2BXVA

Dual binding mode of a novel series of dhodh inhibitors
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
367
structure length
360
Chain Sequence
b'MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Dual binding mode of a novel series of DHODH inhibitors.
pubmed doi rcsb
total genus 133
structure length 360
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bxvA00
4DF0A 2DU2A 1H1YA 4RXGA 1KW1A 1F2JA 3GR8A 3HQ1A 3W1QA 2YR1A 2Y70A 3HGRA 2YYUA 4IOTA 3FKKA 1ZNNA 1LRTA 4NJHA 3NXFA 1XKYA 3NQVA 2VC6A 2VFEA 2F7FA 1BTMA 1KV8A 3NPUA 3HGSA 3YPIA 2FPVA 4XKYB 4O18A 1OX4A 3W2MA 1VLIA 3MHGA 4IMDA 3LV5A 5LSMA 5IBXC 2ZZ6A 1YYAA 1JUBA 2Q3RA 1I2RA 3NZRA 3VI2A 3ATZA 3FEMA 1TPB1 5TBOA 3QFEA 4LVAA 5TIMA 1TREA 5SWUA 5U4NA 3HPSA 4MLRA 1M5WA 1OX5A 5F4SA 4IMEA 3UXAA 3NGJA 1OHLA 3NQFA 3U2OA 4AWSA 2RKXA 2E1DA 3GKFA 4UMBA 1OK4A 1PL9A 3HG2A 4W9TA 4QM1A 2QUUA 2QKFA 4BR1A 1QO5A 2DZTA 1GZGA 3ANYA 4PA8A 4GNJA 1QOQA 4RCXA 2C19A 1OG0A 1K8XA 5DCEA 3W2UA 3MI3A 3NQEA 3NPVA 2JKEA 3W7JA 3TH6A 2C1HA 2Y88A 3FYOA 4NJIA 1K3UA 2PRLA 2VFIA 1Z41A 3O63A 4AVFA 4FNPA 4OHQA 3W7KA 3DFTA 2PRMA 3KVLA 3WJZA 1H7RA 3TSBA 1CI1A 4A2RA 3GXNA 1VHCA 4AHPA 4C1LA 3TNOA 4FNTA 1O5XA 3G1VA 3R8RA 3LLDA 3VE7A 3ZFHA 4DO6A 3FLUA 1HFBA 1TTQA 4RV8A 3SGUA 1SSDA 3N2MA 4H3DA 2Y61A 5G4EA 5D2VA 4E2DA 3RK8A 2E6DA 1W8SA 1DORA 3G1SA 4JTEA 1WAUA 3A24A 4QAIA 1UCWA 1I2OA 3W2LA 5BNKA 4FX8A 1KFJA 1EP3A 3DZ1A 3OA3A 4AWUA 1AG1O 4WOZA 3OG3A 5KINA 3W07A 1KTNA 1RR2A 1KM6A 1TTIA 3LRLA 4LVFA 3LX9A 3M5VA 5AHLA 2ISWA 4LT9A 3NAVA 4JX6A 5AN7A 5D03A 1B4KA 1G6CA 2H6RA 5K9CA 3UWWA 1FXQA 1W3IA 1YTEA 2ZRWA 3I6RA 1W56A 3SSJA 5K3VA 1VS1A 4QNWA 5E93A 3CB8A 4JD4A 3DAQA 5AHNA 3HG5A 2GUUA 2G96A 3PG8A 1F7BA 3P67A 4O50A 4PCFA 3UQNA 5HWMA 3NEVA 4JTIA 3PF3A 4IJBA 4N9CA 3DI1A 2NX1A 1PCKA 2H8ZA 3UD6A 1QPRA 2ZZ7A 2PCQA 2VKZG 1CW2A 1IXPA 1LBFA 3PUEA 3SW6A 2QJHA 5LNUA 2TYSA 6ALDA 5GVJA 4YL2A 4DO4A 1OFDA 1KLYA 1YLVA 5LNRA 2QCEA 4OWGA 3P62A 4NQ1A 3KRZA 2QAFA 3VNDA 3N2XA 3SR7A 1TB3A 4HT3A 3HGOA 1C9DA 3SGZA 1UUMA 3NQAA 3BVJA 1G69A 1XDLA 4UTKA 6TIMA 1O5KA 1KTBA 4L4LA 3IIPA 3HJZA 4XTIA 1V5XA 1WBJA 4LRTA 5CPOA 2EPHA 1XBVA 2YYTA 1PHQA 1FCVA 3EKZA 2X30A 2GJNA 4IMCA 2Q8ZA 1UASA 3L68A 4LNYA 3I65A 3TCEA 4R53A 4ADUA 4O16A 1NAL1 4NX0A 4FX7A 5ABTA 4PFMA 2YFNA 1G4EA 1ME8A 4D2JA 2QCDA 3LCXA 3DFQA 4JTKA 4JTSA 3EKLA 5HQEA 4Z1AA 3CIWA 4BK9A 3IGSA 4ALDA 2V2DA 5DELA 5HULA 3D0CA 2YZRA 1PIIA 1OF6A 4S1FA 1GPWA 1X7FA 1T96A 1SZFA 2YCEA 3BW3A 1EIXA 5D2XA 3NR0A 1KBIA 5DN1A 2FB3A 1TIMA 3W74A 5D2YA 4JTLA 4KFOA 4MOZA 1SFJA 4KWWA 3CHVA 2OZ0A 2Y6ZA 1L9WA 3TAKA 2F84A 1XUUA 4EF8A 4O4WA 3GXTA 1JUKA 4UTMA 2CWNA 2I9EA 1G4SA 4HNVA 3P8IA 3DXIA 5AYXA 4CQ8A 1MXSA 1QPOA 1TO3A 3QPZA 3DI0A 1UBSA 4MYXA 4PC8A 2VELA 3QZEA 1LP6A 2ZTJA 4GXMA 2NX3A 1Z42A 3I7SA 2NXIA 2W6RA 4N6EA 4UFIA 3O6YX 2TSYA 1YXCA 3MBFA 1KM4A 1DOSA 3GAKA 3UWVA 1AL7A 2TMDA 2Q8LA 1H61A 3OVQA 1KM0A 4XWUA 5AHMA 4ZQRA 3RLUA 4K6AA 1ZJIA 2OX1A 4LW7A 3E02A 5G1YA 3FFSA 4ORMA 3LOTA 3W1RA 1VCVA 4WZHA 4OQVA 2VOMA 4Z08A 1O94A 2FTPA 2B7NA 2JGQA 4WJEA 1XBXA 2AAMA 4PL2A 3W1UA 1FBAA 3NZ1A 1YDNA 3TW6A 1NFBA 5CPLA 2V81A 3KVKA 4FO4A 4A22A 4E0CA 2OCZA 1TPEA 3QYQA 3B4UA 1FWSA 4TU1A 3KRUA 2NXHA 4WD0A 3A21A 4FNSA 4UTUA 3GR7A 5D05A 3EWBX 1TPC1 3LRMA 1W54A 5BMXA 4FXSA 5AC7A 4GJ1A 1ML1A 1J5TA 3M16A 3GNNA 4AF0A 2X1TA 4BWLC 1H5YA 3C4UA 2A7RA 4XQ6A 3M1ZA 5CG7A 1UUOA 3GKAA 3EWZA 4M6QA 3W22A 2V2HA 1X8FA 4IXHA 3NQCA 4RZ4A 3PBWA 4HSNA 1E51A 3PUOA 3L0GA 3CEPA 4UR8A 2V9DA 1DL3A 3M5XA 2G5WA 3BK0A 3USBA 3P61A 3DFSA 5HR7A 4LOCA 8TIMA 1K7FA 4DXVA 3LHVA 1K02A 2J27A 3W1NA 2I14A 4IXXA 5H2ZA 1SO3A 4GUJA 2RDTA 1DVJA 4RXFA 3GNDA 1JCJA 2CLEA 1A53A 1KV5A 1JJKA 4DF2A 4ZZ9A 1LOLA 1P4CA 1F73A 4WX2A 2GVGA 3TIMA 1AW2A 2ZZ5A 3BLIA 3W1XA 1NF0A 1BKSA 3PBYA 3QRHA 1WOBA 1F6KA 2Y63A 3PB2A 2Y62A 3W83A 3W7IA 3NVTA 1RPXA 4H6KA 2OT0A 1PCWA 3TKFA 5DBTA 3W1PA 5K9XA 3QM3A 3C2OA 4YLWA 4ZQPA 1IIHA 4XZ9A 4UC5A 3WJWA 1UB3A 3TAOA 3UY8A 3LB0A 3WK3A 1YPIA 3G1XA 2QDGA 3JRKA 1ICQA 2ZCGA 3G1YA 3I7QA 3LCLA 4EVZA 1OFQA 2ZZ4A 1TPUA 4LUIA 2FFCA 5EYWA 4Z0JA 3W7LA 1SZNA 4JYEA 4GFSA 4YXGA 4O54A 4GC4A 3GDRA 2Y7FA 5G2HA 1WBHA 5D09A 4XKYA 2FPTA 1IF2A 1AL8A 1TSIA 2ATMA 4O28A 1RZMA 4UUIA 1CX9A 3TROA 1NSJA 4IPJA 2TRSA 1LLWA 2C18A 2UV8G 4R7JA 1V7YA 4X3ZA 3DFPA 1FDZA 4HKPA 1VGAA 5D38A 4LUJA 3G24A 4UTJA 1G4PA 2YPIA 4ZL1A 4WXYA 4H4IA 5AC6A 4GWEA 2C3ZA 3L5MA 1KM5A 2AQWA 4M5PA 2JKAA 2C13A 3HIJA 4JGDA 3FYPA 2J9XA 1OYCA 5D33A 3PBVA 3AJXA 1ZFJA 3W71A 3DHDA 4NT0A 4JY9A 4N2YA 4GUGA 5CZ0A 5DLCA 2WQPA 1DKWA 4MJMA 4O57A 2BTMA 2YSWA 4JIPA 3HF3A 4LWWA 2A2IA 4MVAA 4C1KA 4MPQA 3TUUA 1C29A 5EPDA 1RD5A 2VENA 5DXXA 3NOEA 2Z2UA 4A3UA 4IWWA 4ZVJA 3W2KA 4HNUA 3P5YA 4JY8A 1FXPA 5LNSA 1OFAA 3B03A 5HUPA 1W31A 2QR6A 5FEPA 4ADSA 3WFAA 4CLMA 1FUYA 3O05A 3R89A 5G2IA 2Y7GA 1K8ZA 3O6CA 4TX9A 2EF9A 4M19A 2ISVA 3HO8A 4UTWA 1TRDA 2FPYA 1C8VA 1GYNA 2YGYA 4JX4A 5KSWA 3FJ6A 5FEXA 3QSTA 4Y8FA 1HG3A 5U7SA 2CLKA 3GDLA 4HPXA 3KOFA 4K36A 1TPVA 4DF1A 1W5OA 3NO5A 3BGJA 3TJXA 5BRBA 2P1FA 1AW5A 5C54A 4UIOA 1GG0A 4JN6A 4N9BA 3LCWA 1LM1A 3HPXA 3P80A 4O4VA 3INPA 1B4EA 3MP5A 5HWNA 1Q45A 3G18A 2E09A 2RDUA 4KWVA 3G0SA 3LHZA 4CCEA 2V8ZA 2ZQ0A 4FB7A 3UPBA 1OABA 1LDCA 1TV8A 3C2EA 4WUIA 1SO6A 4MY9A 4UMAA 2A21A 2R14A 3IGXA 3PB0A 3MHUA 4LS2A 2GVJA 4UTTA 4ADTA 2VEKA 1VYPX 2V2CA 3NPXA 2QCGA 5MHBA 1H7WA 5G2WA 5K2ZA 3I7RA 4PODA 3CT7A 3IRDA 3UXDA 1IXOA 2YW3A 3NM3A 2H3DA 5AYYA 5HWJA 5LHFA 4AWTA 1RVGA 4K8EA 1B57A 2DZVA 4UFMA 5AFDA 2YW4A 3OHIA 3LBMA 3SECA 3QQ1A 1YPFA 2GVLA 3BGGA 2ZZ3A 4KFPA 4CQ9A 1ZCOA 3UWZA 1SFLA 3EX3A 3QSRA 4Z1DA 4EWND 5I3FA 4Q4KA 1TJPA 2QEZA 3E12A 1RQEA 1R2TA 1ZENA 4AHOA 1K7XA 3ZS4A 1GQNA 4Z1CA 5C2XA 4Y6GA 1TYGA 4YWIA 1DQXA 5FF7A 3NQ6A 2H8XA 3TXVA 1RQHA 3DKLA 3ABQA 4I9AA 2QDHA 4RZ5A 1OX4B 3ZWTA 1RQBA 4BWLA 2Z6IA 4FNQA 2BX7A 3JS3A 1N8FA 3F1QA 3MW7A 3W70A 1X1OA 3TSMA 3UZJA 1G4TA 1VRDA 1TPWA 1VYRA 2GPTA 3TFXA 1OF8A 1QDSA 4ICNA 4QNEA 3GXPA 4O0ZA 2WOQA 1RV8A 5KITA 4CNNA 4RKAA 1TMHA 1BEUA 4U4MA 4FEZA 2VFHA 1SZEA 4ZMGA 1M7OA 2X2GA 3MYPA 4MFEA 3FA5A 3DGRA 3NQ2A 4WY0F 3E96A 4IX2A 3W7OA 3WJYA 2G95A 4MLJA 4NX5A 2GOUA 3L5AA 5D30A 2TPSA 4Q33A 4DBDA 3K30A 1JULA 1VH7A 3VFLA 4M6VA 1A5BA 4MIMA 3TA6A 2BWGA 4PH6A 1AMKA 1XFBA 4X22A 1SSGA 3MP4A 5D02A 1JQXA 1DHPA 2CLFA 4FIRA 3CM4A 5CPNA 3LHYA 1PE1A 4O0KA 5LGXA 3S0CA 3L65A 1A5CA 1LTDA 2QJGA 3UYCA 1TJRA 2ZRUA 4RR4A 2NZLA 3N19B 4AEOA 3UPWA 3CIXA 4BI7A 1FQ0A 1WXJA 2KZHA 3T40A 2Z6JA 3S5OA 1WX0A 3QEZA 3E49A 4QIUA 5AHIA 3LGEA 1SQ7A 5HR6A 5FEZA 2HS6A 1THFD 4I7WA 5CSSA 2X16A 1SR9A 3BPWA 5F1UA 1QCWA 1SUXA 1WQ5A 4E38A 2ZRYA 4K39A 2H90A 1S5WA 1G7UA 4O12A 2ZZ2A 1A5SA 2CU0A 2E6AA 4RJEA 3GDTA 3LCGA 2J9YA 3G0UA 5D37A 1EUAA 1EPXA 1VHNA 1AW1A 2RHGA 3MI6A 3GDMA 3HPZA 3PWAA 3W72A 3IIVA 3W7GA 5A8GA 1H60A 4EOUA 2CZEA 4JDYA 4A2SA 2NV1A 5F4XA 2WSYA 2ZA1A 2WJZA 1VQTA 2NUWA 5KZMA 3LI1A 2NXGA 2PURA 3CPRA 2CLMA 1EWDA 4JICA 1EP2A 3BLFA 2HTMA 1VR6A 5DBUA 1VPXA 3E9AA 4LS1A 5I3JA 4NZFA 3LCFA 1YTKA 4MJZA 1KFKA 1X1ZA 3HMJG 4KKXA 4AMAA 2BLEA 4QQ3A 3Q37A 1LRNA 3KRSA 5FF0A 3N3MA 1WDWA 2B0MA 4O13A 3U8GA 1W3NA 4K38A 1QO2A 4LV9A 1SO4A 3QQ0A 5HJLA 1H63A 4DO5A 1QPQA 1MEWA 4N02A 3G1FA 2B7PA 2C15A 1GVOA 1W5MA 5HINA 3PSVA 4NXSA 2W79A 3W86A 4BI6A 5KTLA 4GE8A 4WY0B 3MMTA 3P5ZA 1S5VA 3NA8A 4MUZA 3PC0A 3TQKA 4CNPA 4A29A 3L66A 1LZOA 5FF4A 2E6YA 3O16A 3LTPA 4Y96A 1ME9A 3N34A 4MFDA 3W75A 1OVDA 2NX9A 2ZZ1A 4JTFA 2B4GA 2XN0A 3NL2A 1H1ZA 4LVGA 1GJPA 3EX2A 4JNMA 3SIZA 4BFAA 3ZWSA 1TQJA 3M41A 1LBLA 2Z0IA 3V75A 4A21A 1K8YA 4IX0A 2ZRXA 3MBDA 1R46A 3BV4A 5CZTA 3KHJA 4EF9A 1Q6QA 3L5LA 1XUZA 4GBUA 4UXDA 3LHTA 2BZNA 3W7RA 2G97A 1IXQA 4NZJA 1EUNA 4QJ1A 1N7KA 4IQLA 5C55A 2CLLA 4OBTA 3MUXA 2CZFA 5EKYA 3W7EA 3GB6A 1YXDA 3GZ3A 1M7PA 5FF2A 1XC4A 3T44A 3C2VA 3QJAA 4NVTA 1I2QA 3PULA 1K03A 3HG3A 3LERA 3V1PA 2VFFA 2J9ZA 1JUEA 1BWLA 3LXBA 3BO9A 2AGKA 3A5VA 1WOAA 4FXRA 1DBTA 3W76A 4QISA 3LM7A 2E6FA 3L2IA 1ONRA 3TW7A 4JXCA 3RU6A 1HO4A 2ZFAA 1Q3NA 1X6UA 3C52A 2ABBA 1W0MA 4TMBA 3EX4A 1TPFA 3S1UA 1FWRA 4NUWA 2BSLA 3GAYA 4O11A 4PL1A 5LGZA 5K9DA 4K37A 1W3TA 3IVUA 2H3BA 3EWXA 3TR2A 4N9EA 1GWJA 3RMJA 1SW3A 3W6YA 1OYBA 2D73A 5K4XA 2CW6A 5G1TA 1IIGA 3O8AA 5C6MA 2W0UA 3B0UX 4K7YA 3EXSA 5F2LA 3UNDA 4WY0A 4MY8A 3S5YA 2A1YA 2NWSA 4QSHA 4ORIA 3T78A 5CKSA 4UMCA 2FDSA 3DU0A 3G3DA 2WPBA 4LVDA 1WYIA 1PVNA 5AHEA 2A7PA 3A5FA 4ZQNA 2QCLA 2P0OA 3PBUA 1R2RA 1BWKA 5D2TA 4FX6M 3O6DA 2EGZA 4OE7A 1LOSA 1QOPA 1P0NA 4YMZA 1FCBA 2NUYA 4NU7A 4Z1BA 3WJSA 1W37A 2ABAA 2QCCA 2QUVA 5LNVA 1LLZA 5LZLA 1EP1A 3QMRA 1B3OA 4N9DA 3EWYA 1JCNA 3R13A 3P8JA 1NEYA 3RF9A 1F6PA 3FOKA 2R91A 4ZQCA 1EX5A 3S6DA 1KLZA 1ICSA 3S8HA 5DY3A 4GUFA 1OFPA 3PR2A 3W1MA 3CEUA 3OVPA 1Q6OA 4LS0A 3GVGA 1GVFA 4TMCA 1KFCA 1GOXA 4HNTA 1DJQA 5A5WA 4UTWC 5IM51 3ZR4A 4DBEA 2JKPA 1AK5A 2CLIA 4NNBA 1FCUA 4O10A 3NQDA 2GQ9A 3WJXA 3STFA 4UFJA 2E5CA 3QH2A 4O52A 4HPJA 3C2FA 2DJXA 2DZWA 2ZTKA 2I1OA 2B7OA 3W88A 1XBZA 1XL9A 1H51A 5I3HA 3DFNA 1F76A 1ZAHA 3DH7A 1JCYA 3W85A 5EMUA 4CCDA 3N73A 3KVJA 3M5ZA 4MZ1A 1A50A 2WKJA 1YDVA 1I8JA 4UFKA 4AHQA 1EWEA 1QR7A 3OBKA 1TV5A 2CLHA 3C61A 2ZYFA 3R12A 1FX6A 1LROA 2V82A 3M47A 1D9EA 2HS8A 1LBMA 3H53A 4UNLA 5T26A 3NNTA 1S3HA 3EWUA 3F03K 5KZEA 3LXCA 5L9FA 1EB3A 2VFDA 3R2GA 5D2WA 1SPQA 2RH9A 4P61A 3W7QA 4Q32A 1VZWA 5F4WA 5LKYA 3GK0A 1QFEA 3P60A 3W1TA 3LTYA 4M6PA 3S1WA 5CZSA 3OEXA 3OVRA 3FJLA 2IQTA 1L6YA 4DQWA 2ZRZA 1KM1A 4LU0A 1YXYA 2FB2A 3VKJA 5DY2A 4LRSA 3HOJA 3KXQA 2NUXA 1LORA 3LI0A 1H7NA 1KFEA 1PS9A 1Z44A 4IPIA 3NQMA 4JR5A 4Z0SA 3KFTA 4UTIA 3L0KA 3NQGA 3RFAA 2QCDB 3PSWA 2HSAA 3TC7A 1O95A 4IUOA 5F1VA 3QMTA 1TPDA 2Z1BA 4I7VA 2CLOA 2X1UA 4K8HA 2Y7EA 1KBJA 3TK7A 3EX1A 3PM6A 1MO0A 1H7XA 4IMGA 2GQAA 1YTDA 5IBXA 4S2CA 3ELFA 3NQ7A 1JCXA 1P5BA 4JTHA 1T99A 4JYDA 3C8FA 3CQ0A 1MEHA 1TCDA 1KFLA 3FS2A 2V5BA 2ZDRA 3PUDA 3TE9A 4DEFA 1D3HA 1I4NA 2DZUA 3G22A 3TQVA 3I68A 3S1XA 1HO1A 4O1AA 2QAPA 3IIOA 5KZDA 1GG1A 3O15A 1I2NA 4WQ6A 1H7OA 1IXNA 3GLCA 5L6UA 4ZQOA 4M7SA 1KFBA 2ZBTA 1J2WA 3P7YA 4JIQA 2CZ5A 1WA3A 3B04A 1XCFA 4BI5A 3STGA 5BOOA 1B9BA 4UFHA 4JTJA 3DENA 4EIVA 4E2BA 1SW7A 2NV2A 4HHPA 3DFOA 1QNVA 3L0NA 5F2MA 1FDYA 1W5QA 3KX6A 1KM3A 4IMFA 4JYFA 3CWOX 3OIXA 3B0VC 3IEBA 4NNAA 3M6YA 3C6CA 4NXKA 2YX0A 1QMLA 4G1KA 4RK8A 3G0XA 5FEWA 1SO5A 1TRIA 4HSOA 4XTDA 1MSSA 4HNNA 4UCGA 2WNQA 3MHFA 3QPYA 1A5AA 5FI8A 3BLEA 1W5NA 2JBMA 3HGJA 3LRKA 5CZJA 2PC4A 4Y90A 3P81A 1GTHA 1H7PA 1LYXA 4UR7A 2QCNA 4HIBA 1G7VA 4N4PA 4OGZA 5DCBA 2A6LA 4AH7A 4LTSA 3B06A 3GX9A 1TV7A 5EL1A 7TIMA 3NL3A 2QCFA 1Q6LA 2E68A 1ADOA 4RX0A 1OK6A 3H54A 3H55A 4LC8A 1DQWA 3FKRA 2QF7A 3B0PA 3MI2A 2FQIA 4MY1A 1ZY9A 4OV9A 3M43A 1PHWA 4O17A 3W9ZA 3T4CA 3GYEA 5LHEA 2ZA2A 4GUIA 1QAPA 2NLIA 3A23A 3T7VA 3IGUA 1T8XA 2EAWA 3G8EA 1OX6A 5E0KA 3L9CA 4O14A 4UNKA 3C3NA 3TFCA 4NJGA 5F2IA 2RFGA 1W5PA 3HB9A 3VE9A 5LNWA 2ALDA 1FDJA 2GJLA 5KMYA 4MZYA 2WSRA 4JS3A 1Y0EA 2OT1A 3LDVA 1JRBA 3IVSA 3Q94A 2X1RA 3W7PA 2Q3OA 3GDKA 3C56A 4LVBA 1R47A 3NL5A 3F4WA 3MP3A 4K7VA 5K7JA 2QUTA 4O8RA 3SI9A 5BMWA 3PVFA 3A9IA 2A85A 2WV8A 2DORA 1I45A 3SY5A 2VEPA 3IIZA 3SJ3A 1Z48A 3CU2A 1JRCA 3L67A 4FF7A 2OJPA 3G1AA 4XBKA 3N9RA 3EXRA 4OT7A 5AB3A 1XI3A 4U28A 4RZ6A 5CSRA 1DV7A 2YXGA 1F5ZA 2EKCA 3ATYA 1LRQA 3O06A 4Y9AA 3TXZA 5I3KA 4L4MA 3ABOA 2ZRVA 4X9SA 1JQVA 3BG3A 4R34A 2LLEA 4P2VA 3BW2A 4UTTC 2PRHA 3W2JA 4UFLA 5I3GA 2DP3A 1P1XA 4MYAA 4J9JA 2WNZA 3G1HA 2A7NA 1FWNA 2X1SA 4FIQA 3M0ZA 2A4AA 1L6SA 2C14A 5BW6A 3WK0A 5AHFA 2Y89A 3SFKA 4N4QA 1FY6A 1OJXA 3UZ5A 3TQ0A 2XN1A 4LV4A 3MYOA 3LCHA 3B8DA 4OU1A 1ZALA 3W73A 1ZAJA 4JDBA 3W7NA 1H62A 3W23A 3NDOA 5EA9A 2DJLA 4NJKA 4O1DA 3G1DA 3QF0A 3WK1A 1QWGA 3HG4A 2JK2A 1OFBA 3BW4A 1U5JA 1VC4A 2A6NA 3TC6A 2O7SA 3BG9A 4PTNA 3MO7A 1MZHA 4QITA 3G3MA 3PY2A 3GIYA 1PV8A 3EWWA 1GEQA 3ABSA 3KAOA 1VYSX 1ZHAA 3LHUA 3W7DA 1KA9F 2VXNA 1SW0A 4R33A 4B5NA 3DHFA 4CNOA 3N14A 2NWRA 1I2PA 3FIGA 5I3IA 4YCOA 4NJJA 2ATSA 3BARA 2C6QA 3M5YA 4TR9A 3LLFA 4DPPA 2OMAA 3S42A 4I7UA 2V5LA 3UY7A 1YADA 3NL6A 4UTLA 4O53A 2B7QA 3EXTA 3DKJA 1HL2A 2XFWA 1U83A 2VEMA 1GYLA 1VCGA 4ML9A 2ZA3A 2DZXA 2GQ8A 3THQA 3NM1A 1GTEA 2R94A 2A5HA 5EY5A 1T0OA 2V30A 2QCMA 3IIXA 4N6FA 3W1AA 1J4EA 1ZAIA 3QMSA 5AOUA 5FF3A 4DELA 1FCQA 5D32A 4O1BA 2Y7DA 3P82A 2XN2A 3M9YA 2O7QA 2R8WA 3CC1A 3HBLA 1NVMA 3MJYA 1P0KA 4WOQA 1JR1A 1ME7A 2QJIA 4M7TA 1O4UA 4JX5A 5G4WA 3IV3A 1KM2A 3PAJA 2JGYA 4O15A 1ALDA 4FNRA 3QW4B 4ONVA 3THAA 3TSDA 3O07A 4MZ8A 1H50A 3STCA 1MEIA 4GRSA 3CTLA 1XM3A 5H91A 5FESA 3M7WA 2Y85A 3S5ZA 1VLWA 3AO0A 1TQXA 3NPWA 5E1QA 3S1VA 3NYZA 3PS7A 1L2UA 2C0AA 4IGHA 1TTJA 3LTSA 3JR2A 3SZ8A 3O1NA 3EX6A 4YCPA 3P84A 1QPNA 3TX9A 4JEQA 3LV6A 1TTPA 1OFEA 4LY8A 3M44A 1JVNA 1G67A 5J5DA 1R2SA 3E0IA 4FNUA 3NQ8A 2FLIA 4RLIA 5AYZA 2E5DA 4O19A 3U6WA 3A22A 2FIQA 1ICPA 2RDWA 4OV4A 3W1LA 3R5EA 1XXXA 1NF7A 3LXAA 3W2NA 1GVSA 4AXKA 2P10A 1K7EA 1VJIA 3CLMA 3MWAA 3N9SA 1M6JA 2ISSA 5K4ZA 3QC3A 2DZPA 3NG3A 3UWYA 3T55A 4CQAA 3TDFA 2A0NA 4WXZA 1KTCA 3L21A 4ZQMA 3DBPA 3KVMA 3PG9A 4HN4A 4X2RA 1S5TA 2FJKA 4KFNA 3S9YA 3W87A 4PEKA 5F2GA 3B05A 4UTHA 3CWNA 1EA0A 2QCHA 5HUOA 2J88A 3W7CA 2EHHA 2HMCA 3LHWA 3C0JA 5D04C 3TMLA 1OFRA 1HTIA 2YDAA 2BXVA 5HNRA 1FWTA 3LCIA 3ABRA 5EBUA 3EEGA 3QW3A 1DJNA 4CCCA 1F05A 3C2RA 2DZSA 3S5NA 3TU9A 1GVQA 5DXYA 1LCOA 2CFFA 1WV2A 4XUGA 3TJLA 2YFOA 1UJPA 3UWUA 1W1ZA 3TMQA 2VEIA 2J6XA 3Q58A 1JCMP 2E5BA 3IVTA 1EEPA 1SZGA 4AB4A 3W7HA 1IGSA 5TQLA 3W3OA 2E77A 2V0TA 1YDOA 3BG5A 3W84A 2WO5A 1FWWA 5G5IA 3F4NA 2VFGA 4AF0B 1GVRA 1SU5A 5CGQA 3P74A 5J5RA 1F74A 5HMSA 3EB2A 4FHAA 3WK2A 5DCDA 4AAJA 3RLVA 3VCRA 1VCFA 4JTGA 4JTTA 1D3GA 4S2BA 2PE4A 1N55A 1L6WA 3G8RA 3UWQA 5CPMA 5AC8A 1XDMA 4TO8A 2WNNA 4DPQA 2WSQA 3TV8A 1OFOA 4POCA 2C16A 1XBYA 2CZDA 1O60A 1OYAA 1R30A 3LBCA 4TIMA 2J24A 4NNCA 4BF9A 1LOQA 4LC6A 1HUVA 3Q2DA 3W7MA 4GUHA 1Q6RA 4JTUA 5C5YA 4MKNA 3STEA 3RNDA 4O1CA 1JCLA 1GT8A 1TPH1 4XBSA
chains in the Genus database with same CATH superfamily
4YYCA 1F6YA 2DU2A 1KW1A 5CBBA 1F2JA 3W1QA 5FACA 2Y70A 3VNLA 3HGRA 3U7BA 1LRTA 4J1OA 1CEOA 4KCVA 2QPSA 1W17A 4G7EA 2VC6A 3K8LA 3E2VA 4D8LA 3B8IA 1UMYA 5GQBA 2J47A 4XKYB 1KCLA 3W2MA 3SDOA 3EDDA 3MHGA 3LV5A 4MWAB 4LF2A 5IBXC 3VOCA 5BXRA 1ENUA 2Q3RA 3FEMA 4GJIA 5TBOA 3QFEA 1TREA 1YDYA 4DJFD 5SWUA 2DDXA 2PP3A 2C91A 5F4SA 3GTFA 3NGJA 3EMCA 1JPIA 4L9YA 4D6IA 1UMLA 1N82A 5D4YA 1RJRA 3GKFA 4RNJA 4UMBA 2J78A 1DWIM 2I7GA 4W9TA 3EPOA 5IHSA 2QUUA 4D6FA 3RX2A 2QKFA 4LY4A 1KXTA 1GZGA 3ANYA 4N42A 1VFMA 4PA8A 3FVDA 3L4WA 3UYIA 1OG0A 4TVCA 2Y5EA 1GYMA 1DE5A 3TYZA 1RP9A 4PBGA 2ZUVA 2X42A 3GXDA 2C1HA 4NJIA 2VFIA 1Z41A 3O63A 1REQA 1UUQA 3NWRA 3W7KA 3KVLA 1JGMA 1D8CA 3TSBA 6REQB 1CI1A 3OW1A 5FJJA 4E8CA 4FNTA 1JPKA 4D6GA 5BOEA 3G1VA 3RXZA 3ES7A 3R43A 4GNKB 3H23A 4DO6A 1FWCC 1HFBA 4KWOA 1KR0A 3A3WA 1B0IA 5D2VA 4E2DA 2PBGA 4ACZA 5D9NA 4PUJA 3SY1A 4GVHA 3AIEA 1FWGC 1UCWA 1I2OA 3VKAA 5BNKA 4FX8A 3WQWA 5CQ1A 3OA3A 1Q65A 3Q65A 4FI4A 5LIYX 4B5WA 1UPPA 3OA5A 3N4EA 3VNYA 1TTIA 2PDKA 3VDGA 1MXGA 3RLHA 4LVFA 3S2JA 1ZL1A 1KWKA 2WCAA 2ISWA 1CT5A 3IV8A 5AN7A 1MDRA 3M0VA 2H6RA 5K9CA 1FXQA 1YTEA 2R82A 4XKMA 3I6TA 4IQJA 1L2QA 3BCDA 1HVQA 1F7BA 1X6LA 3P67A 3EEZA 4PCFA 3UQNA 1V0MA 3AIWA 1W1A1 1BPLB 2V6AA 1XRSA 3CQHA 2PCQA 2F8QA 2VKZG 1UHVA 1BSLA 1LBFA 3N1AA 2J8TA 1IWAA 1XCWA 1CXHA 5KZ6A 1IE7C 4CQCA 4GIAA 4LQ1A 4M24A 3ARYA 4J5NA 3U3HA 4WK9A 3FDKA 3P62A 4NQ1A 3KRZA 3VNDA 3N2XA 3U5YA 1TB3A 4HT3A 4G56A 3NQAA 4Q3MA 1XDLA 4UTKA 6TIMA 3HJZA 5DT5A 1WBJA 5CPOA 4KT2A 2EPHA 2YYTA 4XVDA 1UWSA 1LL7A 2I56A 3LEPA 2Q8ZA 3L68A 2XVNA 2VR2A 4KCUA 4NX0A 3UZZA 4Z1YA 3DHPA 2F9RA 5BYWA 1G4EA 1NY1A 3UJEA 3DFQA 4EX4A 5HQEA 4Z1AA 3CIWA 4MDOA 2F61A 3WYZA 1JAEA 3IGSA 1EJTC 2VDGA 3D0CA 4KMQA 1OZQA 8A3HA 2BOEX 2PTXA 4IHCA 3ZT5A 1SZFA 2YCEA 3PN8A 3CH9A 3T05A 1KBIA 2QGHA 1B5TA 2FB3A 3WQ5A 1QVBA 1GOIA 5D2YA 1EFZA 1SFJA 1XR2A 3GU9A 4A3QA 1XLHA 3AS1A 1E43A 2PA6A 3STPA 2F84A 1XUUA 2OLAA 3AU2A 3FA4A 1A3WA 3RM4A 4I3GA 4O4WA 2YL6A 1JZ2A 2W4XA 1IEQA 2REQB 1S38A 4KEUA 4H7VA 4CQ8A 1QPOA 1HP4A 3VC6A 1VFOA 4YNGA 1A3XA 3VU2A 5FJRA 3NDZA 3QZEA 1LP6A 3VX1A 2NX3A 3I7SA 4N6EA 2PPGA 2BHZA 4QX4A 1WDQA 4Q8TA 3PZ9A 4CQBA 5FD0A 1YXCA 1W9XA 3UWVA 1H61A 5AHMA 4QSFA 3EDJA 3VM7A 3RLUA 4L6HA 2QT3A 1XIMA 4K6AA 4PRRA 1XPYA 4F0RA 4LW7A 4GGHA 4J35A 1H11A 3ZR5A 4ORMA 1D7KA 5A8PA 2VOMA 1VPQA 3AYVA 4Z08A 1O94A 2VX7A 3S2LA 2AAMA 3W1UA 1YDNA 4MJ4A 3CL6A 1NFBA 3BJSA 2JEPA 4GQGA 2V81A 2C0HA 5HOSA 3G2GA 1XH2A 4ATWA 3KRUA 2R1PA 2NXHA 1V08A 4WJXA 4W88A 4UTUA 5D05A 3ALFA 1TPC1 3EWBX 4HOXA 3LRMA 5BMXA 4GJ1A 1ML1A 3NDYA 4QG6A 1J5TA 5JH1A 3M16A 1CGWA 3GD6A 3PNUA 3R4IA 4LUYA 5A8NA 3C4UA 1ZSXA 4JNYA 3GKAA 2V2HA 1N2VA 1HP5A 2IXUA 1E51A 3PUOA 2V9DA 4D6HA 1AQFA 2XIMA 3PANA 4M29A 1V6XA 3KDNA 4I6KA 3U9IA 4DXVA 4H6QA 4HU8A 2J27A 2I14A 2ASHA 4MWAE 3VIFA 4WLCA 4RXFA 4LBSA 1ZBCA 1BQCA 4H41A 1JJKA 4ZSTA 2O0TA 1LOLA 2GJXA 1F73A 1A5MC 1Y65A 3TIMA 3IAQA 2ZZ5A 4WEVX 5C9ZA 2Y63A 3ARPA 4H6KA 2BV9A 2ZKMX 5K9XA 4ZQPA 1IIHA 4XZ9A 4GQ0A 3I4EA 5A6MA 3TYBA 4X61A 2V5CA 1YPIA 4IIDA 2AQVA 1PAMA 4Z0JA 1LQ2A 3DERA 4GFSA 1A3HA 1EH9A 1CGXA 4JIEA 4XKYA 4JL1A 3FY1A 2ATMA 4O28A 4UUIA 1NSJA 1LLWA 4LALA 1RBOB 1V7YA 4X3ZA 3M0XA 4GABA 2PI6A 1FRBA 4HKPA 2HISA 2EPLX 2R9RA 5E9XA 1NIUA 1VD6A 3UCDA 3EPNA 4UTJA 1GNXA 2X0HA 2RDXA 4ZL1A 5AC6A 3FV9A 4GWEA 4PEEA 4LYPA 2C13A 3HIJA 3K46A 1OYCA 1Q66A 5I2UA 1ZFJA 4NT0A 1RALA 1C8YA 3MQTA 3NZQA 4L1GA 4O57A 3H26A 1H5VA 2A2IA 4C1KA 3GUGA 1FFQA 2EXOA 3TUUA 1YMYA 4QDWA 3KCLA 3ID7A 4IWWA 4W7WA 4HNUA 4O1EA 4UR9A 3UJ2A 2OKTA 2BBFA 5HUPA 5FEPA 3WFAA 1FUYA 1GJUA 2Z27A 2B81A 1VBJA 2OODA 3O6CA 5EU9A 2EF9A 4H04A 4GCAA 1TRDA 3A12A 2FPYA 5KSWA 2WMFA 3ES8A 3QSTA 4Y8FA 1I0DA 2CLKA 3GDLA 3KOFA 2BHUA 4C60A 4F66A 1W5OA 3SCNA 4H19A 4JBRA 2AMGA 3TJXA 1EJ7L 3W37A 3BH4A 2PDNA 1GOQA 4ZB5A 1M04A 4IIEA 1ZS2A 4JKLA 2REQA 2C79A 4KWUA 1EZ2A 1BWVA 1LM1A 7PTDA 3HPXA 5HWNA 1B4EA 4HA1A 3U5UA 4KWVA 4BQ4A 2V8ZA 2WVVB 1QI2A 1EGVA 4S3KA 2GOKA 3GY1A 3TVAA 2A21A 1V93A 3CMJA 3GR4A 4UTTA 1SJDA 4CU8A 1W32A 1X1NA 8CGTA 2FGZA 2QCGA 5G2WA 5E5CA 2CBIA 3CT7A 2EPKX 3WH6A 3UXDA 4QJ3B 4MWAC 1RY8A 2VP8A 1CDGA 3C0SA 5HWJA 4DJDD 2VYOA 1DP0A 3WH7A 1XW8A 4UFMA 3GW3A 2O9RA 2UY2A 1YPFA 4XVEA 5T91A 1EBHA 5BXPA 2ZZ3A 1ZCOA 1JZ5A 3AS2A 4GI4A 4PTXA 1PIGA 4EWND 2QEZA 3BOFA 3R1ZA 4LBRA 3XISA 5C2XA 3AMDA 4UWMA 1WO2A 4LCSA 1WNOA 5LIKX 2F6UA 2ZIDA 1V51A 4H9MA 1Z6KA 5DQPA 2Z6IA 1PBGA 1QHOA 3PZTA 3F1QA 3MW7A 3W70A 2V3DA 1VRDA 3GTXA 1S2AA 3WQCA 4ICNA 4QNEA 4F40A 5LXEA 1TVLA 2IXVA 3GXPA 3MSRA 4JFVA 1O66A 3N12A 1D8WA 1IV8A 4ZMGA 2OX4A 1M7OA 4LEQA 3RPDA 2XH0A 3MYPA 2VJXA 3WBYA 3WJYA 2G95A 1LQ0A 2GOUA 2Y8VA 3L5AA 2CHRA 3AQUA 1GJWA 4L64A 3WLSA 1A5BA 2XTKA 4NZ4A 4PH6A 1AMKA 4GKTA 1XFBA 1OZMA 2VZTA 1FH7A 2CLFA 1V4YA 5CPNA 1XHGA 4GIEA 3LHYA 4C7DA 1PE1A 3JUGA 2YA0A 5LGXA 3S0CA 4BEUA 4TUFA 3VMOA 1A5CA 1DQUA 2Z1KA 3SCTA 1LTDA 3KLKA 3UPWA 2FKPA 3CIXA 1PSCA 4BI7A 2JF7A 5I23A 1FWEC 1W1PA 1P1MA 4QR6A 4NRSA 3ITXA 3WNNA 4QIUA 4HCHA 1SQ7A 5HR6A 5FEZA 3GHSA 4I7WA 3TN4A 3FK4A 1BD0A 2X16A 1SR9A 5F1UA 2WB5A 1SUXA 3OQEA 3BUVA 1RLCL 2ZZ2A 3FGCA 1V0LA 3TN5A 4J3WA 3QHOA 5I3DA 3G0UA 1VHNA 2JE8A 5DMNA 2I17A 3PWAA 4S38A 3VIGA 5ABEA 3UT0A 4JDYA 1O7AA 1W6TA 2NUWA 2WJZA 1LF1A 3AISA 4K2SA 1VR6A 5DBUA 1VPXA 3CL7A 1B30A 4LS1A 2HNEA 3ME3A 3CMFA 1YTKA 1KFKA 1X1ZA 2XIJA 1JXJA 3Q37A 2XYLA 4O13A 1W3NA 5I5RA 4MAVA 4I9TA 2RAGA 3WH9A 3IJDA 3QQ0A 3T4WA 4IJRA 1H63A 3BMVA 4QAWA 2VO5A 3ARWA 4Y9PA 1MEWA 3ITGA 2B7PA 1GVOA 4NXSA 1K1DA 3F5JA 3W86A 1UYQA 1OINA 3SBFA 3NA8A 2GSJA 2PB1A 3EKGA 3TQKA 3ZVIA 4KETA 2W27A 3HM7A 2E6YA 4IP7A 1E72M 1GORA 3VOHA 3WELA 2SFPA 1OVDA 2NX9A 4YTQA 4KRTA 3WL1A 2QJMA 4IPPA 2OGYA 2EPMX 1H1ZA 1TR9A 4CKQA 5A2BA 5E6YA 1NTHA 3SIZA 4BFAA 3GTHA 3VILA 1E4LA 5EMKA 2W61A 4DM1A 4ZB2A 4FXJA 2Z0IA 4A21A 1K8YA 2EEXA 4IX0A 4Q8NA 3WLMA 1R46A 5I78A 1W1TA 1ZBVA 2WKGA 2G97A 1EUNA 3FX4A 3MMWA 1K70A 4IQLA 3WQGA 4PGLA 2CLLA 2OU4A 2HVOA 4PCPA 2VR5A 3GB6A 1YXDA 2PUZA 3GZ3A 1XC4A 1OD8A 5CZKA 4UQBA 1VB9A 3COTA 3H22A 4OOZA 3LERA 5AZ0A 3G77A 1W9BM 3N3TA 4LPCA 3V0TA 1DBTA 1YRRA 2GJPA 2E6FA 5JH2A 1K9TA 1WXZA 1XLIA 3GDBA 3IJIA 4JXCA 1HO4A 1OT2A 2ZADA 4HK7A 4W8LA 2WMIB 4TMBA 4Q8PA 4QFUA 1XISA 3S1UA 2VC7A 4S3EA 2BSLA 1WCGA 1HQTA 4IT1A 1H2JA 1ELSA 1JZ8A 5K9DA 1XYFA 1W3TA 1DWAM 3IVUA 1EHAA 2H3BA 3EWXA 3TA9A 4FLQA 1GWJA 1FP8A 2DSKA 4IJCA 2CW6A 1IIGA 1R3QA 4RPPA 5H8MA 1EL3A 2VGFA 4MY8A 2A1YA 4A3RA 4LAKA 3TN3A 4ORIA 1TVNA 2FDSA 3MV01 5IRPA 1PVNA 1W2VA 3WQFA 2P0IA 2P0OA 1V3HA 4OE7A 1XLJA 3MDWA 1T8QA 1FCBA 4ML4A 3GE7A 2ABAA 3W25A 4AZ7A 2E9MA 4L1XA 3IK4A 3QMRA 3AHYA 3UG8A 4DWSC 1GZ1A 1UP0A 1JFHA 3LQGA 1JCNA 3R13A 1NEYA 1EX5A 3S6DA 3S8HA 4JTRA 1OFPA 3F5LA 1R7AA 4DHGA 1EC9A 3LYEA 1B90A 2XZ7A 2EPNA 3SCPA 5IM51 2P8CA 3ZYZA 2VUYA 3QY6A 2CLIA 3W28A 4NNBA 1CCWB 3VIOA 5HMDA 3WJXA 4RUBA 3BWWA 3STFA 1QNSA 2WWCA 3FVMA 2PWHA 3QH2A 2DPEA 3VGGA 3H2AA 2ZTKA 3GG0A 7A3HA 5I00A 4X63A 1ZAHA 5FSDC 2QMKA 4PUKA 1JCYA 4YTUA 2DUXA 1KRCC 4BHYA 3D46A 3K2GA 2E0PA 1UROA 1YDVA 3K1DA 1YNPA 2FGBA 4GGBA 3ITVA 3BQ5A 5HQLA 2CLHA 3KS5A 1U2YA 1FX6A 3T2PA 2FTWA 1IZJA 1LBMA 3U57A 4DYEA 4WIWA 1R3WA 4EP8C 4ZO6A 3F03K 5KZEA 1DWFM 3AAMA 4P8UA 2ICSA 3RUBL 4Q32A 5F4WA 4MTVA 2WMIA 4ZENA 4H2CA 4M6PA 3OVRA 3FJLA 2HXUA 5BCAA 1L6YA 1J6OA 1AMYA 4LFYA 4LRSA 4I6VA 1LORA 2DSWA 4W5UA 1H7NA 2P5NA 3VGEA 1KFEA 3FHQA 2XWEA 1QNOA 1FKWA 3RHGA 4JFWA 4V1XA 3NQMA 1VENA 3S47A 4Z0SA 3KFTA 4UTIA 1WP6A 1LWHA 3L0KA 2ZXDA 2QCDB 1CGVA 3GG1A 4L9ZA 2NQLA 3F4VA 4F8XA 2Z1SA 1RD6A 4H00A 3H4XA 2Z1BA 3ANVA 4I7VA 1XSIA 2Q01A 2J7CA 3H2FA 2Y7EA 3CV1A 3TK7A 3BAIA 3PPHA 1TWSA 5A6JA 2EG6A 2J7HA 2QYGA 1YTDA 4FA3A 2VURA 2XPKA 4A4AA 1P5BA 2XSAA 1WB0A 3W01A 4XV0A 2V5BA 3PUDA 5DMLA 1D3HA 3LUTA 4ICMA 3I68A 3TW9A 1HO1A 3O15A 2WANA 3O3RA 4LUTA 1DTNA 1TX2A 2YCIX 4HP5A 3L7RA 4HA0A 4R3UA 1WA3A 1YKWA 4HA4A 3T9PA 5BOOA 1EYEA 3SRFA 3DENA 2BG5A 4HCLA 1XH0A 3OIXA 5CXPA 1GVEA 3H4WA 4NNAA 3M6YA 4KW2A 4ATDA 4PTVA 3C6CA 2YX0A 4G1KA 2IKGA 5FEWA 2QHAA 2GGEA 1SO5A 1TRIA 4XTDA 3VCNA 4HZMA 2HNHA 1EQCA 2WNQA 4JHMA 1A5AA 1U1JA 1W5NA 2DZAA 1ZBWA 5CZJA 5FAGA 4Y90A 4GC3A 3MC5A 3IJ7A 4LYKA 1JEZA 4GYJA 2A6LA 2GYIA 3ZVHB 1S2WA 1CYGA 4C91A 3B06A 3NL3A 2QCFA 2V5JA 1NOWA 2E9LA 3H54A 4ROPA 3H55A 2VI0A 3FKRA 2FZBA 2FQIA 1OY0A 2G37A 1X98A 2FMNA 3GXFA 2EAWA 1OX6A 3BDKA 2WBGA 4UNKA 3C3NA 3TFCA 4P7NA 5F2IA 3VE9A 2ODOA 3LZ5A 2P3EA 4HQVA 2ALDA 3T81A 3SM0A 3BAWA 1A5UA 5KMYA 2W9MA 2OLHA 1GHRA 3O9NA 1AH4A 2X1RA 4F48A 1E1CB 1R47A 1OG6A 1H4PA 3F4WA 5K7JA 3BLKA 5RUBA 3A9IA 3H2EA 2WV8A 1MUMA 1GKPA 4ZFMA 2VEPA 5LIUX 3CUJA 2X8RA 7ODCA 4MSSA 4S3DA 2PDCA 4Q8OA 3TC3A 1RJPA 3H2OA 4LUSB 3O06A 3M4HA 4IPLA 4X9SA 2HK1A 3BSHA 4DB7A 2I5GA 3U7VA 3W2JA 3UR2A 2DP3A 1BKHA 4MYAA 2WNZA 1ISZA 2A7NA 5XINA 4C6OA 2Y0FA 4X0NA 3M0ZA 2ISFA 2POZA 5BW6A 3IJQA 3WK0A 1UWTA 2Y4SA 1HGWA 3CHDA 3RPTA 4C6MA 4EAYA 4N4QA 3GU2A 2PCEA 3SCOA 4LV4A 2G3JA 3W73A 3W23A 3G1DA 3QF0A 5A8QA 3ARTA 1BYAA 3RJYA 1U5JA 1VC4A 1UP2A 2WSPA 3TC6A 2HEJA 1AODA 4ZOEA 2PF8A 1IEIA 3RM8A 4ES4A 4OJYA 1PV8A 3EWWA 1CGYA 3M0KA 3NUKA 1TWWA 3W7DA 3VGHA 1Z7AA 4ZE4A 1SW0A 4GVIA 3TEVA 4B5NA 3CAWA 1P48A 2NWRA 1I2PA 4YCOA 1MUWA 2D1ZA 3BARA 2DIJA 2C6QA 2CLPA 2OMAA 3C8NA 1YADA 3L4TA 5ECUA 1LWJA 1P6BA 3EXTA 2J77A 1HL2A 2XFWA 5CJNA 3IUHA 2DZXA 3THQA 1T0OA 3URBA 4DUOA 2VWTA 1TWDA 3PTQA 3SQSA 5AOUA 5D32A 2XJ7A 1NU5A 2WC4A 5IXEA 3NVDA 2O7QA 1JYXA 4ZXOA 4ZA0A 3WBXA 1O4UA 4JX5A 3L4YA 4CD7A 3L4XA 1KM2A 1I6NA 1XYCA 1VJSA 3TSDA 4MZ8A 3VIIA 2XFFA 3Q67A 2Y85A 3ZXWA 3VIHA 1TQXA 2EG8A 3OZOA 3OIHA 4F0HA 2W62A 3PS7A 2C0AA 3UERA 1TTJA 3LTSA 1NDZA 3OP2A 4GNVA 3SZ8A 3HQOA 3IK2A 3UESA 4FMVA 1H3GA 4IL0A 4JEQA 3LV6A 3JW7A 3QBUA 3CQJA 3WQDA 1BF6A 1GW9A 4OUEA 4J7RA 4H7CA 1ICPA 2RDWA 3RITA 1AJ0A 2GSEA 1GVSA 4M82A 3CLMA 3MWAA 1UWIA 3N9SA 4E3TA 2ISSA 2DFAA 2XM1A 3UG3A 4CD5A 3QC3A 5K4ZA 1TJ1A 3MANA 2DZPA 4CQAA 4GH3A 3TDFA 2A0NA 4WXZA 4ZQMA 1QWKA 3KVMA 4O1FA 2PZNA 1DJZA 3MTWA 2A3HA 2FJKA 4PEKA 4UTHA 9XIAA 1CXEA 2QCHA 1DXEA 4AZIA 3SSZA 2HMCA 2JIWA 4B5VA 2OG9A 3W4RA 3C0JA 3TMLA 5HNRA 2NQZA 2R24A 3GFXA 1S3TC 3ABRA 4CNTA 3QW3A 4BJHA 5A69A 1F05A 2DZSA 4JN7A 1ECQA 3S9ZA 1UC5A 2CFFA 4FS9A 4Z2IA 1X96A 4WKAA 1RCXB 1UBPC 1WV2A 2YFOA 3TMQA 3WBEA 3Q58A 1HJQA 3MKVA 2CZVA 1SJBA 2DSUA 2PDIA 1IGSA 4PYSA 5AYBA 3DYOA 2E77A 2R1NA 4JTQA 1YDOA 4MDPA 1KRMA 1FWWA 1U1HA 3SIMA 1SYTA 5CGQA 4FXFA 3W27A 3W53A 3TR9A 4WSHA 3EB2A 5DCDA 2VCAA 1IZKA 4J3ZA 3RLVA 5BXTA 3T2QA 3N6QA 2PE4A 1CXLA 2OWCA 1XD1A 3JU2A 3TV8A 2X09A 1OFOA 4AYSA 2ACQA 1PB0A 4UCFA 2WYSA 2IPGA 2CZDA 1O60A 1OYAA 1IQ8A 1JF6A 1VJZA 1R30A 4IUGA 3KZSA 4UNIA 2J24A 4NNCA 4EXAA 1JDFA 1HUVA 1C8QA 3WQ4A 4JTUA 5XIMA 2VX5A 3QKEA 3DUGA 3RNDA 4O1CA 1TPH1 3UJSA 4DF0A 1M03A 3AHZA 2HVNA 1H1YA 3TWAA 3N6JA 3HQ1A 3T8QA 2XU2A 2YR1A 3OZMA 1ZNNA 2WXDM 3ERPA 3S46A 4DM2A 1TX0A 1XKYA 5GJPA 4CD8A 3WCZA 3GBEA 2F7FA 1QI5A 3HGSA 1ZQ5A 4DWSB 4YTTA 2ON3A 2ZWZA 7TAAA 3AYRA 4NL1A 4AISA 1MZRA 1YYAA 3U48A 1I2RA 3NZRA 1TPB1 1PX3A 3WUBA 3M07A 4ZOBA 3WLKX 3MSGA 3U4FA 4M1BA 4C1NA 2Y5SA 1S5MA 1V77A 3OODA 1OX5A 2D0HA 2VD9A 2PDWA 1GOKA 5ENLA 3AUOA 5GPRA 3NQFA 4AWSA 1E6XM 3ICJA 2RKXA 4U33A 2FGLA 3MY9A 1XYZA 1JD9A 4P7RA 3MMUA 1C9WA 3PWIA 2PWDA 1QI0A 3RCYA 5JBDA 4GNJA 3AZTA 4GI8A 2C19A 4GXWA 2QS8A 3F4DA 3NPVA 3TH6A 2E28A 1UKPA 1YBQA 1YIXA 1ADDA 1YW1A 3BZJA 1BYCA 4AVFA 2QUMA 3OU8A 4FNPA 4HK5A 4OHQA 4XO7A 1M7XA 4E4UA 2PRMA 1H7RA 3PZQA 3VTRA 3CUXA 4AHPA 1EX1A 3TNOA 3OHMB 1OGSA 3DESA 1ZCCA 3MWCA 3PJXA 4JCMA 1FWFC 1TTQA 2YOCA 3SGUA 1TCMA 2D24A 4H3DA 5G4EA 5LIWX 5EFDA 3F7JA 3VD5A 3G1SA 1WAUA 2D2JA 3SCRA 3W2LA 1CZ1A 1R9ZA 3V7PA 1XDJA 3CHFA 5HATA 3DZ1A 4AWUA 2WJFA 1AG1O 2PWVA 2NLYA 3QV9A 3EGJA 3OG3A 3L4VA 5KINA 4KCTA 1KTNA 1KM6A 5A6SA 4RNIA 2QLYA 4US6A 3LX9A 3M5VA 4LT9A 4JX6A 1B4KA 1G6CA 4DYKA 1OT1A 3QYSA 4DBSA 3ZM8A 3UWWA 5HNUA 1W56A 3SSJA 1VS1A 2OZTA 5E93A 3KBMA 3HG5A 4Q4RA 2GUUA 4Q4QA 4O50A 5C0QA 1MDLA 3LD5A 1E3ZA 2W3ZA 3PF3A 4IJBA 5E70A 2BP1A 2BY1A 4XSMA 2NX1A 3II1A 1OB0A 2WVVA 1MQPA 1FWAC 1JDDA 3SURA 2Q71A 1XLCA 3A3XA 4G2DA 3VNKA 4DO4A 5CC5A 1YLVA 5GNYA 4K8GA 2JEQA 2HZGA 5LNRA 4C5YA 4OWGA 1UD3A 1VFLA 1PKLA 3N13A 1UZDA 3SR7A 3ZQ9A 4XZIA 3WNKA 6XIAA 1C9DA 2DT3A 3SGZA 1UUMA 4XZLX 5A8OA 1NWRA 1O5KA 5ABFA 3AMKA 3IIPA 3DG7A 4XTIA 3GRIA 5CBJA 1OEPA 4LRTA 3TCSA 3KZPA 2X30A 3SY8A 3I65A 3ISIX 4QQUA 1TJ0A 3TCEA 3KS6A 1BGGA 1MNZA 4O0QA 2GGJA 2BY3A 4HU4A 3SJNA 4FX7A 4PFMA 4M8UA 3ZIZA 2YFNA 4MB1A 4AZ5A 4D2JA 1OCNA 4JTKA 4XAZA 1F8MA 1KNWA 5DELA 1CTNA 1DJGA 5ECVA 2PU0A 2YZRA 2WCSA 4S1FA 4IIHA 1R38A 4E3VA 5DMMA 5D2XA 3BW3A 1EIXA 4GKLA 4TX8A 3UR5A 2NVDA 4V28A 5BROA 1GQKA 5DN1A 2VRKA 2PDXA 3UVAA 1CLKA 4KFOA 4MOZA 2WZTA 3CHVA 3VUSA 4W4QA 4C6PA 4EF8A 5FOOA 4JNZA 1Q6CA 5G1MA 2XIIA 3LBOA 1UH4A 1G4SA 2DH3A 3DXIA 9CGTA 1X6NA 1TO3A 1SFSA 3AUJA 1JI2A 3ZMRA 4PC8A 1ITQA 2PMQA 2ZTJA 3VIKA 3OJGA 4M0XA 1OIMA 2W6RA 2TSYA 3UZWA 3BSGA 2ZOXA 2IPFA 4DWSD 5A6KA 3WLOA 4JFSA 2NSXA 4J3XA 5I7GA 2OX1A 3S6OA 2O4MA 5G1YA 3FFSA 3QC0A 3LOTA 2WBKA 1VCVA 4R9XA 1WKFA 3PJWA 2AQOA 2FTPA 2B7NA 1A4MA 2JGQA 5IDZA 3NZ1A 2PD5A 2VX4A 3QGVA 1AQMA 1Q6GA 4U3AA 4XZWA 4A22A 4DZHA 2CCRA 1FWSA 4TU1A 1W9UA 1Q4NX 4WD0A 3A21A 5CBIA 1RA0A 2PS2A 3CXOA 3GR7A 1W54A 3GNNA 2I9UA 7ENLA 5FL0A 4EXQA 4LAMA 4XQ6A 2PBOA 5CG7A 1FFRA 1UUOA 1XLDA 4LYQA 3EWZA 1ITUA 1X8FA 3ENLA 4IXHA 1MVYA 3EOUA 1E0TA 4XD6A 2QXWA 2FVKA 3L0GA 1ONWA 1DL3A 3BK0A 1PDZA 4HTYA 5G4HC 3P61A 1LJYA 5HR7A 8TIMA 3RX4A 1K7FA 3IACA 4PZVA 1SO3A 1DVJA 2BGNE 1JCJA 1K77A 1SMDA 3GG8A 3ORWA 4H9YA 2DGAA 4FR1A 4ERIA 3EB3A 2DT1A 1KRAC 3TKFA 1E9ZB 5DBTA 1FP9A 3W1PA 4ZB0A 3C2OA 4WGHA 4GIYA 2PDLA 3GZAA 3EPMA 1V0KA 3NO1A 3WD3A 4H9VA 1UB3A 2I5IA 4PMDA 3LB0A 3WK3A 2XVPA 2PTYA 2BODX 3G1XA 3CH0A 3CUFA 3BLOA 3SFWA 1PX8A 3CTTA 3RYSA 1S2UA 2CHOA 2WMGA 1TPUA 2YL8A 4IG2B 2FFCA 5EYWA 1EKOA 4A8IA 3IRSA 2D0GA 3BMWA 1GEHA 2FYMA 2Y7FA 4GYPA 4CNUA 2GK1A 2FPTA 2XGZA 2Z7GA 5AKQA 1QBAA 1CX9A 4QE4A 2TRSA 4U5IA 2UBPC 1IWPA 2FFIA 2WSKA 3RCMA 2AMXA 1FDZA 2WPGA 3AMCA 3KP0A 5D38A 1ZJHA 4CVWA 1UZ4A 1G4PA 4PR4A 3OVGA 5HJXA 4BQ2A 4US5A 1KC7A 3NOYA 4M5PA 3FYPA 1PPIA 2J9XA 3W29A 3PBVA 3WLRA 3DHDA 2DT0A 2V68A 4N2YA 5DLCA 2J74A 3TWBA 4JIPA 4J3TA 2BFGA 1QJWA 4GY7A 3TTEA 1PTAA 2GGGA 1EOKA 4H8UA 5M1TA 2PF0A 4MPQA 4I5UA 4F0LA 4MGGA 3VIJA 4NAFA 4Q7NA 2Z2UA 1UA3A 3GU1A 3WEMA 2O4QA 4ZVJA 4R9OA 3TJIA 1MMFA 4CLMA 4DUXA 2Y7GA 4A05A 3A64A 2HQAA 4GY1A 4XD4A 2ISVA 3ITOA 2YGYA 5FEXA 4BCEA 1Y5WA 1RK5A 1HG3A 5U7SA 4XO6A 3LENA 4B5UA 1TPVA 4DF1A 3IJ9A 2BDQA 4DJDC 1QI3A 3S2CA 1K6WA 4K68A 1AW5A 3S9IA 5C54A 1NQ6A 2YDSA 1XG3A 4KIEA 1GG0A 4JN6A 1XGZA 2HJPA 3H2NA 4GPNA 3P80A 2TAAA 3INPA 3G18A 3SADA 4FB7A 3IPWA 5BOFA 4GOAA 3APYA 1OABA 1TV8A 3C2EA 1QU4A 2D2OA 2R14A 3PB0A 3NSMA 3W81A 3MHUA 4ADTA 2V2CA 1T41A 4GCXA 1PKYA 1C8XA 3ZVHA 5K2ZA 4R5EA 1P0BA 4GJJA 4PODA 3ZJ8A 1IXOA 2I57A 2YW3A 3NM3A 1RVGA 5EBAA 2YCLA 1UKTA 2EJAA 2YW4A 3I4KA 3SECA 1Q6DA 1NJJA 3LPPA 4CQ9A 4ZOAA 1SFLA 3BXWA 1WDPA 4DO7A 3EX3A 4Q8WA 1J0YA 3E12A 5IOBA 1ZENA 2HWGA 3WENA 2PDHA 1GOMA 4Y6GA 1DQXA 1SM9A 4GVFA 4P8VA 5FF7A 1W3KA 1J6PA 1GPFA 4J27A 2H8XA 1RQHA 3PJTA 1QHPA 3ABQA 3AIRA 1OX4B 3ZWTA 3N4FA 5MKGB 4Q6XA 2PDFA 3VXGA 3CYVA 1X1OA 2CESA 4K3ZA 1YX1A 1VYRA 1OF8A 1QDSA 3CAVA 3A9BA 3EDKA 1OGGA 4IGNA 5KITA 2DT2A 2VVNA 4QJ4B 4FEZA 5FKYA 3PTMA 2P88A 2X0SA 2VL4A 3FA5A 4OTKA 4HN8A 4IH3A 3K13A 3OGRA 2XH2A 4NX5A 3OYXA 4C6BA 4S3BA 3K30A 3UP8A 1XFCA 1CGTA 2NVAA 4RW3A 4EPKA 3APGA 1H0GA 1O5QA 3GC5A 4M6VA 4MIMA 4QCFA 4JQ3A 5BXSA 2J7DA 3BLPX 3CM4A 5CC6A 2OQLA 4O0KA 3VD9A 4Q8QA 1OM0A 1S1PA 3AS0A 2DIEA 2QJGA 4PN2A 1XYLA 3UYCA 1TJRA 2J8GA 2ZRUA 3EOSA 3N19B 1MI3A 1UZ1A 3PPFA 2P3ZA 1FQ0A 2PLMA 3UG5A 3WO8A 1Q7MA 2Z6JA 3GNOA 4HJFA 2IUZA 3QEZA 2FVLA 3E49A 3N11A 2F6XA 5M03A 3WMLA 3FXYA 1Q8JA 3THUA 2ZE0A 3BLDA 1QCWA 1WQ5A 3EBVA 5BRQA 3VDBA 4MPKA 3CO4A 4KPLA 3P0XA 4H8VA 2E6AA 4RJEA 3IJ8A 3GDTA 4QP0A 1TZZA 3LCGA 5D37A 2CKRA 3I10A 2ZUUA 1CB7B 1C7SA 3WX7A 1L6FA 3XINA 1Q4WA 4EOUA 5A6LA 2NV1A 1LG2A 2OO0A 2ZVIA 1Z32X 3LI1A 4AQLA 3E1F1 3CPRA 1NP2A 3BCJA 5CPSA 1Q63A 4DAIA 4PE8A 5T8GA 4K1GA 3V3WA 1GOWA 2VCBA 4NIRA 3W24A 3C5QA 3HMJG 2OSWA 4ZO9A 4KKXA 3VD7A 4AMAA 5FF0A 3GHUA 4K38A 4PCTA 1IEVA 1KKRA 5AECA 4HSHA 1W5MA 4GE8A 4WY0B 3SGGA 3MMTA 3P5ZA 4MUZA 1MFVA 3KUMA 3L66A 4ICCX 3CUGA 3O16A 4G7EB 1W3HA 2R1KA 2ZZ1A 2QNEA 2B4GA 1XRTA 3NL2A 1XSKA 3K8KA 4LVGA 3F2CA 2GQ3A 4UQAA 2ZVRA 4JNMA 4TV5A 2E1WA 1UD2A 1TQJA 3M41A 1QW9A 4XUYA 3V75A 1E71M 3RO8A 5FSEC 4XBJA 3WDJA 3BV4A 1E40A 1WKYA 4EF9A 1E1FA 3V5CA 2D22A 3MSDA 3W7RA 4NZJA 1N7KA 4HNCA 3AJ7A 4R85A 1TE1A 2I16A 2DVTA 3ABXA 3T44A 3QJAA 4NP7A 3DOPA 1I2QA 1IYXA 3MCNA 2PGWA 4LH8A 3HG3A 1BWLA 3FW6A 4HU3A 4LJ3A 2GJRA 3BO9A 2AGKA 4FXRA 4QISA 3XIMA 3H7RA 2A79A 4LAZA 3LM7A 1WUFA 2WZMA 3PAOA 4RNHA 1TUFA 2ZFAA 2ABBA 3VMNA 1D3CA 3EZ4A 3GQYA 3EX4A 1TPFA 3KBNA 4DI8A 3ZT6A 3BJFA 1PYFA 1TMQA 4B16A 4O11A 4K37A 1P7TB 3C0QA 1SW3A 1TIWA 3BL3A 1OYBA 5I77A 4XIAA 4IIGA 1JIBA 2ZUNA 3O8AA 4K7YA 1F9CA 3QN3A 4QS5A 3AIQA 4FSAA 4WY0A 4AYGA 1FHDA 1OADA 4QSHA 3DU0A 4LVDA 4A6GA 2A7PA 4DN1A 3W38A 1BWKA 5D2TA 1Q7QA 3O6DA 2EGZA 1LOSA 1QOPA 2NUYA 2DV0A 2XHYA 2Y24A 4Z1BA 3E74A 3MUAA 4H9TA 4W8AA 2QCCA 4H9XA 2J7EA 1V02A 2IPWA 4WSKA 4JQ1A 1QNQA 2ZC8A 4S23A 3B9DA 2YDQA 4PB3A 3FOKA 4GUFA 2PP0A 4B5XA 3LMZA 1MW1A 3CEUA 3OVPA 4MNLA 3PBGA 2IMRA 4LS0A 3GVGA 3V18A 4TMCA 1GOXA 4UTWC 4X9YA 3ZR4A 5I07A 4MKVA 1A5KC 1FCUA 4O10A 3NQDA 4GH1A 2VC9A 2AL2A 2E3ZA 4UFJA 2TODA 1B9ZA 5CJ5A 4HPJA 2CIPA 3MV11 2YXOA 2I1OA 3M0IA 3OOQA 3HFYA 2VGBA 3UW6A 3BOXA 3TZNA 3DFNA 3VGFA 3ZJKA 5EMUA 3WLNA 4L61A 1L8NA 3KOZA 3N73A 1R0MA 3M5ZA 1ZRQA 4UFKA 2J66A 1EWEA 1XYAA 4IM4A 3RN6A 3R10A 3R12A 2VM8A 1LUCB 1AQHA 1LROA 1AJZA 2Z24A 1D9EA 2HS8A 3H53A 4UNLA 4AD0A 3NNTA 1XH1A 1XJBA 1UOZA 3B9EA 3R2GA 4REQA 2VEFA 4DBWA 1SPQA 2WM0A 2IKJA 3F5KA 2RH9A 1RXOB 4P61A 1VZWA 4QG8A 2NV9A 4KERA 3LTYA 3S1WA 4NAEA 7REQB 1YXYA 1J01A 5DY2A 4B4FA 3P0WA 3HOJA 4RDVA 3LI0A 1EBGA 4MUPA 3TTSA 3LNPA 3MJMA 3UEQA 3FA3A 4IPIA 1RCOB 4W8BA 3RFAA 5A2CA 3TC7A 5IDIA 5CPQA 3GXMA 3WG6A 2XINA 3IAPA 5KEZA 3PPGA 2XFYA 6ENLA 2INZA 2X1UA 3WH5A 2FVMA 2GFTA 4YVPA 4E2VA 2EBNA 1KBJA 4L9XA 4QJ5B 4L65A 1GQJA 2BHYA 1H7XA 4GZJA 2OVLA 2GQAA 4V15A 1M3UA 1UG6A 1FHUA 3ELFA 3NQ7A 4S3AA 1IWBA 3B0XA 4JYDA 3C8FA 4YHGA 3K5XA 2HVMA 1KFLA 3FS2A 4AIUA 3O2LA 1HKJA 3MUCA 4GINA 3U2CA 3D3AA 2G41A 4O1AA 2QAPA 5KZDA 4WQ6A 4ZQOA 1KBBA 5BWAA 3LK6A 3VOGA 1OQFA 2ZBTA 1BXBA 1UR1A 1JCTA 5BU6A 1XCFA 4BI5A 4DVOA 1PWLA 3VNZA 3CZLA 3STGA 4UFHA 4WCJA 2ZC1A 3TONA 3V0UA 3WD1A 4BY3A 2DSZA 3KCJA 1KD0A 3KBSA 4IMFA 4JYFA 3IEBA 2J79A 2WWDA 4DUVA 3GC4A 1S39A 1VP5A 4RK8A 4P7OA 3V0SA 1XS2A 1ISWA 1KCZA 4UCGA 2PWUA 3P93A 1WDSA 3MHFA 5FI8A 4D8AA 3MVIA 4PMXA 3LRKA 4PFHA 1UJQA 1GTHA 3P3BA 4R7OA 4HIBA 3RIKA 4N4PA 4GI9A 2PDBA 4LCQA 2E4TA 4LTSA 4UZSA 1Q6LA 1G1YA 1MNSA 1IGWA 3PZIA 3BGAA 4PMJA 3UR8A 3T0BA 3MI2A 3VD3A 1XQKA 4MY1A 4DJFC 1PHWA 3M7SA 3W9ZA 3WLIA 3GYEA 2VWSA 2AL1A 3A23A 3IGUA 2J7BA 3G8EA 4PUWA 4O14A 1IZCA 3KLLA 3L4ZA 5LNWA 4LB4A 2GJLA 5EFFA 1UD5A 2OYLA 3WMCA 4DJEA 1BVNP 1MRQA 2PEVA 3W7PA 2FHBA 3NL5A 3EAUA 3WQVA 1REQB 5DRCA 3WQOA 4PCNA 2QUTA 1Z9AA 3SI9A 3CWHA 2VZSA 5BMWA 2A85A 3HV8A 3QVQA 1A80A 3VAVA 3IIZA 3SJ3A 1Z48A 4FF7A 4LAUA 4Y9MA 2QDEA 4XBKA 1D7FA 3MT1A 1TE6A 3KDOA 1ITXA 1XI3A 3UXKA 4OIFA 2PU1A 5CPTA 2EKCA 1VKFA 4S39A 3JVAA 3PPCA 4P2VA 4UTTC 2PRHA 4UFLA 3BICA 2HPMA 4CU6A 4J9JA 3G1HA 3QXBA 4HMCA 3S3GA 1FWNA 2X1SA 1T5AA 1FWIC 1L6SA 2C14A 5H1WA 5AHFA 4H8HA 5LIXX 3LY0A 3VGBA 3UZ5A 2KX9A 3MYOA 4ERGA 1ZAJA 2OOGA 3NDOA 5EA9A 2DJLA 4O1DA 3R11A 2V67A 1J10A 2JK2A 5D9OA 1OFBA 4GYFA 2VDIA 2A6NA 4XZBA 2CC0A 3BG9A 1HL9A 4PTNA 4E2OA 4US5D 4PMUA 1MZHA 3N15A 4E6MA 3HQPA 3G3MA 3RCNA 1ADSA 4Y8EA 2O9TA 1FTXA 3R8HA 3DC8A 1AH3A 4W7UA 3TYAA 3V5FA 1A0DA 1N8IA 3BMXA 3DHFA 4DIAA 3N14A 1BVWA 3FIGA 3VK5A 5I3IA 4QHRA 2ATSA 1B3VA 1MW2A 4GA8A 3M5YA 3WN6A 3LLFA 4DPPA 5I0DA 4I7UA 4UTLA 5AVNA 3DKJA 1JNDA 1UA7A 2NVCA 1U83A 2VEMA 3V5OA 4QROA 2ZA3A 1EZWA 1GTEA 4CN4A 2V30A 1QUMA 3KTCA 3NEHA 3K8MA 1ZAIA 4I8DA 4DELA 1O6IA 3FAXA 3TNBA 3P82A 2RGLA 5IFTA 3M9YA 2XIQA 3QR1A 3HBLA 1NVMA 3MJYA 1JR1A 1ME7A 3ARRA 4M7TA 1BGAA 2XVKA 2WMJA 3IV3A 5G4WA 3PAJA 3A47A 1K4HA 3IJ6A 4F0MA 2QVHA 4D71A 1MEIA 2A3BA 4GRSA 2HROA 3M7WA 3S5ZA 3WF3A 4AXNA 2QDDA 5E1QA 1WE5A 2I5QA 4IGHA 4ECLA 5I06A 1QRQA 2VRJA 2VZOA 5CC3A 3NURA 3UJRA 4IFOA 4YCPA 3P84A 1QPNA 2GLKA 3TX9A 4HBKA 2G4FA 4S3CA 1DHKA 4HNLA 1OFEA 4LY8A 3M44A 1G0CA 1A49A 2X7WA 5EMYA 4LSBA 1I60A 2ZUWA 4FNUA 3RPMA 3HA1A 1BYBA 4L6DA 3A4XA 4O19A 3FHAA 1VBHA 3A22A 2FIQA 4OV4A 4WRHA 3W1LA 3R5EA 4HHLA 3BLLA 1XXXA 1GUVA 1WDDA 2VR4A 1VFSA 4U2YA 5CC7A 3CNYA 1K6AA 1M6JA 4E8DA 1E73M 3T55A 2WC7A 3GM8A 1XIHA 3L21A 2QPUA 3DBPA 1HKWA 1XWYA 5H8UA 3DDMA 3VOJA 3VO0A 4F9JA 4KBXA 4U2ZA 1R3YA 4DJED 2PWEA 3V36A 2J88A 3W7CA 3LHWA 4AD2A 2J75A 3QOMA 4XD3A 1OFRA 1HTIA 2YDAA 2BXVA 5JXQA 1FWTA 3VNMA 4AY7A 1YQ2A 5EBUA 4NZ1A 3SUTA 1CXFA 1DJNA 4CCCA 3E2QA 5DXYA 4CN1A 3B8UA 2X05A 1R5YA 3BOLA 3T8LA 4AIBA 5LXXA 5CSYA 2KAUC 2DVXA 1V79A 1UJPA 4AD3A 5ABGA 5FJUA 1HKMA 2DY3A 1SZGA 3AHXA 3W7HA 2PTWA 3MKKA 4CEXC 2V0TA 2AKMA 3BURA 3BG5A 3H12A 4WGXA 1XCXA 2WO5A 3B4YA 5G5IA 3OLDA 3FJ4A 5J5RA 4AZ6A 1TELA 1BXNA 1UOKA 3TYEA 1F74A 5AZ1A 2W5FA 4AAJA 4KF1A 4KRZA 3B40A 1ZJBA 4HA3A 1VCFA 4JTGA 4JTTA 1MWOA 1NFGA 1E6SM 5JU6A 4EPDC 1N55A 3T09A 3MUY1 4C6IA 3WLHA 1TUXA 5C70A 2WNNA 3EOOA 1EXPA 1PJ9A 5CLWA 1E6NA 1PZ0A 4F4RA 4BF9A 4LC6A 1T40A 4XAPA 4GUHA 1JFXA 4B92A 3UCCA 1Q6RA 4MKNA 4XD5A 3EDEA 1GT8A 4GIRA 3CZ8A 3WUFA 1UD6A 4RXGA 4E4PA 4NHVA 2YYUA 4IOTA 3FKKA 4XZNX 1C92A 3NXFA 2VD8A 1TJ2A 1AJ2A 1KV8A 3NPUA 1CIUA 4XX6A 2FPVA 1HKIA 4O18A 5C2CA 3VNIA 1OX4A 3AMLA 1CENA 1RH9A 3E5PA 3LNMA 3VKCA 4A8RA 3VVGA 2J6VA 2ZZ6A 1JUBA 3VI2A 2G3IA 3ATZA 1Q85A 3TLLA 4CNSA 3SCSA 3PUGA 4BS0A 5BZAA 3QY7A 4MLRA 1M5WA 3MZ2A 4IMEA 3SQMA 3UXAA 3NSNA 1FWHC 1X8CA 3WNPA 5I6SA 1OHLA 3U2OA 2PTZA 1XLBA 1QASA 4M3PA 4NSBA 2E1DA 2PZ0A 3LA4A 1FA2A 4LUTB 2RGMA 1PL9A 3HG2A 3IJLA 1QBBA 2VQTA 3Q4DA 1AQ0A 1QO5A 1ZUAX 1QOQA 1JAKA 4RCXA 1K8XA 3W2UA 3NQEA 2R1MA 3NZPA 3W7JA 2Y88A 3FYOA 2GDQA 1K3UA 1NH6A 5LYRA 1NWTA 1BG4A 3DFTA 1XIIA 3WJZA 4W89A 2GZXA 1HVXA 4A2RA 3GXNA 3S2MA 1VHCA 3ITCA 4C1LA 3QPEA 1BLIA 4AZHA 3VE7A 4UQCA 3FLUA 1SSDA 4F2BA 2Y61A 2HPIA 1Y8BA 3ABZA 1MW0A 5IFPA 3M64A 1ONEA 2X2YA 1R9YA 1DORA 1W8SA 4RE4A 4QAIA 3RR1A 1XD0A 1RHCA 3WH8A 2X0YA 3IS4A 3SUVA 1XICA 2DEPA 4UQEA 3W07A 1B1YA 4W87A 2Z1WA 3NQBA 4AD5A 3CGTA 5A6AA 2WLZA 3NAVA 3WEZA 3BQ6A 4WDTA 3I6RA 5K3VA 1AH0A 4ZODA 2WHLA 3CB8A 2UY4A 5AHNA 3PG8A 3DYPA 2J62A 5HWMA 3VNJA 4JTIA 4AZCB 5I09A 1Q13A 3UD6A 1PCKA 1SJAA 1QPRA 4DZAA 3MCOA 1BHGA 3AZSA 1CW2A 1IXPA 4ROQA 3NCOA 3ANUA 3B97A 2QJHA 5LNUA 1TV2A 4XK2A 3D6NA 2TYSA 4C6KA 5GVJA 4YL2A 2OYMA 1AA1B 1KLYA 2FZMA 2QCEA 3VX0A 5CJMA 1WAWA 3K1GA 2BVDA 3GWQA 4F0KA 3N9KA 3OPSA 3BVJA 1G69A 1AVAA 4MHBA 4MADA 3L12A 1W3JA 4QGCA 2ONEA 1XBVA 1S1RA 1FCVA 3EKZA 1WZMA 4IMCA 4ADUA 4O16A 3QV7A 1NAL1 4HGXA 5ABTA 3U2ZA 2QCDA 3LCXA 2JF6A 3EKLA 2INEA 4BK9A 1WPCA 1DJYA 4AU0A 5HULA 1DIOA 1PIIA 3ZR6A 2RUSA 1X7FA 2WJDA 1A4LA 3ZJ6A 1W1IE 1GVYA 3NR0A 4H9UA 3UNTA 1TIMA 3W74A 3R0DA 4JTLA 2XSXA 4IZGA 4KWWA 2Y6ZA 1L9WA 3TAKA 4GQBA 4AEFA 3GXTA 2CWNA 4KCWA 3QPZA 2XIOA 1UBSA 6TAAA 2AAAA 3WSUA 1QK0A 4MYXA 1V0NA 3CV2A 2VELA 4GXMA 4GYKA 4UFIA 4V2XA 2DQXA 2HDJA 2E9BA 3MBFA 5A2AA 3NIYA 1AL7A 2TMDA 2IS7A 4WHBA 4FAMA 3UFYA 1ZJIA 2ISDA 4WZHA 2PDUA 5B80A 2DH2A 1P0DA 1E1EA 3HV9A 4WJEA 1XBXA 3KBWA 1Z3NA 4PL2A 2Q6ZA 1FBAA 2GWNA 1OCJA 3NXLA 1S5NA 1BRLB 2OWXA 5CPLA 1V3LA 5A6TC 2OSYA 4FO4A 1NDVA 4E0CA 3QYQA 2G0WA 3B4UA 4KS0A 4FNSA 4FXSA 5AC7A 2YJQA 3R7MA 3OGVA 2H9AA 3H2MA 5EMLA 4BWLC 4EANA 2POTA 1H5YA 2ZXBA 1TG7A 2YA1A 3REQA 4D72A 1EIBA 4M6QA 3W22A 1UD4A 3NQCA 3PFMA 1W2PA 3PBWA 4LAOA 4HSNA 4UR8A 1M41A 2WC3A 3IANA 3M5XA 3SAZA 3DFSA 4LOCA 3CB3A 3ARUA 2HBVA 5CAKA 3NFUA 3BANA 1K02A 2FDMA 3W1NA 4IXXA 1YE4A 4GUJA 4GVGA 3O0FA 4Y7EA 3GNDA 2CLEA 1KV5A 4DF2A 2XVLA 4GG9A 1UH3A 1P4CA 3WD0A 3C2YA 2C8NA 1PX4A 4WX2A 4DZ5A 4DRSA 4LGXA 1AW2A 4C6LA 3BLIA 2WHKA 3W1XA 2F2HA 1NF0A 3PBYA 3DG6A 1KBLA 3KBJA 4YS1A 3C3UA 3PB2A 4I90A 2Y62A 2CBJA 4TVDA 3AHVA 1RPXA 2VEGA 2WZEA 3FGCB 3QM3A 2ACUA 2FZDA 4IIBA 4ZBCA 3UZXA 1XRFA 2C71A 4ZTYA 2ZX6A 3SCVA 5CSUA 3WJWA 3TAOA 1XLEA 2ACSA 1ONXA 3UY8A 3F2BA 4KQNA 2W66A 3JRKA 2W67A 2XWDA 4NYUA 3G1YA 3I7QA 3C86A 3LCLA 3GC2A 1OFQA 3O7UA 4LUIA 1LT7A 4QTGA 3LSBA 4GC4A 1KBKA 3MDUA 3HURA 1AL8A 1PUDA 4EAMA 2PDGA 3PK7A 3TROA 4IPJA 4IMAA 2C18A 5B7YA 4R7JA 3KHDA 3DFPA 3KOXA 1GW1A 1VGAA 3VDHA 2XSBA 3G24A 4AUBA 2ZX9A 2YPIA 5GJMA 7CGTA 1B2YA 4H4IA 2GGHA 2C3ZA 3L5MA 2AQWA 2JKAA 4JGDA 4FZIA 5BWFA 4QBXA 5D33A 5DO8A 3W71A 3NJ3A 2BMBA 1BXCA 2D23A 4M51A 4JY9A 2YSWA 3HF3A 4LWWA 4MVAA 1JZ7A 3HN3A 3R8GA 1C29A 5EPDA 3V1HA 1RD5A 2VENA 5DXXA 1CNVA 3AIUA 1XGEA 3NOEA 4A3UA 5M3WA 3K4WA 4JPGA 4BF5A 4JTDA 3P5YA 1FXPA 5LNSA 4NI8A 1S2CA 3B03A 5DFAA 1VRXA 1W31A 5CH9A 3R89A 1RLDA 4OFCA 1PXGA 4TX9A 3SEPA 1YNQA 4M19A 3CZKA 3D3FA 3CZJA 1C8VA 1GKQA 1GYNA 4C5ZA 1KCKA 1S46A 4K36A 1BYDA 3O0KA 1VEPA 1K4GA 3BGJA 3VC5A 5BRBA 5HANA 2Y1HA 4UIOA 1E6ZA 2PGEA 3EA3A 4C6CA 2E7FA 3BV7A 3LCWA 2ZUSA 3A6OA 3PZGA 4AVOA 2E09A 3VD4A 3G0SA 2ZUTA 3WD2A 1C3FA 2QV4A 3GNRA 1LDCA 4GQRA 1HIZA 4JFTA 4RL3A 4UMAA 3IGXA 1DE6A 3CMGA 2GVJA 2NW0A 2VEKA 1VYPX 1B3XA 1V6YA 2VMFA 3QGAC 1H7WA 2V3FA 4R27A 3OZPA 2BY2A 3I7RA 5AY7A 3IRDA 4QE5A 4NYYA 2RJHA 3IARA 2A3LA 5AYYA 5LHFA 4GQQA 4L4PA 2DZVA 1RUSA 5AFDA 3GS6A 1CECA 3ONCA 2G3FA 2GVLA 4KFPA 1YE6A 4Z1DA 5I3FA 1Q6EA 4Q4KA 1TJPA 4F2TA 1WKEA 2DVUA 1R2TA 1RQEA 3TYDA 4DXXA 5DMYA 5GNXA 4AHOA 3ARVA 1PTDA 3ZS4A 1GQNA 3HFTA 4YWIA 2P53A 4Y9NA 4FPSA 3DKLA 4I9AA 2QDHA 1BQGA 2CEQA 3CZGA 4IPNB 4RZ5A 5I24A 1RQBA 4BWLA 1X39A 1M1BA 4KGLA 4FNQA 3JS3A 3F2DA 3MU7A 1N8FA 3L23A 3VZXA 3S83A 3GFYA 4KEVA 1QATA 2OQHA 2GPTA 2C7FA 1KR1A 1XINA 3AYSA 3N2OA 4O0ZA 1PDYA 8XIAA 1RV8A 6CGTA 4RKAA 3LGGA 3M0MA 1SZEA 1A0CA 1J18A 2UZ9A 2L5HA 2X2GA 3DGRA 3NQ2A 3MS8A 3E96A 4IX2A 4WY0F 4D1JA 5C71A 1J5SA 4MLJA 5D30A 4Q33A 4DBDA 1PIFA 1VH7A 1XGDA 3VFLA 2YBUA 2YB1A 4IGSA 4FLSA 3TA6A 3WMSA 1SSGA 3TOPA 1JPMA 5D02A 1JQXA 1M01A 1CLXA 4FIRA 3USZA 3L65A 1M65A 3QV8A 4MNJA 1XIJA 2NZLA 3OBEA 1EDGA 4Q8MA 1WXJA 2KZHA 1DJWA 1HXJA 1HJWA 2J7FA 5AHIA 2ZX7A 2HS6A 4LXFA 1THFD 2O55A 1EC7A 5CSSA 3BPWA 5D8WA 1J79A 4K39A 2P8BA 2H90A 1G7UA 5LA2A 3UXLA 3I3DA 2XGBA 2CU0A 3FSTA 3DFHA 2YXXA 2J9YA 3GSMA 4A8LA 1EPXA 1DJIA 1EXBA 1AW1A 2RHGA 3PHAA 1P6CA 3MI6A 3HPZA 3W72A 4A2SA 2WK2A 3MKCA 4M1RA 2WSYA 2ZA1A 5KZMA 2NXGA 4GO9A 2CITA 2PURA 3N2CA 3WQ6A 3OZYA 4V27A 1EWDA 4JICA 1EP2A 3BLFA 2HTMA 2E67A 4D6EA 3E9AA 3G5EA 1FH9A 2Q8XA 4NZFA 4MJZA 3QHMA 2A3AA 4B3LA 4WKHA 1LRNA 4JQ2A 3N3MA 3CHCA 4RDYA 4X60A 3QKZA 3U8GA 1A5LC 1JDAA 3KTXA 2PGRA 4IIFA 4LV9A 4AEEA 5HMFA 5HJLA 1ZPTA 2HCVA 3CHEA 4DO5A 1US3A