2PC8A

E292q mutant of exo-b-(1,3)-glucanase from candida albicans in complex with two separately bound glucopyranoside units at 1.8 a
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
394
structure length
394
Chain Sequence
b'AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGQWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein XOG1
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 150
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pc8A00
3MUY1 3APGA 1AQHA 1BYDA 1TCMA 2O9OA 1BVZA 2W61A 1ECEA 4F66A 3SEPA 4GQQA 3VILA 5ABHA 3IJ8A 3TOPA 1UD8A 3T2OA 2E9MA 3A47A 4UOZA 3POCA 5TD4A 3HJEA 2A3HA 4CD4A 5JUVA 5D8ZA 1JGIA 3VDBA 3VUPA 2X8RA 1BAGA 1CXFA 3VDCA 4GZJA 3BAKA 4JKMA 3G6MA 4HMDA 3W25A 4OOZA 3WN6A 1NQ6A 1LG1A 4IUGA 5A8QA 1ISZA 2JIEA 2YKKA 5ABFB 5GQBA 4UFJA 4Z2LA 4Z2GA 1BVNP 3L4UA 1EDQA 2WCSA 1I1WA 3NIYA 3WD3A 4LYQA 3VIGA 2IXVA 1GJUA 3RPMA 3ZQ9A 1W9UA 2F2HA 4J3XA 1JFXA 3MMUA 3PHAA 4V28A 5A6BD 1US3A 1Q6EA 1WKYA 1GQJA 1UWQA 4Z2HA 4ZE5A 4AC1X 2DT2A 2VR5A 2CBVA 1JYXA 3QOKA 1V0NA 1O6IA 2J47A 3CPUA 3WNMA 1ZU8A 5I24A 1E4NA 3AIUA 2D23A 5D9MA 2NT0A 3T0DA 1J9YA 4U31A 3GXFA 4EE9A 3ECQA 3WDJA 1JD9A 3EDEA 2VOTA 3MMWA 3AICA 5FL0A 2WWDA 3RMEA 3NSNA 4J27A 2QF8A 3F5LA 4W85A 4GKLA 2J7HA 1JDAA 5I6SA 4D71A 1RPKA 5FCZA 3NUKA 1GVIA 3KZSA 1V0LA 3WQ4A 3MMDA 4GZEA 1M7XA 3AFBA 4AD3A 4OJYA 5A6SA 3BSGA 4WSKA 1UQYA 1UA3A 9CGTA 1WB0A 3EBVA 2YOCA 1UKOA 4ACZB 4FMVA 1V6YA 2WC4A 1V6UA 4WKHA 1E6RA 2C8NA 5LYRA 4PEEA 2D0HA 1FH9A 2WVSA 3N18A 1O7AA 3WELA 2WYSA 4CUCA 3E1F1 4TTGA 5BROA 1CXEA 3VGDA 4W8LA 2EEXA 5LA1A 4JFWA 1CDGA 2WCGA 3ZJ8A 1CWYA 2DEPA 1OM0A 1PX8A 2VRQA 2EJ1A 3FAWA 5E0CA 5I3DA 4R27A 2ZE0A 3F5KA 3M07A 4YPJA 2EPMX 3CZGA 5DFAA 4X0NA 2WW5A 3CUJA 1UKTA 1FP8A 1W2PA 3T09A 4HTYA 1M53A 2BHZA 2WLZA 4P7RA 2PC8A 4PRWA 5AC4A 1UH3A 1QI4A 1JAKA 2ZUMA 3MANA 1JXKA 4H2CA 1IZKA 2ZWZA 5ECUA 2E3ZA 3W6MA 1DP0A 2OWCA 1HJUA 3VIHA 1BG9A 3TONA 1GW1A 1C3FA 4WJXA 1TA3B 1B2YA 2QV4A 1MFUA 4P8VA 3SCQA 4M24A 1V3LA 2WSPA 4GQRA 2XGBA 3RM4A 4QCFA 1NWTA 1QBAA 4NF7A 1ODZA 2XVNA 1RP8A 1W1TA 2J7DA 1KXQA 2XM1A 1VF8A 4V27A 1TE1A 1Y7VA 2XVGA 1WZAA 3RJXA 1DWFM 2ZICA 2BHYA 3A4AA 4B9ZA 3ZMRA 4K68A 4DUXA 3VIFA 1UD3A 5BCAA 3WNPA 4WSJA 1CTNA 1DWAM 1HVXA 1B30A 3EMCA 1TUXA 2VZTA 1E1FA 2WPGA 1JNDA 1Q4NX 2WMJA 1CXKA 2WZHA 4W5ZA 4X0VA 1GOMA 3PTQA 3ZT6A 4CCCA 5CPQA 3NYDA 4MAZA 2DSVA 3ARRA 4NRRA 4UZUA 1UA7A 5D9PA 3CZEA 1J0KA 1W9VA 1UR2A 4BA0A 1CIUA 4P7LA 2D2OA 1AQ0A 1DWIM 2XVLA 1EQCA 2W66A 4EK7A 2D3LA 1HJXA 2VZUA 4NRSA 3NSMA 1ITCA 1E72M 2XTKA 1EA9C 1KBBA 4W7VA 4UNIA 1TG7A 4Q7NA 4ZENA 4MJ4A 3T0AA 1HJQA 4N42A 3UG4A 5FIPA 2DSWA 3VO0A 4U2YA 2WVTA 4MB4A 1MQPA 1X1NA 4ZEPA 5I5RA 4MDOA 3L2LA 3VU2A 3CZLA 1ZS2A 4UTFA 1R7AA 1NOWA 1EO5A 1UR0A 3VMPA 3GM8A 6A3HA 2J7GA 1R8LA 1C7SA 4KWUA 2TAAA 4MNMA 5A6KA 4MB5A 2XSAA 4PTWA 2WVUA 2QMKA 1PX3A 3A4XA 4E2OA 4BCEA 5BXSA 2JF7A 4J3UA 2WMGA 1XHGA 1VEMA 5CGTA 4JHZA 4AZGA 1K9EA 2VRKA 1CXHA 4RL3A 1W3KA 4PMOA 3RM9A 3FAXA 3PZVA 5A94A 3EDKA 2XPKA 3VGHA 4M1RA 2VZSA 1UWIA 3L2MA 1J11A 2YL8A 3QHOA 1XSJA 3VDHA 5GNYA 1BYAA 1KXHA 4X9YA 4MNJA 4XX6A 3LPGA 1LWHA 7TAAA 1MXDA 2DT3A 4D6IA 1R87A 4P8UA 4B9YA 1UH2A 2PF0A 1JZ3A 3K8LA 4GINA 4UFKA 4P7OA 2ZWYA 3VOCA 3DHUA 2YA2A 2ESCA 4E8CA 3PTMA 3BAWA 2X09A 2VZOA 1E9LA 5FL1A 2JFEX 1JIBA 3N11A 1QPKA 4JHOA 5HBFA 4CKQA 2PWEA 1SMDA 2NW0A 1H0IA 1QBBA 2ZXDA 2W91A 3CHCA 2AAAA 1EOKA 5DEZA 3UESA 3VNYA 3WD4A 1V08A 3CZKA 1F4AA 2VMFA 1G01A 3L4YA 4B16A 1UWTA 4P7NA 2WNWA 2WMKA 1V3KA 2VVNA 4QDMA 3AS2A 3BGAA 4LX4A 1V3HA 1E6NA 3OLDA 1UYQA 2J75A 1UD4A 3EMZA 3HN3A 3TTQA 3CBWA 3DHPA 3K1DA 1PPIA 2AOSA 2XUCA 1BYCA 1J0JA 2VTFA 2PBOA 3VD5A 1CGUA 1CZ1A 4HOXA 2CERA 4PTMA 2RGMA 3GDBA 1HJVA 2A3AA 1VFUA 5CJ5A 3SIMA 1GVYA 3VMOA 1JD7A 2J8GA 1EDGA 3W0KA 4PCTA 1KGWA 3WH7A 5A3HA 2EO7A 2GJXA 4AZBA 5CPSA 3K8KA 5DMYA 3UETA 1CGVA 2UY4A 3WSUA 2WLYA 2F8QA 3BLKA 1CGTA 3WY1A 3AIRA 4U2ZA 1W2VA 3KWXA 5GNXA 2VCAA 4LGXA 1KGXA 1W9DM 3CHEA 7CGTA 3HMCA 5C8BB 5JBFA 2E40A 3IK2A 3QHNA 3AHVA 1R86A 1OGGA 2VCCA 1XYFA 5CQ1A 2E9LA 4TVUA 3AHZA 3ZJ6A 3W38A 4FLOA 2VC9A 3DYMA 1Q6GA 1B3WA 5IFPA 1KXTA 4MTVA 3AMDA 1KCLA 1TR1A 3A4WA 2W63A 1J18A 2JE8A 2YL6A 1JI1A 1VAHA 3B9DA 4A4AA 2G8ZA 2PBGA 1ISXA 3PZ9A 4OBRA 1BTCA 2VURA 3L4VA 1H3GA 2YL5A 1QW9A 1UD6A 1GZJA 2EXOA 3OBAA 3HU7A 1UUQA 3WUFA 4GO9A 1HVQA 4MJ2A 2XYLA 3WDRA 3MV01 4CN4A 4AXNA 4D6FA 3WEOA 2WSKA 2E9BA 2ZOXA 3GNRA 3GTNA 1UKQA 2CEQA 2HISA 1E6XM 1CGXA 1GOOA 1E70M 3FXYA 1XCXA 5IXEA 1XSIA 1JFHA 5HNNA 3AMLA 4WK9A 4C7DA 4AD5A 1LF1A 3GZAA 2CHNA 4NSBA 4XZWA 4M56A 8A3HA 1H4PA 4E8DA 1VB9A 1JZ7A 4UFIA 3NCOA 2J79A 5ABFA 1HL9A 4PMRA 4CVUA 4JL2A 1XCWA 2CITA 4M29A 5IHSA 4HU8A 2JEQA 4DWSD 1MW0A 1VJSA 1EHAA 3ZT7A 3W82A 3AI0A 3BAJA 2BHUA 1EQPA 1BYBA 1DWGM 4AZ7A 5HXMA 1BGAA 2QMJA 2CBUA 1NARA 4AZCB 1JG9A 4U5IA 1KR1A 3WUBA 3CHFA 4UQEA 3WNKA 3ZSSA 4U3CA 2OWXA 3CUIA 4IISA 3WEMA 2OLHA 5BWFA 3RDKA 1TZ7A 3WMCA 4KGLA 5A6MA 3AHXA 4PCSA 3ZOAA 5CG0A 1QI0A 3THCA 2E8YA 4W8AA 1FA2A 4J3SA 5A8OA 1CBGA 7A3HA 1E0WA 2PI6A 4CD6A 3MUAA 4J28A 4HU0A 5A95A 1HJWA 4AWEA 1E4MM 2WHLA 1CYGA 2V3FA 4XZBA 2E0PA 2J7CA 4D6HA 2VL4A 5FOOA 4PMQA 3W81A 4PBGA 2WHKA 2XFRA 1MQQA 3MV11 1D7FA 1W32A 3W24A 2DGAA 3M7SA 1B90A 1G94A 4PMUA 4QP0A 1FHDA 2WMHA 4J3WA 1AMYA 2YBUA 1UOKA 1B9ZA 4V2XA 1GNXA 1ODUA 2UY5A 4ACZA 1GPFA 3ARQA 2DPEA 4H7VA 1MXGA 3BCFA 2DT0A 3BAYA 3B8SA 3VMNA 4BS0A 4UZSA 4TVDA 3UEQA 5D4YA 4YHGA 1NP2A 3AZSA 1N82A 2CKRA 2OYMA 3K4AA 1F4HA 2BY3A 1X6LA 3VM5A 2E8ZA 3WF3A 1BFNA 3DYPA 1E6ZA 5ABGA 1E5JA 3ALFA 3RJYA 4BQ2A 1HKKA 1EOMA 4M81A 4P7QA 1FH8A 1E0XA 1KR0A 1HXJA 1MW3A 1CNVA 4XV0A 3VGBA 3F5JA 2ZX6A 1FHLA 1H0GA 2YA0A 2UY3A 3SUTA 4UOQA 4GXPA 1NWSA 3AZTA 4JFVA 3SCUA 4MB3A 4LYPA 6CGTA 1J10A 2G3MA 5C71A 3GH4A 2V5DA 4J3TA 1ESWA 2D22A 1SFSA 3SURA 4DWSC 1TA3A 1WZKA 3WENA 2PB1A 3NDYA 1TMQA 1CGYA 1QW8A 4MADA 3MSDA 3VGGA 2F61A 3CLWA 1PZ2A 4DM2A 2DIEA 1OSEA 2V5CA 1R7OA 2BXYA 3WQ6A 1NM9A 5AYBA 3GH7A 3J7HA 3K8MA 4B3LA 2EBNA 1ISVA 4ML4A 1W9XA 5M3WA 3ARXA 4TVCA 2XJ7A 2FHCA 4TX6A 2BVYA 1UZ1A 2PWFA 4AIEA 3AIBA 2WKLA 2GK1B 3AS0A 1A47A 4IPLA 4JZ5A 5CGMA 2J7EA 3ZJ7A 1GHSA 4UOJA 3AXXA 3T2QA 4D72A 1MWOA 1VFFA 3FY1A 3THDA 4QAWA 1E3XA 3WFLA 1UHVA 2XIIA 1V02E 1DWJM 1LWJA 1VFOA 3AS3A 3I3EA 2OYKA 2BNJA 4DWSB 3FHAA 4BQ5A 4BZYA 4JAWA 1A3HA 4AMCA 1WPCA 1S46A 4CD8A 4OUEA 5A6BA 2VR4A 1QI3A 1UWSA 2G3IA 1OB0A 1CLXA 3N9KA 3ARPA 3GBDA 4GZIA 2CIPA 2UWFA 4PTVA 1D3CA 2FH6A 1E73M 3PZNA 5AY7A 4PMXA 3ARWA 1H11A 2CETA 2X2YA 2X0HA 1Q6DA 5GNZA 4AEFA 3OG2A 4NI3A 3I3BA 4Z2KA 3IAQA 4ATWA 4UQAA 2X05A 4L4PA 3VPLA 2DH2A 5E70A 3TTYA 1CLVA 3N15A 4IPNB 3ZSTA 5BXTA 2D0GA 2DH3A 2J74A 4W89A 1FFQA 2VUYA 2WKGA 1OT1A 4H04A 3GXMA 1KQYA 4KRUA 1K9TA 2CNCA 2JF6A 1UQZA 3II1A 2J62A 4ACYA 3W53A 1VIWA 1NOUA 4BQ4A 5A2CA 3ARTA 2ZX7A 2CBIA 2O9RA 2VX6A 5ABEA 3KL3A 1UR9A 3WQ5A 2BY0A 3AXHA 1GQLA 5D9OA 3TA9A 3OLIA 1NH6A 1EO7A 2CHOA 3AMKA 4Z2IA 3N1AA 3CUFA 1BF2A 1EDTA 5M5DA 1SYTA 4CCEA 2D3NA 3F4VA 4AD0A 2ZXAA 4CN6A 2Q8XA 4NZCA 1M04A 1K9DA 3W27A 2O9PA 2FHBA 1ITXA 1W1PA 1OD0A 1HN1A 1BLIA 2BS9A 1XV8A 3WH5A 1U30A 2YA1A 4ATLA 2A3BA 1CGWA 1XC6A 1W1YA 2DDXA 1E15A 1E4IA 3ARUA 1OINA 1WDQA 1MW2A 2WHMA 4IM4A 5C70A 1JYWA 4KRTA 5M03A 4S3JA 4GIAA 4TUFA 4L4OA 3WDIA 4J3VA 3VNZA 1AQMA 2CCRA 5EFDA 1WZMA 1PIFA 1XYZA 1PX4A 3WEZA 5E9AA 1UD2A 1V0MA 1E56A 1JL8A 4KGJA 2EPNA 2MANA 3A6OA 1BPLB 1H09A 1W3LA 1FFRA 1I1XA 2DIJA 5A8MA 3VIJA 1MW1A 2OSXA 3RIKA 3PZOA 1YQ2A 3AOFA 4N0RA 2VNCA 5AC5A 1WCGA 2WVVA 1UR8A 3AIQA 4UFHA 5BXRA 3OZOA 4HMCA 4AY1A 4PMNA 1AVAA 4AD4A 2EPLX 1V02A 1KFWA 1V6WA 1L8NA 5EBAA 2WC7A 3AS1A 2XM2A 1YHTA 3WNLA 1W9PA 3VX1A 2VQUA 4XUYA 2ZUVA 4AD2A 2G3JA 1MFVA 3OGRA 4D6GA 1WDRA 3AROA 3TTSA 3AXIA 1V6VA 1VJZA 1UWRA 3SCOA 5A1AA 1U2YA 3AZRA 2VI0A 3WD0A 5A6LA 2GVYA 3AJ7A 1P6WA 1G9HA 4U33A 3DECA 4HOWA 2ZUSA 2BV9A 4HP5A 5I79A 1XH2A 4ZFMA 1QNSA 1QNQA 4W88A 3PZQA 2B31A 4PTXA 1MQRA 3PZUA 3MO4A 2FHFA 5EMYA 1KB3A 3QR3A 3ZIZA 3G6LA 3W29A 3QOMA 4H8HA 4CD7A 3SUVA 2WMIB 2WBGA 4HZ8A 1HJSA 4WLCA 5F7UA 6TAAA 1X6NA 1QHOA 3LPPA 2QHAA 4AIUA 2YBTA 3GXDA 3PZTA 3NSXA 3WQWA 3EDFA 1LL6A 1HNYA 3BC9A 1DWHM 1J0ZA 4AYSA 1B3ZA 1CECA 4W86A 3N17A 4RE3A 4FLRA 2V3EA 1LJYA 2ZXBA 3K4DA 4LPCA 1TFVA 2XFFA 4FF5A 1V6XA 1R85A 3WF1A 1V3JA 4Y7EA 1H49A 1CXIA 3WH8A 3VD7A 2WHJA 2CKSA 4TTUA 3VIPA 1ZL1A 4GPNA 1HKIA 4HPGA 3A3HA 1GONA 3GH5A 3VVGA 4CU6A 2Z1SA 2J7FA 3OZPA 1GOWA 2WBKA 3OIHA 5BXPA 3VD4A 1BSIA 1PBGA 2XVPA 3SUWA 1FOBA 4FK9A 4F9DA 1BHGA 1GJWA 3MKKA 4HA3A 3MSGA 5CPTA 1FP9A 4TX8A 4AD1A 2NSXA 4DM1A 4D1JA 3S2CA 2J25A 4LYRA 3ZJKA 4CD5A 2WMFA 3IAPA 2EQDA 1HP4A 5JIWA 5I0DA 3MUZ1 1UZ4A 4D1IA 4JCMA 4PYSA 1NP0A 2W62A 1JAEA 3SUSA 1UWUA 3FHQA 3WNOA 1SMAA 4ZXOA 4MNLA 1HL8A 3VGFA 3B9AA 3BMVA 1OD8A 1JNEA 2CESA 2W5FA 3BAIA 1WE5A 3VIOA 4LXFA 2CBJA 2VX5A 3CO4A 1H5VA 3U5YA 2XSBA 1LQ0A 1JDDA 4CU7A 3PZGA 2D24A 1US2A 3EDJA 3O6AA 3UCQA 4CVWA 3W4RA 1QI5A 2DSKA 3ZR5A 4PMZA 4FLQA 4JKKA 4UR9A 2YDRA 5JIPA 3CZJA 1HP5A 4CU8A 1WAWA 1H1NA 2C0HA 1UKSA 3SCRA 1B1YA 3AHTA 2OSWA 2BVTA 4ATDA 2D0FA 2WCAA 1OGSA 3AIVA 2O92A 1JI2A 3CIVA 5DT5A 3WH9A 1MVYA 4MAVA 3WQVA 4PMDA 3L4TA 1W3JA 3EMQA 1QVBA 3RM8A 1CXLA 2OSYA 3CMJA 3W37A 2YL9A 4GI9A 3W6LA 5HPCA 1UD5A 4B3KA 5CLWA 3UR8A 3WIJA 1XGZA 1C8YA 1UR1A 4UQCA 1CENA 1OGBA 1C91A 3WBAA 1VEPA 3ZR6A 4AISA 2A3CA 3OLGA 4GI8A 4MPKA 2IUZA 4AEEA 3PZIA 3ZT5A 4ZXLA 1WO2A 3ALGA 4MDPA 1L0PA 4LQ1A 3N04A 1J0HA 4M8UA 1HT6A 1E3ZA 2FDMA 3T2PA 2XWDA 2Y8KA 3AMCA 3VIIA 3ZM8A 3AHYA 3VIMA 5HPOA 5IDIA 1QI2A 1WP6A 2VT0A 1KGUA 4UQBA 1HX0A 4M82A 1OWQA 3POHA 1VFMA 1W91A 4GO8A 2YLAA 3UG5A 3ARSA 4DUVA 2JEPA 2VX7A 3AYRA 1CPUA 5A6AA 2VO5A 2AMGA 2ZX8A 1PEZA 1TVNA 5GPRA 2XHYA 4H41A 1GOKA 4WKAA 3W26A 1XH1A 3GNPA 3VD9A 1B3XA 4QLLA 3WMBA 1ISWA 2WK2A 2ZUWA 1QNRA 1GHRA 4F8XA 3WKZA 4Z2JA 4OOUA 1FH7A 1JYNA 2J78A 4FLSA 3K46A 3W28A 2GUYA 4EKJA 2GK1A 1WDSA 2Z1KA 3WBEA 4OIFA 3N12A 1VBRA 2X0YA 3LMYA 2FGLA 3U7BA 1IT0A 2EPKX 3BSHA 5AYIA 4YN5A 1G0CA 3CUGA 1M01A 1W9BM 1K9FA 2J8FA 1ZBWA 4W7UA 3WF0A 4DWSA 1GOIA 1I75A 4BF7A 4W93A 2HVMA 2O9TA 3GNOA 2PWDA 1GOQA 3KL0A 2CPUA 3AMGA 4PMYA 4E4PA 1SR0A 3WDQA 4MB1A 2RGLA 1KBKA 1V03A 1KWKA 1JZ2A 4CCDA 4PUEA 1DEDA 1JZ5A 2Y4SA 4JKLA 4U3AA 1VBUA 1JZ8A 1D2KA 2WWCA 3L4WA 3TTOA 1NWUA 3WD2A 2QPUA 4D6DA 4C7FA 1OIFA 8CGTA 3BMWA 5EFFA 3VKKA 3NDZA 2BXZA 2QLYA 2J77A 1BG4A 4AZHA 1E5NA 3SUUA 3T0BA 3VIKA 1KCKA 3PN8A 2GDUA 3KE0A 4JIEA 1B3YA 4B15A 1IZJA 3WD1A 1ZBKA 1GQIA 5JBEA 2JALA 3T08A 1JZ6A 3CZ8A 2FH8A 2QPSA 1W1VA 3BLPX 3UERA 2ZXQA 2YJQA 4P8WA 1U33A 3WDPP 1E4LA 3TP4A 1LL4A 2D20A 4PSPA 1GQKA 3DYOA 1E0VA 3D3AA 1B31A 3QGVA 1OIMA 2WZEA 4WIWA 4EAMA 1ZBVA 5A8PA 4OBSA 1DHKA 1J12A 3I3DA 4PSRA 1XD1A 5EB8A 3U5UA 1PZ3A 2Y5EA 4A3YA 1V3IA 1J0YA 3OGSA 1JF5A 3ARVA 3N13A 2Y8VA 3CMGA 4U5KA 4R5EA 1Q6FA 1JZ4A 2V3GA 3JUGA 3SCSA 5KZ6A 2OYLA 2WZIA 3VGEA 3CUHA 4W87A 4GI6A 2WXDM 4HZ6A 2OWWA 3EDDA 5E09A 2DSZA 1OCQA 2A3EA 1WNOA 1ISYA 5IHRA 3RCNA 3SCWA 2WB5A 5A2AA 2WANA 2JIWA 4D6JA 3FW6A 2ZUNA 3PBGA 1GUVA 3WL1A 3VD3A 1MYRA 3GXIA 4Q22A 1E43A 5I78A 1Z32X 3AIEA 4KH2A 1BGGA 3ZO9A 4AW7A 3IANA 1J0IA 2VX4A 1QNOA 3IJ7A 2W67A 3EYPA 3QHMA 3UR7A 1XD0A 2G3NA 1XSKA 5A6JA 2W92A 1C8XA 3SCTA 4AZ5A 3WL0A 5CZKA 2FGZA 1QHZA 5A69A 1EIBA 1KQZA 3FN9A 3MS8A 4PN2A 5I23A 3AIWA 3PZMA 2VQTA 2WAGA 2V3DA 5KEZA 2GFTA 3WFZA 3BXWA 1DTUA 5HDRA 1E6SM 5E0FA 1Q6CA 3O2LA 4H8VA 2XVKA 2BFGA 3OA5A 4RE2A 3SCVA 4PMVA 5FD0A 4A3HA 1NWRA 1HF6A 5E6YA 3OB8A 4AZ6A 2VVSA 2W4XA 5DT7A 1E6PA 5DO8A 2G41A 2WM0A 3VDAA 5D8WA 2X1IA 1JF6A 5BRQA 1WDPA 1PIGA 1B0IA 4F9JA 1EGZA 4HA1A 1V0KA 2VRJA 2YIHA 2VZVA 4HA4A 4AIOA 1CEOA 1BQCA 4S3KA 5BRPA 2XG9A 5M17A 3BCDA 5HOSA 1RP9A 4WF7A 1G1YA 4RE4A 3GYCA 2J7BA 3MUIA 1K6AA 3AQUA 4XB3A 2BVDA 3VX0A 4HOZA 4M80A 4P8XA 4CGTA 3BH4A 3KL5A 1HIZA 2PWGA 4UCFA 4TOQA 4WKFA 1H41A 5FKYA 5IFTA 1JYVA 4HMEA 1VEOA 2CXGA 1C7TA 4KMQA 5D9NA 3WH6A 2WMIA 2BY2A 1VRXA 2ZX5A 4TXEA 4DUWA 1ZJBA 4ZE4A 5CXPA 1EH9A 2V38A 2ZUTA 3WF4A 3SCPA 3IJ9A 2XIBA 3DC0A 1GORA 5I2UA 2GDVA 4J7RA 1VENA 5DF0A 5A2BA 1G5AA 2PWHA 4UQDA 2GJPA 1UH4A 3NJ3A 1E71M 2E4TA 3S6TA 4JCLA 2ZUUA 3SCNA 3BAXA 3AISA 1QHPA 4BQ3A 5BYWA 3OLEA 3KEHA 1HKMA 2CYGA 5CSYA 3CGTA 1PJ9A 4HPHA 2XWEA 3LPFA 2NT1A 1UR4A 2WVVB 4HZ7A 3D5HA 1JDCA 2C7FA 2BY1A 2GJRA 1UKPA 5LA0A 2XFYA 1OBAA 4URIA 2ZX9A 4JL1A 1UG6A 2VCBA 1XRVA 3O9NA 2J4GA 1KWGA 1RH9A 2D1ZA 2VJXA 1HKJA 2ZIDA 1LLOA 4C7GA 3GBEA 1W3HA 4D6EA 4QLJA 3CHDA 2YDSA 3RILA 2Y24A 4QCEA 5A8NA 3M46A 2G4FA 5CLTA 1C92A 3VTRA 3B9EA 4AZIA 1GCYA 4EANA 4W7WA 3WQ8A 3MU7A 4QFUA 1C90A 3WDHA 3L4XA 1E40A 3VM7A 4MNKA 3WUGA 3WUEA 1NOFA 1E6QM 1V3MA 4W5UA 3U57A 1IV8A 1J01A 4YHEA 1ZJAA 2DSUA 4JFUA 4UFMA 4OZOA 2EPOA 3U7VA 1ZBCA 1E1EA 1JXJA 2GJXB 1EXPA 3PTKA 1OT2A 4F79A 4UQ9A 5I77A 1XH0A 1LG2A 2IXUA 4D6CA 3FNDA 2XGIA 1RD6A 4H8UA 2GSJA 3AYSA 4AZCA 5E6ZA 1E55A 1ZB5A 3LPOA 2WC3A 3WMSA 3VINA 1C8QA 2DQXA 2UY2A 1H2JA 2YDQA 1TVPA 5LA2A 4OKDA 1C93A 1M03A 2Y2WA 4W8BA 1QOXA 1PAMA 5JBDA 3ARYA 1WZLA 1EHNA 1LL7A 3WF2A 2DT1A 4CN1A 4JFSA 3CTTA 1B3VA 3ARZA 3WNNA 4UFLA 3L4ZA 3UG3A 1QNPA 3M6DA 4PUDA 5CSUA 3CH9A 2YLLA 4W84A 3RO8A 4QLKA 1KXVA 3OGVA 4JFTA
chains in the Genus database with same CATH superfamily
4KERA 3APGA 1AQHA 1ALDA 3RRXA 4MFDA 1TCMA 3NO5A 1P7TB 1ECEA 2R1LA 4GQQA 3QY6A 1MEHA 4KIRA 4NHVA 1Q2RA 5FF2A 4ICMA 4CD4A 2B7OA 3VDBA 3VUPA 4DZAA 1TJ2A 2XN0A 4MJMA 4G5DA 4HK5A 2X8RA 3EB4A 5I07A 3VAVA 3BAKA 1XG4A 3G6MA 3KBMA 2HTMA 4F2UA 1TSIA 2Q02A 3W7QA 2EG6A 1KM1A 3RITA 3STCA 4G8TA 3N73A 3OW1A 4IUGA 2YZRA 1R47A 4WJ8A 3E38A 3SY5A 4NUWA 1NFBA 4O17A 3DENA 5GQBA 1RA0A 3OA3A 2CLFA 3R8HA 4Z2GA 3UW6A 1EDQA 4NNBA 4EWND 3VIGA 3BGJA 2HVOA 2XZ7A 1W9UA 4V28A 4XUGA 5A6BD 1LOSA 4YTRA 1UWQA 4Z2HA 4UTIA 4AC1X 4Q32A 2OZTA 2VR5A 4E2DA 1KLZA 3W02A 4NX0A 3QOKA 4HQVA 2ZKMX 4WUIA 4KWSA 1XBZA 5AHIA 4UTJA 4OU1A 4JICA 4E2VA 3DERA 1J9YA 1JD9A 3OIXA 4TX9A 1RALA 2VOTA 1UP2A 2YCLB 1KV5A 3W7MA 2Y7DA 4LY8A 3QLLA 4QROA 2G37A 3F5LA 4W85A 4GKLA 5EA9A 2VFIA 5D03A 5I6SA 3IRSA 3S0CA 4C1NA 3M0IA 1TPC1 1RPKA 4JHMA 3NUKA 1GVIA 2ZFAA 3OQEA 2DP3A 1V0LA 2VWSA 1M7XA 5HATA 2OQHA 3BSGA 1WB0A 3UYCA 3O07A 4TV5A 2WC4A 4LANA 4LEQA 5EPDA 1V6UA 1E9IA 4WKHA 3QTGA 2D0HA 1ZP3A 4ZOEA 5BROA 3VGDA 3BZGA 2IPGA 1RJRA 2UZ9A 2P76A 1BWVA 2HROA 1CWYA 3UP8A 1AA1B 2E5DA 4O19A 1A3WA 3FAWA 5EMMA 1KCZA 3NL2A 3CZGA 5F2GA 3RCYA 3UWWA 2DVXA 1K6WA 5T26A 2WW5A 1XIGA 4DBWA 3VKJA 4RV3A 2BHZA 2OB3A 4P7RA 1UH3A 3W2NA 1FCBA 2WO5A 3COTA 2QDGA 5ECUA 2E3ZA 2OWCA 1WUFA 4G7FA 4DHGA 3VIHA 4IT1A 3EA2A 3LHYA 1GW1A 2V67A 4WJXA 1TA3B 1MFUA 4FIQA 2YSWA 3QMTA 3MJMA 4NF7A 2PD9A 1A5LC 4C60A 4K1GA 2J7DA 1KXQA 1VF8A 1W54A 2RUSA 2PURA 1JPIA 2FVKA 2BHYA 4GRSA 2DZVA 4B9ZA 3LLFA 1UD3A 5LIWX 3HG4A 4LRSA 1CTNA 3EMCA 4GG9A 4TMCA 2WPGA 3S9ZA 1J5SA 2YXXA 3BVJA 2WMJA 4YVXA 4X0VA 1Q65A 1AL8A 4LRTA 3G1YA 1EKOA 1UR2A 2R24A 4E6MA 1S5WA 4HU4A 4O4VA 2XVLA 3WLHA 4QJ5B 2D3LA 1XWYA 5BRBA 1F8MA 1HJXA 3IIVA 4YYCA 5HQEA 1NDWA 4LC8A 1KBBA 1PHQA 2AGKA 4DN1A 3STPA 4Q7NA 3OBEA 1DJXA 2F2KA 4B5UA 4MWAE 4N42A 3R4IA 3VO0A 4A3RA 3G1SA 1E9YB 5A8GA 1IIGA 4FA3A 4HYVA 5DBTA 3M0VA 3EKGA 5HMSA 5I5RA 1T0OA 4WD0A 1GJPA 1X1ZA 1EO5A 3MUXA 4MYAA 1AODA 3VMPA 6A3HA 4HPXA 1R8LA 4EPDC 1Y5VA 1QPOA 5BU6A 5A6KA 4X3ZA 2ICSA 2V30A 2PRHA 4PTWA 2QMKA 3A4XA 1MUCA 3WLSA 1BQGA 3PTDA 2QJIA 1K4HA 1J2WA 1PTAA 4NNAA 3DOPA 1RV8A 4AZGA 3WBWA 5C9ZA 1F05A 1CXHA 2VRKA 4GNJA 3TX9A 4DJFC 3PZVA 2ZRWA 2VDIA 3VGHA 2I1OA 2D2JA 2YL8A 3THUA 2DUZA 1QTWA 4TV6A 5GNYA 1BYAA 3IJ6A 1YEYA 2PE4A 3SAZA 1LWHA 1FWCC 2CWXA 3U2EA 4O1BA 2DT3A 1KKRA 4CEXC 4NP7A 1LOQA 6ENLA 1GGOA 2RAGA 1HL2A 3W1NA 4G56A 2OODA 3SQSA 3WG6A 3KVMA 1U22A 4INFA 4KCWA 1VBHA 2ESCA 4IGMA 2V81A 2VZOA 1G6CA 2JFEX 2YW3A 4IMAA 4CKQA 3T0TA 3AC0A 2ZXDA 2W91A 2PA6A 4JTKA 2AKZA 2V68A 3VNYA 3CZKA 1F4AA 1G01A 4B5SA 3L4YA 4X60A 1I2QA 4Z17A 6TIMA 1FWAC 4GFSA 4HT3A 3OLDA 2C6QA 1VR6A 3HN3A 3CV6A 2PP0A 1PPIA 2I56A 4LB3A 1XIJA 2DUAA 1V79A 2RH9A 1BYCA 2ABAA 3PJXA 2RDXA 3R8GA 2O0TA 3VD5A 3IIOA 2ZVRA 3HM7A 2PAJA 1HJVA 5HWNA 1DQXA 3VMOA 3S5ZA 2G5WA 3TYZA 2BZNA 4I5XA 1LUCB 2PODA 2EO7A 4H2HA 5LIXX 1LBLA 3K8KA 4TIMA 3TXVA 2AQWA 1UMYA 4M1BA 5K9XA 1DXFA 3WSUA 2F8QA 3H24A 3LMZA 5C54A 1M65A 3H22A 2UBPC 4NU7A 3F1QA 3MP4A 3NVTA 3SGZA 3SSZA 4UXDA 1W9DM 1DBTA 1H7WA 3URQA 3QHNA 3AHVA 1OGGA 1TRDA 1U5HA 4FLOA 2VC9A 1OADA 2QQ6A 1B3WA 5E0KA 1NF0A 4RZ5A 1KXTA 3R0KA 4MTVA 1IEWA 3QTPA 3A4WA 2JE8A 1JI1A 3B9DA 1TPDA 2ISVA 3WQCA 1MUMA 3KVJA 1WQ5A 4OBRA 1E51A 3LSCA 3L12A 1BVWA 2BOGX 1P7TA 4Q3MA 4O0QA 4L4MA 1UC4A 3VCCA 1FWFC 4ZOCA 4MM1A 2XYLA 4PUUA 3TJXA 3TN6A 3N6QA 2X7WA 3WDRA 4D8LA 3EPNA 5JH2A 3MV01 4D6FA 1HKVA 1F3XA 1WDWA 1MO0A 3MI6A 3GNRA 3LTSA 1UKQA 2CEQA 2HISA 1XW8A 1CGXA 1GOOA 1U1UA 3KBSA 1LF1A 2V9DA 3GZAA 4BJHA 4XZWA 4M56A 1EB3A 4E8DA 3G24A 3MWAA 2CXEA 4UFIA 4S3DA 2J79A 1TPWA 2TYSA 4PMRA 4AXKA 1XCWA 2F6UA 3UWYA 3WQOA 4MZYA 2HQAA 3WK0A 4GMEA 3BV4A 4F0HA 2JKEA 4A8LA 1SPQA 2H6RA 3BAJA 1AH4A 3NQDA 2I16A 3P81A 3PC0A 1H50A 2HK0A 4JQAA 2PGFA 4FR6A 2FIQA 2ACSA 1KR1A 3WUBA 4LAMA 2X1RA 4OV4A 2OZ0A 4UMCA 3VNLA 1NSJA 3IVTA 4IISA 1J5TA 4B3ZA 2HNHA 4AH7A 1IT7A 3F4NA 1TE6A 3RDKA 1HTIA 1TZ7A 3OYZA 4PCSA 2ASHA 5FAJA 3E6EA 1T5AA 4J3SA 4CD6A 3HQPA 4HU0A 1EGMA 1HJWA 2YCLA 3B0PA 5FOOA 1LORA 3PK7A 2CLHA 4O8AA 4J3WA 3IUHA 1B9ZA 4V2XA 1GNXA 4IPJA 5GJPA 2UY5A 2DPEA 3UNDA 3VDGA 4H7VA 2R82A 1V4YA 2A2IA 3W75A 2LLEA 3B8SA 4BS0A 1ZALA 2X7VA 1QO2A 2O56A 5D4YA 3NVDA 5JVLA 1FY6A 1EC7A 5EMKA 2WPBA 2BY3A 1JPKA 2PFHA 1KCXA 3FA4A 3WF3A 5FEZA 1VCGA 3GU9A 1YRRA 4GVIA 4BQ2A 5BW6A 4E4UA 1L2UA 5AZ0A 3HQ1A 4BWLC 5K9CA 4EAYA 3OHIA 2E6YA 1S3HA 5C6MA 3F5JA 4XO6A 2NV9A 2ZX6A 3LGEA 1A5KC 5M2FX 2P10A 2YA0A 3GAYA 3D0CA 3JU2A 4JFVA 4HA0A 1NFGA 2V5DA 4IMEA 2E7FA 3RX4A 3C52A 5JU6A 1X97A 1TA3A 3WLQA 3WENA 3FA3A 3NXFA 4HJWA 1TB3A 5I3IA 1IE7C 2G50A 3OO2A 4TO8A 2QKFA 3P5ZA 3NZ1A 1R7OA 2NUYA 4PA8A 1SZGA 3BLEA 1NM9A 3LHTA 4B3LA 2HMCA 4OT7A 5U4NA 4AF0B 3ARXA 1O5KA 2XJ7A 3TXZA 2HNEA 2Y63A 1DJNA 1DIDA 2IQ0A 3UYIA 4LBSA 3U8GA 4Y96A 3IGUA 1A47A 1FVPA 3WK3A 3BSMA 1VFFA 3FV9A 1S2CA 3SRKA 4QAWA 1AUSL 1LRTA 4AWTA 4U28A 1YW1A 1CI1A 1DWJM 2HVNA 4QBXA 4QGCA 2OYKA 2NQLA 4DNMA 1Q13A 3CQJA 2P8CA 2HDJA 3BUVA 1EUAA 3VC5A 4CD8A 4C6CA 3HPFA 4YTQA 3VKDA 5I3JA 1G7VA 1OB0A 3H53A 3OYXA 1OFBA 5CPOA 1W1A1 3PBVA 1Y0EA 3BOLA 3ARPA 3ELFA 3GBDA 1ICPA 3PZNA 4JS3A 4PMXA 1GEHA 3ZFHA 2HSAA 2X2YA 2PZNA 5CZTA 1N8WA 2TSYA 1XQLA 3PPHA 2MNRA 3AWNA 1Z48A 3OG2A 4Z2KA 1QR7A 2VD9A 3IAQA 4ATWA 5EMLA 2ZRVA 2J13A 2DH2A 4ERAA 4LBUA 4HHPA 1CLVA 3TTYA 4PCPA 3CNYA 4IPNB 1SGJA 5I7GA 3S5SA 5CSSA 4GYFA 2VUYA 1N7KA 4ES4A 3GXMA 1KQYA 2JF6A 2ZZ4A 3GUWA 1AL7A 5CC7A 1M1BA 2Z1BA 4BQ4A 5A2CA 1U83A 3SO7A 2VX6A 4ZQNA 3HPZA 5PTDA 1YTDA 4C90A 4DEFA 3N2XA 1Z41A 1RK6A 1EO7A 1I45A 3N1AA 3CUFA 3FYOA 2R91A 4CCEA 3FOKA 4AD0A 2ZXAA 2Q8XA 1M04A 1T6MA 3W27A 3UZYA 1R2TA 2FHBA 2ZDRA 3GUGA 3P0WA 1ITXA 2HPIA 1XLFA 1ADDA 2VEFA 2GLKA 1Z7AA 3TWBA 1BLIA 1XV8A 1XINA 4MOZA 1AZ1A 2PZ0A 3GHRA 1E15A 1ELSA 2IPWA 6REQB 1W1B1 4BEUA 3OODA 4DWDA 1OINA 5AZ1A 1DHPA 3GX9A 2Y61A 2FTWA 5M03A 5FJIA 4GIAA 3N29A 3VNZA 1KM2A 2VGIA 2XFWA 4JOMA 3IJLA 5F1VA 5E9AA 1OX4A 2Z2AA 1E56A 3LLDA 4O50A 3T05A 3A6OA 1BPLB 1W3LA 3O0FA 4PTNA 4S3BA 1FFRA 2DIJA 4UTUA 1MW1A 5C2CA 3RIKA 3TSDA 3PZOA 1BSLA 5AC5A 2Z25A 2OQYA 2WVVA 5BXRA 3OZOA 3EXRA 3HJZA 4FXJA 4MKSA 5EBAA 3GDRA 3P60A 1YHTA 3VX1A 3YPIA 5HWJA 4H8NA 4XUYA 2ZUVA 3O05A 4AD2A 4UCGA 4XD4A 2Z29A 4W9TA 1LUCA 3AXIA 4NNCA 3LD5A 4WDTA 1DQWA 2WNNA 3UF9A 3T42A 4XZHA 3HO8A 3AZRA 2ISDA 2GVYA 2ZUSA 3TAOA 4FX7A 3GNXA 4HP5A 1QNQA 3WQPA 4PTXA 2B31A 5TF0A 1KB3A 2RKXA 4C6IA 3DBPA 3QOMA 1AK5A 3CV7A 3SUVA 4MLJA 5F7UA 6TAAA 4KBXA 4ZO9A 4AIBA 1MXSA 3TQPA 1A4MA 1POKA 1AJ0A 1UBSA 4BHYA 3GXDA 3ZVHB 1XBXA 3PZTA 4OBTA 4B91A 3GHSA 4K8HA 1HNYA 2Z27A 4W86A 4FLRA 2XH2A 4WDXA 4V1XA 4O15A 1LJYA 3KHDA 2ZXBA 3CM4A 1X39A 3GU1A 4PCNA 1TFVA 2QULA 4H1ZA 4DBSA 1V6XA 2BDQA 4Y7EA 4RZBA 4Q8QA 1XLKA 4KT2A 3IJIA 1PSCA 1US0A 4GPNA 3VNIA 1HKIA 1WUEA 5FI8A 3A3HA 4XKMA 2BTMA 3GH5A 3VVGA 2GSHA 2Z1SA 2HWGA 5IM51 2CLLA 1GOWA 5KETA 3V16A 4DLFA 1EJVC 4FNUA 3M1ZA 5BWAA 4GH3A 5TQLA 3XISA 3P67A 5CPTA 5TAOA 1UUMA 2DZWA 3R7MA 4DJEA 3BLIA 3S2CA 4CQBA 2OT0A 2J25A 4LYRA 1MSSA 3W73A 1F5ZA 3ZJKA 3QBUA 4ZOBA 1H7PA 1ONXA 4RK8A 1J6OA 4LY4A 5I0DA 3JS3A 3MUZ1 1LRQA 4D1IA 1LCOA 4C6BA 4A21A 3ENLA 3M0ZA 2JKPA 3C8FA 3WNOA 1JUEA 2P0OA 1SMAA 3M47A 3G0XA 3VIOA 1WE5A 3TUUA 4XBKA 4GH1A 4LXFA 2CBJA 3T0CA 1JDDA 5H8UA 1US2A 2EG7A 4YIWA 4ENLA 2E5BA 3UCQA 1VYPX 1QI5A 3U2ZA 4ZSTA 4UR9A 2C0HA 1UKSA 3SCRA 1A5MC 1LM1A 1ME8A 2R1KA 1RQHA 1GKRA 2D0FA 1JCXA 1HZYA 3TYEA 4B90A 1JI2A 1DJWA 4O12A 3CT7A 3VI2A 4PB3A 5B7ZA 2E68A 3EMQA 5AYZA 1HFBA 2PTDA 3RM8A 3V35A 1DIKA 3CMJA 3W37A 2YL9A 3GG1A 4GI9A 3W6LA 1J6PA 3BDKA 4WR3A 1C8YA 1C91A 4GA8A 3OLGA 2IUZA 4WXZA 1ZP4A 3PZIA 4NXSA 1WV2A 3MCNA 3ZT5A 3C8NA 4M6PA 3C61A 4MDPA 1XRTA 2JBMA 4LQ1A 1V93A 1HT6A 3LLXA 2DUXA 2Y5SA 3ITVA 3W2MA 2Y8KA 3ZM8A 2F9RA 1WP6A 5BU9A 1KGUA 2QGHA 1LROA 1TJ0A 3NQ2A 5HNTA 2YLAA 1O94A 1JDEA 3BICA 3PUGA 3AYRA 2FGBA 3TDFA 3S6DA 5GPRA 3EPMA 3G1FA 4H41A 4FNSA 4MYXA 2Z26A 4A6GA 1KFCA 2OEJA 1GHRA 4AF0A 2YBVA 1S2UA 2C0AA 2QPXA 2VXNA 3BURA 3LHVA 2Z1KA 1Q2SA 2OOGA 4RXGA 2QDHA 3TZNA 1Z8AA 3N6JA 3UPWA 4XVDA 1L6FA 3QZAA 4IGSA 2X0YA 4L6OA 3U7BA 1SO4A 3C6CA 5AYIA 2HE8A 3O15A 4YN5A 3CUGA 1M01A 4UB9A 4W7UA 3WF0A 1FXQA 2BGSA 3T6CA 1J93A 2HVMA 3CASA 7ENLA 3T44A 1JGMA 1IF2A 2PWDA 4I6KA 1YMYA 4NZ5A 3LNMA 3UU0A 2XH7A 4MB1A 3R94A 3RO6A 4WXYA 1KWKA 2OPJA 2V63A 1AFSA 3BO9A 2ZRUA 3K30A 4CCDA 3FX4A 2VWTA 2NV1A 4PUEA 1S2WA 2Y4SA 3MI2A 1DTNA 3E2QA 5C9WA 3MB9A 1D2KA 2QPUA 3UR5A 4C7FA 1OIFA 4PR4A 3MMTA 2REQB 2BXZA 2QCDA 3GDTA 4L64A 3ABRA 4KW2A 3LCXA 3SUUA 4JY9A 1ZY9A 1T96A 1QOQA 1F61A 1OVDA 4ZODA 3C3UA 4JYFA 1SFJA 4B15A 1IZJA 4LALA 3QMRA 4MJZA 4NXKA 3GHTA 1JZ6A 3NM3A 3OVGA 1TIWA 2QPSA 4OGZA 4IF2A 2ZXQA 4GQ0A 1XLBA 3P3BA 4QSHA 3JZUA 2V5BA 2OZ8A 4IGNA 3TP4A 1BF6A 3KS5A 5CGQA 4KFNA 2NQZA 4AVOA 3DYOA 4B92A 3VE7A 1JUKA 1Q7QA 1B31A 5FJTA 1SSGA 1VFHA 1DHKA 3GTXA 3I3DA 5EB8A 5AHMA 3UGVA 4Z0JA 2X42A 1JF5A 3ARVA 1BEUA 4U5KA 4R5EA 1Q6FA 6PTDA 5KZ6A 2F7FA 2AL2B 1TV5A 4GI6A 3E0IA 1WDDA 3PB0A 1JPHA 5IHRA 3O63A 6REQA 2ATSA 4JTUA 2VELA 3FW6A 3UWVA 1GVSA 4Q22A 1EJRC 3SI9A 3DFSA 1Q4WA 4AW7A 4BF5A 2VX4A 2W67A 5A6JA 1TTQA 2Z1XA 2W92A 3GW0A 3TWAA 2QCMA 3V0TA 3T40A 1EXBA 1RHCA 3FN9A 2GVLA 4IP4A 1XLLA 2H9AA 1ZENA 4LU0A 3AIWA 3PZMA 2NVCA 3GVRA 4IFRA 3EWBX 3E0LA 3W01A 2BODX 3BXWA 1B4KA 3HQOA 3B8DA 4KEZA 3O2LA 1UPMB 3CAQA 4L65A 3FCPA 4PMVA 2OG9A 5FD0A 1NWRA 5D2WA 1M9HA 3OB8A 2W4XA 4AZ6A 3ZWTA 1E6PA 3CL6A 3VFCA 2X1IA 1OQFA 1JF6A 3NOEA 3W1AA 2ALRA 1B0IA 1OABA 4UTWC 3QEZA 5D2YA 4NJHA 1LOLA 2YIHA 5K7JA 1AMKA 4HA4A 4AIOA 3BOXA 2PDKA 1BQCA 4PEKA 5BRPA 3V36A 4ZO6A 1BRLB 2CU0A 1A3XA 1RP9A 5XINA 3HF3A 2J7BA 3MUIA 5FF7A 2BVDA 4RNIA 3VCNA 1TV2A 3EA3A 3CEPA 4P8XA 2INFA 1LDCA 4B2DD 3QW3A 4H9ZA 4WKFA 2HXTA 3S2JA 4D8ZA 1DVJA 3BG5A 3W1LA 3PBUA 4ZCWA 3CWNA 4KMQA 1TPVA 3T78A 4A3UA 2BY2A 1VRXA 3CAWA 4TXEA 3A5VA 1ZJBA 2V38A 1TX2A 3BG3A 3SCPA 2XIBA 1PWMA 3S2LA 5I2UA 3ZVHA 4N6FA 2FB3A 3TEVA 2YCIX 2HS8A 3HOJA 2GJPA 3WQGA 1UH4A 3NJ3A 1E71M 4EXAA 1OHLA 3APTA 1XIIA 2WJEA 3W2UA 1ZNNA 1QHPA 3M6YA 4IG2B 1JRCA 3OLEA 4PE8A 1OFRA 3WBYA 3M5XA 1S1PA 1VKFA 1Z9AA 5CSYA 3QGKC 3LPFA 5EKYA 4GZ7A 2NT1A 2I17A 1JDCA 3TYBA 3W3OA 2BY1A 3W23A 2PRLA 2GJRA 4GKTA 3C86A 5LA0A 2XFYA 3LCLA 4JL1A 3WZ0E 2PDGA 1XRVA 3O9NA 5HR6A 3M5YA 4M7SA 4PZVA 1VFSA 1UJQA 3KM8A 4JTHA 3KTSA 4MWAC 4GCXA 1JCNA 2V8ZA 3VK5A 1GVOA 3CHDA 2YDSA 3RILA 4C6FA 1XLCA 1W5OA 2WSQA 1MDLA 4XZ9A 5FJRA 2PDBA 2G4FA 1TPFA 1YBQB 3C4UA 3NDOA 4XWUA 4NJKA 1RA5A 1JRBA 4XTIA 1TKKA 1V6TA 1BKHA 4GXWA 1TTIA 4I9TA 2BP1A 4W7WA 4Y2WA 5C55A 3ONBA 4C6JA 1GEQA 3WDHA 3QQWA 4REQA 1N55A 1FX6A 5SWUA 4K7VA 4S38A 4JFUA 2A5HA 3EXSA 4M0XA 1VYSX 2GJXB 1XLEA 4V33A 3D3FA 4UC5A 4UQ9A 5I77A 1XH0A 4LH8A 1R3VA 3SN1A 1LG2A 1VC4A 3EWWA 2KAUC 1K8YA 4XAYA 3A12A 2GSJA 3AYSA 3LGGA 4H8UA 4AZCA 5E6ZA 3B97A 2NX1A 1E55A 1J96A 1ZB5A 3F2BA 4QAIA 3W7LA 4MPQA 1C8QA 2PP1A 3GVQA 3T4WA 2UY2A 1H2JA 1XFCA 3WQDA 2QEZA 3W7PA 1C93A 2Y2WA 4GBDA 3MO7A 3RN6A 3ARYA 3P2VA 1EHNA 1LL7A 3WF2A 1WYIA 1UASA 3ARZA 1XIFA 3L4ZA 5T8GA 2ZCGA 4ZBCA 3RO8A 1KXVA 3RLVA 3SZ8A 1BYDA 2ANUA 2GQ8A 2J88A 3FLUA 2O9OA 1BVZA 3B0XA 2W61A 3SEPA 3VILA 1UD8A 3QV7A 2E9MA 4JNMA 3A47A 1TWSA 3G2GA 2H3DA 4JQ1A 5D8ZA 1BD0A 3PNUA 1TYGA 3L66A 5FSDC 2P3EA 1ITQA 3REQB 4HMDA 4JQ3A 3W25A 4OOZA 1IXOA 1FWEC 3G3DA 1NQ6A 3NQ8A 3KAOA 3GAKA 5RUBA 2YKKA 3ISIX 3GNNA 1IWAA 4EIVA 4IMFA 1BVNP 3ZVIA 3QV6A 3NIYA 3WD3A 1BXBA 4LYQA 4WX2A 1GJUA 3RPMA 3NO3A 1W56A 3MMUA 5LSMA 2PSNA 3M4HA 4ZE5A 1IGWA 2VDGA 2DT2A 3WK2A 4JTQA 1BXNA 1W37A 1V0NA 3BWWA 2J47A 4ERIA 3NQMA 3CPUA 5U7SA 2ON3A 5I24A 3FKKA 4US5A 4IMGA 3WJZA 3AIUA 4L4LA 3U6WA 2D23A 3GY1A 4HSOA 3UZWA 4U31A 3B4YA 3GXFA 3ECQA 3WDJA 3GC2A 4MUPA 4PFHA 5I02A 3KBNA 3LUTA 1VQTA 4JIPA 3KTXA 2WWDA 3D6NA 3RMEA 4J27A 1PKMA 1TWDA 1R30A 4OHQA 1B4EA 1JDAA 4D71A 1YPIA 5FCZA 4IQDA 3GTIA 3GS6A 1XCFA 1TZ9A 1R3TA 1F7BA 4QX4A 3MMDA 3AFBA 1EBHA 3O7UA 3ONCA 4EWJA 3DU0A 2YOCA 1UKOA 4FMVA 1O5RA 2POZA 4DXXA 4N6EA 5LZLA 1E6RA 3FK4A 4Q7IA 1XLGA 3LS9A 4H7ZA 3JRKA 3FSTA 4WGHA 1O1HA 1O7AA 3WELA 2NXGA 4TTGA 3NPUA 1SO3A 3ZR4A 5LXEA 3MQTA 1CDGA 2WCGA 4R53A 4DPPA 1YDYA 2Z6IA 5TIMA 2DEPA 1OM0A 2VRQA 4K6AA 5E0CA 1VFLA 4R27A 1UPPA 3M07A 3URNA 2ZZ7A 3C2YA 1M53A 3NURA 4EACA 1ZFJA 2PC8A 1XQKA 4ZOAA 3VOJA 3R5EA 1JAKA 2ZUMA 4DJFD 3MKVA 4ZQRA 3BLLA 5XIMA 3W6MA 4E8GA 1HJUA 1EEXA 4ZFCA 1FBAA 3TONA 1PZ1A 3SM0A 5HUOA 2XH4A 3M43A 1B2YA 2QV4A 2R1PA 3MDWA 4GE8A 4P8VA 3SCQA 4Q8TA 1Y5WA 4GQRA 4QCFA 1NWTA 1ODZA 4JTJA 3OU8A 3TW7A 3A24A 2AL2A 2XM1A 4V27A 2XVGA 3PPFA 3RJXA 3PSWA 3NR0A 1GOXA 3URAA 1PKNA 2IS7A 3ZMRA 3CV2A 1W31A 4YS1A 1B30A 2TPSA 1TUXA 1E1FA 4ICCX 2TRSA 1JNDA 2V69A 4JIRA 1GYLA 2A6LA 5LIUX 3W1TA 2VYOA 3QH2A 3R8RA 4W5ZA 4O16A 1GOMA 3I68A 5CPQA 2P1FA 4MAZA 2ABBA 2DSVA 1F3TA 1SO6A 1XYAA 3UWEA 2D2OA 1DWIM 1OCBA 4S23A 1A5SA 4NRSA 3K4WA 1KM0A 2DIKA 3VZYA 3NSMA 4C6QA 4H9UA 4CNOA 1TG7A 4UTTC 3H12A 2X1SA 2INEA 2GL5A 3GZ3A 4HNUA 4GY7A 1XX1A 1HJQA 4B5WA 4LAUA 5FIPA 2QCLA 4RCXA 2CFFA 3DEQA 2WVTA 2HXUA 3DKJA 4UTTA 4MB4A 2YB1A 1MQPA 1GVQA 1X1NA 4ORMA 3DHDA 3L2LA 3E0VA 4RW3A 3M0LA 4GYKA 4LB4A 4UTFA 1NOWA 1UR0A 4LF1A 1F73A 1GKPA 4HU3A 3T07A 3WLKX 4C65A 1K8XA 1TRIA 3A21A 1W17A 3GW3A 1VP5A 2XSAA 1BRLA 2FZNA 2WVUA 4BY3A 3QSRA 1PX3A 5BXSA 3M64A 4D9PA 4HTBA 3CXOA 2PLKA 3B03A 1OX5A 4DJDC 5CGTA 2DQWA 4KEMA 4Y6GA 5HAOA 4DYEA 4UTKA 1K9EA 4CQCA 1W3KA 4IL0A 3B0UX 4KF1A 3SJNA 4DJDA 2PMQA 4M1RA 1A50A 3CLMA 1UWIA 3L2MA 4HK6A 4D2JA 1S2TA 1J11A 4ZB0A 3QHOA 5HUPA 4J4KA 4C6MA 3BANA 2AAMA 4AC7C 7TAAA 2Y1HA 2DV0A 2Y8UA 4L9ZA 4HKPA 1R87A 3MC5A 4P8UA 3CEUA 3NOYA 1UH2A 5BMXA 4JTCA 1QU4A 4IG2A 4UFKA 1JQVA 3H4GA 2OELA 1JCTA 4LUJA 3PTMA 1E9LA 2G3FA 1Z42A 1JIBA 1DJZA 1QPKA 1SR9A 4BR1A 5KINA 5LHFA 4IOTA 1H0IA 3PFMA 1QBBA 3NQVA 1QPQA 1MNZA 1EOKA 5DEZA 3TH6A 2I14A 2VOMA 3STGA 2VMFA 5K3VA 4P7NA 2WNWA 3AS2A 2CLMA 2QIIA 3XIMA 3OP2A 5KZDA 2Q71A 2TMDA 1B9BA 3C5QA 3EMZA 1SW0A 1HO1A 2O7QA 2R8WA 1XS2A 1JVNA 1J0JA 1FDZA 3IV8A 4QG9A 1A0CA 2P8BA 4Q6XA 3B9NA 1CGUA 4PTMA 3GDBA 3MKCA 4CQDA 5D09A 4F0LA 3RNDA 3WO8A 1GVYA 1OC6A 4A22A 1JD7A 1M68A 1V8EA 3P93A 4HSHA 1H7RA 4PB5A 1KGWA 3WH7A 4TMBA 5A3HA 2GJXA 5CPSA 4HCHA 5ECVA 3UFYA 2ZE3A 1SM9A 5DQPA 4YCPA 3WY1A 4U2ZA 3KWXA 3EA1A 4LGXA 4DPQA 1KGXA 7CGTA 3HMCA 5C8BB 5JBFA 4IJBA 1R86A 1X1OA 4QJ4B 2V0TA 3EXTA 2BG5A 4QEHA 3HBLA 3V1PA 1Q6GA 3SR7A 2FJUB 2QR6A 2FZ9A 4CNTA 2W63A 1J18A 1VAHA 8XIMA 4A4AA 2G8ZA 4I5UA 3SECA 1ZAIA 5DY3A 4XZIA 3R58A 3KDOA 5HNRA 5C7VA 7PTDA 2GUUA 1QW9A 3OBAA 3S1XA 3BPWA 4MSSA 1M7OA 1HVQA 4MJ2A 3L5MA 9RUBA 3VZZA 4NASA 4Q8OA 3H70A 3BJSA 1GWJA 5C5YA 3WEOA 3K13A 4QQUA 3REQA 3FXYA 1KKOA 5IXEA 3ITLA 5I3HA 1W0MA 3I4KA 1RCXB 4HHLA 4WK9A 4AD5A 2CHNA 4NSBA 4GVHA 1AD1A 3U0HA 4GQBA 4DQWA 2PDQA 3LTPA 2DFAA 3NCOA 3LA4A 2R94A 4GD0A 2CITA 5IHSA 4PL1A 1MW0A 1VJSA 4B4FA 3ZT7A 3AI0A 2BHUA 1X8CA 4O4WA 3GVWA 3QKZA 1DWGM 4IH3A 3FDKA 2Y0FA 1BGAA 2QMJA 3URBA 4FXFA 3AXKA 3IS4A 3KRUA 4I9MA 3CHFA 4O18A 4UQEA 1I4NA 2YR1A 3ZSSA 1EZWA 4IIDA 2Y5JA 3WEMA 3I7RA 2P3ZA 3DFYA 1M6JA 3GVGA 5CG0A 1QI0A 1ZJHA 4W8AA 1LLZA 1FA2A 5A8OA 2Q3OA 3MUAA 4AHPA 2FMNA 1X6UA 3LBCA 1E4MM 1CYGA 2V3FA 2E0PA 2YFOA 3VKBA 1ME9A 4FP1A 1PIIA 3LHZA 4PMQA 2EPHA 4HSNA 3W81A 3EZ4A 1MQQA 4QHRA 1PZ0A 3G3MA 3IIPA 2J27A 1ODUA 3PUDA 4HN4A 3ARQA 1MEWA 2VM8A 1QASA 2D73A 3M44A 1MXGA 2DJXA 2E25A 3QY7A 3WLLA 2XU2A 4MZ8A 3BCFA 3H2EA 2Q01A 4UZSA 3C2RA 4ZGYA 4CLMA 2Q09A 3PAJA 4BEQA 1F4HA 4S39A 4MVAA 1JCMP 2FZ8A 4ROPA 3W7RA 2PTYA 3UWQA 3DDMA 1EOMA 1E0XA 3HPSA 4L61A 4IIHA 1YNQA 2PPGA 3VGBA 4BKNA 5CC3A 3FKRA 2G0WA 3GSMA 4Y8FA 1QAPA 1WKEA 1TPH1 2VFEA 3SUTA 1NWSA 3SCUA 1EJ7L 2V2CA 5FAGA 1W3IA 4J3TA 3G77A 2QCNA 4O0KA 3ITOA 3SURA 4DWSC 1SFSA 3L2IA 1WZKA 1QWKA 2DZXA 2GVEA 1TMQA 5D38A 3MSDA 5K9DA 2P50A 3ABSA 3EX3A 4IIFA 2C16A 3N9RA 1OSEA 2V5CA 2WJDA 4R3UA 3IRDA 3CJPA 3GH7A 3J7HA 1NF7A 1S1RA 3RFAA 2EBNA 4J3ZA 2FHCA 4AIEA 2PWUA 2WKLA 1YDVA 1IEXA 6ALDA 3A4JA 3AS0A 4GYPA 2J7EA 4RV8A 3RX2A 5CGMA 3AXXA 3S5YA 1F76A 3T2QA 4MY9A 4CQ8A 3L65A 1E3XA 3I7QA 5JQ9A 2Q8ZA 2WQPA 3CUZA 9XIMA 1LWJA 3W1XA 3I3EA 4FNPA 3FHAA 4BZYA 4JAWA 3CK5A 4KQNA 4AMCA 1WPCA 2C91A 4GFIA 1X7FA 4OUEA 5A6BA 3LU2A 1UWSA 2G3IA 2NX9A 4PTDA 3RCMA 5BZAA 1CLXA 5J5RA 3N9KA 1Q45A 1L9WA 3SW6A 2C18A 3JVAA 2ZZ6A 4PTVA 1D3CA 2FH6A 5LNSA 4XD3A 3ARWA 4LT9A 3PP7A 4Q4KA 4LUIA 3DAQA 4OTKA 1RD5A 5GNZA 4FO4A 2NVAA 3FJLA 3I3BA 5GJMA 4UQAA 2UV8G 2X05A 1R5YA 4L4PA 4AWSA 4EOUA 4EXQA 1FWHC 2D0GA 1G4EA 1EEPA 3MBFA 4W89A 1FFQA 2OTDA 4Z1BA 3MYOA 4H04A 1R3QA 3RGTA 1DJYA 4QQ3A 1UQZA 2J62A 1VIWA 4ZO8A 5ABEA 5G2HA 4LVFA 1KO0A 4S2BA 4POCA 1IZCA 3OLIA 1K77A 3STEA 1OC7A 3HG2A 2CHOA 4Z2IA 4FOUA 3W7IA 1GKQA 2HV5A 1W5QA 3IEBA 4KFPA 5M5DA 1KM3A 3KLKA 4HJFA 1XUZA 3TQ0A 4ZVJA 4NZCA 2PU0A 1FDJA 1TQJA 5HWMA 3TLQA 5BOOA 2YW4A 2BS9A 2YA1A 2A3BA 3GFXA 1CGWA 1XC6A 4WDWA 1W1YA 3GXPA 3ARUA 3S46A 5C70A 5KZEA 3E0WA 2I7GA 1ENUA 3QF0A 4EPKA 4P2VA 1AQMA 3SRFA 2QW5A 1PIFA 3F4WA 3N2MA 3H2MA 4JX4A 3UJ2A 1M3UA 1JL8A 4KGJA 2EPNA 3V5CA 1S5NA 1I1XA 1GYNA 3VIJA 3AOFA 3THAA 1UR8A 2AMXA 4UFHA 4JXCA 4A2SA 4HMCA 3M9YA 2ZZ3A 4PMNA 1AVAA 1EYEA 4JNZA 4KIEA 1KFWA 1V6WA 1VHNA 3QZ6A 4JN7A 5EMUA 3DFTA 4RNJA 2XIJA 3AS1A 4GGHA 2OEKA 1A5OC 3OGRA 4D6GA 3AROA 3TTSA 4RZ6A 1L6GA 3LHWA 2ZRXA 2NXHA 3UT0A 4YWIA 3L68A 4LUSB 4Y90A 4U33A 3DECA 1NU5A 1WX0A 3WX7A 3BL3A 4ZFMA 1QNSA 3L9CA 1ICQA 4I5RA 4BI5A 2FHFA 1UUOA 3QR3A 3ZIZA 4JQ4A 3W29A 1A5AA 3U2OA 4CD7A 3VUSA 4RUBA 3LXAA 4HZ8A 1QFEA 1X6NA 3RAOA 2ZA2A 1QHOA 3LPPA 2QHAA 4AIUA 2YBTA 4XZNX 5IRPA 3EDFA 1P5BA 3U4AA 1NELA 4AYSA 3N17A 4RE3A 4IQLA 2V2DA 4N9CA 4EXBA 4DYKA 1OYBA 1JUBA 1H49A 3WH8A 4P61A 3VD7A 2WHJA 4TTUA 4RE0A 3AO0A 4GY1A 2Z7GA 2KX9A 2YYTA 4N9EA 2XN1A 3H21A 1GONA 1IGSA 2NWRA 5A5WA 1XIHA 5T9CE 1RQBA 2WBKA 3E9AA 4ZB2A 3WCZA 2F6KA 4GHRA 2AQVA 4KCVA 3SUWA 4F9DA 1GTEA 2NX3A 3W86A 3MSGA 4E5TA 4PCFA 1FP9A 3PWAA 4GVFA 2WV8A 1AZ2A 2Z6JA 2NSXA 1VPXA 2ZZ1A 1J79A 4RNHA 2WSYA 4BI7A 4AVFA 1L6YA 4CD5A 3IAPA 3IK4A 2PC4A 1PTGA 1NP0A 3FHQA 4J2MA 2YXGA 4AY7A 3GTHA 2GGEA 3OQ8A 4G2DA 3VGFA 2CESA 4G7EB 2OLSA 4LJ3A 4DZIA 1B57A 1S39A 4LS2A 2VX5A 3CO4A 2IKGA 5H1WA 3U5YA 1KBLA 5E9XA 3EOSA 4GBUA 4CU7A 3PZGA 3W7NA 4C6KA 5AHLA 4UR8A 3CPRA 4PMZA 2DZUA 4JKKA 2YDRA 5JIPA 3DGBA 1WAWA 1H1NA 3P0XA 3FJ6A 5AYYA 2DORA 1B1YA 1LZOA 1RBOB 3NQGA 3PULA 4ATDA 2XZ9A 1FWJC 2QVNA 1OZMA 1VPYA 3H4WA 4ONVA 2QDEA 1YYAA 3GC4A 3WQVA 1O1ZA 3ME3A 3U4FA 4DF1A 3PPGA 3F2CA 2C14A 2OSYA 3SGGA 4B3KA 3FEMA 1QK2A 1VBGA 5CLWA 2E6DA 3WIJA 4PMJA 1XGZA 1RJPA 4R7WA 5CAKA 5LGZA 1UR1A 1XDJA 2F6XA 1OGBA 2PLJA 1VLWA 1GZGA 3HMJG 1E0TA 4AISA 4QE1A 4GI8A 3V75A 4O14A 5FF4A 1S2VA 3ALGA 3WJYA 5M1TA 4MZ1A 3N04A 1OEPA 3ZLFA 3BCJA 1IIHA 1THFD 3AMCA 3VIMA 4GWEA 1FKXA 1RK5A 2VT0A 4UQBA 3QYQA 1EA0A 1W8GA 4M82A 2NV2A 1DKWA 2PDLA 3ARSA 2QDDA 1BKSA 3UJSA 2JEPA 2VX7A 3CQKA 3IUDA 5G1YA 5C9RA 5A6AA 2AMGA 1LBMA 3KBJA 2XHYA 4EPEC 1EPVA 4WKAA 3VD9A 3GNPA 1PE1A 2WK2A 3LCFA 1JEZA 3P74A 3UA4A 3D47A 1FH7A 4DY1A 3ZXWA 4IJCA 5C7HA 1FWWA 3K46A 3W28A 2GUYA 1WDSA 4QG8A 1B5TA 4OIFA 3KP0A 2H90A 2A7RA 3S5NA 3LMYA 2FGLA 1IT0A 1RBAA 2RFGA 3BSHA 5HR7A 3A64A 4O1EA 4AVNA 1G0CA 1RJQA 3U9IA 1ZBWA 1LQAA 5I3GA 4JBRA 1GOQA 4ZQPA 3TA6A 3T8QA 3MA8A 1SR0A 3NL5A 1V03A 4LCSA 1JZ2A 4ZTYA 1YADA 4XAFA 4DF0A 1YXDA 5DX7A 3FEQA 2CLIA 1DEDA 1JQXA 5EGRA 4IIBA 4R9OA 2X40A 1R3YA 2IQTA 3L4WA 2PGWA 2V2HA 1XKJA 1KBJA 1XIEA 2JKAA 3BV7A 4GIRA 4YTUA 4QDWA 1BG4A 3UXLA 1E5NA 3C0JA 5HJLA 2QAFA 3EWYA 3VIKA 4UUIA 3N3TA 4YTSA 2AQOA 4Z1AA 1JJKA 3K1GA 3GIPA 8RUCA 1OC5A 3DI0A 3WD1A 1EJWC 5A6TC 1MEIA 2C1GA 3CZ8A 5IOBA 1DL3A 3M0HA 4KWWA 1W1VA 1UR3M 3BLPX 4I3GA 2YJQA 2PTWA 1I2RA 8TIMA 4J1OA 1WBJA 1YTEA 4XAZA 4YVVA 4P8WA 4PSPA 4Z42C 1D8CA 3D3AA 4EAMA 4H6QA 2VC5A 4OBSA 3GU2A 4QE4A 4WOZA 2A7PA 1GVFA 1XUUA 4FNRA 4QG6A 5CPLA 3E96A 1PZ3A 1QO5A 2Y5EA 2FPTA 3OGSA 1V5XA 3ORWA 3CMGA 1XF0A 4EPBC 5CEWA 4O1CA 2FVMA 3BLDA 2OYLA 2WZIA 3SCSA 1DIOA 4IXHA 4GUJA 4XQ6A 2OWWA 4HZ6A 1PCKA 4A35A 1K8CA 4R88A 2DSZA 3R79A 1Y65A 4IIEA 3RCNA 3IGSA 4LBRA 3NA8A 1UZHA 2ZUNA 3PBGA 3E2VA 1DORA 1VFTA 3A5FA 4GLEA 3VD3A 3TYUA 1TPEA 1E43A 3T1GA 4ML9A 4ERGA 1J0IA 1P0BA 3LI0A 4GK8A 3UR7A 3GXTA 5D2VA 1XSKA 2XISA 1PDYA 3BMXA 1H5YA 1QHZA 1FXPA 4MWAD 2H3BA 4G9PA 1KQZA 1P6BA 2YPIA 4PN2A 2FKPA 3KBVA 4PRRA 3TYDA 3NO1A 4PBFA 5KEZA 4FNTA 2GFTA 5E0FA 1Q6CA 1SW3A 4RE2A 1TO3A 5E6YA 5DT7A 3CO8A 2G41A 3H2AA 1XLHA 1V77A 1EGZA 4RNFA 1WAUA 1X38A 1UOZA 5HOSA 3XINA 1RCOB 4LUSA 1G1YA 2ACUA 3BQ6A 4RE4A 5LNUA 1U1HA 4XB3A 2Z2UA 1AH0A 4HOZA 2B0MA 4DO4A 3IUIA 3WLMA 5CC5A 1MZRA 4TOQA 4XIMA 2YX0A 2V5KA 3H54A 3V5OA 2C71A 5F1UA 2GDQA 3HTWA 3GWQA 1JYVA 4HMEA 4KWOA 2FVLA 1UW9A 3QR0A 2PCQA 2ZX5A 3PM6A 4A8NA 1VS1A 4DUWA 2JGQA 3QLDA 4O10A 4ZE4A 1EH9A 5EMJA 3LNPA 3IJ9A 5HQMA 2ZZ2A 2VDHA 1GORA 3WLJA 2FPVA 1PYMA 4J7RA 5AYXA 4JYDA 4HNTA 1EX1A 4K39A 3P14A 1OZQA 2E4TA 4HCDA 3U2CA 3SCNA 1OX4B 1GVEA 1ICSA 1DXIA 3KCJA 1HW6A 1QPRA 3KEHA 2OX4A 4HMNA 2R6OA 1F2JA 1HKMA 3VKCA 1QCWA 2CYGA 4FXSA 4HPHA 3HGRA 2XWEA 3UZXA 1UR4A 2WVVB 4HZ7A 2QJNA 5TBOA 4WZHA 4F48A 2ZX9A 3MSRA 4AMAA 4JR5A 4S3CA 2VCBA 3G5EA 2D1ZA 3R25A 2ZIDA 1LLOA 3QPYA 4C7GA 3W6YA 1W3HA 3LBOA 2OX1A 4QCEA 5DMNA 4IQEA 2INZA 5FF3A 1C92A 2ACQA 4J40A 3AJXA 4RPPA 2ISFA 1A5CA 2BXVA 3MU7A 4G1KA 3ANYA 3GR4A 2I57A 2O55A 3VM7A 4DYJA 3WUGA 4OWGA 3R1ZA 1NOFA 1FHUA 3RRAA 5BOFA 4G7EA 4JDYA 2O4MA 2CZVA 4UFMA 3V7PA 2EPOA 4MUZA 1C8VA 3U7VA 1ZBCA 4WVXA 1F07A 1E1EA 2GUBA 1UIPA 2YZ5A 1OT2A 4A8IA 1LP6A 4JEQA 2IXUA 4D6CA 2XGIA 1RD6A 3ANVA 3V4BA 5HNUA 1XBVA 5D2XA 3NWRA 1CLKA 3PWIA 2YDQA 3VZXA 1OFAA 5T91A 3EGJA 4E4FA 1PAMA 5D04C 1R2SA 1TPB1 1L6SA 4C5YA 1QNVA 2YGYA 3CTTA 3WNNA 5MKGB 4U10A 8XIAA 5AECA 1ZSXA 4NIRA 3OGVA 7REQB 4H4IA 2B7PA 2XH0A 3U48A 3SJ3A 3FGCB 2A3LA 1GW9A 4HNOA 4JTTA 1XR2A 5ABHA 3BOFA 2E6AA 4UOZA 3POCA 5TD4A 3HJEA 3TSBA 2A3HA 3O8AA 3LGDA 5JUVA 1JGIA 3KS6A 1EBGA 1R9ZA 4FF7A 3PF3A 3TJIA 3H8AA 3OJGA 3WLTA 3ITXA 3VDCA 2VP8A 1OFEA 3CB3A 4KPLA 4JKMA 2PDCA 3VYLA 3WN6A 4ZSUA 3SIZA 2D2HA 1LG1A 1VRDA 4M7TA 2FMOA 1ISZA 2JIEA 1KBIA 1DXEA 2OOFA 4K8GA 2Z4GA 1Q8AA 3OBKA 2WCSA 1YPFA 1Q6LA 1I1WA 3OZMA 2HCVA 1W3TA 2F2HA 3PHAA 1US3A 1YDOA 1Q6EA 2QVHA 1GQJA 4GIEA 5LIKX 2Z1VA 4MMWA 4LNCA 1Q63A 4KCTA 1JYXA 1KM4A 1AH3A 4H9TA 4DO5A 1ZU8A 1FWDC 3N2OA 1EWEA 4H6RA 3L0KA 2WZTA 4EF8A 2NT0A 3T0DA 2VFDA 4EE9A 3IGXA 3EDEA 3HIJA 1TJ1A 3DCPA 3SGUA 3AICA 5FL0A 4ZQOA 2QF8A 2QJHA 3HG5A 1ZZMA 1S38A 1T40A 5FJUA 3WQ4A 4AD3A 1UQYA 1UA3A 9CGTA 5DELA 3EBVA 5AVHA 1UJPA 4ACZB 1V6YA 3EX4A 5F4XA 2C8NA 3MWCA 5LYRA 4PEEA 2V5JA 2GYIA 3UPBA 3VOFA 1ZJIA 3UQNA 1IXPA 1KRMA 3N18A 3WLPA 3WFAA 4S2CA 2WYSA 4CUCA 1EJUC 4NQ1A 3RK8A 4W8LA 1Q85A 3LM3A 3BW2A 5CJNA 3B04A 2VGBA 1G4PA 2C3ZA 1O4UA 2ZE0A 4YPJA 4F0SA 4XO7A 1FP8A 4DJDD 4HTYA 4Q8NA 1G69A 1SW7A 5DLCA 4JX5A 2QXWA 4X2RA 4H2CA 1IZKA 1L8PA 4YJ5A 2YYUA 1VH7A 1NQKA 1LRNA 4ZA0A 1C3FA 5KSWA 3RR4A 3NGJA 1V3LA 3EPOA 3TFXA 2XGBA 4I8DA 5HINA 2OFJA 1A0EA 4QRNA 4L6DA 2XVNA 3LERA 2H8ZA 1RP8A 1W1TA 2AGTA 4LEFA 1TE1A 3WLIA 3PWGA 4QDPA 3A4AA 1KFEA 3TK7A 3FSUA 4WSJA 1B54A 2EF9A 1K70A 1HVXA 4H7CA 2VZTA 5DXYA 5D30A 3IARA 1FQ0A 1Q4NX 3CU2A 5EY5A 3FVDA 4B5NA 2Y88A 3PTQA 4JDBA 3ZT6A 3W1QA 3HFYA 1W1IE 4UZUA 1UA7A 3CZEA 4BA0A 4P7LA 2QCDB 1AQ0A 4GCAA 1EQCA 3ATZA 3SQLA 3QPZA 4EK7A 2VZUA 2OR2A 1ITCA 1E72M 2QV5A 2E5CA 4W7VA 4UNIA 3W7DA 4ZENA 4MJ4A 1AG1O 2DSWA 5HA7A 3QY8A 4DLMA 4ZEPA 1HO4A 1PUDA 2GQ9A 1T8QA 2P88A 4MDOA 4CQ9A 3CZLA 2PDHA 3GM8A 2NXIA 1C7SA 2PDMA 2ZRYA 4A29A 1RPXA 2HBVA 1RUSA 2IKIA 1ZQ5A 4MNMA 3KRZA 4IP5A 4MB5A 4JY8A 3MT1A 5K4XA 4PFMA 2JF7A 4J3UA 3VOIA 2WMGA 1XHGA 2A79A 2KZHA 1GVRA 1KA9F 4O54A 4N9DA 3C0LA 1KM6A 2NQJA 4RL3A 4L9XA 4HK7A 3KTCA 4PMOA 1TPUA 3EDKA 1EJXC 3QZEA 2VZSA 1UC5A 3ES8A 5K2ZA 3VDHA 4IP7A 4A05A 4X9YA 4XX6A 3FXGA 5FA5A 1MXDA 4DXVA 1VGAA 1O66A 1DIEA 1Z69A 4OFCA 5LXXA 3HGOA 4GABA 4MKNA 2PF0A 1FCUA 1JZ3A 2ZWYA 3LM7A 4HNLA 3MPGA 1ITUA 3DHUA 1SSDA 1KW1A 1EWDA 1KRCC 4PODA 5G4WA 2X09A 2EG8A 2H9AB 5FL1A 2E77A 1MUWA 1QRQA 4GI4A 3I65A 2HZGA 3RMJA 3E2SA 2I5IA 2P5NA 3SQMA 5HBFA 4UR7A 1PV8A 3E0FA 1SMDA 4ROQA 2G96A 5IBXC 5HMEA 2DZBA 3WD4A 1V08A 3UWUA 5IBXA 1V3KA 1S2AA 5G2IA 3S2MA 4XG1A 4LX4A 5L9FA 1EJSC 1H7NA 4KS0A 3TTQA 5LKYA 1OFDA 3ZLHA 3UPMA 1WXJA 3LZ3A 5HK4A 2VTFA 3B8UA 1RY8A 2E1WA 2QUMA 4BFAA 3OOQA 3TQVA 3W7EA 3I4EA 2RGMA 1VFUA 3TQKA 5AC7A 5CJ5A 3SIMA 3FDGA 2J8GA 4IFKB 4Q8UA 4PCTA 2WM1A 4HNNA 4AZBA 1ECQA 3N3MA 3LDVA 3UETA 2D69A 2WLYA 3BLKA 4DZHA 4R85A 2VCAA 4LSBA 3CHEA 1YE4A 4JTSA 3RXZA 4O28A 4B5XA 4CNUA 2EKGA 2E40A 3C2EA 2VCCA 3O16A 4UNKA 4FXRA 2PD5A 4JYEA 1FWNA 2VUNA 3DYMA 2ZDSA 2PDIA 5IFPA 2EHHA 2QF7A 3BGGA 3MZ2A 3AMDA 4E38A 4Z1DA 5I3FA 2OU4A 3TKFA 2YL6A 4NKCA 5MKGA 1P43A 4RDVA 3STFA 1O68A 2PBGA 1ISXA 7REQA 3DN5A 1ZHAA 3PZ9A 1VPQA 4B2DA 1GYMA 2RHGA 4DJEC 3LCWA 3FGCA 4NT0A 3W70A 1H3GA 3R0UA 3N9SA 1UD6A 3HU7A 1OG0A 1Q6OA 1UUQA 3WUFA 2RDWA 3NPVA 3SB0A 5B80A 3WLRA 2MUCA 4CN4A 3SY8A 2WSKA 2ZOXA 2GSEA 4I7WA 5G1TA 3GTNA 4XTDA 2PLMA 4QISA 3QC0A 3B40A 4C1KA 1XCXA 3PBMA 4C6PA 1R0MA 3AMLA 1K7EA 4C7DA 3M7WA 4REQB 5DANA 5DBUA 2EGZA 1H4PA 4QEEA 5DMMA 3BLOA 3CT2A 1JZ7A 2QUNA 1VBJA 3CIWA 5J04A 3NL3A 4M29A 4HU8A 4DWSD 1U5VA 3QXBA 3W82A 2VC6A 1EQPA 1Q6RA 1OFPA 3V0UA 1BYBA 3W07A 3GTFA 4AZ7A 4ZB5A 5HXMA 3CS2A 4G6CA 4AZCB 4S1FA 1JG9A 3LCIA 4FIRA 4H6EA 3QR1A 4BI6A 5KMYA 2GGIA 3CUIA 3H7RA 5JMUA 3MP5A 4JNYA 3ZOAA 3NYZA 3THCA 2E8YA 3V5FA 1TCDA 1E0WA 2FYMA 1P0NA 4XSLA 3S42A 3CQIA 3I7SA 2WHLA 4XZBA 5AVNA 2J7CA 1X8FA 3N34A 4CNSA 3KWSA 3VCRA 4PBGA 2PS2A 4XSMA 1RCQA 1L2QA 3MV11 2QJMA 2J9XA 1DJIA 3NQAA 1D7FA 4O1DA 1W32A 2DGAA 3M7SA 4PMUA 4QP0A 1FHDA 2WNQA 3HA1A 3UXIA 1AMYA 2YBUA 3JZEA 2A6NA 3CWHA 5CC6A 4ACZA 1GPFA 3EX1A 1BWKA 3H2CA 4UIOA 4QXIA 5C9XA 1F9CA 4ZL1A 2DT0A 3BAYA 2BWGA 4ECLA 3VMNA 4NAEB 3LZ5A 4QTGA 4GJJA 3UEQA 1KLYA 3AZSA 1N82A 2CKRA 2OJPA 3IPWA 4H9VA 4LOCA 2QIWA 3THQA 5DCDA 4QR6A 1RLDA 2VHLA 4IX2A 3DYPA 2QUTA 3WLNA 3ALFA 4IHCA 1X7IA 4UTHA 3IJQA 1FH8A 3DKLA 3B0VC 1KR0A 3E5PA 4FALA 4I9AA 4XV0A 1KM5A 2Z1WA 1W1ZA 2ZTJA 1H0GA 2UY3A 4DO7A 4UOQA 4GXPA 2C15A 3N14A 3AZTA 4MB3A 4LYPA 1J10A 4DXKA 1Z44A 3H2OA 3GH4A 5C71A 3VNJA 3DFPA 2D22A 2XINA 5CZSA 2PB1A 2GZXA 1CGYA 3VGGA 3P6LA 3M0MA 3CLWA 1AD4A 1O60A 1PZ2A 2Y7EA 5G4EA 1XC4A 2DIEA 2DY3A 2BXYA 3WQ6A 1DYSA 4PUWA 5AYBA 4FHAA 3K8MA 1ISVA 1W9XA 4LFYA 4TVCA 4TX6A 2BVYA 3NM1A 1UZ1A 1NDYA 1OYAA 2GK1B 5KTLA 3A9BA 1FHVA 3FYPA 4IPLA 1GHSA 4TU1A 5CBIA 4D72A 1MWOA 2JGYA 2RDUA 4X61A 3THDA 3Q65A 4XKYB 1PXGA 3WJWA 4V1YA 1UHVA 2FTPA 1HQTA 3G0UA 2BNJA 3EWDA 3GR8A 2IKJA 4DBDA 1QOPA 3AAMA 2B7QA 4GNVA 3O6DA 1G4TA 2VR4A 4OE7A 1QI3A 3NTYA 4GNKB 2NVDA 4HD5A 3SSJA 2UWFA 1E73M 4OQVA 5AY7A 1TVLA 1H11A 3N4EA 4N4PA 1PWLA 2X0HA 5DMLA 1Q6DA 4AEFA 2Z24A 4WDUA 1F8IA 2NZLA 3LHUA 5E70A 3N15A 4DVOA 4AQLA 3ZSTA 4EP8C 3CAKA 4Q7BA 5G1MA 2WKGA 5AFDA 3GIQA 3W2LA 3DFNA 2R9RA 4KRUA 1K9TA 2CNCA 3II1A 3SRDA 4A8RA 4ACYA 1S3TC 1NOUA 2CBIA 3C2VA 3EX6A 3LN3A 3KL3A 1XM3A 3QV9A 4C6EA 3WQ5A 3ABXA 2X0SA 4I90A 5D9OA 3TA9A 4C6NA 2CZ5A 3L21A 3GFZA 1TUFA 4LVAA 1BF2A 1EDTA 2DW7A 1OFQA 4M5PA 3SBFA 3MY9A 2D3NA 2PGRA 4CN6A 5C2XA 4H01A 1SJCA 3O6YX 2O9PA 3H2FA 3KVLA 4LS0A 1XDMA 1OD0A 5HANA 3H6OA 4QJ3B 3WH5A 2OMAA 1U30A 4JIHA 4ATLA 1NJJA 4WRHA 4GX9A 4C6LA 4DJFA 2WNZA 2QS8A 1E4IA 1WDQA 4CQAA 2A1YA 3EWZA 2WHMA 4L9YA 3R43A 4IM4A 1JYWA 4KRTA 5D05A 1K4GA 1UWAA 2G95A 3NXLA 3QRHA 1QWGA 3VXGA 3WDIA 4J3VA 2IKHA 3UG8A 5EFDA 1WZMA 4CNPA 1NDZA 1XLIA 3UZJA 3R89A 3UZ5A 1UD2A 4KWVA 1K7XA 3DBNA 2IW0A 5FJJA 2H8XA 2GGGA 1H09A 3EB2A 2OXNA 4WQ6A 2CLKA 4Y9OA 2OSXA 2VFFA 1R3WA 5D33A 2VNCA 3W76A 1WCGA 2TODA 3AIQA 3B8IA 3NQEA 2ISSA 1XIDA 4AY1A 2EPLX 1V02A 4JQ2A 1XYCA 1L8NA 4K1WA 5LNWA 2WC7A 2HPMA 3CIXA 3EKLA 2XM2A 3WNLA 3LRKA 2VQUA 6XIAA 2GQ3A 2PWVA 3JR2A 3BE7A 4IFKA 1MFVA 1WKFA 4K36A 4DX3A 2W6RA 3SCOA