4I6VA

The crystal structure of an amidohydrolase 2 from planctomyces limnophilus dsm 3776
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
425
structure length
425
Chain Sequence
SSPIDQLCAQLDEIVLIDPHSHINPHAAASKNLGDILGYHYFTELAHSAGMPREVIEAPGITAKEKVGRIVEGLAHLDNTIQVKWLIELCERFFGFQDDRLTPDNWEALYDHSEKLMSAPDWEQTVLQKSQLEAVFLTNDFDDPLTGFDTKKYIPCLRTDDLVFHLQKPEVRQRLAKATGFDCATPAKLIHAIGQLFTHFVSHGAKACAISLPPDFEPTPVSHVDAEGPLRAAYAGHVLTTEQSQILSRFVFWTIAEFCSEHHLPFDLMIGVNRRVYESGVYQGQDLFDQRVSLYQYRRLFNAFPRVKFPISVLAHASNMELVSYAWIFPNVIANGHWWYSNIPAFIEPDCRSRLEAIPRNKNIGYYSDMYKLEFGWPKFQMYRRVLAKVLFEDFVVGRHWSEERAVELGRQILRGNVETIFSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Amidohydrolase 2
publication title The crystal structure of an amidohydrolase 2 from Planctomyces limnophilus DSM 3776
rcsb
source organism Planctomyces limnophilus
total genus 153
structure length 425
sequence length 425
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02614 UxaC Glucuronate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.2020.10 Mainly Alpha Orthogonal Bundle uronate isomerase, domain 2, chain A uronate isomerase, domain 2, chain A 4i6vA02
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4i6vA01
4LALA 4G7EA 1ITUA 3UPMA 1ONXA 3TN6A 3E3HA 2HPMA 2PGRA 3FDGA 4LANA 4QTGA 1RJQA 2D2HA 2OOFA 4EPBC 3CJPA 2CZVA 3NQBA 3GRIA 3F4CA 4BJHA 4QROA 2FVMA 3B0YA 3E2VA 2O4MA 4HA0A 4C6BA 4RE0A 1RJPA 2P53A 3O0FA 3QY6A 4CNTA 2VC7A 4C6KA 1O5RA 2IMRA 2G3FA 3UBPC 2PGFA 2YB4A 1PO9A 4XAFA 1K70A 3PANA 1YRRA 1M7JA 1XWYA 4J35A 4GOAA 1KRBC 3T81A 4PE8A 3RYSA 2UZ9A 4XAZA 2QVNA 3K5XA 1EJTC 3B40A 1NDVA 2KAUC 2Z2AA 2PAJA 5HMEA 2R1MA 4DZIA 4H9MA 3MVTA 3LSCA 4XD5A 4EPDC 2I5GA 3GTHA 3PNUA 3A4JA 1P1MA 4XAYA 3G77A 1A4MA 2QT3A 2Z26A 4C6OA 3OU8A 4UBPC 3DC8A 3E0LA 2FFIA 1J79A 4QS5A 4XAGA 4DO7A 3GIQA 3ORWA 2ANUA 3E74A 2EG8A 3MSRA 1PSCA 2Q09A 2E1WA 2PLMA 4V1XA 3SFWA 4KQNA 3F2BA 1FWBC 1KRMA 4B92A 4H9TA 4CQBA 3OVGA 1ZZMA 4YIWA 1UBPC 4C6QA 3EGJA 2ADAA 3ICJA 4NG3A 4HK7A 1UMLA 4F0LA 2OODA 2Q6EA 2FTWA 2PNKA 2WM1A 3TN5A 4L6DA 1A5MC 1EF2A 3GU9A 4IFKA 4GY0A 1GKRA 4EP8C 4EPEC 2GOKA 4PCNA 5AKQA 3DCPA 3RHGA 4TQTA 1EJVC 2HBVA 1YBQA 4KESA 4HK6A 4I6VA 1R9YA 3KM8A 4LAKA 1ITQA 3S4TA 4D8LA 1JGMA 4IF2A 4G7EB 4C6FA 4ICMA 5FSDC 4KEUA 5E5CA 1GKQA 2WJFA 3QGAC 4DI8A 2R1LA 3ID7A 5A6TC 2QEEA 4LCSA 1XRFA 4DI9A 2HPIA 1FWGC 3K2GA 2Y1HA 4C5YA 2GWNA 1XGEA 4AC7C 3A3XA 3IARA 4XD6A 3RN6A 1KRAC 3UR2A 4B3ZA 3NURA 3LGGA 4GX8A 2F6KA 4E3TA 4RDYA 1YMYA 2A3LA 4WHBA 1EJRC 4GYFA 1FWCC 1P6BA 4I6KA 4PBFA 1NDWA 2AQOA 4IQJA 2YZ5A 4C6LA 1NDZA 1K1DA 3GUWA 1FWJC 1EJUC 1XRTA 3URNA 3LGDA 4LH8A 4ERIA 3WZ0E 4DYKA 4GK8A 4LFYA 4IH3A 1UIPA 5HMFA 2Z2BA 1KRCC 2OB3A 4H9YA 4R7WA 1EJSC 4J2MA 1I0DA 3S2NA 2OQLA 3OJGA 3ISIX 2DVXA 1IE7C 1FWIC 4H9ZA 2HQAA 3HKAA 1QXLA 4IFOA 4GY1A 4GBDA 3AUOA 3B0XA 1O12A 4NP7A 2I9UA 3AU2A 4C6IA 4H00A 2OGJA 1E9YB 3QY8A 2UBPC 3R0DA 3AU6A 2DVTA 3LSBA 4KETA 1FWHC 2Z00A 2GZXA 4C60A 3JZEA 3MJMA 4BY3A 3V7PA 4DZHA 3LU2A 4B90A 3EWDA 1FKWA 4DNMA 3URAA 1W1IE 2EG6A 3CS2A 3D6NA 4IGMA 3PNZA 2D2GA 1RAKA 3MDUA 3GG7A 2W9MA 4IFKB 2ZC1A 5HMDA 2AQVA 4C6MA 2RAGA 2R1KA 3OODA 4R88A 3HK5A 1A5NC 3IPWA 4R85A 1YBQB 3QY7A 4KIRA 5G4HC 4LAOA 1K6WA 2BGNE 1FWEC 3A3WA 4F0RA 2HNHA 4H9UA 4IG2A 1PB0A 2DVUA 3CAKA 2WJEA 3MDWA 4C65A 2GWGA 3S2LA 1S3TC 3OOQA 3IRSA 3IACA 4H01A 4EPKA 4C6CA 4JOMA 4M51A 3HK7A 3F2DA 2Z25A 2O4QA 3EWCA 4ERGA 2R1PA 3S2JA 1NDYA 3F4DA 3HK9A 4GZ7A 4KF1A 4MUPA 2Z28A 1A4LA 1EZ2A 1PTAA 4LAMA 2R1NA 1EJXC 3HM7A 3T1GA 4F0SA 4WGXA 4IGNA 1WXZA 4ERAA 1QW7A 4XD3A 4C6PA 3GTXA 4HK5A 5LXXA 3UF9A 4Z42C 1POJA 2Z24A 4CQDA 4CEXC 1GKPA 2Z27A 1YIXA 2ICSA 4B91A 1FWFC 5FSEC 2D2JA 2Z7GA 3FDKA 4PCPA 4ZSTA 3RCMA 4CNUA 1FWDC 2VUNA 4DLFA 3LA4A 2VHLA 3GU1A 1RA5A 4H9XA 1J6PA 1I0BA 3SO7A 2Z4GA 1V4YA 3F2CA 4DIAA 4QS6A 2Q01A 1P6CA 3IJ6A 4C6NA 3LY0A 3GIPA 2WJDA 4RZBA 4GY7A 4KEZA 3GTIA 4LCRA 4ZSUA 4C6DA 1A5LC 1YNYA 2E25A 3IGHX 1A5OC 1J6OA 3MPGA 4H9VA 4BKNA 4C5ZA 4V1YA 4WVXA 1M68A 1KCXA 3T8LA 3TNBA 3LNPA 4CNSA 2EG7A 2GSEA 1HZYA 3HK8A 4NI8A 2HBXA 3TN4A 3HPAA 3ITCA 3URBA 1M65A 1V79A 2QPXA 3BE7A 3LS9A 2PUZA 4LEFA 3WMLA 3GTFA 2QS8A 3MVIA 4P5UA 1V51A 1UIOA 4UB9A 2Q08A 3PAOA 4C6EA 4XD4A 3TN3A 4RDVA 2XIOA 4CEUC 4RDWA 3C86A 3HTWA 3N2CA 1RJRA 3S2MA 3O7UA 3MTWA 4GC3A 3WYZA 1E9ZB 4LCQA 4AQLA 3E0FA 4IFRA 2AMXA 1WXYA 2VC5A 1V77A 2BB0A 3IV8A 1BF6A 4GX9A 4IG2B 3UR5A 1R9ZA 4GXWA 4C6JA 3FEQA 2YB1A 1ADDA 1A5KC 1EYWA 4G2DA 2YXOA 1DPMA 2FTYA 4PBEA 3DUGA 3MKVA 1FKXA 4KEVA 3URQA 1R9XA 1RK6A 3NEHA 4QRNA 4OFCA 2P50A 4INFA 1VFLA 2VM8A 3GU2A 1J5SA 1FWAC 2VR2A 4QSFA 4L9XA 1POKA 3E38A 1ONWA 3OQEA 4RDZA 1V7AA 5CH9A 1RA0A 1RK5A 1NFGA 3PBMA 1EJWC 4J5NA 4DLMA 3QGKC 2Z29A 4CQCA 3K4WA 2FVKA 4KERA 4HJWA
chains in the Genus database with same CATH superfamily
3B3DA 5AOUA 2VX7A 3W1XA 3G1XA 3E3HA 4HZMA 1IEXA 1UR0A 3DDMA 2D2HA 4EPBC 3SCSA 2INEA 4F0KA 3GRIA 4GGBA 3NQFA 4HA0A 4RE0A 5TF0A 2O9TA 4FEZA 1BYCA 3UJSA 5HNNA 3C2YA 2WPGA 1J9YA 4XAFA 4H6QA 5LIXX 1EWDA 1H7WA 2GJLA 2Q8LA 2AL1A 4PE8A 1L6FA 3H7VA 3IIXA 1XW8A 2XH7A 5EYWA 3OP2A 1ZY9A 4AC1X 4UWMA 3A23A 3R10A 3D47A 3CIXA 5KETA 3ZT5A 4GH1A 1P7TB 1G4SA 3ZOAA 1PYFA 3VOIA 1PZ0A 2MUCA 3TCEA 3PR2A 1WDDA 2DSKA 4DJFC 1EH9A 5C9UA 1UH4A 3SGZA 4FF7A 3MKCA 4IMCA 3SDOA 3A6OA 1VR6A 3EOUA 1KRMA 2XH4A 4MAZA 4NQ1A 1CBGA 1C8VA 1BKSA 4IP4A 3O0KA 3TSDA 2PTWA 1IXPA 1EO7A 5LA1A 1XL9A 4RK8A 1DEDA 4ENLA 4KFNA 3EX1A 2PNKA 1LT8A 4HSOA 2ZRUA 4EP8C 4PRTA 1W2PA 3VABA 3EB4A 4Z2JA 4KESA 1LQ2A 4Z0SA 1XJBA 1EA9C 1JGMA 3S1GA 4UMBA 3T9PA 5FSDC 2Z1KA 3G1YA 4KEUA 3L4TA 1XXXA 3SCVA 5TNVA 4ZCWA 4BI5A 3K2GA 4GPNA 1SR0A 3REQB 4NRRA 4DPQA 1VHNA 4WDXA 2G3MA 4P7RA 2R94A 3ME3A 1TUXA 4J28A 2E9BA 2R14A 2WWCA 4HBKA 1FWCC 4HKPA 2PDYA 4GZJA 1BF2A 3KL0A 3LBCA 2OT0A 1FDJA 1VCFA 4C6LA 4DY1A 1WDPA 1KLZA 1W5NA 1K1DA 3LGDA 4DWSA 1GVYA 3DAQA 1FWNA 2Z2BA 3N2MA 2I56A 2OZ0A 4M80A 4IJCA 4CN1A 1HX0A 1Q45A 1DWHM 2PGWA 2EEXA 3HPSA 1QXLA 4U3AA 1AH3A 2J7BA 4ZTXA 3PG9A 2JIEA 2V5CA 2YA1A 4PUEA 5D2YA 3M0KA 4M6PA 4AW7A 5DLCA 2OO6A 1LORA 1FHLA 3N9SA 3EWDA 2VZSA 2CERA 3ITTA 5LKYA 3ZR6A 2WZTA 3OZYA 1JL8A 4PSPA 1OQFA 4IGMA 1RCQA 5E70A 2EAWA 2E9MA 1RZMA 1CGTA 1FQ0A 1ZBVA 4XV0A 1TWIA 4XZMX 4PFHA 5LIKX 1DJNA 3NEVA 3OYZA 1CLKA 2JIWA 1SFTA 1M6JA 3GX9A 3QMRA 1DJHA 4PEKA 5BROA 4R88A 3ZVHA 1S3HA 3HK5A 4FNPA 1F4HA 4BFAA 1W5MA 1D7KA 4QAWA 3K8MA 4J27A 2HNHA 1X6UA 4Z17A 3B04A 5CPOA 4FX7A 2ZWZA 4EOUA 1KGUA 4DJEA 1XPGA 4BF5A 3WLQA 5BXRA 1K9DA 4TX9A 3Q37A 1E5JA 3E5BA 3LPPA 3IVSA 1TB3A 1A4LA 1R7OA 4XB3A 4GFSA 5DRIA 4Z1BA 1XQKA 1W32A 1ZU8A 4PMJA 1QT1A 5LXXA 4MYXA 1I2PA 3CEPA 4JFWA 4PB4A 3RAOA 2ZRZA 2WHJA 1C91A 2F38A 3KE0A 1HL8A 3U8GA 1HN1A 3CC1A 4AHQA 2V63A 2AQWA 3LA4A 1CXIA 1C8QA 4H9XA 5E93A 1R3VA 1I0BA 1CLVA 1UW9A 2TPSA 1WAUA 3KTXA 2HNEA 4ZE5A 4WKAA 3QLLA 4O8RA 4S3JA 4UR9A 1Z9AA 3GTIA 5LNUA 4G1KA 3AYSA 5TIMA 4RNJA 2Y8VA 3CIWA 1A5OC 2Z1WA 1WNOA 3B9AA 3VIKA 3TWBA 3QMSA 2HS6A 3HPZA 3C3NA 4CVUA 2EG7A 3HK8A 3JUGA 4P2VA 4YCOA 3JVAA 1P7TA 3P80A 1V79A 3EDJA 3OW1A 4UB9A 2DQXA 2QNEA 3U0HA 5T91A 4LNCA 1XS2A 2R6OA 3G1VA 2WZEA 1OF6A 4Y9AA 3L2LA 2QF8A 3SQMA 2HISA 3MTWA 1Y5WA 4GC3A 2Q71A 3VDGA 4YYCA 1V3JA 3KWSA 1ZJAA 2VC5A 3WEZA 1R9ZA 5IBXA 3CHVA 2XVPA 3FEQA 3KP0A 4X3ZA 4MY8A 3E96A 4W85A 9CGTA 3AALA 2ATSA 1H61A 4O1BA 3IIOA 4WJEA 3S8HA 3R6IA 3NEHA 4HNTA 3WLRA 3NQDA 4OFCA 1UP3A 3GU2A 3NPUA 5XINA 1GUVA 1IHIA 1Z69A 1C92A 2WNZA 4F9DA 4D6EA 1CDGA 1PTDA 1XH0A 2A3AA 1WOAA 2HRWA 3ARUA 3SY1A 4CCZA 3BAWA 4MWAE 4UZUA 4AD2A 3W7JA 3SCPA 4Z2LA 1FWRA 3EKZA 2QCNA 5FIPA 1PX8A 2XSBA 4GQ0A 4PCFA 1EB3A 3S9IA 3CJPA 3KZPA 4QROA 3BO9A 3THQA 3REQA 3VFLA 4I9TA 3DG7A 3NG3A 1JPDX 4F4RA 1P43A 2VC7A 1O5RA 3ES7A 1YXCA 2D73A 1UD8A 2Y63A 5LHEA 2PGFA 1GONA 2ZKMX 4K7YA 5DRCA 3TTYA 4WOQA 1RQBA 1KRBC 3OLEA 2VDHA 2VZTA 4NSBA 4ZO8A 4GYKA 3W7GA 3GZAA 1OYAA 1G7VA 4K8GA 6PTDA 3DIPA 2KAUC 4JTAA 4A4AA 4DHGA 1B57A 3STGA 3AI0A 4E6MA 2EXOA 3ERPA 3KX6A 1SJAA 1P1MA 4BF7A 2DUXA 3PSWA 1GORA 3OU8A 4ASTA 1K6AA 3IJ7A 3MMDA 3GYCA 4ALDA 3CLMA 2J7DA 3QOMA 3LYEA 1S2TA 2HK1A 4Y9PA 3VCNA 3ECQA 4AEEA 1EPVA 3S2CA 4DPPA 3LOTA 1E6XM 1R85A 5GNXA 2IUZA 6TIMA 2X1RA 4ML9A 1E6NA 4C6QA 5A6SA 4RPQA 4A3UA 3VKAA 3GVQA 5KTLA 4AXNA 4HPJA 2QCGA 7TIMA 3MW7A 3B0UX 2ZYFA 4PA8A 1XYCA 3NDZA 3FS2A 1VQTA 2J9XA 3HPXA 2EJAA 1VS1A 3LPGA 1US0A 2OOGA 2L5HA 3BAJA 2I5IA 1X39A 2QJNA 2AL2B 4CCEA 4R7JA 1VJIA 2FDMA 2DT2A 5D9MA 2AKZA 2Y1HA 3CWNA 2GWNA 4H2CA 1KBKA 2UWFA 4BWLA 3UR2A 1HO4A 2E7FA 3EWYA 2GSHA 1TRDA 4R5EA 1QWKA 4DWDA 1VPQA 4X60A 1DHPA 4WHBA 5RUBA 5CZSA 3C52A 3S5YA 1H7RA 1Q6RA 1T5AA 3PJXA 3VX0A 1SVDA 3CZEA 2ZVIA 5AYYA 1XLKA 4AY8A 3KBWA 7ODCA 1XRTA 3KLKA 4ZB0A 1JFXA 1YDOA 3C2OA 3RO6A 3NL3A 3F5LA 3UD6A 4BQ4A 5AB3A 1QW9A 3MV11 5E9AA 4O8AA 3FJLA 2OB3A 1UR3M 4L1GA 1GPWA 1L6GA 4J2MA 4NI3A 2WXDM 1W3NA 1H3GA 3MUIA 4JZ5A 5FJUA 2IPFA 5H6HA 4CD5A 2PWVA 1LQ0A 3T40A 1XBYA 3NDYA 2CKRA 3UG5A 3QY8A 1M7OA 3VA8A 1ONRA 5HXMA 1NOFA 3CL8A 1XX1A 5DEZA 3VKBA 3VM7A 2GZXA 2EQDA 3MJMA 1XH2A 3A21A 3CS2A 3VKJA 3HQOA 3LLFA 4I7UA 2V9DA 4JYEA 4TR9A 1UH3A 4LS1A 3APGA 2Y88A 3ZJ7A 4H6RA 1VGAA 2RAGA 2X05A 2G8ZA 1NAL1 1I1WA 2F2HA 3PBWA 7REQB 3M7WA 4KIRA 3TC6A 3MHUA 5A8MA 1S1RA 5JMUA 2Y24A 1D3CA 2Q02A 3BUVA 4UFLA 1HP4A 4PGLA 1ZAHA 4E8CA 2FKPA 5FJJA 3HK7A 4L61A 4IP5A 4R9XA 4ERGA 1FWSA 2Q6ZA 1RH9A 3KOXA 1FCVA 4HA3A 1PS9A 1JZ2A 2RJHA 4OUEA 1CXFA 3GXFA 4DM2A 1E72M 3PJUA 5CJNA 1CXHA 5REQB 1W5OA 3H2FA 2FJKA 1VH7A 3T8QA 3MP4A 4JIQA 2DIJA 1UR2A 4KKXA 4AY7A 4E4PA 3W1TA 2WMJA 2YCEA 2DIKA 1I2RA 3UCCA 4LY8A 4QJ5B 4RNFA 1E6SM 2OPJA 5JUVA 3MT1A 1TZ7A 2QCEA 5LHFA 3ALFA 3A5VA 4PCPA 2XIJA 3WQFA 3PPGA 4TVUA 3OA5A 3LLDA 1AL8A 4LAUA 5G2WA 3L7RA 4KIEA 1TE6A 1A5LC 1WDRA 3WLIA 2WKLA 1OC5A 4H9VA 1M68A 2G5WA 1G0CA 1QRQA 2D3LA 4UR7A 3VD3A 1CGXA 4KWVA 1XBZA 4AF0B 1V3HA 4K6AA 3WEMA 4M24A 2NX1A 3KTCA 5JQ9A 1MW2A 3BE7A 4LEFA 3AYVA 3NZGA 3N4EA 3UA4A 4F8XA 3LD5A 2ACRA 2C0HA 4FLQA 4LBSA 3TN3A 1SSGA 4AYGA 1W56A 1P1XA 1JNDA 3P6LA 2OLSA 4PTDA 1XGDA 4LW7A 1TTPA 1KXTA 3SUTA 5A2AA 1X6NA 2BGSA 4IZGA 4IGHA 3GXTA 1X98A 4IPIA 1J0JA 2VEFA 5BRQA 5IHSA 5LGZA 3OVPA 4JQ1A 2CITA 3W7IA 3VCCA 1QK2A 2TRSA 3V0UA 1GQJA 2E1DA 3M0XA 4HNVA 2P50A 1KM2A 3FSUA 3F1QA 3WNNA 4N9BA 5LNRA 4LNYA 1FDYA 3MI2A 1U1HA 3WQ6A 2QW5A 1WKFA 5CZKA 2WZHA 2ZXQA 4K7VA 3UPMA 2AL2A 4Q4SA 1EJ7L 4Q4RA 1X96A 2BHZA 3ITGA 2EKCA 3QYSA 1R3WA 1UH2A 1IEIA 3CUGA 3NSMA 3H8AA 1UD3A 1OC6A 2E5BA 5FJTA 5HMSA 3N1AA 2DT1A 2P3ZA 1Q7MA 3W83A 1HJVA 2WCAA 1CT5A 1UQYA 1XWYA 3F4VA 1SQ7A 3PUGA 3QZ6A 4O4VA 1S5VA 1B5TA 1B31A 5A8QA 4DELA 1BTMA 1R6WA 5I09A 4R3UA 5MF5A 3W3OA 2J7CA 4LYPA 1YTEA 1TMQA 4M8UA 2I5GA 4HHMA 4L56A 4LF2A 3KP1A 2YDSA 3VMNA 1GW9A 3FXYA 3EWXA 2E28A 4K39A 1DYSA 2CZDA 5E1QA 5CPMA 4DO7A 2YCLB 7XIMA 1AZ1A 1EIXA 2A6NA 3K1GA 4XBJA 3W81A 4N2YA 1W5QA 3STCA 1PVNA 4H9TA 3ZR4A 2DZVA 3GC2A 5K9DA 3DHPA 2FPYA 3EGJA 1J2BA 2HJPA 5ABHA 2BXZA 3VOCA 3VNLA 3D46A 4O17A 2NLYA 2A2IA 1MYRA 2FGBA 3W2KA 1A5MC 3SECA 1TWZA 3JU2A 1GKRA 1OEPA 9RUBA 1S2AA 3BMWA 4ZB5A 1JPMA 3LCHA 3VNKA 3WK1A 7REQA 2VKZG 1BVZA 2XVNA 1L2UA 1SFJA 4C1LA 3TXZA 1VFFA 3O15A 1RLDA 1WUFA 1RR2A 4OV9A 4FOJA 4AD4A 3R43A 5HNUA 3EPNA 2WK2A 3DFPA 2IKHA 1NP2A 3H2CA 1QBBA 2HPIA 3NQEA 5L9FA 1V5XA 4HU3A 3AMKA 2ACQA 4WDWA 3P74A 4L1WA 4DB7A 3XISA 1TV5A 1KRAC 2D0GA 3R58A 1Q7ZA 4B3LA 3PFMA 5REQA 4YVXA 1TR1A 2GVGA 4JCMA 1O1ZA 4IQJA 4NXSA 2YZ5A 1Z7AA 3MHFA 4D9PA 1DXFA 3HG2A 5M1TA 3TQ0A 2VD8A 4WRHA 3WD1A 2CWXA 1F5ZA 2ZRVA 3EEZA 5AYZA 2Q3OA 1LQAA 3KVKA 1O5XA 2TAAA 1SMDA 1KRCC 4S3EA 3SCNA 1HVQA 4RNHA 1QU4A 2DVXA 3MUY1 4L4LA 1GT8A 1REQA 4H41A 2PWHA 1GJPA 1ZBKA 4YTRA 3GQYA 2J6XA 1IXNA 2RUSA 3IUHA 4HOXA 1QNRA 1R7AA 1SU5A 2VEGA 1V6UA 3FIGA 2WSQA 2XM1A 4QLLA 1US3A 4AF0A 4DNMA 4IXXA 2E67A 2HE5A 4KH2A 1TZZA 1RAKA 3MDUA 1S5TA 5EB8A 1VIWA 4GRSA 2WCGA 2JALA 4S38A 1L0PA 1Q6DA 3BLDA 1IT0A 4W93A 3UNTA 3TA9A 4MNKA 5BXPA 2V3DA 3IPWA 3VFCA 3KDNA 3F03K 5I23A 3LBMA 5I3KA 5F1VA 4P7LA 1GOXA 4L5ZA 2VOMA 3TXVA 1UR8A 2IQDA 4NYUA 4JFSA 4IIDA 2D1ZA 4M51A 3B9NA 2O4QA 4FNQA 4Y7EA 2X0YA 3TX9A 3WG6A 4NYYA 4MVAA 3IJ9A 1U1JA 4AZHA 1EZ2A 5D03A 3V3WA 2Y5JA 1QI3A 3EWUA 1EF3A 2P8CA 1I2OA 1FXPA 2ZTJA 1CIUA 1POJA 3W7DA 3G8RA 4KRZA 2ICSA 3WLJA 2YSWA 1DWJM 2WZMA 1MO0A 4GHRA 5I78A 2GQ8A 1AFSA 5AYIA 2CLIA 3PWAA 2PSNA 4L4OA 3RIKA 5A95A 4Q8MA 3SO7A 1TO3A 2XU2A 1GHSA 2PBGA 3FOKA 3NYDA 3UESA 4F0MA 5A3HA 4AZCB 1RP8A 1TPFA 2E25A 1S38A 1GQIA 3H2OA 3WDIA 3S5OA 3VOFA 1BG9A 3L4ZA 3UETA 1W9DM 2BXVA 2V8ZA 3GNXA 2VEMA 3N2TA 4CNNA 3WN6A 2Q8XA 3AIRA 1F76A 3PPFA 2XHYA 1OCNA 3BLPX 3BPWA 4DUOA 4J3WA 4TX8A 1ZSXA 2PF8A 3BOLA 4G5DA 2DH2A 3VAVA 1CYGA 2YCLA 5CG0A 1DQXA 2PLCA 3KTSA 4FOUA 3O7UA 1KTCA 4K1GA 1E9ZB 4LCQA 3GFZA 3BWWA 4Z2KA 1Z6KA 2BASA 1BYDA 4GXWA 4O1EA 2OLHA 1W1TA 5H8MA 2C18A 3MHGA 4O1CA 3KDOA 4LUTB 1KLYA 1RBAA 4AZ5A 3E9AA 3K8LA 3TVAA 4TIMA 1LRTA 3LHVA 1T8XA 4WDUA 1B90A 3MA8A 4M81A 3M5VA 1J5SA 1RD5A 4HNOA 4O19A 3IJ8A 2BLEA 3M0VA 4IXHA 3TH6A 1UCWA 1UPMB 3KL3A 3RR4A 4J5NA 2QGYA 3SSJA 2QMJA 1E6QM 1UKOA 5C6MA 2ZFAA 4HJWA 1T99A 3K4DA 3TN6A 3N73A 5E0FA 3N6JA 2PGRA 5CGQA 4ML4A 4OJYA 2OEMA 1I60A 4LANA 4O13A 3F4NA 3ES8A 3HIJA 4OUIA 4RLIA 5EY5A 3W22A 4S3GA 4POCA 2EPHA 1Q8AA 2WHLA 3KBMA 3M0IA 4D2JA 1XKJA 1UQZA 4X0NA 4C6BA 1E1FA 1ZJIA 3B4UA 4MWAB 1WX0A 1ISZA 1L2QA 3UBPC 2J27A 3GDRA 3QHNA 1F73A 1G69A 4E3VA 3KCJA 4UTTC 2PWUA 5HUPA 3G0XA 1U33A 3GW0A 5CC3A 4FXFA 1XCWA 3VNJA 4NVTA 4DZIA 1G01A 5HATA 3GTHA 2CPUA 4M0XA 3AIWA 3FJNA 4A05A 1QOQA 3BCFA 3WCZA 3GXDA 3C8FA 1H7OA 3SFWA 4JPGA 3CASA 4JHMA 2Y7GA 3W7PA 5FOOA 1VFMA 3RRXA 1W31A 2OTDA 2QCDB 1MEWA 2ADAA 4M56A 2C15A 1Q6FA 2ZX7A 1VFUA 3LGEA 2OCZA 5F2LA 2VR4A 3TUUA 1UYQA 2BOGX 2IXUA 3M43A 5K7JA 3M0MA 2Q8ZA 4LVBA 5EGRA 3WMCA 3ZLHA 1PXGA 4FO4A 4PFMA 1DIKA 4TQTA 4UNLA 1KXQA 1OCBA 3NQ8A 3RMJA 1T40A 1F4AA 3TNOA 4IQLA 2A3CA 4FPSA 2P3EA 3S9ZA 2F6XA 4JL1A 1XIJA 4JQ3A 4C6FA 1DHKA 3WENA 3TV8A 1Y5VA 3ZLFA 2C71A 4U33A 3CQKA 5J5DA 4O11A 2AMGA 4LCSA 4H8UA 1E1CB 3TDFA 3TE9A 2J74A 4DF0A 2HS8A 3V5OA 4C7FA 5FEPA 4MB4A 4DBUA 3SEPA 1C90A 4O4WA 2GGGA 3C0QA 4ZXOA 4RDYA 1YMYA 4PUUA 3TA6A 5G1YA 4ATLA 1CGVA 3LDVA 6TAAA 3LV6A 2DSWA 4MUZA 3VK5A 2O92A 4RW5A 4O15A 2DW7A 4GWEA 2YLAA 4ZVJA 1LL6A 4GK8A 5FF4A 2NQ9A 3W0KA 3S6DA 1XLFA 1IT8A 3IV3A 3N6HA 5A6BD 1R3RA 3LHUA 1DVJA 1JDEA 5ENLA 1EXBA 4CU7A 4BQ3A 4FALA 3LUTA 4B4HA 1H51A 1TX0A 3P0WA 4E38A 5HOSA 3QVQA 1T0OA 4AZCA 1W5PA 3PTQA 3WDJA 3LEPA 3WY1A 1YE6A 3PP7A 1C8XA 4IIGA 1UG6A 3GHTA 3H26A 4UTUA 1LJYA 2XFFA 2Z00A 3CBWA 4YYFA 2JKPA 5CZ0A 2G97A 5D04C 1DQUA 3URAA 4US5A 3W2MA 5LGXA 4IUGA 3L23A 4D6HA 3C56A 3HBLA 4UMCA 4JTFA 3VGFA 1TVNA 1ML1A 1A5NC 3QQ1A 1YPIA 2DFAA 2NSXA 4WJXA 4W86A 2YA0A 3TK7A 1VIZA 3VUSA 4IL0A 3MSGA 2FIQA 3GNNA 4ORMA 1VYPX 2OXNA 4G56A 4HT3A 5D32A 3S2LA 1PPIA 1GJWA 5GNYA 1HQTA 4LUTA 3IEBA 5CPSA 5EA9A 1N8FA 2PDIA 1Z41A 3F4DA 3HO8A 5AVHA 4AY1A 2GVLA 2VJXA 4J1OA 4JTHA 2BDQA 2ISSA 1JCNA 1H0IA 4IJBA 4IGNA 1H1YA 5A8NA 1RQHA 3BAYA 3GAKA 5LNSA 5BRPA 3UGVA 2G3NA 3K30A 4DJFD 4U4MA 2WSRA 2EPOA 3BXWA 1FWDC 1YQ2A 2OX1A 3LTYA 3L4WA 4JTLA 3SQLA 4OVXA 3NPXA 4NZJA 2FH6A 3RLGA 1JYWA 3F2CA 2YL8A 3QV9A 1A0DA 3WK3A 4MWAA 4YMZA 4RZBA 3PJWA 4KEZA 4YVVA 1IWAA 3TAKA 3VNYA 3I4EA 3MPGA 4EX4A 5KITA 3NM1A 4V1YA 1OFPA 3I10A 3T42A 1DIDA 3TNBA 4XVEA 4GQBA 3TYAA 1R8LA 5AY7A 4ACYA 3GS6A 1Y65A 4D6GA 4Q4KA 5BYWA 2O9OA 1KFBA 4N4QA 3LENA 2FZMA 1P0BA 2YX0A 3NR0A 3DHDA 2ZBTA 1KFEA 4P5UA 2QR6A 5HA7A 3LHTA 4DNHA 1J0YA 3GYEA 1UJPA 2XYLA 5I24A 1AH4A 3NSXA 1K4HA 5HPOA 3HTWA 1G1YA 1FA2A 3FKRA 5CGTA 3ZS4A 4EIVA 3WYZA 1UJQA 4C90A 3N17A 3QRHA 1PCKA 1PAMA 3ZMRA 4LVFA 1JYVA 2A7NA 3DOPA 4LQ1A 2QCDA 1BAGA 3RPDA 2QUUA 1IR2A 4QSHA 4X63A 3MKVA 3EOEA 4GVGA 1B1YA 4J3SA 1O1HA 1RK6A 3EMZA 3CZGA 4O16A 3ARWA 2ZADA 4UNIA 3WNPA 4PN2A 1E6PA 2OELA 2QUNA 2X41A 4ILSA 4JDBA 3MKKA 1H63A 2FVKA 1ITXA 1Y8BA 5E09A 3ZIZA 4LALA 2PTXA 1MFUA 2J47A 3W4RA 4Q7NA 2ALRA 4ZTYA 4DXKA 1KXVA 4DJDC 2X30A 4WY0F 4FR1A 3GG1A 3CIVA 4PB3A 1E1CA 3W7LA 4NX0A 4YN5A 5JH1A 1QHOA 3B8DA 1PUDA 4X2RA 4UTWA 1EDTA 4PL2A 3UP8A 3W00A 4CNOA 1H5YA 2P5NA 1GYNA 4I90A 1WKYA 3GD6A 4XAZA 1UA7A 2ZUMA 1JR1A 2E6YA 1MMFA 2YL9A 3LX9A 3P2VA 2NQLA 1CEOA 2DSZA 5FJOA 2VFHA 3PS7A 2QQ6A 4Q4OA 3CTTA 1LOLA 4PMYA 2E5CA 2VFIA 5C2CA 1JPIA 5JU6A 1P0DA 3SY8A 1YDNA 4N42A 3DFTA 1A5UA 2QYGA 2H6RA 4F2TA 1N55A 4XUGA 2PP0A 2PTYA 4KGJA 3ICJA 4QE4A 3QTGA 4XAPA 2W62A 2PGEA 2UY4A 1H2JA 3NTYA 2ZZ7A 3CHFA 5DQPA 4EACA 1BG4A 1VBGA 1BKHA 4F48A 4W7UA 1V0NA 3KVJA 2VRJA 1Y0EA 2HXTA 1BGAA 2CHRA 1R9YA 4B2DD 5AHMA 4GG9A 1I6NA 3E2SA 4O0QA 5E5CA 2PDNA 5KZDA 1B4EA 2RFGA 3B9DA 3QH2A 2QEEA 4IX0A 3SN4A 2P1FA 1A3XA 4PZVA 3RLVA 1LTDA 5FAJA 4XWUA 2QJIA 4DYJA 1RCOB 4PB5A 4AD0A 3W53A 1JDCA 5TAOA 3CL7A 3OG3A 2VCAA 1EJRC 2VX5A 2J8GA 4FR6A 4GI8A 3COTA 4I6KA 1KD0A 3MWAA 2TYSA 2AQOA 1AVAA 1E4IA 3UNDA 3GUWA 1FWJC 3URNA 4I8DA 4LH8A 2RDUA 3WBXA 3AFBA 1FP9A 5M17A 5HMFA 3AHTA 1TTJA 1PKMA 3VD4A 2QAFA 4MYAA 1AL7A 1A3WA 1JUKA 3QW3A 5EBUA 3GB6A 3KRZA 1HKJA 3MP3A 4MNJA 4LX4A 3WELA 4GBDA 3EA1A 3B0XA 4NP7A 3AIBA 1NWRA 1GEQA 2IXVA 1XDJA 3FX4A 1W9PA 2DVTA 4MPQA 1FWHC 3C2EA 3WH5A 3L65A 4LUJA 3E0VA 2B7PA 1UZ1A 4GVFA 4K3ZA 2VQTA 1U30A 5T26A 1HL9A 1JD7A 1KM0A 1TQJA 3IWPA 1TV8A 3STEA 4DO4A 4UTWC 3AZTA 4FIQA 3XIMA 3ITXA 2XIIA 1X8FA 1QNOA 4BR1A 2PURA 1AA1B 3BJFA 4NZFA 4FK9A 5CBIA 1W3KA 4GBUA 3HQ1A 1U5VA 5A94A 1BD0A 4WJ8A 1ZQ5A 2A7RA 4R7OA 1KBBA 4H6EA 4Z1YA 2Z25A 3EB3A 3A5FA 3NOEA 3JR2A 4KWSA 3K13A 4ZB2A 2WW5A 4U10A 1XDLA 1A5BA 4JKLA 3W27A 1XLEA 3S1WA 1R3YA 4A29A 4IOTA 3WJXA 4UFMA 3UF9A 4Z42C 1GNXA 3M07A 1JRBA 2F9RA 7ENLA 2YPIA 5IM51 3P62A 4EXBA 1H09A 1XV8A 4O1FA 3PBGA 2XVLA 3FDKA 3NQGA 4ZSTA 6XIMA 4CVWA 2VHLA 3VDAA 3EYPA 5LNWA 3CQJA 1IZKA 1V4YA 4Z1DA 2PRHA 3BLLA 3PB2A 5I79A 3IAQA 1TTQA 3O63A 4GJJA 1XIDA 4A6GA 1J0ZA 4Z1AA 1IF2A 4HZ8A 3UXLA 4IMEA 2A3EA 2X1IA 3KFTA 3W71A 2CHOA 1LROA 3XINA 4J7RA 1OGSA 3GTNA 2VGGA 5C0QA 3W28A 5DELA 1JXKA 3MU7A 1JYXA 4OE7A 1J0IA 2DZAA 3MUZ1 5C2GA 4B5XA 1QOPA 3IGXA 2X42A 2WCSA 4RDVA 2B31A 4JQ2A 3N2CA 3W74A 2VFEA 4O1AA 2ZVRA 4DEFA 2AMXA 4JD4A 3NO3A 1AD1A 4GFIA 2PD5A 1QI5A 3EOLA 2ACUA 3WF2A 3M46A 3WQ8A 3ARVA 5CPLA 3WSUA 2HK0A 4JTKA 5CPQA 4KEVA 4DRSA 1R9XA 1A50A 5EFFA 2QVHA 4AAJA 1DKWA 2B7QA 4PUDA 4HVXA 4O1DA 4N4PA 3THDA 3U5YA 1UA3A 3SJ3A 2A3HA 4ZQMA 1SO5A 2GJNA 3VIHA 3GDTA 4JX6A 3PBMA 1NFGA 4GUJA 5I3HA 1W17A 4UUIA 3UQNA 1W8GA 4I3GA 3D3AA 2PWEA 3V16A 2VVNA 1N8WA 2H90A 4JIHA 1NELA 2CEQA 2ZRWA 3LHYA 3WD3A 1KCZA 3H2AA 1E70M 4XZHA 3W6MA 3WLTA 1IYXA 5GPRA 4LYQA 2Y61A 1TRIA 3A4WA 3G5EA 5G2IA 2G3FA 3H4XA 3PANA 3M5XA 1NWSA 3MCNA 2OFJA 4AB4A 3T81A 3G2GA 1KTNA 1LM1A 1EOMA 3G1SA 3W01A 4JNZA 4ROPA 1DTUA 5HPCA 5JBFA 5GJMA 5D2XA 2QJHA 3CYJA 3TJLA 5IFTA 3WF0A 1WZMA 1OYCA 2JK2A 1NH6A 4E0CA 1B3WA 1OK6A 3CXOA 4MDOA 5I3IA 3WD4A 4CLMA 1GVSA 4PODA 5HWJA 3M44A 1QR7A 1L8NA 2C91A 3HN3A 1JRCA 3L0GA 1ZZMA 3H7RA 4LBRA 2FB3A 4E2VA 2P76A 3IVUA 1CB2A 3MZ2A 3LI1A 4HK7A 4RE4A 4QHRA 4AVOA 3FXGA 3TYBA 1CGYA 2HZGA 3PZIA 2OKTA 2VEKA 2Z1BA 4LC6A 1PYMA 1SJDA 2NVDA 5C8BB 4QG6A 1O6IA 2ZZ1A 4J3VA 3N12A 1IIGA 1XUZA 3N2XA 3R7MA 3F5KA 3U57A 1TWWA 2FZ8A 3CB8A 4JIRA 4OECA 3VGBA 4V33A 3GDLA 4AD1A 2ZRXA 4GA8A 1LBFA 3CWHA 3LCLA 1QUMA 4YXGA 2BOEX 3UGRA 3PAJA 4EWJA 2R1LA 5A6TC 2GJXB 1XLGA 1EQPA 2OGYA 5CSYA 4YL2A 1H41A 2W79A 3AZRA 1TQXA 2V5DA 2WSPA 2PRLA 4CD7A 1IEWA 2CBIA 3SM0A 4OGZA 2V67A 5BW6A 1YPFA 5H91A 4TO8A 3NZRA 1SZGA 4ORIA 1DE5A 1B0IA 3TU9A 3RX2A 2HXUA 5IXEA 1V6TA 3RRAA 4MJ2A 1VFTA 3MO7A 4F40A 3WH6A 3DG6A 1HNYA 1Q4WA 1W1PA 3ABZA 1CECA 3A9IA 4JFUA 2VT0A 2G3JA 1Z3NA 3WFAA 1NF0A 1WO2A 1S5NA 1Q6EA 5C71A 4WCJA 2BVTA 1OT1A 3OJGA 2ZA2A 3BLEA 3WNOA 1JZ5A 2PE4A 2YL5A 3KW3A 2YXXA 5D09A 3NGJA 3SFKA 2G41A 3CB3A 3EXSA 5DANA 4GNJA 1KBJA 3GWQA 1RALA 4KETA 2DV0A 4C60A 1QK0A 4BY3A 1J0HA 3THUA 2RKXA 3LU2A 4B90A 4L1XA 1FKWA 4LU0A 4L7ZA 4GUGA 2ZZ5A 4HNNA 4UQDA 1W1IE 3PNZA 2I16A 1GQKA 2LLEA 3HV8A 2DU2A 2HVNA 1VBRA 4F9JA 5HMDA 1HKWA 1J11A 4HCHA 5A2CA 1YBQB 2QLYA 1S5MA 3VU2A 5FF3A 3RX4A 3WJYA 4GXMA 1YYAA 3AS3A 1E9LA 1GOQA 4AMCA 2JF6A 5C7VA 4CD6A 4QQUA 4W7VA 3WD2A 1E9IA 4BA0A 2F2KA 4K8EA 3IRSA 1ITCA 2TSYA 1AQMA 4NKCA 3DU0A 3LZ5A 3THCA 4CKQA 3H55A 3FN9A 1KC7A 4JIEA 1I9CB 2OYKA 3GHUA 1NDYA 3E2QA 4KF1A 2R1NA 4U5KA 3T1GA 1G4PA 2VZUA 4WGXA 4L64A 3PZTA 1QW7A 1JEZA 2VFFA 2YCKX 4J3XA 8CGTA 4KRTA 3EWZA 1ZFJA 3KBJA 1PZ3A 2DZTA 1M3UA 2GQ9A 2JGQA 2NV2A 1B3XA 3DKLA 5FACA 3ARPA 5JBEA 5EMYA 3WH8A 4KWUA 2NUYA 5B80A 1WUEA 3UZZA 2QCMA 4Y8FA 4H8VA 4MKVA 2BBFA 4M29A 4CU6A 5ECUA 4BKNA 1GOKA 3PJTA 1N7KA 1DE6A 5HWNA 1X8CA 1NTHA 3EPMA 1WP6A 4H19A 4JKKA 3MC5A 5B7ZA 1V6WA 2H8ZA 5HBFA 4XZ9A 1PKLA 2YDAA 4XUYA 3LZ3A 4QIUA 1NVMA 3EZ4A 2EHHA 3VDBA 1L8PA 1UIOA 2BTMA 3W2UA 1A5CA 5CSSA 1VF8A 1KKOA 3N18A 1F3TA 2CBUA 4PUKA 3VE7A 2C79A 4P8VA 3S83A 3UZJA 4AQLA 5JH2A 3D0CA 3ZR5A 3UCDA 3EMCA 3NQVA 2BB0A 3CAWA 1TELA 3S1VA 3AMGA 1RVGA 3QN3A 1JQXA 1VKFA 3TTQA 1QNPA 3TAOA 4Y9NA 3C2VA 1C9DA 5D30A 5LSMA 1A5KC 1Q3NA 5C9WA 5JXQA 4PSRA 3H54A 3OLDA 4W9TA 4FLSA 3ELFA 3B8UA 1J8VA 3URQA 1AW2A 1LYXA 3O8AA 3CQIA 1EZWA 3U2EA 2BXYA 1VFLA 3WUEA 1KW1A 4FNUA 3GKFA 1WB0A 3VIPA 1AMYA 4ZZ9A 5CC7A 1H1NA 4M19A 2G50A 4YPJA 2FGZA 1UWQA 1XG4A 3IS4A 4YHGA 4HP5A 1UZHA 4YJ5A 4DO5A 1A5SA 4LS2A 2NX3A 5AC5A 1W9XA 4UFHA 3RLHA 2GJXA 3AMLA 2FVMA 3E2VA 1E73M 2CNCA 2OZ3A 4QLJA 2V5BA 3O0FA 1EYEA 1W3LA 4JQAA 3C3UA 4A3QA 3QR1A 1IGSA 4RJEA 2D0FA 4JIPA 2F61A 3W02A 1E4NA 4PMNA 2OQHA 1WKEA 3EX4A 3IJIA 4JCLA 4AIOA 2QPSA 5C7HA 3CUIA 2J8TA 2FFCA 1XM3A 3NFUA 5HMEA 3CV7A 1SO4A 2OR2A 4KCVA 3TJXA 4JN6A 2QEZA 4EF8A 4ZO9A 1Q2RA 1KM3A 4PRWA 4IM4A 1T96A 4F2BA 4HNLA 4GJIA 5DF0A 2XIQA 3M64A 1LRNA 3F4WA 1YDYA 3ATYA 3MSRA 5BOOA 1V7YA 2Y8KA 3H6OA 2WMFA 3VO0A 1FY6A 4LUSB 3F2BA 2NX9A 2WC4A 2CCRA 4Q8QA 3W1QA 1KFJA 4O53A 1DOSA 5D9OA 4BEQA 2WMGA 2ZZ2A 5AZ0A 2XWDA 3M0JA 3P84A 2CWNA 3VOHA 1GOWA 1Y5XA 2X40A 2XPKA 3BQ5A 4XZBA 2ZZ3A 1JPHA 2VUYA 2VX6A 4ZEPA 5AHNA 1YBQA 2A21A 3W38A 1ZBWA 1JI2A 2QDEA 1R30A 1KTBA 3AJ7A 2PCEA 2BHYA 1RXOB 2OEKA 2C6QA 3DFYA 4QEHA 1K8ZA 1OFDA 2J78A 1GKQA 3GHRA 3P67A 1TPEA 1JDFA 1SMAA 1NJJA 2Z6JA 3USBA 1OX5A 2VGIA 2WSKA 4UOQA 1U1UA 2X2GA 1FFRA 3L4YA 3QKEA 4FB7A 3MYOA 3C8NA 4J3UA 3RN6A 2OYMA 5I7GA 3E6EA 4OBSA 3NURA 1DIOA 1P0KA 4ZOCA 3ITLA 4E3TA 1Q6OA 4GYFA 4LSBA 1EUNA 3BZGA 5F2GA 4S3AA 4UCGA 1KBLA 1H50A 3SBFA 1DJZA 5K9CA 3ARQA 2ZE3A 2B4GA 3E49A 1E55A 3WQVA 3UWZA 2CKSA 4JAWA 4H9YA 5EMLA 1I45A 4YCPA 3P5ZA 4KCWA 4FNSA 4M5PA 4JY9A 3GXNA 2VWTA 1XCXA 3AS0A 3W75A 4B5WA 6XIAA 4JR5A 5EMKA 4GY1A 3QSRA 2AOSA 1JJKA 3E1F1 3AU2A 1NARA 4CQ9A 5IFPA 1E9YB 3G0SA 4PUMA 1H7NA 4HOWA 1ELSA 3SIZA 4O54A 1GVIA 3V7PA 4HU4A 1NQ6A 4UZSA 2E77A 2X09A 1FCUA 2EG6A 1WZLA 8XIAA 1XLLA 3RMEA 7PTDA 3CHEA 3UZXA 3EMQA 3H23A 2DGAA 3G1AA 4GNKB 4AX7A 4GZEA 4CQAA 4B5VA 3LG3A 3EPOA 3IVTA 3SN0A 1VBUA 5TD4A 3PN8A 4Y6GA 3N34A 1N8IA 4NZ5A 3AMCA 1OFOA 5CAKA 5I03A 2ZQ0A 3CPRA 4H9UA 3CAKA 3C0LA 1T41A 2QPUA 3TYZA 4JOMA 1FVPA 3WL0A 4LVDA 3H22A 3PZMA 3BAKA 5BWFA 3O6AA 3N15A 3QBUA 1J18A 1XISA 8RUCA 4HN4A 3I68A 4F0SA 3AYTA 1TV2A 1HKVA 2YDRA 4Q4QA 1O66A 4CQDA 4CEXC 2XFWA 3ZVIA 4GMEA 3QFWA 1SYTA 3POCA 1UZDA 4HJFA 2CXEA 3V4BA 4MZ1A 3GU1A 2W5FA 3OZPA 1KCLA 1B4KA 1OSEA 4PTXA 1TMLA 1Z44A 1D3HA 3W72A 2WJDA 1W9BM 1K9FA 4JGDA 1CZ1A 4P8WA 1ICQA 4DF2A 4QP0A 1GG0A 5CPNA 4RV3A 2PWFA 2BX7A 3L9CA 3OIHA 3P61A 2BMBA 1TSIA 3TYCA 1ZUAX 3NXLA 4IHCA 2HBXA 2E5DA 2ABBA 1QPQA 2QF7A 4TUFA 3ITCA 1O4UA 1Z48A 3PPHA 1DIEA 2QHAA 3W84A 3KL5A 4KRUA 4JTEA 4YS1A 4C6EA 1OVDA 4XD4A 1OD0A 3B05A 3TTOA 2HE8A 3TC7A 2QDHA 1JUBA 4YLWA 3E0FA 5CKSA 4LUSA 2Z2UA 4DBWA 4GX9A 1MXSA 4YTTA 1TWSA 3OHMB 3B8VA 1K7EA 1JF6A 3U7BA 3KRBA 1B54A 4E2DA 1J12A 1BVNP 2DQWA 1FWAC 3MSDA 3WLKX 2SFPA 3ZO9A 1V7AA 4JNMA 1V8EA 4ROQA 3J7HA 2NUXA 4KERA 1QNSA 1FRBA 3M0LA 4GUHA 3AYRA 4OWGA 1HJSA 2XN2A 3TR2A 3VIMA 1IIHA 3R79A 4BZYA 2XVGA 3L66A 1XIEA 1UWUA 2I17A 3EWWA 1MW1A 5HR6A 3C2RA 4UTKA 2V69A 2IKGA 2ZXAA 2O4MA 3GO2A 8TIMA 3FSTA 3ZJ6A 4RXFA 2XH0A 2W91A 4XIAA 4S3KA 4Y2WA 3KUMA 2D20A 2BY3A 1SW7A 2QIIA 2D2OA 2F84A 4BHYA 3R1ZA 3DGBA 4Z0JA 5DBTA 3Q45A 3KRSA 2NUWA 4D6FA 8A3HA 2ISVA 4J3TA 4M1RA 2NVCA 3VM5A 2V82A 1E0VA 2F8QA 3A4JA 1OF8A 1WYIA 1OIFA 4M82A 3UZYA 4E2BA 4UBPC 3CQ0A 1J79A 3BC9A 4XAGA 3KBVA 3KOWA 1LZOA 3W7OA 2E1WA 4BK9A 1VCVA 4O12A 3VDCA 3ITOA 5C54A 3B03A 4UOJA 2QDDA 2FYMA 1UBPC 2JFEX 2AGKA 3W23A 1EC7A 4ZO6A 1PV8A 1HGWA 5M3WA 4JN8A 1HGYA 2C19A 3UFYA 4GH3A 3QHOA 3DZ1A 4ATDA 1EJVC 2DZUA 1YLVA 1KM1A 2HBVA 4MJZA 4XVDA 3P7YA 1NWUA 2YA2A 3KM8A 2QAPA 4LAKA 1PHWA 2OMAA 1C7TA 2YDQA 1DWAM 2G95A 3RG6A 2WJFA 2IW0A 4DI8A 4O0KA 3OO2A 2DUZA 2XFYA 2PDHA 1AD4A 1OZMA 4IQEA 4NHVA 2NLIA 4JX4A 3E2RA 3PWGA 7A3HA 3KWXA 4D1JA 4AIUA 4RR4A 3QGVA 4YWSA 3THAA 3B0VC 2A3LA 2D3NA 3O06A 2H9AB 4A3YA 4IMGA 2EPKX 2BHUA 4PEEA 5K9XA 4PBFA 4NZ3A 1ME7A 4EAYA 2HVMA 3KCOA 3GVWA 4KEMA 2J62A 4LFYA 4HZ6A 3B97A 3KAOA 2C16A 2DP3A 4PTMA 3DYOA 4A21A 1I0DA 1M53A 3PG8A 2ON3A 2QUMA 4D8ZA 3GG0A 1HJQA 1VCGA 2HQAA 2FHFA 1EP2A 4Q4PA 1UD2A 4MJ4A 4QDPA 4LYRA 3WFZA 3WO8A 3HMJG 2VEIA 4L80A 3UR7A 1VHCA 4C6IA 4DYEA 3W24A 3L5AA 3SRDA 2ZTKA 3BVJA 1XR2A 1AJ2A 3AOFA 2IKIA 3VD5A 4CCCA 3PUOA 1BHGA 2PDFA 4XBSA 4B16A 3DYPA 2PDQA 1HKKA 3N9RA 4UQEA 1NOWA 1OD8A 1SUXA 5CJMA 3LRLA 1XIFA 1V3MA 3ZSTA 3RFAA 1LLZA 1Q6LA 2FMNA 1HFBA 3W26A 2YBVA 2YFNA 2UY5A 2ZC1A 3TR9A 3GDKA 4Q8UA 3WLLA 2C14A 1JCYA 4DJDD 2ZUVA 4JQ4A 3OGRA 4DWSC 1CWYA 1Y7VA 4GIEA 2BY2A 1JI1A 1UKTA 5H2ZA 1PB0A 2ZZ4A 4WEVX 4C65A 3VGGA 1EHNA 4YWIA 3ARRA 4H01A 4EPKA 4P8UA 4Y90A 3UY7A 1VEMA 4S3BA 4O50A 1TR9A 2J79A 4LGXA 4PMVA 1VLIA 1TZ9A 1EJXC 3BLOA 3DFQA 2PF0A 1WXZA 5IOBA 1EEXA 4O52A 3RM8A 3V35A 2UY3A 2ZE0A 4BI7A 3DGRA 1DJQA 3M16A 1QO5A 2ZA1A 3WUFA 4H83A 1FHVA 3L5LA 5FSEC 4E5TA 3HGOA 3CPUA 3AMDA 4DLFA 4GUIA 1QDSA 4PMUA 5CBBA 2WMKA 3WQWA 3BLIA 4Q7BA 4FOKA 4DIAA 2X1TA 2V5LA 2CLPA 4LB3A 2PTDA 2PC8A 4W8LA 2Z1SA 2GOUA 1VJZA 2AAMA 1UKSA 3UYIA 3PM6A 3VKDA 1GW1A 4DJEC 2FJUB 3DBPA 3QC3A 3ANVA 3W1RA 1MFVA 3O1NA 5HAOA 3HPAA 5D05A 3GZ3A 4D8AA 3MVIA 4N02A 4FIRA 2QJGA 3UERA 1JUEA 4HB7A 4GIRA 5DT5A 4KWWA 3GC5A 3S2MA 4FAMA 1GYLA 3DC0A 4RL3A 1IXQA 4NUWA 2YB1A 2D69A 5A6LA 3RU6A 4H6KA 2Y6ZA 1BQCA 5DXYA 3WF3A 3ITYA 3GVVA 3U6WA 3OZOA 1KKRA 4K36A 4UTJA 4HN8A 2ASHA 1GTEA 1QWGA 2GSJA 3QZEA 5JIWA 5CG7A 3ZYZA 1H60A 1ZENA 2WKGA 4AWEA 5A2BA 1D3GA 3K4WA 2C1HA 4FNTA 1HVXA 5GQBA 4E8DA 1ONXA 1JXJA 3O16A 5KZEA 1JZ3A 3KOFA 1VYSX 5ABTA 4MKNA 1F07A 2OWWA 1W8SA 4BJHA 4UTLA 1J01A 3GK0A 1FBAA 1ZTVA 1JCXA 3HMCA 2EPNA 3KVLA 3UXAA 2PP3A 3LQLA 2C8NA 2ZWYA 4EAMA 4EKJA 3QY6A 4AYSA 2PDPA 5IBXC 1S5WA 3CPGA 4RV8A 2H9AA 4JTDA 3UVIA 5DN1A 1M7JA 3I3EA 4ZENA 3PB0A 1TVPA 3EKLA 4GGHA 4W8AA 2HEJA 2EKGA 2X0SA 3TQPA 1X1ZA 2RH9A 3SRFA 1B9ZA 3II1A 3AO0A 3WLOA 2ZUTA 3EKGA 2PAJA 3PC0A 2R1MA 2HTMA 4U28A 3T7VA 1F74A 3VVGA 2YLLA 3IIVA 4KFOA 4IISA 2V3GA 3OBEA 2Z26A 4IP7A 5FF0A 3IRDA 4QS5A 1FUYA 3AS2A 1EXPA 3DFSA 4TMCA 2TMDA 3CV2A 2Q09A 3CUXA 3GW3A 3WBYA 4TU1A 1E6RA 1VFOA 2QCHA 2E6AA 2HROA 4HCDA 1GOIA 4AX6A 3SRHA 4GQRA 1GCYA 3AICA 3GDBA 1XG3A 1XD0A 3NZQA 3CQHA 1GGOA 4GY0A 4R34A 1SW3A 5U7SA 2GDVA 5ABGA 5G1MA 1DWGM 3VMOA 4B5SA 4BQ2A 3VKKA 2OSYA 4LC8A 5DMLA 4TTGA 1IZCA 1QI4A 4I7VA 1EGVA 4S23A 3R8RA 4Q6XA 2W0UA 1RPKA 4BEUA 4HU0A 4Q6JA 2WHMA 3TJIA 4FLRA 2FZDA 3LNMA 1ODUA 2Z1XA 3ZWSA 4HPGA 1MWOA 1A53A 4DBEA 2XTKA 2R82A 1Z42A 1W1A1 4JICA 4PH6A 1BSIA 4JTTA 1GTHA 3U4AA 5HK4A 3EDKA 2WC7A 1ME8A 4US6A 1JZ4A 3S6OA 4UCFA 4E4UA 1MRAA 3H70A 1V03A 3QYQA 2D24A 4ERIA 4DYKA 3WJSA 4NJGA 1UIPA 2NV1A 4YTSA 3T0DA 4R7WA 3PTKA 2OSWA 1VLWA 1H49A 5DMMA 1GOMA 4QITA 3PZOA 5IHRA 1LCOA 4IJRA 1AQHA 2OEJA 1EIBA 4QISA 4ADUA 2FVLA 1ME9A 3ARSA 2VC6A 1VEOA 2XVKA 1EDGA 4AZBA 3VD7A 1TPUA 1C29A 4A8RA 4BWLC 4NXKA 4ZOEA 4BCEA 2HMCA 1K03A 2J7FA 3U3HA 1OCQA 1EQCA 2WMIB 2A0NA 2NT1A 3BJSA 3ZFHA 1DORA 3QF0A 2FMOA 1R2TA 3INPA 1SZEA 1V0MA 3AXMA 1H11A 1RY8A 1XC6A 3BLKA 3KXQA 4Q8PA 4DUWA 1JULA 1XQLA 3OIXA 3W7HA 1FWEC 4EE9A 1XLJA 4KCUA 2NXIA 4JL2A 5I06A 5BNKA 3DI1A 3WEOA 1A0CA 3M0HA 3IACA 4DZAA 2PPGA 5PTDA 4MTVA 1NY1A 2R1PA 2WNWA 2B0MA 3LB0A 3AIQA 1XDMA 1PTAA 3HM7A 3VIFA 5D2TA 3IGUA 1UWRA 1V93A 1HKIA 3BH4A 4JEQA 3GAYA 3W1UA 4HK5A 5I2UA 2IPWA 3CGTA 1UPPA 1E40A 3IANA 4PTVA 3M4HA 2MANA 3R0KA 4NRSA 5A6BA 4M3PA 5BRBA 1ZB5A 3ABOA 3SADA 2QV5A 3QSTA 1BWKA 1AG1O 4LT9A 1Q85A 1IQ8A 1IV8A 4W8BA 4QS6A 3TOPA 4C6NA 5I5RA 3M6DA 7CGTA 1LWJA 1YNYA 3T2PA 1KM6A 2WMHA 1R0MA 1GYMA 3ANUA 1OABA 2XIBA 2FTPA 4C91A 1Q4NX 1KM4A 4MADA 1LG1A 3ABSA 3AXXA 3DEQA 3QXBA 4DX3A 5K2ZA 1W1YA 3HB9A 1TMHA 3A13A 1F3WA 2CLMA 4WIWA 2V2CA 2C13A 2VENA 3DX5A 2PUZA 3GVGA 2IQ0A 3ATZA 3FVDA 3WMBA 1HIZA 4CEUC 2QKFA 3AHYA 4MMWA 5BMWA 2YW3A 3UG8A 1HL2A 4HMCA 4AZ6A 1KR0A 4LXFA 4IFRA 1U22A 5F2IA 1A5AA 1E0WA 3TOYA 5HJXA 3QPYA 2Z1VA 2ZIDA 1Z8AA 3W7MA 3UY8A 3DUGA 2J9ZA 3WH9A 2VRQA 3HG3A 1QPNA 3RM9A 4F66A 1SM9A 2KZHA 4UMAA 3BMXA 3G24A 1ONWA 5AHFA 3H12A 4JTGA 3N2BA 2W4XA 3MZNA 4DJFA 3TYDA 3QGKC 4LRSA 3I6EA 4FMVA 3BOXA 3BL3A 1TG7A 4J2PA 3UG4A 3NL6A 1ZHAA 5HNRA 1H4PA 2YXGA 1J4EA 3NJ3A 2Y2WA 5JBDA 5G4WA 1LT7A 2CC0A 2DZPA 1LP6A 1RJPA 4W5UA 4PCSA 4OIFA 4AHOA 2DH3A 3PZ9A 2VC9A 4HOZA 3LI0A 3P8JA 4AEFA 5A69A 6ALDA 3DENA 1I2NA 3AC0A 1ICSA 1FWWA 3FJ4A 2W61A 2UZ9A 4HU8A 1W1ZA 2YBUA 2BODX 1QI2A 4WD0A 1KCKA 3B9OA 1VFHA 4C1KA 1AQFA 3PNUA 2VL4A 1FP8A 3CAQA 1MXDA 3VPLA 4XAYA 4PMOA 4NY2A 5A6KA 3E0LA 2NWSA 4S3DA 3GIQA 2VFDA 3U5UA 1VPYA 4PL1A 1PSCA 3O07A 2DZBA 1HG3A 2NXHA 3H24A 3IJLA 3FNDA 3AHVA 1YTKA 4GVIA 4CQBA 1LWIA 1FX6A 3EA3A 3C2FA 3WKZA 2A85A 5CAHA 3AS1A 3C61A 4YVPA 3BGGA 2BY0A 4ZA0A 2Q6EA 3VGDA 1GZ1A 2B7NA 1M1BA 1FXQA 4XO6A 3I6RA 4L6DA 3H53A 1YE4A 4XISA 2WMIA 3MANA 3QV6A 3N13A 3U2OA 3DHFA 4MSSA 2GOKA 4PCNA 3RHGA 4EANA 4QJ4B 3VC6A 1F3XA 4O0ZA 2CESA 1S2CA 4QNWA 3AXKA 3UWEA 3HJZA 3TLLA 4Z2IA 2DORA 2YZRA 4Q8TA 1E5NA 3VNDA 1JAKA 4GLEA 1XP3A 4Y9MA 2WAGA 1HKMA 3HF3A 4QE1A 4CN4A 1T6MA 4PUNA 3KOZA 1PBGA 2INZA 4P7OA 3BZJA 4N7QA 4F79A 1RVKA 5T9BG 1OG0A 1JCLA 3P93A 5AFDA 1NDZA 2NV9A 4OU1A 1W3HA 3GLCA 4FNRA 1KWGA 4M7SA 2PZNA 1OB0A 3PZNA 5K4ZA 3R11A 3A64A 3Q67A 3ZQ9A 2E6DA 4X9SA 2V5KA 4U2ZA 1NM9A 2C3ZA 3DKJA 2GJPA 2YKKA 1GK8A 3ISIX 1UWIA 4L65A 3LTSA 3BG3A 5SWUA 4D71A 1UBSA 4UC5A 1K7FA 2W6RA 2RDTA 2XJ7A 4L4PA 2WHKA 2JE8A 4BQ5A 3KBNA 1OC7A 4NU7A 5DX7A 3VIGA 3UWYA 1LLWA 2GL5A 4Y9OA 3UJRA 1EWEA 3CUJA 4R9OA 3VUPA 2PLKA 2WLYA 2E09A 1EC9A 4XTDA 2VXNA 4B2DA 1WKDA 4AEOA 1TPDA 3R13A 1BYAA 4WQ6A 2O55A 1Q7QA 1WZAA 4LAOA 1LLOA 3I7QA 2Y5SA 1HTIA 2CLOA 4AD5A 3LRMA 4ZOBA 4QBXA 1PEZA 3YPIA 4JTUA 3G22A 3WMSA 1LG2A 1CXKA 2BZNA 3NL2A 4GIAA 1RV8A 2A1YA 2DT3A 3W25A 3O6DA 5AN7A 3W85A 2H3DA 1YHTA 2GPTA 3FAXA 1DXEA 3R5EA 3PWIA 3QJAA 2ALDA 3OQ8A 5EL1A 3TQVA 2YJQA 3RLUA 1OFQA 4HMDA 2W66A 3LMYA 5HQLA 2Z27A 4DXXA 2XSXA 1SFSA 1HXJA 4GXPA 2VI0A 3APTA 4W4QA 3LCWA 3OVRA 4D6IA 2KX9A 4LTSA 3G3MA 3HU7A 3WF1A 2OSXA 4MZ8A 3NQ7A 2NSOA 5BOFA 3VD9A 1O95A 2DSVA 1E3XA 3IJ6A 4J4KA 3G6MA 1WDSA 3WQDA 2POZA 4GY7A 4C6DA 3BMVA 2P10A 1IT7A 2WBKA 4WX2A 4YTUA 1IGWA 3R25A 2XN0A 4IT1A 3EXTA 3TMQA 3PUEA 3W2LA 3FJ6A 2I9EA 2FZBA 2E4TA 1W3TA 3BV7A 3R94A 2D0HA 4K68A 1EPXA 4LUIA 3FKKA 2X0HA 4KW2A 1QCWA 3WMLA 1XCFA 5G4EA 3PAOA 3GH5A 4TXEA 2FLIA 3WDRA 1V6YA 1PKNA 4PCTA 2PD9A 5A6MA 5I02A 4J3ZA 2WSYA 4L9YA 4DM1A 4OZOA 1X1OA 3U2ZA 4AH7A 1JZ6A 1V77A 5C2XA 4MIMA 1W6TA 1BPLB 3K1DA 1W0MA 3ZZ1A 1BRLB 1SSDA 3A4XA 1DPMA 4PMZA 3VINA 4MB5A 3T07A 1FKXA 3B06A 3O2LA 1OFAA 3NWRA 4NNBA 2WPBA 2QV4A 2PRMA 3KOYA 5DFAA 1EOKA 1POKA 1WE5A 3R8HA 4AD3A 4HSHA 5GVJA 3TSMA 1ZCOA 3SGGA 2NQ5A 3WUBA 1QMLA 2ZX5A 4IL2A 3PTDA 2UV8G 3V36A 1K9EA 2PDUA 3PZQA 2YYTA 5CPTA 2VDIA 1TX2A 1ITUA 2PDWA 1RY0A 4RZ4A 1YDVA 1K4GA 1RJQA 3RDKA 5C70A 1S1PA 3HJEA 1RP9A 1W9UA 3S46A 1BFNA 3EXRA 1L6WA 1UC5A 4C1NB 2P53A 3IUIA 2PDXA 2OQYA 1RUSA 2P88A 4E2OA 1SJCA 4H1ZA 2JGYA 1CXEA 4W84A 4KT2A 4QG9A 1XH1A 1NOUA 4XX6A 3SCUA 2CBVA 2QVNA 1XIMA 4WGHA 4QAIA 3U2CA 3CK5A 1HJXA 1NDVA 5L6UA 1KFCA 1GVQA 4H8HA 3MCOA 1LBMA 1MSSA 4LVGA 2QJMA 2HDJA 3G77A 3ONBA 1JIBA 4PMQA 2CXGA 4WSJA 2ANUA 4NIRA 1XI3A 1TPVA 1QJWA 3G6LA 4B92A 1ISWA 4V2XA 3CL6A 1MEIA 3Q94A 3GBDA 2E3ZA 2DIEA 1QPKA 2BVYA 3SIMA 4NJKA 1CCWB 3AJXA 1L6SA 3EEGA 5FA5A 3WH7A 1AJ0A 3TN5A 1PHQA 1EF2A 1F3EA 4HMNA 3MCMA 1OCJA 4HSNA 4IPJA 4MLRA 3VOGA 4GINA 3TP4A 3IK4A 3MUCA 2RDXA 3BDKA 3EDFA 3TW7A 1YNQA 3LTPA 4K8HA 3B9EA 1NU5A 1KB3A 1MDLA 4JDYA 3ZXWA 4GCXA 4HNCA 1BXNA 3G3DA 4LVAA 2XN1A 2EJ1A 4WR3A 1DV7A 4ACZB 5DMYA 1BWVA 3H4WA 3SUSA 5BCAA 1WPCA 5D2VA 5D8WA 2YYUA 3WBWA 3LMZA 1E43A 1CW2A 3AZSA 2WV8A 4LAZA 2GVEA 3TYUA 1B2YA 1VZWA 1HT6A 5CXPA 4WKHA 1UWAA 3AQUA 3PSVA 3GNDA 3WFLA 3P0XA 4IH3A 3QC0A 3EWBX 2H3BA 1EBHA 3TFXA 6CGTA 3GY1A 3MMUA 1YEYA 3OB8A 4H9ZA 3IIZA 3CMJA 3WBEA 4P61A 3AWNA 3PZVA 3W1NA 2P0IA 2Y85A 2C0AA 4GO9A 2J24A 3CV1A 1F8IA 5KMYA 4JTSA 4UQAA 2J8FA 4QDMA 1S2UA 4MF4A 1IR1A 2IKJA 1NFPA 4F2UA 3EX6A 5KINA 2CETA 4MG4A 1EUAA 3C4UA 1E4MM 4FF5A 4RNIA 5FF7A 1HJWA 4I9JA 2RDWA 4F3HA 3QW4B 3WUGA 2BP1A 3P14A 4JFVA 3B8TA 3MI3A 1HW6A 1QNQA 2W92A 1KGXA 2XGBA 2PCQA 1VBJA 1EX1A 1E6ZA 1J93A 2VD9A 2DVUA 1AW5A 1TPWA 3GUGA 4BI6A 2VP8A 4J9JA 3ABRA 1BRLA 3W6YA 4QJ3B 2VCBA 2ZOXA 2OZTA 4RXGA 4RX0A 3M5ZA 3ZM8A 1QI0A 3ZWTA 1RSCA 4I8YA 2Z28A 4GJ1A 5CC6A 3KRUA 4ERAA 4PMRA 6ENLA 1KNWA 4PULA 4JTJA 2PZ0A 2IPGA 1QPOA 3N04A 4N6FA 4TV6A 4TMBA 2BY1A 4M1BA 1IWPA 3D5HA 3FFSA 3G1HA 3I65A 1W3IA 1MDRA 2D2JA 3RCMA 4CNUA 3TTEA 4MLJA 3PZUA 2WBGA 4QNEA 2Y0FA 3V75A 1R46A 4QQ3A 4C1NA 4DN1A 3NIYA 4S2BA 3S0CA 1PWMA 4GIYA 5LNVA 2ODOA 1F2JA 3W87A 1F6YA 1XC4A 4C5ZA 1E1EA 4S1FA 5GJPA 2ZDRA 2WQPA 1GQLA 2CW6A 4UFKA 3BGAA 1YADA 4FX8A 1AZ2A 5EMUA 4FHAA 3LCFA 4HPXA 4ZODA 3TROA 3FA3A 3G1FA 3N4FA 3SJNA 3K46A 2XH2A 3DYMA 3UXIA 4MAVA 5HWMA 2POTA 1GHRA 2XIMA 4UQCA 4R33A 3HV9A 5BU9A 3FA5A 4CQ8A 1BYBA 5TQLA 4NILA 3TFCA 1CENA 4DQWA 5CEWA 3PBYA 3T0TA 3OEXA 4HCLA 3Q58A 5HQMA 5K4XA 1BF6A 3UR5A 1PE1A 2QCLA 3H21A 3K4AA 2V3EA 3BSGA 1EYWA 1FHDA 3GNPA 2UY2A 4MWAC 3W70A 3GM8A 3VYLA 2WVSA 3MUXA 4HYVA 4ZFMA 3W7CA 4Q7IA 3S1XA 4QSFA 3POHA 5XIMA 3W7KA 3HGRA 1BXCA 5C9ZA 1IWBA 4DLMA 2BNJA 4ZBCA 3L4UA 4JBRA 3OGSA 2OG9A 3AHXA 4N9CA 4JX5A 1L9WA 3WQCA 1V3KA 4GACA 2GK1B 1NWTA 1MW3A 1JCMP 1PX4A 1ZAIA 4RE2A 4E4FA 3GSMA 4HPHA 3CU2A 5D8ZA 2B7OA 1ZNNA 2X1UA 3EA2A 4ACZA 1XSIA 2VEPA 3MI6A 5XIAA 1UB3A 4W5ZA 2QUTA 6A3HA 3T0BA 4LF1A 1TUFA 4C6KA 2ISFA 3UU0A 4W89A 3OPSA 1REQB 1EL3A 1SJBA 1PIFA 1K70A 1XIGA 3EX2A 4ADSA 3RCNA 3WF4A 5A8PA 1V02E 1F9CA 1OT2A 5D38A 1EJTC 2BVWA 3CO8A 3B40A 4Z2GA 1TJPA 3BARA 3DFOA 1OK4A 2Z2AA 5CZJA 5FEWA 1J2WA 4ZE4A 4JTIA 1OX6A 1KGWA 3LQGA 4DWSD 2WYSA 3GHSA 1L6YA 1VAHA 4JHZA 3DC8A 4Q8NA 1PTGA 3ORWA 3BV4A 4ZQPA 4H2HA 4AMAA 2C1GA 2PTZA 3CV6A 3STFA 5AHIA 4LS0A 1TTIA 2PLMA 2YOCA 3FAWA 4KQNA 3W86A 2Y4SA 1WDWA 3OVGA 4YIWA 1F6PA 1OYBA 4MDPA 1TKKA 4NZCA 3QEZA 4S39A 1DWFM 3V0SA 1FHUA 4GQGA 4Q8VA 5EPDA 4MFEA 3HURA 4MY1A 3SCOA 1NFBA 2ZUWA 4XZLX 4Z1CA 3GIYA 2YFOA 3E0IA 2Y7FA 3BSHA 5A6AA 2PDGA 4UTIA 1EDQA 3T4CA 1G6CA 1J0KA 3TMLA 1VJSA 4W7WA 3VCRA 3PPCA 2ZRYA 2YGYA 2DSUA 2WJZA 4NJHA 1I1XA 5DBUA 1FH7A 3ID7A 2V30A 3NQAA 4HGXA 2PFHA 4C5YA 3APYA 4NAFB 4AC7C 2PMQA 3WNLA 3S5ZA 4D1IA 3LLXA 1KFWA 1OY0A 4DJED 2ISDA 5CJ5A 4I9MA 1DJGA 4IMFA 3A9BA 3SUUA 5FJRA 3BCJA 3FV9A 3IAPA 5DT7A 1QPRA 3DH7A 4AG0A 3QTPA 2PI6A 8XIMA 3UG3A 4GI6A 3M5YA 2ZCGA 3FA4A 1ONEA 2RJGA 1QAPA 4WF7A 1A49A 2A79A 4CD8A 1NP0A 5CC5A 1BLIA 4HHPA 1UOKA 2QUVA 5T8GA 3V0TA 4DVOA 1NEYA 3O6YX 1E0TA 4JHOA 3QM3A 1FWIC 4AHPA 1JDAA 2PDJA 4HTBA 3T4WA 3AUOA 3CZ8A 4H00A 2G96A 3L2MA 2OGJA 2X7WA 1ZP3A 1JZ8A 1Q6CA 1DJIA 2VURA 2BGQA 4C7DA 4L6HA 4CN6A 4E8GA 3FHAA 1VENA 2J7HA 3E02A 4XO7A 4LEQA 2OO0A 2Z6IA 3O6CA 4QJ1A 1UUQA 1EO5A 2GFTA 2W9MA 2ATMA 4Q8WA 2NZLA 5AZ1A 3W82A 4H4IA 2R1KA 2NT0A 4H3DA 2Q3RA 2E8YA 4N9DA 1FCQA 3KLLA 5CZTA 5A5WA 4HHHA 4U31A 1K6WA 3PVFA 1ISYA 3A3WA 4D6CA 5BWAA 1CLXA 2JEQA 1LWHA 4A8NA 3RU8X 1KM5A 2WJEA 2D22A 3MDWA 4GD0A 2GWGA 3IGSA 1SZRA 1UKQA 1UWSA 2O9PA 1DXIA 6REQB 2WLZA 2HSAA 2J77A 2QZRA 4GZ7A 4LAMA 4QCFA 4DAFA 1DTNA 1XSJA 1ZS2A 2I1OA 3WLSA 4QXIA 1SFLA 3GC4A 4DAIA 1PL9A 5I3FA 3CZKA 3RPTA 1O5QA 1AODA 1VP5A 4W87A 1G94A 1FWTA 3NM3A 1G4TA 2FHBA 1GKPA 1YIXA 3GXIA 4ZR8A 3S47A 4DUVA 4B9YA 2GK1A 1EX5A 1W1B1 1FWFC 3T0CA 3MBFA 3CH0A 2Z7GA 3H2EA 3HGSA 1UR9A 3BCDA 3LK6A 3TSBA 2XFRA 2ZUSA 4Q33A 1P6CA 2XSAA 2BFGA 3DECA 3GIPA 4LCRA 3T05A 1UP2A 4OV4A 5F4SA 3OA3A 2XGZA 1MUWA 1I4NA 1D7FA 4BF9A 4HHLA 4XK2A 2CBJA 1YX1A 3T8LA 3VNZA 1OBAA 4X0VA 3C0JA 3O3RA 2GSEA 4AZ7A 1QATA 4X22A 2MNRA 3NUKA 4GUFA 3CO4A 3E0WA 1T8QA 1KV8A 3CUHA 1GPFA 3N9KA 3L0NA 4P7NA 5I07A 1V51A 1K8XA 3ZT6A 4IICA 3G1DA 4RDWA 2GGJA 4AWTA 4TTUA 1KXHA 1OFBA 1UC4A 4PYSA 1MUMA 1X97A 3IV8A 1ZP4A 2A7PA 2OU4A 2PLJA 5F1UA 4B5NA 5AC6A 2DZWA 3CUZA 3TJ4A 4YNGA 3W2JA 4NF7A 3NPVA 4PBEA 5G1TA 5D4YA 1PX3A 1YNPA 4UTTA 2PDBA 5AC4A 4AFYA 3C0SA 4AIEA 3ANYA 4U5IA 4A35A 2VM8A 3UPBA 2VWSA 5U4NA 3I4KA 3HFYA 3MMTA 5CSRA 4EXAA 2FPTA 4O57A 3BK0A 2OT1A 3OGVA 1DP0A 4ECLA 1RK5A 4UTHA 1E51A 1FFQA 1N2VA 4CQCA 1XUUA 5BMXA 3VC5A 1TJ2A 3T08A 4MGGA 1TFVA 2J25A 2W63A 5LIWX 1KFLA 1OFRA 3FDGA 4REQB 5HUOA 4QTGA 3GE7A 3VX1A 2WNQA 3MMWA 4H04A 2CZVA 4DXVA 3T2QA 4NAFA 4U2YA 3A3HA 3PTMA 3EAUA 2J75A 2O56A 3FK4A 4CNTA 2EBNA 3W7EA 3ZLGA 2RHGA 4FLOA 4H7CA 2YIHA 1XF0A 3QQ0A 4UOZA 1SO3A 1B30A 2Y62A 1GVRA 4GOAA 4ZL1A 2VQUA 3SN1A 1FOBA 1RD6A 1W91A 3UWWA 3SI9A 2ZUUA 3UPWA 3N3MA 3DBNA 3VMPA 5E6ZA 2OKOA 4KMQA 2GGHA 1JQVA 2DUAA 4HQVA 2ZC8A 4PMDA 3DESA 1WZKA 1ZRQA 2FFIA 1SR9A 5IDIA 2G37A 4HD5A 4RUBA 3DHUA 5DMNA 2E40A 3CEUA 4UIOA 4OTKA 3CNYA 1GJUA 1ZALA 2YCJA 5D2WA 2NQZA 4IPNB 1P0EA 4FSAA 4H7VA 4IPLA 2ACSA 5H8UA 2HWGA 2DPEA 1DJWA 1S46A 4DO6A 2PODA 2GQAA 1WBHA 3FYOA 1QFEA 2NW0A 5CSUA 2J7EA 5C9RA 1Q6GA 3NQ6A 4CNPA 3T0AA 2WB5A 5JIPA 1KA9F 1PWLA 3ABXA 4HYWA 1AW1A 3GU9A 5D9NA 2HV5A 4MZYA 1R86A 5FL0A 4ONVA 1WV2A 4B15A 4RPPA 3MB9A 1US2A 2ZXBA 3S4TA 3LM3A 4D8LA 5I3GA 4LRTA 3RNDA 1DWIM 3QGAC 3R89A 4MNLA 2OX4A 5LA2A 1H0GA 3SCWA 1XRFA 4DI9A 1FWGC 3NQCA 5I77A 1A47A 4JYDA 6REQA 1PIIA 3A3XA 3OG2A 3V1HA 4XD6A 4WXYA 3ZJ8A 1V3LA 1YXYA 1NQKA 1XYZA 3CHCA 3QLDA 4PUJA 3GXMA 4XZIA 2E6FA 4GYJA 4TVCA 4I5XA 5I00A 4ATWA 5J8LA 1BQGA 3WZ0E 4PTNA 3GFYA 1P6WA 2I14A 4JXCA 3MP5A 4EVZA 3TC3A 1V6VA 2WO5A 5KZMA 4LWWA 1EJSC 5A8OA 2G4JA 4FXSA 1WXJA 3UXDA 3CT7A 1M41A 1RBOB 3KZSA 1ALDA 4NAEB 4IFOA 3T55A 5HR7A 1O12A 4KGLA 3VZZA 3N29A 2ESCA 2GLKA 2EPLX 3QV7A 5FESA 5LYRA 3AU6A 2WVTA 3ARYA 3CZLA 3VE9A 5I0DA 4ZGYA 1TPB1 2J4GA 1MI3A 1WDQA 2VCCA 1K77A 3T44A 4I5UA 3NGFA 1O94A 3GG7A 3BW4A 2ZZ6A 2GUUA 4IGSA 2PDCA 3R2GA 3V5FA 2PDLA 4HA1A 1TJ1A 2XINA 4WK9A 1R3SA 5DCBA 1ODZA 5G4HC 3RO8A 1MUCA 4UQ9A 1YKWA 2BS9A 1LL4A 2BGNE 3FGCB 3RF9A 1RLCL 4CD4A 2HCVA 1JYNA 4K37A 3QOKA 4NNCA 3OOQA 3T6CA 2NQJA 2VDGA 3F7JA 2BSLA 4RZ6A 1KQYA 3ZSSA 2VGFA 1I2QA 1ZLPA 1VRXA 3NYZA 4JKMA 3H2MA 2RGMA 3UWUA 3NPWA 3SRKA 4V27A 1BXBA 5J04A 4C7GA 3EX3A 4XD3A 1B3ZA 2NWRA 2JKAA 3GR7A 1IZJA 4ZQNA 2WNNA 3NO5A 4I5RA 3JS3A 1EEPA 1IEVA 2PU1A 3L5MA 2W67A 1SW0A 4KCTA 3SQSA 4AVFA 5M2FX 3N3TA 4X61A 5F2MA 5FJIA 5AHEA 1VD6A 4REQA 1UMYA 3WL1A 4BS0A 3VILA 2VGBA 1M9HA 3W29A 4NJIA 1D2KA 3GDMA 2VRKA 3R4IA 1B9BA 2WZIA 5D02A 5AYXA 2J7GA 4F0LA 3VGEA 2G0WA 2J66A 3NAVA 5DY3A 2GUYA 1J6OA 4M6QA 3QKZA 2QDGA 4ICCX 1OFEA 3W37A 5AECA 1MNSA 4G8TA 3CH9A 1R3QA 3SY5A 1HZYA 4RW3A 1T7LA 1JCJA 3M0ZA 4NI8A 1TIMA 3EBVA 4G7FA 1M65A 4Z08A 4A3HA 2DDXA 3QFEA 3GTFA 2QS8A 2IPJA 4DJDA 2JBMA 4FXRA 3B8WA 2Q08A 2PWGA 3IJQA 4A22A 3BANA 4O14A 4GKTA 2XIOA 1SPQA 2V6AA 4O28A 3TZNA 1RJRA 1XBXA 4JY8A 3VNMA 3BAXA 4AU0A 2IS7A 3GNOA 2PS2A 2PP1A 3FHQA 3W73A 3EDEA 2E68A 1WXYA 3GG8A 3SCTA 2IQTA 2CYGA 4WDTA 3FCPA 3OZMA 2W27A 1Q13A 3OLGA 3F5JA 2XZ7A 4NT0A 4XIMA 3V1PA 2VELA 4QE5A 1ICPA 1M5WA 4QR6A 4I7WA 3ZJKA 4QX4A 3GXPA 5IRPA 3QPZA 2GGIA 3VZXA 2V3FA 3N6QA 3UR8A 2ZDSA 3WLMA 2VR2A 1G7UA 4LV4A 4A8IA 4RE3A 2B81A 4WSKA 1BGGA 4ZMGA 1K9TA 2F6UA 3NOYA 3ARZA 3VNIA 5DO8A 3BW3A 1XKYA 4JTRA 5HJYA 5HNTA 3GBEA 4JFTA 1BTCA 4ZOAA 3ITVA 2OOFA 1OG6A 1MVYA 4JNYA 5HJLA 4QEEA 2EF9A 3OYXA 3I3BA 1S2VA 1XIIA 1KFKA 4R53A 3SSZA 1QASA 4OHQA 3Q65A 3WLPA 1TVLA 4XKMA 2PEVA 4UTMA 2YB4A 1PO9A 1Q8JA 5F4WA 2YBTA 1DJXA 4GISA 3M9YA 1XLMA 5CBJA 3DG3A 4J35A 2CFFA 3GH7A 4M6UA 1H7PA 3OBKA 3EOOA 3OHIA 1TIWA 1UUMA 1PZ2A 3PK7A 2WANA 3KS5A 3RJXA 3GVRA 1KO0A 3PF3A 5CQ1A 4IQDA 3LXCA 4XSMA 1UR1A 1HF6A 2GVYA 1A4MA 5EBAA 3LN3A 2YW4A 2CLHA 1E15A 2V0TA 4UQBA 4NAEA 3E74A 2EG8A 3M1ZA 3BAIA 2Y8UA 3UXKA 5HINA 3PBUA 4Y96A 4PTWA 3GR4A 3MYPA 3S6TA 4IPPA 3LCIA 1UMLA 4J40A 3GKAA 2Z7KA 1TCMA 4FP1A 1UUOA 3NVTA 4GE8A 1W37A 3ALGA 4Q3MA 3DCPA 2DJXA 2FH8A 4DBDA 3FW6A 4HK6A 4I6VA 2ISWA 5LIUX 1ZJBA 4IF2A 3EB2A 1JD9A 3FGCA 3T78A 2ZX6A 3OVQA 3S9YA 3DERA 4GO8A 3SW6A 1LBLA 5I3JA 3FYPA 4IUOA 2QULA 3DI0A 1D8CA 2D23A 1QBAA 4N9EA 4DZ5A 2X16A 1XIBA 3M7SA 3JZUA 5DY2A 1GG1A 3AWOA 2E9LA 3TLQA 1PCWA 3A24A 4PUWA 1YW1A 4QG8A 5H1WA 3E12A 3QMTA 2RGLA 2VVSA 3A47A 5KSWA 4QCEA 1F61A 1SGJA 3QQWA 2VFGA 5FL1A 1XLIA 4MHBA 1IEQA 2GJRA 2DZSA 3S2NA 2OQLA 5B7YA 1O68A 5KEZA 3Q2DA 3H7UA 5KZ6A 5FJPA 3G0UA 4A2SA 1VEPA 1K8CA 1KQZA 3L67A 4NNAA 3LCGA 3RUBL 5I6SA 4QDWA 3JRKA 5AHLA 3B8IA 3R8GA 1TA3B 1QO2A 4A2RA 1M04A 4DZHA 3WJZA 4D6JA 2O0TA 2G4FA 3JW7A 3D6NA 4ZFCA 3SCRA 1C93A 1QNVA 1I8JA 1VYRA 4LUYA 2AAAA 1EP3A 3EDDA 1UP0A 2XUCA 3TCSA 2WKJA 1S39A 3N2OA 5HANA 4KWOA 5LXEA 1FTXA 4H7ZA 3V18A 3U48A 1RBLA 1X38A 4R85A 3MBDA 5C5YA 5A6JA 3QY7A 1DQWA 4RCXA 2QIWA 3N11A 1RHCA 2XWEA 4XSLA 4WZHA 3UJFA 3LRKA 1M7PA 4GCAA 5FI8A 1JFHA 3MY9A 2GDQA 1S3TC 3UYCA 1W54A 4TVDA 3SURA 4OBRA 3PY2A 1JG9A 2VOTA 5GNZA 4MB3A 1PKYA 2PWDA 2WVVB 2A3BA 2Y89A 3H2NA 3W9ZA 4PRRA 5HULA 4MUPA 3I7RA 3L12A 4TV5A 1Q5MA 1FH9A 4FI4A 4Q32A 3RCYA 3TYEA 4ZO7A 2O7QA 1VB9A 3SB0A 5LZLA 2GUBA 4ES4A 2JKEA 1CGUA