1LQAA

Tas protein from escherichia coli in complex with nadph
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
346
structure length
346
Chain Sequence
MQYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHGLDPAQMALAFVRRQPFVASTLLGATTMDQLKTNIESLHLELSEDVLAEIEAVHQVYTYPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Tas protein
publication title Crystal structure of the Escherichia coli Tas protein, an NADP(H)-dependent aldo-keto reductase
pubmed doi rcsb
source organism Escherichia coli
total genus 125
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1lqaA00
2PDFA 4Q7BA 3N6QA 4GQGA 4LBRA 1XGDA 3UWEA 4PUUA 4WDTA 3P2VA 2ACRA 3V0SA 3BUVA 2AGTA 5LIUX 4XO6A 3UZWA 4JTCA 3CV7A 4NKCA 3RX2A 2PDPA 2A79A 3V36A 3LQGA 2DUZA 3CASA 2PDKA 2NVCA 2IPGA 1QRQA 4G5DA 4FA3A 4DBUA 3O3RA 1LWIA 3M4HA 3V35A 1T40A 1AZ1A 1AZ2A 1C9WA 3WBWA 2IKHA 2CLPA 2DUXA 4WGHA 2PDMA 1SM9A 1PWLA 2HEJA 5DANA 1AH0A 1T41A 1MRQA 2PEVA 3UP8A 1S2CA 3C3UA 4R9OA 4JIIX 4RPQA 4GQ0A 3R7MA 2PDXA 4JQ4A 2FZBA 1PZ0A 1PYFA 1MI3A 1IHIA 1EXBA 3CAQA 2I16A 2HE8A 1HW6A 1Z8AA 1XF0A 1A80A 2PDYA 4LBSA 3UG8A 3H4GA 2IPJA 2I17A 2IKIA 1AH3A 2WZTA 2HE5A 3QKZA 2IKGA 3BCJA 3N2TA 2IS7A 1VP5A 4JQ3A 4WEVX 2HDJA 3UZZA 5JH1A 2FVLA 3LEPA 4PMJA 1YNQA 1Q13A 4JQ1A 3EB3A 2BGSA 5LIKX 1HQTA 3LN3A 5M2FX 3CV6A 2P5NA 2PDIA 4XZLX 3LZ5A 2PDJA 4AUBA 3V0UA 3WG6A 4ASTA 2VDGA 4WRHA 4H8NA 4YU1A 2PD5A 4Q3MA 3R6IA 3F7JA 3WCZA 3LZ3A 1X96A 1US0A 4HBKA 5JH2A 2ACQA 2PFHA 2R9RA 4L1WA 4LB4A 5HNUA 3VXGA 4WDWA 3DOPA 3CAVA 4I5XA 2INEA 3KRBA 3LBOA 4WDUA 5HA7A 4DZ5A 2HVOA 4GIEA 3GHTA 3V0TA 3DN5A 3FJNA 3M0IA 3Q65A 2J8TA 3NTYA 4JTAA 3R58A 4HMNA 1Z9AA 4PRRA 4JTQA 4H7CA 1EKOA 4JTRA 5LIYX 1RY8A 4F40A 3R94A 4GA8A 2IQ0A 1S2AA 3T42A 1Q5MA 4XVDA 1R38A 4PUWA 3R43A 1ZUAX 1LQAA 4FAMA 3MB9A 4PR4A 3GHUA 4ZFCA 3D3FA 4LAUA 4MHBA 4JIHA 1JEZA 3R8HA 4XVEA 3ONCA 2HV5A 2PF8A 5LIXX 4GACA 1PWMA 3S3GA 4XZNX 3M64A 1RALA 4EXBA 4XK2A 4ICCX 1EL3A 2BGQA 1OG6A 1IEIA 5LIWX 2IPFA 2IPWA 1EF3A 4DBSA 1X98A 4QR6A 3ERPA 1K8CA 3WBYA 4QX4A 3LD5A 3UYIA 3LENA 2FZ9A 2ISFA 4IGSA 3BURA 2ACUA 4LAZA 3LUTA 1ZQ5A 2PDNA 3WBXA 3G1RA 1UR3M 3COTA 4QXIA 1QWKA 1ADSA 2BP1A 1AH4A 1PZ1A 2FGBA 1S1RA 3CMFA 4JIRA 4XZMX 2F38A 2FZDA 2PD9A 4GABA 2PDQA 1Z89A 3LNMA 1YE4A 3UZYA 2ALRA 1MZRA 4JQAA 1YNPA 4L1XA 4DBWA 3FX4A 2IQDA 3H7RA 3O0KA 1Z3NA 1AFSA 1ZGDA 4FZIA 3GHSA 4YS1A 3ONBA 4XZIA 3RX4A 1ZSXA 1VBJA 4FALA 2FZ8A 3BV7A 4WDXA 2C91A 3B3DA 3G5EA 3EAUA 4XAPA 2PDHA 2DV0A 3GHRA 4XO7A 1X97A 2INZA 3R8GA 3RX3A 2ACSA 1RY0A 1M9HA 5AZ0A 4JQ2A 2PDLA 2R24A 5HNTA 4PRTA 1S1PA 4YVPA 4IJRA 3GUGA 3UFYA 2WZMA 5AZ1A 3Q67A 5C7HA 4YVXA 4LB3A 4EXAA 1FRBA 5KETA 1J96A 2PZNA 2PDGA 4XZHA 4IJCA 2PDUA 3H7UA 2HVNA 4QBXA 2QXWA 1GVEA 3MC5A 3UZXA 1YE6A 2PDWA 1XJBA 4OTKA 3U2CA 2PDCA 3LQLA 4JTDA 2PDBA 4YVVA 3EB4A 4GCAA 3UGRA 2IKJA 2NVDA 2F2KA
chains in the Genus database with same CATH superfamily
3QY6A 5CLWA 4GRSA 3QHMA 4BS0A 4F0MA 2GWNA 3BCDA 1IWPA 1P7TA 3CAWA 3GXMA 3R79A 1VEOA 3VD9A 1BXBA 3POHA 4LS1A 4D6HA 1WZKA 2WPBA 2I7GA 1R30A 2OG9A 2F6XA 4GZEA 1RJPA 1TJ1A 3UZWA 1VLWA 3CV7A 1WAWA 2EPKX 4ZXLA 3U6WA 7TAAA 4ILSA 3W1LA 4C7DA 1A50A 4HQVA 2QPSA 3UEQA 3I7RA 5TF0A 2PDKA 3TLQA 3PZGA 4IHCA 3CUGA 1DXFA 4G5DA 2HMCA 3NZ1A 2ONEA 3U0HA 4QDMA 3DZ1A 4O8RA 1B9ZA 1T0OA 4K1WA 4IIDA 4E3TA 1PVNA 1FWDC 4S3JA 4GKTA 4RNJA 3UR5A 2HXTA 3GD6A 4ZOAA 3QGAC 1J0HA 1H5YA 4Q8PA 3ARTA 6PTDA 1DQWA 2YCJA 1W1ZA 4N4QA 3HPFA 1AG1O 5C2GA 2PTDA 1UR0A 3VKKA 5ENLA 1TA3B 3ITOA 1TE6A 2J62A 3TN4A 2OZ0A 3AMCA 3OB8A 3R7MA 2XSAA 4FF5A 5ABFB 1PZ0A 3UU0A 3WQ5A 2NV9A 2PI6A 2I16A 4EPKA 4B4FA 1E0UA 2BY3A 2QQ6A 4Z2KA 3IJ7A 3CH0A 1UKSA 4R53A 1WAUA 3NXLA 1JJKA 2NWSA 4CLMA 4G9PA 3P82A 3OYXA 2VR5A 4KRUA 2J7EA 4JQ3A 3DAQA 7REQB 3CC1A 1YDNA 2X09A 3RPMA 3NURA 4JX4A 1UJQA 1RK6A 2VGBA 2ABAA 3DKLA 3TSBA 3XISA 4S3CA 3QGKC 3LN3A 2E9LA 2G50A 1DORA 1MXDA 4MB5A 2D69A 1FWSA 1GZJA 2PWVA 4LF1A 3QC0A 3GX9A 3Q2DA 3W7CA 2GDUA 5EKYA 4EX4A 3APYA 3VMPA 1YHTA 1OZQA 1UZ4A 5EU9A 3A47A 2WWDA 1JPHA 4F48A 3U7VA 1XDJA 9RUBA 3CPGA 1NOUA 2I5GA 2FVKA 1Q45A 2VX6A 1L8NA 5HMFA 2A7PA 1WKYA 3IJLA 4QSHA 4JTKA 2P0OA 2GYIA 1JI1A 3QLDA 3M0IA 5FAGA 2PLCA 3CHVA 4UTWA 3WBAA 2B4GA 4ROQA 1W1VA 4GGBA 5DT7A 1TPC1 4H7CA 2J9YA 1LWJA 2CC0A 1US2A 4F9DA 4XZBA 4LJ3A 2PC8A 2V3DA 3LNPA 5KZMA 3T42A 1B9BA 1TJ2A 2EPOA 3QV9A 5LHEA 1FWWA 3WDPP 2VZTA 4B4HA 1NWRA 4REQA 2ZADA 1VRXA 3QQ1A 1D3CA 2XPKA 2FPTA 1DIDA 1JULA 4GQQA 2VR4A 4Q8MA 5A6TC 3VDCA 2PLKA 5G2HA 2C79A 2VGIA 2BDQA 4NASA 2ANUA 3R8HA 3ONCA 2HV5A 2TAAA 4DIAA 4FOKA 3D6NA 1REQA 4LH8A 3MVIA 1ZAIA 3KLKA 4GFSA 2GJLA 4KWVA 3AS2A 4O1FA 1KBIA 1K9DA 3R12A 1AW2A 3FS2A 4PCFA 3WBYA 4XV0A 5BW6A 5BZAA 3MVTA 1QUMA 4EANA 1X1ZA 4QAIA 1UPPA 2NZLA 1I6NA 1TQXA 5D37A 3IJ8A 2WSKA 5I78A 3MUZ1 2Y70A 3EDJA 4UXDA 3P84A 4YTQA 4WLCA 1B3OA 1RCXB 4RCXA 1PZ1A 3VIJA 2RUSA 3RMJA 4XBKA 5EFDA 3AUOA 3ANUA 5CGQA 1XQKA 3TE9A 3ECQA 1AMYA 3LA4A 4U5KA 5EBAA 4LYRA 1ZHAA 3GB6A 4RW3A 4CQDA 3AS1A 5FEZA 2FTWA 3VKJA 3FDGA 2NX3A 1D3HA 4FNTA 3AFBA 3PAOA 2WMJA 3MMWA 2DFAA 3WLLA 3MO4A 1GPFA 4IMFA 1ODUA 4DJED 1MWOA 1XBVA 3PZQA 5CXPA 4ZFMA 1JDDA 3TQPA 4LALA 5LGXA 3PAJA 1XX1A 3DYPA 3NQ7A 3ZYZA 1SSGA 1KW1A 1XKJA 3GAYA 4N02A 2ZICA 3ID7A 3M43A 2WZMA 3QN3A 2A85A 4N6EA 1CT5A 3NSNA 2CBJA 1DWIM 3GAKA 1H0IA 3HO8A 2DT1A 2P10A 1FCBA 1VJIA 3GVGA 1I4NA 1G7VA 2VENA 5CPQA 1L6GA 3WNLA 1H1NA 4HHLA 3H70A 4Q6JA 3BANA 2GGJA 1TRDA 1DIOA 2XYLA 2CPUA 2FLIA 2J8FA 1FTXA 4RNIA 3S1XA 4IQJA 2YJQA 1G67A 1YTDA 4GQRA 1AODA 2IKJA 1JIBA 2OZ8A 3VIIA 5HXMA 3ARPA 3N6QA 2Y62A 4Z1DA 1RBOB 1NDVA 3UJFA 1GZGA 4PUUA 2YL5A 3W7HA 1LF1A 3QH2A 1F6YA 1CYGA 1XH1A 3TROA 4BHYA 3RHGA 1HKWA 3FCPA 3EOLA 3BV4A 3PTKA 3OLIA 2WVVB 8RUCA 3IWPA 2F6UA 5G1TA 4N9DA 3ZO9A 4O0ZA 5KEZA 4E5TA 1CPUA 1JUKA 3PB0A 1TWDA 3CASA 2QZRA 1JYXA 1PV8A 2KZHA 4ERGA 2Z0IA 1N2VA 3W1AA 4C60A 1MEIA 3W1NA 1EJXC 4NXKA 2Y85A 1KXHA 4L56A 4R88A 5FEPA 4PUKA 1B3XA 4ZXOA 3N2XA 2VR2A 4M0XA 3JU2A 4IGNA 2IKHA 3HOJA 3V18A 3ZR5A 4B91A 2Q8ZA 2Z29A 3PBUA 1JCNA 2DSWA 2AAAA 2BHYA 3BG3A 3SCTA 3NM1A 1LUCA 3VIGA 2IXUA 4L80A 5D33A 2HPMA 3WLNA 4HA1A 4OVXA 3A13A 1QNRA 4O13A 4CN4A 2HS6A 4ZR8A 3CO4A 3S2MA 6XIAA 1VS1A 4CU6A 1MVYA 4YMZA 3NG3A 1ZALA 1N55A 2QCLA 4ZBCA 4Q6XA 1IWAA 2H3DA 2ODOA 4Z1AA 1TKKA 3RLVA 4DO7A 3BSGA 4GUIA 1VYSX 2CLFA 5DO8A 3GG0A 2OLSA 2ZC1A 5CZSA 1C8QA 1R0MA 5H8MA 5K2ZA 4H9YA 1XL9A 1ZZMA 2IKIA 3AHZA 3QRHA 2J88A 3BW2A 3CQIA 3N2TA 2YIHA 1QAPA 1FY6A 3L65A 3S6DA 3M0XA 2CLOA 5HWJA 3BGAA 3T4WA 2ZZ1A 2CZVA 4GUFA 5A6LA 4PMJA 4HOXA 1YNQA 3CLMA 1BGAA 2D0FA 3CUIA 4LXFA 3DBPA 5E6YA 3NVTA 4ZB5A 3HJZA 3LZ5A 2E09A 1L0PA 1GOWA 1ZB5A 3WG6A 2XTKA 1E3XA 2OCZA 1E56A 3B8VA 1RA0A 3M0ZA 3URBA 2BZNA 4DJFA 1FWCC 2ZUVA 1WDPA 4GX8A 3HG4A 3NGFA 1PTDA 2WSPA 1Q7MA 2ALDA 2PFHA 4LEQA 3NO1A 3PC0A 3W23A 3BCFA 4ZEPA 3N3TA 1HO4A 5FJOA 3WSUA 3CAVA 4I5UA 4E0CA 3F2DA 4D1IA 3LOTA 2RDXA 2C7FA 4LYPA 1UC4A 1H7WA 3VZXA 4O1BA 3EX6A 1F4AA 4AYSA 4MF4A 3GKFA 3PBYA 4TR9A 2YCLB 3OGRA 3TV8A 2BHUA 1M03A 3A3XA 3MANA 3Q65A 2HISA 3Q58A 3O05A 1QI2A 2NSOA 4QISA 3MYOA 3TW9A 4JTRA 1BYAA 2OJPA 3I3DA 4DO5A 1UA3A 1VAHA 5XIMA 4Q4OA 1J6OA 4G1KA 4ICMA 1RPXA 4W7VA 1JF6A 1P1XA 1U5HA 3TAOA 1HX0A 2FIQA 3ZT5A 4TVCA 1X8FA 3A6OA 4QQUA 3RU8X 2VL4A 1Y65A 2CKSA 3WEZA 3EXRA 4XQ6A 3DKJA 3WJZA 3I4EA 3RPTA 3BL3A 3N14A 3F2BA 3HJEA 4QTGA 5LIXX 4TOQA 3STFA 1TA3A 3LGEA 1Y0EA 4D9PA 4KETA 5D02A 2VHLA 1HF6A 4BKNA 3B0YA 3RUBL 2V3GA 4IMCA 3KCJA 1OWQA 2VWSA 5LHFA 5ABFA 3MQTA 3C2VA 3FXYA 3S42A 4ZTXA 1XG3A 4IT1A 4UTMA 3PWAA 3T0AA 3K4WA 5ABGA 2RJHA 3UYIA 3EEZA 5D2VA 5D4YA 4IGSA 4H19A 2CLMA 3R2GA 6ALDA 1PJ9A 2ADAA 3NQ8A 3K2GA 1F61A 2V82A 5AYYA 5GJPA 3WBXA 3QR1A 1TPUA 4PMVA 2V69A 4TV5A 1R87A 3BAJA 3QOMA 2CHNA 3EWCA 3TN6A 1HKMA 1K6WA 2F38A 4XZMX 2I57A 5EFFA 2RKXA 2V9DA 1LCOA 3NQMA 1NFPA 4O0QA 3M5YA 1UHVA 2HRWA 4LRSA 3N13A 2J7FA 2X42A 5HWMA 1H1YA 2E6YA 3IGSA 2C13A 4GK8A 3WF0A 3BSMA 1DJHA 5CJNA 3WJWA 1E15A 3MV11 4KEMA 1I60A 3CL7A 4Q7IA 3NDOA 4IQLA 1QO5A 1W3IA 4UFIA 4C6DA 4ORIA 2PS2A 3GIYA 1JNDA 1Z44A 2MUCA 2OYLA 3FAWA 1LT7A 4JDBA 1HKVA 4JCMA 1EXPA 4F0HA 4A8NA 3BMXA 2VCCA 4BA0A 1UWIA 2X05A 4J2MA 1LLWA 2VNCA 1GG0A 1BWVA 1PS9A 4HMCA 4RNFA 1EDTA 4HPGA 4HCHA 4P61A 1OYCA 2C1IA 2G3MA 4AD2A 3AYRA 2CXGA 2VDHA 4AD4A 4EXAA 1ZAHA 2C16A 2PDGA 3FJLA 4C7GA 3D3AA 1DWJM 4OBTA 4OUEA 3VDBA 2HVNA 1UMYA 4CCEA 3GG7A 1QNVA 2GDVA 1XRFA 1QCWA 4PMQA 2ZX5A 4EWJA 2B81A 4XAYA 5IXEA 4GCAA 3UGRA 1F3EA 1N8WA 2Z25A 4BF9A 3DX5A 3OPSA 3DC0A 3BAIA 3BH4A 1NOWA 2YDQA 2WZHA 4IMEA 3T55A 4FR6A 3SCSA 5HPCA 2XIBA 4WDTA 1SFSA 4CCDA 4PFHA 1ZBVA 2DVUA 1ICSA 1GZ1A 2WHMA 1EP1A 3GK0A 4B5UA 1GORA 4K8GA 1J0IA 4JTCA 1RAKA 3B0VC 1U83A 2D0HA 2Y24A 4NAEB 1UQZA 4N0RA 1NP0A 1OG0A 3KP0A 1HKKA 2OFJA 4GI9A 3MUY1 2VQUA 1GQIA 2GFTA 1XLBA 3QYSA 4B2DA 4DBUA 3W4RA 1KO0A 2C15A 2PWUA 2I1OA 1VLIA 3PF3A 3T07A 4ECLA 2BTMA 1CB7B 3W2LA 3WQDA 2B7PA 1IIGA 2V6AA 1F3TA 4QQ3A 3W1UA 5EGRA 4GYFA 2J75A 1Q6DA 3FN9A 3DXIA 5DANA 1ZJHA 4D2JA 5AVNA 1E3ZA 4QJ1A 3QV6A 4NX5A 3NQVA 4WSJA 3FJ4A 5DMYA 4RDWA 2VCBA 1DWFM 4C1NB 1WX0A 1TV3A 3TK7A 3KTSA 5IDIA 1AD1A 4GJJA 2CCRA 3QF0A 4LCRA 3W7RA 1IZKA 1TVPA 1GOIA 1AVAA 3SIMA 2FHCA 1GT8A 1PIIA 4UOJA 4ACYA 1V02A 3GU9A 3E0VA 4QJ4B 2ZXDA 2A4AA 2VURA 3W7NA 1C93A 3LS9A 3E0IA 4ATWA 5CAHA 3S9ZA 4NZ1A 3AIQA 3W74A 3OZYA 2VFFA 1XLJA 2YL6A 4GJ1A 5DCEA 2ZRYA 1J2BA 5HINA 4S3BA 4KW2A 5E0CA 1M01A 2EBNA 3S9YA 4GBDA 3EPOA 1S46A 8XIMA 2RHGA 1OFAA 2O92A 1E5NA 1LLOA 3LPPA 3VGEA 4PMRA 2CLEA 3EB3A 3I6EA 2X1UA 3HIJA 2NQZA 1QW7A 1EC7A 1A0DA 3WQOA 2J6VA 2VZOA 3BAWA 4NXSA 1GOQA 4DYKA 5K4XA 3OLDA 1XBXA 3LRKA 3AI0A 1J79A 4W87A 4US5A 1SO4A 2OOGA 3B0XA 1UWSA 3WH7A 3WD4A 2QCMA 1FWEC 3SZ8A 3WCZA 3AYVA 3TWAA 1EWDA 3LBCA 2J9XA 1T99A 1OX4B 3ZOAA 2YFNA 4XAGA 1U22A 1FWRA 4IPPA 2J13A 3TXZA 4XZWA 3KRBA 3RJYA 4YCPA 3LG3A 1C7TA 1DKWA 3IACA 2QDDA 3QR0A 3WMSA 1I2PA 1Q7QA 4HA0A 3BAXA 3BQ6A 1UOZA 1ENUA 5U7SA 4CD6A 4D6FA 3U8GA 1Q6LA 4JTQA 3SURA 4S3FA 3MI6A 3NYZA 4B3LA 4H2CA 2R1PA 4HZMA 3RN6A 1HFBA 3STCA 3VE9A 2E6FA 2Z6IA 2CZFA 4QJ5B 3JZUA 3QVQA 2B31A 4Z2GA 2E9BA 1ZRQA 1LT8A 2ZUUA 1R3VA 3E2VA 3VX0A 3PZOA 1K9TA 4ML9A 1LOSA 5DX7A 3BO9A 4XVEA 3KCOA 3C2YA 4IPJA 4ICNA 4LAMA 4Y9AA 4XZNX 3RRAA 5JXQA 3W9ZA 3O63A 3VAVA 1GHRA 3WLMA 1YDVA 2IPWA 3WMCA 1SUXA 5FF0A 3HG2A 4PBEA 1S2VA 3U4FA 3FDKA 3KVMA 3PNUA 1I8JA 1NF0A 1L6SA 1K77A 2E77A 4J28A 4ZL1A 1QPRA 4RE3A 3A9IA 4GVHA 3CQJA 1AD4A 2D2HA 3ARRA 3L4ZA 2C71A 3I65A 5FJUA 2G96A 4ZSTA 4NNCA 1KTNA 4UIOA 3YPIA 4AEFA 4QXIA 5CEWA 1ITUA 4GNVA 4HK5A 3G0UA 4R3UA 2W5FA 1TWZA 1W3TA 1SYTA 3CT2A 3AQUA 2XH0A 3BLKA 3FV9A 2FZDA 1NWUA 3QPEA 3TSDA 2V5JA 4JN7A 3GXIA 4AEEA 1OCJA 1B2YA 2QJIA 3N2OA 4O1EA 4XX6A 1W3LA 4TMBA 1EQPA 3DENA 3EKZA 1OBAA 5ECVA 3TYZA 2PRMA 2WV8A 1EJUC 4QE4A 3WF3A 3AIRA 3Q37A 5CC3A 3OLGA 1V3IA 4N42A 3W88A 4FZIA 2XM1A 3O6DA 3WH9A 4PSPA 1HJSA 3PZIA 4DUXA 4FALA 3GIQA 2UY5A 1E6ZA 1H4PA 2CXEA 2OU4A 3NGJA 5DCBA 5IRPA 3EAUA 2I5QA 2F61A 4CU8A 1TJRA 2VGFA 4H9XA 2J9ZA 4XO7A 4D71A 4NRRA 1V6TA 3GDLA 4NT0A 2Y7EA 1M65A 1VCVA 2CBUA 3QMSA 1LQ0A 5I5RA 2AKMA 1V6YA 3EDEA 1UD2A 3AIBA 2XN0A 3MKVA 4DPQA 1FWBC 5PTDA 4P7LA 4P7QA 5BU9A 1Q63A 1GG1A 3N34A 1E6RA 1WP6A 5J8LA 2QF8A 4PMYA 4AD5A 3MC5A 3M6DA 5G4HC 5CBIA 3EPMA 4OWGA 1XLDA 1UBSA 3O16A 3U57A 4AHQA 1O4UA 2VZUA 4TO8A 3FW6A 1W91A 4LBUA 2NVDA 4ALDA 1US3A 2R6OA 2WM1A 3BWWA 1OD8A 1YXYA 3QC3A 3ZXWA 4WY0F 3WO8A 4U28A 5DMMA 4BZYA 3CIXA 4M81A 1DWHM 3S0CA 5GNYA 3N2MA 1CGYA 1VBGA 1UH3A 4TXEA 4HNLA 1RZMA 1W1A1 4I8DA 3LCWA 3HU7A 1O5KA 4GH3A 3V1HA 4B90A 3WDJA 4DBDA 4DWSB 3A4XA 5CJMA 1KKOA 1ITCA 5LZLA 5IDZA 2TSYA 2DORA 3TTYA 4K7YA 1AJ0A 2D2JA 4NJGA 3UBPC 1GJUA 3L2LA 3NEHA 3TC3A 1CI1A 3TX9A 1Y8BA 3KOXA 4UFJA 1HP4A 3R11A 1WDRA 4AVFA 4YYFA 2EPMX 3KZSA 1EDQA 3E9AA 4EVZA 5AHEA 1L2QA 3SCUA 1ZTVA 3EOSA 1XW8A 3VKBA 4BF5A 2BVDA 3OVGA 3CS2A 4C6IA 2FQIA 1H09A 4GQ0A 4CD7A 1JDCA 5H6HA 4LS0A 2Y7FA 4AD1A 2DZWA 4AYGA 3VOCA 4JQ4A 5MKGA 2YYTA 4QEEA 1WKFA 2WSQA 3NPXA 4KCTA 2ZE0A 1EXBA 5GPRA 1W1B1 5D9PA 2C0AA 3H4GA 3WLSA 1EC9A 1W5OA 4JHOA 1YQ2A 3SUUA 2ZA2A 5DCDA 1M1BA 4ZE5A 2O9RA 3W84A 2IS7A 3QGVA 5K4ZA 3RF9A 4HNUA 4L6OA 3SN4A 1I2RA 2H3BA 4GBUA 4EP8C 2Y89A 3ZVIA 2VEPA 4LPCA 1E6PA 3T4CA 4FX7A 1O68A 4WY0B 3GBDA 3BC9A 3SDOA 5LIKX 4NILA 3L5LA 4A3RA 1NIUA 4LSBA 4RPPA 2PWGA 4GMEA 5E1QA 1R9XA 1H62A 1U5VA 2XM2A 2Z1SA 3NOYA 3R0KA 3GU1A 2VDGA 1OFBA 1WUFA 3NPVA 4L5ZA 2GQ9A 2BOEX 3SW6A 5LNWA 3R6IA 4O53A 3RFAA 3IEBA 2C3ZA 1P1MA 3SI9A 3AXKA 2C1HA 2V2HA 4AY1A 1N7KA 4L1WA 1A5LC 5F2IA 3IGXA 1V02E 1KFWA 1H7NA 2CLIA 5BNKA 1VFUA 5A8OA 2EGZA 3MHGA 2O55A 1KCKA 4DZ5A 1LBLA 3W37A 3GVVA 3FA3A 4QM1A 4JZ5A 4NAEA 5EMYA 4QEHA 1B0IA 1MYRA 2NXHA 4JFSA 3H2MA 4PRRA 1G5AA 1HGWA 2VUNA 1TQJA 2XIOA 3PUGA 1YDYA 2TODA 4MJZA 6CGTA 4K1GA 3VFCA 1TMHA 2FHBA 3VD5A 3ZM8A 3S4TA 1R38A 4XD6A 3PTDA 3G0XA 2VUYA 3SRHA 3AUJA 4UTLA 2CWNA 3ZSSA 3SBFA 4CNOA 3B4YA 3IVTA 1GVQA 2V8ZA 4IPNB 4WVXA 5IHSA 1XCXA 1XDMA 4OE7A 3B05A 1OINA 2Z00A 3QKEA 2X1TA 1QW8A 3VNZA 4GIRA 5G1MA 2J47A 1VPXA 2X30A 1Z32X 3RG6A 4QAWA 1OGBA 1RALA 3HPZA 1SJBA 4GJIA 3VPLA 7TIMA 5GNZA 1F7BA 2B7OA 4AIBA 4ORMA 5FF4A 4PODA 4R7WA 4Y7EA 2IPFA 3DUGA 1EF3A 3P0XA 4DBSA 2H90A 1X98A 5JU6A 5HK4A 4S3EA 3LCHA 2ZA3A 4PL2A 2GSEA 2ICSA 2WO5A 4HNVA 2Y88A 3PBMA 4CKQA 1E5JA 4DBEA 2Z1KA 2TPSA 1Q6RA 5F2LA 5BWAA 3R25A 5HJYA 1GVOA 4H9UA 4IX0A 3N9KA 1DE5A 2BP1A 4MAVA 3AMGA 2EO7A 2B7NA 1Q2SA 3MY9A 4AY8A 2D2GA 3WQFA 3S6OA 1JNEA 1J8VA 3VGFA 2PGEA 4FLRA 2RFGA 3MMDA 1JDEA 2E1WA 4W5UA 4JEJA 3A12A 4PMNA 4I9MA 4JQAA 4PUMA 3FHQA 3NR0A 1KNWA 2XGZA 3VA8A 3N19B 1DV7A 4WQ6A 1QTWA 3QHOA 2QDEA 3PUEA 1OC6A 1BAGA 4XWUA 2RAGA 1IQ8A 3L9CA 3MW7A 3WLRA 2R1MA 3QOKA 4YIWA 3S5SA 4G8TA 4DM1A 3WK3A 4OIFA 2WWCA 1FUYA 3G6MA 3WQ6A 4C6LA 4XD4A 1LRNA 4OV4A 2W6RA 3R10A 4JHMA 2R14A 4GWEA 1XD1A 1G69A 3NSMA 1X97A 2INZA 2CLLA 4DY1A 4JGDA 1WXJA 3A22A 4M24A 3DERA 5D8WA 3NL6A 4C7FA 4Y90A 4LVGA 4E3VA 2QVHA 1UP0A 2A2IA 1L6WA 1M7OA 3BMWA 4LS2A 2PTXA 3VD4A 1PDZA 1PZ2A 1XLFA 1QK2A 3IRSA 3F4DA 4J35A 1I75A 3M9YA 1G01A 2OO0A 4GY0A 5IBXC 3QQWA 3H7UA 4Y9PA 3N6HA 1C92A 3KBNA 1GVEA 2ZE3A 3KBMA 3UWUA 3EOEA 3JZEA 2YW4A 1KQZA 2W62A 1XIDA 2PDCA 1XH0A 1E4MM 3GTXA 3BGGA 3VC6A 2V81A 2OYKA 1BQCA 3KWXA 3NQDA 1IR1A 1FP8A 1K6AA 5A3HA 1TB3A 2PDFA 3WMLA 4FXSA 1UD5A 4Q4QA 1XGDA 4LAOA 3W00A 4NZ4A 3LHZA 4WF7A 4PA8A 1XUZA 1UW9A 5M17A 1P6CA 1NY1A 1XV8A 1MUMA 4EPEC 1BFNA 2PUZA 3ARQA 2AMGA 3P80A 3BLEA 1ZBKA 2A79A 2PPGA 1OT2A 1FA2A 2SFPA 3BLPX 3RU6A 3TTEA 3LPFA 1W8GA 2C1GA 1EO5A 4C5YA 3CB8A 1OVDA 2QKFA 3OIXA 1EYEA 4GI4A 2Y0FA 1C9WA 1F8IA 1JXJA 4IXHA 4WHBA 3AAMA 4QIUA 1DQUA 3WBWA 2ZX8A 4ACZA 1GONA 3H2AA 4LWWA 4S3KA 5FJTA 4RE4A 1K1DA 3WLKX 1AH0A 1T41A 3M0YA 3A9BA 3OODA 4H7VA 4UC5A 4JIIX 3ISIX 4PC8A 3TLLA 2O9OA 2ZX7A 3W1QA 4NZCA 5FF3A 1AQ0A 4KEUA 5HANA 3R0DA 2V5CA 1J6PA 3AZSA 2OKTA 4AZBA 3PJXA 1PCWA 3M44A 3THAA 3V1PA 1OF8A 3UZ5A 3GDBA 1TPB1 2WZTA 3UJ2A 2QIIA 3Q45A 1P6WA 3DBNA 1MMFA 4GC4A 4H6KA 2IXVA 3BCJA 3WL0A 2XN1A 5FEXA 3IIOA 4QLKA 4WEVX 1OFEA 3S1UA 1JAEA 3CB3A 1EIXA 4KIEA 1S5MA 3CNYA 3WD2A 4MPKA 1PEZA 4C90A 2DEPA 4HMDA 1EJWC 2BGSA 2CLKA 1EX1A 2RDWA 3C2EA 3PPCA 3DYOA 1WYIA 3E38A 3XIMA 3MUIA 3MSYA 3V16A 1YTKA 1O95A 3GNNA 4DAIA 5CQ1A 5REQB 1PX3A 1QPQA 1SJCA 3KS6A 3N73A 1KR1A 3F7JA 2H9AB 1JD9A 5EMLA 3VU2A 4ATLA 1FOBA 5A6BA 2VD8A 4B15A 1WDWA 5BMWA 2QJMA 2A3CA 1PTAA 1W3KA 2KAUC 1DJYA 2WVUA 4CQ8A 2G37A 2PE4A 3TMLA 4ZOBA 1ZP4A 1ISVA 1UP2A 4AZCB 3AC0A 2V5BA 4WK9A 1FHLA 1LBFA 4HA3A 1KFBA 4GA8A 2IQ0A 1MW1A 1BRLA 2BY2A 2GJPA 1ZAJA 4UCGA 3SCPA 2XGIA 1SU5A 1W17A 2I56A 2PF0A 3G1YA 1ISXA 1MUWA 3APGA 2V5KA 2NSXA 3LLFA 1TTIA 2NVAA 3OOQA 4JIHA 1NJJA 3C5QA 4D6DA 2X1IA 3JUGA 3N11A 4MWAB 3VTRA 2BBFA 1E4LA 1GHSA 2GGHA 2XVNA 3B4UA 2Y4SA 3GYCA 1H2JA 3ZVHB 4YL2A 4QP0A 3BOFA 3PG9A 2QUTA 4J3SA 4ICCX 3R1ZA 2Z28A 3ZWSA 5C9RA 1UZDA 4QITA 2CETA 4WSKA 2E5CA 4XSLA 4QR6A 4UNKA 5A8MA 3EPNA 4Y6GA 3CMJA 4K7VA 1DJIA 3HM7A 3K1DA 4DHGA 5FOOA 2NQ5A 2XIQA 3VIHA 3B9DA 1ELSA 5A2AA 5JBFA 3KL3A 3KRSA 3LCFA 5AHFA 1QWKA 3K46A 2VP8A 3NJ3A 1TWWA 2QJGA 1CIUA 3W01A 3REQB 3W72A 4HYRA 2ZX9A 3W2NA 1W9BM 3SADA 4GABA 1TWIA 4O17A 3CK5A 4M82A 4WY0A 4IXXA 4XD5A 4EAMA 1JPIA 3SY5A 4HJFA 1WOAA 3RXZA 4O18A 4FLSA 4MFEA 1EA9C 1ITQA 2F8QA 1FH8A 4XZIA 4A3HA 5HMDA 3THQA 2D1ZA 1BGGA 4H83A 5AC4A 4GQBA 5CC6A 2DIJA 3S2LA 4ZE4A 1RK5A 4FR1A 2QCDA 1LYXA 2DV0A 4CEUC 2C19A 3QEZA 4GO9A 4K39A 4NJIA 1RLDA 5BU6A 2ACSA 2DVXA 5C9XA 1XCWA 3L4TA 3WQEA 3TZFA 4YVPA 1EZ2A 3EWUA 5LKYA 2P0IA 3A21A 2PLJA 3SGGA 3ME3A 3NCOA 5C71A 3H2FA 4F0LA 1JG9A 4R7OA 1NDYA 2CZEA 4XZHA 4JL1A 1E6QM 3F4VA 2PZ0A 2X2YA 3CV2A 2YA2A 3LM3A 1KLYA 1XLKA 4RJEA 1E9YB 1Q85A 3MMUA 4Z2JA 4C6PA 1IE7C 4L4PA 4PB4A 4LUJA 1Q66A 3GG8A 3R89A 4Y9MA 4A05A 1K9EA 1VBRA 2ZZ4A 5EYWA 3FKKA 2PU1A 5I09A 5B7YA 4HCLA 3G8RA 2V5LA 3M6YA 4PH6A 2WMHA 1JRBA 5AVHA 1MNZA 3KTXA 5AHIA 5A6SA 3C52A 4PUEA 4Q8NA 2P3ZA 3RX2A 4AFYA 3GZ3A 1GOKA 3OTRA 3PTMA 5F2MA 4KKXA 3CTLA 5DEZA 4US5D 3CIWA 3WDQA 1R9YA 3CYVA 5BXTA 2CERA 3VOJA 3S1WA 4FK9A 5A8QA 1L9WA 1G1YA 4RV3A 4GYJA 4HN8A 2DZUA 4PMXA 2G41A 3DEQA 4J5NA 4LC6A 3PP7A 1WCGA 1MW0A 1PX8A 1PKLA 4W93A 4Z17A 5DBUA 3N04A 1CB2A 3BOLA 1VHNA 1X6UA 3LU2A 4C1KA 4ZGYA 1BTMA 2ZUWA 3RM9A 3VKCA 1EJSC 1F05A 1PPIA 3UJRA 3GXNA 1V6VA 5D09A 3SM0A 1K7FA 3M46A 1M68A 3MTWA 5L9FA 2BSLA 4G1NA 1ZLPA 4Y9NA 1AJ2A 3UG5A 1GVFA 1ZPTA 4EPDC 4HSNA 2NUWA 3MKCA 1XF0A 2VEGA 3H6OA 3QV8A 1WKEA 3PBWA 3WH8A 4NAFA 1XRSA 4J40A 3VDHA 4P5UA 5DF0A 4NP7A 2WCGA 4K2SA 5JH1A 1P7TB 4MADA 3G3DA 1E6SM 4K8HA 4MLRA 2WHKA 2VX7A 4GFIA 4B5VA 4UBPC 1VBHA 2A5HA 2GUYA 2OWWA 4ROPA 3FIGA 3TYUA 4J3VA 3DGBA 3LMZA 3KZPA 1UWQA 3GS6A 1VHCA 3PZVA 4FI4A 5FL1A 4P8WA 5A6JA 3MBDA 1IXOA 3EWDA 3IANA 1WE5A 1HJVA 3CAKA 4FHAA 4HBKA 2H6RA 3GTHA 2QCGA 4WJXA 3BE7A 4LB4A 4CNPA 7ODCA 3DOPA 2I5IA 2QUUA 2OPJA 3IK4A 1BD0A 3G1XA 5FJIA 1QPOA 1DXIA 2UY2A 1CNVA 2JKAA 3LBOA 2YA0A 1Y5XA 3M07A 4JOMA 1VGAA 3K8KA 4GIEA 2E1DA 3I3BA 3EOUA 4W85A 3AU2A 3QBUA 2WVTA 1GQKA 4IM4A 3ES8A 3N4AA 4M19A 1GVRA 4M3PA 3KWSA 2P88A 4E2VA 2NX1A 3NDYA 4W7WA 3TJ4A 4AHOA 4XZ9A 1DTNA 4TTUA 4JFVA 3VABA 4EAYA 1Q5MA 4FNUA 3VNIA 4F2BA 4PR4A 4MJ4A 1TUFA 1H50A 3HFTA 4BEQA 5IFTA 2BXVA 2E25A 4DELA 4A3UA 3I4KA 4N9BA 3CPRA 2Z1BA 4S2BA 3K8MA 1S5TA 4DJEC 1RBAA 4G6CA 4LUSB 4FNSA 4XG1A 3W1TA 3GVQA 3URNA 2BLEA 2DSUA 2J79A 1UWRA 3M0KA 3T6CA 1OFRA 3S2NA 5C54A 1C3FA 4KRZA 4EACA 4LNCA 1HL8A 1GEQA 2G3JA 2ISFA 1UZ1A 3BURA 4WGXA 4XUGA 4OGZA 3PZ9A 2OX4A 4AC1X 1K70A 3S8HA 2XINA 7CGTA 3WD0A 3I6RA 3MO7A 4R7JA 1U1HA 5TBOA 1QNOA 3WX7A 1G4EA 4F9JA 3CIVA 3LYEA 2FGBA 1KCLA 3PTQA 5CPLA 9XIMA 3M0VA 1SZFA 1BYDA 4OHQA 3H22A 5KZDA 3PWIA 3LNMA 4X63A 1H41A 1DXEA 2VC6A 4HYWA 1JL8A 4KERA 4UTTC 2C18A 1NFGA 1MZRA 2QLYA 4X2RA 3FVMA 2Q6ZA 4MB3A 1ME8A 3MWAA 1PBGA 4NY2A 3TC7A 1EO7A 2XSXA 3TFXA 1GQNA 4I8YA 1RJRA 4HHMA 1XSKA 2VI0A 3MWCA 3GE7A 4IOTA 1IIHA 1QJWA 4REQB 4X60A 4EF8A 3VMNA 3O6YX 1C91A 1K8YA 1TPWA 2XVPA 3BV7A 3CUZA 3JVAA 2NQ9A 4N7QA 1W37A 2EKGA 2KX9A 4MGGA 1EDGA 2XH7A 2F7FA 4AZGA 2EKCA 5D05A 3WDRA 4U33A 2ZKMX 3PB2A 4QJ3B 3WNKA 1LORA 3WUEA 3OZPA 3J7HA 1TYGA 1QI0A 2WQPA 1XHGA 4BQ3A 4AZCA 2Q71A 3T2PA 4A2SA 3WQPA 4WOQA 5C7HA 4LB3A 4MNKA 2XHYA 3JS3A 3KHJA 1J96A 1HKIA 1VFSA 3AIWA 2VJXA 4IJCA 3T09A 1Y5WA 1CDGA 4HNNA 2WXDM 2V2DA 3F4WA 5U4NA 3QZAA 5I24A 4F2TA 4Q4SA 4BI6A 3WUFA 3T9PA 4PL1A 3EB4A 4M29A 4MWAA 3LDVA 3STGA 1FVPA 2F2KA 1C90A 4Q7BA 4QRNA 5LNSA 3W0KA 3IIPA 3A3WA 4MY9A 1U1UA 1HUVA 5FESA 2OLHA 1XYLA 1EA0A 1GKRA 4XO6A 1YIXA 2J24A 3S5NA 2DH2A 3VKAA 4E8GA 1JFHA 3GW0A 4MZ8A 3PSVA 4MM1A 3AMDA 5HNRA 1K7EA 1S5WA 2NVCA 1GVYA 2Y8UA 3O3RA 4PMZA 1XBYA 1F6KA 3PPFA 1JCTA 1TCMA 4HKPA 3ANVA 5BOOA 2ZZ5A 1IXQA 1R7OA 3REQA 1TELA 1JAKA 2DSZA 1HNYA 2ZUSA 3F1QA 4H6EA 3S2CA 1SW3A 4EE9A 3FFSA 3N12A 1SFTA 4O19A 2W92A 2XIIA 2YKKA 2PEVA 1S2CA 4R9OA 5T91A 1A5OC 4RPQA 4RDZA 4LV4A 5AHNA 3HV9A 4Q4KA 5GQBA 4HA4A 4DF0A 4GX9A 3W53A 2QPXA 3TZNA 1EOKA 3AS0A 1FKXA 3AISA 3UNDA 2ZBTA 5CC5A 4TMCA 1E1FA 4MG4A 1O7AA 2YBVA 1QU4A 1YNYA 1NEYA 1ZBCA 5DY2A 1KGXA 1LM1A 1Z69A 3G1AA 2A3HA 4LFYA 1IV8A 2Y7GA 1OYAA 3CHDA 2J74A 3OHMB 3OP2A 3H26A 1KFKA 2YB1A 1KA9F 4IIEA 5A1AA 4S39A 3RLGA 1EBGA 3HN3A 4UQBA 2Z1WA 5I79A 1M41A 5E0FA 1UKOA 2GL5A 3QQ0A 1W32A 2FVMA 5M2FX 4HOWA 2CZ5A 4ZTYA 4GH1A 5AYXA 4MLJA 1LDCA 3CU2A 3EDKA 3LCIA 4EKJA 5I2UA 1Q4WA 3B9OA 3KVLA 3EYPA 3IIXA 3LZ3A 1X96A 1RH9A 5E5CA 2FMOA 4AQLA 3NOEA 1XLIA 2BXZA 3VXGA 4HHPA 2FYMA 3TTSA 2GJXB 3EWZA 2W61A 1V7YA 1GOOA 3N15A 4V1YA 4NI3A 2OT1A 4WKHA 1XISA 5JIWA 2HVOA 3E2QA 3DN5A 3OA5A 1PO9A 3ZLHA 4M1RA 1TR1A 1R47A 1J2WA 3IV3A 4HVXA 3WK0A 4O1DA 4MMWA 1W8SA 2YDSA 3AOFA 3SCVA 3USBA 2AAMA 3MHFA 4HJWA 4A6GA 2VXNA 1S2AA 3ATZA 3GFXA 4A21A 1IZJA 3MS8A 1BYBA 4F0RA 4HTBA 3TYEA 1V0LA 1D3GA 3GNOA 4HU4A 4D6EA 5D04C 1PL9A 4LAUA 3BG9A 3DFSA 4MHBA 3N4FA 1J0JA 4AXNA 1JEZA 2O0TA 4NJHA 3KVJA 3BAKA 2VD9A 3M64A 3S5ZA 1BG4A 5TNVA 1RR2A 1D8CA 1EL3A 3UXKA 1WZMA 1D8WA 4E4PA 2ZRVA 3BLDA 2XIJA 3MYPA 1YDOA 1OYBA 1JQXA 2XUCA 1LOQA 1W1TA 2GDQA 2ACUA 1OX6A 2VEKA 1FDZA 4XIMA 5HATA 4NJJA 4D6IA 1BYCA 3TW6A 3PM6A 2WVSA 2H8XA 4JTIA 2PAJA 4C6MA 2EG8A 3P7YA 4Y2WA 3SUTA 4W89A 2Y5SA 5FI8A 1R8LA 1A53A 2YZRA 3TFCA 1X6LA 2VYOA 1BWLA 3E02A 3EXSA 1YNPA 3GR8A 4H01A 3IJQA 2JBMA 1S39A 2FHFA 5LXXA 2X41A 2Y5JA 4Z2HA 1MW2A 4GE8A 4M51A 3I7QA 4WXYA 4W4QA 1ZJIA 4E38A 3GXFA 1KTCA 1MQRA 1FQ0A 2Y61A 1KLZA 4GVIA 2NT1A 5DXXA 1AMKA 1M7XA 1I2QA 3GXDA 4FLQA 3EXTA 1VFMA 1E0XA 1F2JA 3VUSA 1Q6CA 2YXXA 3W86A 5C2CA 3GHRA 1UWAA 3NO3A 1KCXA 2ZDRA 1FXPA 4JTUA 4P8UA 3R13A 3W7MA 3C2FA 2GSHA 3GVRA 3TN3A 4DO4A 1GNXA 2WCSA 2OB3A 5A94A 1A5BA 2GGEA 2O9TA 5D2XA 3W25A 2DJLA 3S6TA 3DHPA 4M6QA 3IRDA 5G2WA 5B7ZA 1VCFA 2XFYA 2VOMA 3W22A 3C2RA 1MW3A 1K4HA 1YE6A 2Y5EA 4UZSA 3N17A 1CCWB 2EJ1A 4GUHA 2ZFAA 3POCA 4R33A 3E3HA 3EKLA 3BLOA 3MP3A 1TE1A 1O60A 2WJZA 4MB1A 1F3WA 2E9MA 3QFWA 5KSWA 3QZEA 1PUDA 4BQ2A 4LVAA 3GXTA 4LUSA 5TD4A 3TYBA 3W24A 4OV9A 2ACRA 1WZLA 2ZRWA 2BB0A 4JICA 4XIAA 2PP3A 3WQCA 3GDTA 4UNLA 3ZS4A 4HB7A 4Z42C 2REQA 4C6QA 4AISA 3LQGA 2DUZA 3UPMA 3ARUA 1X39A 2ZVRA 1MEWA 4WKAA 1TMQA 4WX2A 2IPGA 2XU2A 4UFLA 3CZ8A 1LWIA 1B30A 3K1GA 4V1XA 3M4HA 1BSLA 1G94A 4L7ZA 3OG3A 5E9XA 3S1VA 1IR2A 2WJDA 1JCMP 2DSVA 4KWWA 1CECA 4KFPA 4J9JA 3WNNA 4W84A 2W0UA 4IJBA 1YBQA 2RJGA 1W6TA 1KXTA 4GNJA 3ALGA 2CLPA 2A7NA 1IXPA 3ABXA 4CVWA 1ME9A 4IX2A 4J3ZA 3E2RA 5LXEA 3PWGA 3PFMA 3R5EA 1E72M 3C3UA 2X1SA 1Q3NA 4MWAE 2AKZA 4DWSD 3BMVA 3NIYA 4QFUA 2GOKA 3RCYA 1FBAA 3C2OA 5J04A 3DYMA 1IHIA 3LPGA 1XLMA 5D38A 4B92A 2BASA 3QR3A 4LBSA 6REQA 1MZHA 1WOBA 1DWGM 3VD7A 2DIKA 1KWKA 2C14A 2XFWA 3R8RA 1ONRA 1OQFA 4AX7A 1TX2A 2IMRA 3HPXA 3HBLA 1EEXA 1Y7VA 4I6VA 1PIGA 3QPYA 3VDAA 1LJYA 4IICA 2RDUA 4GY7A 3UF9A 4LQ1A 2GOUA 5D8ZA 3CL8A 3TOYA 3BW4A 3R0UA 2WBKA 3L7RA 1A5KC 1J11A 4XB3A 1PSCA 1TVLA 4GYPA 1BVWA 1HQTA 1BF2A 3BICA 4P8VA 1YW1A 2QUNA 3LI1A 5FJPA 1V3HA 2DZVA 2G4JA 3VM7A 2PDJA 4TVUA 4XBJA 2E4TA 4DZAA 3NYDA 2I9EA 3IGHX 2NQHA 3LI0A 4H8NA 1I9CB 3A5FA 5AYIA 1OFPA 2EJAA 4UWMA 2WOQA 1UH4A 3AU6A 4NI8A 2BOFX 2OWCA 2X8RA 1KXVA 4Z08A 3W2MA 1YKWA 3TA6A 4C6KA 4WSHA 1E4NA 4S3DA 1J93A 4YTUA 3QY8A 3PFRA 4WJ8A 4LRTA 2QAFA 2X0YA 1JD7A 3PJTA 2A1YA 1KFLA 2QHAA 2TRSA 3T81A 3S46A 3FY1A 3WIJA 2VTFA 1EP3A 2WLZA 1WNOA 2BV9A 4CD5A 1Q2RA 1JVNA 4MZYA 2PLMA 3ITTA 1TWSA 4CCCA 1A3WA 4DYJA 3MI2A 3TA9A 1TREA 4GZIA 4NZJA 2XFRA 2A3EA 1TTQA 1YXCA 3KP1A 1LQAA 2FJUB 3UXAA 4NSBA 4XKYA 2ZXQA 1GJPA 2QULA 3D3FA 1DE6A 1A5UA 2GVEA 4UTTA 3P62A 4HPHA 3UWVA 1PWMA 4AMCA 1JZ5A 1B3YA 3G22A 1GUVA 3VOGA 4J7RA 3SECA 4NZ5A 4M6UA 1TRIA 1EGVA 2CU0A 2XWEA 1Z7AA 3SQMA 4F66A 1XSIA 5HQEA 4PFMA 8A3HA 1QFEA 4CN6A 1K3UA 3LD5A 3SRKA 4F0KA 1QOPA 4JPGA 2AQVA 2E6AA 3WQ4A 4DI8A 4B3ZA 2VCAA 3CEPA 4F8XA 3APTA 3HGRA 3KOYA 1Q65A 1OFOA 3B9AA 3QFEA 3FGCB 4DUWA 4PTDA 3L4YA 1ECQA 2YGYA 1SMDA 1A4LA 3LTYA 1W5QA 2VZVA 3VGDA 2J6XA 1KB3A 1V4YA 2GQ3A 4HN4A 3UD6A 4GVGA 3BW3A 1ONWA 2YCIX 3UZYA 1IT8A 3SRDA 3RNDA 3ALFA 3PHAA 4KT2A 2IQDA 3NQAA 4G7EA 1QNPA 4UNIA 3GHSA 4A4AA 4Q4MA 2XIMA 3CWHA 3URAA 1HJUA 4XTDA 3HF3A 4IWWA 2QV5A 4OU1A 5JIPA 3LXCA 4OBSA 1P0KA 3AS3A 5DXYA 1JDAA 2J7HA 2WYSA 2QR6A 4M8UA 2GJXA 4UQDA 1QI5A 2E8ZA 3P5YA 2PCEA 1EF2A 3WKZA 3NQBA 4ZB0A 5AZ0A 3P0WA 2PBGA 5HNTA 4PRTA 1UBPC 3INPA 1F9CA 3UFYA 3A4WA 5E0KA 3LLXA 5BWFA 4UTJA 3FOKA 4C6BA 3HQOA 2Y2WA 3GIPA 4GG9A 1YPXA 1VC4A 2ZC8A 4FLOA 4O57A 3SB0A 1W5PA 2OQYA 5JBDA 3AXHA 3IUDA 4FSAA 3UZXA 1FXQA 5BOEA 2JGYA 3U2CA 1CXIA 5L6UA 1VH7A 2WSRA 5C2XA 5J5DA 2DH3A 3HPAA 1THFD 2QEZA 1B57A 3WBEA 4AIOA 4LBRA 3KRUA 4IF2A 3UWEA 5KTLA 5C70A 4ZA0A 1X8CA 4GLEA 4AHPA 1VKFA 5MF5A 5HULA 1XG4A 1Y5VA 3UT0A 2AQOA 1SMAA 1EGMA 2OWXA 5A6KA 1V51A 1XINA 4DF2A 2WZIA 2JGQA 4C6EA 4AW7A 1HO1A 2XVKA 3NQCA 1CXKA 4XD3A 3NA8A 4F0SA 1RXOB 1WBHA 4YHEA 2X40A 3LCLA 3HMCA 4YJ5A 3L67A 4RXGA 2YLAA 1E71M 5A69A 3NL5A 3SAZA 1IGSA 3V35A 5A95A 1AZ1A 3VCNA 1HTIA 1UWTA 5E09A 1CZ1A 3MP5A 3T40A 1VEMA 2VX4A 2ASHA 2I14A 1XRTA 4QROA 3SY1A 5CG7A 3NNTA 4HSHA 3DG6A 4RDYA 3ICJA 1BLIA 1NQ6A 1VFTA 1TJ0A 1JUBA 4QLLA 4OT7A 4P2VA 2OODA 2A21A 1TIWA 5DY3A 1XUUA 1W9XA 3CAQA 3TWBA 4F3HA 4L6DA 1R2RA 4DXKA 4KS0A 2ZZ6A 2WMFA 3TTQA 1W2PA 1WQ5A 5EMJA 2I17A 3QJAA 5G1YA 3VIPA 1K4GA 2IKGA 3DFTA 2WM0A 3WN6A 4J3XA 3UYCA 3O07A 5JBEA 4TU1A 4RL3A 3G6LA 5HR7A 2A6LA 1DVJA 1V08A 2ZVIA 3ZWTA 3M47A 1NTHA 3UCDA 5C55A 2ISSA 1EJTC 2VFGA 5C9UA 3T08A 5DMNA 1SZNA 3DH7A 4XZLX 4AF0A 4KIRA 3CTTA 4QS6A 4ZO8A 4UR8A 5I3FA 1JF5A 4Q22A 1RP8A 4YU1A 2DSKA 1K02A 2OELA 2PD5A 4W86A 1I1XA 5D9MA 1N8FA 1RBLA 4Q8UA 2XFFA 1BTCA 4R27A 1US0A 3NQFA 2E6DA 3L66A 1QHZA 5DN1A 2EEXA 1F6PA 2YL8A 5HUOA 4B5SA 4WUIA 1E0VA 2YB4A 1B4EA 1K8XA 5J5RA 3BXWA 3G0SA 3O9NA 3U2OA 4GUGA 4KH2A 3H23A 4FB7A 2VEFA 3BLIA 3JR2A 3OHIA 1SO6A 4PN2A 3V0TA 3E0FA 5MKGB 1Q8AA 3NTYA 4Y8EA 3MSDA 1A5NC 2BNJA 1BF6A 3LRMA 1SZGA 1SQ7A 1SW0A 3BOXA 1RVKA 1VD6A 2RGLA 2QUVA 4W8LA 3SCRA 3FA5A 2ZIDA 4H8HA 1G0CA 3SJ3A 3H54A 4MUPA 2P8BA 4K68A 4UZUA 2VEIA 2GSJA 3W7QA 4F4RA 1E70M 3M7SA 3QTGA 3AXMA 1X38A 2OMAA 4PMOA 5CSYA 1GTHA 4UQEA 4D6GA 4XK2A 2PGRA 1SR0A 1UMLA 4INFA 3TP4A 2X7WA 3W02A 2ZZ2A 3LXBA 2E28A 3GNPA 4TX9A 3WQGA 3CYJA 1Q7ZA 3EMCA 3L0NA 5C7VA 3ERPA 1E0WA 4LU0A 3GH7A 1LL6A 1UH2A 3AYSA 3L5MA 2WBGA 2YYUA 3CGTA 2FZNA 2IW0A 2QCEA 4JIQA 3HTWA 4GIYA 3IJDA 1ZQ5A 4X61A 5F1UA 3UWYA 2I9UA 4MWAD 4PCSA 5D2YA 3CHFA 3AJXA 3HV8A 3GVWA 4GC3A 4AY7A 4GNKB 3WLOA 4LVDA 4NVTA 4JYDA 2EPHA 3AXXA 4HCDA 3WLIA 3FSTA 4ZOCA 1XKYA 1GYLA 3CH9A 4PUNA 4N4PA 2ALRA 1R3RA 1UOKA 4Q7NA 2HQAA 4HGXA 1FWHC 4PCTA 1TPDA 1ZGDA 3AZRA 2CYGA 4M5PA 4F2UA 2D2OA 1R3SA 4O4VA 1SR9A 1NP2A 2GUBA 4P8XA 3B9NA 5HDRA 3E2SA 5LNUA 4L6HA 3S47A 3RX4A 1OABA 2BVYA 3STEA 4CUCA 3TXVA 1U33A 3QSRA 5FEWA 1GKPA 1B3WA 4R5EA 2CW6A 3O7UA 1WXZA 2ZRUA 2IQTA 4UFHA 2ZUTA 5I3GA 5I02A 5JQ9A 3AXIA 1JFXA 2HWGA 2PDLA 1QBAA 3GXPA 3GY1A 4CN1A 3GZAA 1WDQA 3NEVA 4I90A 3I3EA 3M0JA 1S5VA 4XTIA 3UJSA 4NQ1A 3VM5A 3F03K 2YBUA 2Z2AA 2AL1A 5A2BA 1ONXA 3OO2A 1RJQA 2PZNA 3W07A 5IM51 2CESA 4DO6A 3BZJA 2ISWA 3UG3A 1Q6OA 1UQYA 1J0ZA 3T0TA 1JRCA 2J7GA 3K4AA 2DDXA 4WKFA 1TVNA 3KS5A 3SCNA 4MJMA 1TTJA 1P5BA 1JR1A 4IG2A 1QASA 3NZPA 2YDAA 6TIMA 5EMMA 2Q8XA 1GYNA 3B04A 3MJMA 2BS9A 4FXJA 4HMEA 2CHOA 2VFIA 1PCKA 2XG9A 1WDDA 3LSCA 4FIQA 4PZVA 1W1YA 3XINA 2YXOA 4GD0A 3P93A 3TOPA 1SVDA 2WC3A 2F2HA 3QZ6A 3MU7A 3F4NA 4H6QA 2GGGA 4NKCA 1ADOA 4D1JA 4IZGA 3ARZA 4MUZA 1ALDA 3W75A 1MEHA 3G1SA 4GXWA 3TC6A 3W73A 4YNGA 4YTSA 3KBJA 5FD0A 1MRAA 1DJGA 4J3TA 4X0VA 1KM6A 3FGCA 4HU3A 1RD6A 2V0TA 2VX5A 4WZHA 1RCOB 1ZU8A 1V93A 1DTUA 3MJYA 1WBJA 1EPXA 3G2GA 5BROA 3O6AA 1A3HA 1BXNA 1UWUA 1QO2A 2GK1B 4Z0JA 6TAAA 5MHBA 1OIMA 2BOGX 1ADDA 1HT6A 1WB0A 4Y9OA 1XRVA 4UTFA 4M6VA 2FMNA 1W9UA 1AW5A 2JIEA 4IP4A 3U2ZA 3P81A 3SCWA 2PDXA 1NFBA 1EUNA 3LX9A 3CUJA 3CUHA 3CBWA 5D03A 3HGOA 3ITCA 3TTOA 4IIHA 1Z8AA 1GOXA 3WDHA 1H11A 2PDYA 3D46A 1UR4A 4PSRA 5JMUA 1TIMA 1T96A 2OX1A 1TV4A 1PDYA 4PCNA 2BGNE 4Y96A 1JYWA 3UPWA 1K9FA 5A8NA 4LAKA 3VYLA 2WQDA 1XPGA 4YLWA 2G4FA 4MAZA 3GNDA 3THCA 1EPVA 4DJDC 2AQWA 1CGWA 1NH6A 1XIJA 4Q4PA 4LF2A 2P3EA 3CLWA 5HPOA 3C0JA 2DZTA 4K8EA 4IP7A 3IGUA 3CV6A 3UWQA 5FJJA 5K9DA 4RW5A 2FKPA 4RR4A 4CNTA 2P8CA 4CD4A 3QMTA 1E1EA 1MSSA 2Z2UA 4JY8A 3CHCA 3OZOA 5KZEA 5C8BB 4YXGA 3KOFA 5A8PA 2R1KA 3GW3A 2R1NA 4NNBA 4W8BA 1Q8JA 4Q3MA 1MNSA 3H2CA 2VC7A 4IIFA 4YTTA 4OJYA 3OGVA 5JH2A 2DQXA 4GIAA 1KFJA 4AMAA 4E2BA 2GZXA 4ACZB 2J7DA 1SJAA 3IJIA 1BG9A 2W9MA 1OY0A 1RSCA 2EAWA 3KL5A 2D3LA 2INEA 5C5YA 3SEPA 2XVGA 3TNOA 4MKNA 4KBXA 4K3ZA 2X0SA 4C5ZA 1VYRA 4IFKA 4E2DA 1V6XA 1BSIA 2JE8A 1LLZA 1IGWA 1JZ8A 2ZXAA 4PRWA 3A3HA 1N8IA 1B3VA 2D22A 4G2DA 1XLCA 5HNNA 1GWJA 3RM8A 4X22A 5F4WA 1ESWA 5BCAA 2X2GA 3IS4A 3N4EA 1HKJA 4DN1A 3D0CA 1XQLA 3DFNA 1E73M 3PK7A 1XR2A 4HIBA 4AWTA 1XCFA 1A5CA 5T26A 1ICQA 1V0MA 1ME7A 2J7CA 3KEHA 4ZODA 2HBVA 2A6NA 4L9YA 4LTSA 3C86A 5FCZA 4QG8A 3IARA 3SY8A 2QJNA 2YBTA 2VEMA 5EY5A 1NM9A 4EXBA 1CXEA 3EGJA 3ZJKA 1HG3A 4FS9A 2PTYA 2DT0A 1DL3A 2OQHA 3W1RA 1QVBA 4GI6A 4QGCA 2GQAA 4AIUA 1DP0A 1QOXA 1FX6A 3QY7A 5I3DA 2NV1A 3LGGA 2E40A 5BXRA 2PDNA 4PUDA 3RR4A 2VVSA 4MZ1A 5I3KA 1UASA 3COTA 2AMXA 2WLYA 2FB2A 1AQMA 4UR9A 2PURA 2GUUA 2BXYA 3IVSA 4FPSA 2OR2A 2Z1XA 4B5TA 1VIWA 3B0PA 2PSNA 4OOZA 3LHVA 1A3XA 2ESCA 4LUTB 2INFA 5HR6A 1MFUA 1YPIA 1TPEA 3EX3A 3O0KA 1EH9A 1W9DM 3CUXA 4NHVA 1AFSA 4AZ6A 3ONBA 3EA1A 3NQ6A 3HFYA 4KWSA 3C0SA 1BRLB 1J0KA 1T6MA 4I7WA 3GBEA 3ZSTA 4O15A 2P1FA 3SQLA 4DB7A 1VEPA 4LT9A 3DC8A 4A22A 5FA5A 3WZ0E 4IQEA 1XIIA 4CD8A 4FX6M 4B9YA 3MUAA 1XIMA 2JEPA 3GNXA 4IIBA 1IWBA 2W66A 1M9HA 4O16A 4QCFA 5G4EA 2PB1A 3IIVA 5AN7A 3BGJA 2E0PA 4NZFA 1Q4NX 2HSAA 3HZ3A 4ERIA 3AALA 3ITXA 4KMQA 4PBFA 1E51A 1VJZA 4YVXA 3RIKA 1ITXA 1RV8A 1POKA 2TMDA 3LV5A 2PDUA 1H7PA 5FJRA 1Q6FA 4I9TA 3SUVA 3EA2A 1XBZA 2QYGA 1QNSA 5T9CE 3GYEA 3FAXA 3QW4B 1NF7A 3WH5A 4CQBA 1E9IA 3PSWA 1F73A 3TAKA 3LGDA 4AVOA 1LRQA 4XAFA 2VOTA 1XIHA 4V15A 3W7KA 4AD0A 5HJXA 4B3KA 4E6MA 3PANA 4QNWA 4H9VA 4U2ZA 1POJA 3P2VA 1CENA 4D6JA 3FNDA 3GNRA 3KOZA 3UESA 1OD0A 3UQNA 4IH3A 3W1PA 3ZIZA 1MQQA 4ZMGA 4LEFA 3QMRA 3P5ZA 2ZUNA 1U2YA 1B4KA 1UJPA 3EWYA 1WO2A 4JHZA 3OJGA 5CGTA 1UG6A 1ZNNA 3SR7A 3T1GA 3V7PA 1O6IA 2RDTA 1DWAM 1VPYA 4LYQA 3EWXA 4V27A 1QOQA 5CSRA 4Z2LA 2DZBA 2QCDB 3PPHA 5LA1A 1M6JA 1D7KA 4OZOA 4DI9A 2D24A 9CGTA 2WJEA 4PTVA 1DJQA 1GW1A 3LXAA 3K30A 2DVTA 1DBTA 1FHDA 1E4IA 3L4XA 2F84A 1TX0A 1XIEA 3ZMRA 3S1GA 4RK8A 4NNAA 3CJPA 3W1MA 3P3BA 1H7RA 4AWSA 1I0DA 3GWQA 4MPQA 2NQLA 1J18A 4RNHA 5KINA 3N29A 4O0KA 3IAPA 4GO8A 4E4UA 3TDFA 4XBSA 1RPKA 2WC7A 4B5WA 1HJQA 4GZ7A 3VZZA 3LRLA 4B16A 4PCPA 1XGEA 2YA1A 1DEDA 4UR7A 3OLEA 1XYCA 4MSSA 1OZMA 3ZQ9A 3ARSA 2ISVA 1KM1A 4ENLA 5FL0A 1KM2A 4UOZA 3PNZA 2WMIA 1JPMA 1ISWA 1TV2A 3SCQA 1QHOA 1IEWA 5CCZA 1TPFA 1QK0A 3KW3A 1UKQA 4U4MA 1Q13A 1QWGA 4M7SA 4WD0A 2HK1A 2YXGA 2P5NA 2PDIA 3RJXA 4GHRA 3SIZA 5CLTA 4RZ6A 3FEMA 4I7VA 5F1VA 5FF7A 3K4DA 2ZRZA 3VGBA 3PY2A 2QNEA 4KGJA 4UUIA 1WA3A 1XIBA 5A8GA 5CG0A 4H8VA 2ZUMA 4S3GA 5EMUA 1UC5A 2YCEA 3W7LA 3WUGA 4GXMA 5TQLA 4MVAA 5CPNA 4CQ9A 4HU8A 1YX1A 1VFHA 3GKAA 2OEKA 1EJVC 1O94A 1BVNP 4UTUA 4NL1A 3F5LA 5H8UA 3BTNA 2G97A 3C8FA 3OW1A 5BXSA 2X1RA 3ATYA 3F5KA 3PVFA 3G24A 1SO3A 4JTAA 3R58A 4NG3A 3CM4A 1KR0A 3AJ7A 3WJXA 2QW5A 3WEMA 5AYBA 4F40A 3ARVA 2GVLA 2B7QA 1DOSA 1IF2A 2YFOA 5LA0A 4W8AA 5H8PA 3OGSA 4NAFB 2CWXA 1W9VA 3PPGA 3W83A 4UMAA 5CSUA 3FXGA 2PWHA 1RQBA 1TFVA 1A47A 4JAWA 4RE2A 1UUQA 3UR7A 2GK1A 3JRKA 4MYAA 1DHKA 4AZHA 1ZJAA 4GUJA 3E5PA 5BRQA 3WNPA 3GC5A 1Z42A 2HTMA 2ZXBA 2BVWA 4IISA 1AL7A 1LG2A 4BR1A 4POCA 3IJ6A 1RLCL 1E1CB 1UR8A 4MYXA 3C6CA 1K8CA 4DXVA 4C91A 3T2OA 2Z24A 4H4IA 1JI2A 3MKKA 4A35A 1WXYA 1A0EA 5KZ6A 1TV5A 1AH4A 3TYCA 1S1RA 3AMKA 3NL2A 3VOIA 2VVNA 3U4AA 1CLKA 4YPJA 4H1ZA 1XXXA 4DVOA 5C9ZA 2DU2A 3NWRA 2JK2A 2BY1A 3NPWA 1YE4A 2AOSA 4DEFA 1C9DA 1JCJA 3AZTA 3W71A 2HS8A 4V33A 2PA6A 4Z1CA 3UA3A 4L1XA 4AB4A 4X3ZA 3CV1A 4UCFA 2XJ7A 1JUEA 4WJEA 3O06A 4GISA 3QW3A 4DJFD 4EXQA 5GVJA 3AHXA 3DHUA 3II1A 3KXQA 5D2WA 1IEXA 4DZIA 4FOJA 3UW6A 5DT5A 3CZGA 1CXFA 4FP1A 1VENA 4MOZA 3U9IA 2HK0A 3PJWA 4FO4A 1XYZA 2OXNA 2D73A 2CBVA 4JQ2A 3ZZ1A 3KUMA 4OKDA 4MNLA 1GGOA 2HVMA 2WPGA 1HJWA 4HOZA 4IPLA 4HK7A 1UR9A 3OA3A 3B0UX 3DHFA 2YPIA 4FEZA 5AZ1A 5DBTA 3I6TA 1PKMA 3LHTA 3GO2A 4NRSA 4JL2A 2FPVA 2G0WA 3UXLA 1RQEA 4GOAA 3CZJA 1XWYA 1R85A 1UB3A 3TJLA 1A49A 3SUWA 4DZHA 1GCYA 3WF1A 2EPLX 3H2EA 1EOMA 1QHPA 4JTDA 3GSMA 4HZ6A 4YVVA 4LY4A 5JVLA 4Q8TA 2UY4A 4AZ5A 3LHWA 2VMFA 3A23A 7REQA 4Q4RA 4ZO7A 1BWKA 1JZ7A 4OFCA 3NZQA 5G2IA 4L61A 5AHLA 1HL9A 3BUVA 4RZ4A 1S2UA 3OZMA 1MXSA 4E8CA 3WNOA 3BZGA 3G1FA 3UCCA 5XINA 4O28A 2WB5A 5FAJA 1JZ4A 1CXLA 3G1HA 1FHVA 3ZT6A 1OC5A 2OT0A 1KKRA 1G4TA 1FFRA 4FA3A 3P8IA 4RKAA 3MT1A 1YTEA 3ITLA 4GI8A 1GQJA 2CITA 5CPTA 5I07A 1AZ2A 5JUVA 4DJDA 3EMZA 3O15A 2J4GA 1WPCA 5RUBA 4DNHA 1VPQA 1P4CA 5LSMA 4I9AA 4Q8OA 3LY0A 2HEJA 4LUTA 5F7UA 3AROA 1JZ3A 4UMBA 4ZCWA 3L21A 4JTTA 1X1OA 3HA1A 1KM5A 1OEPA 4ZQCA 4YWSA 1ZL1A 4PBGA 1YXDA 3MSRA 1W0MA 2OTDA 3B8IA 3T78A 2VC9A 4PYSA 4FNRA 4GZJA 1R46A 3L4VA 1LG1A 1VJSA 1ML1A 5BYWA 3MDWA 3OQEA 1W3JA 1PHQA 1XIFA 2YLLA 1IXNA 3AWNA 1OSEA 1JDFA 1AH3A 3NM3A 1JPKA 2QJJA 4I6KA 2QF7A 3DECA 3W26A 4QE5A 3V3WA 3UCQA 4LX4A 4V28A 2ZTJA 1CGUA 4J1OA 4A8LA 3VVGA 2IUZA 3JW7A 4RE0A 1S2WA 4Y8FA 3SCOA 2ZYFA 4LGXA 1SJDA 3MCOA 3RAOA 2DGAA 2W27A 4L64A 4PB3A 4HSOA 5ABEA 1RHCA 1ZBWA 2B0MA 2AL2B 1B1YA 3VE7A 2YSWA 3SFKA 2NWRA 3NL3A 4NU7A 3NDZA 4AUBA 2PP1A 4IL2A 3W7JA 4TIMA 4ASTA 5HMEA 3ZFHA 2QIWA 4DYEA 2XH4A 1LZOA 1QI4A 3BLFA 4JTEA 4MDOA 2F9RA 2R94A 4LC8A 3VK5A 3VIFA 3WD3A 1UD4A 4C1LA 4JS3A 4BFAA 3CL6A 1GQLA 2PC4A 3VGHA 3B8DA 3TCSA 3WDIA 5D32A 4QDPA 5HNUA 3W6LA 3OVQA 3ITGA 3LPOA 2VGGA 3CWNA 3RLUA 2J7BA 3K5XA 3NO5A 2WKLA 2FGLA 3LCXA 1SFJA 1PHWA 3G1DA 3TR2A 4EWND 3W7OA 1KBBA 4CU7A 4MDPA 1H3GA 2Z26A 4NX0A 4B2DD 4N2YA 2A0NA 1Z9AA 4L4LA 2VC5A 5DMLA 3URQA 3S9IA 3MUCA 3SQSA 1ICPA 1PAMA 1EFZA 2NXIA 3N6JA 1P6BA 4ZO6A 4JNMA 3N9RA 1D9EA 4NZ3A 1A5MC 5XIAA 1J0YA 4M1BA 1WV2A 2XVLA 3L2MA 3WJYA 1J10A 1VR6A 4UOQA 4K38A 3E1F1 3F5JA 1V3KA 1DPMA 1V79A 3L4WA 4AD3A 4O10A 3ABRA 4BF7A 2ABBA 3I7SA 3IUIA 1PZ3A 2QJHA 1GEHA 3ELFA 1FWJC 2D3NA 2WHJA 2YX0A 2VELA 2BGQA 2BG5A 4NYYA 3KVKA 4R85A 1QXLA 1NSJA 2ZOXA 2G8ZA 1V3LA 1W56A 1HGYA 4LNYA 5EBUA 1M04A 4PEEA 4EIVA 1CXHA 1TMLA 2WC4A 4ONVA 2HCVA 3ARWA 4O14A 3RM4A 3VNMA 1BVZA 1CLVA 1FKWA 5K9CA 3QTPA 3A4AA 3V75A 1HVXA 5FACA 4OOUA 4FNQA 5AFDA 4JIRA 1H0GA 4C6CA 4NJKA 2XISA 2FDSA 4HD5A 1NDWA 3TEVA 2V3EA 3UNTA 4KQNA 4QSFA 2YZ5A 3LSBA 2V67A 3W76A 3FYOA 5IOBA 3M5ZA 4J2PA 4WCJA 2ZZ3A 1G6CA 1AUSL 3UERA 2DW6A 4Z1YA 3WENA 2WVVA 5HAOA 3P6LA 1NELA 3EOOA 2LLEA 1MUCA 4C6OA 4QDWA 1ZSXA 3VNDA 3RLHA 3UVAA 4JD4A 2EG6A 1L8PA 4DWDA 3G5EA 3ZLGA 4LANA 3T05A 1UA7A 3UY7A 2J27A 1HVQA 1ZENA 4GXPA 3MA8A 3ZJ7A 1TPVA 1R9ZA 2OEJA 4ZQPA 3HGJA 3L23A 1AK5A 3HQPA 3LBMA 4LW7A 4PTWA 2BVTA 4AU0A 1VZWA 4KFNA 1GYMA 1Q6GA 4JTFA 4RX0A 2HPIA 3BARA 3F2CA 4KCWA 4JTJA 5ABTA 4YCOA 1PB0A 8XIAA 3CUFA 3TJIA 5KETA 3MMTA 2J66A 4AVNA 4JN8A 4LCQA 2VWTA 3RMEA 1V0KA 2WMKA 2V63A 3QYQA 4D8ZA 4JKLA 3IUHA 1FWIC 3WEOA 3TSMA 5EB8A 1XJBA 2XH2A 5K3VA 1B31A 1NU5A 3LQLA 1GK8A 3T8QA 3HG5A 4L4MA 4UFKA 3U5UA 4DWSC 1LWHA 4QG9A 3C56A 7ENLA 4H6RA 3E0LA 4L65A 4HNTA 4HNCA 2QMKA 1FHUA 2VDIA 2OZ3A 2Y1HA 3GM8A 1OT1A 1E1CA 4JTHA 5KMYA 1X6NA 4DXXA 5GJMA 3TYAA 2PDPA 5DQPA 1GW9A 4NIRA 1F3XA 1KM3A 5C0QA 5M1TA 5H1WA 3MI3A 1T8XA 3L0KA 3AIUA 2JF7A 4E2OA 2QV4A 4FMVA 4TX6A 2YOCA 1KM0A 4IUGA 4PGLA 5SWUA 3OYZA 1LTDA 4RDVA 1QR7A 3TYDA 1RP9A 5A6MA 3M16A 3WL1A 5F2GA 3O1NA 2CBIA 4JX6A 3TMQA 3WH6A 3VIMA 1CLXA 3DFPA 4CGTA 1S2TA 1KRAC 2YCLA 4JEQA 1OHLA 3LMYA 2BMBA 3SSZA 1KM4A 3L4UA 1UUOA 2POZA 2JKEA 5AECA 3A5VA 2YCKX 3RO8A 2R82A 1PYFA 3EDDA 3LHUA 1IEQA 1ZY9A 4AIEA 5HOSA 2ISDA 3UG8A 2DZAA 3LB0A 4LUIA 4W5ZA 1D7FA 5CPMA 1H1ZA 1KBKA 4DAFA 2HE5A 3QKZA 1XH2A 4MIMA 1FFQA 2O7QA 5BRPA 3GDRA 1VP5A 5I3HA 1DIKA 2NUXA 3MZNA 2CKRA 3CO8A 2FVLA 3E0WA 1MQPA 3CWOX 2CIPA 3KBVA 4PTXA 4FX8A 3H4XA 2ZTKA 3MV01 3T7VA 1UKPA 1SSDA 1W1IE 3SGZA 4J4KA 5AC7A 2QCFA 4XISA 2REQB 3A4JA 2QDGA 3DG3A 3ABZA 3O8AA 1FCQA 2PWFA 3CT7A 1IT7A 4OECA 1N82A 1TTPA 4LY8A 2A3AA 4GKLA 3BJFA 3DI1A 4UQAA 4DLMA 4JTLA 3IVUA 1JYVA 2QDHA 1VFOA 2ZWYA 3FKRA 4DF1A 1DJXA 4JIPA 5I3JA 4ZOEA 1YBQB 3D47A 8CGTA 1O5RA 3WLHA 5IBXA 3FA4A 3W81A 4XAZA 3SRFA 2UV8G 2DZXA 2CZDA 3WLPA 1G9HA 4MFDA 4ADTA 4WDUA 4MNJA 4JKMA 1H51A 2ZWZA 4PE8A 3VNKA 2NXGA 2V68A 1W5MA 1B54A 3TKFA 3FK4A 4US6A 5A2CA 5I23A 1V03A 2PP0A 2ZQ0A 3EX1A 5LNRA 4PEKA 2XZ9A 1EKOA 3EKGA 1U30A 3P60A 3U7BA 1YYAA 4JR5A 3R94A 1M5WA 3WJSA 1JXKA 1AA1B 6REQB 2FDMA 3VMOA 2W63A 2Z4GA 3PUDA 4HPJA 4TX8A 3VD3A 5F4XA 3EB2A 1NWTA 3P74A 1C8YA 3PZNA 1I1WA 4FAMA 2GVGA 4NYUA 1TG7A 3TUUA 1M53A 4HK6A 3QV7A 3HG3A 4G56A 2PF8A 4CQAA 2EF9A 4GACA 4QHRA 3B03A 1FCVA 3PUOA 3QSTA 2CFFA 1OG6A 2XGBA 1O12A 5HJLA 3AO0A 1C29A 1IEIA 1P43A 1WUEA 2UZ9A 4F79A 6XIMA 1ISYA 4Q8QA 1CGVA 1HXJA 4MB4A 2D0GA 2P76A 4UTHA 2FZ9A 2ZDSA 1EYWA 5DLCA 1V7AA 4LAZA 1IZCA 3HURA 4RUBA 1BQGA 4LV9A 4KWUA 2O56A 4FNPA 1QMLA 3RYSA 1TZ7A 4QG6A 4S2CA 4EOUA 2PD9A 5HQLA 2WNWA 2ON3A 4ML4A 5CZTA 3L0GA 3BJTA 3S83A 3EWBX 2G3IA 3LK6A 3HQ1A 2AL2A 1GVIA 3LERA 5D30A 3AIVA 3V4BA 4AAJA 1K03A 3RPDA 3MSGA 1T7LA 3R4IA 1BKHA 4FXFA 1E6NA 1Z3NA 4YS1A 4PMDA 1CTNA 3VOFA 1CGXA 3VILA 3WELA 1XDLA 2GJNA 1CBGA 1BEUA 3DGRA 2QUMA 1KBJA 1OADA 4XKYB 3B3DA 3FEQA 3KCLA 2WHLA 4B9ZA 3FSUA 1UR2A 3GH5A 4LUYA 3UPBA 4YTRA 5LNVA 3F4CA 2V38A 3AWOA 1ZJBA 3CEUA 4JFWA 3OBEA 1F4HA 1JPDX 2R24A 3T44A 2OYMA 3W70A 2G5WA 3KE0A 4I7UA 4J3UA 4BWLC 3BQ5A 5B80A 1E43A 1R7AA 3DG7A 2X7VA 1TPH1 3C0LA 1KGWA 7XIMA 3SN1A 3NZRA 2AGKA 3C3NA 3BSHA 5LYRA 1EIBA 1YRRA 4C1NA 1XD0A 4L1GA 1TV7A 4JKKA 1EJ7L 4S1FA 3WF2A 1XM3A 2ZZ7A 1OK6A 3Q4DA 1NDZA 4QBXA 4ZZ9A 1KFCA 2RH9A 2OEMA 2JIWA 3PG8A 4BI7A 1DHPA 4OTKA 1KGUA 1E9LA 3CMGA 4KPLA 3EDFA 1TV8A 1XGZA 3B9EA 1FDYA 2G3NA 4IGMA 3H7VA 1RCQA 3OVRA 1Q6EA 2OKOA 1MDLA 3NVDA 1RA5A 1KRBC 3H21A 4GQGA 2WAGA 1VB9A 3T2QA 1MO0A 2HNHA 3AMLA 3NSXA 1E0TA 3EX4A 3UR2A 1LP6A 2EPNA 2OGYA 1PKYA 3V0SA 2W79A 3PBGA 2Y7DA 4ZB2A 5E9AA 2ATMA 4G7EB 1XSJA 1AQHA 2WNZA 2Y63A 4ZVJA 3FYPA 3KX6A 1JCYA 3LTPA 3KLLA 4BY3A 1QPKA 1FWNA 4WXZA 1EJRC 1KXQA 2V5DA 4X9YA 4EPBC 1WZAA 3VNLA 2E67A 1T40A 2PGFA 3BPWA 3W2KA 4BEUA 4QS5A 3V5CA 4GINA 2CHRA 1P0BA 6ENLA 4WGHA 3H12A 1OX4A 2PWDA 4DPPA 2Q02A 3VCRA 2E3ZA 1E6XM 3N25A 2VT0A 4UTIA 2OZTA 3PN8A 4DX3A 2ZA1A 3M7WA 2QCHA 3DFYA 2VKZG 1HL2A 1W2VA 4Z2IA 1NWSA 1BKSA 4PMUA 3PR2A 1KV5A 5CBBA 3W7IA 2Y6ZA 2W4XA 4X2PA 2W67A 3LV6A 2WNNA 1O1ZA 3TQVA 3WFAA 3ZT7A 4JYEA 1G7UA 4ZQRA 3KM8A 2DT2A 3B06A 1QW9A 3C4UA 4GPNA 2Z27A 2QGYA 4WR3A 2IPJA 2O4MA 3M0MA 5DFAA 3W7DA 2HJPA 1W3NA 4URIA 3DFQA 3UR8A 1J5TA 4CNSA 3GUWA 2ATSA 4M80A 2GWGA 2HDJA 2V2CA 2ZCGA 4XUYA 1OK4A 3RR1A 3SGUA 3LEPA 2PU0A 3WK2A 3O0FA 4KCUA 2OSWA 4JQ1A 5AKQA 3CQ0A 1E55A 5C6MA 1O66A 3ZLFA 3GC4A 5CH9A 3QPZA 4JDYA 4QLJA 2XDFA 3O2LA 3MCNA 1Z6KA 3ITVA 3B40A 5BXPA 1OC7A 1KC7A 3ORWA 2O7SA 3T0CA 5CGMA 3BLLA 2Q09A 2EHHA 2ACQA 5I3IA 1KWGA 2FFIA 3IPWA 4C65A 4C6NA 1FWFC 3KBWA 5AB3A 3MBFA 1KBLA 4I5XA 3PZTA 4DNMA 1A5AA 3ES7A 1XC6A 5E6ZA 1TZ9A 5HQMA 1FH7A 3NQGA 5AHMA 1ISZA 1CGTA 2ZRXA 3L68A 4Q33A 5AC6A 2CNCA 5IHRA 3I10A 2J8TA 4DUOA 2BHZA 4MWAC 2QAPA 1VFLA 1J12A 1EEPA 3GTNA 3UJEA 4XVDA 2GQ8A 3IIZA 4DLFA 3QXBA 3U48A 1ZUAX 1C7SA 3EWWA 1V6WA 3BG5A 4O54A 3BDKA 1R2SA 2E8YA 2C6QA 2R1LA 1QATA 3WD1A 1WDSA 3UWZA 4W88A 4PUJA 2QVNA 4O12A 5AY7A 4DUVA 4MJ2A 4AF0B 3RCNA 1H7XA 3KTCA 4V2XA 1V77A 4A29A 2BFGA 1FP9A 3QHNA 3VIOA 1OFDA 4O1CA 3NPUA 3LENA 4N6FA 1GKQA 4AH7A 3WFLA 5G4WA 1KCZA 3LUTA 3W1XA 1J4EA 4CVUA 1W5NA 1VCGA 1ODZA 3G1RA 4JX5A 3PZMA 4ADUA 5IFPA 5CPSA 4RZ5A 5CAKA 4IMGA 3WYZA 2Z1VA 2BY0A 4RLIA 5CKSA 3TU9A 4E8DA 2UWFA 2L5HA 3SJNA 1Z89A 3B8WA 1SPQA 5HWNA 3OBKA 3STPA 1TO3A 3ZJ6A 4S38A 4ADSA 1PXGA 1HIZA 4DBWA 1KRMA 3UY8A 3O6CA 3NXFA 4B5NA 1M7PA 2FGZA 1GVSA 1I0BA 2WNQA 1VYPX 1JZ6A 5G5IA 4Q32A 2WMGA 4H2HA 2QPUA 1L6YA 3SUSA 4DWSA 5A6BD 2DQWA 4LVFA 1LOLA 3N18A 2OQLA 2FZ8A 4BJHA 4HT3A 2PTWA 3U5YA 3K13A 4DJDD 5C9WA 3H24A 1K7XA 1ECEA 4XAPA 5EL1A 3CQHA 4I5RA 4GCXA 4YHGA 3VKDA 3EMQA 1LL7A 1Z41A 4J27A 4FF7A 3V5OA 5GNXA 4O50A 4IMAA 2QGHA 1U1JA 1NAL1 1OJXA 1D2KA 2R8WA 1HZYA 3GUGA 3MZ2A 4QE1A 1KTBA 3VDGA 4D72A 5I06A 1HN1A 3N3MA 3QM3A 4KFOA 3HGSA 5CPOA 3Q67A 1IT0A 4U5IA 2MANA 4W9TA 1UYQA 1UCWA 2VO5A 4U10A 1ONEA 4JY9A 5H91A 1FWAC 3W38A 1UIOA 3T8LA 3BAYA 4XSMA 1XLLA 1S38A 1QBBA 2Y8KA 2OOFA 2QXWA 3W7EA 3E96A 2WZEA 1EB3A 3UXIA 2R91A 1I2NA 3E12A 4L4OA 2GJRA 4W7UA 2X16A 2F6KA 4QCEA 5A6AA 6A3HA 4IGHA 1YADA 1OGGA 3CZKA 2DZSA 4IIGA 3G77A 2Z2BA 1LL4A 3S5OA 1SZRA 3G8EA 3VOHA 1JYNA 1BXCA 3S5YA 2OLAA 2G95A 2YDRA 3GH4A 4I9JA 5CSSA 3A64A 4KEZA 1Q6QA 4BQ4A 4EF9A 1CW2A 2AGTA 4RV8A 4O52A 5LIUX 2VZSA 4LVBA 5ECUA 4UQ9A 2G3FA 2VFEA 4GVFA 5FSDC 1UR1A 2JALA 3ZR4A 1F5ZA 2YR1A 5FKYA 1SW7A 2MNRA 3N1AA 2GLKA 1H61A 3HMJG 4CNNA 2PTZA 5D2TA 1QRQA 3WY1A 2POTA 5E93A 1I45A 4EK7A 4ZQOA 1A4MA 1TR9A 4ZQMA 2O4QA 4DJEA 3VI2A 1A5SA 3DHDA 1VQTA 3AHVA 2NQJA 3KDNA 1FCUA 3W87A 4HPXA 2FTYA 2QMJA 1XI3A 3TN5A 1HJXA 1XYAA 3M5XA 2DUXA 1SM9A