5C7VA 4MWAC 2FKPA 4J3ZA 1I2PA 2X1SA 5K4XA 4E2DA 3GNPA 3UCQA 2PRLA 1KW1A 4LX4A 2GJLA 4U2ZA 1GQIA 4WKHA 3C2OA 3L4XA 2HVOA 3LCWA 2ZRZA 3M5YA 3N14A 4EK7A 4ATWA 2W63A 4LRSA 3W1XA 3DKJA 2RDWA 2QDGA 2RDTA 2AKMA 2D2GA 1M7JA 4AWTA 3TYUA 4ZQCA 4RZ6A 3SFKA 3P6LA 3MWAA 1ZP3A 3B0XA 4NX5A 4WDUA 4DYJA 3W3OA 3NJ3A 1E43A 4LRTA 3WD2A 2JIEA 4W85A 1QPNA 4ZENA 1YHTA 4O16A 1JDCA 2V30A 4I5XA 4DX3A 1EFZA 1TQJA 1VJSA 2EHHA 2V5DA 5FF0A 3GG7A 3LOTA 2CYGA 2GOUA 1HL2A 1QCWA 4LY8A 3PBYA 2J47A 3HA1A 4ACZA 5DCEA 3PJTA 3N04A 1XRFA 3TWAA 3H6OA 1OX5A 2ZDRA 4Q6JA 4A4AA 3OBEA 1ONXA 4K36A 3W75A 4AHOA 2VEKA 4XAPA 3TCSA 2C1IA 1A0CA 4LEQA 3GNXA 2A0NA 3ZOAA 3D46A 3C3UA 3SB0A 1VPQA 3DHPA 4YIWA 3N9SA 3RFAA 2J7CA 1TR1A 5KITA 5D37A 1MNZA 2YYTA 3ZXWA 1ZP4A 2RGLA 4XZWA 2AQVA 4QTGA 3CJPA 1VBJA 1VFTA 2A3HA 1E4LA 3ZFHA 1GHRA 3W85A 4AZ5A 1DE6A 2ZUSA 3WK3A 2Y62A 4M6QA 1R85A 5CC7A 2ATMA 1QJWA 3DBPA 5HK4A 1GJPA 3QC3A 2CC0A 4AVFA 4B9ZA 2E3ZA 4NY2A 2QUVA 4S39A 4V1XA 1AH4A 3IARA 2PDLA 4QX4A 5CAHA 1W1IE 2Z2AA 2Z1KA 2PTWA 1XKJA 5LNWA 3UR2A 3WMCA 3PTMA 2Q8LA 2NXGA 5HPOA 1MUCA 1YX1A 3H2FA 4M56A 4DXVA 1U1HA 2IKJA 2E6YA 2CLLA 3KCOA 3A6OA 3PTKA 4WSJA 3V0SA 4RE0A 3R2GA 3GHUA 1B4EA 3PZ9A 3FXYA 2VEPA 1UWRA 3DGRA 3VK5A 3DUGA 1K03A 4HOWA 2C19A 3BGAA 1FFRA 4RZ4A 5BMWA 3FJ4A 3CL8A 2EEXA 1Q13A 4NHVA 3KUMA 3L23A 3CZKA 3S1VA 2ASHA 4XO6A 3H23A 4ORMA 3LG3A 1L9WA 4TX9A 1W56A 1XDMA 3REQB 2YB1A 4ROPA 5FACA 3LBMA 5I7GA 4R9OA 2XWEA 3VDCA 3KE0A 5AZ0A 3CMFA 3VX1A 2IKGA 4Q8NA 1IEWA 7TIMA 3E49A 3PP7A 5CZTA 1BRLB 2R14A 1KGXA 3CIVA 3WMLA 1B3XA 3N25A 2YW3A 5EU9A 1ISYA 1X8FA 3N2CA 3A47A 2R91A 3MA8A 2YA1A 3UR5A 2WPGA 4BI6A 2E4TA 1S5TA 1VYPX 4FP1A 3JRKA 3MCMA 3HZ3A 5EGRA 4ZVJA 1RBLA 1W1A1 3KBNA 2VR4A 3RMJA 4X0VA 1TIMA 1ECEA 5EYWA 3RCYA 2FZBA 3SIZA 3KCLA 3RPTA 2HTMA 3ALGA 2G0WA 1TFVA 1UC4A 1YDYA 2F6UA 4C7FA 4QITA 3QQ1A 3MSYA 1U2YA 3WH6A 2JE8A 1FHLA 1LROA 1OVDA 4JY8A 2TAAA 3M6DA 3IIPA 2YL9A 3PZTA 4M3PA 4UMAA 4NYUA 3W1NA 3VABA 4E4UA 3FA4A 1QUMA 2X0HA 1EIBA 1ZHAA 1UA3A 2G5WA 5FF7A 2E67A 2AL1A 2J4GA 4OQVA 5BXTA 2ZUNA 3EDDA 2Z24A 3TQKA 4O1DA 2J8FA 1SQ7A 3OB8A 2OTDA 1NELA 4KIRA 3HGOA 4ERGA 2WHJA 4NJHA 1J10A 5FA5A 4JXCA 1AZ2A 3WDRA 2D2OA 4Q4MA 4GUJA 1TMHA 2REQB 2WSPA 3BOXA 4Q8OA 5DBUA 1UQZA 4I7WA 3TX9A 5TNVA 3OGSA 1F73A 4R7WA 2FLIA 2VC5A 4CCCA 4S2BA 3HPAA 5HQEA 3S2LA 3ZLHA 1KWKA 3P7YA 1UKOA 3LGDA 4B5TA 3DG7A 4IM4A 1PE1A 3LV5A 4LYQA 3OVQA 1O4UA 3G77A 1MEIA 1JG9A 1EP1A 1PWMA 2GFTA 2PDCA 4JHZA 3UR8A 3PANA 4FOUA 1TPC1 3PZOA 3B9DA 5A8NA 3AJ7A 2VFIA 1SJAA 3ANUA 1HKWA 4G1NA 4OE7A 3G22A 3MZ2A 3UU0A 1BPLB 5DXYA 3IK2A 1L6FA 1LLZA 5AC5A 3PZUA 3ZYZA 5EY5A 4TVUA 1XIEA 1FRBA 1EJUC 7PTDA 3U5UA 1JVNA 3UXLA 3KZSA 3NL2A 2NT1A 1IIGA 3LB0A 2ZXAA 3PZNA 2V69A 5A8PA 1FDJA 3FSTA 2F84A 5I77A 1FCVA 1XDJA 1UASA 3QPZA 2YDSA 3GDKA 4N7QA 3VYLA 2ACRA 3VIKA 3JS3A 3VC5A 3K4AA 3QOKA 3T8LA 3VGGA 1TSIA 3CZ8A 5BOOA 4QEEA 4ADUA 4IFRA 1RY8A 3Q2DA 2CKRA 3RPDA 5GJPA 1JULA 2X2YA 3KL0A 4MGGA 5A6AA 2J62A 4JEQA 3WFLA 3TYZA 4ML9A 3HM7A 3B0PA 4GIYA 1TV3A 1KWGA 2JBMA 4O13A 1E5NA 4L65A 3HG2A 2F6XA 3W4RA 1ISWA 4BF7A 3S9ZA 3LPOA 1EA9C 1GVIA 1QO5A 3SRKA 2OXNA 1O5QA 4HHLA 3LTPA 4ICCX 3ZR6A 3JW7A 3MI6A 4AZCA 2YX0A 2UY2A 3M43A 1GOMA 1TO3A 2OEKA 4MJ4A 2E28A 4CQDA 3BW4A 3NDZA 3GU2A 3MBFA 2QIIA 3HGSA 4PTVA 2FPTA 1OADA 2J8TA 3P84A 4OOZA 4WHBA 5JH1A 3NSMA 2FGLA 3UY8A 1VBRA 2RGMA 1EPXA 2WSQA 1H7WA 2Z4GA 3LLDA 4MYAA 2DH3A 3AIBA 1ML1A 1H3GA 1E9IA 1KO0A 3U7VA 2ATSA 7XIMA 3VGEA 3QVQA 3NQCA 1ZENA 3N3TA 4XBSA 1JIBA 1YE6A 3G8EA 2ZWYA 3IVSA 2IPWA 3H4GA 3CASA 1U1JA 2QPXA 4DI8A 1FTXA 1V0NA 3VD4A 3K13A 2O7SA 1R2RA 3UG3A 3IV8A 2GVYA 4KH2A 1W5PA 3LPGA 5BNKA 3DGBA 3ITOA 4AZGA 3W87A 1H1NA 2LLEA 4HCLA 4X22A 1GEHA 3EX6A 1G5AA 4MDPA 3G1RA 2QCLA 3IRSA 2FQIA 1K7XA 1OY0A 5HJXA 5HJYA 3EA3A 2FDMA 2FMNA 1WA3A 1G9HA 2E5CA 1JZ4A 1Q5MA 4O10A 1AD1A 4PBEA 4XIMA 3M44A 1OHLA 1F2JA 4M1RA 4TOQA 5BWAA 4IMFA 3EKZA 1RJQA 3QLDA 3I3DA 2FJKA 3GKFA 2PU1A 3UXKA 1LBLA 1W5QA 1JCMP 5HMSA 4ZQOA 2P76A 3WK2A 1ZBCA 3CUHA 4TTGA 4D6FA 2HNEA 1JQVA 1QI0A 3NVTA 3SCSA 1UJPA 4DJFA 1Q63A 4ASTA 4W5ZA 4AC1X 3MB9A 2YB4A 1KTCA 1AQFA 2DVTA 2VR5A 4KS0A 1LDCA 1UB3A 3GR4A 1YTDA 2ZDSA 1PHQA 2PDJA 1TWDA 1HJXA 2C1GA 5LHEA 1NU5A 3IJQA 2W61A 3AXXA 4QXIA 5LIKX 3WO8A 2R1PA 2BGNE 1BXBA 1PCKA 1Q6DA 3KL3A 1W3NA 4AHPA 2GGJA 3VI2A 3UY7A 2PE4A 4GIAA 1F6YA 3NSNA 4DXKA 5FEPA 3BSGA 2BSLA 3IEBA 4EXQA 2VC7A 4ZQPA 3C8FA 2WMIA 3N4AA 6TAAA 2PBGA 1SZRA 4UTFA 4EAYA 4H19A 2B7NA 4J40A 3NZPA 3M4HA 1QU4A 1J96A 4G9PA 3NA8A 2BVTA 3PNUA 1JCXA 2ACQA 4PMZA 2WZTA 3SRFA 4DEFA 3WN6A 3P5ZA 4IQEA 4G8TA 1OFPA 3BCFA 1G4TA 4W87A 2O0TA 1R47A 4DZAA 3W1TA 1QOPA 4C6KA 3DCPA 1GOWA 3MP4A 2V5LA 1CT5A 2PDHA 1DE5A 1DWAM 3R8GA 2WVUA 2QJHA 3NPUA 1MXGA 1J79A 2ODOA 4PL1A 3C0SA 2Y85A 4IIFA 4DRSA 5AYYA 2Z2UA 4P7QA 1J9YA 1PBGA 3L2MA 3WX7A 3G3MA 3ELFA 2CBVA 1V3LA 5HULA 3FFSA 1ODUA 1IWPA 4DO6A 4LVDA 3QHOA 4P8WA 1RA0A 3BZJA 2IS7A 1WZAA 3CAQA 3A5FA 4YTQA 3S5YA 3QW3A 3ARYA 2OQLA 3UETA 2BHZA 4FR6A 2DQXA 4PCNA 2R82A 2DIJA 3W26A 4AB4A 5JBDA 4PCSA 3TQ0A 4L1GA 3PZIA 4RDYA 1KM4A 2QDDA 1QNSA 4JICA 3DFSA 1G67A 4LUTA 1W1B1 1W9PA 3WNKA 3VOHA 3EDFA 3FHQA 3THQA 4TU1A 3TN5A 3OTRA 1VHCA 1BF2A 5A6JA 1JJKA 5CH9A 1W3LA 3WDJA 4N0RA 4GXMA 2PDWA 1KXQA 5FOOA 2QAPA 2Y7GA 4U28A 4AWSA 2A3LA 3ZLGA 4WGHA 4FF7A 3TYBA 5LA0A 2ZA3A 1R3RA 1E0XA 3MVTA 1PTGA 3EKLA 4GCAA 4EIVA 4IQJA 3PR2A 4RL3A 2XIIA 1RJPA 5LNVA 5AYIA 3FDKA 3VGBA 1GVYA 1VRDA 3K8KA 4HVXA 1E9LA 4Y9MA 4CEUC 3OHIA 5BOEA 4RDVA 1BKSA 3CL6A 1EC8A 1OSEA 1QWKA 2HK1A 1K7FA 1R87A 1VHNA 1R3TA 3M47A 4HHPA 4OV9A 1QTWA 3UYIA 2XIMA 2UWFA 3NVDA 1SMAA 2VZVA 5CJMA 1Q6RA 1FWNA 2XHYA 5RUBA 4PA8A 3MC5A 1AG1O 3U2EA 2X1UA 2YLAA 1SFJA 4DZHA 2VYOA 5I3HA 1H5YA 3G1XA 4WJ8A 5EA9A 1KKRA 4ZOAA 2E8YA 3N2TA 3S42A 3APTA 3QM3A 4PMXA 2Y70A 2PTZA 5E6YA 1JI1A 4AWUA 1LYXA 3R8RA 1VBGA 5K9CA 1H41A 5PTDA 1QK2A 4NILA 1V4YA 1OCNA 1LG2A 3SUVA 4XZMX 3VKAA 4B2DD 1ITQA 2VFEA 2R24A 3T42A 5M03A 1Q6GA 4LVBA 3CQ0A 3F5LA 5HATA 4KGLA 3MJMA 2CBIA 5BCAA 2BDQA 3T2PA 1TZZA 3G5EA 1XYLA 3SQLA 3VA8A 4F66A 4BY3A 2CLIA 1NF7A 1A3XA 3CHDA 2DSWA 3FHAA 2XGIA 4GYFA 4WVXA 1N82A 1SVDA 3HO8A 1OFDA 3M6YA 1VKFA 2PS2A 1M41A 1WPCA 1UR3M 3RJYA 2W6RA 3GNOA 3BMWA 2NVAA 4IGMA 4UCGA 2PD9A 1RP8A 4CNTA 1QI2A 2J8GA 1A50A 4LCSA 3PPHA 4LAUA 5JIPA 1JAEA 4OVXA 2KAUC 3GC5A 1H1YA 4IXXA 2E68A 3T0BA 1GONA 3NO5A 1K8CA 4YTTA 1WZKA 1DJHA 2TPSA 3RN6A 3CPGA 1YDOA 4L5ZA 4UWMA 4I6KA 1A5LC 1JF6A 1HQTA 5C70A 3FVMA 4K1GA 5AHEA 5HAOA 2AAMA 3SEPA 1DXFA 1W9BM 4M6UA 1C7TA 1VYRA 3DG3A 1SZGA 3TW9A 5DT7A 4N02A 2ZUTA 1TMLA 3DYMA 3BCJA 3GW0A 2R9RA 3AHYA 4PUWA 3WDQA 2CPUA 3LSCA 4X63A 2HS6A 1V7YA 3MS8A 4GRSA 4HYRA 1I2RA 3GIQA 3TQVA 4M6PA 2JGYA 2UV8G 4Y8FA 1P6BA 3BMXA 3E2SA 3V5CA 1P0BA 3GVVA 4B3KA 3U9IA 4NJJA 1XPGA 5EMYA 3UCCA 1PSCA 4H3DA 3GXFA 3AHTA 5A2AA 2XN2A 3DHUA 4AVNA 3QGVA 1B90A 1I0BA 3TW6A 4DWSC 3QY6A 1Q85A 4RUBA 4TTUA 3DYPA 3NL5A 3O05A 2BGSA 3AAMA 3WLIA 3LXBA 2YXGA 1H7NA 4JTDA 1KFWA 1O60A 1NWSA 1IEVA 1QFEA 4IMEA 3W7CA 1V0LA 4EXBA 2E6DA 1XH2A 3LU2A 2TSYA 2Z7GA 4Y9PA 3RILA 1GW1A 2CXGA 3P60A 4RNHA 4HPGA 5F4SA 2WSRA 3UGRA 3BANA 4GZIA 4ZCWA 4WY0B 3ITXA 3VAVA 4OUIA 4G56A 3EX1A 4YS1A 1P7TB 4ZQMA 2FYMA 4EE9A 1TMQA 4Y7EA 1JCYA 3XINA 2V0TA 2VFGA 4KKXA 1PAMA 2D0HA 5CG0A 3M7SA 2ALDA 1XDLA 5AC6A 1G01A 1XCXA 1KXVA 3PBVA 1I45A 3IVTA 4RKAA 3EX3A 4Q7NA 1DJGA 4PE8A 3XISA 3LBCA 5HBFA 4C6EA 5T26A 3WNLA 3VTRA 2YLLA 1FWTA 2DZPA 1I4NA 4R7OA 2NV9A 4F48A 1S5MA 1Q8JA 1ZLPA 5D2VA 1J0YA 2QCMA 2O4MA 4OTKA 4IG2B 4P7LA 1EGZA 1OYAA 3LPPA 4K7YA 3B40A 1EJXC 1QI4A 2NQ5A 2XH0A 3GXDA 5HWNA 3KXQA 3KOZA 2J78A 3LHTA 2ZUWA 3SURA 4FS9A 3NQFA 3PK7A 1Z3NA 4J5NA 4H83A 1R7AA 4OT7A 4GNKB 4RZBA 3TROA 2JIWA 3AYVA 3DI0A 3PZVA 1XLBA 2OKOA 1K02A 4JTTA 3WQEA 4UFMA 1Z32X 1ONEA 4R33A 3M0YA 7TAAA 3SN1A 4W7VA 3RGTA 5D9MA 5D02A 4HNVA 2DV0A 2CHOA 1RY0A 4E38A 5M1TA 2XVGA 3U3HA 2GSHA 1OC6A 4MADA 1EDTA 3VX0A 3RF9A 9CGTA 3ARRA 1G6CA 3VO0A 4AXNA 1VQTA 2WM0A 2HJPA 3G0UA 1VBHA 2WMFA 5C9ZA 1TJ2A 2TYSA 2J9ZA 3QH2A 2NX9A 3GFYA 3B8SA 5LXEA 2QCDB 1E6XM 1IE7C 3NZQA 3SCQA 3K8MA 1FWAC 2ZRUA 2ZE0A 1YDNA 4B2DA 3QR0A 1CCWB 4M19A 3LY0A 3QV8A 1IGWA 5A6TC 3GTIA 1YLVA 7REQA 5U7SA 5LNUA 1JZ3A 3LCHA 1TV5A 2VJXA 2RAGA 2GLKA 1FWCC 4N42A 3ZWTA 3Q94A 1DWIM 2R1KA 1SFSA 3WQ6A 4FLRA 3KOXA 1JDAA 5C9WA 1IV8A 4V1YA 2ZRXA 4XTIA 5A6MA 1A5BA 1XLLA 3VPLA 4PMRA 4MNJA 3WMSA 2OJPA 1TWZA 1EXBA 2HWGA 3VE7A 2BXZA 3PB2A 1HL8A 3R58A 1XYBA 3SCTA 2VVSA 5E9AA 3DZ1A 1HT6A 1KBIA 5H91A 2EPMX 3EOEA 4JTHA 4FR1A 2JK2A 3LQGA 1QHOA 1B1YA 4FI4A 3OLIA 2PCQA 5D33A 1QOXA 3P62A 1Z8AA 2DIEA 2IKIA 4F9DA 2A1YA 3I6TA 4L9ZA 1J6PA 3QYQA 4PBFA 1XYFA 4LYKA 1E1FA 1EUNA 1XLGA 3AO0A 2OZ0A 5HXMA 2I14A 1NDZA 4F2TA 4LBUA 2VC6A 4IF2A 2QNEA 2ZKMX 4MY1A 2WHLA 1CXIA 3VUSA 1XINA 4DPQA 3BV4A 1IYXA 1JNDA 2Y8UA 3C0QA 3GXPA 4XD6A 4QRNA 3PBGA 4MWAA 3CB8A 1ONRA 3L4VA 4PTMA 3UWUA 1NTHA 2WZEA 2OQHA 4BQ4A 3DAQA 3G2GA 3TZFA 1UCWA 2EG8A 1RQBA 2PGRA 3KOYA 1QHZA 3NQVA 3SO7A 5EMKA 5BXRA 3L68A 4YTRA 2WC3A 1UD8A 2XFRA 1RA5A 2XVKA 3W25A 1KR1A 3O16A 3K2GA 1Z48A 3LK6A 7A3HA 4GVHA 4F79A 3A22A 2V3EA 9XIMA 3L7RA 1V6TA 5D9OA 5LGXA 3OG2A 5CC3A 3W7NA 3BE7A 2WJDA 4J1OA 5B7YA 4BF9A 4E2BA 1K70A 1H61A 2WQPA 3OQEA 2GDUA 2ZZ4A 3ZVHB 4OFCA 3WLNA 5IFTA 4OU1A 2C14A 3OBAA 1HF6A 4WEVX 3UWVA 4CNPA 2AQOA 3ABOA 3QSTA 4OBRA 2BX7A 3EMQA 1LWIA 2GGEA 4Q4QA 3VU2A 1AODA 3RU6A 4XSLA 4EX4A 1ZRQA 4I9TA 3AYRA 4A3QA 3OLEA 1TPDA 3NSXA 4ATDA 2SFPA 2Z1WA 3VDBA 4XVDA 3WQ8A 1CENA 1Q4NX 1KFJA 1CXFA 5CPOA 3RMEA 4IIBA 4FOJA 3LRMA 5A6LA 5FF3A 4FXFA 1US0A 2X09A 1LCOA 1NWUA 3VILA 1SM9A 4BQ2A 4DN1A 2V5CA 3QMRA 4IISA 5F1VA 4C65A 3DFNA 4H1ZA 2DT1A 2Y88A 4NNCA 4CQ8A 3DFOA 3QTGA 4M81A 3MHGA 1EA0A 3LD5A 1LTDA 3UNDA 1WDPA 3LLFA 1XISA 3L5AA 3VXGA 3IIXA 1B3ZA 5HNTA 1TE6A 2HPMA 4CEXC 3RLHA 1YNQA 2VDIA 4KETA 4NJGA 3L4YA 3D0CA 1DTNA 3HURA 2OCZA 3P61A 2DIKA 3S9YA 4MLJA 4MB3A 4GFSA 4FNRA 2Y5EA 5FJJA 4ZTXA 3W72A 4B5VA 4KWUA 1UHVA 2VX6A 1DPMA 3WFAA 2PFHA 3GH5A 5D8WA 1M53A 4FZIA 4QSHA 2NXHA 5DCBA 1JF5A 5E6ZA 1FDZA 1MXDA 3OYXA 1QNPA 4ZGYA 1RPKA 3BJSA 5MKGA 3R6IA 4JIEA 3PAOA 4E5TA 3PBMA 1VP5A 1XQLA 3UXIA 2NX3A 1MQPA 1OJXA 1UKQA 2PTDA 3WF2A 5D4YA 3EPNA 3FEQA 4P7RA 1GKPA 4E2OA 4DJED 4IT1A 3TNOA 4INFA 4CD8A 3LS9A 1RJRA 4REQB 1BYCA 3I7QA 1VEMA 2P3EA 3GE7A 3HQPA 1B9ZA 1HN1A 2PP3A 2RJHA 2WJEA 3G1VA 2CLOA 2W9MA 5G1MA 3W82A 1B3YA 4DAFA 1EJ7L 1SYTA 5AHNA 3BDKA 1UR0A 3ZR4A 1W3IA 2PP1A 4LYPA 3W22A 1E55A 4W86A 4UMCA 1XQKA 4FF5A 2QDHA 1IT8A 1GHSA 1NEYA 3E9AA 3OU8A 2FZ9A 3VNKA 3UG8A 1PWLA 1JD7A 4JYEA 3V0UA 3SY1A 2WCGA 1BD0A 2DZSA 1EJRC 2E9LA 1SZFA 3O6DA 3G6LA 4MKVA 3LHUA 1DJQA 1K8YA 1M7PA 2PA6A 3S5ZA 2CW6A 2PRHA 4WRHA 4Z1YA 2GGIA 1YPFA 1DJIA 1RSCA 3QMTA 1Y5WA 1TG7A 3C61A 4R34A 4ZMGA 1MDRA 2P8CA 3THAA 4DJDD 3HJEA 3SM0A 3CV6A 4L4PA 1TIWA 4UTUA 3MBDA 2ZZ6A 4Q32A 2Z2BA 2FTYA 2ZICA 3CV1A 4QLJA 4Z0JA 4EF9A 1C7SA 3F2BA 1GOXA 3B0YA 4D6GA 1XXXA 1EJVC 2DZBA 4IP4A 3HU7A 3SUWA 4AIUA 4H9TA 2A3EA 1HKIA 3WQOA 2EXOA 5C0QA 1J93A 1X1OA 2VURA 3SCRA 3GS6A 1W3TA 4B16A 1NWRA 4E6MA 4QISA 2HEJA 4LBRA 5CPTA 3BLIA 4BS0A 1TE1A 4GY0A 3KS5A 4O54A 5CAKA 1SO6A 4ZO9A 1P1MA 2GL5A 3PTDA 3QR3A 3GX9A 4MAZA 1Q6QA 5CSUA 4XKYB 3NIYA 5FCZA 3ZWSA 3OOQA 1CB7B 4MNKA 4Q4PA 5C9XA 3MCOA 5JU6A 3N12A 4JCMA 1MFUA 1NDWA 3B0VC 3M16A 2WKJA 2W27A 1TPUA 1A5OC 1IZJA 4MM1A 3E0LA 3GQYA 3GM8A 4WGXA 4NZ4A 3R12A 5F7UA 3QKEA 1ELSA 4KQNA 4A8IA 6ENLA 4Q3MA 2WBKA 4UNKA 3TQPA 3DEQA 2X40A 3DERA 2RDUA 1GZJA 4E8DA 3ZM8A 4LS2A 4FLOA 1K9EA 4H9VA 3TSMA 5ABHA 2HVNA 4XZBA 3V0TA 4EAMA 5AN7A 5KZMA 1ZBKA 4XKMA 4GMEA 5HNNA 1P43A 1OIFA 3NFUA 2E1DA 4EVZA 2GGGA 3N17A 4BWLA 4GI9A 4I6VA 4QG9A 4NZCA 2I1OA 1HP5A 1RCOB 1GZGA 1E0TA 4NAEB 1ALDA 3O9NA 1E15A 3ES7A 4G2DA 3TA9A 3CLWA 3RPMA 1R9XA 3E5PA 4K8GA 4DAIA 2WHMA 3DBNA 3E96A 2ZTKA 1T8QA 4DF0A 3W84A 3GDTA 3TSBA 2Z25A 2P88A 3URQA 4QROA 2RJGA 1OABA 1Q8AA 3SCNA 2A3BA 3SZ8A 3EWUA 1V3KA 3B8UA 1OQFA 2ZX9A 3C0LA 1UR1A 3W2KA 1BG9A 1IXOA 2CZEA 3PUEA 3MMDA 2I9EA 2J6VA 3ZVIA 3BC9A 1ZCOA 2DY3A 2JEQA 3OO2A 1FVPA 1UBSA 3UJEA 4US5D 5DY2A 1AL7A 2CBUA 1KFCA 3AHVA 2AL2B 3IJDA 3RM4A 1XG3A 3MI3A 4YNGA 3ZR5A 4QNEA 4KWWA 5TAOA 2KZHA 1E6RA 1WDSA 4IX0A 3K8LA 4TXEA 4UTHA 2VKZG 3CQIA 1PTAA 1EC9A 2JKEA 1PZ0A 5AC7A 3WLOA 2J9XA 1QNQA 2X7WA 3B04A 3RM8A 2O9TA 3N6HA 3QMSA 1JZ5A 3U7BA 2VFHA 2YZRA 1NQ6A 3WQGA 3M07A 3EAUA 1ISVA 2VI0A 1KRBC 1Y7VA 4IOTA 1M01A 3U8GA 2Q01A 3C56A 1Q66A 4N6EA 1E72M 2V6AA 2VXNA 4AYGA 4DUOA 3CO8A 1MW2A 1OYBA 5I09A 3OODA 4J3XA 4DJEA 1R9ZA 3O6CA 2Y8VA 4E4FA 3STEA 1GKQA 1Y8BA 3EMCA 4MJZA 1A4MA 5IFPA 3BPWA 4OKDA 3E74A 1N2VA 2DZTA 5DO8A 4KWOA 2Z1BA 4K1WA 4QJ5B 3EDKA 1R3VA 4NXSA 4RE3A 2CKSA 3GVQA 2EQDA 1YBQB 3FOKA 1XGDA 2OR2A 3F4WA 6TIMA 2FGZA 3ATYA 4JQ4A 1EGVA 3F4DA 5L6UA 3S6TA 5LXXA 2IQTA 4EPDC 1I2QA 2V68A 4YVVA 3N2MA 3ONCA 4HBKA 4DHGA 1LP6A 4XZNX 4OV4A 3ZIZA 3VDHA 1NOWA 2QCEA 1QNVA 4XZLX 3GAKA 4H6KA 4FALA 4DJDA 7ODCA 4MUPA 2VDGA 1UIOA 3GUWA 4MDOA 1A3WA 4RW3A 1G1YA 4Q7BA 3HV9A 3GDRA 3N29A 1VLWA 3KBVA 4OZOA 2FTWA 4S3DA 3QV9A 2GVGA 3T07A 1S3HA 2Y1HA 1GW9A 4LTSA 5I03A 1YTKA 5M5DA 1ZB5A 3WLRA 3RHGA 5K9DA 2X7VA 1WOAA 4A6GA 5A6BD 3TJ4A 4LUSA 4IH3A 4GH1A 5CPMA 3WL1A 3IIZA 1ZY9A 2BXVA 1YEYA 3PSWA 2JKPA 3GBDA 2O4QA 1TX2A 5J8LA 3FJLA 1XLHA 1XI3A 2VX5A 1ZAHA 4W89A 3RLGA 4P8XA 2W3ZA 5DQPA 1TPH1 2E5BA 3WYZA 4D6IA 4GYJA 1UA7A 4NKCA 1TJPA 2I16A 3M0IA 3RIKA 4DM2A 3NM3A 4LF1A 3LI0A 3MT1A 1C8QA 3QZEA 4NUWA 3SJ3A 5M17A 1O6IA 2O56A 5AYZA 1XF0A 3S8HA 5DRIA 3SQMA 4QQ3A 4F0SA 3TXVA 1KFBA 4V27A 1RVGA 3WSUA 1P48A 1XR2A 3BW3A 1SO3A 1WXYA 2VCAA 4GJJA 1AW1A 4DUVA 3WNPA 3MQTA 2WMKA 3S4TA 4X61A 1QPOA 1WAWA 5I5RA 1UC5A 2CEQA 3H21A 1XLIA 3AMGA 4GI8A 3R8HA 1XCFA 1U83A 2ZADA 1I2OA 4XBKA 3P3BA 1KBLA 3ZLFA 4IGNA 4XB3A 4HU0A 2VRQA 5D32A 4QIUA 5JMUA 3WLHA 5KMYA 4AD0A 5BWFA 4L6HA 3LZ3A 4NAFA 5G4EA 1WX0A 1LBMA 2Y7EA 3HG5A 4WUIA 2A7RA 3GRIA 4O1CA 4E3VA 1YE4A 2QEZA 2FDSA 4DWSD 4O8RA 1T7LA 1RPXA 3BJFA 5HMEA 1D3HA 2OODA 3CUGA 4YN5A 4PMNA 1MQQA 4JTRA 4O0KA 4X0NA 3WH9A 1YPIA 3EA2A 3HQ1A 4AF0A 1Z9AA 2ZWZA 1KM0A 3R5EA 4GJ1A 2FZ8A 1OEPA 3UWWA 2NUWA 1HG3A 1JQXA 3H53A 3IJ9A 3T44A 2Y8KA 1UD3A 2ZUVA 5ABTA 2RHGA 5DCDA 2X16A 3TAOA 4US5A 3NL6A 4K38A 1KLYA 3UA3A 2QCGA 1HKMA 3T6CA 2Z26A 5B80A 1BQCA 1FWHC 2Z6IA 1PCWA 2WVVB 3NDOA 1F05A 2DDXA 3L0KA 3AXHA 5HNRA 3I4EA 1REQA 5ABEA 4CD4A 2BOEX 5CSRA 1FQ0A 4C90A 1QI3A 4KF1A 2W66A 1JCLA 2DSUA 1J0HA 3UG5A 4DPPA 3G1AA 4LEFA 4I5RA 2EPLX 5D2YA 4RE2A 3ECQA 5LKYA 3PSVA 3N18A 2YFOA 5ABFA 1TR9A 2QLYA 4OHQA 6A3HA 1XBVA 4GVIA 1PUDA 6PTDA 4H8HA 2PGEA 3ZSTA 1IWAA 4QAIA 3ZO9A 2F9RA 3K4WA 1Q2SA 5D8ZA 4HSNA 5A5WA 4XAZA 2FTPA 3O6AA 4NZ1A 1H0IA 3SCVA 2QW5A 3DFQA 1FY6A 1Q6OA 2W0UA 3KZPA 3WLSA 1HTIA 4H01A 3KBMA 4HMNA 2PC8A 1EX1A 5G5IA 3AHZA 1F07A 2XFWA 1C90A 2XN0A 4GQQA 2GDQA 4P8VA 1O68A 4BZYA 1XIIA 4JFUA 4JTAA 3GIYA 3VKBA 1IGSA 3RLVA 2HBXA 2DT3A 3DFTA 1H5VA 4PMDA 2G4JA 3G1YA 4IFKA 1ZJHA 3EXSA 1SFTA 1TELA 3QW4B 3CS2A 4C91A 3CU2A 2R1NA 5BMXA 3LHZA 4S38A 2VEGA 1J2WA 3E38A 1CTNA 4L4LA 3QN3A 3BICA 4GGBA 3IGUA 3LLXA 5KTLA 1QPQA 4W88A 3M1ZA 1NP2A 4QG8A 2E7FA 3NG3A 4LW7A 4NXKA 1I60A 4F4RA 4HPXA 4MNMA 4PMVA 2ZA1A 1FWSA 5E1QA 3A9BA 2Y5SA 1R3WA 4U33A 3FX4A 1ESWA 2FVLA 2BHYA 3MKKA 3CNYA 2PPGA 2CHRA 4HZMA 5A6BA 2ZZ2A 4NZ3A 1NJJA 2ESCA 4EPEC 1HP4A 3QGKC 4PTWA 2CITA 1DIOA 3FVDA 3TMQA 4W8BA 4Q22A 3AALA 3D5HA 3QV6A 4GPNA 2NVCA 3GIPA 4HZ7A 3W7KA 1NFPA 3CHCA 1M6JA 2NLYA 3TCEA 1OX4A 3PS7A 4LUJA 2GSJA 2HCVA 1ZFJA 3IVUA 2NQJA 5LGZA 4NVTA 3UJRA 3CYVA 2FZNA 4WJEA 5HPCA 1WOBA 1Z6KA 3W7QA 1O5KA 4Q4OA 4PGLA 1X39A 6CGTA 3S2JA 3PB0A 1JPHA 1LLWA 2WMJA 4JTQA 2XFFA 1WE5A 1CNVA 1OGGA 2FHBA 3CV2A 1EYWA 4H6EA 2GQ3A 4H2HA 1JNEA 1W9UA 1R3SA 3FW6A 2C1HA 3AFBA 4JZ5A 1WXJA 4HJWA 4CQCA 2JKAA 4LANA 2O7QA 4UFLA 2POZA 3K4DA 1BVZA 4ERAA 3CAVA 1UYQA 4MAVA 4UBPC 3TP4A 1JDEA 4WOZA 3T0AA 3NL3A 4C6JA 5CGTA 2RUSA 3CM4A 4WLCA 2C71A 1D3CA 1XSJA 2TRSA 3M64A 1IEIA 3F4NA 4L1XA 4JQ3A 1ODZA 5A94A 3MMUA 1I1WA 4DNHA 2D0GA 4ICNA 1GPWA 4GKLA 3RK8A 3TTQA 2XYLA 4DWSA 2Y5JA 4HIBA 3WBAA 4GUHA 3L21A 4R9XA 1K9FA 5XIMA 3ZZ1A 5CC6A 4OBSA 2R1MA 4WDWA 3VM7A 1LT7A 2ZOXA 3B8IA 4LAZA 1RP9A 2Y6ZA 3B8DA 4UQDA 5XINA 2D20A 3PFMA 3LHWA 4JTUA 2J75A 1W37A 4YYCA 2ABAA 2XN1A 5GPRA 3AROA 5XIAA 3SY8A 4Q33A 2YJQA 1CECA 3KBJA 3P5YA 2FPYA 6REQA 4GK8A 4H9ZA 3EXRA 2CESA 3GTFA 2AGKA 5F4XA 1TUFA 3WD3A 5CBBA 3WF4A 4WDTA 4O0ZA 3WJWA 1VH7A 3ICJA 3D47A 2WJZA 3ORWA 2X42A 2YCIX 3W1AA 1SJCA 4JBRA 1AW2A 2FFIA 4DIAA 1GOKA 5C9RA 3S5NA 4MLRA 4GINA 3O07A 3E0IA 1AK5A 3QFEA 1FHUA 1VB9A 1JFXA 4UNLA 4CVUA 4Z42C 4UTKA 3B0UX 2DSKA 4Z2JA 3WFZA 3I7SA 1WZMA 1UZDA 2C0HA 4E0CA 1C8YA 4GXPA 3SQSA 2RH9A 1D8CA 3H2EA 1HUVA 1O1HA 4CU6A 3RR4A 1VS1A 3K1DA 4PRTA 3SUTA 1U5VA 4IQLA 1T8XA 1F61A 2DZWA 2H90A 3NQ7A 1E40A 1HJSA 3BG9A 7ENLA 1AMYA 2W62A 3VIHA 3WQ4A 1XLDA 2JALA 4L6OA 4GC4A 3POCA 1D8WA 5A1AA 1TV7A 5MF5A 4F0RA 1GQKA 5FEZA 1JPIA 1JPMA 3SSZA 1S46A 3UR7A 4PCTA 1JRCA 1IIHA 5CZJA 3TVAA 1OCBA 3V1HA 1O5RA 4IMDA 4HU8A 3TDFA 3ABXA 5I6SA 2ONEA 1DVJA 1CXEA 3IANA 3VOIA 4PTNA 3EKGA 2HZGA 3WELA 2EPOA 4D72A 3EYPA 3KVKA 5AC8A 1F74A 5BRQA 3H7VA 4XAYA 1TPEA 1OZQA 3UVAA 5GNXA 1GTEA 2OT0A 4GVGA 3T40A 1ITXA 2V3FA 1W54A 1Z7AA 1FP8A 4EWND 3VOFA 3L4UA 1Y65A 4ZOEA 5LIWX 1W31A 1JD9A 2E9BA 3U2ZA 2I5QA 4L61A 1KLZA 4A29A 3MPGA 4ENLA 3VMOA 1C3FA 1UUMA 3EOOA 2J88A 4G5DA 3TK7A 3HMJG 2A79A 2WLZA 2EJAA 2QPSA 2XG9A 1RR2A 2CIPA 4DUWA 1Q7ZA 3GAYA 1K4HA 5LSMA 3B9OA 3S6OA 5LIUX 3HBLA 1LUCA 1VC4A 1Q2RA 3FGCA 4N4QA 5CZKA 1QNOA 2GVJA 4IQDA 4QBXA 1L6YA 4K7VA 4Y9AA 3LN3A 4Q4KA 3HJZA 1V6VA 4AYSA 2V81A 3ZMRA 4UQEA 1XCWA 4IJBA 4MIMA 2H6RA 4WSHA 3MUAA 3L66A 3LRKA 3KRZA 4HSHA 3ITVA 3W6MA 2HXTA 1OZMA 3NZGA 1KC7A 1R30A 3OLDA 4M1BA 3EWBX 5JXQA 1E71M 1R86A 2RFGA 3P14A 1L8PA 3CHFA 3F5KA 5KSWA 3KRBA 3W6LA 2Y61A 1TA3A 3C86A 4IJCA 1IR1A 3QHNA 2E77A 1SZNA 1MMFA 4M82A 4ERIA 3N2XA 3USBA 3TFXA 3W2MA 3QHMA 3A21A 4I90A 4GY7A 3N11A 4OECA 3GVGA 2E40A 3GC4A 4JTCA 2AGTA 4LVAA 2YL8A 4GE8A 4PUDA 4PUUA 1J11A 5CJNA 1RZMA 4Q8UA 1K7EA 1V02E 1KM6A 1EPVA 5D30A 3T0DA 2NSXA 2D22A 4I8YA 4JKKA 1T6MA 1VPYA 4TUFA 4IL2A 4KBXA 2W91A 3EWYA 3WQDA 2I56A 1PKNA 1KR0A 1ADOA 1D7FA 3TLQA 4BI7A 3R43A 2J79A 4EACA 2FGBA 1UD6A 5C6MA 3MSRA 1HVQA 3BQ5A 3CHEA 3O7UA 1RHCA 1S2VA 5KEZA 4E3TA 4D6JA 4AEFA 3N4FA 5K4ZA 4S3EA 4V28A 3L4ZA 1NOUA 3VKKA 4RPPA 2Y63A 3I6RA 2XIBA 4PB4A 1T0OA 1GQJA 4ADTA 3RU8X 4WZHA 1NF0A 2PWFA 3LUTA 1EP3A 1ZS2A 1Z44A 1MXSA 5LHFA 4ATLA 4C7DA 4HB7A 1A5KC 1TJ1A 3PULA 5D2TA 3AIWA 3TTEA 1F4AA 5L9FA 1E73M 2WC4A 4P61A 3KP1A 1PDYA 4ZO8A 3L0GA 4XV0A 1BVNP 2GK1B 2OMAA 2ZVRA 1EJWC 3UW6A 5MHBA 3PG8A 3STCA 3W81A 4AIBA 3NM1A 3CQHA 8CGTA 4IX2A 3QY8A 2EGZA 1VIWA 3Q37A 2WHKA 1YNYA 4QE4A 4YHEA 3MYOA 2IW0A 3WEMA 3UQNA 1NFBA 1EO7A 3STPA 3T78A 1UH3A 1PIGA 4ZL1A 3VD9A 4ZO7A 1TTJA 1BGGA 4N4PA 2PP0A 5K7JA 1OD0A 4EKJA 2X8RA 2OG9A 1H2JA 3TU9A 4QJ3B 4Z2GA 4ONVA 4V2XA 2CU0A 1EQPA 1HIZA 2KX9A 3AJXA 1GVSA 2ACUA 1OD8A 4ZO6A 3H26A 3LMYA 3PAJA 2OYKA 1XIMA 3W2LA 2VM8A 3MO4A 2EAWA 4GUGA 3E2RA 2VUYA 1QI5A 2GQ9A 2ZZ5A 3NCOA 5IHRA 3QC0A 1CXLA 4CUCA 3NQDA 3UZ5A 4U4MA 3WF1A 4MB1A 4KRZA 2WPBA 1PYMA 2EKCA 2VZTA 2A3AA 1U1UA 4MNLA 2ZXQA 4H4IA 2YCLB 2ZA2A 1ZAIA 8A3HA 2J13A 1RUSA 4FLQA 1Y5VA 2X1IA 5D9PA 3LRLA 4N9DA 1I2NA 1DJYA 1MZHA 1GG0A 3E0VA 3MMTA 1GG1A 4J3UA 4HNLA 3SGGA 3KCJA 4S3FA 1X6UA 1FKWA 4W7WA 4PMOA 1TX0A 1Q7QA 3H54A 2BOGX 2BVDA 3HG3A 3GY1A 3HPZA 1ME7A 4KFNA 3W2NA 1FWWA 3GO2A 2JF7A 4PBGA 3C2FA 4KGJA 3REQA 2GJXB 2V2HA 3ARUA 2L5HA 4S3KA 4HKPA 4E8GA 1VEPA 3W00A 4IMGA 2XH7A 4NJKA 1OC7A 4UTWC 1UW9A 4ALDA 1BRLA 1DORA 1W1TA 2OGJA 1CGWA 1BLIA 5DRCA 1TQXA 1JL8A 3DHFA 1UPPA 2FVKA 4AD2A 2CFFA 2C13A 4ADSA 1F3WA 1XRTA 3RUBL 5H8UA 1H0GA 3L5MA 3TOYA 5DF0A 5AC4A 1KBKA 1TV2A 3TEVA 4UB9A 3RRAA 1UWQA 4XVEA 3WLJA 1EX5A 1XIGA 1W5MA 2IMRA 4D6HA 4GYKA 4JR5A 3TC3A 3EBVA 4ZFMA 4O4VA 3AOFA 2INZA 2WNNA 3I7RA 5AECA 3VD3A 1E1CB 3AZTA 3MDUA 4EPBC 3IWPA 1DYSA 1PS9A 4U5IA 4AQLA 2ZTJA 1FWJC 4TVDA 4QDWA 1QR7A 1GOIA 3EWWA 5FJIA 2EPHA 4TIMA 3ZS4A 1V7AA 3R10A 1S2AA 3WQVA 5D03A 3BCDA 3HOJA 4D6CA 5JIWA 3BK0A 3FN9A 2WJFA 4S3AA 4MWAE 2GQ8A 4IGSA 1LT8A 1OWQA 2NQLA 4D71A 3CPUA 1PJ9A 3B03A 6XIAA 2D0FA 1P0DA 2A4AA 1LRNA 2VOTA 2PDIA 2REQA 3QQWA 2DZAA 1ICQA 1THFD 1KCKA 3RRXA 1LWHA 3E02A 1FA2A 1NY1A 4AHQA 1QDSA 2BOFX 3AS0A 8XIMA 1R38A 3AZSA 2PD5A 3K1GA 1ADDA 5F2IA 2DQWA 2XINA 2VENA 4I9MA 4QCEA 1EGMA 3B05A 4WF7A 1YXCA 4R27A 3RX2A 4KWSA 1V08A 2XSBA 1GPFA 3VZXA 2J7GA 3M41A 3L67A 4B3LA 1ECQA 1VEOA 3QJAA 3WJSA 4Z1DA 3UG4A 3FXGA 1VFLA 4UFHA 4JS3A 4FNUA 3NQEA 3UNTA 1UWAA 1OFOA 4IIHA 3LEPA 3JUGA 3KOFA 2Z0IA 4IMCA 1KFLA 2Y7FA 2PWVA 1DP0A 1XD1A 2H8ZA 1TCDA 3HFTA 3TKFA 3IAPA 2QYGA 1FWGC 1JGIA 1SMDA 4DI9A 3A4WA 4ILSA 4K6AA 4JIQA 5FJRA 3CL7A 3QPYA 4QE5A 3NOYA 4LOCA 4UQCA 2F2KA 4XZ9A 3THDA 4F2UA 1I8JA 5G1YA 2CETA 3OEXA 5LNSA 2PODA 1DEDA 4O1EA 1QK0A 3E5BA 2HV5A 3CUXA 2ZC8A 2WNWA 1UOZA 3BG3A 1Z69A 2VCBA 2PU0A 2XU2A 1FCUA 2ZRVA 4BWLC 4ML4A 1XL9A 4N2YA 4AY7A 1SW7A 2ABBA 1QPRA 4C6NA 4C6MA 3KRSA 3KWXA 4MY9A 1AJ0A 1VR6A 3HV8A 2FIQA 4AH7A 4RDWA 4O1AA 1CX9A 4YTSA 4MTVA 1MRQA 3H22A 1VGAA 1IEQA 2P0OA 3TYAA 3TXZA 4DO4A 1OM0A 4YWIA 3RCMA 3W0KA 2P3ZA 1ISZA 3ITTA 4H00A 2H3DA 1KRCC 5JBEA 3WK0A 1PVNA 3WLLA 4EXAA 2ZVIA 1A5CA 2OELA 2AMGA 1VYSX 1QXLA 2C0AA 2VWSA 2OU4A 1JGMA 4O52A 2J9YA 2PDNA 4FPSA 5E0KA 3W7LA 3EX2A 1RD5A 3VOGA 4MY8A 3W7PA 4A2RA 5IDZA 3KTCA 4FA3A 2OOGA 2QJGA 2HPIA 4NYYA 2WLYA 3CIXA 1N8IA 2WZIA 1QASA 3HTWA 3THUA 1YKWA 4HJFA 2YBVA 4X9YA 1VRXA 3MV01 2CZ5A 3B3DA 3MCNA 1BFNA 2FH8A 2INFA 3GSMA 4HCDA 4PUNA 3OZMA 4CQBA 5J5DA 2DGAA 2PDPA 1KTNA 1V3MA 1CLXA 1KCLA 2CWNA 3OZOA 4ZQNA 2BY2A 3BMVA 2OYMA 1PKYA 3CZLA 1SZEA 1OINA 3CZGA 1RLDA 1YXDA 4B15A 2VZUA 2TMDA 3BJTA 3WF3A 4RW5A 4JQ2A 3KBSA 4KMQA