1LQAA

Tas protein from escherichia coli in complex with nadph
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
346
structure length
346
Chain Sequence
b'MQYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHGLDPAQMALAFVRRQPFVASTLLGATTMDQLKTNIESLHLELSEDVLAEIEAVHQVYTYPAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tas protein
publication title Crystal structure of the Escherichia coli Tas protein, an NADP(H)-dependent aldo-keto reductase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 125
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1lqaA00
5M2FX 3LD5A 2PDYA 4XO6A 3CAVA 1EL3A 1T41A 3UGRA 2PDGA 2FVLA 4FAMA 2ACUA 2PDWA 4XVEA 3EB3A 4ICCX 2PDIA 1QRQA 2PF8A 3V35A 4GCAA 2PDCA 5C7HA 1PYFA 4LB3A 3CMFA 3M64A 1XF0A 1EKOA 3BUVA 4QX4A 1ZGDA 3N6QA 3R94A 4GACA 1RY0A 4JQAA 3P2VA 2NVCA 4GQGA 4RPQA 3M0IA 2IQ0A 3MC5A 2P5NA 3GHTA 1EXBA 2C91A 2PDBA 3O0KA 2PD9A 2FZ8A 3R8GA 2INZA 5JH1A 1S1RA 4XZNX 1YE6A 3NTYA 3BURA 4EXBA 1M9HA 4NKCA 4WDUA 4WEVX 1ZSXA 3QKZA 2HDJA 1X97A 4R9OA 5KETA 3H7UA 1X96A 4GABA 3MB9A 3V0UA 1IEIA 1PWMA 4Q7BA 4HMNA 2HVOA 4PMJA 3LZ3A 4YVPA 3EB4A 2PFHA 1EF3A 3CV6A 2HE8A 3F7JA 2F38A 4XZIA 2ALRA 3FJNA 3WBYA 2HEJA 3VXGA 4H7CA 2IS7A 3LQGA 4QR6A 2PDFA 3G1RA 3M4HA 4LB4A 1PWLA 4IGSA 1S1PA 5AZ1A 2IKJA 4JIHA 2BP1A 3GUGA 5HA7A 3LEPA 2PDLA 4QXIA 4MHBA 4OTKA 1RALA 1ZQ5A 1FRBA 4XZLX 4JTCA 4WDTA 1MI3A 4EXAA 3B3DA 2R24A 2CLPA 4ASTA 3CAQA 1Q5MA 4WDWA 1HW6A 4LAZA 3BCJA 2IPGA 2ISFA 1LQAA 2PZNA 4PRRA 1Z89A 5HNTA 3LBOA 1AH3A 3LENA 1PZ1A 2PDHA 4L1WA 3S3GA 3GHSA 2PDQA 4YVVA 4LBRA 2IKHA 2WZMA 4JQ4A 4JQ2A 3O3RA 5JH2A 1AZ2A 3Q65A 3R43A 3UZXA 2FZBA 4LBSA 2J8TA 2DUXA 4JQ1A 2IKIA 2PDMA 1VBJA 1Z9AA 2ACRA 1SM9A 1MZRA 1Z8AA 4QBXA 3RX4A 2FGBA 4JIRA 3H7RA 2FZDA 4YS1A 2PDPA 3R8HA 2AGTA 2QXWA 3UYIA 1Q13A 5LIUX 4JTDA 1PZ0A 1LWIA 2F2KA 3GHUA 2WZTA 4HBKA 2IPWA 2IPJA 5LIKX 1R38A 3LNMA 1K8CA 2DUZA 2IPFA 3R6IA 4WRHA 4FALA 1AH0A 2BGSA 4GA8A 1Z3NA 3ONBA 3G5EA 3WCZA 2I16A 3Q67A 2INEA 1ADSA 2PD5A 1A80A 3UG8A 4DZ5A 1S2CA 1AH4A 2ACSA 2PDJA 3V0SA 1AFSA 4JTRA 4I5XA 3CV7A 1QWKA 1US0A 4PUWA 4JQ3A 4PRTA 3DOPA 4DBSA 3UWEA 4H8NA 2FZ9A 4DBUA 3U2CA 4FZIA 1IHIA 1XGDA 3WBXA 3H4GA 3BV7A 3WG6A 4Q3MA 3UZYA 3UP8A 2IKGA 4XVDA 4GQ0A 4YVXA 3EAUA 1JEZA 4PR4A 3LZ5A 5AZ0A 3R7MA 1YE4A 2ACQA 2I17A 4WGHA 1VP5A 3FX4A 2BGQA 2PEVA 1T40A 2A79A 1HQTA 1X98A 3LQLA 4WDXA 4XZHA 4DBWA 4ZFCA 3UZZA 4XO7A 3UFYA 4JIIX 4LAUA 1AZ1A 1MRQA 3GHRA 5DANA 2PDUA 3KRBA 3WBWA 1OG6A 1ZUAX 1UR3M 3RX3A 4AUBA 3UZWA 3ERPA 1S2AA 2NVDA 3D3FA 5HNUA 2R9RA 4PUUA 4IJCA 1XJBA 5LIYX 5LIWX 3LN3A 3ONCA 2HE5A 4F40A 1J96A 3CASA 2PDKA 2PDXA 2VDGA 4YU1A 4XK2A 3RX2A 3C3UA 4G5DA 1C9WA 4GIEA 4L1XA 1RY8A 3R58A 3V0TA 4JTQA 1GVEA 5LIXX 4IJRA 2HV5A 3LUTA 3N2TA 2PDNA 1YNQA 4JTAA 4XAPA 3DN5A 2HVNA 2DV0A 1YNPA 2IQDA 3T42A 4FA3A 3V36A 3COTA 4XZMX
chains in the Genus database with same CATH superfamily
4M5PA 4UTIA 3ABSA 3JW7A 1K7EA 4X2RA 1BLIA 1T41A 3R11A 4NX0A 5T8GA 3B9OA 5DT5A 4HNUA 1VEMA 3L2LA 4D6EA 1ZJIA 1FWBC 1SZNA 1PO9A 4DNHA 1HKIA 4G1NA 4N6EA 1A5BA 4RDYA 1K7XA 4CNNA 1QRQA 4RNFA 5C7HA 4PODA 1CXLA 1E55A 5D2WA 1OSEA 5A2CA 2YYTA 2AAMA 3N6QA 1RY0A 4JQAA 4UR8A 4TVUA 4LCSA 3VABA 2P5NA 5D03A 2YR1A 1EOMA 4UC5A 4OBTA 4YYFA 4ZQRA 1DXFA 3G24A 1BYDA 2XWEA 1RLCL 1ODZA 5F4SA 3CH9A 1MNSA 4LC8A 4NKCA 2WWCA 4ALDA 5ABGA 1A49A 2ZX7A 4NNCA 1XLKA 3LCWA 5JIPA 2PGWA 4HZ8A 4IMEA 3FSTA 3TA9A 3GFZA 2HVOA 4LGXA 4TR9A 4J3WA 2BY2A 4XUYA 3NPWA 2DP3A 4IGNA 3GDLA 4NX5A 3CV6A 1XLAA 3MO4A 3V1PA 4Z2IA 1M3UA 4DXVA 4DYJA 3WIJA 2ZX9A 4H00A 3L5AA 1OFOA 4FLSA 3A3HA 1BAGA 2IS7A 4WOQA 1KXTA 4DO7A 3NQ6A 3T8QA 1TVPA 1W5QA 5HWMA 2V5DA 5AZ1A 2GDQA 2P0IA 2QUVA 1B31A 1P4CA 5CKSA 2E5BA 3OTRA 4JIEA 3VKDA 3WQDA 2IUZA 1W3JA 3TWBA 4MHBA 3G0XA 1J4EA 1CLVA 4R3UA 4MB3A 3WQOA 4OT7A 2R8WA 4GISA 4ASTA 3EWUA 1AJ2A 2W79A 2VT0A 3A21A 2QS8A 1SFLA 1RQHA 2VP8A 1D7FA 2AQVA 1SJBA 3VZYA 3K2GA 1IEQA 4CN1A 1QNOA 2V81A 4O15A 3WDPP 1JCNA 8RUCA 3BGJA 2Z2AA 4XD5A 1GKPA 2V69A 1KM4A 1K6WA 4YXGA 1TPH1 3PPCA 4PMUA 2NX1A 5KZ6A 1FUYA 2WZMA 2CXEA 1PKYA 4G9PA 1YX1A 1OC7A 3P6LA 3U2ZA 3IK4A 2CZEA 3WJZA 4UTFA 1XFBA 3FS2A 3PZGA 1W5PA 1YYAA 2YDRA 1ZBCA 5LA2A 3RX4A 5C6MA 1UC5A 3GIQA 1SR9A 1G4TA 3RJYA 1W37A 2PTYA 4LW7A 4U3CA 4WY0B 2ZUNA 3BH4A 4FI4A 4EXQA 2O9RA 3N4FA 2QXWA 4UFLA 2XVGA 2XFWA 4U33A 1EUAA 5A2BA 1EIBA 1Z69A 3NQMA 1V0MA 5AKQA 1R38A 5BRQA 1Q7MA 1WNOA 4X61A 3T05A 1F7BA 1GYLA 3DYMA 3Q67A 4HA1A 3KZPA 5IM51 4EPBC 2D23A 3JS3A 4C65A 3ITXA 1G01A 1TV2A 3PVFA 1NWUA 1ZCCA 1E72M 2XVNA 4FX8A 3ZSSA 4N9EA 3MP5A 2YPIA 2O92A 3T9PA 4NZJA 2XSAA 2V68A 1AMKA 2J27A 3IPWA 4FLOA 2CESA 5TF0A 2XGBA 3KLKA 4JKMA 4B2DA 2HPIA 2GGJA 4YL2A 3L65A 4S3BA 2DIKA 1UR2A 1XWYA 3TH6A 1IT0A 4A4AA 1Y7VA 2WZHA 1UR8A 4L6OA 1ZAHA 3MPGA 4NU7A 4Q8TA 4ZXOA 1VF8A 2P1FA 5LKYA 3P8IA 3W2UA 2Q6ZA 2PP0A 1FDYA 3EAUA 5H1WA 2D22A 1ME9A 4AAJA 2WJFA 5CGTA 4W85A 2OO6A 4F66A 4JIQA 3NQAA 5J5RA 3W83A 3PPFA 4XZHA 3LDVA 4AZHA 3QR3A 4R9XA 4HNOA 4D1IA 1V03A 3UJRA 3N2XA 3WBWA 1MQRA 3TA6A 3PPGA 3TOYA 1A50A 2Y7FA 2ESCA 3RLHA 1AMYA 3UZWA 5AYBA 1MMFA 1S2AA 1PTDA 4LVGA 3D3AA 1EYWA 3EMQA 1ONWA 1Q4WA 4LNCA 2YCIX 1K4HA 3SCWA 3ONCA 4IMAA 1JPHA 3CASA 1VCFA 1T0OA 4PUEA 1W3TA 1LJYA 1JZ5A 1B3VA 2VQTA 1DE6A 4H9ZA 4C6CA 3BXWA 3E0FA 4XK2A 2A21A 4X9SA 3IV3A 5HQMA 2ZZ5A 2QGYA 5FEZA 4UTHA 2X8RA 1XUZA 4CCZA 3MKKA 4LAMA 4JTQA 1GVEA 4V33A 3GM8A 1WDQA 5HJYA 4O1CA 1WYIA 1Z42A 1EQCA 2G4FA 4PTVA 5KMYA 3UZ5A 2MNRA 5FF0A 2QUNA 1HP4A 3WEZA 1XC6A 2IQDA 3VIIA 1ZZMA 1GW9A 5DFAA 4DJEC 1BSIA 4D1JA 4JY8A 1U22A 2XGIA 4RV3A 3LSBA 5CZ0A 5CJ5A 3AYSA 2EF9A 2ISDA 3NGFA 1BEUA 5I79A 4R5EA 2C14A 2YXGA 1HFBA 1UH4A 1K8ZA 2PDGA 1BWKA 3A23A 2E6AA 3B0PA 4HZMA 3IEBA 3N9KA 1KM1A 2WSPA 2ASHA 4L65A 3N19B 1W1A1 1GEHA 5HMEA 4IGMA 2PF8A 3UR8A 4D9PA 5A2AA 1R2RA 3THAA 3TQPA 1EDQA 2WPBA 3F4NA 2ZRVA 3M64A 3SCPA 1U5VA 3CYVA 2V5LA 1XLLA 4OBRA 1BGAA 2ZDRA 4ZB2A 2QPSA 2X1UA 1GVOA 2NW0A 2CU0A 4IQEA 3W38A 1DPMA 4DZAA 1VBUA 3W29A 2AAAA 4XISA 1YKWA 3G1XA 4GIAA 3IIVA 3G2GA 3LXBA 4JDYA 4B90A 3BMXA 5I02A 4J3ZA 1H0GA 4CU6A 2RGLA 3BMVA 3E74A 2PRMA 2EPLX 3CWHA 3MUCA 2PA6A 5ABTA 1CYGA 2YB1A 1QI3A 2A85A 4IP7A 1E56A 3DAQA 3KZSA 3MKVA 5HNNA 1EF2A 1SGJA 2J9XA 6TAAA 1UWTA 3WF1A 4HZ7A 1J2WA 4IMFA 3BDKA 1UA7A 3MBDA 1TV7A 1LF1A 4KETA 4WXZA 5MHBA 4HK6A 3LHYA 3RF9A 1I0DA 5FSDC 1XHGA 2NV1A 3CT7A 4CVWA 1UD3A 3VD3A 3CZGA 5FL0A 5GJPA 1S3HA 3MDWA 3C0JA 3O16A 4EPKA 1XIFA 2QCFA 1PCKA 1HKMA 4RDWA 4UWMA 4FNTA 3QYQA 1CB7B 4NSBA 4A21A 3QC3A 1X6UA 1VRXA 1QK2A 1IEVA 4C1NB 3M5VA 2WJZA 1FWIC 5I24A 3ZVIA 4XZBA 1UH2A 4B5XA 1TELA 3UYCA 4AD3A 2AQWA 2DFAA 1X8CA 3CZKA 4GK8A 1MXDA 2WMJA 4W7WA 5REQA 2GGIA 3T6CA 3P93A 4H6EA 4JQ4A 1O5QA 3TC7A 3BLFA 2VX7A 3KTCA 3M0ZA 1UP3A 2FZBA 4C7FA 2OZ8A 2IXUA 4WJ8A 1GCYA 2J8GA 4UCGA 3EKLA 2GK1A 5HNRA 4NVTA 3WELA 1PB0A 3UESA 4JTEA 4XV0A 4TVDA 4TQTA 3H4XA 4GKTA 1IIGA 2Q8ZA 4MNMA 3HIJA 1THFD 3IVSA 2X2YA 7TAAA 4C6QA 3UYIA 4TIMA 4S2BA 2UY4A 3C2RA 3KP1A 5LIUX 3WO8A 2W67A 3GG8A 1C3FA 3QSRA 3DG3A 4A2RA 4EACA 2YSWA 4H9UA 1K8CA 2ZRXA 4UOZA 5DX7A 2O0TA 3CK5A 1RP8A 3PUDA 5FF3A 3K4AA 4U2YA 3DG7A 5CAKA 1AH0A 4O4WA 1Z3NA 3QV7A 1WDWA 3UZJA 4ZOEA 3K8MA 4PUKA 5AY7A 2BHYA 3NJ3A 1X6LA 3A12A 1ZY9A 4XUGA 4QG8A 1IEXA 1O12A 4IQDA 1J5TA 4PRWA 4JPGA 3F2BA 2XSBA 1HKJA 3RFAA 1JPKA 5A6AA 3EOSA 3UG3A 1W3LA 4I5XA 3S5SA 2PC4A 2OLSA 4G56A 4BI6A 1QWKA 4NZ3A 1US0A 2DZSA 1FH9A 4JQ3A 5H8UA 3HJEA 4GI9A 2ZCGA 2L5HA 3T0AA 3TJ4A 1XIDA 4D72A 4I9AA 1UR0A 4MJZA 1B57A 2FZ9A 4DBUA 3F2DA 5REQB 2YGYA 3EX2A 1TMLA 3WBXA 5C0QA 3GYCA 3SUWA 5M3WA 2ZDSA 3UZYA 5C2CA 1EZWA 4XVDA 3VOFA 3VNJA 3BSHA 4K8GA 2NWSA 3W70A 2GK1B 3UVIA 3I6EA 1O6IA 3OLIA 3KCOA 2GVJA 1HQTA 3GDRA 3LQLA 1KXHA 3ORWA 3TW9A 2VD9A 3AWOA 3AMGA 2B7OA 4LAOA 2FJKA 2FFCA 3STPA 1UA3A 2C18A 1A5OC 2Y7DA 3GU1A 2G3JA 1E43A 4NJJA 3ARRA 1XDMA 3SCRA 3KHJA 3C2EA 2R91A 4KFPA 4D6FA 3RR1A 4GH1A 4C60A 3A4AA 2DPEA 1L0PA 1AL7A 4HQVA 1J96A 1S2VA 3P81A 2WSKA 1F61A 3MP4A 3NSXA 4E6MA 3RLGA 3ZFHA 4JNMA 2BX7A 2J77A 5HUOA 3EXRA 3VM7A 3FJLA 5BWFA 4B3ZA 4GGBA 4QS5A 2V3FA 4AVFA 3WBAA 2J7CA 2CERA 2VTFA 2WWDA 4H83A 4QITA 2ZA2A 1XDLA 5LNWA 1TKKA 2X0YA 2J7DA 1O1HA 3LTPA 4A3QA 3TTOA 3ATZA 2W91A 2YDQA 1YNPA 4E8CA 4LVDA 2W63A 2CKSA 1WB0A 4AIEA 1JULA 3G1YA 3UJFA 5BRPA 2J7GA 1B1YA 1QVBA 3IGHX 1EPXA 3W6LA 3GNDA 1EDGA 3B0YA 1VJIA 5HXMA 3W7OA 3DECA 3TYEA 3WKZA 1K3UA 2PUZA 3VX0A 4B92A 3BW4A 4E5TA 2BDQA 1M5WA 1JF6A 4IISA 4HKPA 3M0MA 1RJRA 4JDBA 4PN2A 1FCUA 1JF5A 1NEYA 4QQUA 3S1XA 4ZSTA 5AHNA 3A5VA 4GMEA 4UFHA 1XBVA 4HNLA 1WDSA 1AUSL 3NIYA 4PTMA 2J62A 2VOTA 3KOXA 3M16A 2P8BA 2VDHA 1JL8A 3MYOA 1T8QA 1FKWA 1C8QA 1XBZA 3UWUA 3DGRA 2Z26A 3ANYA 4GIRA 1PL9A 3NQ8A 2NVCA 4HHLA 3U4FA 4Q8PA 4B4HA 2G3FA 3ZJKA 4TVCA 2OOGA 2C91A 4W4QA 4ENLA 2HNHA 2PD9A 1TZZA 3O2LA 1F8MA 3GIYA 1S1RA 3EXTA 4HPGA 1QNQA 1M9HA 5CSUA 3WUEA 4WEVX 1IT8A 3SCNA 1DJYA 2PGEA 2PRHA 2XFFA 3WUFA 1C29A 4ZOAA 1IEIA 3ZYZA 4P5UA 3XINA 3MZ2A 4M8UA 3MCNA 1EGZA 3DH7A 2EEXA 4YVPA 1IGSA 4B3KA 2PFHA 3WQWA 2HE8A 5IRPA 1P0BA 1W1IE 1TWDA 5GQBA 3PUEA 3RO6A 5DN1A 5A8NA 1MDRA 1EX1A 1BTMA 5CSRA 4PTWA 4D8AA 4PSRA 3KL5A 3MHUA 3N9RA 2F6UA 4OBSA 3P0XA 4H9TA 3REQA 2VURA 3QZEA 5LYRA 1KGUA 3CHEA 3VAVA 1KBBA 1OY0A 2C19A 3DHFA 1W3HA 1VLIA 1Z7AA 1KO0A 1MUCA 2GL5A 4O0ZA 1WZLA 2I5QA 4HNTA 4EXAA 3B3DA 1LWJA 2X1TA 2CLPA 4JNYA 1H63A 4F0RA 2RDTA 5LHEA 3LM7A 3MV01 4YN5A 3KRUA 3UPBA 4LF2A 3TAKA 4OHQA 4YHGA 2ZICA 1KTBA 4RL3A 3IJ6A 5JBFA 3B8VA 3TLLA 2WMIA 3LENA 3TQ0A 1A4LA 4FIRA 1S46A 3TN6A 1XI3A 4LUJA 1XLFA 1IXOA 3LPOA 4GBUA 5KZMA 1G7UA 3R89A 5SWUA 4PL1A 3SGGA 2CZ5A 1XYCA 4AHOA 6XIAA 1PPIA 2EPOA 5DXXA 1TMQA 4MJ2A 1C8XA 1TE6A 2V2HA 4TMBA 2F8QA 3GVQA 4PMRA 3KS6A 3CIWA 1J18A 2DSKA 3SGUA 1TV4A 1OYAA 3H8AA 5C5YA 2FZDA 2XGZA 3CUJA 1C7TA 4R7WA 3W37A 1MYRA 3MWCA 1XYFA 1EH9A 3BW2A 5CG0A 1SYTA 3T44A 4DPQA 5LA0A 1GVFA 4NJHA 1VZWA 4R27A 2NXHA 3LCLA 2PCQA 1EYEA 1LWIA 2WVSA 3AXIA 2WQDA 1OIFA 3REQB 4M51A 5AN7A 1Q6RA 5FJPA 3KAOA 1F4HA 2PBOA 5DEZA 3QR1A 1NELA 4EOUA 3LPPA 1ZP4A 1V3KA 1UWSA 1XLMA 1FFQA 4UMAA 1J93A 4O1AA 4LS2A 4YTSA 2BG5A 5I78A 4DN1A 2CYGA 4E4FA 2QJJA 4YHEA 1I4NA 4FX6M 5F4WA 1NP0A 2QAPA 4OU1A 4FHAA 4AX6A 2YDSA 3NG3A 1JCYA 4A22A 2WMIB 2G8ZA 4GOAA 5I3DA 3BMWA 4JHOA 1JQXA 3VKCA 3ITLA 1RJQA 1W9XA 4IT1A 1HJVA 1K7FA 1XGDA 3H4GA 2EPKX 1QO5A 3I7QA 2ZOXA 1YW1A 1W9VA 4PA8A 3XIMA 3C61A 5RUBA 1JZ8A 4MJMA 1R9XA 4H19A 3CHDA 4UTWC 3SCQA 4W88A 4A6GA 1KKOA 1M53A 2I9EA 1IYXA 4FIQA 5BWAA 1I60A 3AHXA 5BXRA 2WPGA 2J7FA 4XAYA 5IDIA 5DANA 1D3HA 1ZJHA 3KRBA 1PJ9A 3O7UA 4KIRA 2CBUA 5DY2A 1RBOB 3TMQA 2ZZ2A 1G5AA 1LTDA 4PMDA 3RX3A 2VZOA 3TCEA 2BB0A 1DHKA 3DENA 4NI3A 4QAIA 1AQHA 1OFBA 3NXFA 3FIGA 3VTRA 4MAZA 1PDYA 1QATA 2DIEA 4OECA 2WSYA 1TFVA 4AC7C 2QJIA 1Q4NX 4MWAC 4JY9A 4QDWA 4CEXC 3TYCA 1IR2A 4US6A 1AD1A 1XBYA 3UVAA 4F48A 1CEOA 4BF9A 3GB6A 3EA1A 4H6RA 4L9XA 1C9WA 1QO2A 1ZL1A 2CFFA 2BVDA 3RR4A 4UMBA 2GSEA 2WC4A 1MFVA 2PGFA 5DQPA 3ZT5A 2VEFA 1JGMA 3CQ0A 3VDGA 1PVNA 1YNQA 1SW7A 3RLVA 4O1FA 4XAPA 3S0CA 3WJSA 2QDDA 4PMYA 4HU3A 4AWSA 1XKJA 2ABBA 3MP3A 4KRZA 2E28A 1D2KA 4B15A 3WD2A 4CLMA 2DT2A 2J47A 2XUCA 2RUSA 1GPFA 4DWSC 3SUVA 4H8UA 2FQIA 2YCJA 1J6OA 3A5FA 1AA1B 1E40A 4PGLA 3V1HA 2OPJA 3S8HA 4WIWA 1VEOA 1AW2A 4M82A 2FPYA 1E4LA 4ROQA 4IIEA 3W7PA 1T7LA 4CU7A 1G4EA 3OGSA 3LU2A 4CQDA 2VKZG 3D46A 3OBAA 3S9IA 2Y2WA 4WSKA 4K8EA 1W8SA 1NH6A 4J2PA 7CGTA 3W2LA 1KM3A 4WD0A 3EOOA 4BQ4A 1V77A 2FPVA 4HYRA 2Y62A 2O4QA 1KM5A 3LLDA 4WDUA 4KEVA 4XD3A 4QIUA 2J7HA 4UTTC 4WCJA 3WNNA 1RCXB 1Y5XA 3NM1A 4GUIA 2XH2A 3SUSA 2G3NA 1TV3A 3FFSA 5FACA 4KH2A 3NYZA 4RV8A 1JZ7A 2XG9A 1JPIA 1OF8A 1MEIA 2D73A 2X41A 4MDPA 4Y90A 1WX0A 2WCSA 3CZJA 3DC0A 1A47A 1F07A 2OCZA 2QJHA 4A3YA 3FJNA 3ITYA 3L2IA 4DYKA 2ATSA 2HEJA 1OD8A 4GG9A 1F6YA 5A6MA 1YDOA 2PDFA 5K4XA 1MSSA 1EHNA 2REQA 3AIVA 4FF5A 3SIZA 1O66A 1EJUC 2VR2A 2ZTKA 2PLCA 5FEXA 4LVFA 1OCQA 1BWLA 3NQ7A 1Q7QA 2Y24A 3F03K 5CPMA 3IIZA 4BQ3A 4Q4KA 1UKQA 1IV8A 1EX5A 1EJRC 2XZ7A 3CAQA 2ZTJA 2YXOA 3GRIA 3IGSA 3TZFA 3HF3A 2VC9A 2PWDA 2TRSA 3SRDA 4AZCA 3NSMA 1AH3A 3GKAA 3OLEA 2X7WA 1HKKA 2PCEA 3EBVA 3BAXA 1KM6A 4W87A 1EIXA 4Q8WA 4YVVA 1B2YA 2W0UA 1PBGA 2BMBA 1OBAA 3UZXA 1WP6A 3PTKA 5A6JA 1XPGA 2WSQA 3PBUA 2DY3A 4F3HA 2PAJA 4R7JA 4AB4A 3ZS4A 2PDMA 3NQCA 3MMTA 1PS9A 4PMXA 1HGWA 4HYVA 1NVMA 1U33A 1BKSA 1W31A 2X1IA 5DRCA 3G6LA 4YMZA 1DTNA 1GOMA 1WPCA 3W7JA 3AIRA 4GUJA 4O16A 3VFLA 1LM1A 2OGYA 2V2CA 2VEPA 2G4JA 3T2QA 1UPPA 2QJNA 3GHUA 2IPWA 5CPQA 2REQB 4HVXA 2GGHA 2H8XA 4OWGA 5JU6A 2XN1A 3AIWA 3VMPA 2OWWA 4JFSA 4AY7A 3QQ0A 1MUWA 4ICNA 3VKJA 4AWEA 4DZ5A 3LA4A 4M80A 1AH4A 1H7OA 4FXJA 4HNCA 4UTLA 4GJJA 3VYLA 1RCOB 4ML9A 4L6HA 1KXQA 3BAIA 1VFOA 1ICSA 1V6XA 4AZCB 3NQFA 1OC6A 2FB2A 5E6YA 3PG8A 1TWSA 2CW6A 4JTLA 2D24A 3AUJA 1E5NA 4QGCA 1ONXA 3K4WA 3UF9A 4EE9A 1F3TA 1QPQA 1O1ZA 5MF5A 4Q4SA 3WD0A 1B30A 3DESA 3GH4A 3OLGA 2YDAA 4MSSA 2H90A 3UWWA 2JKAA 1DWAM 2F2HA 1GVSA 3CS2A 3EDDA 1UWUA 2A79A 1POKA 4I9JA 3RHGA 1KWGA 4NIRA 3LLFA 5T26A 3SJ3A 1DQXA 1JXJA 2BY0A 2UY5A 1GG0A 3OU8A 4MNKA 3ABXA 2NT1A 3CQIA 2NQ9A 2BXVA 4AHQA 2Z1WA 3NL6A 4C6EA 1VFMA 1CDGA 1ZUAX 4G2DA 1IZJA 3S46A 3NWRA 3LCXA 4RDVA 2DJXA 4HU8A 3IIPA 5FJIA 1XYMA 2PLMA 4IZGA 2ZUSA 3OP2A 1V3IA 1GNXA 4JZ5A 1B9ZA 4M19A 3MVTA 3R5EA 2WZEA 5LZLA 3NVDA 2QF8A 3B8DA 3W2MA 1VBRA 3W07A 3HGRA 1ITCA 5FEPA 5HMFA 3OB8A 1F76A 2VEMA 1DIKA 1FOBA 3DFQA 3K1GA 4V1XA 3SM0A 3FGCA 3TWAA 2GGEA 1UUOA 2QT3A 1I6NA 5FF4A 3FN9A 3QHMA 1UJPA 1QHPA 3W23A 3DBPA 2BGNE 1YMYA 4U5KA 3WK1A 3IGXA 1QUMA 3TX9A 1MW3A 3E2VA 3PWAA 5DT7A 1WXYA 1Y8BA 1Z6KA 3M0VA 3MWAA 5BZAA 3H2EA 3KBVA 3HFYA 4FA3A 3QHOA 4IQLA 1EP3A 3TXVA 1V0KA 1B5TA 2RDUA 1R85A 3SY8A 3PP7A 5HJXA 2QDHA 4EIVA 4DLMA 3IJQA 3ZLHA 3ZVHA 5A8OA 2V2DA 2NSXA 2WBGA 2ZQ0A 3MZNA 5C2XA 5I03A 1DIEA 2YIHA 2V3DA 1VIZA 3ZLGA 2BY3A 5K9XA 4ICCX 5FJUA 2WMFA 3MMWA 3B40A 5E6ZA 1UD2A 3CPUA 1QHZA 4KESA 2ZRZA 2CZVA 1Q6QA 4ZE4A 4I7VA 4IICA 1EKOA 2VJXA 3WLNA 1QW8A 1UWRA 1XH1A 4PEEA 5D37A 4DAIA 5HINA 1V0NA 5EMMA 1TZ7A 1SSDA 5DBTA 1S5TA 3G0SA 2V6AA 4CNTA 3LTSA 4NNAA 1UW9A 2QMKA 3PB2A 2ZVIA 4IG2A 4O11A 5D8WA 5EFFA 4J3UA 3SRFA 1SO5A 2P0OA 4AZBA 3NTYA 3NL2A 3UGVA 4O1DA 1EWEA 1Q6FA 2HDJA 3SO7A 3RITA 4EVZA 5KETA 4FR1A 3O06A 4RE0A 3SCTA 3T4WA 5JXQA 3FGCB 4Q7BA 4DBEA 1J0YA 1QMLA 5I7GA 4RK8A 5D2XA 2D0HA 4CQ9A 5JUVA 1W1ZA 2WHJA 3H2MA 3D6NA 2WNNA 2XIBA 2J8FA 5FIPA 5LXEA 1P7TA 3UEQA 3CLMA 3CZ8A 1GG1A 1I1WA 2YA0A 1UQYA 4HJFA 5E93A 1R3TA 3OVQA 1IEWA 4FX7A 4A3HA 4W9TA 3VIMA 4K2SA 4MUZA 3DU0A 4DELA 3F4WA 3A4WA 3GK0A 1GONA 4AVOA 5J04A 4GVHA 1RVGA 3TSDA 4J9JA 1GPWA 1LQ0A 3BLLA 5HWJA 3UWYA 1EBGA 3MJYA 5B80A 4W5UA 2BP1A 4J5NA 3EDJA 4LYRA 5AC6A 3LPFA 4AX7A 1A3HA 5D30A 3G0UA 3M0JA 3IJ7A 2INFA 6A3HA 4XIMA 1KD0A 1FDJA 4DJFD 2R24A 3UA4A 1ZP3A 1TPVA 2Z28A 4F0HA 2ISSA 3G18A 1Z89A 1L9WA 3IAQA 4PMZA 4AIUA 4ZVJA 3OLDA 4DJEA 2QCLA 2PDHA 4M6UA 4L1WA 2VXNA 3GNXA 3S3GA 3BO9A 5CSSA 4GJ1A 4NT0A 3FXYA 4GHRA 2NVAA 5CAHA 2DDXA 4ZZ9A 4MZ8A 3IUDA 2Y8KA 4IG2B 1CCWB 2G95A 3QMRA 1ZBVA 4H41A 1XGZA 1E1CA 1FWCC 3EWWA 1YXDA 3LS9A 3B9EA 3WQGA 1PIFA 4JGDA 3PM6A 2GUYA 1FWFC 1SZFA 3W81A 3C5QA 4AEEA 4YYCA 3RM4A 3CUGA 1PX4A 3LV6A 1EHAA 3GG0A 4IL2A 2Z7KA 2A3HA 4MGGA 4Q4RA 3U2EA 3ZO9A 6PTDA 1P7TB 4Y96A 4LS1A 3BVJA 1OT1A 2CIPA 1LBMA 1E9YB 3C8NA 1AG1O 3GXFA 4O50A 3AMLA 4HBKA 4PYSA 2G5WA 2H8ZA 1TG7A 3H24A 2NLIA 3TQKA 4DIAA 3USZA 1GQKA 1T96A 3JR2A 5DCDA 3W00A 2X1SA 3IVUA 3AALA 4PUMA 5K9CA 3W7RA 5AC8A 2GVYA 3VOJA 4BFAA 3NEHA 1R7AA 1TQXA 3C2OA 3W1QA 3PWGA 4GI8A 3K30A 3SN4A 3MMDA 4A8RA 1JDFA 5C9XA 2PC8A 3H22A 1OK6A 3IJ9A 3CV7A 1OWQA 3THUA 1VFTA 4NYYA 4KERA 1F3WA 3QQWA 1BF6A 4PBEA 4P8UA 5HR6A 2GWGA 4AWTA 1DV7A 3MCMA 5DMNA 4WJEA 3RJXA 1UKSA 1K77A 3W53A 4S3KA 3KWSA 4NNBA 1UH3A 1PKMA 4ONVA 5A8GA 3FVMA 1ISYA 1SR0A 3EA2A 4HOXA 4JTUA 4YVXA 4FK9A 3LTYA 1A5SA 1JEZA 1E1CB 4HK5A 5AZ0A 2VUNA 3GH5A 1YE4A 2HMCA 3O63A 4QLLA 5HPOA 3WSUA 4Q8QA 2G0WA 3LSCA 2BGQA 2PEVA 4AY1A 3MHGA 4CEUC 4WDXA 4CKQA 4Q8OA 4DJDD 4LAUA 1ISVA 2ZZ3A 2NXGA 2EKCA 1XYLA 1X38A 3GZAA 1Q2RA 2NX3A 1W9BM 3R12A 3KL3A 1NOFA 3V5CA 1RLDA 1UQZA 3ZM8A 2VEIA 3V5OA 3R2GA 1TUXA 5AECA 3RXZA 4O8AA 1LORA 4KCWA 3N4EA 1J6PA 1GOXA 4JOMA 1UMLA 4IPJA 3MCOA 3WDJA 1F05A 4M56A 3R0DA 1LQ2A 1VPYA 4WGXA 4GX9A 4D6DA 3UBPC 5E5CA 4AIOA 3RYSA 1IT7A 4O13A 1FXPA 2TAAA 4HMEA 5CPNA 4LJ3A 2VFIA 1H61A 2HV5A 3A9IA 5A6SA 3TJXA 4KWUA 4XKYA 1K9FA 3CH0A 4ADUA 3WJWA 4US5D 3HPXA 1SMDA 3M47A 3GBEA 3VM5A 4MTVA 3U6WA 3T1GA 4Q33A 3NA8A 3G3DA 4P2VA 2DJLA 1XR2A 3WLQA 3VC6A 2QEZA 2C8NA 1DVJA 2GVGA 4YIWA 3MY9A 3KOYA 4XZMX 1JR1A 4Q4PA 1J01A 4LV9A 2GWNA 4Z2HA 5I06A 5XIAA 1C7SA 1V6UA 3I7RA 2PI6A 2WB5A 1KCKA 4YWSA 2EG6A 1GTHA 1XG3A 1NY1A 5BMXA 4A8LA 2HK1A 2VX5A 4IP4A 1WXJA 4MB4A 4GCAA 3HJZA 1T8XA 4HU0A 1A53A 1RH9A 2J25A 3OVGA 3F5JA 3IV8A 2VCAA 4A35A 2XIQA 2X09A 1TE1A 3ARVA 3DERA 2A5HA 2NQ5A 4L9ZA 4L9YA 3P2VA 1BXBA 1XISA 3EMCA 1UKTA 4PEKA 4DEFA 4JTKA 3GAYA 5CLTA 1B3YA 2ISVA 1OC5A 5BXSA 5K4ZA 5A8QA 4L4MA 4Y9NA 3OJGA 1OX5A 1V3HA 2VR5A 3PTMA 2NX9A 2AMGA 1CI1A 3TCSA 4PTXA 3NOEA 1YADA 2HRWA 4IPIA 4FLQA 3URAA 1ITQA 3THQA 3ZZ1A 2OODA 2XVLA 3MUY1 3EEZA 1IXNA 3W1TA 4LUYA 3WNPA 2HSAA 4XKYB 1E9ZB 3BGAA 5DXYA 1JJKA 4NI8A 3A4XA 1MQPA 1E6XM 4X0NA 4O17A 3VXGA 4ZXLA 3A64A 3PZUA 3SN0A 1JNEA 3G1RA 4RNIA 3SRKA 3OVRA 4JX6A 2IKJA 4BEUA 1FXQA 2XU2A 4JBRA 1JD7A 3DBNA 1LRTA 3GUGA 2R1KA 1BGGA 4CCDA 1VS1A 2C71A 3TMLA 2PS2A 4D8LA 4A05A 4YCPA 4EKJA 4JHZA 4CVUA 3BCFA 1FWRA 3SI9A 4IIFA 3N2CA 4QNEA 2PURA 3PZMA 4LT9A 6REQA 2Y89A 4L7ZA 5EBAA 1WA3A 4S38A 1HZYA 3BSGA 3V18A 5CQ1A 1F73A 1VLWA 4JEQA 3WY1A 4GGHA 5ABFB 4JKLA 5AC5A 4HMDA 1ZS2A 2PDQA 2DT3A 1OFRA 3P7YA 4MKVA 1PXGA 3Q65A 4TTGA 5BU6A 4ZMGA 3ZWTA 2J8TA 4K8HA 3F4DA 2RGMA 2HVMA 1KLYA 4UTJA 3N29A 1P5BA 1Z9AA 4WLCA 1R3SA 3BGGA 1BRLA 1AJZA 1VYRA 1YBQA 5BOOA 2FGBA 3BE7A 4JIRA 4H6KA 4ZB0A 3FOKA 1VBHA 5AYXA 4OKDA 2ICSA 3G1AA 2JIEA 4ZBCA 3S5YA 3DFPA 5A6BA 3A4JA 1U2YA 3MI6A 2VVNA 2Z25A 2RKXA 2Z1SA 3G6MA 4KF1A 2ZA3A 3BPWA 3AS0A 3BAYA 3H53A 3ITVA 4WXYA 1TCDA 2IPFA 1UOZA 1RVKA 3KUMA 2NSOA 4LYQA 2VM8A 3GO2A 3M5XA 3JRKA 1DEDA 4UR9A 3E2SA 1A3XA 3QKEA 1A4MA 2G96A 2HTMA 2Z1XA 1EB3A 3NEVA 1ZAIA 1S2CA 3HM7A 2GQAA 1XYBA 4ZQNA 4KW2A 4CQ8A 2ACSA 5D02A 4I5UA 4TOQA 3WD3A 6REQB 3AFBA 3NO1A 3EWYA 5KEZA 4E2DA 4MG4A 1CLKA 1WQ5A 3VI2A 3U5YA 2OOFA 4WJXA 8CGTA 1XX1A 3UWVA 4BHYA 4IFKA 3UWEA 4S39A 3ITOA 2WSRA 2WZIA 3BQ6A 4MKNA 3WH9A 1ZBWA 4L1GA 5JBEA 2ZKMX 1XCWA 1I45A 1FCVA 3QQ1A 4O57A 5HUPA 5AYIA 2QW5A 8XIMA 3E5BA 4L6DA 1YDVA 1NDWA 1NWSA 4HMCA 3R13A 1UUMA 1BRLB 3AIBA 5LGXA 4QCFA 4M7SA 1YBQB 2Z1VA 5I09A 5BRBA 1QT1A 1U5JA 3BZJA 2EPHA 4CNOA 3W74A 4NZ5A 6TIMA 1HF6A 2YXXA 2C16A 1O4UA 1BQCA 1UR3M 1N8FA 5CC3A 2HXUA 1EDTA 1R2TA 4G6CA 4GVIA 1GOKA 3CAWA 4HA3A 2OO0A 3HG2A 3AHYA 4LRTA 4DQWA 2Q3OA 1FKXA 5D4YA 3W7KA 4EX4A 2V9DA 4F9JA 4AXKA 3HQPA 4OQVA 2GDVA 1W1B1 1I2OA 5A69A 4ML4A 5FESA 3G1SA 1HGYA 1EPVA 3N2MA 1DYSA 4RE3A 4PCFA 2HK0A 1J0KA 3I4KA 4DM1A 1LBLA 3IACA 5T9BG 4H4IA 4Z2JA 3KBMA 3P74A 5HWNA 2X2GA 1B3OA 2Y5EA 4FXSA 1MNZA 3VCRA 1TV8A 5LIXX 2ADAA 3OGRA 4IOTA 4EAMA 4WF7A 1WDRA 1O7AA 2WOQA 3UG4A 3LY0A 4I7UA 4IFKB 1R47A 1M7XA 2DV0A 3SZ8A 3I65A 4WZHA 1AJ0A 3UY7A 3VNIA 1RJPA 1UWQA 4XQ6A 3BWWA 3DOPA 3NAVA 3LCFA 2QDGA 1E3ZA 4FOUA 4JNZA 6XIMA 4NAFA 4EF9A 1GKQA 4OV4A 1EL3A 1K6AA 3M44A 4HT3A 4W84A 3QM3A 3FHAA 4XVEA 7ENLA 2ZE3A 3S1UA 3A3WA 4EPDC 3QN3A 1PYFA 1KRAC 3HG5A 5IHSA 1RHCA 3BUVA 4XAZA 4GACA 3SQLA 1LT7A 2DSWA 4UFKA 4NRRA 3CWNA 3MC5A 1QWGA 4BY3A 3GHTA 2A0NA 2D2OA 3ABRA 4UNIA 3OBEA 4XTDA 4M81A 1LBFA 4UTWA 1YE6A 3STFA 3BURA 1W1TA 1X96A 4G1KA 2GQ3A 4F0KA 1LLWA 3CBWA 5CZJA 4ZQMA 3LMYA 3OYXA 4H04A 1P48A 2QJGA 1QI2A 4B5UA 3C86A 4BF5A 1B4EA 2XH4A 3EB4A 1TJ1A 4O53A 5HANA 3A24A 3DXIA 2WNQA 3SFKA 4I6VA 4XZIA 2PTXA 2ALRA 1R3QA 1KFBA 2D20A 3M5ZA 3CQJA 1VPQA 1QJWA 4MPKA 1H09A 3UJ2A 4P8XA 2CEQA 3PJUA 1O5KA 3SCSA 4GIYA 4MWAA 4CCEA 2D3NA 1OM0A 3GDKA 1AK5A 4AXNA 1BG4A 5I3IA 4QEHA 4NAFB 1QNVA 4QXIA 2Y8VA 3QC0A 4M3PA 3B9DA 1GQIA 1W9DM 1FRBA 4XZLX 1NDVA 4RZBA 3CM4A 1C93A 2NT0A 2XN2A 4PE8A 5DCEA 3POCA 4QISA 5BXPA 3GTNA 4WDWA 4LCRA 1CB2A 1GOOA 4MPQA 4LYKA 1F5ZA 5KITA 1PEZA 2O7QA 5F2GA 2V63A 2A3BA 3NNTA 3VFCA 2WVVA 3VO0A 1YIXA 1EXPA 3AJ7A 3WLIA 3SJNA 4IXHA 3QMSA 1XD0A 3NUKA 1EJSC 3NQVA 1V4YA 3OZYA 1NFPA 2VWTA 1FHUA 3OA3A 4JKKA 2CLEA 1JD9A 3IARA 1A3WA 2GUBA 4KGLA 4KWOA 3LHZA 4GY7A 2IKHA 4DWSA 2DW6A 4HZ6A 1DTUA 1VFFA 1EUNA 2QAFA 5TQLA 3F1QA 4LBSA 1E51A 5C9UA 4NF7A 2A7NA 4FSAA 2P53A 4XX6A 4IUGA 3ECQA 5I00A 4Y7EA 2E1DA 4C6JA 3BOXA 2DEPA 5E0CA 3MV11 1UHVA 4NZFA 1RV8A 1E0UA 2AGTA 4L5ZA 2WW5A 4LSBA 3UG5A 1RA0A 3K5XA 1XRSA 1FWHC 2WVUA 2GFTA 4R88A 3W2NA 3QVQA 1EC7A 2YKKA 3VILA 1E1EA 2WZTA 5FF7A 4OOZA 4PMNA 1DQWA 1U1UA 4MWAB 3KM8A 3LGEA 2CLKA 4UTTA 3DG6A 2RH9A 2BSLA 2ZX8A 3W02A 4Y6GA 1XIGA 3ZJ6A 2QR6A 2D0FA 2AL2A 3SUTA 3VVGA 3FNDA 1OB0A 3EDKA 1C90A 1WDDA 4XWUA 2OEJA 4FXRA 2VELA 4I9TA 1CW2A 1X7FA 4O0QA 2WVVB 3L67A 1ICPA 1E6PA 2OT0A 2UY2A 4Z1DA 4ZO6A 4JR5A 2DT1A 2BNJA 3GU9A 3WDRA 4GVFA 1E0VA 2J88A 4WSHA 3E2QA 5PTDA 4BQ5A 3AAMA 5BU9A 1DBTA 1SW3A 1RXOB 3R1ZA 1JZ2A 4MNJA 4LVBA 3C0QA 9XIAA 3M7WA 2QV4A 4LV4A 2B81A 4QHRA 5KZEA 3AYTA 3DKJA 4JIIX 1QTWA 4BJHA 3UW6A 1VHNA 3B04A 3NO3A 3GXIA 4BZYA 1J2BA 2CZDA 4X3ZA 3S9YA 2EKGA 3ARWA 1Y5WA 4ADSA 5HNUA 4A29A 3WK3A 1TR9A 5IHRA 4MB1A 2CLLA 1TSIA 1QAPA 2XISA 1F8IA 4F4RA 4F40A 5LNUA 4Y8EA 3BAJA 1GQJA 1A0CA 2PDKA 3NO5A 2AL2B 1VD6A 1DJGA 1UR4A 2QNEA 1ALDA 3QY7A 1JZ3A 4L1XA 1RY8A 3S2MA 3P60A 4N2YA 5H2ZA 1KRBC 3HQOA 1LUCA 4O1BA 4PMOA 2A6NA 1UD4A 4NJKA 3J7HA 3OODA 2R82A 1XLEA 5F1VA 4Z1CA 4RJEA 2GJRA 3VPLA 4KFNA 1WUEA 3RCMA 3TN5A 3HPSA 3QYSA 1V79A 1JUKA 5F7UA 1PE1A 2QV5A 2P3EA 4QSFA 4ROPA 5BOEA 1J0HA 4W5ZA 2Z2UA 1TQJA 4JEJA 2FZNA 4GFIA 4BKNA 3EOLA 1W17A 1NIUA 1YXYA 4UQDA 3L4UA 3A13A 2JGYA 4G8TA 5JIWA 4LB3A 3PBMA 5A94A 1MEWA 2E8ZA 3AJXA 3V4BA 5DELA 2E9LA 3CEUA 3ABQA 2NUXA 1JDDA 1IWBA 1QXLA 3E02A 5FF2A 2VZVA 3T0BA 1CT5A 1GQNA 5TD4A 1DWJM 1OQFA 4H8HA 2IQ0A 3K4DA 4FXFA 4Z0SA 3O15A 1IR1A 1I8JA 4PFMA 2FZ8A 3VDBA 3AISA 1M7PA 5JH1A 1LRQA 4YTUA 4F2BA 3C52A 3WFAA 4A2SA 1EQPA 1ZSXA 2FGLA 3QKZA 2Z6IA 1PX3A 4GABA 2J24A 4JIPA 3VCCA 3BCDA 1JRBA 3N2BA 1DORA 4HHMA 3E3HA 1X39A 2PWGA 3L4YA 1ME8A 4LUTA 1EF3A 1NOUA 1LUCB 3EMZA 5K2ZA 3HQNA 3VIKA 3QGAC 3B9NA 3ARSA 2FGZA 4IIBA 2YL6A 5KSWA 2H9AA 3W86A 2ATMA 2YA2A 3P5ZA 3RM8A 1BYBA 5IDZA 3M9YA 2AOSA 2YZRA 1Q6OA 3WF2A 1KFJA 1VFUA 3M4HA 4LB4A 4B5WA 3GFYA 1ODUA 2CHNA 4N02A 3VIHA 4KCUA 4IGSA 1JAEA 2ZZ1A 1UP2A 1VB9A 3OG2A 1WXZA 1Z44A 4PMVA 4OTKA 1KFKA 3ME3A 4C6DA 2FPTA 3QY6A 3K13A 3WMBA 1AQFA 4L4PA 3QXBA 2WJEA 1L6YA 1H7RA 2CLFA 4X60A 3MUZ1 1EEPA 1WBJA 1AODA 1EP1A 8XIAA 1M7OA 2VVSA 1KM0A 4BF7A 4ZO8A 1SVDA 4OVXA 4C6KA 3RPTA 4ILSA 3R8RA 4N9BA 5ECUA 5FJRA 2NUYA 4UQEA 5MKGA 2RDWA 3BC9A 3HGOA 1OCJA 1R46A 2V67A 3DX5A 1W3KA 1NTHA 1GK8A 2WAGA 3SSJA 1Q7ZA 1VCGA 3R43A 1KBKA 1ZLPA 4UMCA 1AL8A 4PSPA 3THDA 1ZALA 3CUHA 4EP8C 1DIOA 4NQ1A 4MNLA 3G1HA 3AXKA 3MU7A 3AHVA 1FBAA 5A1AA 1DQUA 1Z8AA 5FOOA 4LUTB 4PB3A 4QAWA 4RLIA 5EMKA 4NG3A 3IK2A 1QCWA 1EC9A 1OFQA 1UKOA 3GNOA 1E1FA 3EX6A 2WKGA 3AWNA 3GTHA 1QU4A 3JU2A 1TPWA 4GH3A 2H9AB 3G22A 3N6JA 3W87A 4S2CA 3U7VA 4R7OA 3ARUA 1TTPA 3QGVA 1PZ0A 3GUWA 3QHNA 4LXFA 4CU8A 4RZ4A 2ZWZA 1VBGA 3N15A 2P76A 4Z0JA 4GY0A 3IRDA 2V38A 2X16A 4QJ1A 3I10A 1HL9A 3TSMA 3S2JA 3Q2DA 5JBDA 4QE1A 1YTDA 3M6DA 4UUIA 3HO8A 2FTYA 3P84A 3N1AA 4LFYA 1SO6A 2SFPA 3F4CA 5D38A 2ABAA 3APGA 2YBTA 3E9AA 4MB5A 2JE8A 3TN3A 2PWFA 3FY1A 2E25A 4F79A 5H8MA 3F5LA 5D9NA 2OWCA 2PDJA 2VEKA 2DVTA 3S2CA 3FDGA 1V7YA 1ISXA 1DXEA 2V5JA 4W8AA 1ICQA 1UPMB 3FKKA 5G1MA 5B7YA 3W6MA 1W1VA 1LL4A 4PCTA 3T09A 2OR2A 1KXVA 4BK9A 3H2FA 4ZODA 5MKGB 4HNNA 1C9DA 1X7IA 5CZSA 3FKRA 3U2CA 2HQAA 1TB3A 1VGAA 4EAYA 3VDAA 4ZEPA 2GPTA 4L61A 2PWVA 2PGRA 5F4XA 1W54A 3QFEA 3VNLA 2ZC8A 4IF2A 4OUEA 1JDEA 3SB0A 3W3OA 4DF1A 3M0HA 1M6JA 3FW6A 2OU4A 2A1YA 4JX4A 1GUVA 1VP5A 4A8NA 3KVKA 4PTDA 1KGWA 4PUNA 4DF2A 3CPRA 3PBWA 4XAFA 3UFYA 4AMAA 2I5IA 5U7SA 4R53A 4O54A 2E9BA 4YWIA 1BG9A 2Z27A 1XLJA 3ZIZA 5I3KA 2VO5A 4JTJA 4OE7A 5CEWA 4AUBA 2E77A 3VDCA 2BBFA 1CTNA 3DHDA 4LWWA 3LOTA 3D3FA 4B5VA 4YTQA 3TSBA 3H12A 3CAKA 2XM1A 3WEMA 3A3XA 2DORA 2Y4SA 4KIEA 3GDMA 3UR2A 2ZUWA 4NP7A 5CCZA 4KGJA 4GVGA 3S6DA 3UD6A 2W3ZA 1TREA 1N8WA 2VMFA 1S38A 5CBBA 3N11A 4TV5A 5HK4A 4G5DA 3B4YA 3ID7A 4LTSA 3DIPA 3MHFA 3VOCA 4O4VA 2BHZA 2JF7A 1L8PA 3NXLA 4HPXA 3W4RA 4IJRA 5CXPA 4IMGA 4HN8A 4GPNA 1R9YA 4EANA 3QZAA 1BVWA 2QZRA 4UOJA 3WEOA 4FR6A 3MBFA 3A47A 2Z2BA 2HVNA 3M6YA 1XQLA 1ZFJA 1ISWA 3W2KA 2QCEA 3APTA 3U2OA 3ZR4A 2OKOA 1LZOA 1KTNA 1ZAJA 4HJWA 1GZGA 3UXDA 2Q3RA 4UQCA 5BXTA 4WY0F 2OZ3A 2OYMA 2B31A 1EP2A 1LP6A 2J6XA 3B8SA 1HJXA 1XRTA 3HA1A 1WCGA 5H8PA 3KX6A 1S2UA 4JD4A 4RXFA 1FCBA 4AZIA 3NZGA 3WN6A 4CN4A 5F2IA 4RW5A 4GNVA 1XLHA 4O8RA 1U30A 5E09A 4C5YA 1OADA 5J5DA 5G1YA 1TRIA 1OGSA 4WUIA 1H60A 5F2LA 4MYAA 1LROA 1P6WA 5BYWA 3E5PA 3WQEA 4C6IA 3FEQA 3W71A 1GZ1A 3OIHA 5FAJA 4J3TA 2Y7EA 3BJTA 1L2UA 4NHVA 3RU6A 4QTGA 4DM2A 4NJGA 5BOFA 3BOLA 3LI1A 4MOZA 1YLVA 4DUOA 2BXYA 5BNKA 2TMDA 4UFIA 1A5MC 3N25A 1GJWA 2QCNA 2BVTA 4HSOA 1IE7C 3KCJA 3SQMA 3UPWA 3W24A 3WMLA 1PSCA 1XFCA 4NY2A 1EJ7L 2XTKA 2VEGA 5E0KA 1WZMA 3PZQA 2WCAA 2Z0IA 1K9DA 3O6DA 2HWGA 1PTGA 3WL0A 3GQYA 3LX9A 3LRKA 5EKYA 4DLFA 1PIIA 1UCWA 3YPIA 4QR6A 1PX8A 4U31A 5IFPA 3UERA 1UD5A 4JIHA 4L64A 5H91A 2CWXA 1VRDA 3LEPA 1MVYA 1P1MA 1ZQ5A 3P0WA 1KRMA 4O12A 4AF0A 2D69A 4B5SA 1M7JA 3EPOA 3L4ZA 1YNYA 5EBUA 1AW5A 4H3DA 3L0GA 1U5HA 2MUCA 1SU5A 3I68A 1FWDC 4HYWA 3D47A 3HG4A 2YJQA 1NDYA 2JIWA 1F4AA 5A8PA 3PF3A 3RPMA 3WLHA 3T78A 1OGBA 1PDZA 4QJ5B 1PZ1A 2ZXAA 2GDUA 3AOFA 5EMYA 2P10A 4FNSA 3W2JA 3QRHA 3WH6A 3R4IA 2HISA 4J2MA 1YXCA 3P8JA 1QASA 1R8LA 1QNPA 5CBIA 5AHFA 4LCQA 1M41A 4AIBA 4O19A 3H2NA 1E4NA 1DJHA 3BOFA 2WXDM 2YX0A 5I5RA 3CO8A 4J27A 1G1YA 1TWWA 1XS2A 3MO7A 1UWIA 1ZJAA 2IKIA 1Z32X 3WLKX 3PN8A 3EKZA 4E2BA 2R1MA 2ZXDA 3AZRA 4XIAA 1JFXA 3WBEA 3BG5A 2PDPA 5GVJA 3S42A 3TW6A 1TTIA 1XP3A 3OQEA 2WHLA 1FWNA 3EWDA 1M1BA 4PBFA 4LPCA 4B3LA 4GCXA 4CNUA 2AKZA 4IIGA 4DJFC 3NZ1A 9RUBA 2IPJA 5G2WA 3LNMA 2J6VA 3T0DA 1R3RA 2QGHA 4O28A 3L4WA 1S3TC 3HU7A 2JK2A 2J78A 3UR7A 1DJZA 4ZENA 2C1IA 2I14A 1TMHA 4WKFA 1U1HA 4AF0B 2ZRYA 3HBLA 1ZRQA 1KWKA 2OTDA 5D2VA 3VOIA 1YQ2A 3SUUA 4Z1YA 1M68A 4QG9A 3ZOAA 3BANA 5DMLA 1I2NA 1H1YA 3BLOA 1FHLA 4QLJA 4A3UA 2G50A 2FHCA 1EOKA 3N2OA 2O4MA 3VMOA 5ENLA 1WAUA 3APYA 2BHUA 1TPEA 3CTLA 1R6WA 5I6SA 3EXSA 2OZTA 1HX0A 4NL1A 3QTGA 4TU1A 3RDKA 3STGA 1WKFA 3ARXA 3QJAA 4J28A 3VNMA 4PUJA 3WDIA 1X8FA 3DFSA 4MFDA 4TX9A 4Q3MA 2ZUTA 3SCVA 4HTBA 1A5UA 3LG3A 2V3EA 3I6TA 1EGMA 2ACQA 1LG1A 4B5NA 3FX4A 4IQJA 2X40A 4JCLA 2VFHA 2I56A 1PZ2A 4UIOA 4DBWA 1VIWA 3UZZA 4S3AA 1F2JA 4Q4OA 3WFZA 3CB8A 3QY8A 4NXKA 1W9PA 3B03A 4MDOA 3EGJA 1YPIA 4RNHA 1K1DA 5H6HA 1VC4A 4WR3A 3GY1A 3MSDA 5AHMA 1D7KA 3MSYA 1JG9A 3W22A 1I75A 1VKFA 1XRVA 1FWAC 2DZAA 4YPJA 4GJIA 3AROA 3KBJA 3MA8A 5IOBA 4MY8A 1JCLA 1KB3A 2AMXA 3GC5A 1Q6CA 3PZTA 1DWGM 3AXHA 4PFHA 5GNYA 2ZRWA 1L2QA 1KLZA 1KRCC 1VEPA 4NJIA 3T4CA 4E38A 1XDJA 2HE5A 6ALDA 5L6UA 2PDXA 5CZKA 5D05A 4YU1A 1XLGA 3RRAA 3BAKA 3TW7A 3QMTA 4KFOA 2JQXA 4Z2GA 4OUIA 4P7NA 3NFUA 1CBGA 1NP2A 3ANVA 5LA1A 3O0FA 3B0VC 4MMWA 3NPUA 1LOSA 3LUTA 4IWWA 4E4UA 5CG7A 1NFBA 3WQ5A 3W26A 1J12A 3H21A 3GR4A 2DT0A 1NAL1 3R10A 2PTWA 4CCCA 5I3GA 1J0JA 3W85A 3LERA 5TBOA 2GOUA 3FVDA 1KGXA 2WC7A 4RNJA 2XPKA 3KHDA 1E5JA 4DJDC 1OIMA 5M2FX 1VQTA 1RSCA 2CITA 3RO8A 1G7VA 3NL3A 3PZIA 4AHPA 3TYUA 2VFDA 4B2DD 2V5KA 1IXPA 4CNPA 1C8VA 4PULA 4WK9A 4ATDA 4J3SA 3AU2A 4ZE5A 4MADA 3WF3A 1UR9A 1J11A 3UCDA 3RILA 2WO5A 2A4AA 3NL5A 4PCPA 1QPKA 3V35A 5EPDA 1MDLA 3R0UA 1E0WA 2VX6A 1QNRA 3WQ4A 4QNWA 4QX4A 1QI5A 4JFTA 1OT2A 2XIMA 2ZWYA 3TOPA 5DMMA 5HOSA 3IJIA 4EPEC 3UWQA 3E0WA 3H6OA 1I2RA 3QTPA 3PTQA 3PBGA 1KBLA 4MVAA 1NWTA 1K9EA 5E9AA 2PPGA 3WLRA 1NM9A 1E71M 4S3EA 4Q7NA 2XHYA 1DXIA 3MI3A 1FWEC 1SQ7A 2ZRUA 4HMNA 4NILA 3GR8A 2NV2A 1QK0A 3CEPA 3IANA 1ELSA 2FLIA 3W82A 3S5NA 2Y6ZA 1KM2A 3C0LA 1DWFM 5FSEC 1JGIA 1L6GA 2GJNA 1O94A 3V5FA 1TZ9A 4AW7A 3CLWA 4JTHA 4H7CA 1WZKA 2GYIA 1M04A 3R79A 4ACYA 4CQBA 3OW1A 3KEHA 3HTWA 2QVNA 4MYXA 2Y7GA 3EB2A 5CPOA 1HJQA 3MTWA 3RMEA 1RK5A 4KWSA 3ZR5A 2YL8A 3SGZA 1WUFA 1OINA 4V1YA 4IHCA 1WZAA 1GOWA 3LCIA 4FLRA 1XC4A 1PHWA 5I23A 4F8XA 4AC1X 2X7VA 1W8GA 1KA9F 4ZQCA 3PC0A 4FOKA 1SJCA 2R94A 1RPXA 2BODX 3PNUA 3RU8X 2HROA 4IX2A 4D8ZA 2O56A 4AG0A 1BHGA 5LGZA 3OOQA 5LNRA 1SZEA 1JNDA 4UZUA 3H4WA 3XISA 1UBPC 1X1ZA 4ECLA 2W9MA 1TCMA 1W2VA 5CLWA 1UWAA 1H50A 1NQ6A 1QOPA 1IWAA 3LB0A 3H2CA 1PTAA 4IIDA 2FKPA 4GNKB 3QZ6A 1DWIM 3W84A 3GYEA 4RX0A 2DUXA 4JTIA 2OSYA 2WV8A 3KOWA 3W6YA 2HNEA 5A6KA 3AI0A 4RR4A 2ACRA 3QPEA 1X6NA 3BTNA 4QBXA 3TONA 3W1AA 2ZZ4A 4HCDA 1D8WA 3AYVA 4HPNA 4I90A 5F1UA 1MXGA 2DZVA 3M41A 5E1QA 3MS8A 5GNXA 4MM1A 3H2OA 2G3IA 3JZEA 4DUXA 2F2KA 4QJ3B 3UQNA 3CL7A 4WY0A 4JXCA 1JCTA 3S4TA 1MQQA 3LNPA 5D09A 1HO1A 3LXAA 3TR9A 1GW1A 3ZSTA 3SQSA 1NSJA 1AVAA 1M65A 2YOCA 4LBUA 3ONBA 3E2RA 2VR4A 3WCZA 4XKMA 1V6TA 2FIQA 3WQPA 2W6RA 2PP1A 2PD5A 3TJLA 4XBJA 3W7MA 2V30A 4E3VA 3BW3A 3DHPA 3TC6A 3NZQA 1I2PA 4DI9A 5DBUA 3E6EA 3LK6A 5G1TA 1XXXA 2W27A 4YTRA 1GYNA 4JTRA 4PBGA 1VR6A 2CZFA 4I7WA 1Z48A 3T8LA 2FJUB 2RFGA 1UROA 1XGEA 3CHVA 3PTDA 2YCKX 4HK7A 1XYZA 3DFHA 1PKLA 2QCHA 4XBSA 4GO9A 4OGZA 3UETA 2CLMA 2GOKA 4ORMA 4N6FA 1N7KA 3O8AA 1E9IA 4IXXA 1US2A 5EFDA 3I4EA 1SFSA 4E3TA 4LANA 3E96A 4QM1A 3DFTA 4GRSA 4HN4A 4PR4A 5J8LA 5IFTA 4UFMA 4F2TA 4ZOBA 4GXWA 3WH7A 4Z2KA 4JYDA 3UXAA 2P50A 3PAJA 1REQA 2VL4A 5CPTA 3E0VA 2Y5SA 3PK7A 1AZ1A 3GHRA 4DPPA 1VCVA 2XN0A 4RDZA 3AIUA 3TTQA 3CHCA 3SW6A 1WKYA 5I3FA 1XIBA 3O6AA 2B4GA 4BEQA 3HZ3A 1L6FA 2BLEA 4GI4A 2FVMA 2GJXA 5C71A 2FVKA 1KC7A 1E0XA 4FO4A 2PSNA 2JF6A 4IM4A 3B8UA 3L21A 4JYFA 3L4TA 5D04C 3LN3A 4E2OA 1OYCA 1K4GA 3RIKA 4Z42C 4ZSUA 3PZNA 5HBFA 3H23A 4YTTA 1V6YA 1G4PA 1I1XA 2BOFX 2FYMA 1RQEA 5IBXC 3TUUA 1KNWA 2E6FA 4S1FA 4KCTA 3FK4A 2PLJA 2ZA1A 4ERAA 2RJGA 3PULA 3G1VA 3DEQA 4FMVA 4K7YA 3N2TA 1QOXA 4F2UA 2PDNA 4DXKA 4ZFMA 3PG9A 2E7FA 5G2IA 4ZA0A 2FMOA 1OCNA 2VX4A 1IZCA 3S2NA 3F2CA 4N9CA 3WQVA 4UTMA 4GZEA 4ATWA 1H7PA 2EAWA 3OZMA 4AMCA 4P8WA 4H1ZA 2OX1A 3MT1A 1KW1A 3KRSA 2PDYA 4XO6A 3N04A 3LGDA 2HBVA 5EU9A 4W86A 5A95A 4REQA 2FDSA 2VHLA 2HXTA 4Q22A 2ACUA 3KFTA 1BXCA 1REQB 3ICJA 3DCPA 3POHA 1D3GA 3W76A 1ZTVA 5C9RA 1SJDA 3GTXA 1HIZA 2OYKA 3EPMA 4LX4A 3WNKA 4LUSA 2QCCA 3DUGA 2EGZA 1O95A 1R87A 1US3A 4XD4A 1TRDA 3ARYA 2GJXB 2BVWA 1L6SA 4NASA 3SIMA 2GZXA 1E6RA 1E6ZA 1E4IA 4JN7A 4Z17A 1RBAA 1EXBA 3HV9A 1H7NA 2P88A 1XW8A 3N9SA 5LNVA 4EXBA 3W75A 5C54A 5IXEA 4GBDA 2XSXA 1FWGC 3LBMA 3KVMA 2IQTA 1PWMA 1EC8A 5L9FA 1V6WA 2HS6A 4FOJA 1K9TA 3OZOA 3HG3A 3MSGA 3CL8A 2F38A 3ALFA 1RAKA 2VC5A 1PAMA 4M6VA 1WBHA 3ZQ9A 1LL6A 3PBYA 4UQ9A 2WK2A 3T81A 3AHTA 1Y0EA 1XKYA 2EQDA 3N13A 3NPVA 4RKAA 3PZVA 3HPAA 3WJYA 1ZHAA 3QLDA 1MRAA 3OZPA 3CL6A 1R3WA 2Y88A 3LHWA 1A5KC 4REQB 3W0KA 3W72A 1OZQA 3WLTA 4S3JA 3MI2A 1JI1A 5G4EA 3WZ0E 3NQ2A 3AS2A 4G7EA 3LGGA 2IPGA 3P3BA 3BL3A 3L2MA 3S2LA 2VZTA 4IIHA 5HNTA 2Z6JA 3IRSA 4BS0A 4CGTA 4LUSB 2WC3A 4UQBA 3CNYA 1XIJA 3NQBA 3WF0A 1F74A 1QNSA 2VC6A 3EYPA 4C1NA 5LHFA 4FNUA 4LUIA 1Y5VA 2XIJA 1YTEA 1GTEA 3PB0A 3LLXA 1OGGA 4QQ3A 3SDOA 1K8YA 5FA5A 4A8IA 4LNYA 3AHZA 3WLOA 4M7TA 1TA3A 1SUXA 4KPLA 3PJXA 3CUXA 1ISZA 5EGRA 3MDUA 1Q6LA 4C6NA 1VFHA 1KCXA 2B7QA 3PHAA 3RM9A 4O0KA 3M0YA 3PFRA 4B9ZA 1SW0A 2XIOA 3ZXWA 4YS1A 3NGJA 5K3VA 3S83A 2XZ9A 3RCNA 2EXOA 2XIIA 4ZO7A 3ABZA 2BASA 2QPUA 4YCOA 2F6XA 3HPZA 3LV5A 2ZYFA 4UXDA 1T6MA 1BXNA 1TPC1 4H9VA 1P0DA 4GYFA 5AVNA 1RCQA 3BG3A 5LIKX 3PBVA 1V08A 5K9DA 4GC3A 1DJNA 4Q8NA 4XTIA 2CETA 2PBGA 2J74A 5CGQA 2BS9A 3PANA 3DI0A 2J9YA 2BGSA 3KXQA 1Q6EA 3E0LA 1UYQA 1TPDA 2ZUMA 1XLIA 3QEZA 2E0PA 1A80A 1SPQA 4DYEA 4K7VA 1WAWA 1FH7A 2QCMA 1P43A 1WDPA 5CPSA 4G7EB 4JTTA 1A5AA 4C6FA 1XIMA 4Q4QA 1V6VA 3PZ9A 1YPXA 1GVYA 1ECQA 1B0IA 2RJHA 4AZ6A 3OYZA 1MFUA 3HB9A 1ONRA 3CB3A 2YZ5A 1XG4A 3SR7A 1GYMA 1KKRA 4HSHA 5JQ9A 3AUOA 2IW0A 1KV8A 5AC7A 1P0NA 3RG6A 2QLYA 4D2JA 3H54A 3PNZA 3QW3A 4GQ0A 1TA3B 1EJXC 3VGHA 5EA9A 2QUTA 4ZTYA 2FHBA 1TPFA 3L7RA 3C6CA 1YHTA 3GD6A 3EEGA 4WGHA 3FJ4A 3IS4A 4U5IA 1H5VA 1SJAA 2R6OA 2Z24A 4K1WA 5TNVA 4C5ZA 1H49A 2FH8A 3L9CA 2QMJA 3SAZA 1X1NA 3OVPA 2CLHA 1E70M 5HAOA 4S3GA 2VD8A 4B5TA 3PSWA 1EWDA 1J79A 5FD0A 4IPLA 3B0XA 4URIA 2DZWA 4N0RA 4PB5A 1B3WA 3TYBA 3WYZA 4RE2A 1CGYA 1TWIA 1A5CA 5LIYX 3GNPA 1DOSA 3FYOA 2OGJA 3V16A 3TP4A 3ZJ7A 2ZADA 1NQKA 3UA3A 3EX3A 4Z08A 4EF8A 2R1PA 3N3TA 2VGGA 2BVYA 2J9ZA 1F6KA 1ADOA 3T55A 3VD9A 1M01A 1H41A 4GQQA 2E8YA 1CXIA 2HBXA 1DWHM 5G5IA 1V3LA 3VIFA 1V02E 1BD0A 5A8MA 1D9EA 2DSZA 3VIOA 4H9YA 3ZJ8A 2R1LA 3ZVHB 4O18A 4UB9A 4B91A 1T99A 5D32A 4MIMA 2BZNA 4MJ4A 2YLAA 4AY8A 4GUFA 3LD5A 5ABHA 2DZBA 4PCNA 3RGTA 4V15A 3OO2A 5C9WA 1CXKA 1LL7A 3F4VA 3ABOA 1VH7A 3TYAA 2CC0A 1ZCOA 4W89A 4C6MA 1FQ0A 3DFOA 2J75A 3WUGA 4LY4A 2OEMA 4I5RA 4KEZA 2VWSA 1QPOA 3VU2A 1DIDA 1R2SA 1LWHA 2WMHA 1XF0A 4NZ4A 1CWYA 4U3AA 4TV6A 3WQ6A 1VFSA 1P0KA 3ZWSA 4EWJA 2PWEA 5CC6A 2D3LA 4JN8A 4JTSA 4G7FA 3RAOA 3M0IA 4IFOA 3CQHA 4WSJA 3GXPA 3GW3A 4M0XA 2E40A 5CC5A 3NZRA 3H7UA 4EK7A 3SBFA 2NQZA 3PPHA 1FCQA 3RNDA 5T91A 4PMJA 2VYOA 3Q58A 3UXKA 2E6YA 1RA5A 5C2GA 1Q45A 4HIBA 1H5YA 2O7SA 3IUHA 1KCLA 1UZHA 3RMJA 5EL1A 1CENA 3VNYA 1VFLA 3M43A 4M29A 3OIXA 4GINA 2PWHA 4MZ1A 5I2UA 2P8CA 1W91A 3MQTA 1HVXA 1BQGA 4ERGA 1TIWA 4V28A 3HPFA 3FYYA 3NURA 3W7QA 2EHHA 2DH3A 3WX7A 3UXIA 4WDTA 5A3HA 3OA5A 1MI3A 4ZTXA 1EBHA 1XIIA 2GVLA 2GLKA 9XIMA 3H55A 5C8BB 3R0KA 3BCJA 3W1UA 1S39A 4MZYA 3WQFA 3AZSA 3S5OA 2OFJA 2ZX6A 1KFWA 1V02A 4BWLC 3GE7A 1E6QM 3QFWA 2QF7A 3LHTA 3M07A 3FAWA 1E15A 1TWZA 4AU0A 1HNYA 3UNTA 3V75A 4O52A 1P6BA 1TV5A 1XLDA 4GZJA 2DVUA 4LBRA 1EFZA 3O3RA 3RRXA 3F5KA 1AZ2A 3T2OA 3WUBA 1BF2A 1ENUA 7A3HA 1LLOA 2GUUA 4P7LA 2XJ7A 1EZ2A 3KLLA 3KBNA 2JEQA 5BMWA 4QE5A 2IXVA 3K46A 4GYJA 2HCVA 2J79A 4HP5A 1FP8A 2XVKA 2QIIA 3QPYA 3H7RA 4DAFA 3VMNA 5FCZA 3CUFA 2YL9A 1PKNA 3C4UA 5HR7A 2WQPA 9CGTA 2PF0A 2ZE0A 3SFWA 4GQRA 2F9RA 1G4SA 3VIJA 2XYLA 2OQHA 2GGGA 1GZJA 1H3GA 4U10A 3WNLA 2W62A 4JICA 1TUFA 4RE4A 4HPHA 4WX2A 2ZUUA 1XIHA 2NQHA 3HMCA 5TAOA 2DIJA 3BLKA 3C2VA 2VCCA 3E49A 3TU9A 3KRZA 2R1NA 1ADSA 2VUYA 4MF4A 2OSXA 3EWCA 3ATYA 2WCGA 3URQA 3WLLA 1VYPX 3V3WA 3CWOX 2PTDA 1Q8AA 4K3ZA 4H7VA 3V0SA 2C79A 3B8WA 3DI1A 1A5NC 3FCPA 4W7UA 4UFJA 4PUWA 1CXEA 3MUIA 1Y65A 3W1LA 1EEXA 1HN1A 1ITXA 3AMKA 4DBSA 4H6QA 1IGWA 3ZMRA 4E2VA 2PP3A 3CUIA 3L66A 2AQOA 4FZIA 1IHIA 3K1DA 6ENLA 5FAGA 2DQWA 3UP8A 2IKGA 3N3MA 1OX4A 1CX9A 1OYBA 2W66A 5G4WA 3W1PA 3TZNA 4AD1A 4J40A 2J13A 3KBSA 1XCXA 2OSWA 1XLCA 3B4UA 3P80A 3BK0A 4AD4A 1R3VA 2XDFA 4AH7A 1VPXA 3M7SA 2PDUA 3VE7A 3W7NA 2Y1HA 3MANA 3Q45A 3ELFA 3ES8A 2C3ZA 2GSJA 3G1DA 4TTUA 3DHUA 1KFLA 2YCEA 4B4FA 1QFEA 2ZXQA 4JS3A 5CH9A 2NVDA 4U28A 2ZIDA 3T0TA 3L0KA 3BAWA 3WQCA 1XM3A 3P14A 2ZUVA 2OZ0A 1GJPA 4GYPC 1F6PA 4GLEA 1MXSA 3L0NA 1BFNA 3JUGA 4N4QA 4DF0A 2CKRA 1DL3A 2E4TA 2GJLA 1FDZA 4BCEA 3GC4A 5A6TC 4GWEA 4CQCA 3UNDA 1KR0A 2UZ9A 5ECVA 3C0SA 2XFYA 1A5LC 4OZOA 2YCLA 3GBDA 1XH0A 1UMYA 2BOEX 4GIEA 2DGAA 1SZRA 3VZXA 3SADA 2OWXA 3MUXA 3KDOA 1DJIA 4GQBA 3S47A 1PV8A 5AHEA 4NAEA 4F0MA 2OEKA 4OFCA 5C70A 4D6GA 2Y70A 4O14A 1G67A 4DJFA 1K8XA 2C13A 2NXIA 4MY1A 3LXCA 2WBKA 4ADTA 3EPNA 3GVVA 3KVJA 5GJMA 1W56A 1DJWA 4UZSA 4XAGA 3HV8A 1JAKA 3COTA 3QR0A 1OX4B 2YL5A 4Q8MA 1OZMA 4RPPA 3JVAA 4D6IA 1I9CB 2WJDA 3TDFA 2Q8XA 2FVLA 1ME7A 5CJNA 5D33A 4LALA 4HA0A 1OVDA 3CHFA 4UBPC 2BTMA 2Z29A 5FEWA 4ZO9A 4ZGYA 1M03A 3W7IA 1GVQA 2QKFA 3FYPA 1ZGDA 2CPUA 1DHPA 3BLDA 4CD5A 4GI6A 4LU0A 4TXEA 5HULA 4ZQPA 4GQGA 2OYLA 2QYGA 2E9MA 3GDTA 1A0EA 1V5XA 1RD6A 3SCUA 1R30A 3P62A 3SY1A 1JYNA 2KAUC 4AZ7A 4XZNX 3PY2A 3IGUA 5F2MA 3EDEA 4Y9PA 4FF7A 3ARQA 1PYMA 1ZU8A 2H6RA 1CPUA 3URBA 2YCLB 2PWUA 7TIMA 3LZ3A 2PZ0A 2RDXA 1H2JA 1UD8A 4NAEB 2FHFA 4ERIA 3RPDA 4L4OA 3G8RA 4S3DA 3C3NA 1NJJA 2WMGA 2D2HA 3USBA 2A3CA 3VKBA 1CGUA 1JCXA 4D6HA 2NWRA 2ZBTA 4HTYA 2PU1A 3FDKA 3GWQA 1UBSA 3STCA 3E38A 4Q6JA 1XSIA 1BWVA 4IPNB 4KRTA 3TV8A 4WKHA 1UR1A 2DZXA 1QHOA 5HA7A 3AICA 3GS6A 2C1GA 3EOUA 1PHQA 2JGQA 2NQLA 3SCOA 3URNA 1JCMP 4RUBA 2VRQA 2X0HA 3V7PA 1UC4A 5FJOA 1AD4A 4JN6A 3SN1A 3T2PA 2E09A 1UIOA 2VC7A 1Q5MA 4DO4A 2I9UA 1HW6A 4LAZA 2GQ8A 1Q2SA 4X2PA 4L4LA 2KZHA 1K03A 3TYZA 2XINA 3MVIA 4UOQA 1UJQA 2ZX5A 3M1ZA 2O9OA 4JFWA 4XB3A 4AZGA 1XSKA 2Y0FA 3Q94A 3GHSA 1E6NA 1CZ1A 4DJDA 3CV1A 4AVNA 4CQAA 1XIEA 2VFGA 2BY1A 2AGKA 3AMCA 2W61A 2JKPA 3D0CA 1FH8A 3QOKA 4MKSA 5C55A 2EG8A 4BQ2A 2E67A 1HKWA 3GZ3A 1WOBA 1VBJA 4GUGA 4Y9OA 4X9YA 2A6LA 3BLIA 3DGBA 2V82A 4ATLA 4JAWA 1W32A 4CD4A 1VHCA 3R8HA 3ARZA 3B06A 3NQDA 4KWWA 1N82A 3VE9A 1N55A 1LG2A 3CT2A 3EKGA 1V3MA 1Q13A 3W88A 5I3JA 2HZGA 3A6OA 1LOQA 5DLCA 5G4HC 3Q37A 5CBJA 2QPXA 2CCRA 3QOMA 1JUBA 2RAGA 1WKDA 4KMQA 3U5UA 3UR5A 3GAKA 4V27A 4US5A 4GA8A 5BROA 2EPNA 3G5EA 4XZWA 2Z1BA 3U8GA 3GLCA 4HGXA 1H51A 1GEQA 2HJPA 2A3AA 2VI0A 2PE4A 2NUWA 3ES7A 3TK7A 2OELA 2PTZA 3CXOA 4JTGA 4AZ5A 1XUUA 4WHBA 3E0IA 4QJ4B 1IXQA 2PU0A 2QHAA 4F0LA 1XH2A 2TODA 4C7DA 1C92A 4DO5A 3EWXA 3H7VA 3GR7A 1IIHA 3RK8A 1JIBA 3GG1A 4KEUA 4TX8A 4C7GA 1FHDA 4RZ6A 1JPMA 3CGTA 3TFXA 1RUSA 3VGGA 3GVRA 3T0CA 1TO3A 2UY3A 1P6CA 3BV7A 3VNZA 1GT8A 5CJMA 2BV9A 5GJNA 4AEFA 1FWWA 3R7MA 2I17A 2POTA 3L12A 3QH2A 2IMRA 3GIPA 2QVHA 2RHGA 1EO5A 5BCAA 4DJED 2CNCA 1SO3A 3TVAA 1RPKA 1QPRA 2XH7A 2WHMA 3QLLA 2WM1A 1H0IA 3KL0A 4J1OA 4K1GA 2ZC1A 4HD5A 1Z41A 3HGJA 1KFEA 1MEHA 2G3MA 2PRLA 3GTIA 3UCCA 4AD5A 5AFDA 4W8BA 4YJ5A 3BG9A 5AOUA 3NVTA 2ZXBA 2BXZA 3W1MA 1KBJA 2R9RA 1NWRA 1FWSA 4GZ7A 3DFNA 2OG9A 1XJBA 4FNPA 5LIWX 1XD1A 3EWZA 5HJLA 3VNDA 3N18A 4WOZA 3MSRA 2LLEA 4HCHA 3INPA 1JUEA 3OPSA 4DI8A 1J0IA 4FP1A 3PJWA 4XG1A 1OJXA 3N4AA 1L8NA 4HB7A 4M1RA 5HQLA 3IAPA 4H7ZA 3VD7A 3P67A 1JI2A 2Z00A 2UBPC 1N2VA 4K68A 3ZLFA 3EDFA 1V7AA 4Q8UA 4JTAA 3MW7A 3OG3A 4XSMA 3DN5A 3CUZA 4GX8A 2VDIA 1OF6A 4JTFA 2TSYA 3OHIA 3I6RA 4UNLA 2E5CA 1KQZA 2F84A 3T42A 3W1NA 1CGTA 2B7NA 1MUMA 4DUWA 4AWUA 3L4VA 3FA4A 2JBMA 1FHVA 3NQEA 4MUPA 5CGMA 1ZBKA 1IQ8A 5XINA 3UGRA 1PIGA 3N6HA 2Q8LA 3IJLA 3O07A 4YNGA 2PDWA 4WVXA 3FSUA 1GVRA 1BYAA 3EB3A 2ZVRA 2BFGA 1XINA 1R5YA 4GNJA 1KCZA 1LCOA 3AC0A 1YDYA 2G37A 3K8LA 5D9OA 4PC8A 5AVHA 2FTPA 3CMFA 1Q8JA 5E0FA 4X22A 2QJMA 4C6BA 4GXPA 3TNOA 3WJXA 2PODA 3CZLA 3IVTA 2XH0A 2FTWA 3W7LA 2DZTA 4AD2A 1SFJA 1TX2A 4LEFA 2YYUA 3W1RA 1QW7A 1J0ZA 4GFSA 5HATA 2P3ZA 4P7RA 2DU2A 4KCVA 3K8KA 3VUPA 1CGWA 2OLHA 3MB9A 3M5YA 5G2HA 4ZL1A 2J7BA 1Q63A 3ARPA 3T07A 4JCMA 4OJYA 5LXXA 1HJSA 3MMUA 3BJSA 3TTEA 4KRUA 1I0BA 1QI0A 2PB1A 3F7JA 5EYWA 3STEA 3LYEA 5DRIA 4M6PA 1E73M 1OEPA 4FPSA 5M17A 3TIMA 3WFLA 1W3NA 2ZZ6A 2QCDA 3C56A 3WQ8A 3BARA 2O55A 3WBYA 4GYKA 2I5GA 4HOWA 4DZIA 2W4XA 1F3XA 3LQGA 3KBWA 2ZFAA 2D0GA 3GFXA 2BWGA 7PTDA 3VGBA 3AZTA 2R14A 4AFYA 3G3MA 3CIVA 1JZ4A 3N73A 3WMCA 4LOCA 3SRHA 3ITGA 1OK4A 3U4AA 4MFEA 5KZDA 5IBXA 3EX4A 1TX0A 1HL2A 4JX5A 3TAOA 1QBAA 4HSNA 1HTIA 2V5CA 2ISFA 2PZNA 2ODOA 4HA4A 2JKEA 3UT0A 2YFNA 4BR1A 1G94A 5D2YA 3LBOA 5D9MA 1AW1A 5E70A 3GXTA 1EGVA 1NFGA 1AQ0A 1C91A 4FB7A 5CPLA 4DWSB 1Q66A 2QUMA 2PMQA 4D6JA 3S1GA 1E9LA 4PCSA 3TTSA 5LNSA 2EJAA 2KX9A 1HJUA 3NQGA 5EMLA 2OMAA 3GTFA 4CN6A 2FDMA 2XWDA 1LRNA 3LMZA 1JDCA 3HOJA 1DKWA 2WM0A 4QLKA 3WK0A 3PZOA 4P7QA 2JALA 1O60A 3QF0A 4NUWA 4IJBA 1U83A 1B3ZA 1VJSA 2Z1KA 3W27A 4AD0A 2O9PA 3I7SA 1W2PA 4DUVA 4LY8A 3HGSA 3G8EA 1E3XA 2WLYA 4DHGA 2I57A 3C2FA 2QCDB 4O1EA 4Y2WA 3O6CA 3VDHA 4QCEA 1SSGA 3GC2A 1YTKA 2VZUA 3KW3A 4HNVA 3LHUA 2F61A 1ML1A 2Q01A 1GJUA 1PCWA 3DKLA 2Y61A 1WO2A 4K37A 4FALA 1J5SA 1VYSX 3KP0A 2GVEA 2WNZA 2QQ6A 1FFRA 1KBIA 4NXSA 5M1TA 1S2WA 2O9TA 3VX1A 3P61A 3AU6A 5CSYA 3TNBA 2D2GA 3FAXA 3BV4A 1QBBA 4ES4A 3W73A 3W25A 3U9IA 4C6OA 3CQKA 3P82A 3DDMA 4DY1A 3S6OA 3I3DA 1LLZA 1LOLA 4RCXA 2EBNA 1H11A 3WDQA 3VUSA 3GVWA 4ZB5A 4UTUA 3UWZA 4RW3A 1KR1A 2OB3A 4HHPA 1ONEA 1S5WA 4IH3A 2CBVA 3QBUA 3L5MA 4B9YA 1ZB5A 2H3BA 1QW9A 4BI7A 1UZDA 3CTTA 3PR2A 1JYWA 1G0CA 1TTJA 3M46A 4C6PA 3WG6A 3TLQA 3PUGA 4I8YA 4J4KA 4J7RA 3VK5A 3WH5A 1D8CA 4M24A 1QR7A 5JVLA 2OQLA 1SO4A 1MW1A 1GHRA 2C0HA 4GO8A 3JZUA 1XYAA 4KBXA 4LC6A 3IIXA 1B4KA 4XO7A 3CC1A 4E0CA 1RD5A 3TYDA 4PZVA 1TIMA 1MRQA 4IGHA 2W5FA 3LHVA 1RK6A 1OG6A 2X0SA 1UASA 5DY3A 1B90A 3TE9A 3KVLA 1JPDX 5XIMA 2DZPA 1EJVC 4WKAA 4UQAA 1XPYA 1NF0A 3ERPA 3QV6A 5D8ZA 3B0UX 4JFUA 1FWJC 4KWVA 4PUUA 4DB7A 5BW6A 2VCBA 4IJCA 3M0KA 1O5RA 1JQVA 4NRSA 4HCLA 3NCOA 1ZNNA 1R7OA 3THCA 5TIMA 1EJWC 1UZ1A 5HMDA 4OV9A 3ENLA 1OX6A 2C7FA 5A6BD 1O68A 1IWPA 4IP5A 1OABA 1W5NA 3R58A 3V0TA 5AB3A 2V3GA 1C8YA 3ARTA 5E9XA 4U4MA 2VFEA 1CIUA 3IUIA 3QW4B 3U48A 3I3BA 4H8VA 2WLZA 3IWPA 4C1KA 1R3YA 4B16A 3KDNA 3GVGA 1JVNA 1LYXA 1OFPA 4ICMA 4CNSA 3TTYA 5DF0A 8TIMA 5CZTA 5EB8A 1V8EA 5FI8A 2VGIA 3AIEA 4TMCA 5EMJA 3EWBX 4X63A 1F9CA 1RP9A 4POCA 3CAVA 4I6KA 1S2TA 2CBIA 3CYJA 2GQ9A 1TR1A 4K6AA 3CJPA 5AHIA 3W1XA 1TPUA 2VQUA 1CNVA 4LRSA 2Y5JA 3E1F1 2Q02A 4YLWA 2JFEX 2PDIA 3WLJA 4GXMA 1RQBA 1OG0A 2PDCA 4UR7A 3DYPA 4O10A 4QFUA 3VOGA 3N12A 1CXFA 1P1XA