2BXVA

Dual binding mode of a novel series of dhodh inhibitors
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
367
structure length
360
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title Dual binding mode of a novel series of DHODH inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 133
structure length 360
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bxvA00
1RVGA 5FF3A 2A7NA 3QMRA 1NVMA 4BK9A 4CCCA 2ZTKA 3GNNA 3HGJA 5C5YA 1GJPA 1T96A 1VHNA 2A6LA 3HG3A 3C56A 3HB9A 4UCGA 2I1OA 5HMSA 1QMLA 4FNUA 3MP5A 3SI9A 4UMBA 3A5FA 1P4CA 3RFAA 4MZYA 2XN1A 3UZJA 3M9YA 3QSTA 3N3MA 4Y9AA 4JDBA 2Y88A 2A6NA 3A23A 3G24A 4YLWA 3EX6A 4A21A 3O8AA 1IGSA 1RPXA 3P7YA 5D09A 3MUXA 3ABOA 2CZDA 4PL2A 5KSWA 1JCLA 3TIMA 3IIZA 2DP3A 3TFXA 1FCUA 3OHIA 3W1AA 2CW6A 4DBEA 4LS1A 2P0OA 1O5XA 2ABAA 3WK2A 2VEIA 4YMZA 3BG9A 4A2SA 5ABTA 2C0AA 2QUUA 3HG5A 1FBAA 3KVJA 1CX9A 1GZGA 4HPXA 4JTFA 1JRCA 3MHUA 4AWUA 4RV8A 2ZRUA 5FEXA 2YW3A 4RX0A 4QSHA 2WQPA 2GPTA 2CLFA 1XC4A 4KFNA 3NPWA 1K7XA 4OT7A 2E5CA 3EEGA 4ZQPA 5HR6A 1Z41A 5SWUA 4UMAA 2VFEA 3P82A 3BK0A 1A50A 4ZQRA 4QAIA 2NWSA 3P5ZA 1FQ0A 3GAYA 2YR1A 4O11A 3V1PA 5H2ZA 3PVFA 1QFEA 1CW2A 4N4PA 3W7LA 2QCCA 1Q6RA 5G1TA 1OF6A 5EKYA 2FPYA 4M7SA 4CNOA 3VI2A 4E0CA 2VXNA 4IMEA 4D2JA 2Y6ZA 3QFEA 1P0KA 4FNPA 3L0NA 5D38A 4X22A 3E12A 1R47A 3B03A 4AEOA 1SQ7A 2RKXA 3NAVA 1S5WA 4DF1A 1SSDA 4OHQA 3KXQA 4DBDA 4R7JA 4OV9A 3TC7A 4O14A 1OX5A 2J24A 1KTBA 2BWGA 1A5CA 4PH6A 4WUIA 3TQVA 1OK6A 4A22A 4JYEA 3RNDA 3GDTA 3PAJA 2E1DA 5D02A 1H1YA 3W7MA 4N9DA 1FDZA 5J5DA 4M6VA 3W07A 2HS8A 4JTJA 3NQFA 1GEQA 1H7RA 5EMUA 1KBJA 1ZALA 3N73A 5EL1A 4LVAA 4O52A 1H5YA 3N14A 3EXRA 1GTEA 1SR9A 1L6SA 2ZA3A 3EWWA 5AHFA 1BWKA 4OWGA 3PF3A 3SECA 3P61A 4H4IA 2PURA 4JN6A 3NM3A 1SZGA 3M5XA 1YXDA 1VCFA 3CU2A 3PUEA 2QKFA 1TREA 3DENA 3BLEA 3W7OA 4QQ3A 3YPIA 3I7QA 2JK2A 5DXYA 3W2JA 4AF0A 2VENA 3QYQA 5D04C 2BTMA 5EA9A 1A5BA 1BWLA 3S0CA 3M0ZA 1FWSA 2X2GA 4MZ1A 3CB8A 3W2UA 3O15A 2TSYA 1YADA 1IIHA 1OFEA 3W2NA 1NF0A 4LVFA 3SFKA 3EX3A 3STEA 3M1ZA 1PVNA 1QDSA 1YXYA 4NT0A 1FXPA 3PG9A 1YDNA 1THFD 5IBXA 1OFQA 4CCEA 3PUOA 1TCDA 2DJXA 3PBVA 1H62A 3E49A 1FWTA 3M5VA 3BPWA 3TR2A 3QW3A 5HWJA 4IGHA 4O57A 4C1LA 3NM1A 2A1YA 3G8EA 3UXAA 3G1DA 5DELA 1AW2A 2QAPA 1NF7A 4L4LA 3SR7A 4Y8FA 1IXNA 3N9RA 3DFPA 1XM3A 3OVRA 2Y89A 4IX2A 4B5NA 1LDCA 3TX9A 1NFBA 3FLUA 3G0XA 2OX1A 1H7XA 2QDGA 1B57A 1XFBA 2YYTA 4IMFA 4MY8A 2YSWA 1KFEA 4NJJA 1X7FA 4LRSA 2WSQA 3TCEA 4P61A 1GQNA 4CNNA 2ZFAA 2NXHA 5FF2A 4CQ9A 4IXHA 4I7UA 4XQ6A 2FB3A 3GR8A 3P60A 5E93A 4FB7A 5G2HA 4HNUA 3TUUA 3TV8A 2VC6A 3THAA 5G4EA 4QM1A 3TK7A 3LBMA 3A5VA 2FDSA 1P0NA 1OYCA 4NJHA 2ZZ4A 1VYPX 1BEUA 3IEBA 3S9YA 2EGZA 4IPIA 2Q3RA 5LNRA 4LU0A 4ADSA 1JJKA 2ZYFA 2ISVA 2HTMA 2FLIA 5FEZA 2RH9A 4GJ1A 1EP1A 1PHQA 1OFOA 2DZXA 4UNLA 1FX6A 1WYIA 2Z1BA 4UTTC 1LOQA 3TAKA 3LCWA 1LRQA 1K8XA 3M5YA 1KW1A 4GUHA 1TIMA 1OYBA 5FF7A 1VLIA 1WV2A 4YWIA 2FQIA 4UTLA 4TIMA 3G1HA 3CEPA 4NXSA 3VCRA 2WJZA 1H60A 3MI3A 1XBZA 2VFGA 5G2IA 1OX4A 3IGUA 2H8ZA 1VLWA 4N4QA 2E6FA 5CPLA 3CHVA 3W3OA 3S5ZA 4O54A 1ME9A 2NUWA 3W1XA 1EP2A 4HNVA 1LROA 1OFBA 3EKZA 4NZFA 5D37A 1MZHA 4K8HA 4WY0B 4NQ1A 4ONVA 1Q6OA 1OJXA 5K9XA 4DF0A 2ALDA 4ICNA 4XTDA 3R8RA 3KAOA 2AGKA 3UPBA 3T55A 3VKJA 3T7VA 1T0OA 4MLRA 4O10A 3LCHA 3BG5A 2WV8A 4A3UA 1I45A 4K7VA 4IJBA 4XBSA 3DFQA 4UFMA 3LTYA 1T99A 5D03A 1ZHAA 2ZA2A 3CM4A 3V75A 3LCLA 3A9IA 3W1NA 5BNKA 4Z1DA 5DXXA 2V8ZA 1HUVA 4HT3A 3LERA 1EPXA 5DBTA 4BI6A 3GNDA 1BTMA 3B06A 4MJMA 2C18A 3GXTA 3LLFA 3HGSA 1W56A 3MW7A 4XZ9A 2P1FA 4MJZA 1NEYA 1O60A 4MY9A 2WSRA 3LM7A 3MWAA 4ADTA 3GLCA 2B7NA 2ZRWA 2OJPA 3LRLA 3RLUA 3VE9A 2V2CA 4FNQA 2GQ9A 1O4UA 3NVTA 4XKYA 1OFRA 3B0VC 3GB6A 1N7KA 2OCZA 3F1QA 1JQVA 2ZZ1A 4UTKA 1F2JA 2B0MA 3W7RA 3UWUA 4WZHA 1Z48A 5G5IA 4GRSA 3NYZA 2J9XA 3PBWA 4IPJA 5AC6A 2TYSA 3QMTA 5CPNA 1AW5A 5F4XA 3W7QA 2QCGA 2J9YA 4UTHA 2A2IA 1ZJIA 3G1YA 2P10A 2TPSA 3BARA 3H54A 4HSNA 4MUZA 3OA3A 4MLJA 2UV8G 5K4ZA 2EKCA 2WNQA 1UASA 1TPC1 2Z2UA 1C8VA 1ZENA 5CZTA 5K9DA 3B4UA 2JGQA 3SJ3A 4XKYB 1KLYA 3LCIA 4Z0SA 4LWWA 3RK8A 5C55A 3QZEA 1LRNA 2GVJA 1XDMA 2QCLA 2WO5A 4WXYA 1QOQA 4LUJA 3MP3A 1F05A 1OFDA 3FIGA 2BX7A 3KRZA 1M6JA 1HTIA 2B4GA 4O4VA 2FPVA 1OX6A 4LNYA 1ZAJA 5AOUA 2C19A 1L9WA 1QPQA 3FS2A 2WSYA 5H91A 4CNPA 2CWNA 3EB2A 1KM2A 1RV8A 2ISWA 3ABSA 3I6RA 1UUOA 5FEWA 1HO4A 1TRDA 5KMYA 1W0MA 3W1TA 1FXQA 1W5OA 3DHFA 3SGZA 3C52A 1YTKA 1ALDA 1LM1A 1VHCA 5F1UA 1H50A 1H7OA 2QEZA 2YX0A 2TRSA 3HG2A 4O13A 4O19A 3QSRA 2E68A 1I2PA 3W6YA 2YDAA 3S5OA 3TW7A 1F76A 2YZRA 1U5JA 2DZUA 4R34A 2G95A 4IX0A 1O95A 3KVLA 4GUIA 3LB0A 1FWWA 3PULA 1Q6LA 2I14A 2Z6IA 4CCDA 3UXDA 2CLLA 3KRUA 1TTJA 2GJNA 3N2XA 5BRBA 4CQAA 4EF8A 2X1UA 5AFDA 4UTTA 3T44A 5EYWA 3G0SA 1QOPA 4Q4KA 1ML1A 5C6MA 2CZFA 3TMLA 1G7UA 4YL2A 3C2EA 4JTUA 4NX0A 2OT0A 4MOZA 3FOKA 3NZRA 4AHQA 3WJWA 4U4MA 4JYDA 2Q8LA 4NXKA 1LBMA 5AC8A 1RQBA 3L2IA 4GWEA 3MBDA 1QAPA 3UWQA 3SIZA 2R8WA 2X30A 3ABRA 1RR2A 3W7KA 2YXGA 3PB2A 1B9BA 4UTWA 1LZOA 5EPDA 5KTLA 4N9CA 3E9AA 5IBXC 2ZZ6A 1I2QA 5KZDA 4IWWA 1VPXA 1JUEA 2CLKA 1TTPA 2J27A 1KM3A 3NG3A 5D2WA 3TKFA 4N02A 1DV7A 4GE8A 1WXJA 4HPJA 3UPWA 3ATYA 5DN1A 2RDUA 1EA0A 2TMDA 3SY5A 3PG8A 3HF3A 2FTPA 1EX5A 2C13A 3B8DA 6ALDA 3MYOA 4ZMGA 1R2SA 3SW6A 1MSSA 4G1KA 3G8RA 1ONRA 3LCGA 2PE4A 3O6CA 2PC4A 5HWMA 2ABBA 1SSGA 3QH2A 3DGRA 3TSDA 1XL9A 1G4SA 1WOAA 1JULA 3ANYA 3TROA 2PCQA 2NWRA 1FCQA 3S6DA 1QNVA 1ZY9A 1TJPA 3BV4A 4EVZA 4JX4A 2CZEA 2Q3OA 4ZL1A 4JD4A 5LGZA 3FJ6A 3HO8A 3GYEA 3ATZA 3MO7A 1XUUA 3WJZA 4JX5A 3BGJA 5D2YA 1N8FA 2VFDA 3B04A 4ZQMA 1ICPA 5DY2A 3L67A 3W7HA 4BR1A 4LTSA 4MYXA 3U8GA 1QPNA 1KM4A 3NQ8A 4L4MA 3FA5A 4IUOA 2IQTA 1YPIA 4DO5A 4U28A 1N55A 4K8EA 1GYNA 4M5PA 1L6YA 3HPZA 4WD0A 3ZR4A 1X6UA 3M16A 5CG7A 4PCFA 4DF2A 3TH6A 1TPFA 2HMCA 1C29A 3WK1A 4UNKA 2RDWA 1TPWA 3BVJA 3C0JA 1WDWA 1TTQA 2H3BA 2VEPA 4Z08A 5TBOA 2WOQA 4O8RA 4XUGA 3DU0A 4K36A 1FUYA 5CZSA 2A0NA 3QQ1A 2FB2A 2C3ZA 1I2OA 3DFNA 5F2IA 1HL2A 3PR2A 1L6WA 3LOTA 4FXRA 3GDMA 3VNDA 3BO9A 4JICA 1SFJA 4QITA 1AG1O 4HKPA 3OIXA 4HHPA 4Y90A 5HQEA 4ZVJA 3DFOA 4O4WA 4HNNA 4JY8A 1DQWA 2PRMA 3UY8A 2QCNA 4DXVA 4MKNA 2HSAA 3QRHA 4DPPA 1HO1A 4AHOA 1JCNA 3C2RA 1AK5A 2E5BA 3W1MA 1J5TA 4AHPA 1TPVA 4WXZA 3FYOA 4LV9A 3PC0A 1JRBA 3HQ1A 4RZ6A 2QJIA 1W8SA 1QR7A 1JVNA 1SO4A 1GWJA 2DZVA 1ADOA 4TU1A 2V30A 2Y85A 4FNSA 1TV5A 3B05A 3N2MA 3GDRA 4LVDA 4WQ6A 3DI1A 1EIXA 1QCWA 3G3DA 3USBA 4BF9A 4UFLA 2YFOA 3I65A 1VS1A 2JBMA 4P2VA 3GX9A 3PSVA 4J9JA 3W9ZA 4AB4A 4Q33A 3EKLA 3NQMA 1TV8A 3DH7A 5CPOA 1KLZA 1KV5A 3M44A 3CWOX 5LNVA 3GIYA 3LI0A 3W75A 5HR7A 2CLIA 1OFPA 3W1RA 5A8GA 2GVLA 2V5BA 3L5LA 3S1WA 4GUGA 4QJ1A 4I9AA 5BMXA 1W5MA 3NQAA 2I9EA 3GKFA 3LDVA 4FX7A 4RCXA 5C2XA 2ZQ0A 5I3KA 3Q37A 1VH7A 1FCBA 1NAL1 1QO2A 1PE1A 5D2XA 4AF0B 5KITA 3A24A 3WJYA 1KFBA 2CZ5A 4EIVA 1A5SA 4FNTA 2BSLA 1I2NA 5CSSA 5I3IA 4JNMA 4S2BA 4UR7A 2CLHA 4JTIA 3CT7A 2ZZ7A 4GFSA 1DHPA 1RZMA 5J5RA 2HS6A 2AAMA 3I68A 4M6PA 5HINA 4TMBA 1D3GA 4K6AA 3BW2A 4AVFA 4KKXA 3TMQA 5K4XA 3MHGA 3O63A 3QM3A 1W31A 4ORIA 1VGAA 3L21A 1WBJA 1F7BA 3S5NA 2R94A 1LP6A 6TIMA 2NUYA 2WKJA 1TQJA 1JCYA 1KFLA 3L0GA 1DORA 3NQCA 1ZAIA 3SZ8A 1G4PA 1VYSX 4ZZ9A 1JCXA 3W7EA 2ZBTA 4ADUA 3TQKA 5BW6A 5LSMA 2Q8ZA 5DLCA 4E2DA 4MYAA 1JCJA 2F7FA 3S8HA 2EAWA 1SZEA 2DJLA 5EY5A 3S1VA 1MEWA 1YYAA 3IVTA 2X1TA 3M7WA 3CEUA 3L5AA 3EXTA 1OK4A 3EX2A 4RR4A 3MP4A 4AWTA 3G1SA 1O5KA 2CLMA 1DJQA 4N9EA 1HFBA 1DBTA 4H6KA 5U4NA 1ZNNA 3T4CA 2NV2A 2YYUA 4I7WA 3W23A 1WOBA 4O28A 2ATSA 4UTJA 3W2LA 3QF0A 1KA9F 2A5HA 3DKLA 4R53A 1G6CA 1VR6A 5LZLA 2Y7GA 3LV6A 1D9EA 5FF0A 1Q45A 3H55A 5F4SA 4R33A 3MYPA 3BLFA 3PUDA 5CZJA 4MZ8A 5BMWA 3LXAA 3P84A 1E51A 4FIRA 4MY1A 3IIVA 1DVJA 3UWWA 2OT1A 2QDHA 4Q32A 4GXMA 2FJKA 4OU1A 3HPXA 2QR6A 1W3NA 2YGYA 3W83A 4RXGA 3PS7A 3RU6A 1YLVA 1U83A 1TYGA 2ZCGA 4FX6M 4UUIA 3N19B 3LHTA 3R89A 3N34A 4UTWC 1SZNA 1XBVA 4UFJA 4UFHA 4JTTA 1TPUA 3TDFA 3BW4A 3IIOA 5FEPA 2QJHA 3EXSA 1UB3A 4LOCA 2YPIA 1FWNA 2X16A 3P81A 4UTMA 1PHWA 4FXSA 3G22A 3IVSA 4O53A 1OX4B 1TTIA 4KWWA 3W2MA 3LBCA 1P1XA 2W0UA 2C1HA 3O05A 1TPEA 1Q3NA 1TPDA 1H61A 4X3ZA 2EPHA 3JRKA 4QNEA 1EWEA 3LRMA 5GVJA 5LNSA 3E02A 3DBPA 3G1AA 5CKSA 4JTGA 1PCWA 1J2WA 3GXNA 4MFDA 5D05A 1TPB1 4YXGA 1B4KA 1KM5A 3U6WA 3IGXA 1GVQA 1XBXA 3TQ0A 1R46A 1H7PA 3GDKA 5K7JA 1RD5A 3FYPA 3G3MA 5F1VA 3NQ7A 3ZWTA 7TIMA 5AB3A 4MVAA 4NUWA 1XI3A 4HNTA 1W3IA 2GVGA 1VRDA 3C2OA 3PBYA 3STCA 4GUFA 2KZHA 2H6RA 1EUAA 2E6AA 4CQ8A 2X1SA 2H90A 1TV7A 5LNWA 3LXCA 2OZ0A 1JR1A 3T78A 3NEVA 2XN2A 5DY3A 4FHAA 5AHLA 4JDYA 4ZQOA 3WK3A 4FF7A 4XTIA 3O6YX 4M7TA 4NJGA 4ZQCA 3AJXA 3FJLA 3MI6A 2ZTJA 3W73A 1SFLA 2C6QA 2Y61A 3OVPA 4UMCA 3KVMA 4H3DA 4JYFA 1DOSA 4LUIA 2GQAA 5F2LA 3H53A 3MJYA 3RF9A 4NNCA 1GTHA 4UIOA 3IVUA 5D32A 1MEHA 3R12A 1UBSA 3EWBX 3NDOA 3HG4A 1LTDA 1VYRA 1VJIA 2A21A 2OMAA 4QNWA 2Y7DA 2RHGA 3W7CA 1OG0A 3M41A 1W5QA 2VFFA 1D3HA 1FWRA 2ZA1A 4O17A 3M43A 1KFCA 2WPBA 3W7JA 1LLZA 5I3JA 2DZTA 3PM6A 3GAKA 1R2RA 4HIBA 4OE7A 4LY8A 4LS0A 4A2RA 4O50A 1WQ5A 4BI7A 4RK8A 3S42A 1I2RA 1A5AA 3PSWA 3UYCA 3O16A 3GKAA 1XKYA 2E77A 3TXZA 2PRHA 3P5YA 3LLDA 3NL6A 3O07A 3TSBA 1QO5A 1ZFJA 2CU0A 2EF9A 5LHEA 5HJLA 3VFLA 3L9CA 4RLIA 3C2FA 4FX8A 5EBUA 2V9DA 3GZ3A 5HUPA 1UJPA 5CZ0A 3TC6A 1YDOA 3LX9A 3TJXA 3NO5A 1W37A 4JIPA 2G97A 2ZRZA 1TB3A 1DKWA 4UFKA 4JIQA 4AAJA 2WNNA 2Y62A 2AQWA 2C16A 1OYAA 4K39A 3W7DA 1W5PA 1C9DA 1PCKA 3KX6A 5K3VA 3JR2A 2G96A 3HMJG 4UC5A 4TR9A 3W7IA 3K30A 4O1CA 4KFPA 1GVSA 3TE9A 3RMJA 1SO3A 3W1QA 5HNRA 2CFFA 4WOQA 3S1XA 4O0KA 2ZDRA 3N9SA 5D2VA 4IQLA 1MEIA 2VFHA 4PODA 2QJGA 1LOLA 3NQDA 3LI1A 2YCEA 1NSJA 4PL1A 3WK0A 1SUXA 3UY7A 3QPYA 4LW7A 5G4WA 3GXPA 3FFSA 1A53A 1GG1A 1TRIA 2NX3A 3L65A 1WA3A 3MBFA 5FESA 1SW3A 1SO6A 3HPSA 2F84A 4LRTA 4BI5A 3I7RA 2E09A 5D2TA 4Z0JA 4UFIA 2GUUA 1IF2A 4RXFA 5I3HA 4TX9A 3UWYA 1ME7A 2ZZ2A 1KTCA 2D73A 3NL5A 3HJZA 3A22A 4DQWA 2NXIA 2CLOA 3HBLA 4K38A 1GPWA 4BFAA 1YTEA 5L6UA 2YW4A 3CLMA 1FY6A 2A4AA 2QCMA 1VCGA 1CI1A 2W79A 2FIQA 4AH7A 1LBLA 5D30A 1S3HA 2B7PA 1K8YA 3CC1A 2RFGA 5D33A 4A29A 5FF4A 3BGGA 1JCMP 3BW3A 5K9CA 3LTSA 3CPRA 1IXPA 2GOUA 3NPUA 5T26A 1IXOA 1V5XA 3NXFA 4O18A 2XFWA 1J4EA 2QCDA 4IOTA 1KFKA 1LCOA 4S2CA 5I3GA 3C61A 1SZFA 4X2RA 5AHIA 3TW6A 5F4WA 3W2KA 4NJIA 1ICSA 1ME8A 1WX0A 1VCVA 2QCEA 1KM1A 2DZSA 3F4NA 3TFCA 1G4EA 5U7SA 4Z1BA 3DAQA 4JTLA 1YXCA 4AMAA 4WY0F 4KWVA 4NNAA 5AHMA 3ABQA 4OQVA 2Z0IA 3M5ZA 3QQ0A 3S5YA 2V5LA 2ZRYA 3O6DA 3LHUA 3NPXA 4FNRA 4TO8A 1XXXA 2JKPA 3NGJA 2A7PA 3Q94A 3TSMA 5E1QA 3GDLA 3O06A 5FI8A 4O1AA 4NU7A 4BWLC 1IIGA 3PWAA 5A5WA 2QCDB 4M6QA 2H3DA 4ORMA 1JUKA 2Y7FA 4N2YA 4YCPA 3P67A 2QUVA 2V82A 3O1NA 4XWUA 1SU5A 4Y96A 4LS2A 3STGA 3NL2A 4OV4A 3WFAA 3NOEA 4XBKA 1L2UA 3JS3A 5I3FA 1H63A 3LV5A 1O94A 1V7YA 3MI2A 3L0KA 1Q6QA 1H7WA 2VEKA 4HSOA 3UNDA 2V81A 2YFNA 1FCVA 5E0KA 4O0ZA 3DFTA 4OGZA 3I7SA 3EX1A 3W85A 2WNZA 3UWVA 1TO3A 2O7SA 1K03A 2E6YA 1PV8A 1G69A 4LC8A 3A21A 5G2WA 5CGQA 1QWGA 5AC7A 3IRDA 4QIUA 1AMKA 3W1LA 4JTKA 1F5ZA 3W84A 2A7RA 1ZAHA 4LC6A 3G1XA 3G0UA 1G4TA 2DZWA 1RQEA 4KFOA 1G67A 4JS3A 1GVRA 4ALDA 1PS9A 2RDTA 1RQHA 3G1FA 3D0CA 3GR7A 4WX2A 3R13A 3C6CA 1Z42A 3DKJA 1EWDA 3QPZA 4TMCA 3LHZA 1ICQA 3KOFA 2VOMA 3C2VA 1LRTA 2FPTA 5F2GA 3FEMA 3ZFHA 2GQ8A 1YDVA 3VE7A 4CLMA 3IGSA 1R30A 3W7PA 1HG3A 4RJEA 2BLEA 1LYXA 1VC4A 3HIJA 3LXBA 4NJKA 3QEZA 1TQXA 1LORA 4FEZA 3NQGA 1TJRA 3P74A 3CQ0A 3LHYA 3EWZA 3W70A 2B7OA 2LLEA 4PEKA 3DZ1A 4IXXA 4JEQA 3HGRA 4JXCA 4NNBA 3LHVA 3L68A 1AW1A 2NX1A 4E2BA 3NZ1A 4RZ4A 1SO5A 3E0IA 3KRSA 4DELA 3EWXA 3NPVA 4GUJA 3P62A 1B4EA 1YTDA 5BOOA 2XN0A 1LBFA 1UUMA 3CIWA 1EP3A 2VFIA 3BLIA 2JGYA 2H8XA 3LGEA 2ZRXA 1TSIA 3OBKA 3M6YA 1GVOA 3CWNA 4O16A 4UXDA 2QCFA 2Y63A 3W7GA 2R91A 3W76A 4MIMA 4JTEA 3OG3A 3ELFA 1H51A 1MO0A 1EUNA 5KZMA 3NQVA 3TU9A 2E5DA 2W6RA 3PB0A 4JR5A 3FKKA 4UTIA 1KV8A 1SW0A 4HN4A 1XBYA 3HGOA 1AL7A 2V2DA 3TA6A 8TIMA 3TXVA 1F74A 1YPFA 4EOUA 1GVFA 4ML9A 2X1RA 2NX9A 2QUTA 4S1FA 2NLIA 1LLWA 1W5NA 3B0PA 3WJXA 3QC3A 1OF8A 5AHEA 1I4NA 3EWYA 3NR0A 1KM6A 1X8FA 4WY0A 1PL9A 2NV1A 1W54A 3L5MA 1VQTA 1KFJA 3ZWSA 2V2HA 4LV4A 5HULA 4IMDA 4PA8A 1OHLA 4FO4A 1IXQA 4BWLA 4N6EA 3QW4B 3SGUA 4NVTA 2C14A 4MPQA 5F2MA 4YCOA 1ZCOA 4GBUA 4W9TA 2Z6JA 3PBUA 3W1PA 2VEMA 5LGXA 2A85A 3DI0A 3ZS4A 3W72A 2QCHA 3OVQA 1GG0A 5AYXA 3W7NA 4FIQA 2VELA 4AWSA 3M47A 2JKEA 3C8FA 4OBTA 4WJEA 3P80A 1KTNA 1OABA 4JX6A 1F6PA 1OVDA 3TJLA 2C15A 2NUXA 1KM0A 2Y70A 3C4UA 3T40A 3TNOA 1K3UA 4IMCA 4DEFA 1K02A 3RLVA 4O1DA 2ATMA 5C54A 4UTUA 4LVGA 4DO6A 1GYLA 3PY2A 2CLEA 3UWZA 3S1UA 1M7OA 4GNJA 3DFSA 4POCA 5MHBA 4LT9A 4MFEA 1EB3A 3DHDA 2Y7EA 3KHJA 4DPQA 1TMHA 3LHWA 3IIXA 1DJNA 1K8ZA 3W88A 2J88A 5K2ZA 5AHNA 1X1OA 4E38A 1DQXA 3EX4A 4O12A 1TPH1 2G5WA 3HOJA 1M5WA 1AL8A 1I8JA 2J6XA 3KFTA 5AYYA 2VKZG 5CSRA 1W1ZA 5AN7A 5HWNA 3LTPA 1H1ZA 2ZZ5A 5KZEA 3L66A 2R14A 1KBIA 1LOSA 4JY9A 1SW7A 1K7EA 1M7PA 3W22A 1PIIA 4I7VA 2EHHA 2NXGA 5DBUA 4WOZA 3FKRA 2QAFA 5DCDA 1F73A 1S5VA 3W87A 4EWND 4ZQNA 1XCFA 4Z1AA 2GJLA 3KVKA 1Z44A 4C1KA 1G7VA 4O15A 3EWUA 3W74A 4PFMA 3DXIA 3LCXA 4IMGA 3NA8A 3F4WA 3W1UA 1BKSA 5DCBA 2DORA 4UR8A 3INPA 3SSJA 3TAOA 1Y0EA 3R2GA 1XDLA 3UD6A 5IM51 4JTSA 1S5TA 3GK0A 1MXSA 2ISSA 2ZRVA 4QISA 3GVGA 1EEPA 2BXVA 3UZ5A 1JQXA 1T8XA 5CPMA 3IV3A 2DZPA 3AO0A 3NL3A 1W3TA 4Y6GA 3P8JA 3CTLA 5TQLA 1JUBA 1F6KA 4N9BA 4JGDA 1GOXA 3U2OA 1R2TA 4EF9A 2PRLA 1FDJA 1B3OA 1K7FA 1WBHA 1OFAA 5LHFA 4AXKA 2O7QA 4GC4A 3STFA 2J9ZA 3F03K 4N6FA 4JTHA 1VZWA 2B7QA 4K7YA 2JKAA 3C3NA 3MMTA 2NZLA 3NQEA 3Q58A 5L9FA 1SPQA 4DO4A 2QF7A 4RKAA 1P5BA 1WAUA 1FDYA 4LVBA 3QMSA 5TIMA 2DU2A 3LCFA 4O1BA 4RZ5A 3IIPA 4Z1CA 3W86A 3LRKA 4K37A 5G1YA 1QPOA 3B0UX 3P8IA 3WJSA 5AYZA 3NNTA 1QPRA 3W71A 5HUOA 3NQ6A 3Q2DA 2BZNA 2FFCA 5LNUA 1X1ZA 4PC8A 4X9SA 3G18A 4M19A 3G1VA 5KINA 1GT8A 1UCWA 3E96A 3OEXA 3THQA 3R5EA 1DL3A 3QJAA 3UQNA 1XUZA 2E6DA 4NX5A 2V0TA 5LKYA 1H7NA 3NQ2A 5DCEA 4NZJA 4PTNA 3BG3A 3CIXA 2ZZ3A 3MHFA
chains in the Genus database with same CATH superfamily
3QTGA 1VP5A 3SRDA 1NVMA 1R9ZA 3GNNA 4HPNA 4L1WA 1KR1A 1EDQA 1LL7A 4W89A 3C56A 4C6NA 4HYRA 3HB9A 3AISA 4E6MA 5HMSA 1QMLA 1V6VA 3MP5A 2CZVA 4UMBA 3BCDA 4MZYA 3UZJA 4A3RA 3QSTA 2J62A 5E70A 4LH8A 2V3GA 2A6NA 4LUSA 2WC3A 1AJ2A 1EFZA 1PZ0A 3MUXA 5T9CE 2CZDA 5KSWA 1W3JA 2WXDM 4C6OA 4QR6A 2QVNA 2GK1A 4XZBA 4NL1A 1O5XA 2ABAA 3EEZA 2C0AA 2QUUA 1CX9A 1GZGA 4HPXA 4J3UA 4BEQA 4AEFA 4A8RA 4RV8A 2ZRUA 5FEXA 2YW3A 4QSHA 3MDUA 4M6UA 4LF2A 1XC4A 4K68A 1UC4A 4Q4OA 2E5CA 3NXLA 4NZ1A 2PTXA 3WH7A 2Z2BA 2HJPA 4KGLA 2VCCA 4LUSB 5SWUA 2VFEA 5CLWA 1PKNA 3BK0A 1MNSA 1DWJM 3P5ZA 2PA6A 2YR1A 1FWEC 2WJFA 4N4PA 4BCEA 2BY0A 1UD5A 4J3XA 5G1TA 5C2CA 4H2HA 5HA7A 4D2JA 4E0CA 3QFEA 3IUDA 3LNPA 3PBGA 1V6YA 1DYSA 4DYKA 1KBKA 2RKXA 3H7VA 4IL0A 2XWDA 3KXQA 5A3HA 3TC7A 3AJ7A 1OX5A 2BWGA 3FJNA 4Y7EA 4WSHA 4WUIA 3TQVA 4ECLA 1BQGA 3FN9A 1AQFA 5DMNA 2CEQA 3U7BA 3PFMA 4N9DA 1FDZA 3KS5A 4M6VA 1QWKA 1F61A 4D6GA 2C79A 3NQFA 5EMUA 5IFPA 4TTUA 3VZXA 4H7VA 4O52A 1X39A 5EMLA 3SADA 3TTSA 3N14A 2C1GA 3WDQA 1L6SA 5AHFA 1PEZA 4FA3A 4GXPA 4RE0A 3SECA 3IWPA 3A4WA 2YDRA 4J4KA 4H00A 4K2SA 3VD5A 3LA4A 3CU2A 6XIMA 4QQ3A 4PTWA 1EGZA 4AF0A 5DXYA 2Y2WA 1V0LA 4C6BA 2WCGA 4PZVA 4J3WA 1BPLB 3GG7A 4MZ1A 4PMXA 3EB3A 2IMRA 4GNKB 3WH8A 3WF0A 3PTKA 3O15A 2PS2A 3H26A 3SFKA 2WJEA 3FNDA 3STEA 3E5BA 3M1ZA 4ERAA 1YXYA 4PMUA 3MVTA 3DFYA 3F5JA 5IBXA 1OFQA 5I79A 3PUOA 4PBFA 3BPWA 3TR2A 1GKQA 5I03A 3D3FA 2CCRA 3NM1A 1XIJA 3AS1A 2A1YA 5KEZA 1HXJA 2QLYA 4KEZA 1ZPTA 2QDDA 2QAPA 3BAYA 5GJNA 4L4LA 1OCNA 4WIWA 1CCWB 3SR7A 3SM0A 2Y89A 4FLSA 4QJ4B 4ZTYA 2FTYA 1JEZA 3KLLA 3FLUA 4GFIA 3R8GA 3V18A 1T41A 1J79A 3L4YA 3PZMA 1B57A 2CETA 3DESA 2YYTA 3EAUA 1QHZA 2AAAA 2ODOA 2EPLX 4LRSA 3V0TA 2WSQA 4CNNA 3AHTA 2NXHA 4RPPA 4S3BA 5FF2A 3R58A 3QC0A 3GR8A 4P7LA 3P60A 4HNUA 3NUKA 5I78A 3TK7A 3LBMA 3A5VA 1X1NA 4NYYA 3WL0A 3MKVA 1H3GA 1RA5A 3EDDA 1OYCA 1ZBWA 3WQWA 1VYPX 1B9ZA 1SFSA 2EGZA 2OLHA 4Q8VA 4ADSA 3QR3A 1VIWA 3R4IA 1D8CA 3B8UA 1JFXA 3AIEA 1MFVA 3WUGA 1EGVA 1EJTC 2VI0A 4F4RA 2Z1BA 4DJDD 4TUFA 3WLNA 5IDZA 3CO8A 4DYEA 1K8XA 2OQHA 2F8QA 4GI9A 4KGJA 4GYKA 1CBGA 1E70M 4IL2A 2X41A 5LXXA 2X09A 4Q8MA 3WQEA 1E1FA 3H7RA 5XIMA 3GVRA 1XBZA 1DJWA 1OX4A 5E0FA 4N4QA 2E6FA 4H9VA 2OWXA 2X8RA 1ME9A 4JTAA 1D2KA 3W1XA 3KCJA 1OFBA 4ZFMA 2QJNA 1SMAA 4LUTA 3W37A 4K8HA 1EJWC 4WY0B 5K9XA 3AXIA 4DF0A 4C6EA 2J25A 1OBAA 2E4TA 1XRFA 1PX3A 3AXHA 3BG5A 3VC6A 1V0KA 4IJBA 2PD9A 3DFQA 3VUPA 4GYPA 3KTSA 5D03A 1ZHAA 4Q4RA 4JTQA 3LCLA 5BNKA 5DBTA 2R24A 3B06A 2C18A 3GXTA 5T9BG 1XLCA 1NEYA 3K1DA 1PAMA 2B7NA 4LUTB 4KWUA 3VIIA 2V2CA 4FNQA 4XKYA 1OFRA 5C9WA 2OCZA 3MZ2A 4GH1A 3WNNA 4S3AA 1G5AA 1W9DM 4ZE5A 4WZHA 3UA4A 3GE7A 1Q66A 2HBVA 3NYZA 4IPJA 5AC6A 4I5XA 2EBNA 3E38A 4QSFA 1JI1A 1BYBA 3G1YA 2XPKA 1SJAA 4JNYA 3VNYA 2CHRA 2UV8G 5K4ZA 2EKCA 2JF6A 1R3RA 2WNQA 1UD8A 1UW9A 5M5DA 1ZENA 5CZTA 1NDZA 5K9DA 2EO7A 5A6AA 4CVUA 4XKYB 1KLYA 4Z0SA 1U22A 3RK8A 1DEDA 3QZEA 1LRNA 1XDMA 4WXYA 3DHUA 3AIVA 3AWOA 1F05A 3FIGA 4M56A 2BX7A 1MI3A 3E2SA 5EBAA 2FPVA 4GIYA 5AOUA 1L9WA 1QPQA 2WSYA 2CWNA 2ISWA 1W9XA 3I6RA 4QG9A 3APGA 4Y9PA 1Q63A 5FEWA 4WDTA 1W0MA 3W1TA 5KMYA 1FXQA 1W5OA 4C6PA 1ALDA 5F1UA 1VHCA 4JQAA 3GG8A 4G7EA 4O19A 2WVSA 3T6CA 4LYKA 2YDAA 3FXGA 4DY1A 1PTDA 4D6CA 4R34A 3U0HA 1M41A 4DB7A 2C91A 4IX0A 1O95A 4GUIA 1Q2SA 1FWWA 4A35A 2I14A 3GC4A 2CLLA 2GJNA 2WSKA 3N2XA 4CQAA 2X1UA 5AFDA 4HMEA 3T44A 4DJDC 1VPYA 3UZYA 3TEVA 1DIDA 1E6QM 2CZFA 3NSNA 1R3YA 5JIPA 1JZ8A 4H8HA 4JYDA 2Q8LA 2PLCA 2DPEA 1DPMA 5AC8A 4GWEA 3K4DA 2FHCA 1EJRC 5EU9A 3ABRA 5IRPA 3W7KA 2YXGA 1QI0A 5BXPA 1QK2A 3PB2A 4PTMA 1V3IA 2Q71A 4XIAA 2YCLA 3E9AA 4FOKA 2ZZ6A 1I2QA 5KZDA 1EGMA 1BFNA 3MSRA 3BJFA 3O7UA 3G5EA 2CC0A 3NG3A 4N02A 4HPJA 3ATYA 1I1WA 2WK2A 2CKSA 2C13A 4N0RA 3SURA 3REQB 4S3EA 3RJXA 2VTFA 1R2SA 3WQPA 3G8RA 1ONRA 3LCGA 2PE4A 3N2OA 1JI2A 2PC4A 2ABBA 4PBGA 3GH7A 3E6EA 3KP0A 4C6CA 3CB3A 4C7FA 3TSDA 3IJ7A 1VBRA 5C70A 1JULA 3DECA 3LU2A 3PZNA 1HVXA 3L7RA 1ZY9A 3BV4A 4JX4A 2CZEA 2Q3OA 2OPJA 1KCXA 4IFRA 4HMDA 1MW0A 1XLIA 3GYEA 4PBEA 5D2YA 5HBFA 4LNCA 1PZ2A 3U8GA 2ADAA 4F0SA 4L4MA 3FA5A 4ICMA 3CXOA 3PNZA 1N55A 2Z1KA 3M6DA 1PPIA 4Q7BA 1L6YA 4PTVA 2HROA 1K8CA 3VABA 4D1JA 4RDVA 1X6UA 3M16A 3UCDA 1CGYA 4Z2LA 2TODA 4PB3A 3NURA 3CZ8A 1W1YA 5D9MA 1V03A 2RDWA 4MKSA 5I23A 2INEA 1Z8AA 4XUGA 1LWIA 1I2OA 5F2IA 1HL2A 4XG1A 3GDMA 3VNDA 1VBGA 1SFJA 3URQA 1AG1O 4HHPA 4B90A 2O9RA 2WJDA 4P7NA 5HQEA 1CPUA 2WNWA 3GW3A 4NI3A 2ACRA 5EFFA 2XUCA 2PRMA 4EACA 1UWQA 4MKNA 3SBFA 3BSGA 4DPPA 3V36A 4D71A 4ZB0A 2GL5A 3RO6A 2Y1HA 2E5BA 3WUFA 2NVDA 1V93A 4RL3A 4RW5A 2OSWA 4J3ZA 1XHGA 5M2FX 4K1WA 4NAEA 1DWFM 3WH6A 1FKWA 2QIWA 3LPFA 4FLOA 4XSLA 4AYSA 1GWJA 1S1RA 4B5TA 2V30A 2XTKA 4Q7IA 3MSDA 3B05A 2FHFA 3GDRA 4WQ6A 1LG2A 3PBMA 3O9NA 3EMCA 3USBA 3GY1A 5J8LA 2Z7GA 3I65A 4YVXA 2RJHA 2F6KA 3TR9A 1QU4A 3PNUA 5CPOA 3RM4A 3M44A 2XWEA 3W75A 3CHEA 2CLIA 1OC6A 3M0KA 4H6QA 4IICA 2SFPA 4M80A 4QE5A 1KB3A 3F2BA 3ZQ9A 3SCWA 2GVLA 4GI4A 5HNUA 3S1WA 3MKKA 4LFYA 4NAEB 2ZXAA 4QG8A 4QJ1A 2X0YA 5C2XA 1M3UA 1U5VA 1ZS2A 2QUNA 2ZQ0A 2BY1A 1XKJA 5I3KA 1GJUA 2C0HA 1LUCA 5KITA 4U33A 1A5SA 3VOIA 1MVYA 4FR6A 4KT2A 2BSLA 3VNLA 3KBNA 1I2NA 1XISA 5CSSA 3UXKA 2XM1A 1J0HA 4JTIA 2X40A 4LSBA 3RR4A 4PUKA 3SY8A 1Q7MA 3BICA 4AVOA 4HK6A 3FEQA 1F3XA 3GR4A 4QBXA 4HVXA 1W31A 3KCLA 1DWIM 1WBJA 2WCSA 3L21A 1LUCB 2WKJA 4CEXC 3NCOA 2DSUA 4ZZ9A 1OD8A 1JCXA 4ADUA 4F9JA 2UY4A 4C6FA 2J78A 4CQDA 1JCJA 1E43A 2EPKX 3LN3A 4UOZA 3S8HA 1XIIA 3RCMA 2EAWA 1FWHC 3IVTA 2X1TA 3VGFA 3EX2A 5JIWA 4C6LA 3G1SA 1O5KA 2CLMA 4N9EA 1DBTA 4H6KA 5U4NA 2NV2A 1YW1A 2YYUA 3W23A 3UW6A 1AZ1A 3ZSSA 3QF0A 3DKLA 1G6CA 3HQOA 4J7RA 2R6OA 5LZLA 2Y7GA 5F4SA 3CBWA 3ARTA 1E4MM 1FTXA 3PUDA 5CZJA 4MZ8A 5BMWA 4EKJA 1E51A 4FIRA 4J28A 3UWWA 2IPWA 3WLOA 2OT1A 3VAVA 4XBJA 2IXUA 2QR6A 1EC9A 2YGYA 3W29A 3OLEA 3PS7A 2A3HA 3KRBA 3RU6A 1U83A 2ZCGA 4UUIA 2YLLA 3R89A 4U10A 3N34A 1E40A 3UNTA 1XBVA 4ZO6A 4UFHA 1R6WA 3TDFA 3BW4A 3GQYA 1BSIA 7ODCA 1XF0A 4LOCA 2POZA 2X16A 1TWZA 2VRQA 4UTMA 4WKFA 3AU2A 4FXSA 3NOYA 3G22A 3IVSA 5BOEA 2O9OA 2W5FA 4KETA 3LBCA 1TPEA 4W87A 1EOMA 4D8ZA 1H61A 3QPEA 2EPHA 4GKLA 3JRKA 5GVJA 3RILA 3DBPA 3G1AA 2GJRA 1WUFA 2WCAA 3GXNA 1VEMA 1K6WA 2VC9A 5HQLA 1TPB1 5DANA 4YXGA 2JFEX 2J7HA 5I2UA 4WR3A 3S46A 3TQ0A 1H7PA 2DQXA 3NQ7A 4Y8EA 3P0XA 4NUWA 3T05A 3C2OA 7REQA 3STCA 2KZHA 2FZNA 3QGVA 2I5IA 4JL2A 2X1SA 5LNWA 4O8AA 4L5ZA 1IE7C 3T78A 1SR0A 4JDYA 3W24A 2X2YA 2E1WA 5JH1A 2OG9A 3MI6A 4IIGA 1M01A 4YTQA 5BWAA 3KVMA 4JYFA 3V5CA 3G6LA 3T2OA 3H53A 1F9CA 3WIJA 3F4DA 4F0RA 1JYXA 5FIPA 3IVUA 5D32A 1H4PA 4US5A 5M3WA 1NH6A 2XYLA 3NDOA 3N13A 1VYRA 1UKSA 3QZAA 2VNCA 3MCMA 1W5QA 1D3HA 4JAWA 5I3JA 2DZTA 3BDKA 3GVWA 3H22A 3GO2A 4A2RA 1WQ5A 2ZE0A 4RK8A 3GUWA 3CQIA 2VDGA 1AMYA 3IJ9A 3PSWA 4XIMA 3FHAA 3CL6A 3TXZA 2PRHA 1GK8A 1U2YA 4YVPA 3LLDA 3NL6A 3O07A 4QFUA 5HJLA 3VFLA 4ZO7A 2V9DA 3GZ3A 5CZ0A 1XYAA 3LX9A 4I5RA 3TJXA 1V0MA 1H2JA 3RCYA 1FP8A 1DKWA 3WLPA 1S1PA 4JIQA 4AAJA 2Q01A 1XD0A 1XDJA 4NZ5A 3GHRA 1C9DA 5K3VA 4UC5A 4TR9A 1UG6A 4IPNB 2W27A 4TVCA 4KFPA 3BZJA 4KEVA 3TE9A 2ZUWA 1SO3A 5HNRA 1WDDA 3FGCA 2HZGA 1V6TA 4O0KA 1OADA 2XJ7A 2Y8UA 3CAQA 2VGFA 3CGTA 4PTXA 1Q4WA 5AKQA 4RNFA 3M0IA 4DWSA 3BZGA 2YCEA 1BHGA 2YIHA 4B5SA 3UY7A 1GYMA 3QPYA 1JIBA 3JZUA 1FWIC 3VDCA 3QHOA 2NX3A 2GVYA 2YXOA 5D9NA 3DOPA 3H2AA 1CLVA 1AJZA 3ICJA 4GG9A 3OZOA 2VRKA 4RXFA 3L4UA 4LQ1A 4TX9A 3UWYA 2EPOA 4PUDA 2AMXA 1D8WA 1UKPA 1UWUA 2D73A 3HJZA 3IGHX 1RBOB 4K38A 1UH3A 2Z24A 1W1VA 1RLCL 4DWSB 1TVNA 1GQJA 3CK5A 3CH0A 1UIOA 5JMUA 3VIFA 3AHYA 3MT1A 2ZVRA 3WQ5A 2CLPA 2FIQA 4RZBA 3WMLA 5D30A 3UJFA 7ENLA 1S3HA 2B7PA 1K8YA 3CC1A 4URIA 3KLKA 3BGGA 1HP4A 2DEPA 3C0LA 2FVKA 1PSCA 2GGEA 3WL1A 4HYWA 1CGTA 3VUSA 4IP5A 3NXFA 4O18A 4DJFA 1J4EA 1HNYA 3QGAC 2WKLA 3ARWA 3C61A 1SZFA 1J93A 4XZNX 4MNLA 4NJIA 3BLOA 1ICSA 5ECUA 2NQLA 3OTRA 1VCVA 1ECQA 4HHLA 8XIMA 1AUSL 1DE5A 4C5YA 2VCBA 3H2CA 4RW3A 1NWUA 4PMNA 2YDSA 3LSBA 4IUGA 2WMIB 2V5LA 4JN8A 4G1NA 1O1ZA 3NGJA 3O06A 5FI8A 3T07A 4AY8A 3N4FA 4KWSA 3ZOAA 3E0WA 3GH4A 2X7WA 3DDMA 1JUKA 3ZO9A 3P67A 4XWUA 4P8UA 1IEWA 1CZ1A 3WYZA 1UMLA 2P3EA 3NL2A 1T8QA 3N2CA 4I8YA 3RM8A 3NOEA 4XBKA 1H63A 2YB4A 3LV5A 1L8PA 1CXFA 2XH7A 3N6JA 2VEKA 4HSOA 4W8LA 2V81A 1FCVA 5E0KA 1B0IA 1WKEA 1X8CA 4C6KA 5FSDC 3HA1A 2XGBA 1NU5A 3MB9A 2ZX5A 3OPSA 5E9XA 1U33A 4YJ5A 3IJDA 3A3WA 4D6DA 1TO3A 1X97A 1K03A 4LC8A 1RALA 3A21A 1RBAA 5G2WA 5AC7A 1GQIA 2VX7A 4LB4A 4QIUA 1AMKA 3CHFA 4JTKA 1NDWA 3CQHA 4LC6A 3BLKA 3TTQA 4JS3A 4H7ZA 3H7UA 2IPJA 3T0BA 3ZJKA 3VMOA 3LUTA 1V3JA 1W1PA 3D0CA 3R13A 2I5QA 1ONEA 1HVQA 2FZ9A 3UCCA 2PDKA 1EWDA 2GGIA 2IW0A 5CPTA 2FPTA 2X1IA 2IQ0A 3FEMA 1UHVA 4CLMA 4FK9A 1HJXA 3IK4A 3WELA 1PYMA 1CEOA 1HG3A 3CYVA 3U2CA 4Y9OA 4U5IA 5JU6A 2JIWA 1BVZA 1TA3B 1JPIA 1XPYA 4H9TA 1FWFC 1E1CB 5CGMA 5CC7A 2W92A 2VD9A 3ITOA 3UERA 3KZPA 3DZ1A 3RX3A 3L68A 4JIRA 2NX1A 1Y5XA 3NZ1A 4NASA 3E0IA 3KRSA 3UBPC 1ZU8A 2R1NA 4GUJA 1B4EA 2W9MA 1XIEA 1YTDA 1ZP4A 1WB0A 1UZDA 2XN0A 4KEMA 3CIWA 3CPGA 3CZJA 2D2JA 1UKOA 4IPLA 4DN1A 2VWTA 3GDBA 2XVGA 3N12A 4UZSA 2ZRXA 2O0TA 3M6YA 1GVOA 1VFHA 2OXNA 2J7FA 2Y63A 1WPCA 4AZ5A 3W7GA 2R91A 1MW1A 3B9OA 2PDXA 1H51A 2BG5A 2ZADA 3TU9A 1E5NA 3ZT7A 2E5DA 4HN8A 3H70A 2HV5A 2QPSA 5FJUA 1KD0A 3W53A 1AL7A 1WNOA 4P7OA 3TA6A 3QN3A 3TLQA 4ML9A 2C1IA 2X1RA 2NX9A 3W6LA 1PJ9A 3QC3A 2J13A 2CITA 1X8FA 5HMDA 4F2BA 1BXCA 1VQTA 1KFJA 1UYQA 1HJQA 1OHLA 4PN2A 4QLJA 1KKOA 4N6EA 3NZGA 3LGGA 4YCOA 3ZXWA 4FLRA 1UZ4A 4W9TA 3PBUA 4MWAE 3RCNA 3VX0A 1FH9A 3PZOA 2PGRA 1QK0A 1VFOA 1GG0A 1TIWA 4BKNA 2GUYA 5CC5A 3M47A 4IG2B 3A47A 3CTTA 2HRWA 3AYSA 1C8QA 3TTEA 2NUXA 2Y70A 3RAOA 1XX1A 1P43A 2OYKA 4DO6A 1UIPA 1R86A 1XH2A 4LCRA 2Z1WA 3PY2A 2CLEA 4LYQA 3BAWA 4ZENA 5D9OA 3AOFA 4POCA 1DP0A 3RITA 1EB3A 4MB4A 4UB9A 4HU8A 3BWWA 3UFYA 3KHJA 4W85A 3AWNA 3LHWA 6REQA 3WD4A 1MRQA 4E38A 1DQXA 3M0VA 4HU0A 4O12A 1XYZA 1MW2A 2B81A 1GORA 1AL8A 2J6XA 3S2MA 1HN1A 4AISA 1W1ZA 1OT2A 1V02E 1CGVA 2CHOA 4Q8UA 5AN7A 5HWNA 1KBIA 4QDMA 4JY9A 1LQAA 5HJXA 3W22A 4I7VA 4HU4A 4P8WA 1NELA 1SJBA 1IEIA 3ZLGA 4EWND 5LXEA 1A4LA 1A5KC 3MJMA 3BXWA 2R1MA 4QROA 2IXVA 3N4EA 2XSXA 6REQB 2VCAA 3W74A 4S23A 4FS9A 3DXIA 1D3CA 2REQA 3W1UA 2VJXA 5A2CA 3TZFA 3VC5A 4Q8PA 2A79A 4GMEA 2VC7A 3U2EA 4PSRA 1UPMB 4D6FA 3MSGA 3USZA 1E71M 2WM1A 5FJTA 3E0VA 1S5TA 2ZRVA 3R11A 4HGXA 3F2DA 3GVGA 2BXVA 3UZ5A 4A3HA 4WK9A 1EC8A 5CPMA 2DZPA 2D2HA 6CGTA 1XGZA 4NSBA 1JUBA 4LYRA 3I3BA 1GOXA 3WNLA 4EF9A 4AXNA 3KEHA 2AMGA 1B3OA 3QV9A 3MWCA 5LHFA 4AXKA 3TNBA 1NWRA 1E3XA 1G01A 4JTHA 3BUVA 2B7QA 3PJUA 2XINA 4NKCA 3PWGA 5CJMA 1E72M 4N42A 4XAPA 4HCLA 1WAUA 1FDYA 2AQVA 3LCFA 3F5KA 2G3NA 3W86A 1QPOA 2QULA 3B0UX 5AYZA 3H2OA 4IT1A 3TOYA 4AIBA 4CKQA 3W71A 1TJ0A 4PC8A 4X9SA 4IH3A 3SCSA 3KOXA 3FV9A 3R5EA 3CQKA 3EYPA 3VCCA 4B16A 2R9RA 1NARA 5LKYA 3UPMA 4NZJA 3CIXA 3E74A 3TTOA 1E9ZB 1CT5A 5FF3A 3VINA 3SRKA 1TMQA 1QUMA 3QMRA 2DVUA 4BK9A 2B31A 2QIIA 2ZTKA 1VFFA 4GY1A 2NV9A 5C5YA 1GJPA 2CBJA 5A6MA 4FLQA 1T96A 1AQHA 1EJXC 2QGHA 3C0QA 2KAUC 2WHMA 3UR2A 2I1OA 1JGMA 1P4CA 4MKVA 3L4TA 3RFAA 4A3QA 1DHKA 1ZBCA 2XN1A 3OLDA 1D7KA 2Y88A 3B9EA 3S2NA 3A23A 3G24A 4YLWA 3EX6A 1VFTA 3WFLA 5D09A 3ZVHB 4PUEA 3GG0A 3ABOA 3UG4A 3F2CA 1J01A 5CPQA 5HOSA 3SO7A 2DP3A 1ADDA 2CW6A 4DBEA 4B3KA 1OC7A 2QVHA 1EKOA 3BG9A 4PUWA 3A4AA 2PWEA 3CZGA 5B7ZA 4YPJA 4JTFA 3MV01 4Z2JA 4KCVA 4H7CA 2GPTA 4F9DA 1TWWA 3NPWA 4OT7A 3EEGA 3STPA 2GGGA 4ZQPA 1UD2A 1DJHA 4WGXA 2OQLA 4DX3A 1UPPA 3RHGA 1TZ7A 3FAWA 1A50A 3PZGA 4ZQRA 1VJZA 3V1PA 5H2ZA 3PVFA 1QFEA 3ONCA 4N7QA 5CCZA 1Q6RA 4M7SA 4CNOA 2VXNA 3AIWA 2YA0A 3I3DA 3L0NA 5A6JA 3E12A 3KOWA 1EZWA 1SQ7A 4XAZA 3NAVA 4ZFCA 1NDVA 1SSDA 4DBDA 2PTYA 1SM9A 3OIHA 3QBUA 2ZVIA 2DT1A 3RO8A 1A5CA 1Z89A 4A22A 5H8UA 1RBLA 4JYEA 2J79A 2E1DA 2P8BA 1FWCC 5E9AA 3W7MA 2QPXA 2EJ1A 2O92A 4YS1A 1HJUA 4IQEA 2PU1A 1H7RA 1FHVA 1GOQA 3N73A 3MZNA 2YA1A 3AMLA 3OGVA 4CGTA 4H83A 1EBGA 1GTEA 2ZA3A 2XIIA 3L2LA 4E3TA 3CQJA 5C7HA 4OWGA 1S2AA 3EDKA 3P61A 4H4IA 4XO6A 4DJDA 3WNOA 3NM3A 1SZGA 3M5XA 1VCFA 3PUEA 2QKFA 3DENA 1UR1A 4EPEC 2NQ9A 1W1B1 1QXLA 3YPIA 3W2JA 2JK2A 3N17A 3SRFA 2VENA 1NIUA 5EA9A 1BWLA 2DSZA 2X2GA 4Z2GA 1J2BA 3FDGA 4QDPA 1OFEA 1NF0A 4LVFA 3EX3A 1XYMA 3LYEA 3EDEA 3WMCA 1PVNA 3V35A 2QS8A 3R10A 5FJOA 3VDBA 2DZAA 3PG9A 3ONBA 2GVEA 1THFD 4CCEA 2CXEA 3H2FA 3SQSA 3WFZA 5CH9A 2DJXA 1M7JA 1E6PA 1FHLA 3M5VA 4M1RA 3QW3A 1KFWA 1Z9AA 2HCVA 4IP7A 3FA4A 4C1LA 2OWWA 1RY8A 3LY0A 4EXBA 4R88A 1LF1A 3UXAA 3G1DA 1SFTA 4UTFA 5LIXX 3ORWA 1NF7A 3ITTA 4M8UA 1IXNA 1JPMA 3OVRA 1LDCA 3G0XA 2CNCA 4YTUA 1QI5A 3WLQA 1H7XA 4GQBA 3BOFA 2XIBA 4MY8A 1OM0A 4NJJA 1X7FA 1FH7A 1ODZA 4JHOA 1GQNA 2ZFAA 4RDYA 3RDKA 4C60A 3O0FA 3G1RA 4J27A 2FB3A 1RXOB 4C90A 3TUUA 1YRRA 3FXYA 4QM1A 1NY1A 3QGKC 3C86A 1ITXA 1I60A 4WDWA 2NLYA 4W88A 2UY2A 3IEBA 3S9YA 4IPIA 1RD6A 3P2VA 4ENLA 2EG6A 4LU0A 1JJKA 2ISVA 1AVAA 3BLPX 2FLIA 3RGTA 1KBLA 1EP1A 1UD6A 1OFOA 1TG7A 4NI8A 1EH9A 2DZXA 3MCOA 4UNLA 2A3BA 2OOGA 1PKMA 3M4HA 2PFHA 4WLCA 3O0KA 3FSUA 2I17A 3JW7A 2POTA 4DUXA 3ENLA 1XYBA 1Q6EA 1O6IA 1KQYA 2YJQA 3CEPA 3VCRA 3Q4DA 2F9RA 1H60A 3MI3A 2VFGA 4MWAD 2E3ZA 4DBUA 5EMMA 3W3OA 2DT2A 2YOCA 1EP2A 4HNVA 5HPCA 3S1GA 5D37A 2ACSA 1OJXA 4ICNA 4XTDA 3VIKA 3R8RA 2AGKA 1ZL1A 4LAOA 4GIEA 4PUNA 1J96A 4JFSA 1T0OA 3LCHA 2PDUA 4A3UA 2X7VA 1B31A 1O5RA 3BAXA 4L61A 1ZBKA 2UZ9A 1P6WA 3FYYA 1UWRA 1AQ0A 3A9IA 3ZJ7A 4Z1DA 2WMJA 2XSAA 3LERA 1CB2A 1TE1A 2PWUA 5G4HC 3HGSA 4P8VA 4GI6A 2PBGA 3IJ8A 1O60A 2WSRA 1XRVA 3VD9A 3CLWA 2CPUA 5DT5A 2ZRWA 5D8ZA 2GWGA 3CZEA 3RLUA 2A3CA 4LANA 2DGAA 2R1LA 2VX6A 3OZMA 2BBFA 1VB9A 2D3LA 3GB6A 3LGDA 2FYMA 3CIVA 4UTKA 1F2JA 1AH4A 1GVYA 2B0MA 3W7RA 2OB3A 2FH8A 4CN1A 1Z48A 1CXLA 4W93A 1XLBA 4J3VA 4BF7A 3PBWA 4IZGA 4CU8A 3QMTA 5F4XA 1AW5A 3W7QA 1W1TA 2J9YA 4UTHA 4GJJA 1E56A 3GHSA 2P10A 1EBHA 4XD3A 2WM0A 4PMZA 1EYEA 3R1ZA 4AZ7A 1UR8A 1UASA 3S2CA 2Z2UA 1BVWA 2CIPA 3R94A 4HA0A 4H04A 2BHZA 5I02A 1BF6A 3L4XA 2CHNA 1QOQA 4LUJA 1RVKA 2ON3A 1H5VA 4H9UA 4D8AA 2B4GA 2W67A 4O4VA 4KF1A 4ZOCA 1OX6A 4LNYA 3WNMA 2FMNA 2C19A 2WBGA 4P5UA 3SUWA 4DO7A 1KM2A 1RV8A 2D2OA 1KWKA 1TRDA 1PO9A 1B1YA 3W28A 4W5UA 2ZE3A 1LM1A 1H50A 1DQUA 3GXMA 2YX0A 3HG2A 2ZUVA 1XIGA 3UR5A 3TW7A 2G0WA 4FZIA 2DZUA 2WC4A 2G95A 5A8MA 4A4AA 3LB0A 3PULA 2BFGA 2Z6IA 4ATWA 3G0SA 2YCIX 1K9FA 4WGHA 5C6MA 2D1ZA 2J7EA 3C2EA 1OEPA 1QT1A 2R82A 1FP9A 2PF8A 2ZWYA 3ZSTA 1TELA 4NXKA 1LBMA 5AC4A 3L2IA 4HHHA 1QAPA 3UWQA 2I5GA 2E28A 1RR2A 3NSMA 4ILSA 1LZOA 1XLAA 4N9CA 2IKHA 2C71A 4HTYA 1VPXA 2CLKA 2Z26A 6A3HA 4R3UA 3IJIA 1UOZA 5D2WA 4AIUA 1DV7A 1EJUC 1WXJA 4GE8A 4JQ4A 4B2DD 4F8XA 4KESA 3SY5A 1IZCA 4E4UA 1UJQA 2FTPA 2G3IA 3BL3A 3GNRA 5BU9A 3EOOA 4ZMGA 3GHTA 1WCGA 3SW6A 1MSSA 2OWCA 2DVTA 4IIFA 5C7VA 2JF7A 4NF7A 5A6BD 1ISYA 1G4SA 2PDGA 3ANYA 2BOEX 3M64A 3LBOA 2E9LA 1KXTA 9RUBA 2V63A 2WW5A 3T9PA 5CC6A 1UKTA 3KZSA 4EVZA 1F07A 4HOZA 3TN4A 4Q6XA 1YKWA 3ATZA 3TVAA 3MO7A 4HYVA 1OCQA 3M0XA 3BGJA 2VFDA 3MU7A 2PDCA 1WDRA 3B04A 4ZQMA 1X6LA 1Z32X 1BRLB 4LTSA 5JH2A 2PTDA 4IJCA 1KM4A 3NQ8A 2W91A 3S4TA 4U28A 5GNYA 3QQWA 1W32A 1X6NA 3FJ4A 4ZSUA 4INFA 3VM7A 3SCNA 5LIKX 4PCFA 4DF2A 1AJ0A 3RMEA 3WK1A 1Z7AA 4UNKA 2FZ8A 3T2PA 1MRAA 3BVJA 3WD3A 1GOMA 3LMYA 3R43A 1TTQA 2VEPA 5TBOA 3M0HA 2Y5SA 1FUYA 2D22A 2A0NA 2HE8A 3WY1A 4FXRA 5LA2A 3SN0A 3BO9A 4QITA 4L1XA 3N04A 4I3GA 1GW1A 5JUVA 5CZKA 4DJED 5HATA 3DFOA 4L6OA 4E3VA 2WLZA 2QCNA 4DXVA 2HSAA 4DBSA 3GBDA 3DC8A 3H2NA 1EIBA 2ESCA 1JAEA 4WXZA 3FYOA 1JRBA 2Y8VA 2BV9A 3FDKA 4TU1A 2Y85A 1BGGA 1FH8A 3BCJA 3N2MA 3NTYA 1QCWA 4XZLX 4BF9A 2E8YA 4GD0A 4PCSA 4O0QA 3VOJA 3U7VA 4P2VA 3GX9A 9XIMA 4DZAA 4PR4A 4EP8C 2J7CA 4Q33A 4R9XA 2J74A 3EKLA 1KRCC 2VM8A 2QJJA 1WXYA 1B54A 1J8VA 2YBVA 1KLZA 2OYLA 4H6EA 5HR7A 1OFPA 3OLIA 1WZKA 3L12A 1VKFA 3VIMA 4B91A 1V3KA 1P0EA 4LCSA 4MADA 5BMXA 2I9EA 3NQAA 4RCXA 1UH2A 3GKFA 4GYJA 4NZ4A 4Z2HA 5FAGA 3THDA 2PZNA 1FCBA 1YPXA 5D2XA 2D3NA 4M81A 5FJPA 3QXBA 4EIVA 2Q6ZA 6TAAA 2XISA 4LUYA 3W82A 1Q7QA 2FGZA 1C8XA 2NVCA 4WKHA 5FKYA 4S2BA 3FK4A 4UR7A 2CLHA 3CT7A 4JIEA 1S39A 2VGGA 1S2WA 2OYMA 2ZZ7A 3E0LA 1DHPA 1LL6A 2AAMA 2CWXA 1BVNP 4HPGA 3BW2A 3ZJ8A 2C7FA 3CMFA 3TMQA 2E40A 3CYJA 3MHGA 1AFSA 2NQHA 6TIMA 4Q22A 3CH9A 4YTTA 1TQJA 1KFLA 1DORA 1ZAIA 3NQCA 3SZ8A 3WBAA 5JBFA 2PCEA 2Q8ZA 4E2DA 2VQUA 4MF4A 1PZ3A 3HTWA 3CAVA 5JBEA 2DJLA 5LYRA 3S1VA 2PPGA 3CEUA 3TLLA 3EXTA 2YL8A 4RR4A 1RJRA 3BURA 1O5QA 3T4CA 4PMRA 3QV7A 1WZMA 1WZAA 4XK2A 4ZXOA 3QOMA 1KA9F 2V3EA 4R53A 2PODA 1NTHA 1D9EA 3H55A 3V16A 3AIBA 3MYPA 4F2UA 3P84A 1IZJA 4MY1A 4LJ3A 1DVJA 1JFHA 3M0JA 4KS0A 2QDHA 3K5XA 3WSUA 1W3NA 4DJEC 2VWSA 4M1BA 4RXGA 1UP2A 1RP8A 1E0XA 9CGTA 4LBUA 4GKTA 3IANA 2HNEA 4XD5A 4UTWC 4Y9MA 1SZNA 3EWCA 2IPFA 1L0PA 2J66A 4UFJA 4JTTA 1KXQA 4DWSC 1TPUA 1SZRA 3AC0A 5FEPA 4B4HA 4OIFA 2I56A 4KRZA 4X0NA 1VIZA 3T1GA 1U1JA 3AMDA 1XIDA 2W63A 2G41A 4MUPA 2PBOA 4QLLA 1TTIA 3W2MA 1XLEA 3N2TA 1GGOA 4HZMA 1P1XA 2W0UA 5D4YA 1IHIA 1SYTA 1Q3NA 3FW6A 4YHEA 4GINA 1TPDA 3FAXA 2VZUA 5IFTA 1V3HA 4QNEA 1JZ6A 5LNSA 3E02A 4P7RA 5CKSA 4JTGA 1HGWA 5D05A 4CN4A 4Y2WA 1B4KA 1BLIA 4D6JA 1EO7A 1M7XA 1R46A 5K7JA 1RD5A 3MKCA 1S38A 3FYPA 1H09A 2EPNA 4HNTA 2GVGA 4AZ6A 4BQ3A 3IARA 2GYIA 3UESA 3DGBA 4ROQA 4UQAA 1CYGA 4XZWA 3UZWA 3K1GA 2H90A 2P8CA 3LXCA 2OZ0A 3WF1A 5CC3A 4GVFA 5AHLA 2PB1A 4ZQOA 3WK3A 4FF7A 3VA8A 3B97A 4M7TA 4ZQCA 3FJLA 4KH2A 2ZTJA 3W73A 1RHCA 2GQAA 1GCYA 5F2LA 3RF9A 2D24A 4L4OA 3QKEA 4NNCA 1GTHA 3NDZA 1M68A 4S3FA 1IR2A 1KXHA 3HG4A 3EOUA 1NOWA 2A21A 3W25A 2ZXQA 1WDQA 2FZMA 3BTNA 5BWFA 4DM1A 3W7CA 1MQQA 1OG0A 3ZR5A 1V7AA 1FWRA 2ZA1A 5FJJA 4O17A 3M43A 1KFCA 1RCQA 1Q6GA 2XSBA 2DIJA 4PSPA 3GAKA 4HIBA 4OE7A 1JDFA 4O50A 4BI7A 2OGYA 3GYCA 3OB8A 4H9ZA 1A5AA 3O16A 4L6HA 3KW3A 3UT0A 3TSBA 1ZFJA 5LHEA 1Q85A 4NAFB 2J4GA 4A8IA 3U4FA 5EBUA 1UJPA 1NQKA 2Y0FA 2UY3A 1W9PA 1YDOA 2NQZA 1BKHA 4W8BA 1TB3A 2FFIA 2WNNA 2C16A 3WEOA 4K39A 3W7DA 1W5PA 1PCKA 4CUCA 1KXVA 3JR2A 3HMJG 1GKPA 3W7IA 3GIPA 2V3FA 3ZLHA 3H4XA 2XGZA 5C9XA 3K30A 4ZSTA 3ARQA 4DLFA 2AKZA 3S6OA 3RMJA 2OZTA 4O1FA 1M9HA 5AZ1A 4GHRA 4WOQA 3S1XA 3MSYA 2ZDRA 4L80A 4IQLA 2VR5A 2Y5EA 1ENUA 2QJGA 1LOLA 3NQDA 3LI1A 1NSJA 2W3ZA 4PEEA 5ECVA 1O66A 3GU2A 1XLFA 4A05A 4GH3A 1A0EA 1A53A 1GG1A 4C91A 3FSTA 1SW3A 1SO6A 1V8EA 1ONXA 3AHVA 2E09A 3VO0A 2V67A 2GDUA 3GH5A 3CUGA 3KBWA 3OZPA 3C5QA 1ME7A 2ZZ2A 1H1NA 3VGHA 4PTDA 1KTCA 1MFUA 2E9MA 3NL5A 1U1HA 1XR2A 2NXIA 3DCPA 3HBLA 5G1MA 4UWMA 5DEZA 3ARZA 4UOJA 1M04A 4C6IA 1YTEA 2ACUA 2YW4A 2XG9A 1BF2A 2A4AA 4I6VA 3QKZA 1QNPA 4ATDA 4UQCA 1VCGA 3IACA 2W79A 3NJ3A 3MC5A 4BJHA 1JNEA 4A8LA 4OJYA 5FF4A 4MAZA 4RNJA 3BW3A 3NIYA 2WB5A 3LTSA 3ZIZA 1IXPA 2GOUA 3MTWA 1LWJA 3AMGA 5T26A 1NOUA 4GY0A 2OZ3A 4D6EA 5CAKA 1T5AA 2XFWA 4IOTA 4J5NA 1TZZA 1TVPA 1K1DA 4KMQA 4Z2KA 3SB0A 1GW9A 4L9XA 5AHIA 3TW6A 3W2KA 2VEFA 2PDWA 2D0FA 3PZTA 2DT3A 3ITYA 1KM1A 2EJAA 3ABXA 4S3KA 3F4NA 5DT7A 1G4EA 5U7SA 4Z1BA 4JTLA 1YXCA 4WY0F 1SGJA 3DBNA 5CSYA 2HNHA 1XLGA 1FFRA 2PMQA 1S46A 1TX2A 1W9BM 1NOFA 3O6DA 3LHUA 1TZ9A 1GVEA 2A7PA 5E6YA 3TSMA 1Q6DA 1XINA 4NU7A 3AS2A 4M6QA 1W1IE 2DUAA 2H3DA 4ORMA 1K77A 3ABZA 1NFPA 2V82A 3UVAA 2EKGA 3N18A 2G3MA 3H2EA 4LS2A 4OV4A 4GQRA 3WFAA 1VFMA 3PK7A 2XFFA 3KDOA 1L2UA 4MB3A 4HJWA 1JYWA 1O94A 1V7YA 2DUXA 4DIAA 3SCTA 1E9LA 1KCZA 1XJBA 4OGZA 2WVVA 4YN5A 3EX1A 1XGEA 4QE4A 2WZTA 1JL8A 1TJ2A 1VFLA 4E5TA 2E6YA 5JXQA 1UWAA 2O4MA 3ZT6A 5CGQA 3WCZA 4Z2IA 2Y4SA 3W1LA 3TYAA 1Y5WA 3NVDA 1K70A 3G1XA 1X38A 1R85A 3AHXA 3P93A 4ZB5A 2BMBA 4L9YA 4LY4A 3CV2A 4G7FA 4IIBA 2RDTA 1VRXA 4QX4A 2VEGA 3CUXA 5H6HA 3C6CA 2VMFA 5F7UA 2WVVB 2NSXA 3LHZA 1ICQA 1MYRA 4UBPC 3C2VA 4Q4SA 3VNJA 1J0KA 1EL3A 3PPHA 2GQ8A 3IGSA 3KS6A 3W7PA 2BHYA 3LXBA 5CEWA 3QEZA 1MMFA 3QV8A 1L2QA 3CQ0A 1HKVA 2ISDA 3LG3A 4K8GA 2RDXA 5E0CA 3EWZA 3V5OA 5HNTA 4YTSA 4IXXA 1DJZA 4KRTA 4NNBA 4W4QA 4E2BA 1R9XA 1BYAA 3NO3A 2ZKMX 3C0SA 4LBRA 1TX0A 4RNHA 3EWDA 3NPVA 3P62A 2WHJA 1ITCA 4IIEA 1TKKA 2ZUSA 4EAYA 1LBFA 1UUMA 4RE2A 3WLSA 2BDQA 4JFUA 3K8KA 3B8SA 4HJFA 2H8XA 3LGEA 3OBKA 4O16A 1IT0A 3KCOA 4BY3A 3AIUA 4Q6JA 1HF6A 2PDMA 2D0HA 1OIFA 4HA4A 1DWHM 1MO0A 1I0BA 2D2GA 1Q8AA 3NQVA 3N1AA 1HIZA 3BMVA 1XRTA 3D3AA 2HBXA 1RA0A 4UTIA 4HN4A 1IYXA 4FOJA 1UWSA 3IK2A 3HGOA 2HPMA 1J5SA 4QRNA 3BLDA 4IISA 3TXVA 4EOUA 4PUUA 1JXKA 5C2GA 1M03A 4S1FA 1W5NA 3B0PA 1OF8A 5BZAA 1ECEA 3GRIA 3T0CA 1SJDA 1PL9A 4WY0A 3T09A 5BOFA 1VEOA 3L5MA 4CD6A 1H41A 2O9PA 4W5ZA 2Y8KA 3FY1A 2WMGA 4IMDA 2BS9A 3R0UA 4MPQA 1OSEA 5F2MA 2DW6A 2BXYA 4PUMA 3SUSA 4IHCA 1EZ2A 2QNEA 4AZGA 3LD5A 1R3VA 3DI0A 1FOBA 2QCHA 3OVQA 3EDJA 4G6CA 3W7NA 4EWJA 1A47A 2VELA 4HNOA 1K4GA 3C8FA 4OBTA 4WJEA 2XVPA 4B3ZA 1ITUA 2BVTA 1RCOB 1F6PA 4KBXA 2C15A 1QI3A 3C4UA 3N6HA 3A9BA 1K02A 4F2TA 4L6DA 2ATMA 5LA0A 4UTUA 4S3CA 1TR1A 3VD4A 3OQEA 1GYLA 3UWZA 5LIYX 5TAOA 4HK5A 3S1UA 1M7OA 2OSYA 4GNJA 3DFSA 5MHBA 4QJ3B 3DHDA 1S2CA 1IEVA 3HN3A 4OOUA 3IIXA 2WVTA 1W91A 1K4HA 3W88A 2J88A 3EX4A 5T91A 1TPH1 2G5WA 3HOJA 2QJMA 1IR1A 3VCNA 5CSRA 5LIUX 1PDYA 4BA0A 1XLDA 5CAHA 3LTPA 2ZZ5A 5KZEA 3L66A 2R14A 1SW7A 2A3AA 1M7PA 3PTQA 1Q7ZA 4V15A 2NXGA 1F73A 3GXIA 4ZQNA 4IIHA 1I75A 1XCFA 2E25A 2OEKA 2W61A 4Z1AA 3WD1A 4DXXA 1Y5VA 1Z44A 1G7VA 4HK7A 4JKMA 4O15A 2A3EA 4GX8A 4ACZB 3LCXA 1EO5A 2HQAA 2WPGA 3F4WA 3GTIA 3PTMA 2WSPA 4AX6A 1W17A 2BY2A 5CLTA 1EX1A 1ZSXA 3INPA 3TAOA 2BY3A 4OBSA 1XDLA 1A5NC 2ZX9A 1V51A 2OVLA 4MNKA 5IM51 2CBVA 4MJ2A 4HZ6A 2ISSA 5CXPA 1Q6CA 2PDBA 1EEPA 2WLYA 1XS2A 3AO0A 1W3TA 4Y6GA 3IAQA 2G3JA 1QNRA 2OTDA 3UGVA 3U2OA 2PRLA 3AZTA 2XH0A 4JOMA 1WBHA 2MUCA 2J9ZA 3A3XA 1VZWA 3MMTA 2NZLA 3NQEA 3Q58A 1BQCA 1SPQA 4NZCA 2FVMA 1B5TA 3VIHA 2QF7A 4G8TA 4RKAA 1P5BA 8A3HA 5TIMA 3T42A 4O1BA 3IIPA 2YDQA 1A80A 1YX1A 3AMKA 5G1YA 3P8IA 4S3GA 4GIAA 3NNTA 1QPRA 4ZODA 5HUOA 3Q2DA 3AFBA 2BZNA 1X1ZA 3G18A 4M19A 1QBBA 3G1VA 4TX6A 1IZKA 4OTKA 3OEXA 3THQA 3REQA 1XUZA 2E6DA 2V0TA 5DCEA 4PTNA 1RVGA 3EMQA 1MQRA 2A7NA 2PEVA 3OVGA 3KE0A 2DIKA 1LWHA 1R0MA 1GKRA 4UNIA 1JD9A 1VHNA 2V5DA 1IEQA 3WF2A 3N9KA 2IKJA 1UD4A 2A6LA 5ABFA 1E9IA 4ZEPA 3HG3A 4HOXA 4MDPA 3K4AA 3M0MA 3ANVA 3NFUA 4CD4A 3A4JA 1R38A 2GUBA 2VD8A 3UJRA 1JF5A 3M9YA 3N3MA 2HEJA 4Y9AA 4R9OA 5I06A 3O8AA 1O12A 3GM8A 1IGSA 1RPXA 2AKMA 1GVIA 1XW8A 4KQNA 3V4BA 5FJRA 2ISFA 2PUZA 1XG4A 3DERA 1JCLA 1OWQA 1R87A 3TIMA 3IIZA 1WZLA 4LAUA 1FCUA 3OHIA 3W1AA 2VEIA 3PFRA 4YMZA 5ABFB 5ABTA 3HG5A 1JXJA 3A4XA 3KVJA 4AC7C 3VOGA 3MHUA 3BSHA 4MTVA 3T08A 3ECQA 3LSCA 4RX0A 2JQXA 2WQPA 3F4VA 4KCWA 4A6GA 2WHLA 3UGRA 1OZMA 5T8GA 3I6EA 1SMDA 2IPGA 3ARXA 4UMAA 3NDYA 1OQFA 3SJNA 3P82A 4IGSA 2NWSA 1FQ0A 3GAYA 4O11A 3GVVA 3RUBL 3H12A 1UWIA 4FXFA 3LENA 3D47A 5BXTA 5A6KA 1OF6A 5EKYA 2FPYA 4IGNA 4IMEA 2Y6ZA 1P0KA 2DDXA 4FNPA 1E6SM 4X22A 1CENA 1R47A 2D0GA 3VYLA 1XQKA 4ATLA 3FVMA 8XIAA 1S5WA 1UOKA 4DF1A 4OHQA 2XFRA 5FL0A 3GFYA 3KOYA 5TNVA 3II1A 4OV9A 2J24A 4QS6A 2PD5A 5GNXA 1PWMA 4PH6A 4ZE4A 1OK6A 3VNMA 4AX7A 4ZA0A 3RNDA 3GDTA 3PAJA 3HFTA 1S5NA 5D02A 1H1YA 4F79A 3W07A 1EF3A 2VX5A 4JTJA 6XIAA 2QPUA 1O68A 4C6JA 5EGRA 1K9DA 4LVAA 1YIXA 1H5YA 1QW9A 4IFKA 3EXRA 3I6TA 1SR9A 3EWWA 1YDYA 1V08A 3ZT5A 2V3DA 1DXFA 2PURA 1F8MA 1PB0A 2WQDA 2OQYA 3HV9A 1IWAA 1YXDA 1HKKA 3BLEA 3MMDA 1HKJA 1A5LC 1A5BA 2VUYA 1H11A 2HK0A 3APTA 1E0VA 3W2UA 3WUBA 3TC3A 1YADA 1IIHA 4MWAA 3W2NA 3POCA 4IFKB 1X7IA 5EMYA 2V5KA 3ANUA 3LMZA 4NT0A 2P50A 2R1PA 3TWBA 3TZNA 3U3HA 1YDNA 2DSKA 3MUIA 2P3ZA 1TCDA 2GSEA 5FACA 1H62A 3E49A 1FWTA 1QHOA 5H8MA 5HWJA 4IGHA 3WLTA 2DFAA 1QRQA 1A5MC 3SDOA 3G8EA 5IHRA 1AW2A 5A2BA 5XINA 3GFXA 1RJQA 4Y8FA 3VGEA 3N9RA 4IX2A 1PKLA 4B5NA 1Z69A 3TX9A 1GONA 4MWAB 1JZ2A 2OX1A 2UWFA 5CPSA 2BB0A 4Q3MA 1XFBA 1IQ8A 4IMFA 3SQLA 3KOZA 1ZQ5A 2YSWA 2XVNA 5AYBA 3TCEA 4EPKA 2WWDA 4BQ5A 2OU4A 3CL8A 1V02A 3CAKA 4IJRA 2GJXB 4CQ9A 3AU6A 1XYLA 5HPOA 3NQBA 1W2VA 5E93A 1XH1A 2PGFA 3UA3A 1B3ZA 1A0DA 3H6OA 4EX4A 5I00A 2FDSA 2PTWA 2ZZ4A 1BEUA 2MANA 3TYEA 3WBXA 5LNRA 4X2PA 2ZYFA 4GVGA 3VKCA 3ID7A 4GI8A 3URBA 3ITVA 2RH9A 3CHDA 2VR4A 3GU9A 1YBQB 1L6GA 1FX6A 1MNZA 1EF2A 1LOQA 3TAKA 3H8AA 9XIAA 2VGBA 1KGUA 4E8GA 4GUHA 4UR9A 4QQUA 3IJQA 3AIRA 4HB7A 2DQWA 1VLIA 1MDLA 2JEQA 4H8VA 5FJIA 4TIMA 3G1HA 2E67A 2J75A 3PTDA 4DI8A 1MUMA 2PLMA 3AIQA 5G2IA 4R85A 4HZ7A 4AW7A 2H8ZA 3CZKA 2AL2A 1VLWA 4JCLA 4Q8OA 3S5ZA 1LROA 4LB3A 2NW0A 4OECA 3TTYA 2BASA 3R0DA 4NZFA 3CMGA 5BYWA 2AL1A 4NQ1A 4ONVA 4PCNA 4ZGYA 4NP7A 3UPBA 1P6BA 3MUY1 5A1AA 3OODA 2UBPC 2WV8A 4TVDA 3OA5A 4XBSA 3LTYA 1T99A 3CM4A 1EOKA 3V75A 3W1NA 3HURA 1MUWA 5DXXA 1PUDA 2V8ZA 4Q8WA 2AL2B 4BI6A 1EPXA 2QQ6A 3G77A 3H4GA 2DSWA 4MJMA 3LLFA 3MW7A 4XZ9A 2P1FA 1J0ZA 3E1F1 3MWAA 5MKGA 4KEUA 4S3JA 4ADTA 3GLCA 4JIIX 2OJPA 3LRLA 4AD0A 2PP1A 3VE9A 4AZIA 1KGWA 2GQ9A 1O4UA 3NVTA 3WUEA 3RX2A 3WEZA 3UWUA 1C8YA 5G5IA 4GC3A 1E1EA 5CPNA 4AD5A 1UP3A 4B2DA 1JG9A 1R7OA 2A2IA 5A8PA 3BARA 4HSNA 3OA3A 3FHQA 1GZJA 3CUJA 5MKGB 3ME3A 1TPC1 1C8VA 1POKA 5E09A 2XZ9A 2E7FA 5A6BA 3LCIA 5C55A 2GVJA 2WO5A 3MP3A 4U5KA 4JCMA 1RSCA 1B3VA 3KRZA 4M3PA 1M6JA 2XFYA 2V6AA 2WYSA 1QTWA 3MUCA 4GQ0A 1REQB 3FS2A 5HNNA 1QI4A 2OKTA 4CNPA 1FFQA 3WQGA 1V3MA 4J2PA 1KCLA 1XIFA 2IS7A 4M0XA 5FOOA 2J8GA 2V38A 1F3WA 2BVYA 2OFJA 1YTKA 2XU2A 1LJYA 5B7YA 2QEZA 3CNYA 4O13A 3BE7A 2E68A 3W6YA 2PDQA 3S5OA 4QTGA 3E2VA 2YZRA 1HKMA 1NDYA 3KVLA 3UG8A 3DEQA 1Q6LA 3VGBA 4CCDA 2V5CA 3KRUA 1TTJA 3V5FA 4UTTA 4MB5A 5EYWA 1GQKA 3N2BA 1QOPA 5M17A 4GJIA 2IKGA 3ALFA 3TMLA 3VKBA 4YL2A 3T8LA 4JTUA 2ICSA 4NX0A 4JFTA 1R3TA 3WLRA 4AU0A 1AQMA 4YHGA 4AHQA 4HCHA 3WJWA 4U4MA 2RJGA 4GACA 2WANA 1Q4NX 1JDDA 2JIEA 2OODA 3LPOA 4DJEA 1IWBA 3MBDA 2NQJA 3P0WA 2X30A 4F40A 1EJ7L 3TOPA 3DYPA 1B9BA 4UTWA 5KTLA 5M1TA 3HZ3A 3RLHA 3BJTA 3SN1A 3VKAA 4ICCX 4IWWA 2WAGA 4DZ5A 3UR7A 2CKRA 1TTPA 1KM3A 3TKFA 5DN1A 2ZXBA 1PKYA 3IJ6A 2RDUA 2HVMA 1EA0A 3O2LA 5DF0A 3GXFA 3PG8A 3QR0A 5ABGA 1TR9A 6ALDA 1TWIA 3AYRA 3MYOA 3VZZA 1XG3A 3WLHA 4G1KA 3HM7A 5DQPA 3SCPA 3O6CA 3NSXA 1OCJA 1SSGA 3ARPA 4XKMA 3SCUA 3QH2A 3TYDA 3UZXA 2PCQA 2NWRA 1YMYA 1QNVA 1YE6A 3JUGA 4TVUA 1CXEA 2A3LA 4JD4A 1K6AA 4IPPA 4ZL1A 4KIRA 4B4FA 5CBIA 2NVAA 2PDJA 4HPHA 1CTNA 1XUUA 3WJZA 4JL1A 3N6QA 3I10A 4JX5A 4PFHA 3RPDA 1N8FA 1VFSA 1XH0A 1ICPA 4HBKA 3I4EA 4F0MA 4BR1A 3EMZA 2YA2A 4MYXA 3GU1A 1E55A 5HMFA 3SCQA 2WMIA 3PWIA 4W8AA 4DO5A 4OZOA 4K8EA 3GS6A 3M7SA 1YNYA 3HPZA 3NZPA 2GK1B 3PPGA 1QNSA 4WD0A 3ZR4A 1UZHA 4V28A 2DT0A 1UUQA 1KO0A 3LEPA 3ZLFA 4G56A 3TH6A 2P88A 1F3TA 2HMCA 3N11A 1X96A 3C0JA 1WDWA 4Z08A 4ZR8A 3DU0A 4K36A 1FWDC 5CZSA 2WZMA 1NWTA 1BG9A 2FB2A 2C3ZA 3DFNA 2J47A 1L6WA 4QLKA 4Q8NA 2RGLA 3OJGA 4Y90A 1RPKA 4GZEA 3UJSA 1PBGA 4H9YA 4JQ1A 2NQ5A 3VMPA 4ZOAA 4HNNA 3H2MA 1DQWA 3COTA 1S2UA 4FI4A 4GX9A 1HO1A 4AHOA 3BQ6A 1JCNA 4EE9A 3C2RA 1CNVA 1AK5A 4MHBA 3KL0A 3W1MA 2OOFA 3IRSA 3IAPA 3VPLA 3WQFA 4RZ6A 2QJIA 5B80A 1J0JA 5GJMA 1HL8A 1W8SA 1SO4A 4TTGA 2DZVA 1HP5A 1ADOA 4FNSA 2F6UA 1TV5A 4LVDA 4ZXLA 1H49A 4DUVA 4MNJA 2J6VA 3TP4A 2INFA 4QP0A 4R5EA 4ZOBA 3R6IA 2VZTA