2BXVA

Dual binding mode of a novel series of dhodh inhibitors
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
367
structure length
360
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title Dual binding mode of a novel series of DHODH inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 133
structure length 360
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bxvA00
3O6CA 3TFCA 1OK4A 4IGHA 3HG5A 3OVQA 1VLIA 1G4EA 3HGJA 3TSBA 1RZMA 1DV7A 1VQTA 4LNYA 1TTQA 4W9TA 4P61A 2OT1A 1YDNA 2Z2UA 1KFEA 1ZJIA 1XUZA 2YCEA 4M6PA 3E12A 1W5OA 4IMEA 2LLEA 1DOSA 3HPXA 4XBSA 3N14A 2QCCA 1G67A 3N34A 4NNAA 5HNRA 3SZ8A 1W1ZA 2NXIA 1FUYA 5AHIA 1XC4A 4A21A 4M5PA 3W7LA 1P4CA 4O28A 1THFD 4I7VA 3TCEA 3LXAA 1Q6LA 4H3DA 4JTLA 4FNUA 5D32A 1DBTA 4YLWA 2NV1A 2VFDA 3M44A 1OF6A 2F7FA 1OFDA 1F05A 2JKPA 4AH7A 3L0KA 3KXQA 3DFOA 1G7VA 3S1VA 3QMTA 3G1HA 3P60A 1R2SA 1U83A 3W76A 3BGJA 3OG3A 4JIPA 3M7WA 3NVTA 3W1AA 2A7NA 1SFLA 1I45A 4GC4A 3B0VC 3G22A 4TU1A 3NPWA 1JUBA 4UNLA 5FF4A 1GOXA 1TCDA 2GPTA 1UB3A 3P7YA 4JX5A 4O10A 5DBUA 3VCRA 4HNVA 4O52A 1UJPA 1NF0A 3LB0A 1KTBA 4H6KA 3L2IA 3NPUA 2E5DA 1BKSA 3QM3A 5K2ZA 2GVLA 3GR8A 1YTEA 1FWNA 5DY2A 3BARA 1KM2A 3EKLA 4DBEA 1LBLA 1LBFA 2YYUA 4Y6GA 3KFTA 3QPZA 4JGDA 3R5EA 1O4UA 2XFWA 4UNKA 4MKNA 4N9BA 2OX1A 3N3MA 5C55A 3ANYA 1LROA 3TU9A 4UTWA 1DVJA 4TO8A 4QNWA 4DXVA 3K30A 4JYDA 4O19A 3W7CA 3AJXA 1FXPA 4O1DA 4NJGA 3QQ1A 3FEMA 3GDLA 5BOOA 1JCNA 4S2CA 1Q45A 1W5QA 1KV8A 3G24A 3HOJA 1JCMP 4JIQA 1OX4A 3LXBA 4MY1A 3A5FA 2EF9A 4N9CA 5D2XA 1H62A 2XN1A 1OVDA 4DF0A 4Y96A 3HO8A 2VFIA 4O16A 3W7RA 3W85A 2FFCA 3L9CA 3T7VA 4UFIA 3NQ7A 5LHEA 1W37A 2BXVA 1EUNA 4UTJA 5D2TA 1KTCA 1TQXA 5AHFA 2JGQA 3QMSA 1VZWA 2NLIA 3PBYA 5E0KA 2Y61A 3CIXA 3GDKA 4JYFA 5GVJA 5AHMA 4PL2A 1JRCA 5EKYA 3LRMA 1T8XA 1A50A 4HHPA 1W5MA 4AWSA 4KFPA 1VHNA 3HGSA 4RZ6A 3FKKA 3M43A 2C18A 3L65A 1KFCA 1QFEA 4DO4A 5FEPA 2NUWA 3MO7A 5CZJA 1SW3A 5E93A 1W3NA 3LCWA 2BLEA 1HUVA 2ZRVA 5CPMA 3QF0A 4O12A 1XUUA 3M47A 3TQKA 3PB0A 1B9BA 3W72A 2PRLA 2ZZ3A 1B3OA 4L4LA 1UASA 4WD0A 3TDFA 1IXPA 4NZJA 1S3HA 2ZZ6A 1BTMA 1H51A 3DENA 4MFEA 1QO5A 3STGA 4FB7A 4IUOA 2QUTA 3GZ3A 1QOQA 4GUHA 1XI3A 3DKJA 5AC6A 2O7QA 1RR2A 5EMUA 2HS8A 3E96A 4AB4A 4AF0A 4RKAA 3O8AA 1VCGA 3HBLA 1PCWA 3N73A 1F73A 3ZR4A 2RKXA 1VRDA 4DF2A 5HR6A 5LGXA 2J9ZA 3IGUA 2V81A 3QYQA 4I7UA 3OVPA 1FDZA 4WXYA 1N7KA 4ZQMA 4QSHA 4QAIA 3BG3A 1Q6RA 4UFMA 1QAPA 4RCXA 1ME9A 4K8HA 3NA8A 3NL5A 3TJXA 4KWWA 4ICNA 3CPRA 4D2JA 3O63A 2Y62A 3MUXA 2JKEA 4YL2A 1OFBA 4ADTA 5T26A 1O94A 2A21A 2ALDA 3SW6A 5FF0A 2DZWA 2GJLA 1RQHA 1TV5A 1XL9A 4JTTA 1TQJA 5U4NA 3UPWA 3R13A 4LT9A 5AYZA 1T0OA 2DZUA 1MSSA 4O8RA 3S5ZA 3LCIA 3MHGA 2Y89A 3GK0A 4FNRA 1BWKA 4K8EA 1GVSA 1X8FA 2A7RA 3NNTA 1YDOA 3KRUA 3VNDA 2VKZG 4IMFA 1X1OA 3PC0A 3UXDA 2R8WA 4XBKA 4FNQA 2WO5A 3B04A 2V2HA 4N02A 4XZ9A 4JXCA 3FS2A 4ADSA 2TYSA 1WAUA 1M7OA 2Q3OA 4ALDA 1GPWA 4AHOA 1XBYA 3LCXA 5TBOA 2VEMA 1RPXA 2YFNA 1LRNA 5D33A 3SR7A 4EOUA 4M6VA 4O1CA 4NXSA 2E68A 3M5XA 3TXVA 4DO6A 5KZMA 3SGZA 5A8GA 4CCDA 3OIXA 3S5OA 4A22A 4N2YA 1SZGA 2HS6A 3BK0A 3NAVA 2GUUA 2KZHA 4FO4A 3M41A 4OGZA 4Q32A 3H53A 1Z42A 2YX0A 3MHUA 3UZ5A 3FIGA 5EY5A 3LRLA 1GG0A 2NX1A 2ATMA 5HMSA 4GRSA 1GVQA 1VYPX 3DFPA 4O1BA 2C0AA 1VYRA 3V75A 5KMYA 1YYAA 2ZZ1A 2FB2A 3LTYA 4PH6A 3M9YA 1AG1O 4O57A 4NX5A 1QPRA 5BMXA 1IXQA 3O6YX 3W2LA 3A5VA 1EWEA 3ABOA 2E6FA 3IRDA 3WJXA 3TC7A 1ONRA 3W7GA 1OFEA 2YDAA 3ABSA 1H7XA 2AAMA 3FOKA 3VE7A 3EWYA 2GQ9A 4ZVJA 5MHBA 3LI1A 3L5AA 3LCLA 3TFXA 3SY5A 3W2UA 5HINA 4OV9A 2DJLA 5CG7A 1Q3NA 1ICPA 2BX7A 2E6AA 2Y85A 3B03A 3SI9A 5F4WA 2NWRA 3LHWA 3W7JA 3A24A 2ZZ7A 2EGZA 4DF1A 4EF8A 2CZDA 2OJPA 4GFSA 2FTPA 3E02A 3LHTA 2XN0A 3RU6A 3M5ZA 2VFEA 3MJYA 1DKWA 1TSIA 2YR1A 4UTWC 4JTEA 4QJ1A 5AB3A 3NQMA 3P61A 5TQLA 4JX6A 5G5IA 2VENA 2E09A 5AOUA 2J9YA 2H90A 4AWUA 4N6FA 5CSSA 3GXTA 3BW2A 3S9YA 3KRZA 2ZRUA 3W23A 1SZNA 1SR9A 2QCDB 3LERA 4DBDA 1JRBA 2B7PA 2FB3A 3DFNA 3W7MA 5AHEA 1TJPA 4NX0A 1W5NA 3TV8A 3LV6A 1JCYA 1Z41A 3BVJA 4WOQA 1JR1A 5E1QA 1OHLA 1U5JA 1ZY9A 3HQ1A 4MPQA 2QCMA 4ORMA 3G1YA 1LP6A 4UMCA 4UCGA 1PV8A 3QEZA 4MZ1A 4UFHA 3N2MA 1OFAA 4OU1A 2ZQ0A 4BF9A 3KVMA 1R2TA 5I3GA 1EP1A 3LXCA 3DHFA 3B0PA 5D2VA 1G69A 3HG4A 2EKCA 4OHQA 4QQ3A 2PRMA 1W3TA 5AC8A 1DQWA 1PE1A 3LCFA 5I3IA 2VFGA 2DJXA 3W2JA 2RH9A 2R94A 3KOFA 1WDWA 4FXSA 1F5ZA 1VCVA 2AGKA 2BTMA 3QW3A 3W1QA 3IVTA 3S1XA 2CLEA 3E9AA 2PE4A 3G1FA 4JICA 1OG0A 1LLWA 4NVTA 2CLLA 4MOZA 4X22A 1K8ZA 4WY0B 2X16A 2CU0A 1PS9A 3WJZA 1QNVA 3PSVA 1AW2A 3TIMA 1NSJA 2OMAA 1E51A 2C6QA 2CW6A 3DKLA 1JCLA 2X1RA 4PC8A 1DJQA 1A5CA 3QSRA 2Q8LA 5F4XA 3LBMA 1TPUA 5DBTA 3WJWA 4GJ1A 1C8VA 4QNEA 4GBUA 1GYLA 3DXIA 1XKYA 3MP5A 3NOEA 6TIMA 1TPFA 5D02A 1SO4A 2E1DA 4YCPA 3LTPA 1TTIA 3L5MA 3F4WA 2ZRYA 1S5WA 5I3KA 1TPB1 4FHAA 3GR7A 3L0GA 3RF9A 4NJKA 4M6QA 5AYXA 5BRBA 3LBCA 1WOAA 2V82A 3DU0A 3FKRA 3BW3A 2X30A 3DFTA 3IIOA 1PCKA 2QCLA 3WK3A 4AVFA 5G4EA 3GXNA 3IV3A 4UTLA 1JVNA 4O15A 4UC5A 3L0NA 4JTKA 1NVMA 1KBJA 2YZRA 3NGJA 1K3UA 1NAL1 4WX2A 1HO1A 3CWNA 3I7SA 4YCOA 3PBUA 3UQNA 1ME7A 5F1VA 2FPVA 2PURA 1TRIA 3AO0A 3LI0A 1EP3A 5LHFA 4RR4A 3O07A 2B7OA 2EAWA 4JTUA 4RZ4A 1KV5A 3W7EA 2WSYA 1TMHA 1KBIA 2A5HA 1V5XA 3P80A 5G2WA 3ZWSA 4DELA 2E5BA 3RFAA 1TJRA 4FNSA 1M7PA 2W6RA 4IQLA 1H60A 3W75A 5SWUA 5K4ZA 2X2GA 1TIMA 1Q6OA 4MY9A 2V5BA 4NQ1A 1SPQA 1YPFA 3I7QA 3G3MA 5CZ0A 1KFBA 4Z1DA 2CLMA 4MZYA 1AL7A 5LNVA 4LVBA 1WV2A 1TV7A 3KVJA 5LGZA 3VFLA 4GUFA 3F03K 3UWWA 3NL3A 3QRHA 3NQVA 1PHWA 3C2EA 1TV8A 2VEKA 3WK0A 2CZ5A 4O54A 5KTLA 3UWZA 3CTLA 3NQGA 3IVUA 5CGQA 4O1AA 5KINA 1FQ0A 1TTJA 5DCBA 3NQFA 3E0IA 3NG3A 3GNDA 3EX1A 1TO3A 4IWWA 2I1OA 1IF2A 4NNBA 4QITA 3EXTA 3S6DA 1G4SA 3G1DA 1RVGA 1ZAJA 3CEPA 5C6MA 1ZAIA 1H5YA 3CU2A 4CCCA 5LNSA 3IIZA 3L21A 3BPWA 1JULA 4IJBA 1P5BA 4MZ8A 3S1UA 3DH7A 2ZBTA 1VS1A 3LLFA 3R8RA 5EBUA 3T78A 4ZQRA 1V7YA 1WBHA 3MP4A 4WOZA 5HWJA 3CM4A 3MYPA 2G97A 2QDHA 4CQ9A 4IX2A 5EPDA 3NQ2A 3W1UA 3BLFA 2OT0A 3FJLA 3G0UA 4Q4KA 2CZFA 3T55A 3IGXA 3PS7A 2ZZ5A 1G7UA 2Y7FA 4PCFA 1JCJA 5D2WA 2FPYA 2ZA3A 1SZFA 4HN4A 4QIUA 1C9DA 2WSRA 1WX0A 3SSJA 1W54A 4C1KA 1Q6QA 1FCBA 2Q8ZA 1LRQA 2J88A 1FDJA 1LOLA 5HULA 4Z1CA 3LHUA 4MY8A 1I2NA 1VJIA 3MWAA 3M6YA 3GYEA 1AL8A 3JR2A 2ATSA 2QF7A 1X7FA 5K7JA 4O4VA 3N9RA 1ME8A 4KFOA 1KM1A 1XCFA 4PL1A 4Z0JA 3C3NA 4RXGA 1YXDA 3MP3A 1EUAA 3TMQA 1GVRA 4Y9AA 3S0CA 4J9JA 3UD6A 3C61A 3HGOA 1LTDA 4NJIA 3O1NA 3WJYA 1YXYA 1Z44A 2CLKA 2DU2A 3M0ZA 1OABA 1RD5A 5BMWA 3RLUA 2A7PA 4MYXA 1QPQA 4A29A 3E49A 2WPBA 1KM3A 4JX4A 3UWQA 2ZDRA 4O13A 7TIMA 1DHPA 4GUJA 4MYAA 1F74A 3PM6A 4MFDA 2YXGA 5HWNA 5DCEA 4AWTA 2H8XA 2ISVA 3GX9A 3OVRA 4DPPA 5F1UA 3R2GA 3HMJG 1VCFA 1Y0EA 2GOUA 3UNDA 3PBVA 3UWUA 2E5CA 5L6UA 5C2XA 2QUVA 1TPH1 1M6JA 1QDSA 3EX3A 4K38A 1TPEA 1LOQA 4JYEA 4JTSA 5KZEA 3H55A 1TPDA 2C15A 2I14A 2WOQA 4LWWA 3QQ0A 3C2RA 3MI2A 3HIJA 1EX5A 3TSDA 3A22A 1A5BA 3QSTA 3EWZA 3UZJA 1K8XA 2X1SA 1LBMA 3S1WA 1LOSA 4LW7A 2ZCGA 3O05A 1F6KA 5CSRA 1G4PA 1OFRA 3GXPA 5C5YA 2ABBA 1EIXA 4TR9A 1SO3A 2FQIA 1UUMA 3T4CA 2GQAA 5CZSA 1LDCA 4UTHA 4POCA 3GDRA 3B8DA 3QZEA 2QKFA 4LC8A 3DHDA 1OX6A 4PFMA 4CQ8A 1MO0A 2R91A 3BLIA 5IBXA 3DZ1A 3FJ6A 3G1SA 2D73A 5EYWA 1OF8A 1R2RA 3F4NA 3BO9A 3TA6A 3CT7A 1F2JA 3NZ1A 1GYNA 2C14A 1OX4B 1B57A 3DAQA 4Z08A 3STFA 1TB3A 2FLIA 2WKJA 3USBA 1WYIA 5K9XA 3TW6A 3G0SA 3PVFA 3KVLA 3ZS4A 2P0OA 1B4KA 1HFBA 3PUOA 5D09A 4JTJA 1KTNA 1G6CA 1S5VA 2DZSA 1VC4A 2CWNA 3EKZA 2A1YA 5HUPA 3W7IA 4E0CA 3P82A 3C52A 4Y8FA 3VE9A 2VC6A 4TMCA 4LU0A 1EB3A 5EL1A 4BFAA 3P81A 1XM3A 2CLOA 2ZA2A 4HNUA 4JTFA 3G8RA 2Y63A 4PTNA 1ALDA 4FF7A 3NQEA 5LZLA 2QCDA 1QWGA 4B5NA 3TJLA 1GTHA 3PUDA 3TROA 4GUIA 3OHIA 1GZGA 3PAJA 1OK6A 5F2IA 2GJNA 4EVZA 4XTIA 2VEIA 4RLIA 3P8JA 5BNKA 4GXMA 2DZPA 4WXZA 4LOCA 5LNRA 4UTMA 4RX0A 4BWLC 4LRTA 3CC1A 3SIZA 4OWGA 1CX9A 3UWVA 1UUOA 3BW4A 2WSQA 3MBFA 1X6UA 3EWWA 4IMCA 3PG9A 4QM1A 1IXNA 3P5YA 3S8HA 2A0NA 2ZA1A 4MVAA 1XDMA 2J24A 3FFSA 4N4QA 4X9SA 4LC6A 1LCOA 2RHGA 2ZTKA 3QMRA 2A4AA 3NL6A 2E6YA 4LUIA 4O17A 2YPIA 3A9IA 1KM4A 3IIPA 4ZL1A 4FNTA 4L4MA 5KZDA 1DJNA 4AMAA 3WJSA 3P84A 2R14A 2TMDA 3F1QA 1EEPA 3L5LA 1W8SA 1GVOA 1ZFJA 3GLCA 3P62A 1H50A 3G18A 3CLMA 1YADA 5DN1A 3UXAA 1PVNA 5DXYA 1H7WA 3SJ3A 4XUGA 3OA3A 5CPOA 2QDGA 1BWLA 1FXQA 2NXHA 3C0JA 4MIMA 1XBZA 4AXKA 3GKAA 4YMZA 2NWSA 3PWAA 3CHVA 2EPHA 3EWUA 2DP3A 2BSLA 1OYBA 1RV8A 1ICSA 2Z6JA 3DGRA 2QCEA 2A85A 3EB2A 1O60A 2NXGA 2JKAA 3W7DA 3LRKA 1YDVA 3PG8A 4JY9A 1LM1A 5DLCA 2QJHA 4ZQOA 4UFLA 2ISSA 1R46A 3LOTA 1SU5A 4TMBA 2ABAA 2V5LA 3UY8A 5L9FA 3EX2A 4K6AA 2E77A 1JCXA 2QCFA 4E2DA 2ZYFA 1XFBA 4HPJA 5LNUA 4PA8A 3W1RA 3W1MA 4ZZ9A 1IIHA 4UTKA 3W73A 2QUUA 1ZHAA 1UCWA 1D9EA 1K7XA 4RZ5A 4LV4A 5D30A 3H54A 4G1KA 3D0CA 4ZMGA 1BEUA 3IGSA 2NX3A 2ZRXA 1S5TA 4WY0F 2G95A 4Z1AA 1I2QA 3DI1A 2Y7EA 4EF9A 4BI5A 3W1NA 3A23A 3EWXA 3U6WA 3INPA 1H7NA 2V30A 2A2IA 3W07A 2TSYA 1FWSA 3KX6A 3RLVA 4FIQA 4CNNA 3RNDA 1VH7A 2A6LA 3ABRA 2IQTA 3NM1A 2HSAA 4P2VA 4MLRA 3I65A 4C1LA 1SO6A 5H91A 2Z6IA 1GG1A 3O15A 1G4TA 4S1FA 3STEA 1VYSX 4DPQA 4NT0A 3LX9A 2NV2A 3PUEA 2QCNA 1DQXA 3W7KA 5HQEA 4BI6A 1YTDA 4Q33A 3PSWA 2DORA 1KFLA 4TIMA 1H63A 2G96A 3A21A 2WJZA 4NNCA 1ML1A 3VKJA 3T40A 1F76A 1SW7A 1KM5A 4JNMA 4A2RA 4IXXA 1F6PA 3UY7A 3W1TA 1AMKA 3GNNA 1K7FA 2WQPA 3C6CA 3NPVA 3W7OA 3R89A 1VGAA 5AYYA 4RK8A 1I2PA 5F2LA 4UTUA 3TUUA 5LSMA 3TH6A 2QAPA 1ZNNA 3NEVA 4JEQA 3CQ0A 3QC3A 4EIVA 1I8JA 1WXJA 1ZENA 5FEWA 3M5VA 3NQ8A 3LHZA 3LHVA 2TRSA 1JUKA 2Y88A 1XBXA 4NJJA 4I7WA 4M19A 5FESA 1EPXA 3UPBA 2H3DA 4HKPA 4OT7A 4A3UA 5DCDA 4XKYB 4UFJA 1MZHA 2V2CA 3LM7A 4QISA 2Z0IA 3IIXA 4CNOA 2FDSA 1MEHA 3N9SA 1UBSA 2V0TA 3JS3A 3P8IA 4OQVA 4GUGA 3B06A 3QFEA 3HJZA 2W0UA 1MXSA 1HO4A 4JS3A 2PC4A 1OFQA 2B7NA 3NM3A 3TE9A 2VOMA 3THAA 3NQCA 5IBXC 2DZTA 4BK9A 5K4XA 1O95A 4JD4A 3MYOA 1I2RA 3G1AA 1GWJA 4BWLA 1X1ZA 3W70A 3GDTA 4OBTA 3WK2A 3TSMA 3SFKA 4LY8A 1I2OA 5D2YA 5HUOA 1LZOA 2ZRZA 3LTSA 1FWTA 3EX4A 4IX0A 2WNNA 1QO2A 4YWIA 4K36A 2JGYA 2XN2A 1L6WA 1D3GA 1PIIA 2J9XA 4ORIA 2CZEA 3KRSA 1H7PA 1PHQA 1H61A 4UMAA 5FF7A 4LVGA 1GTEA 1O5KA 2V8ZA 5FF3A 1SW0A 1IXOA 4OE7A 4LS1A 1HTIA 3P5ZA 3Q37A 2BZNA 1QCWA 3ELFA 3OEXA 4I9AA 4XWUA 5J5RA 5A5WA 2QR6A 2VFHA 3FYPA 3G1VA 3T44A 4CQAA 1YPIA 3GKFA 2RFGA 5KITA 2CLHA 1LYXA 1KA9F 5D37A 4ZQNA 4UUIA 2YSWA 3GAYA 3EXSA 3EWBX 5KSWA 1HL2A 5ABTA 5IM51 5EA9A 1I4NA 4ZQCA 4XTDA 1RQEA 4N4PA 4HPXA 1FCUA 4YXGA 3W7PA 4KWVA 4HSOA 1JQXA 4R34A 5K3VA 2VXNA 5AFDA 5HJLA 3C4UA 3PY2A 3WK1A 1SSGA 3TKFA 1T99A 1NFBA 3L66A 1QPOA 2FJKA 1TPWA 2BWGA 3TK7A 1FY6A 4ZQPA 1P0NA 3NZRA 3TAKA 5J5DA 1F7BA 4R53A 4LVFA 3NXFA 3CIWA 1P1XA 5U7SA 3O06A 1SSDA 5LKYA 1H7RA 2NZLA 2H6RA 3C56A 2VFFA 1LLZA 3TQ0A 2CLFA 2C19A 3CB8A 2Y70A 3QW4B 1YLVA 2QJIA 2Z1BA 3ATZA 5F2MA 2B0MA 3BGGA 1WA3A 1KW1A 2GVJA 3M5YA 2DZXA 5FF2A 3DFQA 1SZEA 3QPYA 4BI7A 1JQVA 2C3ZA 2RDUA 1OFPA 1QPNA 3G3DA 3TMLA 1TPVA 3EXRA 4LUJA 3PF3A 4FX8A 4IMGA 4K39A 3V1PA 2QEZA 3C2FA 4HIBA 2PRHA 3W1XA 3W87A 2WNZA 4WZHA 1XXXA 4A2SA 1TYGA 1JUEA 2GQ8A 1AK5A 3DFSA 2O7SA 4KKXA 1Z48A 4MJZA 3LCHA 3I6RA 3KVKA 2V2DA 1A53A 3PULA 4Y90A 1D3HA 3B4UA 4NZFA 1RQBA 5D05A 3W74A 3N19B 2I9EA 4FEZA 4M7TA 5F2GA 4S2BA 1TREA 3S5YA 4H4IA 4GWEA 5I3JA 1H7OA 4MJMA 5FEZA 4M7SA 4UR7A 3O16A 4CCEA 4FX7A 5G1TA 4O18A 1L6YA 5AHNA 3THQA 1CW2A 2EHHA 5C54A 2C16A 1W5PA 2QAFA 1K8YA 4IPIA 3MBDA 2B7QA 1J2WA 1L9WA 4ADUA 5CKSA 1VPXA 1J5TA 4HNNA 2YW4A 1H1YA 1ZALA 3MI6A 2DZVA 5HR7A 1CI1A 2YW3A 1QMLA 1L6SA 2FPTA 4MUZA 2ZRWA 1AW5A 1DORA 3HPSA 2Y6ZA 3RMJA 4U28A 4DQWA 3LDVA 4RV8A 3TQVA 4PODA 3ABQA 3EX6A 1T96A 1WBJA 1SFJA 1KFJA 3KHJA 1ZCOA 3RK8A 1GT8A 2TPSA 1ZAHA 2NUXA 2AQWA 1MEIA 4UIOA 1ICQA 1NEYA 3W1LA 1J4EA 3LLDA 3B05A 1B4EA 1XDLA 1M5WA 4TX9A 1VLWA 1N55A 3W84A 3KAOA 5H2ZA 2VELA 2J6XA 2X1TA 2YYTA 4UTTC 5AC7A 2P1FA 3SGUA 4O0KA 1P0KA 1VHCA 4LV9A 4AHPA 3IIVA 3W9ZA 4CLMA 2WV8A 2B4GA 3TW7A 2Q3RA 2G5WA 3N2XA 2V9DA 4OV4A 4JDBA 4UMBA 3TC6A 3FYOA 3HB9A 4HNTA 1K7EA 3WFAA 1EA0A 3HG2A 1WOBA 3QH2A 4O0ZA 3R12A 3GIYA 2HTMA 3TR2A 3C2OA 3NQ6A 4ML9A 2YGYA 1TTPA 3Q2DA 1W31A 1H1ZA 4K7YA 4NJHA 1DL3A 3IVSA 3G1XA 5K9CA 4XQ6A 4O4WA 3NO5A 1L2UA 1GEQA 2ZFAA 5DXXA 5K9DA 3I7RA 4FX6M 2C1HA 2QCHA 1FWRA 3PB2A 1AW1A 3FLUA 3L68A 5AHLA 1FX6A 4LTSA 1LORA 1TRDA 2GVGA 4JTGA 1GJPA 2CLIA 4X3ZA 3TX9A 4O53A 1EP2A 3O6DA 1YXCA 1YTKA 4DO5A 4R7JA 1OYAA 4JDYA 1QR7A 1FCQA 1PL9A 4UR8A 2JK2A 2J27A 4HT3A 4WUIA 2CFFA 3QJAA 4LVAA 3MI3A 2VEPA 4LRSA 5F4SA 4GNJA 5LNWA 3PBWA 4AF0B 1C29A 3W7QA 1W3IA 3I68A 3IEBA 1R47A 3ATYA 3OBKA 4PEKA 3LCGA 1SO5A 4WY0A 1XBVA 3EEGA 4JR5A 4NU7A 3W2MA 3CWOX 5G1YA 4MLJA 1O5XA 3S42A 1SQ7A 4HSNA 3TNOA 3MMTA 2HMCA 4LS0A 3NPXA 4K7VA 4Z1BA 4WQ6A 5G2HA 3UYCA 5HWMA 2W79A 4JTHA 1IGSA 5I3FA 3MHFA 1K03A 1WQ5A 2C13A 1OX5A 5D03A 4CNPA 4RJEA 1MEWA 1ADOA 4IOTA 3YPIA 3STCA 2X1UA 4NUWA 4UXDA 3W1PA 3HG3A 5DELA 3M1ZA 4Z0SA 4GE8A 6ALDA 2OZ0A 2P10A 3TAOA 1FWWA 3BLEA 4IMDA 3U8GA 3BG5A 3TXZA 3G0XA 1IIGA 4XKYA 4X2RA 1A5AA 3GAKA 1KFKA 3HF3A 3NYZA 2QCGA 4FNPA 5D04C 8TIMA 1LRTA 2FIQA 1KM0A 4FXRA 1TPC1 3L67A 3W7HA 2RDWA 2ZZ4A 3UWYA 4FIRA 3GB6A 3HPZA 5I3HA 2A6NA 4O50A 1NF7A 1QOPA 2YFOA 3W88A 5CPNA 3W86A 2F84A 4UTIA 4KFNA 3DI0A 3BG9A 3HGRA 4AHQA 2OCZA 3W2KA 1GVFA 2Y7GA 4E2BA 3NQAA 3M16A 3DBPA 4JY8A 4DEFA 4LVDA 1OYCA 4N9EA 1OFOA 3C2VA 3W3OA 1R30A 3NDOA 3P67A 3Q94A 2ZTJA 3NL2A 5CPLA 3W6YA 3SECA 3ZWTA 4WJEA 4IXHA 3LHYA 2RDTA 1W0MA 3W7NA 3GDMA 4RXFA 2UV8G 5AN7A 2NUYA 1A5SA 3W71A 4IPJA 2Y7DA 3LGEA 3CEUA 5G4WA 3NR0A 3W22A 2JBMA 1SUXA 3P74A 3MW7A 1KLYA 2PCQA 4JTIA 3NQDA 1HG3A 1OJXA 5DY3A 4NXKA 5G2IA 3U2OA 3Q58A 3VI2A 2QJGA 3W83A 4EWND 4O11A 3ZFHA 3LV5A 4JN6A 4UTTA 2ISWA 4R33A 1K02A 4UFKA 4K37A 2H8ZA 1GQNA 5BW6A 2ZZ2A 5TIMA 3JRKA 1JJKA 3S5NA 3BV4A 4N6EA 1KM6A 5FI8A 5FEXA 2E6DA 5D38A 1FDYA 3FA5A 1EWDA 1W56A 1KLZA 3GVGA 3C8FA 1FCVA 4N9DA 4LS2A 3B0UX 2H3BA 3W2NA 4U4MA 2NX9A 3PR2A 5CZTA 4AAJA 4O14A 4BR1A 4E38A 4AEOA 3G8EA 4ONVA 1VR6A 1FBAA 1N8FA 2WNQA
chains in the Genus database with same CATH superfamily
4ZEPA 1CXEA 3TFCA 1OK4A 3VOGA 1VLIA 3TSBA 3WMSA 3TZFA 1FHUA 1TTQA 3NUKA 1SJCA 1BGAA 2OQHA 4P61A 3CQIA 1YDNA 5HJXA 3TN3A 2VT0A 1QTWA 1ZU8A 1XUZA 4QEEA 4M6PA 3E12A 1W5OA 1EBHA 1EC9A 1CGYA 2VRJA 5XINA 1BXBA 3BAJA 4JKKA 2WVTA 3UXLA 3T9PA 2QCCA 1G67A 3ANUA 4J3WA 4NNAA 2X2YA 5HNRA 3SZ8A 2ICSA 2NXIA 3KBMA 2W9MA 1Z7AA 4M5PA 4NZ3A 1S2CA 3TCEA 3LXAA 1Q6LA 3CH0A 4FNUA 5TD4A 5D32A 3KP0A 1KBBA 1F3XA 4YLWA 2NV1A 1V08A 3LGDA 3AOFA 2OOFA 1J0KA 2JKPA 3GH4A 4GCAA 3OW1A 1G7VA 5FIPA 1SYTA 4PUMA 3BL3A 1FH9A 3TEVA 3WNKA 1AUSL 1CPUA 2JE8A 3H2CA 3WL1A 3BGJA 3OG3A 2WHMA 3NVTA 3CQKA 2A7NA 3TCSA 1VIZA 1DJZA 3B0VC 3G22A 4TU1A 5M1TA 5A8NA 1JUBA 2BMBA 5FF4A 3VX0A 3BV7A 1GOXA 3BSGA 4TOQA 3VM7A 3GM8A 4JX5A 4AIOA 3DG7A 2EG8A 2XUCA 3AQUA 2PFHA 1JYNA 2E5DA 3HPFA 3GR8A 1YTEA 5HAOA 4DJDD 3VZZA 3OODA 3UA4A 4GJIA 3N13A 3KFTA 3QPZA 1GPFA 1K77A 1YW1A 4S39A 4MKNA 1OC7A 3WELA 4UTWA 4GIYA 2YCIX 3OHMB 1DVJA 4TO8A 1HGYA 2OVLA 3GFXA 2YL9A 3W26A 2PWVA 2X7VA 1JCNA 4S2CA 1W5QA 1KV8A 3G24A 3HOJA 1JCMP 3AYRA 4JIQA 2NW0A 1OX4A 3LXBA 2A79A 2VNCA 3QGKC 3D3FA 1OVDA 4K1WA 3HO8A 1DJGA 3W7RA 3W85A 3I6TA 3L9CA 4UFIA 3B8IA 1VJSA 1HT6A 3N04A 1KTCA 4DJFC 1UQYA 5AHFA 1UMLA 2NLIA 3BZGA 5EMMA 2Y61A 3GDKA 4GG9A 4JYFA 4LALA 4PL2A 1JRCA 2QDEA 3WF2A 4HHPA 1LWJA 1R6WA 4M0XA 4HCHA 4RZ6A 2GVEA 3L65A 1KFCA 4PBFA 4W7UA 1NP0A 5CZJA 5E93A 2CCRA 3CL6A 3L4VA 5CPMA 2XTKA 1EDQA 1XUUA 4OOZA 3PB0A 1ZS2A 2O9PA 1JDEA 3T2OA 2CNCA 1XGEA 3WLMA 4WKHA 4I9MA 2JALA 5D8WA 4GYKA 1CEOA 3GUWA 4QJ5B 2QUTA 4LSBA 3U48A 1P0DA 1RAKA 2IPFA 1IGWA 5XIAA 3CHEA 3E96A 5IFTA 4RKAA 3CS2A 3O8AA 3QXBA 3ITGA 3T0AA 4C5ZA 2XDFA 2YB1A 4ENLA 2PDHA 5HR6A 2R1KA 2X05A 3QYQA 4I7UA 2PBGA 3VKDA 4CU6A 1Q6FA 3ZVIA 1N7KA 4ZQMA 4QSHA 4ILSA 4BQ5A 4QAIA 4QLLA 1Q6RA 1QAPA 4H6RA 3NL5A 5HATA 5H8MA 5FSEC 3DN5A 2BP1A 2QS8A 3PFRA 1B5TA 2QGYA 3VIIA 4EANA 1PYMA 1R7AA 2A21A 2ALDA 1XRTA 4H04A 2W62A 1TV5A 4JTTA 1KNWA 2DPEA 3R13A 1T0OA 3AIUA 1MSSA 1BYCA 4QJ3B 4O8RA 4ZENA 4HU0A 4AC7C 4C6BA 1YDOA 4DUWA 1LL7A 3KRUA 2DT3A 3UXDA 4RNHA 2Z1SA 4EX4A 2WO5A 4W8LA 3UG4A 2AQVA 2VDGA 3KM8A 3PWIA 2CKSA 3S2JA 2YDSA 2Z28A 5A1AA 1XWYA 4ADSA 4S3AA 4LJ3A 1XIFA 3VNJA 5I7GA 3W53A 4ALDA 4ATDA 2ZE0A 5FJJA 3LMZA 3SQSA 3DUGA 2E9LA 4HOXA 4M6VA 4AMCA 4NXSA 2E68A 5KZMA 5CBBA 2TODA 2UY2A 3AALA 1KKRA 1LG2A 2CBJA 7CGTA 3HURA 1SZGA 2HXUA 5FJTA 4UQDA 5RUBA 2X41A 3WZ0E 1FWGC 1ZQ5A 2HK1A 3A64A 4L1XA 4YIWA 3KS6A 4H9XA 1ZB5A 1HKJA 1BG9A 5KMYA 1YYAA 1TV3A 2ZZ1A 2FB2A 1W91A 1O1HA 1OGGA 2CERA 4EPEC 1AG1O 1QPRA 1AODA 1IXQA 3O2LA 1RA5A 3OZMA 2BHUA 3R79A 5DFAA 4KF1A 3R1ZA 5G4HC 1XCXA 3MC5A 3SSZA 3L4XA 1GGOA 1H7XA 1Q7ZA 4U33A 4EXAA 3VE7A 2VWTA 3IJ8A 1CYGA 3FGCA 3V5FA 1ISVA 3W02A 3WL0A 3LCLA 3SY5A 5HINA 3UZXA 4L4PA 2WMHA 1DJIA 2ACQA 3GE7A 3LHWA 3W7JA 3LN3A 3A24A 2EGZA 2HE5A 4A05A 3E02A 4RL3A 1SMDA 2EEXA 3WLOA 3MJYA 3A47A 2XG9A 3NQMA 2VENA 1AJ0A 1J10A 2VVNA 5DF0A 2E28A 4HB7A 1OWQA 1E9IA 3GH7A 4YTTA 1SZNA 4HSHA 4V28A 4X9YA 4ZSUA 4DBDA 1JRBA 3SCOA 2R1LA 1O1ZA 3AHZA 3DFNA 3WG6A 2DSVA 3WLJA 4KGLA 4QG6A 5E1QA 4DWSC 1OHLA 3DECA 3HQ1A 2QCMA 3QTPA 1LP6A 1GZJA 2QF8A 4KERA 4E3VA 2AL1A 1W3KA 5LIKX 4BF9A 3KVMA 2ZE3A 1EP1A 1ITXA 3LXCA 3NJ3A 5D2VA 3VX1A 5HPCA 4AIUA 4OHQA 2HXTA 3NWRA 5I3IA 2VFGA 2DJXA 5JUVA 1JGIA 1Z69A 3A6OA 4FXSA 5GNZA 2BTMA 2XVNA 4H9VA 5DANA 1OQFA 1V6TA 4YPJA 1UKPA 1VENA 3WEOA 2BY1A 2GL5A 4WY0B 1PS9A 1AW2A 1M9HA 1M04A 2CW6A 2WVUA 4PC8A 2ANUA 4PTMA 1XRVA 4TXEA 3M0YA 4XZHA 3A12A 4QNEA 2VRQA 3DXIA 2GGEA 2QXWA 1TPFA 5D02A 1SO4A 1BVNP 3A13A 1CLXA 3LTPA 1Z32X 3F4WA 3L5MA 1PX8A 2ZRYA 3TYBA 3BQ6A 4ZB5A 5BXSA 5LIXX 1XYLA 3FW6A 3LBCA 2J7GA 1CIUA 2V82A 1ZJHA 1JF6A 3BW3A 3FKRA 2X30A 2IXVA 3DFTA 3IIOA 1NY1A 1PCKA 3WK3A 2BGSA 2WSPA 3L4TA 4HU3A 4UTLA 1WZAA 1AD1A 2YZRA 4XAZA 4W4QA 1PDYA 1EYWA 4WX2A 2BB0A 2BV9A 3CWNA 2QJNA 3I7SA 2XSXA 3BAIA 1ME7A 2XSBA 2J8GA 4Q8VA 4A4AA 2PWFA 4JTDA 3MVIA 1YMYA 2V67A 5LHFA 4RR4A 5A2BA 5DEZA 4F0RA 1SJBA 3CZLA 1TMHA 3AU2A 3ZWSA 3A3WA 5AYIA 3RFAA 3IJ6A 1H60A 4A6GA 5XIMA 2JEPA 2X2GA 4GPNA 1FP9A 4S3KA 3ORWA 4D8AA 2V5BA 1DXIA 4NQ1A 3I7QA 2XPKA 3CUXA 3WLNA 5CZ0A 4XG1A 4Z1DA 1R5YA 4RW3A 4LVBA 3V0SA 1CGUA 4JBRA 1WV2A 3NCOA 4JTRA 1MUCA 3VFLA 2WSKA 3UWWA 4ZSTA 1F4HA 1M1BA 3DBNA 4Q6XA 2WQDA 3UZZA 1PHWA 4B15A 1UP3A 4FI4A 5KTLA 3CTLA 2OSXA 3VNMA 2PTDA 2PGEA 3BSMA 1CXLA 3NQFA 2G4FA 3KCLA 4GNVA 4PUJA 1IF2A 1QHOA 4QITA 3S6DA 3CPUA 2HROA 1PAMA 4CCCA 3IIZA 3L21A 3BPWA 1JULA 3B97A 4ASTA 2DSZA 1RBOB 2YDQA 4NI3A 1FVPA 3LLFA 3R0KA 5H8PA 1GOQA 1V7YA 4ZQRA 1WBHA 4WOZA 4AIBA 4C6QA 5HWJA 3RILA 1GOOA 3L2MA 4MB4A 3G0UA 4Q4KA 3MU7A 3T55A 3PS7A 3I4EA 1JCJA 5D2WA 2ZA3A 1JAKA 1SZFA 1DXEA 1WUFA 2WSRA 3SSJA 1HKVA 1W54A 1Q6QA 4S3FA 1DWGM 2J88A 1ZUAX 1LOLA 5HULA 4Z1CA 1PB0A 1VPQA 4PRRA 3M6YA 3JR2A 1AL8A 1LLOA 4DUOA 2QF7A 3RLHA 5GJPA 3EOOA 5ENLA 4RV3A 2Y5JA 2YLLA 1ME8A 4PBEA 4FR1A 4R88A 1KM1A 3C3NA 3BLPX 3V0UA 1EUAA 3TMQA 4Y9AA 1SFTA 3S0CA 4QAWA 1LTDA 3OGVA 3RGTA 1YXYA 2DU2A 3M0ZA 4RDVA 1OABA 3E2SA 2NT0A 3GYCA 2A7PA 2Z4GA 2ZDRA 3IACA 2V3FA 3EPOA 3OBEA 1TX0A 2F2HA 2D3LA 5DCEA 5CC3A 4C6LA 1A4MA 3QV8A 3GNPA 3R2GA 1Y0EA 4MJ2A 2GOUA 2QDDA 3PBVA 1M6JA 3EX3A 3BDKA 1V6XA 4JYEA 3BICA 2WYSA 5I23A 3H55A 4TUFA 2HISA 4F2UA 2WOQA 4LUTB 1QW9A 3ARYA 4LWWA 1UD5A 3UJFA 3TONA 2D0HA 3HIJA 4B5XA 2XGBA 4GXWA 3V1HA 4MNKA 2E9BA 3KTXA 4DVOA 1C92A 3VC5A 3O05A 5EB8A 3WY1A 3GFYA 2A3CA 1LDCA 4POCA 5HNNA 1KXHA 3KE0A 3ZT5A 3GDRA 4LC8A 3DHDA 5HQMA 2R91A 3BLIA 3FJ6A 2D73A 4LAUA 1GUVA 5D8ZA 3OB8A 4BA0A 3CT7A 1S2VA 1J18A 3NZ1A 3TC3A 4V2XA 1B57A 3PBGA 5M3WA 3RYSA 5CG0A 4JNZA 1TB3A 3AXKA 2FLIA 2WKJA 3USBA 1MQRA 2X0HA 1NWSA 3PVFA 2O4QA 1UROA 3KVLA 2P0OA 3EYPA 1POKA 1S5VA 5MKGB 1JL8A 2DSUA 3UCCA 4O8AA 2VC6A 4B2DD 1DJHA 4OOUA 1XC6A 1W1IE 2PDGA 4TMCA 3PZTA 2PD9A 4XD5A 4W87A 2GJPA 2YIHA 5JXQA 2XVPA 5AECA 2Y63A 1F4AA 5LZLA 1NFPA 3USZA 1GTHA 2W3ZA 3OHIA 3MDWA 3UU0A 3T2PA 1O6IA 2HZGA 3D6NA 1LQ2A 1QATA 1PKMA 2WW5A 4GXMA 1XLKA 4WXZA 5GNXA 4HHMA 2Z27A 4UTMA 3APTA 4LRTA 3UWVA 3WQPA 2WSQA 1XV8A 3TYEA 3EWWA 4OJYA 5FKYA 3PG9A 1MI3A 5CPTA 3P5YA 2VZSA 2YL5A 1P0EA 4AYGA 3PWGA 2A0NA 3WF3A 4XO7A 3CHFA 4X9SA 3L4YA 3ICJA 2ONEA 3M0HA 2RHGA 3ZT7A 2ZTKA 3SCTA 2A4AA 2E6YA 3GG7A 3A9IA 3IIPA 1DE6A 3GTNA 5KZDA 4AMAA 2DQWA 3P84A 3F1QA 1EEPA 3L5LA 2F2KA 3G18A 3CLMA 3VINA 4KETA 5CGMA 3UXAA 5DXYA 3NOYA 1RJPA 1H7WA 4XUGA 1V02E 1FXQA 3WQ4A 1XBZA 4AXKA 3MA8A 3GG0A 4B3LA 2NWSA 3FVMA 3PWAA 3CHVA 2R24A 3E2RA 4JAWA 3VDGA 3F5LA 2PBOA 3CUIA 3EB2A 3W7DA 4D71A 3LRKA 3R7MA 3U0HA 2Z29A 4IGNA 1ZL1A 5DLCA 2ZXQA 4AD2A 4OKDA 4TMBA 1XLDA 4AZBA 1UR1A 3KBVA 2WB5A 3EX2A 3AISA 1W1PA 1YNPA 3UJEA 2XINA 3TN4A 2PWDA 1PZ2A 3NSNA 5A94A 5C2CA 3F4DA 3ARPA 3W1MA 1O7AA 3APGA 3B8TA 4CN4A 4ZZ9A 1UCWA 4HA3A 2Z1XA 2D23A 1WZMA 2CHRA 2XIIA 5D30A 3H2AA 4G1KA 3BCFA 1DWIM 2ZWZA 1FWCC 3IGSA 3G6LA 4JPGA 3POHA 4GI9A 2G95A 4GYPA 2VL4A 1S1RA 1I2QA 2MNRA 3CQJA 2V30A 1L0PA 3UF9A 2UY4A 1OB0A 4YNGA 3EDEA 2TSYA 5DMYA 1TWZA 4HZ6A 3PZMA 1VH7A 3RNDA 2IQTA 1KFWA 4PTWA 2HSAA 5HNUA 4MLRA 1BKHA 1BYBA 1G9HA 1VYSX 1JYXA 4HJWA 3PUEA 1PKLA 3VFCA 4GYFA 4Q33A 2DORA 2WJZA 4NNCA 2CPUA 1ML1A 8RUCA 1SW7A 1K70A 1M53A 3PBMA 1F6PA 3MZNA 3UY7A 2D22A 2XIJA 3NPVA 4ZOEA 3W7OA 3FHAA 3R89A 2CC0A 2WMFA 4RK8A 2PZ0A 2BG5A 3TTQA 5LSMA 1ZNNA 1NWUA 3NEVA 3MVTA 2PMQA 1ZLPA 1I8JA 2EPMX 1NDZA 2X0YA 3M5VA 2Y88A 1W1TA 2Q6ZA 1GKQA 1XBXA 2DW6A 4LB3A 1ZP4A 4M19A 4MG4A 4HKPA 3O3RA 4XKYB 4LF2A 5IFPA 4QISA 1W9XA 5A69A 3UGRA 1OIMA 3OPSA 1UBSA 1Q8JA 5LIYX 3NYDA 3UFYA 4WRHA 2W0UA 1MXSA 1UP0A 1V3MA 2C79A 3NM3A 2EPNA 3K5XA 3THAA 3CPGA 5BCAA 2XWDA 1MXDA 2PDMA 5E09A 1HJUA 5LA2A 1PTGA 2NVCA 3BLOA 3BUVA 2FFIA 4LY8A 1IE7C 1LZOA 3VGBA 3WDJA 1FWTA 4HJFA 2IKGA 3WLHA 3SUUA 2WNNA 3MUAA 1KC7A 2CZEA 4G7EA 1VBGA 1ECQA 1H61A 4UMAA 5FF7A 5FF3A 4OE7A 3Q37A 4GVFA 5A5WA 2QR6A 2VFHA 4Z1YA 2E0PA 3BSHA 2IQ0A 1GOMA 3T44A 3NDYA 1PZ1A 4BQ4A 3LA4A 3NZGA 7A3HA 4ZQNA 4DRSA 3U5UA 3FEQA 2DFAA 3B40A 3GAYA 4L6OA 5ABTA 2CXGA 5HMEA 3SADA 1FWFC 1HP5A 3BOFA 4YXGA 4GIRA 1JAEA 1PTDA 1JQXA 4J27A 1M7JA 4B5SA 3PY2A 1QW7A 1SSGA 3F2CA 1TWSA 4Z2GA 4LX4A 1NFBA 1Q6CA 2FJKA 1FY6A 1OIFA 1S2UA 5J5DA 4HA0A 4Z17A 2UY3A 3O06A 5LKYA 3F4VA 4I9TA 4GY7A 3K1DA 1J96A 2P8BA 8A3HA 1C3FA 3QW4B 3S6TA 1DIOA 4F79A 4M24A 3SCWA 3DFQA 1SZEA 1L6FA 2C3ZA 3A4JA 1OFPA 4C91A 1QPNA 3UT0A 3TMLA 3PF3A 4W85A 2GZXA 4IMGA 1YQ2A 4IIDA 4CVWA 2PRHA 1GK8A 3W87A 2WNZA 4A2SA 4GZ7A 1JUEA 2GQ8A 2PDNA 3DFSA 4HK6A 2F6KA 4AX6A 4GJJA 2O92A 4AVOA 4D8LA 3GDBA 3PULA 1ZJAA 1QNQA 2G3JA 5MKGA 1ISXA 3ARUA 3AXXA 2X42A 5I0DA 3W74A 2AKMA 4R85A 3N19B 3GSMA 1Y5XA 1XS2A 3HM7A 1A5NC 4HD5A 2Y8UA 4RZBA 4NILA 4H4IA 5I3JA 3DFHA 4F9JA 4MJMA 4PUKA 4UR7A 3HU7A 2OU4A 4KIEA 1B3ZA 2VDIA 4P7QA 3IJLA 1BF6A 1WKEA 1L6YA 2DT1A 2C16A 1KGUA 3ABZA 1W5PA 1C91A 3VOHA 2WC7A 1R9ZA 3FA4A 3SCPA 2JF7A 2IKIA 5CKSA 1Q63A 4B5TA 3RPTA 2DT0A 1ZALA 3QOKA 5JMUA 1MRAA 1I60A 2D2JA 1FH7A 2I16A 1DTUA 4RV8A 2R82A 1CGTA 3PN8A 1T96A 3ARWA 1WBJA 4XD6A 4JQ1A 3KHJA 1ZCOA 3T42A 1ZAHA 2E8YA 3BCDA 2PGRA 2CBUA 3AXMA 4AFYA 2IW0A 1NEYA 1J4EA 1B4EA 1XDLA 4H00A 2ADAA 4TX9A 1R3VA 5JBDA 2J6XA 2YYTA 1E3ZA 5AC7A 2DZBA 3KW3A 2J13A 2HNHA 4F0LA 5C9XA 1U5HA 2J78A 4LV9A 2A3LA 3TW7A 2I7GA 3N2XA 4JDBA 5E6ZA 1JD7A 3HB9A 3HQPA 3LY0A 5CPSA 6XIMA 3K2GA 4MNMA 1EGZA 4IGMA 4IP5A 3WQDA 1VB9A 2BVDA 4GQ0A 4KRTA 1VAHA 4ML9A 2YGYA 1K6AA 1T40A 2SFPA 3KCJA 4NJHA 1R9YA 1L2UA 4JIEA 3I7RA 4FX6M 1XSJA 1EHNA 3PB2A 4XO6A 3FLUA 3O0FA 3L68A 1RBLA 2FMNA 4F66A 1R3YA 1NDVA 4ZO8A 2Q09A 2GVGA 1GJPA 3UVIA 4WDUA 3T1GA 4WSJA 3WH8A 1W9PA 1QR7A 1PL9A 4IFKB 3ME3A 4X0VA 4QFUA 4ZB0A 1EL3A 3FAXA 5DMLA 1KCLA 2WBGA 2YA1A 2PWEA 4HT3A 1GYMA 4LVAA 3K8LA 4H8UA 1P7TB 4GNJA 1L6GA 4FLOA 2XIMA 3CAKA 2DGAA 1IQ8A 4HA4A 4ZO6A 4AQLA 1V3IA 3OBKA 1VF8A 1XBVA 4OVXA 5I02A 3EEGA 3PJTA 1SQ7A 3EKGA 2PD5A 3TNOA 4RE3A 3MMTA 2HMCA 4LS0A 4C6JA 1CXHA 1KB3A 1TMQA 2PDJA 3N15A 5HWMA 4JTHA 1AA1B 2C13A 4RJEA 3STCA 2X1UA 3KDNA 3B8UA 3DC0A 4JIRA 3E1F1 3W1PA 4PUWA 1E1CA 4W89A 3C8NA 5CSYA 2H9AB 6ALDA 2J66A 2I17A 1KQZA 3TAOA 1E0UA 4IMDA 7REQB 3BG5A 3SUTA 3N2BA 4J5NA 4XKYA 3HF3A 5D04C 3QN3A 4FXRA 4S3GA 3L67A 2QNEA 3UWYA 2VCCA 2Y4SA 3T07A 3N4AA 3UXKA 3W86A 4AZCA 1SM9A 5MF5A 1JNDA 3ARVA 3HGRA 3W2KA 3NQAA 3M16A 1UH4A 3W3OA 1W1VA 4GBDA 3WFZA 4ATLA 5CPLA 1YRRA 3SECA 4Q8QA 2PWHA 1W3HA 5A6SA 5AN7A 2Y7DA 3LGEA 5G4WA 3EWCA 2JBMA 3P74A 2PCQA 4C1NA 2VO5A 1J0JA 2GSJA 4C6DA 1AQMA 2J77A 3OVGA 4V1YA 1JPKA 3W83A 4O11A 3LV5A 2ISWA 1KR1A 4L9YA 3GNXA 2H8ZA 2OGYA 2ZZ2A 4L80A 5FI8A 5FEXA 1U33A 1ZZMA 5D38A 1PEZA 1FDYA 3E6EA 1W56A 3ZT6A 1KWKA 4ZA0A 1E5JA 4FOUA 3LBOA 3C8FA 2J62A 3RM8A 1FCVA 3VD9A 4I5RA 3VTRA 4IICA 1X96A 4D6GA 3M46A 4O14A 5HPOA 1X7IA 4GY0A 3G8EA 3H24A 3L4ZA 1A5KC 2NQJA 3G6MA 1VPYA 1T41A 3VNLA 4LBUA 1TG7A 3K1GA 3MV01 2FKPA 4FK9A 1SGJA 3V16A 3N9KA 4AU0A 2Z2UA 1ZJIA 3ITLA 1Q7QA 2FTWA 4IMEA 2LLEA 1XLJA 3URQA 1DOSA 1UIPA 4XX6A 5I3DA 3N34A 2J75A 2WVVB 2A3HA 4PTDA 2Z2AA 1MDRA 1TR9A 2FJUB 3T0DA 3OZPA 1ONXA 1ITCA 1PTAA 1P4CA 4O28A 3VMNA 4I7VA 4CQDA 3EA1A 3LK6A 3H12A 2PTZA 2D2HA 4NHVA 5BXRA 2F38A 3M44A 5DO8A 2F7FA 7ENLA 2A3AA 1EOMA 3N11A 3CQHA 3DFOA 1RPKA 4LQ1A 3S1VA 1AVAA 4X61A 5EGRA 1U83A 3VKAA 2DY3A 4M80A 4LB4A 1V6UA 3W1AA 4L4OA 5DT7A 5E0CA 3EAUA 4UNLA 3SIMA 3ZM8A 3QR0A 1UB3A 4PUEA 5DBUA 3VCRA 1G5AA 2VR5A 3LQGA 4IFOA 4MF4A 1F6YA 3LB0A 2BS9A 4H6KA 3L2IA 5A6BD 1BKSA 4GHRA 3QM3A 3UJ2A 2GVLA 3NDZA 4GZIA 2WMGA 4XAFA 1LWIA 4DBEA 3DYOA 2YYUA 4Y6GA 4NYUA 3UPMA 4JGDA 1O4UA 3AIWA 3F4CA 4IUGA 3T0TA 2XZ9A 2PS2A 5JH2A 2OX1A 3N3MA 3ANYA 1LROA 4Q8WA 4DXVA 4AEFA 4AX7A 2ZX6A 4CD7A 4ACZA 4FXFA 3COTA 1LJYA 5BOOA 2WZHA 3H8AA 1OCBA 2E1WA 2EF9A 3F5KA 2NSXA 4I90A 2XN1A 4YTQA 2JEQA 1QNPA 3NQ7A 5LHEA 3W28A 1W37A 3HV9A 4UTJA 5D2TA 3B0XA 3L7RA 1TQXA 3URAA 2JGQA 3QMSA 3VIKA 2YCJA 3LPGA 4V27A 3HQNA 5E0KA 4EAMA 4CD6A 1W9VA 5GVJA 5E9XA 1T5AA 3LRMA 4PN2A 1W5MA 1US0A 1VHNA 4URIA 5BWFA 1VEPA 3P14A 4Q4QA 1UIOA 4OUEA 4FP1A 4B4FA 4HZ8A 1SW3A 2WANA 1W3NA 2W5FA 1XLCA 3QF0A 3M47A 4IG2B 3TQKA 1CGWA 4Q4PA 2ZZ3A 4M29A 1UASA 1R3RA 1KXTA 1REQB 1ZCCA 1XLHA 1IXPA 2ZZ6A 4IFKA 2E25A 4LCSA 1QOQA 5I03A 3V4BA 4FA3A 1XI3A 4RPQA 3U2ZA 3PNUA 1RR2A 4AISA 4AB4A 2GGGA 3A4WA 1A0DA 3URNA 3ALFA 4PUDA 2IMRA 3HBLA 2A3BA 1OSEA 4FPSA 4QG8A 4HMDA 4DYKA 3VILA 3T4WA 1BF2A 1W1A1 1EC8A 2V81A 2NQHA 4WXYA 3W00A 3AMGA 4D72A 1NH6A 2YOCA 4ICNA 1I0DA 3CPRA 4D2JA 2ZC1A 4Q8NA 2HPIA 4WDTA 2JKEA 4ATWA 4YL2A 4H9YA 2CHNA 4ADTA 2OLHA 5FACA 3CXOA 5FF0A 2DZWA 3EGJA 3KOWA 2IXUA 2NT1A 5U4NA 1UKOA 3N6HA 1JPIA 4MUPA 4LEFA 3S5ZA 3PUGA 3ZXWA 1WPCA 3IV8A 1CB2A 4K8EA 3BANA 2HBXA 1X8FA 2A7RA 1C9WA 3VNDA 2VKZG 5I6SA 4GCXA 7REQA 4BF5A 2FVLA 2R8WA 1JGMA 4FNQA 1FKWA 3MKCA 4U31A 3B04A 3G5EA 1SFSA 2V2HA 2FTYA 4V1XA 1X8CA 4JXCA 3FS2A 3ES8A 2TYSA 4B9ZA 3PTMA 2Q3OA 2HBVA 1GPWA 4XZBA 3LCXA 3CUFA 1RPXA 2YFNA 4ACYA 2VX5A 3EMCA 5EMKA 1XYAA 3AU6A 3M5XA 3TXVA 1EX1A 3W81A 1JZ7A 3D46A 4CCDA 3OIXA 3S5OA 1FWIC 4A22A 2E67A 3KBNA 1OM0A 2VOTA 2AAAA 2KZHA 3W27A 4S3DA 3M41A 1S1PA 3MSDA 1J12A 3H53A 5A6LA 1J8VA 4NY2A 2YX0A 3MHUA 4H01A 3VDAA 4ERGA 1JZ6A 2NX1A 5HMSA 3LYEA 4RDZA 2ZVIA 3N6QA 1GVQA 1IHIA 2C0AA 1E5NA 3VCNA 2PLJA 3LTYA 2E3ZA 1XSKA 1H2JA 3UERA 4O57A 3PZVA 2VTFA 3O6YX 2D20A 4AZ6A 3VCCA 1HGWA 1K8CA 3S2CA 3ABOA 4UTFA 2OEJA 3CGTA 3IRDA 4ZR8A 3RHGA 3FX4A 2VEFA 3WJXA 3WLQA 4I9JA 3TC7A 1ONRA 3EOEA 3K46A 2OYKA 2YDAA 2PF8A 2YL8A 4WDWA 1XLAA 2EJ1A 4DJFA 4DJED 2R1NA 4ZVJA 5MHBA 4AD5A 3LI1A 4Y9OA 3TFXA 2WLYA 3W2UA 4J2PA 2ZDSA 1ICPA 3V35A 2NWRA 4JKMA 1DJXA 3CV7A 1LT8A 5J04A 2FTPA 2GK1B 1AH0A 2VEGA 3GWQA 2XN0A 4E8CA 4LAOA 5I2UA 1XX1A 1DKWA 4UTWC 4JTEA 4QJ1A 2OYLA 3U3HA 3S3GA 5G5IA 1RLDA 2E09A 3UR2A 4E4PA 2WCSA 2XFYA 2J9YA 1Q6DA 4WEVX 3L2LA 3GXTA 3S9YA 3KRZA 1UWTA 4UCFA 1XCWA 2PU1A 2WVVA 3LERA 4PGLA 1MW3A 2B7PA 3LSBA 3W7MA 5AHEA 4K2SA 3E0VA 1M03A 2J7HA 1FWBC 1W5NA 3LV6A 1JCYA 2TAAA 3BVJA 3TTSA 4U3CA 1JR1A 1AZ2A 4U2YA 3QLLA 1ZY9A 2BGNE 3G1YA 1OFAA 2X0SA 1MUMA 5I3GA 4B90A 5AVHA 3B0PA 3EEZA 1G69A 5A8MA 2ZUMA 3PZNA 4QSFA 5REQA 1W3JA 1WDWA 1VCVA 3W1QA 3IVTA 3UZWA 2CLEA 3E9AA 2PE4A 5HNTA 2XGZA 4JOMA 2OR2A 4MOZA 4X22A 3NVDA 2CU0A 2DZAA 1RALA 2RGLA 1NSJA 3EMQA 3QZAA 5JBEA 4ERIA 4WGHA 1PO9A 2DSKA 3U2EA 1OD0A 3DKLA 3WENA 4KIRA 2X1RA 4BY3A 1DJQA 2QUMA 2Q8LA 1TCMA 3LBMA 1TPUA 3WJWA 1TVLA 4MHBA 1UA7A 2XIQA 5FSDC 2J7EA 2ACRA 4GKTA 3NOEA 2HK0A 3S9ZA 2E1DA 4X0NA 1WB0A 1S5WA 1TPB1 4Q7BA 4Q8MA 5AYXA 4H19A 2D3NA 4IP4A 3DU0A 1JPHA 2QCLA 2D69A 5G4EA 4DXKA 3DERA 3NGFA 4N42A 1NVMA 3NGJA 4YVVA 4LAZA 1K3UA 1NAL1 2RJHA 1E6XM 3SEPA 1YIXA 5F7UA 2PP1A 2HQAA 3AO0A 3LI0A 2EAWA 3FSTA 2OQLA 1TA3A 2WSYA 5M2FX 4XKMA 2IKHA 1KBIA 3UNTA 1V5XA 3N18A 3P80A 1UR9A 4FNSA 1X6LA 1M7PA 4HMNA 4KRZA 1H3GA 3W75A 2PC8A 1RCXB 5I00A 3BC9A 1TIMA 2EG6A 2XVKA 2BODX 4MY9A 1MZRA 4RDYA 1SPQA 2P3EA 4GABA 2YJQA 1ODZA 2CLMA 5LNVA 4GIAA 1TJ1A 3CL8A 4E8DA 1OZMA 5C7HA 1CBGA 5LGZA 5CH9A 4GUFA 3F03K 4HK5A 4H41A 1JZ4A 1P6BA 3GBDA 8CGTA 3C2EA 2VEKA 4J28A 4HYWA 4XZIA 4ZO7A 5CGQA 2EPOA 4HOWA 1FQ0A 1TTJA 1UOZA 4I5UA 3NG3A 3GNDA 3VK5A 4Q3MA 4WF7A 4YVXA 4QBXA 1AH3A 1G4SA 1RVGA 4XD4A 4AW7A 2EPKX 3K13A 1JPDX 5H6HA 3Q4DA 4MZ8A 3ZIZA 4DJEC 3R8RA 1CXFA 3MP4A 1O12A 3MYPA 4AG0A 2G97A 3C86A 3V3WA 4GA8A 4CQ9A 5EPDA 4AZGA 3NQ2A 1EGMA 2VMFA 2VURA 3HQOA 4UQEA 3FJLA 2XH0A 3TOPA 1UBPC 4PCFA 3LZ3A 1E0VA 3UYIA 3GS6A 1WZLA 1DWFM 1WX0A 3VD5A 5LIUX 3AXHA 3BAKA 4EK7A 1FDJA 2GGJA 4C65A 4FSAA 3RXZA 1I2NA 3GY1A 2KX9A 3EZ4A 2PPGA 3MTWA 3SCSA 4JFSA 4OUIA 5K7JA 4ZOAA 4KFOA 5IHRA 4PL1A 4A8NA 1RSCA 2Z7GA 4AC1X 4GGBA 3SM0A 4NJIA 3O1NA 3LPOA 1Z44A 2CLKA 3WJYA 3OTRA 1RD5A 1QW8A 5BMWA 3SRHA 3RLUA 4F0SA 3F2DA 5AY7A 1PBGA 5C8BB 4O13A 1A0CA 4PMYA 1DHPA 3ALGA 3ARRA 2EO7A 3C0QA 3C5QA 4GACA 4MFDA 1IT7A 5HWNA 4J3VA 3WMCA 3UJSA 1W9DM 5A8OA 3GX9A 4L9XA 1EKOA 2D0FA 3DIPA 3HMJG 1GVYA 1VCFA 2PDQA 2XH4A 4ZBCA 3SQLA 3UNDA 1XIBA 2E5CA 5CJ5A 5L6UA 3LMYA 1TPH1 1QDSA 1CTNA 4K38A 1LOQA 5DX7A 4JTQA 3H6OA 4ML4A 3WLPA 2C15A 3ECQA 1J9YA 3ITCA 1GQJA 3C2RA 3IJDA 1PKYA 1EX5A 2PEVA 3P0XA 3EWZA 2OLSA 1LOSA 4LW7A 1F6KA 3TYDA 1JNEA 3TZNA 1G4PA 3FCPA 1EIXA 3AWOA 3TN6A 4TR9A 3R43A 1UUQA 4J2MA 2GQAA 3UP8A 5CZSA 3BAXA 3EMZA 2GWNA 2XVGA 3VDCA 4JN7A 1OX6A 1RA0A 4NI8A 1QWKA 1GOWA 1TUXA 1ODUA 5EYWA 3FYYA 3EOUA 1R2RA 5C9RA 3CO8A 2CBVA 1GYNA 2UY5A 1OX4B 1BD0A 2WZIA 5T9BG 5CAHA 3CH9A 3T0CA 1UR2A 1VFUA 1HKKA 3LM3A 2W92A 2QPUA 1WE5A 4PZVA 1T7LA 4NG3A 3DGBA 3ZS4A 1B4KA 1HFBA 3VD4A 5D09A 4JTJA 4P8XA 1G6CA 3PP7A 4CD8A 2QGHA 2CWNA 3WH7A 1TR1A 1UR4A 3W7IA 3I4KA 2E4TA 4DNMA 1DE5A 3P82A 1RBAA 1RK5A 3C52A 3VE9A 2DH3A 1XG4A 1VKFA 4BFAA 4GZEA 2ZWYA 2UWFA 4HNUA 4JTFA 3SRDA 1QWGA 3TJLA 1DHKA 1ZPTA 1UJQA 3WQ5A 5I07A 2XFRA 3UA3A 3WH6A 1E6QM 3WLTA 3GHSA 4XTIA 2RAGA 2B81A 4RLIA 5BNKA 4OFCA 4J3XA 1Q8AA 3CWHA 4FR6A 4IH3A 4MWAD 4JCLA 4BWLC 4IGSA 1CX9A 1B2YA 3BQ5A 1UUOA 1X6UA 3KL3A 5EMJA 1IXNA 3MUIA 3DX5A 3OP2A 3TQPA 3S8HA 2WHKA 2VQUA 2ZA1A 3A3HA 1C7TA 3UZYA 3FFSA 4N4QA 4LC6A 3QMRA 1W9BM 1V0MA 4LUIA 2NQ5A 2YPIA 4L4MA 4G9PA 4FLRA 1BHGA 2DW7A 2EXOA 3R8GA 2P8CA 3P62A 4IISA 1H50A 1YADA 3TWAA 5C9ZA 2DIJA 4JQ4A 3VGDA 3ONBA 3GH5A 1TX2A 4AY8A 1NWTA 2NXHA 4R9XA 1S2AA 3GKAA 4TTUA 4E3TA 3FXGA 1EGVA 1V4YA 4V33A 1OYBA 1RV8A 2Z6JA 3DGRA 4S38A 2QCEA 3GHUA 1C8XA 2JKAA 3WLKX 1YDVA 1UQZA 4FS9A 1LM1A 4KT2A 4UFLA 1MQPA 3LOTA 4QS5A 1BXNA 1EJRC 4PEEA 1VFHA 4HPGA 3BZJA 1POJA 3SN0A 4K6AA 1CT5A 4NZCA 2XVLA 1UWIA 4ZCWA 2QCFA 2VR2A 2BFGA 4AXNA 4HPJA 5LNUA 2FH6A 4QCFA 4PA8A 5B80A 1M7XA 1LQ0A 2YBTA 1BWVA 5ECVA 1S39A 4UTKA 3W73A 2DQXA 4RZ5A 3GXFA 3PZ9A 3MT1A 3K4WA 1BEUA 4F0KA 1KO0A 2BNJA 3S5SA 3DI1A 2Y7EA 1KRCC 4CD4A 4BI5A 1UC4A 3W1NA 3EWXA 3U6WA 4H7ZA 1NOFA 3W07A 2A2IA 4C6IA 1QRQA 4KWUA 9CGTA 3MUY1 1EO5A 3KX6A 4FIQA 1GJWA 2QMJA 2A6LA 3ABRA 3NM1A 3ZVHB 1DTNA 4P2VA 3I65A 2G3FA 1SO6A 3CV6A 4C1LA 2F61A 1GG1A 2CITA 3STEA 2VZOA 5D9NA 4NT0A 1B3VA 3LX9A 4YVPA 3W7KA 2AMXA 1YTDA 1WKFA 4H2HA 3PSWA 4DIAA 2OGJA 4WIWA 4KCWA 1KFLA 1B3XA 3PZGA 3VKJA 1MXGA 3T40A 4BZYA 3CHCA 4HBKA 4S3JA 2YCLA 5AYBA 3VUSA 3SJNA 1AMKA 1GOIA 4EAYA 3ITOA 1HF6A 5AYYA 5IDIA 1I2PA 1EO7A 4P7LA 5F2LA 1CZ1A 4UOQA 3WBAA 3G2GA 3VD3A 3FGCB 3CLWA 4JEQA 3CQ0A 1WXJA 5FEWA 1FHDA 2TRSA 1JUKA 5FESA 1EPXA 1J6PA 3UPBA 2H3DA 4OT7A 5IRPA 3G1RA 2GFTA 4UFJA 1MZHA 2Z0IA 3IIXA 3QGVA 4D6DA 2FDSA 1MEHA 2BXYA 1D8CA 4KMQA 4DWDA 3AAMA 5BU9A 4XUYA 1QT1A 3B06A 3QFEA 4PYSA 3HJZA 5AC4A 2V5CA 2G4JA 4QTGA 4IT1A 1PZ0A 5TF0A 1HP4A 2P5NA 4BK9A 2GQ3A 5K4XA 2YCKX 4F0MA 3CIVA 1EFZA 2DT2A 3PZUA 3W70A 4HU4A 5CC6A 3AYTA 3NFUA 3FDKA 4XD3A 3WK2A 5LYRA 1EZWA 4AWEA 2G41A 1XJBA 4GIEA 1I2OA 1WO2A 3LTSA 3A9BA 2W61A 4JEJA 4IX0A 2FZMA 3APYA 4YWIA 2BGQA 3UESA 2JGYA 2XN2A 2QLYA 3CJPA 3QOMA 2QIWA 1H7PA 1GHSA 5CCZA 4LVGA 2V8ZA 3BGAA 4LS1A 1GCYA 3GW0A 1E56A 4I9AA 2BZNA 3ELFA 3TP4A 4MWAC 3NZQA 2HEJA 1F9CA 1YPIA 1US3A 2RFGA 3AZRA 3WNPA 4UUIA 4DI8A 4LNCA 3EXSA 2YA0A 1HL2A 1E6RA 1E0WA 5EA9A 1I4NA 2Y5SA 4JFWA 4ZQCA 4ZFCA 4K8GA 4XTDA 1RQEA 1VEOA 2ZUWA 2PF0A 3W7PA 3U5YA 4HSOA 4GQGA 3RG6A 3AHTA 1DIDA 3SCQA 1S46A 2FDMA 1QPOA 1KKOA 1FOBA 1F7BA 5D9PA 5CJMA 1H0IA 1V3LA 3CIWA 1P43A 2H6RA 2VFFA 1LLZA 2PA6A 3WLRA 3SCNA 4XVDA 1RP8A 2CLFA 3VU2A 2ZIDA 1XW8A 3ATZA 3MJMA 5F2MA 4YTSA 3BGGA 1WA3A 1KW1A 4YHEA 2DZXA 5C2GA 1UZ4A 3WDPP 1SMAA 1JQVA 4G1NA 3FVDA 2DSWA 3EXRA 4FX8A 1QXLA 1UKQA 1EQCA 2MUCA 1E15A 1BXCA 3LSCA 3W1XA 4WZHA 1XXXA 4HTYA 3MMWA 4WLCA 1AK5A 2O7SA 2J8FA 4KKXA 2A3EA 1Q2SA 3KVKA 4PMOA 3BXWA 1A53A 1TZ9A 1XG3A 1D3HA 5D9MA 3KZSA 1XYFA 4D6EA 3B4UA 2D1ZA 3RO8A 4ICMA 4FEZA 1PUDA 2ESCA 4M7TA 2WM1A 1TREA 3AIRA 4AZ5A 1G0CA 3AI0A 4KBXA 3H2NA 5FAGA 2ZOXA 3D47A 1VFSA 1IEWA 4DWSD 5IOBA 1CW2A 2ZVRA 2QAFA 1K8YA 4IPIA 1EDTA 1J2WA 3BOLA 2E7FA 4ZTYA 1VPXA 1O5RA 1RY8A 4GYPC 2YW4A 2DZVA 3B9NA 1CI1A 5AZ1A 1TE6A 3FA3A 2BVWA 2FPTA 3S47A 2ZRWA 1AW5A 2GUBA 2D2OA 3HPSA 4W8BA 2Y6ZA 4J1OA 2AMGA 4U28A 3LDVA 3SY1A 4QLKA 2GDUA 3TQVA 4PODA 1E4MM 3WSUA 3RMEA 1V03A 4QG9A 4Q4RA 1IT8A 2PCEA 2TPSA 2NLYA 5GQBA 4GVGA 2AQWA 1WCGA 1MEIA 4UIOA 3W1LA 3B05A 1KGXA 4QDMA 1N55A 3IK2A 1K6WA 5CC7A 3RM4A 4O1FA 2X1TA 4UTTC 2DIEA 4B2DA 3CMGA 3TR9A 2R9RA 2WV8A 2G5WA 4QXIA 2V9DA 3WDQA 5C70A 4UMBA 4PB4A 1E72M 3K4AA 3P3BA 3XINA 3HN3A 1BG4A 4HNTA 1HVXA 4B4HA 1WOBA 3QH2A 1AQHA 4QR6A 1XISA 2QYGA 1PDZA 2HTMA 4F9DA 3TR2A 2C1GA 1TTPA 3ANVA 4K7YA 5K9CA 4XQ6A 3RX2A 4O4WA 5T91A 1GEQA 2ZFAA 1S5MA 5DXXA 1H4PA 1OINA 1PIGA 1M65A 2C1HA 3WF1A 1UG6A 2QCHA 1FWRA 1A5OC 2VC9A 1QI3A 4Q8OA 4F0HA 3V36A 5AHLA 5EU9A 3TVAA 3JZEA 4LTSA 1UWAA 3ZQ9A 1JI2A 1TRDA 2QVHA 1BVZA 4IHCA 3SBFA 4GKLA 3VABA 4O53A 4DBUA 2NVDA 4HCDA 1VFMA 4DO5A 3RJXA 1OYAA 4JDYA 1UHVA 1UR3M 2JK2A 2WM0A 1TVPA 2J27A 4AZIA 3WBYA 4WUIA 1GHRA 4P8VA 2CFFA 3ZVHA 4HYRA 4I6KA 2PGFA 5F4SA 4HK7A 5LNWA 3PBWA 4C6FA 3RRAA 3W7QA 1W3IA 1ADDA 3MY9A 4XAYA 3ATYA 4PEKA 1F3WA 4UR9A 4G8TA 4NU7A 1V6WA 4XSMA 1XQLA 1H0GA 1O5XA 3S42A 4WK9A 4MB3A 3P93A 4IIHA 4Z1BA 3BJSA 1Q85A 3UYCA 3C2YA 1KCXA 3B0YA 3LEPA 1GORA 1K03A 3I10A 1H09A 1WQ5A 5D03A 1HQTA 5GJNA 4DAFA 3SCUA 1XGDA 2W4XA 4E4FA 3M1ZA 4JTCA 4GE8A 1TVNA 3KL5A 4IIGA 3UW6A 4NSBA 3U8GA 2KAUC 4PUUA 4IQJA 4X2RA 1A5AA 3GAKA 4BEUA 5LXEA 4KCTA 5CJNA 2Z2BA 1LRTA 2FIQA 1KM0A 1TPC1 3ID7A 1R86A 3WD4A 4E4UA 3GB6A 5I3HA 1NF7A 1QU4A 4JHMA 2WBKA 2F84A 3MB9A 3MS8A 9RUBA 2OCZA 3BMXA 3DHPA 3AWNA 2Y7GA 4H8HA 3T81A 5BXTA 1B31A 3CUZA 4JY8A 4LVDA 4N9EA 1OFOA 1OT2A 4YYFA 4WJEA 3XIMA 1DQUA 4IXHA 4EKJA 4YHGA 2I5GA 1VFTA 3AS2A 3W71A 1V0LA 1OGBA 4GLEA 3CEUA 4P8WA 3NR0A 3E38A 4Q8UA 3ZJ8A 4DNHA 2Z1KA 2F6XA 4B5WA 1XH0A 2X40A 1HG3A 2WCAA 2QVNA 3SCRA 3VI2A 3HZ3A 4EWND 5ABEA 1U5VA 3MUZ1 3ZFHA 1XQKA 1K02A 3PK7A 1RK6A 5A6MA 1GQNA 3AHYA 8XIAA 1FHVA 4XAGA 3S5NA 2I5IA 1KM6A 4TVDA 2E6DA 4CNUA 3JU2A 1V79A 3VIOA 1EWDA 1KLZA 4XZNX 1A3WA 3REQB 1CLVA 3TYUA 1NQKA 4E8GA 1XHGA 1L2QA 1TFVA 2XU2A 2H3BA 5C9WA 4U4MA 3PR2A 1ISWA 4AAJA 4AUBA 4ONVA 4KWOA 1FBAA 3GVWA 4PMRA 3IRSA 3TA9A 3O6CA 2C7FA 5DRIA 1S2TA 2D0GA 3EA3A 3IJ9A 4IGHA 2VCBA 3H26A 1G4EA 1LL4A 3HGJA 4KH2A 4MAZA 1E0XA 1VQTA 1E40A 3GC2A 4W9TA 2Q01A 4BKNA 1VFFA 4I8YA 3H23A 2YCEA 1V93A 3BH4A 3ITXA 4KEVA 4XBSA 1J0YA 1WDRA 1DJYA 1W17A 1LUCB 4Q22A 3VNZA 1XC4A 1KGWA 3W7LA 2VI0A 4X2PA 3QHMA 4REQA 1MDLA 3OLDA 3GHRA 4GQRA 1H5VA 4H3DA 4JTLA 3ZOAA 4I5XA 4C6OA 3S83A 1DBTA 4JTAA 2VFDA 1LG1A 4IQEA 1BYAA 4DB7A 2W67A 2I9UA 2OSYA 1SJDA 4AH7A 1XRFA 3L0KA 3KXQA 2NQZA 3QMTA 4IM4A 3P60A 1R2SA 2MANA 5G1MA 4JIPA 3M7WA 2ZX5A 4DBWA 1OC6A 3MCMA 3IJIA 4XV0A 1GW9A 1I45A 2G0WA 3NPWA 4YTRA 2WK2A 1A49A 2INFA 5I79A 1TCDA 2JQXA 4O0QA 3QV6A 3P7YA 4O10A 4DM2A 4HNVA 4O52A 2ALRA 1EF3A 1XH1A 3SUVA 4E5TA 4H8VA 3AJ7A 1NF0A 2NV9A 1FWNA 5DY2A 3BARA 1KM2A 3EKLA 3W01A 4TV5A 4GO8A 2PZNA 1XPYA 3R5EA 2XFWA 1VP5A 2REQA 3GRIA 4N9BA 5A6JA 1W32A 1JCTA 1Q6GA 3M4HA 5C55A 4HNOA 4QNWA 1HX0A 4JYDA 4O19A 4NP7A 2OKOA 5JBFA 4O1DA 3QQ1A 3FEMA 1BLIA 3U7VA 2VC5A 1GQKA 2OWWA 2OZ3A 3LNMA 3TW9A 1R3SA 1W1B1 2VD8A 4C6PA 2XSAA 4IPPA 1F3TA 5D2XA 2VFIA 4O16A 1BSLA 3BJTA 3CUGA 2FFCA 3T7VA 3ABXA 1VBUA 2BXVA 1EUNA 5BRQA 1MVYA 2ACUA 2GUYA 4U10A 3SY8A 1PZ3A 4LYPA 1VZWA 4E6MA 3PBYA 3AZTA 4PCSA 3MCNA 1Y7VA 5EKYA 4DAIA 4G7EB 2VX7A 1TZ7A 4AWSA 4KFPA 3FKKA 4GYJA 3M43A 3WLSA 2C18A 3BURA 1QFEA 5FEPA 3JUGA 3LCWA 2BLEA 3M0MA 3ZLFA 4QS6A 3PNZA 3W72A 1B3OA 5A95A 2EQDA 4UQBA 1S3HA 4NAFB 1H51A 1U1UA 4DLMA 1QO5A 4FB7A 4KEZA 2R1PA 4GUHA 3DKJA 1LL6A 4M1BA 4QRNA 5LA1A 4QLJA 4PMXA 5EMUA 1AMYA 2V68A 2HS8A 3M0VA 1VCGA 3O0KA 3VGFA 1XLMA 3RR1A 3N73A 1CXKA 2Z7KA 3ZR4A 2RKXA 1XD1A 5LGXA 4EPKA 3B8SA 3IGUA 4XZLX 1XYBA 2J8TA 3QV7A 2QULA 1FDZA 4GH1A 4UFMA 2XH2A 3NA8A 4FMVA 5IXEA 1A5MC 3BLKA 3VNKA 1PJ9A 4L9ZA 4TX8A 2EKGA 3O63A 3BLDA 3GU1A 3MUXA 5FJRA 1B0IA 1OFBA 1VEMA 3V0TA 1IEXA 4Z2LA 5FD0A 3SW6A 2GJLA 4QE4A 6PTDA 1K9FA 1TQJA 2VCAA 2DIKA 3UPWA 2J7FA 1K9EA 3AMDA 5AYZA 2DZUA 2OELA 3MHGA 3ZMRA 5LXXA 1GVSA 3UR8A 1OC5A 3LENA 4US5D 2YBUA 4J40A 3IARA 4LYKA 3FN9A 4L7ZA 5CPQA 4CUCA 1BSIA 4XBKA 2BHZA 2PLCA 1E9LA 3WFLA 3WF0A 4DBSA 1G01A 2J7CA 4N02A 4XZ9A 5CLWA 2DVXA 4U3AA 4P7RA 5M03A 4WCJA 2VEMA 1LRNA 1XYCA 5D33A 2BOFX 3PANA 3ZLGA 4O1CA 4DO6A 4JL2A 1J01A 5LIWX 4IJCA 5DT5A 4WGXA 5A2AA 3BK0A 2HS6A 2GUUA 4KRUA 3WX7A 3GD6A 5CBJA 1F8IA 4OGZA 7XIMA 1ISZA 3EOLA 3EPMA 1A0EA 3MPGA 4C6KA 4R27A 3FIGA 1RY0A 4ROQA 3LRLA 1GG0A 2P88A 2ATMA 4B5UA 3W37A 1D8WA 5FJUA 2G50A 3QR1A 1VYPX 3DFPA 2FZNA 2XYLA 1VYRA 1FWDC 1WXYA 3MUCA 4PH6A 4IP7A 3R58A 4NX5A 4EXBA 3S9IA 4E2OA 1Q5MA 4B3ZA 2PDIA 4HZ7A 3W2LA 1V77A 4I6VA 3A5VA 5BZAA 4D6HA 4L6HA 5AC5A 2FHCA 3LPFA 3W7GA 3C0LA 4JHZA 4CN1A 4G56A 3ARSA 3P6LA 3BJFA 3FOKA 5FJIA 3REQA 2PDUA 3EWYA 3L5AA 3PPGA 4U5KA 3RN6A 5IHSA 3CUJA 1E9ZB 2DJLA 2POZA 1ISYA 3B03A 3B4YA 2Y85A 2ZX8A 5FAJA 3WLLA 1XIDA 3VOIA 6XIAA 4HMEA 1XIJA 4DF1A 4EF8A 2V3DA 1L8PA 4S3EA 4GMEA 1AJZA 3RX3A 2ASHA 2WAGA 2CZDA 3GTFA 4JL1A 2NVAA 3H21A 5AOUA 2H90A 4AWUA 1E4NA 5CSSA 1HJSA 1RVKA 3N12A 2QCDB 4MMWA 2RGMA 3PZIA 1LUCA 3VA8A 2ZXAA 4UZUA 4NX0A 3H2FA 4WOQA 1SR0A 4ORMA 1V7AA 3WQ8A 1XH2A 4MZ1A 1HZYA 3N2MA 2O9OA 2ZQ0A 4OU1A 2FZ8A 3OOQA 1R2TA 1QNSA 3VMOA 1V3KA 3DHFA 4TVCA 2EKCA 2PRMA 1W3TA 1PE1A 1Q65A 1CGVA 2W91A 4A8IA 1XIHA 3QW3A 1BRLA 3AYSA 3S1XA 3VZYA 3G1FA 3T05A 1OG0A 1LLWA 4MB5A 4R5EA 1IR1A 4NVTA 1R3WA 2OSWA 1K8ZA 2CWXA 4XAPA 2PDXA 1HKWA 3EOSA 1AJ2A 1QNVA 3WQEA 3ZJ6A 3TIMA 2OMAA 3H7UA 2C6QA 1B3YA 1JCLA 1OG6A 5H1WA 3BCJA 3QSRA 5F4XA 3KS5A 3GO2A 5DBTA 2GDVA 4GH3A 1FFQA 2PTXA 1C8VA 1FWHC 4J7RA 4GBUA 1PWMA 1XKYA 2G3IA 6TIMA 4YU1A 1G1YA 3H4WA 5I3KA 4A3QA 3GR7A 3L0GA 3RF9A 4NJKA 4M6QA 2DUAA 1E1CB 4D6JA 1PKNA 5BRBA 1WOAA 3GXNA 3IV3A 1JVNA 4O15A 4UC5A 1KBJA 1TE1A 2PLMA 5A6KA 3UCQA 4YCOA 3WLIA 3PBUA 3UQNA 4LPCA 1EC7A 2WJDA 4XIAA 4UZSA 1WP6A 2FPVA 1KCKA 3AYVA 2J7BA 1TRIA 2IQDA 4AZCB 1EP3A 2B7OA 1MNSA 4W5UA 4MNLA 4RZ4A 4QJ4B 3SRKA 3A4XA 4TTGA 1EJVC 4DELA 5A6AA 2E5BA 1EPVA 3CK5A 2W6RA 4IQLA 4P8UA 1EJ7L 3OO2A 5SWUA 5K4ZA 4KEUA 4LCRA 1BVWA 3WDRA 2ODOA 4H7VA 3EA2A 1Q6OA 1UR0A 4MDPA 3OG2A 3VPLA 5A6BA 1YPFA 2BVTA 1JIBA 3G3MA 5BU6A 3F5JA 5DMNA 4CCZA 1H41A 4MZYA 4C1NB 4GK8A 5HMFA 4NRRA 2G3NA 1OEPA 1TV7A 4QE1A 5HK4A 3TTOA 1UWUA 5FOOA 5FJOA 2PWUA 4XBJA 3WK0A 3UWZA 4NAFA 4PMDA 1U2YA 3IVUA 4O1AA 3R4IA 3OLEA 1YE4A 3AMKA 2VC7A 4Z2KA 2YZ5A 2I1OA 2EG7A 3EXTA 4JQAA 3CEPA 1ZAIA 1H5YA 4XK2A 2ZX7A 5LNSA 1WZKA 1YPXA 1P5BA 3S4TA 1EJWC 1XP3A 2VGBA 3DH7A 4GQBA 4ZXOA 2AL2B 1FWAC 5BRPA 1W2PA 5EBUA 3T78A 3JW7A 1C7SA 3CM4A 2QDHA 3VDBA 4A35A 4IX2A 4OZOA 4UNIA 3ES7A 3LGGA 1J0ZA 2WNWA 2Y8VA 2CZFA 2ZZ5A 4MADA 3G77A 1G7UA 2Y7FA 5LA0A 3GXMA 3U4AA 4HN4A 3DFYA 1F07A 1C9DA 4QIUA 4Q8PA 4WJXA 2INEA 2EBNA 1FCBA 1B9ZA 2Q8ZA 2ZXDA 4LUSB 1ITUA 1P0BA 5A3HA 3POCA 2VP8A 4A8RA 1Q6EA 2X7WA 1VJIA 3LG3A 3LQLA 4O4VA 3CO4A 2OFJA 4JCMA 2X8RA 2O4MA 3HMCA 4FZIA 1IEIA 5C9UA 1GVRA 2YXOA 1VJZA 4MSSA 2YLAA 1JZ2A 4G5DA 1N8WA 3HGOA 5CEWA 4U5IA 3W29A 5CZKA 1B3WA 3IWPA 5CAKA 4G2DA 4QROA 5GJMA 4MYXA 4A29A 4BEQA 3MO4A 2WPBA 4JX4A 3UWQA 3THDA 3DYPA 7TIMA 1R0MA 3SCVA 4GUJA 4HPNA 4HQVA 1F74A