3FJLA

Human dihydroorotate dehydrogenase in complex with a leflunomide derivative inhibitor 3
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
364
structure length
361
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Structure-based design, synthesis, and characterization of inhibitors of human and Plasmodium falciparum dihydroorotate dehydrogenases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 136
structure length 361
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fjlA00
1LLWA 3C6CA 3QEZA 4RZ4A 3STEA 3SGZA 3G1XA 3MMTA 4MKNA 4W9TA 2H3BA 1YPFA 3CWOX 3CU2A 3TIMA 3O06A 2E5DA 4GFSA 3HMJG 5J5RA 2ZRYA 2Z0IA 1D9EA 3NM3A 3R12A 3G3DA 1WA3A 3A9IA 1RV8A 3MWAA 3S5ZA 3O8AA 5CSRA 3W6YA 3EWWA 3CTLA 2ALDA 2QCFA 2XN2A 2Y89A 2ZRZA 1LM1A 2E6AA 4X3ZA 4N6FA 3L66A 5D09A 3ABRA 4IMDA 3W1UA 3GKFA 4O0KA 5F2IA 1TPFA 5KZEA 1X7FA 4GBUA 1KM0A 3LI0A 1H5YA 4UTIA 1JUEA 4BF9A 3W7DA 3G0SA 4JTIA 5C2XA 3OEXA 1H7WA 1M7OA 1YDNA 2OZ0A 1ML1A 3W1TA 4Q32A 3HGSA 1VZWA 2ZQ0A 4NJIA 1D3GA 1P5BA 1OVDA 2FTPA 3R89A 5LNWA 4UTWC 5K4ZA 3JRKA 2V30A 3W7JA 2GVLA 4FXRA 1W3IA 5LHFA 4JX5A 2Q3RA 1RZMA 2GUUA 3ATYA 4UR7A 5HNRA 3NA8A 5EBUA 4H3DA 3ZWSA 2KZHA 3IGUA 4POCA 5H2ZA 1YPIA 4OGZA 4JICA 4A2SA 2YZRA 1QWGA 1RQHA 1XBZA 2A7PA 3ABSA 2QR6A 1BEUA 1LDCA 4IMGA 4K38A 1KM2A 4M7SA 4ADTA 4WD0A 1IIGA 2TSYA 2BLEA 1ZHAA 4MY9A 3NQAA 3HPXA 1ME7A 4IMCA 2C6QA 3TH6A 1LOQA 1FX6A 3FKRA 4RXGA 1ZNNA 4Y8FA 1YDVA 2E6YA 3PG8A 1SFLA 5BMWA 5FF0A 3M41A 1ZAJA 3MI3A 2Y7EA 1KM4A 1W54A 3NL6A 4N2YA 3LCLA 3QPYA 5G2IA 2VEKA 1XM3A 3CEUA 3GIYA 5I3JA 3FIGA 3W1RA 3S6DA 1TRIA 1EUAA 1LOSA 1H7OA 4UTHA 3QZEA 3RU6A 1YXDA 4MIMA 5F2LA 4RCXA 3SY5A 1DJQA 2X1SA 1ZCOA 2Y63A 3LHZA 2RKXA 3M5VA 1H1YA 2ZRVA 4JTKA 4LOCA 3S1XA 2R8WA 1GT8A 1FWNA 3GDMA 4LTSA 5K2ZA 1LRTA 1FUYA 1AL7A 2VENA 4JTHA 3OG3A 4IWWA 2NV1A 2VELA 5F4SA 3WJZA 4AMAA 4Z1CA 1O5KA 3MHFA 3TA6A 4N02A 3T55A 3CQ0A 4S2CA 2NX9A 1H7NA 1W8SA 1OX6A 4PEKA 3PY2A 3TC6A 1NVMA 1Q6QA 3W7CA 4ICNA 1NSJA 1KM5A 3HOJA 5D05A 3L9CA 2CFFA 4OV9A 2FQIA 2WOQA 5AN7A 2GQ9A 4RX0A 3W9ZA 1TV7A 3W1QA 1OFAA 2WSQA 3MP4A 5D2TA 4GNJA 2ZA1A 2VFGA 5CZJA 3P8JA 4MLRA 1WAUA 2A1YA 1TB3A 2QEZA 4MYAA 3CM4A 1TPC1 1DJNA 3NG3A 3OHIA 2QCMA 1Q3NA 4UFJA 2G97A 3TAOA 4IX2A 4S1FA 2VEIA 4R33A 4K39A 1X6UA 3LRKA 1MEHA 2ATSA 3FKKA 1QR7A 3IIOA 2C15A 3NVTA 4IGHA 1QCWA 5F4XA 1H7PA 2DU2A 3C52A 1O95A 1HTIA 3QW4B 2Y7GA 3LOTA 3VI2A 3ANYA 1EWEA 3PWAA 5I3GA 1JQXA 4DO4A 2JKEA 1F05A 3HGRA 4JTFA 5HJLA 1G4TA 5EPDA 1L9WA 1K8ZA 4IMEA 5FEZA 4M19A 1XL9A 3LI1A 4DF0A 2NWSA 2Y61A 1TPVA 3DI0A 1AMKA 3TNOA 4GRSA 1OYCA 3E02A 1JCMP 3M9YA 3T7VA 3TCEA 4IQLA 4FXSA 2WNQA 4YCOA 2QCLA 2OT0A 5LGXA 1BWLA 4LVBA 4O14A 4QQ3A 1FWSA 1Q45A 1YTDA 3LDVA 2YFNA 1VH7A 2C0AA 4JR5A 2CZDA 3I65A 5AHMA 1HG3A 5CKSA 5E0KA 1SPQA 5TBOA 4U4MA 2DJLA 1KM3A 1VYSX 2ZZ6A 5HR7A 3G24A 1KFBA 2GQ8A 3W7HA 1CX9A 3TUUA 3LGEA 4ZQOA 1HO4A 3LXAA 5L9FA 1K3UA 2FB2A 3FOKA 2PC4A 4IOTA 3ZR4A 1SW0A 1QOPA 3KVKA 1AW1A 1O94A 3DFPA 2B0MA 2HSAA 2TMDA 4JTUA 2JGQA 3QW3A 4FNRA 5C54A 4A21A 1LRNA 1VRDA 3SR7A 5T26A 4UMAA 1OABA 2QKFA 2OT1A 4AVFA 3L5LA 5DBTA 4C1LA 2J88A 3E9AA 1E51A 1QPQA 1VYPX 3AO0A 3LCXA 3G18A 4EF8A 5HQEA 2OJPA 3NL3A 3TQ0A 3A21A 4E38A 3QSRA 3F03K 3GZ3A 2YYUA 2UV8G 1F6PA 1PIIA 3M7WA 3G22A 1VPXA 3NL2A 5HULA 2VFIA 5DXYA 2Y7FA 4BWLA 3Q58A 5D33A 4PL2A 3TK7A 1XDMA 4O11A 3L0KA 2GJLA 4CQ8A 3ABOA 4EIVA 4HNNA 1DORA 1Y0EA 3H53A 4ORIA 3AJXA 4LRTA 2ZBTA 4JNMA 1UB3A 3OVPA 4HNTA 4LS2A 3TX9A 3GKAA 1OX5A 3KVJA 3DH7A 1KV8A 5CG7A 1G4PA 3O6YX 2X30A 2I14A 4OWGA 1HFBA 1F74A 3GR8A 1G67A 1I4NA 4XTIA 1YTKA 1F73A 3KXQA 3ZFHA 4ZQCA 2NUXA 3W7MA 4IJBA 3HB9A 5AHIA 4NZFA 3EXRA 5AHEA 1A5SA 3TQVA 1YADA 5CZ0A 3YPIA 4PA8A 2A5HA 1X8FA 1I2QA 3F4WA 1KTBA 5DY3A 4LNYA 3ABQA 3W7LA 4OU1A 2QJHA 3RLUA 1NEYA 3C2OA 2FPVA 4B5NA 5U7SA 4GC4A 5KTLA 6ALDA 2JBMA 3A22A 1JCNA 1TJRA 3UNDA 2GVGA 4A2RA 1RD5A 1SR9A 1IXNA 1A50A 5HINA 3W72A 4R34A 3L0GA 5KITA 4XBSA 2VOMA 4P61A 1MZHA 1B3OA 3W84A 8TIMA 5K9XA 3P82A 1GG1A 4I7UA 5I3KA 4MOZA 1KM6A 3LHYA 3NQDA 1VQTA 2FB3A 2VFEA 3N3MA 3FS2A 4DPQA 5EYWA 3NQMA 3DGRA 4K8EA 3MJYA 1TTQA 3IIPA 3HG4A 2A0NA 3H54A 1LYXA 5CPLA 2ZFAA 2JKAA 4JS3A 2BZNA 1FXPA 3CIXA 2DZVA 3ZWTA 5D04C 4ML9A 4NXSA 2RDTA 1OYBA 3EX2A 1G69A 3QFEA 4K7YA 3VCRA 3BG5A 4DEFA 3ATZA 5DXXA 1W5NA 5TIMA 2J24A 2Y6ZA 3IIVA 2J9XA 4N9CA 4KFOA 4BFAA 3VE7A 1IXPA 1VGAA 3CEPA 5HWNA 3RK8A 3HBLA 1XFBA 3B4UA 2CZEA 1LCOA 1FXQA 1KTCA 1OX4A 4QSHA 4O12A 5D32A 4N9DA 3NPVA 3QQ0A 5AC8A 1B4EA 3HO8A 3W83A 2JK2A 2TPSA 3OVQA 2NUWA 4PFMA 4CNNA 1J2WA 1OFDA 3P7YA 4H4IA 3PM6A 3G3MA 2QJGA 4FNTA 1K8XA 4G1KA 3THAA 4KWWA 2G95A 2V5LA 1VS1A 3GDKA 2BWGA 4NXKA 1EP1A 4UXDA 4N9BA 3S1VA 2V0TA 1KFKA 1SU5A 1LOLA 5SWUA 1H7XA 3EKLA 3G1HA 2CZ5A 3S5NA 4XZ9A 5FEWA 2W0UA 2X2GA 3NEVA 3QMRA 2CW6A 3NNTA 3QMSA 2E77A 4N4QA 3WK2A 3MI2A 3NQVA 1OG0A 1VCGA 4WY0F 4O16A 3HG5A 5LZLA 3O6CA 1DV7A 1Q6LA 3NQ6A 3T78A 4UFMA 5AC6A 3CHVA 3NM1A 3LTPA 4KWVA 4AF0B 1OJXA 1TSIA 4O19A 3W2KA 4Z1AA 4HNVA 3E96A 4Z08A 3E12A 5HWJA 1VCVA 3C2EA 5I3FA 3QM3A 2R94A 3KRSA 3PBVA 4WJEA 3PG9A 1DHPA 2A6LA 2V82A 4U28A 5IBXA 3MP3A 4IPJA 2ABBA 2RH9A 2TRSA 4GJ1A 3GDLA 3O07A 1WQ5A 2GPTA 3HG2A 4Q33A 4BI6A 3R13A 4XKYA 4AHPA 3W74A 4S2BA 4DXVA 4FB7A 3E0IA 4UTLA 4O54A 3HG3A 4DPPA 2F84A 3L5AA 4GE8A 4UC5A 3UPBA 2ZZ2A 4A22A 4MLJA 5I3IA 1ICSA 4GUHA 3W76A 1FCUA 1A5BA 4OHQA 4YCPA 4JD4A 2DZXA 5K3VA 1ICQA 3CT7A 4LS1A 2FFCA 3W2MA 1KLZA 1QPOA 3GB6A 4M6VA 3A5VA 4KFNA 3GNDA 1I2OA 3UWZA 1TJPA 5FF2A 1OFOA 2NV2A 1I8JA 1ONRA 2Y7DA 1KA9F 3TE9A 1ZAIA 4YMZA 4IX0A 4EWND 1K7EA 2ZCGA 3KVLA 3DI1A 3PF3A 2P0OA 4L4MA 3PUOA 4LVFA 3WJWA 1ZALA 2A7RA 2A2IA 3W7NA 3N14A 3LTYA 5EY5A 3TDFA 3S0CA 4TIMA 4X9SA 3LCIA 4UIOA 1H1ZA 1SUXA 1UBSA 2P1FA 1F2JA 3TC7A 3M5ZA 2QDGA 3LCFA 3DFTA 1NF7A 3G1VA 3EWXA 1OYAA 5CGQA 4HPJA 2CWNA 3KRUA 2I1OA 3G1FA 1H7RA 1R30A 3SSJA 3BG9A 1UUMA 1EUNA 1LROA 4OE7A 3HGOA 3P74A 4RJEA 5C55A 3W7PA 2V2CA 4Y96A 2LLEA 3LLDA 3T44A 5KMYA 1LP6A 2NZLA 1GYNA 4LY8A 4WXYA 3IVUA 5HR6A 2YXGA 1XC4A 3VNDA 1L2UA 3M44A 4O13A 1K7XA 1UJPA 1PCWA 4JN6A 3EB2A 1PHWA 1FQ0A 1TPDA 4MY1A 2ZZ4A 4FEZA 4TMBA 3UY8A 1OK6A 3KHJA 3L2IA 1DQXA 5HUPA 5KZMA 1W1ZA 4TR9A 2AAMA 1T99A 3RLVA 3UPWA 2NWRA 2C14A 1EP3A 4JEQA 4O10A 4M6QA 3B8DA 2E6DA 2A4AA 2V2DA 3PBUA 5DCDA 3CC1A 4LUIA 5EA9A 3BO9A 5DCEA 2CLOA 3NPXA 2DORA 1LRQA 5AHLA 3NQCA 3HJZA 4JDBA 1C9DA 1TV5A 1TPWA 3EX3A 3P5ZA 3LLFA 3W73A 5G1YA 1NAL1 1AK5A 5IM51 1VHNA 2FDSA 4UTKA 2WKJA 3I68A 3WJSA 3SGUA 4FX7A 5EL1A 4RLIA 2ZRWA 3T40A 2QAPA 2R91A 5E1QA 1C8VA 3KVMA 3P62A 3IVTA 3HF3A 2QCDB 1MEIA 3W7GA 1VYRA 3LRLA 3KOFA 2X16A 3RNDA 1OK4A 5LKYA 2NXGA 1XBVA 1EPXA 4UFLA 1CI1A 3QRHA 3TJXA 2VKZG 4QISA 3MO7A 1VR6A 3MP5A 3LERA 3B04A 2FJKA 3NDOA 1QNVA 2C19A 4WUIA 1MEWA 1MSSA 1TTPA 1YLVA 4FNQA 2XN1A 4CNOA 2YYTA 2QUVA 1JCYA 5DLCA 1OFRA 3M5XA 3LM7A 1KTNA 3W70A 5EKYA 1SZFA 1WXJA 1JUKA 3O16A 4M7TA 1I2RA 5K7JA 1U5JA 4FHAA 4NJJA 1T96A 4QM1A 3LB0A 3GXPA 3B05A 5D2YA 3PULA 5A8GA 2NX1A 1RVGA 1QDSA 4IXHA 5BW6A 2O7QA 3NGJA 3C4UA 3DHDA 4UFKA 5BMXA 4J9JA 3TW6A 4O4VA 2NX3A 4IMFA 3LHTA 2J6XA 2WQPA 2V9DA 1J5TA 1UCWA 2V8ZA 4PTNA 4CCCA 1H61A 3NQ7A 3L67A 1SFJA 1ZENA 3UYCA 2YW4A 2GVJA 3NQEA 1FCVA 4TMCA 2BSLA 1IGSA 5A5WA 2C3ZA 3JR2A 2PRMA 3S5YA 3LBCA 4NNBA 4UTUA 1KLYA 1ICPA 1ZAHA 1EIXA 4LVDA 1ZY9A 4UFHA 1THFD 2JKPA 4HSNA 3FA5A 2GJNA 3W7RA 1N55A 3N9RA 2QF7A 3S9YA 2BX7A 4FO4A 2EKCA 3D0CA 4AH7A 1L6SA 5DN1A 3UZJA 3DXIA 3UY7A 2VFHA 1W37A 4BR1A 2FLIA 1XKYA 1Q6RA 4NX0A 4O52A 2CLMA 3JS3A 5AHFA 4WX2A 4O4WA 5G1TA 2ZTKA 3TQKA 3SECA 4XTDA 1ME9A 4AB4A 3U6WA 1DOSA 1P0NA 4NUWA 3C61A 4O1DA 1GOXA 1G6CA 1N8FA 1N7KA 4LC8A 1DKWA 2EAWA 3STCA 4LV4A 5FF4A 2PRHA 1JCLA 3FYPA 4BI5A 2QCEA 3W1PA 1YDOA 2Q3OA 1K03A 1XUUA 1PCKA 4HPXA 1W56A 3L0NA 1W5QA 1F76A 1WBHA 4ZQPA 4GWEA 4WY0B 4IXXA 2ZYFA 3MYPA 4NZJA 3V1PA 3HPSA 4DBEA 4HHPA 5CZTA 5K9DA 3C8FA 4BWLC 2E5BA 4JY8A 2WJZA 1JR1A 3EXTA 3PBYA 2A21A 3OIXA 1PE1A 3DFOA 4QIUA 3RF9A 3NXFA 3UWQA 2C18A 3BGJA 5AYXA 4UCGA 1TIMA 1KW1A 5BNKA 3QSTA 3CWNA 3QH2A 1SW7A 3GK0A 2D73A 1O60A 2Y88A 5KZDA 5AFDA 1FDJA 4RV8A 1OFEA 2VFFA 4MVAA 2CZFA 1SO3A 4LVGA 3S1WA 2CU0A 3C56A 2JGYA 1FDYA 1FDZA 3W23A 4RR4A 1LTDA 1R2SA 3NQ8A 5U4NA 4FNPA 2Y85A 1HO1A 1S5VA 3M1ZA 4O53A 1K7FA 1L6WA 4JTSA 4MY8A 4TU1A 3BW3A 3ELFA 4KKXA 4RKAA 5F2GA 4Z0SA 4FX6M 4JGDA 3MI6A 3A23A 4GUIA 1AW2A 2BXVA 3TJLA 4JY9A 1JRBA 3TXZA 3WK3A 3TSMA 4JYDA 3P84A 1S5TA 4LRSA 2B4GA 3MBDA 4N6EA 4HSOA 4E2BA 3UQNA 3OA3A 3QPZA 3W75A 1QPNA 4XBKA 3RMJA 1TQXA 1TPB1 3L68A 4CQAA 2Z6JA 3VFLA 4FNSA 4M6PA 1SQ7A 4MZ1A 5F1VA 4EOUA 3DFSA 3UXAA 2GOUA 4MJMA 1LBMA 3V75A 1UASA 3MBFA 3LHUA 4R7JA 1V5XA 2DZWA 3O1NA 4AWSA 2EF9A 3GNNA 3BW4A 3P80A 3E49A 4N9EA 5F4WA 1TPH1 3S5OA 1R46A 1P4CA 1G4SA 1RPXA 1Z41A 3LRMA 3SJ3A 3PUEA 1X1ZA 1ME8A 3EWYA 5L6UA 3GVGA 4ADSA 5DY2A 2H8ZA 3PB2A 3QMTA 3IVSA 4MUZA 3FYOA 1XCFA 1H63A 1Z42A 1TRDA 3FJ6A 1GZGA 2HS6A 3Q37A 3ZS4A 1JQVA 4CQ9A 2YX0A 1T0OA 3TAKA 1VC4A 2J9YA 3L65A 3O05A 4UFIA 3MW7A 3NR0A 5LNVA 2OMAA 1FBAA 3G1DA 4I7WA 2WSRA 3MHGA 1BTMA 3N73A 4JX4A 4OQVA 1H50A 3CB8A 4AXKA 3TFCA 4JDYA 4D2JA 4NQ1A 3INPA 1G4EA 4NJGA 2CLLA 4NJKA 3W1XA 3EX4A 3IGXA 2YPIA 3STFA 3W2UA 3SW6A 1KFEA 1TMHA 4NNAA 4O18A 3RFAA 4UMBA 3S8HA 2Y62A 1QPRA 1LLZA 2J27A 1PV8A 5KINA 3G8RA 2V2HA 1GTEA 4JTTA 5ABTA 4DBDA 3HGJA 2V81A 1G7VA 3W2JA 4ADUA 1S3HA 3NQGA 5E93A 3UXDA 3NPWA 1W5PA 2XN0A 2G5WA 5LNRA 3R5EA 3LCWA 4JYFA 3USBA 3TSBA 3PSWA 2W79A 1Z48A 2EHHA 4PH6A 2G96A 3PR2A 1MO0A 4QNEA 4XUGA 4EF9A 5IBXC 3SZ8A 3B03A 3GXTA 1KBJA 4TO8A 4NVTA 1X1OA 2VEMA 5AB3A 4ORMA 2NLIA 4UR8A 3I7RA 4E0CA 1SSDA 4O1BA 5AYZA 4GUJA 1LORA 4YXGA 4UTTA 1AG1O 3P60A 1L6YA 2EPHA 3GLCA 1T8XA 1K02A 1QOQA 3FFSA 3W86A 2YR1A 2QCNA 4K7VA 3NAVA 4IPIA 1TPUA 4GXMA 3L5MA 5KSWA 1GEQA 1WX0A 4ZZ9A 5LNSA 2E68A 1EX5A 3C3NA 4OT7A 1I2NA 4HKPA 3W2NA 1P1XA 4O50A 2CLIA 1ZFJA 3QF0A 2RFGA 1SSGA 4NX5A 2RDUA 4WQ6A 1KFCA 2Z1BA 1W5MA 4DF2A 1H60A 5FF3A 1JJKA 2V5BA 4MZYA 5BOOA 1TPEA 3O15A 3WJXA 1TO3A 1YXCA 1NFBA 1WDWA 3GX9A 4OBTA 2NXIA 1R2RA 1G7UA 3PAJA 4Y90A 1O4UA 3O63A 3P61A 1LZOA 1B57A 5AOUA 3S1UA 1IF2A 4YLWA 1SO4A 3R2GA 2A6NA 3P81A 1PS9A 3WJYA 4FX8A 3BW2A 4UTWA 3MHUA 1LBFA 1FY6A 1BWKA 3W71A 1HL2A 2PCQA 2R14A 3C2VA 1KFJA 1TCDA 4PC8A 1R2TA 4ZQMA 5FEPA 1OX4B 5FESA 1RQBA 4CNPA 1B4KA 1YYAA 2ZDRA 1KFLA 4UTMA 1WV2A 3FEMA 5DCBA 1OF8A 4O0ZA 5HWMA 2DZSA 2YCEA 2ISWA 3GDRA 3W88A 3LX9A 1RQEA 3KRZA 4LVAA 4DELA 3F4NA 3KFTA 3NZRA 4NNCA 2YGYA 3LBMA 1C29A 5HUOA 1PHQA 4A29A 1P0KA 3LCGA 2VXNA 5FEXA 1YTEA 2QCCA 4YL2A 1SO5A 4ZQRA 2AQWA 3HIJA 3P67A 3K30A 3QJAA 3W07A 3I7QA 2YDAA 4CCDA 3B0VC 1GVRA 3S42A 3VKJA 2WV8A 2RDWA 3BARA 3PBWA 3MYOA 2ZZ5A 3OBKA 4DQWA 2QUUA 1A5AA 3GYEA 1AW5A 2E5CA 2H8XA 1EA0A 2X1UA 2B7QA 2DP3A 2H3DA 3LCHA 3LTSA 4WY0A 1AL8A 4AHOA 1OF6A 2VEPA 4JIQA 2OX1A 4RZ5A 3KAOA 5F1UA 1KV5A 2NUYA 3C0JA 3DBPA 4ZQNA 2Z2UA 2X1RA 5D02A 2QCGA 1GPWA 3DZ1A 3NPUA 3M0ZA 2WSYA 1W0MA 1UUOA 3O6DA 4JTJA 2CLKA 3IIZA 2I9EA 3LHVA 2ZA2A 5HMSA 4PODA 3U8GA 3PSVA 5CPOA 1TYGA 4XWUA 3NL5A 1VLIA 2FPTA 4X2RA 3Q2DA 4X22A 4O28A 3LV6A 5BRBA 1F7BA 1WOAA 4XKYB 3TU9A 4MPQA 1ADOA 1JRCA 1I2PA 1FCBA 4QITA 3BLIA 1EB3A 3DU0A 2ZTJA 1EEPA 3N2MA 5LSMA 3GDTA 4MYXA 1F5ZA 5TQLA 4L4LA 2ISVA 2XFWA 2BTMA 2ZA3A 3EEGA 3BGGA 4JIPA 3PUDA 2DJXA 4ONVA 2E1DA 7TIMA 2CLFA 3G1AA 5G2HA 3W1LA 3W7KA 4PCFA 2WPBA 3W85A 4Z1DA 3QQ1A 4WXZA 3SI9A 3F1QA 1XDLA 4LU0A 3G8EA 3TXVA 5G4EA 4WZHA 2Q8LA 4P2VA 2ZZ3A 4CLMA 2Z6IA 1DL3A 1B9BA 2HMCA 1GJPA 2H6RA 3G1SA 5F2MA 4UUIA 2E09A 1TREA 3M43A 5C6MA 1JUBA 2J9ZA 3SIZA 4O15A 3N9SA 4I7VA 5G5IA 3UZ5A 4WOZA 2QDHA 3W3OA 3UD6A 3GXNA 1Q6OA 5CZSA 5MHBA 1IXQA 4KFPA 3SFKA 1BKSA 1SW3A 2ISSA 3TMQA 3EX1A 2TYSA 6TIMA 3P5YA 1FWTA 1V7YA 3FJLA 1R47A 3G0UA 3I7SA 1SZNA 3STGA 3G1YA 2B7PA 4GUFA 4C1KA 2YW3A 3UWVA 3G0XA 1FWWA 2H90A 3GR7A 4BI7A 4MZ8A 3W1NA 2QAFA 1WOBA 2ZRXA 5LGZA 2P10A 4FNUA 4AWUA 1QAPA 4ZL1A 3TV8A 3TKFA 1MXSA 4ALDA 4RZ6A 3QC3A 5D2WA 3EWZA 4Y6GA 1A53A 2C1HA 3W2LA 1GQNA 4MJZA 5D38A 1GVSA 5GVJA 3TSDA 4JXCA 3WFAA 1F6KA 1SZEA 3A5FA 4AEOA 2CLHA 4O17A 4LV9A 4ZVJA 2O7SA 2IQTA 3N34A 3CIWA 3GAYA 4QNWA 3DENA 1A5CA 4FF7A 1GTHA 5LNUA 3A24A 5D2XA 4E2DA 3M6YA 5D37A 1NF0A 3C2FA 1EP2A 2VC6A 5FI8A 3PS7A 4LC6A 1OFQA 3EWBX 4UNKA 2NXHA 3LXCA 1OHLA 3TW7A 3DKLA 4AF0A 3W1AA 3I6RA 4O1CA 1KBIA 2E6FA 2PURA 1XXXA 1GVOA 1WYIA 1OFPA 4ZMGA 2YSWA 4CCEA 2DZUA 3IV3A 4FIRA 5FF7A 4JYEA 5CPNA 3GAKA 1KM1A 3DFQA 4XQ6A 3N19B 4A3UA 1J4EA 2ZZ1A 2EGZA 4BK9A 3NQFA 5LHEA 3PVFA 3VE9A 5DBUA 2RHGA 2ATMA 2FPYA 3TROA 4EVZA 2A7NA 5G2WA 4LS0A 3U2OA 1DVJA 1QO2A 2Y70A 2W6RA 1QO5A 3NQ2A 1VCFA 3LHWA 3EX6A 1XBXA 5AYYA 1W5OA 1M5WA 4HIBA 2HS8A 2HTMA 3OVRA 1JCJA 3BLFA 3DHFA 4RK8A 4YWIA 3P8IA 3W7QA 2ABAA 1GYLA 1DQWA 3IEBA 4IUOA 1LBLA 3QYQA 2WNNA 3CLMA 4PL1A 1XBYA 3LXBA 5CPMA 2C13A 4JX6A 1FWRA 4NJHA 5AC7A 4NU7A 1IXOA 1IIHA 2QUTA 5J5DA 4K36A 3BK0A 1YXYA 3BLEA 4QAIA 3THQA 3DFNA 4DO6A 3FLUA 1D3HA 4LT9A 5CSSA 4N4PA 2YFOA 3PB0A 1QFEA 4JTLA 3NZ1A 5DELA 1FCQA 2QCHA 1GVFA 1H51A 3NOEA 1PL9A 4O8RA 1OFBA 4M5PA 3HQ1A 3W1MA 2B7NA 3BV4A 4HN4A 3W7OA 3W7IA 3B0PA 2ZRUA 4JTEA 3EXSA 4UMCA 3BG3A 1XI3A 3TMLA 3B0UX 1SO6A 5K9CA 4R53A 5D30A 1TV8A 3M47A 4AHQA 4DF1A 3DAQA 4Y9AA 4TX9A 2C16A 2PRLA 1JVNA 3PC0A 4K6AA 3TR2A 2PE4A 5K4XA 4LW7A 4H6KA 3W7EA 2CLEA 4JTGA 4WOQA 5H91A 4Q4KA 3UWWA 5D2VA 5C5YA 5G4WA 4NT0A 1PVNA 4O1AA 1U83A 1TTIA 3C2RA 3EKZA 2F7FA 4GUGA 3L21A 3EWUA 3T4CA 1I45A 4Z1BA 4MFDA 2FIQA 1RR2A 4QJ1A 1HUVA 4AAJA 2WNZA 3IGSA 3Q94A 4K8HA 2VFDA 3IIXA 1XUZA 2DZTA 1GG0A 1JULA 2DZPA 1GVQA 3H55A 3WK1A 1H62A 3MUXA 2AGKA 1O5XA 4Z0JA 3KX6A 2B7OA 4O57A 1W31A 3W22A 3NO5A 2WO5A 1S5WA 2QJIA 4HT3A 4UTJA 4MFEA 1JCXA 3HPZA 1EWDA 4K37A 3LV5A 3UWUA 1VJIA 2A85A 4UNLA 4FIQA 3IRDA 3TFXA 3M16A 1VHCA 3CPRA 4OV4A 1Z44A 3M5YA 1TQJA 4HNUA 1M7PA 3DKJA 1ZJIA 4I9AA 1SZGA 1QMLA 4AWTA 5EMUA 5AHNA 5I3HA 3UWYA 4LUJA 2Q8ZA 1CW2A 1W3TA 1W3NA 2QCDA 5D03A 1ALDA 4LWWA 3NYZA 3BVJA 2ZZ7A 4UTTC 1K8YA 3R8RA 2OCZA 3N2XA 2GQAA 4RXFA 1TTJA 3B06A 1DBTA 1VLWA 3WK0A 3BPWA 1WBJA 1M6JA 2X1TA 1GWJA 4DO5A 3W87A
chains in the Genus database with same CATH superfamily
1LLWA 3C6CA 4RZ4A 1YX1A 3EMQA 4AD0A 5IDZA 1J6OA 4W9TA 1R9ZA 2H3BA 3CWOX 4D8LA 1CGTA 3HMJG 3GHRA 5J5RA 2ZRYA 1B5TA 1R7OA 1WA3A 3A9IA 2VEFA 4PB5A 3L4XA 3O8AA 4H9ZA 1HXJA 3A3HA 1WUEA 3CTLA 3SUUA 3E1F1 4X3ZA 2E6AA 4B9YA 4NHVA 3W6LA 3M7SA 4R27A 3GKFA 4O0KA 3TN4A 1Q8AA 3GW0A 3H4WA 3VDCA 2INEA 4GYJA 3GXMA 3RJYA 4BF9A 1HF6A 1OCNA 2O9PA 4JTIA 1M7OA 1REQA 5HMDA 4NRSA 4Q32A 3HGSA 2NW0A 4E2OA 5LNWA 3R89A 3VIFA 3WFZA 3P2VA 3F4CA 4N7QA 3II1A 5DEZA 2GVLA 4ZB2A 4Q7IA 3VTRA 2Q3RA 1RZMA 3MY9A 1WP6A 4BS0A 1V6WA 4IQDA 5I6SA 2QJJA 2R9RA 3WDPP 4MNLA 4OGZA 4JOMA 4MJ2A 4JICA 2YZRA 1XBZA 5E70A 2QR6A 1XCWA 4IMGA 2AGTA 2O4QA 3AIQA 3HPXA 4IMCA 4D9PA 4RXGA 3RLGA 1ZNNA 2E6YA 3GHUA 3M0HA 1OINA 5BMWA 3M41A 1ZAJA 1ITXA 2P3ZA 4N2YA 3ALGA 3QPYA 2VEKA 1XQKA 4IL2A 4JCMA 3CEUA 4WDUA 4DBUA 5AY7A 3TYAA 4MB3A 3S6DA 1TRIA 1H7OA 2QJNA 3V0SA 1HW6A 3AROA 1I0DA 3VKDA 2OG9A 4MADA 4DI8A 1GYMA 4W8AA 3RR4A 4BHYA 3LHZA 1ODZA 3M5VA 4XUYA 3H2CA 1SYTA 1BPLB 1RALA 1JPKA 4NYUA 3S1XA 4ACYA 1XD1A 1FWNA 5K2ZA 2OKOA 3T0CA 4EXAA 1AL7A 3CBWA 4IWWA 2NV1A 5F4SA 3KLKA 4AMAA 3PPFA 4Z1CA 3CUXA 1O5KA 3MHFA 3SN4A 4N02A 3FGCA 2CBUA 4S2CA 3MVTA 1W8SA 4HMDA 3IRSA 3MMWA 4FALA 2BV9A 3R11A 3N13A 5D05A 1NSJA 2XVGA 4FMVA 4XD6A 2FQIA 2WOQA 1NM9A 4QE5A 4Q22A 4D71A 5IXEA 3DBNA 3Q65A 5D2TA 4GNJA 2XGIA 4V1YA 5CZJA 3P8JA 1KXVA 1WAUA 4YIWA 4Q4RA 3CUIA 4CNSA 3BXWA 4D6HA 4UFJA 2G97A 3TOPA 2IKHA 1J01A 3TAOA 2POTA 1EO7A 4IX2A 1X6UA 2BGQA 2JQXA 3LRKA 3GQYA 3TNBA 3T2OA 4L7ZA 3NVTA 3UVIA 3BICA 1VBJA 2OEJA 4FLQA 1GJWA 3PWAA 1C92A 1JQXA 1Z7AA 4DO4A 4J7RA 2OZTA 2VGGA 4A3RA 1G4TA 4S3BA 3MCNA 3TVAA 2FZDA 4S3KA 4DF0A 2W27A 2NWSA 2V6AA 2QGHA 3RX4A 3DI0A 3TNOA 2OEMA 3CV2A 1ZBVA 3CO4A 3T7VA 4IQLA 1QTWA 1A3HA 4GH3A 2QCLA 4DRSA 5M2FX 2BASA 3HU7A 4QQ3A 1FWSA 4ERIA 2YFNA 1AH0A 2C0AA 2QIIA 4HB7A 5AHMA 4A05A 1PXGA 3WEMA 2DJLA 3B9NA 4IIHA 4D1JA 2GQ8A 3W7HA 4WHBA 3TUUA 3TYZA 1D8WA 3E5PA 4FLRA 1PKYA 1TCMA 1QOPA 4G7EA 1AW1A 2NQZA 2VT0A 3QW3A 5C54A 3ID7A 3SR7A 4UMAA 3OGRA 5A95A 4XB3A 5H6HA 5EGRA 1DTNA 1E51A 4IPPA 3LCXA 3G18A 2O9OA 3VIMA 3A21A 3BAIA 4E38A 2WZIA 3PHAA 2BVTA 1XSJA 3F03K 2YYUA 3UZXA 2D3NA 2X8RA 2XFYA 4RW3A 3HURA 3U4FA 3RDKA 2VFIA 4GXWA 2INFA 4DYJA 5DXYA 3AICA 2E9LA 2Y4SA 4BWLA 3VUSA 2OWWA 3AYSA 4PUWA 3L0KA 3CHDA 1FWIC 4EIVA 1K6WA 4IGMA 3AJXA 3UVAA 4Q7BA 4JN8A 3QGAC 1FWCC 4LRTA 2I5GA 4C6JA 1H09A 4LS2A 3N1AA 3EKGA 1WNOA 1G4PA 4H8VA 1HFBA 4D6FA 3GR8A 1GVYA 5CJNA 2RUSA 1QI2A 3I4KA 1F73A 4Z2LA 3OVGA 4REQA 4ZQCA 4L9YA 1VAHA 2OWCA 3EXRA 4J3TA 1GVEA 4FLOA 2DQWA 1KTBA 1TE6A 4C6KA 4KRUA 1LJYA 2QJHA 3ZLFA 3U4AA 1V0NA 4S3JA 2W66A 2C0HA 3PJTA 5U7SA 4L1XA 1JCNA 3PZIA 4YTRA 1SR9A 2V5DA 1TFVA 1A50A 4R34A 3FVMA 3PZNA 4XBSA 3E2SA 2BG5A 3P82A 1GG1A 4LAOA 5E6ZA 3KCLA 4MOZA 4WIWA 3CL6A 3WQOA 5C2CA 4JBRA 1VQTA 3NQMA 3DGRA 1BYBA 1MUCA 1XLAA 5CPLA 2BZNA 4W5UA 1LG1A 3CIXA 3QFEA 3VCRA 1LUCB 4DEFA 1G5AA 4JNYA 1W5NA 4E4UA 3AHTA 3IK4A 3V35A 3A6OA 1UH3A 3QGVA 3ZYZA 1OC5A 2HQAA 1W1YA 2FH6A 2CZEA 4A8LA 3ISIX 1KTCA 1OX4A 3GSMA 2VDHA 2WMJA 1B4EA 3FEQA 3N9KA 6PTDA 2VX7A 2NUWA 1UJQA 4CQBA 5I78A 3FDGA 2QNEA 1UZDA 5BU6A 1TZ7A 4R5EA 2DW7A 4G1KA 3THAA 4HNCA 1D3CA 4KWWA 3VOHA 2DUZA 2V5LA 2D69A 4IIEA 3MWCA 3SAZA 3EA1A 3FV9A 4KEUA 4N9BA 4KWUA 2DZBA 1J93A 4PTWA 2V0TA 3QGKC 1SU5A 2OEKA 2OLHA 3RXZA 1LOLA 1VD6A 3G1HA 2CZ5A 5TAOA 1PKMA 3VGGA 2W0UA 3QMRA 3MI2A 1OG0A 1VCGA 1H0GA 1QOXA 4WY0F 4E2VA 1AQHA 1E43A 3WLMA 4UFMA 5AC6A 2HE5A 2JEQA 4KWVA 1TV2A 4O19A 1KR0A 4QRNA 3WBEA 3E12A 1NP0A 3GXDA 5I3FA 3QM3A 2GYIA 3KRSA 2GGEA 1V0KA 3ABZA 1CXHA 4YNGA 4J3ZA 4WJEA 1DHPA 1G9HA 4F40A 3U3HA 3CYVA 2TRSA 3GDLA 4W87A 1WQ5A 3EA3A 1MQRA 4XKYA 1FH8A 4DXVA 3S4TA 4AIOA 4UTLA 4URIA 2YDRA 3GIQA 4DPPA 1VPQA 4YS1A 2IQDA 4RZBA 4UC5A 4Y2WA 2OOGA 2WKGA 4MLJA 2CC0A 1ICSA 2Y8KA 4GUHA 1A5BA 2RDXA 4M24A 3BQ5A 5K3VA 4HYRA 4LS1A 2FFCA 5E6YA 2UY5A 2ZOXA 3A5VA 4CNTA 1I2OA 1UA7A 1GK8A 4JQ1A 3UT0A 3C3UA 2FDMA 4MSSA 4XZIA 2X05A 4JQAA 3TE9A 4IX0A 3AIVA 2ZCGA 3ZM8A 2JE8A 3PUOA 1SJDA 3VABA 1ZALA 2A2IA 4Q4PA 5E5CA 3BOFA 1U22A 4DYKA 2CXEA 9XIAA 3TDFA 3S0CA 4I9MA 3LCIA 1LL6A 1SUXA 1UBSA 4UOJA 3TC7A 4B5VA 1EGVA 5DT7A 3LCFA 1BG4A 4D72A 1XIDA 1NF7A 3EWXA 2DVTA 3H24A 3MKKA 5HMEA 5CGQA 3UJFA 2J8GA 4HPJA 2CWNA 3KRUA 1S1PA 2PWHA 1CDGA 3SSJA 1UUMA 3BAJA 2E4TA 3SCVA 1LROA 3HGOA 4RJEA 3BJFA 3QC0A 3GRIA 4A8IA 2V2CA 3A4XA 3KOZA 4DZIA 5KMYA 4WRHA 3EOUA 1XC4A 3IJLA 3VNDA 3UNTA 2GVEA 3M44A 4GISA 4O13A 4YPJA 5BWFA 3TTOA 1UP2A 3UR2A 4FEZA 1OK6A 3L2IA 4H41A 4IIGA 5HUPA 4JHMA 1M65A 1T99A 3RLVA 1FA2A 4KEMA 1LT7A 2WC4A 1B3WA 4JEQA 2ESCA 2OB3A 3CC1A 1XLGA 3BO9A 3M0IA 2X41A 4M82A 3QV8A 2DORA 1LRQA 2FGZA 1I1WA 5JH1A 3V16A 2C71A 2FDSA 1JL8A 1H4PA 2WKJA 2G3JA 4Q4QA 2ZRWA 3CPUA 4ROQA 4KH2A 1VBHA 3MSGA 1OD0A 3ORWA 2NXGA 4Q3MA 2REQB 3QRHA 2PDCA 3AMDA 3MO7A 1XICA 3MP5A 3LERA 2E67A 1GNXA 2FJKA 2C19A 4G6CA 2XN1A 2JEPA 3QR3A 4Z1YA 1KTNA 5EKYA 1VBGA 1MW2A 1JYXA 2HCVA 2HXTA 4AG0A 5K7JA 5AYBA 4NJJA 3ARVA 3LZ5A 1PYFA 3PULA 5A8GA 2CHOA 1RVGA 3T6CA 1QDSA 3C4UA 3DHDA 1ZUAX 5XIAA 1KRBC 2XVLA 3BMXA 3MA8A 1DWGM 3LHTA 1NH6A 2GGHA 2V9DA 1UCWA 2V8ZA 5FAGA 1JNDA 2HROA 4PTNA 3MUZ1 2VX5A 3L67A 4KCWA 2J75A 4KIRA 2OFJA 1YHTA 1DJYA 1ZENA 4H00A 1REQB 4M80A 1FCVA 3TWBA 4XX6A 5FD0A 3JR2A 2PRMA 3LBCA 4NNBA 3UEQA 3HFYA 1KLYA 1ICPA 3WQEA 1OC6A 1ZY9A 4LVDA 1NWUA 2JKPA 3VNJA 4HSNA 3OYXA 3W7RA 3M0JA 1O66A 1AQMA 3D0CA 1L6SA 3GE7A 1W1B1 3UZJA 5A69A 1W37A 2J6VA 3SDOA 4BR1A 4PMQA 3KEHA 4O52A 3CTTA 3H22A 3SECA 3U6WA 3WD4A 1DOSA 4M29A 1P0NA 3E2RA 4XKMA 1GOXA 3N2CA 4PUDA 1N7KA 3WQ4A 1DWHM 4H6QA 1DKWA 3UERA 4LAMA 2X0YA 5BRPA 1JCLA 3FYPA 4K2SA 2QCEA 1V3LA 4QG8A 1YDOA 1K03A 3L0NA 3S1GA 2GDUA 1BD0A 4QJ4B 1MNSA 1VFHA 2XM1A 4OJYA 3V18A 4NZJA 3OU8A 3HPSA 5A2BA 5XINA 3LS9A 2XVPA 5K9DA 3VGFA 1F8MA 5AZ0A 2IKJA 2VRJA 4BWLC 1V03A 2AAAA 3CAVA 2YL9A 3P0WA 4P8XA 1BHGA 4LYPA 5FJOA 3DFOA 1ESWA 1QASA 3SM0A 2C18A 4GX9A 3QSTA 5CSUA 3QH2A 4G2DA 2D73A 3PWGA 2ICSA 5KZDA 5AFDA 4HA3A 5C7HA 2BDQA 5EFDA 3L23A 4MVAA 1B54A 1SO3A 4DLMA 3CL8A 3AXIA 4LVGA 4IM4A 1MRQA 1RPKA 2JGYA 7PTDA 1XIIA 3W23A 4RR4A 1R2SA 3EBVA 3WN6A 3W4RA 3ZZ1A 3R94A 4FNPA 5D9PA 5EU9A 3M1ZA 1MW0A 4H6EA 1E6NA 1Q4NX 1HZYA 4JTSA 4RKAA 3MI6A 3A23A 1AW2A 2BXVA 2VC7A 4HYWA 1N2VA 1K6AA 2AQVA 3P84A 4LRSA 1AFSA 3M0LA 1NDYA 4N6EA 4E2BA 3UQNA 3W75A 1FKXA 1O5QA 2X40A 4KEVA 1XP3A 4QCEA 4R9OA 3ZR6A 2V38A 2CHRA 5HATA 1F4AA 3MV01 5F1VA 3D3AA 3UWEA 3N6JA 1LBMA 1E6PA 3CZEA 3MBFA 1PBGA 3LHUA 3WZ0E 3FY1A 2EF9A 3AOFA 1R46A 2RGMA 1RH9A 3RLHA 3VC5A 1X1ZA 3PB2A 1W8GA 1E4IA 1KXHA 4BF5A 4FK9A 4LNCA 3FJ6A 2BY1A 4AVNA 4PRRA 1VF8A 1UP3A 1J11A 3SCNA 3LU2A 3C8NA 1MMFA 2J9YA 4D6EA 3O05A 3MW7A 5BXRA 3I3DA 5LNVA 2OMAA 3K4DA 3MSDA 4YU1A 3CASA 4UQBA 4IPNB 2GLKA 2WMHA 4AXKA 3CB8A 3PNZA 3QVQA 3D6NA 3ME3A 4JDYA 5FSEC 2G4FA 3INPA 4G7EB 1FH7A 4OVXA 3TP4A 3EX4A 3KBWA 2YPIA 1XR2A 1TMHA 4O18A 2Z00A 3NURA 3RFAA 5C9RA 4UMBA 2J27A 1JFHA 1Q2SA 3G8RA 2V2HA 2QDDA 4PB3A 4GY7A 2P50A 1BYDA 2ODOA 4INFA 2Z2AA 2PTYA 1S3HA 5AC5A 2W91A 5FIPA 3HV8A 2G5WA 3R5EA 5GJNA 3CWHA 1XG3A 2INZA 2EHHA 4PH6A 3WLKX 2CZVA 4QNEA 4XUGA 4EF9A 3C0SA 4B92A 1UD2A 5PTDA 1TUXA 3T07A 3AS1A 4L61A 4TO8A 1G94A 5AB3A 3OGSA 4DIAA 1XDJA 1L8PA 1CENA 1KBKA 1IGWA 4YTQA 4C5YA 4WKAA 2OQHA 4UTTA 4S39A 4QDWA 2I56A 1L6YA 3ITOA 3O3RA 3VOIA 1R3RA 2VP8A 1JXKA 2QCNA 3CL7A 4A3QA 3K8MA 1GEQA 5LNSA 2E68A 4FOJA 1E15A 4OT7A 2DFAA 3S2LA 1P1XA 1ZFJA 1UC5A 2A3LA 2OTDA 2RFGA 1HKJA 3DN5A 4QJ3B 1A5LC 2QYGA 2RDUA 3CUGA 1H60A 4MZYA 3ZQ9A 1KCZA 3CZLA 1W17A 3WJXA 2VVSA 2PDQA 4U5IA 1MFVA 3FW6A 3PAJA 1XRVA 3O63A 1JPHA 3LY0A 1GOWA 2IPJA 2ZDSA 2D2HA 3OG2A 3CUJA 1SO4A 2A6NA 1A3WA 1PZ1A 5H8UA 3MHUA 3PZOA 1BWKA 7A3HA 2OXNA 1JGMA 3QPEA 4ZBCA 3C2VA 4GMEA 1UWAA 4H04A 4HHLA 1OX4B 5FESA 1CIUA 1RQBA 4BY3A 1YYAA 3TTYA 2ZDRA 3BC9A 4F9JA 3WF2A 5DCBA 1MXDA 3RYSA 2PGRA 4O0ZA 5HWMA 3GVWA 1TKKA 2DZSA 3REQA 1UR0A 3GDRA 3AUJA 1N8IA 3LX9A 1R3SA 3TR9A 3KRZA 1ECEA 2WVUA 3KFTA 3LBMA 4G7FA 5HUOA 1E73M 4YL2A 4DUWA 4ZQRA 2V63A 2YA0A 4ATLA 4A4AA 3KTCA 1UPPA 3A13A 3H70A 4TVDA 3VKJA 2WV8A 4JIIX 1LG2A 1KGUA 3MYOA 4DQWA 2JIEA 2Y2WA 4JFTA 4DM1A 4GXPA 3GYEA 4GINA 2QXWA 2V69A 3LTSA 4WY0A 4P7RA 4PMXA 4GIRA 4JIQA 2YOCA 2OX1A 3SRKA 3S2MA 4ZQNA 2X1RA 4P7QA 3ZLHA 4AYSA 3UFYA 3DZ1A 4LCRA 2WJDA 3M0ZA 4JTJA 2CLKA 3LHVA 3VVGA 1RCXB 1EC9A 1PX4A 3G2GA 2XTKA 4XWUA 1VLIA 5CBBA 3Q2DA 4XKYB 1ADDA 3E3HA 3ANVA 4MPQA 3QR0A 2CBVA 3GY1A 3IV8A 4DI9A 4QITA 3BLIA 1RBAA 4DO7A 4C6BA 3PPGA 4H1ZA 3GDTA 5C2GA 5TQLA 2DT1A 4XZHA 4YTSA 3WENA 1M04A 2ZA3A 1GPFA 1IR2A 5I09A 1SVDA 3OLGA 4JIPA 1BLIA 4KW2A 3DYOA 7TIMA 5HQLA 5FL1A 3W7KA 3CAKA 1WDRA 3W85A 4Z1DA 3F1QA 4HD5A 3G8EA 3NSNA 4PUJA 3B9OA 3SO7A 3DFYA 1AUSL 3WO8A 3MUY1 1JEZA 1CNVA 2DV0A 1AH3A 1DL3A 1F4HA 2E25A 4Z17A 3GG0A 2YA2A 4AC1X 5A8OA 1YRRA 1TREA 4AZBA 1QATA 2J9ZA 3SIZA 4PUEA 3MQTA 3N9SA 5G5IA 3M6DA 1JDFA 1EC8A 4C6FA 3UD6A 5JQ9A 3WQGA 3BAKA 1IXQA 3GFYA 4LUSA 3TEVA 2ISSA 1OIMA 1RJRA 3EX1A 2TYSA 1QBAA 4PSRA 1ISWA 3F2CA 1FWTA 3FJLA 2D1ZA 3SRDA 1NFGA 4B9ZA 2BXZA 4LPCA 4F3HA 1XH2A 4A8NA 1KC7A 4EXQA 4BI7A 1BSLA 2WB5A 3CV7A 3UXKA 4IIFA 2VR5A 1UPMB 5LGZA 1GQKA 2Q8XA 2WYSA 3JVAA 4W5ZA 1KR1A 1D2KA 1D8CA 3PJUA 3DESA 3N25A 1SJCA 4RE3A 4RZ6A 1I0BA 3EOOA 3EWZA 4Y6GA 4F0LA 1A53A 3TN5A 1ZPTA 3VINA 1GVSA 3F2DA 5GVJA 2XHYA 3WFAA 2R24A 3A5FA 4GY1A 2PP0A 4ZVJA 2O7SA 4EPBC 2PDNA 1VB9A 3NFUA 2O9RA 3HN3A 1OWQA 4DUXA 1GTHA 4HNOA 4JFSA 3ARPA 1VFTA 4LAZA 1EP2A 1P7TA 2CYGA 3TYCA 3MPGA 1TELA 3VOJA 1OHLA 2CCRA 3QOMA 3DKLA 4J3WA 3CMFA 4CU8A 2G3MA 4PYSA 1OGBA 1W91A 4NIRA 3I6RA 1XXXA 1VEMA 3AHYA 3NSXA 3NZGA 3GTIA 4Y9PA 2YSWA 3LGDA 2WMFA 4GD0A 4GI4A 3ZJKA 3QTGA 3MMUA 4YVPA 3N19B 5H1WA 5JVLA 2H9AA 3MDUA 2PZNA 3S9IA 5LA0A 4QLLA 5ECUA 5BZAA 5E9XA 3WQ8A 2AL1A 2ATMA 2FPYA 4DHGA 3KL3A 3H2OA 3B97A 4MB4A 1XG4A 3BAWA 4Q4SA 5D4YA 2NQJA 3BMVA 1OT2A 4IZGA 4P7LA 1LL4A 2YL5A 4IFOA 3DHFA 1IR1A 1CT5A 4YWIA 3P8IA 3W7QA 2YXXA 1I6NA 2ABAA 4OOZA 4IUOA 1GYLA 2D2JA 1BVNP 3AXHA 3IEBA 4AX6A 4C6LA 3L4WA 5CPMA 3S2JA 4C6PA 3GU9A 2GGGA 4P7NA 1P0BA 3B0XA 2ZX8A 4D6DA 1O5RA 1D3HA 1JPMA 3PZ9A 2BGNE 1C8QA 3NO1A 2DT0A 3UU0A 1FWEC 4ZOCA 4FLSA 1QFEA 1C91A 3R7MA 3NZ1A 5CPSA 3U9IA 3IJDA 2PTWA 4XD3A 3V5OA 2WPGA 2XWDA 5FKYA 1TWSA 3WQCA 3B0PA 4XZBA 4UMCA 2PTZA 1XI3A 1JD7A 3I3EA 3AXXA 3EB4A 3B0UX 3N2OA 5CGTA 4HQVA 2WZHA 4TX9A 1DIKA 4WLCA 4YJ5A 3UP8A 1NOUA 3SFWA 3PC0A 1JZ3A 2R1MA 1V0MA 4WOQA 5H91A 4Q4KA 3PTDA 1RY0A 3OZYA 1R9YA 3EKZA 2PDYA 4GUGA 4YN5A 3L21A 4OIFA 1I45A 2AMXA 1RR2A 4LSBA 1PEZA 1HUVA 2GJXA 3IGSA 1J5SA 3Q94A 4KS0A 1A49A 4LQ1A 3WK1A 3MUXA 4AEEA 2B7OA 3GFZA 3IAQA 2QV4A 3AU2A 3GM8A 2FZBA 1JCXA 3HPZA 1EWDA 4K37A 1GUVA 3UG8A 5FJIA 4LGXA 1E1EA 1VFUA 2PF8A 4O1EA 4L80A 3OBEA 3M5YA 1V3KA 3DKJA 3SN1A 4Z2JA 2ZC1A 1QMLA 4AWTA 1B90A 4J3UA 3QHMA 1W3NA 2QCDA 1ALDA 4UTTC 2ZZ7A 2J79A 3N2XA 3NIYA 1DBTA 3LSCA 4UQ9A 3H12A 2PWVA 3WK0A 3ZXWA 1KCXA 5BOEA 1M6JA 2X1TA 5IRPA 1GWJA 4GQQA 3PFMA 2W61A 2ZUMA 3THDA 4L65A 1JGIA 2PWUA 3MMTA 1P6BA 1YW1A 2F6KA 5HAOA 3AHVA 4Z2HA 3PZTA 5FJJA 3TTQA 4GFSA 2XFRA 4QS6A 3G3DA 2O55A 1RV8A 1YPXA 5CSRA 4KPLA 3W6YA 3EWWA 1LM1A 4N6FA 3MMDA 3VZZA 2UZ9A 3W1UA 4HA0A 5F2IA 4GBUA 2QT3A 1QW9A 1H5YA 1XSIA 3SUVA 2WQDA 2OZ0A 1JDAA 2BHZA 1WKEA 4EANA 2ZQ0A 4NJIA 1P5BA 4RE0A 1OVDA 2FTPA 1JZ7A 3QOKA 4CN1A 5FSDC 1VJZA 3W7JA 4DXKA 4FXRA 4MDOA 5LHFA 3ATYA 4GO9A 4H6RA 4E4FA 4V15A 1WCGA 3IJQA 3ZWSA 2PDLA 4JN7A 4POCA 1YPIA 2GJPA 1UZHA 3IAPA 3OHMB 5CAHA 2GSHA 1LDCA 4K38A 4YWSA 1KM2A 4ADTA 4K1GA 1L6GA 3T8LA 5LXEA 2TSYA 1ZHAA 2G41A 3FJNA 2EJAA 3UXIA 3TH6A 1Y5XA 3FKRA 3NVDA 3LMYA 4KERA 4HA1A 2ZVIA 2EO7A 3C0LA 3N4FA 4KQNA 4IFRA 3WD0A 3K1GA 5HJXA 3UZYA 3DX5A 1JZ4A 1W1VA 2XM2A 3QZAA 1QBBA 5BXSA 2G3NA 3FIGA 3W1RA 1W1IE 1KB3A 3AC0A 2QVNA 1IT0A 1XLKA 2WVVA 4RCXA 4DAIA 3IARA 1ZCOA 4HP5A 2Y63A 3B40A 4Q8WA 1HVQA 3E6EA 4A3HA 3E0WA 2R8WA 1HKIA 1TJ1A 4LTSA 1VFOA 1CPUA 1NWTA 4LXFA 1EGZA 3OG3A 4QE4A 1AQ0A 3W37A 3LA4A 1HJVA 4RNJA 1V02E 3T55A 2NX9A 1H7NA 3LQLA 4LX4A 1HKWA 3W7CA 3BLDA 2CFFA 2GQ9A 3ITVA 1XH0A 5HNNA 5CCZA 2XSAA 5DO8A 2ZA1A 2VFGA 2D3LA 4MLRA 4A3YA 3CB3A 3ZT6A 3OODA 2ZXDA 1VJSA 4TV5A 3AWOA 2A3EA 3NGFA 1DJNA 4NZCA 1SR0A 1C9WA 3WIJA 4S1FA 4Q4OA 1HJUA 4R33A 2GOKA 4WKHA 3FKKA 2C15A 2HPIA 2PODA 1QCWA 3WLLA 1H7PA 2DU2A 1HTIA 3ANYA 5I3GA 1CXFA 1QUMA 2ISFA 2JKEA 4JTFA 4ZB5A 4GX8A 3T0DA 2PP3A 4M19A 4E3TA 3ARYA 1AMKA 2J8TA 2VCBA 1JCMP 3M9YA 3B9DA 5CJ5A 4FXSA 4WSJA 1FHDA 3LYEA 4C6MA 3UA3A 5LGXA 3DEQA 4LVBA 4BEQA 2ZE0A 4O14A 4WSKA 1Q45A 1XLFA 1YTDA 2HDJA 3LDVA 4GCXA 3REQB 2YCIX 2PTDA 3I65A 1HG3A 3S46A 5I03A 5TBOA 2XGBA 3RX2A 2IMRA 2ZZ6A 5HR7A 1CX9A 4PUKA 5HJYA 2IXUA 5I23A 4GABA 3WBAA 1UQZA 5A6BA 2HSAA 2TMDA 5MKGA 2I5IA 2ZXAA 1LRNA 2Z7GA 1F3WA 1V6TA 3WBXA 3QKZA 2J88A 3E9AA 4LF1A 4FOKA 1ADSA 1M3UA 5HQEA 3VD4A 3NL3A 4QTGA 3R8GA 3QSRA 4CKQA 4ZR8A 1AH4A 4HMCA 1PIIA 1RCQA 2CNCA 1LQAA 3NL2A 3R79A 5HULA 1GKRA 2Y7FA 2PDUA 2EBNA 3TK7A 3QFWA 1XDMA 3ABOA 4GZ7A 4HNNA 3GHTA 2PGWA 4O0QA 4ORIA 4AEFA 1M7XA 4LYKA 4R9XA 1OSEA 4DWSC 4LB4A 1XIJA 4PTVA 1XINA 2HWGA 3ZMRA 3TZNA 5CG7A 4B5TA 2I14A 3UGRA 1E4MM 3CQJA 4OWGA 1BKHA 3VUPA 3W28A 3M4HA 1YTKA 3W7MA 1WXZA 1A0EA 4MF4A 4NZFA 3L2LA 4G5DA 3TQVA 1TV3A 3B9EA 3H2EA 1X8FA 5BWAA 3F4WA 1LWIA 3LK6A 1GEHA 1XGDA 3ABQA 4ERGA 1XYZA 3RLUA 3PBMA 1NEYA 3AYTA 3IUIA 1OCJA 1DJIA 3VIHA 4KRZA 2PLCA 2PU1A 3SQMA 1TJRA 3GXFA 1MQPA 4A2RA 1RD5A 5HINA 3L0GA 3UJRA 4H2HA 3LD5A 2P88A 5K9XA 4I7UA 3SY1A 1KM6A 1B3XA 3LHYA 2ON3A 2G4JA 5ABFA 3N3MA 4XIMA 3FS2A 3BSMA 5EYWA 4DNHA 4K8EA 1E5JA 1TTQA 3ZOAA 2A0NA 3H54A 4LUSB 2ZUNA 1UC4A 4JS3A 5A8PA 1FXPA 1CB2A 1DJWA 1IWAA 4X2PA 3EX2A 1G69A 4K7YA 3ATZA 9CGTA 5DXXA 3ITCA 2Y6ZA 3WDHA 3IIVA 2J9XA 4CNUA 2I7GA 1GW1A 4FAMA 3PWIA 4IL0A 4N9CA 2WAGA 4PEEA 1IXPA 3VE7A 5HWNA 4HZMA 3HBLA 1W6TA 2C1IA 2E7FA 2EPMX 2WWCA 5E0CA 1GCYA 3WNPA 1FXQA 3P3BA 4QSHA 5D32A 3KOYA 3U5YA 2WCAA 3SQLA 3WUBA 3NPVA 3QQ0A 3GU2A 1AQFA 2TPSA 4ZO9A 4PFMA 1J2WA 1LT8A 1UQYA 1OFDA 3PM6A 4HVXA 2VMFA 3K2GA 4FNTA 1V3JA 3OYZA 5I5RA 2G95A 2X7VA 2PDHA 3KTXA 3GDKA 1ZGDA 1GOMA 1EP1A 1OQFA 3BLPX 2VUYA 4WDTA 8XIMA 2D23A 1KFKA 2NVDA 3AWNA 1H7XA 4A8RA 3FVDA 2VJXA 2X2GA 2J74A 2CW6A 4IUGA 2E77A 3W0KA 4N4QA 4YHGA 3NQVA 3CV6A 1EA9C 4AW7A 4BQ2A 1EHNA 2R1PA 1PPIA 4K3ZA 1DV7A 3NQ6A 1VFFA 2WZTA 3CHVA 4Q8VA 1DJGA 4DXXA 3LTPA 4KWOA 1WB0A 1EDGA 3MS8A 1IV8A 3W2KA 4HNVA 3E96A 3WD1A 5HWJA 4GNKB 3C2EA 3URBA 4Z2GA 5DMLA 3VIGA 1NY1A 5GPRA 4QDMA 5C7VA 4U28A 5AZ1A 4ZGYA 3XISA 3FXYA 3Q67A 4IPJA 2ABBA 3N4EA 5GNZA 4B90A 4GJ1A 2E40A 4BI6A 1W9DM 2H9AB 1OBAA 5T8GA 1PSCA 3E0IA 3SIMA 3PFRA 2GFTA 4KT2A 4NG3A 3KBSA 4O54A 2NQ5A 1IZKA 2PFHA 3AUOA 2R1LA 3L4VA 1E9IA 4CUCA 4RE2A 2HV5A 1LLOA 4J28A 5CXPA 4JD4A 4YCPA 2GK1A 4ZCWA 2FMNA 4NSBA 1ICQA 3EDFA 1Z8AA 2B81A 3W2MA 2OQLA 5JBFA 4M6VA 3GNDA 2D2OA 3UWZA 1TJPA 1E40A 5FF2A 1R7AA 2IKIA 4XSLA 3KP0A 1I8JA 3GS6A 3MUAA 4B5SA 1E0VA 3DHUA 1NOWA 4L6OA 2F9RA 3M0KA 1XGEA 1SJAA 4YMZA 4NZ5A 3VIPA 1BGAA 4JCLA 4L4MA 1E1FA 3WJWA 5FCZA 5KZ6A 3W7NA 1E56A 3N14A 2XWEA 5BOFA 1S2VA 1A4MA 5EY5A 3CNYA 1FP9A 3VYLA 3DIPA 4GFIA 2DW6A 3FA3A 3G1VA 4QS5A 1H7RA 3BG9A 3GFXA 4NI8A 3TN3A 4OE7A 3QKEA 3P74A 5C55A 3W7PA 3DC0A 2LLEA 3T44A 1LP6A 1W9VA 1WKFA 2HVNA 1GYNA 4WXYA 3IVUA 5HR6A 1L2UA 1EH9A 4JN6A 3CH9A 1E0UA 1TPDA 2ZZ4A 4TMBA 3NTYA 4HU0A 4HJFA 2GJXB 1DQXA 5A1AA 2AAMA 3UPWA 1NDVA 2C14A 1EJRC 2XH7A 1DXEA 3B8DA 2E6DA 2V2DA 3PBUA 5DCDA 5EA9A 1K9FA 3OTRA 2CLOA 3CAWA 1R85A 4RNFA 3NPXA 1C9DA 1RAKA 3LLXA 1AK5A 3DYMA 2PDIA 5I0DA 3I68A 3WJSA 3SGUA 4FX7A 3T40A 2R91A 3P62A 1P6WA 2QCDB 1BVWA 4L56A 3ZJ6A 2VUNA 3GG8A 2X16A 2PSNA 2FH8A 1XBVA 1EPXA 4JQ2A 4CQCA 3TJXA 5D9MA 4E3VA 4QISA 3ITLA 4L5ZA 2NQ9A 2HJPA 2DH3A 4ZB0A 4WUIA 4FNQA 1MSSA 1YLVA 1FWJC 3MSYA 1CWYA 1JCYA 4S3CA 3M5XA 3M07A 1SZFA 3PP7A 1CCWB 2FYMA 1JUKA 1I2RA 4ZE4A 3QR1A 1J79A 1T96A 3BL3A 3CV1A 4JNZA 5JXQA 3B05A 3GTFA 2PS2A 2NX1A 5BW6A 3NGJA 5BMXA 3TW6A 4O4VA 6A3HA 2NSXA 2J6XA 4AIUA 3I6TA 1QPKA 7TAAA 4CCCA 1TVLA 1JXJA 2CXGA 3KS6A 3KRBA 2XUCA 3TCSA 2YW4A 2GVJA 3NQEA 2DIJA 1UWRA 5EFFA 4TMCA 2BSLA 2WBGA 2XIJA 4J3XA 3BQ6A 1CXEA 2PF0A 2BY3A 2BFGA 2DEPA 4UTUA 1ZAHA 1GQLA 4XAFA 1THFD 4ENLA 2OVLA 4OBSA 2GJNA 4MAZA 4DJDA 1N55A 2QF7A 3S9YA 3RHGA 2BX7A 4ZFMA 1AD1A 4GQ0A 1OIFA 4AH7A 2YBUA 4HOZA 3A9BA 3DXIA 1RD6A 4HJWA 3UY7A 4CEXC 2FLIA 1XKYA 1Q6RA 4X0NA 4NX0A 3WDIA 3JS3A 4WX2A 1QNQA 2L5HA 4BQ5A 3BUVA 1UR3M 3ITTA 4ZOBA 4XTDA 4AB4A 3KBJA 4NUWA 2WZEA 1N8FA 3DECA 3STCA 4LV4A 3ZLGA 5FF4A 3THCA 2PRHA 4BI5A 3W1PA 2Q3OA 3VD9A 1XUUA 4HPXA 1W56A 4RE4A 1F76A 4ZQPA 3CHEA 4GWEA 2OSWA 3MANA 2ZYFA 2E1WA 2FFIA 5HMFA 4JEJA 4DBEA 2WVVB 4HHPA 4XK2A 2WJFA 1K1DA 1EQPA 3C8FA 3OW1A 4AVOA 4D6JA 1VKFA 3EXTA 3PBYA 2A21A 2JALA 3W26A 7ODCA 2BVWA 3RF9A 3BGJA 5M03A 1KW1A 3G6MA 1P6CA 3WQDA 3EEZA 3FX4A 1M01A 3VM7A 1O60A 2OELA 1XLMA 2CZFA 1QVBA 1IWBA 1WO2A 1L2QA 2VL4A 4MM1A 5HA7A 3S1WA 3I6EA 1S1RA 3ES8A 3W02A 1EHAA 4B4FA 4O53A 1L6WA 1EJVC 2VR2A 4HN8A 3SUTA 1D7FA 3GW3A 3BW3A 1Y8BA 4TVCA 1B9ZA 4FX6M 2Z1VA 1XF0A 5BROA 1JCTA 3O9NA 4JY9A 2WZMA 1S2UA 4K68A 5FA5A 3KLLA 2YB1A 1E1CA 4WCJA 4EPEC 3WH8A 3RMJA 1TQXA 3P0XA 4J3SA 1ZS2A 4H9UA 2W3ZA 3VCCA 3RITA 3L68A 1TX0A 2G37A 2VM8A 3CO8A 3SCQA 4M6PA 4RW5A 4MZ1A 3TW9A 1T5AA 1EYEA 3DFSA 1ITCA 3WQ6A 3RPMA 6XIAA 1KO0A 1GKPA 4N9EA 3PPHA 1TPH1 1P4CA 3EMCA 1X7IA 1RPXA 5ENLA 3EWYA 2H8ZA 4Z42C 5HNTA 3CPGA 3GTHA 4KMQA 4L6HA 1TRDA 3LUTA 2QW5A 3W81A 2ZUTA 1A80A 3ZS4A 4I6KA 2EG6A 3TAKA 4ZSUA 1VC4A 3H6OA 3L65A 3OJGA 3NR0A 4WJ8A 3GNXA 1OM0A 1Q2RA 4G56A 2OU4A 4I7WA 2WSRA 1BAGA 3MHGA 1BTMA 2DDXA 8XIAA 3WDJA 1H50A 4W8BA 1KGWA 4NQ1A 5EMJA 1QT1A 3MSRA 3XIMA 5MKGB 3CIVA 3W1XA 5A6BD 1GKQA 2WHMA 3IGXA 3PJWA 4GVIA 3STFA 3SW6A 1KFEA 4FI4A 1XGZA 3S8HA 3IACA 2WLYA 4GOAA 1F07A 5KINA 2PTXA 1GTEA 1K4GA 3HGJA 2V81A 4BKNA 4ADUA 3URNA 2VZTA 5E93A 2BMBA 3UXDA 1W5PA 4U3CA 4CD8A 1GZJA 1SJBA 5REQA 3USBA 3TSBA 3PSWA 1Z48A 4IG2B 3UGVA 3PR2A 3C86A 3RILA 3F4DA 5JBEA 1MRAA 2ZUWA 2OPJA 4PBFA 5JMUA 3SZ8A 1AZ2A 1KBJA 3LPPA 3VZYA 4MNKA 4PMUA 3SUSA 2VEMA 3WQ5A 2NLIA 4UR8A 3I7RA 2GWNA 4GVHA 1RK5A 1SSDA 5AYZA 4GUJA 3O7UA 1H0IA 3G1RA 1AG1O 4JFWA 1TWDA 3IJ9A 1QOQA 1K02A 2XISA 1FFQA 4OFCA 2YR1A 4GBDA 4IPIA 4ILSA 4JZ5A 5DF0A 1WDQA 2OX4A 2NT1A 2R1NA 3T8QA 3W2NA 3VNMA 2CLIA 3QF0A 3VIIA 3NYDA 4XO6A 5BRQA 1SSGA 4Q4MA 1C8YA 2RJGA 4HSHA 4WQ6A 1W5MA 1O12A 1XW8A 2CITA 4X60A 5BOOA 1TPEA 1MDLA 3NDYA 1S39A 4IGNA 3GWQA 1E6SM 1XKJA 5ABFB 1NFBA 3GX9A 4OBTA 4P8UA 3GUWA 1OZMA 1DWFM 3QV7A 1XIMA 4Y90A 4EKJA 3KL0A 3K13A 4RV3A 5FJTA 3HFTA 1ZRQA 2VHLA 3S1UA 2Z1SA 1E4LA 1S3TC 3R2GA 2XIIA 1CGWA 1ZCCA 1NOFA 3SCOA 1PS9A 2ZX7A 3BW2A 4P7OA 4ATWA 4UTWA 1ZJBA 4XAYA 1E9YB 4X61A 2VWTA 1HL2A 2PCQA 2TAAA 4ZQMA 2WMIA 1X6NA 2W9MA 1BQCA 3AMCA 3EPMA 3MUIA 2EPOA 1TVPA 3AAMA 2YCEA 3UJEA 3POHA 1HVXA 1RQEA 3O0FA 1B2YA 3HTWA 2EG7A 1RBLA 2G50A 1XYAA 3AYVA 5A6AA 3KTSA 1P0KA 1CTNA 4J4KA 5FEXA 2BVYA 4GI9A 6CGTA 1UWQA 5CH9A 1B0IA 2AQWA 2QV5A 3GVRA 3W07A 3I7QA 2YDAA 3IS4A 1NELA 3JW7A 3QN3A 2J7HA 2P53A 5JUVA 2ZZ5A 3F4VA 1ZZMA 2DVXA 2XG9A 1A5AA 1ZB5A 4G8TA 3LPGA 2PLMA 5JH2A 1S5NA 2A3HA 2X1UA 2B7QA 2DP3A 2H3DA 4P8VA 5B7YA 4Y9OA 3TONA 4A35A 2VEPA 2VRQA 4RZ5A 1KV5A 2OO0A 5D02A 3GIPA 1IEXA 1GOQA 3WF4A 2J78A 1UUOA 2MUCA 2I9EA 2PBOA 2ZX9A 1EJTC 4PODA 3WKZA 1PZ0A 2FPTA 2EPKX 4O28A 3LV6A 3OLEA 3NO3A 1FWGC 4AXNA 3GD6A 1ADOA 4H8HA 1EB3A 2ZTJA 4AIEA 1UD6A 3N2MA 4U3AA 4GG9A 4WF7A 4ZO8A 2BODX 1QW7A 1ELSA 2Z4GA 4QDPA 2GK1B 3W82A 4W85A 3MJMA 4PMZA 3W25A 4ONVA 2CLFA 5G2HA 3W1LA 4FOUA 3RIKA 2WPBA 3CZ8A 4YHEA 3LEPA 4LU0A 1JZ5A 5G4HC 4PUUA 3S6OA 4L4PA 3UR7A 1B9BA 2HMCA 3G1SA 3K4AA 5F2MA 4UUIA 2E09A 3M43A 1TR9A 1Z6KA 2R1KA 3W3OA 3BZJA 4HMEA 5ABHA 5MHBA 1BKSA 1SW3A 4JKLA 2WJEA 2YKKA 4PCSA 3AISA 6TIMA 5IHRA 3P5YA 1XIEA 1MVYA 1V7YA 2A3AA 3G0UA 4S38A 3ITXA 2YIHA 4GUFA 5AKQA 2PDBA 1FWWA 3GR7A 2DY3A 1QNRA 4MZ8A 3W1NA 4UTFA 2QAFA 4L64A 1WOBA 7XIMA 4DZ5A 2VC5A 4B3LA 3IK2A 2Q71A 5I7GA 1CZ1A 1XD0A 1NARA 3GG7A 3QC3A 3RU8X 4EK7A 1HKVA 4RDZA 2V5CA 1JI1A 3WMCA 3RRXA 1JPDX 4AZCA 4O17A 1Q6FA 4LV9A 2IQTA 4PRWA 1M7JA 2PC8A 3DENA 1A5CA 1OY0A 4AZHA 5LNUA 3A24A 3WFLA 4E2DA 3CGTA 1Q7QA 2VC6A 5FI8A 4MWAE 4LC6A 5M5DA 3EWBX 7ENLA 2EQDA 4C6EA 3LXCA 4MDPA 3APYA 4U10A 4HCHA 4JFUA 3TW7A 1BXCA 3V5FA 1XRTA 1E9LA 1UMLA 3GZAA 4O1CA 1KBIA 2PURA 2F61A 3TC3A 1GVOA 3VCNA 2GZXA 1OFPA 4ZMGA 4LUTA 4CCEA 2DZUA 2ZWYA 4JYEA 2XVKA 1KM1A 2QF8A 3WSUA 4ACZA 4GVGA 4GZJA 3U0HA 2SFPA 1Q7ZA 3SJNA 3AIWA 2O0TA 5T9BG 4BK9A 4XV0A 1UH2A 2NQLA 3F7JA 3DG6A 1XWYA 1K9DA 4Q8QA 2A7NA 1VEOA 5G2WA 3U2OA 1DVJA 3DERA 3M0XA 1QO2A 3BMWA 4QLJA 1QO5A 3CZJA 3AFBA 3A4JA 1XBXA 4YYCA 1J96A 1W2VA 4HIBA 2HS8A 2HTMA 3OVRA 3SY8A 3VFCA 1XQLA 3WLRA 5CC5A 4DM2A 2FGBA 3MZ2A 4QEEA 1F3XA 1ZTVA 3EPOA 3B8IA 3CQIA 4ZXOA 3MO4A 1XPGA 4CCZA 4DVOA 2GUBA 2C13A 4B5UA 4NJHA 5AC7A 3GNRA 2QUTA 1BWVA 3ZVIA 1PKNA 1YXYA 3BK0A 3BLEA 3THQA 3ZSTA 1CYGA 3DFNA 4ROPA 3SCPA 3WLSA 1J8VA 2P76A 3FLUA 2OSXA 3PB0A 4JL2A 4DJDD 1FWHC 3SRHA 1FCQA 2W92A 1RP9A 1WZMA 1GVFA 1OFBA 1CXLA 3W1MA 4QQUA 2VURA 3W7OA 2ZRUA 4DBWA 4JTEA 3LN3A 1W2PA 5DRIA 3WELA 3BG3A 3TMLA 4DJFA 1V6VA 1SO6A 4R53A 1BVZA 5D30A 1TV8A 2ZUVA 1PIGA 1K8CA 3M47A 3DAQA 4I3GA 3TR2A 3KWSA 4LW7A 3W7EA 2XZ9A 2CLEA 4JTGA 1EBGA 4MKSA 5C5YA 5G4WA 1GJUA 1U83A 4B3ZA 3DC8A 3C2RA 2F7FA 3ZJ7A 4AZGA 3EWUA 3T4CA 4MFDA 3RPDA 2FIQA 4QJ1A 4FP1A 3R0DA 2BBFA 1TUFA 6REQA 3GDBA 1JULA 2DZPA 4KGJA 3NO5A 1G1YA 4WK9A 1H49A 4UTJA 2HXUA 3VX0A 1VJIA 2A85A 3CS2A 1HN1A 3IRDA 4EACA 1VHCA 3CPRA 4OV4A 1IT8A 1Z44A 5MF5A 4EP8C 4I9AA 4L1WA 3TYEA 3NSMA 5I3HA 1S5MA 1MW3A 3UWYA 1RBOB 2Q8ZA 3BCJA 4LWWA 3VOGA 3R8RA 7REQA 1K8YA 2GQAA 3NEHA 4MNJA 8A3HA 1VLWA 2V68A 2Z1KA 2OR2A 4LAUA 1TZ9A 1WBJA 1QK0A 2ZWZA 3QEZA 3V36A 1XLBA 1YKWA 3SGZA 4MTVA 3WF3A 4MKNA 4DUOA 1S46A 1OG6A 3CU2A 1EZ2A 3TIMA 3BZGA 1V0LA 2Z0IA 3R12A 3PZGA 1E72M 3NUKA 3DCPA 1HJQA 1RSCA 3P14A 1E1CB 3CUHA 2ALDA 2QCFA 2XN2A 2Y89A 2ZRZA 3L66A 3FJ4A 2CERA 3TTEA 1X7FA 2PLJA 3HQPA 5I77A 3LI0A 4I9JA 4KIEA 1JUEA 3G0SA 4CVUA 1SMDA 5C2XA 1K4HA 1UD4A 3HQOA 1DE6A 1B3ZA 4UTWC 2PDXA 1XYLA 1OB0A 3JRKA 2V30A 2HNEA 3T1GA 1W3IA 3BSHA 3H7UA 1BYAA 4JX5A 4H8NA 5EMKA 2Y8VA 4F66A 3ENLA 5CAKA 5HNRA 3MUCA 4H3DA 3H23A 3UXLA 3IGUA 2V67A 4NL1A 2HK1A 1QWGA 3LGGA 2A7PA 4M56A 3PPCA 2YCKX 3ABSA 4W7UA 1BEUA 3T0TA 1M53A 4WD0A 1QWKA 3OZPA 4DY1A 1ME7A 1UG6A 4I5RA 1VRXA 4Y8FA 1YDVA 5M17A 4XAZA 4I9TA 3MI3A 2Y7EA 1W54A 3NL6A 3LCLA 1TX2A 1XM3A 1KCLA 1IZCA 3MC5A 5HDRA 2C79A 3DYPA 1UKOA 2QS8A 2UY3A 1P0DA 5I3JA 2BGSA 3BURA 1LOSA 5CBJA 3QZEA 1YXDA 2UWFA 4HGXA 3SY5A 5REQB 5C9UA 1EJWC 2X1SA 5GJPA 4GACA 1LF1A 2RKXA 4OOUA 4QAWA 3VA8A 3V1HA 2ASHA 4JTKA 1V77A 1GT8A 5C9ZA 3EOLA 3RCMA 1LRTA 1U1HA 1FUYA 2UY2A 4I5UA 3WH5A 4JTHA 3R0KA 3CQHA 2VCCA 1OZQA 3TA6A 3CQ0A 3WNLA 1OX6A 4JPGA 3T0BA 1L0PA 2WMKA 1Q6QA 3AS2A 4ICNA 3HOJA 3L4YA 4QXIA 3SEPA 4OV9A 4WKFA 5GJMA 5AN7A 3WNKA 1DHKA 1YE4A 1TV7A 3W1QA 1LL7A 2WSQA 1YIXA 3VKBA 1RP8A 3PZUA 1QNOA 3SSZA 2A1YA 2GL5A 1KXTA 1T7LA 1TB3A 4MYAA 3CM4A 1RK6A 1TPC1 3R8HA 4I8YA 3OHIA 2QCMA 1Q3NA 3G6LA 1H11A 4DZHA 1MEHA 5F4XA 1O95A 3QW4B 3KUMA 2BY2A 3CYJA 2XPKA 3AZSA 4JIRA 4US6A 1HX0A 1XISA 4DX3A 1AVAA 3HGRA 1RJPA 5EPDA 4ZFCA 3LI1A 1BFNA 1TPVA 2JF6A 4CD4A 4B16A 1OYCA 3E02A 1Q7MA 1S2CA 1US0A 5DX7A 3CH0A 3TCEA 4HMNA 3UJ2A 2HISA 2WMIB 4AY1A 5BXPA 4YCOA 1BWLA 4CN4A 3N6QA 4FS9A 4U2YA 1VH7A 1V6YA 3KZPA 4GI8A 1HIZA 1KM3A 3G24A 1KFBA 4IIBA 4ZQOA 1F6YA 2OOFA 3WQPA 1HO4A 3LXAA 3VC6A 1WPCA 3FOKA 4WR3A 3ZR4A 1SW0A 3KVKA 1TVNA 1O94A 4JTUA 2B0MA 1WZAA 3V3WA 4FNRA 1UP0A 1VRDA 5T26A 1OABA 2OT1A 1ZP4A 3L5LA 5JBDA 1V8EA 4NAEA 1QPQA 3AO0A 1W9UA 4F0RA 3FA4A 2VQUA 4OECA 4S3EA 1ZLPA 1UROA 3TQ0A 2DT3A 4LEQA 2O56A 3GZ3A 2WANA 1F6PA 4R88A 2YBVA 4FR1A 4HZ7A 5CPTA 1X97A 2EKGA 5LIUX 3VDAA 1EBHA 1YMYA 4HTYA 4KEZA 8CGTA 1U1UA 4PL2A 4M8UA 4CQ8A 2AKZA 1FHLA 1EJUC 5EB8A 2BOFX 4M0XA 3H53A 5TF0A 4IP5A 4JNMA 3OVPA 4ZA0A 3OA5A 3GKAA 4H9MA 1OX5A 3N04A 1JG9A 1LWHA 5HXMA 1F74A 3EAUA 1I4NA 4XTIA 3ZVHA 4XO7A 4JTAA 2NUXA 5AHIA 4B3KA 1NQKA 5AHEA 3NWRA 4PA8A 2A5HA 3U48A 5DY3A 4E8GA 5H8PA 3H2FA 4AX7A 2FPVA 4GVFA 4B5NA 3CUZA 1GQJA 3OZMA 5KTLA 6ALDA 2JBMA 4UNIA 2X0HA 2GVGA 4AQLA 1WDPA 1XLIA 5KITA 4PMVA 1MZHA 1EGMA 2ACQA 8TIMA 1KQYA 3BAXA 2AL2A 1UR9A 4UZUA 1IEQA 3NQDA 2VFEA 1ZSXA 4WGXA 2ZVRA 4PGLA 3MJYA 3AXMA 1TJ2A 3IIPA 2CBJA 3HG4A 4DJEA 1YEYA 1LYXA 3E74A 2ZXBA 2PA6A 3FHAA 3RR1A 2JKAA 3FSUA 1W3LA 2ZKMX 2F2HA 2DZVA 5D04C 4NXSA 4NASA 2OO6A 3BG5A 2PD5A 2J24A 3NOYA 2FTYA 3FSTA 4KFOA 1PTGA 3LQGA 4DJFC 3AU6A 3RK8A 3SQSA 4WDXA 4L6DA 3THUA 3B4UA 1POKA 1HNYA 4O12A 3WLJA 1MUMA 5AC8A 3HO8A 3G77A 1FKWA 1X39A 3WMSA 5CC3A 1A47A 3P7YA 2QJGA 2DUAA 4F2TA 4PTDA 2YL8A 4GLEA 3S2CA 3R4IA 4LCQA 1QXLA 4UBPC 1VS1A 2BWGA 5FJPA 4NXKA 4AZCB 3H2MA 2J77A 3S1VA 4JHZA 3WDQA 3PZMA 4BJHA 3QLLA 3WMBA 4FR6A 2OGJA 4XZ9A 4E6MA 1WUFA 4UOZA 4B5WA 3E0LA 4HHMA 2NLYA 1GHSA 3RMEA 3QMSA 3CAQA 3WF0A 1TZZA 3A3WA 3HG5A 4KGLA 5LZLA 3O6CA 3AZRA 3U2CA 1Q6LA 1B3YA 3SBFA 4GQBA 1TSIA 4Z1AA 4AISA 4Z08A 3A3XA 2AMGA 2Y0FA 5CBIA 5FOOA 2R94A 3U7BA 3PG9A 4L9ZA 4LUTB 4TV6A 3HZ3A 2V82A 5IBXA 3MP3A 3H2NA 3XINA 4ACZB 5LA1A 2GPTA 4Q33A 3R13A 4XVEA 4GKTA 4S2BA 4AD3A 4HOWA 5AYIA 3EDDA 3SCRA 2F84A 2Z29A 1MZRA 4DYEA 5HOSA 3UPBA 3BV7A 1PUDA 1R3TA 3R0UA 1CXKA 4A22A 5XIMA 1FCUA 4OHQA 3GH4A 2OSYA 1M03A 4CD7A 3CT7A 2XGZA 2YBTA 4LAKA 1KLZA 1QPOA 2BS9A 4QGCA 3GB6A 4AD4A 5I79A 2Y8UA 1ECQA 4KFNA 3AHZA 5LA2A 5A6SA 1FWBC 2OWXA 3GO2A 3WDRA 4Y7EA 1K9EA 3C0QA 4L4OA 3WLOA 5A6KA 2A79A 2F2KA 1RHCA 1KA9F 1ZAIA 5CC6A 5CEWA 4HPGA 1K7EA 3KVLA 3DI1A 3PF3A 1IWPA 1VEPA 4LVFA 2WMGA 4S3AA 3H7RA 4TIMA 4AUBA 4UIOA 2PZ0A 4PSPA 2P1FA 1C7TA 1F2JA 1W3HA 3DFTA 4HU3A 1OYAA 1YBQA 2FVKA 3PANA 2BHYA 3NZPA 5F7UA 1R30A 2KAUC 4DJFD 2J62A 2XIQA 1Q5MA 2VWSA 1U5HA 2HPMA 4Y96A 2J7DA 2NZLA 3H4GA 4LY8A 4GI6A 4RDYA 1K7XA 4UQEA 1DPMA 1PCWA 1UJPA 5GNXA 3VDBA 1FQ0A 3BH4A 3H7VA 4MY1A 1B31A 3UY8A 2HRWA 3KHJA 4IT1A 3R10A 3UBPC 4LYQA 1UKPA 2QPXA 4R3UA 1MWOA 5KZMA 4TR9A 2PGEA 1V7AA 1ZP3A 6REQB 4XIAA 3QLDA 3O6AA 2Z26A 4M1RA 1C93A 4MNMA 1ENUA 3NQCA 3HJZA 4JDBA 3K8LA 4L1GA 1TV5A 1TPWA 3PAOA 3P5ZA 2CESA 5G1YA 4QR6A 3ZT7A 3EWCA 3RG6A 2QPSA 3SCWA 1W9BM 2HK0A 3IVTA 3HF3A 1MEIA 3W7GA 3LRLA 7REQB 3KP1A 3KOFA 4G9PA 3RNDA 1OK4A 4PMJA 3O2LA 4TUFA 4UFLA 5FJUA 3LNPA 2VKZG 3EZ4A 3ARXA 3B04A 4MHBA 1QI3A 1QNVA 2MANA 4WGHA 1E71M 3WBWA 2AKMA 4CNOA 4H8UA 2YYTA 2V3DA 1DE5A 5HNUA 5DLCA 3LM7A 1R0MA 1TE1A 3TZFA 3W70A 5J8LA 6ENLA 1UH4A 3MCOA 5LIYX 4QG9A 2FMOA 1KBLA 1U5JA 2D0FA 2DZAA 4QM1A 3LNMA 1US3A 1EXBA 2X09A 2G0WA 3VAVA 4IXHA 4OUEA 2O7QA 2P5NA 1CGUA 4J9JA 4F2BA 2NX3A 4IMFA 3I10A 2WQPA 3URAA 1J5TA 3VGHA 3A12A 3R25A 3ICJA 2X1IA 3NQ7A 1SFJA 4RNHA 1GVIA 1PX8A 3VMPA 1IGSA 1KRMA 1J10A 4M3PA 2EPLX 2C3ZA 1FFRA 4TTGA 4PTMA 3AZTA 1EF2A 1BRLA 2Y24A 3W00A 1PDZA 1C3FA 3S9ZA 1RVKA 4E4PA 3BJSA 1EIXA 2FZMA 2WC3A 3OPSA 4UFHA 4F0SA 2YA1A 3WX7A 3N9RA 1JDEA 4F0MA 4FO4A 2CLPA 4ICCX 2EKCA