4I6VA

The crystal structure of an amidohydrolase 2 from planctomyces limnophilus dsm 3776
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
425
structure length
425
Chain Sequence
SSPIDQLCAQLDEIVLIDPHSHINPHAAASKNLGDILGYHYFTELAHSAGMPREVIEAPGITAKEKVGRIVEGLAHLDNTIQVKWLIELCERFFGFQDDRLTPDNWEALYDHSEKLMSAPDWEQTVLQKSQLEAVFLTNDFDDPLTGFDTKKYIPCLRTDDLVFHLQKPEVRQRLAKATGFDCATPAKLIHAIGQLFTHFVSHGAKACAISLPPDFEPTPVSHVDAEGPLRAAYAGHVLTTEQSQILSRFVFWTIAEFCSEHHLPFDLMIGVNRRVYESGVYQGQDLFDQRVSLYQYRRLFNAFPRVKFPISVLAHASNMELVSYAWIFPNVIANGHWWYSNIPAFIEPDCRSRLEAIPRNKNIGYYSDMYKLEFGWPKFQMYRRVLAKVLFEDFVVGRHWSEERAVELGRQILRGNVETIFSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amidohydrolase 2
publication title The crystal structure of an amidohydrolase 2 from Planctomyces limnophilus DSM 3776
rcsb
source organism Planctomyces limnophilus
molecule tags Hydrolase
total genus 153
structure length 425
sequence length 425
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02614 UxaC Glucuronate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.2020.10 Mainly Alpha Orthogonal Bundle uronate isomerase, domain 2, chain A uronate isomerase, domain 2, chain A 4i6vA02
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4i6vA01
2VUNA 4B3ZA 4B92A 3IARA 3SFWA 3MTWA 2UBPC 3ORWA 4C6NA 3PBMA 4EPDC 2QPXA 3S4TA 1FWHC 1KRAC 2R1KA 4EP8C 1J6PA 2HBXA 3GG7A 1PTAA 4F0RA 1WXZA 1POKA 2G3FA 1HZYA 5HMEA 3HK5A 3LGDA 3TN5A 1J79A 3GTXA 3HK8A 3WMLA 3D6NA 2Z29A 2ZC1A 1A5OC 3O0FA 3MJMA 4WVXA 1RAKA 3UF9A 4GX8A 3UR2A 4ICMA 2ICSA 2GWNA 2RAGA 2BGNE 3DC8A 3HTWA 4C6PA 1K6WA 2UZ9A 3FEQA 1XRFA 4V1XA 2R1MA 1NDWA 1BF6A 4C6QA 4G7EA 4DIAA 4GX9A 3ID7A 2Z7GA 3TN3A 1FWFC 1YIXA 3S2MA 2E1WA 1EJWC 1P1MA 5FSEC 4G7EB 4QRNA 4RDWA 4QSFA 4CEXC 3LS9A 3LSBA 2FFIA 1V51A 4GZ7A 1XWYA 4LCSA 4QS5A 1P6CA 1PO9A 1RA0A 1V79A 3IPWA 3OOQA 4Z42C 4GYFA 2AQVA 3GRIA 2DVUA 4DI9A 2QT3A 2P50A 3RHGA 2HPIA 3FDKA 2PAJA 1IE7C 3AUOA 2XIOA 4R85A 1FWAC 2PUZA 2VC5A 2EG6A 3IRSA 4IFOA 2YZ5A 3GU9A 4CNUA 2OQLA 2OODA 1KRBC 1A5NC 1FKXA 3URBA 4KESA 1UBPC 2R1LA 1E9YB 4DI8A 3LA4A 3GTHA 3MPGA 4IFKA 3CJPA 2D2GA 2F6KA 4ERAA 4QROA 3OU8A 3MDUA 4KIRA 3E2VA 4IFKB 1PB0A 4ERGA 2Q6EA 2R1NA 1RJQA 4DNMA 1EF2A 1A4LA 4DLFA 3N2CA 2HQAA 2AMXA 4M51A 4C6FA 1FWBC 1YBQA 3HM7A 3MVIA 5G4HC 4DZIA 3HKAA 4KERA 2QS8A 3SO7A 1K1DA 3DUGA 4HA0A 1YBQB 4ZSTA 3TN4A 1NFGA 3B0XA 4YIWA 2OB3A 3RYSA 4C6LA 1QXLA 4EPKA 4OFCA 4UBPC 1JGMA 3URNA 4R7WA 2HBVA 4LALA 1YRRA 2Z25A 2Q08A 2Z24A 1UIPA 1KRMA 4C6BA 3UPMA 3S2LA 3E0FA 3EWDA 3UR5A 3T81A 4R88A 2FTWA 4IH3A 4DLMA 1FWDC 1O12A 3F4DA 4LCQA 1ITUA 2Z2AA 3LNPA 2Z00A 4RDVA 2PGFA 4B91A 2HPMA 4H9UA 4LAOA 3IV8A 1RK6A 4CNTA 3OODA 1VFLA 4J2MA 3K4WA 4ERIA 2WJFA 4F0LA 4RZBA 5HMDA 4IFRA 3E38A 3OVGA 5A6TC 1EJUC 2BB0A 4C6IA 3T1GA 4HK7A 2Q09A 2FVMA 2AQOA 4XD6A 2Z26A 2YXOA 4XAZA 3LGGA 4PBFA 1FWIC 4KEZA 1RJRA 4DO7A 3EWCA 4KEVA 4C6MA 4EPEC 3T8LA 1RJPA 1NDVA 3HPAA 2PGRA 2WM1A 1A4MA 4BKNA 3WZ0E 4LCRA 4INFA 3LU2A 1NDYA 1RA5A 3EGJA 2D2JA 1M68A 2W9MA 1FWGC 4H00A 1KRCC 3OQEA 1QW7A 2VC7A 3G77A 1PSCA 5E5CA 2WJDA 2Z4GA 5AKQA 4LFYA 3F2CA 2IMRA 2DVTA 2Z27A 4NI8A 4PE8A 3HK9A 1FWJC 3FDGA 1YNYA 4J5NA 4GC3A 4H9YA 3IACA 4AQLA 2EG7A 1A5LC 2VM8A 2YB4A 3CAKA 3NQBA 1YMYA 4P5UA 4DYKA 3ICJA 2Q01A 3AU2A 3QY6A 3QY8A 4E3TA 1V77A 2Y1HA 3F2BA 4GBDA 4KF1A 3MKVA 2GWGA 5LXXA 2PNKA 4XD3A 2I5GA 3PNUA 4BY3A 1EJVC 2VR2A 3PANA 4GY7A 3RN6A 3MVTA 3LSCA 3ITCA 1J5SA 1R9XA 3E74A 3F2DA 4I6VA 2KAUC 4BJHA 1ONWA 1UMLA 1GKQA 2EG8A 2FTYA 3PNZA 1K70A 4IG2A 1A5MC 3AU6A 2D2HA 2O4MA 2GZXA 3RCMA 4GY1A 1XRTA 4KQNA 4L9XA 4H9TA 3WYZA 1EYWA 4IG2B 5CH9A 3A4JA 4H9MA 2YB1A 4RDYA 2FVKA 4PCPA 3E3HA 1ADDA 4LANA 4PCNA 3S2JA 4C60A 4XAFA 2ADAA 4UB9A 1EZ2A 3URAA 3QGKC 4WHBA 4GY0A 2HNHA 1EJRC 4XD4A 4NG3A 1O5RA 3GU2A 2GOKA 4B90A 2OOFA 4KETA 2ANUA 4J35A 3LY0A 3GIQA 4NP7A 4IGMA 1FWEC 4CQBA 4CEUC 1V7AA 4LAKA 3GTFA 3B40A 3TNBA 1I0DA 4CNSA 4WGXA 1J6OA 3E0LA 1E9ZB 4GOAA 1P6BA 3URQA 4XD5A 3IJ6A 2VHLA 1EJSC 3K2GA 3NEHA 3UBPC 3HK7A 3PAOA 2CZVA 2A3LA 4MUPA 4C5YA 1FWCC 2GSEA 3TN6A 4QS6A 3OJGA 4C6DA 4H9XA 4IF2A 4F0SA 4C6EA 4D8LA 1ZZMA 3V7PA 1ITQA 3R0DA 3S2NA 3JZEA 4HK6A 4GXWA 4IQJA 4HK5A 4C6JA 4C6CA 1A5KC 4DZHA 1POJA 4XAYA 1UIOA 1W1IE 3GU1A 5FSDC 4KEUA 3NURA 3KM8A 3O7UA 3A3WA 4L6DA 1I0BA 4AC7C 5HMFA 1M65A 4V1YA 4C6KA 3DCPA 1V4YA 1DPMA 2Z28A 1GKRA 4RE0A 2QVNA 2O4QA 3GUWA 3QGAC 3GTIA 1RK5A 3B0YA 4JOMA 4QTGA 4LEFA 1S3TC 2Z2BA 1WXYA 2OGJA 4C6OA 3BE7A 1R9ZA 2R1PA 4GK8A 4XAGA 3F4CA 4CQDA 4CQCA 3A3XA 1FKWA 4ZSUA 4H9ZA 3MDWA 4G2DA 1R9YA 2DVXA 4C5ZA 1M7JA 2WJEA 2E25A 3IGHX 3K5XA 2QEEA 4H01A 3GIPA 4RDZA 1XGEA 1KCXA 4EPBC 3QY7A 3ISIX 4C65A 4LAMA 4IGNA 3MSRA 1NDZA 1ONXA 4TQTA 3CS2A 1EJXC 2PLMA 4I6KA 2P53A 4PBEA 4HJWA 4LH8A 1GKPA 4H9VA 2I9UA 3C86A 1EJTC
chains in the Genus database with same CATH superfamily
1ZGDA 2V69A 4GZEA 1E71M 1OFEA 4S3AA 5D2WA 2D2OA 2QV4A 2VELA 4EP8C 4WLCA 5E70A 1M53A 1OFPA 4IP5A 3TA6A 2VEGA 3TN5A 3C2RA 1OD8A 4RNHA 4MWAE 2WZTA 4F3HA 5DRCA 2ZZ2A 4ZO7A 4ML9A 1TG7A 4IPLA 3UF9A 3RM9A 5ABFA 2PTZA 3AWNA 5C7HA 2DIJA 4H8VA 4HJFA 3DC8A 1G69A 3EXTA 5E0KA 2DORA 1UQYA 1V3IA 3PZNA 2O56A 2J4GA 2CITA 4LSBA 5FF4A 1JZ6A 1S2AA 4JTJA 3V1HA 4C6QA 3KBMA 3PHAA 4DIAA 2OO0A 5C9XA 5AYYA 3L2IA 3ID7A 2GK1B 1GEQA 4G7EB 5BRBA 1IR1A 3IAQA 1KGWA 3VDGA 3UCQA 5IDZA 3AXIA 1Q2SA 4LVFA 1DJWA 1PL9A 1PO9A 3KDOA 1ZRQA 3Q37A 3MI3A 2PAJA 4W8AA 3LHZA 3WLNA 1VRDA 2F61A 3GHSA 2ZZ6A 2VFDA 1EIXA 2POZA 4QLLA 1JPHA 3A6OA 1OSEA 1E0UA 4DWSC 1PDYA 2E6DA 4H8UA 3S46A 5HR6A 3QMRA 5C7VA 3UJRA 3VGEA 1ZAHA 2O92A 3OU8A 2DSKA 3B9EA 1UHVA 4KBXA 4IFKB 5C9RA 3QZAA 3HV8A 3ME3A 4DLFA 1AW2A 1GORA 1J12A 2ISDA 1QVBA 1Q4NX 4Y8FA 5G2WA 4C6FA 4QQ3A 4REQA 1B3VA 1R3RA 3STPA 3SUSA 3P3BA 2JBMA 4KWSA 2OWWA 6REQB 3DUGA 1YBQB 4JIEA 3VTRA 4FXSA 1DJNA 4Z1AA 1QXLA 3MKKA 1GVOA 1YDYA 3NDZA 1B57A 5I03A 4P7RA 1KRMA 4C6BA 1P7TA 4WJEA 3H4XA 1G67A 1ZSXA 1VFUA 1EGMA 4GCXA 3MI2A 2P3ZA 3OODA 5I00A 4AZ6A 4ZQRA 5ECUA 4C6IA 4O1DA 3P7YA 4CVWA 1GT8A 1CGWA 4Z08A 3BLIA 4Q4RA 3V5FA 4CD5A 1RJRA 4KEVA 1KBIA 3O0KA 5FAJA 4WGHA 4JTRA 1UH2A 2J7GA 2NX1A 4FNQA 4O57A 3AAMA 4LCRA 1HUVA 4HSOA 2GUUA 3M16A 2Z6JA 4PTVA 3SRHA 2QXWA 2AGTA 4ORMA 4HNVA 2DH2A 3CUHA 5AKQA 5CPTA 3V18A 2PDXA 1B4EA 1J4EA 4WIWA 3W74A 2WWDA 1R46A 2GGEA 2IMRA 4J3SA 3P0XA 3HPXA 2ZUMA 2WBKA 3CASA 1A5SA 2V5JA 1FX6A 3UR7A 4DJFA 1VENA 5AC8A 4B16A 3M64A 4MHBA 2TODA 2EGZA 1WAWA 5LSMA 1A5UA 2Q01A 1OC5A 3AU2A 3QY8A 2H9AA 1TWSA 5C9ZA 4W84A 1UQZA 3TYCA 3W2UA 4JTEA 5BXPA 3MKVA 4XD3A 3T55A 2XPKA 3P81A 3VM5A 5CLTA 4BS0A 5FF3A 4QFUA 1LUCB 3TJLA 4U3CA 3WNMA 4JTTA 3WNPA 4JHOA 4OGZA 3KVJA 2YA1A 3WLIA 3T2OA 3H22A 3CZKA 1ZS2A 3BMVA 3VVGA 4NZFA 1UZDA 3O1NA 3WEOA 1EZ2A 2QCNA 1TV7A 2HK0A 5J04A 2F7FA 2B31A 1EX5A 4A3UA 1GOXA 2CXEA 3W1UA 1C8QA 1W31A 1W5NA 4PUKA 3VYLA 4Q4OA 3VABA 1VGAA 2ZA3A 1NQ6A 3GTFA 3LM7A 2IS7A 3INPA 3NAVA 3F5KA 1OYAA 3EBVA 3ITXA 3UG3A 1KBLA 4D6DA 4JKKA 4PGLA 2BVTA 2PP0A 5D2TA 2INZA 6XIMA 3PZOA 3KBSA 4LB4A 1TCDA 2VDHA 4ONVA 3GH7A 4AZHA 2DZAA 4PUDA 1TJ0A 3JZEA 2CLPA 4HK6A 5FL0A 4NKCA 4MADA 4E8GA 3AUJA 3WQ6A 3UW6A 1GZJA 1GVFA 1WP6A 3UXDA 1M7OA 3PZ9A 5E6ZA 5FJPA 4LPCA 4LF1A 2WKLA 3UVAA 1J0IA 1TUFA 4JDYA 2YFOA 1JDFA 3M44A 1JCNA 4DBEA 4UCFA 4E0CA 3R1ZA 2YYUA 4A21A 3EZ4A 3BICA 2ZYFA 1PHQA 3CEPA 1NWTA 4RR4A 3LLFA 2DSWA 1AW5A 3N19B 1R9YA 5FL1A 1R3VA 3N4EA 3QLDA 4JS3A 2UWFA 1M7JA 2F84A 4Q4KA 4ZE4A 4MNKA 1HKKA 2ZRYA 1Q45A 2HVOA 3OPSA 4AZBA 2R8WA 1NJJA 1XCXA 1CLVA 2VZUA 3L2MA 5A6KA 4FO4A 1G94A 1BKSA 1SZEA 1G6CA 4CU7A 3EKLA 1FFQA 4LQ1A 1D7KA 2DPEA 3G1DA 3LCXA 1S5MA 3WLQA 4HNUA 2V81A 1IR2A 1YHTA 4DVOA 2HDJA 1WXZA 4UQEA 1OFQA 1POKA 5HMEA 2WV8A 3LPPA 2GLKA 5JU6A 2ALDA 1A3XA 4P2VA 3I65A 4IQLA 3NEVA 5HUOA 5REQA 2F8QA 4DF2A 1JYVA 1RXOB 4FP1A 2R14A 1G5AA 2W91A 2FH6A 3G6LA 1XRFA 3M0XA 1M6JA 1TPEA 2H8XA 3ZLGA 2RFGA 4M80A 2PCEA 3LI1A 4U10A 4DNHA 3M7SA 4PRRA 4E3VA 3P62A 4J3XA 1B9BA 4AHOA 3WLOA 1TB3A 1KB3A 1E4LA 5FEZA 4FSAA 3WLKX 3SURA 3IPWA 5FOOA 3GC2A 5BW6A 2DVUA 4MJ4A 4NVTA 3KOFA 3A9IA 2Q8ZA 3GZ3A 5DCBA 4I5RA 4LC8A 3WQDA 5MKGA 3RUBL 4R85A 1G01A 3IRSA 4OIFA 4XKYA 4LAUA 2VURA 2OODA 4DJFC 3NZPA 4AMAA 3W23A 3K4AA 1A5NC 3EOLA 1EBGA 4H3DA 1LWHA 3DI0A 5KZ6A 5CLWA 3EWUA 1U2YA 4JICA 5I0DA 3WBEA 1X6LA 3GZAA 3E96A 3ABRA 1CLXA 1HJUA 1VYSX 3OTRA 4BCEA 1CGYA 1XHGA 1WDSA 2Z2UA 5G1MA 1BTMA 1WZLA 2HQAA 4IIHA 2AMXA 5A6JA 4JX4A 3B9DA 3G0XA 3KCOA 3DHUA 3C3UA 2ZIDA 5D09A 1GQNA 1NFGA 1UZ1A 1KR1A 2ZUVA 3DBNA 3SRFA 2C13A 3MMDA 2VFGA 1LBMA 2AL2A 2FTWA 4ZQPA 4QEEA 1CGTA 5KINA 4L9YA 2A79A 3WG6A 1T5AA 5DY2A 4H9UA 3M7WA 3ABXA 1RR2A 2OOGA 4I8DA 2EO7A 3T8QA 4UQDA 1U5VA 4FIRA 2X1SA 3BURA 3LPOA 3SIMA 3CWOX 1IEVA 2C8NA 2FVMA 1VFTA 4B2DD 3LGGA 3AHYA 2YCLB 2OJPA 2PDJA 1HTIA 1Q65A 1R2TA 3ARZA 1IGWA 1SZRA 2PD5A 2XZ7A 4O18A 1NDVA 5A5WA 3J7HA 3VGHA 4JTQA 1MXSA 1Y65A 4W86A 5CG7A 2X7WA 4XG1A 1NP2A 2WMHA 1US2A 1KM3A 4GI9A 1ZB5A 3DENA 1O95A 4XIAA 1ZJIA 5HBFA 2DSVA 2JEQA 2Y70A 3ZJKA 3U2CA 3U4FA 3LRMA 3W1AA 1CECA 4H6KA 1GJWA 1JCXA 2DDXA 3RDKA 1PE1A 4P7OA 4KPLA 1FWRA 1DYSA 1IZJA 1Q66A 1UWIA 3C4UA 5LXXA 1EL3A 3O6AA 3EDKA 3PANA 2QIWA 4JQ1A 1WBJA 3AISA 4NXKA 2J25A 3FA4A 1Q6QA 2ISVA 3NYZA 4NNAA 1W3LA 4Q4QA 4XZBA 2AOSA 3WEZA 3S5ZA 4QJ4B 3U2OA 5CBJA 3NL3A 2ATMA 1ADSA 2Y2WA 2GJPA 1O1ZA 1H50A 2QDHA 3VKBA 3KTSA 2X8RA 3OZYA 4GD0A 3W1MA 4PB4A 5DRIA 3VIOA 1G1YA 3OLEA 2EQDA 3SGUA 4H6QA 4L61A 7XIMA 3WDPP 3QN3A 2UY5A 1DWHM 5GNZA 1DXIA 3NQCA 1Q2RA 4MLJA 1H60A 2ZZ7A 1RPKA 4MG4A 1KFJA 2VFIA 1MEIA 4M6UA 1FWEC 4U2YA 4CEUC 1LT8A 3OVPA 5AHFA 1NF0A 1O1HA 1GVSA 4AD4A 1EC7A 2VHLA 3TH6A 5JIPA 4O14A 5CXPA 2ZX5A 5JIWA 1KM6A 1WKYA 4GIRA 1JQXA 4JFWA 3W9ZA 1XUZA 3GVWA 4C6EA 1M03A 3PPGA 1K4HA 4GXWA 4MWAC 4ASTA 5G1TA 3CTTA 2FZMA 4S3FA 4XAPA 4UTTA 2UY4A 2G3NA 3PBVA 1J5TA 3B9OA 4HU0A 4UFLA 2IQDA 3EX6A 5K2ZA 3S6OA 3BE7A 1JCLA 4ENLA 1EBHA 2D23A 3FW6A 4HN8A 4ZB5A 1EJ7L 3AIEA 3VO0A 4GK8A 5AOUA 2J7FA 5F4WA 4PODA 2NSOA 4C5ZA 4QJ3B 4CVUA 1VR6A 4UXDA 2ESCA 3EYPA 2W61A 5CC3A 3QC0A 2PBGA 4D6EA 2QZRA 2EHHA 1K77A 1J0ZA 3SUTA 3A21A 1UKTA 3K8LA 2ZKMX 4AISA 2OLSA 3ZR5A 1BRLB 1AD4A 1EJTC 3H54A 2J7DA 2VEPA 3T05A 3UP8A 1Q8JA 1QMLA 3MTWA 4AY8A 4UC5A 2WLZA 4UWMA 1TO3A 4F0RA 1QK0A 3B4YA 3LENA 3VIPA 3HK5A 2O7QA 3AS1A 2PMQA 1EO7A 4UFHA 3WDRA 2HEJA 3PTMA 2RDWA 3CPGA 3KBJA 3NA8A 1LOQA 3UR2A 2I56A 2GWNA 1KTCA 1KW1A 3HG4A 2Y0FA 3SCPA 4V1XA 1OCQA 1UR8A 1T99A 4HOZA 1UH3A 4L4MA 1OQFA 3VCRA 3BCDA 1X97A 5LGZA 1HO4A 2X42A 3DFQA 3ARQA 4WRHA 1G4SA 1O6IA 3TN3A 5EMYA 1K8CA 1WZMA 2B7OA 4ES4A 4HYWA 4YWSA 2ACQA 4FALA 2EPLX 1WZKA 5AC4A 1KNWA 2WMIA 3IIZA 1XC4A 1TSIA 1JXJA 1XLIA 3B4UA 4GIEA 2G8ZA 1MXGA 3SEPA 1WDWA 4PA8A 5G4WA 1AW1A 3W7GA 3WSUA 3LPFA 3COTA 5DCEA 4CN1A 3N4AA 2PRHA 1BEUA 1VIWA 5FJIA 1FKXA 3URBA 4YCPA 3W86A 5H8UA 4M24A 1JDCA 1XXXA 1UWQA 1XGZA 3QYSA 5L6UA 2DT1A 1Q6DA 1ESWA 4M6QA 2VOTA 1J8VA 1KM0A 3LQGA 1JNEA 4UR7A 1A4LA 3NSXA 3BO9A 5TAOA 1MQPA 4IPIA 1EHAA 2GDQA 5G4HC 1K1DA 3R2GA 4H6RA 3QC3A 3I7RA 3M0LA 1XQKA 3R0KA 1KV5A 3GAKA 2VX4A 1GHRA 3W7PA 2ISWA 3BVJA 3ERPA 2Q8LA 3VZYA 4WSHA 3WUGA 5KETA 3CAVA 4GIYA 4I8YA 4LCQA 2FHFA 1UR1A 2W79A 4DBDA 1RK6A 4PUWA 1E4IA 3W3OA 4O1AA 3W07A 4ERIA 1XIHA 3ATZA 1GQIA 5A6BD 4KFNA 4N0RA 3E38A 1B1YA 3WDQA 1U33A 1EO5A 4AF0A 3P8JA 1P0DA 5DQPA 4DO7A 3EWCA 2OSYA 1P4CA 4I7UA 2VDGA 2CHNA 3TDFA 4L1WA 4L6HA 1QAPA 1RD6A 4FXRA 3MO4A 3RG6A 5AYXA 3SADA 1FXQA 2BP1A 3KL3A 2D2JA 1OFBA 2QCDA 4MPQA 3WF3A 3OQEA 2BHYA 4LWWA 3W81A 1F3TA 4JIQA 3DKJA 3S5NA 4RK8A 4UTTC 4GABA 1V03A 2DQWA 4NX0A 2QJGA 5EGRA 1ZQ5A 4PE8A 4POCA 3H26A 1UP3A 4J5NA 1TZ7A 5HQEA 4ZB0A 3LPGA 1HJVA 1BSLA 4Q8OA 3OZMA 2VMFA 1YMYA 3U2ZA 4GLEA 5D33A 3AMCA 4E3TA 3TTQA 4QDWA 4QM1A 4BZYA 1HXJA 2YJQA 3H23A 4Q4MA 1WOAA 2FHBA 3CH9A 5F2IA 4BY3A 5K9DA 1FUYA 1OWQA 1XJBA 2J7BA 2NUWA 2G3JA 3WF2A 1TE6A 4LYQA 3S9IA 1ITXA 1D9EA 3KOWA 2JQXA 4BWLC 1YTDA 3AMLA 3BPWA 2BLEA 3CNYA 2IPGA 4M6VA 1GVQA 4IG2B 2D3LA 5KMYA 3MW7A 3THDA 1PVNA 4B2DA 2XSAA 2NQLA 1W54A 4KRTA 4NZ5A 3M5YA 4FHAA 3G22A 3URAA 3N4FA 3WBWA 1KXTA 3REQB 1E3ZA 3A22A 1QI3A 2XM2A 1JF5A 3P84A 4J35A 2A2IA 4Z2GA 2W4XA 3BCJA 4LY8A 4CQBA 1R3WA 2P5NA 1JJKA 3HGJA 4N9BA 4U2ZA 5AYBA 4RUBA 5I24A 2EPHA 5D05A 4LNCA 1D3GA 3DU0A 4GI6A 5H6HA 1S46A 3S1UA 1CIUA 1LL7A 1GOOA 1ONEA 1X7FA 2G4FA 3G0SA 4V2XA 1B3XA 5T9BG 2WVUA 3SR7A 4R33A 2OKOA 4MUPA 3MT1A 3OG2A 5EB8A 1ZY9A 4UFJA 4F0SA 2WAGA 3BG3A 3L21A 4BI6A 1VYRA 1TWWA 4AC1X 1C8YA 4KMQA 1UIOA 4MB3A 2Y7DA 4KEUA 5F4XA 4I9AA 2ZUUA 1R7AA 1C29A 2YCJA 3G24A 1JDAA 4X2PA 3N2BA 1KM2A 3N12A 4L80A 3JW7A 4LTSA 5HJLA 3EWZA 3DOPA 5FI8A 1PPIA 4DWSB 2EKCA 2WCAA 1K8XA 3VIHA 5IXEA 4HU3A 1SZNA 3UG8A 4I9TA 3AJXA 4LYKA 3LV6A 3G1HA 1UD2A 3SW6A 4G2DA 3H53A 3SY5A 3QF0A 3S47A 2NVDA 2IQTA 3WH8A 3CYJA 2GQAA 4GNKB 3NZGA 3UZWA 1K7FA 3WJXA 3TNOA 2YLAA 3NIYA 4HHMA 4D6IA 3GNOA 4JR5A 1P0KA 2DW6A 3IEBA 4TV5A 2FB3A 5CPSA 2WZEA 3C86A 3W27A 5FAGA 5HJYA 4XTIA 4NYUA 3WD1A 3KRSA 4XSMA 1F05A 4FNUA 3S4TA 1D3CA 3GG7A 4UQCA 1F9CA 4Y2WA 3TWBA 1QNOA 2PC4A 3WUFA 1Y5VA 5CC6A 1IIGA 1MNZA 3CQJA 4HTYA 4MAZA 3MJMA 3A5VA 4QIUA 1XH0A 1DIKA 4GX8A 2YCEA 2XIQA 3PZMA 4ZVJA 3W75A 3H2CA 4LYRA 1W9PA 4Q8TA 3B0UX 4NZ3A 1ECEA 2J8TA 1ONRA 4JX6A 2R1MA 2VDIA 4UTWA 2QPUA 3GFZA 1MUWA 1CW2A 3VIGA 3BAKA 2BVWA 1JPDX 3C0QA 2ZRZA 1IXQA 4M82A 3W7OA 1XS2A 4OOZA 1D2KA 4WDWA 4LUYA 1IGSA 5CSSA 2Y7GA 3B8UA 3W38A 1HVQA 5D9NA 4Q6XA 1XIEA 1H7WA 2AQVA 1EP1A 3ARVA 1W3NA 4UCGA 1CXFA 2H3BA 1SFLA 4Q7NA 4IMFA 1JI2A 3LK6A 1FH8A 4G56A 3I7QA 1N8WA 3CAWA 5IOBA 1GZGA 1TYGA 1OX4A 5A6LA 1RP8A 1HVXA 4JXCA 1F4HA 3MDUA 4TVCA 3O07A 2EEXA 3T07A 4A29A 2Q6EA 1TQJA 2GSJA 3PJUA 4PMJA 2VEFA 5CSUA 1X39A 3V5CA 1K8ZA 3GDLA 4LEQA 3W7QA 1JAKA 3WK1A 2Y6ZA 3HPSA 1JCMP 1M01A 1XYBA 3ZS4A 1VLWA 2WOQA 2J77A 4Q7BA 1JGMA 1R2SA 3M0MA 2VGBA 4LALA 2Z24A 3KRUA 2TPSA 3ZSSA 2VFHA 3F03K 1B2YA 5I7GA 3W7LA 3UPBA 1FWDC 1A47A 4H2HA 2HPMA 4OQVA 1BG9A 3DFOA 3W84A 4D1IA 3GC4A 3P5YA 1E51A 3TMLA 1F76A 1XDLA 3NO3A 4MY9A 1N8FA 1X38A 4Y9NA 3RO6A 4PMQA 4XD6A 2Z26A 4M0XA 2PZ0A 4JIIX 5HPOA 3NL2A 4RE4A 3PG9A 2YBVA 4WD0A 5RUBA 1TV3A 1XDMA 4FA3A 3BOLA 3B04A 4EPEC 3QRHA 3LV5A 1L8PA 1W8GA 2PGRA 3QR0A 1KFBA 5EA9A 2DT0A 3VDCA 1RLDA 4FF5A 3LCHA 5T26A 1JD7A 4W8LA 2I9EA 3VNJA 2V38A 1QWGA 3L9CA 3POCA 4MM1A 2PF0A 1EEPA 4KFPA 3OZOA 6TIMA 4YXGA 3CL8A 2PDLA 1GOIA 3V0TA 1XFCA 4NI8A 3FV9A 1U5HA 1V0NA 4W88A 3OG3A 2CLOA 3AMDA 2FMNA 1BWKA 3WLTA 3BGGA 4NI3A 2D1ZA 3UESA 3HQPA 5DMLA 5GNYA 2VEIA 2IUZA 3U5UA 1VC4A 4LBSA 2YZRA 1YDVA 4NAEA 3SSZA 3TQ0A 4KF1A 5EFFA 4LUSA 1GEHA 2VR2A 2YLLA 4HIBA 3VZXA 4ATLA 1Q4WA 1W9BM 1YYAA 4AWTA 2X2GA 1GHSA 1J5SA 3NQ8A 1SFJA 4QQUA 4LUTA 1WDRA 4K6AA 1CNVA 1Y5XA 2EG8A 4O1FA 3H2MA 4HVXA 4AX6A 3AU6A 4LT9A 5A6BA 3AWOA 5T91A 4GY1A 1KFWA 3M46A 3OBAA 5CH9A 4OHQA 3AIVA 4PCPA 1XV8A 4H6EA 1X1NA 2PA6A 4XAFA 1GYMA 3AYVA 5I09A 5LA2A 3E2RA 3EA1A 2HNHA 5TNVA 1OD0A 1O5RA 3QQWA 2NX3A 2VVNA 4KETA 3RX4A 3NR0A 4JNZA 4NP7A 2LLEA 1BGAA 3W7EA 8RUCA 4A3HA 2GPTA 3IWPA 2H90A 5C2GA 1XSIA 4GOAA 2X1RA 7ENLA 2XVPA 1EJSC 2CLLA 1HKVA 4WOZA 3STEA 4C5YA 2XN2A 3FY1A 3I68A 4ADTA 2VGFA 3WELA 3QHOA 4AAJA 4CLMA 2I57A 4H9XA 3WNNA 5A2BA 4FXFA 5AB3A 1OADA 4GA8A 2YOCA 3V7PA 1FWNA 8A3HA 2QPSA 3LI0A 1A0CA 1ISXA 4F4RA 2Y61A 2PRLA 3VA8A 4B4HA 3QV6A 3KM8A 3B06A 4DZ5A 3SGZA 3CZLA 1C91A 4V1YA 1VBHA 1XLGA 2AAAA 5CPLA 4BQ3A 2Z28A 1GKRA 2BY1A 3LM3A 3TOPA 2OZ0A 1Q13A 5HNRA 3BK0A 3CZJA 4JOMA 5HWJA 2W66A 3W22A 2DIEA 3W28A 4BF7A 2F2KA 2E6YA 5IHSA 1CXIA 3GVVA 1QRQA 3KBVA 3S2CA 2FVLA 3T78A 4UTKA 1XKJA 8XIAA 4XZLX 2C16A 1KCXA 3RMEA 3HBLA 4LAMA 2J7CA 3UEQA 1DP0A 4C1NA 1TE1A 3UY7A 4S3DA 1JEZA 1QNPA 4LH8A 2GGIA 3WQOA 3EAUA 3ECQA 1WKDA 2J9ZA 4H83A 4O1CA 3ORWA 4JFTA 1J2WA 1BVZA 1PTAA 4FK9A 4S3EA 1NEYA 2C19A 2GL5A 4FEZA 3OLDA 5HR7A 1GQKA 4K39A 3GNNA 4UR8A 2Z29A 1QNRA 2R9RA 4QGCA 1RAKA 4OUEA 4QITA 5I5RA 3VAVA 2ICSA 3KFTA 2RAGA 3VD7A 4O4WA 1DJZA 1K6WA 1VIZA 4YHGA 1V6YA 2QIIA 1OC7A 2CLIA 2OGYA 1E15A 1UBSA 3HIJA 2A3BA 3VFCA 4IX0A 4AWEA 4GX9A 3D5HA 2HWGA 2VOMA 3KWSA 3T2PA 3PAJA 4O50A 1XLCA 2WNZA 3UXKA 3G3DA 2WZIA 2FFIA 3BMXA 1EP2A 3B97A 4PBGA 3GDKA 3UZZA 4CD6A 2DZVA 3TQKA 2DGAA 3PJWA 2GOUA 1UROA 2QV5A 2DT3A 3PZGA 3FDKA 5LKYA 5HWMA 2WNQA 4F66A 4DQWA 4MY8A 4HOWA 1RP9A 4IGHA 1SMDA 2WPBA 5C9UA 1IHIA 3MBFA 3LMYA 1S5TA 2GGHA 1DHKA 3H2AA 1W1ZA 3DG7A 4ACZA 1TA3B 3MB9A 4AU0A 4YLWA 3AIBA 3ARUA 3TMQA 1KFCA 1DXFA 2HISA 1JZ2A 3WLLA 3BGJA 2ZQ0A 3CHVA 4IMAA 3SUWA 4HPHA 4AVNA 3G2GA 5I3JA 1FDZA 2R1NA 1TTIA 2RJHA 3OIXA 4XZHA 1B5TA 4B9YA 3NDYA 3BSHA 4HPNA 2P8BA 1FWBC 3AS2A 4HMCA 4UMCA 5AECA 3C5QA 1ZBKA 3KOZA 2DZSA 4WY0F 4GGBA 4HYRA 4J4KA 4JTSA 1NAL1 3TN4A 3WQFA 1SO3A 3OLGA 2E40A 2PDIA 4W87A 5LNUA 4OFCA 3MA8A 4O8AA 2VENA 3WN6A 2Y7FA 4IL0A 2C7FA 4NNCA 1SM9A 4UZUA 3KAOA 3TXVA 1EUAA 1P0NA 2ZA1A 1UYQA 5CEWA 3DESA 2WBGA 3HA1A 4AEFA 1CXHA 1EC9A 4UTUA 1US0A 4W89A 3CLWA 4CNNA 3IV8A 2G41A 3FX4A 4IIBA 3CZ8A 3W00A 2YL5A 4FLRA 1D8WA 3OIHA 1G9HA 3W37A 4O12A 4W85A 2NSXA 4EXAA 1AH4A 1EC8A 3P82A 3LBOA 4ZO9A 3BMWA 1E1FA 1BWVA 5EMUA 3PJTA 3QV8A 2ABAA 2CLEA 1RJPA 3AIRA 3FJLA 2RGLA 4I7VA 4L1GA 1A4MA 1YX1A 5C9WA 3WK0A 4GYPC 4PL2A 1TPFA 3QJAA 3CHCA 4JTDA 3B8IA 4NXSA 2CERA 1J0JA 3IIXA 4HTBA 4LBRA 3GXFA 2C1GA 4HOXA 1R30A 1BFNA 4UQ9A 2V8ZA 3E2QA 4MWAB 3G77A 5AN7A 1NWRA 1XLMA 2JIWA 1F8MA 1BYDA 3IIPA 3RK8A 3Q94A 1XLJA 3BSGA 3HQOA 2XINA 3HK9A 3FJ6A 4H1ZA 4KWOA 3WF1A 4HZ7A 1GGOA 5BYWA 1JCTA 3FVMA 1FWTA 1UD8A 2DY3A 2GVJA 5K9CA 1LJYA 4W9TA 1I2RA 1DV7A 1TV2A 2VRQA 4JBRA 3F2BA 4J28A 2PDMA 4R7OA 3WFLA 2JALA 4PRTA 1LRTA 1T7LA 2I5GA 1NSJA 3SQLA 4MYXA 1J93A 3MHGA 3E02A 4RV3A 1NH6A 5AHMA 1QBAA 4AZCA 1XIBA 1LP6A 2Q3RA 3ZQ9A 1S2WA 3M0KA 1RHCA 2V6AA 4NJKA 3TYUA 1GVEA 4KQNA 2FZ8A 1XLKA 4JEQA 4ZXOA 3V0SA 3GIYA 1GCYA 3WQ8A 5D2XA 5G4EA 1XIJA 3GR4A 5K7JA 3LX9A 4PTXA 4WHBA 1V3LA 7TAAA 1M7PA 2FDMA 4PMDA 4KGLA 1EX1A 1I2NA 2OT0A 5M2FX 1AQHA 2A3AA 4NAFA 4DPQA 1YKWA 1OZQA 1XPGA 3GW0A 4OJYA 4WGXA 4JL2A 5DBUA 3TKFA 4O1EA 3UWUA 1SFTA 2VZVA 3SSJA 1VFOA 2G4JA 3PULA 4XISA 3N9SA 2OWXA 4K38A 4GJ1A 4EE9A 2XVNA 2PB1A 2CZVA 3IRDA 4HYVA 1M04A 1AJ2A 3KL0A 4FF7A 6PTDA 3TX9A 5DEZA 1ITQA 1SZGA 5AZ1A 2OT1A 1DTUA 5CJ5A 3WX7A 3ITYA 2ZICA 1TTQA 4Y90A 4MJMA 1QHZA 1VFFA 1TJ1A 4BF9A 4XAYA 3QHNA 1W1IE 3GU1A 3DFHA 3HJZA 3PM6A 4CD8A 4L6OA 3W70A 3HGSA 4IX2A 1QPKA 1NARA 1NWUA 5M1TA 1W8SA 3SCRA 4BEUA 3SCNA 3TYDA 3D47A 3NGFA 2YBTA 1OM0A 2I17A 5GPRA 4JQ4A 2OPJA 1W3KA 2E3ZA 1JR1A 4A8RA 3F4CA 4YNGA 5ENLA 3R25A 1QT1A 1AH3A 3CV6A 2E25A 3EOSA 2BXZA 1W1YA 4C65A 3ATYA 4X22A 1SO4A 1J2BA 3ITOA 4IIFA 1T8XA 5LIUX 2CIPA 3RJXA 4AYGA 5FJUA 5LIYX 1S5NA 4S2CA 4LUJA 4KCVA 5TQLA 4JCLA 4A8IA 3QKEA 3CPRA 2DIKA 2OQHA 1UWTA 4P7LA 2QUMA 2V2HA 5E9AA 5KITA 3S42A 3LRKA 4J3TA 4KCTA 3LMZA 2VC6A 3DXIA 5JMUA 2QCEA 4W7VA 1LLZA 1NM9A 1KV8A 2BASA 2ZC1A 1A3HA 3O0FA 3SDOA 1RSCA 1AD1A 1OZMA 3WKZA 3LERA 2TAAA 3ZT5A 1DJIA 3KE0A 4WSKA 1AUSL 5CJNA 4GQBA 3Q58A 4FAMA 5A2CA 3WL1A 4DYEA 2XIJA 2ISSA 1DE5A 2J7EA 3EXSA 3LTYA 4PSRA 3GHTA 4A3YA 1IEQA 3OHMB 1JUEA 7REQB 4RV8A 3OP2A 3FFSA 2C0HA 2CPUA 1KTNA 3UETA 4E2BA 3QMSA 2G5WA 1WUFA 3A47A 3GRIA 1GPWA 3LHVA 4G8TA 1B3OA 2ZRUA 3GDRA 1W3JA 2VD9A 3G18A 4MSSA 4R9OA 5JH2A 3S8HA 2CCRA 3SRKA 1EA9C 4DJEC 1PTGA 1PZ3A 4P8XA 2ACUA 1Z89A 3TZNA 1ODZA 1EDQA 3AXXA 3GDMA 2ZOXA 3B8DA 1K8YA 3UYCA 2J78A 1JYWA 3UXLA 2IW0A 1F4AA 4E6MA 3GX9A 3UQNA 1VEPA 4PMXA 1J10A 3RCYA 3RPTA 5I3IA 2WANA 1KCLA 3VOJA 3DEQA 1YLVA 3VE7A 4W7WA 4KWVA 3WBXA 3ITVA 3IUIA 3WFAA 1L9WA 3F1QA 7TIMA 3DYOA 5IHRA 1BYBA 2PRMA 5E6YA 5AFDA 1EHNA 2PDWA 4OT7A 1SO5A 4NU7A 4DRSA 3QOKA 3DIPA 4RW5A 1AK5A 1JD9A 3GHRA 1REQB 4P8VA 3SB0A 1VJZA 2Y85A 1GQJA 4IZGA 3H21A 1AH0A 5AHNA 5EMJA 4ECLA 1Q6OA 1UD6A 3WL0A 4W8BA 1ZALA 3T08A 2NV2A 4HA1A 5DF0A 3NOYA 3PZVA 3KUMA 4HZ8A 4HPGA 3V5OA 4MKNA 5HULA 3D3FA 3GG1A 3AHVA 3A64A 1J0KA 2WM1A 4YU1A 3USBA 2DJLA 1NDYA 4OE7A 4H7CA 2V0TA 2VEKA 1J0HA 4DBUA 4EF8A 3A9BA 4QJ1A 3NM1A 2QVHA 1WE5A 4PFHA 1W3IA 4FX8A 1HQTA 3W4RA 3TIMA 1JAEA 3WD4A 1UPPA 3IVTA 3NVTA 1SQ7A 3UYIA 3ES7A 3SN0A 4E5TA 3BUVA 2P3EA 3OYZA 4ZO6A 3IACA 2WZHA 4PMYA 5BXRA 4L1XA 2ZWZA 1RH9A 4XZIA 1YTEA 1V08A 2PWDA 4PTDA 4LVBA 3SQSA 1P43A 3VIJA 3AMKA 1K03A 1UD3A 2BS9A 4IUGA 3MZ2A 1MW2A 2WNNA 1AL7A 1EJVC 4K8GA 1E73M 4E8CA 2OEMA 4CKQA 4I6VA 3HG3A 1MW1A 3TC6A 5HMSA 2FTYA 3W1LA 1RLCL 4O13A 4H9TA 3QPZA 3P93A 2ZWYA 3T40A 1I8JA 1HO1A 2W5FA 3GBEA 3UZJA 3ENLA 2XTKA 1QI5A 5FIPA 4JTIA 2VRJA 3R8GA 4S3CA 2W92A 5EMMA 2OOFA 4K1WA 3G0UA 1QOXA 1UUMA 1I60A 2X09A 3OGRA 1W5QA 2CBIA 4MB5A 1DJHA 1RY0A 2DFAA 3AICA 3KLKA 3EOUA 3TEVA 1E9ZB 4XZ9A 2GJNA 1LDCA 3ZJ7A 5EY5A 3NCOA 3ZFHA 2VX6A 5CGMA 3UBPC 1XLFA 3LQLA 4KFOA 3NL5A 5D4YA 3L0NA 4QS6A 1OCJA 1VCFA 5A8PA 1LWJA 3VOGA 5I3GA 4IJCA 1L6YA 3C0SA 5BRPA 1QOQA 5DMMA 3L4UA 3E0IA 5FF7A 3U57A 2D0GA 2CESA 5A95A 3IJ8A 4Z1BA 1KFEA 4GG9A 3G5EA 3G1FA 4EF9A 3UG4A 5MF5A 3W24A 2VFEA 3VX0A 3RX3A 4ZE5A 2O4QA 3GUWA 4YYFA 5FACA 2WCGA 2QCMA 1HT6A 3G1SA 2WSKA 3FK4A 1LZOA 1R9ZA 4PL1A 1W6TA 1V3KA 1ZBCA 3GBDA 2FFCA 4MMWA 2BOFX 2CKRA 4NZ4A 3IAPA 2OVLA 2A7PA 4TR9A 3VUPA 3MKCA 1KM5A 2E7FA 3AO0A 4YWIA 4EPBC 3SJ3A 1GOWA 4NL1A 3T4CA 1LORA 1H51A 4GC4A 4ZGYA 3MSRA 4MZ8A 1QUMA 2BBFA 1JRBA 2P53A 2I7GA 1MZHA 3H2NA 4O11A 1AVAA 2P88A 3N9RA 3PPHA 4Z0JA 3MY9A 2RKXA 3QV7A 3BLKA 4NJJA 1LQAA 4F48A 1PKLA 1EIBA 1QBBA 3T0AA 1DTNA 4HU8A 4Z2HA 5GNXA 3KZSA 1KRAC 3VDBA 1P48A 2GVLA 2E5BA 3OA3A 4FZIA 3PUGA 5IFPA 1EKOA 3NQAA 3C8NA 3VMOA 3P6LA 3ABSA 5L9FA 1UR4A 3ABQA 3R89A 3BXWA 1TV5A 3HB9A 4JD4A 4IIGA 3BQ5A 3HTWA 4IQDA 3WJYA 3TJXA 4E2OA 1XUUA 4H04A 1WKFA 4S3BA 2Z1VA 3II1A 3H55A 4XUGA 5HAOA 5AHEA 1XX1A 2GK1A 1G4EA 1X8FA 4G7EA 3PB2A 3M43A 2B7NA 3S1VA 3GXIA 4Z0SA 5HNNA 1B9ZA 2HTMA 3N2TA 4QSFA 1QI0A 3I6TA 4LBUA 1I4NA 4NIRA 3SGGA 4B5SA 1RA0A 2ABBA 1FQ0A 5A6AA 2E67A 1CT5A 4TU1A 5BWFA 6ALDA 1IE7C 1ZJBA 3LCLA 2QDEA 3QZEA 3ANUA 4MDOA 4LVAA 1V6VA 4NHVA 4A2SA 1AL8A 1MEHA 3BV4A 4US5D 2OQLA 3WH5A 3MUIA 3PTQA 2X41A 4AUBA 3EOEA 1BXCA 4V28A 1TQXA 3LA4A 4IFKA 3KBWA 3MPGA 3T09A 1VD6A 3CEUA 2XHYA 5CZKA 2QJIA 4G7FA 2IKGA 6REQA 1GNXA 4CQ8A 1YBQA 3MCOA 2GVGA 4IGSA 3DFSA 4X61A 3UT0A 1AZ2A 3AJ7A 1XG4A 1FVPA 3E9AA 1UKPA 1A49A 4IICA 2NZLA 2DV0A 4WZHA 2VCCA 4MOZA 1MW3A 4LUIA 3QW4B 2D3NA 4JYEA 2WKJA 3UWQA 4QEHA 2JK2A 3IJ7A 5FEPA 2R24A 2WHKA 3S2LA 3UR5A 1S39A 4IH3A 4RKAA 3W7KA 3R11A 3F4DA 1EDTA 1ITUA 2ZUNA 1GTHA 3ZSTA 3QTPA 4HQVA 1FA2A 4RNIA 2WHMA 1PAMA 1O5KA 5A6TC 1HJSA 2WVTA 3WJWA 4QHRA 2JKPA 4XAZA 1W32A 1MRAA 2CKSA 2BHZA 4O0QA 2G97A 3PS7A 3RIKA 4Q8VA 3CXOA 3QVQA 4BKNA 3EB3A 4H00A 4NNBA 1A50A 2DUZA 4WCJA 2NQZA 1IZCA 3AHZA 3XIMA 4KH2A 1F73A 3A3HA 2Z4GA 4CQAA 3ARRA 1NY1A 1XW8A 1UA7A 3F2CA 3FEMA 1TUXA 2DW7A 4EX4A 3FDGA 3LHWA 1RQEA 4RXFA 2XGZA 1A5LC 4DO4A 3W6MA 1XCFA 3NQBA 3VKCA 1MQQA 5ABHA 3TLLA 2QMJA 4M1RA 3VMPA 2PDNA 5DX7A 4EXBA 1OF6A 4PC8A 3MCMA 1B4KA 5IM51 4IQEA 3CT7A 3T0CA 2A7RA 3DFYA 2BGQA 3IS4A 4AYSA 1QPRA 3BG9A 1ALDA 1BYCA 4HSNA 3HZ3A 3ITCA 3K8KA 1LUCA 3GH5A 3VDHA 2NUYA 1LL4A 2W0UA 2VR5A 2PP3A 4DJDD 1QPQA 3LBMA 2A3HA 3EKGA 2G3MA 2A0NA 3ZYZA 1JUBA 2X1IA 3MWAA 3WYZA 4IL2A 4J3UA 1TV4A 5AVNA 3OZPA 2B7QA 1A5BA 1OVDA 3AC0A 1XRSA 4C60A 2QJJA 3CMFA 1B31A 2G50A 1ZTVA 1Z8AA 2VT0A 2DZWA 3EDDA 3HMCA 4NY2A 2YA0A 4K2SA 4FS9A 2JFEX 2J24A 2OG9A 3BW3A 1BTCA 1N2VA 3CO4A 3IJ9A 2E9BA 1US3A 4ZQOA 2IXVA 4C91A 1WCGA 4O16A 1J6OA 4IXXA 2VGIA 1P6BA 4YTSA 3AZSA 2PWUA 3VGFA 2NWSA 1OGSA 1V02A 5FEWA 2WMFA 3GYCA 1KXQA 4JCMA 2PPGA 4S23A 4MJ2A 4H4IA 3FJNA 1R3YA 5CQ1A 1E6NA 3RLUA 4GQGA 3KZPA 1OGBA 2WM0A 4O1BA 4AC7C 1UWAA 2E09A 3E1F1 4K1GA 1VYPX 3RPDA 1P5BA 4DUXA 4LB3A 3ALFA 4RE0A 5I79A 3CBWA 3KP1A 4OBRA 2YKKA 2OTDA 4LEFA 4EVZA 4R3UA 4M3PA 3BAJA 3SUUA 4G5DA 4V27A 2Z1KA 1JCJA 3VOIA 5GVJA 4EAYA 1OIFA 7PTDA 4C7DA 4RXGA 1BQGA 3GIPA 4JIRA 4PMNA 4RDZA 3MC5A 2XM1A 3PBGA 3G1XA 3SUVA 3AHTA 3DHDA 2QGHA 2ZDSA 4I6KA 3PVFA 3CHDA 1TWDA 2V5CA 1WA3A 4S39A 3UR8A 1W5MA 4EXQA 1G4TA 5XIAA 3HFTA 2UY2A 2VUNA 1NQKA 3SFWA 4O10A 5D9OA 3BQ6A 1IT7A 3NZQA 3I3BA 2XN1A 1ZUAX 1X96A 2R1KA 1W1A1 2WYSA 5I6SA 5JBFA 2Y8KA 3C52A 2G3FA 3HN3A 2Y5JA 1FH7A 4GQ0A 3D6NA 5BRQA 3W85A 2BY0A 4AXNA 3WMCA 3VCCA 1GOKA 3C8FA 1MDLA 2GQ3A 3W53A 3ZWTA 4ZODA 5ABEA 2Q6ZA 2ASHA 1UD4A 1RZMA 4N9CA 1F3EA 4HD5A 4ATDA 3FHAA 3BDKA 4LV9A 1E6XM 1FHVA 2J8FA 2OLAA 3I3EA 2GVEA 5K4XA 2XU2A 1SYTA 1W0MA 4XBKA 2E1WA 1EJWC 3WH7A 2NVAA 4HNNA 4AD2A 3LCFA 2QDDA 3RU8X 4B15A 3N29A 4GZ7A 5H2ZA 4ZTYA 2XSBA 4A8NA 2I16A 4LCSA 5C2CA 3R7MA 1JZ8A 3PSWA 3VU2A 3NGJA 3U4AA 3RHGA 4JY9A 4JZ5A 4Q8PA 3NQEA 1UB3A 3QPYA 1DHPA 1SW0A 3FKRA 1FWAC 3U5YA 4GH1A 1BGGA 3BLOA 3R94A 1PS9A 5CZ0A 4QG6A 4R27A 5FJJA 2G37A 5M3WA 3U2EA 5EYWA 4UNKA 4GUGA 2F6UA 4KRZA 1MQRA 2YL8A 2FYMA 1Q7MA 2ISFA 4XO6A 3R6IA 1Q63A 4TUFA 4IMDA 1R8LA 3CQ0A 5B80A 2EPNA 3TYBA 1VRXA 1LYXA 2XJ7A 4AVFA 2V3DA 3W7MA 1FHUA 2J9XA 2Z1XA 1RBLA 3MVIA 3VXGA 1EH9A 4DZIA 1MMFA 1RUSA 5CZTA 5KTLA 3B0XA 3NQ2A 4YIWA 1S2VA 4AMCA 3RYSA 3CM4A 1FCQA 3URNA 3LZ3A 3OBEA 3W82A 3IJIA 4GUJA 3ZR6A 3FYOA 3HJEA 1QPNA 4MJZA 3QZ6A 4GYKA 4AHPA 2Z1SA 2YCIX 2E77A 3GY1A 4B4FA 1HGWA 2WWCA 1IF2A 3KTXA 4CUCA 2ZX9A 4PB3A 3KOXA 4CNTA 4HKPA 3RU6A 1CX9A 3MP4A 2DP3A 1U30A 4CQ9A 1R85A 2YCLA 4JGDA 4AFYA 4LYPA 2V2CA 3RO8A 2VKZG 1WUEA 2OMAA 3JRKA 1GG1A 2VCBA 5I23A 3ARPA 4Y96A 2PDFA 3TR2A 1ZAIA 4UIOA 1OX5A 1GONA 2YIHA 2KZHA 2PD9A 4ORIA 1XSJA 4GJIA 3OLIA 4GUIA 4US5A 5LIKX 2PWFA 2DH3A 2J47A 1E5NA 4ZOAA 1ELSA 4W5UA 1VB9A 1VPXA 4UFKA 3ZVHB 3O15A 3VI2A 1KRCC 3IVUA 4Y9AA 1E43A 3OYXA 3AIQA 4D1JA 4YTRA 2PLCA 3QFWA 2UV8G 2H8ZA 3E0WA 1GK8A 2GVYA 1YNYA 2FJKA 3SCWA 3SJNA 3GR8A 1SPQA 2VM8A 5DMNA 4ACZB 1JL8A 1W37A 3CAKA 1CGVA 3CU2A 3JVAA 1VJSA 3NQMA 4WK9A 2ZFAA 3ICJA 1SU5A 3Q65A 1KLYA 4NZJA 1V77A 1OCNA 2D22A 4E4UA 4K8HA 1L6SA 7CGTA 5CPMA 1IWAA 1PIIA 3TCSA 3NG3A 4DWSD 3W1TA 3CWNA 1QHOA 5TF0A 5BU9A 2QNEA 3R12A 1O66A 1QNVA 4R53A 1U1JA 4AD3A 3HMJG 3FSUA 4WJXA 1F3WA 5JH1A 1XGDA 2Y8VA 1TRDA 5HDRA 5KSWA 3GHUA 1FXPA 3HOJA 1LQ0A 3A4JA 2FVKA 5FF2A 4H8HA 1SVDA 4N02A 1I75A 4AH7A 3SCOA 1E4MM 4DX3A 3VIKA 2TYSA 5JQ9A 3PBUA 4PCFA 2XYLA 1UUQA 2PCQA 5C5YA 3AFBA 5C0QA 5GJMA 3NOEA 2J6VA 4QP0A 2CWXA 4IUOA 1SR0A 1CXKA 3B8TA 4UOZA 3T6CA 1UP2A 4Q8QA 2J7HA 1S38A 4F9DA 1KKRA 2BWGA 1UR3M 1K9EA 5IBXA 5TIMA 4UNLA 5HQMA 1GUVA 4P8UA 1XLBA 3GFXA 3TCEA 2YFNA 2HSAA 3PTKA 1IV8A 2DUAA 3H6OA 2FPTA 3W1PA 3APGA 4DUOA 4U33A 2GSEA 3EDFA 3B8SA 1KM1A 3ARYA 1VKFA 2CHOA 5JBDA 3TJ4A 1ZZMA 3HPZA 3W1NA 2TMDA 4HK5A 4PUNA 4DZHA 3HG5A 3W73A 5HOSA 4M5PA 3PWIA 2FB2A 3FA5A 4ATWA 2JGQA 4G6CA 1I0BA 2I14A 2CWNA 4G1KA 4JL1A 4TOQA 3UNTA 4F2BA 3NPXA 4YMZA 1DL3A 2QVNA 3PP7A 4AD5A 1VBRA 2D0FA 4QTGA 3L4WA 4CN4A 5C55A 4DJDA 1XICA 4JX5A 3CL6A 1PYMA 4NZCA 1WYIA 1GOQA 5B7YA 1OFAA 4UOJA 1TMLA 1RALA 3K5XA 2QEEA 3O9NA 4PN2A 1XGEA 3L4XA 1EEXA 4K7VA 4PYSA 1BRLA 1C8VA 2Z7KA 3UWYA 1GKPA 3R10A 4OBTA 4RZ4A 1TWIA 2X1UA 2VYOA 2BOGX 1PWMA 1MFVA 4ROQA 2HCVA 1XBYA 4FXJA 4XWUA 3M1ZA 2GYIA 3WJSA 4ZENA 1V7YA 2ZC8A 1FWHC 1J6PA 1PXGA 3G1AA 3LG3A 5I77A 2NXHA 3I6EA 1B3ZA 3BJTA 1EB3A 3I3DA 3HF3A 5GQBA 3SI9A 4WVXA 4OU1A 1A5CA 3W6LA 3IUDA 4B3LA 3WQ4A 1S2CA 2VQTA 4JN7A 4AD0A 4CNPA 1C93A 4LX4A 4ZQCA 3FEQA 2O7SA 1BF6A 1FY6A 4I5XA 1XSKA 4AWUA 1WDPA 4DM2A 3RLGA 2YR1A 4YTQA 2QJMA 4I9MA 2NX9A 2GJLA 3VIIA 3M6YA 1Y5WA 3CV7A 1HX0A 5F2GA 4QNWA 4DBSA 1AMKA 5KZDA 1P6CA 4QLKA 3W1QA 2DJXA 1LROA 4HHPA 2BY2A 4QDMA 4PB5A 4XSLA 2YL6A 3POHA 3N13A 5DT5A 3LRLA 1TX0A 1H7PA 2Z1WA 1QPOA 3H7UA 5CG0A 3UJSA 2PU0A 1H2JA 2ON3A 3UG5A 1UBPC 1JNDA 3BLFA 3CJPA 1FP9A 2J74A 1PZ1A 4AY7A 2HS8A 4CD7A 1UJPA 4OZOA 1OFOA 1H09A 3EWXA 4GJJA 5LNRA 2P8CA 5SWUA 1TMHA 1B3WA 1TPH1 3TSBA 3N2CA 5I3DA 3GG0A 2WVSA 1VFMA 3EX1A 1TIWA 3VNLA 1W9VA 2PDBA 1KCZA 4MNLA 4PTWA 3AYTA 2BVYA 4GUHA 2PWVA 4NF7A 4R7WA 2HBVA 4DUWA 3AZRA 5D9MA 2BMBA 3I7SA 1VCVA 3VIMA 1YEYA 3EWDA 3N04A 1R86A 4U4MA 4PMOA 1D8CA 5M5DA 3DDMA 1A80A 2Z2AA 2YA2A 1ICPA 1A3WA 3UJ2A 1PCWA 1TREA 3DHPA 4TVDA 1VFLA 2JIEA 3UNDA 1AG1O 1CBGA 1L6WA 1BPLB 3MUXA 4HK7A 2BODX 3KHJA 2REQB 4V33A 2WNWA 4KEZA 5AY7A 2NQ5A 4BI7A 1XR2A 4XK2A 1FDJA 3T8LA 4FMVA 2FKPA 4QE5A 5E93A 4Q4PA 2BX7A 2QJNA 3A4WA 1VBUA 3DFNA 4A05A 5BXTA 4H19A 2WLYA 1RA5A 4QCFA 1OF8A 2BV9A 4CCZA 1X1ZA 2KX9A 1TELA 1VH7A 3TC3A 3EA3A 3QLLA 3M9YA 5CZJA 1EPXA 4DELA 3MU7A 3FYPA 4TVUA 3ABZA 4YJ5A 2DVTA 5LHFA 3PB0A 4CCEA 1XIFA 4YVXA 1ECQA 3TYAA 2IKJA 1IEWA 3VNIA 3EWYA 4LOCA 1Z69A 2CLKA 4U3AA 2PDUA 3QW3A 1FWWA 1TZ9A 3WH6A 3QY6A 1PYFA 5C71A 2CLFA 1C8XA 1E3XA 2YDSA 2OO6A 3BAYA 3FGCB 1UZHA 4DJFD 3C2OA 3SY1A 4GKLA 3OEXA 3VD9A 3FKKA 4IHCA 3M0IA 1DJGA 3LN3A 4IG2A 4GINA 4N9DA 2ZRVA 4MKVA 1HIZA 2GZXA 1ZBVA 4L9XA 2YB1A 3CGTA 4HA3A 2PDQA 3WLSA 1LBFA 4J2PA 5I02A 4NUWA 3W02A 4ZFCA 3ZZ1A 4ALDA 1ADDA 4PCNA 3REQA 3PPFA 2DZBA 1PX3A 3V3WA 1E70M 4D6GA 4HPXA 4UFIA 4EOUA 2J62A 3QEZA 4M7TA 2GOKA 4DPPA 2ANUA 3M0VA 4UQBA 5KZMA 1QCWA 2WQPA 5KEZA 3WBAA 2D20A 4I7WA 3B3DA 2QJHA 1QWKA 3TNBA 3ZLHA 2ZXBA 1F6KA 3D3AA 3O16A 1DQWA 4H41A 4UQAA 3URQA 3W2LA 2CHRA 2OXNA 3WEMA 4N4QA 4MY1A 1E6ZA 1O4UA 3PAOA 3MANA 1GW1A 1E72M 1FWCC 2PTXA 2X30A 1R0MA 2GGJA 3QR1A 4E4FA 5D03A 4C6DA 3TSDA 3IK2A 3S2NA 1Z44A 2CZEA 4PTMA 4Z2IA 3K46A 4K36A 4DAIA 2ODOA 3UJFA 3FS2A 4Z2JA 2V5BA 2XFWA 1TJ2A 1LBLA 1HKIA 4WKHA 1VFHA 2JEPA 2XGIA 4UR9A 4XZMX 3NUKA 4DWSA 5DXYA 3DFTA 3IANA 1MDRA 1QHPA 3JR2A 3S5SA 2OGJA 4HU4A 2X16A 4A22A 2R91A 2GFTA 4GRSA 1W1VA 2ZX7A 2WVVB 5EKYA 3RGTA 4HZMA 4Y9OA 3L65A 1J9YA 2VL4A 3ISIX 4YVVA 3UERA 2HXTA 1PV8A 3BTNA 1XG3A 4HJWA 4PMRA 3CB3A 5HXMA 3BGAA 3TROA 2DQXA 1XYMA 3ZIZA 3TYEA 1BLIA 2UBPC 3AMGA 2NQ9A 3A4XA 2J6XA 4JKLA 1LTDA 1R2RA 1T96A 2EKGA 4GI4A 4RCXA 3N2OA 1CB7B 5F2MA 2XFRA 3PUOA 3HK8A 1E40A 3CIVA 3LHUA 4GNJA 4IMCA 3OW1A 2Y62A 1XBXA 3P14A 3UFYA 1L6FA 3MV01 2PTDA 3N3TA 1RPXA 1XKYA 3CUFA 4AIEA 1BSIA 3LB0A 2CEQA 1JUKA 3M0ZA 1QNQA 1THFD 5F4SA 4IIEA 4BI5A 3N15A 3QH2A 2Z7GA 1W56A 1F6YA 1GVYA 5FSEC 1MFUA 3W7RA 4EANA 4LJ3A 5CC5A 4M6PA 3IJLA 3HFYA 1YXCA 1MW0A 1XWYA 4QS5A 1RY8A 4I90A 2WXDM 1E6PA 2AMGA 4GYFA 2BSLA 2X0SA 2BDQA 1KD0A 4ZFMA 2QF8A 4HN4A 3W26A 1D7FA 3WLJA 2XH4A 4Q33A 2OYMA 4S2BA 3WF0A 2VC5A 1E6QM 4LS1A 3GU9A 1VF8A 2OWCA 5HPCA 2ZXDA 2OSXA 2HNEA 1X98A 5EL1A 2QDGA 3PFMA 3TXZA 5HWNA 2PWHA 4JY8A 3NPUA 4MWAD 2F9RA 1JIBA 2D2GA 1ZP4A 4ERAA 3P2VA 3AROA 4E2DA 2PLJA 1IQ8A 1IZKA 1PB0A 4W7UA 1H7OA 1QFEA 1WQ5A 1AJ0A 1E9IA 2J27A 1QTWA 1VBJA 3BARA 3ZOAA 2P1FA 5H1WA 2FLIA 4M51A 2OZ8A 2BOEX 1ZENA 5LNSA 5DN1A 4WDTA 3KCJA 3TOYA 1UPMB 2XH2A 1NP0A 3C56A 3I4KA 1B3YA 5LIWX 4EPKA 4GBUA 1V6XA 2ZE0A 3EB2A 1DWGM 1DBTA 3QSTA 2GUBA 1KQYA 1H7RA 1HP5A 4X63A 3LCGA 1JPMA 2PWEA 1JPIA 3AQUA 1Z3NA 4GVGA 2Z00A 2VFFA 1O94A 4KGJA 4J7RA 4BQ5A 4J2MA 2Q8XA 3IV3A 2YW4A 2CBUA 4ZXLA 1EJUC 4IP7A 2AQOA 2OU4A 4XX6A 1BG4A 4PBFA 3EEGA 3GC5A 2ZZ4A 3G1YA 4IM4A 3MUCA 1HJXA 4DZAA 2AGKA 3B9NA 2C0AA 4B5XA 1K7EA 3PFRA 1JFHA 4W5ZA 4PMUA 4WKFA 1FWGC 5A1AA 3VCNA 3W25A 5BOEA 1XC6A 2RH9A 5HANA 4PSPA 2VRKA 2ZUWA 3IGUA 2PBOA 3NYDA 4LFYA 2ZZ1A 3WQGA 4X2RA 4GC3A 2CBJA 2EG7A 2GQ8A 4NT0A 4ADUA 4Y9MA 3LXCA 2O0TA 1F5ZA 4KS0A 3N6QA 2Y1HA 1VPYA 4AXKA 1PCKA 1XYFA 4M8UA 3BJFA 1CXLA 2ZZ5A 4HCDA 5AC7A 3LUTA 1R9XA 2W3ZA 4ZOCA 4MZYA 1BKHA 1KBKA 3B9AA 4BQ2A 2V3EA 3UZ5A 4J9JA 3DC0A 1K70A 3QPEA 4RW3A 3IIOA 3RR4A 3W1RA 4RDYA 3MUAA 1L6GA 4TXEA 4LANA 4IMGA 5IDIA 3ZWSA 1XH1A 4UTHA 4JTUA 1FOBA 1CWYA 4XD4A 3KWXA 1XIDA 1PJ9A 2BHUA 1W2VA 4B90A 3N6JA 4H7ZA 1XLEA 3B05A 3EWBX 3WNKA 4D71A 1NWSA 1OFDA 3C0LA 4US6A 1XD0A 4HCHA 4QBXA 4HB7A 2JE8A 4F0KA 1V0MA 3BLDA 4X0NA 3RR1A 4FNTA 1MVYA 5D8WA 3WLRA 1W2PA 1H7NA 1ZNNA 1EGVA 1VBGA 1YQ2A 3TTYA 1OC6A 3NEHA 2PODA 3CHEA 3RNDA 3WD3A 1XL9A 2R94A 1K02A 5BNKA 3GVRA 1ZU8A 2PZNA 4IF2A 1MSSA 1WX0A 4PEKA 3GNXA 2FDSA 3OO2A 3FOKA 4WY0B 3SQMA 5FA5A 1W1B1 3PZUA 1HP4A 1DJXA 3VGDA 2WHLA 4F0MA 2VGGA 1LT7A 3EB4A 5A8MA 1A0DA 3GKAA 3F7JA 1ENUA 4QE4A 4QLJA 1IWPA 3DFPA 3HQNA 5BMWA 2ZTJA 3SN4A 3P8IA 3N1AA 4C6OA 4HMNA 1DIEA 4LC6A 3H70A 4F9JA 3TQPA 1EWEA 1RQBA 1ZJAA 4GH3A 3MDWA 5CKSA 3K1GA 5EBAA 2CNCA 3U7BA 4KWWA 4O52A 4UTJA 2CLHA 2XISA 3OVQA 3TU9A 3GYEA 1I1WA 3Q67A 5ECVA 1QR7A 3CS2A 2PLMA 3WH9A 4X60A 5FJTA 3OBKA 4H9VA 2V30A 4JHMA 2V5KA 3TSMA 3GM8A 3WIJA 3VNKA 4QNEA 4B92A 3IARA 1X6UA 1TVNA 1Z48A 1EDGA 1KA9F 4RZ5A 1F3XA 1E1CB 1F07A 3K4DA 3CIXA 1EOKA 5F7UA 2XH0A 3HGOA 1KGUA 3PBWA 4U31A 2VNCA 2DSUA 4JAWA 3WMLA 1VHNA 3A13A 2ZBTA 9RUBA 1A5OC 3THCA 2DZTA 4NQ1A 2IPFA 3EDEA 3TYZA 2FPYA 2WB5A 1WXJA 5GJNA 2VUYA 2RGMA 2BGNE 3SCQA 3ZLFA 1E1EA 3BZGA 1FCUA 4XUYA 5ABFB 3MMTA 1BQCA 4O0ZA 3TTSA 2WPGA 3BJSA 3VKDA 3RXZA 3UCCA 5D32A 3R58A 3CTLA 2E5CA 6CGTA 4Z1CA 2YDRA 4YCOA 4JTGA 1P1MA 1CB2A 3NQVA 1GVRA 2C1HA 3TAKA 1SO6A 1HN1A 2DUXA 3M5XA 3OOQA 2PDKA 3LHTA 4GYJA 4BA0A 2CU0A 3IGSA 1EUNA 4D2JA 4RNJA 3TTOA 3GFYA 3SY8A 2PEVA 1L8NA 1GYNA 5D30A 3U7VA 4CNUA 3NQGA 1TA3A 3GSMA 4IISA 2V5LA 3WFZA 1KRBC 1BWLA 2GJXA 3CMGA 3OHIA 4YHEA 4HA4A 5CPNA 2O9OA 1EXBA 1BVNP 5AHLA 4MYAA 3KVLA 1K4GA 1WAUA 1I9CB 2QEZA 4ERGA 2Y7EA 4N42A 3DERA 3R79A 3AYSA 4EIVA 2XVGA 4DEFA 4WXZA 3MWCA 3VGGA 1UASA 3HM7A 1B0IA 1QO5A 2F6XA 2QS8A 3BANA 3UXAA 3FAXA 3SO7A 3KLLA 5J8LA 4HA0A 3U6WA 3GVQA 4REQB 3BG5A 3IGXA 4GGHA 3WO8A 3ZVIA 3P5ZA 4C6LA 4XZNX 1OINA 5F1VA 3SFKA 3MYPA 3SIZA 3WJZA 3T81A 3KVMA 2ZXAA 2FGZA 3LDVA 4DLMA 1P7TB 3V0UA 2E0PA 2XDFA 1U83A 1AFSA 4LAOA 3WLPA 3DBPA 1JZ7A 4JN6A 1DORA 2PDGA 4F79A 4TV6A 3U9IA 1AQFA 1ISVA 3PTDA 1XPYA 4Y8EA 2ACSA 1P1XA 2E68A 1XYCA 3GNPA 1NFPA 1PBGA 4M1BA 4AX7A 4UMBA 3L4ZA 3ZJ8A 4UTWC 4I9JA 1HJQA 4ICNA 3N34A 3KHDA 4W93A 3HPAA 4GXPA 4NX5A 3MQTA 4N4PA 5HNUA 4XBJA 1X8CA 4HZ6A 2NVCA 3EGJA 5FD0A 3BOFA 3GNDA 1M68A 5B7ZA 4MWAA 2X7VA 4J40A 2I1OA 5HA7A 3DYPA 4H7VA 1TJPA 1OGGA 5E5CA 3VOHA 1GYLA 1TCMA 2QCGA 3CIWA 1FRBA 3A12A 4HGXA 4JIPA 3UA4A 3CC1A 4XQ6A 1VCGA 4PTNA 1A53A 1C9DA 1L2QA 5JXQA 5JVLA 1TKKA 3P67A 3DX5A 4S38A 4DYKA 3WQCA 3SZ8A 4C7GA 4LGXA 2WO5A 1DWIM 1EYEA 4JQAA 3ALGA 2HVMA 1MEWA 2H9AB 4UTLA 3UWWA 3KRZA 1NU5A 4FLOA 4GY7A 5D8ZA 3KDNA 4Q6JA 1VS1A 2WMGA 2X0HA 2MUCA 4PRWA 1PUDA 1XQLA 3ONCA 1G4PA 1W9UA 3THAA 4DXVA 1DIDA 5A8GA 3RM8A 3MHFA 2WJZA 2Y89A 3ITGA 1EF3A 2PGWA 3L0GA 1UP0A 3W7CA 3PUDA 3ANVA 3CZGA 3C2EA 6A3HA 3W29A 2ADAA 4UB9A 3QGKC 3GR7A 1OB0A 3QYQA 1JVNA 2PF8A 1ODUA 4L4OA 1IT0A 4IP4A 1UKQA 5FF0A 4LAKA 3D46A 4IPNB 3B40A 1VP5A 1L2UA 4LV4A 3O06A 1I0DA 5FJRA 5LNVA 1KTBA 3ZT7A 3E0LA 1WBHA 2YXGA 3L68A 3N73A 4JNMA 4XD5A 1JRCA 2XG9A 4TMBA 3K2GA 2PTYA 2E9LA 1Q7ZA 1KC7A 2CYGA 2IXUA 4DO6A 3TN6A 3C61A 1ZPTA 1MZRA 3OJGA 3MCNA 4C1LA 1Z9AA 3B0VC 2A21A 3H8AA 1YPIA 4R5EA 4AZ5A 1HF6A 4N7QA 3GE7A 4D8AA 2PDHA 3O7UA 1S1PA 2NXIA 4PUUA 2VI0A 9XIMA 4RZ6A 3KCLA 3MMUA 3O63A 1ZBWA 1IXPA 1ISWA 3R0UA 2QCLA 2ZVIA 3FNDA 3V16A 1TR1A 4X9SA 1WXYA 3FXYA 3N17A 4N6FA 2NLIA 3UY8A 2XWDA 4XAGA 3LOTA 3CO8A 5A8NA 2VVSA 2EJ1A 4WDUA 1TJRA 4MZ1A 2BXVA 1FH9A 3UXIA 4RE3A 2VXNA 2HZGA 2FIQA 4M56A 1N7KA 3M47A 1D3HA 1ICSA 3MUY1 5CBBA 1QI4A 5D2YA 2V5DA 3W7NA 9XIAA 1Z41A 1QK2A 1UWSA 4PCTA 1QNSA 4S3KA 2VTFA 2VQUA 1E0TA 1LLOA 1OCBA 3DGBA 2EPKX 4JTFA 2HBXA 4NJGA 1OT2A 3KBNA 3MO7A 3MUZ1 1J79A 4WJ8A 4J3WA 1I2PA 2OX1A 2W67A 4D6JA 1FTXA 3UU0A 3GWQA 3PC0A 3KX6A 5LNWA 4C6PA 5K9XA 2UZ9A 1TPDA 2C6QA 2DT2A 5REQB 1NDWA 3UWZA 1ISYA 1A5AA 2W6RA 4EWJA 2O9TA 5HATA 2BVDA 1OJXA 4QE1A 3NSNA 4YVPA 7REQA 4AVOA 1GVIA 4XVEA 6TAAA 3CQHA 3LZ5A 4IOTA 4M29A 3RF9A 4NRRA 4XBSA 2FZDA 2RHGA 1V51A 3N6HA 4OECA 1LCOA 4GUFA 1O5QA 5AYZA 3F4NA 4GQQA 5XIMA 2I5IA 5FJOA 2C79A 2GGGA 2B0MA 3T4WA 4G1NA 4Z2LA 4AIOA 5A2AA 2XIOA 3VD5A 1A0EA 3PUEA 1WB0A 3W72A 4UTMA 4RNFA 5MKGB 1EQPA 2QLYA 4FIQA 4PUMA 4XKYB 2NV1A 1QDSA 2XSXA 4JQ3A 3T2QA 4DI8A 3GTHA 3GXDA 1R7OA 3LLXA 2PI6A 5FEXA 4KIRA 4CNOA 4D6HA 2YX0A 1JQVA 4DNMA 4HMDA 1R6WA 2WMJA 4CCDA 3WNOA 3WD0A 4B5WA 2XGBA 3PZTA 1PKNA 3NM3A 4BF5A 3W88A 2V3FA 4ZZ9A 3HKAA 2PWGA 3N25A 1OBAA 4GIAA 2NUXA 3N2XA 2G96A 4BWLA 4A35A 3V75A 5EMLA 3BCFA 3I6RA 2VWSA 3E12A 3TP4A 2WK2A 2GJRA 1JF6A 1EOMA 1REQA 4O53A 1TX2A 2GUYA 3UPMA 4AEEA 2E6AA 5DLCA 4R88A 1YNQA 2Y5EA 1WV2A 3W2JA 1O12A 2C1IA 4JHZA 1KXVA 2AL2B 5CZSA 4KRUA 1SUXA 4MFDA 2WJFA 5U7SA 1H62A 3BAWA 3O3RA 4Q7IA 5HMDA 4IFRA 3OVGA 2HMCA 3EX2A 4DM1A 2Q09A 4K8EA 4GO9A 4MPKA 4O19A 3O05A 3W71A 2WMKA 5K4ZA 3HU7A 5DANA 2YXXA 1YDNA 3GKFA 2QGYA 1WO2A 1YPFA 4INFA 4FNSA 4ML4A 3LTSA 3O6YX 2WSRA 2V3GA 1PEZA 1Q6LA 1E4NA 4LS2A 2OR2A 3LLDA 3BSMA 3S1XA 4LW7A 1MRQA 4XB3A 1QW7A 3DECA 4UNIA 2W63A 4K37A 4YPJA 3VE9A 1P0BA 4ZCWA 5BZAA 5HNTA 1J96A 3N18A 3KRBA 3M5ZA 4BHYA 2P10A 2A7NA 1Q85A 3L2LA 3ES8A 3KS6A 2VJXA 1DXEA 4W4QA 1KXHA 2DU2A 3ARTA 3TONA 2ZX8A 3S9ZA 2QYGA 4DWDA 2XIIA 4MNMA 4GVFA 2YCKX 3WY1A 1Q6CA 4R34A 5D37A 1UJQA 2NW0A 4E4PA 3MVTA 1SMAA 2IPWA 4XIMA 2D24A 3C2VA 1E0XA 1UMLA 1X6NA 5BU6A 3AS0A 3GK0A 3LXBA 3O8AA 4Y9PA 1UKOA 1T41A 2D2HA 4RL3A 1UG6A 4AB4A 1KFLA 3I4EA 3LEPA 2WKGA 1XDJA 4MF4A 2OFJA 4WEVX 2NV9A 4XZWA 3S2JA 2FGBA 2IPJA 4IJRA 3WDJA 2H3DA 4PMZA 4O54A 3TK7A 5LA0A 1DQXA 3O6DA 3VX1A 1TVLA 2WC7A 4FB7A 1H0GA 1MWOA 4AY1A 1KM4A 4TTGA 3GIQA 3ZXWA 4ZOEA 2MANA 5C70A 2ZRXA 1WOBA 3AXHA 1W3TA 4MIMA 1M41A 5D04C 1U22A 4Q8WA 4WX2A 1FHLA 1C3FA 2R6OA 2B81A 1MUCA 3PBYA 3OGSA 1GJPA 1CLKA 3VNZA 1O60A 5C2XA 2QMKA 3VKAA 4XO7A 4KKXA 4MLRA 1BD0A 3CQIA 1R5YA 3HPFA 3RCNA 4D8LA 1H5VA 2JGYA 4O8RA 3BC9A 2RUSA 4TO8A 4IQJA 4C6JA 3IJDA 3ZM8A 3BV7A 4YYCA 1G7UA 4L6DA 1TIMA 3EWWA 1VQTA 3GNRA 3BLPX 3C3NA 2WC4A 3GTIA 4KWUA 4EWND 4GZIA 4QDPA 2E4TA 2Z2BA 2VO5A 4B5TA 4H8NA 3S0CA 5J5DA 1ZL1A 3M4HA 1XD1A 2V63A 1E6SM 4H9ZA 4GWEA 3ABOA 1H11A 2W27A 5A8OA 3IGHX 4LAZA 1OIMA 1OX6A 3VK5A 3FAWA 4H01A 5I78A 2OKTA 4JKMA 2QR6A 3CPUA 4HNCA 4Z1DA 3GS6A 3NQFA 5E0CA 4D6CA 1L0PA 1MYRA 1XINA 3UZXA 1EJXC 2WZMA 1E56A 1S5VA 3DI1A 3C6CA 3RAOA 1V6TA 1UH4A 4GFIA 4DN1A 4B3ZA 3LNMA 3OQ8A 1SZFA 2Y8UA 3PBMA 1XI3A 2ZVRA 4F8XA 1PWLA 1HZYA 3LGEA 1RV8A 2PFHA 2HJPA 1M3UA 1VEMA 3Q4DA 3OB8A 4MFEA 2E28A 3GDBA 4B5NA 5F2LA 2VP8A 3O6CA 1C7TA 5A6MA 2INEA 3E5PA 3TWAA 4TTUA 3VM7A 1I1XA 2P0OA 4DB7A 2E1DA 3PZIA 3CL7A 3PR2A 1E0VA 4Q4SA 3W2KA 1QW9A 3NNTA 4RLIA 2BFGA 2RDUA 4FNRA 4QRNA 4RDWA 1XIGA 3W7IA 3R13A 3DYMA 2XZ9A 3GTNA 3W01A 1OHLA 2XWEA 3MSYA 1X1OA 4TX6A 3GXTA 1OEPA 1IYXA 3VNDA 3BW4A 3PSVA 1Q6GA 5LHEA 1KFKA 4PH6A 2WMIB 1H4PA 4D9PA 2CBVA 1IEXA 1ZHAA 3HV9A 4MUZA 5DY3A 3QM3A 3O2LA 1HKMA 3CT2A 5HK4A 1JCYA 3G8RA 1GQLA 1E55A 3W6YA 1E6RA 3C0JA 4O17A 1H1NA 1RJQA 5AVHA 1EF2A 2FTPA 3ZJ6A 3A4AA 3HGRA 3CMJA 3DZ1A 3NTYA 3KEHA 2FZBA 2OZTA 3RFAA 1KGXA 4GVHA 4QAWA 1V6WA 2L5HA 4HHLA 1B90A 1R38A 1XCWA 1W1TA 3RRAA 5C54A 2P0IA 1YRRA 2Z25A 4DXKA 4GNVA 1JG9A 4DHGA 2CFFA 1H7XA 1S2TA 1DWFM 4JTKA 4FLQA 4U28A 1IEIA 1E0WA 1LLWA 1EGZA 1V02E 1AJZA 1ZFJA 3LNPA 3VC6A 1V6UA 3L5AA 4B91A 3PY2A 3AXMA 4N9EA 1H0IA 1DE6A 4JEJA 3ITLA 2QCFA 4JYFA 4KW2A 4MDPA 2CZFA 3L12A 1IWBA 2DZXA 3F4VA 1M1BA 5HUPA 4E8DA 1KLZA 1UC4A 4V15A 3DH7A 3K1DA 1JULA 3MP3A 3VILA 1UWRA 1SR9A 3FYYA 3TZFA 4AF0B 1Q6RA 1RBAA 3PWGA 1FCVA 1HNYA 2R82A 4JTAA 3AOFA 2Q3OA 3EMQA 5G2HA 2RDXA 1N8IA 2PC8A 2HS6A 3EKZA 4JYDA 2A6NA 3YPIA 3QV9A 4WKAA 2GDUA 1R87A 1P0EA 3ONBA 2QCDB 2VEMA 2FPVA 3KW3A 4JPGA 3Q2DA 1EXPA 1TZZA 2AQWA 3OGVA 3GD6A 4MB1A 4AW7A 2J13A 1VPQA 1RCXB 3SCSA 4DBWA 2O9RA 1YE6A 1QATA 4FOJA 1FP8A 3PPCA 1Z42A 1K9TA 1TPUA 5BWAA 4ZTXA 3WCZA 3KS5A 3VKKA 2J9YA 2C3ZA 4FR6A 4JFSA 1DWAM 4L56A 5HINA 3BZJA 4DJED 1W1PA 4P7NA 1ML1A 4ZMGA 4HCLA 1W5PA 4AD1A 5M17A 2ZX6A 4JFUA 3WQEA 3DN5A 1AA1B 1H49A 1SW3A 4MAVA 4Q3MA 1VEOA 2FQIA 3FJ4A 4DUVA 1UMYA 3TJIA 3T0TA 1KKOA 4DO5A 3RLHA 3EPMA 3FA3A 2JKAA 1WKEA 3IUHA 7ODCA 4YS1A 5A69A 2CLMA 4AWSA 4F2TA 3VZZA 2OZ3A 5AZ0A 5CGTA 3JU2A 3LD5A 4QSHA 1WNOA 4WR3A 1FBAA 4GY0A 3G3MA 8XIMA 3E6EA 4Z2KA 1R3TA 1PIGA 1BHGA 3UJEA 1SSGA 5I07A 3N9KA 4IXHA 1HW6A 1ITCA 1EWDA 4XV0A 3VFLA 1LRNA 5C8BB 1KBJA 3ITTA 5H8PA 1NTHA 4OV9A 4UMAA 3T7VA 3H2EA 5CSYA 4NASA 5CSRA 4FLSA 3HK7A 4AZIA 3CK5A 1GZ1A 2BTMA 1UCWA 2QHAA 1HL9A 1NVMA 1KO0A 1KQZA 3NJ3A 2HE8A 2XIMA 1QO2A 3V35A 2QCHA 3M5VA 1TMQA 4ZQMA 1KWKA 1DIOA 5I3KA 1B54A 2D73A 1ME8A 3CUJA 3TTEA 4I3GA 3G1VA 1V0KA 4F0HA 3S5YA 4OOUA 2ZUTA 5LZLA 1SW7A 1M65A 4YL2A 3RM4A 2NLYA 3NSMA 2Z1BA 4AG0A 1YADA 3FN9A 1U5JA 2PURA 3CUZA 4IJBA 1V4YA 2XVKA 1RK5A 3B0YA 4HNLA 1XRVA 1V93A 1PX4A 1GWJA 1YE4A 4ACYA 3GB6A 1MUMA 3LHYA 4CQCA 3MMWA 2B7PA 1FKWA 3VPLA 1S3HA 4IMEA 3W7DA 3QFEA 3HURA 3VOCA 2C14A 2WJEA 3RX2A 4U5KA 3EX3A 3BAXA 3EXRA 6ENLA 4A2RA 1AQMA 1JPKA 3XINA 2EXOA 3TE9A 3L7RA 1ONXA 4TQTA 1EQCA 1Y0EA 2CXGA 1Z6KA 4UOQA 3SCTA 3L4TA 4PBEA 2ZA2A 4AZ7A 3WLHA 3R4IA 2I9UA 3RILA 3L4YA 1H41A 1SFSA 1QJWA 3U8GA 1S2UA 2X1TA 3A24A 2JF7A 4F2UA 4Z17A 2OSWA 5AC5A 3LGDA 2OLHA 1AZ1A 2ZRWA 1H61A 5EU9A 1U1HA 5TBOA 3WQWA 4ZO8A 3EPOA 2WQDA 5DXXA 3T0DA 1PDZA 2FHCA 4KEMA 4LXFA 1PZ2A 1UW9A 3H7RA 4BEQA 1BYAA 4GZJA 3SN1A 1B30A 4FOUA 1JDDA 4PCSA 2ATSA 4GYPA 1HJWA 2NQHA 1FWFC 3GO2A 1ZCOA 3R8RA 3EX4A 3K8MA 1F7BA 1IIHA 3BH4A 1K6AA 2PTWA 1UR9A 2EAWA 4Z42C 3S9YA 3NDOA 1JZ3A 1YDOA 3D0CA 3GAYA 4DI9A 1W3HA 3EDJA 2P50A 3NVDA 1BF2A 2BNJA 1YXYA 2XUCA 2CETA 3S6TA 3OVRA 3AZTA 3F5LA 2PUZA 2EG6A 4IFOA 3M0YA 2EPOA 2A4AA 1XLAA 2P76A 4M81A 4KESA 4JIHA 2R1LA 4P8WA 3W7JA 1GOMA 2ACRA 2C15A 4N2YA 1J0YA 3CH0A 2XH7A 2BZNA 1OX4B 4HMEA 3BAIA 1GPFA 1MXDA 2RDTA 1LOSA 1IXOA 3LBCA 2IQ0A 4CN6A 3F4WA 5CBIA 4PMVA 2W62A 3H24A 3B0PA 5I3HA 1OABA 4CGTA 4M19A 4J3VA 1V5XA 1O7AA 1ZLPA 1QOPA 2Q08A 4GKTA 1UIPA 2Y4SA 1XLDA 4RX0A 1VAHA 1TFVA 1XP3A 3GH4A 3QQ1A 5BMXA 4K3ZA 2PGFA 3TW7A 4I5UA 3S3GA 3PZQA 3APTA 3AHXA 4F0LA 4RZBA 3S1GA 8TIMA 4PR4A 5E9XA 1KCKA 1W9DM 1FWIC 3NO5A 5EBUA 3EOOA 5ABGA 4QG9A 2J79A 3R5EA 4Q8MA 3AS3A 2CZ5A 1FCBA 3E5BA 4HNOA 3K13A 3A23A 1KBBA 4LNYA 3ZVHA 2GSHA 3U3HA 4A6GA 4WOQA 4L64A 3H12A 1MI3A 1Z7AA 2WSPA 2W9MA 3H7VA 2CC0A 2EPMX 2A3CA 2PDPA 5DBTA 3HO8A 3KL5A 4S1FA 4MKSA 4MTVA 1MNSA 3WNLA 1S1RA 3TAOA 4Y6GA 2WJDA 2A85A 3IVSA 2CZDA 1TPB1 2VX5A 2D0HA 3M41A 3NXLA 4JNYA 1FWSA 1UR2A 5E0FA 3BW2A 4A3RA 2GJXB 3CUXA 2DEPA 5IFTA