1LQAA

Tas protein from escherichia coli in complex with nadph
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
346
structure length
346
Chain Sequence
MQYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHGLDPAQMALAFVRRQPFVASTLLGATTMDQLKTNIESLHLELSEDVLAEIEAVHQVYTYPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Escherichia coli Tas protein, an NADP(H)-dependent aldo-keto reductase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Tas protein
total genus 125
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1lqaA00
3LZ5A 3CASA 4JIHA 4FA3A 2AGTA 2IPJA 4EXAA 2IPFA 1AH3A 3UZXA 2PDMA 4GQGA 3H4GA 4YVPA 4RPQA 2IPGA 1QWKA 2HE8A 2ACUA 2PDQA 3S3GA 5DANA 5HNUA 1EKOA 1A80A 5LIKX 3BUVA 3VXGA 3V0SA 2HV5A 4DBSA 3N2TA 3CV6A 1T40A 3M4HA 1RY0A 1YE6A 2PDWA 4PMJA 4JQ1A 1R38A 3GHUA 2PDLA 5JH1A 2PDNA 5HNTA 3UZZA 2PDUA 1EXBA 4JQ2A 2FVLA 1PWMA 1FRBA 2FGBA 4GIEA 1EF3A 1EL3A 3RX3A 1ZGDA 3D3FA 4WDTA 4XO7A 1MRQA 4DBUA 1J96A 2C91A 4LBSA 3UZWA 4JTQA 5LIUX 1C9WA 1SM9A 4IGSA 1K8CA 3H7RA 1AH0A 2PDCA 5LIXX 2PDKA 3FJNA 4LBRA 1RALA 1LWIA 3DN5A 4YU1A 1RY8A 3LD5A 4GABA 3R7MA 3WCZA 3R8GA 4QBXA 4JQ4A 2BGQA 3F7JA 4PRTA 1US0A 2INEA 4XZLX 3R58A 4R9OA 2A79A 4FAMA 3BCJA 1MI3A 4XO6A 2IQDA 1VBJA 2DV0A 1YNPA 1AZ2A 3GHSA 4QXIA 4XZMX 4GACA 3MC5A 3LEPA 4XK2A 4JIIX 4WGHA 1VP5A 4L1XA 2PDGA 3UP8A 2IKGA 2ACQA 1X98A 3BV7A 5LIWX 1IHIA 2PDYA 3WG6A 4Q7BA 3UWEA 3V36A 3KRBA 1IEIA 3UG8A 4YS1A 2PDBA 3U2CA 3EAUA 3NTYA 1Z3NA 2P5NA 3RX2A 3CAVA 1PZ1A 1AZ1A 2F2KA 1Q13A 2BP1A 4Q3MA 2WZTA 4ICCX 2PDFA 4ASTA 4JTAA 1UR3M 2PDXA 3ERPA 2BGSA 3COTA 2PEVA 4GCAA 4QX4A 4H7CA 3ONCA 3UYIA 3V0TA 1Z9AA 3O0KA 2ISFA 4XVEA 2HDJA 4PUUA 1XF0A 4EXBA 1HW6A 4JQAA 1X96A 3V0UA 1ZSXA 2R9RA 3R8HA 1X97A 2IQ0A 4JTDA 1YNQA 4GQ0A 4IJRA 2IS7A 4WDWA 3MB9A 4PRRA 2DUZA 3UGRA 4ZFCA 4XZIA 4LAUA 4WDXA 1YE4A 3G5EA 2ACSA 1PWLA 4H8NA 3LQLA 1OG6A 3R6IA 4XZHA 2ACRA 3GHRA 3DOPA 2FZBA 1ZUAX 2NVDA 2VDGA 1M9HA 1MZRA 3N6QA 4JIRA 3WBYA 4XAPA 2IPWA 5AZ1A 3QKZA 3R43A 5AZ0A 3Q65A 3R94A 1JEZA 2HVOA 4WEVX 3LUTA 1LQAA 2PFHA 4AUBA 5C7HA 4DBWA 3UZYA 3GHTA 2CLPA 3M64A 3RX4A 1QRQA 3G1RA 4I5XA 4HBKA 3LZ3A 3O3RA 3EB4A 2F38A 3GUGA 4JTCA 4FZIA 5KETA 3WBWA 2PDPA 1S1PA 2PDIA 2QXWA 4XVDA 2R24A 2FZ8A 2I16A 2HVNA 4WRHA 4LB3A 1GVEA 2IKIA 2HEJA 3Q67A 3FX4A 3WBXA 2WZMA 3BURA 1T41A 3EB3A 1S1RA 3LBOA 2IKHA 1XGDA 1S2AA 3CV7A 3B3DA 4PUWA 3P2VA 2PDHA 2PD9A 2J8TA 3H7UA 2PZNA 3LN3A 3LNMA 4MHBA 1AFSA 4NKCA 3ONBA 2DUXA 1PYFA 3UFYA 2HE5A 4YVXA 5JH2A 4YVVA 2NVCA 3LENA 4OTKA 1Z8AA 1ZQ5A 2FZDA 2PD5A 4PR4A 4WDUA 3LQGA 4GA8A 2PDJA 4L1WA 1AH4A 1HQTA 4QR6A 3T42A 1Z89A 2PF8A 5M2FX 3CAQA 1XJBA 3C3UA 4LB4A 5LIYX 2IKJA 1Q5MA 4XZNX 3V35A 5HA7A 2FZ9A 4G5DA 4FALA 2I17A 1PZ0A 2ALRA 4HMNA 4JTRA 4DZ5A 2INZA 3M0IA 4F40A 1ADSA 4JQ3A 1S2CA 3CMFA 4IJCA 4LAZA
chains in the Genus database with same CATH superfamily
1G94A 3CK5A 3S2CA 3GH4A 2X0YA 5AHMA 1W0MA 4WXYA 1L6SA 2ABBA 4RDWA 2CU0A 4PMZA 1LDCA 4ZXLA 2AGTA 3HIJA 2IPJA 2BHYA 3V1HA 4Q4PA 2WVVB 3WFAA 1QWKA 2VOMA 1S3TC 4WSJA 3URBA 4WSKA 1X38A 4KEUA 4UTIA 4EKJA 3IJDA 2QULA 1GW9A 2W5FA 1BLIA 1YHTA 3S4TA 2FIQA 2Y7DA 4FF5A 2ZZ1A 4BK9A 3F03K 3ALFA 4DAFA 3QV7A 4YXGA 5HNTA 2J8GA 3WNKA 4LF1A 5TAOA 3OJGA 2QV4A 1EJ7L 2OT0A 2ZUMA 3NCOA 4DUVA 2H90A 4PBGA 2Q09A 1F2JA 1TJPA 2D0GA 1W5PA 2Z1VA 1XSKA 1RK5A 3UZWA 2BFGA 3P74A 1FP9A 3M7WA 1TFVA 1E9YB 1VS1A 3AU2A 4O50A 1SFSA 2E5BA 4RL3A 3USZA 1BTMA 2WVUA 3GWQA 2V5KA 4C6EA 1G4SA 3HQOA 3NM1A 3FS2A 2BZNA 3SAZA 1BG4A 1RJQA 1UBPC 1F8IA 4LRTA 2VM8A 3LS9A 4M6PA 4LUTB 2DZSA 1K8XA 3CQKA 1CXHA 5CZKA 3RRXA 1TTIA 5JIPA 3QHMA 3VM5A 3PNUA 3V3WA 1V6TA 3ID7A 2W3ZA 1Q6QA 1RA0A 3F7JA 5CPNA 9RUBA 2B81A 1BGAA 2Y88A 3W86A 3I7RA 4EE9A 4R9OA 3BPWA 4Z0SA 3ABZA 4QXIA 4GACA 4HA0A 4PTMA 2BXZA 1ONRA 1LF1A 1XPYA 5HAOA 1OFRA 4D6HA 2BVTA 1X98A 3EDFA 2HXUA 3G1AA 2PDYA 1KFBA 2YLLA 3ME3A 3SN0A 4UIOA 4H19A 1EJVC 2D20A 4DYKA 1ME9A 3S5OA 4A4AA 3AHTA 3PPHA 5HULA 3MSYA 3SCRA 3NWRA 1B57A 1KC7A 2HNEA 3UXAA 4AEOA 3B8IA 3I4EA 3T78A 5D30A 3HU7A 3OP2A 3OVGA 1KM0A 3VDCA 2BASA 1GVYA 3EA1A 1EYWA 2I57A 4HHLA 3LNPA 1Q13A 3EMQA 1JFHA 3WLMA 2YLAA 1G67A 1KO0A 4QEEA 3S9IA 1K7XA 3H2NA 2W4XA 1GTEA 1IXPA 1FDZA 5FEPA 4Z0JA 4AQLA 1VHCA 1AQHA 3RF9A 4GIAA 3SCPA 1DJZA 3GVGA 4D6IA 2PURA 3PTDA 1EJTC 3QHOA 1XUUA 1XLHA 4MZ1A 3UETA 1HKWA 2JK2A 4NI8A 3I7QA 5DCBA 1KV8A 1JG9A 3IJQA 3PUEA 1BWLA 3LSCA 3UG4A 4EWJA 4DUOA 1FFRA 3JW7A 1XLGA 3M6YA 4WY0B 5LA1A 4AZHA 3SIZA 3OHIA 4ONVA 2NT0A 3BDKA 4S3KA 3MSGA 1HKMA 4PH6A 1NH6A 3U57A 4GYJA 1K9EA 4XZIA 3TZFA 1QBBA 3G5EA 3MUCA 2WPGA 1OG6A 5CKSA 4I90A 2J6XA 4J3SA 3TYEA 2J7FA 1U2YA 3CXOA 4QHRA 4O14A 2EPMX 4DYJA 4YIWA 3H2AA 1QI5A 3BLPX 1W3TA 2FGLA 1H63A 3VM7A 5A95A 1W9VA 2VURA 1V6YA 4GO9A 3T8LA 4UNLA 3TYCA 1W3NA 3VFLA 4AVNA 1LQAA 3LCIA 4MWAD 1LQ0A 3VYLA 2CYGA 2CLPA 1S38A 2X16A 2C14A 2OQLA 4TV5A 2VD8A 2BY0A 3EZ4A 5CC6A 1EEPA 1AUSL 3U0HA 1PPIA 3GUGA 2F38A 3UA3A 1O5XA 1JNEA 5GNZA 2JGQA 1Z48A 2WNQA 4FLRA 3ARYA 1QHZA 3GR7A 4MIMA 2XFRA 2QDDA 1KGWA 3TOPA 3GR4A 3MBFA 3U48A 4RXFA 1AODA 1BG9A 3FSTA 2DZXA 4RZ4A 2R24A 4XVDA 3RAOA 5CJ5A 3I4KA 4JEJA 2QW5A 1SZFA 5BRQA 3KRZA 5EKYA 4J2MA 4E38A 3AU6A 1M1BA 2HEJA 2VGFA 3FX4A 1OG0A 1BF2A 2OZTA 4FHAA 5GJPA 1S2AA 3TQ0A 4M19A 3H7UA 1F6PA 2J27A 3LN3A 3ONBA 3FK4A 4YVXA 4DPQA 3D47A 3A13A 2Z28A 3QV6A 4XZWA 1SGJA 4QGCA 4X9YA 4LVGA 1HQTA 1G9HA 4QR6A 1R46A 1R8LA 2EG7A 3S0CA 3DEQA 1MQRA 2OX4A 3GDRA 3OGSA 2ZWZA 5A8MA 4B5XA 4LF2A 4DELA 3MP5A 3VKJA 2XSBA 2JBMA 5CSSA 3TQKA 1BYAA 3L4WA 2DZPA 4U5IA 3KTXA 3UU0A 1K02A 3CUIA 3POHA 5HATA 2OWXA 1LBLA 5D9PA 4AD0A 1MNZA 1R9XA 1TZZA 4K8HA 5AY7A 3VUSA 3AXIA 3LCWA 5HK4A 2YA2A 4O54A 3G77A 2DIKA 2AL2B 3QZAA 3S5NA 3CAKA 1HJXA 1IWPA 3GXIA 1ME7A 3LHVA 4F9DA 2R1KA 3EEGA 3WO8A 3DGRA 5FJIA 4QLLA 1KXHA 2HXTA 2Y89A 3B04A 2PRLA 3LPPA 5F4XA 4N7QA 1DJNA 4LCQA 3RCMA 4M6UA 5HWMA 4KFPA 3Q4DA 1OYBA 2IPFA 3UZXA 3WLQA 1XRFA 3N4AA 4CD4A 3ITLA 4DY1A 1DJWA 1I8JA 2HE8A 3EBVA 2DGAA 3O9NA 4NVTA 5DANA 3TN5A 1EKOA 4WQ6A 3VD7A 3ZJ6A 3QF0A 1H41A 4OV4A 4QG9A 3S2JA 4WOZA 3G1SA 3TLQA 3ZS4A 3VZYA 3NVDA 4JTUA 2PDUA 1UKSA 2G3MA 4CD6A 4JL2A 1HL2A 2QCNA 4HSOA 3AIVA 1KR0A 6XIMA 3AIRA 2TAAA 2WVVA 4PYSA 3NO5A 4B15A 2R94A 4JFTA 2CHNA 2C91A 1DJYA 3ZR5A 1J2WA 3TUUA 2VC6A 5A8PA 3EWXA 1KFLA 1Y8BA 2BVDA 3XIMA 1Z6KA 2BVYA 4UTTA 4AVOA 1KBLA 4GLEA 3G0UA 1GNXA 3PSWA 5K9DA 4UNKA 3L4YA 1UZ1A 3A4XA 2EO7A 3SGGA 4HK6A 5ABFB 1ITQA 1VIWA 4FR6A 2VD9A 3IRDA 5BU9A 4D71A 4L6OA 3F4NA 1V02A 2A7PA 4JTSA 3B97A 3BZGA 3CUGA 1AW1A 4ZQNA 2PTDA 2X0HA 3WUFA 3PFMA 3L68A 3MCNA 1HL9A 2QCHA 1X8FA 2OOFA 5DRCA 5A5WA 3SR7A 4DZAA 4ZZ9A 1B3ZA 1GQLA 2CZ5A 5EMKA 4JTIA 1AZ2A 4CN1A 2ZRZA 2GVGA 4XZMX 4A8NA 1KFWA 2DZUA 3MP4A 4MY1A 3S9YA 4HMCA 4WSHA 4CCDA 3U4FA 1HGYA 1AW2A 2NQ9A 1OX5A 3GDBA 1XCFA 1Z42A 4DF2A 1CLVA 4KH2A 1S5MA 4A8RA 3N2BA 4E8GA 5EPDA 1UR0A 1HN1A 2GJXB 3RXZA 4RXGA 3UCCA 5CC3A 2DIEA 3EOEA 1PIIA 3VIKA 5JU6A 2CCRA 1CT5A 1YNYA 3KBMA 1KB3A 2OPJA 5I24A 2VI0A 1JZ2A 4V1YA 4HQVA 4IPJA 1JZ7A 4XSLA 4LJ3A 3TLLA 1SMAA 1QPKA 5D04C 3VNMA 4XKYB 3LB0A 3COTA 1WV2A 4PMVA 4BI5A 3CHFA 4DF0A 1UR4A 2JKPA 3V0TA 3BWWA 1OADA 1R85A 1Z9AA 4S2BA 5HJLA 1VC4A 2OOGA 3FOKA 3VGDA 3TU9A 1XBXA 3H22A 3V0UA 2R9RA 2ZE0A 2OG9A 1FDJA 4IWWA 2G50A 3SCNA 4PCTA 4IQLA 2CLFA 4CQ8A 4KWVA 1HKKA 4Z1DA 9XIMA 4IQEA 3O6YX 3NFUA 3VX1A 4NXSA 1R3YA 5C55A 2DUAA 4C7FA 3UPBA 1YE4A 3E0WA 2YYTA 4H8NA 1UASA 1UZ4A 3SM0A 4O11A 2YCEA 1AW5A 4L64A 4S3BA 1UD8A 2EAWA 1JUKA 3AS1A 3LV5A 3KBJA 3A9BA 3QXBA 2OLHA 5BWFA 3TJIA 1SJCA 1XC4A 4M5PA 3HG5A 3EXTA 4J3VA 4JTHA 4Q22A 2FHFA 1LBFA 3VNZA 3MKKA 3RPDA 3NDYA 5E09A 4V2XA 3WQ4A 3JRKA 3MI2A 3MV11 1UIPA 4B3KA 1PTAA 3OZPA 1JJKA 4MY9A 3DCPA 2WBGA 3NPVA 4DO5A 3MZNA 3EPMA 4XKMA 3DIPA 3GTNA 3I68A 3N2CA 1WNOA 5K9XA 1NDZA 3GB6A 1K7FA 3G6LA 5D8WA 4XAZA 4B2DA 3QV9A 3H4XA 1E5NA 3UJFA 3NVTA 5A1AA 3W6MA 4J3TA 3EDJA 1W8GA 1RBOB 1TJ2A 3OGVA 4N9BA 3KVJA 4D2JA 2YPIA 3MYOA 2GYIA 3LLXA 1I0DA 1XX1A 4XSMA 4LYKA 2YCLB 2QLYA 1VJZA 5HR6A 1ZFJA 3CZEA 3TJ4A 1M7OA 2PD9A 2PZNA 5DX7A 4D8AA 2XPKA 4RUBA 5H1WA 3CNYA 3VI2A 2NVCA 1PJ9A 2Z6IA 1LLWA 3PWIA 3W7KA 1UC4A 4J4KA 1UUQA 3PJTA 1TR1A 4HCLA 4J1OA 1EZ2A 1T7LA 2BHUA 3F2CA 1GTHA 2E6FA 1W1VA 1L8PA 1WDPA 5FEWA 4AD3A 1W54A 3M5VA 4UXDA 4G5DA 1W6TA 2P8BA 2PWGA 5GVJA 5A69A 5C5YA 4D6EA 3GNPA 1GYNA 4R7OA 1LOLA 3UJ2A 3BLLA 2VEGA 4LS0A 2W61A 5HUOA 2E6YA 4IJCA 1WDWA 1ZTVA 4N42A 4KWWA 4UCGA 3B8TA 1K4GA 2VQTA 3WLRA 4LUTA 4C6CA 1QNOA 4KETA 1JQXA 2H3BA 1RP8A 3MMTA 3BZJA 3LCHA 3DKLA 2XIQA 1H51A 3B8WA 2HISA 3GNRA 3FAWA 4MGGA 2HRWA 2FDSA 4FNRA 3VNKA 5LNUA 2VT0A 3UZZA 6ALDA 1SW0A 5J8LA 3H12A 2VGGA 1VLWA 3MUAA 1W1PA 1JRCA 5SWUA 4O4VA 3VOJA 2Y2WA 1A5KC 3K8MA 3ZR6A 2RFGA 1UWTA 3ECQA 3GBDA 2QUMA 5DY3A 3LRKA 3CZJA 3RRAA 4QIUA 5FI8A 5LIUX 5FJRA 4DWSC 1PIFA 1G01A 2YOCA 1LT7A 5DBUA 1UPPA 2YDSA 3NQEA 4KKXA 1AG1O 3BJFA 2FB2A 4GFIA 4MWAE 3GTXA 4JIEA 5CXPA 5JIWA 1AQMA 3B9OA 1UBSA 1I75A 3ABRA 3M0ZA 3DDMA 3LHZA 1EEXA 1W3JA 2TMDA 2O9OA 5G4WA 5CPLA 1ZJBA 1E0TA 1TJ0A 2ZXBA 3U7BA 3ZLGA 3DBNA 3KL3A 3R58A 3LXCA 3CWHA 5ABFA 3EYPA 3DBPA 4KEMA 3U5YA 3WZ0E 3W2LA 1AK5A 1F7BA 2XGBA 2AMGA 2CLEA 1OC5A 2VZVA 2Z00A 1A4LA 4KFNA 4F9JA 1XGZA 4PE8A 1XP3A 1O5QA 4TXEA 3NDOA 3UP8A 5FSEC 1DORA 3GVWA 1TE6A 1IYXA 3VDHA 4XKYA 1KTBA 1W3KA 1IEIA 1H60A 2WM1A 3HZ3A 4AIBA 2R1PA 1QNPA 3CUFA 1OM0A 1YBQB 4RK8A 2GQ9A 1OFDA 5FF2A 4H2CA 3VMPA 3NL6A 3E5BA 3GNOA 4QP0A 4F0MA 1QCWA 1GVRA 3SBFA 4L4LA 5HOSA 1BVNP 2A7RA 2VO5A 1B54A 3AI0A 4UB9A 4K39A 3ERPA 1QW8A 1TCMA 3NL5A 3LCLA 3LGEA 3PSVA 3HMJG 3S6DA 1KA9F 5D2XA 1ZCOA 5LNRA 3FJLA 4AH7A 4H01A 3MHUA 4HMDA 3W2JA 4JN8A 1VJSA 1XRSA 1CW2A 3JZUA 7REQB 4GUFA 5D38A 3MMDA 1Z69A 4PUUA 1XIMA 2Z2BA 3L4XA 2ZXQA 2GDVA 2QUNA 2YJQA 4HGXA 3CQHA 4GQ0A 3E0IA 3H26A 3I3EA 4CD5A 1NQKA 4EWND 5EFFA 3C2RA 4Z2LA 3VNIA 4MKSA 5LGZA 1YBQA 1O1ZA 2BHZA 2PLCA 1W1ZA 4LEQA 1HKVA 4WDXA 1XW8A 2OYLA 5HNRA 1MDLA 1JCNA 4O15A 3E2VA 4AZIA 3CTTA 4O57A 4PCSA 1QFEA 2Y8VA 4IIEA 5AFDA 3BE7A 4IL2A 4H3DA 5A8GA 4TQTA 2HS6A 5CGTA 1MZRA 4JIRA 3SUVA 3WQWA 1V0MA 1XYBA 2Z27A 4Q8NA 3Q45A 3WLLA 3KOWA 2OZ0A 4F2BA 2PB1A 5AZ1A 1YLVA 3NYZA 3ABQA 3CUHA 4HD5A 1VF8A 3LPOA 5LHFA 1NIUA 2JIWA 2ISDA 1IWAA 4DLFA 5CG7A 4AUBA 5CBBA 4H8VA 4UTWC 3KS5A 4DEFA 4F48A 4IPNB 3PP7A 4ZQOA 2A3CA 4RE2A 3KHDA 3GIPA 1BVZA 3CLWA 3SCSA 3QR1A 2V2DA 2Y61A 4QAIA 4PCFA 1GOWA 2PAJA 2CITA 3L4TA 4TVUA 2V69A 4Y9OA 3DYOA 2OZ8A 1YDVA 3QLDA 1M3UA 2J9XA 4LXFA 3PZQA 3VKDA 4QS5A 4O1AA 4GISA 2ZTJA 4QITA 1V08A 2IKIA 2Q71A 2ZBTA 4RZ5A 4OWGA 3ARVA 4IXXA 3WH7A 2CZDA 1I0BA 5F1VA 1JPDX 3AALA 2D2OA 2GGIA 4JKMA 1V5XA 3ANVA 4IM4A 4BF9A 4NHVA 3UFYA 3THCA 3GSMA 1XIDA 1W1B1 3KTSA 2WCAA 4FO4A 5B7ZA 4GC3A 1CX9A 4HZ7A 5HXMA 3UCQA 5I77A 4N02A 2O4MA 3UF9A 1ZS2A 3W7QA 4CUCA 4WJXA 2MNRA 1ONWA 2J4GA 2R14A 2R1MA 4V27A 3LRMA 4KQNA 3H23A 3V35A 2FZNA 4P7QA 4Y9MA 2YR1A 1DBTA 5KSWA 1JCTA 1VFMA 4GUHA 1EUNA 5LGXA 3LMYA 2Q01A 4D1JA 4KMQA 4FIRA 4ZTYA 4MB4A 2NX9A 2F84A 3DG3A 3VIGA 1J0ZA 1OD8A 1QNQA 4LAZA 4LWWA 2W9MA 1MDRA 3BAIA 3CASA 4K8GA 3WEOA 1O6IA 2PLJA 3BQ5A 3NQGA 1NWUA 3W26A 1LCOA 4W88A 4NNCA 1OC7A 3W25A 2QS8A 1JPHA 4C6KA 4LSBA 3A3HA 1NFBA 1SYTA 2PDQA 2QF7A 5CEWA 3AJXA 4O0QA 3IIPA 1EDGA 4PSPA 3KFTA 4QRNA 3LXAA 1POKA 1V3IA 6A3HA 2OO0A 2Z29A 4QJ5B 3W87A 1R38A 4TIMA 2VKZG 1YPXA 5I06A 2NSOA 3EKZA 3NPUA 3USBA 4KIRA 1EF3A 1X6UA 4ALDA 3URAA 4RV8A 1ZGDA 2RDWA 3UR2A 3NOEA 1TA3A 3NSNA 4GXWA 1JFXA 3DG6A 1ISWA 3VGFA 4WLCA 4KCVA 3LHWA 3HO8A 4GZIA 5BOOA 3RM8A 4DF1A 2XFYA 1K8CA 2YB4A 2E3ZA 2QVNA 2RDUA 4JL1A 5C8BB 1LRQA 4RNIA 2XFFA 3KX6A 4OJYA 4AMAA 2ZKMX 2VCBA 4OVXA 3L4ZA 1WZKA 4F0SA 2VEMA 5HANA 4URIA 4YTTA 3PZNA 4IMEA 3CIXA 4KCUA 4M0XA 2QJGA 1D7KA 4ZCWA 4FX6M 4TO8A 2CEQA 3O2LA 2DH2A 4W5UA 1HXJA 4OV9A 2WKLA 1DXIA 3LY0A 3T0DA 4I6VA 1QPNA 2B7NA 4HVXA 1T96A 4ZOCA 3QY8A 4N2YA 5C0QA 4Q8MA 1JD7A 1OX4A 1ZJAA 1D3GA 2FZMA 2I9UA 3XISA 1FWNA 3GTFA 3O6CA 3O63A 3W7CA 4GK8A 1WKFA 1S2TA 3L67A 1XGEA 4XIAA 3NQAA 1FCQA 1AZ1A 4US5A 3LRLA 2GPTA 4GPNA 1N7KA 3C86A 4NJHA 4JGDA 3WJXA 1OFQA 1EWEA 1ONXA 1WXZA 4EX4A 3GVQA 3RMEA 3GR8A 1VFTA 1YMYA 1UR3M 3WQCA 4HZMA 2X0SA 1QW7A 4S3GA 3W1NA 4JTGA 3WQDA 4XD4A 3NXFA 4LAMA 4U33A 3UWQA 4ZODA 4H7CA 4JCLA 4S3CA 4C1LA 1JCXA 5EMYA 2BOFX 3O0KA 4IX0A 1QK2A 3B8SA 3HQPA 1U1UA 1VCGA 3FAXA 4IFKB 4CNSA 5BXPA 3QY6A 4FX7A 1TPVA 3GVVA 1V7AA 1XISA 5KZDA 1VKFA 4NAFB 2RHGA 4JHZA 2QCDB 4NASA 1VRDA 4EOUA 2OVLA 3MHGA 3VIMA 5DMYA 1RBAA 1WOAA 4PRRA 2VVSA 3GYEA 2FB3A 4INFA 5HQEA 3HPAA 3WQEA 4KESA 1EA0A 3G1VA 3L0GA 2GJXA 4IFOA 1H11A 2XH2A 1JD9A 1B30A 4FXFA 2PRHA 3DHFA 1S2VA 1E4LA 3WNPA 3WLIA 3TTEA 1D7FA 3GZ3A 2WJDA 2E77A 3WMCA 3VGGA 1TWZA 4DXKA 2X8RA 3GFZA 2YCJA 2V3FA 2XSXA 3N12A 3EXRA 4ATLA 4NIRA 4FMVA 3WQGA 4K2SA 4U3CA 1M03A 2A21A 3CPUA 1AQ0A 4XUYA 3VNJA 2WC7A 2XVPA 2NX1A 1UWRA 1UH4A 1DJGA 3EB4A 1ZJIA 3ARRA 1AMYA 1PDYA 3RLVA 3H55A 5FF4A 2DQWA 3M0JA 1Z7AA 2CKSA 2FTWA 5M3WA 4GVIA 4WJEA 2I7GA 3QW4B 3C2EA 1DTNA 2OWCA 1N82A 5FAGA 2VHLA 3FDGA 1W1A1 1QPQA 4E4FA 1KRMA 2VZSA 4MAZA 3DERA 2G0WA 3JUGA 3LERA 3Q67A 4RE4A 3UBPC 3WEMA 3M47A 3FVDA 3L0NA 4LUJA 1A5MC 1HIZA 5I02A 4ML9A 1ZNNA 3Q94A 5D2YA 4FR1A 1TTJA 5ECUA 4A3HA 5F2MA 1A5LC 3UG5A 1TPWA 3T2PA 3P2VA 1G5AA 1XPGA 1CCWB 3PBMA 1PYFA 2GWNA 1NY1A 3BSGA 3G1YA 2O9RA 1U30A 4C6IA 4PZVA 3H2CA 4HKPA 4B5WA 1J2BA 2A1YA 4YLWA 3ANUA 1OX4B 4K3ZA 5FIPA 4RR4A 4QG8A 1O66A 4F0LA 3N9SA 3OU8A 3MO4A 1P0DA 4NJGA 3BLDA 3L2MA 2ZX8A 2J7HA 1VCFA 2FZ9A 3P6LA 2VWSA 2I1OA 1Y0EA 1RBLA 1UB3A 3Q58A 1UYQA 1JAKA 2X40A 3IARA 4DNMA 2INZA 4GC4A 4AEFA 1HJUA 1UH2A 3KRSA 4CU6A 1H7NA 2QCEA 1RA5A 1S2CA 3ZJ8A 3PZMA 4IF2A 2J75A 3DKJA 1A5BA 1YIXA 1CGXA 3SFWA 4M8UA 1SO6A 2A4AA 4L5ZA 4HHPA 5F4SA 4QNWA 4PBEA 1RJRA 2GVLA 1BGGA 3D0CA 4PMUA 1WBHA 2OYMA 1I45A 3PB0A 4N9CA 4RPQA 1F5ZA 1EA9C 1ZBCA 1XLKA 1OC6A 1GW1A 3W07A 2WJZA 4YJ5A 1YPIA 4L7ZA 1WX0A 1L6FA 3H8AA 8RUCA 5T9CE 4H2HA 2QF8A 1TKKA 2R1NA 3WDIA 3ZWTA 1IR2A 1KFKA 3SUTA 1I2QA 4C6PA 1IXOA 2WSRA 4PUNA 4KGLA 3WLSA 4FPSA 2ZRXA 5CG0A 5JBDA 3M0YA 5FD0A 1RUSA 4JBRA 4JCMA 3GUWA 2GK1A 4DJFC 2XG9A 3PAJA 4WR3A 2XIBA 4PB3A 5DN1A 1V3HA 3UA4A 3DECA 3GY1A 1KCKA 1OCQA 4NAEA 3VOFA 3SI9A 3QM3A 2GDQA 1ZAJA 2NQ5A 3CMJA 5EFDA 2CERA 2Z1BA 2XIMA 2YSWA 3QYSA 1PTGA 2X42A 1XI3A 4UBPC 5HMEA 1I2RA 4OHQA 1MNSA 2DT2A 1ECEA 4FAMA 3ABSA 4HSNA 4R7JA 3S2LA 3T8QA 3LSBA 2DVUA 4RW5A 3AMCA 4PN2A 2ZA3A 4AYGA 3OOQA 1ODUA 2GSEA 3MC5A 3C2VA 1EIXA 3HJEA 4AFYA 5AC5A 1QNSA 1VP5A 3VIJA 3BAWA 3KZSA 3T0AA 1XICA 3BV7A 4GGHA 3REQA 2ZXDA 1UD5A 4XD3A 3LCXA 1K8YA 3JR2A 3ARSA 1HF6A 1H2JA 3MU7A 4N6EA 2JIEA 4CKQA 2GVEA 1WDRA 5E0FA 3DENA 1PKLA 2XH4A 1UH3A 3H2EA 4ICMA 3G3DA 4GIRA 4HNOA 1S2UA 3WNNA 4IIFA 4IMAA 1MW1A 3QKEA 3R12A 4DJDD 7PTDA 1A5NC 2BNJA 3P84A 3AAMA 3W7JA 3ABXA 1DE6A 1GHRA 2E09A 5IFPA 4TX9A 4F2UA 1JQVA 3B8UA 3DYPA 3IUIA 3UCDA 1O1HA 1A50A 5CC7A 1VYRA 3A5VA 1FKWA 3EOOA 3MV01 2I5IA 4GY7A 4E5TA 1U83A 4MADA 3PZGA 3AS2A 3IV8A 3LU2A 4MF4A 2WANA 3KL5A 4Z17A 3PFRA 2VX4A 1TCDA 3DFQA 3W70A 3HBLA 3BANA 3MB9A 2BXVA 3RK8A 1XSIA 2G3NA 4AY1A 3WEZA 1C7SA 3PAOA 3IVUA 1SJAA 3L66A 1AJ0A 3N17A 2O55A 1XLJA 1MYRA 1VJIA 4GI8A 4QM1A 2WLZA 4PUDA 2H8ZA 2R1LA 3MHFA 4GMEA 3W73A 3GFXA 3NO3A 4QSHA 3GIQA 2G4JA 3T4WA 3GG0A 3M9YA 2AKMA 4AIEA 5CLWA 4H00A 4GYKA 1QMLA 4JTTA 1W9BM 4DJFD 4O10A 2DY3A 3ZLFA 1T99A 3O0FA 1V3LA 4Q6XA 1HL8A 4DWDA 5K7JA 1O68A 2GQAA 5FEXA 1V3MA 3BJSA 3F4VA 4C1NA 3GU2A 3SJ3A 4HBKA 4MLJA 1JGIA 3OTRA 2C0HA 4MSSA 1OCNA 2CZVA 5C6MA 1S3HA 1LL4A 2C6QA 2NXIA 3OBAA 4MZ8A 2V5JA 3SB0A 5HQLA 2AL1A 1E6XM 3B9EA 3PPGA 1NTHA 2GWGA 1XKYA 4Z1CA 1PZ3A 3WD3A 2OKOA 4DJEA 1KKRA 3W38A 2DU2A 2NT1A 2QR6A 1OSEA 3T08A 4FXSA 5EMMA 4NZCA 3GH7A 1XGDA 3CV7A 3VKKA 1JZ6A 3K4DA 1NWTA 2YA0A 1EJXC 1FHDA 1SJBA 4IIHA 4HU0A 3C3NA 1XIGA 2SFPA 4WCJA 1RPKA 3V1PA 1GQJA 4XD6A 3MUIA 3WMBA 3T9PA 2VEFA 2QCMA 1CXIA 1VRXA 2C16A 3VE9A 1R7OA 4K1GA 1K6WA 4YNGA 1D9EA 5LXEA 3ANYA 2VCCA 2Q3OA 1MVYA 1CECA 1A0EA 4TVDA 3WY1A 5D33A 2OU4A 3T42A 1UC5A 3PG9A 1CPUA 2VZTA 5E70A 1TJ1A 1GUVA 3C3UA 2PSNA 3QSRA 1NDYA 1TV3A 1D3CA 4XZNX 2VP8A 1F6KA 4PTVA 3IJ9A 3AZTA 3P8JA 4FALA 3O16A 4ZOBA 4XD5A 3IIZA 3IRSA 3WF0A 4JTFA 3TZNA 4DZ5A 3W0KA 3RR1A 2JF6A 3PPFA 3TTYA 3EX3A 5I3DA 4EF9A 3NNTA 3A4WA 4JQ3A 2E7FA 5E1QA 1P1MA 2A0NA 3PUDA 2X1RA 1ZCCA 2J66A 1OY0A 4I9JA 1GONA 2C7FA 3ENLA 4EXAA 1L2QA 2QUVA 1UJPA 2BV9A 3NO1A 1Q4WA 2Y8KA 1BKHA 2CBJA 4C6MA 1GJWA 3VD5A 1W5QA 2Y70A 3QGAC 4NZFA 2CWXA 2ZTKA 3QLLA 2R82A 1RQBA 3AJ7A 4W84A 3ZVHB 4O13A 1EHNA 1ICPA 3NGFA 1YE6A 2PDWA 4FX8A 4JQ1A 4R9XA 3GHUA 2PDLA 3M0KA 3BVJA 1TRDA 1O5KA 1EXBA 2WHLA 1MQPA 3I3DA 4D72A 1ICQA 5BMWA 5F1UA 3NG3A 5CBJA 5K4XA 3BMVA 4NILA 1BYBA 2NQJA 3IGXA 5BROA 3HPZA 3D3FA 4WDTA 1OGSA 2Z0IA 4UTUA 5ABTA 1K7EA 2AL2A 4FOUA 4TOQA 4WUIA 1K9FA 1AMKA 3SGZA 2XVNA 1OZMA 2YBTA 2J74A 5FA5A 2BOEX 2AKZA 1C9WA 4BA0A 3SCUA 3SUWA 1A3HA 3AS3A 2ZZ5A 7REQA 1JR1A 1FHVA 2QCDA 2BVWA 4GUJA 1C92A 2XN1A 3N9KA 1R3VA 1S5WA 1XSJA 4AU0A 3LOTA 2OFJA 3K4AA 2PTZA 4IMDA 1NDVA 3CT2A 3N29A 1HP5A 1H7PA 4MB5A 3WK3A 3SQMA 1ZP4A 2VC9A 5GJNA 3QOMA 1TMLA 4CLMA 1I4NA 3M6DA 5K2ZA 3BSMA 3EEZA 3TYUA 4UOJA 4L61A 4W7UA 1YNPA 3BLEA 3M0LA 3VCNA 3EMCA 4NX0A 4W86A 3M5ZA 2ZC8A 4JIIX 2AQWA 5H8UA 2PDGA 2F2HA 3OZYA 4KRZA 2ZADA 5M03A 3WQFA 4DJED 1NF0A 4PMDA 3AZSA 3RLUA 1BVWA 4W8LA 4EPBC 1R9ZA 4DIAA 2WCSA 2NLIA 5BU6A 2EPKX 5FESA 1BSLA 3AYSA 1A0CA 2BY1A 4BJHA 3SY1A 7TIMA 2XSAA 1F05A 3KWSA 3GO2A 3CM4A 3UERA 4Q3MA 3E2RA 1PX3A 3HQ1A 3I7SA 3IK2A 3VDAA 3M16A 3BLFA 4MVAA 1CWYA 4CEXC 1UQZA 4A21A 5DBTA 1DWGM 4AISA 1JULA 3N6HA 3H6OA 3EX6A 3MSDA 5TQLA 5AECA 3F1QA 2XIJA 1GOMA 1QOXA 1N8WA 2HMCA 1X96A 1TV8A 1JCMP 3YPIA 2E5DA 1CLKA 4D1IA 2IS7A 4MWAB 3FA5A 4BFAA 4R27A 1JIBA 2VR2A 3MP3A 4OUEA 5BW6A 2OCZA 3UWZA 2QGYA 4HIBA 1IIGA 1UKQA 1ISYA 3TA6A 3LM7A 3RUBL 3IUHA 3P0WA 1OVDA 3PB2A 1EHAA 1GYMA 3NQVA 3QGVA 5K3VA 1XUZA 4G6CA 3AXHA 4YPJA 3VC5A 2ACRA 3GHRA 3NQ7A 1R3RA 3RLHA 3OO2A 2DFAA 4GH3A 4TV6A 5BCAA 2E1DA 4MY8A 3AHVA 3CB3A 4B5TA 4Q8UA 3A3WA 1KM1A 2HVOA 1OYCA 3G22A 3W75A 3MJMA 3TH6A 3R10A 4I6KA 1CB7B 2JEPA 2XH0A 1LWJA 3WNLA 2VR4A 4L4OA 3QPEA 4A3UA 1MUMA 3PBWA 4UQEA 1UR9A 3GLCA 2PWEA 1KM4A 3BH4A 1MEHA 2D0HA 4OUIA 3WLKX 3BAJA 2DW7A 1LLOA 2CNCA 4JNYA 4UR9A 1P6CA 2FHCA 3E38A 4LCRA 3VMNA 4ACYA 4PC8A 3HFYA 1E9LA 3TW9A 1E71M 1ITCA 2WAGA 3RMJA 3BCDA 4WD0A 1EPVA 4UFKA 1T6MA 1KLYA 1H50A 1W1YA 2V9DA 5BRPA 2XTKA 1E0VA 3Q2DA 1M6JA 1PCKA 3KW3A 3GXNA 3INPA 5E0KA 1XLEA 4CD7A 4PULA 1X1OA 1SVDA 5IBXC 1E6SM 4DXVA 3S9ZA 1QASA 3DFYA 4W7VA 3SCQA 3B05A 1H62A 4U28A 1IQ8A 1UJQA 4BKNA 3QQ1A 1RLCL 2OEKA 4XAGA 3VE7A 3LNMA 4QLJA 1P0EA 2HNHA 3W82A 2QYGA 1V4YA 3P5ZA 2XUCA 3C8NA 4DUXA 5LA2A 5B80A 1M04A 2ZUVA 1UWQA 4PR4A 2Z1XA 1Q6CA 4L9ZA 4DX3A 4UR8A 1GYLA 1X6LA 2E5CA 2X1IA 3PBGA 3OLIA 2OB3A 4Q33A 1KWKA 1RCXB 4ZQPA 1XL9A 3R0KA 4H6RA 2VOTA 3OEXA 3ZVIA 3SEPA 4D9PA 1W37A 5IXEA 3BW4A 4IISA 1WUEA 3GKFA 4X61A 3N13A 1W5OA 5LYRA 4GWEA 4WX2A 2PWFA 4V15A 4F8XA 1DPMA 1V6VA 4JIHA 3B0XA 4MWAC 3KVMA 4AZ7A 4IFKA 3W02A 1F9CA 2GOUA 2XDFA 3S3GA 4W4QA 3AISA 4J3XA 1ZZMA 3VUPA 3MJYA 3TV8A 3ABOA 1PAMA 3W1TA 3UNTA 4A3YA 2AGKA 3VGEA 3W1QA 4AHOA 1U5VA 3OLEA 4J27A 1QI0A 2VELA 4NX5A 3IIVA 4BR1A 3AMKA 3PC0A 3WF1A 3TFXA 2ESCA 3P67A 1ZY9A 4L65A 3DX5A 2Z7GA 2DEPA 1GPWA 1RLDA 1I1WA 4CN6A 1L2UA 3WLOA 1S2WA 3DU0A 4GFSA 2ZQ0A 4CNUA 2X2YA 1G7UA 1LROA 1UOKA 1C9DA 3CB8A 1EO7A 4N0RA 3UJSA 4LH8A 4RCXA 3H2OA 3NDZA 5AHLA 4AG0A 1OB0A 5D9MA 3GNDA 3OYZA 4AXKA 3P80A 5CGQA 2R6OA 4WKHA 1DJQA 3NZQA 3CZKA 1B90A 2GFTA 1UCWA 1VYSX 1J79A 1JDAA 2DVXA 3UWWA 4LYRA 2ZUTA 3K1GA 3R8GA 4H8UA 3BTNA 1SW7A 3VILA 4YCPA 1XBVA 1IGWA 1JDCA 4Z1AA 3GK0A 3TR2A 4A3RA 1UPMB 1OZQA 3BW2A 1UUOA 3APGA 4DUWA 4B4FA 3W76A 1TREA 1YRRA 2NWRA 4LUSB 5M1TA 2ZZ2A 4BQ5A 5D32A 4XK2A 5AHNA 1EQCA 3L21A 1PKYA 1SO4A 2Z2AA 1W1IE 5AHIA 5CC5A 2ODOA 2ACQA 3EKLA 2PRMA 3GS6A 3G24A 5G1TA 3WG6A 1F61A 3GKAA 4CNNA 3ZM8A 1C3FA 2VCAA 3L2IA 2A7NA 3LA4A 2J78A 2Z7KA 2QVHA 3CO4A 1R6WA 3JU2A 3PY2A 1JVNA 5FF7A 3CJPA 3TOYA 5KMYA 4GUIA 3R5EA 1PIGA 3NOYA 4BS0A 3SUUA 2HJPA 4G7EB 3T0TA 5MKGB 4H6QA 5DLCA 3VD4A 3PN8A 1MXSA 4AB4A 1F73A 1TE1A 3WF2A 4ICCX 1FWBC 3LDVA 2P50A 1FWGC 2BGSA 2NV2A 1SSDA 3QOKA 2BLEA 1E51A 1DIOA 1YTKA 4Z2IA 1D8CA 5H8PA 4PTXA 3U4AA 4DO7A 3TSBA 4C90A 1HUVA 3D46A 4HNUA 1EGZA 1DWIM 3MKVA 4G9PA 5G1YA 2FFIA 1TJRA 2PBOA 3NQDA 3WF4A 1LG1A 5BZAA 4QDMA 1BSIA 2CLOA 4WVXA 3S6TA 1SJDA 4O19A 3SGUA 1UIOA 3D3AA 3AHYA 3P62A 3CLMA 1PXGA 1JYXA 3BAYA 2B4GA 1ISZA 1XD0A 4LUYA 3R4IA 4G7FA 3QHNA 3W72A 1OQFA 1E0UA 1M01A 2XWEA 2OXNA 3PJXA 1YW1A 3CL7A 2GJPA 3KOZA 1BYDA 2EKGA 3MDWA 3HGSA 1GQIA 3WJSA 3URNA 3AHZA 4F3HA 1V7YA 3ZFHA 4NZ4A 2XIOA 1QI2A 4AWTA 3P93A 4XAPA 4GUGA 2IPWA 3R94A 1XS2A 1GZ1A 4C6LA 3VX0A 4JNZA 5AKQA 9CGTA 3N11A 3GC4A 1PHWA 2QJJA 3WLHA 3A12A 3TN6A 1XCXA 3HG2A 3HGRA 4I5XA 3R2GA 3WJZA 5LKYA 1EYEA 1DXFA 1X1ZA 5CSUA 4M56A 1Y5XA 2QAFA 7TAAA 2Y85A 2EHHA 3VIOA 3S1XA 1R3SA 4MWAA 4Y9AA 3M0VA 1H7XA 2E6AA 1DHPA 3EA3A 3QFEA 2XVGA 4E6MA 9XIAA 2ZVIA 4W9TA 1SZRA 2WZHA 1KM3A 5CZTA 4GX9A 4UUIA 3VPLA 5CPSA 3MT1A 4ERIA 2ZUUA 3KWXA 1CXFA 1T41A 2V5BA 4CN4A 1S1RA 4GQRA 4E3TA 4CVUA 1PVNA 4UQDA 4R33A 5AHFA 2QJIA 2P53A 4PUKA 3K2GA 2FMOA 4FIQA 2QJHA 4NKCA 3AS0A 4XBKA 1XH2A 3FIGA 3PK7A 1JPIA 2ZUNA 1VCVA 3WQ6A 2A5HA 2E40A 3OIHA 1N8IA 4DRSA 4UTHA 1GCYA 1EX5A 1JDEA 4L6HA 4M7SA 1LLZA 4I7WA 1NM9A 3IIOA 4RZ6A 2RH9A 4WZHA 3RR4A 3P82A 1XQKA 3ATYA 3QPZA 3B03A 1GEHA 4UZUA 1IEXA 3O05A 1FCBA 3W1UA 3PPCA 3TEVA 2DVTA 1NOUA 1OK4A 4J28A 4LOCA 1Y5VA 4RDZA 1J4EA 2TYSA 1QNVA 3PULA 4QISA 3THAA 3I3BA 5HA7A 3HPXA 5CPTA 1UZHA 1ZBKA 3E96A 1C8QA 1LQ2A 2XINA 4I7UA 4ZQRA 4AAJA 3WJYA 4K36A 4NZJA 2WHJA 3AYTA 1BWVA 1B5TA 4IOTA 3TXZA 4WJ8A 1FOBA 4KWOA 1EOMA 2YYUA 2ZRVA 4IGHA 3H2MA 2OGJA 4P7RA 3CMFA 3KRUA 1SMDA 3MVIA 3QZEA 3LZ5A 3WD1A 4HB7A 4DYEA 3VKCA 4FA3A 1W3HA 3ZSTA 1Y7VA 4ZTXA 4D6JA 1XLAA 2C1GA 1DOSA 4XAYA 1ZBWA 2CIPA 5AVNA 1ITUA 2RGMA 2VENA 3FHQA 4G2DA 1E70M 5D37A 3HM7A 4A6GA 3UT0A 3WX7A 1E4MM 4NUWA 3WUBA 3VTRA 2OYKA 3W81A 2WBKA 3RPMA 4I5UA 2PWVA 4N4QA 2BODX 4MFEA 2PZ0A 2WMFA 4M6VA 3PZUA 4FI4A 2FGBA 2INFA 4P5UA 3B06A 5AYZA 4PMOA 3T09A 2ISVA 2YA1A 4DBUA 4M24A 2A3EA 2DSVA 4XIMA 4ZFMA 4CNTA 1GVSA 4Y9PA 1LWHA 1KCLA 2X41A 4IL0A 2PGRA 1HKJA 5LNSA 4AZCB 3ARWA 2E9LA 3QMTA 4KIEA 2OMAA 3W7MA 2XZ9A 3U2EA 4MNJA 3PNZA 1FWTA 4JPGA 4C6JA 2QPUA 2W62A 3FXYA 2NV9A 1KD0A 1TTPA 1J10A 1F6YA 1QU4A 4IIGA 3WCZA 4J7RA 1RJPA 5AB3A 5EMUA 2ZRUA 1P1XA 4ORMA 3QMSA 3VD3A 4Q8WA 2Y5EA 3W53A 3M0XA 2QMJA 2VFEA 2H3DA 4XO6A 1VBJA 3S2NA 4BF7A 2QDHA 3CGTA 5BWAA 5FF0A 1SU5A 1RQHA 2RAGA 3CYVA 3DFNA 2RJGA 4OE7A 5E93A 1Q6EA 3WL1A 3P81A 1XINA 3OZMA 1OIFA 1FWHC 4IIDA 4XZ9A 1R3WA 5KINA 5I5RA 2PU1A 3UG8A 1E56A 1XDLA 5MHBA 2BXYA 4P8VA 2OJPA 3OBKA 3QMRA 1US2A 4GKLA 3U2CA 1KXVA 3S1WA 1Z3NA 5A6SA 1SR9A 5EMJA 2P5NA 4FNQA 5H8MA 2E6DA 4P2VA 3TN4A 1W9UA 2WVTA 1VYPX 3IK4A 1J0KA 3EKGA 1A3XA 1XLCA 3AXXA 1EP3A 3AO0A 3QPYA 1GOKA 4MUZA 2CW6A 3GW3A 2YZ5A 5TF0A 1ZB5A 4M7TA 3WFZA 4LAKA 4Q8QA 5I3GA 4QX4A 4D8ZA 2BSLA 3UYIA 3SCVA 3LLDA 3WLJA 3VDGA 3STCA 4Q4OA 2V2CA 4NAFA 1GVOA 2D22A 1P6BA 5AHEA 1YTEA 4O52A 4AZ6A 2PP1A 3CAWA 3V18A 1ZSXA 4NJIA 3TAKA 3IV3A 3R8HA 1SFLA 1EB3A 4IPIA 1RD6A 1IGSA 3DZ1A 1XBZA 4Q8OA 5DQPA 4L80A 1TPUA 4LS2A 1JL8A 1L6YA 1UHVA 3BG3A 4DWSD 3NM3A 5C7VA 1WYIA 1S39A 2IMRA 3G0SA 4HYRA 3REQB 1WCGA 5ECVA 2GQ3A 1Q6LA 2B7PA 3GD6A 4LAUA 4DO4A 3LQLA 1Q66A 4TVCA 1QHPA 5DXXA 3R6IA 1UUMA 1FCVA 2YZRA 2QPXA 2YL8A 3QSTA 3CV1A 1KGUA 3UJEA 2FQIA 1ADOA 1GZJA 2VX6A 5JQ9A 2NQHA 2YIHA 2MANA 2G5WA 3C6CA 2J62A 1UMYA 1XLFA 4I3GA 2AQOA 2ANUA 3AROA 3OZOA 3QR0A 3TP4A 1CB2A 4ZEPA 3OQ8A 3R25A 4AF0A 5A6KA 5DMLA 1RXOB 3O3RA 1V51A 2C8NA 5A6BD 3FY1A 1JNDA 1FBAA 2EQDA 1NWSA 5LNWA 4GVFA 5A8OA 2PDIA 5I23A 4B5SA 3LHYA 2QXWA 3QTPA 2J7CA 4BEQA 3EWYA 1IT0A 3UVAA 3F4DA 3CU2A 3ARQA 5C70A 1PZ2A 1XYMA 4AHQA 3ATZA 4RKAA 3W7IA 4S23A 4JTEA 3CIVA 1OEPA 4FNUA 3NPWA 4M1BA 3CMGA 2NWSA 4S39A 3IVSA 4NQ1A 3RO6A 4GY1A 1C91A 3EWBX 2ISSA 2WXDM 4FSAA 3G6MA 1PE1A 1SO5A 3QC0A 2PODA 1A49A 3W37A 3LI1A 3KEHA 5JMUA 1D8WA 3LX9A 4YVVA 2ZDRA 4TU1A 4NZ1A 4WY0A 1DQUA 3R79A 1EDTA 2G41A 1SUXA 2CKRA 3DFOA 2Y5SA 4BCEA 2WWCA 4ZOEA 3M43A 1KTCA 1QVBA 1IXNA 1K6AA 5TBOA 3WH9A 2UY5A 1Q5MA 1UWIA 2OZ3A 5LXXA 3BO9A 3LV6A 3MCOA 4J5NA 4CQAA 1EWDA 4HCDA 4LRSA 1JZ8A 3GX9A 2CXEA 3V4BA 4WKFA 1G4TA 3OB8A 2XZ7A 2J6VA 3QEZA 5T8GA 5AYXA 1LOQA 3ARPA 5LA0A 1T8QA 4HNVA 6REQA 3WFLA 3L5MA 2V38A 4Y6GA 1YQ2A 5I79A 3KCOA 5LZLA 6ENLA 5CJNA 3F2DA 3UXKA 5I3FA 4GIYA 3T7VA 4GD0A 4LC8A 3TFCA 1EC7A 1HX0A 3BXWA 4P8XA 4KGJA 5D05A 1QHOA 1VEOA 1CZ1A 3TA9A 5FJPA 3HTWA 3IACA 4POCA 3BUVA 1XDMA 1S5TA 4DBSA 1FX6A 3CS2A 1TZ9A 1UOZA 5M5DA 3KP0A 3VO0A 2REQB 4GZ7A 5BXRA 1F3EA 1GT8A 2CHRA 4XZBA 5E6ZA 1BEUA 2YGYA 1GK8A 4MYAA 2D73A 1NQ6A 4K8EA 5H91A 4I9AA 4XG1A 2OLSA 2V82A 4KBXA 1MUCA 5HQMA 1OT2A 1W8SA 1WUFA 2I56A 2HPMA 4XO7A 1JAEA 3II1A 4FOKA 4AIUA 3RCYA 2EG8A 3MUY1 3N19B 1ISXA 2ZZ7A 2B7QA 2DW6A 5L6UA 4A2SA 2GUUA 3STFA 5A6JA 4XWUA 1XG4A 2E4TA 2Q02A 1Z44A 3C2OA 3BL3A 4YTUA 4H4IA 1OFBA 1VFHA 2WSKA 4Y90A 3RM4A 2E28A 3OVRA 3W1LA 3WD4A 3FJNA 1DWHM 2TSYA 1JDDA 1LORA 5C71A 1G69A 3LD5A 3ITVA 3UR8A 4QBXA 2PCEA 1VFSA 2FJUB 2BGQA 3U7VA 4ZGYA 3KUMA 3TC7A 5AC4A 3FEMA 4C6NA 5IBXA 5AC8A 4ZO9A 1B3OA 4JS3A 1MI3A 3T2QA 3G0XA 1LOSA 3W22A 3BLIA 3TYBA 1U33A 4C6BA 3B8DA 4GE8A 2O56A 4Q4MA 3MDUA 2F6UA 3FDKA 4WGXA 2GJRA 3R1ZA 4NRSA 4KRTA 1H1NA 2ZRWA 2FHBA 2X1TA 3IPWA 3ES7A 4YS1A 1Q6OA 1NF7A 4MJ2A 5G5IA 3WBEA 1WQ5A 3ORWA 4S1FA 1TIMA 1BXCA 1SPQA 2VDHA 1E1CB 1DIEA 3B0VC 2WV8A 2HZGA 4UMCA 3M5YA 2HTMA 4UOZA 1PZ1A 2O9TA 1ZAIA 6CGTA 5GJMA 2VEKA 2FTPA 5BXTA 2ICSA 2JKEA 2PDFA 4JTAA 1YXYA 4DN1A 4N9DA 1G4PA 1PYMA 4JKKA 1EUAA 4IXHA 2UBPC 4YWSA 5CPQA 4J40A 2EPLX 3M5XA 4QCEA 2OSYA 2D2GA 2EPHA 1F3WA 3NL2A 4GYPC 2P76A 1VBGA 3P61A 1HTIA 1M7JA 2Q8LA 3ELFA 2PP3A 4AW7A 3E2QA 3WQOA 3QFWA 4X22A 2JKAA 3EX2A 5C54A 3BICA 2PC8A 4CQBA 1KWGA 2YDAA 2WK2A 3TDFA 2E68A 4NL1A 1QUMA 4HP5A 2RDXA 4MM1A 1JYWA 4AZ5A 4AZBA 1QDSA 3L4UA 3SRFA 1G4EA 2VC5A 3HG4A 3AOFA 4C6OA 2QNEA 3RDKA 3C2YA 4GBUA 3KE0A 1KCZA 4WKAA 3DH7A 2NUWA 4B5VA 1DVJA 1F3XA 1HP4A 4LUIA 4C1NB 2ALDA 3C52A 2VVNA 4GH1A 1N2VA 1ZAHA 2IUZA 5EGRA 3NZRA 2NVDA 3W9ZA 1TV2A 3PJUA 1CGTA 3KOXA 5FJTA 1WDSA 5C9ZA 3EWZA 4A22A 5BNKA 4IMCA 2J79A 3ZMRA 2O7QA 2GGGA 3WL0A 1C93A 3HMCA 2WLYA 1K1DA 3UZYA 3GHTA 1E0XA 3EWUA 3RFAA 3EX1A 1O4UA 3GC2A 4YYCA 1MEIA 3SW6A 1QRQA 2GVJA 3GU1A 5D9OA 2GUYA 1DP0A 1EGMA 3OA3A 4Q4SA 4AXNA 4QQ3A 3E3HA 2OWWA 4UTJA 3L5AA 1FCUA 4ERGA 1VBRA 1T0OA 1ZP3A 2XM2A 3TMQA 2DZAA 3TW7A 4YTQA 1EQPA 1YDNA 5I3IA 5FKYA 4PMQA 1RV8A 3EDDA 4K37A 4Y8EA 1CGYA 2VNCA 3BURA 2DZVA 5HPOA 1R2SA 4GJ1A 2ZE3A 1TTQA 5FF3A 4NRRA 3WIJA 4PUMA 2Y63A 4O1FA 4QE5A 4KFOA 3LYEA 2CXGA 3VGHA 3B3DA 1BF6A 4PUWA 1WE5A 4GYFA 4Q32A 4IMGA 1TV4A 1E6ZA 1QJWA 2P3ZA 2L5HA 2WPBA 4QROA 2WQPA 2CLIA 1Z8AA 3A5FA 1TWIA 3TTQA 4AZCA 4PTNA 3IJ8A 1E72M 1RCOB 5I03A 3QVQA 1OINA 4F4RA 1AH4A 1LYXA 1MW2A 2EF9A 5EU9A 3W27A 4I9MA 3DESA 4JN7A 3TAOA 3GRIA 1B31A 1TUXA 4ZR8A 3A4JA 3VMOA 4JTKA 5IOBA 1EXPA 1K3UA 3PUOA 1XYCA 3N25A 6TIMA 1VHNA 3WH5A 1WZMA 2I5GA 3UD6A 1FWDC 3N6JA 1Q4NX 3M0IA 5FL1A 4DWSB 4JICA 1VEMA 3S6OA 3HURA 1W91A 4U3AA 1LP6A 5A8QA 4F2TA 2HQAA 2WO5A 4V1XA 2DH3A 4YMZA 4LY8A 4BY3A 4G1NA 4GQGA 3NEVA 4XV0A 3H4GA 4CGTA 2ON3A 4ZA0A 3W6LA 5IRPA 2EJAA 4ENLA 4HT3A 1I6NA 2XN2A 2ACUA 2QCLA 3N2XA 4UMBA 1NJJA 4TTGA 4PB4A 4RNHA 5LIKX 1A80A 3T0CA 3V0SA 4PRWA 3C8FA 3N2TA 1TSIA 1GOOA 5LSMA 3RLGA 1CGVA 4LANA 2VXNA 4H6EA 1JF6A 4UWMA 4Q6JA 4J2PA 4Q8TA 5XIMA 4P7OA 2A85A 5FCZA 1D3HA 3N4EA 4ACZB 4QAWA 1VAHA 3HQNA 1VD6A 1L6WA 4AC7C 1H0IA 4GIEA 5J04A 5DXYA 1LJYA 1BQGA 3RX3A 3N18A 1LL7A 2Y1HA 3NPXA 3AIBA 1DTUA 1RCQA 4ICNA 3BOXA 2OGYA 4O16A 1JCYA 1ALDA 2O92A 4MJ4A 1SM9A 5T26A 4UFLA 2P8CA 4NSBA 1GJUA 4EVZA 2JEQA 1R87A 4HPHA 6REQB 4QQUA 3GU9A 1W3LA 3ZLHA 5HUPA 4OBTA 1KFCA 1IE7C 1TG7A 3VIPA 1GG1A 1AQFA 1TWSA 3R7MA 2VZOA 1SZGA 1US0A 3ZT7A 1TZ7A 2DJLA 5D2VA 3GXFA 3ITXA 3LPGA 3S8HA 1MSSA 4AD4A 3GHSA 3AMLA 4QEHA 5E5CA 1FP8A 1EBHA 2E1WA 2XGIA 2J8FA 1KBIA 1H0GA 2VTFA 1EJWC 1PDZA 4M51A 1Q45A 2ZX7A 1BPLB 3LLFA 4JN6A 4US5D 3KBVA 3EMZA 1O7AA 3N2OA 4Q7BA 1D2KA 1HVXA 3EX4A 4DM1A 3BJTA 3B8VA 3E02A 2W92A 3NSMA 3WDRA 4MDPA 3UY7A 3IJIA 2D1ZA 2DSZA 3QZ6A 1WO2A 1JCLA 1XLMA 5FEZA 3ITTA 4TMCA 4ERAA 5G2IA 5A2CA 1E9IA 1XH1A 2IXUA 4QG6A 1RAKA 1KM5A 2WCGA 3FN9A 1TX2A 4ASTA 4EPEC 1X6NA 1XKJA 1UP2A 3A21A 4BZYA 3TCSA 3U3HA 1QT1A 4AD1A 2DORA 4EACA 3NXLA 1CXEA 4HPGA 1YX1A 3H24A 4P61A 3OG3A 3W1MA 3UR5A 3MBDA 1XIBA 1GPFA 1OFEA 3VZZA 4XTDA 2HDJA 2J7EA 5U7SA 5CZJA 5D03A 4H04A 3P5YA 1X8CA 2EPOA 4PFHA 1B3XA 4JEQA 3BC9A 3WQ8A 1KTNA 1A47A 3WUEA 3UEQA 5CAHA 1UKTA 4QS6A 4WDWA 1U5JA 4OBSA 1KV5A 2PLMA 4H7VA 3IAQA 1GGOA 1XLLA 3W7NA 4Q4QA 1AD4A 2Z6JA 1CIUA 1PKMA 5T9BG 4R85A 1QXLA 3LTPA 2PS2A 1PWLA 4B9ZA 5DEZA 1KBBA 1XIEA 1FWFC 4MKVA 2QQ6A 1AL8A 1W32A 3A4AA 3AXKA 3M46A 2FZBA 3W7LA 1O60A 5AYYA 1NSJA 3TWBA 3WDPP 5JBFA 2Z1KA 2D3NA 1VLIA 3PS7A 1QATA 3E5PA 1UP3A 4UNIA 1Z32X 1N55A 2QUUA 4FOJA 1US3A 4IUGA 2JFEX 3V5OA 3VOCA 3EB2A 2ZX9A 3M64A 4A3QA 2O4QA 4KWSA 5DCEA 1IEVA 4PTDA 4IQJA 1XRVA 1DXEA 1H49A 2YBVA 2VQUA 2Z2UA 1E0WA 3ZXWA 1TYGA 5BMXA 4AEEA 3GE7A 3EXSA 2RKXA 2H9AA 4FNTA 4Z42C 4B92A 4HYVA 1WBJA 3LGGA 2E9BA 5CZ0A 4DJDA 2HVNA 2Z24A 2F61A 2V3GA 4G56A 4LB3A 5BRBA 4YTRA 3IJLA 2WQDA 3WBXA 4ADTA 3EB3A 4CCCA 5I07A 4S2CA 4OZOA 1KXQA 3M7SA 4TX6A 4LW7A 4X60A 4JYEA 2HE5A 5CQ1A 4UCFA 5JH2A 1W1TA 1ZALA 2IQTA 4O0KA 2DPEA 3MO7A 4QTGA 1QR7A 4ZB2A 1Z89A 2NXGA 3W7OA 1LM1A 1TX0A 4IG2A 2VFDA 3T1GA 1E9ZB 3CH9A 1UR8A 3W84A 3IS4A 3GQYA 3N3TA 4LB4A 1KXTA 4Z1BA 4K38A 1MW3A 3PTKA 1PL9A 3W1AA 1UZDA 2I17A 2I14A 2TPSA 5EL1A 1JXKA 2WHMA 2Y8UA 1PO9A 3BLKA 3OGRA 1W5NA 4I8DA 3TC6A 4KS0A 4BQ3A 5CGMA 3WH6A 3UW6A 3PG8A 3I65A 2NZLA 1ICSA 1QPOA 3QRHA 2X05A 3FCPA 3UR7A 2A3LA 1LUCA 1DWFM 3AYVA 1AH3A 2WMIB 1SZEA 4A29A 3U9IA 1VEPA 2DDXA 2H9AB 4Z2GA 1FWAC 2WMHA 4A8IA 3VIIA 3L5LA 2VL4A 5HBFA 4IP5A 2VUNA 2FPTA 3P14A 1RQEA 4JYDA 3LK6A 3M4HA 4PB5A 4QE1A 5JH1A 4GO8A 5IDIA 4MPQA 1FTXA 1TPC1 1PUDA 1FWCC 2CFFA 2VRQA 1FDYA 3DHDA 5TIMA 1UQYA 4DBEA 5DMMA 1TV5A 4HNNA 1V6WA 2C1IA 3EDKA 4B5NA 3W29A 4DZIA 2IXVA 2W6RA 4IGSA 3MY9A 3FGCB 4IPPA 1ITXA 2AOSA 3N2MA 1VH7A 1AH0A 3W83A 4H9XA 3DG7A 4JAWA 1EJSC 3MANA 1IWBA 4IGMA 3QYQA 4HZ6A 1ZHAA 1REQA 3DN5A 4H9MA 5AC6A 1K8ZA 1NVMA 3C0SA 4Q4KA 4NYYA 5GPRA 1FY6A 2GLKA 3CO8A 4AY8A 2QPSA 3VOGA 1KQYA 2Z1SA 4WOQA 4IT1A 3H54A 4UTLA 4XZLX 2PGWA 3MWCA 3SN1A 4UOQA 3EOLA 4KEVA 3GM8A 3W1XA 4HHHA 2REQA 2DJXA 1K77A 1EX1A 3W7RA 2NV1A 3VA8A 4GINA 2WJEA 4QLKA 2D23A 2HK1A 3H70A 5IM51 2HK0A 1G1YA 1XFBA 4BF5A 3AWOA 4JFUA 3AZRA 4JD4A 4ZL1A 3T81A 3SO7A 2BMBA 4AY7A 3GC5A 4O1EA 3TR9A 1Q6RA 5A6MA 3KTCA 3TVAA 4LNCA 4PMYA 1NAL1 2YCLA 3DC8A 2PDBA 3KVKA 4JFVA 1E5JA 1M7XA 3AIWA 4LY4A 4UQCA 2DSUA 5DELA 3AYRA 3KDNA 4L1GA 4MG4A 2ZRYA 2VGIA 1ZL1A 4QJ3B 2W91A 1M41A 2JE8A 2NLYA 4ZVJA 3IGUA 4L9XA 4U5KA 4XUGA 2XIIA 3SIMA 3C5QA 3BSHA 1JUEA 2A3AA 1NP2A 1HVQA 2W63A 2FPVA 3TROA 1UROA 3N1AA 2PLKA 5BXSA 3VNDA 3HG3A 4NU7A 1R2TA 1HW6A 4NF7A 2CC0A 2NSXA 1A5AA 1FHLA 3TSMA 1TQXA 2X1UA 4REQA 4LUSA 3O7UA 4PCPA 5F4WA 4TX8A 3KOFA 4BHYA 3WYZA 3GXMA 2ZA2A 3WD2A 2ZWYA 3VK5A 4M82A 4GJIA 5C2XA 4HSHA 4X9SA 4A2RA 1NFGA 4GVHA 1QWGA 1UW9A 3CBWA 1W2PA 3LBMA 3URQA 3WH8A 3AQUA 1KM6A 1UMLA 1POJA 1TQJA 2I5QA 3T4CA 4ES4A 4TUFA 2BOGX 2OX1A 1J6OA 1KGXA 1YDOA 3POCA 3WBYA 1TR9A 4KCWA 3SCOA 1TB3A 3R43A 4AF0B 3STEA 4H7ZA 4DI9A 1M68A 2FTYA 5IHSA 1DJXA 1XD1A 3A64A 4XBSA 3LUTA 2DSKA 5CPOA 4RE3A 2BTMA 4JFWA 3C56A 1R2RA 3NQBA 2NXHA 3TNOA 2QKFA 5G2WA 2X1SA 1YXDA 4S3AA 3LZ3A 1JRBA 1EIBA 4O28A 1C8VA 5I6SA 4O4WA 3VIHA 4U4MA 2FYMA 3G8EA 4EP8C 3KOYA 5LHEA 3ZOAA 1KW1A 2PC4A 2UV8G 3RO8A 1MUWA 1UA3A 4UFJA 2NVAA 4V33A 1YXCA 3FSUA 2I16A 2GK1B 2J88A 2WKGA 1RPXA 4H9TA 2P10A 5A2BA 1GVEA 4ORIA 1JXJA 3B4UA 1NDWA 1QOPA 4PUJA 3N04A 5TD4A 4C6QA 2WOQA 3NYDA 4GXMA 2WKJA 1P6WA 4DWSA 1PKNA 1ZRQA 1C90A 1O94A 4CCZA 4FS9A 3UWVA 4DLMA 1QK0A 1ENUA 4J3ZA 1J12A 3P0XA 2ZFAA 1L0PA 2HBXA 4MHBA 2ZUWA 3RPTA 3G18A 2H6RA 1VFOA 2WNNA 3L65A 1JYVA 1JCJA 2ZICA 2E8ZA 3MCMA 2X7WA 5E9XA 1JPMA 2J7DA 3MI3A 1BFNA 2BDQA 2YDRA 4KW2A 3FFSA 4WDUA 1PEZA 4L1WA 4X2RA 3W24A 5E9AA 3OPSA 2V3DA 2JGYA 1HJQA 4AZGA 1UD3A 4LAOA 1J18A 5M2FX 1KR1A 3CHDA 3RG6A 3W2NA 3R0DA 5MF5A 1DJIA 6PTDA 3CUJA 2WMJA 1K70A 3DGBA 2ZUSA 3GTHA 3S5ZA 1GVIA 4C65A 5A94A 1MO0A 4HMNA 3WDJA 5CBIA 1IZKA 3W00A 4ZQCA 1KLZA 4LVBA 5I0DA 1VZWA 3IUDA 1WB0A 3CZLA 4D6GA 2YBUA 3A47A 1UD6A 1ZPTA 4E2OA 2RDTA 1BTCA 1GQKA 1A0DA 1FH8A 1FXPA 2C3ZA 1ADDA 4C5YA 3KLKA 5G4EA 4PSRA 1EGVA 5F7UA 3IAPA 4E2VA 2UWFA 1BHGA 1SR0A 1WDDA 3S5SA 3VXGA 6XIAA 2F9RA 1P4CA 4MNLA 3CV6A 3H53A 1T40A 1OHLA 3H2FA 4LX4A 5I3KA 3UZ5A 2Z4GA 1OIMA 2E25A 1TUFA 1ME8A 1EF2A 2GOKA 3DFHA 5ENLA 4EANA 4D6DA 1V03A 4HJWA 5REQB 1XM3A 2FGZA 3FA4A 3TJLA 2VMFA 1MRQA 2QHAA 3TK7A 3TMLA 1J5TA 3VAVA 2QDGA 3QN3A 1HJWA 3ARZA 3ZWSA 5HMFA 3LMZA 3TNBA 1F4HA 3CYJA 3H7RA 5LNVA 3AMGA 1PV8A 1YADA 3THDA 3W2UA 2KX9A 5EBUA 1RD5A 3NZ1A 4TR9A 1V3JA 4ZBCA 4P7NA 1RY8A 3WUGA 3FJ4A 3AXMA 1PCWA 2FPYA 4JTJA 4GABA 5AOUA 2ABAA 4YN5A 4JQ4A 5U4NA 5EBAA 4RX0A 4NZ5A 3FKRA 5CCZA 1SSGA 4D8LA 4Q7IA 3QQWA 3KL0A 1Q63A 2VX5A 2A79A 5EY5A 3QTGA 3W74A 2ZZ4A 3W71A 5I00A 3NQMA 3TX9A 4OU1A 2CBVA 3L9CA 3E0FA 3UG3A 4YCOA 3GG8A 4XBJA 1JUBA 4WGHA 4PBFA 3SDOA 2YXXA 2Y6ZA 2XN0A 2POZA 3QW3A 1EDQA 4QSFA 1V0LA 5F2IA 5G4HC 2EEXA 5LIWX 2WSPA 3LXBA 5AYBA 3UWEA 3O6DA 3KRBA 5I3HA 2NUYA 3WKZA 3U2OA 4LPCA 2WMGA 2ZX5A 3B0YA 3NTYA 3CL8A 2YFOA 1OABA 1P7TA 1Q7ZA 2WHKA 3KM8A 1U1JA 4O18A 2NW0A 4X3ZA 3KXQA 3L4VA 4Y9NA 3FKKA 4DVOA 4BWLA 4W93A 4RNFA 4AD2A 1O5RA 3DHUA 4UC5A 5HJYA 1J0HA 4QCFA 5HDRA 3HB9A 1XCWA 4MTVA 3WJWA 5H2ZA 1CGUA 2D2HA 1V77A 4GI4A 1V02E 2CPUA 4WIWA 4KT2A 5KZEA 3UXLA 2NQZA 1XIIA 1H7OA 4H9ZA 1P0NA 4IP7A 3WK2A 2ASHA 4X0NA 1TPFA 3THQA 4L4PA 2Y7FA 3K46A 3FVMA 1IZJA 3GXDA 1V3KA 4LC6A 1GKQA 2D24A 4MLRA 1UR1A 5FJOA 4IHCA 4O8AA 3LM3A 3VINA 4JTLA 5KITA 1OF6A 3K8LA 1OFOA 4P7LA 2V67A 1S5NA 4I5RA 3FHAA 1JDFA 4LTSA 3AHXA 1VBHA 3QH2A 4HJFA 4W5ZA 3DI1A 4XZHA 2DZBA 4M6QA 4B4HA 4GX8A 2YFNA 1JYNA 3SADA 2QCGA 3CTLA 4XISA 4RNJA 4WXZA 2PUZA 4GRSA 5I78A 2VUYA 1TMHA 2PPGA 4MB3A 4YYFA 1LTDA 4CQCA 1VIZA 1E15A 4HMEA 1VPXA 1H5VA 2PFHA 3NAVA 1OFPA 4GOAA 1F4AA 4JIQA 3W7PA 2A2IA 3RX4A 4EPDC 1VBUA 3KDOA 3RU8X 3CQJA 3B0UX 4GCXA 1I2NA 3DFSA 3I10A 3BW3A 1A5CA 4R5EA 1LRTA 3TCEA 1PBGA 1UA7A 1XLIA 4HA1A 2FJKA 2DT1A 3MYPA 2Q8XA 2B0MA 5I3JA 1Q7QA 3W28A 3GAYA 2BGNE 2YL9A 1YPFA 2XFWA 2YL5A 1G7VA 4C6DA 4DHGA 4YTSA 2F6KA 4WY0F 5B7YA 2WJFA 3T55A 4GZJA 4J9JA 1ECQA 1MZHA 1M7PA 3A23A 5KZ6A 2YL6A 3PZ9A 4YWIA 1EC9A 2IKHA 1I60A 1CYGA 1DWJM 4YL2A 2GJLA 3BV4A 1FH9A 3KAOA 1RK6A 4UTMA 2J8TA 1DV7A 1C29A 4HOWA 1MRAA 3C0QA 4G7EA 3CHEA 1GQNA 1UD2A 4OTKA 3IANA 3ITOA 3TKFA 2BB0A 6TAAA 3U8GA 3JS3A 2VFIA 4GA8A 5DMNA 1CDGA 3LHTA 1PB0A 1W56A 2YX0A 3MWAA 2ADAA 3LI0A 1FVPA 4UFHA 3EOSA 1KRCC 3CAQA 3WBAA 2VRKA 4ZQMA 4H41A 3FYPA 3W2KA 1SFJA 3MMUA 2OQHA 3WK1A 4CU8A 1OJXA 3V75A 1H09A 2PE4A 5D09A 1THFD 4IPLA 3NZPA 2GSJA 2CLMA 1KNWA 1RZMA 2F8QA 1FH7A 1QW9A 1MFVA 1E43A 2J77A 2ZVRA 1E3XA 3AMDA 3OLDA 1ADSA 2BWGA 3EGJA 3FXGA 1GZGA 3EWWA 1ELSA 2PWUA 3GTIA 4Y96A 4M81A 4AIOA 4F0RA 2V6AA 3IJ7A 3ZZ1A 1I2PA 1B9BA 3DI0A 2C18A 4EXQA 1QBAA 5F2GA 2QDEA 2PDMA 4MKNA 4CQDA 3O06A 2PU0A 2IPGA 3RN6A 3FYYA 3HV9A 4PEKA 4ZB5A 5IFTA 3SZ8A 1ISVA 2H8XA 4JX4A 1BQCA 1OCBA 5GNXA 1J01A 3CPGA 2P88A 1OGBA 2HV5A 3GNXA 1LZOA 3DYMA 1TVNA 3E0LA 4J35A 2PCQA 1E4IA 2NUXA 1BYCA 4E4UA 5ABEA 4NYUA 1F76A 4HCHA 4NP7A 3H21A 3KBNA 3PHAA 1JGMA 1WKYA 1QI3A 2E8YA 2P0OA 3ARTA 1XH0A 4HN4A 4HU3A 4XTIA 3F5JA 3WN6A 4DBDA 4CNOA 1B4EA 5GQBA 2V8ZA 3CT7A 4DJDC 3PM6A 3ARXA 4EIVA 3B9AA 4R53A 4Y2WA 3TN3A 3OVQA 1KRAC 4H1ZA 2V30A 1B9ZA 4UZSA 3T44A 4LYPA 5FAJA 4WF7A 3GIYA 3MA8A 3AWNA 3RU6A 5JXQA 5F2LA 4UQBA 1MXDA 4B9YA 3XINA 4UQAA 2J24A 3H4WA 3TIMA 3ZYZA 5FSDC 3OLGA 2J47A 4E4PA 1C7TA 1PS9A 1CTNA 2G96A 4CD8A 1P0KA 2DV0A 5I2UA 1DL3A 1R7AA 4B90A 2BY2A 2OKTA 2W67A 4X2PA 4Z08A 1JPKA 3N4FA 1E6PA 2P0IA 4LGXA 4E8DA 4Q7NA 1XYLA 3OW1A 5DO8A 1DKWA 3PF3A 4IH3A 1VFFA 1A5OC 1E1EA 4JOMA 4JDBA 1EH9A 1GHSA 2OELA 3DAQA 2QCCA 3WK0A 4DJEC 3QBUA 3MSRA 2ZDSA 3NQ8A 2EGZA 2PTXA 2QAPA 4JIPA 2VDIA 2QIWA 2DZTA 1JZ4A 3S1VA 2MUCA 4OKDA 1NP0A 1CXLA 3V5CA 1V8EA 3AICA 1ESWA 3PZVA 4MJZA 2QJMA 4UTTC 2X2GA 1K03A 5G2HA 4DO6A 4HYWA 2AAMA 3GH5A 3W7DA 4GKTA 3UXDA 3THUA 3RITA 5ABHA 2X30A 1DYSA 1PSCA 1OFAA 3QY7A 2PBGA 3APTA 3GVRA 4GCAA 4ZO7A 3ZJKA 4XB3A 2A3HA 3PWGA 4NNBA 1J11A 1UKOA 3R13A 1VPYA 2OQYA 2ISFA 4ML4A 1V0NA 1TO3A 1DEDA 4EXBA 1UKPA 3EWDA 4IFRA 1J0YA 4JKLA 2F6XA 1X97A 4ZMGA 2IQ0A 4JTDA 4RDVA 2GSHA 1YNQA 1MMFA 2VZUA 3RHGA 3K5XA 4NJKA 5CPMA 3CV2A 5K4ZA 2YB1A 4EAMA 1LT8A 2A3BA 4HNTA 4CU7A 3ARUA 3E12A 4FNSA 3Q37A 1XBYA 2GGHA 3T40A 3O8AA 4OIFA 4GI9A 3UGRA 2UY3A 1XIHA 4GNJA 4GZEA 2IW0A 1AA1B 3HF3A 4RZBA 2ACSA 3BOFA 3SCWA 4JYFA 3SQSA 8TIMA 1E1CA 3BLOA 3DOPA 4DJFA 3WLTA 3E0VA 3L7RA 2PP0A 3UESA 4LYQA 2NX3A 1UG6A 1LG2A 2VDGA 3N6QA 4EPKA 2YKKA 3JVAA 1H5YA 3GDLA 1BD0A 3CEUA 3Q65A 1NARA 2XJ7A 2XGZA 4WEVX 4U10A 4PGLA 3D6NA 2Z26A 8CGTA 3PTMA 1FWWA 1SZNA 1K9TA 4RJEA 2VJXA 2C0AA 4C1KA 4I8YA 5D8ZA 1RH9A 3RNDA 3UWUA 4FZIA 1FWJC 1XIJA 4W8AA 4LEFA 2R91A 1S1PA 2E67A 4F0KA 1YEYA 2OLAA 2WW5A 1X1NA 3TSDA 5HPCA 3B4YA 2Y5JA 3NA8A 2QT3A 4GJJA 4HOXA 1HZYA 1KKOA 2DT3A 3B40A 3KBSA 5XINA 1P5BA 5M17A 2C71A 1I2OA 2XU2A 3WD0A 5T91A 4HPXA 1FA2A 3OBEA 2KAUC 2G95A 2VEIA 4GQBA 3WF3A 1JI1A 3L23A 1TIWA 4NNAA 4FEZA 2FH6A 2Q8ZA 3FEQA 4N9EA 1WKDA 5EB8A 1EO5A 1UD4A 4QJ4B 2OTDA 1Q8AA 3WQ5A 3HPFA 3H7VA 1IV8A 3I6EA 4M80A 1J8VA 4BI6A 4S38A 4HU4A 1EBGA 1GJPA 4PODA 4JX6A 1L6GA 5D9NA 3OIXA 3PZOA 2OT1A 3S2MA 3LENA 3CL6A 3W3OA 1E55A 2PGFA 4LV9A 4PL2A 1P0BA 4LALA 1TA3B 3CIWA 4EAYA 3KZPA 4NAEB 3VABA 4FNPA 4IMFA 2DZWA 2OODA 3LHUA 4I7VA 3BQ6A 3U6WA 3VIFA 4U31A 4HPJA 3STGA 2QUTA 1SW3A 1CENA 2V5LA 4HNLA 1AVAA 2OSWA 7A3HA 1EP2A 3W1PA 1ODZA 3A24A 3E74A 2O0TA 2PTWA 2QV5A 2YDQA 4MZYA 1EP1A 4X0VA 2ALRA 4UTFA 1XV8A 3LCFA 4DQWA 2C13A 2VWTA 3GDKA 3W4RA 5C2CA 3PJWA 2CETA 4JZ5A 3RJXA 2EPNA 4J3WA 5ABGA 2YXGA 1GG0A 1Q3NA 1E1FA 1MWOA 4W85A 3PZIA 1FWRA 3IGSA 3BGGA 3MW7A 3NL3A 3A22A 1YTDA 4DB7A 3LBCA 4AWUA 3UZJA 3T2OA 1KFJA 2BY3A 1GKRA 3KCJA 1W9PA 1DJHA 5DY2A 4P8WA 2FDMA 2VC7A 2A6LA 5CJMA 1KQZA 3S47A 1GOQA 1QOQA 3M41A 4MPKA 4CQ9A 1XFCA 2GGEA 4Y7EA 4GNKB 4C7DA 3FA3A 4O0ZA 2XVKA 1I1XA 3NQFA 3FGCA 7ODCA 1M5WA 1UR2A 3G1DA 3DC0A 2PDNA 4HA4A 3DFTA 1PWMA 2DT0A 1R86A 5FJJA 4RLIA 1H61A 4IQDA 3VGBA 4LFYA 1XG3A 3TXVA 5FJUA 4JX5A 3GDTA 4O1CA 1E6NA 1J96A 4LBSA 1L8NA 2VGBA 3GYCA 1HKIA 2ZX6A 4LVDA 2V0TA 4GXPA 1UWAA 5C2GA 4HHMA 3NGJA 2YW4A 4HOZA 2QCFA 3TTOA 3TQVA 2B7OA 2PDKA 2HROA 4LBRA 2RGLA 4GGBA 2XH7A 1L9WA 3B9NA 5EMLA 4QE4A 4C5ZA 3NQ2A 3KHJA 1WAWA 1P48A 3BMXA 3P3BA 4RV3A 2FKPA 4LS1A 3S1UA 4BEUA 2CWNA 2INEA 3ZVHA 4R3UA 2IQDA 1Y65A 3VD9A 3VC6A 3EOUA 1Q8JA 5I7GA 5CH9A 1O95A 4UMAA 4S3EA 3SUSA 1NELA 1G6CA 2QZRA 2GL5A 3EDEA 3V7PA 1GVQA 1NEYA 3M0MA 4ZOAA 1LBMA 4O53A 1FXQA 1IXQA 1IHIA 1Q6FA 1F8MA 1Q85A 4PMXA 3V36A 4AVFA 4PMRA 5JVLA 2QGHA 1B3WA 3B9DA 1DIKA 3BCFA 4IX2A 2QJNA 5C9UA 2OR2A 2VRJA 1A5SA 3CAVA 3R0UA 1X39A 2ZOXA 4GHRA 4XAFA 3FW6A 2ATSA 1WP6A 2W0UA 5D4YA 3IVTA 5H6HA 5J5DA 2ATMA 1W3IA 2ZC1A 4MNKA 2PDXA 1TPB1 4CCEA 3QV8A 1E3ZA 3G2GA 3CWNA 1GOIA 4ZB0A 2PEVA 5BYWA 4FLOA 2FVMA 4AWEA 3IIXA 4J3UA 4H9VA 5CLTA 4O17A 2R8WA 4LNYA 4O1DA 4W8BA 1E4NA 2PWHA 3DHPA 1NU5A 5HMSA 1G0CA 2XWDA 3PBUA 1UWUA 2WM0A 4JQAA 5HWNA 8XIAA 1XQLA 3B0PA 3HFTA 2NQLA 3TE9A 3WELA 2J9ZA 1R3QA 5DRIA 3ZSSA 1OBAA 2ZZ6A 2VFGA 4AD5A 4Y8FA 2W79A 1SFTA 1XWYA 2Q6ZA 5A3HA 3OG2A 1UP0A 4CVWA 1RHCA 1H7RA 4C91A 4LQ1A 1CXKA 3W88A 4E2DA 5JBEA 1EC8A 3UWYA 4B2DD 4D6FA 5REQA 1MQQA 1ZENA 1KRBC 1TPH1 5A6AA 4MB1A 3BG5A 3S5YA 3VKAA 3CC1A 3HN3A 1YKWA 1ZUAX 3RJYA 4TMBA 4B16A 2BBFA 3MTWA 1HGWA 4IG2B 1EJUC 4DI8A 3UPMA 5FACA 4XQ6A 3VKBA 1Q2RA 3I6RA 2GZXA 3QKZA 1R47A 4B3ZA 3SECA 3RIKA 1H3GA 3RILA 4I9TA 1OF8A 1WDQA 4O12A 4NY2A 3GZAA 1J0IA 4AHPA 2P1FA 1VFLA 2Y7EA 3VOIA 4US6A 4HK7A 1XIFA 5GNYA 4BI7A 5C9WA 4GVGA 3SFKA 3DFPA 4F79A 5KETA 4W87A 3W01A 4ADUA 3PBYA 1V0KA 2Z1WA 1VR6A 4IUOA 4UFIA 3JZEA 4OOZA 2V2HA 4F0HA 3PVFA 3E9AA 4JDYA 3NURA 5C9XA 4WRHA 1B0IA 1HT6A 4OFCA 3T05A 3TW6A 1JZ5A 5KEZA 3MPGA 4Q8VA 4DZHA 3VCRA 4AWSA 2Y24A 4GY0A 1IT8A 2DSWA 4HU8A 1EJRC 1U22A 2Y62A 3ZT6A 3CUXA 2AQVA 3M07A 4AYSA 3MI6A 4L4MA 2WNZA 1SQ7A 1T5AA 4GNVA 2DUXA 2JF7A 1U5HA 2HS8A 4KPLA 1VQTA 3OYXA 1ZQ5A 2FZDA 4B91A 4QNEA 1DQWA 1GVFA 3BG9A 2HBVA 3O15A 4AMCA 4OBRA 4ZXOA 2XHYA 4C6FA 1FQ0A 2D0FA 4FLQA 3R89A 3KVLA 4DXXA 2V68A 3IGHX 1MW0A 1M65A 1XJBA 4NI3A 4JNMA 1XDJA 3N14A 4A05A 3K8KA 2HWGA 1PHQA 2GDUA 4PUEA 1FWIC 3QJAA 2CLKA 4MAVA 2W66A 2CZEA 4ZE4A 4HA3A 2ONEA 2F7FA 4S3JA 4GG9A 1JF5A 3EPOA 1KBJA 3NSXA 1BAGA 5PTDA 2J13A 3MKCA 3MVTA 3L2LA 1Q6DA 3CZGA 2RJHA 4UTKA 4L56A 1AJZA 3RCNA 4K6AA 2WZIA 4B5UA 4YVPA 2V81A 2EXOA 2UY2A 5EYWA 3GDMA 2HVMA 3I6TA 5HNUA 4A8LA 2ZA1A 5A8NA 4L6DA 4PL1A 4OOUA 2HPIA 1ZLPA 4W7WA 4DM2A 2EJ1A 3UVI