1LQAA

Tas protein from escherichia coli in complex with nadph
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
346
structure length
346
Chain Sequence
MQYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHGLDPAQMALAFVRRQPFVASTLLGATTMDQLKTNIESLHLELSEDVLAEIEAVHQVYTYPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Escherichia coli Tas protein, an NADP(H)-dependent aldo-keto reductase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Tas protein
total genus 125
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1lqaA00
2PDNA 4XZIA 2PD9A 2IQ0A 4DBUA 4WDTA 4ASTA 1QRQA 3H4GA 4XAPA 1Q5MA 4QX4A 5HNUA 3MB9A 3WBWA 3UGRA 1Z9AA 3O3RA 1S2AA 3GHRA 1YE6A 2IPJA 1QWKA 3LBOA 1Z89A 2I17A 4LAZA 3CAVA 1EKOA 2ALRA 1Z3NA 4JTCA 4WEVX 4XK2A 3DOPA 1S2CA 1C9WA 4WDUA 2P5NA 4GACA 4WRHA 4JTAA 3F7JA 4PR4A 2R24A 1RALA 2C91A 4F40A 2FZBA 1XGDA 2DV0A 2HV5A 2DUZA 3FJNA 2HDJA 3V0UA 1ZSXA 4LB3A 4GA8A 2PZNA 1IEIA 2HVNA 4GQ0A 1K8CA 2PDGA 3UZYA 1ADSA 4DBSA 2DUXA 3Q65A 3CASA 2PDUA 2WZMA 4XZLX 3UWEA 2AGTA 3LENA 3R94A 1PZ1A 3BV7A 4JQ2A 1MI3A 3LZ5A 1HQTA 4JQ3A 2PDPA 3M64A 1YE4A 4YVXA 4YVVA 4XVDA 3CAQA 4QR6A 2HE5A 3WCZA 4PRTA 5AZ1A 2PD5A 1X98A 1RY0A 5AZ0A 3T42A 4FALA 3WG6A 4JIRA 3V0TA 1HW6A 4XZNX 2PDWA 2IKHA 4IJRA 3H7RA 2PDYA 5LIXX 3V0SA 1PZ0A 3LNMA 4LB4A 1ZUAX 3LQLA 2ACSA 5HA7A 3LZ3A 4PMJA 4GIEA 4JTQA 4XVEA 1EL3A 1R38A 3H7UA 3NTYA 3N6QA 3CV6A 3BUVA 3CV7A 4XO7A 3B3DA 2NVCA 3G1RA 2PDXA 3GHTA 2PDQA 3D3FA 2BP1A 1AFSA 1PWLA 4JQAA 3BURA 4FAMA 3N2TA 4HBKA 3R8GA 4FZIA 1VP5A 5HNTA 3R7MA 2R9RA 2BGSA 4H7CA 1XF0A 2HE8A 2PDCA 1X97A 1X96A 2INZA 2INEA 2PEVA 4NKCA 3UP8A 1AH4A 2ACRA 4YVPA 3ERPA 1T40A 4GQGA 2IPFA 2PDLA 1UR3M 2IS7A 2PDFA 5JH1A 3GHUA 3G5EA 4IGSA 3GHSA 1Q13A 2CLPA 3LD5A 3UZXA 2A79A 2FGBA 1YNQA 1PYFA 4LAUA 3V35A 5KETA 3LN3A 3R43A 5M2FX 1OG6A 2IKGA 2IKJA 2PFHA 3EAUA 3M0IA 4LBSA 3RX2A 3WBYA 2NVDA 1US0A 4ZFCA 4WDWA 3Q67A 4DBWA 3S3GA 4JQ4A 3GUGA 2PDJA 4OTKA 4WDXA 3ONBA 5LIKX 3CMFA 2IPGA 3R6IA 4Q7BA 2F38A 2ACQA 4XO6A 4L1XA 4YS1A 3UG8A 2QXWA 5LIYX 2FZDA 4G5DA 2ACUA 4Q3MA 4DZ5A 3U2CA 3R8HA 4PUUA 2FZ9A 1S1PA 3DN5A 4GABA 4JIIX 3RX4A 2FVLA 4HMNA 3V36A 4IJCA 1RY8A 1Z8AA 2PDHA 3KRBA 3FX4A 2BGQA 1M9HA 2WZTA 2PDKA 2J8TA 4XZMX 3EB4A 4L1WA 4LBRA 3LEPA 4RPQA 4R9OA 3WBXA 2PDIA 1LQAA 2HVOA 1A80A 4JTRA 1GVEA 5LIWX 3LQGA 1EF3A 2IQDA 1AZ1A 1PWMA 1LWIA 2HEJA 4XZHA 3O0KA 3MC5A 4I5XA 1AZ2A 1ZQ5A 4ICCX 4AUBA 3P2VA 4PUWA 3UZZA 1SM9A 4H8NA 2F2KA 1S1RA 1EXBA 3BCJA 4PRRA 2I16A 4YU1A 1MZRA 3VXGA 4GCAA 2ISFA 2VDGA 1ZGDA 4FA3A 3UYIA 4JIHA 3EB3A 1YNPA 1IHIA 4EXAA 3COTA 3C3UA 5LIUX 3R58A 5DANA 3UFYA 2PF8A 3M4HA 2PDBA 4JQ1A 4JTDA 1J96A 1AH0A 5JH2A 2PDMA 1VBJA 1FRBA 4QBXA 1AH3A 3LUTA 1MRQA 4MHBA 2IPWA 2FZ8A 2IKIA 3ONCA 4EXBA 1JEZA 3UZWA 1XJBA 3QKZA 4WGHA 4QXIA 1T41A 3RX3A 5C7HA
chains in the Genus database with same CATH superfamily
4D71A 4JOMA 3S2NA 4O15A 3T40A 2WKGA 3PTKA 4PGLA 1G9HA 3JRKA 1YNYA 4JTJA 1W0MA 5EMUA 1N2VA 2XPKA 2NUWA 1QUMA 1UMLA 3WUEA 1GT8A 1H63A 1HO4A 4YMZA 2WSPA 3BJSA 2PCQA 1JGMA 5RUBA 2ZC1A 1PXGA 1OZMA 2DIKA 2VX7A 5ECVA 4MNMA 2HSAA 4AEEA 2QS8A 1Z3NA 4ES4A 3RLUA 4CN6A 4QDPA 2F6UA 1UH2A 4KBXA 3AO0A 1FVPA 2HXTA 4TIMA 4MAZA 5EYWA 4Z1BA 1KBLA 2V5DA 4FF7A 3ABZA 4KCWA 3GW3A 1LG1A 2GUBA 4KERA 1TCDA 1FQ0A 5I79A 1V3KA 3VO0A 3T6CA 5JU6A 1AQFA 2BGNE 2YIHA 3VINA 4M56A 3BCFA 3GC5A 4HU0A 5IFPA 3T09A 3TYUA 5JBFA 4S3JA 5C6MA 2PZNA 3DFTA 1IXNA 4HOWA 3TNOA 2V67A 3O0FA 3FFSA 3QMSA 1EOKA 3GDBA 4TXEA 3B8DA 2PRLA 1DHPA 2Q8ZA 3AIBA 1V0NA 3S2CA 3E2QA 2YCLB 4JL1A 4S38A 5HMDA 4GQRA 3W73A 2QR6A 3BV7A 4IIGA 4JKKA 1BLIA 2DGAA 4O0KA 3HFYA 3QF0A 4UTKA 2YL6A 3AU6A 3LM7A 5F4XA 3B9EA 3CAQA 3WLMA 3P0XA 1M7PA 3T42A 4FF5A 4BQ4A 3LBCA 4KEZA 2FTWA 2DZWA 2ZUNA 3TNBA 4IHCA 5G4WA 4RE4A 4ORMA 3DFHA 3H4WA 2V9DA 3CWNA 1UD4A 3W72A 4ATLA 3PZGA 3FHAA 4R88A 5IDIA 3GXPA 2O9TA 2XH7A 3BLEA 3ZXWA 1EQPA 1VPYA 1YXCA 1P0KA 3KL5A 2A3HA 1XIEA 3KOWA 3L0KA 1FY6A 1XLFA 4TV5A 1Q7QA 1Q6DA 1K8ZA 4MJ4A 4I3GA 1VFMA 5HJYA 1XV8A 1I1WA 3PAJA 5HANA 4LAOA 2V6AA 3W23A 4DHGA 2IMRA 2W61A 4REQA 3WF2A 1YEYA 5FIPA 3U8GA 5A8NA 4XD6A 4H7CA 1TUFA 3VNYA 1EWDA 2INZA 2VX6A 3TONA 3PF3A 3GNOA 1TVLA 4H9ZA 3M47A 1UB3A 1NELA 4W7UA 3WK3A 2C79A 1UR3M 1UG6A 5D32A 1UQZA 1VFFA 3GTFA 5HAOA 4FLQA 2CLPA 3HG5A 5D9OA 3QGAC 4A4AA 4OU1A 3NVTA 2B81A 1UZHA 3VGEA 1UYQA 4LS2A 1PYMA 3TFXA 3JVAA 2PFHA 1S3HA 1J5TA 1RK6A 3TW9A 1LM1A 3D5HA 4XZBA 4HNTA 3UPWA 3ABQA 1O1ZA 4PODA 4XBKA 1US0A 1CB7B 4OGZA 5C8BB 3TTEA 1DWIM 4IP5A 4PB4A 1Q6RA 3E1F1 1WE5A 3M16A 3IPWA 4EWND 5F1VA 3W9ZA 2PDJA 2ZICA 2YA2A 3P62A 1W3NA 4JDYA 2G3MA 2FHCA 3RGTA 2XINA 1WZKA 1B90A 4LVBA 4KCVA 1NWUA 3UG8A 3U4FA 3WQDA 2ZDRA 4V1XA 2PP1A 5C7VA 4DJDD 4UFHA 1VIZA 1OADA 3NDOA 4LGXA 4Q4OA 3VNLA 3WNOA 1GZ1A 1ZY9A 3SB0A 3G77A 4O0ZA 5A6KA 4H9XA 4F4RA 4W86A 1WCGA 1BGAA 1DKWA 1FCBA 3MANA 3LGDA 4KRTA 4XQ6A 2I14A 5EA9A 4E6MA 3TYEA 1IT7A 3VIOA 4HA3A 1W9XA 2WJEA 4ZR8A 1B9BA 3DHPA 1C7TA 1W3LA 5FI8A 3TSBA 3L9CA 1FFQA 2VELA 4JFVA 4R9OA 3VNKA 3WBXA 4HCLA 5G4EA 1ISWA 4PULA 2YBUA 2FPTA 3LRKA 2A3CA 1BXCA 1E0UA 2XH4A 3IANA 1B3YA 4RXFA 5HBFA 1AW5A 3TZNA 1F4HA 1WNOA 4C7FA 3ELFA 1UJPA 3WFZA 4GXWA 3IUHA 4NP7A 3UXKA 3EWBX 1JDAA 3ARXA 2OLAA 1GTHA 5CPNA 3RIKA 1RH9A 2R6OA 4O11A 3P2VA 4Q6JA 3R11A 1K7EA 1RD5A 1QO2A 2P88A 3AS0A 5K4XA 1LBMA 1FDZA 2D24A 4ZOEA 4O57A 1E6XM 2HRWA 3P5ZA 2YZ5A 5HMFA 1BSIA 3T0CA 3W70A 5GPRA 4LF1A 5CG7A 2G0WA 2R1LA 3GXIA 3THAA 1SVDA 4A29A 4B9YA 1WDSA 5JH2A 1OIMA 1VRDA 2JF7A 4A3YA 3PP7A 2GK1B 3P67A 1G5AA 4RZBA 3TYAA 3CH9A 4H6QA 1AH3A 3EYPA 1XLCA 1EIBA 1HX0A 2FKPA 3EPOA 3TSMA 1P7TB 2HVMA 5E9XA 3AHZA 1E4MM 4IIFA 5A8GA 4DYKA 4O54A 4UTTA 2CLIA 2PD9A 2EJ1A 1BQCA 4JTIA 3SCOA 4IG2B 1EYWA 1A49A 1ML1A 3RN6A 4UNLA 2D3LA 9XIMA 4IFRA 4JCMA 1DIDA 5E1QA 1IEWA 3PWIA 3GR4A 1ONRA 5GNYA 4D8AA 3MCMA 5E5CA 1MW0A 4ZQNA 1UASA 1AK5A 2QZRA 3WLPA 3NQMA 4US5A 3T55A 1L6WA 5JVLA 4MG4A 1DIKA 2YFNA 4K8GA 3AXKA 4IL2A 1HKIA 3H2OA 2ISWA 3TQ0A 3LNPA 2VZSA 3WY1A 3OJGA 5AHFA 1GOQA 5TF0A 5M3WA 4B4HA 2I1OA 2PWGA 3CJPA 4AZHA 2I5QA 4MY8A 1TSIA 3QPYA 4CD7A 4KS0A 4IH3A 1XGDA 2DV0A 2EPOA 3L23A 4W5UA 1WQ5A 3EMZA 4U3CA 3CEPA 1DXEA 4HSNA 1FWIC 1G4PA 1ZP4A 4DM2A 1MXGA 1ZSXA 1BYDA 3ARVA 1IEIA 5DO8A 1V3HA 3WN6A 3NQ2A 4ZXOA 4KIRA 4JX5A 2GK1A 2PDUA 3UWWA 1PIGA 4XZLX 3GG8A 3UA3A 3AXXA 2DQXA 4MMWA 4JN6A 3HQPA 4DWSA 1X39A 1XC6A 2PD5A 3VM5A 3PBUA 2CLLA 1J10A 3SECA 4GVGA 3CXOA 4ZQCA 3HPXA 4ADSA 1FTXA 2D2JA 2IKHA 3DG7A 3QHOA 3IIZA 2X2GA 3H7RA 3GU2A 2PDYA 4WX2A 3BWWA 1VF8A 2YFOA 1MEWA 1TR1A 3M0HA 1XLKA 1XS2A 5GJPA 5HA7A 1SMDA 3LZ3A 1E1EA 2DSZA 3G1FA 1RJPA 1F2JA 1S5TA 1F07A 1E55A 4IISA 5EU9A 4AISA 3LHTA 2BP1A 2QF7A 3ZJ8A 5CPOA 1OY0A 3NQ8A 4LH8A 2JK2A 4O1FA 4KGLA 1E9LA 1O5KA 4TO8A 4PSPA 1XGEA 3SUUA 5CBJA 3NVDA 4H7VA 1GQKA 2QCMA 4QIUA 2ZX6A 2PEVA 3SCUA 1L9WA 1FWCC 4CCEA 1K7XA 3TC7A 5KZDA 1MNSA 2VC7A 3WD4A 4LCSA 1DWJM 3BQ6A 2VUNA 2QQ6A 5D38A 1W5PA 4ZTXA 4F0HA 5FCZA 1KM6A 3CHFA 2BVYA 1T96A 3C0SA 1Q2SA 1TV4A 2ZRWA 1MNZA 1US2A 3BK0A 3HQOA 3EOSA 1IXPA 2GQ9A 3VKBA 5FEPA 2O4MA 4LAUA 4RNFA 1ZU8A 2E5DA 4L6OA 3KW3A 5DEZA 2D0HA 1RBOB 1TPVA 4C1NB 2XVLA 2C3ZA 3MZNA 2DFAA 1TIWA 4GMEA 3VD5A 1GOXA 3OG3A 3DH7A 2BXYA 3S9ZA 2V3EA 4W85A 1OFPA 1TPDA 4OIFA 4BQ5A 1I2NA 2EO7A 1KA9F 5I09A 3CHVA 4I7UA 2VQTA 2FGZA 4W8AA 3ARUA 1DE6A 4DO6A 5JQ9A 1QK2A 1UZDA 3N29A 3RPTA 3EOOA 4Y7EA 4ERAA 4KPLA 3TW6A 1ITUA 1OG0A 1ZBCA 4NZCA 2VOMA 1QDSA 4CQCA 3EDEA 2WLYA 2EG6A 4GABA 4PBGA 4K8HA 2FVLA 3KCJA 3L5MA 4LEFA 2AL2B 2GGHA 3GVQA 3CIXA 4PMOA 2ABAA 4HD5A 2QKFA 1W9DM 1GW9A 3CYVA 1PAMA 4JTTA 3B8UA 2RDWA 4C6KA 2E8YA 4BF9A 4P7RA 3EXRA 1J8VA 1C8QA 4GRSA 1I60A 3VOCA 3T1GA 3E3HA 3CZLA 3BZJA 4GZ7A 3RCMA 4AZ7A 3S5OA 3QEZA 4ZOCA 3UVAA 4EWJA 2IQDA 2E6FA 2DZBA 1UP0A 3DHDA 3A9IA 1X8CA 1XCFA 3UJSA 4BZYA 4BK9A 4XZHA 2ZBTA 5AYXA 2WZHA 3H7VA 3KL0A 3SBFA 2QYGA 3AJ7A 5FF3A 3P7YA 3BAYA 3WF4A 2CC0A 5AYZA 4YPJA 4JTKA 1A5NC 2P0OA 1UIOA 1KWGA 3B0YA 4NILA 4Y96A 2VTFA 3KLLA 1REQB 1XH2A 3BAWA 3FXGA 3BCJA 1W3HA 1MUMA 3PK7A 3GNNA 1S3TC 2CWXA 5K9CA 2YL8A 4PMQA 3NO3A 1KRAC 2RH9A 3BGJA 4MGGA 1FOBA 3GU1A 4QITA 5CBBA 5IBXC 3G6MA 1H0IA 2CLKA 4Y9OA 4GI9A 1XSJA 2DZAA 1OCNA 1FCVA 4YN5A 4ML4A 4FLSA 4QBXA 3W1TA 2VVSA 3G0SA 1A0CA 4N6FA 3RILA 2Y7EA 1AMKA 2NUYA 2WQPA 3L2IA 4S23A 4JN7A 4YTQA 2VNCA 1QW7A 4PSRA 5CJMA 1P4CA 3KOFA 1K9TA 3T07A 3GTNA 4IQJA 2F6XA 2OWWA 5F2GA 2WMFA 2WW5A 4OE7A 3CTLA 4MKSA 1GW1A 4L80A 2EXOA 4Z2LA 3HV8A 2VP8A 2PTDA 2C1IA 4DWSB 3UY8A 1F3WA 4JNYA 1BF2A 3E5PA 4PMXA 4F0RA 2A4AA 4RDWA 3GBEA 4X9SA 4N42A 5DRCA 4O4VA 1RSCA 3FA3A 4UFMA 2YZRA 3KDOA 2F84A 4EKJA 3SW6A 4IIBA 3NO1A 3T8QA 3CUZA 3W7PA 4Z1CA 3IJDA 1PTAA 2NT1A 3P3BA 3ARQA 2E09A 5BOEA 2V3FA 3DGBA 1C3FA 3EX6A 4JYEA 2AKZA 3FNDA 3APYA 3T2PA 3IIPA 4BCEA 4LB3A 1E9IA 4CN1A 2EBNA 3REQA 1YDYA 1UPMB 4M0XA 3VOFA 2W67A 1U1JA 2E9BA 1EJSC 4DXXA 2IXUA 3B9DA 2ZZ1A 4IMAA 1QPOA 1EFZA 2V69A 1GYMA 2GJRA 5DCEA 3HA1A 4Q8PA 4I7VA 1RCQA 1IEXA 5D2TA 3BOLA 1P0BA 5HMSA 2DT0A 2A0NA 1NDYA 2D1ZA 2WCAA 4W7VA 1SSGA 3QM3A 3RJXA 4HT3A 2I56A 3VILA 5EBUA 4Z2GA 1JZ8A 3MI6A 4EF9A 5C2CA 1X98A 3N25A 4IXHA 1NU5A 2OX4A 3CUGA 1GVQA 3GSMA 3LMZA 1JYXA 1WBJA 4BY3A 1LRQA 4F0SA 1V3JA 3BAIA 4P7LA 3P93A 4P2VA 4S2BA 2Z1BA 4IZGA 3I68A 3P84A 2P76A 5I02A 3V0SA 2BY2A 2VRQA 4IMCA 3S2LA 2O92A 3VVGA 3GK0A 1VLIA 2VT0A 4KWSA 3NTYA 4JIQA 2HISA 3L7RA 2QDGA 2Z00A 3N3MA 2XISA 4N2YA 2DDXA 1KM4A 3CUXA 4L9ZA 1AODA 3ZWTA 4MWAD 1BGGA 3VFLA 4XZ9A 4L4PA 2YBTA 3WK0A 4E3TA 4JYDA 1WDQA 3DEQA 2PDCA 2R1KA 1Q45A 5DY2A 4LX4A 2HNEA 3BLOA 1LCOA 2NQJA 1CEOA 4DM1A 3ZFHA 1CLKA 4EAMA 4M6PA 4UQDA 4GUIA 1AUSL 3U57A 3NPUA 1Q8JA 4A8NA 1DJZA 3TA9A 3WQEA 5F2LA 1TVPA 2C7FA 4PB3A 3R43A 3N12A 4JIPA 4NJGA 3WMLA 2CU0A 2VJXA 3GKAA 4DO4A 1WDPA 3OVQA 2JEPA 2H3BA 2PI6A 1GJPA 3M43A 4Z0SA 2WWDA 4K39A 3TYBA 4A3HA 1GZJA 2A21A 1MDLA 3FK4A 5FD0A 1EJUC 1SJBA 2PODA 3HOJA 3C86A 2E4TA 2IPGA 3UPMA 1LBFA 4UQ9A 4XO6A 4FR1A 1Q6EA 1L2UA 1DJYA 4NJKA 1FWSA 3AMKA 4XX6A 1JUEA 2FHBA 4CQAA 2JKPA 1BTMA 1SZEA 1JF5A 3SCQA 1N8WA 4B16A 2BOEX 3CMGA 4OQVA 4NQ1A 4JNMA 4UTJA 4AHOA 1UR4A 4UCGA 1Z69A 4PMVA 4GFIA 1E70M 2Z6IA 2Y6ZA 1V03A 2YXXA 1JDCA 1JCTA 3VFCA 1YLVA 4DBDA 4DF1A 3UWUA 3EB4A 4Y9PA 2RDXA 3LEPA 2X1IA 3ZO9A 1LQAA 3MYOA 2FZMA 3HPAA 1DIOA 2OVLA 2NX3A 4RDVA 4H83A 2ZTKA 2E40A 1M3UA 4CCCA 5BMWA 4WHBA 4OBTA 1JDDA 1JUKA 5FEZA 3VNJA 2YDQA 3MVTA 3KBWA 3PC0A 4UTWA 3TDFA 3THUA 3QQ0A 1XP3A 4FNQA 1TX2A 4US5D 4ICCX 5GNZA 4PRWA 5U7SA 5D02A 4FNRA 1EGMA 4N9EA 5D8ZA 2DT3A 2C16A 3TMLA 4XB3A 3MUIA 3LHWA 5H6HA 2KZHA 3F4DA 2FTPA 4AG0A 4B5SA 1POKA 3B04A 3LI1A 1VEOA 1GHRA 1U1HA 2VX5A 1OC5A 3CO8A 3COTA 3G6LA 3LBMA 2DZSA 1ZBWA 4JQ1A 1EBGA 4TX6A 1AH0A 3M5XA 3GNRA 4HGXA 3IJ8A 3S1XA 4LUYA 1QPNA 1JPIA 2WK2A 3WQWA 3NQBA 1BYBA 2WJDA 1FH7A 4AXKA 4ACYA 1OCJA 2IKIA 1M04A 1N82A 3W37A 3C8NA 1B30A 3E2VA 3DECA 5FL0A 4A2SA 1QW8A 5DBUA 3NZQA 3QFEA 3WO8A 4Q4PA 4D6FA 4EPKA 2PPGA 2CERA 2PU0A 2JKAA 1IEVA 4FB7A 1Q5MA 4UIOA 4MWAE 1E5NA 1H41A 3AXHA 2QF8A 3L0GA 4QFUA 1VBGA 4R3UA 3W7KA 4QTGA 3WBWA 3WH9A 1Z9AA 2ZUMA 2P53A 3M41A 4JXCA 1XYCA 4GUFA 5E6ZA 4QISA 2WMHA 3QV8A 2WLZA 1AD4A 2ALRA 4R7JA 4NAEB 9RUBA 2Q01A 5C9ZA 1UQYA 4Z2IA 1Z44A 1VYSX 1L6GA 3IIOA 5J04A 5C5YA 3KBNA 2YA0A 3KOZA 1W32A 4BWLA 6ENLA 1RALA 3M5ZA 1HFBA 4D1JA 5I23A 1NF7A 5HNNA 1UA3A 2WV8A 3KHDA 1JZ2A 3LGEA 1I45A 2QUNA 2V5CA 3K2GA 3RITA 4C6IA 4PFHA 4ZVJA 4ZQMA 2VEPA 4ZO9A 3QJAA 3C61A 1ADSA 1XLEA 4N7QA 4DWSC 3MMTA 5LKYA 3RMEA 2G96A 4L4OA 4HNNA 1O1HA 1TCMA 1NWTA 4HN8A 1GQLA 4NRRA 4MLRA 1BSLA 3THCA 1EX1A 4Y9AA 1DL3A 3VIPA 1LLWA 1JZ4A 2W3ZA 3EXSA 2WM1A 3F5KA 2BY0A 4R53A 1C8YA 2PWDA 1AW2A 4HSOA 1GYNA 3UVIA 4NJHA 2C8NA 2ZADA 1MFVA 5HDRA 1FA2A 3RR1A 4X2RA 3VPLA 5CAKA 5DCDA 3VIMA 3QZ6A 3IRDA 3KWXA 5FA5A 3K1DA 2AKMA 2E9LA 1UIPA 3CIWA 3GAKA 3UWZA 2EPHA 1NOUA 2XM1A 2AAAA 2W4XA 5ECUA 3P80A 3WJWA 3WUGA 1SO3A 2BY3A 4KWVA 1TWIA 2BHYA 1S5MA 4JKMA 4JTQA 3L4TA 3PBGA 4XVEA 2QDDA 1O95A 4H00A 3G1RA 3E0VA 3WDQA 4RLIA 3B8TA 2QJMA 3SAZA 4H7ZA 1EWEA 2NW0A 5HWNA 3B8VA 4F48A 1BG9A 5EPDA 1J9YA 4HBKA 2QJIA 4G7EB 3AOFA 3APGA 3LA4A 4AIEA 1TTJA 2DU2A 3VGDA 3EKZA 4HPJA 3D6NA 4D6EA 4GUHA 4NKCA 4Q8NA 3DYPA 4IL0A 4YVPA 2VFGA 2QV4A 1E5JA 3QYQA 2OXNA 2QEZA 1QNQA 2IS7A 2PDFA 4GISA 5LHFA 3ZM8A 4B5NA 1XIFA 1J01A 4OBSA 3PNUA 3LTSA 1W3IA 1A53A 2ZOXA 4R27A 1JCYA 3VKCA 2YL5A 2XN2A 2FMNA 2A79A 4NU7A 4UB9A 3W6LA 6ALDA 3H26A 1KCLA 1WXJA 3W7OA 2WSQA 4FOJA 1BWKA 3UWYA 2VEMA 3NGJA 4G56A 4YIWA 5BMXA 1JPHA 5BXTA 4PCPA 3WL0A 2ISDA 4DBWA 4WIWA 3M6DA 4AY1A 4Q7BA 4RE2A 4KEMA 1P43A 2W6RA 3KEHA 3MUZ1 2QXWA 1KFJA 4S3FA 1FWRA 1DJIA 4ZODA 3IAPA 1SFJA 4DYJA 3KLKA 3T05A 3W7HA 1H49A 1MVYA 3NIYA 1R9ZA 3H22A 3O6CA 2POTA 4BJHA 1PS9A 3QV6A 3ALFA 2PDKA 3NPXA 1XM3A 3P61A 4A22A 3KRZA 3FOKA 5FJJA 4JEJA 2HQAA 3OZOA 5FAJA 3QR0A 2ZQ0A 3DFNA 1R46A 4ZL1A 4AD4A 3WFAA 2Z24A 1MXSA 4H6EA 3W1AA 3FCPA 4XSMA 1SMAA 1WZLA 4KW2A 1R6WA 3EWZA 3CPUA 1LZOA 3TWAA 4A2RA 3VI2A 5I78A 4YTTA 1OD0A 4GZEA 3L0NA 1B3WA 1WX0A 5LA1A 1AZ2A 1UWAA 1WAUA 2ZRZA 3L67A 3FJLA 4C7GA 1PKNA 2XVPA 1QR7A 2V5LA 1BPLB 1QAPA 4N4QA 4D6HA 4UOJA 4GYFA 4ATDA 1IZKA 4JGDA 3N9RA 4QG8A 4DNHA 2OQHA 4FA3A 3SSJA 2JF6A 3EB3A 3EB2A 1IHIA 3NEHA 3C3UA 4ZOBA 3F4NA 3BLIA 5TQLA 2G4FA 4Q8VA 4URIA 4JYFA 1P1XA 5BOFA 1H2JA 4LCRA 2PUZA 3WLRA 4ZENA 1EA9C 2GJXB 4C1LA 2BVDA 3G3MA 1FRBA 4LVFA 4C5YA 4UFKA 2B7OA 1S2UA 1Y8BA 3LLFA 1F76A 1I2OA 2B4GA 3BOFA 2WSYA 2JEQA 2SFPA 3W1XA 4L56A 1XJBA 4L65A 5LNWA 3KBJA 2RAGA 2VWSA 1US3A 4PMRA 5I3FA 3B0XA 1D8WA 2QJHA 3OZPA 5FACA 4TQTA 4U10A 5H8UA 3UCQA 2B0MA 1D3HA 1TIMA 4J5NA 2FZNA 3DI1A 4QX4A 3TYDA 3NQGA 3MB9A 3ZMRA 5AC6A 1WBHA 1RBLA 3W7CA 1UMYA 1KQYA 1JAEA 5L6UA 1VS1A 4C6OA 3C52A 3LV5A 2I5IA 1Q4NX 4MADA 5I3KA 1EKOA 1UZ1A 3ZR5A 5CZSA 1CGVA 2D3NA 4ZA0A 1FP9A 1V3LA 4QGCA 2OYKA 3EKGA 4J3ZA 1LOSA 1EDGA 3FDKA 1TPFA 5FJPA 4GQBA 1BKSA 4N9CA 3OOQA 1H7RA 2G8ZA 1YDVA 4UTTC 2ZE3A 4H04A 1QATA 2V3DA 4GYJA 1TJPA 4J3TA 1NQKA 3LCXA 4ONVA 1XYFA 2ZZ3A 3OZYA 1GEQA 3RO6A 2YLAA 1M53A 3HG3A 4M81A 3A4XA 4NZ3A 2QAPA 1W1IE 4GCXA 2DJLA 3O15A 2WJFA 5CPQA 2F9RA 4ICNA 1WZAA 3VD4A 1Q6GA 3ECQA 1FKWA 2PDGA 3MPGA 3K4WA 1R3SA 3A12A 4NJJA 1K77A 4PUDA 3TWBA 2VRJA 3KM8A 5CSRA 2Z29A 3O1NA 3QH2A 3RCNA 1M03A 4P5UA 3M64A 1EP2A 4NXKA 3KE0A 4LF2A 4C6MA 3LRLA 3OW1A 5I3DA 3W3OA 3WD3A 1ICPA 5AZ1A 1S46A 1Q6OA 5AZ0A 1RY0A 3EWCA 3RU8X 2INFA 4WZHA 4LC8A 1XBZA 1OFAA 3W87A 2PDWA 3UD6A 3H2NA 1IZCA 1VJIA 4E4PA 1C8VA 4NRSA 2CNCA 4OHQA 3FVMA 4DPQA 5BYWA 3TAKA 1ZENA 1NP0A 3TAOA 4RXGA 1JUBA 2J7BA 3UR8A 2G3FA 3PPCA 2I7GA 1UWQA 1GK8A 5H91A 3O63A 1G94A 3FEMA 4JEQA 3S5SA 2YKKA 4W8BA 6TIMA 4P7OA 1GTEA 1FDYA 3N6QA 5REQA 5AOUA 1L6FA 3B8SA 1X7FA 2QDEA 1EJTC 2PDXA 3KRUA 4WJEA 4JZ5A 1O12A 1W54A 3H2AA 3ZT6A 3BOXA 5CPTA 1AJ0A 3OA5A 3HQNA 1LL6A 1R8LA 3MUCA 1X97A 4N9DA 2A3LA 3MSYA 4MFEA 3NWRA 1D3GA 2QNEA 3B0PA 1GNXA 1KKRA 1QCWA 2LLEA 4DIAA 3L12A 3MMWA 1TJ2A 2FFCA 2VKZG 2ZWZA 2TAAA 2WMJA 1XYMA 3TXVA 3WDHA 3F4CA 4LXFA 5T91A 4NY2A 4ICMA 4D6DA 2FGBA 2DZUA 1XLGA 1IV8A 3M7WA 5DXXA 2GVGA 1DTUA 1R3YA 4LSBA 2J25A 5D30A 1JFHA 3LHUA 1ZJHA 4J7RA 1TB3A 4G6CA 1NH6A 2ZX7A 1AMYA 3EXTA 4GWEA 1V8EA 4DN1A 3PPFA 2ZFAA 3IGUA 1V0LA 4IWWA 1XUZA 4O50A 3WEMA 4DUVA 3R6IA 1ME8A 4WD0A 2Y8UA 4FOKA 1GONA 1SR0A 3EZ4A 2TYSA 3AMLA 4MSSA 4QNEA 2GWNA 3KVKA 1S5WA 4Q8WA 3S42A 3OBEA 3GNDA 3CUFA 4Z08A 4IX0A 1U5VA 4OOZA 1UKOA 1YXYA 4U2YA 3QR3A 3L4VA 3S46A 4FIRA 3NQVA 4H3DA 4KH2A 2W92A 1H51A 3DN5A 4G9PA 4A05A 3VCRA 2Y0FA 3MMUA 1X1ZA 2GJXA 1RLCL 2CEQA 3IJLA 4LU0A 2DZPA 4EOUA 3F4WA 3LTYA 4F0LA 1F61A 2WZTA 4XIAA 4U5IA 2OEJA 1C8XA 3T9PA 3BW4A 3DFOA 2RFGA 4C6CA 1RP9A 4MDPA 2OCZA 4Q4KA 4WJXA 4AF0A 1GVEA 5IDZA 3QOMA 2QV5A 1LF1A 6XIAA 3LQGA 4UZSA 1EEXA 2QCNA 3CUIA 1KQZA 2VOTA 3KBSA 3JZUA 1VB9A 3MJYA 4LYQA 2ONEA 3KTCA 3O6AA 1UPPA 3PUDA 3VGBA 2O9PA 3U2EA 3ABSA 4NASA 3USZA 2UY3A 2VEKA 3B0VC 1WDRA 4AD2A 3MQTA 1OGGA 4YU1A 3GFXA 5JMUA 5ABFB 4MIMA 3CL7A 4DB7A 1RCXB 3SQSA 2W79A 4JIHA 6TAAA 3GH4A 1U33A 1H5YA 2DP3A 1JNEA 3UFYA 2PDBA 4GYPA 2UWFA 4H2CA 1M7JA 5C2XA 2V63A 4D72A 4LPCA 4OV4A 1TWSA 4RL3A 4G7FA 1KR1A 2VX4A 4XIMA 1LDCA 5GQBA 2DSVA 2PA6A 1V7YA 2YW4A 3WEZA 3UJ2A 4MNLA 1CGTA 3BZGA 3VD3A 3GDRA 2G4JA 1VFTA 4QXIA 1OX4B 2PC4A 3ATZA 4RDYA 1DXIA 1ICSA 3CTTA 1TYGA 3B06A 4PYSA 3URQA 3H53A 1F3TA 1HTIA 5FAGA 4ZXLA 1SQ7A 4LJ3A 7REQA 2QT3A 3AYTA 2NWRA 4Y9MA 3N34A 3UA4A 1V51A 4DJEC 3VDAA 3LHYA 1YDNA 2Z25A 1TPH1 2CITA 4J40A 3PUOA 1QWKA 3AICA 4ZB5A 2POZA 3NQFA 4PBEA 1E40A 4K8EA 3M9YA 2YBVA 1CYGA 5A8PA 3MT1A 3DHFA 2ZVRA 1J2WA 1EEPA 3CS2A 4UQEA 2X16A 1KLYA 2E6YA 1XHGA 2E77A 2ATSA 2R24A 1A5LC 1J12A 1XKJA 1W3JA 4MWAA 4DWSD 4HK5A 4J4KA 2W91A 6CGTA 2DUZA 2X1UA 4X61A 1UOZA 2D22A 3TSDA 2Y89A 3VIJA 4M3PA 4RJEA 2PTWA 2ZKMX 4FXSA 5A6LA 4DBSA 1V77A 3E74A 1T99A 3SUSA 4EPEC 3G0XA 3BLPX 2OGYA 4E4UA 3C2FA 3LZ5A 4QLKA 1E6RA 2PDPA 2PGEA 4HU4A 2QAFA 3H2CA 1IR1A 3SUVA 4IGMA 2HE5A 1XFBA 4WOQA 1EC7A 3INPA 3VOHA 4FALA 1QT1A 4JIRA 1ZLPA 4K3ZA 3UF9A 3GXFA 3MV11 5A6TC 1GJWA 2DORA 4NZ1A 3N73A 4JTGA 1QTWA 3ITGA 4ZZ9A 2W0UA 3KHJA 3OZMA 3SCSA 4UOQA 3C0LA 3PZIA 4JY8A 4YTUA 1KFCA 4CNSA 2P8BA 2J74A 1R86A 1IT8A 3TQVA 4MJ2A 2VZTA 4GVIA 3V18A 1EL3A 1MFUA 2JQXA 3H7UA 3NGFA 3BE7A 1E56A 3L2MA 4QCFA 3BPWA 1Y5XA 2DZTA 3NA8A 3VOGA 5CEWA 1TV8A 2GQ3A 1DYSA 1Z32X 3ITOA 3W85A 5CZ0A 1O5XA 4PMYA 3VOJA 1H1NA 1DE5A 3R8GA 3ABOA 2VO5A 3V7PA 4B2DD 2Z1VA 1NWRA 3LK6A 3QW4B 4G2DA 3AXMA 3BG3A 3PWGA 4K7YA 4POCA 1E6PA 4NG3A 4TMCA 2INEA 1B57A 4JDBA 3W1RA 2ACRA 1UUQA 3AIQA 4GINA 3U5YA 1A5OC 1QVBA 3UG4A 3MDWA 3I10A 3PS7A 4LS0A 3B9AA 1IWPA 4P8UA 3HBLA 4D6CA 2DT1A 4O12A 4S3CA 4QJ5B 1RV8A 1PYFA 4Q8UA 4ROPA 3I65A 1DORA 3CO4A 4L6HA 3TMQA 1OX4A 4I9MA 3H70A 3WBYA 1M7XA 4X0VA 1ZL1A 1P6WA 1HN1A 4O53A 1QNVA 1EP1A 4BI5A 1H62A 2CZDA 3KCOA 1WOAA 1DQXA 4V1YA 3S3GA 3GUGA 2CZVA 1E6SM 1NDVA 1J0YA 3ENLA 3GZAA 5I5RA 4AFYA 3OB8A 3LB0A 2OYLA 4XAYA 1XBYA 3R0DA 1NEYA 3P82A 3QRHA 1YPXA 2ICSA 3U6WA 3ZSSA 2WOQA 3A4AA 3I4EA 4I5UA 4YCPA 4ZEPA 1GWJA 3CIVA 3TEVA 1RAKA 4Q3MA 1ISYA 3IARA 1S5NA 3WLSA 4W4QA 4CD8A 3M0ZA 2Z1KA 2VR4A 1Q4WA 3U7VA 3GC4A 3WLQA 1JYWA 1UW9A 2PTXA 1SO4A 3DERA 1QI0A 5A6BA 1E9YB 4WXZA 1RY8A 1QO5A 3HIJA 3VIGA 4S3DA 1EHAA 2CLFA 1Q8AA 8TIMA 3A3XA 7A3HA 4B3LA 3MI2A 3A23A 4H01A 3GDLA 3OGRA 2C71A 1ADOA 4MAVA 4V33A 1T0OA 3STEA 4ZMGA 1R3WA 3QY6A 3DBNA 4LC6A 1OHLA 3PVFA 4GD0A 1FWFC 4Q4QA 1H3GA 2OODA 1OC6A 3IVSA 3F5LA 1V0MA 4O10A 3F2DA 4I5XA 1J4EA 3FJ4A 1EZWA 4JPGA 1E1CA 3EWYA 2Y7FA 4Y2WA 3P5YA 4YHEA 5DLCA 3NL6A 4E3VA 1GCYA 1RP8A 3RM8A 4GC3A 1EXBA 4LVDA 3G1XA 3ZLHA 1YTEA 2WAGA 3SDOA 3W53A 4AD3A 2QJNA 2RHGA 1XPYA 3HGSA 4O1EA 1O5QA 1W3TA 3Q2DA 3T0AA 2JIEA 1B9ZA 4LTSA 4GVHA 1FCUA 3BLFA 4U31A 1ECEA 4JX6A 1V79A 1M1BA 2YB4A 5ABFA 1W1A1 2H6RA 3W24A 4N0RA 5FJTA 3BAKA 3MY9A 1OIFA 5DCBA 4AB4A 3JZEA 3ABXA 2X2YA 4AWTA 4DJEA 2P50A 1CCWB 3GXNA 5LNSA 3P8JA 4XWUA 4QE4A 5G1TA 3LV6A 4H9MA 1O94A 4HZ6A 4D8LA 5FJRA 4K1WA 2QCDA 2UY2A 3D47A 3O2LA 4FK9A 3OVGA 3EX4A 2XIJA 3VMNA 1AVAA 3UW6A 3UXLA 4PCTA 3WF0A 1Q7MA 2VRKA 3W7QA 1PSCA 1QRQA 3PBWA 4MZ8A 1EBHA 4DJDA 4GNVA 3RJYA 3WBEA 1EQCA 4QROA 1XX1A 4FIQA 4M7TA 2VXNA 1VR6A 1V02E 2QIWA 2VZOA 1Z89A 3WK1A 1VBHA 2FTYA 2YDAA 3DOPA 1PV8A 1S2CA 3TN4A 3FEQA 2B7QA 2UBPC 1KV5A 1LL7A 1F6KA 3UPBA 1B2YA 1NSJA 1QI5A 1XDLA 1WP6A 3H8AA 3MS8A 4TTUA 1Q3NA 1X6NA 2VCAA 2J7HA 4MPKA 1JQXA 1NQ6A 2WHLA 1EJXC 1C29A 1NOWA 3WQVA 4B3ZA 5D05A 1EPXA 1EUAA 1O66A 4CNOA 2EPMX 2AGKA 2HVNA 1K8CA 3W2JA 4NNCA 3UZYA 2QUVA 1LLOA 5TD4A 2DQWA 4M7SA 1OZQA 1YTKA 2BX7A 4NUWA 3W83A 2BHZA 3WLKX 4AY7A 1BAGA 5LGXA 2CWNA 1PZ1A 5A2CA 3OGVA 3IJ9A 3NAVA 1YYAA 3BGGA 3ARTA 3O6YX 1EJRC 5C9XA 5IHRA 3WCZA 1F73A 4W8LA 5AHEA 2WM0A 3SRKA 3VGFA 1HW6A 1UROA 3K5XA 2PE4A 3GKFA 1XYBA 4WXYA 4C6QA 3U2OA 2OSYA 2VQUA 2ZA1A 2H3DA 3W6MA 1TX0A 2O55A 5BROA 1PZ0A 1FWTA 4FHAA 4PTXA 3E12A 4WSHA 4NNBA 4WOZA 5A6JA 3GO2A 1VYRA 4H4IA 3CT2A 1SFTA 4WLCA 3TW7A 1XKYA 3AZTA 4NI3A 3MKCA 4IPPA 2OPJA 2WHMA 1SJDA 3O05A 2IQTA 3BLKA 3II1A 1Q66A 4R34A 3BUVA 3CV7A 1YPFA 3FSTA 4YWSA 3W02A 4OUIA 4O1DA 3WNMA 5LA2A 3PPGA 1UR0A 5JBEA 1G0CA 1C93A 2Y8VA 2YCJA 1W9VA 2DY3A 2VFDA 2WMKA 3ANVA 1V6TA 1YPIA 2BGSA 3GBDA 3WLTA 4MYXA 3ALGA 3HJEA 4GI8A 1AW1A 1DBTA 3KAOA 3ID7A 2JFEX 3RHGA 2WHKA 4AHQA 3WMCA 5HPOA 1A0DA 3MSDA 3FGCB 4C6NA 1F6YA 3U0HA 1CT5A 5DMLA 1XRTA 3GIYA 5B80A 2V68A 3QW3A 5CZKA 1Q13A 5ENLA 3W38A 1DWAM 3OVPA 5KZEA 1WB0A 1KBKA 3UZXA 1V08A 4JFTA 4HP5A 4RE0A 4J35A 1HJWA 1SZGA 1XYAA 4DXVA 5AC8A 3ABRA 3QZAA 5KETA 1F05A 3QSRA 3P81A 2IKGA 5FJIA 1V6WA 2V0TA 4K6AA 3KDNA 1E0WA 1OCBA 4JNZA 3FA4A 3BCDA 1VKFA 4WKAA 4KRUA 1AQMA 3W7EA 1LP6A 2NQ9A 1G4TA 3N15A 1VD6A 2FVMA 4JL2A 1O6IA 3AXIA 4WDXA 4E8GA 2VFHA 5K4ZA 1PX3A 3TV8A 5GNXA 3AAMA 3CBWA 4AD0A 5H8PA 1GOWA 3FA5A 1H1YA 3VDCA 4YNGA 2BG5A 3EMCA 3VE9A 1Z41A 1CXLA 3E0WA 3OLEA 5F2IA 4PTNA 2PLCA 1CZ1A 4B9ZA 1BEUA 3DFQA 1UWTA 3UJFA 1MUWA 3K1GA 5AKQA 1OFQA 4LY4A 4UTHA 2R91A 1FXPA 2DJXA 3JR2A 3VOIA 4KQNA 3M0LA 4LQ1A 3KP0A 3JUGA 2J9ZA 5EMYA 2PAJA 1KGUA 4PUNA 1XI3A 4MB3A 3IGSA 2NXIA 4Q4RA 1EGVA 4F66A 1OVDA 3CNYA 2BGQA 1JRCA 1NFGA 3S83A 3WNPA 2J8TA 4XZMX 2WVVB 2BLEA 3HGOA 2A3AA 3M0XA 2AL1A 2EAWA 1Q85A 3VE7A 1G7VA 1PIFA 3TXZA 4DPPA 1ME7A 1WDWA 1NARA 2J6XA 2V5BA 4KEUA 5KEZA 3O6DA 2GSEA 4J9JA 3W28A 1T8QA 1R2RA 3NURA 3SCPA 4GIAA 3MC5A 1HJUA 1YMYA 2QUMA 1I0DA 2J8GA 4I6VA 5IRPA 1MZHA 1KM1A 1UH3A 3AWNA 4TVDA 1CGYA 2BTMA 5E09A 1FHDA 2XIBA 3UEQA 4DWDA 3R79A 1E15A 5BWFA 5E6YA 1OSEA 3E0FA 1UR2A 5A8OA 4ACZA 1JF6A 3S2JA 1PL9A 2VD9A 3AMGA 1L6YA 1DV7A 1FUYA 2A6LA 1ZALA 1IR2A 3S6TA 4QHRA 2QHAA 5G4HC 4HA4A 4JCLA 3LPFA 3SY1A 1HP4A 1LQ0A 1JNDA 2ZXQA 3WF1A 3GNPA 4GLEA 1H5VA 4B90A 4FEZA 5BU6A 1YTDA 1XH1A 2YJQA 3WNNA 3GTXA 2FZ8A 1KO0A 4JTHA 3MP3A 3ONCA 3OP2A 3L4ZA 4QDWA 2V2DA 1ONXA 2EPLX 4A21A 1GVOA 2TSYA 4PBFA 3POCA 2ZX8A 5XINA 3EDKA 2QUUA 5D8WA 2IQ0A 3B9OA 1Y5WA 2VC5A 3ARPA 1TG7A 5ABEA 2VCBA 1UJQA 4I9JA 3HZ3A 5C71A 4I8YA 4AU0A 4M1BA 1VJZA 1TO3A 1R7AA 5K2ZA 1ALDA 3QVQA 4IICA 4OFCA 4GJ1A 2IPJA 3GUWA 3ANUA 3CQJA 1VCVA 1TJRA 2ZDSA 4E0CA 4HOZA 3HM7A 1HO1A 5DMMA 4GACA 2XWEA 3MZ2A 2Q3OA 1OB0A 1QU4A 3UR5A 3I4KA 1LBLA 5HULA 4PB5A 1GKRA 2XZ7A 4OJYA 1RUSA 2J66A 1NIUA 1XRVA 2I9UA 2J75A 3A5FA 1VCFA 5K9XA 4DUWA 1A5SA 4K68A 2CBUA 3W2LA 3VYLA 1FHLA 3W86A 4GQ0A 1FBAA 4YHGA 3MO4A 4G8TA 3CHDA 4TVCA 1N55A 3G24A 4E38A 1KFEA 2RKXA 1E3ZA 3SQLA 3QXBA 2GJLA 3N2XA 1MW3A 4XAGA 3W27A 2X42A 2CKRA 4M6QA 3QLDA 3PJTA 1GVRA 1P7TA 1A47A 4UTWC 1THFD 3M0KA 4GXMA 2PU1A 3S0CA 1KTCA 5J5DA 3C3NA 1B31A 2VC9A 3WG6A 3QTGA 1MUCA 1XCWA 3TROA 1TRIA 3G8RA 4CNUA 1UKTA 4JHOA 2ESCA 1GPWA 2PWVA 3U5UA 1SSDA 2V3GA 2CLMA 2BFGA 3ARZA 1QPKA 3CPRA 2NT0A 5AVHA 4C1KA 3ZR4A 3L66A 5TIMA 3DENA 1J0KA 3BG5A 3FY1A 3B0UX 4FPSA 3ZIZA 3GR7A 3W74A 4LBUA 1FWAC 1REQA 1B3XA 4GX9A 3TTQA 2GL5A 1JDFA 2ISSA 4FS9A 4XKYA 4MB4A 5EFFA 3S8HA 2Y88A 1GEHA 4MWAB 2OGJA 3NZPA 3IIVA 3BAXA 4H41A 1L2QA 3TE9A 3WX7A 1VFHA 1R30A 4HMDA 8A3HA 3W7IA 5A95A 2CW6A 3CQKA 4KCTA 4BQ3A 3B40A 4MUPA 3H2EA 4PL1A 4HMCA 3Q45A 4K36A 3AISA 4CU8A 1PO9A 2GSJA 1QNOA 1UC5A 4DO5A 2HMCA 5FJUA 1HJVA 3WNLA 4UMAA 2FVKA 1X7IA 1UD2A 3B4YA 1P48A 3SCRA 3QHMA 1A5BA 4RCXA 1OFEA 2ZUTA 4L9YA 1XYLA 4IGSA 3GHSA 1KM5A 2PTYA 3LS9A 3EDJA 3LD5A 3TQPA 1QHOA 1R2SA 1YHTA 3I7RA 1XL9A 2HCVA 4NX5A 3OBAA 4ZSTA 3GXDA 3EWDA 4TX8A 1OGSA 1JFXA 3RX2A 4QCEA 2BHUA 4HK6A 3NUKA 3AYVA 3GFYA 2PC8A 3AMCA 5BXRA 1QMLA 1RVGA 2C0HA 4O19A 4QJ1A 3HF3A 2D0FA 4YL2A 3CM4A 4GY1A 5IM51 1BFNA 1Y5VA 1KGWA 4NZFA 5K7JA 2YDRA 4GIRA 5LIYX 2J47A 4FI4A 3M44A 2QCFA 1TMHA 4GZJA 5CAHA 3S47A 1XD1A 2H9AB 2Q8XA 7REQB 5U4NA 2FZ9A 4J3XA 2OZ0A 2OWXA 3N14A 1QK0A 4PTVA 3RX4A 3MSRA 1OYAA 1WYIA 1SPQA 3ITYA 4S3KA 3S1VA 4CVWA 1JPDX 4BR1A 2OOGA 3HGJA 1BRLB 1QBBA 2CYGA 5D9PA 2RUSA 1Q6FA 1XIBA 3S6OA 3HTWA 2DH3A 1TPB1 4IGHA 4HCDA 2PBOA 1XIGA 2X41A 3KZSA 3SUWA 4QQ3A 3LGGA 5F2MA 4DXKA 2GJPA 1W1PA 3PBYA 4B4FA 3MYPA 5IBXA 1EF3A 2JBMA 3W2NA 4I90A 4IG2A 8XIAA 4GFSA 4AF0B 1K7FA 4E2OA 2HEJA 1TJ1A 5BU9A 3EA3A 3KBVA 3W2MA 1JIBA 3AMDA 4S3BA 4PZVA 2EKCA 2X0SA 2PURA 4PUWA 3G1VA 1XLHA 4OWGA 1KFLA 1B5TA 4C65A 1M7OA 4HZ7A 1DJXA 1AJ2A 3T44A 3V4BA 3F1QA 1A5MC 2C1GA 3H2MA 3L65A 4H6KA 4WKHA 5KINA 1BF6A 2VFIA 5LXEA 1ADDA 4ZB0A 3EDFA 4HTBA 4PA8A 2EPNA 2QGHA 1EJ7L 2E6DA 2PWHA 3URNA 4LEQA 3VNIA 2J9XA 5CKSA 4MHBA 1E1FA 4PMUA 4YWIA 3OLIA 2OQLA 2XIQA 3NCOA 2A3BA 2DSKA 3R0KA 3HURA 1MQPA 1JJKA 3ES7A 4A3UA 2WC7A 1X1OA 2C6QA 3W0KA 3QQ1A 4U3AA 3SCVA 1GHSA 2BOGX 2XIIA 1ODUA 1J6PA 3H4GA 1PBGA 3G1DA 4GGHA 2P10A 2NX1A 3LLDA 1KFWA 2D2GA 3MW7A 3ME3A 4FX8A 5T9CE 4DJFA 4BWLC 4JHMA 5EBAA 1ELSA 1MDRA 3GAYA 3C2RA 4DAIA 4A8IA 1VBUA 2Y62A 3ORWA 2EF9A 4WEVX 3VAVA 4LYRA 2D73A 1J0IA 3WJSA 2XDFA 5D9NA 1Q6CA 1QOXA 3VKJA 1L8PA 4DAFA 1IZJA 4UC5A 3QV9A 2Z1XA 4JTFA 1TTPA 2REQB 3LXAA 4B5VA 4AMAA 2F8QA 4IMFA 4HYWA 2GOUA 3G3DA 1RVKA 2R82A 4GVFA 3FW6A 3N17A 5EGRA 3E96A 4AAJA 3CZJA 2BZNA 3DHUA 1A5AA 3QYSA 1OD8A 4W87A 3QR1A 3MCNA 2FHFA 3RDKA 5LSMA 2QPUA 4IFKA 1TZ7A 1KRBC 3SIMA 4GA8A 3KWSA 5G1YA 4LV9A 3UNTA 3BSMA 1QNRA 4L7ZA 1KC7A 1E6NA 5I6SA 1E43A 4AXNA 2R1NA 1UBSA 3Q65A 4QEEA 3CASA 5B7ZA 2PCEA 5AECA 2Z2UA 4ML9A 2AGTA 3N18A 3PUEA 3R94A 1WO2A 4JQ2A 4ORIA 1MI3A 5BRQA 2CBVA 2AQWA 3FAXA 4H8UA 3IV3A 1R0MA 4RV3A 4YVVA 3W7RA 2QMJA 2VZVA 2ZUSA 7PTDA 4FP1A 1PTGA 1CDGA 3BANA 1HIZA 3BARA 1WUFA 5CH9A 1DQWA 1E4NA 1FWNA 4ZBCA 3WQFA 3SEPA 3LTPA 4IUGA 3PBVA 3ZS4A 1NM9A 4A6GA 4LB4A 4PEKA 4U4MA 1MWOA 2OU4A 1B3ZA 4QG6A 3UBPC 1TWWA 5AHMA 3CZGA 2QCEA 1GGOA 5C70A 1AA1B 5BCAA 2AOSA 4LALA 3DYMA 3LHVA 1OFBA 3P8IA 1MRAA 3GHTA 3D3FA 4RDZA 1PPIA 2OOFA 2EG7A 4QEHA 3HGRA 3FSUA 3PTDA 1QHPA 3E0LA 2ZCGA 3KTSA 1BD0A 2CHNA 1V4YA 3S5NA 4DJFC 5CQ1A 4JTLA 4QS6A 4W5ZA 4AD1A 4FZIA 1Q6QA 3RFAA 5I3IA 3H4XA 3V3WA 3HV9A 4DELA 5CJNA 2FGLA 4MY1A 3NNTA 4S3GA 5FESA 1VFSA 3DKJA 5H2ZA 5FSDC 3SY5A 2YPIA 1W1TA 4H8HA 2IPFA 2J79A 3QPEA 1J0JA 4MZ1A 3SY8A 1H4PA 3NQ6A 3NZRA 2Y85A 4M82A 5HQMA 1H11A 2HROA 3M46A 2Y61A 4O14A 4Z0JA 2WB5A 2A3EA 4ERIA 3TOYA 7TIMA 3PZVA 3S5YA 1OX5A 1UR8A 3KXQA 4Y8EA 4V15A 2ZUVA 1M68A 1JI2A 3JW7A 3NYDA 5DN1A 3AI0A 4RKAA 1KLZA 3HPSA 3PULA 2GYIA 4HNVA 3QSTA 1UWRA 1HVQA 1XIHA 3PZUA 4B5UA 3L68A 3SCNA 1W2PA 3PFMA 2OLSA 4ZQRA 1VEPA 1POJA 3EOEA 3LCHA 5DQPA 2J7FA 3QN3A 3WQ5A 2XIMA 1RLDA 3V5CA 3N4AA 4F2TA 3W7NA 1ZJIA 1UZ4A 3AJXA 3K4AA 2FB3A 1G1YA 4DBEA 2Z0IA 4ILSA 2HK0A 3H24A 3UCDA 4PUEA 1CXHA 1LTDA 4H9YA 5E9AA 4HMNA 2VWTA 1VZWA 3LYEA 3N3TA 4ZGYA 1ZAIA 3AC0A 4RNHA 2REQA 5MKGB 2MANA 4WGXA 5I3HA 1X8FA 1I2RA 3MWAA 4NZ5A 4B15A 4PTWA 1SUXA 4M24A 5JXQA 3HMJG 2PBGA 2V30A 3R25A 5LIWX 3FGCA 3URBA 3VMOA 3NG3A 1O60A 2E8ZA 3PZNA 1AD1A 4AWEA 1UUMA 1RBAA 1GVYA 1R5YA 5I2UA 3T4CA 4AEOA 4J1OA 3WMBA 1HG3A 5LA0A 8XIMA 3W1UA 2X7WA 2OLHA 3KS6A 1M41A 1K02A 3WQCA 1E0VA 4IFKB 1K6WA 3UERA 4CU7A 2ZRYA 2OJPA 3CUJA 2Y1HA 4H8NA 2P0IA 3ITTA 1JCXA 1TTIA 2AMXA 3UYCA 4BQ2A 2D69A 3C56A 3ZYZA 5I3GA 1S2TA 4P8XA 3NSMA 4RK8A 3AHVA 3EDDA 3UYIA 2WNQA 1LJYA 3BQ5A 1Z42A 2WPGA 4OECA 1N8IA 4WY0F 1HKWA 5L9FA 3QQWA 4M6UA 4JTDA 1LWJA 3E5BA 4CKQA 4IP7A 5BZAA 1R9XA 1UKPA 4LVAA 4AZCA 5HUOA 1CXKA 1B3VA 3W01A 4JY9A 5LNUA 4NNAA 2ZZ7A 3W07A 5E0CA 1MRQA 3AALA 3PJUA 3CQ0A 3ZVHB 2B7NA 3G1HA 3WLOA 5B7YA 2GDUA 4MY9A 3TA6A 3ARRA 2EPKX 4LUTA 1PX4A 3HQ1A 5HUPA 1ZS2A 4OV9A 3V5OA 2PDNA 4XZIA 1F6PA 1EYEA 4Z2KA 3U7BA 1OFDA 1UWSA 3C0JA 1XRSA 4BI6A 5EKYA 1GQIA 2R1MA 4LUJA 1KBBA 2PZ0A 5D2XA 2ON3A 4XAZA 1QPQA 3OVRA 4WVXA 1TPUA 2PSNA 4GH1A 1IF2A 1SO6A 5ABTA 3O3RA 4HJFA 1KCXA 3WD2A 1GG1A 3HU7A 3LBOA 2ZC8A 3FIGA 4XUGA 5FJOA 5HWMA 3UWQA 2NUXA 4HK7A 5DMNA 5I06A 3MCOA 3IJIA 4AHPA 2FYMA 3NEVA 3VKDA 1NP2A 2P5NA 2HZGA 3UG5A 4NXSA 2XTKA 4NVTA 1YADA 1DHKA 3WH6A 2FDMA 1ICQA 2Q71A 1R2TA 3SFWA 2CHRA 4DI8A 4O1BA 4HYVA 1LUCA 1VCGA 3VK5A 3DGRA 1TMLA 2GGGA 2PWFA 3N11A 1OK6A 3TFCA 1XG3A 3K8KA 4KWOA 1CLVA 4P7NA 4GKTA 1JPMA 1J11A 3POHA 2GGEA 3TR2A 3RXZA 2XM2A 1V6XA 1HGYA 1JZ7A 3UXAA 1M65A 1KRMA 3KBMA 5HOSA 1XIIA 3SRFA 4IM4A 2XFFA 4EPBC 4IGNA 4DO7A 2A5HA 1HNYA 4XTIA 3VC5A 2ZXDA 1KRCC 1XUUA 1O4UA 4X60A 4UFJA 3SCWA 3WFLA 4UQBA 1S5VA 4WCJA 3BDKA 4WUIA 5D09A 4IQLA 5KTLA 2PF0A 4JFSA 2ZYFA 1MW1A 3WSUA 4IIEA 3MP4A 3WJXA 2HNHA 5JIPA 3BC9A 2YA1A 1BG4A 3LQLA 4HPXA 1I6NA 4Q7IA 3IRSA 5CPMA 3C2OA 4X63A 3VUSA 1A3XA 5AYBA 2CIPA 3G18A 4HNOA 3CB3A 5I0DA 3LXBA 3BMWA 4ADUA 5BXPA 5HK4A 5AC4A 3QC3A 3DZ1A 3FJ6A 3HG4A 5K9DA 3QFWA 2R8WA 4FX7A 4IPIA 2ZE0A 1XCXA 2OEKA 2QLYA 1TZZA 4CEUC 2PLMA 2DVUA 3DFYA 1ITCA 2FMOA 4AEFA 3PY2A 1XQKA 2R9RA 3MUAA 3RUBL 5CLTA 4XG1A 1XRFA 1XWYA 5CGQA 4UZUA 4XD3A 2H8XA 4H1ZA 3K8LA 3SIZA 4GQGA 3O07A 1Z7AA 3OIXA 3UXIA 2G95A 4PN2A 3WF3A 2NXHA 2QJGA 4ZO6A 2WXDM 5A5WA 5AYYA 4GY7A 4OKDA 1EJVC 4C6JA 3BSHA 3ITXA 1D7KA 1LT7A 3V35A 2ZVIA 1W9PA 2TMDA 3D46A 1RXOB 3OODA 5CC5A 4CLMA 1CECA 4ZQOA 1OWQA 3EA2A 2IKJA 5EMMA 5EMLA 3FKKA 1HT6A 4KEVA 4BKNA 4AX6A 3ICJA 2BV9A 4RZ6A 1L6SA 4R9XA 4JR5A 2AQVA 4V28A 5CXPA 1VFLA 4UQCA 4H9TA 4I6KA 4BF5A 2PGFA 4IF2A 3GFZA 3PB2A 4TR9A 4OTKA 3ZZ1A 1MMFA 5LIKX 3E0IA 4HHHA 4FXFA 2Y7DA 4L1XA 1EF2A 3WDJA 1DWFM 3AZSA 4XV0A 5AY7A 4YS1A 1JCJA 2XN1A 4ZE5A 1RQEA 3DXIA 4IMDA 2Y4SA 4HJWA 2FZDA 3W1PA 4PE8A 4AD5A 3U48A 2ACUA 5EL1A 4V2XA 5I07A 3TN3A 3TCSA 1MW2A 4HU3A 4J2PA 4C6FA 2WNZA 1FWHC 1UD8A 3ARSA 5HJXA 3R8HA 4PUUA 5FF2A 2DSUA 1RJRA 3DCPA 1CIUA 3WZ0E 2VUYA 3ZVIA 1OABA 4FNTA 1CW2A 3PB0A 2PLJA 2GVLA 1E1CB 3MVIA 4ZO8A 3ZJ6A 2Q09A 4O8AA 1UP2A 1KM2A 1WA3A 3R0UA 3RAOA 3BJFA 2G3NA 2GOKA 3FDGA 1LOLA 1OFOA 4DY1A 2BVTA 1CXFA 4INFA 1OF8A 1PWMA 1KW1A 2BSLA 3ZLFA 2YDSA 3SN4A 1VC4A 2YOCA 1H7XA 3UCCA 3NR0A 1HXJA 4AUBA 2TPSA 3WEOA 3LDVA 4UQAA 1V6VA 3NZ1A 4HPHA 4NSBA 3GD6A 4JTSA 4FXRA 5CG0A 4I7WA 4F3HA 1W5QA 2J8FA 4PRRA 2ZXBA 2PTZA 4AZIA 5DELA 3NPVA 4HHMA 4LY8A 4GC4A 4JFUA 3M0YA 1RJQA 1HUVA 4GCAA 3VXGA 1P0EA 3MDUA 4GG9A 2QUTA 3TX9A 4TVUA 2GFTA 4FMVA 3WLIA 3R58A 5LXXA 2NLIA 3MJMA 4GX8A 4CCZA 5LYRA 1BKHA 1UKQA 1SZNA 1B54A 2BXZA 4DX3A 3ITLA 5A6SA 3WYZA 3HO8A 2C18A 2V5KA 4H2HA 4E5TA 3RU6A 5G2WA 3UZWA 4E2BA 4UBPC 1Y0EA 3A6OA 4AQLA 1HL2A 4AC7C 3NQ7A 3VM7A 1WOBA 3BJTA 2W9MA 1O68A 1QJWA 4O4WA 4QG9A 4JX4A 3FVDA 5CPLA 3ISIX 5A8QA 4LT9A 3SO7A 1PX8A 4AYGA 2GPTA 2NLYA 3LERA 1CTNA 5LGZA 2C1HA 2VEFA 2XVKA 3GYEA 2UY5A 1DXFA 4ZO7A 1XLIA 3UR2A 2QMKA 1RD6A 3CWHA 1G4SA 4ECLA 4R85A 2HS6A 2A85A 3DDMA 1GQJA 1EH9A 4MWAC 2W27A 2XVNA 3SGZA 1JXJA 3AHTA 2CZ5A 3OLDA 3NL3A 2JGQA 4W84A 5AC7A 3CWOX 2EEXA 3WELA 4PCFA 3O8AA 1TVNA 4W7WA 1YQ2A 1L8NA 5MKGA 2IUZA 4ALDA 3SGGA 1FHVA 3CAWA 5JIWA 3PUGA 3OGSA 4O8RA 4KGJA 1DJQA 3CZKA 4ZCWA 2A7RA 2Z4GA 3S4TA 3A5VA 4LUTB 3TOPA 4MJZA 2X0YA 1C92A 2FJKA 2EGZA 2BODX 2ZA2A 3GB6A 2O7QA 3BL3A 3UWEA 1W1VA 3MA8A 2VGFA 1XLBA 1G69A 1I1XA 5DMYA 1W9BM 1LOQA 1NOFA 1HQTA 1PHWA 4DQWA 4TV6A 4NI8A 4UNKA 3P60A 5I03A 1XW8A 3AYSA 4EAYA 2D20A 1C90A 1ISVA 2WVVA 4FNPA 2OG9A 3LPGA 1T8XA 1VIWA 3VTRA 3BH4A 1TV5A 3U9IA 2XFWA 1NDZA 4HU8A 2CHOA 2WWCA 1H7WA 3DFSA 4UNIA 1W5NA 1PCWA 1SW3A 3CZ8A 1F74A 9XIAA 2Y5SA 2VDIA 1GJUA 2E5CA 1ESWA 3OYXA 2XSBA 3NQAA 5JBDA 4J28A 1BWVA 1FDJA 5BOOA 1HVXA 1N7KA 1JGIA 2R14A 2W5FA 4PMJA 5MF5A 3E6EA 5BWAA 3O16A 2AL2A 1SFSA 2WC4A 1CXEA 4CNPA 3LPOA 4CQ8A 1R38A 1F5ZA 1FHUA 4OT7A 3CV6A 4XO7A 1O7AA 3N9KA 1JPKA 1W91A 4JAWA 4QLJA 2G41A 1J6OA 4GBDA 4RZ5A 1S2VA 1WKYA 3GH7A 5AHLA 4CD4A 3U3HA 3W75A 5FL1A 2GQ8A 3VD7A 3VX1A 4EXQA 1H61A 1W5OA 2ZUWA 5HMEA 3BVJA 5KITA 5C55A 3HFTA 1DTNA 4JTEA 1JYVA 1XSIA 2J88A 1QPRA 2BNJA 1ISZA 4DZHA 5I00A 3BICA 3S9YA 4RZ4A 3ERPA 4RX0A 2DUAA 4XD4A 4WY0B 4C91A 5FF0A 5JH1A 4W93A 3RPMA 2CBJA 3W1LA 3G5EA 3ITVA 3TN5A 1SYTA 3GXMA 4IQDA 1VYPX 3SCTA 1XLAA 3CC1A 4DF0A 1YNQA 1VH7A 3FKRA 5AN7A 5CJ5A 2DH2A 4OOUA 4Q8OA 1XSKA 3PJWA 5DRIA 5M2FX 1CNVA 1VAHA 3P0WA 1H0GA 5HR7A 1PE1A 2I57A 3PZMA 4QNWA 3VDGA 3MUXA 1BQGA 3PZQA 4MNJA 2ZIDA 2KX9A 3N19B 3ZJ7A 1W31A 2F61A 2O0TA 3MKKA 4A35A 4XKYB 3TJIA 4GO8A 2ACQA 2VYOA 4IMEA 1CXIA 2A7PA 2O7SA 2DVTA 3HPZA 3GRIA 4BF7A 1PCKA 4UMCA 7XIMA 3WD0A 3W2UA 2PGRA 2J7EA 1KXHA 1U5JA 1NFBA 3U2CA 1EUNA 1S1PA 3OBKA 1DWGM 1E0XA 1XXXA 2YX0A 1Q2RA 4BA0A 3U4AA 3KRBA 4O18A 1HKJA 3OHMB 3B8IA 2WCSA 3GH5A 3UESA 2XVGA 4OUEA 3QBUA 1J5SA 1SW0A 4RE3A 2ANUA 4EE9A 5M5DA 4RNIA 3HG2A 1QFEA 4IXXA 3GDMA 4MKNA 1BXNA 4LFYA 4ADTA 2NVAA 3W4RA 4AVFA 1CENA 1P1MA 4HA0A 1X6LA 1E4LA 4PEEA 1GYLA 4X2PA 2OSWA 4RNJA 4H8VA 3ZR6A 1UD6A 3TTYA 3TH6A 3RM4A 3CT7A 1EIXA 4CD5A 3F03K 2CXEA 4YCOA 1KBIA 3ITCA 1WUEA 3TQKA 4HKPA 2J62A 1B0IA 4HOXA 2WYSA 1K9EA 1P0NA 3EKLA 2F7FA 5DFAA 2VDGA 3A4JA 3T81A 4EXAA 1OC7A 2WJZA 1CLXA 1N8FA 4DF2A 4H6RA 1J96A 5E70A 1OT2A 1E51A 3A3HA 5M1TA 3KZPA 1WPCA 5BXSA 3VABA 4M5PA 3APTA 1PZ2A 4XD5A 2RJHA 5J8LA 1Y7VA 2XZ9A 1V7AA 5CC6A 4TTGA 1G01A 2IPWA 3T0BA 1JEZA 4AIUA 1LRNA 4FOUA 5A6MA 3DX5A 5T26A 5EMJA 3W2KA 3GE7A 2WMIB 5DXYA 2XYLA 2HK1A 1XD0A 3W1MA 3VIHA 5DF0A 3GU9A 4KIEA 3WENA 3SUTA 1JZ5A 3FS2A 2OQYA 3SRHA 1CPUA 1WKDA 1PDZA 4WDTA 1YRRA 1NY1A 5D37A 3K4DA 3BTNA 4EVZA 1FWGC 2HPMA 4L6DA 5HNUA 3IACA 2L5HA 3REQB 1P5BA 3T78A 2PLKA 3WDIA 4M29A 3GHRA 1YE6A 1DJNA 3E9AA 3B05A 5A8MA 2PWUA 2I17A 4LAZA 3CAVA 1KNWA 2C13A 1A5CA 1JCLA 4JTCA 2V5JA 4XK2A 1MQQA 1WKEA 4KCUA 1C9WA 2ASHA 1M6JA 4GJIA 5XIAA 3F7JA 4J3VA 1VBRA 4AIBA 1JDEA 3O06A 3W71A 1TJ0A 3UZJA 1ZCCA 4K2SA 5ABGA 2W62A 4Q4SA 5J5RA 3S2MA 2NQ5A 1TWDA 2H90A 3SADA 4H9UA 4GPNA 5KSWA 1EC9A 5LNVA 3LU2A 5GJMA 2RDTA 1XLJA 2Z1WA 3V0UA 2YXOA 2I5GA 2G3IA 2VGGA 2V2HA 1MXDA 1G6CA 3Q37A 1XQLA 1FWDC 4M51A 2KAUC 4D6IA 2DT2A 2XFRA 4B91A 4EK7A 3AHYA 3LX9A 2DIJA 4F2BA 1DVJA 3E2RA 3VKKA 2OYMA 5CC3A 3GVVA 6REQA 1JCNA 3ZT5A 1HKVA 4JQ3A 2ZWYA 3WQPA 2Q02A 1U5HA 2J27A 1Y65A 3Q4DA 2G5WA 3BW2A 5ABHA 3T08A 3KL3A 4QR6A 3NQDA 3TCEA 3WDPP 1JD7A 3QKEA 3LSBA 1SW7A 1DIEA 3I3EA 3FYPA 3TUUA 4LS1A 2D23A 3R89A 1VHNA 4O0QA 3M0VA 4V27A 3TLQA 2W66A 1FH9A 2DVXA 4PC8A 1KM3A 1M01A 4EANA 1ZCOA 4GBUA 1J0ZA 4F8XA 3G8EA 1UKSA 2OZ3A 1QI3A 5XIMA 2QVNA 3IUIA 2WZEA 4PH6A 3UT0A 4B3KA 3G1AA 2YGYA 5I24A 4XUYA 3AZRA 4UTMA 3G2GA 3TK7A 2RJGA 2QPXA 5AC5A 3EOLA 4HVXA 2XWDA 2Y5EA 1E6QM 1U2YA 2R1PA 1P6BA 2Y2WA 4CCDA 1IXOA 3BURA 1BVNP 4S1FA 3VIKA 4MFDA 3R7MA 3CEUA 1QWGA 1TR9A 1BRLA 5LNRA 2HE8A 1LUCB 3I6RA 1SJAA 1X96A 1V0KA 4A3QA 2F6KA 1E4IA 4AYSA 1YXDA 4U33A 5I3JA 3MHGA 1AH4A 1VFOA 4UXDA 2J7GA 2PRMA 3CGTA 1V5XA 3UWVA 3AROA 1FWWA 1DJGA 4IMGA 3GHUA 1ZPTA 3WLJA 3RK8A 4XSLA 5F4SA 4WQ6A 4NHVA 2BBFA 4IPLA 2DPEA 2HBXA 2BVWA 2PWEA 5D9MA 5G2HA 4ZB2A 1TE6A 3LN3A 1OQFA 1EXPA 2EJAA 2FB2A 2BOFX 1OG6A 5FF4A 1FH8A 5SWUA 1ZBVA 1VEMA 3W25A 4LBSA 5BRPA 1KB3A 3IUDA 4BI7A 4ZFCA 2ABBA 3STGA 3TC3A 3AU2A 3K13A 4WDWA 3Q67A 3V16A 4JQ4A 4UR7A 5A1AA 4DNMA 2F38A 5EB8A 4WJ8A 1MEIA 5CCZA 2E5BA 1W1YA 1VHCA 3DBPA 3EPMA 1VQTA 2ZA3A 3GLCA 2PGWA 1AG1O 1Q65A 1OBAA 4N9BA 2ZRUA 3EMQA 3M5VA 4OZOA 1W2VA 5D2VA 5E0KA 2XG9A 4MUZA 3EX1A 4DZ5A 4O1AA 1R3TA 3NFUA 5BW6A 1I2PA 1W9UA 3VDBA 1SJCA 3T7VA 2XGIA 3BMXA 1NF0A 3DESA 3FX4A 1JD9A 3VIFA 4HB7A 3WJYA 3BSGA 4RV8A 2OZTA 1UA7A 4L1WA 2YR1A 1ZZMA 4RPQA 3EOUA 3VX0A 2PDIA 2YLLA 4XBJA 5TNVA 2QIIA 5IFTA 2E1DA 3H12A 3VDHA 3IAQA 3EX3A 1E73M 3GVWA 2JALA 1XLLA 4LUIA 4I8DA 2ZZ5A 5D33A 4NIRA 1LWIA 1Z48A 2ADAA 1SZFA 1F9CA 2MNRA 4FSAA 4L5ZA 1O5RA 1A3WA 3L5LA 1EP3A 2CCRA 3W76A 3I3DA 4U5KA 2YYUA 2WVTA 3TP4A 4L4LA 5A3HA 4ACZB 4B92A 2YCEA 4C1NA 3VNZA 4AW7A 1NJJA 4XTDA 5HWJA 5AB3A 4AX7A 1FP8A 4UMBA 1NDWA 1S2WA 3BMVA 3RG6A 2HXUA 4DZAA 3NSXA 3H21A 3H2FA 4FX6M 3URAA 2ZX5A 4P61A 1MSSA 1K03A 4YYFA 4F79A 5REQB 3FAWA 2PDMA 4R33A 4XBSA 3TIMA 2VGBA 2QVHA 1NTHA 1B4KA 3A13A 4DJFD 1HJQA 3GVRA 3CK5A 3ZLGA 1PHQA 4ATWA 5IXEA 4D1IA 3KOYA 3C5QA 4KRZA 4J27A 4EXBA 3KCLA 3OIHA 1AQ0A 1VGAA 3RX3A 1CB2A 5C7HA 3RMJA 4NZJA 3UJEA 1F8MA 3NL2A 3PSWA 1FCQA 4DVOA 3PG8A 3VGGA 4PUJA 3WLHA 4UTFA 2OKOA 2XH0A 1QASA 1T7LA 2JIWA 2VM8A 3MBFA 3N6HA 4DUOA 3N6JA 2NX9A 2X1SA 2DSWA 4HCHA 2QDHA 2OEMA 4FNUA 1GZGA 6PTDA 5LZLA 1UUOA 4MPQA 1IWBA 4QJ3B 5AYIA 4AVOA 1AQHA 3ES8A 4NAFB 3WBAA 4CQBA 4WDUA 2XH2A 4UTLA 1XG4A 2BY1A 4E8CA 2I9EA 1U83A 2CZEA 4HTYA 2ZZ6A 1ZTVA 2WSRA 4ZTYA 5HQEA 3MKVA 4S39A 4B5WA 2X7VA 3B9NA 4Q6XA 4W88A 1CX9A 3VUPA 4C90A 3SJ3A 3OQEA 4S3EA 4KKXA 4PFMA 3EWWA 1FWEC 1HKMA 7TAAA 3L21A 3E38A 1A50A 3M5YA 5CSUA 3SQMA 1J79A 1TWZA 4QAWA 4GE8A 4RUBA 2GUUA 4I5RA 1BTCA 3LENA 4DJDC 3BW3A 4J3WA 1V3MA 2Z6JA 3JS3A 1YE4A 2GWGA 4GUJA 1EDQA 4PRTA 3SN1A 2ZXAA 4IT1A 1UBPC 1BXBA 4LUSB 3TJXA 3V0TA 2OSXA 1ECQA 3SJNA 1E3XA 4PUKA 5AFDA 3QGKC 1S39A 3W29A 3NXLA 3L2LA 2J7CA 5CBIA 1XC4A 5LHEA 4HN4A 2OB3A 1HKKA 1BYAA 4UTUA 2ZRXA 3UETA 3R1ZA 5KMYA 5LIXX 2ZRVA 3LNMA 4TU1A 3CL8A 1HZYA 1ZUAX 3UJRA 3WQGA 2XUCA 2W63A 4IUOA 5EMKA 3F5JA 5G1MA 2AMGA 3C6CA 5CSSA 3M07A 4KFOA 4FLOA 1G7UA 4PCNA 1BYCA 4D2JA 2X30A 2Z27A 1DOSA 2QPSA 2J78A 5BNKA 3QPZA 3N1AA 1QOPA 4HNUA 4QSHA 3BAJA 3GXTA 4AY8A 3CUHA 1RPKA 3K46A 3T2OA 2NXGA 1C9DA 1DJWA 5HNTA 5AVNA 4NT0A 1XF0A 3DKLA 2HTMA 3LHZA 1UWUA 3WQOA 1R3RA 4QS5A 4N6EA 2OZ8A 2A2IA 1KGXA 5GVJA 1XICA 4GZIA 3UP8A 3WH8A 1T40A 8CGTA 4DLMA 3L4UA 5FSEC 1UWIA 1EPVA 3ANYA 3NOEA 4CD6A 4E2VA 1X38A 3AUJA 2WVSA 3M7SA 4MDOA 2OT1A 4ZSUA 1GPFA 4ENLA 4AZGA 3TJLA 3RLGA 1QOQA 3U2ZA 2O4QA 1K70A 4Z17A 3EAUA 1QW9A 3SM0A 4TX9A 3S9IA 1UR1A 3CLMA 3WL1A 3LXCA 4MVAA 5K3VA 3E02A 3T0TA 4RW3A 3AS2A 1PZ3A 4LOCA 4YLWA 4RW5A 4LVGA 4BHYA 4K37A 3EWUA 3IV8A 4LRSA 1VFUA 4DI9A 2WQDA 3ZSTA 4WF7A 2E28A 4P8VA 1W3KA 5C9RA 2VMFA 1CWYA 1GOKA 4W9TA 3B8WA 3EX2A 2VL4A 4UOZA 1KM0A 1TQXA 1XH0A 1CGWA 4O16A 4F9JA 3HB9A 1WAWA 2WO5A 1GORA 3OO2A 2J77A 3B97A 3STPA 1J93A 3CHCA 3MMDA 4NYYA 1OFRA 1A4LA 1OCQA 2Z7GA 1YIXA 1FWBC 1W1B1 3IJ6A 1VPQA 4O52A 4E8DA 1K9DA 3YPIA 4KWUA 3SSZA 3STCA 2HWGA 1GQNA 1JXKA 3T8LA 1HGWA 1KFKA 3SFKA 2HVOA 2NSXA 4CQDA 4G1NA 3MO7A 2V82A 3VCNA 2X0HA 3IGHX 4LWWA 4HZMA 1DEDA 3QY8A 1R7OA 2BWGA 3MHFA 1TZ9A 3SZ8A 3BLDA 4TUFA 2DZVA 3K8MA 4D8ZA 2GGIA 2WNNA 1IEQA 3QLLA 3H54A 4ERGA 3EGJA 1R9YA 4JIEA 3CYJA 1ZQ5A 5HINA 3TC6A 1JG9A 1IGWA 1TRDA 3BGAA 3ZT7A 5A6AA 4LRTA 2A6NA 3UG3A 2J7DA 4EP8C 3GG1A 1P6CA 1PJ9A 5D04C 2F2KA 4AWSA 3NYZA 5D4YA 3ARYA 3R12A 1OM0A 4HNLA 4JHZA 2Z2AA 3VKAA 3W1QA 2NZLA 2X09A 4AZ6A 4NJIA 1T6MA 1XBVA 1YNPA 1IGSA 3V1HA 4P8WA 3N04A 2FLIA 1W6TA 4NZ4A 3F2CA 1MEHA 3N13A 4MZYA 2PF8A 3WNKA 4AH7A 4Z1AA 2HJPA 3RNDA 4R7WA 2GSHA 3S1UA 4GYKA 3VNDA 5FEWA 4IOTA 1EDTA 1D3CA 2E68A 4IQEA 4GNKB 3HMCA 4AMCA 4MOZA 4G1KA 3CQIA 4WGHA 3N2CA 4MF4A 2ODOA 3STFA 2H8ZA 2YW3A 2V38A 2VEIA 4XKMA 2BDQA 4Q4MA 5CLWA 1XIMA 1YDOA 3EEZA 4ASTA 1GVIA 1MQRA 2YCLA 2VVNA 3WH7A 1OK4A 1SFLA 1RR2A 1ZP3A 3PTQA 3ZWSA 2F2HA 3RCYA 3H23A 3WH5A 3IVUA 3KS5A 7ENLA 2G3JA 4CN4A 3PG9A 1IIGA 4K38A 4U28A 3M0MA 5KZ6A 1E6ZA 1K3UA 1OEPA 2ATMA 2BS9A 4FR6A 2VHLA 2CPUA 5FKYA 3ARWA 3QMRA 2RDUA 1TELA 1JZ3A 3B4UA 1WDDA 1ZJAA 3DFPA 2FDSA 4F40A 1EO5A 1GKQA 1ZB5A 2G37A 4NF7A 1OJXA 2C19A 3QV7A 1OT1A 3FJNA 3OPSA 3L5AA 2ZTJA 3TVAA 3GIQA 5I77A 2QCDB 1KWKA 1PKMA 2CKSA 1GVSA 4DLFA 2VDHA 1JCMP 3OQ8A 2WKLA 1SU5A 3DG6A 4C6DA 3WQ6A 3RLHA 3WLNA 3NM1A 5AHIA 1MYRA 5HQLA 4QLLA 2QW5A 1JR1A 2Y7GA 2IXVA 4ROQA 2Z2BA 3IEBA 3IK4A 3M6YA 3HJZA 2VFEA 3GS6A 4JKLA 3I6EA 1ZRQA 3CV2A 2E67A 3AS1A 5DT5A 3FLUA 3N9SA 1H7OA 3O9NA 4BEQA 4XZNX 3S6DA 4R7OA 4IJRA 1EX5A 2J24A 4CQ9A 1A4MA 4GGBA 4MNKA 3W7JA 1TREA 4CUCA 4MM1A 1A5KC 1XFCA 4AZ5A 1YBQB 3WUBA 1Z6KA 2AQOA 3SR7A 3W22A 4QE1A 2QCLA 4IFOA 2UV8G 2XFYA 1RA5A 3DAQA 3NDZA 4LAKA 2NQLA 1XDJA 3CH0A 5DX7A 5M03A 4KFNA 2GQAA 4JBRA 4AZCB 3LPPA 2CESA 3FN9A 3EPNA 5H8MA 1M5WA 3NDYA 3S1GA 4JQAA 3SI9A 4GI4A 1UOKA 5IHSA 4PTDA 2P3ZA 6A3HA 1W8GA 1QNPA 3VCCA 1RHCA 4M6VA 3C8FA 5C0QA 1EC8A 1C7SA 3A9BA 3GDKA 2XSXA 1H7NA 4Y8FA 2X8RA 4Q8TA 4HNCA 5D2WA 1YX1A 1KCKA 4O17A 5C9WA 2YCKX 1K9FA 3SRDA 3DI0A 2XJ7A 4M1RA 3PZOA 1W5MA 4CNNA 2EG8A 1ZFJA 5F4WA 3D3AA 3NM3A 5A2BA 3UR7A 5AHNA 3UNDA 4D6JA 1PIIA 1BWLA 4Z1DA 1AJZA 2QGYA 2J13A 4A3RA 1KTNA 2NVDA 3B03A 4L61A 3L4WA 4UUIA 3PANA 4D9PA 3CL6A 5GJNA 3CMFA 4UTIA 1VLWA 1U22A 3E49A 1RZMA 2O9OA 4Y6GA 3BXWA 1TV3A 9CGTA 7CGTA 3THDA 1EJWC 3SURA 4J3SA 3HN3A 3LSCA 1V3IA 4IJBA 5PTDA 1FWJC 3VU2A 3PBMA 4AC1X 3T0DA 1L0PA 4WK9A 4LAMA 3LY0A 1ME9A 1J0HA 1H60A 5CC7A 1G4EA 3L4XA 4O28A 3V1PA 3W84A 1PTDA 2XIOA 5TAOA 1RQHA 4LBRA 2IW0A 3QOKA 5EY5A 2DIEA 3MWCA 1P0DA 1A80A 1G67A 2FIQA 3C2YA 4CEXC 1JL8A 1UCWA 4YYCA 2V81A 1CBGA 1WV2A 2UZ9A 1R87A 1ZHAA 1VPXA 1TA3A 4KETA 3O0KA 2VI0A 3WKZA 4WSJA 4FNSA 5CZTA 2PMQA 3WK2A 1NFPA 3IK2A 2VGIA 5TBOA 1EZ2A 3QZEA 2Y8KA 3UZZA 2WC3A 3MBDA 2E25A 1SO5A 3TTSA 4UR9A 3C2EA 1YKWA 2EKGA 3RM9A 4EX4A 1LRTA 3GY1A 1ITXA 1UC4A 1MZRA 3NXFA 3CAKA 1JVNA 2FPVA 4PCSA 4GKLA 4DUXA 1TA3B 1K8YA 1IWAA 5LIUX 2C14A 3MI3A 3PTMA 4ZQPA 2X40A 3LOTA 1KFBA 1UH4A 1EGZA 3TU9A 1WXYA 1VBJA 3KP1A 4NAEA 4GXPA 3R5EA 3W6YA 2BB0A 3LCGA 2E6AA 1ODZA 1XDMA 2EHHA 2B7PA 2H9AA 5G2IA 6XIMA 5BRBA 2G50A 3VNMA 1ISXA 3BO9A 1T41A 1TMQA 1QI4A 2E9MA 3A24A 4F0MA 4MB1A 2QCCA 4GQQA 5A69A 4NAFA 3VZXA 2OX1A 1LYXA 1OGBA 2GUYA 3WIJA 3N4FA 4US6A 2CZFA 1UHVA 4XAPA 3R10A 4HIBA 3USBA 4L9XA 1IYXA 3AIUA 2NV1A 2VC6A 3UGRA 3XINA 2DEPA 1A3HA 3WD1A 1QNSA 1FX6A 4Z42C 1S2AA 3JU2A 3OA3A 3W00A 2CBIA 3GW0A 4Q7NA 3ZJKA 7ODCA 3RF9A 4D6GA 1HL8A 2NV2A 1UR9A 3PFRA 4KF1A 4M80A 5CPSA 2WHJA 2PRHA 2Y5JA 1JAKA 3UXDA 4WRHA 2OO6A 3DC0A 3OHIA 4PR4A 1QHZ