2PC8A

E292q mutant of exo-b-(1,3)-glucanase from candida albicans in complex with two separately bound glucopyranoside units at 1.8 a
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGQWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hypothetical protein XOG1
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance.
pubmed doi rcsb
source organism Candida albicans
total genus 150
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pc8A00
4F9JA 3N12A 4ATWA 1ISWA 4ML4A 4AZ6A 3THCA 3VIPA 5I77A 2J79A 3WNMA 1E55A 2UWFA 1IZKA 3D5HA 5ABFA 1Q6CA 4HA1A 1H2JA 2A3CA 1H0GA 3K46A 3WNKA 3ZIZA 1LG2A 1W9BM 2WKGA 3AI0A 3WQVA 1JI2A 1GHSA 2ZUSA 1DWHM 4DWSA 3AIUA 4JKMA 4GZEA 1NWTA 1E0XA 3W24A 2OSWA 1JYVA 5HPCA 3ARXA 2VX4A 4UQ9A 4PN2A 3CIVA 1Q4NX 3EDKA 4MNMA 2GJXA 2EPMX 3M7SA 3WMBA 2RGLA 3PZMA 5I6SA 3DYMA 1W9UA 3CZKA 2YIHA 3VUPA 3WMCA 5JBDA 1H3GA 4QCFA 3NDYA 5CPQA 1J10A 1R7OA 1DTUA 2OWXA 2A3EA 2J7FA 4GI9A 3OA5A 4J3WA 2NSXA 1BYCA 2D3LA 2D0GA 2YA0A 4UFKA 1FH9A 1MQQA 4BZYA 3HN3A 3WD1A 1CLXA 1JNDA 4JL1A 4PMDA 3BCDA 1MW3A 1C90A 4A3HA 5LYRA 2O9TA 2O9RA 3M07A 2C8NA 4U5IA 4CN4A 3WUGA 3SCUA 4D1JA 3W6MA 5BRPA 4AXNA 1I1XA 2XVKA 5A6LA 1JG9A 4PUDA 1OD8A 1E43A 3K4AA 2V5DA 3BSGA 4TVUA 5DEZA 1XHGA 2G3IA 3RM4A 4AZGA 3DYPA 2FHBA 1VFFA 1VFMA 1RH9A 1Z32X 4AD2A 2FGZA 4D6HA 2CIPA 2CHNA 4PMXA 1LLOA 3ARUA 3AS1A 1WZAA 5KEZA 3MMDA 3AS0A 2VR4A 2PBOA 5CSYA 2CPUA 4PRWA 3WL1A 2Z1KA 1M04A 4B3KA 2XIIA 3ARRA 3OLEA 3WIJA 1NM9A 4GKLA 4PSPA 5A2AA 3UEQA 1FH7A 3ECQA 1EDQA 2F8QA 1W3JA 1NARA 4TXEA 2WVTA 1QI0A 4EANA 2JF7A 2YDRA 1B1YA 3W26A 1ODUA 3SUTA 1H0IA 2AAAA 4AWEA 5M17A 3G6MA 5A6JA 3CHFA 1QBBA 1W32A 4PMQA 1JZ8A 2UY2A 3BAWA 3WQ5A 4GZJA 1XGZA 2PC8A 2WW5A 4BQ5A 1BF2A 3SEPA 2WMHA 3AS2A 2WCAA 1MXDA 1CDGA 2QLYA 4BF7A 1ISVA 3OIHA 4JKKA 2DGAA 1GUVA 2WHJA 5I2UA 3SCRA 3VNZA 3DC0A 3OGVA 2XVNA 1UWIA 1UKOA 2ZWYA 1JZ5A 1CXHA 3AXIA 3WN6A 1QHZA 1X6LA 2BFGA 1DWIM 4CD8A 4LPCA 3AIQA 4JFVA 1E6NA 3EDEA 1Q6DA 1OGBA 2ZUVA 1UR0A 1UWRA 2VL4A 1W3KA 2DSVA 3BAJA 1WNOA 3BLKA 3L4WA 1UD6A 3F4VA 4M24A 1U2YA 2YL5A 5TD4A 4M8UA 4U31A 1LL6A 2YOCA 2YL8A 3RCNA 2HVMA 4UOQA 4MNLA 1OBAA 1N82A 4PTWA 1UWQA 4E8CA 3BXWA 4S3KA 1OWQA 1W1YA 4XB3A 3AIRA 2ZUTA 1CWYA 2XWDA 3VIFA 5GNXA 3ZJ8A 1MYRA 2WVSA 4AIUA 5KZ6A 2E4TA 1NP2A 3AXXA 2JEQA 2QHAA 3ZO9A 1E56A 5F7UA 2QMKA 1VFOA 1RD6A 1P6WA 1UZ4A 1VRXA 3QGVA 5DFAA 3K8KA 3RPMA 1HP5A 2W66A 4P8VA 1B31A 5C70A 3WMSA 4CUCA 3ARQA 2Y2WA 2PB1A 2VR5A 3W25A 1GHRA 3VDHA 2JALA 1UR8A 3U5UA 3MUY1 1G1YA 3ARSA 1V02E 4QLKA 3CUIA 4WK9A 4AIOA 4D6DA 4DUXA 3BMVA 4AEFA 3ZJKA 4M29A 3CZGA 5EFDA 3WQ4A 1WE5A 1EH9A 1JDCA 2YJQA 3FHAA 5HOSA 3QOMA 5CXPA 3N9KA 1UR4A 1YQ2A 4GQRA 4U3AA 1L0PA 3T0AA 6CGTA 4W8LA 4YHGA 4B9YA 3K8MA 2YA1A 1JAKA 3TTQA 4JCLA 2WB5A 1UKTA 4HA4A 2BVDA 3G6LA 1EO7A 2GVYA 1SMDA 2VI0A 3WF3A 4J3UA 1NWRA 1TUXA 2WVVB 4X9YA 2XSBA 5D8WA 2XG9A 3II1A 3OLIA 1UQZA 4KMQA 3VIOA 4D6IA 2CBUA 2X0YA 2WAGA 3FAXA 1GW1A 2DEPA 3WDIA 2OLHA 1E4IA 4FLSA 3WQ8A 3WNOA 2ZXBA 3HJEA 2NT0A 2CKRA 1XSKA 1E15A 1X6NA 2BVTA 1X1NA 3AISA 3EMZA 4BA0A 1E6ZA 1V0MA 2Y8KA 3ARYA 1CXIA 1EHNA 4ACYA 1KB3A 1HP4A 3GNPA 4WF7A 3SCVA 2GFTA 4BQ4A 1BAGA 3ZR6A 2ZUNA 5M5DA 3WD0A 4CU8A 1VENA 3BAXA 1KGXA 1V3KA 3VMPA 1ZU8A 4P7OA 2WSKA 3GXMA 4U3CA 1WCGA 1C92A 2V3DA 1OIMA 4Q7NA 3WF4A 1V6WA 3GBDA 3SUVA 2GK1A 1JI1A 4UQDA 1TVPA 4CN1A 1CXEA 2J75A 4LYQA 1VEMA 1HJVA 3RO8A 3WH5A 2QV4A 3L4ZA 1FH8A 1UKQA 2GDUA 4OZOA 1UWTA 3CTTA 3BLPX 4C7GA 1UR9A 5DO8A 3QOKA 2F2HA 2BHUA 3GBEA 4R27A 3BAKA 5DMYA 1M01A 5A94A 2WXDM 2IXUA 2PWEA 1SFSA 1UH2A 3T2QA 1VJZA 3SUSA 1BG9A 4AD3A 2E8YA 4J7RA 3VIHA 4AISA 3U7BA 5IHSA 3E1F1 1GCYA 2E8ZA 3W53A 2WVUA 1EXPA 3HU7A 4MDPA 4MNKA 4UFHA 3WNPA 3UCQA 4HTYA 1B3ZA 1WP6A 4WKHA 3WD3A 5I78A 2D20A 2GDVA 4JAWA 1OGGA 1UYQA 3CLWA 1BLIA 4HP5A 4QLJA 1PX3A 2QMJA 1CXFA 2BY3A 2EPLX 1KBBA 3K1DA 3PHAA 2D0HA 4AZ5A 1DEDA 4MJ2A 3VM5A 1HKMA 3A4WA 2VCCA 1PZ2A 2ZX9A 2ZXQA 1E40A 2J47A 1JAEA 1CEOA 4PMVA 1JD9A 4DUWA 3L2MA 1V02A 4P7QA 3GZAA 1ZB5A 2YBTA 4C7DA 4D6CA 3N13A 5DT7A 4GZIA 4D6GA 3PTKA 1XCXA 1TG7A 3RJXA 3AIEA 4R5EA 3WDJA 1JZ4A 2OWWA 2VT0A 1I1WA 2XUCA 4ZE5A 4MB4A 4HOXA 1GZJA 3EDFA 3SCOA 2DDXA 1ECEA 4MB3A 2G41A 4J3TA 2NT1A 1E4NA 4N42A 3B9DA 2QF8A 2FH8A 2J8GA 1ITXA 1US3A 4HOWA 5AY7A 3S6TA 2AMGA 1G5AA 3EDJA 3GDBA 2EO7A 1BFNA 2WMKA 4NSBA 2WHLA 4F66A 5DF0A 4JHOA 3CO4A 2J8FA 3N18A 1HKJA 3ZR5A 3FY1A 5CSUA 4D72A 4XZBA 3N15A 3MMUA 2WMFA 3WDQA 4WSJA 1J0KA 1K6AA 1KXVA 1WDSA 5D9PA 4H04A 3WENA 4LQ1A 4UOJA 2O92A 2Y4SA 2WVVA 1BYDA 2E40A 4TVDA 5EB8A 3WDPP 3KE0A 1O6IA 3VIJA 3WSUA 4F79A 5FOOA 1RP8A 2XGBA 3TOPA 1J11A 1WAWA 3O6AA 4PCSA 3AZSA 5CLWA 3RMEA 1KCLA 3LPGA 2DH2A 2EPNA 5I5RA 5FKYA 3UG5A 2WCGA 2ESCA 2B31A 4Z2KA 6TAAA 3GXDA 3IJ8A 5BXSA 7TAAA 2JIEA 1KXQA 3GH4A 1CIUA 4N0RA 4W7VA 2VURA 3CGTA 2TAAA 3MO4A 2BY1A 3CHCA 3OGRA 1YHTA 1GQJA 1TVNA 2BY2A 1UD4A 2VX6A 4URIA 4UFIA 1UH4A 3CHEA 2UY5A 2CBIA 1W1VA 3VGGA 4M1RA 1SR0A 3ALFA 1F4HA 1KWGA 1W3LA 4NF7A 2FGLA 1GVYA 2VRKA 4RE2A 1J0HA 1BG4A 5A3HA 1GOKA 3SCSA 5GNYA 1VB9A 1UA7A 3VD5A 1WDQA 1NQ6A 4CD7A 4BS0A 2VVSA 2BHYA 3UESA 2YBUA 1Q6EA 3W28A 4TTUA 3T0DA 1C8XA 1PIFA 1OGSA 2VMFA 4PMRA 4AD4A 4Z2LA 3OLDA 3FNDA 1OIFA 4KH2A 2JF6A 1KFWA 3SCTA 2W63A 5ABHA 4DWSD 4PTVA 3AHZA 5AYIA 3VOCA 2X09A 1HXJA 1LG1A 2WLYA 2YKKA 9CGTA 2V3GA 1WO2A 3IK2A 2XFYA 3N11A 3B9EA 2WZHA 3ZT7A 3A6OA 5IFTA 2DSKA 4DUVA 4AD1A 1CGVA 4HMCA 4CD6A 3WEZA 2V3EA 1QNRA 3B9AA 1V3MA 4U2YA 1V3JA 5A69A 1E6SM 4W93A 1J0YA 5LA1A 1CPUA 3T08A 4U33A 3WEOA 1PZ3A 1UD3A 3VU2A 4KRUA 1KQZA 1QNQA 4TOQA 5I0DA 1JF6A 1VBRA 2XVLA 3RILA 5BROA 1AQMA 3DHPA 1W1PA 2BVYA 1CZ1A 3VIGA 3W0KA 4AIEA 5A6AA 1JL8A 1TCMA 1E9LA 1TMQA 1QW9A 1D7FA 1XD0A 3CUGA 4Z2GA 5LA0A 1MVYA 2NW0A 3OG2A 1ZBCA 5I79A 3L4VA 7CGTA 1EHAA 3KL0A 5I24A 1V0KA 3GNOA 5BYWA 4M81A 5GPRA 1RPKA 2XM1A 1BQCA 1BVNP 2D2OA 2XM2A 3PN8A 1GOMA 2DT3A 3EMQA 4AZ7A 1W2PA 2X05A 1JD7A 4FF5A 3AYRA 4AMCA 3WDHA 2YDSA 3U5YA 2F61A 2DSWA 2GK1B 2J7HA 4Z2JA 4GI6A 4XUYA 3WELA 1XC6A 1KR0A 4YPJA 2JFEX 3PTQA 3O9NA 3WH8A 4J3VA 3VIMA 2WZEA 4NRSA 3UR7A 3TTOA 1OT1A 1L8NA 1KWKA 2Y5EA 4KGJA 5HBFA 1E70M 3N17A 1OCQA 3AHTA 1MW0A 3VM7A 1QOXA 4V27A 1XV8A 3VD7A 3PZVA 4P8UA 2D3NA 1G0CA 1XD1A 2ZWZA 3VMOA 2BXYA 1UH3A 4WKAA 2J7DA 1CENA 3BAYA 3TTYA 1LL7A 1CBGA 1R87A 1W3HA 3CZJA 3MUAA 4MDOA 4ACZB 4H8HA 3GM8A 4AZHA 1UG6A 3ZOAA 1DHKA 2DT1A 3PZTA 4JFSA 3VDCA 3AMDA 2WHKA 3PZ9A 4HOZA 3VGEA 2G4FA 4W8AA 1ZBWA 3CPUA 2W61A 5BXTA 1AQ0A 1B90A 3L4YA 4CU7A 4U2ZA 5A8NA 2WMGA 1JF5A 4JL2A 1QPKA 5I23A 4L4PA 3VX1A 3S2CA 5D9OA 5A8MA 1GONA 1UWSA 1R85A 4MB1A 1TZ7A 2OWCA 1E5NA 5CLTA 3EYPA 1V3HA 4PBGA 7A3HA 3WUBA 4FLQA 1G01A 1K9FA 1WZMA 1S46A 4QLLA 3L2LA 3MSGA 4MADA 3OBAA 3KEHA 4V28A 1CXKA 1K9TA 1CECA 1HNYA 3W6LA 5E6ZA 3OZPA 3DHUA 4W88A 4CVWA 3N04A 2OSYA 4CVUA 4KRTA 1VIWA 3IJ7A 1J9YA 3WD4A 3VILA 3POHA 3QHNA 3MS8A 4PSRA 4PMUA 1CGUA 1EIBA 1GQIA 3KZSA 4W8BA 4AZCA 2WMIB 3NDZA 4W7WA 5CGMA 4HPHA 1LJYA 1H09A 1V3IA 3EDDA 4XV0A 3AHYA 1CGXA 4H7VA 3CHDA 1RP9A 4OOZA 3PZUA 4PMZA 4AEEA 1E3ZA 5BXPA 3F5LA 2VC9A 3MUIA 1HVQA 1WZKA 4OIFA 3PBGA 5CGTA 1JYXA 4FLRA 2BXZA 1VF8A 3IANA 1C93A 3T0BA 2Z1SA 1Y7VA 3FHQA 3VGHA 3UERA 1XYFA 2XJ7A 4UQBA 2DIJA 5EBAA 3DYOA 4MTVA 2VX7A 3OZOA 1BVZA 2J7GA 3QHOA 1W9VA 3BC9A 3PZOA 2ZOXA 3AFBA 2VCBA 1MQPA 4QCEA 1KGUA 2VQUA 3TP4A 4D6FA 1C8YA 3ALGA 3WH7A 3CUJA 5A95A 1UD2A 3RM8A 3AHVA 1V6VA 1BGAA 3ARVA 5FL0A 1HL8A 2WC4A 5A2BA 1WB0A 4EE9A 3SCNA 1PX8A 4UTFA 1E0VA 1H5VA 2OYLA 4H8VA 3WDRA 1C7SA 2VOTA 1PEZA 4HU0A 4RE4A 3D3AA 1FFRA 1HKIA 1R8LA 4PTMA 3VDBA 1VJSA 4K68A 1VAHA 3FN9A 3IAQA 5A1AA 3GXFA 1E6PA 4RE3A 2GUYA 1GOOA 3ARWA 5E70A 3W4RA 4ZENA 2A3HA 2W4XA 3WY1A 1B9ZA 1HKKA 2WKLA 4XZWA 1FA2A 3VTRA 1CGYA 1JGIA 3SCQA 2IUZA 3VDAA 3W81A 1H1NA 1ISXA 1QNOA 1KGWA 4Z2HA 1QI5A 1HJUA 5BWFA 2UY3A 1U30A 1QBAA 2WANA 4GPNA 1EO5A 3GXIA 4L4OA 1UZ1A 3GH7A 1UWUA 4ACZA 3T09A 5A6SA 5ABEA 1OINA 4GI8A 1XYZA 3UG4A 4JFUA 2WZIA 2J74A 4FLOA 2JEPA 1B3WA 1M53A 2CKSA 2VRQA 3AZTA 4DM1A 2X8RA 4UFMA 1LWJA 3N1AA 1MXGA 2VZVA 1VBUA 3AMCA 3AMKA 3W82A 5CQ1A 5BCAA 3VIIA 4AZIA 1IT0A 2CNCA 1K9EA 3GH5A 2YLLA 1QI3A 1TA3A 5BXRA 4CKQA 1NP0A 2Q8XA 1V0LA 1Q6FA 4HPGA 2CHOA 4MB5A 2PWFA 3SCPA 4UOZA 3SCWA 3GTNA 1TFVA 1DWJM 2EXOA 4V2XA 5CG0A 3OB8A 1E0WA 3APGA 5E09A 2AOSA 3AXHA 1E5JA 2PBGA 1H4PA 2WWDA 4TVCA 2VJXA 4OKDA 1MFUA 3A47A 2WMIA 3CZLA 1CNVA 2DIEA 1B3YA 3K8LA 1XH0A 2DT2A 1J0ZA 4OOUA 3L4UA 4CU6A 3WFZA 4TX6A 3NSXA 2W67A 5JBFA 2E9MA 3AMLA 4NRRA 1QHPA 3KL5A 1IZJA 1NOWA 4UQEA 4W7UA 4B15A 4A4AA 1PBGA 5CPTA 4FMVA 3AZRA 2CESA 5JUVA 3RIKA 1VEOA 3M46A 2EBNA 5A8QA 4JHZA 3RDKA 2G3JA 2CBVA 1DWAM 1G94A 1J12A 2OYKA 3VGFA 4LGXA 3MANA 3WQWA 3F5JA 1M03A 2WNWA 3ARTA 4GIAA 1JZ2A 2WK2A 5I3DA 2O9OA 1O7AA 1QI2A 4UFLA 5EFFA 1ITCA 1TE1A 5FL1A 3TONA 2XWEA 2XFFA 4IM4A 4LYRA 1JYWA 4ZE4A 3OGSA 4ATDA 4PTXA 3WF1A 2WCSA 4JKLA 3QHMA 2WWCA 1EOKA 1LWHA 4W89A 3NSMA 5FIPA 1XCWA 3CUHA 1H11A 2XGIA 2VVNA 3W37A 1W9XA 1JXKA 3VNYA 3WD2A 1HIZA 4GXPA 3WNNA 4B16A 2VQTA 1CYGA 4XX6A 5A6BD 1LF1A 1QNSA 5D9MA 1HT6A 4WIWA 4J3SA 4FK9A 5LA2A 3EBVA 1K9DA 1NOUA 1E72M 5E9AA 1E3XA 6A3HA 1C91A 1E4LA 3VD4A 4MAVA 4M56A 1HN1A 1AQHA 2J62A 1UR1A 4JIEA 3K4DA 1BSIA 2BNJA 5JIWA 2JE8A 1GOQA 1EDGA 3LMYA 1HX0A 2CITA 4UCFA 2CYGA 1ZBVA 5C8BB 1W2VA 5C71A 2FHFA 4AD0A 1JZ6A 3WH6A 5JIPA 4CD5A 4AZCB 1MW2A 1FP9A 1BHGA 1JXJA 4H2CA 4MAZA 2PWGA 1ODZA 1EGZA 4OBSA 4CCDA 3I3DA 2GJRA 1J0JA 2OSXA 3LPOA 1UHVA 2EPOA 1W9DM 1NWUA 4EKJA 2VX5A 3NJ3A 4W5ZA 2XSAA 5IXEA 2ZIDA 2DSZA 2ZICA 4GINA 3BAIA 4HMEA 5FCZA 4QFUA 5CJ5A 1M7XA 3UR8A 4P7NA 4UFJA 2V5CA 4H41A 3WH9A 2BY0A 2DT0A 3WNLA 3ZQ9A 4JCMA 3I3EA 2DH3A 1V03A 2QPSA 2D22A 3ZT5A 1I75A 3AIVA 1FFQA 4UZSA 4PMYA 2Y24A 1KR1A 2JIWA 2CCRA 8A3HA 1GJWA 3PTMA 3KWXA 1JDAA 5E6YA 4YN5A 4TX8A 2FDMA 2HISA 2ZUWA 2O9PA 5M03A 2XTKA 3NSNA 1ZJAA 1MW1A 4LYPA 3U57A 4W85A 2A3AA 1GNXA 2D1ZA 1U33A 3ARPA 4H8UA 3AS3A 5E0CA 4QP0A 3L4XA 2G8ZA 1JFHA 3U7VA 1UD8A 3NCOA 4E2OA 2WM0A 2DPEA 1C7TA 1XSJA 1GOWA 3BH4A 4OJYA 3L4TA 1XH2A 2GSJA 1A3HA 3WUFA 3GYCA 3T2OA 2UY4A 2XPKA 1E4MM 5ABGA 4JZ5A 4BQ3A 1UQYA 3BMWA 1B3VA 4EK7A 4OBRA 1MWOA 2EPKX 3AJ7A 4GO8A 4KGLA 3DECA 3ZSTA 1PJ9A 4ZFMA 1V6UA 1OSEA 5D8ZA 4Q22A 5AC4A 4D1IA 1UKSA 1CGWA 2BV9A 2CXGA 4LXFA 3VKKA 5FD0A 4QDMA 1B30A 1B3XA 2V3FA 2W5FA 2W92A 1MFVA 1WDRA 1HJQA 2WMJA 4P8XA 2C7FA 4Y7EA 1WDPA 3ZSSA 2ZX8A 3MUZ1 4WKFA 3WF0A 2WBKA 3FW6A 2ZUMA 2PF0A 1G9HA 2A3BA 4AD5A 5A2CA 4MJ4A 4ATLA 4D71A 3EMCA 2YL6A 1ESWA 2WC7A 1OB0A 1NWSA 4UQAA 4BCEA 3VMNA 3SURA 3WBEA 4IPNB 3A3HA 4AYSA 2E3ZA 1B2YA 3RJYA 4F8XA 3WQ6A 1TR1A 5ECUA 4M80A 4CCCA 1XSIA 4RL3A 1QVBA 2IXVA 1NOFA 1UD5A 1HJXA 2EJ1A 4KWUA 1ZJBA 1TA3B 4WSKA 3JUGA 2YDQA 1OD0A 3WF2A 1V6XA 4PMNA 1VFUA 1B0IA 3PZQA 2G3MA 3VGBA 1W91A 4P7RA 3LPFA 2WBGA 1CLVA 2J77A 4P8WA 3CZEA 2Y8VA 3VIKA 1H49A 2J7EA 1KQYA 1PAMA 1PIGA 2WHMA 2X2YA 1ISYA 4M82A 1KCKA 1JFXA 3CZ8A 1CXLA 3WUEA 4IUGA 3CMGA 2EEXA 4LX4A 3KL3A 1D2KA 2WC3A 4PEEA 3WBAA 1HJSA 1WZLA 3ZJ6A 1CTNA 3NIYA 4P7LA 4AC1X 1FOBA 1Q6GA 2X0HA 1JDDA 1R7AA 4CGTA 1HF6A 1E6RA 5CZKA 1EQCA 2VZUA 2XFRA 2RGMA 4WLCA 5GNZA 2FH6A 4PUEA 1HVXA 4X0VA 3UG3A 5HXMA 3PZNA 3ZT6A 2V38A 2EQDA 1AVAA 3NUKA 1QI4A 4X0NA 4J28A 3WEMA 1XH1A 1ZS2A 2D24A 4TTGA 4TUFA 5AC5A 1UUQA 1VEPA 3POCA 4DWSC 4W87A 2WLZA 3VD9A 1DWFM 1FHDA 1NH6A 4ZEPA 1DP0A 3TA9A 1PX4A 4ZXLA 4CCEA 1E1EA 4BQ2A 4GO9A 4HZ8A 1E1FA 3SUUA 3WFLA 3HMCA 4ZXOA 5JBEA 3ZMRA 4WJXA 1PPIA 4IISA 2X1IA 3ARZA 1E6QM 2CBJA 4AZBA 3SIMA 4AW7A 3BCFA 1C3FA 4QAWA 4W86A 2BS9A 1EDTA 4B9ZA 4D6JA 1BPLB 2VNCA 1F4AA 2J7CA 3F5KA 2VZSA 4UR9A 2VZOA 3VPLA 2WYSA 1BYBA 4NI3A 3J7HA 5A8OA 1V3LA 2ZE0A 2GJPA 5IHRA 4UZUA 1J18A 4A3YA 1H41A 5A6MA 3SUWA 3FAWA 5GQBA 1E73M 1DWGM 3WKZA 3TTSA 1IV8A 1BTCA 4W84A 1UKPA 2CERA 3IAPA 2XVPA 4Z2IA 2WSPA 1JZ7A 3CBWA 1ISZA 3W38A 2W62A 3MU7A 3AIBA 4HA3A 4J3XA 1GQKA 2E0PA 3B8SA 4B3LA 4E4PA 5ABFB 4OUEA 2DSUA 3CUFA 2ZX5A 1E71M 4PMOA 3VD3A 8CGTA 2E9LA 2MANA 3BSHA 1J01A 2OYMA 2D0FA 2J78A 2ZUUA 3MMWA 4DWSB 4S3JA 3W27A 4DM2A 3BGAA 3PZGA 3FXYA 1XRVA 1HL9A 1W1TA 1JYNA 2GJXB 1JNEA 2C0HA 4MPKA 3GNRA 1US2A 3AHXA 4J27A 2W91A 2YLAA 3MV11 2PI6A 3UETA 4E8DA 1QHOA 2ZXAA 4C7FA 1QW8A 4JFWA 2XYLA 3W29A 3ZM8A 3VINA 2VUYA 4CD4A 4PCTA 4GQQA 1BYAA 3CH9A 1MQRA 3NYDA 3AMGA 3O2LA 1GJUA 2BHZA 2D23A 1ZBKA 5HDRA 4PYSA 4MNJA 1FHLA 1SMAA 2J4GA 3MKKA 3VVGA 3AROA 4UQCA 1OM0A 3AQUA 2FHCA 2VRJA 2XIBA 1C8QA 3VX0A 1E6XM 1ZL1A 2VCAA 1KXHA 2CEQA 3AYSA 2ZX7A 5IFPA 5EMYA 2E9BA 2VTFA 1BGGA 5CPSA 2J7BA 1LQ0A 4W5UA 3VGDA 2XVGA 1V6YA 1OT2A 3IJ9A 1EA9C 1JZ3A 4U5KA 3RM9A 1V08A 4F9DA 2DQXA 2ZX6A 3WL0A 2VO5A 1FP8A 4CN6A 1SYTA 2WPGA 5D4YA 1UOKA 3OLGA 1GVIA 2J25A 3VO0A 5M3WA 1W9PA 3THDA 3AOFA 3LPPA 1CGTA 3MSDA 1WKYA 2QPUA 5IDIA 4NZCA 5BRQA 3A4AA 3ZJ7A 5DT5A 1GORA 1V0NA 4HZ7A 1KXTA 3QR3A 4UNIA 1R86A 3PZIA 4D6EA 3A4XA 1GQLA 3M6DA 1A47A 4HMDA 1D3CA 1HJWA 5A6KA 4AY1A 1UA3A 4EAMA 4JFTA 1J0IA 3CMJA 3I3BA 5E0FA 5A8PA 3MV01 1AMYA 2ZXDA 5AYBA 5HPOA 1EQPA 2G3NA 1JIBA 4IPLA 1KBKA 1EOMA 1WPCA 5A6BA 2YL9A 2CETA 2YA2A 3AIWA 5D9NA 4YHEA 5HNNA 4HU8A 1GOIA 2PWDA 1GPFA 4HZ6A 2XHYA 3AICA 3T2PA 1LL4A 1QNPA 1UR2A 2PWHA 2VZTA
chains in the Genus database with same CATH superfamily
4TIMA 2J79A 4KERA 3GX9A 1FWHC 5AVHA 1PTAA 3UZYA 1XBVA 1Q6CA 1MMFA 2XN1A 3KXQA 1H2JA 4LC8A 4R7OA 2D2GA 2WKGA 3HG5A 3LHYA 2AGKA 3NVDA 1XP3A 1GHSA 2ZUSA 3KBVA 5SWUA 1DWHM 3QMRA 4QGCA 1NWTA 1R3TA 4CQDA 3YPIA 7REQB 4R88A 1YTDA 1PTDA 1GEQA 3ARXA 4UQ9A 5FSDC 1Q4NX 4MNMA 2EPMX 4HPNA 2RGLA 1K8CA 2PDQA 4YS1A 3VUPA 1RQEA 3G1SA 1ZJIA 5CPQA 2Y7FA 4H3DA 4K36A 2A3EA 3LI0A 2J7FA 3OA5A 3TWAA 3UD6A 3ABXA 1FH9A 1SQ7A 3WQGA 4BZYA 3WD1A 4XAPA 3WLRA 3H53A 3S46A 4QHRA 4IP7A 4NAFA 1KM2A 2Y88A 4U5IA 1ZLPA 3QY7A 2XFWA 3B9OA 1R3SA 4ICNA 4AXNA 1EF2A 4RJEA 1ZFJA 1F74A 4PUDA 3PWAA 3V4BA 4BWLC 1SFTA 1OD8A 1YDOA 1E43A 3LBOA 3S9IA 3OW1A 5CKSA 4IQLA 4ML9A 1K8XA 4AZGA 3AUJA 3DYPA 3UY7A 2CZEA 4HNVA 3S2NA 4RLIA 1YDYA 4UCGA 3RN6A 2FGZA 2R1MA 2CHNA 3HMJG 4O13A 4PMXA 1VZWA 1M65A 4GXWA 4O50A 2Z6JA 3AS1A 3W2JA 1W37A 4DXKA 4O15A 2VR4A 2PBOA 3CV7A 3RU6A 2HE5A 3CXOA 4IXXA 4B3KA 1F3WA 3FX4A 2X2GA 4PCPA 4PSPA 5A2AA 3KRZA 3C2VA 2JF7A 4GISA 3W26A 1XYLA 5C0QA 2FVKA 3LSBA 2AAAA 3UCCA 5A6JA 4C6QA 1A5NC 1VC4A 1XIBA 3WQ5A 4GZJA 1XGZA 2WW5A 1VFTA 2WMHA 3TVAA 2QLYA 3THUA 4JKKA 2DGAA 2WHJA 3VNZA 1X1OA 4M5PA 2ZWYA 3UFYA 1CXHA 3AXIA 2IPWA 4Q7BA 3MSYA 2QJNA 4JGDA 1FQ0A 4WEVX 4ZA0A 4J9JA 4JEJA 5D2YA 2CZDA 1Q6DA 2XH7A 4FI4A 1OGBA 1UWRA 2VL4A 3BAJA 5AFDA 3TSMA 5FEPA 3QBUA 4WXZA 1T7LA 5TD4A 4M8UA 4GBUA 3OYZA 3LHVA 4FA3A 4JQ3A 1OK6A 2V81A 2DQWA 4G7FA 4UOQA 3VCCA 1OBAA 4S2CA 1KLYA 4XB3A 2Y0FA 3AIRA 2P3ZA 2PPGA 3MUXA 1K1DA 2QJJA 2XWDA 3M64A 3VIFA 3HTWA 4KBXA 2ALDA 3DGBA 2E4TA 3AXXA 2JEQA 1E56A 4Y8EA 1VFOA 1B5TA 1P6WA 1G67A 1VRXA 1TSIA 2V9DA 5DFAA 3K8KA 1HP5A 1PL9A 1VCGA 4RE0A 5C70A 1T41A 1JEZA 3T0CA 2VR5A 1Q13A 4EIVA 3U5UA 1UR8A 1HGYA 3MUY1 1G1YA 4QLKA 2OG9A 4WY0F 2NX9A 4HB7A 4AEFA 4M6QA 1EF3A 6XIMA 3WQ4A 4YWSA 4BJHA 3FHAA 4ZB2A 4IMDA 4DB7A 3H4XA 3KS5A 1YQ2A 4GQRA 3RCMA 4U3AA 5I3IA 1H7NA 3BQ5A 3CQ0A 5C9ZA 3LGEA 4JN8A 2BGQA 4JCLA 4KFPA 3NQDA 3SRFA 1NFGA 3G6LA 3R0KA 2XISA 3U9IA 2Z00A 1W0MA 1W54A 2VI0A 3NZPA 2B7OA 3R12A 4BF5A 4PBEA 5I06A 1NWRA 3RLHA 2WVVB 4X9YA 2XG9A 3STPA 4KMQA 1XDLA 1K77A 5E93A 3CT7A 3LMZA 1DXIA 2RFGA 2X0YA 2WAGA 3BJSA 1GW1A 2DEPA 3WDIA 1PDYA 2DZTA 3LY0A 4C6MA 1S2TA 4RXFA 4NHVA 3ZVHA 1BWKA 1F6KA 3S5ZA 3U4FA 3WFAA 1EFZA 3TKFA 2B7NA 1CXIA 4WF7A 4PR4A 1ZZMA 3IGHX 3ZR6A 3EXRA 2PWVA 3PPCA 2ZUNA 4A2SA 4CU8A 2TODA 1XYCA 1KGXA 1QT1A 3JVAA 4IFOA 2FFIA 2WSKA 3KCOA 3DDMA 1V77A 4RW3A 2GK1A 4UQDA 1TVPA 3PANA 2J75A 2OO0A 3WH5A 2VKZG 3L4ZA 1UKQA 3D0CA 3BLPX 1UR9A 4HHMA 2TSYA 3EWUA 2F2HA 2BHUA 3ATZA 3GBEA 4R27A 3WLPA 1TJRA 2WXDM 2PWEA 1SFSA 4ZO6A 3T2QA 4GJJA 3T8LA 4K8GA 4PH6A 1GT8A 2GQ8A 1RQHA 3C0SA 4AISA 2E8ZA 2WVUA 3HU7A 3ZZ1A 1T96A 4I9MA 4BWLA 1B3ZA 3M5YA 1ZAJA 5I78A 3OYXA 4JAWA 3GO2A 3H7VA 1T0OA 1UYQA 3CLWA 4C90A 2QMJA 4UTJA 4F0KA 2O7SA 5G5IA 1WKDA 4H2HA 3W07A 4ZL1A 2D0HA 1RJQA 3MKVA 3BZGA 2H8XA 4IIDA 5BW6A 1TWZA 1CEOA 4L6DA 2NZLA 1S5VA 1RD5A 1UZDA 4R9OA 1W1IE 4PFHA 1UJPA 3BLIA 3PTKA 3P60A 3GY1A 3MCOA 1TG7A 3KBMA 4R5EA 2YCJA 1M9HA 2OWWA 3OJGA 3W7PA 4MB4A 1XCFA 4C6BA 1DE5A 4L9ZA 2OZ8A 1S5WA 2NT1A 4FR1A 2QF8A 1N2VA 4C6KA 1US3A 4WCJA 5AY7A 5F4SA 3S6TA 2AMGA 3PJXA 3GU9A 1ONEA 1XLAA 4UTLA 4JHOA 3CO4A 2HMCA 1A49A 1L6YA 2E6YA 2ZZ1A 4D72A 2IQDA 3N15A 4QDPA 3GNXA 5D9PA 1G7VA 2NLYA 3LHUA 3Q4DA 3HPFA 1EJWC 4AY8A 2O92A 2Y4SA 3IIXA 3FVMA 3TA6A 3N25A 3WSUA 4O54A 5FOOA 2XGBA 4GC4A 3TOPA 3T40A 1WAWA 3ITGA 3O6AA 5AYXA 4PCSA 4Q8QA 3LN3A 2OEKA 1VBJA 3LPGA 3IJLA 2HBVA 4RNFA 2B31A 1NF7A 3ME3A 6TAAA 7TAAA 3LBCA 4I6VA 2J88A 2VURA 3MO4A 2BY1A 1XRSA 4RV8A 3CHCA 3P61A 5DRIA 1AH3A 1GQJA 1TVNA 4DZHA 5FF3A 1UH4A 3S6OA 1SR0A 1F4HA 2I5GA 2X42A 2P5NA 2VRKA 5A3HA 4L65A 4ZOBA 5AHFA 1VB9A 3UA4A 3GDKA 3WK1A 5EYWA 1ICQA 3ANYA 3VD5A 3A21A 4BS0A 1DORA 4PZVA 3T0DA 5E5CA 4ZMGA 3CM4A 4DNMA 3GTFA 3PTDA 1OGSA 3L12A 4B5TA 4B5NA 1U83A 2V2DA 3W1LA 4HHLA 8XIMA 3S5YA 3VOJA 1ONRA 3PUOA 4UMAA 3SCTA 5ABHA 4UTWC 4DWSD 4PTVA 3DUGA 1O5RA 2BVWA 3AHZA 5AYIA 4UIOA 2PGEA 4NNCA 2P1FA 2X09A 4Y9NA 2WLYA 3HPXA 3W74A 2V3GA 3MI6A 3IK2A 2WKJA 1LRQA 2WZHA 1FBAA 3FGCB 3VOGA 2ZVIA 4AD1A 5H6HA 3OIXA 4JTJA 1QNRA 3OVGA 1E6SM 2YZRA 1J0YA 1S2VA 5C7HA 1IEWA 2EKGA 5C54A 4U33A 4LUSA 3H2AA 1FRBA 1RY0A 3EWDA 4B3ZA 1W17A 1JF6A 3UWEA 1WUFA 1VBRA 1Z8AA 1XIDA 2YCEA 1W1PA 4NQ1A 2BVYA 1GG1A 3TXVA 3N34A 3W0KA 1JL8A 4QG8A 1F6PA 4DNHA 3KBSA 1D7FA 2PU1A 3G8EA 1XD0A 3GDRA 2PTDA 4R85A 5LA0A 2NW0A 4Q6JA 3UZ5A 1X8CA 2ACSA 2G37A 5I24A 4RPQA 3E12A 1QTWA 2FZDA 4YXGA 3MB9A 2XM1A 3H2NA 3OG3A 5HQEA 4CEXC 3KCLA 3EMQA 4Q3MA 4AZ7A 3EOSA 5DCBA 1JD7A 4K7VA 4AMCA 3WDHA 2F61A 3EB2A 2DSWA 3W7CA 3WELA 3WG6A 1KR0A 4YPJA 3PTQA 3N2CA 5DXXA 3VKDA 1ZTVA 4HCHA 3UR7A 1S5MA 1DTNA 2QVHA 4KGJA 1TRDA 2HDJA 1MW0A 8XIAA 3E74A 4V27A 2PWUA 1XV8A 4L5ZA 1A5LC 3W7GA 2ZWZA 2AQWA 2BXYA 3G8RA 1OFPA 1S3HA 1LL7A 4MDOA 1CBGA 1R87A 1TTPA 1UIOA 3CZJA 4H8HA 1L9WA 3GTXA 4AZHA 3ZOAA 4H00A 2DT1A 3PZTA 3C2YA 3PZ9A 3BG5A 1RPXA 3CYJA 1ZBWA 4GY0A 1TPH1 3L4YA 1S1PA 1XLLA 3QV6A 4O0ZA 3B9NA 5RUBA 2FTWA 3IIPA 1GONA 3EX3A 4MB1A 3SGUA 1TZ7A 3A5VA 4MM1A 1E5NA 3EYPA 1NDWA 2KX9A 5HQLA 3DFTA 3P7YA 4OV9A 3GRIA 1RV8A 4QLLA 2BX7A 3KEHA 1KV5A 4V28A 3TC7A 3O3RA 3CO8A 3BVJA 3W6LA 3JW7A 1H51A 3SJ3A 4B5SA 4CVUA 4KRTA 4U10A 1NEYA 4ADTA 3LZ5A 4QJ5B 2WNNA 3POHA 4UBPC 3GTHA 4PSRA 5H8PA 3O15A 1GQIA 4J2PA 2JKPA 3NDZA 2VWSA 3WQCA 1B54A 2I5QA 1H09A 5FA5A 4J3ZA 4XV0A 2V6AA 3AHYA 4JQ1A 4JXCA 1CGXA 4F0MA 2QCMA 3LCWA 4AEEA 4LS1A 2GPTA 3DFYA 1B9BA 5BXPA 3F5LA 3LCIA 1OC7A 1H63A 1RCOB 4AX6A 1TELA 2IQ0A 4OIFA 4AFYA 2NVAA 3PBGA 4M19A 1JYXA 1Z42A 4AAJA 3NZQA 3KTSA 1R47A 1C93A 3BJFA 1SFJA 2SFPA 5AZ0A 3SBFA 4UQBA 4ZODA 4MJZA 3QHOA 4KIRA 4O28A 2ZOXA 4JDBA 1MQPA 2VQUA 3GIQA 2R1PA 2PP3A 1U22A 2V5JA 2CWXA 1AJ2A 4YTSA 2ZCGA 3CUJA 3VUSA 1V6VA 4PRTA 1IT7A 4PUWA 3NPWA 1NVMA 1G69A 2OYLA 2VC7A 3WDRA 4KT2A 4O1CA 1C7SA 1JDFA 4FOJA 1RQBA 1FFRA 1HKIA 3EWXA 3VKJA 1XLGA 4K68A 3FN9A 4B5WA 3IAQA 5K7JA 3GXFA 1E6PA 3ITCA 3ARWA 1GOOA 1X97A 3WJXA 4MWAD 1A50A 4UTWA 2YCLA 3H54A 5HQMA 4XUGA 1XIIA 3SI9A 1VBHA 1CGYA 4GYPC 1R2SA 2OXNA 3GG0A 4FF7A 4H9VA 1NY1A 4FNQA 1M7JA 4EXBA 1ISXA 3H7RA 1KGWA 4V33A 4GG9A 2UY3A 5BOFA 1XLMA 3IRSA 2WANA 2PFHA 1EO5A 4B90A 2J27A 1UZ1A 1UWUA 5H91A 3C2EA 4POCA 2YR1A 3LHZA 3TCEA 3WLJA 1OINA 2QR6A 3VOFA 2PU0A 3QFEA 1EPXA 1IGSA 3W1PA 5B7ZA 2Z24A 4JFUA 3LNMA 3FJ4A 4OQVA 3GZ3A 3ZYZA 1Q6LA 1B3WA 3E2VA 1XXXA 4EPBC 4J2MA 2VRQA 2DUAA 1XRTA 2VEIA 5FJJA 1UR3M 4UFMA 3XISA 3N1AA 4ZQPA 4GY7A 2VZVA 4XZMX 2Y63A 1Q6QA 3LOTA 3W82A 2EJAA 5BCAA 4AZIA 4DX3A 1IT0A 5CCZA 1K7XA 4DBSA 5JH1A 2EF9A 3IVTA 2ZKMX 5GJMA 4H7ZA 5BXRA 1EJXC 4F2TA 1V0LA 1BSLA 1LYXA 4N6FA 4MB5A 4UTIA 1W1A1 4C6NA 1QO5A 2XH4A 4H01A 3OQ8A 5AHMA 3BANA 5CG0A 3C0QA 3QEZA 5E09A 4KEUA 1E5JA 3CAKA 2Z1BA 4TVCA 2VOMA 1WAUA 3TH6A 3CAVA 1F8MA 3RX3A 1CNVA 1B3YA 1XH0A 3UJ2A 4OOUA 2JGYA 2Y62A 4A6GA 4UR7A 3VC5A 4TX9A 4JTLA 5JBFA 1LUCB 3EXTA 4HBKA 1XISA 3MHGA 2BP1A 1NOWA 1VHCA 1A5UA 5JUVA 3RIKA 5LKYA 5A8QA 3RX4A 4QS5A 1J12A 4NKCA 3AYVA 4IQJA 3VGFA 2EAWA 3ZWTA 3F5JA 2WNWA 3USZA 2AKMA 3N3MA 3EWZA 2YZ5A 3L0NA 3TAOA 1JZ2A 1YNPA 3RGTA 2O9OA 1O7AA 1ITCA 3EPOA 2ASHA 4LYRA 5KTLA 1JYWA 3P6LA 4MFDA 4IL2A 4LB4A 3OGSA 4PTXA 3WX7A 1TWWA 2WCSA 1JQVA 4GVFA 3E2RA 1EOKA 1UC5A 1LWHA 1XCWA 3COTA 2VVNA 3BJTA 4N4PA 3APTA 1HIZA 4GXPA 3WNNA 5TNVA 4B16A 2VQTA 4XX6A 5A6BD 2R1KA 5MKGA 4K1GA 5D9MA 1HT6A 3HG2A 3VCNA 1UCWA 2C3ZA 2QJMA 1H7RA 4B5UA 3URQA 1K9DA 1E3XA 3EB3A 1C91A 1E4LA 1IEVA 4ZCWA 3HQNA 3Q2DA 1AQHA 3UR5A 2J62A 3AO0A 5JIWA 4Y9OA 2PLJA 6REQB 3LMYA 3UT0A 1RJPA 2DVXA 5HA7A 2CYGA 3AWNA 1ZBVA 3CQKA 1W2VA 3PWIA 3CWOX 4L56A 2HPIA 5D04C 1Q8AA 4AZCB 1VPYA 2A85A 4S3CA 4YVVA 1BHGA 1UB3A 2PWGA 1FCVA 3I3DA 1YE4A 4GUGA 1VYSX 2ZBTA 3R79A 1UHVA 4HU3A 2EPOA 4HK6A 4XWUA 4EKJA 2H3DA 3PPHA 1PYFA 3W1XA 1VS1A 2XSAA 2ZIDA 4NY2A 3FDGA 4Q4KA 1EUNA 3BAIA 1T40A 4HMEA 3MW7A 5FCZA 1M7XA 1T8XA 2WJDA 3I10A 3K4WA 2BY0A 3C2OA 2QIWA 4EAYA 2D22A 4ZTXA 3W2MA 1ELSA 3B03A 4PMYA 1P1XA 5HK4A 1KR1A 4GUIA 4Z0JA 1SJDA 1ADDA 1GJWA 1A53A 5KSWA 3GHSA 4TX8A 4WRHA 2HISA 5U4NA 4GC3A 2HQAA 3DFQA 5M03A 3AC0A 1EIXA 3T42A 5IM51 1G4EA 3EZ4A 3G1XA 1U33A 4GYPA 2DORA 2ZZ2A 4H8UA 3AS3A 5HR6A 1N7KA 4QIUA 4KWVA 2G8ZA 1JFHA 1UD8A 1LP6A 5CPLA 3M0IA 3NQMA 3PNZA 1C7TA 1GOWA 3HGJA 3W7OA 3BE7A 2GSJA 4HNUA 3NM1A 3GYCA 2UY4A 4LC6A 5CZSA 1Q7ZA 3IJIA 1UQYA 1FUYA 1B3VA 4GJ1A 4G5DA 4EK7A 3KOFA 4GO8A 3N73A 3MP3A 3T0TA 4K6AA 1KCZA 2GUBA 3GHUA 3U3HA 1V6UA 1OSEA 3HOJA 4Q22A 1UKSA 1CGWA 3UZXA 3C3UA 3N4EA 3VKBA 4LXFA 4QDMA 3DG3A 3FV9A 2W5FA 2WOQA 1OX4B 1HJQA 2VFEA 2H3BA 4DJEC 3QGKC 3PUGA 1Q7MA 4LVAA 2HCVA 3GIPA 1IWAA 1TWDA 3JS3A 1L2UA 4O1AA 3TK7A 4WKFA 3WF0A 3SR7A 1WUEA 3FW6A 4XZ9A 1EBGA 2RDUA 2XH2A 4F48A 4AD5A 5A2CA 3LI1A 3VNMA 4E0CA 4D71A 4JN7A 1QOPA 3NNTA 4V15A 4DELA 1ESWA 1SJCA 1OB0A 3VMNA 1OX6A 3W1AA 4HQVA 1AW1A 2QQ6A 3TROA 3UPWA 4J5NA 1MEHA 1GTEA 4Y6GA 3TMQA 4EACA 4CCCA 1SFLA 1IEQA 1RCXB 4WSKA 3JUGA 3OEXA 3HFTA 2BODX 3VGBA 2G3MA 4JN6A 3CJPA 2W0UA 2WBGA 1CLVA 4P8WA 3HG4A 3CZEA 2Y8VA 2XIMA 1ZY9A 3NFUA 1MUMA 1H49A 2ISSA 1KQYA 2YPIA 2FTPA 3MWAA 2NVDA 5HWJA 1ISYA 1XIFA 1C29A 3A3XA 1I2PA 4IPPA 3NEVA 2EEXA 3KL3A 1AL8A 1Q6RA 2QDDA 4S3EA 1WZLA 1CTNA 7REQA 3DKJA 5LNSA 4UTKA 1WV2A 5GNZA 4Q4PA 2PSNA 5G4WA 3NUKA 1QI4A 3CIXA 3G24A 1ZS2A 4R34A 3PNUA 3E0LA 4DYJA 4DXXA 3M16A 4DWSC 3TN4A 3VD9A 4HNTA 1FKXA 3XINA 3WJZA 4ZXLA 1TJPA 2ZFAA 5CC3A 4HZ8A 1E1FA 3O6DA 3FKKA 1TZZA 3ZS4A 1E6QM 3NA8A 3TYEA 4AZBA 4AW7A 3BCFA 1C3FA 4QAWA 3IACA 5LHFA 2VNCA 2CFFA 1DJZA 2VZSA 4GABA 1PDZA 5BRBA 3KTCA 3AUOA 3W3OA 4DJDC 1QPOA 3BO9A 1BYBA 2YBVA 1V3LA 5IHRA 1AD4A 3BL3A 3QPYA 1M1BA 1W3IA 4A3YA 1H41A 1J93A 1F5ZA 3F1QA 1X7FA 4TO8A 2ZE3A 1E73M 1IV8A 3BARA 3KDOA 2P76A 1UKPA 4W84A 2OKTA 2NXIA 2HS8A 4FPSA 4RZ5A 2OGJA 3CBWA 4QJ3B 1ICSA 2CZ5A 3TN6A 3MU7A 4V1YA 1GQKA 1QK2A 3E5PA 4E4PA 4OUEA 1P0KA 2GGHA 3CUFA 3VD3A 3W86A 4ORMA 2E9LA 4IT1A 2Z4GA 1J01A 1ZHAA 3NG3A 1VHNA 4QEHA 2J78A 3KRBA 4S3JA 3W27A 2Z6IA 4KRZA 3WK2A 3SZ8A 1SPQA 3JR2A 1JYNA 5I02A 1BXBA 4MPKA 3GNRA 3EX6A 3AHXA 4J27A 1FWAC 3F03K 1GVEA 2YLAA 5AHIA 4WR3A 2PAJA 3DXIA 3ZM8A 4C91A 5G4HC 4DHGA 3ISIX 1BYAA 1KLZA 1MQRA 1VGAA 1FWSA 3TFCA 3O2LA 1QU4A 3TV8A 2GGEA 3B0XA 1KA9F 3H24A 5E9XA 1P0NA 3VNIA 3B0YA 4JQAA 1OC6A 1C8QA 2CXEA 2VCAA 1S5NA 4O12A 2ZX7A 3BLEA 5LXEA 5EMYA 2E9BA 2VTFA 4GH3A 2QUMA 4NIRA 1A3WA 4W5UA 3VGDA 4DN1A 4DYEA 3EOLA 4PULA 4Q4RA 4ZOCA 1JZ3A 1EA9C 3K2GA 4U5KA 4DJEA 3RM9A 3CYVA 3UY8A 2G0WA 1WXYA 4M6UA 2ZX6A 2VO5A 2QJIA 4XKYA 1SYTA 1KO0A 2B7QA 1ZALA 3OBEA 5EMMA 1W9PA 3A13A 3LPPA 2ISFA 4A3RA 3MSDA 1T5AA 3M0ZA 1XUZA 4FNTA 2PDLA 5DT5A 1FWJC 1OG0A 2NXHA 3GG8A 2DV0A 3BV7A 5G1YA 2X1UA 3IUHA 1V0NA 2GUUA 4UNIA 5DMNA 3PZIA 2HROA 1V93A 3VNJA 4JTSA 3G3MA 1TWIA 4ERIA 3SIZA 1VYPX 3M6DA 3W72A 2DJXA 2DZXA 3LTYA 4BK9A 1J0IA 3I3BA 3SSJA 2XZ9A 3L5AA 1NFPA 3WQOA 5HPOA 2G3NA 4IPLA 1WPCA 5IBXC 5T9CE 1P43A 3CQIA 4HU8A 1LCOA 1GOIA 3I65A 5C9UA 5EGRA 2Y8UA 1XRFA 2QIIA 4G1NA 1I2RA 3WNMA 1V8EA 3V0SA 5XIMA 4ZR8A 4ZFCA 3RR4A 2UWFA 3P8JA 3D5HA 5ABFA 2XIJA 2VFHA 4GFIA 2INEA 1FXPA 2V0TA 2X1TA 1H0GA 3U0HA 1RHCA 3WNKA 1GYNA 1TPUA 2J9XA 3AI0A 3H6OA 5CC5A 4DWSA 1Q7QA 3AIUA 1ZPTA 4GZEA 4MYXA 1E0XA 5B7YA 2IW0A 4LAKA 2VX4A 3CQHA 3CIVA 4GIRA 2GJXA 2Y7GA 4C6FA 4LAUA 3UQNA 3PZMA 2G3FA 1EYEA 1XLFA 4HYRA 1U5HA 2A1YA 2OOGA 4XZNX 3NDYA 3TR9A 4DJFD 1MDRA 1FVPA 1J10A 4CLMA 1XYBA 3IPWA 1MUCA 4GI9A 5DRCA 1FKWA 3G1YA 1KNWA 4C6DA 1MQQA 1CLXA 2ZA3A 1JNDA 2B81A 3S2MA 1C90A 1JPIA 4MSSA 2ALRA 3M07A 4DJDA 3M0MA 2C8NA 2RH9A 3V16A 4DZ5A 3LB0A 1U5VA 3SCUA 4D1JA 4JTTA 3OVQA 5BRPA 3CC1A 3KOZA 2XVKA 5A6LA 1JG9A 4GUFA 3MVTA 1IT8A 2A7RA 3K4AA 1QWGA 4NI8A 3BSGA 3SJNA 4IFRA 1ZRQA 3RM4A 6ALDA 3H2EA 4ZO7A 1DV7A 4UUIA 3TQ0A 2I9EA 4AD2A 1KFCA 5HUOA 1QFEA 1LLOA 2OB3A 4ENLA 1PKLA 3BGJA 4HPJA 1WZAA 5FAGA 4Q32A 3W02A 3MMDA 5CSYA 2CPUA 5AYZA 3NQGA 3RG6A 3WL1A 2Z1KA 2ZZ5A 3ARRA 4GCXA 1N8FA 3KVKA 3OLEA 3C0LA 4I5UA 1NM9A 4GKLA 3UXDA 5GJNA 4O53A 1EDQA 5FEWA 3SW6A 1NARA 4TXEA 2PP0A 2YDRA 1B1YA 1ODUA 3SUTA 1H0IA 4AWEA 2DW7A 2NLIA 5BMXA 4K3ZA 2QV5A 1QBBA 1M68A 1W32A 5AB3A 1SVDA 1XW8A 3NXFA 3H4GA 4BQ5A 1BF2A 3M5VA 3AS2A 3P8IA 2RDTA 4LRSA 5EMUA 2ZDRA 5T91A 4QAIA 3GXNA 3OIHA 3F4DA 3EOOA 5M1TA 1JZ5A 3KTXA 3WN6A 1DWIM 4L7ZA 3EXSA 3T44A 4LPCA 2NSOA 2OPJA 1EBHA 2DSVA 1POKA 1HUVA 1W8SA 4C5ZA 3L4WA 4M24A 4QE1A 4PUMA 4LVDA 1LL6A 1OCJA 2INZA 2HVMA 3D3FA 2QCNA 2V8ZA 4MNLA 2IS7A 3LD5A 4DBEA 3VZYA 3EKLA 4I8DA 4FSAA 1CWYA 2DVTA 4K7YA 1AZ1A 3EA2A 1XFCA 5D37A 4QM1A 1W3NA 1YTEA 3ZJ8A 3OZYA 4AIUA 1NP2A 3GSMA 2QHAA 3R0DA 4WGHA 1TPDA 5BOEA 3M47A 1DJNA 3E49A 3WLHA 5DCEA 3RPMA 1B31A 2MUCA 4CUCA 4ONVA 2GDQA 4L61A 3ARQA 1L6WA 4S3FA 3QW3A 2Y2WA 2FPTA 3W25A 2HRWA 2JALA 2YDAA 4EPEC 1NDYA 4WUIA 1BF6A 3GQYA 1SW0A 1EWEA 4IX2A 1F73A 3BMVA 3ZJKA 4M29A 3NVTA 3BDKA 1UP3A 3B8WA 4HSOA 4FNUA 3QOMA 4JDYA 5CXPA 3N9KA 1TV7A 3P3BA 3W7DA 1YTKA 2QUTA 3KHJA 2PDXA 4N02A 2G4JA 1OY0A 2GVLA 3N9RA 3FGCA 2YA1A 3O6YX 1TV4A 1EJTC 2BVDA 2IKHA 1EO7A 4G1KA 1LT7A 2GVYA 3WF3A 2ZDSA 5IBXA 4J3UA 5AC6A 1OFOA 2XSBA 3LCFA 4XAZA 5D8WA 1W1B1 4M3PA 4AF0B 4D6IA 1VLWA 2Z0IA 1HQTA 3BZJA 1VIZA 2UBPC 1E4IA 2REQB 2YCKX 3HPAA 3PS7A 1WDWA 1XSKA 2BVTA 3N19B 1E6ZA 1V0MA 3ARYA 4LW7A 3L68A 4ACYA 1O60A 1TR9A 1HP4A 3MJMA 3R94A 2F38A 4BQ4A 1BAGA 4LAOA 4QRNA 1PSCA 3WD0A 3DAQA 3UWUA 1XBXA 1VENA 4X3ZA 1V3KA 4FXRA 4LVGA 1TREA 4P7OA 4U3CA 1R2RA 1C92A 2V3DA 3WF4A 1XUUA 3SUVA 3AALA 3M5ZA 2OT0A 1H7WA 1DHPA 4CQAA 1W5PA 3QMSA 1U5JA 3E2SA 4NXSA 3S47A 4OZOA 5I3HA 3CTTA 4C7GA 3IS4A 4IIGA 3QOKA 1XQKA 4AEOA 1S1RA 3BAKA 4UC5A 5DMYA 4EVZA 4MYAA 4M51A 4JY8A 1J8VA 5LIUX 4KF1A 3SUSA 1K70A 1GVQA 3AWOA 1ZENA 3MA8A 4YVXA 5A5WA 3VIHA 5DANA 4KQNA 3E1F1 1GCYA 2HK0A 3W53A 4PUUA 3RU8X 4UFHA 2ZQ0A 2D20A 5F1UA 1OGGA 1FWBC 3FOKA 2BY3A 1KBBA 3K1DA 1Z9AA 2HV5A 3PHAA 4AZ5A 1DEDA 4MJ2A 1HKMA 3A4WA 1PZ2A 5C2XA 1Y8BA 3P5YA 1JAEA 2Q71A 2DW6A 4DUWA 3L2MA 4MMWA 4C7DA 1QO2A 3MUCA 3F4CA 4GZIA 4D6GA 4IMGA 3W76A 3QR1A 2PDBA 1JCXA 1JZ4A 1X6UA 2CLLA 1I1WA 3IJ6A 1ECEA 4MB3A 4H83A 2G41A 1UWAA 3U8GA 4H6KA 1E1CA 2PTYA 3OVRA 3S9ZA 4FX7A 3HPZA 4O4VA 1A5OC 1ZP4A 2OFJA 3RRAA 1VYRA 3EDJA 2EO7A 2OGYA 3GDBA 2FDSA 3UR2A 4NSBA 2WHLA 1ECQA 2J8FA 2OZ3A 3B97A 4AHPA 3MMUA 2WMFA 3WDQA 2EKCA 4WSJA 2FJUB 1TE6A 4ZO8A 1WDSA 2W9MA 3WENA 3MTWA 3SN0A 4TVDA 3ABSA 1PZ0A 3VIJA 2PDFA 1YX1A 2WJEA 1JPMA 3TSDA 2E6FA 2Y85A 4JTFA 1Q4WA 1W5MA 2DH2A 1RBLA 5D2VA 2B0MA 3LHTA 2EPNA 5I5RA 7TIMA 3HV9A 3S9YA 3TN5A 3HF3A 3NPVA 1VLIA 3KLLA 2JIEA 1KXQA 5HJXA 4N9CA 4XZHA 2WJZA 3W1TA 3E0FA 3PJTA 3EAUA 3CGTA 3RAOA 2R6OA 2TAAA 1JUEA 5K4XA 2BY2A 1DJWA 1OADA 3M0JA 4URIA 4UFIA 3N2MA 1XLCA 2NUYA 1W1VA 1CB2A 1W3LA 2FGLA 4EWJA 3KVMA 3ATYA 3E5BA 1G4PA 1WKFA 2PTWA 3GAYA 3JRKA 3SCSA 4LRTA 4QG6A 3UJSA 4ZOAA 1A5AA 5TQLA 1NQ6A 4CD7A 3GU2A 2YBUA 2RAGA 4KFNA 1Y5XA 1PIFA 5D2XA 5B80A 2VMFA 5BU9A 1KM4A 4Z2LA 3TC6A 3H4WA 3QMTA 3ZWSA 4W9TA 1VFSA 2C79A 1KFWA 1E9ZB 5LSMA 3VOCA 3TCSA 1LG1A 3G0UA 3P81A 3SN4A 2YKKA 1WO2A 3GTIA 3LDVA 4DAFA 4QJ1A 1Z3NA 4KEZA 1XLKA 3A6OA 3LXCA 2DSKA 4DUVA 4XZIA 2FLIA 3WEZA 1V3MA 1V3JA 5LA1A 1VP5A 1PZ3A 1RA0A 3LTSA 4JTQA 4GZ7A 3TUUA 3KLKA 4TOQA 1XWYA 2XVLA 4H9TA 3DHPA 3UWQA 4YL2A 3QQ0A 4L80A 4WGXA 4YTUA 3R7MA 1CZ1A 3VIGA 4Y9PA 5A6AA 4HJWA 4NZ1A 3FEQA 3UW6A 1QW9A 4DO4A 3CUGA 3LCHA 1MVYA 1S2AA 4ZB5A 2PGRA 3L4VA 5HMEA 3KL0A 4FHAA 2QGHA 1H5YA 3PFRA 5BYWA 5GPRA 4FR6A 2VFGA 3GNDA 1BQCA 4RK8A 2XM2A 5G2IA 3STCA 4EXQA 4XQ6A 3WJWA 1GOMA 4GIEA 1A4MA 1W2PA 3AAMA 4YTRA 2VHLA 4FF5A 3AYRA 1LTDA 3U5YA 4L1GA 4WDTA 1B3OA 3IGXA 4L4LA 2JFEX 1CW2A 4HK7A 4AHQA 2DZWA 3RITA 1OT1A 2IQTA 2Z2UA 1L8NA 2J24A 1CX9A 4GKTA 2Y5EA 1E70M 2VELA 3S42A 1AFSA 1THFD 3N17A 4XK2A 1OCQA 3AHTA 1MNSA 1K4HA 4Q4SA 2GSHA 3VD7A 4K2SA 2D3NA 4XAFA 1VH7A 3RLUA 1D8WA 3M0VA 1CENA 3BAYA 3TTYA 3MUAA 2UV8G 4LS0A 4E4UA 3LGDA 3GFYA 2WHKA 3W85A 2QAFA 4Q6XA 1F76A 1B90A 2GLKA 2D2HA 5A8NA 2WMGA 1JF5A 4JL2A 3MCNA 4JYDA 1XG3A 5I23A 5D9OA 1UWSA 1IR2A 3WLOA 3IV3A 1KM5A 5CLTA 3QVQA 4IIHA 2E68A 4US5D 3CU2A 2BBFA 1QAPA 2PA6A 7A3HA 3KCJA 3EKZA 3N4FA 3WLQA 1K9FA 2O4MA 4EP8C 1R46A 3IWPA 1ZCCA 1LLWA 5C9RA 2VP8A 2ZA2A 2VM8A 1HNYA 3BLLA 3OZPA 3DFNA 3SY1A 1EJUC 4B5XA 1YADA 4N9DA 2OSYA 1VIWA 3LM7A 4GMEA 2YW4A 2VEPA 3QHNA 4IGMA 3DFOA 2PODA 4W8BA 4AH7A 4AZCA 1SM9A 3W2UA 1LJYA 2EG6A 3DZ1A 3NO5A 4D8ZA 1QMLA 4EF8A 1HVQA 4JNYA 3NO1A 4TR9A 2A21A 5CGTA 2WNZA 2BXZA 1VF8A 3FIGA 2VFIA 1Y7VA 3FHQA 3QH2A 3UERA 2XJ7A 1O94A 2DIJA 4DJFC 4NX0A 2VX7A 1BVZA 4QS6A 1O95A 4Y2WA 3C8FA 2GVEA 1DXEA 4D2JA 2VCBA 3CL6A 5D05A 2XDFA 4B92A 1TPVA 4L4MA 4D6FA 3RM8A 4DXVA 5FL0A 2ABAA 5A2BA 3QYQA 4R7WA 1WB0A 4EE9A 1WX0A 2I17A 4UTFA 3HIJA 3TNBA 4A05A 2HNHA 4AHOA 1EC7A 1M7OA 2W27A 2PDGA 4XD5A 4HU0A 3D3AA 3TLQA 1DYSA 1ZAIA 4PTMA 1AUSL 1VJSA 1CCWB 4G2DA 4MVAA 1VAHA 3W7JA 3TYZA 5E70A 1B9ZA 4AVOA 2PCEA 1HKKA 1VPXA 4XZWA 1ADOA 1FA2A 3VTRA 1PO9A 3PUDA 4Q8MA 1YNYA 2IKJA 1H1NA 2R8WA 5F1VA 4C6PA 4Z2HA 1QI5A 1Q85A 5BWFA 1OX4A 4HVXA 1U30A 1KRBC 2WSYA 1PKYA 4JYEA 4G7EA 3GXIA 4B4HA 3AU6A 3DGRA 5A6SA 5D02A 1XYZA 2GYIA 1KBLA 3S5OA 4QJ4B 1H50A 2OZTA 3O1NA 1NELA 3LERA 2JEPA 1MSSA 2I16A 4PA8A 1M53A 2QCFA 3IUDA 2PDPA 2X8RA 1LWJA 4OTKA 2ZRXA 3QF0A 4LVFA 1IE7C 1VBUA 5CQ1A 3VIIA 4ASTA 2Y7DA 4H6QA 3HGRA 4B2DA 2ZTKA 3S8HA 1K03A 5C2GA 3UG8A 1Q6FA 4PBFA 3GG7A 4DQWA 3O8AA 2GGIA 1EKOA 3E3HA 3L5LA 3GAKA 5HINA 4XO6A 2QUVA 5AHLA 3LBMA 2HJPA 4LVBA 4PB5A 3APGA 4MIMA 1UUMA 2AOSA 4XVEA 2WWDA 2VJXA 4OKDA 2BSLA 4LB3A 2WMIA 4HK5A 2DIEA 4F0SA 1J0ZA 4QISA 4E2BA 3B8TA 3VNLA 4IMCA 3KRUA 4A29A 1EYWA 1P4CA 4FXJA 3LQLA 3W84A 4BI6A 1FWDC 3N29A 3AMLA 1OF6A 3LM3A 3LSCA 3Q58A 1QHPA 1F7BA 2PD5A 3KL5A 3MWCA 4A4AA 4NNBA 4JX6A 4FZIA 1LROA 3R89A 3AZRA 2P0OA 2CESA 3CHVA 1VEOA 2G3JA 2CBVA 1TO3A 2C1HA 4LGXA 3TQKA 2OKOA 3EA3A 1OYAA 3ARTA 4GIAA 1XC4A 2WK2A 3E38A 5I3DA 1QI2A 4UFLA 1TE1A 4X22A 3P0XA 3QFWA 4DLMA 4FIRA 2PCQA 2QCLA 2VC6A 1W31A 5D33A 3VE7A 2HEJA 4IIEA 1EA0A 2WWCA 2FZNA 1FY6A 4B4FA 4W89A 3NSMA 1H11A 4PRRA 2XGIA 3L2IA 4AG0A 5CAHA 2ZZ7A 1YIXA 3B3DA 3VNYA 4IGSA 4KCTA 4Y96A 1BQGA 3SB0A 2DFAA 4C6EA 1QNSA 5FEXA 4O1BA 4WIWA 5I3KA 5AECA 4FK9A 3EBVA 2WZTA 1E72M 5E9AA 3RR1A 1YLVA 4LCSA 3AJXA 1LORA 3FFSA 4MAVA 1HN1A 1XJBA 3W88A 2BNJA 3T4CA 1Z89A 1GOQA 5EA9A 1JCLA 5KINA 1TJ2A 5CZJA 2FHFA 4AD0A 2VGBA 1IEXA 4IJRA 1FP9A 2QAPA 2I7GA 3STEA 4MAZA 1FDYA 1M6JA 4OBSA 4CCDA 3G1HA 4KWOA 4DF1A 3TW7A 3H2FA 2FZBA 3EOEA 1QW7A 1JCYA 2VX5A 5J8LA 4REQA 4DUOA 3GXPA 4W5ZA 5E1QA 3PWGA 2V68A 2Z7KA 4P7NA 2V5CA 1J6OA 5I3JA 2DT0A 3GYEA 4E2DA 4JCMA 1LQAA 3QQWA 4FNPA 1V03A 2E6AA 3PK7A 3SO7A 1Q2SA 4UZSA 1FFQA 4XG1A 2Y24A 4L6HA 2CCRA 3W1RA 8A3HA 4R9XA 3DKLA 2PLCA 3PTMA 5DCDA 5DBTA 3TNOA 4IL0A 2FTYA 2QVNA 3RFAA 1H1YA 3LRLA 4BEQA 1JPDX 1R2TA 3CV6A 1VJIA 2A3AA 2V30A 1GNXA 2D1ZA 2AQVA 2GWNA 3PULA 2ZC1A 3GIYA 4GE8A 5BU6A 4DEFA 5FEZA 3BH4A 3GFZA 5DN1A 3RPTA 1XH2A 1A3HA 3W83A 1I0DA 3D46A 3T2OA 1TV2A 4C6OA 5ABGA 1X8FA 2VDIA 4JZ5A 4C65A 4BQ3A 3BMWA 5CZ0A 3URAA 4GYKA 4BFAA 3OO2A 1PJ9A 4ZFMA 3EX1A 4K39A 2BV9A 4HTBA 3VKKA 5FD0A 2Q01A 4FIQA 1B3XA 1EEPA 4LFYA 2PTZA 1PZ1A 4PL1A 4D9PA 1Y5WA 3XIMA 1AD1A 2C7FA 1ITQA 1WDPA 3T6CA 4X9SA 3NDOA 3RX2A 3QV8A 3MUZ1 2Q09A 1TB3A 3KM8A 1G9HA 2A3BA 5LNWA 3ABZA 3GVWA 3UCDA 4EXAA 3BG3A 3HZ3A 2IMRA 3AXMA 1Y0EA 1X1ZA 1F3TA 4BCEA 1UMLA 3LTPA 2Y1HA 4IPNB 3HFYA 3A3HA 2V5BA 3RJYA 1QXLA 2E67A 3WQ6A 6PTDA 4M80A 1ZGDA 1J96A 2XU2A 3UPMA 2DUXA 1QVBA 2Z1WA 1HJXA 2X7VA 3G5EA 1Q3NA 2YDQA 1OD0A 4V1XA 4INFA 4PMNA 1LWIA 4MZ1A 1QDSA 3MZ2A 3PFMA 2V69A 3UXLA 1N55A 4FS9A 1SUXA 4QSHA 3W7MA 3RLGA 3M44A 1A5CA 4M82A 5HAOA 1CXLA 1XBZA 3WUEA 3R8RA 3TX9A 1C8VA 2WC3A 1HJSA 4XTIA 3AYTA 4Z0SA 4PODA 4P7LA 2QUNA 3R11A 4HPXA 1JUKA 4DBDA 4UMBA 1P7TB 5DY2A 1SGJA 3L5MA 3PJWA 4G9PA 1EQCA 2VZUA 2XFRA 5DMLA 2RGMA 3NO3A 4PUEA 4IFKB 2F6UA 1RJRA 5HXMA 3PZNA 3ZT6A 1LQ2A 2V38A 2EQDA 3GE7A 1KTCA 2BOFX 4X0NA 1XH1A 3LX9A 4XKYB 4JQ2A 2ZA1A 2I57A 4O1EA 1GW9A 4X61A 1VEPA 4XISA 4IGHA 1DWFM 3NPXA 3TA9A 3GC5A 1JVNA 1PX4A 1TPC1 4RX0A 2TMDA 1E1EA 3I6RA 4D8LA 4GO9A 1F2JA 5HATA 2ZZ4A 3E0IA 4AXKA 2DZAA 3E02A 4PB4A 1QWKA 2I1OA 1LT8A 3ARZA 4LTSA 5F4WA 4W86A 4AVFA 4C5YA 4IIBA 4B9ZA 4CNSA 3R2GA 3F5KA 1G4SA 1PWMA 3T8QA 4YCPA 2EGZA 2GVJA 2VZOA 1FCUA 3QC0A 4P61A 2C71A 3S1UA 4RPPA 4NI3A 3J7HA 4EWND 2HVNA 2ZE0A 4WX2A 4UZUA 2R82A 4LCQA 4BHYA 2OTDA 5GQBA 1MRQA 4X2RA 1OYBA 4R7JA 1AG1O 3IAPA 3DFPA 2XVPA 4L64A 4Z2IA 2Z2BA 4CNTA 4LAMA 3W38A 4GK8A 2GQ9A 2P8BA 3AIBA 3C52A 4E5TA 5ABFB 4R33A 3S5SA 1US0A 2DSUA 2ZX5A 1E71M 2VDGA 4PMOA 1OZMA 2CLOA 2ZRWA 3BICA 4JEQA 3L67A 1SZEA 4IX0A 2ZUUA 3MMWA 2DP3A 4DWSB 2HPMA 1XKYA 4DM2A 2KZHA 3FXYA 3LG3A 1XRVA 1HL9A 1H60A 3N9SA 1W1TA 2HK1A 4JIRA 2GJXB 4LSBA 5HUPA 3DBPA 2W91A 4GD0A 5LZLA 4GACA 2ZXAA 3LNPA 4C7FA 4Z1DA 1SO6A 3W29A 4IG2B 3VINA 1P0DA 2VUYA 2FMNA 3CH9A 5REQB 5HMFA 1GJUA 3MZNA 1ZBKA 4PYSA 4MNJA 1FHLA 1EUAA 1OFAA 3LS9A 3LRKA 1OYCA 3MKKA 3ONCA 3AROA 4IIFA 3MSRA 3ABOA 4IJCA 2HS6A 2QCHA 1V6TA 2VRJA 4GVIA 4EPDC 3EKGA 1KXHA 4XBKA 3AYSA 3UJEA 3MI2A 2VD8A 1R6WA 2W3ZA 2DZSA 2J7BA 3FYYA 3IGSA 1K7EA 2XVGA 3OA3A 3IJ9A 5H8UA 5AVNA 1V08A 5I3GA 3ITXA 1PWLA 3QN3A 2DQXA 1GVRA 2FGBA 1OK4A 4H9XA 2NV2A 4AUBA 2F84A 2WPGA 3OLGA 1GVIA 3VO0A 1OC5A 4QXIA 3NXLA 1HFBA 2D2JA 4X60A 1GQNA 2W79A 1WKYA 2J6VA 5I7GA 4H9UA 1DJYA 5IDIA 5TF0A 3C3NA 1PCWA 5BRQA 3A4AA 1DE6A 4ZTYA 4O11A 2A2IA 3E9AA 5LGXA 3GDLA 4AF0A 5LNVA 3P5ZA 2NX1A 4D6EA 3O0FA 2IKGA 1GQLA 2WNQA 3NQFA 2REQA 1X38A 1D3CA 1HJWA 2P88A 3WLLA 5CC6A 1EB3A 4J4KA 4EAMA 3HQOA 3H7UA 3FS2A 1ITUA 5K4ZA 3GB6A 3MV01 1AMYA 5AYBA 2QGYA 1A5BA 2E5BA 3UU0A 4GHRA 1RLDA 4JHMA 4YHEA 3RUBL 1X7IA 4FP1A 1ZP3A 3R58A 1GPFA 3LUTA 4HZ6A 2XHYA 4LUTB 3T2PA 1TJ0A 1UR2A 3N6HA 4FB7A 5FJRA 4NX5A 3N12A 1K8ZA 4ATWA 4ML4A 4PE8A 4YIWA 5I77A 1TMLA 3VIPA 1SW7A 1BTMA 5C9WA 1IZKA 3VDGA 4HYVA 5F4XA 1J5TA 2A3CA 3ZIZA 1LG2A 1XDMA 1FXQA 2P50A 4NUWA 3GD6A 3QLDA 1IGWA 5FJUA 4JKMA 1HZYA 2QUUA 1O66A 3W24A 1H7XA 4E38A 2OSWA 1DXFA 3GVGA 5GVJA 4AQLA 3EDKA 3W01A 3M7SA 3WMBA 1DIOA 4FEZA 4IOTA 4H9MA 2RJHA 5I6SA 1QR7A 1I2NA 3DYMA 3CZKA 2YIHA 3PR2A 2NQ9A 1SZRA 5A8GA 3MO7A 1Q66A 4I9TA 6TIMA 1UW9A 1DTUA 4HHHA 4GX8A 3WQFA 2PS2A 3APYA 4XO7A 2D3LA 2D0GA 2YA0A 1EP2A 3NZRA 4GVHA 3T07A 1DQXA 2QCCA 4JL1A 3BCDA 3U4AA 2NQZA 5DBUA 3G3DA 4ECLA 1MW3A 3W7IA 5LYRA 2O9TA 3NZGA 4YNGA 3S4TA 2XH0A 4KKXA 3AU2A 4KEMA 3WUGA 4Y9AA 4MF4A 3TJLA 3TDFA 2OEJA 2QDGA 1KM0A 2XIOA 2V5KA 2ZVRA 2V5DA 4FAMA 4TVUA 1Q8JA 1Z48A 2WO5A 3FA5A 1QJWA 1XHGA 2G3IA 5HNRA 3EX2A 1VFFA 3W2KA 3NWRA 4I5XA 4NU7A 2DZVA 1RH9A 1FWEC 4MZ8A 4D6HA 1L8PA 1S2CA 4O8AA 3ONBA 3ARUA 1W5QA 1XX1A 1UBSA 1KFLA 3W1UA 1FDZA 1UPPA 3AS0A 1U1HA 2XINA 1DIDA 4ORIA 2FVLA 1WYIA 2NX3A 3T81A 5D2WA 4A2RA 2D69A 2EG8A 1FH7A 3ECQA 1W3JA 2WVTA 3A22A 1LDCA 1M7PA 3IEBA 5M17A 1Z44A 3CUZA 5CSSA 3L9CA 1QASA 4TV5A 2UY2A 4HGXA 3SEPA 1TCDA 4JNZA 1MXDA 4XBJA 1CDGA 2VXNA 3I7QA 1RA5A 4BF7A 1ISVA 3QW4B 2FMOA 1HG3A 4UNLA 4S38A 5BNKA 1ONWA 3OGVA 2XVNA 3TIMA 2BFGA 1X6LA 3TTEA 3A24A 3VKAA 4QROA 2YSWA 1KRAC 1EJSC 3A4JA 3EDEA 3PBUA 1UR0A 1E0TA 1JCTA 1K6WA 3TMLA 3PSWA 1UD6A 3F4VA 4JTKA 1U2YA 4U31A 2YOCA 3KP1A 4B91A 2YL8A 2Y6ZA 3UXIA 5K3VA 1T99A 2PURA 4PTWA 1UWQA 4E8CA 3BXWA 4S3KA 1A5SA 2JK2A 3JU2A 1EPVA 1YPIA 2DU2A 3DHDA 3BG9A 3P0WA 1HO1A 1IZCA 2NWSA 1YEYA 4GA8A 4GYFA 5GNXA 5I09A 1YPXA 1TWSA 4GLEA 1MYRA 2WVSA 3SADA 4ERAA 3M6YA 5F7UA 1Y5VA 1UROA 2W66A 5EKYA 3QR0A 3WMSA 1Q63A 5CPOA 1GHRA 3OHMB 3GR4A 1TTIA 1V02E 4AIOA 3REQA 1E1CB 4DUXA 2HZGA 3CZGA 1WE5A 3DH7A 1L6SA 2AGTA 5TBOA 5HOSA 3ANUA 2H9AB 2P0IA 3W1QA 1L0PA 3T0AA 6CGTA 2NUWA 4LBRA 3IIVA 2PDMA 4YHGA 1OHLA 1JAKA 3NQ2A 2WB5A 1IQ8A 4DO5A 3WJYA 1UMYA 1JGMA 1XYAA 2VR2A 5AC7A 1TUXA 2OO6A 5J5RA 2V67A 1UQZA 1Z7AA 4GI4A 4RZBA 3V36A 4E8GA 2CBUA 4S3BA 2E09A 5FSEC 4ZVJA 1ALDA 1EC9A 3FAXA 3ES8A 2AL2A 5F2LA 4FLSA 3NL5A 3WQ8A 4GNVA 4C1NB 3HJEA 2NT0A 2CKRA 4WVXA 1E15A 2TRSA 1E9IA 5C6MA 3RYSA 3HQ1A 3EMZA 4BA0A 3KHDA 2QT3A 1EHNA 3NQEA 1KB3A 2C91A 3GNPA 5K2ZA 1ICPA 5XIAA 5M5DA 2QEZA 1XINA 1ZU8A 4BKNA 1WCGA 4MLRA 1OIMA 1R3RA 4Q7NA 1V6WA 3DG7A 3V1PA 1CXEA 3R10A 4LV9A 4QDWA 4LYQA 1EX1A 3PVFA 4PGLA 5H8MA 1VEMA 3RO8A 4AVNA 4HN4A 2YXXA 1FH8A 1F3XA 1OVDA 2GDUA 3GDTA 2GWGA 1UWTA 5DO8A 4NAEB 2XIQA 1O4UA 2WQDA 1FWTA 3UGVA 5A94A 2FZ8A 2L5HA 1A4LA 1VJZA 1FWIC 4RDZA 1L6GA 1HKVA 4GQBA 1BG9A 3L65A 4AD3A 3EA1A 3U7BA 4HNNA 9XIAA 4KESA 3GKAA 1F07A 1SZNA 4MDPA 4MNKA 1DJQA 2HXUA 4WKHA 1E51A 2QCDB 1P5BA 2GDVA 4Q8NA 4HZMA 3FXGA 1JCMP 2QDHA 2E25A 1CXFA 2EPLX 2G95A 4QSFA 3UXKA 4M7TA 2ZX9A 4TU1A 1E40A 2J47A 1JD9A 1V02A 4P7QA 4D6CA 1ZB5A 3N13A 4PUNA 4H9ZA 1WKEA 2G5WA 3R6IA 1XCXA 3AIEA 2VT0A 3EDFA 3VZXA 3SCOA 2DDXA 2FPYA 3NQ8A 3E96A 1PHWA 4J3TA 3KRSA 3B9DA 2FH8A 2J8GA 5LGZA 4HOWA 5T26A 1SSDA 1DJXA 3PB0A 5HANA 1A0DA 5DF0A 5HMSA 1GKQA 3N18A 2C14A 5CSUA 4XZBA 1CI1A 3UXAA 1J0KA 2YB4A 4H04A 4LQ1A 3KBNA 2ABBA 3MMTA 2E40A 3FEMA 5EB8A 3B8IA 3WDPP 3KE0A 2IKIA 4YVPA 1O6IA 8RUCA 1W5OA 4F79A 4P5UA 4O8RA 4PEKA 1RZMA 2H6RA 3W71A 3CL7A 3AZSA 5CLWA 3ORWA 1U1JA 3CV2A 4M6PA 1UASA 4XIAA 3KZPA 1TPFA 4AB4A 2OLSA 4YLWA 1MDLA 5FKYA 2BGSA 2A6LA 2WCGA 4DI8A 2ESCA 4Z2KA 3QJAA 5I00A 3VA8A 5C5YA 2O4QA 4QR6A 1CIUA 7PTDA 4N0RA 4LV4A 4W7VA 3WBXA 4IH3A 1SJBA 1XLIA 4CQ8A 5CZTA 1KKRA 4WOZA 1YHTA 1UD4A 1PXGA 1XIJA 4FX6M 3MT1A 2UY5A 3IUIA 2F9RA 2CBIA 4NYYA 1HO4A 3VGGA 1TPWA 1MZHA 4B5VA 1ME9A 3TLLA 3UWZA 3DX5A 3G0SA 4M7SA 4OU1A 4RE2A 1KD0A 5C2CA 1J79A 1GOKA 4WDUA 4C6CA 3GVQA 4Z08A 1XFBA 2OQHA 4S23A 1UA7A 5AC8A 4Y8FA 1RLCL 2VVSA 3UESA 1R38A 2PD9A 1C8XA 4JIQA 2RDXA 3FNDA 4Q33A 4HA0A 1PUDA 4KH2A 4GUJA 2JF6A 4M0XA 1NTHA 4NZ4A 2FZ9A 2GJNA 4MGGA 2F6KA 1O1ZA 5H1WA 4DO6A 1HXJA 5JMUA 2XFYA 1IIGA 1H1ZA 4UWMA 5EMJA 1F9CA 2POTA 5CGQA 1CGVA 4CD6A 2V3EA 1RK6A 3B9AA 4U2YA 3OBKA 3TXZA 1HGWA 4GFSA 4LJ3A 4JICA 2VEGA 4MKSA 3T08A 3S1XA 3FJ6A 3WEOA 3VU2A 1UD3A 4KRUA 1KQZA 3DESA 4F0LA 3B05A 4JTUA 5FI8A 4Q8WA 2Q3RA 4ZOEA 3RILA 3SAZA 3C4UA 2YXGA 4O14A 4QX4A 4AIEA 1XLBA 3L23A 1TCMA 3DCPA 1GYMA 2V82A 1C9DA 1E9LA 1XLEA 4CNNA 3ABQA 3M0YA 2OODA 5CPMA 7XIMA 7CGTA 5JXQA 1EHAA 1V0KA 3TOYA 4KETA 3DG6A 2YB1A 4PFMA 1PYMA 2VEFA 4M81A 3LK6A 2I5IA 2V63A 3V5FA 1BVNP 2D2OA 3PN8A 2DT3A 3TAKA 1PB0A 2X05A 3TYDA 4HHPA 2Y5SA 4XTDA 2YDSA 4PTNA 2PRMA 2J7HA 4XUYA 3STFA 2GOUA 3DENA 5MHBA 3O9NA 3WH8A 4J3VA 1N8IA 2E77A 3VIMA 4E3TA 4XVDA 3V18A 2WZEA 4ZSTA 5BWAA 1UBPC 2OX1A 1R3YA 1KWKA 2C19A 5HBFA 3DERA 1RXOB 3FA4A 1QUMA 3UF9A 3VM7A 2ISVA 1U1UA 4OUIA 3P74A 2PP1A 3PZVA 3LLDA 1XD1A 1RUSA 3VMOA 3GXTA 4HIBA 4G7EB 1EJ7L 4WKAA 3EWYA 2J7DA 2Y89A 1YRRA 3NAVA 1W3HA 3GW3A 3G18A 3E0VA 1DHKA 3VZZA 4JFSA 3VDCA 3AMDA 4I6KA 2GGJA 4HMNA 4OECA 3GR8A 3CPUA 1QOQA 2W61A 5BXTA 3PBVA 1GGOA 4CU7A 4DPPA 4U2ZA 3UYCA 3ITLA 5FF2A 4L4PA 1AH0A 3S2CA 5FJIA 5A8MA 1XG4A 1LM1A 3KOYA 3O16A 3G2GA 2OWCA 3ID7A 4GIYA 3SY5A 2Q3OA 3OU8A 1EZWA 1OFRA 1V3HA 5CH9A 3WUBA 4FLQA 4R53A 1G01A 1WZMA 3T1GA 3LHWA 1S46A 3L2LA 1PS9A 3QLLA 1LBLA 4IICA 2YFOA 3VFLA 1CXKA 1K9TA 5FESA 1UIPA 2R1LA 1CECA 5E6ZA 2FB2A 9RUBA 3IJ7A 4Q4OA 2HTMA 3W00A 1J9YA 2TPSA 2HWGA 4IXHA 3WD4A 1ZNNA 3DI1A 4TMCA 2A4AA 4PMUA 4GOAA 1CGUA 1BVWA 1EIBA 2WMIB 4JIPA 5CGMA 4HPHA 3V5CA 1V3IA 3BURA 2EG7A 4Z17A 3CHDA 1IXQA 3CWHA 4OOZA 3WLKX 4DBWA 2VC9A 3WQDA 4LOCA 1VPQA 3L66A 1EEXA 2JGQA 4FLRA 1EGMA 3VGHA 2E1WA 1XYFA 3A64A 5EBAA 4DRSA 2CZVA 3OZOA 3W2NA 3BUVA 1W9VA 1KV8A 1TV5A 3PZOA 2OOFA 4MUPA 3V7PA 1KGUA 1OZQA 3TP4A 1C8YA 3ALGA 1A3XA 1Z69A 5A95A 3V35A 2WC4A 3PM6A 2Z28A 4MZYA 3VI2A 3SCNA 1G7UA 4DVOA 3B4YA 3CB3A 5TAOA 1E0VA 3ITVA 1SZGA 4HU4A 1JUBA 2VOTA 1PEZA 1UJQA 4RE4A 3NL6A 3WLMA 3QQ1A 1R8LA 3HURA 5A1AA 3B04A 1GVFA 2W4XA 4YJ5A 1EC8A 3WY1A 3W23A 2WKLA 1JGIA 3EEZA 3LENA 3QRHA 4QG9A 4RNJA 1UOZA 2VGIA 2IUZA 3OHIA 2FIQA 3VDAA 1X98A 4YTTA 2IPFA 4C1KA 1IXPA 3A9BA 3ZLGA 1HKWA 4IPJA 1RVGA 2CC0A 4WJEA 1R9YA 1XGEA 3IARA