2BXVA

Dual binding mode of a novel series of dhodh inhibitors
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
367
structure length
360
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual binding mode of a novel series of DHODH inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE
total genus 133
structure length 360
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bxvA00
2QUVA 1I2PA 5DLCA 4CQAA 4J9JA 3G8RA 3TK7A 3E9AA 4JEQA 4PTNA 5IBXC 1YTKA 3LX9A 4HSNA 4K39A 3CLMA 1TRDA 4LVDA 3N2MA 4JTTA 2PRHA 4YLWA 3UD6A 3MJYA 4AHOA 3A9IA 1XKYA 5HNRA 1OABA 1F76A 2B0MA 3W3OA 3GDMA 3QEZA 4JYEA 4DF2A 4WOQA 1G4EA 5C54A 3U2OA 4I7UA 4RCXA 2J24A 1SO5A 3JRKA 1NAL1 3W1NA 5D2YA 3CWNA 2ZCGA 4AWSA 1EX5A 3W2NA 3P82A 1F5ZA 3HOJA 3IV3A 5G1TA 4Z0JA 1OFPA 1QFEA 4POCA 2GQ9A 1G69A 3O15A 2NX1A 4JD4A 3G0UA 2ZRXA 3AO0A 4FX6M 4U28A 1NEYA 1XM3A 1FDJA 1YDOA 2ZZ3A 3TKFA 4K7VA 5EBUA 2FDSA 2FB2A 5L9FA 3NXFA 3CC1A 3NR0A 4N9DA 3BLFA 1H7OA 3LV5A 4X22A 1FBAA 1CW2A 2DZVA 2ZRZA 3S42A 5H91A 1OF6A 3W7EA 1AL7A 3KRZA 4D2JA 1K7EA 2ZTKA 1YDNA 3HG2A 3W2LA 2FTPA 2F7FA 4JTLA 1OG0A 1FX6A 3NYZA 4M6PA 2ISVA 1I2RA 4Z1AA 4QITA 2WSYA 4PEKA 2PCQA 3C56A 1TTJA 2X16A 3MWAA 3E96A 1JCJA 4CCDA 2NX3A 4WOZA 4HPXA 5T26A 2ZQ0A 4FX8A 3NQAA 1O60A 3LBCA 3B0UX 1JRBA 5FEZA 3PG8A 1VCGA 1H1ZA 3NAVA 2G97A 4C1KA 3LB0A 5BOOA 2DZSA 2VFEA 1R2SA 2P1FA 5CZSA 2WNZA 2ZRWA 4AMAA 4JTEA 5D2WA 5ABTA 1TPH1 3IIVA 3IIPA 2CZFA 3QQ0A 4GUJA 2FJKA 3WK3A 4M6VA 1EP2A 4CNPA 1IXNA 2E1DA 1Z41A 1OYBA 4S2BA 2WQPA 1M7OA 2X2GA 3A5FA 4OV4A 5U7SA 1WBHA 5FF4A 4EVZA 4DXVA 1ME9A 3LI1A 3QPZA 4LT9A 3FJLA 1DQXA 5KTLA 1QPQA 1OVDA 4G1KA 3QRHA 4XQ6A 1HL2A 5KZEA 5CGQA 3S5OA 3CM4A 3D0CA 3NGJA 1Q45A 1GTEA 4FF7A 4X9SA 2DZTA 2RH9A 1ME7A 1W31A 4NUWA 4N4PA 1T99A 3M16A 5F2MA 3THQA 3W85A 3LCLA 2ZZ4A 1W3NA 5BW6A 3LI0A 1M7PA 3R13A 3S0CA 1I4NA 5AHLA 3LRMA 2CLEA 2Y62A 1Q6LA 1Q6QA 3ABOA 2F84A 2YW4A 4JICA 4UMBA 4XKYB 4Q4KA 1DORA 3NPWA 4UFKA 3HO8A 3ANYA 2IQTA 1ZALA 1UBSA 3UYCA 2A4AA 3BPWA 3TXVA 3EX4A 3NNTA 5CG7A 2H90A 1FCQA 3O1NA 3T78A 1JQVA 1T96A 1TV8A 1XCFA 3A23A 1GVRA 1KM4A 5KZMA 5AHEA 3GX9A 3W7GA 3B0VC 3P62A 1D3GA 1GEQA 4JTIA 3NG3A 4Q33A 3LRKA 2A6LA 3DGRA 2VFIA 1F2JA 1Z42A 1ME8A 3STGA 5CKSA 4GNJA 4Y8FA 2VFGA 4QNEA 4RK8A 3PUDA 1L2UA 4KKXA 4YCPA 1YXCA 5EY5A 3G8EA 3W1PA 4H6KA 5AYXA 2Z1BA 5EA9A 4JS3A 5F2LA 3IIXA 2VFFA 2QKFA 2NLIA 5FESA 4KFNA 4QNWA 5D2VA 3WJSA 3LCIA 3M47A 4N9CA 2E68A 1HFBA 5KZDA 3MHFA 1WAUA 4UTTA 3QFEA 3KVKA 3Q94A 2QJHA 1QMLA 2RDTA 3TU9A 4M7TA 1T0OA 4FX7A 3M0ZA 1FQ0A 1C9DA 3TIMA 4UTTC 4NX5A 4HNUA 4UTMA 3MO7A 4AF0A 4NQ1A 2Y63A 5HULA 3VE7A 4AEOA 3UWVA 1SZEA 4RZ5A 4TO8A 3G1DA 4UR8A 4HNTA 1VC4A 3IVUA 1TCDA 4NU7A 1KFCA 3BGJA 4A2SA 4BWLC 1XC4A 1FY6A 3TV8A 2DZPA 3W83A 2HSAA 3W6YA 1B4EA 3W2KA 4KWVA 4NZJA 4GUGA 2RDWA 5A5WA 4PCFA 3F4WA 1EP3A 4TIMA 1IGSA 4MZ1A 3MP4A 2EKCA 3N73A 3P80A 3WK1A 4JTUA 4MY1A 4NNBA 5F1UA 3EX2A 2QCLA 3NM3A 1Q3NA 4O0ZA 3UPWA 3W1XA 3PG9A 3M5ZA 1MO0A 3VI2A 3OBKA 3NQ7A 4KFPA 1FCUA 3EB2A 2QCHA 4KFOA 3LHTA 3CB8A 1KFEA 3CEPA 3BG5A 3FLUA 4ZQCA 5FEXA 2DJLA 4IQLA 4Z1DA 1OK4A 3FIGA 4M6QA 1UJPA 4DPPA 4BI5A 1LTDA 1PCKA 4MZ8A 3NO5A 2YGYA 1EB3A 3H54A 3TMLA 2Y7EA 3GDLA 1H50A 4FIQA 4ZQOA 4RJEA 1XBYA 3CEUA 3NL5A 3IVSA 2HTMA 2NXHA 2QAFA 4EF9A 3R89A 2P0OA 3GYEA 2ZBTA 3GK0A 1WBJA 3FKRA 2NXIA 4M7SA 4U4MA 3B03A 3W1MA 1G7UA 2QJGA 2VXNA 3ABRA 4E2BA 3PS7A 3O6CA 5HJLA 4ONVA 2QR6A 4MLRA 5I3JA 4O28A 2ZRYA 4JIPA 1TJPA 3W7QA 5LZLA 1UCWA 1ZCOA 3DI0A 3FFSA 2FPYA 4L4LA 1QPNA 1SFLA 1XDLA 5F4WA 2QDGA 4ZQMA 1XDMA 3MBFA 1XUUA 2EF9A 3M44A 3S9YA 1O94A 5TQLA 1VYSX 2BWGA 3RF9A 2GQAA 2PRLA 1A5CA 1H7XA 3W84A 1FCVA 1FWTA 3BW4A 2E5DA 4WQ6A 2XN0A 3VNDA 2ATMA 1S5VA 3LGEA 1IXOA 3O05A 3A24A 1JUEA 3QMRA 3R5EA 3DI1A 3GLCA 4LU0A 1VJIA 4RX0A 5I3KA 1HO1A 5FF2A 1K8XA 1OF8A 3H55A 4PL1A 1Q6RA 1N7KA 1LLZA 4GRSA 1DBTA 4Y90A 4I9AA 1F7BA 3W2UA 2RHGA 2I14A 3W2JA 3QH2A 3LHYA 3HGRA 2BTMA 4JDBA 3IIOA 4TX9A 2V0TA 1TJRA 5KITA 1EPXA 3L9CA 1YXYA 4JTFA 1OYAA 4H4IA 4HNVA 1OFRA 1W54A 2WO5A 1WA3A 2B7QA 1RZMA 2ZFAA 4HIBA 3TA6A 1RPXA 1B3OA 3EWBX 1A5BA 4K37A 4RZ6A 1VR6A 2HS6A 2J9XA 3JS3A 4HPJA 3HMJG 3UZJA 4O17A 3HPXA 1KM0A 3PR2A 4LC8A 1LP6A 4MOZA 1ALDA 3W1RA 3LM7A 4JN6A 5BMWA 3KRUA 2QCFA 1ML1A 1EP1A 1G7VA 4P2VA 5AFDA 1LCOA 4AVFA 3MI2A 3LLFA 5AHMA 5C2XA 3S5NA 3GAYA 1P4CA 2JKEA 1WOBA 1F6KA 3ATZA 4DF0A 5D05A 3THAA 3MI3A 3KX6A 3CHVA 3NEVA 1H1YA 4A22A 2Y88A 4MPQA 3V75A 1N8FA 5EKYA 1FCBA 5EYWA 4NNAA 6ALDA 4DEFA 3TCEA 1JULA 3M9YA 3QMSA 2QCEA 3KAOA 3VKJA 3W23A 4DPQA 1VZWA 3F4NA 3CU2A 1ONRA 2YFNA 2C19A 3P5YA 1K8YA 1OFAA 3HIJA 1TTIA 1YYAA 2VKZG 1Z48A 3UWZA 2CLLA 4WY0F 5LKYA 1WYIA 4I7VA 3DKJA 3R12A 3W1UA 3WJXA 4X2RA 1O5KA 1CX9A 5CZTA 2FFCA 3W7PA 2V2DA 4JX5A 5DBTA 3TUUA 1JJKA 1XXXA 3OEXA 4PC8A 1JVNA 4EIVA 4DQWA 1I45A 1DOSA 4WXZA 3BW3A 1V5XA 4FNUA 4ZQNA 3NZ1A 8TIMA 1QR7A 4XTIA 4MUZA 2EAWA 4ZQRA 3WK0A 1THFD 3CPRA 1LBFA 4Y96A 1ZAJA 4HHPA 2EPHA 3RMJA 2ZRVA 3G1VA 2ZZ2A 4YWIA 1KFJA 3U8GA 3G1XA 4HSOA 4BF9A 1R46A 5D04C 2JKAA 2QCNA 2WV8A 3QC3A 1G4PA 1K7XA 3LCWA 2JK2A 3P7YA 3DH7A 5LHFA 2CLFA 3W7KA 3NDOA 2J27A 3QW4B 2ZZ5A 2ATSA 1LZOA 3L0GA 4FNRA 3GIYA 3O6YX 3BLEA 4FNTA 4Z1BA 4RR4A 1SFJA 3G24A 5BMXA 1BEUA 3BW2A 4O18A 3GDTA 3L21A 3LXAA 2B7OA 1M5WA 5AYZA 5CSRA 4UXDA 4N9EA 2C15A 4JTJA 3TW7A 2R14A 3RLVA 3NQCA 3VCRA 4DELA 1O5XA 3NQ8A 4JTGA 1R47A 1ZFJA 3QZEA 1GVSA 1K03A 3O63A 1H7WA 3I7SA 1G6CA 5K4XA 1KTCA 1UUOA 4UTLA 4FIRA 4LWWA 4LS2A 2ZDRA 3FS2A 4LS0A 3W7HA 3NQ2A 3TFCA 2WJZA 4O8RA 2OJPA 3QW3A 4ICNA 2QEZA 2VFDA 1AW5A 3LRLA 4PODA 5AC7A 2ISWA 2KZHA 2BSLA 1PV8A 3NQVA 3MBDA 4O14A 2YR1A 3RK8A 1LBLA 1YPFA 3E12A 3W7DA 3LHZA 1FXPA 1OHLA 2HS8A 4R53A 4P61A 5K9CA 3L68A 4AWTA 2WNQA 1UUMA 1SPQA 1ZNNA 2NWSA 3UNDA 3STEA 4MFDA 5LHEA 1YDVA 2BXVA 2EGZA 2JGQA 1PS9A 4AHPA 5E93A 1VYPX 3W75A 2YYTA 4ZVJA 5G5IA 5G2HA 4QJ1A 1JUKA 1KBIA 4CCCA 1XFBA 1KLZA 3HQ1A 2A0NA 2DZWA 3CQ0A 3KRSA 4GWEA 3W87A 4GUIA 4N6FA 4O0KA 3O6DA 3L2IA 2TSYA 3C4UA 1KFKA 4GXMA 4IXHA 5EL1A 1NF0A 1CI1A 4E2DA 4BK9A 1LRTA 4K36A 3T44A 4LV4A 1DVJA 1VHNA 1JCMP 3G3MA 4N6EA 1SW3A 5E0KA 5IBXA 4EF8A 4QQ3A 3GAKA 3ZWSA 3QJAA 1JCXA 3MW7A 4ZQPA 4O1CA 3G18A 3SECA 2YFOA 3PUOA 1IIGA 3W70A 2Z6IA 3BLIA 3CWOX 3S1VA 3I68A 4FO4A 4WX2A 1AK5A 1XL9A 2GVGA 5MHBA 4K8EA 2QF7A 1SO6A 2QCDB 1B57A 3QQ1A 4N4QA 2G95A 3KVMA 3G3DA 5CSSA 1BWKA 3L5AA 5DY2A 3TJLA 1L9WA 3N3MA 4YCOA 3DFSA 1VHCA 2HMCA 1NF7A 4UC5A 3TE9A 4GJ1A 3W7NA 3UQNA 1TTQA 1W0MA 1FWNA 3Q2DA 1Y0EA 3W7OA 3N9SA 3UWQA 3OVQA 4GE8A 4QISA 2GQ8A 4N9BA 1SSDA 3P5ZA 1VRDA 1GG1A 4MFEA 4DO5A 3EWUA 2OT0A 3T55A 2YSWA 3O8AA 4LW7A 1R30A 1SO4A 3W76A 1R2TA 1SZNA 4WY0B 5HINA 2TYSA 3TQ0A 1MXSA 3BV4A 5K2ZA 3C2FA 4LRTA 5BRBA 3PULA 2DZXA 3Q37A 3I7QA 3MHUA 3DFQA 2BX7A 3T7VA 1TPUA 1VLWA 2AQWA 4X3ZA 1SU5A 2Z0IA 4R7JA 3CIWA 1ICSA 4FXSA 3S5YA 3KVJA 1L6WA 1YXDA 4IGHA 3SW6A 5HUPA 2YXGA 1GYLA 2O7QA 5AN7A 1FDYA 2V30A 4I7WA 5F2GA 5FEWA 3HG5A 4DF1A 3P84A 1NSJA 1GPWA 3EKZA 4IMCA 5J5DA 2NV1A 1JRCA 4Q32A 2QAPA 3MUXA 2ZA1A 5I3IA 1SR9A 2RDUA 4XBKA 3PSVA 2VFHA 1VS1A 4O57A 1QPRA 3WJZA 4UTWC 1KM6A 4FNSA 1C8VA 3PC0A 1GVOA 5F4XA 3B06A 3TX9A 3TW6A 2G96A 3K30A 2TRSA 1IXQA 1QO5A 1FWSA 4JTSA 1TTPA 3G1FA 3IGXA 1KW1A 4QIUA 3LTPA 1SW0A 4UTWA 1K8ZA 1GVFA 5DCBA 4FNPA 3W74A 1J4EA 2ZTJA 2FPVA 5E1QA 1TQXA 1EUAA 3G22A 5HWMA 4O4WA 2RKXA 4A2RA 1RQHA 4O16A 3HG3A 5LNRA 3UXAA 2J88A 5KINA 3L0NA 4O54A 1W56A 1IIHA 2FQIA 3O16A 5I3HA 3PAJA 1F05A 2TMDA 1ZENA 1OX5A 3SIZA 3SJ3A 4IX2A 3DFPA 1ZAIA 1X1OA 2ALDA 3W88A 3M41A 2X1RA 4OE7A 2CZDA 3PF3A 1OFDA 2J9ZA 5G1YA 3E49A 3SR7A 4JYDA 1OFQA 3YPIA 2GJLA 1QWGA 3L5LA 5LSMA 4MKNA 2VEKA 1QDSA 3P8JA 5HQEA 3UZ5A 1Q6OA 1SO3A 3IVTA 3OVRA 1EIXA 4ZMGA 5LNVA 3OA3A 4UUIA 3P60A 1JQXA 4GC4A 3TQKA 1FWWA 1ZAHA 1XUZA 1EUNA 2C6QA 1H7NA 1X8FA 1X6UA 2JBMA 1S5WA 4UMCA 3W7JA 3P67A 2E5BA 3TDFA 2ZZ7A 3C52A 1FUYA 4R33A 3M1ZA 3L67A 2YW3A 4MJZA 3IGUA 4PA8A 1TSIA 4XBSA 4YXGA 3QSRA 3W7LA 3FOKA 2P10A 1LRNA 3LCHA 2A21A 3MHGA 3L65A 2LLEA 4WXYA 4UIOA 1KTNA 1X1ZA 3PBVA 4NT0A 1TRIA 4K6AA 3G1YA 1VGAA 3LCGA 2I1OA 1HUVA 3M5YA 3TJXA 3NPVA 3W22A 3UWWA 1K3UA 1EA0A 3RLUA 3KVLA 1H60A 3M5XA 3PB0A 1G67A 4OQVA 2A2IA 3HPZA 4NJJA 4NXKA 5FF0A 2J9YA 5K4ZA 1S5TA 3NPUA 1RQEA 5D09A 3G1AA 1TV7A 1W5OA 4O1AA 3BGGA 5C5YA 2CLMA 4M5PA 1VYRA 4PL2A 3EXTA 4OV9A 3C2OA 2E09A 2FB3A 4Z1CA 4O10A 1W5QA 4UTKA 1D9EA 2UV8G 4AXKA 3G1HA 1JCYA 3W1AA 1F6PA 2FIQA 4JTHA 3C6CA 4S1FA 1B4KA 2C18A 5D2XA 5DBUA 1OK6A 1EWEA 1OFOA 3DENA 2DP3A 3BG9A 3UWUA 5HR6A 1SZGA 5TBOA 3OIXA 4HKPA 2QUUA 2GVLA 1PVNA 3QSTA 3NQEA 3EWWA 4NJIA 4Y6GA 1UASA 2A1YA 3ZWTA 1TPFA 3NVTA 3SSJA 2CFFA 2R94A 2DORA 4QSHA 1I8JA 5I3GA 1VQTA 2Y70A 2A7PA 3ELFA 1KFLA 1TREA 1AMKA 5AYYA 3DBPA 5D38A 2OT1A 4AB4A 4LTSA 4N02A 4MZYA 1TPVA 1VCVA 3HB9A 1A5AA 1VPXA 3EWZA 4BR1A 3EX1A 2AGKA 3N14A 3B04A 2ZZ6A 4IMDA 4ZZ9A 2NUXA 5DCEA 1ADOA 1MSSA 4XZ9A 3W9ZA 2QDHA 3SY5A 2EHHA 2C1HA 5KSWA 3LERA 1K02A 1JR1A 1KLYA 4HNNA 3PB2A 4TU1A 4MIMA 2YZRA 3EX3A 3DFOA 4FNQA 1TPB1 4LUJA 4XWUA 5BNKA 2PE4A 1LORA 4CCEA 3TQVA 2G5WA 3LDVA 3LCXA 4O1BA 3TC7A 4ZL1A 4IMFA 5C6MA 1DJNA 4IMEA 1KV8A 2JGYA 4DO6A 4BWLA 4BI6A 3MP3A 2Q3OA 1TV5A 1RVGA 7TIMA 3W2MA 2YPIA 2E6AA 1OFBA 3GKAA 1OFEA 2A5HA 3EEGA 3ZR4A 4ML9A 3CTLA 1NFBA 2WSQA 2O7SA 5F2IA 3ZFHA 4ORIA 2QJIA 3TMQA 5U4NA 2FPTA 3NM1A 3C2EA 1QOPA 5DELA 3QYQA 2GVJA 4O19A 4RXGA 2C0AA 1MEIA 3BARA 1H51A 3UY8A 2ZZ1A 2E5CA 4M19A 1L6YA 3LHVA 1XI3A 1EWDA 2R8WA 2CW6A 1U5JA 3STFA 3F03K 4XKYA 1GZGA 3GKFA 3LXBA 3MP5A 1AG1O 4S2CA 3S5ZA 3S1XA 2QCMA 2X30A 2V2CA 4MY8A 5IM51 1JCNA 4AHQA 3S6DA 5F4SA 4L4MA 2ABBA 5HUOA 1KM1A 4CNNA 4N2YA 2ZA3A 1GYNA 4UTIA 2GPTA 1DJQA 4DBEA 1W37A 3NA8A 3EXRA 2W6RA 1V7YA 2W0UA 2NUWA 4UNLA 1UB3A 1IXPA 3LHWA 2V9DA 4LNYA 2PC4A 3U6WA 3W1LA 4UFHA 3PBUA 3PSWA 4MVAA 3L5MA 3LCFA 3QMTA 4RXFA 4WZHA 2CWNA 3B05A 4MY9A 5CPNA 5FF3A 4Z08A 4ADTA 1ICPA 1N55A 1WQ5A 4YL2A 4NVTA 4JYFA 1W5MA 4JY9A 5A8GA 2C13A 1J2WA 3ZS4A 5D37A 1OYCA 5DXXA 3W86A 5K9XA 3DHDA 2NZLA 3PWAA 1E51A 3KFTA 1GWJA 3LV6A 1KM5A 3W72A 5AHFA 3H53A 3MMTA 1KM3A 4JIQA 1ZJIA 1TIMA 3GDKA 5AHNA 1S3HA 3DFNA 3NL6A 4AF0B 3F1QA 2VELA 5G4WA 1OX4A 1GT8A 3TSDA 3N2XA 1KBJA 3N9RA 2WNNA 4HN4A 4LVGA 2V8ZA 2YCEA 3DFTA 2AAMA 3LLDA 3QPYA 4LC6A 4C1LA 2OCZA 2NV2A 3MYPA 2H3DA 3LOTA 3O06A 4YMZA 3IEBA 3P8IA 3LTYA 1EEPA 1M6JA 4JR5A 2DU2A 2VEMA 3PVFA 1JCLA 4OBTA 4GUHA 1XBVA 2W79A 1PHQA 3EXSA 4QM1A 4K8HA 4ADSA 3O07A 1QCWA 2WKJA 4NZFA 1MEWA 3WK2A 1DHPA 3NZRA 4EOUA 3GB6A 4NJKA 5CPLA 4E0CA 4K7YA 5EPDA 3PUEA 5CZ0A 1YLVA 4OT7A 4UNKA 1F73A 1KTBA 2VENA 4TMCA 4QAIA 1T8XA 1LBMA 1LYXA 1J5TA 3GVGA 1DL3A 4XTDA 3W1TA 2Y85A 1U83A 3DHFA 1AW1A 1O4UA 2NXGA 1TPEA 3TC6A 2H3BA 2Q8LA 2CLIA 3GXPA 2WSRA 1AL8A 1PL9A 3QF0A 4KWWA 4AH7A 4RV8A 3UY7A 2H8XA 4Y9AA 3C61A 5D30A 3W7MA 5DXYA 4CQ9A 1W5PA 1H62A 1W8SA 5GVJA 2VEIA 5K9DA 3OHIA 3BO9A 5AC8A 4O11A 2R91A 4WD0A 4DBDA 3KOFA 4FXRA 2Y7GA 5FEPA 2NX9A 1YPIA 1G4SA 3I7RA 2DZUA 1WV2A 4NJGA 1WX0A 4O50A 3B0PA 1KFBA 5FI8A 3BG3A 2GOUA 4WJEA 3M7WA 2ABAA 3OG3A 4UTHA 4OHQA 5AHIA 5SWUA 3HF3A 4UFMA 1LLWA 3DU0A 1X7FA 1FWRA 1W1ZA 3C8FA 3DKLA 4A3UA 4AWUA 4JY8A 4MYAA 5AB3A 2CZ5A 3VE9A 4O53A 3GXNA 4NJHA 2PRMA 3SFKA 3GR7A 4O52A 1SQ7A 3A21A 3RNDA 5AOUA 4A21A 3W7RA 3AJXA 1LOQA 2VOMA 1GVQA 1QO2A 1LDCA 5D03A 3TROA 4JX4A 4TR9A 3HGOA 1QAPA 2ISSA 4XUGA 1FDZA 3I6RA 1VCFA 1TQJA 4IPJA 4IPIA 1P0KA 4UR7A 5CPMA 1QNVA 3TR2A 3UWYA 4LUIA 3TAKA 4WY0A 4FB7A 3HJZA 4FEZA 1TO3A 1SZFA 2Y7DA 3PM6A 3NL3A 5G2IA 3KHJA 2VEPA 3N19B 2E6YA 6TIMA 3IIZA 1BKSA 2CLKA 4GBUA 1OJXA 3DAQA 2H8ZA 1FXQA 3TFXA 5CZJA 1W3IA 3NL2A 2YDAA 3CIXA 2RFGA 3PBYA 3W71A 4ADUA 1P0NA 2CLOA 3GNNA 4AAJA 2BLEA 4OU1A 4R34A 1GQNA 2C16A 4GUFA 4B5NA 4JNMA 1YTEA 3NQMA 4IX0A 3T4CA 1PIIA 1LOSA 4RLIA 1I2QA 3NQDA 4MYXA 3WJYA 5D02A 5LNWA 4O13A 1PCWA 2FLIA 2NWRA 3RU6A 5C55A 4JX6A 1YADA 1HO4A 5G4EA 3NQ6A 1MEHA 4ALDA 3P74A 4CNOA 2X1UA 3UPBA 1BWLA 1YTDA 3M43A 4BFAA 4OWGA 4LS1A 1A50A 2QUTA 3INPA 3M6YA 3JR2A 1ZHAA 4JGDA 1A53A 5EMUA 4IUOA 3KXQA 1GOXA 5DCDA 3SZ8A 2Y61A 1WOAA 4LVAA 2YYUA 3EKLA 1TPWA 1RV8A 4IXXA 4RKAA 4BI7A 2V2HA 1O95A 1LRQA 3BK0A 4A29A 4RZ4A 1LROA 2J6XA 3STCA 2OMAA 4HT3A 3NQGA 3FJ6A 3W7CA 4NXSA 4OGZA 4UTUA 1XBXA 2Z6JA 3LTSA 4GFSA 5L6UA 3E02A 2A85A 3L0KA 5I3FA 3ABQA 3G1SA 2Q8ZA 4CQ8A 1WDWA 1L6SA 3TAOA 3G0SA 5LNSA 2D73A 2BZNA 1W5NA 4LVFA 3T40A 3TNOA 3MYOA 2QCCA 3TSMA 4O1DA 1TYGA 3C2RA 4PH6A 3S1WA 4Z0SA 3SGZA 4CLMA 4UMAA 4EWND 3L66A 2CU0A 1ICQA 2V5LA 2NUYA 1OX6A 2CLHA 3MI6A 4ORMA 4UFIA 2X1SA 4IMGA 2Q3RA 4TMBA 1D3HA 4JXCA 1TPC1 4JTKA 3NQFA 2GUUA 3V1PA 2E6FA 1RR2A 1H61A 1LM1A 2X1TA 2Y6ZA 2Y89A 4LY8A 1MZHA 2XN2A 3W07A 4K38A 4IWWA 4UCGA 3LHUA 2Z2UA 1DV7A 5HR7A 1G4TA 3LBMA 3S1UA 3W1QA 1GTHA 2C14A 4FHAA 4LVBA 4O4VA 5AC6A 5FF7A 4O15A 3Q58A 5KMYA 1WXJA 5DN1A 3N34A 3GNDA 1C29A 5LGXA 1LOLA 4UFLA 1HG3A 3P81A 3NOEA 2A6NA 3WFAA 4JDYA 3SGUA 2PURA 1IF2A 5H2ZA 1KA9F 3HG4A 3PY2A 1DKWA 2OX1A 1ZY9A 3UXDA 5HMSA 1KM2A 1AW2A 1B9BA 1SUXA 5K7JA 5D2TA 4NX0A 4O12A 2H6RA 3W73A 3TXZA 3TH6A 2B7PA 3IGSA 1K7FA 2OZ0A 1VLIA 4LOCA 2WPBA 1HTIA 2ZA2A 3QM3A 4H3DA 2B7NA 5HWNA 2DJXA 1GG0A 3VFLA 3FKKA 4PFMA 1TMHA 1QOQA 4NNCA 3FEMA 3SI9A 1H7PA 1F74A 1TPDA 3GR8A 2B4GA 1TB3A 3GZ3A 3USBA 3HGJA 1KV5A 5K3VA 5HWJA 3M5VA 2VC6A 3LXCA 5LNUA 1SW7A 3A5VA 1PE1A 2JKPA 1I2OA 3FYOA 2V5BA 4IJBA 1GJPA 3S8HA 3GDRA 3ABSA 2E77A 1BTMA 2A7RA 5DY3A 3C0JA 3TSBA 4DO4A 5J5RA 3EX6A 1JUBA 1DQWA 3GXTA 3ATYA 1W3TA 3R2GA 5LGZA 2CZEA 3R8RA 4W9TA 3CT7A 3B4UA 3FYPA 1A5SA 2ZYFA 3PBWA 1I2NA 3C3NA 2YX0A 1RD5A 3E0IA 2ZRUA 5CPOA 1P1XA 1NVMA 2I9EA 1RQBA 2WOQA 2TPSA 2XFWA 3B8DA 3EWYA 3HGSA 2QCGA 3RFAA 1H63A 1XBZA 4IOTA 4UFJA 3W7IA 3EWXA 4MLJA 1Z44A 5G2WA 2A7NA 4LV9A 4E38A 1QPOA 2XN1A 2C3ZA 3HBLA 1P5BA 2V82A 1OX4B 3P61A 3WJWA 2Y7FA 4LRSA 3HPSA 2QCDA 2V81A 3I65A 3A22A 4WUIA 1VH7A 3C2VA 4MJMA 3OVPA 3IRDA 2E6DA 3DXIA 5D33A 3FA5A 3NPXA 1PHWA 1H5YA 1R2RA 3BVJA 5F1VA 5D32A 3G0XA 2GJNA 1SSGA 3DZ1A 1H7RA 5TIMA 4UTJA
chains in the Genus database with same CATH superfamily
4IIEA 5DLCA 1R85A 1FRBA 3G8RA 4HQVA 3E9AA 4JEQA 1JEZA 4IP7A 3K2GA 3CLMA 5J8LA 1Q65A 4JTTA 4WJ8A 3BMWA 4JEJA 3ZVHA 1C91A 3ARPA 3AS1A 3U2CA 3VIKA 2Q01A 3GDMA 1B3ZA 4P5UA 4B3ZA 3AXHA 2HV5A 3GVWA 4I7UA 4D6HA 2PDGA 3DBNA 9XIMA 1Y5XA 3JRKA 5CJNA 2ZCGA 4AWSA 4KMQA 1XLIA 3WDJA 2JEPA 3HOJA 1OINA 3V35A 2VVNA 3BLPX 4GFIA 4LNCA 3UYIA 1X97A 1W32A 1VD6A 3Q45A 4DWDA 5J04A 1XM3A 1FP9A 2ZZ3A 3SQMA 2VX5A 3TKFA 2D2GA 5EBUA 2FDSA 5L9FA 1V51A 1H7OA 2WAGA 1FBAA 4A3QA 1CW2A 3S42A 1V02E 3SCSA 1OF6A 3W7EA 3MU7A 3NTYA 3R4IA 1K7EA 1QVBA 2PODA 3HG2A 1OD0A 5DQPA 2FTPA 1FX6A 2ISVA 1I2RA 5MKGA 5DMNA 2FZDA 1TZZA 2PCQA 2C7FA 4HSHA 4J27A 3PTKA 2ZC8A 4MSSA 4H6EA 3MMDA 4FX8A 3SUTA 3PTQA 3NQAA 1P6BA 3LBCA 3WDIA 2XINA 2Q71A 2PWHA 2G97A 1XRSA 2DZSA 4GI9A 4TOQA 4H2CA 1CXKA 2P88A 8XIMA 5FJJA 5HNUA 2UBPC 2QIWA 1RP9A 3LYEA 4JTEA 5D2WA 1MQQA 3TN6A 4OOZA 3LPGA 4IL2A 5JMUA 4AD0A 4M6VA 1EP2A 3GHSA 4L9YA 4J3XA 2WQPA 5U7SA 2X1IA 4LT9A 4UQDA 2Z7GA 3FJLA 4W85A 1QPQA 4A4AA 1Q7MA 1TVLA 3QRHA 4JZ5A 4XQ6A 2E1WA 3WMLA 3LNPA 1XLCA 3OPSA 3SQLA 3NGJA 1DQUA 1Q45A 4YTQA 2DZTA 1KRBC 4NUWA 4I9MA 5F2MA 2Y0FA 4PUNA 2ZZ4A 5BW6A 3LI0A 1I4NA 5HJXA 5A69A 1H1NA 4D8ZA 3LRMA 2BVWA 2CLEA 4PR4A 3ABOA 4QRNA 4U5IA 2F84A 3ARXA 2DZBA 2YXOA 2FVMA 2IQTA 1WXZA 3QZAA 3UYCA 4H2HA 4N7QA 3NNTA 2E9LA 2O92A 2NSOA 1GW9A 2C0HA 3M0VA 1P48A 1KM4A 3E38A 3GX9A 3P62A 1WPCA 3H21A 1UQYA 3D3FA 4Q33A 4L64A 5E0FA 4MTVA 3STGA 1CXIA 2AMGA 4GI6A 4AZ7A 1UWRA 3LSBA 4QNEA 2X2YA 2G3IA 3T0CA 1XR2A 1YXCA 4JQ2A 4XK2A 3G8EA 4H6KA 4GY7A 4F66A 3OBAA 2ZE0A 4LX4A 2J8GA 4W7UA 3WKZA 2XH4A 1RLCL 2WJDA 4FOJA 5FESA 2WZEA 4KFNA 5I78A 3LCIA 3M47A 4N9CA 3E74A 4UTTA 3QFEA 1NELA 2QJHA 2WMIA 1TWZA 4GYPC 1RHCA 3B8WA 3F2BA 1QI4A 3VOCA 4Q4PA 4NX5A 3IUHA 4UTMA 3MO7A 3UG5A 4NQ1A 5HULA 3UCCA 3ZIZA 4AEOA 1JZ3A 4A3RA 2PZNA 1EBGA 1QK0A 3G1DA 4DNMA 4JTRA 1VC4A 1TCDA 1NOUA 4P7QA 2GLKA 4ZODA 1QU4A 4HHHA 3WLMA 3OYXA 3UG8A 3W6YA 3UZZA 2IKHA 3VIHA 2YL5A 4PCFA 3AZTA 1C93A 2FDMA 1AVAA 1E0TA 1TG7A 1SYTA 1GHSA 1Q6DA 5F1UA 3BANA 1ONWA 1B31A 4RPPA 1NOFA 3WMCA 7REQB 5JU6A 4KFPA 4MMWA 4LJ3A 4KFOA 3T8LA 3LHTA 3CB8A 3BG5A 5FEXA 2I5IA 3KOZA 2ZICA 1UJPA 2C91A 1EXBA 1OIMA 2P0IA 3DHUA 1EB3A 3H54A 2Y7EA 1H50A 4ZQOA 3LMYA 1XBYA 3BLOA 2ZBTA 1WBJA 3GK0A 4GCXA 2E8ZA 2NXIA 1ISWA 5C9ZA 3ZLGA 4HMDA 1YW1A 1XH0A 3B03A 1G7UA 1KFWA 3QV8A 1HIZA 2VXNA 3BDKA 4E2BA 3PS7A 3O6CA 3URQA 4MLRA 1HJQA 2ZRYA 1S3TC 4JIPA 4Q4MA 3W7QA 1R5YA 1UCWA 2UY5A 1LUCA 1HJWA 3L2MA 4ZSTA 3FFSA 2WZTA 3RO6A 1EC7A 1SFLA 1XDLA 1XISA 2ZUNA 3DG3A 1BPLB 3F4CA 1XUUA 1PWMA 1VYSX 2FZBA 2BWGA 2HPMA 1A5CA 1H7XA 2DIEA 2E9BA 3CUJA 2P8BA 2V69A 4Q22A 3BW4A 3IV8A 3MSRA 4E8CA 2XN0A 3VNDA 1S5VA 1RSCA 3A24A 2OLAA 3B8UA 4LF2A 3QMRA 3R5EA 3LSCA 3DI1A 1VJIA 1K8XA 4W4QA 1R3QA 1TVNA 3H55A 3KL5A 5LIYX 1LT8A 1DIDA 3W2UA 4S3JA 4YU1A 1XG4A 1H09A 4IH3A 5TNVA 3N11A 4NASA 4FAMA 1GYMA 3HGRA 4JDBA 1I0BA 1YX1A 2V0TA 2BHUA 1BFNA 2GGHA 1OYAA 4L80A 2BGNE 5C9UA 4DZAA 6ENLA 1XCXA 4S3KA 4EAYA 4W5ZA 5H8PA 1RPXA 3EWBX 5I0DA 2HS6A 4HPJA 1FFRA 4O17A 3HPXA 1GZJA 1KM0A 2IPWA 1UOKA 3PR2A 4MOZA 2XGBA 1CT5A 3SFWA 1KGXA 2Y5EA 2QCFA 1ML1A 1RALA 2DUAA 4ZTYA 5C2XA 4YTRA 1BLIA 1P4CA 2JKEA 1FHDA 4DF0A 3B9NA 3HURA 1CPUA 3MI3A 4A22A 2Y88A 3V75A 1N8FA 1J0KA 3UG3A 2HZGA 3B3DA 3S46A 1JULA 1EJXC 3LGDA 2J7FA 3RCMA 3W23A 2XJ7A 3CU2A 4CVUA 3P5YA 3HIJA 3MDWA 5EFFA 2D24A 3SEPA 5JUVA 3WQCA 3OGSA 4WY0F 3DKJA 4QCFA 1O5KA 1CX9A 1J6OA 3G1RA 5CZTA 3W7PA 3VK5A 3TQPA 1TFVA 1Q6GA 1UWSA 3WLKX 3OEXA 1JVNA 4EIVA 1I45A 1DOSA 1XWYA 4XTIA 4GO8A 3DUGA 4DYKA 2Q09A 1IR2A 4WJXA 2ZRVA 1FWAC 3QOMA 3G1VA 4OECA 3ZJ8A 3U8GA 4HSOA 3E0VA 4BF9A 4R5EA 5I6SA 3LCWA 3DH7A 2CLFA 1A80A 4F4RA 4GNKB 2J27A 3EWCA 3H26A 3L0GA 3BLEA 1S39A 3GNRA 1SFJA 5BMXA 3ZT7A 2FTWA 2VVSA 3GDTA 3B8SA 2B7OA 1M5WA 5AYZA 3HU7A 4C6IA 1U2YA 3URNA 2R14A 1S2AA 3VCRA 2C1GA 4S3DA 4BF7A 1R47A 1QXLA 5DEZA 1V3MA 3QZEA 2BHYA 3O63A 4PMRA 3HPFA 1WAWA 4QDPA 3VOHA 4PZVA 1KTCA 1E4LA 1A0CA 3NUKA 4LWWA 3W7HA 3WQOA 2J47A 2GL5A 1U1JA 3TFCA 4U3CA 4O8RA 4TTGA 3QW3A 3OLEA 2WSKA 1FH9A 4YYCA 3MCOA 1AW5A 1K9FA 3LRLA 4GD0A 4QS5A 4PODA 4BQ4A 2BY2A 1UC4A 2KZHA 1AD1A 1PV8A 4QG6A 4GOAA 2IKGA 2WNWA 3RK8A 1YPFA 2DT1A 3LHZA 2HS8A 5H1WA 4NAEB 5K9CA 1RK5A 3L68A 2GVYA 1VBUA 1UUMA 1Q2RA 2NWSA 3UNDA 2VWSA 3STEA 5LHEA 2BXVA 1AQHA 1X98A 4ZXLA 2YYTA 3H8AA 4JQ3A 5G5IA 3W27A 4XAYA 5G2HA 3VIGA 3AWOA 3HQ1A 2DZWA 4N6FA 3VGEA 1V3IA 1UR1A 3UXLA 1F07A 3VKKA 1KFKA 4DI9A 1NU5A 2DPEA 3R25A 4K36A 3T44A 1XYCA 4DNHA 4LYRA 4GMEA 1G5AA 5E0KA 5CBJA 1E0UA 1IYXA 4IQEA 3MW7A 5FL0A 3SECA 2OSWA 4DRSA 3BURA 1IIGA 2Z26A 5CCZA 3S1VA 5PTDA 1OIFA 5MHBA 3F4VA 3MA8A 1H0IA 1KWGA 3EYPA 2QCDB 4WDUA 3QR3A 2JIWA 5CSSA 3L5AA 5DY2A 3VIPA 2J7EA 3SRDA 2FZMA 4CEXC 4CKQA 4YCOA 3L4VA 4QBXA 1US3A 2WPGA 1FH7A 3WD4A 2VX6A 1TTQA 4PSRA 3FDKA 3GUWA 3SURA 2G3JA 3OVQA 3W82A 2GQ8A 1SSDA 3P5ZA 4PGLA 4DWSA 4JNZA 5CC7A 5E9XA 3B4YA 3T55A 3WMSA 3O8AA 1R30A 2TYSA 3AJ7A 5K2ZA 1JG9A 1BRLB 4LRTA 4V15A 2DZXA 3Q37A 2OLHA 1PXGA 2BX7A 5C0QA 1JNDA 3T7VA 2AQWA 1EJVC 2YCJA 2IW0A 2Z0IA 1DJZA 1XPYA 2XGIA 1L6WA 1YXDA 2CBIA 1DIKA 2O7QA 3O0KA 5E9AA 5CH9A 3TA9A 4F0SA 1FDYA 4H9TA 9CGTA 4I7WA 3HG5A 3P84A 3S3GA 1GPWA 5J5DA 1JRCA 5DT5A 3CXOA 2ZA1A 5I3IA 3QV7A 4HGXA 3WJZA 2DZAA 1ITQA 4L1WA 3PC0A 4XZWA 1GVOA 3GC4A 2PEVA 1PEZA 1S2VA 1B2YA 4D1IA 1RBLA 4D6CA 3EPNA 3G1FA 1WZAA 5FJIA 4ZO6A 4UTWA 1GVFA 3CS2A 3NQBA 4JQAA 1GOIA 3W74A 2WMJA 1J4EA 1QHZA 2FPVA 4ZSUA 1YQ2A 5DRIA 1E5JA 1C8XA 4AUBA 3OOQA 4K8GA 2D22A 4O4WA 4A2RA 6REQB 1BF6A 1NWSA 1SMDA 3L0NA 4O54A 4CU8A 3ES7A 2XM2A 1QI2A 2FQIA 1E5NA 3FJNA 1F05A 1F9CA 3E6EA 4Z2KA 3CHFA 3SJ3A 4IX2A 3VKBA 1X1OA 1AH4A 3W88A 2WLYA 2X1RA 4F9JA 3TONA 1ITCA 4YN5A 1OFDA 3CT2A 4PE8A 1DEDA 1REQB 2DW6A 4KIEA 1QWGA 4GA8A 3L5LA 5LSMA 4IIBA 4MKNA 4MNLA 2WMFA 2G3MA 4RE0A 3GH5A 1TV2A 3QHNA 2NQJA 3IVTA 2XWEA 5CJ5A 3B8VA 3P60A 4GC4A 4HHMA 2ZIDA 1OSEA 3CIVA 4GH1A 3H2CA 1X6UA 2VO5A 3OODA 4UMCA 4ECLA 2BXZA 3K4AA 3FXYA 2VDIA 4Q4QA 1MQPA 1XYAA 4PA8A 4GQQA 5XINA 1TUXA 3L65A 4CU6A 1X1ZA 5BCAA 1SM9A 3N2OA 4DN1A 1TRIA 3LCGA 3M5YA 3TC3A 2DQXA 3SIMA 3M5XA 3PB0A 4OQVA 4NJJA 1NH6A 4HZMA 3S1GA 5FF0A 1E1CB 5K4ZA 1S5TA 5CC5A 2QVHA 3N6HA 4KWOA 1UIOA 4XVDA 4O1AA 3ARYA 1PTDA 3T09A 5C5YA 4E2VA 4GQ0A 3EXTA 4MWAE 3N15A 1KRCC 4CQDA 2FB3A 1C92A 4UTKA 1LL7A 4AXKA 3W6MA 3G1HA 4PCNA 5BYWA 4FMVA 3LZ3A 2I16A 3R8HA 4AEEA 4L6DA 2PTWA 3BAWA 1JPDX 4S1FA 1V3JA 1UW9A 3H6OA 2QPSA 2DV0A 4XSLA 4TVCA 1EWEA 3UWUA 4ACZB 2BS9A 4Y9PA 1W9XA 3DYPA 5TBOA 4CGTA 4HKPA 3QSTA 3V0TA 3H7VA 3NQEA 2OWWA 1CLKA 4KWUA 1UASA 2A1YA 3S83A 3XIMA 1LG2A 3NVTA 1G9HA 2CFFA 3GIPA 2R94A 4QSHA 1Z9AA 2VD9A 1V0MA 1VQTA 3N1AA 1R86A 3ELFA 3BCJA 3AIQA 1TREA 2CIPA 1JD9A 1V08A 5D38A 1PTGA 4AB4A 4PUMA 3SY1A 2WVVB 1B3YA 1TPVA 1VCVA 3HB9A 4JNYA 4DUVA 3TYAA 4L1GA 4A6GA 2PDHA 4BR1A 4C6EA 4ZZ9A 4IMDA 2NUXA 1ADOA 1XSJA 3F5LA 3VINA 2VQTA 4WIWA 4Y9NA 3ES8A 3AYRA 4L65A 1W3HA 3GRIA 1KLYA 6REQA 1E4IA 3SAZA 1RA5A 3WH7A 3S9IA 2G5WA 3LDVA 1SR0A 3T6CA 4LCQA 1DJNA 2IS7A 3GU1A 2OYLA 2DQWA 4HK6A 4V1YA 4JFUA 3WNOA 2WCAA 1EF3A 3I3BA 3H7UA 2YPIA 3T08A 3WQDA 4LBSA 3QLLA 3A3HA 1PYMA 3CV2A 4WKHA 5HQLA 2QJIA 4J3TA 1A5LC 5A6MA 3NM1A 1QOPA 5DELA 3U5YA 1DWGM 1TVPA 1MEIA 1H51A 3GSMA 3QBUA 1L6YA 1R3YA 3M0LA 4HOXA 1UWIA 4A8LA 4XX6A 4Z2HA 3NEHA 5I3DA 2DSUA 1W91A 3GKFA 1BTCA 2J4GA 3MP5A 3FY1A 3S1XA 4GVGA 4MY8A 4X0VA 1JCNA 1FWFC 4AHQA 1VFMA 2PD9A 3GTNA 1YE4A 4L4MA 4L6OA 1MVYA 2ABBA 3W24A 4IJCA 1XSIA 2VRKA 4UTIA 2GPTA 1DJQA 4DBEA 4HZ6A 3OQ8A 1S1PA 5REQB 2W6RA 1V7YA 2NUWA 3TLQA 3LHWA 2VCCA 1RAKA 4S3AA 3PBUA 4PBGA 1XLDA 4MVAA 1EOMA 4MY9A 3DHPA 5A6BA 4ADTA 1ICPA 3LLXA 1N55A 4ACYA 4Q7NA 4NVTA 3VZXA 1W1A1 4JYFA 2F2HA 2YCLB 5A8GA 2FZ9A 1W9UA 3ZS4A 3WQWA 1OYCA 4GISA 4JTCA 3GC5A 1PYFA 2RJGA 5C9WA 1ONXA 3GDBA 4GQGA 3EDFA 4IG2B 2Y8KA 2VI0A 4B5UA 5I77A 4PUEA 3ZVIA 3NURA 1WDSA 1HKWA 1ZJIA 4GGHA 1PO9A 3GDKA 4FK9A 1PBGA 3ICJA 1CIUA 4DHGA 2VELA 3SN1A 1GT8A 3OO2A 1KBJA 3CK5A 3MV01 2WNNA 1J10A 4V28A 2YCEA 4LC6A 1FWCC 1ESWA 3GZAA 4PMNA 1XICA 3TYCA 1E9IA 3UCDA 4H9XA 1FWDC 1EEPA 2HEJA 4PB5A 1A3WA 3HJEA 4JR5A 2VEMA 2CKRA 4NY2A 4Y9MA 3PWGA 8A3HA 1PHQA 3FK4A 3EXSA 3P3BA 4QM1A 5IXEA 5FA5A 4S39A 1GVYA 3ITOA 4NJKA 3QYSA 3SUVA 1Y7VA 3N4AA 3PUEA 3AHZA 1QHPA 5LA2A 2X8RA 1OM0A 2GYIA 1LYXA 3L4UA 3POHA 1DL3A 3VNKA 2J25A 3P6LA 2Y85A 1AW1A 1O4UA 2NXGA 2PGEA 4BHYA 3RU8X 2Q8LA 1H0GA 3GXPA 5BROA 3V4BA 2WSRA 4AH7A 1OBAA 3U2EA 2H8XA 3H4GA 2DSZA 3D3AA 2J77A 1W5PA 2VUNA 2VEIA 2KX9A 3BO9A 3A6OA 3KOFA 1TA3A 4FXRA 3RJXA 3LBOA 5ECVA 1YPIA 4OTKA 4BEUA 3OLDA 4NJGA 7PTDA 1PZ2A 3FCPA 2YKKA 3VNJA 5SWUA 3CMFA 2GGIA 4IIFA 1FWRA 3DKLA 1KQZA 3GXIA 1ZS2A 2CZ5A 2GWGA 3A12A 3VE9A 1REQA 4O53A 4PMUA 2WCGA 1BRLA 3JW7A 4D1JA 2WZHA 4O52A 1SQ7A 2JEQA 3A21A 4DI8A 3RNDA 3DYOA 3WH9A 2Z7KA 2BG5A 1CGTA 1M1BA 1GVQA 1H11A 3TN3A 7CGTA 3HGOA 2ISSA 1XLMA 3UERA 1T6MA 1JF6A 1TQJA 4CUCA 5CPMA 4H6QA 3HJZA 2PDMA 1VEPA 5M5DA 2QUMA 3THCA 1ZPTA 4AC7C 2Y7DA 4Q6XA 3TP4A 3M07A 3ANVA 2YCLA 3EKGA 3SADA 3KHJA 1XJBA 4B5XA 3N19B 4PRTA 6TIMA 9XIAA 1FKWA 2CLKA 3DAQA 1EQPA 2VC9A 3HN3A 2VR2A 4HP5A 3FHQA 1W3IA 3NL2A 3CIXA 3PBYA 1W9DM 1V93A 1P0NA 2CLOA 3GNNA 2BLEA 4OU1A 2C16A 4GUFA 4YTSA 2HXTA 4L4PA 2WC4A 2AQOA 2PDNA 4IQDA 1E70M 1E1CA 1NWUA 4EPDC 3IAPA 3AISA 3NFUA 1MXGA 1XLHA 2ZOXA 3BJTA 4JX6A 1R7AA 4CNOA 2X1UA 5BRPA 2PAJA 3INPA 3M6YA 1A53A 5EMUA 3KXQA 2HVNA 3W25A 4INFA 1XQLA 1O6IA 5DCDA 2C1IA 3VPLA 2VC7A 4QFUA 4U2ZA 3A4JA 3ZYZA 4M3PA 4PCTA 2V2HA 3UG4A 1U22A 4A29A 3BH4A 2HDJA 2XSXA 4MWAA 1B3VA 2EG7A 4HT3A 2XVGA 5IFPA 1XBXA 3PJXA 3THUA 3BAIA 3KZSA 1AFSA 3ABQA 3AAMA 4AY7A 2J66A 2Q8ZA 4L4OA 4MB1A 5LNSA 2BZNA 4LVFA 2VMFA 4S3GA 1GHRA 1IT7A 4O1DA 3PZ9A 4ZOEA 1IEWA 2UY3A 2CLHA 2X1SA 3GG1A 5HA7A 3WLJA 3H2AA 2D2HA 5EMLA 4ZE5A 1I9CB 4JCLA 3KOWA 4JTKA 1KR1A 4GGBA 2E6FA 1RR2A 1ECQA 4L5ZA 1TJ2A 2Y89A 2XN2A 3W07A 4MPKA 1RD6A 5GNYA 2JALA 2D20A 4UCGA 3LHUA 2ZUVA 1G4TA 4HB7A 1GTHA 2C14A 4S3BA 4O4VA 4DYJA 5AC6A 1B54A 1R8LA 3RPTA 5DANA 1TWWA 4O15A 3QR0A 4C6QA 3GNDA 1LOLA 3IAQA 4UFLA 6XIMA 4B9YA 6CGTA 1NJJA 3PY2A 2Z2AA 2FHCA 5DF0A 3UXDA 4H1ZA 4ROPA 5ABFB 1SUXA 5K7JA 5D2TA 1F8IA 1E3XA 3WBXA 3W73A 4JFTA 3S2MA 4LUTA 5I09A 2REQA 3F7JA 3ITTA 1HN1A 3QM3A 5HWNA 2DJXA 4P7OA 3WLLA 4Q8TA 3CNYA 2O55A 3KRBA 2ZX5A 1QOQA 3FEMA 3NDZA 2HJPA 3SI9A 1JDCA 2B4GA 3GZ3A 2POZA 3CZ8A 2WK2A 2DGAA 3STPA 1MW0A 1JPMA 2ZVRA 1OT2A 3HM7A 2VC6A 2V63A 1BG4A 1S46A 5HDRA 4XG1A 1SW7A 1CENA 4DJDA 1SFSA 2OZ3A 4IJBA 2WB5A 4FLQA 3S8HA 3N13A 3GDRA 3ABSA 5HMEA 5FAGA 3TSBA 5LA1A 1JUBA 1MXDA 3GXTA 3RDKA 3ATYA 1EC8A 1P1MA 4W9TA 1XG3A 1EGVA 3CUFA 4EPEC 2REQB 3CT7A 4UWMA 2ZYFA 1KXVA 1JF5A 3ITGA 2OWCA 2ZRUA 3AIWA 1RQBA 1CXHA 2WOQA 3CUGA 4AZCA 3POCA 3WF3A 1V6UA 4LFYA 4JKLA 2OSYA 1WXYA 3QGAC 5C7VA 1W3JA 3RX4A 1VPQA 4KGLA 2CITA 1Z44A 3UGRA 4AX6A 4GYJA 6XIAA 2XN1A 1E6RA 2FHBA 4V2XA 2PDXA 5ENLA 4LRSA 2V81A 1QNQA 1EHNA 3CMGA 3WBEA 3V16A 3DXIA 5D33A 2V3DA 1W1VA 5F1VA 5D32A 4RZBA 5FL1A 3KUMA 1A49A 2WSPA 3DZ1A 1H7RA 2VGBA 1S2UA 4ZO8A 2PDWA 1I2PA 5C7HA 4CQAA 2PZ0A 4B3LA 4G2DA 3LPOA 2ACUA 3MUY1 1YTKA 3LX9A 4QAWA 1Z69A 4FLSA 1UD3A 2RAGA 3N2MA 5BXTA 1M68A 1BVNP 1KC7A 4AHOA 4YTUA 1JGIA 3VOGA 1OABA 2R1NA 1F76A 3W3OA 2WC3A 3QEZA 4JYEA 4DF2A 1HW6A 4E8DA 1W1YA 7A3HA 1E15A 4J4KA 2DUXA 4HU0A 2WMGA 3W53A 1MFVA 1GKPA 2FKPA 5E0CA 3W2NA 1F5ZA 1HP4A 1OFPA 3MZ2A 3GHUA 4HYVA 2NX1A 3NJ3A 2ZRXA 3AO0A 4FX6M 2D3LA 1WUFA 4L6HA 2OR2A 3WNPA 2PWGA 4GKLA 4K7VA 4E6MA 5FAJA 1G0CA 3CC1A 3NR0A 1ZUAX 4Y9OA 2ZRZA 3MVTA 4ZB2A 5H91A 3KRZA 3VNLA 1XX1A 3AU2A 4ILSA 4Q8WA 2DT0A 3WN6A 4C7GA 3LQGA 3FX4A 1UMLA 1YDNA 3UCQA 3W2LA 3TCSA 2DFAA 1OG0A 4B91A 1JI1A 4QITA 1I0DA 2WSYA 3GO2A 3C56A 1TTJA 2OEJA 3MWAA 3RLHA 4HPXA 3QY6A 2Y5JA 1LQ2A 1QW7A 1O60A 4R7WA 1JRBA 3EDEA 1UR8A 1VCGA 4JCMA 4C1KA 3LB0A 5BOOA 2VFEA 2BODX 1W9VA 4ATLA 4W87A 1OD8A 2F6KA 1R9XA 3CHCA 4KEUA 1C7SA 2ZRWA 3E1F1 3G77A 4AMAA 5AY7A 1S2CA 1TPH1 3IIVA 1ITUA 4PMDA 3NZQA 2CZFA 1YNPA 4GUJA 2ZDSA 2FJKA 4HPHA 3WK3A 5A8OA 4OV4A 5FF4A 3EGJA 2WJFA 4JHOA 1MW2A 1OVDA 2UZ9A 4FF5A 3WH6A 2GSHA 2YJQA 3BJSA 2DSVA 1HL2A 4OBSA 3D0CA 4O1EA 4D6GA 3WF2A 1KR0A 1E71M 3M16A 1EZWA 4WHBA 1M7PA 1OZMA 3P2VA 4US6A 3ITYA 3AMDA 3FV9A 5H8MA 3OG2A 2Y62A 2VURA 3KCLA 3WD1A 2YW4A 1VFOA 1TWSA 4JICA 1V03A 1K6AA 4UMBA 4XKYB 2EG8A 3SCOA 1NDWA 2A4AA 3CZLA 3KS6A 1RH9A 3EOSA 2H90A 1Q6FA 1FCQA 4US5D 3T78A 2W62A 1XCFA 1CGXA 5KZMA 1CLVA 5AHEA 3B0VC 3W7GA 4AZIA 3FVDA 1UYQA 1JDAA 2HNEA 4JTIA 2QULA 1TWDA 3NG3A 2A6LA 3DGRA 3FHAA 3KLKA 1XD0A 1Z42A 1ME8A 4GZEA 3UA4A 2XIOA 5D9PA 4Y8FA 2VFGA 3HQPA 4NZ1A 5I06A 2QJMA 4KKXA 5EY5A 2QIIA 5AYXA 3OQEA 4O1FA 5EA9A 1JDDA 3IIXA 2NLIA 4AWEA 2E68A 5JBDA 1LQAA 2RDTA 2WM0A 3TU9A 4M0XA 5CSUA 1T0OA 4FX7A 3M0ZA 1EJTC 2PA6A 3SRHA 3TIMA 4UTTC 4DJFC 2XIIA 3ZZ1A 3VUPA 4C6FA 1YMYA 3R0UA 5DMMA 4HNTA 4NU7A 1KFCA 1C7TA 3H24A 2VCBA 1AZ2A 3VGFA 4A2SA 4BWLC 1XC4A 1GCYA 2DZPA 4PMYA 4MB5A 3WDRA 5ABFA 1B4EA 4I5XA 3MJMA 3RM9A 3BOFA 3CPUA 2RDWA 5A5WA 2IPJA 4PUJA 3BCDA 1EP3A 4C1NA 5KEZA 1A0DA 2J62A 2WBGA 4F79A 5LIUX 4M82A 3H2FA 1JZ2A 2J79A 2WZMA 4DJFA 3P80A 3WK1A 4FSAA 2GQ3A 2VGFA 3ARVA 2QUNA 2PTZA 2QCLA 3D5HA 3NM3A 1J8VA 1Q3NA 4QP0A 4O0ZA 3PG9A 4Q8QA 2FVKA 3NQ7A 1FCUA 3R8GA 1V0KA 3EB2A 3SCUA 5A6SA 4H7VA 1HJVA 1M03A 1EDQA 1KFEA 3AYVA 1S38A 1WUEA 1NARA 3WEMA 4EAMA 5B7ZA 1BAGA 3B9AA 1S5NA 4J35A 2IXUA 5GJMA 3TMLA 3AZSA 5TAOA 3CEUA 3MMWA 3RM8A 3VDBA 1RA0A 3PNZA 4EF9A 3R89A 5C8BB 3GYEA 3FKRA 2UY2A 2OEMA 4YPJA 4HTBA 2QJGA 3TOYA 2DDXA 3ABRA 7TAAA 3KWSA 4KEZA 4CU7A 4PCSA 5I3JA 4O28A 1TJPA 5LZLA 3HV9A 4FOUA 2FPYA 4L4LA 1CGVA 3PUGA 3T4WA 4XV0A 5F4WA 1QRQA 1XCWA 2QDGA 3BWWA 1XDMA 3MBFA 4H04A 4QGCA 2EF9A 3S9YA 3VKAA 3RF9A 2PRLA 3W84A 4NF7A 1FCVA 3IANA 1EO5A 3AC0A 4LAOA 5AECA 4WQ6A 1TCMA 4UQCA 4GLEA 4DJEA 1TV4A 5CC3A 1FWBC 3GLCA 3I10A 4RX0A 4A8NA 3ARWA 2VT0A 4JTDA 2JF6A 3UXKA 1LLZA 1ZTVA 1W1TA 4HK7A 5E6YA 1SMAA 2PCEA 1F7BA 4HMCA 4H7ZA 2EEXA 3W2JA 3BV7A 4GK8A 3QH2A 3LHYA 1VFFA 1Q8JA 4TX9A 4LANA 3BMXA 5KITA 1EPXA 1TJ0A 3GG7A 4JTFA 3S2CA 4NAEA 1J0ZA 4H4IA 4R85A 2WO5A 2OU4A 3B40A 4MJ4A 1NWTA 2VZTA 4CQBA 1RZMA 2GZXA 1B3OA 1OEPA 3N12A 4K37A 3JS3A 2F6UA 3CMJA 2G50A 4GPNA 1E73M 4LC8A 2PDLA 2HVOA 3LM7A 5BMWA 3B0XA 1XIIA 4KW2A 3DG7A 3KRUA 2O9OA 3WUBA 1LCOA 3GAYA 2HQAA 1YE6A 1BVWA 3L4TA 3P93A 3KX6A 3CHVA 3NEVA 1H1YA 4EX4A 4MPQA 4IMAA 5EKYA 5T8GA 5LIKX 6ALDA 2AL2A 4H83A 2C79A 2VGIA 5XIMA 3TN5A 2QDDA 3F4NA 1ONRA 4C6CA 2C19A 1OFAA 1TTIA 1A3HA 1O1HA 1QATA 3OHMB 4NAFB 1IZKA 2EPNA 1Z48A 3MCMA 1S2TA 3UWZA 5H6HA 4KCTA 3ARSA 1IT8A 2ZXAA 4ML4A 1NFGA 4X2RA 1IWPA 2J8FA 3T05A 2V2DA 5DBTA 7ODCA 3CUXA 4PC8A 4HTYA 4DQWA 3WQ8A 4MG4A 1V5XA 4FNUA 3BAYA 4HNOA 2R6OA 4NP7A 4Y96A 3TWAA 3RMJA 4LAKA 4YWIA 1KFJA 4NAFA 2QZRA 2J7BA 3MUCA 1CGWA 1R46A 4C6BA 2QCNA 2WV8A 3QC3A 3U2ZA 1G4PA 3WQ5A 4ENLA 4QG8A 5LHFA 3NDOA 4HBKA 2GGJA 2ATSA 1LZOA 3GIYA 2IUZA 2ACRA 3OU8A 4LSBA 2J74A 1B9ZA 1BEUA 4O18A 4GNVA 4U10A 3FNDA 3WEZA 2ISFA 1TE6A 3LXAA 3BZJA 4UXDA 1N8WA 4U31A 5ECUA 2GOKA 3NQCA 3KTXA 3C0QA 4WRHA 4H00A 4IG2A 4JTGA 1ZFJA 1V0NA 3G6LA 1H7WA 1XIMA 3I7SA 4GQBA 3PJWA 3ANUA 1UUOA 2I5QA 4UTLA 9RUBA 3PPGA 3NQ2A 3RN6A 1IEVA 3CQKA 1TE1A 3S4TA 1IZCA 3R43A 4AU0A 2WJZA 5CAKA 2PGWA 2QEZA 2RUSA 4R9OA 1RCOB 3V5OA 2ISWA 6A3HA 1UPMB 1UG6A 3BSHA 1IQ8A 3NSNA 2YR1A 1X8CA 3KL0A 2GJRA 3M0HA 4HA0A 8RUCA 4TV6A 1XHGA 3M7SA 2JGQA 2POTA 3KW3A 5A8NA 3U7BA 7ENLA 5E93A 1K9DA 2OO6A 4B92A 4G7FA 1E72M 4ZVJA 1JUKA 1H3GA 2A0NA 4PUDA 4GWEA 3W87A 4GUIA 2WMKA 4YYFA 5M03A 3LY0A 4O0KA 4XIAA 1UBPC 1ECEA 3N4EA 2WBKA 4XKMA 3C4UA 2YDSA 3MB9A 3NSXA 5EL1A 1OB0A 4BK9A 5KZ6A 1TZ7A 3OA5A 4K1GA 3ITCA 3TOPA 4EF8A 4QQ3A 3GAKA 4J28A 5I79A 3QJAA 4ZQPA 5ABHA 3PUOA 4ATWA 1BGAA 2PP0A 4XD5A 3I68A 4WX2A 1XL9A 4L9ZA 4LYPA 1SO6A 4N4QA 1MUMA 2G95A 3KVMA 3IJIA 4D6IA 1UD6A 1KXHA 1L9WA 3N3MA 1UIPA 3KBJA 3CHDA 1CZ1A 2ACSA 5HK4A 3DFSA 3IK4A 1XINA 2W4XA 1NF7A 4CCZA 2XU2A 4GJ1A 2PWFA 1MW3A 2JQXA 3TVAA 3WBYA 3UQNA 1W0MA 1FWNA 4B5VA 4D9PA 1HJXA 1Y0EA 1V6WA 3N9SA 1NDZA 2WZIA 1GG1A 4MFEA 4DO5A 3EWUA 1UD2A 4BY3A 1EIBA 2YSWA 5A95A 1NTHA 3W76A 1R2TA 3MKVA 1CBGA 4EK7A 1MXSA 4E8GA 4GXWA 3ZJKA 2AGTA 2V5CA 5DMLA 2GDUA 3CIWA 1ICSA 3S5YA 1M7XA 3SW6A 5BZAA 3UWEA 3GQYA 4J3ZA 1H2JA 1V3HA 4L7ZA 1QWKA 5AN7A 4KQNA 2HPIA 4AD1A 4AMCA 2A3CA 1K6WA 1KRAC 1VFHA 5FEWA 1W17A 1NSJA 1RVKA 3MC5A 2PSNA 3EKZA 3GG8A 1UH3A 1UWAA 1T41A 2QAPA 1SR9A 4XBKA 4CN6A 3C86A 1C8VA 3EDKA 4MJ2A 3MQTA 3C0SA 3KCOA 3K46A 3JZUA 1IXQA 1QO5A 1FWSA 1TTPA 4QIUA 4JIIX 4L56A 5EMJA 2WMIB 2V38A 1RXOB 5DCBA 4FNPA 1B3WA 4C7FA 3UETA 4HPGA 4AG0A 3K1GA 5JH1A 1RQHA 3UJSA 5LNRA 2J88A 2NQZA 2WKLA 4GX8A 3ZJ7A 4OJYA 4GI8A 1ZENA 1ONEA 1ZAIA 2QDEA 3OLGA 4CNSA 3WMBA 2VRJA 3A47A 3P0XA 4OE7A 4EANA 1UC5A 3PF3A 3PANA 4XVEA 4PTVA 2BP1A 4HZ8A 2OGJA 2VZVA 4S3FA 4AZGA 4LB4A 3S2LA 3P8JA 2YA2A 2YLLA 3XISA 5LNVA 4A35A 3OA3A 3TEVA 3O3RA 1US0A 5M1TA 1J5SA 4W84A 2PP3A 1S5WA 5DFAA 3W7JA 2HCVA 1XLGA 4JPGA 3C52A 3QFWA 4R33A 3BCFA 3IGUA 1UR4A 4XBSA 3I6TA 1PKNA 3QSRA 3MWCA 3W7LA 2YOCA 3FOKA 1LRNA 3PTMA 1KTNA 1GOMA 2E67A 3PBVA 4M24A 3D46A 5A6BD 3G1YA 2I1OA 1BQCA 4LEQA 3TJXA 4DM2A 2PI6A 4QE5A 4JN8A 4LYQA 5IHSA 1UA3A 3WNKA 5FJTA 4OZOA 1RQEA 4DZ5A 3UXIA 3G1AA 4JQ4A 1TV7A 1F61A 1KBBA 3RGTA 3WLRA 4IQJA 3BGGA 3AMKA 1MQRA 2XVLA 4PL2A 4D8AA 3HFTA 4OV9A 1L6GA 2E09A 3TNBA 3MUZ1 4LXFA 4O10A 4UZSA 1D9EA 2UV8G 3VD4A 3EBVA 1JCYA 4YVVA 1BF2A 5C2CA 2R9RA 4F2BA 1F6PA 4KEMA 2HISA 4C6OA 3TYDA 3VYLA 4JTHA 2Z24A 3A4AA 2VJXA 1N82A 1HP5A 3VFCA 4Z2LA 3U3HA 1HKKA 5BOEA 2EJAA 4IFRA 2NW0A 5DBUA 1OK6A 4FA3A 3VMNA 3BG9A 1HGWA 5HR6A 4GG9A 5E70A 1IZJA 4UQAA 2QUUA 2FMOA 1E6XM 4GACA 4ZTXA 1H4PA 2NVDA 1TPFA 3SSJA 1I8JA 4EXBA 3SRFA 1RY0A 4J7RA 3GFXA 1UKTA 3OW1A 3DBPA 3EMCA 4N02A 4LYKA 4MZYA 1HZYA 3FSUA 1A5AA 3WQVA 3EWZA 2ZZ6A 1O66A 3AHVA 3W0KA 3B8IA 1MSSA 3ZOAA 7XIMA 3AIVA 4XZ9A 1JFXA 3UVAA 2J7CA 2QDHA 3A64A 5A94A 1Y8BA 3GHTA 3LERA 1K02A 1VFSA 1F3EA 2ZC1A 2YZRA 3EX3A 4HJFA 4FNQA 1EL3A 1TPB1 1JZ4A 5BNKA 4QXIA 4TX6A 3TQVA 4UQBA 2CETA 4ZL1A 2QQ6A 3K4WA 4IMFA 5EMKA 4IMEA 1HGYA 2EG6A 5HPCA 2DEPA 1M04A 1UKOA 2HROA 5G4HC 4AY8A 1K1DA 1RVGA 1QASA 3IWPA 4Q4RA 2HBXA 2IKIA 3WLHA 3NXLA 3MV11 1OFBA 2A5HA 3EEGA 3CL6A 3ZR4A 4B2DD 3WIJA 3ZFHA 3ARRA 1IE7C 3TMQA 2QVNA 2WVTA 3ABXA 3WDHA 2C0AA 2AKZA 2PDIA 2ZZ1A 1V6TA 4GIRA 1R3TA 1GOQA 3WQFA 3LHVA 5CZKA 3RPMA 1XD1A 5A6AA 4XKYA 1GZGA 1YPXA 4S2CA 4BS0A 1RUSA 2X30A 3S6DA 4IUGA 5ABGA 2D1ZA 1HQTA 1R0MA 1EO7A 3AWNA 2JFEX 2ZA3A 2B81A 4QE1A 5E5CA 3MDUA 3RX3A 3UEQA 1UB3A 2GDVA 2V9DA 4LNYA 1OY0A 4UFHA 3PSWA 4TX8A 3QMTA 4RXFA 2CWNA 3B05A 3ARUA 5CPNA 4C7DA 3T9PA 1WQ5A 4FLRA 3BTNA 4RDVA 4Z42C 5HMDA 3L7RA 1XC6A 1W5MA 5HNTA 4DBSA 1TELA 5I2UA 1K9EA 2C13A 1UMYA 1J2WA 4YHEA 3W86A 5K9XA 3AMGA 3VNMA 2NZLA 2VWTA 1JFHA 3PWAA 3LV6A 2Y5SA 3EOEA 5JBEA 4PB4A 4AZ5A 3ZXWA 4MDPA 1TIMA 3H7RA 5AHNA 3DFNA 3NL6A 4AF0B 3F1QA 3AXXA 4H6RA 3WQPA 4V1XA 2FJUB 1CYGA 4Q8MA 4WLCA 3KTCA 1DWFM 3LLDA 4C1LA 4CVWA 2OCZA 3IJLA 2H3DA 3LOTA 3O06A 4YMZA 3ZJ6A 3VMPA 4H9YA 2WKGA 1B1YA 3FW6A 3LTYA 4EPKA 1M6JA 4HOWA 1DIOA 3QZ6A 3DG6A 3VCNA 1QI3A 1JYWA 3PBMA 3WK2A 3UP8A 1VBGA 1DJYA 3GB6A 1C3FA 1NIUA 4OT7A 1HVQA 4DX3A 1GOOA 4TMCA 4QAIA 1LBMA 4X63A 1OCNA 3GVGA 1XFCA 3W1TA 1MW1A 3W38A 2DUZA 3BXWA 4S3EA 1XYZA 1TPEA 3TC6A 3WF0A 2CLIA 3CZGA 3ME3A 1PL9A 2J8TA 2PDCA 4XD4A 4HOZA 3U57A 4X61A 3NYDA 3GM8A 5D30A 1E9ZB 3W7MA 1W1IE 1D8WA 3GFZA 5GVJA 1TWIA 5K9DA 3OHIA 2E8YA 3B9EA 2JIEA 2ZVIA 2NX9A 4JKKA 4RDZA 3PZIA 1ISZA 1G4SA 3I7RA 2DZUA 1PKLA 1WV2A 4CEUC 1WX0A 4O50A 1LQ0A 1UR2A 4WJEA 4H8HA 3ARTA 2G0WA 4UTHA 1KGWA 5AHIA 4UFMA 1LLWA 2V6AA 5C9XA 3C8FA 3EB4A 4A3UA 3CTTA 4YIWA 4OIFA 3S5SA 4NJHA 1Z89A 3SFKA 3GR7A 2ACQA 1XP3A 3VABA 1GQLA 3VUSA 2VOMA 1BD0A 4PMQA 3C3UA 1LDCA 2HE8A 3TROA 3WFLA 1IR1A 2XIQA 1QAPA 4KCWA 4IPIA 4DZHA 1P0KA 1QNVA 2ADAA 3TAKA 4HK5A 3VZZA 2HE5A 2YA0A 1XRFA 4GC3A 4I8YA 3UJFA 5CLTA 1DXEA 3UR2A 3NL3A 3UVIA 2FH6A 2L5HA 2XDFA 1OJXA 2Y1HA 2PF8A 2ALRA 3CAWA 3W26A 5HMFA 1L2QA 2GFTA 4Z2JA 2YDAA 2RFGA 2GGGA 3UW6A 4R34A 4D6FA 1XIFA 4B5NA 1YTEA 3NQMA 4IX0A 2AOSA 1DJWA 1IEIA 3RM4A 1I2QA 3NQDA 1W3KA 3RJYA 1QHOA 1UWUA 4F0MA 1UKSA 3ZR5A 4HYRA 3CO4A 5CGMA 3TTQA 5D02A 2PLJA 3MPGA 2DVUA 1Z3NA 5C55A 2XFFA 4LUSB 3NQ6A 4ALDA 3R7MA 3DESA 3VM7A 1FWIC 4IGNA 2SFPA 4OWGA 1A50A 3H4WA 4JGDA 1NM9A 3Q65A 3SN4A 3SZ8A 2QV4A 4XO6A 3KWXA 4QEEA 3E2QA 3OGVA 4AYGA 4DZIA 1PX3A 4RKAA 1P0DA 4D8LA 3BK0A 4DM1A 1M65A 4L61A 4RZ4A 4LPCA 1LROA 1UZ1A 3NQGA 3W7CA 3TZFA 3KOYA 4NXSA 2Z6JA 3SUUA 3LTSA 5L6UA 4HN8A 4ASTA 2A85A 2VZOA 2WHLA 5EFDA 4ZB5A 1VFTA 4CQ8A 4B4FA 1MNZA 1T40A 1L6SA 2INZA 3KHDA 4XSMA 2D73A 4F0KA 3MYOA 3TSMA 1NQKA 1TYGA 3C2RA 1GKQA 5LXXA 1BKHA 3L4ZA 3OYZA 4CLMA 4UMAA 2CU0A 1ICQA 1CB2A 3MI6A 1E1EA 3L4XA 1AMYA 3TYBA 4TMBA 4MWAB 2IKJA 1D3HA 2W91A 1PB0A 4QROA 2ZUSA 3CV1A 4W88A 3EB3A 2GUUA 4RV3A 3T0BA 1C9WA 1LM1A 2X1TA 3K5XA 4DBWA 3AROA 3UJRA 4N42A 2Z2UA 2CNCA 3U0HA 3OP2A 5EB8A 3B97A 1DV7A 3LBMA 3IRSA 1R7OA 2OG9A 2VDHA 1WZLA 4LVBA 4W7VA 4ES4A 1CWYA 5KMYA 3Q58A 3LENA 2H9AA 1E43A 1HG3A 1GJUA 3NOEA 3WFAA 3SGUA 5H2ZA 2RGLA 3BUVA 2OX1A 2OEKA 4QSFA 2PUZA 1XS2A 2BGSA 1KM2A 1AW2A 5DMYA 1KCZA 2W63A 4O12A 3TH6A 2B7PA 4DBUA 3IGSA 3WF1A 2OZ0A 2WW5A 1UPPA 1TZ9A 3AMCA 5FD0A 3LG3A 2G37A 1VAHA 3ZSTA 3DIPA 1TMHA 3GH7A 2VX4A 2FYMA 2XIMA 3W02A 3GBDA 1TPDA 3GR8A 3DYMA 5I07A 1QI5A 1Q6CA 4IFKA 4GH3A 3HGJA 4A05A 2EQDA 5K3VA 2OODA 3R58A 1KGUA 3A5VA 4DAFA 3QTPA 2XWDA 4BQ2A 3SQSA 1ZB5A 2A7RA 1I60A 1X39A 3R2GA 5LGZA 1A47A 3GNXA 3IJDA 2V5JA 1YNQA 2F38A 4Z17A 3KOXA 3O6AA 2YX0A 3E0IA 3IARA 1P1XA 1NVMA 2I9EA 2BGQA 4XUYA 1AQ0A 1F4HA 2TPSA 3S9ZA 1GOKA 2ZE3A 1B30A 1H63A 1XBZA 1SJDA 4IOTA 3W7IA 4FPSA 2YL9A 2GJPA 3EWXA 4MLJA 5G2WA 5EMYA 3UJEA 1GOWA 3WLQA 1VRXA 2C3ZA 4PRRA 2NSXA 3N6QA 4UZUA 2I57A 2EKGA 1E6ZA 1Z32X 2V82A 3WJWA 2Y7FA 1L8NA 3HPSA 5HQMA 3A22A 4WF7A 4K68A 4WUIA 3C2VA 2BBFA 3OVPA 4H9ZA 4P7RA 1RJQA 3NPXA 1H5YA 3BVJA 3G0XA 1AQMA 5TIMA 3V0SA 2FMNA 4ZCWA 3WQGA 3RCNA 4UCFA 1RY8A 4P8XA 3O0FA 4K39A 3KDOA 3LK6A 3VIFA 3WG6A 2V5KA 2QGHA 2PRHA 5D9MA 4YLWA 3UD6A 3B8TA 5HNRA 1NOWA 4ZO7A 1G4EA 3GFYA 5C54A 1LT7A 3WLNA 1BGGA 5BWFA 1QW8A 4G7EA 2XVKA 3CWNA 2NT0A 3P82A 1OGGA 1XIHA 5G1TA 4U3AA 1G69A 3O15A 3KL3A 4CD7A 3WEOA 4QE4A 1FDJA 1YDOA 4GBDA 3SCPA 3AFBA 2CXEA 4MWAD 2FB2A 2CHRA 3NXFA 4OUEA 3VGHA 4U5KA 1NDYA 1GQJA 1JAKA 3DOPA 3BSMA 1YDYA 1AL7A 4QJ5B 4IIHA 4D2JA 1GPFA 2AMXA 2ZTKA 3EOUA 2ESCA 1CECA 4WR3A 2XIBA 4JTLA 4LGXA 3NYZA 1ZL1A 1UROA 3PNUA 2YZ5A 3LZ5A 2WMHA 2WVVA 3OLIA 3VC6A 3CB3A 3I3EA 4XZBA 4WOZA 3PFMA 3SCNA 3WD3A 5HAOA 3CZEA 3IUDA 3NZPA 3PBGA 3AS2A 3B0UX 5FEZA 3L23A 1H1ZA 3NAVA 3BQ6A 4YWSA 2P1FA 4KERA 2WNZA 4E4UA 2OSXA 1EEXA 5ABTA 1MRAA 2OQHA 1A5UA 2IQ0A 5LXEA 3URAA 3IIPA 1DXIA 3LD5A 4CNPA 4HA1A 2E1DA 1Z41A 1X7IA 2X2GA 2WLZA 3A5FA 3K1DA 3TJIA 4FALA 1ME9A 3LI1A 1HKIA 1DQXA 3GU9A 1E1FA 1RCQA 5KZEA 3QLDA 5CGQA 1OCJA 3S5OA 3CM4A 5A1AA 4FF7A 4X9SA 1RP8A 2RH9A 1ME7A 3WYZA 1K4HA 4N4PA 4GX9A 3UESA 1HX0A 2GSJA 3W85A 3ZSSA 1W3NA 2PMQA 3S0CA 3VMOA 1AH0A 1DTUA 3MCNA 5AHLA 3K8KA 3EWDA 4IM4A 1EGMA 5I7GA 2WANA 4B90A 4YVPA 3VD5A 3KEHA 4Q4KA 1DORA 5CG0A 5GQBA 4W8LA 1ZALA 3LA4A 4AC1X 4WDTA 4J40A 5CG7A 1T96A 1TV8A 3A23A 3LGGA 1GK8A 3I3DA 5CXPA 1D8CA 2F6XA 3PZQA 1PKMA 3QC0A 4B5SA 5CKSA 3HFYA 4GNJA 4FLOA 3KP0A 4RK8A 3HQOA 2QPXA 3PUDA 4ATDA 5CJMA 1F6YA 1L6FA 3OTRA 2Z1BA 4JS3A 2O56A 2QKFA 2NQLA 3WJSA 4DUXA 5KZDA 3MHFA 1WAUA 4HJWA 3KVKA 3Q94A 2PGRA 1QMLA 4H9UA 4M7TA 1C90A 2YBTA 4I3GA 2ASHA 2J13A 1FQ0A 2YDRA 2CC0A 1CNVA 1DP0A 2PTDA 2Y63A 1HKJA 3UWVA 3EEZA 4LB3A 4RZ5A 3RG6A 1CTNA 3H23A 3FDGA 3WUFA 4B15A 2X0HA 3O7UA 5LIWX 1BHGA 1FY6A 3W83A 2ZUTA 2HSAA 1NP2A 4YNGA 4WDWA 2VM8A 3CUZA 3DC8A 2PBOA 5CPSA 2VZUA 3PZOA 3ECQA 1KBKA 4TIMA 3GNPA 3HPAA 5A2CA 4KETA 3N73A 2VDGA 2VR5A 3MSYA 4NNBA 3FA3A 4JTQA 3EX2A 4ZR8A 2OLSA 1W2PA 1MO0A 4D6JA 3VI2A 4ICMA 1JL8A 5GNZA 2GGEA 2OYKA 4BF5A 4ZQCA 3FLUA 1HJUA 4D71A 5A3HA 1M01A 4Z1DA 1JYVA 4M6QA 2PD5A 4KF1A 4DPPA 1LTDA 1PCKA 3SY8A 1JAEA 4ZXOA 4NZ4A 5A8PA 1J96A 1EQCA 4Q8NA 4FIQA 4WSKA 3A4XA 4RJEA 2OX4A 5TD4A 1JGMA 3VGGA 3NL5A 3IVSA 2HTMA 2NXHA 2QAFA 3EMQA 4IP5A 2Y2WA 3QGVA 1DWHM 2Z27A 3GTHA 4M7SA 4U4MA 1UH2A 1EGZA 4A3YA 3R11A 4PEEA 2A3BA 2QR6A 1E4NA 4C6MA 2WHKA 4DLMA 1VJSA 4H41A 3DI0A 3AYSA 2O9PA 5AYIA 3S47A 3TYUA 4QG9A 4DJED 4Q7BA 1ZP4A 1G94A 3OZOA 1QPNA 3ITLA 1DXFA 2YDQA 1GUVA 3M44A 1O94A 4LCRA 3IK2A 5H8UA 1FWTA 2E5DA 2R1KA 2PDYA 4GINA 4M1BA 7REQA 3DX5A 3O05A 3GTXA 1JUEA 3WBWA 4NRRA 1CXFA 5B80A 4PL1A 5KETA 4TVDA 4PTWA 1Q6RA 1N7KA 3H2MA 4Y90A 3E0LA 4I9AA 4URIA 1E6NA 2PBGA 2RHGA 3F4DA 2I14A 2IPGA 3Q67A 4PUUA 4DUOA 1TUFA 3CQHA 3VOJA 3IIOA 5HNNA 3VU2A 1TJRA 1FWEC 1YXYA 1DYSA 2CKSA 1OFRA 4PUKA 2B7QA 1LL4A 2ZKMX 4AD5A 5E09A 3TA6A 1H41A 5CBIA 4LALA 1A5BA 3KE0A 4RZ6A 5JH2A 1VR6A 4ROQA 3RRAA 4KH2A 3UZJA 4JBRA 1RCXB 3EOOA 3OBEA 1M41A 3A13A 4HMNA 1LP6A 2D2OA 4JN6A 1AJ0A 4OBRA 4X9YA 2FTYA 2A79A 1EP1A 4P2VA 3COTA 5AFDA 3N6JA 5BXPA 3LPFA 4AVFA 3MI2A 5AHMA 2PPGA 4G56A 4JQ1A 3S5NA 3RUBL 3CBWA 1WOBA 1F6KA 3ATZA 5D05A 3BE7A 1FCBA 5EYWA 1KQYA 3UFYA 3TCEA 3ISIX 4A3HA 3GVVA 3M9YA 1J0IA 3QMSA 4PBEA 3KAOA 2X7WA 1D3CA 1VZWA 1UR9A 4XBJA 2YFNA 3BAXA 1K8YA 2J7HA 3A9BA 1YYAA 2NV9A 2XSAA 3VZYA 2VKZG 1PUDA 2DH2A 3IACA 5LKYA 3QHMA 1WYIA 3IPWA 3ZT5A 3R12A 3RXZA 1UR3M 3QV9A 4MF4A 1PDYA 1W8GA 1C8QA 4M1RA 1XXXA 3PZVA 2VEGA 2VR4A 3BW3A 1QK2A 8TIMA 3D6NA 1SZRA 4H8UA 3T0TA 2EAWA 4ZQRA 1THFD 1XYBA 2P3ZA 3CPRA 4NZ3A 5AKQA 1LBFA 1V0LA 3PZUA 1ZAJA 2EPHA 3C2YA 4R9XA 2EBNA 4MM1A 2ZZ2A 2YL8A 4F48A 2O4MA 2X09A 4PMOA 1OCQA 1KXTA 2GDQA 1I1XA 2VNCA 2JKAA 4DXXA 3I6EA 3P7YA 4QCEA 5G1MA 3QW4B 1XQKA 5BWAA 2DIJA 3M64A 3O6YX 4C6PA 4LF1A 4Z1BA 4KIRA 4DWSC 1G1YA 3C5QA 5IOBA 4IICA 3BW2A 3L21A 4N9EA 4JTJA 1BQGA 3TW7A 3RLVA 4N0RA 3GWQA 2CHOA 3NQ8A 1GVSA 3N04A 3APTA 3QR1A 1UHVA 1DWIM 2P76A 3ZVHB 1G6CA 2QPUA 4A8RA 5K4XA 3A3WA 5D4YA 3T0AA 4FIRA 3VDGA 5TF0A 4LS2A 2ZDRA 1BYDA 4LS0A 1ELSA 3GHRA 3VTRA 1AQFA 4J2PA 2OGYA 3GH4A 2ZWZA 4JL1A 2OJPA 3IGHX 2IQDA 1O5QA 5IDIA 5FOOA 1S1RA 3ENLA 2CZVA 3WH8A 4CN4A 1DWJM 3QTGA 4O14A 3E12A 3W7DA 1W3LA 3L4YA 1NFPA 5MKGB 4R53A 3PZGA 4H19A 1ISVA 2WNQA 3E0WA 1SPQA 3VNZA 1YDVA 2EGZA 4AHPA 4UR9A 1VYPX 1W1B1 3W75A 1P6WA 3ALGA 1FH8A 4DY1A 1GNXA 1KBIA 4CCCA 3SCQA 1KLZA 2GUYA 3KRSA 3CQ0A 3GD6A 4D72A 1OGSA 5GJPA 2Y24A 3O6DA 2TSYA 4LY4A 4MUPA 5IRPA 4IXHA 1GEHA 2XZ9A 5CC6A 2OB3A 1ZJHA 1LRTA 4W86A 2I56A 1DVJA 3OIHA 3G3MA 1UZ4A 3MKKA 5IBXA 2G4JA 3QN3A 1KCXA 4JFWA 3ZWSA 4AQLA 3TTSA 4O1CA 1WCGA 3WLIA 3W70A 2Z6IA 4O8AA 3CWOX 1CB7B 4FO4A 1PWLA 2BOEX 4YJ5A 3PAOA 4C60A 2QF7A 3V36A 3AU6A 2XGZA 2VQUA 4CD5A 3G3DA 3GVRA 3TJLA 4MGGA 3QVQA 2YBVA 1LLOA 3AYTA 2R1LA 1S5MA 1W6TA 2Z00A 3UZWA 1DJIA 4OKDA 1VHCA 4UC5A 3RILA 1UJQA 3EA1A 1RK6A 4BEQA 4RL3A 3WSUA 4JOMA 3S6OA 3EA2A 2GK1B 4JTAA 1PTAA 1WNOA 4QTGA 1QNPA 2ZUUA 2YB4A 3SCVA 2BXYA 4PMJA 4F9DA 4WY0B 3TQ0A 3BV4A 3I4KA 4IISA 5IDZA 4ZOBA<