1LQAA

Tas protein from escherichia coli in complex with nadph
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
346
structure length
346
Chain Sequence
MQYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHGLDPAQMALAFVRRQPFVASTLLGATTMDQLKTNIESLHLELSEDVLAEIEAVHQVYTYPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tas protein
publication title Crystal structure of the Escherichia coli Tas protein, an NADP(H)-dependent aldo-keto reductase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 125
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1lqaA00
4R9OA 2PDKA 4FZIA 4H8NA 3LZ3A 4FA3A 1M9HA 4ASTA 3V0SA 2DV0A 1C9WA 1J96A 1ZUAX 2FVLA 2PDMA 4GQGA 1PZ0A 3UWEA 4XK2A 4QX4A 4DBWA 3M64A 3O0KA 2HE5A 1AZ2A 2INZA 2HEJA 3R8HA 1EF3A 2DUXA 3NTYA 4JTAA 2PD5A 3LEPA 3DN5A 1PYFA 2BP1A 3R7MA 4XZHA 4JIHA 1T41A 4RPQA 3ERPA 5AZ0A 3CV6A 1QWKA 2PDWA 4XZNX 1S1PA 2CLPA 3G5EA 1S2AA 1LQAA 2ISFA 1AZ1A 1EL3A 3LQGA 1MRQA 2IPFA 2F38A 3H7UA 4L1XA 1YNPA 4YVPA 3T42A 3CASA 1Z8AA 4LB3A 2PDYA 4XZMX 3O3RA 4ZFCA 2IS7A 1X96A 3RX4A 3LZ5A 1AFSA 2HDJA 1SM9A 2PDIA 3LUTA 3R43A 1PWLA 3LNMA 3Q65A 1Z3NA 4GACA 3MB9A 4XVEA 3WBXA 4F40A 3R58A 3V0UA 1A80A 1S1RA 1T40A 1YNQA 1XGDA 4HMNA 1RY8A 2PDGA 2PDXA 1ZQ5A 2ACQA 3R8GA 4DZ5A 5LIWX 4LAZA 5HNTA 1X97A 3BV7A 4PRTA 2FZDA 3GUGA 4YVVA 2HVOA 2PFHA 3EB3A 4WEVX 2BGSA 3BCJA 2PEVA 2PDUA 1Q5MA 3CAVA 3MC5A 4OTKA 4QBXA 4EXAA 1AH4A 3FX4A 2PDPA 4GIEA 1EXBA 3WCZA 5HNUA 3ONCA 4LBSA 4JQ2A 3UP8A 4GQ0A 1EKOA 2IKJA 2C91A 2PDJA 2IKGA 4ICCX 1UR3M 1K8CA 4PMJA 3UG8A 3VXGA 2ACRA 3S3GA 3UZWA 1MI3A 4JQ3A 4XZLX 3CAQA 4WDXA 4LAUA 3P2VA 2PDBA 3BURA 1IEIA 3G1RA 5KETA 3KRBA 3UZYA 3R94A 4IJCA 5HA7A 3D3FA 3Q67A 3V36A 4EXBA 4JTRA 2PDCA 2ACUA 4PR4A 4JTDA 3LD5A 5JH2A 4XO6A 3LN3A 2I17A 2J8TA 1AH3A 4QR6A 2F2KA 1VBJA 1LWIA 4WDWA 4LBRA 4L1WA 5AZ1A 2QXWA 2INEA 4WDTA 3WG6A 3N2TA 4IGSA 1HQTA 1GVEA 3CV7A 3M4HA 1JEZA 5JH1A 2NVDA 4Q3MA 3CMFA 1ZGDA 2R24A 3V0TA 1XF0A 5LIYX 2FZ9A 4JTQA 2ACSA 4I5XA 5M2FX 1YE4A 1MZRA 4HBKA 2HV5A 4AUBA 3GHTA 3H7RA 3UZZA 2WZTA 4MHBA 3COTA 1AH0A 1US0A 4JTCA 4H7CA 4JQ4A 4JQAA 4PRRA 2FGBA 2A79A 2PDHA 3EB4A 3WBWA 2BGQA 2IPJA 3EAUA 1PWMA 2PF8A 1IHIA 1ADSA 3UFYA 2HVNA 4FALA 2AGTA 4JQ1A 4GCAA 4XO7A 4WDUA 4GA8A 3RX2A 4LB4A 3RX3A 2ALRA 1RALA 2FZ8A 4G5DA 2PDNA 4Q7BA 2PZNA 2IPWA 4YVXA 4JIRA 5LIUX 1Q13A 4WGHA 3U2CA 4NKCA 1S2CA 1Z9AA 1QRQA 3QKZA 2WZMA 4JIIX 4WRHA 4XAPA 3UYIA 3LQLA 2FZBA 3R6IA 3DOPA 3C3UA 4FAMA 1Z89A 2R9RA 3LENA 4GABA 4PUUA 1PZ1A 2IPGA 3N6QA 2IQ0A 1OG6A 2VDGA 3GHSA 5C7HA 1YE6A 2PDFA 2IKIA 3M0IA 3GHUA 1VP5A 1XJBA 1ZSXA 2P5NA 2NVCA 1FRBA 3BUVA 3UZXA 2IQDA 3LBOA 3B3DA 3H4GA 2HE8A 4YU1A 1HW6A 4XVDA 3V35A 5LIXX 3UGRA 1RY0A 4IJRA 2PD9A 2PDQA 5LIKX 3GHRA 4DBSA 2IKHA 4YS1A 4QXIA 1R38A 4PUWA 4XZIA 5DANA 3F7JA 2DUZA 3ONBA 3FJNA 3WBYA 1X98A 2I16A 4DBUA 2PDLA
chains in the Genus database with same CATH superfamily
2VOMA 2PDKA 1S46A 1YTEA 2NT0A 2VZVA 1H1ZA 2XTKA 4XD6A 3GXFA 3PUEA 1HO1A 3ABSA 5G1TA 3AJXA 4AC1X 3KL0A 1FKWA 3G6MA 3V0SA 4RW3A 5T8GA 4CU7A 1EJVC 2J7GA 4X63A 2ISWA 1E6PA 2NV1A 4E4UA 3TQKA 1XIDA 2V5KA 1WDDA 2V81A 1NWRA 4LUSB 1EJXC 3LLFA 1GOIA 3VNJA 3MVIA 3G0UA 4ZFMA 3K8LA 5MF5A 4O1AA 1K7XA 1QNVA 1FWRA 3KBMA 3WMBA 1T8QA 3C8FA 3AS3A 4RNJA 1PX3A 5EMYA 2DPEA 1SW0A 4UQCA 2A85A 4BKNA 3GFZA 4DEFA 2Z6IA 5AZ0A 3MHGA 3PPGA 1K02A 4HYWA 5EKYA 4ICNA 1BG9A 3PVFA 2XH0A 1MXSA 3R25A 4QE1A 3SM0A 2R6OA 4JTHA 1UKSA 3M46A 1RR2A 4A05A 4FB7A 1M7PA 1OFPA 2AL1A 3O3RA 4GRSA 2IS7A 1G69A 2R1NA 1PDYA 2OO6A 2ZA3A 2PDIA 3V5FA 2PCEA 1H63A 1JIBA 3S1UA 1T40A 5JBFA 4NNBA 2P3EA 5G2WA 1KXVA 1YNQA 3O2LA 2OZTA 2O9RA 3GO2A 1C29A 2OPJA 3WQ5A 2E09A 1TPFA 1Q7ZA 4MY9A 2OOGA 2WXDM 4O13A 1VLWA 3SRFA 2CZ5A 4RV3A 2DU2A 1KTCA 3QPYA 1WZLA 1GVFA 6A3HA 2ASHA 4GKLA 2ZWYA 3FX4A 3MSGA 4GIEA 2RJHA 4C91A 1D3HA 3WCZA 3WH8A 3GNNA 3TN3A 1WA3A 4Y8EA 3R0DA 3VGBA 1QW8A 4C6MA 3BH4A 3ARQA 1UR4A 1XRVA 5A2CA 1QT1A 1Y65A 2EAWA 2Y6ZA 2YGYA 3M5XA 4F0LA 3LI0A 4MJ4A 1OFAA 1YLVA 1GGOA 3U7BA 3JUGA 2DVXA 4EPDC 5DF0A 2BXZA 5K2ZA 1ME9A 3P0XA 3QGAC 2BY3A 5FCZA 4O0QA 4XZLX 3KL3A 4QAIA 1JYXA 3TN4A 2OR2A 3ITGA 5F2MA 5FAJA 3EOLA 5IM51 3BG5A 3TX9A 2ABAA 4HN8A 3UPMA 3W88A 2J27A 1UA7A 1CWYA 1J79A 1CX9A 4JTJA 4JIPA 4FLSA 3CT7A 4JTDA 3ZVHA 5C7VA 2QCGA 3N6HA 4XTIA 4XO6A 5EYWA 3WKZA 3VI2A 2J9XA 2WCSA 3KVLA 2JKAA 1EUNA 3GBDA 3R1ZA 1XBVA 5KSWA 1X1ZA 4UFHA 2E67A 1ONWA 2PU1A 1CGVA 3DFYA 2I5IA 1HG3A 4K7YA 3NZQA 3GK0A 3MV11 1V3JA 4U10A 4RNFA 1KQYA 4CCDA 5H8PA 3R10A 5I3HA 3R89A 4Q8OA 1V0KA 1YE4A 3CHDA 2D23A 1DJHA 2V3GA 5K9DA 3UQNA 5HR6A 1A5SA 1UP0A 3IAPA 1I6NA 3SCRA 2R1PA 3C8NA 3F2DA 1E15A 4L6DA 1LORA 1WKFA 4RE0A 2FPVA 3QR0A 2DIKA 4B4HA 2DZWA 1DWHM 3ABZA 3S9YA 3QGVA 4JQAA 4WKFA 1H5YA 2EPLX 7XIMA 2BASA 5T91A 1RQBA 1XLDA 3OB8A 1YX1A 4Q32A 1XLGA 1VCFA 4AISA 4ZTXA 3L4VA 1TRDA 1TIWA 2VMFA 5I24A 3UFYA 1UZ1A 4ACZA 1VEOA 3WF2A 1GT8A 1OYCA 2WMIB 1Q66A 4J40A 4GA8A 1U33A 2QIWA 3BK0A 5AECA 5AHFA 3RX3A 3EKZA 5EMJA 1HGWA 1PX8A 4JNYA 2EPMX 3VNMA 1YDYA 3DCPA 3TQVA 1DVJA 3QM3A 3EKGA 3NGFA 4AX7A 3VKCA 1UKQA 1QOQA 4JHOA 3TQPA 4LF2A 1YDVA 3A4AA 4HP5A 1H09A 4MB1A 3CK5A 1EBGA 1VF8A 1F6KA 3LENA 3CB3A 2WW5A 3HPAA 1TPWA 1XYFA 2W5FA 3H55A 4ECLA 1PS9A 1KWGA 1DBTA 2IQ0A 1PDZA 4ZTYA 3CL8A 3BAYA 3CB8A 5HNNA 3S1VA 4MJZA 1EA9C 1JPKA 2IKIA 4RDVA 3FV9A 5DXXA 2SFPA 5BXRA 9RUBA 3R8RA 1DHPA 3BAXA 1EX5A 2V63A 6CGTA 1FOBA 4BI5A 3AS2A 3S9IA 3DAQA 1QAPA 2Z1XA 4WOQA 4NP7A 3NEVA 1HW6A 2V9DA 3RU6A 1R47A 5LIXX 4UTWC 2OWXA 3DIPA 1A3HA 1XR2A 3TJLA 2FGLA 3N17A 2VR5A 3I7SA 4XZIA 2EPKX 5JUVA 1ZTVA 3GFYA 2DT2A 3NOYA 2PWHA 3K1GA 3UXDA 2OGYA 7A3HA 3N04A 4K36A 4YNGA 2VO5A 3LX9A 1P43A 1WV2A 5EMUA 1LRQA 4EACA 4R5EA 4JCMA 3AICA 1M1BA 3EDJA 5LA1A 4Z2LA 2IXVA 1RZMA 5JBDA 4ZBCA 2BWGA 3FW6A 4P7QA 3W2UA 4CNOA 3L5MA 1BQCA 2D2GA 3CZGA 3KRSA 3BAKA 1VD6A 2BVYA 5AC4A 3NTYA 2Q3OA 4IX0A 1TJPA 2PD5A 3W7RA 3PJTA 3OLEA 1Q3NA 3WUFA 1FWBC 4N9CA 2Z26A 3VOGA 1M7XA 4QG9A 3PZTA 4M3PA 3L2IA 3VCCA 1V6TA 4AC7C 4JDBA 4K8GA 2QQ6A 5B7YA 1F73A 4FEZA 1XC6A 4A2RA 5HINA 4JOMA 3C56A 5AHEA 5BMWA 4LCRA 4Y8FA 3ZXWA 5H1WA 1V8EA 4UB9A 3AIVA 2ZOXA 4GYPA 5KTLA 1X38A 3LBMA 3LRMA 1BVZA 3T42A 1AMKA 1UKOA 1MVYA 1HKWA 4NAFA 1Z32X 4XD5A 2ZRWA 1X8FA 2YBTA 1R30A 3UXIA 3TK7A 4PULA 1AK5A 4AWTA 4IIEA 3LNMA 1TCMA 3THQA 3N2OA 4IMEA 5FSDC 1P6WA 4QG6A 4MZ1A 3ZSSA 5D2VA 5HJYA 2XIJA 3MKVA 3E2RA 1TJ0A 8XIMA 4BHYA 1YYAA 2YL9A 3O1NA 1RCOB 1OX5A 1JZ6A 4R9XA 4CCCA 2ANUA 2V38A 1EGVA 2YCKX 2VX4A 1UUQA 2PFHA 5FKYA 4E4FA 4Q6JA 1ZB5A 3QR1A 1NWTA 2V2HA 4YJ5A 5AYXA 3O16A 2VEMA 2GUBA 5F4SA 4NVTA 4HK6A 4C5ZA 2CLEA 2VZUA 4KWOA 5E0CA 1AH4A 3VU2A 1KO0A 1QUMA 4FXFA 4UQBA 4CN1A 2PDPA 1Q63A 1NVMA 1S2VA 1NWUA 5HQLA 5HNUA 3WLHA 3KBVA 2E5CA 1UA3A 1MXDA 3NQ8A 5M1TA 3WLJA 4F0RA 2X0YA 4Z2IA 3T08A 3EWYA 1WDSA 2J9ZA 3UXAA 2JALA 3TDFA 1O12A 2PTXA 2KZHA 5C5YA 3T8LA 3MCOA 1UWRA 3SCUA 4ZE5A 4D8AA 2OT0A 3CAQA 1POKA 4EWND 4GI9A 2XU2A 4MVAA 4C6KA 2Z2AA 1JZ5A 4TUFA 3TJ4A 1K77A 4ATWA 4PCNA 4GE8A 3E5PA 2C1GA 2ACUA 3EXRA 5CPSA 3IGUA 4I9MA 5TNVA 3S5OA 4NAEA 4GBUA 3BGGA 4LALA 5A8NA 2WMKA 5I3IA 1H5VA 2DZXA 3EWXA 2A21A 3L5AA 3NQDA 5DEZA 4UZUA 1QNQA 5KZEA 3VKDA 2PWGA 3T0TA 2QCHA 1XDMA 3KVJA 3NVTA 2ZC1A 1XF0A 3IJDA 3S1XA 3T07A 3R5EA 1FH9A 3N19B 1NELA 1UROA 2FZ9A 1AD1A 4I5XA 1RA5A 2QCMA 1K9DA 1UPMB 4B3LA 1QDSA 3CZKA 2C19A 5LXEA 1GHSA 3RM4A 3MDUA 3AWNA 3V7PA 1XYBA 3HV9A 3CQKA 4TXEA 4JD4A 1VENA 1ZJAA 4N42A 3MCNA 3QC0A 1TZ7A 4ATDA 4O19A 3UJEA 1Z6KA 2MUCA 7PTDA 4H7CA 4N9EA 1TV5A 2Z27A 4JQ4A 1W9UA 3CU2A 3VE7A 1OX4B 1GTHA 3EB4A 2ZZ5A 3PNZA 1R3SA 3TH6A 1YEYA 1O68A 3O6AA 5B80A 2PLMA 3LPPA 4KKXA 2PF8A 2E9LA 1R3YA 4JKKA 1KTNA 4FALA 1XUUA 4L61A 1VPXA 1DKWA 1R9YA 3AHXA 9XIAA 1JYWA 4BFAA 2OLSA 1J4EA 3R13A 3F4NA 4IPIA 3WEMA 1SW7A 1HVXA 3LV5A 2DSKA 3GVQA 4PUJA 4GO8A 4NRRA 3IV3A 1A0CA 3GE7A 4RK8A 1FFRA 3DI0A 4LYRA 2PWFA 3U8GA 1WDQA 4KCVA 3BMVA 3UG4A 2X8RA 4JYEA 1J01A 3SCPA 2WMJA 3FNDA 2BS9A 2ONEA 3EKLA 4MM1A 4R7WA 4LANA 1ME7A 3NR0A 2WMFA 4JDYA 3QZAA 3ZOAA 2CLLA 3E0WA 2D3LA 3ME3A 2GSEA 3A24A 1W54A 4LEQA 5KMYA 4MWAA 3O07A 4DIAA 1TPH1 4HZ8A 3CZEA 3VILA 1A5KC 4FR6A 1NSJA 4P7RA 4AW7A 4PMUA 4HNUA 5AC5A 4N6EA 2INFA 2GWNA 4CN6A 1A5MC 3RJYA 5C9XA 2RH9A 4DY1A 3R0UA 3OG3A 3VD9A 1GVSA 4IG2B 1LRNA 5CXPA 4U33A 1MQPA 4U28A 2A3HA 1E56A 4D2JA 4JTFA 3R12A 4MWAE 3GC4A 4NZCA 3DGBA 1BVNP 3VFCA 3VOIA 2YPIA 1TPDA 4UUIA 8XIAA 5JU6A 5HNRA 2V5JA 1TWZA 4GY0A 3FJNA 2RDUA 2Z2BA 3M0HA 4D6IA 1QR7A 3W00A 5DRCA 4MDOA 2VC6A 2NUXA 3PZ9A 2QJNA 4HPHA 3GX9A 4R9OA 2DSVA 2O7QA 2A7RA 3LZ3A 5DMYA 2VT0A 1J5SA 3IRSA 2REQB 2JE8A 3KRUA 1WDWA 2Y62A 1J96A 2E6AA 3KE0A 3WF1A 1YIXA 1JNEA 3VZYA 3MYPA 4GQGA 5A6BA 3CUIA 3E49A 4XK2A 3VX1A 2VGIA 4HKPA 1Q6RA 3W2MA 4UCGA 1PAMA 2P8BA 2NX1A 1JZ8A 3RCNA 2E40A 4LS0A 5F1VA 2FMNA 4Y90A 5REQB 3TCSA 4D1JA 3GIQA 3N4EA 3KWSA 4ZCWA 1MZHA 4F9JA 3WK3A 1IZKA 4LUIA 1M01A 1RQHA 2QCDB 1X7FA 2WVSA 5TIMA 3VIHA 2QDGA 2B81A 1CZ1A 3SADA 4CU6A 1JPDX 3K13A 3BZJA 3W1PA 2F38A 2F8QA 1NFBA 3P7YA 3AS1A 2DZAA 3ZFHA 3CQ0A 4XZMX 3T0DA 4FNRA 2XIIA 3JW7A 4BZYA 4H9UA 1JDCA 3SO7A 4FIRA 2XFFA 1R2SA 3QF0A 3RN6A 4WD0A 4N02A 4DNMA 4X9SA 4JN6A 3GU9A 2A1YA 1TMQA 3GC5A 1H1NA 1ADDA 3K4DA 1FQ0A 4P7OA 3USZA 3SQSA 4AYGA 5HNTA 3NZ1A 6XIMA 5A6LA 2O55A 1VIZA 2ZX5A 2C71A 5J8LA 3M0YA 2O92A 2PCQA 3BW3A 4I3GA 2A6LA 3FK4A 3RG6A 1VHNA 2BNJA 2C79A 1H3GA 2YB4A 3BG9A 2UY2A 4EXAA 1GORA 4GZEA 2WJZA 4CD6A 4FOKA 3W75A 3K2GA 4KETA 3BVJA 1WCGA 4LRSA 3HMJG 2WSPA 1PCKA 1EXBA 2PSNA 2WCAA 4HOXA 2ICSA 4JTSA 3C0JA 3MKKA 5C9RA 4Q7NA 1LBLA 2VOTA 2Z24A 1KC7A 2C6QA 5J04A 1UD4A 4ICCX 1JF6A 2BBFA 4NZ3A 1YBQB 4W5ZA 4MOZA 1KGXA 5TF0A 3S2MA 4PUEA 3QHNA 1MMFA 2DP3A 3QRHA 2ZE3A 4J3ZA 1N2VA 3MUCA 5BZAA 5D9PA 2VVNA 1KA9F 2GSHA 3D3FA 5HJXA 2YDAA 3V36A 1VFMA 1GUVA 1ZP3A 4RZ5A 3QQ0A 3KTXA 3GXMA 1C92A 5CZSA 3PJWA 4AD1A 4BQ5A 2JQXA 2QKFA 3GXDA 3BG3A 1JF5A 1VCGA 2XJ7A 3N4FA 3LLDA 4AXNA 1LWIA 1RPXA 3PR2A 5K9XA 4WF7A 1ZAIA 2FZNA 4W88A 3VDHA 5E6ZA 3WF0A 1TYGA 2B0MA 4GIYA 1AJ0A 2E77A 4WDTA 1XH2A 3M6YA 2XYLA 1GYLA 1EEXA 4H00A 1SO4A 4DB7A 3GB6A 2XVLA 5I3KA 3QFWA 5BRQA 1N7KA 4J2PA 1IE7C 1OD0A 4JTQA 4G8TA 1KR1A 2ACSA 4IXXA 3B0UX 3ABQA 2UY3A 4OWGA 3IUDA 5A8PA 3HG4A 2I1OA 2VQTA 4O52A 2FLIA 2HROA 3EXTA 1GOOA 2WZTA 2E1WA 3CUGA 4MKNA 3HU7A 1S38A 4X60A 4QROA 1UASA 1JAEA 4ZVJA 1W1ZA 4K6AA 2FGZA 3MT1A 3ZSTA 1KM3A 1DQUA 4C1NB 4US5A 1YPFA 1RD5A 1DIKA 1IWAA 4FK9A 4JPGA 4O18A 3AIEA 2TMDA 4NZ5A 2FQIA 4W87A 3URBA 1AQHA 4NYYA 5B7ZA 6REQB 1D8CA 4CD4A 4LB4A 4HK5A 3P5YA 2PDNA 1QI3A 1DIOA 1FHLA 3G24A 3DYOA 1WZMA 3UU0A 3M44A 1VGAA 1Q13A 4M6UA 1H62A 1TWWA 3V4BA 1Z9AA 5C0QA 2PGFA 3FHQA 2EJAA 3CIVA 4QITA 4HU8A 2F61A 5E93A 1L6SA 3HJEA 2BOGX 2ZRYA 2QVNA 3MW7A 5AC6A 4L56A 4PMZA 5I02A 2FVKA 5BOFA 2POTA 3MTWA 5J5DA 2IPGA 4HOZA 3LM7A 2YXOA 3H2AA 3N15A 2D73A 4B5UA 1QK2A 3PTQA 1GK8A 4BQ3A 2YOCA 1O7AA 2A6NA 3GD6A 4HHHA 4HU4A 2EEXA 4S3DA 5E70A 5I6SA 1V4YA 1F8IA 4PMVA 2F6UA 5D38A 4HCHA 1GHRA 4Z17A 1W5OA 1FRBA 1JYVA 2GGEA 1Z7AA 4RXFA 1W9XA 1VZWA 3H2EA 3LCFA 3A22A 2W67A 3VOJA 5LNRA 4LSBA 3BZGA 2V2CA 2XSXA 1NOFA 1KFWA 1PXGA 3GH5A 2XSAA 4YS1A 1P0NA 1U5JA 1SJDA 3ONBA 1XIEA 1BFNA 1W8GA 1BPLB 4PB5A 3PWAA 2FKPA 2QUTA 3TOYA 1UPPA 2R82A 5DX7A 3R8HA 2BVWA 4MY8A 3GSMA 2G95A 1NIUA 5GNYA 4E0CA 1HO4A 1J0IA 3GLCA 3SB0A 3EZ4A 4ZQMA 4ASTA 1KFJA 4C6QA 1TR1A 1LOLA 4BCEA 4W84A 1PZ0A 2J13A 4WY0A 5AC8A 3CYVA 4X0NA 1AA1B 4TOQA 2HE5A 1SR9A 3AZRA 3A4JA 3VIPA 1E6NA 3RUBL 2CWNA 3VMNA 4DN1A 5HWNA 3SUVA 3WQDA 4RLIA 3RIKA 3FAXA 2Y70A 4YTRA 2QVHA 4PCPA 3GIYA 1BYCA 1EDQA 4AG0A 3U2EA 1FH7A 1RBAA 2EG6A 5CSUA 3AMKA 5CPLA 3AWOA 4D6DA 3H7UA 4CNUA 1Q85A 2GLKA 2EKGA 5FJIA 3VIJA 1W9BM 3KAOA 4L64A 3IJLA 3B0VC 3GH7A 2PE4A 3NM1A 4JY8A 1TV3A 2W0UA 4GJJA 1SR0A 3CHCA 1SM9A 3H2OA 4GACA 4P5UA 5SWUA 1S1RA 1FXPA 3OVQA 1CXFA 2WSYA 4XAFA 1MEWA 3M5VA 3AIUA 4HA3A 5M03A 3I6EA 3R8GA 1XCFA 2W3ZA 1GKQA 2OX4A 4XQ6A 3GUWA 1XGEA 5JIWA 1K9EA 1V79A 3M1ZA 1OQFA 2NQHA 1DE6A 3BCJA 3QSTA 2ZZ7A 3V5CA 4FNTA 5JIPA 1KFEA 2QCLA 4KCTA 3T78A 3QW3A 5AKQA 2BY1A 1E9ZB 5LGZA 1WUFA 1UH4A 3DYPA 1NFPA 1PE1A 2GPTA 4INFA 3ANUA 7CGTA 3AUJA 3SCVA 1IF2A 2PDJA 3FDGA 1EJTC 4C6DA 2R94A 2WC4A 1FX6A 3CM4A 3PB2A 1F2JA 3HQPA 4MLJA 1U22A 3QMTA 4UZSA 3NOEA 3JZEA 3FVDA 1NH6A 1C90A 3GTXA 3SRKA 4JX4A 3PF3A 5KETA 3LI1A 1XDLA 4N9BA 3HO8A 1EC8A 3S2JA 3A47A 5A6SA 3RR4A 2CBVA 3NA8A 4DZHA 1EDTA 3LYEA 3OOQA 3GWQA 2PDCA 4C1LA 3I3DA 4PR4A 1UBSA 4ORMA 1Q6DA 4FXSA 1XI3A 3TW9A 2ZZ1A 4QR6A 1F05A 4NI3A 5DN1A 4BF7A 4S3GA 5GNXA 1ZAJA 4UBPC 1SJCA 5D9OA 1OFDA 1W9DM 5AC7A 3NFUA 5CBJA 1AD4A 3QQ1A 5CJ5A 1IXQA 3ANYA 1JEZA 3W07A 1Q45A 2Y85A 2PMQA 1WPCA 1VKFA 2GK1B 1FH8A 3LM3A 1L8NA 3WLMA 1BD0A 4P8XA 1SMDA 1D2KA 1E6ZA 2Q8LA 3IV8A 5HUOA 1O1ZA 1KV8A 2YLAA 4OU1A 2HS6A 4NASA 2ZZ2A 1F61A 2VGGA 4JS3A 3RAOA 3SUWA 3DBNA 3H7RA 1PCWA 1UWUA 1JGMA 2ZWZA 3EOSA 3FA3A 2DT0A 4GXPA 1SMAA 5H2ZA 4IFRA 1F5ZA 1BRLB 4Q4QA 3OZOA 2WK2A 3URAA 3DFTA 2ZA2A 3BW4A 3U6WA 1TQJA 4AWUA 3PJXA 3T2QA 2GJNA 5AVHA 2H3DA 4NHVA 3GYEA 4JIEA 4WSJA 4YTUA 1WE5A 4GCAA 4JFTA 1T0OA 4XUGA 5DMNA 3PUOA 5FF3A 4HZ7A 4UTTA 3WQCA 5ABFB 4J5NA 1NARA 2X40A 2V8ZA 2JEQA 3TSMA 1AG1O 1OK4A 1UW9A 1AQFA 3NQAA 1IYXA 4HN4A 1PIIA 1I2PA 3CEUA 1DEDA 2J47A 2OXNA 1U30A 4W5UA 4JNZA 1TREA 1FCVA 2W9MA 1XFBA 1ICQA 4WQ6A 4WY0B 4OBSA 1ZLPA 3LPOA 3ARWA 3AYRA 3IRDA 4J3UA 2X2GA 3A3WA 3TAOA 1Q6CA 3QY6A 3FEMA 3BTNA 2WZEA 4MMWA 1L8PA 4OBTA 1J0ZA 4C7GA 3UYIA 3CTLA 3VKKA 5A6MA 5A2BA 4KPLA 1WOBA 4AZHA 4GABA 2DEPA 3E0LA 1PHQA 1RJRA 2VYOA 3AYTA 4BR1A 1E1CA 1WZAA 3MPGA 4MG4A 3FCPA 3KZSA 4LVBA 3T9PA 3UCDA 1YE6A 6ENLA 1AUSL 1MEHA 4ZO9A 5IRPA 3UGVA 1XW8A 5M17A 1GWJA 2IQDA 3W7EA 2XWEA 3S6OA 4XVDA 4PEEA 3V35A 4DYKA 2AL2B 3D3AA 3AYVA 3KL5A 5C9ZA 1F3EA 4R33A 4BA0A 4S3KA 1FWFC 4E5TA 2OOFA 3VKAA 5BWFA 4MZ8A 1ZP4A 3LSCA 1SFLA 1XFCA 3FYPA 1BVWA 4HA4A 1OWQA 1EP3A 1ODZA 1TQXA 1PO9A 4J3SA 1ZENA 5L6UA 1KLZA 3EWWA 1XQLA 1UR2A 3EEGA 3Q2DA 3GR4A 4GGBA 3D6NA 1KFLA 3EBVA 2JKPA 2O0TA 1F4AA 1CLVA 2ZCGA 5LNWA 4WUIA 3HG5A 1EHNA 4GC3A 2OKOA 1TJRA 4QQ3A 3U4FA 2QUUA 3PP7A 4UR9A 3KOXA 3F4CA 1DWJM 2ZTJA 4WR3A 2DORA 4IUGA 1SZEA 1TA3A 1Q8JA 5EU9A 1Q2RA 2ZZ6A 1FWWA 1PKLA 5FI8A 3LEPA 3WNKA 1K7EA 4RW5A 3H4WA 3S8HA 5LA2A 4GX8A 3KBSA 2OCZA 3WDRA 1UWIA 5AY7A 3EXSA 3I4KA 3LTPA 3L7RA 1S39A 4HU3A 3OQEA 4BI6A 1IWPA 2A3LA 4I7WA 5FJTA 1CXKA 5A6JA 1TO3A 2FIQA 5C55A 1FWNA 3CASA 1Z8AA 2Y7EA 3B9NA 1D9EA 2FB2A 3AXXA 4AIBA 3CZ8A 1FDZA 2WZHA 4QQUA 3ANVA 3QV9A 5LGXA 3QZEA 4J7RA 1A47A 1GQLA 2GFTA 1KB3A 2OELA 3QFEA 3B8IA 1J9YA 1UC5A 1ZJIA 2JBMA 3S5ZA 1MFVA 2FZDA 3CO4A 4U5IA 2OODA 4V15A 3HGOA 1HGYA 1TTPA 1N8IA 1KFBA 2Y8UA 3HQNA 2CLHA 4MB5A 4Z2KA 3ZWTA 3SY5A 3GVVA 1Q5MA 3CAVA 3W22A 3SURA 3B03A 1OT1A 3V1PA 1GVRA 4O53A 2YCLB 4B92A 1MUCA 3CO8A 3GDBA 4OTKA 4GI6A 4GQQA 2FH6A 3NURA 3U4AA 3DH7A 4B91A 1BSLA 4IGHA 1D8WA 4C6IA 2ZZ4A 5CPTA 1OF6A 3B8DA 3ONCA 3FSUA 1FWAC 1EKOA 3QY8A 2NZLA 3EOUA 4X22A 1TPEA 1XM3A 3KBJA 3WLTA 1TB3A 1WNOA 2WQDA 4L65A 4MADA 3H23A 2VWTA 3F2BA 2AMXA 3UWUA 3FGCA 4YIWA 1R3QA 2JKEA 3C3NA 3QXBA 2EQDA 1LYXA 2J24A 4OZOA 1PEZA 3L23A 2NVAA 4HNNA 4LAUA 3V1HA 3P2VA 2B7PA 3TFXA 4J3TA 4EAMA 3NIYA 3W53A 1CIUA 3C0QA 4IIGA 3VGDA 1XRTA 4J9JA 1ZBKA 3VUPA 4LNCA 4YHGA 1DQXA 1NP0A 4ZB2A 2WANA 3I3BA 1DXIA 5EY5A 2Y5SA 2QPUA 4QDMA 4IXHA 4GQRA 3LN3A 1S2TA 4KW2A 3BANA 1JD9A 2W66A 5CPNA 3C0LA 4JTTA 2CKSA 1MW1A 1SSGA 1TVLA 4NZ1A 1XH0A 2PUZA 2V5BA 2C0HA 3AHVA 4ZGYA 3M4HA 1AQ0A 1E4NA 3CMFA 4KEMA 2OZ0A 2JEPA 3NO1A 2FPTA 4QAWA 4DXVA 2PGRA 2CC0A 2GQAA 3UG3A 4AF0A 3BXWA 3BAIA 3D47A 1Q6EA 4GK8A 5FEWA 3NEHA 5CJNA 3L68A 3TTQA 1TSIA 1THFD 2QHAA 4CGTA 1GQJA 4MHBA 3QV7A 3KCJA 4IWWA 2ZYFA 3LCLA 3QYSA 4POCA 2HS8A 2YA2A 3MYOA 5A6BD 2HVMA 1V6XA 2HRWA 2RFGA 2Z7KA 1KKRA 5D03A 2BGQA 2ATMA 4J3VA 3AISA 5CC5A 1XGZA 1ONEA 3N3TA 3LHWA 1XKYA 3WLRA 1YPXA 3QOKA 4WDUA 2CIPA 5I23A 1H1YA 4ZE4A 2Z1KA 4TQTA 1RHCA 1KGWA 3BMWA 1LL6A 1J18A 4IQDA 2FFCA 3GIPA 3OGRA 3B4UA 4GJ1A 3TTYA 3N2XA 5IOBA 2VEKA 3MUZ1 4I9AA 4AMAA 4Z1AA 1XCWA 4L4PA 4KH2A 2IQTA 1WP6A 1ECQA 1LT8A 2B7QA 3WQ6A 1R3RA 2OWCA 5CSSA 2BY0A 5D4YA 3WD0A 3ZZ1A 2V2DA 4E2BA 3FY1A 3CQHA 2OYMA 4QRNA 4O10A 3LG3A 5FJPA 2FTWA 2JIWA 4PTVA 1TJ1A 3GAYA 1IXOA 3WH7A 2P8CA 2FB3A 1PZ1A 1XLBA 3QMSA 2JK2A 3OBAA 1E0TA 2OLHA 3W76A 2C13A 5ABEA 4ONVA 5G2HA 1VP5A 4JEQA 4BF9A 4LAMA 1O60A 4B3KA 1F9CA 2WMGA 4XZBA 1SO6A 1GOXA 4OUIA 4NL1A 4DO5A 4CUCA 1S5WA 3QC3A 5E1QA 3T2OA 1E55A 4ZQRA 4GUIA 5CC6A 1ITCA 3LGEA 1I0DA 5KINA 1ENUA 4TV5A 4ZOAA 2ZXAA 2IKHA 2J4GA 3G6LA 2CLFA 2E9BA 3FOKA 5LNUA 4GNJA 3WLOA 3R2GA 3U2OA 1GG0A 4KCWA 4QDWA 1ZFJA 3CUFA 1P0BA 5GNZA 1OYAA 4LW7A 3VOCA 3BLIA 1FWHC 4H19A 4H2CA 4O50A 1PSCA 4UMCA 1ICPA 1K9TA 1XIJA 1LBFA 3UPBA 1DTUA 2YX0A 3HV8A 4B16A 3GG8A 2DV0A 3H53A 3KBWA 1O5RA 1ZUAX 1X6LA 2HPIA 1W8SA 1P48A 3G3DA 2INZA 3IGHX 2ZUMA 5BXTA 4IFOA 3MV01 3KTCA 4S3AA 4DJED 3WL0A 2QAPA 2CZDA 1QWKA 3NZPA 2PTYA 4G6CA 2W27A 4U31A 2QR6A 1UP3A 3EX3A 4C6NA 4PMRA 2E3ZA 3OP2A 1M6JA 2HXUA 1JGIA 1AZ1A 1T96A 2VEFA 2AMGA 1POJA 2WB5A 4AY7A 2HWGA 4YVPA 4Q8MA 3URQA 2ZTKA 4FLQA 1NFGA 1UR1A 3XINA 1T6MA 1H0GA 4ZFCA 3NG3A 4F8XA 1JAKA 1VC4A 2P88A 3V5OA 4G7EB 4WSHA 1UH2A 1SVDA 3IIVA 2OVLA 4FLRA 3MO4A 4QHRA 5D32A 5C2GA 5DELA 4WX2A 3S5NA 3CV2A 3WH5A 3FSTA 4AEOA 3UG5A 1QXLA 3BV4A 4O28A 1DWGM 1C93A 4L9ZA 4DZ5A 1OSEA 3TZFA 4BQ2A 3POHA 1KV5A 2DZPA 4H9MA 3K4WA 3PPCA 2J9YA 2XGIA 3VDAA 4L1GA 4AF0B 2Y8VA 2PEVA 3CUJA 5CC7A 2H8ZA 2VRJA 4AHOA 4ICMA 4L7ZA 1QNSA 4IP5A 1JCTA 1JZ3A 2NQZA 4UTLA 1IGSA 4NNCA 2PWEA 3EOEA 5IDIA 1FHUA 3SY1A 3UY8A 4XKYB 1HJVA 3O06A 5DMLA 4LBSA 4GQ0A 1YXCA 1H7XA 1ZU8A 4XD4A 5I7GA 3EMQA 1R6WA 3TOPA 4PZVA 3EDKA 4L6HA 1GCYA 3TYBA 4PGLA 2FYMA 3UG8A 3U7VA 1UZHA 5XIMA 1JRBA 1SGJA 3PZQA 5JQ9A 1VRXA 4W8BA 3WDHA 1KGUA 4HCLA 2X1UA 3BMXA 1W1IE 3DBPA 3CWNA 1ZRQA 2ZUSA 4CQ8A 3ALFA 3M7WA 3H2NA 4JHZA 1WBHA 3G1HA 4LPCA 1YHTA 3RO6A 2OMAA 4A3HA 3E0IA 1L2UA 1MW0A 3BOFA 3OQ8A 2VX7A 3WN6A 4GUFA 1UUOA 3IANA 2ESCA 3F4DA 4QNEA 3ITVA 4MNJA 1C3FA 4O12A 1FTXA 2OTDA 1WUEA 4PTMA 5C70A 4WKAA 3W6YA 3LNPA 4ZO8A 2XIMA 3CTTA 3SRHA 1RJPA 4Q3MA 4RDWA 1RSCA 3OLGA 4K3ZA 2Q09A 5H8MA 3WJSA 1V6WA 3FXGA 2QCFA 2ZX9A 2ADAA 4H4IA 4RX0A 3MUXA 1I2RA 1M53A 4DJDC 4A21A 3BPWA 1K4HA 4DBEA 2WV8A 3REQA 4JTEA 5EMMA 2GUYA 3A4XA 4MB3A 4IP4A 1US0A 3EMZA 5A6TC 1JXJA 5FA5A 2ZUWA 1WYIA 1TPB1 4EK7A 2A7NA 1Q4WA 3G1DA 1W1YA 1XRFA 1G5AA 2P10A 3LHUA 3W72A 4XKMA 4B5XA 2BZNA 5JMUA 2YZRA 5M3WA 2HVNA 3OZYA 1IT0A 1JFXA 3CNYA 3P5ZA 4XO7A 5FOOA 4EPEC 3CS2A 1CXLA 2VHLA 4OQVA 3MS8A 1FWDC 4QE4A 4H83A 3W73A 5T26A 1ISWA 1E71M 1QO2A 1VHCA 3BLKA 3PZUA 4CD5A 1W1VA 4HNOA 3MP3A 1RXOB 3PC0A 4N9DA 4NX0A 1QMLA 2QCNA 4QFUA 1P6CA 2VENA 4EPKA 1PTDA 1YMYA 1J2BA 3HOJA 2OEMA 4K2SA 1OGGA 2PF0A 1EGMA 3S6DA 3UJRA 3KP1A 1W0MA 1RLCL 4U2YA 8A3HA 2YYTA 4FNSA 1W3NA 1OBAA 1X6UA 1X1OA 5D9NA 3TW6A 2Z1SA 2G96A 1ELSA 3TNOA 3PFRA 3BGJA 3PTDA 3H24A 4I6VA 3QN3A 1NDVA 3MHFA 1JUKA 4JR5A 3GFXA 4TR9A 2D0GA 3WD2A 1K8YA 1MUWA 1AL7A 2OEKA 3TC7A 3T1GA 3PPFA 1GPWA 3KHDA 3LY0A 1DP0A 4NU7A 5AHLA 1KR0A 1GZ1A 3ALGA 2TSYA 2YYUA 3NSMA 4L4LA 4W4QA 3M47A 4KWUA 5BRPA 2YIHA 4MDPA 4K1GA 4PUWA 4PMDA 1MFUA 3SFWA 5CPMA 3U2ZA 2VDHA 3DKLA 3ZR5A 1ME8A 4DZIA 3NYZA 1OFOA 2V3EA 5D09A 5MKGB 3W6LA 4JNMA 4UQAA 3CHFA 4IM4A 2VR2A 3RF9A 1EJRC 3W7IA 2FJUB 3ISIX 3TA9A 2VVSA 3BCDA 2LLEA 3LMYA 1AL8A 3SN1A 3W02A 4ES4A 4EAYA 3WDPP 1SZNA 5TAOA 5EFDA 1O4UA 1JZ7A 2PWDA 1Q6QA 8CGTA 2OO0A 4W8AA 2XWDA 3WNLA 1XLAA 4IFKA 3PNUA 3TMQA 3W2LA 1FP8A 2BGNE 1I8JA 1MDLA 2BV9A 3ZJKA 3DFQA 4ADUA 3HGJA 1CNVA 4ZOBA 3R7MA 3RDKA 3DESA 3ARRA 2PDWA 1IEVA 4W85A 3ICJA 1EJ7L 1LQAA 3UWWA 3VA8A 4BK9A 1I4NA 2NWSA 2VFEA 1HX0A 2G3IA 3VUSA 4LB3A 2PDYA 2CHOA 1XLFA 4M81A 2OZ3A 4NIRA 3QTGA 5CBIA 3ECQA 5HQEA 2Q8ZA 4WVXA 3WF4A 3HFTA 1O6IA 3KDOA 1YXYA 3ATZA 3MBFA 4B90A 1UZDA 2J66A 2CBJA 2YCIX 4NZJA 7TAAA 3MSRA 5F2IA 3STPA 2DY3A 5LKYA 3S1WA 2ACQA 5D02A 4UIOA 1GKPA 2YDSA 4PRTA 4D6FA 4Y6GA 4AYSA 4RV8A 1MUMA 2VEPA 1DIDA 1O66A 3E96A 2EPNA 1ONXA 5CH9A 1I45A 5EBAA 4CKQA 3PSWA 3UW6A 5AHNA 1MDRA 2IUZA 2WSQA 1EIBA 1XKJA 4F79A 4GZIA 4UFJA 1RQEA 2NX9A 4C7FA 5EMLA 1PL9A 3FAWA 1QPNA 1UWQA 1XLJA 1UMYA 1FWTA 1H7RA 3GG0A 4A4AA 3O15A 2YFOA 2BODX 3W1UA 3ZQ9A 4WY0F 4X3ZA 3PN8A 1JDDA 2XH4A 1K70A 1PZ3A 3PULA 4F2TA 2NUYA 3GTFA 1PVNA 1H60A 3DXIA 4O16A 3A3HA 5CSRA 2G3MA 4R27A 3TTSA 2BY2A 1V3HA 3DEQA 1XQKA 3H26A 3M0JA 1OFBA 3W1NA 3UZYA 2BHZA 3ITYA 5DBUA 2CZVA 1IIGA 2Z6JA 4H8VA 1TWIA 4Z08A 4A3YA 3NL2A 1TV4A 4M1RA 4ROQA 2GGHA 3QV6A 2XVGA 4A8LA 5HMFA 3UWQA 4LBRA 3VD5A 1E4LA 3CLMA 3EA3A 3AXMA 3VGEA 2UWFA 4O54A 4PMQA 1GJUA 1SJBA 4DPPA 3PS7A 1W9PA 3WQ8A 4E38A 2XM2A 3E2SA 1OFRA 1HIZA 3R11A 2Y88A 5HMSA 1CB2A 2DSWA 4M7TA 1OM0A 5BYWA 1BGAA 1ZGDA 5ECVA 4MPKA 1TIMA 3KXQA 7REQB 4AZCA 3P6LA 1ML1A 2XPKA 3N12A 2CKRA 2VGFA 1BKHA 1KXQA 3NSNA 2BLEA 5CBBA 1J10A 1W1PA 3CIWA 1JR1A 4NJGA 1NP2A 2X05A 2WNZA 4IX2A 4F0KA 1UHVA 2VRQA 3W7PA 4LAOA 3OLDA 4JTCA 4NF7A 3PAJA 1G9HA 2PURA 2GJXA 5ENLA 2NLIA 1BYDA 2WBGA 4AQLA 4Y96A 3C2YA 3LSBA 3DFNA 1ZPTA 1PWMA 3W1RA 1ADSA 1W5QA 2WVVA 5HAOA 4JIQA 1HN1A 4A3QA 1V03A 5CEWA 2ALRA 3B0PA 5JVLA 3RM8A 4Z2JA 3TC3A 4I6KA 4CVWA 3VGFA 1AJZA 1OYBA 3BJTA 3G3MA 2WLYA 4PE8A 3SCQA 1A4LA 1WXYA 4XZ9A 1P1XA 4GKTA 3CMJA 2CLOA 4KWVA 4GGHA 4GXWA 4IHCA 3FJ6A 4WGHA 5TQLA 1N82A 4Y9AA 1SZRA 3DDMA 3KVMA 4K39A 4UQEA 1FWJC 2AAMA 1W2PA 2BSLA 3ZVIA 1ZY9A 3STGA 5I3GA 3CUXA 1E1FA 3DOPA 3DYMA 3N9KA 1QHZA 3CQJA 4DM1A 3UY7A 4H04A 2JF6A 3Q94A 2UBPC 4Q4KA 2B7OA 3PTKA 2JFEX 4U2ZA 4JTGA 1OG6A 1E6XM 1CXEA 3P3BA 3E6EA 2Z28A 2CZFA 5C7HA 3MMTA 4C6CA 3SAZA 1I0BA 3IVTA 2I9UA 4RE3A 2G3JA 4JEJA 3F5JA 5F2GA 4B4FA 4QJ4B 3N4AA 4DO4A 3EA1A 3U3HA 4GVHA 4W7VA 3EWCA 3UR5A 5FACA 4EF8A 3ZR6A 3DG7A 2VC9A 3T55A 3H2MA 2Y1HA 4KESA 3FYOA 4HQVA 4E6MA 3G0XA 7ODCA 4FHAA 1R38A 2DJLA 1G94A 4YCOA 1R87A 1YPIA 4UXDA 2G4FA 1HJWA 3QV8A 3QTPA 4O57A 4FNUA 4DBUA 3VCRA 3AIQA 3LA4A 3CUZA 3W1MA 1G1YA 5GJNA 5EPDA 3N2MA 2OGJA 4TVUA 4L80A 1J0HA 4FOJA 1G0CA 3RLHA 4LAKA 1ZAHA 3AALA 1QNPA 3RJXA 3WLIA 4AD0A 3WQGA 3L4XA 1JPHA 3FVMA 4GLEA 2HMCA 3PTMA 5L9FA 3GDTA 1W91A 1HJUA 1V93A 3NJ3A 3PHAA 5K7JA 3H70A 4UTIA 1AZ2A 5IXEA 3BC9A 3DHPA 4REQA 2VL4A 4IPPA 2YL6A 3PPHA 1VPQA 1B5TA 1HTIA 5D2YA 4N4PA 3KZPA 4C1KA 4OIFA 1V0MA 1E6SM 1HNYA 1REQB 3FYYA 2WWCA 3IUIA 2XZ9A 4XZNX 3EX2A 2I57A 2CLPA 1PB0A 1E3ZA 2I14A 4FX8A 2JIEA 1W3LA 1S2AA 1VLIA 2PA6A 5AN7A 5HWMA 4X2PA 1F6PA 1H4PA 4EKJA 3IJ6A 4AU0A 1N55A 1RVGA 2NXIA 2D1ZA 4IQEA 4DJEC 3RR1A 1C7TA 4UTHA 3ENLA 3M16A 2BHUA 4I5UA 4DUVA 4HNCA 1Y7VA 5J5RA 3DX5A 1XISA 4DWSA 3GDKA 3WF3A 3UR7A 4ERGA 4LTSA 1W2VA 1XLEA 1Z3NA 1J8VA 3SR7A 3V0UA 4W86A 2WQPA 3W01A 4MUZA 3GS6A 4CQ9A 1O5KA 3EA2A 5XIAA 3WQFA 4LAZA 2E7FA 3H21A 2HVOA 1F3TA 2O4QA 3KLKA 3TNBA 1BAGA 4WEVX 1IR1A 3UCCA 3BLLA 1B3XA 3O63A 1KBBA 2YB1A 4KGLA 1JCXA 1DPMA 2QT3A 3Q37A 1D7FA 1J0KA 4ENLA 4AH7A 4GIRA 1XINA 4Q7IA 3NSXA 3SI9A 4KWWA 2C7FA 1I2OA 5DCDA 3BL3A 2X2YA 5CGMA 2C91A 1IT7A 2X7WA 3PBMA 4GUJA 1U83A 1DTNA 2IKGA 2YL8A 2WZIA 3ARSA 2TAAA 4MNMA 4PMJA 3C0SA 3SDOA 1AJ2A 4PB4A 3UA3A 2J8FA 5A8MA 3GQYA 4J27A 3GW0A 3GTIA 4QM1A 4NYUA 2PPGA 3WQPA 4XB3A 1DV7A 2E4TA 1XYMA 3GTNA 1MW2A 3LTSA 3O7UA 3OIXA 3EWDA 3BARA 4I9JA 9XIMA 2J88A 1SFTA 5CG0A 3APYA 4AD3A 2X42A 1GG1A 4CQCA 3CHVA 1OG0A 4GVGA 4KWSA 1U1UA 4DO6A 2I17A 2QZRA 3DKJA 3UZJA 2F2KA 3WEZA 2TODA 1C8YA 3RGTA 1X6NA 3EX1A 4IMAA 3C2FA 1VRDA 3S2CA 3FDKA 3N2TA 5FL1A 1GQIA 4RNIA 4DYEA 4MJMA 3B04A 3L0GA 2MANA 3MU7A 3H6OA 3WMCA 4XISA 1XLKA 1J93A 1WKEA 4Z42C 4NJKA 5TBOA 2GOUA 1TVNA 3TAKA 4FIQA 4QCEA 4IIFA 1C9DA 1CTNA 2C18A 4G9PA 1Q4NX 3VIKA 1DIEA 4GNKB 4HYRA 4DJDA 2RUSA 1EO5A 1QJWA 3ZLHA 2VFFA 2QJGA 1MQRA 3C2EA 2XFWA 2FDSA 3HPZA 3QOMA 4KF1A 2E9MA 3B97A 4MUPA 4H8UA 4Y9NA 3TV8A 3OTRA 4ZENA 3HG3A 2I5QA 3E12A 1CDGA 4X0VA 4P8UA 1RLDA 2NUWA 4GG9A 3B05A 2BTMA 1E6RA 3MI3A 2GJRA 1QOXA 2FTYA 2XDFA 2YA1A 4WXZA 3UERA 4ZMGA 4OGZA 3IS4A 3AC0A 1FCUA 3KS6A 4Q4SA 1TTJA 2XZ7A 4H7VA 2YSWA 1VIWA 1UJQA 4PB3A 3BAWA 1V02A 4DYJA 3WD4A 3DG3A 2NLYA 3GG1A 4ADTA 1WAUA 2AKZA 5AHIA 4LNYA 4DQWA 3C61A 2QJJA 4PMNA 2PTWA 1VR6A 4HCDA 1J2WA 1GQNA 3RPDA 5IFTA 1BSIA 4S3BA 1S2CA 3ARPA 1DJXA 3F1QA 3ATYA 3ITCA 3LU2A 3IEBA 1WX0A 3MMUA 1GTEA 5AYBA 1V02E 1YNYA 2B4GA 4QGCA 2QAFA 3TLLA 2R9RA 3OVPA 4WK9A 1V6VA 1TELA 1FHDA 2I7GA 1JULA 3PBYA 2EXOA 2Z00A 2Z4GA 5E9XA 2E0PA 1TX0A 3SGZA 2Q3RA 1S3HA 4F0HA 1R5YA 4HPXA 1XSKA 4HNTA 4K38A 3A3XA 2V6AA 4XAGA 5DXYA 4MGGA 3GZAA 3IIXA 3PY2A 1V3IA 4FXRA 1OD8A 3ZVHB 3MDWA 5I3FA 3HN3A 1GEQA 3AXKA 2NSOA 1BTCA 3C4UA 5LHEA 1GJWA 4JYFA 3BCFA 4K7VA 4Q4RA 3RCMA 1EXPA 3VCNA 4DBSA 3W7NA 3AUOA 5HULA 4DI8A 1V0LA 5AB3A 3F7JA 3B9DA 1XXXA 3IWPA 1P7TA 4Z1CA 3LPGA 2E68A 1EB3A 4FOUA 1K03A 1S2UA 1D3GA 3QLLA 4ML9A 1RA0A 4AMCA 1RK5A 1YTKA 1EOKA 1QHPA 1YKWA 4I9TA 4HPJA 3N2BA 4LUTA 3FS2A 2ON3A 3UWEA 2VCBA 4GJIA 3QPZA 4MTVA 4GFIA 2NV2A 5D2XA 4M7SA 1GW1A 4R53A 3TSBA 5FEXA 4CCEA 2P3ZA 1RD6A 3B8SA 4DUXA 3LGGA 4ACZB 3TJIA 2CWXA 1JG9A 2E8ZA 1W17A 2ZXDA 4JIHA 4V1YA 4M5PA 4RPQA 2R1MA 1IZJA 1I1WA 2QMKA 4TVCA 4LT9A 1JQVA 4BEUA 2X1SA 3PZOA 1OX6A 1CPUA 4RJEA 4D8LA 1EJSC 2FMOA 3LQGA 1W5NA 5HK4A 1B0IA 3E0FA 4H6KA 2ZX7A 5D37A 1DE5A 4Q4MA 4W7UA 1B3VA 3BOXA 4J4KA 3MZNA 2NXHA 3T0BA 1UB3A 3JRKA 3T81A 3UA4A 4ZQCA 3LZ5A 3TR2A 1IT8A 2IXUA 3OBEA 4QG8A 4GNVA 1HXJA 1PWLA 3MB9A 2VFHA 1JCNA 3RMEA 1HP4A 1ODUA 4IMFA 2WNQA 1OEPA 3A64A 1W32A 2PDXA 1E70M 1UJPA 1BYAA 3S42A 3AS0A 3AJ7A 4C7DA 3B0XA 3DC8A 3A21A 1J5TA 4UTUA 1G01A 3T7VA 2WNNA 3GYCA 2E1DA 1E51A 4RKAA 1B4EA 3C2OA 3AIWA 2PDUA 4O0ZA 5DCEA 1E1EA 2QS8A 1VPYA 2ZVIA 3W7CA 4QBXA 3IARA 4IMDA 3QQWA 4RDZA 3VK5A 4C6OA 3I3EA 1X39A 4A8IA 4GY1A 2DZSA 4HMDA 2J6XA 3OYXA 3VVGA 1XX1A 3NGJA 2J75A 1NU5A 2C16A 3I6TA 3UP8A 1BF6A 2J7HA 2QDHA 3OIHA 2V3DA 3HFYA 3L67A 1GQKA 4UTTC 1LCOA 1W56A 4F0SA 2PODA 4O1DA 3SQLA 4ZO7A 3PJUA 1LLWA 3TCEA 1I9CB 5F2LA 1L9WA 1YDOA 2CHRA 3W37A 2OQLA 1SJAA 4JQ3A 2ATSA 4IQLA 3LK6A 4LVDA 2HK1A 1UMLA 2IMRA 2VJXA 3IJ8A 3G1RA 4AZBA 3DERA 3R94A 1RPKA 1E0VA 3RPMA 2QIIA 3V75A 2E6FA 5CKSA 1A53A 3Q67A 3IAQA 4AZIA 3P67A 3TONA 3KOZA 3ARVA 5FSEC 1JFHA 2JGYA 1EOMA 3CJPA 1KXTA 1VBJA 3HQOA 1NWSA 3GW3A 1RBLA 5AZ1A 4DLMA 3MHUA 4FS9A 3CIXA 4CD8A 4GYFA 2HXTA 4HIBA 2XN2A 3N6JA 1US3A 3NUKA 1TVPA 4Q8TA 3NZGA 1LBMA 2VDIA 3SN0A 2HBXA 4NAFB 3WBAA 1QK0A 3ZJ8A 5RUBA 1G7VA 3PFMA 2NWRA 1Z42A 4M82A 3T0CA 1MZRA 2GVGA 3I10A 3GR7A 2VC7A 1PPIA 4D9PA 3W7JA 1CBGA 3N2CA 3UZZA 4B3ZA 1F6YA 4D6JA 1TRIA 4UWMA 3B9OA 3A9BA 4LUSA 4BY3A 2A79A 4QEEA 3WBWA 2W92A 1FDYA 4UC5A 5I78A 4LYPA 2PTDA 1EIXA 1P7TB 5C6MA 1LOSA 2BOFX 1IHIA 4PRWA 1PZ2A 5DBTA 4LU0A 1B2YA 1RCXB 3NNTA 2YBUA 4DXKA 1AODA 4MFEA 2GJPA 4DELA 2VM8A 1RALA 1VCVA 4G5DA 1W9VA 1LOQA 3DECA 3GNRA 2GOKA 1GVQA 4JTIA 3WLNA 4M6PA 1A0EA 3IVSA 9CGTA 4D6EA 4LUYA 3UVAA 3P8JA 3CBWA 3EWUA 2V5LA 4XAPA 5DLCA 5FEPA 1I60A 4M8UA 3E5BA 4HHLA 2ODOA 1C8VA 1KQZA 2J6VA 1K1DA 3OA3A 3DUGA 5C54A 2PTZA 1ITXA 2AQWA 3EWBX 2IW0A 4KCUA 1XJBA 3PSVA 2D0FA 3UZXA 3LBOA 3L2LA 1ZALA 3VNLA 4TX6A 3HTWA 3WELA 3EDEA 4NAEB 4CQAA 4FI4A 2HE8A 4ZQPA 4AEFA 3B8WA 1W6TA 4PUNA 5D8WA 4E2VA 3FHAA 1W1TA 3LXCA 4QS5A 4PBEA 2A0NA 4L4MA 3LCWA 1BEUA 1L2QA 2A2IA 1R3VA 3IJIA 4BS0A 3DGRA 1TUFA 1UR0A 4MZYA 1UKPA 2VFDA 1BQGA 5FEZA 3VM5A 5H6HA 1K9FA 4BWLC 1P0KA 4FF5A 5FL0A 3WNNA 1XLIA 2PDLA 3CZLA 5DT5A 2V69A 4HPNA 4FNPA 2DDXA 1JPMA 1JYNA 1L6YA 2WHKA 1A4MA 2UV8G 1T99A 4UFKA 2DT1A 2YXXA 2E5DA 3HURA 4MYAA 4GOAA 3NXFA 1S2WA 3WDJA 3H8AA 3M64A 4GPNA 1V77A 1XG4A 2C14A 4GI8A 4YYFA 3IJQA 4DVOA 3OVRA 4HHMA 1TG7A 4JTAA 3WFZA 4FLOA 3I7RA 5C9WA 4CNNA 2YJQA 4UMAA 4PUMA 5ABTA 5DY2A 1UWSA 2W63A 4J28A 1ZBWA 4O8RA 3T0AA 3ERPA 1UG6A 4DBDA 4N6FA 3ZJ6A 5IHRA 1S1PA 4GQBA 4BJHA 2D24A 3L4ZA 3TYZA 5I03A 4HSOA 3CQIA 3W38A 1OFQA 1QU4A 4NXSA 1WXJA 4AD2A 1MRQA 5BU9A 3STEA 4E8GA 4DJEA 3NM3A 1LRTA 3PAOA 1EF2A 1OZMA 3QHMA 5FF2A 5I06A 1XV8A 5I2UA 2OLAA 2DSZA 4S23A 4GISA 4PTWA 3GNPA 3R58A 2YKKA 3WYZA 1GONA 4MWAB 2DQWA 4P61A 2Z7GA 2PLCA 2F6KA 1L6GA 3IIZA 5K4XA 3NQGA 3MMDA 1J11A 4KEVA 4DJFC 1G4TA 2VC5A 4H2HA 2PZ0A 4YVVA 2VUNA 4GC4A 4YHEA 3L4TA 4N4QA 1OVDA 3QYQA 3MJYA 3WNOA 2ZE0A 3MANA 1UR9A 1KRAC 2FFIA 2VTFA 2WMIA 3FA4A 1B3ZA 3N14A 2ZUUA 3RLUA 1GKRA 1J12A 1TTIA 3VNYA 2F84A 5T9CE 4Y9PA 4YCPA 2EPHA 5AFDA 1TE6A 5BOEA 3AMGA 4LRTA 4JAWA 1OC5A 4NY2A 1IQ8A 3DHFA 1GOMA 3ARUA 3DFSA 2RGMA 3ZLGA 4AVNA 2IKJA 3AHYA 4HMCA 3W3OA 2X41A 3WJWA 1M03A 4M19A 5FJJA 2D22A 3WUBA 4RDYA 4Q4PA 1J6PA 5KITA 3LHZA 2H6RA 3AMCA 1WXZA 1MW3A 4AX6A 3EX6A 2D0HA 3JVAA 3A12A 4PN2A 5I07A 4GUGA 3BURA 2R1LA 1ZL1A 3CWOX 4MNKA 1RP8A 3WY1A 2XHYA 4IJCA 4QP0A 4L5ZA 2DQXA 4JN8A 3F4VA 2QGHA 1Y5XA 1AVAA 3EEZA 1P1MA 4ZZ9A 1CCWB 3LD5A 2RKXA 4M0XA 4LVFA 1UQYA 5A5WA 5CGTA 1CB7B 4L9YA 2EGZA 1HP5A 4R34A 5U4NA 3GNXA 2XSBA 4HA0A 1X8CA 3D5HA 3WG6A 4C90A 4MAZA 3UETA 4NJHA 4HSHA 5JH1A 3WLLA 4RNHA 4M1BA 3L0KA 3JR2A 3SCNA 2ABBA 4TV6A 1CT5A 3UESA 2ZDRA 3BSHA 5DRIA 1IEWA 3HBLA 2P0IA 3VDGA 3M0MA 2P53A 2BHYA 1GPFA 3ARTA 2QJHA 5XINA 4FSAA 4GI4A 2PP3A 4MNLA 5CSYA 3LCIA 4AAJA 3SBFA 3UBPC 1A5AA 1PX4A 4V27A 2I56A 3G1YA 4GIAA 3H2CA 3VDBA 3CH0A 1P4CA 4NI8A 4G1NA 4RXGA 3W7GA 2FGBA 3W26A 4H6RA 1KRCC 1AMYA 3BW2A 2FHBA 5MHBA 3HPXA 2DW7A 1WDPA 3CPRA 3CZJA 4HNVA 4PMOA 4IPJA 4IGMA 5E0KA 3RX2A 5A95A 3P74A 4A3RA 1G4EA 4IOTA 1Q6OA 3AU2A 5GVJA 1IV8A 4TMCA 2VZSA 4HK7A 1LZOA 4LXFA 1E6QM 1EFZA 1I2NA 1XHGA 2VP8A 2PZNA 1OC6A 2IPWA 4G1KA 2CEQA 2V5DA 4DNHA 1RBOB 3LXBA 1XH1A 3W29A 2R8WA 4ZXLA 1UWTA 3BLPX 1NM9A 3QKZA 4WJXA 4JIIX 2WHLA 4WRHA 3WUEA 4DWSD 3NPWA 1GVIA 1Z89A 1H50A 1Q6FA 1W3IA 1R3TA 5CZ0A 3WQOA 2OWWA 2I9EA 3ZWSA 2Z25A 2WBKA 3IACA 4AD4A 1OF8A 1V0NA 3VABA 3VX0A 2GQ9A 3N34A 1KNWA 1VFHA 1CGTA 2R91A 3KCLA 4MSSA 2O9OA 1M5WA 3UVIA 3MWAA 4QDPA 1VH7A 5AYYA 2EF9A 4B5WA 2DT3A 2ZX8A 3GXTA 1JNDA 2ZADA 4HHPA 1T5AA 2F7FA 3NPUA 4OECA 4B5TA 4OOZA 3KBNA 4I8YA 3CUHA 1IWBA 3VNKA 2Y7GA 1Y5VA 4AHPA 5DCBA 3LMZA 2TYSA 1ALDA 1Q2SA 5HWJA 3NPVA 1E9YB 2V5CA 3WQ4A 3WEOA 1VBHA 1DJZA 3WBYA 4GYKA 1VFSA 4QSHA 1FHVA 1E9IA 3PZMA 3BJFA 1IZCA 1E40A 4TTUA 5KZMA 1PKYA 3KLLA 3M6DA 3HPFA 1BWLA 2AQVA 3QH2A 4QEHA 4DF0A 4TTGA 3VE9A 4M6QA 4XSMA 5FJUA 4Y2WA 4FA3A 1M9HA 4US6A 1Q6LA 3RHGA 3SSZA 1QPOA 4ZOCA 4RZ6A 5BCAA 2PDMA 1OY0A 4R7JA 2PC4A 1B9BA 4QX4A 5AOUA 1K6AA 3O0KA 6TIMA 3YPIA 2XG9A 5LA0A 2DZBA 5KZDA 1H11A 1LG1A 1Q7MA 2ISVA 1X1NA 4H41A 3VAVA 4OHQA 3GZ3A 5D04C 4FF7A 1PUDA 4PCTA 2J7DA 4PCSA 4LVGA 2QF8A 3BOLA 3E38A 2BXYA 2AQOA 3IJ7A 4HPGA 4R88A 3B06A 1EUAA 1VQTA 3G5EA 2ZFAA 3C2VA 1XUZA 3K46A 4B2DA 1EL3A 3THUA 2A3CA 3OU8A 2IPFA 2CYGA 3UNTA 3UJ2A 5CCZA 1J6OA 3S47A 3RMJA 4QTGA 1SW3A 3BAJA 3ES8A 5BXPA 3LTYA 4JX5A 2OEJA 4A3UA 4O11A 1QW7A 2F9RA 3G77A 4AVOA 3W25A 1QHOA 3KCOA 3GXPA 3SIMA 2OU4A 2WMHA 3S46A 2WPGA 4WIWA 1LM1A 1C7SA 4DJDD 3PZVA 5E09A 1Z41A 3S0CA 1PJ9A 3RITA 1EBHA 1UD3A 5IBXA 1EQCA 4HD5A 1OX4A 2WSKA 1CXIA 1S5VA 4G56A 4Q8PA 3SZ8A 3GUGA 1Y0EA 2Y63A 3P14A 1OIMA 3K5XA 4W93A 3B4YA 3PZGA 1WKYA 3NDZA 3WDQA 2O56A 2GGGA 3PBWA 5ABHA 4C65A 4EOUA 5BWAA 1EZWA 3IIPA 4IL0A 1E4MM 5HJLA 2VX6A 4GH3A 4LY8A 3XIMA 1QI0A 3MMWA 3BO9A 2G3NA 1HL9A 4E4PA 4ZB5A 1G4SA 1A5CA 2VCAA 3VD3A 1UR3M 1TCDA 4XUYA 3TU9A 1XLHA 3LERA 2NSXA 5BXSA 4JN7A 4NZ4A 2NQ9A 2QULA 2YZ5A 4MKVA 1RVKA 2PU0A 4DUOA 2GQ8A 4HJFA 3KRBA 4IMGA 3KEHA 4RZ4A 1FKXA 2OKTA 3RU8X 1YADA 3OZPA 4FP1A 1EHAA 4IICA 3TTEA 5FD0A 3W7LA 1B9ZA 4IG2A 5AHMA 4XSLA 2PWUA 1DOSA 3CPUA 3LHYA 3SGGA 2C3ZA 3CHEA 1E73M 1B3YA 4L1WA 2GL5A 2ZUVA 3STFA 4JCLA 1C91A 1XWYA 4ZEPA 5KEZA 3EWZA 2DUAA 3E2VA 1EWDA 2XISA 2R24A 1E5JA 1SPQA 4MAVA 1OJXA 2AKMA 1EP1A 1R46A 3WJYA 1W3HA 2O9TA 4O1CA 3FJLA 3ARYA 4QLLA 3STCA 1HZYA 1KCKA 3KRZA 1BTMA 1KD0A 1VS1A 3PUGA 2OSWA 1KM1A 2QLYA 2TPSA 5AVNA 2REQA 2BDQA 2J7FA 5T9BG 2VXNA 1AH0A 1NQKA 1OADA 1EYEA 3CXOA 1V3KA 4HU0A 3BQ6A 4D8ZA 1QWGA 3U0HA 2A7PA 5DFAA 1H7NA 1Y5WA 3BE7A 4N2YA 4K68A 2QCCA 3EAUA 1K8ZA 4Z0SA 4KERA 3CYJA 1UH3A 3WBEA 3IK4A 3AIBA 3GG7A 5REQA 1WZKA 1A49A 1Y8BA 2QCDA 3WIJA 4I7UA 2YCEA 2Y4SA 3HQ1A 1W3TA 3N13A 3PBUA 4H6EA 4I5RA 3G0SA 2E6YA 3U2CA 3N29A 3M0LA 2CPUA 1YRRA 1JCJA 5JBEA 2NV9A 1DHKA 5G4HC 1KFKA 3NQ2A 1QNRA 4DHGA 2FTPA 7TIMA 3N6QA 3Q4DA 4CQDA 3GHSA 5EBUA 3EPMA 3W2JA 1HVQA 4MLRA 5C2CA 2OJPA 4QJ3B 1DWAM 2DIJA 1E0XA 4LQ1A 2W6RA 5ABGA 4BF5A 2CCRA 4KRTA 1VJIA 2NQLA 3NVDA 4OVXA 2FDMA 2VZTA 3W1XA 4C6PA 1NTHA 2WKJA 1QPKA 3KVKA 4S2CA 1VFUA 2EPOA 3RLGA 1QPQA 2Y89A 4TX8A 4GH1A 3PK7A 4IJBA 3SEPA 3TXVA 3UR2A 5D2TA 4IJRA 3TROA 1QBAA 4JICA 5LIKX 3CGTA 3GR8A 1FCBA 4F2UA 4LVAA 1JDEA 4JFSA 3BLOA 4NXKA 5BU6A 4GINA 4ZR8A 5EMKA 2EHHA 4XG1A 5LHFA 3MBDA 5BNKA 3WQWA 4BWLA 4RR4A 1MXGA 1B4KA 3S5YA 1ECEA 3VD4A 1DWFM 3GNOA 1YBQA 1JPIA 3UT0A 1OCJA 4F2BA 3HMCA 3JZUA 1QVBA 3M5YA 3C6CA 2FVLA 2RDTA 3AXIA 2Z0IA 1EH9A 3PUDA 1P5BA 3IIOA 2VQUA 4PEKA 5BROA 3WENA 1EDGA 1L0PA 3VINA 2CNCA 2W61A 2DUXA 2VI0A 1CENA 1KCLA 5HPOA 5CZKA 3WLKX 1PYFA 5A94A 1UZ4A 3BQ5A 5FF0A 3TMLA 2DZTA 4IQJA 1ITUA 1FVPA 3AFBA 4QLKA 1TTQA 2BG5A 1OT2A 2H90A 3SCOA 4M80A 4RL3A 4TIMA 4LCSA 3S1GA 4URIA 3KS5A 3KX6A 2PBGA 3TWBA 3V16A 2VZOA 5GPRA 1ITQA 2CW6A 3OEXA 4Q8WA 1QTWA 3WQVA 1OGSA 4Q6XA 2QGYA 4B5NA 5HUPA 3LGDA 1VBGA 3E74A 2ZRXA 5A6KA 1LLZA 4Z2HA 3WJZA 3O6YX 3DENA 1RJQA 4UTMA 3CEPA 3HF3A 4D6CA 1G7UA 1XRSA 2UY5A 3I4EA 4V1XA 3VYLA 1E1CB 4H8HA 2WHMA 4CNSA 3TUUA 1KKOA 1ZQ5A 3EB2A 3FA5A 4LF1A 1X97A 5KZ6A 4C1NA 4R3UA 4DJFA 4GHRA 2XN1A 1XSJA 3II1A 1KM0A 4CQBA 1HL8A 4UQ9A 4D6GA 1E0UA 3P8IA 1VEMA 4KFPA 3MC5A 4CVUA 4C6BA 4B5SA 2RDWA 2P50A 3N9RA 4Q8UA 4S3JA 6REQA 3W7OA 1XC4A 1XPGA 1H61A 1MNSA 2ZXQA 3L5LA 4E8CA 2FZMA 3IJ9A 2CU0A 3W70A 1W5MA 4DX3A 3WNPA 3WZ0E 4GY7A 1I75A 2G5WA 1XIIA 3U5YA 3GY1A 3GU1A 2XH7A 4O14A 2BVDA 3NQ6A 4KRUA 4TX9A 4CNTA 1JD7A 2XVNA 4C6EA 1K8CA 4N7QA 3W7MA 3S9ZA 4WKHA 4A2SA 1MI3A 2VFIA 1BF2A 3QR3A 1F3XA 2DGAA 4OV4A 1FWGC 2V0TA 4XWUA 4AY1A 3OG2A 3W28A 1FP9A 4A6GA 1VFTA 1P0DA 1EEPA 1A3XA 3IGXA 3M9YA 3W7HA 3B9AA 1CI1A 3SJ3A 5ECUA 1UP2A 1TA3B 4EXBA 2WNWA 1VBUA 3M41A 4JFWA 1ADOA 2W4XA 1XD1A 1JXKA 4IPLA 3W87A 1AH3A 1TFVA 3WNMA 1WOAA 4N0RA 3SUSA 4AIUA 3NL6A 2NXGA 4JBRA 5HPCA 3EMCA 2PGWA 2HQAA 4F66A 1NOWA 4IL2A 1BXBA 4V28A 1VFOA 3HA1A 3TYAA 3VNDA 3LCXA 4YTTA 1GYNA 3ZR4A 4Z0JA 4ZQOA 1EQPA 3A23A 4PSRA 2AAAA 3TVAA 4YTQA 4LBUA 1D7KA 5M2FX 3HGSA 3GNDA 3LS9A 3UJFA 1A50A 5A2AA 3TYCA 5H91A 1CXHA 4LOCA 1E43A 4LJ3A 3Q58A 5PTDA 4QS6A 3WLPA 5DQPA 1SUXA 3CH9A 1OC7A 3WMLA 3P93A 2RGLA 3SIZA 1HJSA 3EGJA 4NX5A 3W6MA 4GO9A 1TMHA 4GUHA 1L6FA 4JL2A 4DUWA 4S3CA 3E1F1 3NO3A 3L2MA 3AQUA 1E0WA 3KWXA 2XFYA 3GDLA 4C6FA 1QFEA 2RDXA 4UMBA 4NUWA 4LC8A 1M04A 1EO7A 1FCQA 4PODA 4UTFA 3IVUA 3W1TA 2ISSA 3QJAA 4AIEA 2Z1BA 2G50A 4F3HA 4HB7A 1F3WA 4ML4A 4Q7BA 3RM9A 3ZMRA 3E2QA 3VNIA 3W82A 2D3NA 2GVLA 2XFRA 3PB0A 4UFMA 4NKCA 5FESA 4AZ6A 1JI1A 3SSJA 5F4XA 4DF1A 3HIJA 4CCZA 2FZBA 3H12A 2CETA 3FGCB 3G22A 1TE1A 2QV5A 2WOQA 3C3UA 3ZO9A 3L0NA 3M0ZA 1U5HA 3B0YA 3PWGA 4DZAA 1GOKA 2UZ9A 4PA8A 1BXNA 1EYWA 1B54A 3MQTA 3KOYA 2HZGA 1M7OA 1TV8A 5K4ZA 3MZ2A 4AWEA 1UWAA 2YCJA 1PYMA 3GHUA 1AW5A 4DWSC 2DVTA 4YL2A 1EA0A 3GC2A 2X09A 3AO0A 4MJ2A 5E9AA 2WVTA 3GU2A 1N8FA 3DI1A 2X0SA 2Y7DA 3H4GA 4IISA 5I0DA 4W7WA 3O9NA 1H7WA 3QZ6A 3FKKA 1GVOA 4RE2A 3W1LA 4KMQA 2ZBTA 1C8XA 2PC8A 1XLCA 4EXQA 1XIHA 4LC6A 4RPPA 1UC4A 3ITXA 3PANA 3R79A 5D05A 3W27A 4O15A 2FJKA 3G1FA 1ISZA 2Y0FA 1W1B1 5D30A 1UYQA 1X7IA 3T09A 1KCXA 4UR7A 4M51A 4IH3A 2XGZA 5CG7A 4FZIA 5I77A 2CESA 4J35A 7ENLA 3B9EA 1GVYA 3DFOA 1R8LA 5M5DA 3M43A 1R0MA 1C9WA 2X1IA 3UYCA 3MJMA 1HKMA 4NZFA 3RFAA 4QNWA 4DBWA 4WCJA 4DPQA 1KRBC 1WDRA 2HSAA 2DSUA 1EF3A 5LYRA 1SZGA 4FXJA 3K4AA 4O1FA 1UQZA 3W24A 3N18A 4ROPA 1JUBA 3SJNA 4XZHA 4U3AA 5HBFA 1DJYA 1T41A 2OG9A 4IIHA 5DY3A 1NF0A 3VPLA 4E3VA 3MWCA 4PYSA 3OGVA 4PL2A 3N11A 4J1OA 5I79A 1GEHA 1VYPX 2WC7A 4B5VA 2GK1A 1YXDA 4PUDA 4LS1A 1YDNA 2W62A 4IF2A 3QEZA 1CEOA 3G1XA 4GZ7A 3P84A 1QI5A 3OO2A 4U3CA 3W86A 4KIRA 1X96A 2G41A 2GVEA 2J7CA 3RX4A 3RYSA 4AEEA 3EPOA 2HDJA 2QNEA 3Q65A 4XVEA 3AU6A 4EF9A 2V68A 1UD6A 3AHZA 1ZJHA 3OYZA 3QBUA 2VR4A 4GX9A 2P1FA 4XIMA 3TIMA 1CGWA 5K9CA 3MVTA 1XGDA 1DORA 4UTWA 4AIOA 4HMNA 1RY8A 4DXXA 1V3MA 4H3DA 2GZXA 4W89A 2NQJA 1KBJA 1BRLA 4P8VA 1ZBCA 3W23A 1NQ6A 1UD2A 3W84A 3OODA 2H3BA 4FX7A 2BGSA 3WSUA 3N25A 2OQHA 3MUIA 5ABFA 5D33A 3G8RA 3CV1A 2QDDA 4JFVA 3WLSA 4E2DA 5CAKA 4F9DA 3UWZA 2J25A 1EC9A 3WK1A 1XLMA 1FA2A 4HT3A 2GVJA 2HJPA 1OHLA 2GVYA 5C8BB 3MSYA 1ZCOA 4JL1A 4E8DA 3UXKA 1HJXA 1QBBA 2CBUA 3AZTA 2B7NA 1H2JA 2PBOA 4QISA 4WDXA 4RE4A 3EDDA 1O94A 1IEIA 1TMLA 2YA0A 3V3WA 1NOUA 2QUMA 3S2NA 2HK0A 1QI4A 3GKFA 5CAHA 2CZEA 4HTYA 2ZICA 3KHJA 3C2RA 2XN0A 2F6XA 8RUCA 2L5HA 2CXEA 2VWSA 3R4IA 1IXNA 2RAGA 2Z1VA 3UXLA 3ZS4A 2YDQA 1H0IA 5JH2A 4A22A 4AHQA 2NX3A 2J8TA 2PB1A 3NQVA 5IHSA 4WHBA 1A5NC 2AL2A 2QXWA 5CGQA 3RRAA 1JCYA 2C1HA 1V08A 3APTA 4M56A 3CV7A 1OIFA 2NVDA 4CEUC 1HF6A 1PKNA 5LIYX 5BOOA 4LFYA 4DM2A 1KBKA 4QSFA 5AYIA 4S2BA 1ISYA 3MCMA 4O1EA 3M0KA 4TO8A 5C71A 1V3LA 4CU8A 5D9MA 1BGGA 3SUUA 2VNCA 3P61A 4BQ4A 1LWJA 4AY8A 4K37A 5CJMA 2C0AA 4FMVA 4OV9A 1AW1A 3VIGA 3COTA 3KM8A 4H9VA 2W91A 1OK6A 3VDCA 2OQYA 5DMMA 1TX2A 3SCTA 3RILA 2JGQA 2PDHA 2OFJA 4C6LA 3BSGA 1U1HA 3WJXA 3EYPA 4S1FA 4XTDA 2IPJA 2X0HA 5CLWA 2W79A 3GVWA 4XD3A 5G2IA 3NL3A 2QW5A 1MEIA 1GJPA 2VEGA 3OHIA 1ISXA 3ITTA 1H41A 2XIBA 3KW3A 1LTDA 3HPSA 2QUNA 1GYMA 2CITA 3B8VA 4RCXA 2KAUC 3AMDA 3QPEA 1LROA 5A8GA 2Y8KA 3QW4B 4B2DD 1LG2A 4YVXA 1LDCA 4OJYA 4JIRA 2GYIA 1YQ2A 3VTRA 4CD7A 1TZ9A 1XYAA 1I2QA 3G18A 1T7LA 4XAYA 1VJZA 3VFLA 2XIOA 3VM7A 2CLMA 2VD9A 1KBIA 1TPVA 3BWWA 1BKSA 3LQLA 2BOEX 3WMSA 4A8RA 4UR8A 4FAMA 2GQ3A 3OBKA 5GJPA 3CC1A 1MQQA 4GWEA 3FJ4A 1QATA 1KRMA 3K8MA 2PP0A 5H8UA 4V33A 1R2TA 3CPGA 4Q8NA 2D2OA 1MRAA 3PZNA 2OYLA 1EP2A 5CPOA 3U9IA 3M0IA 3O6DA 3URNA 3VC5A 5A1AA 4PBGA 2OYKA 1ZSXA 3SRDA 3BUVA 2VEIA 4EANA 3VOHA 4HVXA 3DG6A 1PTAA 4XX6A 4QJ1A 4DAFA 4YU1A 3QLDA 4LWWA 2J8GA 1FWEC 4MYXA 1E9LA 2YCLA 2YW3A 1NDZA 1WB0A 4LX4A 3H22A 2ZXBA 3GKAA 3W0KA 4D6HA 4H6QA 4W8LA 2DUZA 1LJYA 4GYJA 1M7JA 3VIIA 3A13A 2D2HA 1X98A 4MIMA 4WSKA 1FWIC 3RCYA 5FIPA 3FFSA 1FFQA 1PV8A 5LNVA 1WBJA 4JKMA 3TSDA 1B1YA 2BMBA 1IGWA 4DLFA 5I3JA 2Y61A 4KGJA 3REQB 4U5KA 2BFGA 1KM6A 2WJDA 4PUKA 2XGBA 3G8EA 4HGXA 5G4WA 5EB8A 2EKCA 5EFFA 1R2RA 3BLDA 1BG4A 2F2HA 2G4JA 3GXNA 3MI2A 5E5CA 3W71A 3ZIZA 4GBDA 3LV6A 1DQWA 3E3HA 3DN5A 3NDYA 2VCCA 2CFFA 3THAA 3K1DA 1K6WA 3F5KA 2B31A 4R85A 2BP1A 5HATA 4LS2A 1LUCA 1GNXA 1F74A 2Q71A 3SUTA 4JKLA 2WSRA 3S4TA 3A9IA 1TUXA 1BHGA 2ISFA 3ES7A 2RHGA 3NQBA 3FEQA 1Q7QA 3A4WA 4L1XA 5I3DA 3N3MA 2X1RA 1MO0A 3PM6A 1BLIA 3F2CA 1NDYA 2YXGA 4GZJA 5EL1A 3SN4A 4WZHA 1Q65A 3ELFA 1XICA 4LY4A 3UZ5A 3R0KA 1UUMA 4JY9A 1E72M 3LUTA 3R43A 3TR9A 4D71A 1EC7A 2VUYA 3TJXA 4S39A 4NJJA 2WC3A 2VFGA 4DAIA 4XBJA 4ZO6A 5A8QA 5I09A 4ERIA 2Y2WA 5BRBA 1H51A 3CL7A 5HOSA 3T05A 4EPBC 4A35A 2G37A 3QGKC 3T40A 1CW2A 1ZHAA 3VKJA 3WDIA 4JGDA 2OSYA 1R7AA 3BDKA 2V67A 3G2GA 5K3VA 2PRHA 3TC6A 3NWRA 3LB0A 3A6OA 4P2VA 4DO7A 3HJZA 4X2RA 2ZRZA 1XG3A 2GSJA 4XAZA 1YTDA 2DH2A 4E3TA 4AWSA 4KRZA 4B9YA 5HANA 3ZT5A 1A3WA 2BVTA 2HPMA 3SFKA 3ZT6A 2HISA 4HJWA 2ISDA 3TQ0A 3MA8A 2Q6ZA 3CAKA 4MY1A 4O4WA 1XCXA 1CLKA 5A6AA 5I00A 3IGSA 3RLVA 1UOKA 3VXGA 4HA1A 3WL1A 3L4YA 3NZRA 3MY9A 3LPFA 2VGBA 4HNLA 1JJKA 1GZJA 3GM8A 3FKRA 4GD0A 2ZDSA 1W31A 2H8XA 1MSSA 3O6CA 1F07A 2YL5A 1JZ4A 1QO5A 3PG8A 5HA7A 3H7VA 4KFNA 2XH2A 4IFKB 4LGXA 5C2XA 1LT7A 3TN6A 1UBPC 3AAMA 3GVGA 3U5UA 3EDFA 3D0CA 4RZBA 2ZUNA 4FPSA 1XIBA 4JFUA 1O95A 4YTSA 3ZYZA 3LRKA 2OB3A 3MP5A 3ZJ7A 3NAVA 4JTUA 1XD0A 3SY8A 3CWHA 3P82A 1ZNNA 3MP4A 4Q4OA 6XIAA 4ZQNA 4WDWA 3AYSA 3TE9A 3POCA 1ZCCA 3K8KA 4AZ5A 2INEA 1B90A 2DVUA 1TPC1 2Y24A 3BGAA 3LXAA 3I68A 2GUUA 4ZSTA 4O0KA 3T4WA 3CT2A 4KT2A 3P60A 4QE5A 2ZC8A 3V0TA 4M29A 1EX1A 3HM7A 5HMDA 4JTLA 1VFLA 1D3CA 5HDRA 3S5SA 3SCWA 4LYKA 4UTJA 3ABRA 5A8OA 4S38A 4HBKA 1A0DA 2EJ1A 1WO2A 3L21A 3FN9A 2NQ5A 3G1SA 3RNDA 3VMOA 3O0FA 4K8EA 2H9AA 3LRLA 2YBVA 4ZSUA 1XYLA 5A69A 2QPSA 3G1AA 4PRRA 4J3WA 1O5XA 5C9UA 3OZMA 3TA6A 4O8AA 2D2JA 2FH8A 5EGRA 1UIPA 2WLZA 1TZZA 3KOFA 4Z1YA 4DWDA 3CMGA 2YDRA 1LQ0A 1DJGA 5F7UA 3NQ7A 4UQDA 3HZ3A 3GBEA 3VKBA 4LV9A 4JX6A 2PP1A 3AHTA 2CBIA 4KS0A 3VIFA 3VNZA 2Y5EA 2OT1A 1R9XA 4PMXA 1G67A 2X1TA 3WH6A 4MWAD 3N9SA 5LIUX 1OB0A 1PBGA 3UF9A 4EIVA 3TLQA 3VMPA 4CNPA 1XPYA 3ABXA 1K8XA 1NEYA 4OE7A 1ZZMA 3W85A 3M5ZA 1F8MA 1B57A 4G7EA 3P80A 4UTKA 1QNOA 1LUCB 2D69A 3W1AA 8TIMA 3HB9A 4CN4A 3ITOA 4C5YA 4D72A 5F1UA 5FF7A 2G97A 1TKKA 1P0EA 1TV7A 3CL6A 1E3XA 2PDFA 5G1YA 2HBVA 4BI7A 1FY6A 2X16A 2PS2A 3F5LA 2I5GA 1KXHA 3HG2A 4Z1DA 1SQ7A 3AMLA 1ESWA 5IDZA 1XS2A 1QW9A 4PCFA 4DJFD 3H4XA 5DT7A 2A3EA 1JDFA 2G3FA 5LZLA 2P0OA 5CZTA 3LBCA 1CECA 3PZIA 4D1IA 3H2FA 3NCOA 4YYCA 2WM1A 1RUSA 2PAJA 4I90A 1PKMA 4QXIA 1JCLA 5TD4A 5DANA 1IR2A 3P0WA 4XKYA 4MFDA 4AZCB 1BWKA 4HTBA 3WK0A 2GDVA 1EPXA 4HZMA 3ABOA 5FF4A 3EPNA 4NSBA 1EJWC 2J77A 3LHTA 3SGUA 5BMXA 3F03K 1K7FA 3S6TA 4C60A 3TTOA 1GW9A 1A5BA 4F4RA 2Z29A 3W1QA 1R3WA 1OFEA 2G0WA 2GJXB 1ONRA 3LHVA 2WPBA 1VYRA 1U2YA 4HYVA 3UEQA 2E28A 2DJXA 3NXLA 1UOZA 1JCMP 1XBXA 4LUJA 5HR7A 1SZFA 1XBYA 4I7VA 3W81A 4L4OA 4K8HA 1DYSA 1ICSA 1DJWA 2WVVB 1BWVA 4W9TA 3B8TA 1JRCA 2C15A 3NQEA