2BXVA

Dual binding mode of a novel series of dhodh inhibitors
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
367
structure length
360
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title Dual binding mode of a novel series of DHODH inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 133
structure length 360
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bxvA00
2YYUA 5F4WA 3I68A 5H91A 1Q6OA 3PBVA 3PF3A 1THFD 3C2OA 5LHFA 3KAOA 3R13A 3G1FA 4DF1A 2YX0A 4MOZA 1RPXA 3C52A 3MBDA 3IVUA 4X3ZA 4CNPA 4EF8A 5HWNA 1OABA 4JR5A 3NM3A 2J6XA 1VCGA 1IIGA 1XC4A 2ATSA 4CCEA 3LHTA 2NWRA 1AW2A 1SQ7A 4BI6A 4UCGA 5CZSA 3WJYA 3W7OA 1JCNA 3GZ3A 4DQWA 1SO5A 4PEKA 2QCHA 2H90A 4GUIA 4BWLC 4UMAA 1OFEA 2J24A 1A5AA 1NSJA 5U4NA 2XN0A 5KITA 1AW5A 1GTHA 1KM3A 1GVRA 3W73A 5I3HA 2A2IA 3DKLA 4P61A 3STFA 1DQXA 5CSSA 4DPPA 1JUKA 1UBSA 3W1PA 2B4GA 5BNKA 3PSVA 2H8ZA 3GYEA 2BLEA 2Z2UA 4JTIA 3NR0A 5FF4A 5FF7A 1G4EA 1TRIA 3V75A 2ABBA 3CWNA 3GAKA 1FXPA 2F7FA 4N2YA 3Q94A 1AW1A 4IMCA 1KM0A 3TA6A 1Q6RA 4IMEA 4RCXA 3RLUA 3VCRA 3HMJG 2ZTJA 4AWUA 4O57A 1RQEA 4RK8A 4ZMGA 4FB7A 1IF2A 4OGZA 4UTTC 1K8YA 4K39A 3NQ8A 1RQBA 1KFEA 5HUOA 1H7NA 1TJRA 3CM4A 4I7UA 4NVTA 4CNOA 2A21A 3C6CA 3N34A 5LGXA 1OFDA 1NF0A 5C2XA 5DELA 1HO1A 2ZRZA 3W2JA 1YPFA 2W79A 5EYWA 4A3UA 2J9XA 2GQ8A 1LROA 3G1AA 1Q6QA 1Z41A 1SFLA 1W5QA 1GJPA 2V0TA 1QR7A 3CT7A 1TPUA 1U83A 4PL2A 4Q4KA 4LVFA 4ADTA 2C19A 1KW1A 1I45A 1WQ5A 3RNDA 1R2TA 2WNNA 4Z08A 2JGYA 3ANYA 3VKJA 1W56A 3O05A 1ICSA 1D3GA 1YXYA 4E2BA 1K7EA 3PULA 3NQ6A 2CLHA 3QMRA 1GYNA 3BW4A 1OK4A 4ORMA 2QJGA 5F2GA 3O8AA 1H7PA 3LLFA 4UTHA 3G3DA 2ZZ1A 2Q3RA 1O94A 1R46A 4K6AA 3S1XA 3TSDA 4XBKA 4LNYA 4JS3A 2QCCA 3FS2A 3W7JA 4CCCA 3G1SA 2YDAA 3LCFA 1TV7A 2QCDB 3F1QA 1EUNA 2PRLA 2CZEA 1Y0EA 1KM5A 3UZ5A 2WQPA 3RMJA 3S5YA 4IUOA 2OCZA 3HGJA 3NQMA 4IXXA 2ISVA 3NXFA 2TSYA 1LLWA 4GJ1A 5FEWA 1L6SA 3QF0A 3NG3A 1VYSX 1I2NA 4GUHA 2DZUA 3G1HA 1P0KA 1ZAJA 3VE7A 1KFLA 2NZLA 4JTGA 5F4SA 4DELA 2DJLA 1W8SA 1WBHA 1WXJA 2BX7A 1C8VA 5SWUA 4LS2A 2A5HA 1JQXA 3EX4A 2PC4A 4S2CA 3NZ1A 2A85A 1JUEA 3IGXA 4MZ8A 4AAJA 3LHYA 2BWGA 3L0NA 1H7OA 1XXXA 1MXSA 1R30A 3AJXA 1FCUA 3W23A 4PODA 1LYXA 2FJKA 4ADSA 1VJIA 1VRDA 3L2IA 1L6YA 2YCEA 1KFKA 2Y7GA 1DV7A 3KVJA 4DBDA 3OVQA 2E6FA 4RXFA 3CB8A 3UY7A 1K7FA 3TW6A 4U28A 1DVJA 3UQNA 1OYCA 3EWUA 1VLWA 1GQNA 3GXTA 7TIMA 3TAKA 2A0NA 4WXYA 5C54A 3LHVA 5D2WA 1A5CA 4DF2A 5LHEA 1GYLA 1GVOA 5EY5A 5HNRA 4LVAA 3GKAA 3SI9A 2QKFA 2E6DA 3MUXA 4C1KA 3BVJA 3KOFA 2Y7EA 4CQ8A 1FWWA 1LOSA 2V5LA 4IX0A 2I9EA 4JNMA 5G5IA 1OFOA 3FIGA 3NQ7A 4AHQA 2WOQA 5AYZA 2EF9A 5FESA 4ZQCA 3EB2A 3TROA 3NGJA 1TV8A 3IGUA 3TC6A 1OK6A 1VPXA 3HF3A 1QAPA 1VC4A 2CLFA 3LI0A 3HG5A 1OX4B 2UV8G 3P5YA 3PG9A 1RZMA 2CWNA 4JTJA 1X6UA 1XDMA 4OWGA 5I3IA 1YTKA 4AHOA 4Z1BA 1H50A 2CZFA 4JTUA 3QEZA 2CLLA 2ZFAA 3W88A 5DY2A 3ZR4A 3HPZA 3IV3A 4AMAA 1QCWA 3NO5A 5K4XA 4UFLA 4Y90A 2R91A 5KSWA 1TPH1 5AC8A 3USBA 2TRSA 3GDKA 5EMUA 3QPZA 3DFNA 1EP1A 5I3JA 4ALDA 4D2JA 4GNJA 1LTDA 5EA9A 1SZGA 4AF0A 5D05A 3EKZA 3IEBA 3NPUA 4IPJA 3HO8A 5DLCA 3BGJA 3UD6A 3W2KA 2ZZ5A 1TIMA 3BK0A 4M19A 1VS1A 4O11A 3G0UA 1OG0A 1JR1A 3HGSA 3LLDA 4OV4A 2CW6A 4UFKA 3G8RA 2PE4A 5CZ0A 2Y88A 2I14A 5BRBA 4O19A 2G5WA 3ELFA 1C29A 3G0XA 3M5XA 3P67A 4UNLA 2B7OA 2DJXA 2CZ5A 1G4TA 1F6PA 2QUTA 3LXAA 2O7SA 2X1SA 1EIXA 2A7PA 4O50A 3NA8A 5HUPA 5BOOA 1ME7A 3MO7A 1TRDA 3QFEA 5HWJA 3DU0A 3O6YX 4XTIA 1QPRA 2F84A 1TREA 2VFDA 3M43A 2QCDA 3GIYA 3QZEA 4UR7A 4TR9A 2NLIA 4UTIA 2GQAA 3W7HA 3O6DA 4A29A 1SW7A 5IBXC 2E5CA 3KXQA 1TYGA 5AN7A 5AFDA 3HG2A 3R8RA 3W72A 2V30A 4LVBA 1QPOA 4AH7A 2IQTA 1N7KA 2QCEA 1YTEA 2OJPA 3ATZA 4YLWA 2Y89A 3CC1A 4I9AA 3L9CA 5E93A 3LTPA 1KM4A 3UXDA 1D3HA 2ZCGA 2GJLA 4FNQA 3DGRA 1LCOA 3A5VA 4O53A 4JDBA 3R5EA 4UTJA 4HT3A 3TH6A 1GEQA 3OG3A 4ZQRA 4BK9A 4UTKA 5CPOA 4RX0A 2CLKA 3YPIA 3W1LA 3ATYA 1GWJA 4IWWA 4RZ5A 3MHFA 4H4IA 2CLMA 3QSTA 3ZWSA 4M6PA 5J5DA 3H53A 2GQ9A 5AB3A 2NWSA 2VELA 1S5WA 4O1BA 5D38A 3BLIA 1LORA 3QRHA 5L6UA 5F1VA 1W3IA 4DO4A 1LBMA 3W75A 2QCMA 4QNEA 3HJZA 3GXPA 3S5OA 2OMAA 4DO5A 5LNVA 1U5JA 4QITA 2V2CA 4O1CA 4HNTA 5D2YA 3GNDA 2QAPA 3W6YA 1OVDA 3MHUA 3M1ZA 4MIMA 1F5ZA 4NJKA 3LXBA 4FNPA 1K03A 4TMCA 5L9FA 1OFBA 2ZA3A 1XCFA 2QCFA 3S5NA 4QJ1A 5CZJA 3GDMA 3U6WA 3DZ1A 1YDNA 5FI8A 3MJYA 3W7DA 4LOCA 4XTDA 3PC0A 1YLVA 5U7SA 1W5NA 4CQ9A 4CNNA 4O8RA 3HPXA 1QPQA 4IJBA 1OX4A 1JCYA 1IIHA 1L6WA 3B03A 1P1XA 2A6NA 3M5YA 1IXQA 2B0MA 1JCLA 2PRHA 3NQGA 1MEHA 2XFWA 4IGHA 2CLEA 1BEUA 5K9CA 1TB3A 4QISA 3W2MA 4UUIA 1XFBA 1B4KA 3IVSA 2DZTA 4S2BA 1TQJA 3E9AA 5D37A 2JGQA 4DO6A 2OT0A 3NQEA 5LKYA 1S5VA 1XBVA 3BV4A 3A23A 2DZVA 4AHPA 4K37A 2X2GA 4R7JA 2R94A 2QJIA 1GT8A 5FF2A 1MSSA 1HG3A 3UPWA 2Y7DA 4AB4A 4DEFA 4AEOA 2QF7A 4BF9A 2DZPA 3NYZA 1H63A 1W5PA 3DFPA 4PL1A 1HFBA 2QR6A 1OFPA 1QOPA 2Y70A 4DPQA 2QAFA 3IIOA 3LV5A 3MYOA 1OFRA 2YFNA 1TJPA 4FNUA 5FF3A 5TQLA 5EPDA 3N2MA 1PIIA 4ICNA 1H1YA 3G3MA 1LBFA 3EXRA 4MUZA 1XM3A 3C2EA 4A2SA 4PH6A 1PCKA 3HGOA 3W1MA 4N9EA 3W1QA 3GR7A 3SW6A 3A22A 3KRUA 1F76A 1VCVA 4RR4A 2WO5A 3W7GA 3OA3A 1EPXA 1PV8A 1YTDA 4TMBA 5CSRA 1MEIA 3TC7A 3UWYA 4YCOA 1M5WA 1CW2A 1MO0A 5KZEA 2FLIA 1XBYA 1W54A 4IMGA 4XQ6A 3SSJA 2NV2A 1WYIA 3DENA 1AK5A 4LUIA 1AMKA 3W1NA 3WFAA 4MFEA 3CU2A 1OFQA 3C61A 3W85A 3DFOA 3HG3A 3EWBX 1K02A 1H61A 3H55A 4A22A 1I2RA 4IXHA 4QAIA 2OT1A 3STEA 3M44A 4RV8A 2A4AA 1LDCA 2WSRA 4O10A 3W1TA 4O0KA 3I7RA 3HBLA 2ZDRA 4NNAA 4JY8A 4OV9A 3UWWA 3STGA 2EPHA 1F7BA 4LY8A 5AHEA 1G67A 4KKXA 2ISSA 2EAWA 3HGRA 3SFKA 1FBAA 2H3BA 3TCEA 6ALDA 2ABAA 4ZQPA 3R2GA 2DZWA 1ADOA 3M41A 3HIJA 4JYDA 2D73A 4LC8A 3TJLA 3L68A 4UIOA 3OVRA 4TO8A 2E77A 1B57A 3N19B 2HS8A 2RH9A 3P80A 3P84A 1KLYA 1GVSA 1ZAIA 2VFIA 2ZA1A 3KFTA 2W0UA 2KZHA 2H3DA 4GUFA 3FKKA 4H3DA 1XL9A 4LS1A 1EP2A 3SGUA 5KZMA 3E0IA 4K36A 3QQ1A 5G2IA 3T40A 4O17A 4XBSA 1ML1A 5KTLA 1GOXA 3MP3A 1I2PA 3W83A 2GOUA 1X7FA 1V5XA 4UFIA 2ZRVA 2V82A 2VFGA 3C8FA 2JKEA 5D32A 4GBUA 1ZHAA 3N3MA 3B0UX 3GAYA 5FEPA 4XZ9A 1DORA 4IMDA 1H7XA 4HHPA 2C14A 4JIQA 1LP6A 3VI2A 3F03K 5HULA 4HKPA 1PHQA 2A1YA 2YFOA 3EWZA 3TK7A 1H7WA 1OF8A 3UNDA 4WY0B 3DBPA 3BW3A 3NOEA 3W7MA 1LM1A 1GZGA 3LM7A 4UTWA 3P5ZA 4UMCA 3E96A 2BZNA 4XKYB 1TPVA 3UWZA 2Y62A 4HSOA 2NXIA 4UTMA 1G69A 1GG1A 1QPNA 3AO0A 1H60A 3W87A 4ZQOA 1H1ZA 1QOQA 3DI1A 1Q45A 1XBZA 3HQ1A 3LCHA 3W71A 1F05A 1HUVA 3TQVA 1EX5A 2G96A 4FEZA 3RF9A 3B0VC 1R2SA 1FQ0A 3JS3A 2HTMA 5D02A 1J5TA 3O15A 4O12A 1NFBA 5DN1A 1XUUA 3S42A 1M6JA 3IGSA 4OE7A 3QMTA 2OZ0A 2QDHA 4UTLA 3NEVA 3STCA 3TIMA 3DI0A 1X1ZA 5HR6A 3UXAA 5G1TA 3W2UA 3QW3A 4HIBA 3LCGA 1O5KA 3L0KA 1IXOA 1DJQA 1YXDA 5D30A 5HJLA 4MY9A 2YSWA 3PY2A 4E0CA 2O7QA 4A21A 1L2UA 1DQWA 3HOJA 1WAUA 1SZFA 4M5PA 1TTQA 3TV8A 2E1DA 4Z0SA 1E51A 4L4MA 5CG7A 2W6RA 3W7NA 4JICA 2WPBA 4O4WA 4JN6A 3FFSA 4BWLA 1B3OA 3P8JA 4JX5A 2QUUA 2LLEA 3SR7A 5CPMA 2VXNA 3THQA 1CI1A 3LHWA 5G4EA 4JTHA 5D2VA 2EKCA 3GB6A 3M6YA 4Z1CA 5GVJA 2NUXA 3PBWA 1CX9A 4RZ4A 4PFMA 3Q37A 4O1DA 3KVMA 1Z44A 5I3KA 2GUUA 4HNUA 1SR9A 6TIMA 4MZ1A 3P74A 1T99A 4JXCA 4ZVJA 4FO4A 1Q6LA 4HSNA 3DH7A 3L66A 4Y6GA 5DBUA 1YADA 2VC6A 1DJNA 1LRQA 4NZFA 3MHGA 5IM51 3B04A 3FEMA 4N6EA 5G2HA 5T26A 4UTUA 1LLZA 4LVDA 2ZZ7A 2Z0IA 3B06A 4UTTA 5LZLA 2YYTA 5LSMA 2Z6JA 3MI2A 3OBKA 5AYYA 4ONVA 2CFFA 3W2LA 3F4NA 1S3HA 4YWIA 4ADUA 3G18A 1OX6A 5LGZA 2JBMA 4O14A 1KV5A 1QWGA 3O63A 3BARA 2G97A 2C18A 4OBTA 5CKSA 4K8HA 1IXNA 4S1FA 3C2VA 4E38A 3DAQA 1O60A 1W3TA 3Q2DA 3GX9A 5ABTA 4JTSA 1H62A 4RXGA 1O95A 2ZRWA 1YDOA 3EKLA 4EWND 3LRKA 3BG5A 4UFHA 3BG9A 2HS6A 5AHNA 3G1YA 3MI6A 5LNSA 1LZOA 3W76A 4JYFA 2DP3A 1ZFJA 5CGQA 1TO3A 3HB9A 1JULA 4M7TA 3CIWA 2ZRXA 2JK2A 3BLFA 4KWVA 3T4CA 1N55A 4EIVA 1K3UA 3PM6A 4KFPA 3W7EA 3WK2A 1PE1A 4WY0A 5E0KA 3CWOX 3LGEA 3CPRA 3CQ0A 2RDTA 4IX2A 4O18A 3MMTA 3ZFHA 4X9SA 3C0JA 2OX1A 3PUOA 4XKYA 3LB0A 1G4PA 1EB3A 1W5OA 1KV8A 3DFSA 2EGZA 4UC5A 5DBTA 1KBIA 2ALDA 2CLOA 1I8JA 1ZALA 3TFCA 4XWUA 3NNTA 2FPTA 4WY0F 2FB3A 3U2OA 3W7IA 4WX2A 4BI5A 5F4XA 1L9WA 1FCVA 2FTPA 3Q58A 3E49A 3UWVA 3EX1A 4K8EA 1RR2A 1SSGA 1H51A 3LCIA 2VKZG 1FWRA 2E68A 1JUBA 4LV4A 3N14A 1J4EA 4LUJA 1H7RA 2VFHA 2I1OA 1TPFA 3TW7A 2YW4A 4M6VA 1JRBA 3IIPA 3T78A 2ISWA 2NX1A 4N02A 2QEZA 2ZZ2A 4GUJA 3NZRA 2FPYA 1EWDA 3FKRA 4QQ3A 3GXNA 4QIUA 1KA9F 1AL7A 2CU0A 4AWSA 1G7UA 5AHFA 1P5BA 3L0GA 2Y61A 2JKPA 3M9YA 3TSMA 3O1NA 2VEKA 1NAL1 4JEQA 4O0ZA 4J9JA 1ZAHA 2PRMA 1WA3A 4OT7A 1KTBA 2Q8ZA 1TCDA 3PAJA 2Y7FA 3TX9A 1TPWA 1VYRA 1N8FA 2C13A 3S5ZA 3LCXA 1SU5A 4N9DA 4EF9A 1YYAA 3R89A 1KFCA 2Y6ZA 1W1ZA 1QNVA 1ZENA 2QUVA 4AVFA 1TSIA 3GDRA 1RD5A 3P7YA 2TYSA 3QH2A 1VR6A 3S8HA 4FX7A 3O6CA 3W1XA 1BTMA 1F2JA 4R34A 3KVLA 2J88A 5E1QA 5MHBA 5J5RA 2P0OA 3EWWA 3L21A 2QJHA 1VYPX 4MJZA 4LT9A 1UCWA 1FCQA 1QFEA 5TBOA 1SFJA 2ZA2A 2NUYA 3BPWA 4E2DA 2EHHA 4UNKA 3S1UA 5D2XA 3BO9A 3G8EA 4LU0A 2BSLA 5LNUA 2R8WA 2VFFA 3S1WA 1PVNA 4FX6M 1VLIA 2Z6IA 4FIRA 2C3ZA 3SECA 3EEGA 1OF6A 5K7JA 2VFEA 3QW4B 1UUOA 4NXKA 4Y9AA 4W9TA 4N9BA 5G1YA 3DHDA 4QSHA 2E09A 2X1TA 5BMXA 5F2MA 1KM1A 1TTPA 4OHQA 1FDJA 3I6RA 4Z1DA 5HMSA 2V5BA 3D0CA 4ZL1A 4Z1AA 1KTNA 1G4SA 3B4UA 3F4WA 2FPVA 3P81A 1SSDA 3CEPA 3DKJA 3UPBA 2NV1A 3LXCA 2XN2A 3TQ0A 1ME8A 1PL9A 1W5MA 3NPXA 1JVNA 1JRCA 3FOKA 3C2RA 1P0NA 2NX9A 1SO3A 1SW3A 1XUZA 1QO2A 1VGAA 4FNTA 4O54A 3E12A 3LTSA 3MP4A 1UB3A 2QDGA 5CPLA 3NAVA 1GVFA 1KBJA 3PBUA 3GR8A 4M7SA 4JTTA 4JIPA 2VEMA 1G6CA 2NUWA 4KFNA 1OFAA 3BGGA 3HPSA 4R53A 2GVLA 4IPIA 2GJNA 2PCQA 4JX4A 4LRSA 3P62A 2H6RA 1W37A 3M47A 1NF7A 3W7RA 2ATMA 2C15A 3VFLA 4MFDA 3NQFA 1FWSA 3CIXA 5LNWA 1VZWA 2QCGA 4CLMA 1PHWA 1TQXA 3PWAA 5KMYA 4DF0A 3UYCA 2JKAA 3NPVA 3PUDA 3WJSA 3W7KA 2J27A 4BI7A 3W70A 3CTLA 4LV9A 4R33A 2B7PA 5IBXA 4N4QA 1NEYA 4HPJA 5G2WA 3G22A 3A24A 1JJKA 3QPYA 4H6KA 4WD0A 5D09A 4LRTA 1HL2A 4JTKA 4NJGA 4N4PA 4NJHA 4NT0A 4U4MA 2VEIA 3VE9A 4PC8A 1HO4A 1UASA 1J2WA 4WJEA 5EL1A 4JGDA 3W7CA 2VEPA 5BMWA 1VH7A 4PA8A 3SZ8A 1LOLA 3PVFA 3FJ6A 5CZTA 1K8XA 3LBMA 3IIXA 4A2RA 2RDUA 1WOAA 2ZQ0A 3NPWA 3TR2A 5HQEA 3THAA 4MKNA 5DCBA 1VHCA 3W22A 3RFAA 4HNVA 3C3NA 3EX2A 4KFOA 1OHLA 2CLIA 4MLJA 3SJ3A 4JX6A 3W3OA 2NXHA 2YXGA 1ICQA 3NL5A 4UXDA 2ZYFA 1TPEA 2QCLA 4JD4A 3I65A 4NQ1A 3K30A 3M0ZA 3GVGA 1Z48A 2ZBTA 4CQAA 4WOQA 1B4EA 4N9CA 1AL8A 3ABRA 5I3FA 2FFCA 1M7PA 2E6AA 4JYEA 4TU1A 4JY9A 1VCFA 1W31A 1QO5A 4GUGA 4Q32A 5A8GA 3JRKA 1K7XA 4GWEA 4JTEA 2BTMA 5F2LA 4NX0A 4MYXA 3TFXA 4I7WA 3MBFA 4C1LA 3INPA 5AYXA 2WJZA 1MZHA 3PS7A 4EOUA 3DFTA 2AAMA 3EXTA 4ZQMA 1QMLA 3LCWA 1LRNA 4MPQA 1SO4A 2YW3A 2FQIA 3FYOA 4HPXA 8TIMA 4Q33A 2FDSA 4QNWA 2Q8LA 4M6QA 3SGZA 4OQVA 4FF7A 3JR2A 3PB0A 4NJJA 4NJIA 2DZSA 2WSYA 2WNQA 3TAOA 4K38A 4AWTA 1ALDA 5CPNA 4AF0B 2DZXA 1BWKA 3PR2A 2J9YA 2H8XA 3G0SA 2ZZ6A 2Q3OA 3FA5A 3CEUA 3MP5A 1G7VA 3PG8A 4YXGA 4MZYA 3EWXA 2B7NA 3H54A 1Q3NA 5G4WA 4FXSA 2V9DA 3IRDA 2GVJA 4ZQNA 5D33A 3M5VA 3V1PA 4NU7A 5KZDA 2Y85A 3KHJA 3T7VA 4HNNA 1X8FA 3ZWTA 3VNDA 1FDZA 1EWEA 3B0PA 3WK0A 3S6DA 1UJPA 3LDVA 2CZDA 4LS0A 1V7YA 2WNZA 1NVMA 3G1DA 3LRMA 3W1RA 1GG0A 3NQDA 1IGSA 3LV6A 3RK8A 3QC3A 4RJEA 3TMLA 5K9DA 2RHGA 3BLEA 2ZRUA 1ZNNA 3L65A 1FY6A 3W1UA 4Y96A 1FUYA 1LBLA 4KWWA 3IVTA 3DHFA 3L5MA 4ZZ9A 2V2DA 1UUMA 2ZZ4A 3R12A 5DXXA 3I7QA 1Z42A 2XN1A 3TNOA 3WK3A 4IMFA 3FYPA 5K9XA 1TPC1 5AHLA 1I4NA 3NL2A 1F6KA 5DY3A 5I3GA 1SZNA 2C0AA 3L67A 3T44A 3BG3A 3O06A 2P10A 3TSBA 4WZHA 4NNBA 1XKYA 1OX5A 4PCFA 2HMCA 5H2ZA 2R14A 1GVQA 3ABSA 1VHNA 4JTFA 5LNRA 5HR7A 1VQTA 2VENA 4LW7A 3RLVA 2DU2A 4NUWA 3W7PA 4I7VA 4YCPA 5HINA 1XDLA 1PS9A 1IXPA 4RKAA 3OHIA 4FNSA 3TU9A 3ABOA 2TPSA 5C5YA 2A7RA 3EX6A 2E5DA 3E02A 3LI1A 4GFSA 3MWAA 1DKWA 3NDOA 3NM1A 2RKXA 3UY8A 2J9ZA 1TPB1 3LOTA 1OYAA 4LC6A 4AXKA 1JCJA 3W74A 3C56A 4GE8A 3B8DA 4MYAA 4PTNA 4K7VA 3NQCA 2GVGA 3TJXA 1DBTA 5AC6A 4LWWA 2WSQA 2E5BA 3N2XA 4GC4A 1AG1O 4O28A 1K8ZA 3OEXA 2ZZ3A 5K4ZA 4MVAA 3LERA 3LCLA 5F2IA 4FX8A 3GNNA 1EEPA 2C6QA 4FHAA 3W2NA 5AHIA 2WV8A 1M7OA 4O4VA 5BW6A 4IQLA 4O1AA 3W7QA 4EVZA 2RFGA 2YZRA 3L5LA 1TTJA 3P8IA 3SIZA 3C2FA 1RV8A 5D2TA 2V8ZA 1BKSA 1SPQA 3PSWA 5FEXA 3WJZA 1JCXA 3GKFA 4Y8FA 4JDYA 2A7NA 3LTYA 3CLMA 3QSRA 3TQKA 4DBEA 3MW7A 1T0OA 4MJMA 3G24A 5HWMA 1SUXA 2PURA 3P60A 3O07A 1FCBA 4UMBA 4LTSA 3W84A 4BFAA 3ZS4A 4WUIA 1S5TA 1F74A 4K7YA 3WJWA 1KTCA 1LOQA 2FB2A 3L5AA 4O13A 3BW2A 1EUAA 3RU6A 3TXVA 3NVTA 3PBYA 1R2RA 4NX5A 2ZRYA 3P82A 2A6LA 4LVGA 3UWUA 2WKJA 1C9DA 3NQAA 2P1FA 4GXMA 2YR1A 1KM2A 1WDWA 4ORIA 3KRSA 1D9EA 1ME9A 1SZEA 5F1UA 2V2HA 1A50A 1FWNA 4FNRA 4TIMA 3LHUA 4UFJA 1I2QA 1QDSA 4NXSA 3IIZA 3A5FA 1P4CA 2X1RA 5D04C 2C16A 3QQ0A 4XUGA 3CHVA 3S0CA 4POCA 3TDFA 1O4UA 2AQWA 3LX9A 3TKFA 5K3VA 4UR8A 4N6FA 4X22A 3NL6A 3GLCA 1F73A 4UFMA 1TPDA 1TMHA 3W07A 2NX3A 5DCDA 3QM3A 4NNCA 3W1AA 1FX6A 3M7WA 4DXVA 2V81A 1FWTA 2X30A 3B05A 1RQHA 3NQ2A 4QM1A 1KFJA 3A21A 1B9BA 3GDLA 4O52A 1W3NA 4MLRA 2Z1BA 2G95A 1A5SA 3LBCA 1RVGA 5C6MA 1A5BA 5DXYA 1WOBA 1R47A 3W9ZA 4P2VA 4WQ6A 2C1HA 3GDTA 5EBUA 3G1XA 3OIXA 3LRLA 3TXZA 3O16A 3G1VA 1YPIA 1SO6A 1FXQA 3W86A 3A9IA 1A53A 3KX6A 3MYPA 1JQVA 4TX9A 1BWLA 3U8GA 2X1UA 1EP3A 3NL3A 4RLIA 1GPWA 4X2RA 1ICPA 1LRTA 4FXRA 3N73A 5AC7A 4BR1A 5FEZA 2HSAA 5KINA 3EX3A 1TTIA 1WBJA 1T8XA 3UZJA 3QYQA 1SW0A 4O15A 1O5XA 5EKYA 4G1KA 1FDYA 3FJLA 4WOZA 3N9SA 2VOMA 1ONRA 1WV2A 3TMQA 1PCWA 5AOUA 3TUUA 1OJXA 2B7QA 3ABQA 3M16A 4RZ6A 1H5YA 1OYBA 2RDWA 2E6YA 1I2OA 1ZCOA 3PUEA 4OU1A 3OVPA 3KVKA 3NQVA 3GK0A 3MI3A 4WXZA 2DORA 3C4UA 3KRZA 1KLZA 3LHZA 2YPIA 3HG4A 5D03A 3QJAA 5C55A 1ZJIA 4YMZA 2QCNA 5FF0A 4YL2A 4IOTA 4MY8A 3W7LA 4Z0JA 3QMSA 1JCMP 4FIQA 4MY1A 2NXGA 5A5WA 1KM6A 1XI3A 3TE9A 4UTWC 3PB2A 1XBXA 3N9RA 1TV5A 5DCEA 3P61A 4HN4A 2BXVA 1MEWA 3IIVA 3S9YA 5AHMA 2GPTA 3EWYA 3FLUA 2AGKA 3T55A 1W0MA 4CCDA 2YGYA 1X1OA 1YDVA 4ML9A 1T96A 3EXSA 2Y63A 1HTIA 4O16A 5K2ZA 1DHPA 3M5ZA 3WJXA 1DL3A 1DOSA 2FIQA 2ZTKA 3DXIA 1WX0A 3WK1A 3S1VA 2X16A 3DFQA 1GTEA 3SY5A 4JTLA 4NZJA 1YXCA 2TMDA 4L4LA 5TIMA 1KFBA 1ZY9A 4B5NA 4GRSA 3UWQA 3I7SA 1EA0A
chains in the Genus database with same CATH superfamily
4GPNA 1F3EA 4PR4A 3SCSA 3C3UA 5F4WA 3EMQA 5H91A 1BTCA 3ARTA 3PF3A 3CH9A 8RUCA 1TVNA 2CKSA 3G1FA 4DF1A 3MBDA 4EF8A 3UETA 5FOOA 1MQPA 1WB0A 3F5LA 2P8BA 1R9XA 4Q4QA 4I9TA 1EJXC 4PMZA 1HT6A 1B90A 2OSWA 1AW2A 1JZ3A 4J4KA 1SO5A 1HVQA 3VILA 5C9ZA 3DG3A 3AJ7A 1HKIA 1S46A 2J78A 3GG1A 2IKHA 4DJFD 1AW5A 2OZ3A 3VYLA 1GTHA 1JYXA 3W73A 4DNMA 3WQ8A 3I3DA 2A2IA 4P61A 4WHBA 4I90A 3UXKA 1PTDA 3SO7A 2Z2UA 3K13A 1UWUA 1V0KA 3IK4A 2OFJA 2VDIA 3B8UA 1QI3A 1E4LA 2VX5A 3WH9A 5JIPA 4MNMA 3VM7A 3RLUA 3VCRA 3WD3A 2ZTJA 3W82A 4O57A 1RQEA 2VZTA 4UTTC 1K8YA 4QHRA 1JCTA 3NQ8A 3FGCB 4LBUA 3BE7A 4OUIA 2PLCA 3CM4A 1XLAA 5DMLA 3C6CA 3RCMA 1NF0A 1PXGA 1U1UA 1HO1A 2VRKA 3CZJA 1DJHA 3W2JA 3KBJA 2IMRA 4FA3A 2W79A 3T4WA 2O4QA 3VIGA 3I4EA 3FXGA 5FJOA 3IPWA 4ERAA 4D71A 1GJPA 5CXPA 3VC5A 2YKKA 4ENLA 3KW3A 1X6NA 1GCYA 4BQ4A 1M7XA 3O3RA 1WQ5A 4LCQA 3AYTA 4LUYA 4PB5A 3VKJA 3WDPP 4E2OA 4DUXA 4X2PA 2OSYA 1K7EA 1MUCA 3RGTA 3PULA 3QMRA 2DZAA 2BY3A 3BW4A 1CLKA 4ORMA 1ISYA 1H7PA 4UTHA 4P8VA 1QXLA 3G3DA 2ZZ1A 4PMRA 4I5UA 4FXFA 4C5YA 4PCTA 2QCCA 3G1SA 2VM8A 3LCFA 4JTDA 1IZKA 3TQPA 2J7FA 3QV6A 4W87A 2CZEA 3GBEA 3OQ8A 3C5QA 1Y0EA 2DSVA 3COTA 3UZ5A 4DI9A 3HGJA 2GSEA 4M1BA 2ISVA 3NXFA 4GJ1A 3GU9A 2G3IA 4LYRA 3ABZA 3WIJA 2WZHA 3BMWA 1SJAA 1KFLA 3WF4A 2VQTA 3N4FA 2BVTA 2BHUA 3P93A 3CZLA 3UR5A 2A5HA 1RY8A 4MZ8A 2VP8A 3LHYA 4AVNA 1H7OA 3PPGA 3W00A 3AI0A 3WLPA 1M53A 1EC8A 2FJKA 3MY9A 1O12A 1UP0A 1VJIA 1VRDA 3L2IA 2YCEA 5G1MA 1DV7A 4GNKB 3OVQA 2E6FA 2X41A 2CETA 4LYKA 4HN8A 3BCFA 1DVJA 3EPMA 1OYCA 3EWUA 1VLWA 4B5SA 4ACZB 1XSKA 4EPEC 4MWAB 4LVAA 4P7OA 1W9BM 3SI9A 1X8CA 3DERA 5JXQA 4C1KA 1GQLA 2AL2B 3PN8A 4C90A 2I9EA 3VD7A 2QHAA 1IEXA 1W9DM 2ZE3A 1CB2A 1ITCA 1U1HA 2E8ZA 4UOQA 5ECUA 1R9YA 2IPJA 2C91A 3M07A 3IGUA 5JUVA 1J01A 2QGHA 2HXUA 1QAPA 1VC4A 2CLFA 2YL5A 3QTPA 4WLCA 3SCWA 4DZHA 3BH4A 1KFWA 4YHGA 4D9PA 4Z1BA 4JTUA 2ZFAA 4P7LA 4S3KA 4XVEA 3U5UA 4J35A 1UQZA 1VFHA 1XLDA 5K4XA 4MJ2A 4MKSA 2R91A 2V38A 1H2JA 2YL9A 1A5UA 4P7RA 4YVVA 4HK7A 4H8HA 2ZX8A 5I3JA 1H3GA 3CBWA 1OCBA 5D05A 2NQHA 2Z29A 3UD6A 3BK0A 4K1GA 1CLXA 3CASA 1AJZA 3WQCA 5CZ0A 2Y88A 2I14A 5C9RA 2YXXA 3P67A 3VIMA 2XWDA 3LXAA 2Z28A 4HP5A 4QX4A 3CT2A 5HWJA 3DU0A 3O6YX 3AZTA 4XTIA 1CPUA 4DBSA 2BOFX 1QPRA 4ACYA 2VFDA 3AXMA 2VT0A 5FAJA 5FJIA 1LG2A 3M0XA 2NLIA 4UTIA 3HQOA 2J8TA 4A29A 1SW7A 5IBXC 4HA3A 2E5CA 3UEQA 3R8RA 3W72A 4LVBA 1QPOA 1RCXB 4AH7A 2IQTA 2QCEA 1XLFA 4JHOA 1GOOA 2YIHA 4I9AA 3NTYA 1KM4A 4J3ZA 4EKJA 1YDYA 3UXDA 2ZCGA 2GJLA 3DGRA 2V63A 3A5VA 1V4YA 1KBKA 4JDBA 3R5EA 7ENLA 4FLRA 3OG3A 4ZQRA 1XLHA 1ZS2A 1Z6KA 1GZ1A 4L64A 3WQ5A 5DO8A 1RP9A 3ATYA 4IWWA 2GDUA 1H5VA 3APTA 2ACUA 2CLMA 2YA0A 5J5DA 2NW0A 5AB3A 3LY0A 4MSSA 3VZZA 4FZIA 4O1BA 1EJRC 3CO8A 5L6UA 1W9XA 5M5DA 1W3IA 2FDMA 3CS2A 2QCMA 3HJZA 2XFRA 3SRDA 4PUEA 1U5JA 1IT0A 4DM2A 1HJSA 3HMCA 1MRQA 4KCWA 4AZGA 3WF1A 3ZLFA 4NJKA 1W9UA 4GQGA 4FNPA 1K03A 4TMCA 3WENA 2PAJA 3CTTA 3IANA 1OFBA 3RDKA 1LWHA 1XCFA 2J7BA 3R10A 1KCLA 4ZXOA 3S5NA 3CQKA 2UY3A 4IF2A 2VEGA 5FI8A 1PWMA 4LOCA 1YLVA 2PWHA 4OJYA 1V03A 5U7SA 1IEQA 3HPXA 2WJDA 4DNHA 1JCYA 1L6WA 3OBAA 2PWUA 3QZ6A 3WBXA 1RA5A 2PRHA 1W1B1 1MEHA 2XFWA 4W89A 3W26A 1BEUA 2XH0A 9XIAA 3W2MA 2D0GA 5FIPA 5FL1A 1XFBA 5D37A 3FA4A 2AKZA 4CU6A 3V4BA 1KD0A 4I9MA 2WM0A 1UC4A 3BV4A 1UP3A 5DT5A 4KBXA 2W5FA 2W92A 3EWDA 3OOQA 4K37A 2DW7A 1FH8A 2Y4SA 4R7JA 3ISIX 4CNSA 4N42A 3UR2A 2QJIA 2O9TA 5FF2A 4W85A 1R87A 5FJUA 3BZJA 3UZZA 5AY7A 1A3XA 4CUCA 3NYZA 1B5TA 2Q8XA 1F3TA 1HFBA 2HV5A 3WMLA 3IIOA 3LV5A 2L5HA 4CEXC 1OFRA 2PP1A 2EPMX 5TQLA 1S1PA 3W38A 3G3MA 4UQEA 1LBFA 3EXRA 4REQB 1XM3A 3C2EA 3RLHA 3NEHA 4N9EA 4TV5A 3EPOA 4RR4A 3T07A 1K4GA 5CCZA 3FCPA 1EPXA 1YTDA 3BDKA 1MEIA 3QGKC 8XIMA 2XU2A 1MO0A 5KZEA 2FLIA 1TMLA 2BHYA 3LENA 3BURA 2Z26A 1EEXA 1WYIA 4E6MA 4LUIA 3W1NA 4QDPA 3CU2A 1OFQA 1ZLPA 3B4YA 1U5HA 1XKJA 3EWBX 2OQLA 2REQA 2IPFA 1H61A 3GUWA 2ZXDA 4IXHA 3OJGA 1ZBKA 3STEA 1YRRA 2HZGA 3W1TA 4O0KA 4D6JA 2V5DA 3MCOA 3UWWA 3BLPX 1FFQA 4FXJA 4TV6A 3T2PA 4LY8A 1G67A 2EAWA 3HGRA 4L80A 1FBAA 6ALDA 3SCRA 2CLPA 4WDTA 4HGXA 4DYJA 2D73A 4P8WA 3KTSA 1R7AA 2E77A 2RH9A 1LL7A 2ZA1A 5FSDC 3GW3A 1S3TC 1W3LA 4GUFA 2O92A 3UZWA 4DZAA 4H3DA 4PRTA 3QBUA 3SGUA 4O0QA 2E4TA 4S3AA 4K36A 5KTLA 4O17A 4XBSA 1HJQA 1GOXA 3LG3A 1F3WA 4TVUA 4UFIA 2ZRVA 4MKVA 5CLWA 3C8FA 5I5RA 1ZHAA 3B0UX 1JDFA 4XZ9A 3R25A 1POJA 1XP3A 3PTDA 2I17A 3PFMA 5HULA 1TVLA 4PZVA 1BRLA 4NF7A 3WF3A 2DSWA 2O56A 1MFVA 4R85A 1LM1A 1GZGA 2WC7A 5DANA 1UIOA 2CESA 3SCQA 5T9BG 1JAEA 2Y62A 4HSOA 1VP5A 1G69A 3AO0A 3WQ4A 3P0WA 4W5ZA 2DT0A 3DX5A 4XD6A 2QDDA 2YLAA 4FEZA 3H12A 1ONWA 4RW3A 1VD6A 5HMEA 1J5TA 2ZWYA 1RH9A 3QV9A 3S42A 1EJVC 3IGSA 2OZ0A 2QDHA 4UTLA 1S2CA 3NEVA 4FI4A 3STCA 2XIIA 4UQ9A 5EGRA 1QNPA 3EDEA 2UZ9A 4IL2A 5G1TA 3UYIA 2RAGA 1EF3A 5KETA 1BGGA 1K9TA 4HA0A 1IXOA 1P0DA 1EXBA 1ZBWA 4A21A 1TTQA 4WRHA 2AAAA 1J8VA 4L6DA 3OGVA 1V6WA 4W8LA 7ODCA 1TZ9A 2DPEA 3FFSA 4FPSA 4BWLA 1S2WA 1B3OA 4TQTA 5HJXA 3GO2A 2HVNA 2EKCA 3GB6A 4ZB5A 2NUXA 3WLNA 3PBWA 4DX3A 1CX9A 4AQLA 2YCIX 1CB7B 1D3CA 1UD3A 1UMLA 3ZR6A 4XKMA 3BSHA 3ZT5A 2GUUA 1UR4A 3KOWA 4AVOA 1GZJA 1ELSA 6TIMA 4KEMA 3P74A 4ZVJA 4FO4A 2PD5A 1Z8AA 3L66A 3T2OA 3IJ7A 3HM7A 1Z32X 2WWCA 3DFHA 3W37A 1UQYA 3B04A 3FEMA 2DQXA 4V28A 4B9YA 2YYTA 1R38A 3NYDA 5AYYA 1D7KA 3CQJA 1A80A 5A6JA 2CFFA 2J66A 4GGHA 2JBMA 2WHLA 2G97A 1BQCA 2D2GA 5CKSA 3OG2A 4S1FA 1M7JA 2BODX 1W3TA 5DT7A 4AZCA 4M6UA 4ZO9A 3RHGA 2FVLA 1O95A 2YBUA 3WF0A 3AOFA 2XGZA 4EWND 3LRKA 4UFHA 3CAVA 3MI6A 4ZOCA 3W76A 2DP3A 1ZFJA 3M0HA 1JULA 2DIJA 1H09A 2VZVA 4M7TA 5HQLA 3AS3A 4GYKA 1X98A 1K3UA 3PM6A 3W7EA 6A3HA 3FYYA 1NY1A 3BV7A 1KKRA 4Q4MA 3LGEA 4OBSA 5A2CA 2X7VA 2Z7KA 2OELA 4XKYA 1EB3A 1NDZA 1KV8A 1KBIA 2OGYA 3MKKA 1I8JA 2IKGA 3IS4A 2FPTA 1TX2A 2WVUA 3N6QA 1FWJC 1Q8JA 4XVDA 4LCSA 4U2ZA 2FTPA 3MUIA 3U4FA 4GC3A 5AC5A 1HX0A 5BCAA 4LV4A 2E68A 3N14A 2J8GA 1R3VA 4DWDA 4H6QA 2ODOA 2VFHA 4ZA0A 1XLJA 4F9DA 3BJTA 5D8ZA 1C7TA 1QU4A 3WD1A 3ZVHA 1JRBA 3IIPA 3T78A 4CD5A 1V51A 3RM9A 2ZZ2A 4GUJA 5BXPA 4K2SA 3FKRA 4QQ3A 3HFYA 4QIUA 4EACA 3RAOA 2Y2WA 2PDXA 1CGUA 3W53A 3ARVA 2JKPA 3WEZA 1NAL1 4XO7A 4XSMA 4QP0A 5FL0A 3IJDA 4O0ZA 4OT7A 1KTBA 2Q8ZA 1TCDA 2VVSA 2PDBA 3PAJA 4Q4RA 1H11A 1QASA 1TPWA 1VYRA 4A3RA 1OCNA 1AMYA 2HXTA 3WDIA 2AGTA 2Y6ZA 1ZENA 4AVFA 5H8MA 1MW1A 3TNBA 3RX2A 2TYSA 3ES8A 4FX7A 1PX8A 1VEOA 3WLKX 5J5RA 3EWWA 3WBWA 3BCJA 9CGTA 1UCWA 3LU2A 3CMGA 2E1WA 3O6AA 1JXKA 2ZA2A 2OLSA 1ECEA 5AC4A 5EFFA 3BO9A 4P8XA 1E6NA 3BCDA 5HNNA 3S2MA 3S1WA 2ISDA 2FHCA 2EQDA 1U5VA 1HP5A 1R3SA 2XINA 1VLIA 3GW0A 5K7JA 3QW4B 1WKFA 4IP7A 2CWXA 2E09A 2HPIA 3LD5A 4Z1AA 1C90A 1KTNA 3B4UA 4PTXA 3LNMA 5C9UA 3CEPA 1UWQA 4HVXA 3NZPA 2P88A 5DF0A 1XDJA 1FWGC 3LXCA 4Q8PA 1B3XA 1EXPA 3NPXA 1O6IA 4ZOAA 3IRSA 4H83A 4M29A 1NDWA 1HN1A 2PODA 1SO3A 4GKTA 2XM2A 3WQEA 1XUZA 1G9HA 1UP2A 3E12A 2XIBA 1Q6FA 2PDYA 1GHSA 5T91A 3URAA 2A79A 3GR8A 1VBGA 4JTTA 4JIPA 2VEMA 1K77A 4HJFA 4GVHA 3PJUA 3A6OA 3BANA 3SUUA 4LRSA 2H6RA 2ZXQA 4CNTA 3CYJA 1NF7A 4IT1A 4A3YA 2JEPA 1PUDA 3NQFA 3IUIA 4UOZA 1GKPA 3OU8A 1PHWA 2ZX7A 1TQXA 3PWAA 5KMYA 1UMYA 3W7KA 4Y9PA 4D6GA 4LV9A 4R33A 4I5RA 3TN6A 3SN0A 4RE2A 2FZBA 3G22A 1KGUA 1WKDA 4J3UA 5H8UA 4U33A 4LRTA 3PUGA 5A8PA 3OGRA 4N4PA 5IDZA 1HO4A 1UASA 4W8AA 1UWTA 3DFYA 4IG2A 3MC5A 4PA8A 3UJRA 3N18A 3GC4A 1Z7AA 2HBXA 4RZBA 5CZTA 3VNKA 2HJPA 4A2RA 1QBBA 2PDNA 3ITXA 5HQEA 1C8XA 3H2FA 1VHCA 1JG9A 4PMVA 2BHZA 4HNVA 3VAVA 3N6HA 1OHLA 2CLIA 5I07A 4JX6A 3O9NA 4UTFA 2NXHA 2ZUMA 1Q66A 3VTRA 5EMKA 3SM0A 2ZYFA 2QCLA 4NQ1A 1EJUC 4I9JA 4IISA 2ZBTA 2GDVA 1REQA 1HXJA 3PZQA 3HA1A 4FR1A 1GW1A 2ZUTA 4TTUA 4F4RA 1R7OA 2PBOA 5I24A 1W31A 4U10A 4Q32A 1K6WA 1V77A 4RNFA 4H41A 3LUTA 3E5BA 1HJXA 3T8QA 5IFPA 2J7CA 5IDIA 4NAEA 4P5UA 4I7WA 4E5TA 3CUFA 1E73M 3B8SA 4KS0A 2OX4A 1TV3A 1DWHM 3LCWA 3RCYA 1OM0A 1SO4A 3SN4A 4Q33A 4C6LA 5GPRA 4QNWA 4Z2KA 2VJXA 4M6QA 2Q8LA 1GPFA 4FF7A 4C6OA 1CGYA 1CDGA 3JR2A 1VJZA 3KBMA 2V5KA 3K5XA 2WNQA 4D6IA 3CAQA 5CPNA 2J77A 4GZIA 1XYCA 3C0QA 3LEPA 3PR2A 3NVDA 2H8XA 3G0SA 4ROPA 4XAYA 2Q3OA 4ZO7A 2YXOA 3MP5A 4L1GA 3EWXA 2Y5SA 2B7NA 1Q3NA 3KWXA 2PTYA 4QE5A 1TIWA 2F61A 4ZQNA 3PNUA 7A3HA 3V1PA 5HOSA 3R0UA 2VRJA 3ARXA 1X8FA 3BZGA 4DIAA 1RY0A 3VNDA 2IKJA 2XVLA 4XAPA 3S6DA 1UJPA 3J7HA 1V7YA 2WNZA 1NVMA 4YN5A 3G1DA 2W4XA 3CLWA 3VZXA 3JVAA 3TMLA 2QUMA 5K9DA 3PPCA 3BLEA 4G7EA 3MV01 3L4UA 3N2BA 1NH6A 1FY6A 2D3NA 4Y96A 4ZZ9A 4MAZA 3R12A 3CO4A 4CEUC 3B0YA 5XINA 3L2LA 2EPNA 5HAOA 3CPGA 3E2VA 2JALA 1JIBA 3OTRA 4IMFA 3KOZA 3EZ4A 3FHAA 4XIMA 1RVKA 3GXIA 4TUFA 3GG7A 2OYLA 3T44A 3RJYA 2P10A 3TSBA 3WNMA 4Q4OA 1XLGA 4WZHA 1QNSA 1MUMA 2R14A 4LUTB 1A3WA 2OYMA 3BAYA 2CBJA 2VENA 2VR4A 1DXFA 1E1EA 3L4WA 1AZ1A 4I7VA 1SVDA 4YCPA 4F0KA 4U5KA 4GYFA 2ZOXA 3RCNA 3SGGA 2A7RA 3WLSA 3EX6A 2E5DA 1BKHA 2P5NA 4GFSA 3RR1A 3GXMA 3MJMA 1IZCA 3KBWA 1J0IA 1OYAA 2ZX9A 3EDFA 2WANA 2XISA 2C71A 2OEJA 4AXKA 1JCJA 1UD4A 1WE5A 3PZOA 1XICA 1ZP3A 3AIRA 1W2VA 4K7VA 5I77A 2GVGA 4RDWA 2QDEA 2GOKA 4MTVA 3APYA 2QXWA 3S1GA 1G94A 1AG1O 4O28A 5CC3A 2UWFA 1K8ZA 3AU6A 5K4ZA 3LERA 3LCLA 3TC3A 3VOHA 1M9HA 3ZIZA 4C6QA 3I3EA 3K1DA 4AZIA 1J0JA 1J9YA 1TA3B 3ZYZA 2J47A 3WFLA 4YYCA 1RJQA 5A3HA 4DWSB 3N11A 2CBVA 3DYOA 1JI2A 2RFGA 2BVWA 1TTJA 1MQRA 1WDPA 4JQ3A 2GUBA 1BKSA 3PSWA 3WJZA 1PDYA 3S83A 2IQ0A 4Y8FA 4JDYA 3LTYA 3TTOA 3CLMA 2ISFA 2WBKA 2VRQA 1SUXA 2PURA 3P60A 3ME3A 3H7VA 4IPLA 2WKLA 2WSPA 3ZS4A 1UWRA 1F74A 4K7YA 3WJWA 1XSIA 3BICA 1EUAA 3RU6A 1VBHA 3LSBA 3PBYA 1R2RA 1VBRA 4NX5A 4JTCA 3P82A 5LYRA 2YBTA 2WKJA 3U7BA 2OO6A 1DQUA 1C9DA 2V5CA 3IGHX 3UA3A 3KRSA 4HZ7A 1D9EA 2V2HA 1XIBA 3LGDA 1XV8A 2QS8A 3LPFA 3IIZA 4CVWA 4ZB2A 3A5FA 1P4CA 4BY3A 4LBRA 4F79A 3CHVA 4KW2A 2QT3A 1ESWA 4E4FA 4GIYA 1BAGA 4POCA 1A4LA 3TDFA 3LX9A 1QNRA 3WNOA 5K3VA 1CTNA 3GSMA 2Y5EA 1DTNA 4X22A 1BXNA 2PLJA 1TMHA 3W07A 1YNPA 3SCOA 3QM3A 1FX6A 2GJXB 3GNXA 3V36A 1GVIA 3KDNA 4Z2LA 1B9BA 4S38A 3VKAA 3AIEA 4O52A 3VD3A 2G95A 1EGZA 1Z3NA 1YBQA 3BLDA 3GIQA 4OECA 4MB3A 3TA9A 5JH2A 3TYUA 3LGGA 5LXXA 5EBUA 3LRLA 3A4AA 3TXZA 1OINA 1YPIA 5CC5A 1ADSA 5BWFA 1P48A 1A53A 3MTWA 4OZOA 3MYPA 3U8GA 4ZE4A 3KDOA 1AA1B 4YJ5A 1GPWA 3P6LA 3TLLA 4BR1A 4RL3A 4HCLA 3GC2A 4QE4A 3QYQA 4D8ZA 5EKYA 1FDYA 4FOKA 4Q7BA 3N9SA 4WOZA 4AW7A 3QC0A 1OT2A 4RDYA 2OZ8A 4J3VA 5A8NA 4C6IA 3ERPA 3MVTA 3M16A 4RZ6A 4URIA 1H5YA 3E2RA 3A12A 1ZQ5A 1E0UA 2FH8A 3GQYA 3KVKA 4I8DA 4MM1A 2DORA 3KRZA 1HW6A 3LHZA 4HHHA 4V33A 5C55A 2WLYA 4AU0A 5BOEA 3W7LA 3CPUA 4DJED 1G0CA 2ZUWA 1JCMP 3ZSSA 4PMNA 3ANVA 3GTFA 1S5NA 3PB2A 1O66A 5DCEA 5JBEA 2BXVA 1MEWA 5AHMA 3GNRA 2WMHA 3Q45A 1NOWA 1QJWA 3FLUA 2XPKA 1FH7A 3PFRA 3D6NA 3GR4A 1JZ7A 4C7GA 1X1OA 2FHFA 2XSBA 3EXSA 3WLMA 3M5ZA 1B3VA 4AD2A 2FIQA 3RJXA 3DXIA 1WX0A 2X16A 4LAKA 2XZ7A 3SY5A 4NZJA 4L4LA 2BVDA 4GH3A 3R8GA 4GRSA 2X40A 2YYUA 4JQ1A 3I68A 4A6GA 1HKWA 3PBVA 1THFD 2DIKA 3C2OA 4E3TA 3KAOA 3ICJA 1UW9A 3II1A 3ID7A 4NRRA 5HJYA 2PDFA 3E0WA 3MWCA 1VCGA 1XC4A 1QT1A 2ATSA 4PBFA 4CCEA 2W27A 4DZ5A 4BI6A 4CQBA 3WG6A 5CZSA 4QLJA 3GZ3A 4PEKA 3U3HA 2X2YA 1HF6A 4YWSA 2H90A 4GUIA 4BWLC 1FWFC 1A5AA 1NSJA 2WZTA 4JNZA 4FLQA 2FGBA 4LAMA 1XLBA 2ZVRA 2GFTA 2F2HA 3VNJA 3R4IA 1UBSA 2XVKA 3AMDA 2B4GA 3PSVA 2H8ZA 2X0YA 3GS6A 3AXIA 4XZWA 5FF4A 3NR0A 3LA4A 1V02E 5FF7A 1DJZA 1UKTA 1AH0A 2R1PA 1FXPA 3AWNA 4UQCA 2CHRA 3TA6A 4Y9MA 2QNEA 3JUGA 4IMEA 1WZMA 4NG3A 3HMJG 4WDUA 3WQPA 4AWUA 4FS9A 3PZNA 5LIKX 1T6MA 4OGZA 1QTWA 2XH7A 3WLHA 4H1ZA 1KFEA 1Q6CA 5HUOA 1WNOA 3UERA 2V3FA 3I6TA 3AMCA 1BF2A 2A21A 4ILSA 3QPEA 4GQ0A 4H6EA 3N34A 2P3EA 3SFWA 1OFDA 3E0VA 3G5EA 5C2XA 3LYEA 1RPKA 1E1CB 6TAAA 1QHOA 3PBGA 1KGXA 3T0BA 3VGEA 1SFLA 4GXPA 1W5QA 6REQB 3GFZA 3BLKA 1V3MA 2V0TA 3SY8A 4PL2A 4Q4KA 2INZA 1EO7A 3RNDA 2WNNA 4Z08A 3O05A 3RR4A 3M0IA 5EMJA 3MDUA 1AH4A 3CV7A 4HPGA 2CLHA 2FYMA 3W01A 4PRRA 2CHOA 4IICA 2WMIB 4V27A 1RUSA 1EYWA 2Q3RA 3DUGA 2F6XA 4K6AA 4JKKA 1UWAA 3H21A 4LNYA 3W7JA 4JN8A 5JU6A 3KCOA 3F1QA 2PRLA 3EDDA 4YS1A 1W2PA 1PZ0A 1KM5A 5CJ5A 1E15A 3S5YA 1BF6A 4GI8A 3OB8A 4ERIA 3VGBA 4IJRA 1LLWA 3VOJA 5A6AA 5FEWA 1DP0A 4QG8A 3QF0A 3NG3A 2BS9A 4GUHA 3G1HA 4HSHA 1GOWA 1P0KA 3MANA 1Q2RA 5F4SA 2DJLA 2BX7A 5SWUA 4DY1A 2BMBA 2PC4A 4OKDA 2A85A 3IGXA 3WMBA 4AAJA 3NO1A 2PU1A 1L6GA 3H2OA 4DLMA 2A3CA 3CH0A 2BWGA 2PS2A 4JZ5A 3VKBA 2BOEX 4Q7NA 3W23A 1LYXA 2P53A 2VQUA 3SCTA 2Y7GA 4V1YA 3R43A 1VIZA 4RXFA 5BZAA 3TW6A 4L5ZA 3TAKA 2A0NA 3VC6A 5C54A 3LHVA 1UD8A 1UWSA 5EY5A 1GVOA 1ZL1A 1UD5A 1AJ0A 1ZJBA 3GKAA 3DG7A 4S39A 3DEQA 1LOSA 2YL8A 4JNMA 4R7OA 5G5IA 4KF1A 3B3DA 4MUPA 1IWBA 4KEZA 1ZTVA 5B7YA 4AHQA 2V6AA 2QJJA 2WOQA 1TR9A 5HMDA 3SY1A 2HBVA 2CXGA 4KRZA 3F2BA 4WDXA 1TV8A 5EMLA 3R6IA 3TC6A 1VPXA 1OQFA 3LI0A 4XBJA 3FGCA 1SZRA 2UV8G 1XLCA 2BY0A 4JTJA 3OW1A 5ECVA 5I3IA 4Q22A 2P0IA 1E70M 1NWRA 4Z1YA 2CLLA 3SIMA 3UG4A 3W88A 5DY2A 1UZ1A 1RJPA 3D47A 3IV3A 4JL1A 3VUPA 4AMAA 4BQ3A 4UFLA 4WSHA 2TRSA 5EMUA 2DH3A 2YB4A 1EP1A 3MCMA 4ALDA 2PCEA 4D2JA 4LH8A 4HOWA 3WX7A 4ICMA 1BYBA 1TV2A 3EKZA 2OOFA 4IPJA 1XYLA 4ZENA 4M3PA 5DLCA 3E2SA 3PNZA 4M19A 5HDRA 4NZ1A 3G0UA 2E25A 2P50A 3HGSA 3WQDA 1LLOA 4M1RA 1W17A 2CW6A 3QGAC 1L8PA 3DG6A 1MYRA 3TTQA 3OLGA 5BRBA 3G0XA 1IT8A 1KC7A 2CZ5A 1KRAC 1G4TA 2YDSA 4XD4A 2QUTA 3DOPA 2NQZA 2O7SA 1W1IE 1E72M 2X1SA 1EIXA 2A7PA 5HUPA 5BWAA 2G3NA 2F6KA 1TRDA 2Z1KA 4C91A 3WQOA 3M43A 1U2YA 1Q7MA 4UR7A 5CZKA 3UNTA 4MNLA 5A69A 3AUOA 2VCAA 3HFTA 1TYGA 3HG2A 4IQEA 1N8WA 2V30A 1YTEA 4MB1A 1PB0A 1GNXA 2E3ZA 4MG4A 4IFOA 3CC1A 3L9CA 2OWWA 3W4RA 4QJ5B 4H7CA 4HT3A 3LMYA 3M0MA 1GEQA 1KCZA 4BK9A 4FAMA 4UTKA 1RBLA 2QZRA 3W1LA 1O1ZA 3NWRA 1GWJA 3ARRA 5M17A 3MHFA 3VKKA 2XIOA 2UBPC 3RPDA 3KHDA 3ZWSA 3S9ZA 4M0XA 2VELA 3DESA 5D38A 2CZVA 1LORA 5F1VA 4DO4A 2WZMA 4ACZA 5BU6A 4QNEA 4MWAA 4DO5A 5LNVA 1DIEA 3H7UA 4Q4PA 3BMXA 3MMUA 1KXHA 1UD2A 2V2CA 4HNTA 5A6MA 5D2YA 2AL2A 2QAPA 2Z27A 1OVDA 3MHUA 5CLTA 1NU5A 4NAEB 2PDKA 1OBAA 5L9FA 2DV0A 2NSOA 4IIFA 5CZJA 2C7FA 1W32A 2WNWA 3VIJA 1LT8A 4MGGA 1YDNA 4YTTA 1OGGA 3W6LA 1KR1A 3FDKA 1QPQA 1B3WA 3ZVIA 1JPHA 1VFSA 2B0MA 4HU3A 3NGFA 4HTYA 3NQGA 3GHSA 3QR1A 2CLEA 1TB3A 3SADA 4AC7C 4DBUA 1O5RA 4UUIA 1B4KA 1XRSA 1F6YA 3DCPA 1TWZA 3BMVA 2OT0A 1NQKA 2OSXA 2W63A 3UZYA 4EK7A 4H04A 2PDQA 1VFFA 1FHUA 1UR9A 1OIMA 3TVAA 3CUGA 1GT8A 5E09A 1RP8A 1XWYA 3RXZA 4HD5A 3WNKA 1ITQA 1H63A 1QI0A 1W5PA 4G7EB 4WGHA 1TVPA 1QOPA 4DJDA 2V3EA 3MYOA 4FNUA 5FF3A 1V6TA 4C1NB 1PIIA 1VRXA 1K4HA 3HGOA 2GDQA 1XCXA 3SW6A 3ALFA 1F76A 2AL1A 2WO5A 1E56A 1E9IA 3TC7A 3UWYA 1CYGA 1XBYA 3CL7A 1IV8A 4GHRA 2HISA 3T1GA 2PDGA 2X0HA 1AMKA 3WQWA 1U1JA 4EP8C 2G4FA 2XVNA 3C61A 3W85A 3DFOA 5C2GA 3HG3A 4WSKA 4KWUA 2XH4A 1WXYA 4A22A 2OT1A 3M44A 4H9MA 3THCA 1OGSA 1LDCA 4W8BA 3HBLA 3WLOA 1TZ7A 4OV9A 4HBKA 4RPQA 3H26A 4MDOA 1Q85A 4HMCA 2DZWA 1ADOA 2VZOA 3HIJA 1ODUA 2EEXA 3L68A 4UIOA 3WZ0E 2W66A 1QK2A 2FKPA 3K1GA 3PZUA 3QYSA 1M01A 1QNOA 3P80A 5GJMA 3NQBA 2VFIA 3W81A 3PWGA 3N3TA 4U2YA 3KBVA 2W0UA 1MDLA 3GU2A 4NAFB 3FKKA 4PUJA 4R3UA 4LS1A 1KGWA 2WQDA 3QQ1A 3T40A 2ON3A 3S2JA 4MWAD 2GOUA 4UWMA 4A3HA 1V5XA 4HNCA 5FSEC 1GGOA 2VFGA 2D0HA 3QFWA 5D32A 4GBUA 4IGNA 1W91A 1UYQA 1D8CA 1DORA 4HHPA 2C14A 4JIQA 3VI2A 1I1WA 3VO0A 2YFOA 2RDXA 3EWZA 1EQCA 1H7WA 1BPLB 1DE5A 3E5PA 5B80A 4MWAE 3BW3A 3T0DA 3WUBA 1BLIA 2JIWA 3BUVA 2ESCA 3P5ZA 1TPVA 3HU7A 1GOMA 2NXIA 1UR3M 4KIEA 1GG1A 1QPNA 3T05A 3SCVA 4ZQOA 5E0FA 1QOQA 3VXGA 3W71A 1IEIA 4Z17A 1HUVA 1RAKA 1HL8A 3TQVA 3WD0A 1EX5A 2G96A 1R2SA 3QKEA 3MB9A 4DHGA 3JS3A 5D02A 2CNCA 3O15A 4YIWA 1NFBA 1MI3A 1CNVA 4C5ZA 1KR0A 5DN1A 1UROA 4OE7A 1TFVA 1Y5VA 3QMTA 5BYWA 3RX4A 3UP8A 1X1ZA 5PTDA 1CENA 3TYZA 3W2UA 3LCGA 3FNDA 4Q8TA 1UR0A 2J4GA 1YXDA 5HJLA 2DVTA 1VAHA 3PY2A 2O7QA 5BU9A 4B2DA 3HOJA 1SZFA 4JHZA 5FKYA 4ES4A 4M5PA 3TV8A 1A4MA 1E51A 5CG7A 5FD0A 2W6RA 4G2DA 4REQA 4JN6A 2FZ8A 1E4IA 4ZR8A 4ZSUA 3KLKA 3THQA 4PFHA 5G4EA 4JTHA 1JPMA 3GXFA 4Z1CA 5A6TC 4MJ4A 1R3WA 1W9VA 2MNRA 3SRHA 2IPWA 3AROA 2XHYA 3Q37A 4O1DA 2NVCA 2J25A 4HNUA 1SR9A 2YZ5A 4JXCA 2C1GA 1Q6LA 4KESA 3DH7A 1YADA 1S2UA 2VC6A 4KGJA 4NZFA 2DT1A 4UR9A 3OZOA 3TEVA 3RLGA 3P14A 4W93A 5G2HA 4UTUA 1V08A 1GEHA 4L9ZA 1H0IA 5D4YA 4FLSA 5LSMA 1Y65A 4XZNX 3OBKA 2GWGA 3KCLA 4INFA 4ONVA 3TZFA 1JDEA 1A5LC 5DX7A 4GIAA 3TR9A 3LS9A 4O14A 1QWGA 2AQVA 4NILA 3REQB 4K8HA 3R8HA 2QV4A 2DT2A 4KT2A 2OQYA 5GJPA 3AIWA 2CIPA 3ARSA 5C71A 1UPPA 4XO6A 4E3VA 2VUNA 2CYGA 2WJEA 3EKLA 3BG9A 4F9JA 5AHNA 3DDMA 3TCSA 2XFFA 1G01A 4HA4A 4JYFA 4QLLA 5CGQA 4U5IA 2J75A 4MF4A 2ZRXA 3L4XA 2B81A 3WDRA 3KTCA 3BLFA 4KWVA 1J10A 2DUZA 4GQRA 4I6KA 1V0LA 4LAUA 1X96A 3AS1A 3ZFHA 4O18A 3MMTA 4GH1A 3R0DA 3C0JA 2OX1A 3TYAA 3LB0A 2YBVA 1XRVA 1Q8AA 1KNWA 2V68A 4GYJA 3DFSA 3TONA 1EZWA 3BL3A 3CZ8A 2CLOA 3N6JA 3CHDA 3TFCA 1BQGA 4XWUA 2BBFA 3NNTA 2BGQA 1QW7A 3V35A 4WY0F 2FB3A 2VX4A 3UGVA 4WX2A 5F4XA 3B9OA 3UWVA 1SSGA 1H51A 1JUBA 3SEPA 1IQ8A 4EWJA 3ITGA 2I1OA 4E8CA 1EX1A 2YW4A 4M6VA 3KOXA 2PLKA 2ISWA 4LB4A 2PGRA 2HRWA 4QROA 1GQJA 1J0HA 3W0KA 2A3EA 3VABA 4WKAA 3WN6A 1O7AA 1Q63A 4Q4SA 3UXIA 1XPGA 3WLIA 4HHMA 1CGVA 2A3HA 3E1F1 4NL1A 1US3A 1WA3A 4IGSA 1N8FA 3LCXA 3U5YA 4N9DA 3EPNA 1XIMA 1RSCA 1IE7C 3A4WA 5D9OA 4PCPA 4AD3A 1RD5A 3P7YA 4IFKB 1IYXA 4GVFA 1I9CB 1F2JA 2ZX5A 2JFEX 5T8GA 5E1QA 3L21A 3MZNA 1VYPX 5I78A 1QFEA 1B9ZA 4ATDA 4ATLA 5TBOA 3GVWA 3QN3A 1UOZA 3OHMB 3OYXA 2NUYA 4C6JA 3S1UA 1MRAA 1SM9A 5D2XA 4XD3A 2XSXA 2RJGA 5LNUA 2VFFA 1QRQA 3HURA 3BSMA 3EDKA 3O0KA 3SSZA 4GBDA 3SECA 4FIRA 3EEGA 3NSNA 1OF6A 2R82A 2X05A 4W9TA 2GGHA 4D1IA 2DZBA 1LUCB 4ECLA 5FACA 1UKSA 1W1A1 1TTPA 4OHQA 3VFCA 1FDJA 3I6RA 3D0CA 3B40A 1G4SA 3F4WA 1SSDA 4PBGA 4DZIA 3UF9A 5HNTA 4KCTA 1FHDA 3CUJA 5A6BD 8XIAA 1JRCA 3VZYA 1M04A 4M51A 3DBNA 4B15A 1IEWA 3VCCA 1P0NA 4PMYA 1XIGA 3PZGA 3IARA 4HQVA 1CGXA 1JDAA 1VGAA 4FNTA 5A2AA 4O54A 3BQ6A 3MP4A 3WLTA 1UB3A 2QDGA 4WCJA 3BQ5A 1WZKA 4X0VA 4ZFCA 1O1HA 1OFAA 3VDAA 3BGGA 1C93A 3IK2A 3AUJA 4IPIA 2GJNA 4JX4A 3S4TA 2DY3A 4NZ4A 1Y5XA 4HYWA 3W7RA 2VL4A 3CIXA 5KZ6A 4DF0A 3PUDA 5MKGB 2J27A 3W70A 4HU8A 4HPJA 1J11A 3MKVA 1SGJA 4GI9A 1BSLA 4IQJA 5G2WA 3P2VA 1YPXA 1TJ2A 3V1HA 1ONXA 1WDDA 1XLMA 4BF5A 1R0MA 4UQAA 3QPYA 5D09A 1R8LA 4JTKA 2DSUA 4NJHA 4H9TA 2DVUA 3OZMA 1J2WA 2O55A 4JGDA 3VKDA 3HPAA 5I7GA 5E6YA 1MW0A 3QV7A 4X0NA 2VEPA 1IWAA 3Q4DA 4IJCA 4NASA 3W25A 3V0TA 3SZ8A 5LIYX 1E1FA 3PVFA 4AD4A 1V0NA 3CUHA 1K8XA 1UD6A 3U57A 3KWSA 4HA1A 2RDUA 1WOAA 4JKMA 4MKNA 1KXQA 5CC7A 3W22A 3BC9A 2WVTA 3C3NA 4TVDA 4LYQA 3AICA 4LUSB 3T81A 1ICQA 3H2CA 1VFOA 1EHAA 2PB1A 1XS2A 2PGFA 3CZEA 4GGBA 3K30A 3M0ZA 2G3FA 3NIYA 5F7UA 1B4EA 2OEMA 1DWGM 4AY7A 2WVVB 3MUCA 2E6AA 2DSZA 4TU1A 3GZAA 1E40A 4GUGA 1QO5A 3JRKA 2I16A 3THDA 1KBLA 4JTEA 4GFIA 4XAZA 3DIPA 4MYXA 4FF5A 3TFXA 2HPMA 4W7VA 3INPA 5AYXA 4F0LA 3XIMA 4AY1A 1F61A 4W5UA 4WVXA 5I03A 4MPQA 4IH3A 3R94A 1AD1A 1BVZA 3N4EA 3SGZA 4US5A 4OQVA 3JZEA 4F0RA 3T9PA 3AMKA 4JQ2A 4PBEA 3TTEA 3TAOA 1KB3A 4K38A 4GLEA 3EWCA 4L9XA 1G7VA 4YXGA 2PLMA 3UJEA 3N2OA 5G4WA 5D33A 4B4HA 4WK9A 4PULA 4WIWA 3T7VA 1FWDC 3E2QA 4GZ7A 3NDYA 1FDZA 3CHCA 1T41A 1GG0A 3GM8A 3TYBA 3LZ3A 2FTYA 4J3WA 4RJEA 4DXXA 3AALA 3ONBA 3VA8A 2I9UA 2HROA 2RHGA 3R7MA 3IV8A 3L65A 4TXEA 1XISA 3GVVA 5IHRA 4KWWA 3L5MA 2J6VA 2ZZ4A 1F8IA 2HVOA 1UH2A 1Z42A 4EXBA 2PWFA 5M1TA 1I4NA 4FR6A 3VDCA 4C6FA 2BP1A 4KPLA 3NUKA 5DY3A 5I3GA 4L6HA 1SZNA 4GQQA 4IM4A 1XKYA 4PCFA 4PUNA 3RM4A 1AD4A 1JPKA 5E0CA 5LNRA 3C0LA 5HR7A 1VQTA 2FMNA 4LW7A 2NVDA 1LL6A 3B9DA 4NKCA 3KZPA 1EO5A 5HINA 1XYZA 5EFDA 3SCPA 1IXPA 4RKAA 3OHIA 5AZ0A 4FNSA 3TU9A 3ABOA 4GINA 5DFAA 1X97A 3UESA 4Q6JA 3LSCA 3LI1A 4EX4A 2NQJA 4ROQA 1O5QA 2XIMA 4LC6A 2V3GA 1IGWA 3FVDA 1J96A 1OC5A 4MWAC 6ENLA 4MYAA 1NFPA 3NQCA 3TJXA 5AC6A 3RPTA 3LZ5A 2PEVA 1P6BA 2XVPA 1DJIA 4D8LA 1EIBA 2WB5A 3IJ8A 1AQFA 3AIUA 3WLQA 4AEFA 3GU1A 1YQ2A 4FHAA 3W2NA 1XGZA 3M0JA 1NWTA 2WV8A 3T0AA 1CXHA 2WYSA 1VFTA 4EVZA 4HOZA 4PTVA 4W7UA 4XD5A 2VUYA 5C8BB 3QSRA 4C6MA 4TTGA 3CAKA 3QR3A 4ZOEA 1PIGA 1T0OA 4MJMA 2EO7A 1EHNA 4UMBA 1FCBA 3W84A 4WUIA 3PZIA 1S5TA 4OIFA 2VNCA 3GUGA 4O13A 1KO0A 3ZM8A 1E6PA 3EMZA 3VMOA 2CBUA 5AZ1A 3UWUA 3LLXA 1RK5A 3NQAA 1Y7VA 3EA2A 3NO3A 3WL1A 1KM2A 4I8YA 4ORIA 2PTZA 3UJSA 5F1UA 3WQVA 4QR6A 2E8YA 4UFJA 4NXSA 1RXOB 1B3ZA 3NDZA 5D04C 1YNYA 3S0CA 4Q8WA 3HN3A 2WHJA 3HZ3A 3A3XA 4S23A 3NL6A 1NM9A 4PMDA 1RCOB 1F73A 1LT7A 3CV6A 4U3AA 5DCDA 1RK6A 3RO6A 1BD0A 1BXCA 4JIHA 4DXVA 5A8OA 3B05A 4QM1A 3BAWA 3GDLA 4IFRA 3GXDA 4Y9OA 3TWBA 1UZ4A 2JE8A 3LPGA 7REQB 4Z2IA 4LUTA 1JNDA 1MUWA 4P2VA 2C1HA 1UJQA 5B7ZA 4Q8UA 3ZT7A 2GZXA 3W86A 1JZ6A 1XLKA 2G3MA 1BWLA 4PMQA 2J8FA 4RLIA 1ZB5A 6XIAA 1ICPA 1UZDA 5ABHA 4OTKA 5E70A 5AC7A 3MV11 3KZSA 5KINA 1T8XA 1FWIC 4O15A 4QEHA 3CMJA 3FJLA 1DWIM 2VOMA 1ONRA 4S3FA 5I79A 1WV2A 5LA1A 2QYGA 5AOUA 2D20A 3TUUA 4RNIA 1OJXA 4JIEA 3MT1A 5E9AA 3ABQA 2E6YA 4WKFA 3U2EA 3CV1A 1K9EA 3GK0A 3MI3A 3UJ2A 1NJJA 1K8CA 3C4UA 3AIBA 4JKLA 2OKOA 5D03A 3QJAA 1EJ7L 4G5DA 1TA3A 5A5WA 4KQNA 3VDHA 1XI3A 4DWSA 1TV5A 4HK6A 3P61A 4B3ZA 3CGTA 1HJVA 3S9YA 3RIKA 4BCEA 2J7EA 5D9NA 4BS0A 4DUVA 2AGKA 3QY6A 5I23A 1W0MA 4CCDA 3OBEA 1J6OA 2Y63A 1HTIA 3IJ6A 1SR0A 1WDRA 2X7WA 3M7SA 1DOSA 2VI0A 1J2BA 3VDBA 4K1WA 4L1XA 3G1RA 4MMWA 2XTKA 1GTEA 1NOUA 2VVNA 2DFAA 5TIMA 1QBAA 4LF1A 1ZY9A 3GTIA 3OZPA 3I7SA 1D7FA 1SFTA 3QZAA 1JYWA 1Q6OA 1J93A 4AUBA 4UZSA 4WJ8A 5LHFA 3R13A 2XFYA 3KEHA 2YX0A 4MOZA 3C52A 4CNPA 3C2YA 4X3ZA 1CZ1A 5HWNA 2JQXA 3NM3A 4JR5A 3V0UA 4DI8A 2WHMA 1J6PA 3CL8A 3LHTA 2NWRA 1SQ7A 4UCGA 2DEPA 1JCNA 3E0FA 2Z1SA 4DQWA 2QCHA 5CJMA 4I6VA 2F2KA 1YNQA 1W3KA 2SFPA 4L4OA 2J24A 1XYBA 3WDJA 5KITA 4AD5A 1KM3A 1CECA 1VFMA 3DKLA 3STFA 1DQXA 5CSSA 3ARUA 1TUFA 3GYEA 2BLEA 1QK0A 2VOTA 1GYMA 2GJXA 4AX6A 1G4EA 4XB3A 3SQMA 4H8VA 3GD6A 1B3YA 4RNHA 4W7WA 3V75A 3CIVA 2VURA 3BSGA 2F7FA 1AW1A 4HNLA 4IMCA 4JTRA 1FRBA 1JF6A 4LY4A 3DGBA 2BXZA 1Y8BA 4MHBA 2EBNA 4RK8A 4ZMGA 4FB7A 1IF2A 2MANA 2G3JA 3HTWA 4K39A 1ZSXA 4XX6A 1EDQA 2FJUB 4QG6A 3UBPC 1E55A 3O7UA 2WMKA 3PTMA 5DELA 4GY7A 4F40A 5IXEA 4Q3MA 3THUA 1DE6A 5EYWA 4A3UA 1LWIA 3U4AA 2GGEA 2GQ8A 4HB7A 4D6HA 5BXTA 5D9MA 3G1AA 5ENLA 1GHRA 1Q6QA 1Z41A 3JW7A 1V3IA 4NI8A 1TPUA 1U83A 1EC9A 3OODA 4ADTA 2MUCA 1I45A 4KEUA 4XK2A 1R2TA 2JGYA 4H19A 4C60A 4ATWA 1UKQA 3H70A 3NQ6A 3NSMA 5BOFA 3C0SA 3O8AA 1OWQA 2NSXA 1KXVA 3LM3A 3VVGA 1HKVA 3WH5A 3TSDA 1EF2A 4EPDC 1WCGA 4KEVA 4JFSA 4DXKA 3MSYA 4JS3A 3FS2A 4CCCA 1B30A 3WBYA 2WZEA 3M6DA 5CQ1A 4V15A 2QCDB 7CGTA 2D23A 3A3WA 2H9AB 3RMJA 4IUOA 2OCZA 3VNYA 5ABEA 5C9WA 3V5FA 2TSYA 7PTDA 3E38A 3GHRA 1T7LA 2OLAA 4US6A 2DZUA 3VINA 4NZCA 1ZAJA 1FVPA 4YTUA 3WLLA 1YX1A 1W8SA 3UR8A 4QXIA 1Q7ZA 4GXWA 4LS2A 1TV4A 4G9PA 4S2CA 1JUEA 3EAUA 2ONEA 3ARWA 4S3DA 5I0DA 3AIVA 4OUEA 1XXXA 4WF7A 1MXSA 1R30A 3AJXA 3ZR5A 4ADSA 1FWBC 3VPLA 1NQ6A 1KFKA 2G50A 2OWCA 4U28A 3MDWA 4GG9A 3UQNA 3GXTA 7TIMA 4YVPA 2Q71A 5GNXA 1JAKA 4DF2A 5A94A 1DXEA 1GYLA 5HNRA 2EJ1A 3M0VA 2QKFA 4GZJA 2INEA 3MUXA 3BVJA 4DVOA 4LB3A 4CQ8A 5EBAA 3RX3A 1IT7A 4IX0A 4GJJA 4AG0A 1OFOA 3G6LA 3NQ7A 3UJFA 2RJHA 3AYSA 5FESA 3RRXA 2DGAA 4ZQCA 1HZYA 8A3HA 1IZJA 2GJRA 4ML4A 4S3BA 2VC7A 1OK6A 3HF3A 2VYOA 8CGTA 3HG5A 5JBFA 1XX1A 1OX4B 2YA2A 4XG1A 3P5YA 3PG9A 3N2CA 1XDMA 2ZXAA 2WCSA 3B8WA 3BJFA 4AHOA 2WC4A 1H50A 2OOGA 3WBAA 1DJYA 3EKGA 1XG3A 3Q65A 3HPZA 5HNUA 3NO5A 4CD8A 1C3FA 3VNZA 1E1CA 4Y90A 3L4ZA 5KSWA 4A4AA 2EG6A 5JBDA 3QPZA 2ZC1A 6REQA 2DSKA 2Z1WA 1Q7QA 4CN6A 4GNJA 3V5OA 1SZGA 3SQSA 3F2CA 3HO8A 5E5CA 3HJEA 3BGJA 2ZZ5A 2A3AA 1TG7A 1JR1A 1TWIA 5CPTA 4UFKA 3G8RA 3WF2A 4IGMA 4J2PA 4H9VA 2WMIA 3SCUA 5H6HA 4BZYA 3LPOA 3PZ9A 3M5XA 4UNLA 2B7OA 2DJXA 1F6PA 1HIZA 5FCZA 2QJNA 3NA8A 4PMOA 3QFEA 5CBBA 1P6WA 2XGIA 2F84A 3WDHA 4OOUA 3GIYA 1MFUA 4DJFA 1DIKA 1P7TB 3FSTA 2GQAA 3W7HA 3O6DA 1W1YA 1H41A 2C79A 5AN7A 2J7DA 3CJPA 2Z4GA 3LPPA 1GK8A 1N7KA 4LJ3A 4C6EA 2Y89A 1NDVA 1QI4A 3CHFA 1PKLA 3LTPA 1EJTC 2YCLB 3H4XA 1D3HA 3P0XA 4FNQA 3VOGA 1V3HA 5I09A 4O53A 4UTJA 3TH6A 2ZC8A 3MCNA 1J0YA 3A9BA 1TKKA 4LF2A 2CPUA 4RZ5A 3SUTA 3E3HA 1XH0A 1DWFM 4M6PA 3H53A 2GQ9A 1WAWA 5CSYA 1S5WA 3L4YA 4JIRA 2NQ5A 2FVKA 3N12A 1J12A 1LBMA 1M3UA 1MDRA 3CZGA 3SBFA 5AYBA 3W75A 3S5OA 3H2NA 3KS5A 2VDGA 1PAMA 2BDQA 2PGEA 3H24A 3D46A 4HYVA 4KETA 3W6YA 3HQPA 4PUDA 2QF8A 2I57A 2R1KA 2QMJA 1F5ZA 6XIMA 2ZA3A 5M2FX 1EPVA 4GCAA 4L1WA 3WEOA 2DW6A 4QJ1A 3GDMA 3S6OA 3U6WA 1A3HA 3W7DA 3L2MA 2PDLA 3K46A 5J04A 3KL3A 2DUAA 4KERA 4CQ9A 4O8RA 1IIHA 4PUKA 5ABGA 3T09A 2A6NA 2PDHA 4Y8EA 3AYVA 3M5YA 3NSXA 1IXQA 1OCJA 4AYGA 4P8UA 1V3KA 4IGHA 5DMYA 2XZ9A 3H2EA 4D72A 1SMDA 2EPLX 3UZXA 3BAKA 2DZTA 2ZADA 4XSLA 4S2BA 3E9AA 5CPQA 2ADAA 2JGQA 4DO6A 3NQEA 3UGRA 3G77A 1XBVA 3NOYA 5C70A 2DZVA 1I6NA 3GFYA 1GVEA 4LEQA 1MSSA 1HG3A 2D2JA 4AB4A 4DEFA 1CBGA 4QFUA 4AEOA 3DFPA 2VWSA 2BNJA 2WXDM 2QR6A 1OFPA 1ZJHA 4J1OA 3WYZA 1CLVA 2W67A 1ZBVA 4ZGYA 2YFNA 4B5WA 1TJPA 5FJJA 1GOKA 1M1BA 3ITYA 3N2MA 3ZLHA 1AQ0A 4ICNA 1H1YA 1XD1A 3S2NA 4XZHA 3V16A 3P3BA 3W1QA 3GR7A 3OA3A 1PV8A 5CSRA 4S3EA 4YCOA 3WQ6A 4I5XA 4PUMA 3V18A 5LIXX 4XQ6A 2NV2A 1ZPTA 2Q6ZA 1KCKA 3DENA 1XRFA 2GVYA 2F8QA 3AXKA 3WFAA 4AD0A 1GJWA 4M56A 4PTMA 2O0TA 3K8LA 1K02A 1QOXA 4EANA 3H55A 2GJPA 2DH2A 1VEPA 5J8LA 4QAIA 1EKOA 4RV8A 4R5EA 2WSRA 4O10A 3I7RA 4AZ6A 2Y1HA 2OWXA 3STGA 2EPHA 4PSPA 5AHEA 2YOCA 1HQTA 2H3BA 4ZXLA 3TCEA 4DLFA 4ZQPA 3VCNA 4Z2JA 3VMNA 2R9RA 3R2GA 4JYDA 3VIHA 3TJLA 1FWCC 3OVRA 3EOOA 4TO8A 1GQIA 2Y24A 4IUGA 1B57A 3N9KA 4NY2A 1GVSA 4QCEA 5IFTA 1WUEA 4HMNA 3KFTA 3VGHA 4UBPC 3WO8A 2H3DA 4NI3A 4ZFMA 3EOSA 4LX4A 1XL9A 1EOKA 5A8QA 2R6OA 1EP2A 3WFZA 1EQPA 1A49A 1Q6DA 1BVWA 3E0IA 3ZLGA 1ML1A 4F3HA 4O8AA 3MP3A 1I2PA 3W83A 1X7FA 4AZHA 1A5NC 4EAYA 2V82A 3LK6A 2ZUNA 3FJNA 1EBHA 3F4CA 3N3MA 3FK4A 3GAYA 2QPXA 3DHUA 4FOJA 1EC7A 2Z24A 1H7XA 3F03K 4JFVA 4HKPA 1PHQA 2A1YA 4HTBA 1OF8A 2YL6A 1C7SA 3UNDA 4AIBA 4WY0B 3MSRA 3DBPA 3NOEA 1Q6EA 3TWAA 3M64A 4IIGA 3LM7A 3K8KA 3B9AA 1AODA 4UTWA 4MB5A 4UMCA 3E96A 4GY1A 3B9NA 2BZNA 1UR8A 4K68A 1CXKA 4UTMA 3U48A 2TODA 2QV5A 3W87A 3UFYA 1H1ZA 4QDWA 4KWOA 3DI1A 1Q45A 1XBZA 3JU2A 1J18A 1F05A 1GVYA 4RPPA 1XGEA 3S9IA 1DIOA 3AWOA 1DXIA 4A8RA 1S38A 2Y5JA 2PDIA 1FQ0A 1YHTA 2HTMA 1UKOA 4G7FA 1U30A 4O12A 3DC0A 1AQHA 1XUUA 2W91A 1M6JA 3AXXA 1XLLA 4GQBA 1NWSA 2G4JA 3VIFA 4UCFA 1RD6A 5HR6A 3UXAA 3QW3A 4HIBA 4Y7EA 1PKMA 1R5YA 4J3SA 1O5KA 3L0KA 1LWJA 5D30A 3F4DA 4E8DA 4MY9A 2R24A 1E43A 4E0CA 3N29A 1L2UA 3VIKA 2PTWA 1MVYA 1HVXA 1UUQA 2E1DA 4Z0SA 4L4MA 3JZUA 3B8VA 3LQLA 4J7RA 2DIEA 4C1NA 4O4WA 3TJ4A 3APGA 1J0KA 3AU2A 3WQGA 1L8NA 4B9ZA 4CD4A 1B54A 3KUMA 3P8JA 2RGLA 2LLEA 3VGFA 2VXNA 5D2VA 2HVMA 1WPCA 5AVHA 3WL0A 4PYSA 4G8TA 3V3WA 4FK9A 4RZ4A 1OSEA 1WZAA 3KVMA 1Z44A 3L12A 2OKTA 3WBEA 3RILA 1T99A 2OR2A 4HSNA 2YDQA 1ITUA 4A8IA 3CUIA 5DBUA 1PKYA 3EOLA 1LRQA 2J7HA 2F9RA 1ZCCA 1PZ3A 3GC5A 1Z9AA 5CEWA 4LVDA 2Z0IA 4QEEA 5LZLA 2NQ9A 3MI2A 1EJSC 4LQ1A 2CBIA 1S2TA 2VGIA 1S3HA 3F4NA 5LGZA 3G18A 1OX6A 2HDJA 1CT5A 2FTWA 1KQZA 4TOQA 3K4AA 4OBTA 2C18A 1IXNA 4NAFA 3OP2A 1JDCA 1JXJA