3FJLA

Human dihydroorotate dehydrogenase in complex with a leflunomide derivative inhibitor 3
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
364
structure length
361
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
publication title Structure-based design, synthesis, and characterization of inhibitors of human and Plasmodium falciparum dihydroorotate dehydrogenases
pubmed doi rcsb
source organism Homo sapiens
total genus 136
structure length 361
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fjlA00
1DQWA 3STGA 2NX9A 3W72A 3T40A 2BX7A 1QO2A 1EIXA 3LB0A 1SO6A 3LI1A 2FB3A 4N9CA 1H63A 5AYXA 1ICPA 3BARA 1WV2A 3PS7A 2A4AA 3LHZA 2Y7EA 3KRUA 3DHFA 5BW6A 4YL2A 3FEMA 5I3JA 3JRKA 3M1ZA 1FWNA 4HT3A 3M6YA 1QNVA 3WJYA 1AMKA 2V9DA 2GQAA 4NJIA 4LRSA 4O1CA 2BTMA 3KRZA 2QCMA 5K4ZA 4HKPA 1OABA 2NXIA 3IIVA 3KVJA 3CT7A 2V5BA 3NDOA 3NQ6A 5K9XA 1IIGA 1TREA 4FX8A 1I45A 1DKWA 2YR1A 3STCA 1B4EA 2QDGA 4WXYA 5HUOA 4Z1BA 4KWWA 3GK0A 1WBJA 2DP3A 2CFFA 2ZZ2A 3V1PA 3DHDA 5DLCA 5FEZA 1P4CA 2TRSA 5CPOA 4IQLA 2F84A 1Z42A 2R91A 3L5AA 5D04C 3HGOA 2VXNA 3U8GA 2ZZ4A 4O15A 3HBLA 2YW3A 2CZFA 3NPWA 5FI8A 4DXVA 1R46A 2VEIA 3QSRA 1TTIA 3CEPA 3HGSA 2ALDA 3W1TA 1VCVA 2CZEA 4TIMA 3W2LA 4LVBA 4PODA 1TV5A 3BO9A 2B0MA 4ADUA 1QWGA 3ZS4A 1RV8A 4P2VA 1AK5A 4MY8A 3S8HA 1NF7A 4LWWA 3NAVA 3FKRA 5AHNA 1FBAA 3NQ7A 2C19A 4CNPA 3RLUA 1VHCA 2CWNA 3ATZA 1H1YA 3KVKA 2ZZ6A 1KW1A 1KLYA 1TRIA 3G24A 1GYLA 4JICA 3M47A 4JTLA 4UMAA 5J5RA 2VOMA 1SU5A 3TJLA 3LHVA 2DZSA 1DOSA 3DH7A 3W75A 4Z0SA 5LSMA 4RKAA 3O63A 1AW1A 3B4UA 4ZL1A 1R2SA 1JQXA 5IBXC 1KTCA 1LLWA 1TSIA 3Q37A 4AF0B 1TTQA 4N6FA 4O18A 3CIWA 1L6YA 1XXXA 4N4PA 4WD0A 1RQHA 3L2IA 3CHVA 5K4XA 3W2UA 4HN4A 3L68A 4JTGA 3PBVA 3W7NA 4IJBA 4UC5A 2ISVA 4GUFA 4MYAA 4IGHA 5CZSA 1OFQA 2JGYA 1UJPA 4JS3A 5HR6A 2ISSA 2JKEA 5D38A 4JXCA 4JN6A 4N4QA 2NZLA 1DORA 1K7XA 3DBPA 2JKPA 2QR6A 3M5ZA 3LCHA 4O28A 3W1PA 3TKFA 1EP2A 4JTKA 5KINA 3Q2DA 1BWLA 1G4EA 1FCQA 4ML9A 1HG3A 4ZQNA 2B7PA 1FWWA 2C15A 4FNRA 1SR9A 5AC8A 3H54A 4AWTA 4FNTA 3GR8A 4WY0A 1VQTA 3U2OA 4FIQA 1M6JA 4ADSA 1C8VA 3NQAA 4JYDA 4O4WA 5IM51 3PBWA 1HO1A 3E0IA 3EB2A 2QCDB 4OHQA 1LBLA 3DGRA 3N2MA 4JD4A 3DFQA 3ATYA 3NNTA 4KFOA 4RZ5A 2FJKA 3W1UA 3L21A 3W1NA 1QR7A 4RX0A 2ISWA 2AAMA 3DFOA 3PWAA 2A85A 5E1QA 4OU1A 1H7WA 3P84A 3OVRA 4CLMA 3CPRA 4OGZA 1F76A 5G2HA 2H3BA 3ABRA 3RU6A 4RXFA 4O52A 1XUZA 4PFMA 4UTLA 5HJLA 1TYGA 2Y70A 4GE8A 2A7RA 4FNQA 1JCXA 4JTTA 3W84A 4UTWA 4ORIA 3QM3A 4POCA 2WSYA 5I3KA 4HPXA 3BLIA 3W22A 2QUVA 5HUPA 2EKCA 5F2MA 4WY0B 3ZWTA 1FWRA 4NXSA 4E2BA 1GZGA 5KZDA 3W6YA 1JCJA 3P5YA 4WJEA 1W0MA 2E6DA 1OX4A 2H8ZA 3I7SA 2RFGA 4DPPA 1LZOA 2QCGA 4WXZA 2TYSA 3Q94A 3P61A 2WNNA 3I7QA 3W7JA 2BLEA 2J6XA 1ZALA 4NNBA 3N19B 3LM7A 3HPZA 4LW7A 2FQIA 4JTFA 4XZ9A 1BTMA 4UTJA 3MJYA 1D3HA 1I2OA 2UV8G 3QF0A 3TAOA 1LTDA 2NUXA 2JK2A 4AWSA 2G97A 3WJXA 1SW3A 1FDZA 3IGXA 3LTSA 3TMQA 3G1HA 1OF6A 3VE7A 3KAOA 2QJGA 5K9CA 4X22A 4JTEA 1BKSA 3UY8A 2GQ9A 4XBKA 5HNRA 3EWBX 1BEUA 4GWEA 1I2QA 5KSWA 1ZAIA 2DZXA 3NQDA 3BK0A 4EF9A 1TPWA 2I1OA 3G0SA 1OX4B 4GUGA 3KRSA 5C54A 3VFLA 2Y7DA 1I2RA 3LCWA 3BW3A 4QIUA 3O1NA 4NUWA 4JY9A 4UFLA 4O0ZA 4IPJA 1EUNA 2CU0A 5LZLA 4AEOA 1EPXA 1MEWA 3UZJA 1XBZA 3MP4A 4AH7A 5AC7A 2QJHA 3MI2A 3BPWA 3GXNA 4NNAA 3I65A 4O16A 6TIMA 1IXQA 4FB7A 3NM1A 1Z41A 2VKZG 4RR4A 3QC3A 1YADA 3LOTA 1VCFA 2ABBA 2QAPA 2LLEA 1XBYA 5HINA 4YXGA 1JCYA 4MZYA 2TSYA 4NNCA 1WQ5A 2XN0A 3M43A 1NF0A 3PB2A 1DJNA 2X1TA 3T4CA 5DY2A 3SI9A 5D37A 5SWUA 4A22A 3M9YA 3BG5A 1UCWA 4OBTA 1FX6A 2YFNA 1LOLA 3TFCA 2GVJA 4UMCA 3TV8A 1LOQA 1TQJA 1R47A 2Q3OA 3WK0A 1KFLA 2FPTA 2CLHA 3W7LA 3W2MA 5G2WA 3LHUA 4AHQA 1XCFA 3MHFA 3BG3A 3G8EA 1WXJA 1B57A 1ONRA 5HQEA 1ZNNA 3A23A 1UUMA 4DEFA 4PL1A 2PRLA 2YDAA 4RK8A 4KFPA 5G1YA 4MPQA 4U28A 1RZMA 3EWYA 1NEYA 1SSGA 3T55A 2HTMA 1SZGA 3WK3A 1JQVA 4IOTA 4CNNA 1L6SA 4TMCA 2J88A 1KV5A 1QAPA 3RMJA 2X16A 2CLIA 3W70A 3G3DA 5D02A 1OG0A 5D2WA 5DBUA 2PC4A 3MWAA 4YLWA 4TMBA 3N2XA 3ABOA 3QQ0A 1HUVA 2FDSA 3G1SA 3L67A 1KM4A 5L9FA 4NZJA 1M7PA 5F4WA 4O0KA 3IGSA 5HR7A 1X7FA 4CQ8A 5LHFA 2Z2UA 3ELFA 3FKKA 1XM3A 3LCXA 3BG9A 3LGEA 2H6RA 3UPBA 1YDNA 4UNLA 3HMJG 3TE9A 1XC4A 2JKAA 3L65A 3WK2A 2X2GA 3C3NA 3KXQA 1WYIA 2A7PA 4AHPA 2ZTKA 1X1OA 4JEQA 4H6KA 3S42A 4I7VA 3W1LA 1SQ7A 4ZQCA 3LCLA 4TR9A 3BLFA 5BOOA 1YPIA 1XDMA 1TRDA 5G4EA 4L4MA 5L6UA 3G22A 2I9EA 1G7UA 3UWVA 1QDSA 4BI7A 3HPSA 4XTIA 1KFKA 1GVRA 2Q3RA 1TPDA 1J2WA 1THFD 3W7IA 4JX5A 4CCEA 1VRDA 4MLJA 3LBCA 3C2EA 3G8RA 6ALDA 5LNSA 3L5LA 1TV7A 1W5OA 1OYAA 5G1TA 4QAIA 3UZ5A 2E6FA 4M7SA 3W85A 4MJZA 4WOQA 4I9AA 4DBEA 3DU0A 1EWEA 3IIXA 1ZENA 3CEUA 3QMTA 3C61A 5K3VA 4Z1AA 3I68A 2Y7FA 1OFRA 3BVJA 4O11A 3BGGA 1NFBA 2DORA 2GOUA 3W87A 3A5VA 4QM1A 5FF2A 4GRSA 2VC6A 3RNDA 4UTWC 3PUDA 2QF7A 3DXIA 4JR5A 4AAJA 1K8ZA 3N34A 1S3HA 3C2RA 1DVJA 4BK9A 1JRBA 2E5CA 1JCMP 3QYQA 2QUTA 4HNUA 2WJZA 1T0OA 3PULA 4LV4A 5CPMA 3UQNA 3DENA 4RLIA 3K30A 2H3DA 3HF3A 4JX6A 2QCNA 4DF0A 3R89A 3C52A 2J27A 3E9AA 3GB6A 3EWZA 4UUIA 3KHJA 5DCDA 2A0NA 2GQ8A 2VFHA 1TTJA 3NQCA 1WA3A 4I7UA 2Z6IA 4RZ4A 2DJLA 3U6WA 1ME9A 3B8DA 1LORA 5BMWA 4NZFA 4LC6A 1T96A 1H7PA 1W3IA 2R94A 1LM1A 3DKJA 1GVOA 1YTKA 2BWGA 3C2VA 2QCHA 3GAKA 5LNRA 5EY5A 3TR2A 1W37A 4BFAA 3USBA 1CW2A 1JULA 3VE9A 4QSHA 2J9XA 3STFA 3B05A 1CX9A 1TTPA 1OK4A 3W2JA 3UWZA 2D73A 3O06A 2ZQ0A 1X6UA 1T8XA 3IRDA 1F7BA 3NPUA 2YX0A 3F4NA 4AF0A 1OFDA 4ZQRA 3IVTA 4MZ8A 1RVGA 1UB3A 3LLDA 4QNWA 1B3OA 5HMSA 4Z1CA 3MHUA 3O6YX 1Z48A 3C6CA 3LRKA 1W3TA 5CKSA 3EWWA 4CQ9A 3W3OA 1Q6LA 2NX3A 3F03K 1H61A 4IUOA 4S1FA 2QCCA 3LCIA 1WOAA 3S5OA 3G1AA 4HSOA 1TPEA 3S1VA 3EWXA 1ZAJA 1KM3A 1TJPA 3UWQA 1QO5A 5I3HA 3A21A 1LP6A 1PL9A 3NQMA 4TO8A 5CGQA 1KM1A 3CQ0A 1QMLA 4N9BA 1AL7A 3TX9A 4CNOA 4KKXA 5AN7A 2GVGA 1IXOA 3QEZA 4FEZA 3P60A 5EBUA 1V7YA 4UNKA 3W74A 1JUBA 2YCEA 4UTKA 4JDYA 1SW0A 2R14A 1FCUA 4Y90A 3THQA 2OZ0A 3IIZA 4G1KA 2OX1A 3SJ3A 3E12A 1W3NA 1YPFA 3P81A 3UWWA 2VEKA 3P74A 2KZHA 2DJXA 1X1ZA 4UTUA 2ZRYA 1QPOA 2QCDA 3NA8A 2YYTA 1NAL1 4MY1A 1GOXA 2A21A 3EXRA 2FTPA 4DPQA 4IXXA 2EAWA 4JGDA 4LS0A 1SSDA 2X30A 2A6NA 1K03A 1KA9F 1AW5A 3W7EA 3HGRA 1MSSA 2B7OA 3C8FA 3CIXA 3G1YA 3TSMA 4IX0A 4M19A 4NQ1A 3QQ1A 2Q8ZA 3SGUA 5HWJA 2C13A 3IGUA 3CC1A 2G5WA 4LTSA 1GG1A 2V30A 1OX5A 1QPNA 1ZJIA 1QOPA 4A29A 1Q6QA 2YFOA 2NX1A 1LYXA 4ADTA 1L9WA 3RF9A 4DO6A 5AHLA 3RLVA 4QNEA 5TIMA 3O16A 4UTTC 3B06A 5KZMA 4K39A 3F4WA 1O5KA 3GXTA 4LVFA 2CLKA 1SFLA 1E51A 3MP5A 2ZZ5A 3UWYA 4LC8A 5D33A 4DBDA 1PE1A 5BMXA 4O4VA 3EEGA 2QCEA 5G4WA 1T99A 2Y7GA 3N3MA 1LOSA 3GIYA 3SGZA 3S5ZA 4DF2A 4LVGA 5EL1A 2NUYA 3GDMA 3OA3A 2E09A 3M44A 5D32A 4Q32A 3BW2A 3NYZA 3HPXA 5A8GA 5GVJA 3VI2A 1PVNA 1HO4A 3F1QA 4JDBA 3QFEA 3UXAA 2E77A 2ZRWA 2FIQA 5EKYA 3TA6A 1MEIA 3QSTA 4JYFA 3FYOA 4OWGA 3LV5A 4GNJA 1WBHA 3PVFA 3OBKA 3ZR4A 3B0UX 3W83A 4IXHA 3O6DA 1VCGA 4BI6A 3JS3A 3SR7A 3ABQA 1QPQA 5KITA 1W54A 3TC7A 2Z1BA 3NQ2A 3MW7A 2ZYFA 2QAFA 3MBFA 4GJ1A 4WUIA 1MZHA 1PIIA 3IIOA 2FPYA 1F6KA 4R7JA 4E38A 3HOJA 2AGKA 3NL3A 4NJHA 1JRCA 3NZ1A 3O07A 2O7SA 4JTSA 2IQTA 1X8FA 2PE4A 5AB3A 4HNVA 4LVDA 2CLFA 4O1DA 2YSWA 3GKFA 1SUXA 1N7KA 1G69A 3N14A 1RR2A 3OIXA 4UFHA 3NQVA 4RJEA 1ICQA 4BR1A 2VEMA 4PL2A 3IVUA 3EWUA 3R13A 4IMFA 2CLMA 5CSRA 4X2RA 4EIVA 1KFJA 3PC0A 3NQ8A 3N9SA 4TU1A 4GFSA 3P67A 1LROA 1PCWA 3EXSA 1OYCA 4XBSA 5AOUA 4Y8FA 3GLCA 2H90A 5EPDA 1P0NA 3GZ3A 5D2XA 2QUUA 5K9DA 5F2GA 1JUEA 3NOEA 2Y6ZA 3EXTA 5LNUA 2DU2A 3TJXA 2RKXA 4LNYA 1H7NA 5E0KA 2QJIA 3MUXA 5FF0A 2V81A 2R8WA 5HWMA 2VFFA 4AWUA 3S9YA 3EX2A 1TMHA 5D05A 3GYEA 3TC6A 1M5WA 5J5DA 1OVDA 2ZRUA 3QPYA 1K8YA 5F4SA 1FCBA 2Z6JA 4NVTA 3S0CA 2YXGA 3LCGA 4PEKA 5AHFA 2E68A 1EB3A 2ZBTA 3ZWSA 5K7JA 4YCPA 5LNVA 4BI5A 1WOBA 1CI1A 2XN2A 3A5FA 1GTHA 3G0UA 2OMAA 5LKYA 1XBVA 4WOZA 3TK7A 2ZA3A 3CLMA 4UIOA 3HQ1A 4FX7A 3R5EA 3D0CA 1XUUA 4HHPA 3TDFA 3H55A 2VFDA 1TPH1 1Z44A 3TQVA 1A53A 2J24A 3MO7A 3FFSA 3SW6A 5LGXA 4O14A 3HG3A 2J9ZA 1KLZA 3IIPA 3S5YA 2WKJA 5U7SA 1ZAHA 3MYPA 1RQEA 4K8EA 1ZFJA 1U5JA 3G1FA 3LX9A 1N8FA 3PBUA 4P61A 1JVNA 3O05A 3W7GA 3TFXA 4K37A 2C3ZA 1OF8A 4W9TA 4YMZA 4OT7A 3QW4B 1LLZA 2VFEA 3GX9A 1EA0A 1R2TA 4CCCA 1FWSA 3THAA 1VGAA 4DO4A 2RH9A 5F2IA 3WJSA 1TPVA 1G67A 4EF8A 3AO0A 4M6PA 3TQKA 5TBOA 3NG3A 3W1QA 2GJNA 4CCDA 1G4PA 2VFIA 2V0TA 2WNZA 3DFNA 1SZFA 3PR2A 5D2TA 4XKYA 3L0NA 2DZPA 1GWJA 1H50A 3T44A 3Q58A 1YXCA 5EMUA 2E1DA 1FCVA 1VPXA 2PURA 4EOUA 4UTTA 5G5IA 4K38A 3HB9A 1G7VA 5A5WA 3TIMA 4M5PA 1ADOA 1QOQA 1JJKA 3PUOA 2RDTA 4LRTA 1ZHAA 1GVFA 3TAKA 4LOCA 2X1UA 2YYUA 3EKZA 1H7OA 5FF3A 1DV7A 2G95A 4D2JA 2F7FA 2Y85A 4PCFA 3IVSA 3PM6A 5CZJA 3P82A 5KZEA 4JYEA 3NQEA 4M6VA 3QMSA 5FESA 4OV9A 4S2BA 2PRMA 3LTPA 2V8ZA 4JIPA 5E93A 1I8JA 1XBXA 4M6QA 4N9EA 5CZ0A 4JY8A 3NQFA 1W1ZA 4LVAA 2BXVA 5C55A 2C1HA 3RK8A 1U83A 3PBYA 1KFBA 3B0VC 3UWUA 1O95A 5DXYA 4FNPA 1YDOA 4JTJA 3BV4A 4ICNA 4H3DA 4XKYB 2ZRVA 4S2CA 3T78A 3UY7A 2GPTA 4JTUA 2WOQA 4PC8A 3BGJA 4WZHA 3W7DA 2RDUA 2VELA 5FEWA 2E6AA 3O6CA 1VHNA 1O4UA 3DAQA 4BWLC 3EX3A 1P0KA 1TO3A 5C5YA 5AC6A 3P62A 1QCWA 3C56A 4PA8A 1VYRA 4MZ1A 4HNTA 2A1YA 3TMLA 4NJJA 2Y88A 1J4EA 3L5MA 5FEPA 1LBFA 1W5NA 1OJXA 1R2RA 3W1AA 2JBMA 1YDVA 4UXDA 2YGYA 4UFIA 3LXCA 5I3GA 5AFDA 5KMYA 4AHOA 1TCDA 1A50A 4FXRA 1ZY9A 3CU2A 1LCOA 1EEPA 1KBIA 2RHGA 3GNNA 2ABAA 4B5NA 1D9EA 3JR2A 3PAJA 1FUYA 2BSLA 3OHIA 1S5TA 4Z08A 1HL2A 4AMAA 3OVQA 3C2FA 4NJKA 4FF7A 1YYAA 1FDYA 3DI0A 3FA5A 5HULA 1UUOA 1KBJA 2EF9A 3LXAA 5DCEA 3CTLA 1GQNA 1ML1A 1NVMA 2EHHA 4TX9A 3L66A 4O8RA 1FXQA 1FWTA 1C9DA 3DFPA 3W2KA 3G1VA 3CWNA 1TIMA 3LHYA 4Q4KA 3KOFA 3W7CA 4H4IA 1OK6A 4HNNA 1MEHA 2YZRA 3GVGA 3FJLA 3A9IA 2HMCA 1AG1O 3W7QA 3SFKA 5TQLA 1RQBA 1XFBA 3NGJA 4UTMA 3G1XA 3TW6A 8TIMA 2H8XA 1GG0A 1K7FA 1H5YA 3L0GA 4JX4A 1UASA 4GBUA 3P80A 3TH6A 2ZCGA 3GDKA 1KFEA 1D3GA 4FX6M 3W7MA 1KTNA 2HSAA 3DI1A 1HTIA 2NWRA 3LCFA 5D03A 5H2ZA 4IMGA 5D2VA 4FNUA 1R30A 4NU7A 4N6EA 2XFWA 3W1XA 1H51A 4MYXA 2OJPA 1ME8A 3O15A 2V2CA 3NXFA 3EX1A 4WX2A 1YTDA 3LHTA 5DY3A 2RDWA 3P5ZA 1KV8A 5AHEA 3S1XA 2P1FA 5D09A 4UTHA 4QITA 4OE7A 2Q8LA 3PUEA 2EGZA 3GNDA 1YXYA 2TMDA 4NX5A 4MVAA 1UBSA 3GAYA 1DQXA 3G18A 5BNKA 3FIGA 1VH7A 2WPBA 4EVZA 1G4TA 4JNMA 3S5NA 3HGJA 1ZCOA 4AXKA 5AYZA 4N9DA 1L6WA 5FEXA 3FOKA 5DXXA 1TV8A 3NM3A 3SECA 4O1AA 4ORMA 3LERA 3QMRA 2A6LA 1IF2A 2ATSA 2Y89A 2QKFA 3AJXA 1TPB1 3KVMA 3LV6A 3VKJA 1B4KA 3DFTA 4PH6A 4DELA 2A2IA 3HO8A 2E5DA 2WV8A 5F2LA 4J9JA 4M7TA 1F5ZA 1IGSA 2VEPA 2I14A 2X1RA 2FLIA 5LHEA 2CLEA 3ABSA 4O13A 1SFJA 3NL5A 1XKYA 3MI3A 2EPHA 1GJPA 1TPFA 1MXSA 3CWOX 3N9RA 4LUIA 1FXPA 1S5VA 2ZDRA 4KFNA 1WDWA 1P1XA 3W71A 4X9SA 1S5WA 2XN1A 1WX0A 1VS1A 1Q6OA 4I7WA 4LUJA 1YLVA 1EUAA 4FHAA 4HPJA 4MLRA 2A5HA 2X1SA 4R33A 3PB0A 3QJAA 2DZUA 3PSVA 1I2PA 2YPIA 3C2OA 4LY8A 3LLFA 5CPLA 1YTEA 3GR7A 1O94A 4R34A 3NZRA 3TXZA 4LS2A 4RXGA 1OFEA 1LRQA 3W88A 4ZQOA 2C16A 1ICSA 1F74A 2Y61A 1AL8A 3OVPA 4MJMA 1OFPA 2WNQA 1ME7A 3H53A 2E5BA 3WJWA 4Z1DA 4A21A 1KFCA 1NSJA 1O60A 1OFAA 2WO5A 3NEVA 3UPWA 4R53A 4K7YA 3NR0A 3W9ZA 3DZ1A 5ABTA 2WSQA 3A22A 3TSBA 2JGQA 5AHMA 2ZTJA 3MP3A 3R2GA 2HS6A 4N2YA 1SO3A 3CM4A 3WJZA 5LGZA 4Y9AA 4BWLA 4O53A 5CSSA 1H1ZA 5C2XA 3QH2A 4MFDA 1A5BA 3SIZA 3ZFHA 2ZA1A 1LBMA 4DQWA 3TSDA 3TU9A 3W73A 1DJQA 5F1VA 2NV2A 1O5XA 4LT9A 1LRNA 4ZMGA 4IMDA 1PHQA 4K6AA 4JTIA 1TB3A 3NPVA 3EX4A 2A7NA 2OT0A 5DN1A 3LRMA 4GUJA 3S6DA 3QZEA 5FF4A 1GVQA 2WQPA 1Y0EA 5U4NA 3P7YA 1W31A 3NVTA 1LRTA 3SY5A 5EA9A 3P8JA 3LXBA 1JR1A 4Y96A 1VC4A 3QPZA 3WFAA 4Y6GA 5AHIA 2GJLA 4MKNA 1WAUA 4NXKA 3L9CA 7TIMA 4E2DA 4O1BA 3DKLA 4ONVA 1W5QA 2BZNA 3LI0A 2W79A 3TROA 4RCXA 3UD6A 3YPIA 1VYSX 3EKLA 3NO5A 3HG5A 4HSNA 3M5XA 3N73A 1LDCA 1M7OA 1PHWA 1A5AA 1FQ0A 2V82A 3I6RA 2CLLA 2NUWA 4UR7A 2NWSA 3W7PA 1SO5A 3E02A 2J9YA 4O57A 3GXPA 1EP3A 1VLIA 4X3ZA 1VYPX 3W86A 1JCLA 1H7XA 2VFGA 3HJZA 3NQGA 4GXMA 1TPC1 3KX6A 1BWKA 3OG3A 3TNOA 4A2RA 3FLUA 5K2ZA 3CB8A 3E96A 5DELA 3B0PA 3LTYA 4AVFA 4YCOA 3UXDA 4XUGA 3W2NA 4CQAA 1F73A 4LU0A 2ZFAA 1SZEA 4O50A 1RPXA 1TQXA 2B4GA 3SZ8A 4NJGA 1K7EA 2Z0IA 3E49A 1IXPA 1IIHA 4FO4A 1I2NA 4MIMA 1G6CA 4O54A 3HIJA 3FJ6A 3HG4A 1Q6RA 4KWVA 1VJIA 3LRLA 3T7VA 3IEBA 4L4LA 4ALDA 3GDTA 5D30A 3M0ZA 4MFEA 1K02A 1VZWA 2ZA2A 2CW6A 1KM5A 3W7KA 1W56A 3W07A 1DHPA 1F05A 4FNSA 4BF9A 3LHWA 3TUUA 3W76A 2ZZ7A 3B04A 1SPQA 1KTBA 4O17A 4ZQPA 1K3UA 3FYPA 2FFCA 1Q3NA 4MUZA 4UFMA 1PS9A 2ZZ3A 5H91A 1N55A 2QCFA 2C6QA 2QCLA 1JCNA 1VR6A 3PSWA 4K36A 2NLIA 2Y62A 1H62A 1P5BA 3M16A 1DL3A 3V75A 1SZNA 2ZRXA 4GUHA 2NXHA 4UFJA 2Y63A 1W8SA 5DBTA 1KM0A 5CG7A 2P10A 3DFSA 2YW4A 4A2SA 3BW4A 1A5CA 2V2DA 4U4MA 3MBDA 4OV4A 1SO4A 4GUIA 3L0KA 2NXGA 5I3FA 1OHLA 4MOZA 5C6MA 1YXDA 1GVSA 1XI3A 2OCZA 4FIRA 1TPUA 3W1RA 3I7RA 2ZZ1A 3B03A 4IWWA 1A5SA 1GT8A 1EP1A 3P8IA 2B7NA 3RFAA 1HFBA 5IBXA 4QISA 4JTHA 3C4UA 2CZ5A 3FS2A 1K8XA 4C1KA 1OX6A 3G1DA 1F2JA 2C14A 4DF1A 3NL2A 2E6YA 3INPA 2PRHA 2P0OA 2O7QA 1DBTA 4AB4A 4OQVA 4IX2A 2QDHA 4RZ6A 4ZZ9A 2TPSA 2GUUA 5I3IA 1GYNA 3C0JA 3MYOA 4YWIA 1SW7A 3LBMA 4Q33A 2V2HA 4QJ1A 2C18A 1KM2A 1FDJA 2NV1A 4ZVJA 4UFKA 4HIBA 2DZTA 5HWNA 3PG8A 1L2UA 1IXNA 1PV8A 3PF3A 3QW3A 4UTIA 5F4XA 1OFBA 1F6PA 5KTLA 2DZWA 3BLEA 2PCQA 4DO5A 4PTNA 5G2IA 3UYCA 2ZRZA 4E0CA 2W0UA 5AYYA 3A24A 5CZTA 4IPIA 4K7VA 1B9BA 1RD5A 3NPXA 4WY0F 3G0XA 3M5VA 3QRHA 2FB2A 3M5YA 3TW7A 3O8AA 2VENA 3NL6A 3TXVA 2HS8A 4UCGA 3GDRA 5LNWA 2G96A 1TJRA 1FY6A 3EX6A 3HG2A 1I4NA 1OYBA 1V5XA 2FPVA 3VNDA 4ZQMA 1EWDA 3W7OA 3R12A 4O19A 1H60A 3S1UA 5F1UA 4WQ6A 3LDVA 4IMEA 4LV9A 1KM6A 3M7WA 2ATMA 2WSRA 4C1LA 1PCKA 1Q45A 3M41A 4NX0A 3TQ0A 5FF7A 4O10A 4NT0A 1GTEA 1MO0A 1C29A 3PG9A 3ANYA 4N02A 4XTDA 4Z0JA 3STEA 4EWND 3MMTA 4JIQA 1QPRA 4MY9A 2B7QA 5D2YA 4UMBA 3PY2A 5EYWA 4K8HA 1AW2A 1G4SA 3IV3A 3VCRA 3G3MA 4RV8A 1W5PA 2C0AA 3W7HA 3MI6A 5T26A 3UNDA 3W7RA 1VLWA 4IMCA 5BRBA 2W6RA 3R8RA 3KVLA 3TCEA 2V5LA 5DCBA 3KFTA 3SSJA 1W5MA 2OT1A 3GKAA 2GVLA 3WK1A 4GC4A 4QQ3A 1XL9A 1GEQA 3W1MA 1H7RA 1QFEA 2CZDA 4UR8A 2QEZA 4LS1A 3OEXA 5MHBA 4O12A 1GPWA 3MHGA 4FXSA 4XWUA 1J5TA 1ALDA 4A3UA 3GDLA 1XDLA 1JUKA 1EX5A 3S1WA 4XQ6A 2AQWA 1OFOA 2CLOA 2DZVA 3W23A 5CPNA
chains in the Genus database with same CATH superfamily
3T40A 1QO2A 3AWNA 1XINA 4A8IA 1SO6A 5BXRA 3O6AA 1GZJA 4QDWA 4ZFCA 3WDJA 4B5TA 3RM8A 3GW3A 4H8UA 2RJGA 2Y7EA 3B8UA 5BW6A 3JRKA 3M1ZA 1FWNA 4HT3A 3QY6A 1QNVA 2GQAA 1O6IA 1E1EA 3VMPA 1BXBA 2HV5A 1Z32X 2YJQA 1VFFA 2YB4A 2OSXA 4QLLA 3AS2A 2FZ8A 4IIHA 5D9NA 1W3HA 2NXIA 7REQA 2UZ9A 1H11A 2V5BA 3UG3A 4XZBA 3NQ6A 3BAJA 5K9XA 1PKNA 3STCA 4GO9A 4LUSA 1VEMA 4ACYA 1OT1A 1WBJA 2UY2A 2DP3A 3V1PA 3NURA 4KCVA 2XZ7A 1R7OA 2A3HA 4UWMA 2WWDA 2PP1A 1OGGA 1Z42A 1NWTA 1GVIA 2W27A 3APYA 2PDLA 4O15A 3WF3A 3HBLA 2CZFA 3N1AA 3NPWA 1HL8A 4DXVA 1MDLA 2CETA 1DWHM 4ZOEA 3QSRA 3OHMB 3HGSA 4C6EA 2ALDA 3RAOA 2A3BA 3W2LA 4LVBA 1YIXA 4IM4A 1V02A 2B0MA 2FMNA 5D8ZA 1RV8A 4TVCA 3S8HA 3OGSA 1NF7A 3H70A 3AOFA 4BF7A 5B7ZA 4EPBC 3GVWA 4EXBA 1JG9A 1CXHA 4B4HA 4DJED 3M47A 3ES8A 3TJLA 5FSEC 2CXEA 3DH7A 4Z0SA 3SN1A 1S5NA 3O63A 3N15A 4FAMA 2QDDA 3K1DA 4AF0B 3VM5A 3CIWA 4LAZA 4N4PA 4WD0A 3L2IA 3CHVA 4R88A 1TWDA 3U4FA 1CPUA 2BHZA 4IJBA 4L6DA 4W5ZA 2ISVA 2DSKA 4MYAA 5CSUA 1R3SA 3RDKA 1X38A 2WK2A 2EPKX 3AMKA 1P7TA 1V6VA 5HR6A 3RM9A 3IJLA 4D72A 4JXCA 4JN6A 9XIAA 3OLDA 4D6DA 3QV9A 1HKKA 4NAEA 4HJWA 5JBFA 2JKPA 2O4MA 3VGEA 3TVAA 4XD5A 1EP2A 4CD6A 3VVGA 4CN1A 5KINA 3Q2DA 3SN4A 3HFTA 2Z7GA 3V7PA 2HE8A 4B3ZA 4BQ3A 5JMUA 3PZOA 3F2BA 4FOUA 3L12A 4ZQNA 2B7PA 3E38A 2VZSA 1SR9A 4XZIA 4O1EA 2QS8A 3S83A 4WY0A 1VQTA 2BY1A 3H4GA 3GBEA 2BY0A 2EBNA 4OZOA 2G3MA 4GI9A 1UW9A 1QI0A 5A2AA 3V0UA 1A4MA 4GVIA 3AHZA 4OHQA 1NQ6A 2WZIA 1TIWA 1UD8A 4ZE5A 4TX6A 4HSHA 2FJKA 5E0CA 3W1UA 2DV0A 3VINA 3PWAA 4IGMA 5E1QA 4W85A 2XIJA 1H7WA 4PMDA 3U9IA 3WH7A 4PMNA 4OGZA 1F76A 5G2HA 4INFA 4RXFA 4FI4A 1XUZA 1DWIM 4HTYA 3C5QA 1TFVA 1KRBC 1HKVA 4FNQA 2PDFA 6XIMA 1AQFA 3BLKA 2WSYA 5JBEA 2Z1SA 3FCPA 4R7WA 4ZCWA 1I6NA 4IP4A 4RE3A 1JCJA 4WJEA 1OX4A 1UZHA 1CGXA 3S2CA 3VO0A 4YVVA 2PDIA 3W37A 4IF2A 3WEZA 2TYSA 3Q94A 3W7JA 1PWLA 3AFBA 4V27A 1VBJA 4YTRA 2VZOA 4E8DA 4NNBA 4LW7A 3WF0A 3VZZA 2FQIA 1UWAA 4IG2B 5CPTA 1D3HA 1I2OA 3PJXA 2JK2A 4OECA 3WJXA 4R9XA 2GDUA 2X7WA 1QOXA 1IE7C 1OF6A 3R10A 3E0WA 3H2AA 5K9CA 1VRXA 1NDZA 4JTEA 4H19A 2GLKA 3MMUA 1J6PA 4IZGA 2DVXA 1QBBA 3AIBA 5IRPA 1GGOA 3BLOA 2A79A 3SBFA 4XSMA 3KRSA 1NTHA 3GZAA 3BW3A 4HYRA 4UFLA 2QNEA 1XLAA 3DESA 1VFHA 4KEMA 2AL2A 1Q2RA 2XGZA 1V0LA 3WDQA 4KWOA 4C6NA 4P7RA 1Z41A 4RR4A 3I4KA 3LOTA 2WHLA 2ABBA 3WG6A 3NIYA 1GQKA 2LLEA 4M56A 1XBYA 2OX4A 5HINA 4YXGA 3W02A 4MUPA 1FWJC 2TSYA 1VPQA 2I57A 1NF0A 3CXOA 1EQPA 3T4CA 3SI9A 5D37A 1R3YA 2VD9A 1FX6A 3UW6A 4XO6A 4NSBA 4HNCA 5EFDA 4F0KA 4IISA 3W26A 2OLSA 1RY0A 3WK0A 1KFLA 2WCAA 2FPTA 3SB0A 4GVFA 2B31A 1WDQA 3W2MA 4AHQA 4GNVA 2OOGA 1RLCL 1B57A 1ONRA 5HQEA 1ZNNA 3PZTA 3CUXA 3A23A 4DEFA 4NF7A 2OODA 1FP9A 2YDAA 3IV8A 1M1BA 3U2CA 4U28A 1WP6A 3D3AA 1FWFC 2ZIDA 3T55A 1V3JA 4Q6XA 4C7FA 4IOTA 1KV5A 2CHNA 4UQBA 1I9CB 4F0MA 3RMJA 3LSBA 2X42A 4LCSA 4ERIA 1O5RA 3N2XA 4XX6A 3EMCA 3ABOA 3ANUA 3L67A 2WJDA 2WHMA 4N7QA 4IPPA 4D1IA 3FKKA 3DECA 1XM3A 4OOZA 1TA3A 3LCXA 4B4FA 3BG9A 5EMKA 3UPBA 1YQ2A 4UNLA 1OIFA 1GPFA 3T4WA 2JKAA 3F2DA 4I90A 3WLRA 3WK2A 2X2GA 3C3NA 3I10A 1KCKA 1S39A 1TKKA 1E73M 4AHPA 3S42A 4I7VA 3R1ZA 2PDYA 5BXTA 3MS8A 1YPIA 1XDMA 2C91A 3G22A 4JN8A 1G7UA 1TWWA 3UWVA 2FZNA 1QDSA 4BI7A 2PWGA 1KBLA 1J2WA 3FJ4A 1THFD 4JX5A 1VRDA 4MLJA 3UGVA 3C2EA 5C9ZA 4XAFA 1W5OA 5G1TA 5FOOA 3UZ5A 4WOQA 4GH1A 3IIXA 3CEUA 3BLLA 5CG0A 5G1MA 3C61A 3GXDA 4Z1AA 4O11A 3SADA 5CAHA 1XIFA 2E9MA 1RK6A 3E0LA 3WLNA 4QM1A 3UA4A 1ONWA 2VC6A 1NQKA 3QGAC 4QBXA 3VKDA 3JZUA 1NJJA 4IMAA 1B3WA 4JR5A 2NV9A 3ZT6A 2BBFA 4AAJA 1EF2A 1GOIA 3WBWA 4BK9A 4E6MA 3UG5A 3PANA 1UKPA 3PULA 2DUAA 3TYDA 1HT6A 4FOJA 1LWJA 2J27A 1AH0A 4MWAD 1RJPA 2A0NA 2IKJA 3VCNA 4DUXA 2PDCA 3TWAA 2Z6IA 3U6WA 1IHIA 1LORA 2R94A 3TQPA 2NSOA 4IIDA 1LM1A 4A8RA 1RXOB 4H9ZA 3DKJA 4US5A 2BWGA 1QHZA 1RCXB 5LNRA 2QPUA 3USBA 4IHCA 2YCIX 4ZE4A 2OQHA 2J9XA 1EXPA 1HW6A 3LLXA 3ICJA 1TTPA 1OK4A 5CH9A 1XG4A 3S9ZA 3O06A 4JQ2A 3H2NA 1A4LA 1ISYA 3IRDA 1UP0A 2I16A 5GNZA 2YX0A 3E0VA 3IVTA 1M65A 2UBPC 4HD5A 1EHNA 4Z1CA 3MHUA 3FYYA 1XLBA 3C6CA 2X0YA 2ZX6A 1CYGA 4U33A 4GBDA 1Q6LA 3F03K 5GJNA 1OC6A 2D1ZA 1O66A 3SQSA 1LT8A 4AY8A 4Q8TA 2A3EA 3KDNA 3LCIA 3QTGA 1MRAA 1N2VA 3S1VA 1KM3A 4KT2A 3V5FA 1QO5A 5I3HA 1LP6A 5CGQA 2NT0A 2V3FA 3TX9A 3MCNA 2J47A 4FXJA 2GVGA 3C0QA 4PMQA 4YJ5A 1IXOA 3AYSA 2JF6A 2VCAA 4C5YA 4F2TA 2YCEA 2ADAA 2HK0A 4UTKA 4Y90A 3THQA 4F79A 3BZJA 3RILA 1GQLA 3P81A 2VR4A 3UWWA 2VEKA 4QP0A 1J11A 2QCDA 5I78A 2PTXA 3EXRA 2FTPA 4IXXA 4PR4A 3GH7A 3G6MA 1YE4A 1SSDA 5CJ5A 1NOFA 2BFGA 2HDJA 1K03A 3L4YA 4DAFA 3RG6A 4M80A 1MSSA 4GO8A 3HV8A 1U1UA 5GJPA 3C8FA 4NP7A 3CIXA 3G1YA 4WSHA 4IIGA 1ZJBA 4IX0A 3QQ1A 3SGUA 4WEVX 5HWJA 3BANA 3CC1A 2G5WA 4TOQA 1QPNA 1UYQA 1ZJIA 4A29A 2NX1A 4ADTA 1L9WA 3RF9A 5AHLA 1V77A 4FR6A 3B06A 4NYUA 5JBDA 1Q7QA 7ENLA 3CUJA 1KGWA 2CLKA 4QTGA 1SFLA 4Z2JA 1BD0A 3E1F1 1PE1A 5BMXA 3VU2A 1XICA 2XISA 3N3MA 1QHPA 2HVMA 4QSFA 2ZUTA 4DF2A 4TQTA 5EL1A 2VZVA 4Q32A 3BW2A 3AHXA 5GVJA 4LY4A 1PVNA 5HBFA 3OZOA 4B92A 2CHOA 3UXAA 2ESCA 4Q7IA 3GHTA 3TA6A 1TCMA 1RP8A 2ZX8A 4L6HA 4OWGA 5ABHA 3S1GA 1V0NA 3LV5A 3N3TA 3PVFA 3BJSA 4YVXA 3W83A 3RO8A 5ABFA 1ODUA 1XLGA 1QPQA 3BAYA 5KITA 1W54A 3TC7A 5IFTA 2QUMA 1PX8A 3NQ2A 4GJ1A 4HCHA 4M3PA 1F6KA 4E38A 1UWSA 1XS2A 2AGKA 4HOXA 3EYPA 2O7SA 3ZO9A 4KGJA 1X8FA 2WZTA 1UWQA 2VX6A 1V02E 1ISVA 4XISA 2DGAA 3NJ3A 4CVUA 4DXKA 3GHRA 4RZBA 2Q01A 3OIXA 1RR2A 3KP1A 5AVHA 4RJEA 3V0SA 4L5ZA 1C93A 2VEMA 1OWQA 3SURA 3C86A 2CLMA 2J7EA 1BQCA 3BURA 4WKFA 1GHSA 1TJ0A 2IQDA 2UWFA 3KTCA 1UD3A 1PCWA 1T40A 2FKPA 3E6EA 3BSMA 4X0NA 3EXSA 4YWSA 3A3XA 4IQJA 1GVYA 3KOXA 1Q63A 5AOUA 1CGTA 3GLCA 1OM0A 2XHYA 2H90A 4DYJA 1XLKA 2PGRA 3GZ3A 3W4RA 2QUUA 3A12A 3VPLA 5F2GA 1XIDA 1JUEA 2Y6ZA 4J2PA 5AYBA 1FWBC 3TJXA 1G0CA 4Q8OA 3R43A 2RKXA 5IDIA 1XRVA 2WHJA 4QQUA 1E70M 2R8WA 5HWMA 2XVPA 4DLFA 1TMHA 3MWCA 3TC6A 3WCZA 1YPXA 1KXQA 3S5SA 3AMDA 5F4SA 4CD5A 4KGLA 1POKA 1IV8A 4HA4A 2XSAA 4NZCA 1EB3A 3LNMA 4BI5A 1WOBA 4ZB0A 1TV3A 1HKJA 5FJRA 3A5FA 4ZR8A 1UH4A 4AIEA 4S3EA 3BQ5A 1XBVA 4WOZA 3CLMA 4FX7A 3R5EA 4V28A 3D0CA 4LYRA 3WD0A 3TQVA 1BF6A 3ZQ9A 4O14A 3WLIA 4LJ3A 4PUKA 3IIPA 3ARWA 5U7SA 3MYPA 4K8EA 3OODA 3GQYA 1LLOA 2WYSA 2ISDA 1VENA 3B8SA 2DUXA 1I0BA 2E25A 4DAIA 2C3ZA 1CECA 1VB9A 1LLZA 2DFAA 2VFEA 4JCMA 4P7LA 1UKOA 1FWSA 4GZEA 4S3FA 5CGMA 3THAA 1TPVA 3A6OA 1FP8A 1KCXA 4D6JA 3MDUA 7PTDA 4ICMA 3WX7A 4LF1A 1G4PA 5D2TA 4JTCA 1GORA 1ODZA 1H50A 1QTWA 4J3TA 2E1DA 1FCVA 1VPXA 2PURA 1JJKA 4LRTA 1ZHAA 1QHOA 4Z2LA 1H7OA 2GDQA 2VJXA 3AIEA 5FF3A 1DV7A 1PZ1A 2G95A 1BXNA 2Y85A 3P82A 4DIAA 2CCRA 1EF3A 4C65A 1Q4NX 1NOUA 1H2JA 2OWCA 3LQLA 2WVVB 1I8JA 5I03A 3N18A 2QGYA 4MHBA 4J7RA 2ZUMA 3OP2A 4W87A 5E9XA 2BXVA 3LU2A 3N6HA 1QI4A 2C1HA 4M8UA 3CO4A 4M0XA 3RK8A 1U83A 4QDMA 1W3LA 6XIAA 4WKAA 2OWXA 1PKYA 1QATA 3BV4A 4ICNA 2XIIA 3GM8A 2I5IA 3PWIA 2MNRA 3T78A 2INFA 1EO7A 2GPTA 4CQDA 4WZHA 2VELA 5FAJA 1DE6A 2E6AA 3H7UA 1VHNA 3DAQA 1MXDA 3EX3A 1P0KA 1V3HA 1TO3A 5C5YA 5AC6A 1W3JA 4HYVA 3AJ7A 3P62A 1C8XA 1P0DA 3C56A 2A1YA 2Q02A 3A4WA 3MVIA 2VGGA 4UXDA 3LZ3A 2YGYA 4PMJA 4UFIA 1IZCA 3LXCA 4L9XA 4FXRA 4B5NA 1BAGA 5BOEA 3VNYA 4FK9A 1D9EA 1J0IA 2ZE0A 5CC6A 1NIUA 3AWOA 1S5TA 4PFHA 1R3WA 1HL2A 1UD6A 5EMJA 3FVDA 4FF7A 3IACA 3WMLA 1VFTA 1YYAA 1FDYA 2J8FA 1YX1A 4PCTA 4AY1A 3J7HA 2EF9A 4WVXA 4DN1A 5EBAA 1PUDA 5DCEA 2DSWA 1JPHA 1GQNA 1H49A 3PAOA 3OW1A 2EHHA 4AG0A 4GFIA 3MO4A 2NVCA 1JZ7A 3W2KA 5EMLA 3CWNA 1TIMA 3LHYA 3KOFA 4RW3A 1SJBA 2QV5A 2YZRA 3W00A 3T1GA 5DMLA 4FLRA 3FJLA 3A9IA 3GXMA 1QI5A 4LQ1A 5HK4A 2XM1A 1XIBA 3K1GA 4PSPA 4QEHA 4UTMA 3HQNA 1JPDX 8TIMA 3GY1A 4US6A 1F8MA 3M0KA 4L9YA 1K7FA 5E6YA 1H5YA 1GVEA 3NSXA 3TH6A 3QR0A 4AC7C 1XWYA 2AQOA 4HPHA 1MQRA 4MDPA 3LCFA 5D03A 4FZIA 5HNTA 2GZXA 3CWHA 3OLGA 3CUFA 4QGCA 4ERGA 3VUPA 1E43A 3PNUA 4PRWA 3EX1A 5DY3A 3MZNA 3WLKX 4C91A 3P5ZA 2WM0A 3RX3A 2P1FA 2PDXA 2Q8LA 3NDZA 3A4XA 2QDEA 1YXYA 4NX5A 1DJHA 1UIOA 2HROA 4TUFA 5BCAA 5BNKA 4GI8A 4MNLA 3RXZA 1QNPA 4JNMA 3WZ0E 5AYZA 5GJMA 3WLLA 3SECA 4B16A 1EL3A 1TV8A 2CBJA 3QMRA 2Y89A 4LF2A 3H2EA 3B4YA 3LA4A 2VP8A 2A2IA 3HO8A 5F2LA 1JCTA 3CQHA 4J9JA 2D69A 2PC8A 1CT5A 1IWPA 2EEXA 4YNGA 4ES4A 2PDQA 1M3UA 2VEPA 1PWMA 3BWWA 4P7OA 3QOMA 1QJWA 3ABSA 3VDAA 4PRTA 4BEUA 2PCEA 3MI3A 3B9OA 3WUFA 1LG1A 4FMVA 1DPMA 1FXPA 4EPEC 2ZDRA 4KFNA 1S5WA 1EBGA 1Q6FA 1EJWC 3FAXA 3GYCA 1IT0A 3R11A 4KRZA 4R33A 1FFQA 3PB0A 3KTXA 4PTMA 2PA6A 3C2OA 4PE8A 1JIBA 4HMNA 3LLFA 2G3IA 5LIYX 3PZIA 3B9AA 2A3LA 3FNDA 1AJ2A 4LS2A 1OFEA 3PNZA 1HX0A 5XIMA 5BWFA 1XQKA 1OFPA 1IQ8A 2WNQA 4MB4A 2YBTA 2E5BA 5M2FX 1SM9A 1CENA 1JI1A 1O60A 4CU8A 4Y9PA 3NEVA 1VEPA 2G0WA 3W9ZA 3DZ1A 2F38A 3TSBA 3L23A 1DQUA 4AVNA 3RLHA 3N13A 1YNQA 2HS6A 3UA3A 2YA1A 3ZM8A 5T9BG 5FACA 3M0MA 4XK2A 2BODX 5LGZA 1XIHA 4O53A 4LYPA 3QH2A 4MFDA 5A6TC 3SIZA 2Y8UA 1LBMA 2OU4A 3FVMA 4DQWA 1E5NA 4ZMGA 1PHQA 3KS5A 2OT0A 1A5LC 3S6DA 2I7GA 2YCJA 2VRKA 1GVQA 2WQPA 5G4HC 1UD5A 2EG7A 1CCWB 1W31A 6REQB 3P8JA 5LA1A 3SRHA 1REQA 3VUSA 5AHIA 1BHGA 2GJLA 1WAUA 3L9CA 4EAYA 4E2DA 4O1BA 3DKLA 4ONVA 3WLOA 2J7HA 3TROA 4ICCX 2WSPA 2P88A 4S3BA 3YPIA 3T6CA 3EKLA 5J8LA 4HSNA 2BOEX 3M5XA 5LXXA 1LDCA 2YXOA 1HKIA 3TJIA 3A4AA 4UR7A 3ITLA 1T5AA 1SO5A 3E02A 2J9YA 2DVUA 3W86A 1H7XA 4GXMA 1TPC1 1BWKA 4IT1A 4OVXA 3UXDA 2WAGA 1FKWA 3W2NA 4LU0A 2X0SA 1RPXA 3SZ8A 2B4GA 3KUMA 2VGIA 4MIMA 3SY8A 1TX0A 3GUWA 3HIJA 2AOSA 3FJ6A 4B2DA 4FLQA 1VJIA 1V6TA 1JDDA 3T7VA 1S46A 1AMYA 2WVUA 4MFEA 3ALGA 1K6WA 1F05A 5AZ0A 1GEHA 4ZQPA 1K3UA 5IHSA 1PZ2A 2ZZ3A 3D46A 3F4CA 4URIA 1W32A 2Y62A 4GCXA 3M16A 1TJ1A 2XPKA 4XAGA 1PBGA 2ZRXA 3WIJA 2PTWA 2YBVA 2I5GA 1DWJM 1Q7MA 2PBOA 3CH0A 3L0KA 1TVNA 2NXGA 5C6MA 2FYMA 2D2HA 3EOOA 2F9RA 4YTTA 2VYOA 4FIRA 4RUBA 4RE2A 3W1RA 3FHAA 3B03A 4IWWA 4MWAA 4DUOA 5MF5A 3P8IA 2Z1VA 1Y7VA 3BAWA 2D23A 1F2JA 4TXEA 4RNJA 2PRHA 1DBTA 1KD0A 4RZ6A 4ZZ9A 2B81A 3D3FA 4YWIA 4JIHA 3FEQA 2HWGA 4G5DA 4H9VA 4UFKA 4ZVJA 2DZTA 5HWNA 2PSNA 4QE4A 2OEMA 1C8YA 3GD6A 1VFUA 3QW3A 1OFBA 1G1YA 3T0TA 2WBGA 3VKAA 4ZGYA 1FTXA 4I5UA 2YCKX 1W1YA 4PEEA 4DO5A 3UYCA 2D2GA 4LBUA 3BQ6A 2G37A 5AVNA 3VTRA 2OR2A 4K7VA 3G0XA 3M5VA 4KRTA 5HA7A 3LN3A 1KBKA 2WXDM 5I0DA 4C6MA 1VIWA 3TXVA 2G96A 1FY6A 1HKWA 1OYBA 4PUWA 3W7OA 2Y8KA 3AZRA 4KEVA 3S1UA 5F1UA 3BMWA 3M4HA 3LDVA 2ZVIA 2WC3A 3SCQA 3FAWA 4GYFA 4B3LA 4W8LA 3ENLA 2ATMA 2WSRA 4C1LA 2W3ZA 1H0GA 4RW5A 3M41A 4REQB 4NT0A 1C29A 4JQAA 2XFYA 2CWXA 2CLPA 1JI2A 4XTDA 4XD4A 3WF2A 4MY9A 2YDQA 4GHRA 2B7QA 3VYLA 5D2YA 3CHDA 5AECA 5EYWA 4X63A 1AW2A 3SCNA 3GNOA 1ZGDA 3VCRA 2DSUA 5T91A 1VFLA 3MI6A 3T08A 3W7RA 3AXKA 4W89A 2XIQA 3KVLA 3TCEA 3KFTA 1JD9A 3ITTA 1QUMA 3SSJA 3CYVA 2YA0A 3QLDA 4F0LA 4H04A 3W1MA 2CZDA 4UR8A 4AZCB 1WZKA 2WSKA 3RITA 4W93A 4DVOA 1PXGA 2FVMA 3TYZA 5MHBA 4NHVA 2WVTA 4FXSA 5ENLA 2V63A 5B80A 4A3UA 3GDLA 1XDLA 1XW8A 1AD1A 4S38A 1KB3A 2R1LA 1EX5A 1PPIA 3QHOA 1J0YA 3OYXA 4N0RA 4K1GA 1VBGA 1BTCA 5C9WA 2NX9A 2BX7A 5DX7A 4DBUA 1XRSA 1VKFA 3G1RA 4N9CA 1ICPA 1WV2A 4G9PA 3M0LA 1NP2A 1E9IA 1EOKA 3GC2A 4L7ZA 4YL2A 3FEMA 2G3JA 5I3JA 1AFSA 1AMKA 4WRHA 1XGZA 1L0PA 2ZX5A 4NZ3A 4O1CA 1ZBKA 5BOFA 4UNIA 2QPXA 5DMMA 3UZYA 3WL1A 1IIGA 1TREA 1GOQA 4FX8A 1BRLB 5J04A 4QXIA 5FKYA 4RDZA 3SCPA 3DYOA 3L4ZA 5HUOA 4Z1BA 3GK0A 3UGRA 3SM0A 2ZE3A 3DHDA 4DNMA 5DLCA 1Z8AA 3FY1A 3WMCA 2Z2BA 4IQLA 3L4TA 1B0IA 2R91A 3NWRA 3L5AA 4LX4A 5H8PA 3VD7A 2HZGA 4DWSA 1H3GA 4MADA 3BMXA 5FI8A 4MJ2A 3IPWA 2VEIA 1Q8AA 1TTIA 1V6WA 1EC7A 3QN3A 3OQ8A 3MC5A 1UJQA 1VCVA 3WENA 4F4RA 3M0VA 3BO9A 1RVKA 4ADUA 3ZS4A 3P3BA 1FBAA 3NQ7A 4L65A 4XSLA 4F0HA 2X1IA 4H9TA 3KVKA 1KWGA 2ZZ6A 1KW1A 1DWGM 3G24A 5E6ZA 1US0A 4JTLA 5F7UA 1C9WA 5J5RA 2JF7A 3GU9A 1SU5A 2DZSA 3DX5A 4UOZA 5CLWA 1OG6A 4RKAA 2CHRA 3WF4A 1NELA 1R2SA 1JQXA 1YNYA 1QXLA 1KTCA 1E3XA 3Q37A 2QHAA 1TTQA 2PFHA 1QW8A 3SQMA 4ZTXA 3CH9A 1MQPA 2OOFA 5K4XA 4HN4A 2F6UA 4BQ4A 3WBAA 1UR8A 3W7NA 1V4YA 2PB1A 4B91A 4IGHA 1XLJA 1OFQA 2OSWA 1Q6DA 2ISSA 2ON3A 3A4JA 1XGEA 4JIRA 5D38A 4N4QA 2DDXA 2NZLA 4G6CA 3ECQA 4HN8A 3MY9A 1K7XA 2QGHA 4HCLA 3DBPA 1RH9A 1HP5A 3W1PA 3CMFA 6A3HA 3SQLA 3HV9A 1EZ2A 1BWLA 1X7IA 3GHUA 1J6OA 4GVHA 3VKBA 4A4AA 1HG3A 4PB5A 5ABEA 3SCUA 4FNRA 3UCQA 3GR8A 9CGTA 4FIQA 3CTTA 4P7QA 8XIAA 4ADSA 1ISZA 4AD1A 1LL4A 1C8VA 2FDMA 3NQAA 7CGTA 3VILA 2WMFA 1P6BA 5IM51 3U0HA 1HO1A 3E0IA 1ZZMA 4KEUA 3MZ2A 3EB2A 4EACA 3N2MA 5T9CE 3DFQA 3ATYA 3NNTA 3T09A 3UR2A 3FGCA 3NDYA 4JTDA 1P7TB 3W1NA 1QR7A 1D8WA 4RX0A 2ISWA 4LB3A 2AAMA 3DFOA 1VBRA 4IIFA 4OU1A 1E6PA 1UZDA 3RR1A 4DZHA 3CPRA 2H3BA 3RU6A 2P8CA 3GFZA 2E4TA 4MMWA 4F48A 4PFMA 5CGTA 3R6IA 5HJLA 1TYGA 2Y70A 1JGIA 3NUKA 4LNCA 1E71M 1RBOB 4JTTA 4POCA 5I3KA 4A3YA 3RJYA 1L6GA 1KRMA 1UKSA 3W22A 5HUPA 2EKCA 4WY0B 2E40A 3T05A 1N82A 1FA2A 1X6LA 4QFUA 5CXPA 3W6YA 1J2BA 2H8ZA 3I7SA 3TOYA 2QCGA 4WXZA 3WF1A 2REQA 3LMZA 3WDIA 2BHUA 4F0SA 3N19B 3HPZA 3PPGA 4XZMX 4FR1A 3AU6A 4UTJA 5DO8A 3MJYA 3TAOA 4AZ7A 2YDRA 4CNUA 3LSCA 4A3QA 1EJXC 3RIKA 1SW3A 5LIXX 3LTSA 4OTKA 1XKJA 4S3KA 5DF0A 2FZBA 4Q8VA 4DUVA 3CL6A 3VZYA 1EGMA 4H7VA 4X22A 1ZCCA 1XV8A 1XR2A 1ZL1A 4XBKA 1ITQA 3UJ2A 1WKFA 3GDBA 4GWEA 1TZ7A 3NQDA 3HQPA 2W5FA 1EDTA 1OX4B 4GUGA 4LAOA 3VFLA 2ZUNA 1EA9C 2E0PA 3KRBA 4QIUA 4NUWA 4IPJA 1EUNA 3AZSA 2CKSA 3THCA 5LZLA 1EPXA 1MEWA 4AH7A 3TN6A 5AC7A 3BPWA 1UUQA 1OCBA 3GXNA 4JCLA 3WBYA 6TIMA 1IXQA 1PX4A 4FB7A 1EKOA 2YLLA 1BGAA 1GKPA 3R4IA 3UYIA 4GQRA 2OB3A 4IPLA 3HTWA 1VCFA 2QAPA 3N2BA 5A6BD 3WQ4A 2ZUUA 1JCYA 4MZYA 4NNCA 5HANA 1WQ5A 2YL9A 3Q4DA 5HMDA 1SFTA 3KBWA 1YE6A 4V1YA 3ZYZA 1UZ1A 4HOZA 2QQ6A 4UR9A 5SWUA 3M9YA 1UCWA 2YLAA 4D6GA 1IZJA 1LOLA 3TFCA 1F8IA 3VK5A 1RAKA 1TQJA 3UZXA 2PLJA 5G2WA 4AMCA 3UCDA 3MHFA 3G8EA 1OQFA 1UUMA 1U33A 1WDSA 2J7FA 3ARSA 4MGGA 3KWSA 1V08A 3AISA 2XWDA 4A8NA 3DIPA 6CGTA 2PTYA 5G1YA 1K6AA 1NEYA 3C8NA 3K4DA 2DIJA 4GJIA 4B15A 4GQBA 1KR1A 2GWGA 3WD3A 1SZGA 1HZYA 3RRXA 1TMLA 1E15A 1L6SA 4TMCA 2J88A 3XISA 1NY1A 2RJHA 1UKTA 1I1XA 5D02A 1OG0A 5EFFA 1PZ0A 1IZKA 3QQ0A 5L9FA 1XD1A 1E55A 4NZJA 3APGA 5C2CA 4O0KA 1X7FA 5LHFA 1QK2A 4Q8MA 5A6SA 3KL5A 1OGSA 1R7AA 3IJ6A 1JYXA 4RNIA 3L7RA 3B9EA 3HMJG 1F3EA 2VHLA 3XIMA 1X98A 3L65A 3TR9A 4NILA 2Z00A 1YDYA 2CC0A 1MWOA 3KXQA 3S2LA 3E74A 2A7PA 4B5VA 1WUFA 1X1OA 1X97A 4JEQA 4H6KA 1SJCA 3WNLA 2BGSA 5BOOA 5A2BA 4L4MA 1BYAA 2OKOA 2I9EA 2E1WA 1S2CA 3VIIA 2Q3RA 3B9NA 5A6MA 3FX4A 3AIRA 3G8RA 3AIQA 3LNPA 2YL6A 1RBAA 1OYAA 4QAIA 2E6FA 3W85A 4DBEA 1EWEA 1MUMA 1ZENA 1YW1A 2V5JA 3MMWA 4CCZA 5K3VA 1B31A 1XSIA 2HK1A 3M0XA 1NFBA 2DORA 3QOKA 3V5OA 3H21A 1UC5A 5M1TA 2ZC1A 3QKEA 3IJDA 2VC5A 1LL6A 3K46A 1AJ0A 5HAOA 3CQKA 4GIRA 3WMBA 3QYQA 5DEZA 1T0OA 5CPMA 3UQNA 4RLIA 1M53A 1XPGA 5BWAA 3K30A 3HF3A 4NI8A 5FJIA 3ORWA 3R89A 1YNPA 3GB6A 4GKLA 3EWZA 2JQXA 4UUIA 3KHJA 5DCDA 3CPGA 4ZBCA 4Y9NA 1WA3A 1ISXA 4RZ4A 2R1MA 1A0CA 1WNOA 5BMWA 1FHDA 4LC6A 1J18A 1W3IA 1A47A 1XF0A 4S3GA 3NXLA 4C6BA 4Q3MA 2QCHA 1W37A 4RDYA 1EJVC 1EYEA 1JULA 3VE9A 4UQAA 4QSHA 1Q66A 3STFA 1UR9A 3B05A 3TN5A 5CBIA 3UWZA 3CHFA 4DY1A 2ZQ0A 1T8XA 1F7BA 2V5CA 3KLKA 1UR1A 4AF0A 3FA3A 1W9XA 4MZ8A 5HMSA 1IT8A 3O6YX 3LRKA 2WANA 5CKSA 1RK5A 2C7FA 2HISA 4H7CA 3EPMA 1EC8A 4IUOA 2Y4SA 3T2QA 5BU9A 1WKDA 3W53A 2H9AA 5C2GA 1WOAA 1GW1A 3S5OA 1CLKA 4HSOA 3CIVA 1A0DA 1TPEA 3KCOA 4DBWA 2GJXB 2NVDA 2HPMA 3KBMA 3A21A 1PL9A 3NQMA 4AX7A 5CBJA 3CQ0A 3VD3A 5TD4A 5E09A 3EB3A 1V6YA 2HNHA 1RCOB 2GGJA 1XCWA 3P60A 1O68A 1V7YA 5CJMA 1JUBA 3NEHA 3HQOA 3BZGA 1SW0A 1R9YA 2AKMA 5KEZA 2OZ0A 2OX1A 3LY0A 1J96A 1YPFA 3ARQA 2KZHA 4UQEA 3RX2A 3I3DA 1QPOA 4AY7A 4MY1A 3O0KA 2A21A 4M6UA 4L61A 3WQVA 2EAWA 1L6FA 4L6OA 4R85A 1UMLA 1YRRA 3W7EA 4A3RA 1TUXA 1B90A 2B7OA 3TN4A 2GSJA 3PPFA 3N2TA 4NQ1A 4M19A 5BRPA 2OYMA 1J0ZA 1R3QA 3RJXA 2C13A 3IGUA 3CLWA 4AXNA 1EPVA 5EGRA 1PKMA 9RUBA 2YFOA 3AUJA 4DO6A 4QNEA 4UTTC 5KZMA 4K39A 3UEQA 1O5KA 4NAFA 3SO7A 5I79A 2J8TA 1PIGA 1Q85A 1E51A 3MP5A 4C90A 3UWYA 5D33A 1QNOA 1XJBA 3COTA 3CO8A 1LOSA 3GTXA 5BRQA 4C60A 1F3XA 2PPGA 5D32A 2E09A 1DP0A 4IG2A 3HPXA 2XZ9A 3H2CA 2PLCA 3F1QA 4GNKB 2E77A 1MYRA 2ZRWA 3EDFA 3URQA 1XFCA 5EKYA 1MEIA 1EGVA 4CQBA 1ZJAA 3DHPA 4UTFA 3AICA 4GNJA 3EDEA 2VDHA 3OBKA 2ZC8A 3GG8A 3ZR4A 3B0UX 3BMVA 1MZRA 1JEZA 3O6DA 1VCGA 4BI6A 1U22A 3SR7A 8A3HA 3ARVA 3ABQA 2DZBA 1M41A 2ZYFA 3MBFA 3KZSA 1PIIA 3QYSA 4KCUA 4R7JA 3PPCA 3AHYA 3HOJA 3NL3A 4NZ5A 1WKEA 2XDFA 4NJHA 4F66A 2VWSA 2O9RA 4IFRA 1EOMA 2PE4A 1OY0A 3EGJA 1MW1A 2CLFA 4IFKB 3UCCA 3LYEA 2WJEA 3IJ9A 3TEVA 1G69A 4ZOAA 1Q6EA 3NQVA 1ICQA 1VD6A 4PL2A 4D71A 3IVUA 3EOEA 2ZICA 1TR9A 1CNVA 3UR7A 3KBNA 3OZYA 4NKCA 2YIHA 5CSRA 2IKIA 3PC0A 3AMCA 3N9SA 2IS7A 4PTVA 1JYWA 3EDDA 1QVBA 2WVSA 5ABFB 1GUVA 4AW7A 4GA8A 1OYCA 4HYWA 1W9PA 2W62A 1CB7B 4GGHA 1JYVA 4FOKA 4J40A 3NOEA 4IJRA 3VGBA 3EXTA 5LNUA 2PODA 4XZHA 3UXLA 3OLIA 3E5BA 1A3WA 1PYFA 4PUUA 2XH2A 4MB3A 3ZJKA 3N2OA 3VA8A 2FH8A 3KW3A 5DT7A 1P0EA 5FF0A 2V81A 5A8PA 1IYXA 4S23A 2INEA 5XIAA 4DM1A 3QKZA 1K8YA 2Z6JA 3MKVA 3S0CA 2VRQA 2DQXA 2D2JA 4PEKA 4JQ1A 3WQ8A 5C7HA 2QVNA 1UP2A 3WFLA 3KEHA 5LNVA 1R8LA 5CEWA 1CI1A 3CUZA 3OBEA 1P6CA 5JQ9A 2OLHA 3G0UA 3TK7A 2ZA3A 3WD1A 3HQ1A 5EU9A 4GZIA 4IP7A 1Z44A 2PDJA 3TYUA 1ENUA 3FFSA 4CQCA 5LGXA 4H7ZA 4DYEA 4NRRA 2P76A 3V0TA 2J9ZA 1JDEA 4W7WA 3VKCA 1GONA 4DZAA 1P43A 1RQEA 1ZFJA 1U5JA 2NQJA 3S6TA 1VFOA 2UY4A 4P61A 4Q4OA 2ACSA 3RU8X 2G3NA 2WC4A 2V3DA 4OT7A 3UZWA 1R2TA 1JDAA 4CCCA 3RMEA 1SMAA 3CNYA 4PGLA 2O9TA 4F40A 3W0KA 3Q45A 4W5UA 4L4OA 4Z2GA 4XVEA 3NG3A 3W1QA 5I5RA 2VFIA 2V0TA 1ZSXA 3PFMA 4XKYA 4AEEA 2J7DA 4JKKA 1GWJA 3T44A 3Q58A 5EMUA 5DQPA 3ZJ6A 4LGXA 2QMJA 4K38A 4G56A 1G7VA 3TIMA 3PUOA 3TONA 4C7GA 2TODA 1GVFA 4LOCA 2YYUA 3F2CA 3CQJA 1UR4A 4D2JA 2PU0A 4D6IA 3IVSA 3PM6A 5KZEA 3QMSA 3NZPA 4CN6A 4W7UA 1US2A 1XIMA 2PRMA 4MM1A 3WLQA 2V8ZA 1V6UA 1WZLA 1EQCA 2DEPA 3AYTA 2FJUB 2IPJA 2PD9A 4L80A 3DGBA 1W1ZA 2PP3A 4LVAA 1TX2A 2O0TA 4U5IA 5HATA 3UWUA 3AMLA 3POCA 1KCZA 1IEXA 4H3DA 3VDHA 4AD0A 2KX9A 2CBVA 2PLKA 3N29A 2WOQA 2VR5A 3W7DA 4WGXA 2GGEA 4M1RA 4BHYA 8RUCA 3SCWA 4PA8A 2VX5A 4MZ1A 2PWHA 1S2AA 3TMLA 3L5MA 3HFYA 1W5NA 1OJXA 3QHNA 2JBMA 1YDVA 2OELA 4DJFD 3AZTA 1ZBVA 4KETA 3WQGA 1K1DA 5I3GA 3IAPA 5KMYA 1ZY9A 3UESA 3CU2A 1EEPA 3FW6A 2RHGA 3MTWA 4E4PA 5LIKX 1BWVA 3JR2A 1KXTA 2EO7A 1H09A 1FUYA 4MNJA 3HM7A 5FJJA 2BSLA 4AMAA 1Q6GA 3C2FA 4KIEA 3QGVA 5E0FA 3C0SA 1XLEA 3JVAA 1Z3NA 4W88A 3V1HA 3DI0A 3HPAA 3LXAA 3VIPA 4D9PA 3CTLA 1E4NA 1FWCC 1ML1A 1NVMA 1EJRC 1FXQA 3ZVHA 1C9DA 3Q67A 3G1VA 1TMQA 4Q4KA 3W6LA 1QASA 5ECVA 3OG2A 1DXIA 4HNNA 2Z1WA 3SUTA 4L1GA 1QPKA 1AG1O 3W7QA 2DT3A 2GUBA 3AXXA 3SFKA 2AL1A 1RQBA 1CDGA 3NGJA 1GG0A 1GHRA 4FLOA 4JX4A 1UASA 2J79A 3KCLA 4X2PA 4GY0A 4ZO7A 1HVQA 4XO7A 3GDKA 1KFEA 7TAAA 1D3GA 4FX6M 4MKVA 4AYGA 1C92A 3VIOA 1VF8A 2Y24A 5H2ZA 1RUSA 5D2VA 4NU7A 4N6EA 3U2ZA 5JIPA 2XFWA 4H1ZA 1UROA 3NZGA 2OJPA 3KOZA 1MNSA 5FL0A 3K13A 3RCYA 3S1XA 3CZKA 3BCJA 5D09A 1E6SM 2R9RA 4OE7A 1ADDA 3PUEA 3GNDA 4JZ5A 4ZTYA 4MVAA 2PU1A 1UBSA 4S39A 1NP0A 3GAYA 3G18A 3T0BA 2Y5JA 1XLHA 4WF7A 4L1WA 1VH7A 3TTSA 4ACZB 2GOKA 4U31A 3WNNA 2Q8XA 3U2EA 1ZCOA 3FA4A 5FEXA 3FOKA 2GK1B 3NM3A 1RHCA 5DXXA 4ORMA 3LV6A 1XIJA 3VKJA 1B4KA 3ZT7A 4DELA 1ZQ5A 3GC4A 2J74A 1F5ZA 1IGSA 4H6RA 1K70A 1WXYA 2FLIA 3LGDA 4TVUA 1SFJA 3AROA 2EPHA 1GJPA 1TPFA 2CKRA 2GGGA 5HDRA 4WLCA 3MUIA 3ZZ1A 1WDWA 3CV6A 3SFWA 3S47A 1Q6OA 1PB0A 1YLVA 1V0KA 3KWXA 3PTDA 2A5HA 2DZUA 2I17A 3PSVA 3BOFA 2GUYA 4EPDC 1FH8A 4BQ5A 2XH7A 1O94A 4R34A 1A0EA 4RXGA 1OEPA 2AQVA 3W88A 1CLXA 2OWWA 1ICSA 3DDMA 4UOQA 4QLKA 1NWSA 2C8NA 4C6DA 3WJWA 5DMYA 3AXIA 5DMNA 3UPWA 2E67A 3EB4A 3NR0A 1AQHA 2WSQA 3MA8A 1XQLA 2WMGA 3MP3A 3MV01 5A6AA 3K8MA 3WJZA 4HK7A 2PUZA 4LUTA 5CSSA 4PCSA 4Y7EA 1H1ZA 5C2XA 5C7VA 2E8YA 1A5BA 4CUCA 1B3VA 1W1IE 1FHVA 2PZ0A 5C0QA 1JZ2A 2PDBA 5F1VA 2J7CA 4LT9A 1LRNA 4IMDA 4JTIA 1R3RA 1TB3A 4XIMA 3VDCA 1J5SA 1XHGA 2KAUC 4GQQA 2FGZA 4MNMA 4G8TA 2I56A 3LXBA 1JR1A 4Y96A 4CNTA 2PDKA 4OFCA 5JU6A 3WFAA 4Y6GA 1J9YA 1S2UA 7TIMA 4M29A 2BZNA 3PBGA 2CZVA 2QV4A 1E6QM 3CAWA 1NDYA 3S4TA 3UD6A 1VYSX 1KBBA 2ZVRA 3F5LA 4YVPA 3UVIA 1EJTC 3GFYA 1XYMA 2BOGX 3WUEA 3VDGA 4QDPA 2BVYA 2Z25A 2NWSA 3GXPA 1VLIA 5HNNA 1GKQA 2J13A 3KX6A 4J3WA 4QHRA 5A8NA 3OVGA 3GVQA 2Q09A 4AVFA 4YCOA 3LTYA 4XUGA 5MKGB 2CBUA 2YOCA 2XVGA 1F73A 3VNKA 2P50A 3EOUA 4O50A 4RNFA 2QLYA 4H41A 2F2HA 2OSYA 3E49A 1LUCB 3MPGA 1UQZA 4FO4A 3ITXA 4K3ZA 1K4GA 4PUNA 3HG4A 4KWVA 4NIRA 4ALDA 4G7FA 3CHEA 1K02A 1KM5A 3W7KA 5D4YA 1AQMA 1W56A 1DHPA 4FNSA 4BF9A 4ECLA 3BJTA 4UZSA 1Q3NA 2HQAA 4UFMA 1PS9A 1JCNA 2PEVA 4K36A 3MSRA 3W27A 1WCGA 1DL3A 5ABGA 3V4BA 1CGVA 3V75A 3VGFA 3FSUA 4IJCA 4GUHA 1W8SA 1Y65A 4C6JA 5CG7A 3DFSA 2YW4A 4HZ6A 3LPOA 3RCMA 4U4MA 4UB9A 3UXIA 3VIKA 4GUIA 4J27A 4F9JA 5I3FA 1OHLA 4MOZA 1Q7ZA 1NU5A 1UD2A 1FWHC 1TPUA 3I7RA 5AZ1A 4ILSA 1A5SA 4IGSA 5IBXA 3WH5A 1R86A 1RD6A 2XGBA 2C14A 2WVVA 2P0OA 2RDXA 4OQVA 1E6NA 1HP4A 3PWGA 5I3IA 3SCSA 1GYNA 3C0JA 3MYOA 3LBMA 4E8GA 3QQWA 4H01A 2NQZA 2C18A 2HRWA 3GH4A 3PG8A 2WB5A 1L2UA 1MW3A 2V69A 1JZ5A 3W38A 2EKGA 1IXNA 1PV8A 3PF3A 4Z17A 5KTLA 1O7AA 4H2CA 3SDOA 4PTNA 2EPNA 2ZRZA 3CYJA 3WQOA 1W9BM 2W0UA 2WHKA 3A24A 3KL0A 5LA0A 2PDWA 4B90A 5I7GA 3TW7A 4E2VA 4Q22A 1NWRA 2DH2A 2QPSA 1S3TC 5A3HA 4UCGA 5C9RA 4P7NA 3HG2A 2G4JA 2J7BA 2OEJA 2FPVA 1FVPA 4TV5A 3VOGA 1M68A 2BHYA 1ISWA 3EMZA 4S3DA 2P0IA 4JIIX 3LM3A 3M7WA 1D2KA 1PCKA 1Q45A 3GVRA 3TQ0A 4LFYA 3PG9A 3ANYA 3WMSA 3II1A 2AKZA 5IXEA 4GJJA 3IK4A 4N42A 2EQDA 2J4GA 4H6QA 4RV8A 4AISA 3QHMA 1DJIA 3UNDA 2CPUA 4IMCA 2W6RA 8XIMA 5D9MA 1W5MA 5A8MA 2GVLA 2BXZA 2PTZA 1H7RA 1QFEA 4BQ2A 4X60A 2FTYA 4LS1A 3IUDA 4KESA 1KXVA 3MHGA 4H9UA 2R1KA 1GQJA 4I5RA 1F4AA 4NZ4A 3BTNA 4XQ6A 3VD5A 1OFOA 2BB0A 2QT3A 3AXHA 3WNKA 4AZ5A 2DZVA 3W23A 1I1WA 1DQWA 4L64A 3STGA 5HOSA 4OIFA 1LWIA 1EIXA 3LB0A 1A5MC 1V3KA 1S1PA 3PP7A 1UR2A 3PPHA 1XYBA 1H63A 2XH4A 1R85A 3O0FA 3IANA 3PS7A 3WN6A 2A4AA 3L4VA 3LHZA 4EAMA 4JQ3A 2QIIA 3KRUA 5CC3A 3MUCA 4AD4A 2XFRA 3WJYA 2V9DA 1QRQA 4HKPA 1GOMA 3APTA 3BSGA 1OABA 3KVJA 2CIPA 3PTQA 1QI3A 1V93A 3T2PA 2ALRA 2YR1A 3CQIA 3UETA 1B4EA 2QDGA 1P0BA 4F3HA 4KWWA 1P48A 2ZZ2A 5FEZA 2CYGA 1P4CA 3CGTA 5CPOA 2BGNE 5CC5A 3HGOA 2VXNA 3U8GA 2ZZ4A 5KETA 2YW3A 3GIQA 2XG9A 2YZ5A 3VC6A 2CZEA 1JZ6A 3IUHA 3EZ4A 3AC0A 3NO3A 4PODA 5HNUA 4HMEA 1TV5A 3TLQA 1F9CA 1QWGA 5FJPA 3FKRA 3L4WA 5AHNA 3JUGA 3FXYA 4CNPA 2CWNA 3CUHA 3ATZA 1H1YA 3SY1A 3ZIZA 3HA1A 3QZAA 1GYLA 3DG3A 1JPKA 2VOMA 1F07A 1Q65A 1UR0A 3LHVA 1MMFA 3QZ6A 1DOSA 4D6EA 2DT1A 2QW5A 3PTMA 3NTYA 4ZL1A 1P1MA 4F2BA 4N6FA 4O18A 1TUFA 3MSDA 1K8CA 1XXXA 4UOJA 3H6OA 1RQHA 1CZ1A 3EA1A 1ZBWA 3TZNA 4JTGA 2VWTA 3PBVA 3IK2A 1ONXA 4UC5A 1BYDA 3PFRA 4GUFA 4JL1A 1GNXA 1LWHA 5CZSA 1HN1A 2JGYA 2OFJA 1UJPA 2XSXA 2D0HA 3N4AA 1DORA 3WQ6A 1J10A 5E70A 2QR6A 3M5ZA 2FMOA 4JTKA 4PUMA 3WLJA 4AUBA 4GI4A 1SFSA 4PB3A 1FCQA 6REQA 5LIWX 1FWWA 5AC8A 4AWTA 1TJ2A 3MVTA 3BLDA 1M6JA 1CGWA 4G1NA 1E0VA 4JYDA 2PTDA 3QVQA 2ZWZA 1HJUA 1OD8A 1H41A 1W1TA 3WQFA 3WBEA 2VURA 4JD4A 4J35A 1E4IA 3OTRA 3PHAA 1XPYA 3L21A 4FP1A 4ASTA 2DSVA 1TV4A 3P84A 3AALA 3K4WA 4OUIA 5BZAA 1UKQA 3OVRA 2NQ9A 2Y2WA 4TTUA 2HEJA 3ABRA 4O52A 2D3NA 1QWKA 4PTXA 7XIMA 2A7RA 1JCXA 1F4HA 3W84A 4UTWA 2ZKMX 4ORIA 1UG6A 3QM3A 1RCQA 4HPXA 3MSYA 3KHDA 3ZWTA 4WDUA 3A9BA 1TVPA 1GZGA 1BLIA 5KZDA 4AZBA 3P5YA 4ZOCA 3KCJA 1W0MA 4B5WA 2PLMA 3FDGA 4F9DA 4DPPA 1LZOA 3F7JA 5FJUA 2WNNA 3R8GA 4MDOA 1ZALA 4PZVA 2GGIA 2Z26A 3FGCB 1BTMA 2R1PA 4X9YA 3UJRA 4W84A 3U7BA 3EPOA 3QV6A 2UV8G 3H8AA 3QF0A 2J62A 4AIBA 2X05A 1XH2A 3BDKA 2V38A 4AWSA 2G97A 3WD4A 4ZXOA 3W24A 1FDZA 1IEIA 3IGXA 3ONBA 3KAOA 3VNJA 4JEJA 1BKSA 4CNSA 3STPA 5AKQA 3CV7A 3EWBX 2O92A 4QG9A 1I2QA 1ZAIA 3BK0A 4GG9A 3E2QA 1TPWA 2VO5A 3G0SA 1YBQB 2ZADA 5C54A 3VCCA 3NQBA 2REQB 1I2RA 3ARRA 1JNEA 2FHFA 1PTAA 1ZS2A 3ARTA 4O0ZA 1DJZA 3RM4A 4AEOA 1UOZA 3GNPA 1G01A 3MP4A 2G4FA 2NQ5A 4RDVA 1M01A 4S3CA 4NNAA 3I65A 2R6OA 1MUCA 4ZODA 1ZBCA 3NM1A 3H4WA 3MV11 3OQEA 3MB9A 2VKZG 3EDJA 3ISIX 4J28A 2Q71A 1JDCA 2ZUSA 1OIMA 2YL5A 3TYEA 4U2YA 1E6RA 2DQWA 4WIWA 4KH2A 3M43A 3SGGA 4JOMA 3PB2A 2F61A 1PZ3A 5DY2A 3IS4A 3QXBA 4WKHA 4A22A 5I2UA 4GISA 4YHGA 2YFNA 2R24A 1DYSA 3RGTA 4UMCA 1LOQA 3TJ4A 4HHMA 4KEZA 2Q3OA 3DEQA 3RN6A 4DZIA 4P8WA 1OC5A 2OO0A 2CLHA 3W7LA 3H24A 3M0HA 3E2RA 2FZMA 3VX1A 1XCFA 3ZOAA 4LB4A 3WLPA 1Q13A 1IT7A 4REQA 4PL1A 3ITYA 4JFTA 4KFPA 3SN0A 4AQLA 4IL0A 1XH1A 2WMKA 4MPQA 3E2VA 4WCJA 1WDRA 1RZMA 3VD9A 2IKGA 3O7UA 3GBDA 3MSGA 1UMYA 2HTMA 2HBVA 1JQVA 3H4XA 4CNNA 4YYCA 3FHQA 4ZO8A 2PDPA 1M7XA 1QAPA 3T07A 4MG4A 1EC9A 5C9UA 4LAUA 2X16A 1AUSL 2CLIA 2WCSA 5D2WA 5DBUA 2PC4A 3MWAA 4MPKA 1J79A 3G1SA 4XBJA 1KM4A 1I60A 2PGFA 4A35A 5F4WA 2W67A 3IGSA 4CQ8A 4PSRA 3N6QA 3BSHA 3RUBL 4JFVA 3TE9A 2WNWA 1XC4A 2Z27A 1TZZA 1WYIA 1BVZA 3UG8A 4TR9A 4GY7A 4DJEA 1CXFA 5G4EA 4K2SA 1XLIA 1J0JA 4RDWA 5L6UA 1WB0A 3IJ7A 3VOFA 1S1RA 1KFKA 3C2YA 1GVRA 1TPDA 2YBUA 4WSKA 3OBAA 3VD4A 1X39A 4CCEA 1UC4A 4QR6A 3LBCA 3PZVA 4U5KA 6ALDA 1TV7A 3TTEA 4MJZA 3UBPC 1ZP4A 1VJSA 1NARA 1C91A 3I68A 4ML4A 3BVJA 3BGGA 2Y8VA 2VDGA 1POJA 3CUGA 4GRSA 1H4PA 1Z7AA 3RNDA 4PBFA 3L4UA 1ZRQA 3ZR5A 3PUDA 3NFUA 3WUGA 4LEFA 2ZX9A 1K8ZA 3N34A 2V68A 4MB5A 4LYKA 1S3HA 1JRBA 1XCXA 2E5CA 1JCMP 2QUTA 5D8WA 2ZXBA 4HNUA 2X8RA 4LV4A 4GI6A 3DENA 2FHCA 3IUIA 2H3DA 4JX6A 4GQGA 2QCNA 4DF0A 3C52A 3E9AA 2ODOA 3A3WA 5FAGA 2GQ8A 1FWGC 2UY5A 1X1NA 1TTJA 3NQCA 1KC7A 1MW0A 1Z69A 3B8DA 2XUCA 1T96A 1H7PA 3D6NA 2PP0A 2E3ZA 1MRQA 2OGYA 4JQ4A 2GJRA 2E7FA 2ZWYA 2IUZA 2JFEX 3GAKA 5EY5A 4BFAA 3RYSA 1CW2A 2Y5EA 4Y9MA 3OYZA 1OBAA 4E5TA 2CNCA 4LBRA 4O0QA 3W2JA 2OZ8A 2D73A 3AXMA 4HNLA 3AMGA 3IJ8A 3F4NA 4J1OA 1HNYA 1RVGA 1UB3A 3LLDA 5CC7A 4D6FA 1Z48A 4J3SA 3EWWA 4CQ9A 5B7YA 3TTYA 3GNXA 2RGMA 3S2NA 2OPJA 4GCAA 2Y5SA 3KLLA 4U3AA 2YCLB 1ZAJA 1XP3A 1TJPA 5EMMA 2VQTA 4NYYA 2VEFA 5EMYA 2ISFA 2J8GA 3N25A 4HA3A 1Q6CA 1QMLA 1AL7A 1E56A 3KBVA 1IEVA 3GG1A 5AN7A 3GTHA 4RPQA 2W92A 3BLPX 4FEZA 1A49A 4JAWA 3WQWA 4PN2A 5EBUA 4UNKA 5DRIA 1R6WA 4JDYA 2OO6A 2R14A 1FCUA 1JL8A 2VD8A 1R3VA 2YXXA 4ATDA 3IIZA 3SJ3A 3U3HA 4DYKA 3AAMA 1BVWA 4HPGA 4UTUA 1U5HA 5A6JA 1D8CA 2YYTA 1GOXA 4CEXC 5HQMA 4CVWA 4DPQA 2Y1HA 4WDWA 1T8QA 4RE4A 2H9AB 4LS0A 3ERPA 1PDZA 2X30A 5FL1A 1AW5A 1WZAA 4HU3A 3F5KA 4R27A 2VGFA 4B9YA 1FWDC 1KCLA 3OPSA 4D6CA 2DH3A 3GO2A 3PZMA 5RUBA 4CGTA 2OZ3A 3VGGA 1M7JA 4LTSA 4JNYA 2OYLA 1GG1A 5D9PA 1CXIA 4S3AA 3U5UA 1VAHA 4M24A 1OX5A 3WLMA 1QOPA 3W01A 1Q6QA 3NSMA 1DIOA 3RLVA 4Z2HA 1F61A 1BFNA 2XVKA 4XB3A 3O16A 3DC0A 3P2VA 4JIEA 3VMOA 4C7DA 4LVFA 4UQ9A 4JHZA 4LANA 3SCVA 3QV8A 2FH6A 3ITVA 4O4VA 3EEGA 4HCDA 1E3ZA 2POZA 2QCEA 1MQQA 1T99A 1PYMA 3SGZA 4IFOA 3S5ZA 1Y5WA 4LVGA 1RA0A 1CGUA 4WR3A 3GDMA 3OA3A 3N04A 1XISA 5A8GA 3VI2A 5A69A 1HO4A 1QI2A 3AU2A 3H23A 1UH2A 3V5CA 1GK8A 3RPTA 4JYFA 3VIFA 3FYOA 4NRSA 5CSYA 3L2MA 2E28A 1D7KA 1K9DA 3QY7A 3A47A 4NAFB 2Z1BA 4J3XA 4WUIA 1MZHA 3IIOA 2FPYA 3NGFA 3SCRA 1JRCA 3O07A 3WSUA 3T0DA 2IQTA 4J4KA 1IR2A 5AB3A 2C1GA 3W82A 4HNVA 4O1DA 1HKMA 3WDPP 5C70A 3GKFA 1SUXA 2ZDSA