4FXRA

Crystal structure of the mutant t159v.r203a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGASIYLADNPAAAAAGIIESIKDLLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 80
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fxrA00
4S1FA 2ISSA 2NX3A 2VFIA 4LC6A 1Q6RA 1SFJA 2JK2A 1QOPA 1EEPA 1O60A 2E6AA 2OT0A 4HNNA 4JN6A 3KVJA 5CZSA 1QPNA 4AXKA 5HWJA 3UPBA 4M19A 4LC8A 4EF9A 4IMEA 3LRLA 3W84A 1OYAA 4B5NA 4ZMGA 3U6WA 3P80A 3V1PA 1GT8A 4JX4A 2ZZ4A 1W5PA 1RV8A 4JDYA 5LNWA 2VELA 3UZ5A 3O63A 1VHNA 3W7PA 1O5XA 1L9WA 2XFWA 4XBKA 3L66A 4UC5A 1XDMA 3LV6A 2QCDB 1KM5A 1RQBA 4UTTA 1DKWA 3B4UA 3TJXA 4LWWA 5HULA 1LDCA 1LROA 1V5XA 1DJNA 1B4EA 4UTLA 3TNOA 3S6DA 1VYPX 2C1HA 5U4NA 4A21A 5EA9A 2ZFAA 2PCQA 3W7CA 4AMAA 2RKXA 3DENA 1XUZA 1W3NA 3FYPA 3ABSA 2NXHA 2R91A 5BRBA 4ICNA 4IXHA 1GJPA 2Q8ZA 3A5VA 3BG5A 1RPXA 4NZJA 3W3OA 3L0NA 3UXDA 3BGJA 1XUUA 3TAKA 4TMBA 4O50A 3SECA 3G1VA 4YMZA 2P0OA 5CSSA 3G1YA 1TREA 5CKSA 3TA6A 4WZHA 3MI3A 4ML9A 1OK4A 2Z6JA 5KSWA 1OFBA 5U7SA 4PTNA 3R89A 1LBLA 1U5JA 4K36A 5D02A 1G4SA 1WQ5A 4UIOA 4UMCA 3W1QA 5D2YA 1EPXA 1ZAJA 3UWWA 5KZDA 3OVQA 3CM4A 3LCHA 1H7OA 2VEPA 3TMLA 5BNKA 3S42A 3NM3A 1HO4A 4WQ6A 4G1KA 1D3GA 4JTIA 5BMWA 2ATSA 2ABBA 1NFBA 4M7TA 3OEXA 4UMBA 5LZLA 3PB2A 1DHPA 5D37A 4DF0A 2ZQ0A 1L2UA 3G1AA 3CTLA 3SW6A 1R2TA 1TJPA 4YCOA 3M44A 2CLHA 4NJHA 5BW6A 4O28A 3QMSA 3SR7A 2DP3A 1YDOA 2ZTJA 1JCNA 5GVJA 5EYWA 1SZGA 1PCWA 2R94A 3PC0A 3PUDA 1WX0A 2A7PA 5FEZA 2FPTA 3O8AA 2C18A 4LU0A 3WJSA 2E5CA 1TCDA 4UTUA 2PE4A 2CLEA 4AWTA 2F7FA 2B0MA 3NQEA 3FJ6A 4X2RA 1GG0A 3W1MA 5HQEA 4UTJA 5J5RA 5E0KA 2W79A 2QUUA 3W73A 2WOQA 1SO5A 3DFTA 2JGYA 3N34A 1SW3A 2Y63A 5D03A 1OJXA 3LHVA 1NVMA 1DV7A 1F76A 1H1ZA 2C0AA 1SR9A 2WNNA 2CZEA 4NZFA 3L68A 4BI5A 1ML1A 3B06A 3C8FA 3TQVA 4GE8A 5DBTA 3KXQA 4O12A 2VFEA 4X3ZA 3TE9A 3O1NA 2X16A 4ZVJA 3HPSA 3NR0A 1Z41A 3VI2A 1LCOA 3THAA 1ZNNA 5D2XA 1W37A 1GQNA 4PL2A 4KFNA 2C19A 2HS8A 5K9CA 4JNMA 1VCVA 4LVGA 2NWSA 1ZALA 2VFHA 2CZDA 3GNNA 4A3UA 3O07A 4ORIA 4N2YA 3BARA 3W7LA 3W7DA 2EHHA 3STGA 4JTGA 1VC4A 3DAQA 3HPXA 4HN4A 1I2PA 1W3IA 1W5QA 5CPMA 4AHQA 1SSDA 2YR1A 5KTLA 3NL3A 2Y6ZA 3P67A 4GUHA 2QCMA 5F2GA 1JUKA 1Z42A 3C0JA 2X2GA 3HB9A 1TV7A 1UASA 5LGXA 1EUAA 5DY3A 3OA3A 2X1UA 2RH9A 1EP3A 3TQ0A 2VC6A 2DZUA 2BXVA 1OYCA 3QMTA 3M5YA 4MY8A 5AHMA 1K02A 3ABRA 1SO3A 1ZAIA 1SU5A 3CEPA 2QCNA 3HG3A 3STFA 1LZOA 5G4WA 3IV3A 1A5SA 1WYIA 2ZBTA 3IGSA 1FWWA 1GWJA 4YL2A 5AC8A 4O1DA 4O14A 3QFEA 3DBPA 4Y8FA 2X30A 1QPRA 3GLCA 1AMKA 2NUYA 2OMAA 3HO8A 2QUVA 4ZL1A 2B4GA 1PL9A 2CLIA 2H6RA 4J9JA 6ALDA 3TX9A 3IVTA 3QW3A 2BTMA 3SI9A 3G1SA 4UCGA 1J5TA 3L2IA 3PUOA 4K7VA 1XBYA 5D38A 3P62A 3M6YA 2QCLA 2NZLA 4N9CA 4GUJA 3GYEA 4XZ9A 3NQ2A 1H51A 4M6VA 2A5HA 2PRLA 3P82A 3QM3A 4JTTA 1K3UA 1GYNA 3C2VA 3UYCA 3NQ7A 4FNSA 2GVGA 4O15A 4NJJA 4Q33A 4Z1AA 4GUGA 4WY0A 3LCLA 4JIQA 4LUJA 4NVTA 3NDOA 2QUTA 3DHDA 2NXIA 3GK0A 1PHWA 4ALDA 4O1CA 3L5AA 4ONVA 4EVZA 2VENA 2VKZG 2NX1A 2TPSA 1S5VA 2V30A 4I7UA 1FWRA 2ZZ6A 4QJ1A 2I1OA 5A5WA 1Q3NA 3LXBA 2ZTKA 3N14A 5DXXA 5AYZA 3PG9A 5CZ0A 1TQXA 2A6LA 2W0UA 3RFAA 3RLVA 4CCCA 3MWAA 4NXSA 5A8GA 2TMDA 1LTDA 4NXKA 5F4WA 2ZRWA 5EMUA 1F6PA 4K7YA 4RV8A 2DZTA 1XBVA 5FF7A 4UR8A 3A21A 1MEIA 1VJIA 2A85A 1KLYA 1O94A 2J9XA 1SUXA 1ZCOA 4MLJA 2FPVA 1J2WA 4YLWA 4HKPA 1HFBA 3M41A 4O53A 4OHQA 4Q32A 3E12A 1AG1O 3EWZA 1KM3A 4OE7A 2NWRA 2VFGA 3PR2A 5F1UA 1K7EA 1T96A 4N4PA 4GFSA 3W86A 4TR9A 5G4EA 2GQAA 5I3GA 1GVQA 3EB2A 1JRCA 4WXYA 4OV4A 1BEUA 3L65A 5DXYA 3CEUA 4BWLA 5K4XA 1L6YA 4N9BA 5H91A 3YPIA 3NQFA 4PEKA 4DF1A 3W7EA 1K03A 3FS2A 4GBUA 2NUWA 1L6SA 1EUNA 5FESA 2NUXA 1OK6A 1VYSX 3MP4A 1VYRA 4QQ3A 5HWMA 2V82A 1G67A 3TW6A 3LLFA 3W1TA 1DL3A 1MXSA 3R8RA 3UY8A 2WNZA 3G1XA 3H54A 3ELFA 3C2RA 3W7RA 1W5OA 3A24A 5CZJA 4IOTA 1SZNA 4WD0A 3HGJA 3BG3A 1AK5A 3G0UA 4RKAA 4S2CA 3C3NA 1THFD 3NQCA 4NNAA 4BI7A 3M9YA 3TK7A 1I45A 1SSGA 2VOMA 3FLUA 1O95A 3FYOA 1QDSA 4JS3A 1ONRA 3LX9A 3CQ0A 4UFIA 4M6QA 1VQTA 5EL1A 5F4SA 4MLRA 3UWQA 3EX1A 3EEGA 1VHCA 4O17A 5LNRA 3EX2A 1KTNA 3W71A 2X1RA 2YCEA 3P7YA 2DJLA 4DO5A 2VEMA 2QCCA 1KTBA 3GVGA 1GOXA 3LI0A 4UTKA 1G69A 3UWVA 3F1QA 2CW6A 2RDTA 2Y7GA 2JKEA 1VH7A 4OU1A 2Z0IA 1KM6A 3GAKA 3O15A 1ICQA 1RQEA 1OFPA 3P60A 1TTQA 1F5ZA 3KRUA 1JVNA 1GVOA 3C56A 3LCXA 1ALDA 2OX1A 2ZRXA 3NPUA 2A4AA 2Y61A 1SZFA 5AYYA 5C6MA 1FCUA 4MY9A 5CG7A 3RMJA 4AF0A 1JRBA 4R34A 4R53A 1UUOA 1NF0A 1LOLA 5FF0A 4QSHA 3TMQA 1FDYA 3W1UA 2WPBA 3W2UA 1DORA 5D33A 2GJLA 3STEA 4K39A 3ZS4A 4JICA 1R47A 3FEMA 4HPJA 2KZHA 3LTSA 1JUBA 4HHPA 5EKYA 1XDLA 3GXTA 5LGZA 6TIMA 3CLMA 1UUMA 3B04A 1KV8A 2QCDA 1LRTA 1KTCA 3W2MA 4FNPA 2YXGA 1EX5A 4MYAA 5FF4A 2XN1A 3UWZA 3W74A 2OZ0A 1G4TA 4XTDA 3B8DA 3QW4B 2YFNA 2ZZ5A 1U83A 2V9DA 1TTJA 5G2HA 3PUEA 2H90A 1PVNA 3R5EA 8TIMA 1S3HA 3N19B 2QJGA 4AF0B 3S9YA 5DCEA 1DQWA 2WSRA 3NAVA 3WK1A 5FI8A 5HNRA 2J27A 1GEQA 1TRIA 2QCFA 4DO4A 1EP1A 4CQ9A 2Q3RA 1X6UA 3LCGA 1F74A 3P61A 3P5YA 4BFAA 1LRNA 2FLIA 1TYGA 3SGUA 2DZVA 3N9SA 4R33A 3GDTA 3W7GA 1J4EA 1C29A 1EIXA 3GAYA 1RZMA 3NPXA 4AHOA 3DGRA 4FB7A 5DCBA 3PSVA 1N7KA 2B7NA 3NQDA 1QPQA 1H1YA 2WV8A 3MHFA 4QAIA 1WDWA 1QOQA 2H3BA 3STCA 5J5DA 2DZXA 2NLIA 1LRQA 3VNDA 2C6QA 3M5XA 3O6DA 1AW1A 3IIXA 4Z1CA 4CCEA 3EXRA 4M7SA 3PM6A 3MI6A 1FDJA 4A2SA 3GKFA 3W1RA 1B57A 1JCYA 1HTIA 2WSYA 1YTKA 4IGHA 4O13A 1TIMA 1AW2A 1RVGA 3EXTA 4LVFA 4LT9A 3P5ZA 4FX6M 3HBLA 1Q6QA 2FB2A 1TRDA 1JULA 3B0VC 4FX8A 4LUIA 2E6FA 3P74A 5F4XA 3RU6A 4IX2A 3ANYA 3RLUA 3TC6A 3A5FA 3MW7A 4LS0A 3HG2A 3B05A 1S5WA 3I7QA 4GUFA 3LXCA 3C2EA 2FPYA 3W7NA 3SJ3A 3W23A 3OG3A 2LLEA 3MHUA 3LCIA 5CPNA 3USBA 1W54A 4LVDA 1TTIA 3QC3A 3ZFHA 5TBOA 1PIIA 2HS6A 2YW3A 3L67A 5AOUA 4X9SA 4S2BA 4KFOA 2CLOA 4LV4A 2J9YA 2V81A 2G97A 3ZR4A 3OBKA 3NQ8A 1X7FA 2ZA1A 1H5YA 1KM4A 3ZWSA 2FJKA 4DEFA 4RR4A 2XN2A 2PRMA 2CWNA 1CI1A 3EKZA 3WK2A 4NJIA 3T40A 1M5WA 3W1LA 3LV5A 3CPRA 3PBVA 4AWUA 3LTPA 4QITA 4EOUA 5G1YA 1LP6A 1XC4A 3FIGA 3LHUA 4UFKA 4JTUA 1C8VA 1FWSA 2J24A 3G3MA 2Y89A 3DU0A 2AAMA 3W83A 4LV9A 1G6CA 1P0KA 2V2DA 3EWBX 4AH7A 2WSQA 3TROA 3WFAA 1XBZA 3GDLA 3LHWA 4BR1A 4UTWC 2RDUA 2QAFA 4JYDA 1TPWA 4QNWA 5F1VA 4MZ1A 3I65A 1KV5A 3QPYA 2FFCA 2WQPA 4JTLA 4AVFA 3DFQA 3DKJA 4NUWA 4O0ZA 3G24A 3DFNA 5HR6A 3MI2A 4O16A 2QJHA 3CU2A 3LGEA 3OHIA 3HIJA 4UFMA 4JDBA 1ADOA 5D09A 1KFBA 4KKXA 3AO0A 1KW1A 5D05A 4ZZ9A 3LM7A 2WKJA 1OHLA 1YPIA 1M6JA 1H61A 3TAOA 4ADSA 2EGZA 3TC7A 5MHBA 1CW2A 2YDAA 2GUUA 3HOJA 4PODA 2X1SA 3NGJA 4JTSA 1JCJA 3DKLA 2PC4A 4P2VA 4FO4A 3O6YX 2R14A 1ME7A 5AC6A 3S8HA 4K8HA 1A5AA 2V2CA 3N2XA 3UXAA 2ZYFA 1OX4A 3LHYA 4PFMA 3BK0A 1D9EA 1TB3A 5LSMA 5AHEA 1A50A 3ABOA 3GIYA 3PY2A 4UTIA 5AHLA 1Y0EA 4ZQRA 3W85A 1GG1A 1K7XA 1TPB1 3EWYA 3MP5A 3JS3A 4IMCA 4QIUA 4ZQMA 4HNUA 5C2XA 4UTHA 1PV8A 1I2RA 1LBFA 1ICPA 2TSYA 4RXGA 1QNVA 1TQJA 1EP2A 1MSSA 1RQHA 3T7VA 4PCFA 3W22A 4LOCA 3L5MA 5HUPA 1QWGA 3MMTA 5IM51 4OQVA 2QF7A 3IRDA 2QCEA 2YFOA 4CCDA 3O16A 3NPWA 2CU0A 4Q4KA 2O7SA 3MBDA 3BW3A 3KVLA 5D30A 3WJWA 4CNOA 1FX6A 5LNSA 5K2ZA 4GRSA 2CLMA 2QKFA 5D32A 3NO5A 1X1ZA 2ZZ7A 4M6PA 3R13A 1N8FA 2CZ5A 4JTHA 1TPUA 1Q6OA 3W6YA 1TPFA 5I3HA 3LOTA 1E51A 2V2HA 1H7NA 4TU1A 5D04C 2ZA3A 4D2JA 1TO3A 3CWOX 4DQWA 4IMDA 2B7OA 4UNKA 5LHFA 5IBXC 5G1TA 2B7PA 1LOQA 4O1BA 2E5BA 1HL2A 3VCRA 4JTKA 1VLIA 3L5LA 4WX2A 1VS1A 3QEZA 2DJXA 2J9ZA 4O11A 4DXVA 1W5NA 1ZJIA 3TU9A 1YYAA 3NL6A 3GXPA 3MUXA 3NG3A 4E2DA 3TQKA 2PURA 3BG9A 3U2OA 4FEZA 4OT7A 4IWWA 4M5PA 2QEZA 4MPQA 4OV9A 2FDSA 2UV8G 4O0KA 1SQ7A 3S1XA 4CQAA 3PBYA 2CLFA 1ME8A 3NZRA 4NNCA 2VFFA 4JR5A 1LBMA 2Q8LA 2YPIA 3O06A 3BLEA 4HSNA 3M7WA 4MFDA 5K9DA 3HJZA 1XKYA 1LM1A 5LNUA 1SW0A 2G95A 4LRSA 3WJXA 5C54A 4GWEA 3HPZA 4FIRA 2FTPA 3LB0A 1WOBA 3GR8A 3W2JA 1YADA 4O4WA 3GZ3A 4Y6GA 4E38A 2JKAA 1QAPA 1HG3A 4HSOA 3GDRA 3VFLA 1KFLA 4GNJA 3W07A 1K8XA 4FIQA 1SFLA 1WV2A 1FBAA 1W1ZA 4U28A 5KZEA 2VEIA 3GNDA 1W31A 4X22A 2YX0A 1X8FA 4IX0A 2CZFA 4DPQA 2HSAA 2QDHA 2DORA 1OFDA 4CNPA 2E6DA 3QJAA 5KZMA 3RNDA 3M0ZA 3OIXA 4OBTA 4LRTA 2P10A 3LI1A 2VFDA 4JY9A 3H55A 1MO0A 4MVAA 1A5CA 4IJBA 2DZPA 5I3IA 2DZSA 1H50A 4CQ8A 3QF0A 4RJEA 3C4UA 1PE1A 3IEBA 4FNTA 3P81A 3R2GA 1OFQA 1NSJA 3L0GA 5AHIA 4MIMA 2X1TA 5IBXA 4P61A 1KFEA 3NQVA 4HNVA 3QYQA 3VE9A 4FHAA 5K9XA 1FQ0A 5H2ZA 3Q94A 1IGSA 2E5DA 1XBXA 1BKSA 3DH7A 3W7HA 1XCFA 2RHGA 1DQXA 1YTDA 5EY5A 3TFXA 3HMJG 3R12A 3FKRA 3CHVA 4XKYA 2GPTA 4JY8A 3IIZA 1OFEA 3GDKA 3IIPA 5L6UA 4BK9A 1AL8A 1F73A 5CPOA 3TFCA 3W1NA 4LW7A 1TPC1 3C52A 4O54A 3W2LA 5HINA 2J88A 2Y7EA 2OJPA 1O4UA 3PB0A 3BW2A 4ORMA 3CWNA 1Z44A 1YXYA 4RCXA 4UMAA 1D3HA 2A0NA 1KM2A 1GTHA 2JBMA 3TXZA 1DJQA 1R46A 1IIGA 3B0PA 3NZ1A 4I7WA 1OFAA 5KMYA 1I2QA 4Z1DA 1WXJA 5LHEA 1DBTA 4XWUA 4CLMA 1PS9A 2YYTA 3ABQA 3LCFA 3T55A 3NVTA 1KFCA 1OF6A 4MUZA 4WOQA 1ME9A 2Y88A 3C2OA 5F2IA 1G4PA 3NM1A 2ATMA 5FF3A 1OF8A 4JTEA 5HJLA 3W76A 2D73A 4JXCA 4NNBA 3HF3A 4RLIA 1H62A 4NU7A 1DOSA 3BLFA 2E09A 1KM0A 3DXIA 1H60A 3TV8A 3ATYA 2EPHA 3THQA 2Y85A 2Z2UA 2A1YA 3ATZA 2ZRZA 3NPVA 4FXSA 5C55A 2CFFA 1C9DA 1TTPA 2WNQA 3TDFA 1VRDA 1YXCA 2XN0A 3MP3A 4IPIA 4UFJA 5L9FA 2TRSA 3O6CA 4LTSA 4OGZA 3N3MA 4KWWA 4PA8A 3F4WA 1W56A 2R8WA 2YZRA 3FOKA 3RF9A 4RX0A 1MZHA 3V75A 3D0CA 3RK8A 3P8JA 2FQIA 5SWUA 2Y7FA 3QQ1A 5HWNA 4JYEA 1EWEA 4H4IA 3EX6A 1WAUA 1VCFA 1YDNA 3LHTA 3S0CA 1TPVA 3GKAA 3IIVA 4BI6A 4C1LA 7TIMA 1QFEA 4O10A 2ZCGA 1T0OA 1LLZA 2Y62A 1M7PA 3HGSA 4IXXA 4FNRA 3DHFA 3UZJA 5FEWA 4N9EA 3FKKA 2CLLA 2V5BA 1KFJA 1BWKA 3LBCA 3L21A 3B0UX 2ZA2A 3EWXA 3UD6A 4GUIA 4YXGA 3PF3A 5FEPA 4O1AA 3DFPA 1KBJA 2Z1BA 3W72A 5CGQA 4FF7A 1I8JA 4UUIA 3HG4A 1QO5A 4NX0A 3G0XA 4RXFA 1OFRA 3WK3A 2FB3A 3EXSA 3LHZA 1TPDA 3BLIA 3PBWA 2ABAA 3VE7A 4TMCA 4RZ5A 2Y7DA 4EWND 4HIBA 4L4LA 1F05A 1KFKA 3TCEA 2YGYA 1FCVA 3A9IA 4A2RA 1JJKA 5DLCA 4AB4A 2ZZ1A 3KHJA 4NT0A 1DVJA 1UBSA 3TKFA 5KITA 2A21A 1LORA 3HGRA 3AJXA 1K8YA 4MOZA 1JUEA 3LERA 3F03K 4RZ4A 1FCQA 2I9EA 1OX6A 3CIXA 3I6RA 2JKPA 1BWLA 3PVFA 4UTMA 3UNDA 4Y90A 4MY1A 1WBJA 5C5YA 1QCWA 1GVRA 2E1DA 4E0CA 3MBFA 2RFGA 1O5KA 2BZNA 3PBUA 4BWLC 1JR1A 1T8XA 4K38A 5D2VA 3W7OA 3M5ZA 4DBDA 3K30A 2BLEA 1KM1A 3NL5A 1R2SA 2ALDA 2Q3OA 3N73A 1N55A 3Q58A 4NJKA 3I7SA 3M5VA 1H7XA 5HMSA 5AHNA 1SPQA 3CB8A 4UTWA 1W5MA 5I3JA 5EPDA 3SY5A 3HGOA 4TIMA 3DFSA 1SO6A 3G1DA 3NQGA 4JD4A 1TJRA 1JQXA 3TSMA 4LY8A 3W1XA 1A53A 4UXDA 4N9DA 5KINA 3TJLA 1AW5A 3G1FA 3GX9A 2GVJA 3LBMA 3KRZA 2HTMA 4O52A 1YDVA 4NJGA 2OCZA 3U8GA 1TPEA 5FF2A 1RR2A 4L4MA 3IVSA 1P1XA 1P5BA 3MJYA 3CC1A 1TMHA 4JEQA 3GDMA 4AAJA 2G5WA 4EIVA 1GVFA 4RZ6A 1JCLA 1Q6LA 2ISWA 3E9AA 3QZEA 2GQ8A 2OT1A 1H7WA 4DBEA 1UCWA 2H8ZA 3KVMA 1KBIA 3OVPA 1JQVA 3EWWA 1M7OA 3I68A 3S1WA 4XQ6A 3HQ1A 2B7QA 3UQNA 2V8ZA 1VGAA 1W3TA 3S1VA 3QSTA 2GVLA 4C1KA 1FCBA 3BV4A 4O8RA 3IGXA 3G3DA 2CLKA 3UWUA 2V0TA 4HNTA 3L9CA 4GJ1A 3NEVA 1JCMP 4HPXA 3W2NA 4MJMA 2F84A 3S5NA 1SZEA 4ZQCA 3I7RA 4FNQA 3PWAA 2HMCA 3BW4A 1LYXA 3C61A 1MEWA 2GJNA 4K6AA 4DO6A 2ZRYA 1G4EA 3SFKA 4O4VA 2QJIA 1TSIA 2YYUA 3BPWA 3SGZA 1P4CA 3TIMA 5G2IA 1IIHA 3A22A 2IQTA 4GC4A 5FEXA 4YCPA 2C16A 1CX9A 3T4CA 1GPWA 4TO8A 4JGDA 1ZY9A 2DZWA 5I3FA 4KWVA 1EA0A 4K8EA 3N9RA 4N4QA 3O05A 2GOUA 3W7MA 2ISVA 3QRHA 4MJZA 3UWYA 4WOZA 1GYLA 2ZZ3A 2C13A 3TW7A 1UB3A 1TPH1 4O19A 3F4NA 3LTYA 4JIPA 3LCWA 3KAOA 4JTFA 3EX3A 3C6CA 4TX9A 1V7YA 3A23A 1B3OA 4YWIA 4DPPA 1B9BA 4Z0SA 1OG0A 3FA5A 2AGKA 1BTMA 2WO5A 3NQMA 1OYBA 5E93A 4W9TA 2G96A 4AWSA 3QQ0A 5AYXA 3EKLA 3W70A 3LLDA 4A22A 3S5YA 3NQAA 1TV8A 3SZ8A 1GVSA 2A7RA 3GXNA 3TSBA 5D2WA 4Z08A 1VZWA 4DF2A 4N6FA 1ZHAA 4GXMA 4MZYA 1KLZA 1FY6A 4XUGA 3GR7A 3M47A 1NAL1 3H53A 3WJYA 4ZQNA 3TR2A 1XXXA 4JX6A 1LOSA 3G0SA 1QPOA 2NV2A 1QR7A 3PSWA 3M1ZA 1OX5A 4K37A 4N6EA 4AHPA 1YLVA 4I7VA 3DI0A 1JCXA 2BX7A 4JTJA 5I3KA 3WK0A 3E0IA 4QM1A 1TV5A 2YW4A 3FJLA 3FFSA 5T26A 4PL1A 4FNUA 1W8SA 3W88A 3BO9A 2ZRUA 1IF2A 2NXGA 2QR6A 1IXOA 4MFEA 2I14A 3Q37A 1YXDA 5D2TA 2A6NA 3W7KA 3MYOA 3QSRA 3SIZA 3W1PA 3M16A 4O57A 3NXFA 1K7FA 1K8ZA 2AQWA 1F2JA 3KFTA 3W7JA 1FWNA 1H7RA 5DCDA 3GB6A 3UPWA 3TUUA 3IIOA 1FWTA 3DZ1A 2NV1A 5K3VA 3TXVA 4H3DA 3VKJA 5ABTA 4XTIA 5CSRA 1SO4A 3E02A 4RK8A 3G1HA 1WBHA 1Z48A 1HO1A 3C2FA 1GZGA 4NX5A 5DN1A 4WJEA 1LLWA 1OX4B 3S5OA 3G8RA 4FXRA 1I2OA 3CT7A 2EAWA 4QISA 4LVAA 4HT3A 2QCGA 1VPXA 5F2LA 4AEOA 3L0KA 1H63A 3DI1A 3ZWTA 5CZTA 1ICSA 1OFOA 5AN7A 1HUVA 2VEKA 1PHQA 3G22A 4IMFA 3UY7A 4KFPA 1YTEA 3QH2A 4Y96A 1FXPA 4OWGA 4MYXA 3S5ZA 1Q45A 1B4KA 4NQ1A 3SSJA 3W7QA 4QNEA 3T44A 1FDZA 3NA8A 4ZQOA 1X1OA 3JR2A 3NNTA 3NOEA 3INPA 4UR7A 2E77A 5AHFA 1VLWA 3LRMA 2E6YA 1EB3A 3CIWA 2O7QA 1H7PA 3PG8A 2ZDRA 4N02A 2WJZA 2BWGA 1XI3A 2TYSA 4E2BA 2DU2A 3N2MA 4LS2A 4Z0JA 3W7IA 4ADUA 3W87A 2JGQA 1L6WA 4O18A 4UNLA 3E96A 3S1UA 1NEYA 1XFBA 4Y9AA 4H6KA 1ZAHA 5EBUA 3LRKA 1P0NA 4WUIA 3BVJA 4LNYA 3IVUA 1A5BA 4LS1A 3W2KA 4IQLA 3NQ6A 1ZFJA 5AC7A 1QMLA 1NF7A 2PRHA 2VXNA 1R30A 5HUOA 2E68A 4WY0B 3JRKA 4A29A 1PCKA 2GQ9A 3LXAA 1OABA 1MEHA 1IXQA 2QCHA 1GTEA 1FUYA 2C3ZA 2EF9A 1EWDA 3KVKA 4PH6A 4UTTC 4IPJA 3PAJA 1RD5A 1QO2A 2A2IA 4IUOA 4ADTA 3NL2A 3PULA 5LNVA 3Q2DA 4UFHA 5BMXA 4Z1BA 4XBSA 1G7VA 1T99A 2V5LA 2ZRVA 3P84A 2BSLA 3QMRA 1IXNA 1W0MA 1G7UA 1SW7A 3E49A 3KX6A 2QDGA 4PC8A 3KOFA 3P8IA 4U4MA 3OVRA 4POCA 4DELA 2FIQA 4XKYB 1VCGA 5AFDA 2QAPA 1FXQA 3KRSA 3BGGA 4BF9A 3WJZA 2A7NA 2Z6IA 4ZQPA 3MYPA 4I9AA 3MHGA 4FX7A 1KA9F 2J6XA 3EX4A 2RDWA 4WY0F 2W6RA 3W1AA 5BOOA 4MKNA 3TH6A 4CNNA 2EKCA 2C14A 3IGUA 5HR7A 5TQLA 5DBUA 4IMGA 3W9ZA 5DELA 1I4NA 1S5TA 4UFLA 4EF8A 2C15A 2P1FA 1F7BA 5G2WA 5AB3A 1AL7A 2H8XA 4JYFA 4LVBA 5K7JA 3TSDA 1IXPA 1XL9A 1WA3A 1R2RA 1F6KA 2Y70A 3MO7A 1XM3A 2ZZ2A 1WOAA 1I2NA 5G5IA 3PS7A 5F2MA 5TIMA 2NX9A 3LDVA 3NYZA 4WXZA 3M43A 4MZ8A 5CPLA 4R7JA 4JX5A 1ZENA 1VR6A 2H3DA 2YSWA 3EWUA 3HG5A 3DFOA 3G18A 3QPZA 1OVDA 5E1QA 3G8EA 5DY2A 5K4ZA 1UJPA 3T78A 3B03A 1YPFA 5LKYA 3W75A
chains in the Genus database with same CATH superfamily
4LC6A 2VFIA 4A8NA 1VBJA 2Y2WA 2OT0A 2HPIA 3LNMA 1QPNA 1EGZA 4EF9A 4IMEA 3K46A 3MVIA 1AD4A 3W25A 3GNPA 4LAOA 1GT8A 1AH4A 1W5PA 1RV8A 4JDYA 1VBRA 3VAVA 1XLCA 1L9WA 4KRZA 4UC5A 1XDMA 4KCWA 2AQVA 2QCDB 2VVNA 2PWFA 2XHYA 1W91A 4DZIA 3ERPA 3AMGA 1A5UA 3O0FA 4HA1A 4UTLA 2C1HA 1TWZA 4C6JA 4MNKA 3QV7A 6CGTA 4AMAA 4B90A 2OKTA 3IUDA 2HXTA 1W3NA 3S2JA 1T8QA 1E6XM 2PA6A 1GJPA 1RPXA 2R24A 4XIMA 3T09A 3W3OA 3L0NA 2WM1A 3UXDA 2X09A 3BGJA 1XUUA 4TMBA 1QATA 1YNYA 4GKTA 3SECA 4YMZA 3UG5A 2P0OA 2ZUUA 1K9FA 1TREA 5CKSA 2XISA 1OFBA 5U7SA 2V68A 1UZ1A 3SO7A 5FKYA 2NSOA 1WQ5A 4UIOA 4G7FA 3CPUA 1GEHA 2XWEA 4E4UA 3UWWA 5KZDA 3OVQA 2WCGA 1H7OA 5BNKA 1J0KA 5GQBA 2GGJA 1QRQA 1Z9AA 1F3EA 1MNSA 1DTUA 1D3GA 2ATSA 5A6KA 1NFBA 4D6IA 1XIHA 1JF6A 1DHPA 3U9IA 3HJEA 3KHDA 3D6NA 2CLHA 2C71A 4JTRA 3SR7A 5T8GA 3OP2A 2DIJA 4GKLA 1AQFA 2VC5A 2DUXA 2R94A 4FI4A 3WDPP 3PC0A 3QHMA 5FEZA 2DSKA 1OT2A 3O8AA 1JDEA 4LU0A 1UP2A 2E5CA 1TCDA 4ZTXA 4J3ZA 2PLCA 4UTUA 2OQYA 3DN5A 1GG0A 5C70A 4TXEA 4UTJA 5J5RA 5E0KA 2W79A 2QUUA 3BOFA 1SW3A 4YTRA 5CAKA 4H00A 3ID7A 5HQMA 3LHVA 3EMQA 4OOUA 8CGTA 2QULA 2OOFA 1F76A 5EMMA 1QI0A 1EYWA 4H8NA 3ZXWA 5DBTA 3KXQA 5HBFA 4LUSA 3WBEA 1J11A 1B3ZA 4L64A 1Z41A 3VI2A 1LCOA 2IKIA 3THAA 5D2XA 1GQNA 5FL1A 4XIAA 1M53A 1JG9A 1UKTA 5K9CA 1HKWA 1VCVA 2R1PA 2NWSA 1OGBA 3WD2A 4WLCA 4N2YA 3W7LA 3W7DA 2VRKA 4JTGA 2EJ1A 1VC4A 4HN4A 2UWFA 1NJJA 3IGHX 5KTLA 4BEUA 5F2GA 4QDWA 2X2GA 4L4OA 1YNPA 3BJSA 5RUBA 1XX1A 2X1UA 2ACUA 1EP3A 3TQ0A 4IHCA 1T7LA 3VM7A 1C7TA 2BXVA 3N17A 4MY8A 1SO3A 3UXIA 3VGBA 3CL6A 2O56A 4ZTYA 3GFZA 4GD0A 3IGSA 4WVXA 1GWJA 3AU6A 3IJQA 5AC8A 3QFEA 3F2DA 2QXWA 2X30A 4KEUA 5CQ1A 3B9AA 4OVXA 1N8IA 5A8OA 4IGMA 1XDJA 4W4QA 5D38A 3AYVA 3W6MA 2QCLA 3V5OA 1J0IA 2WCAA 3P82A 4JTTA 2V38A 5T9BG 1GYNA 3C2VA 1C7SA 1W3JA 3UYCA 1JDFA 3WLKX 4FNSA 3GXDA 4O15A 4IMAA 4LF1A 1KWGA 4Q33A 3LCLA 1UKSA 3NDOA 5FAGA 3U5YA 2HROA 1PHWA 2O9PA 4ALDA 1UOKA 4W7VA 2VKZG 2NX1A 2JE8A 4I7UA 1VENA 2ZZ6A 3WQVA 4KEMA 5A5WA 1QVBA 1XLEA 3KBMA 4L1GA 4HBKA 3LXBA 1XH0A 3N14A 3VNJA 2W0UA 2ANUA 3EMZA 1XIJA 4GX9A 4L6DA 2QPSA 4LAKA 2VEFA 4IQDA 5E09A 4B2DD 4D6FA 4G7EA 1UQZA 3VX0A 2XM2A 5FF7A 4UR8A 5A6BA 1B2YA 3B3DA 1UZHA 1SUXA 1ZCOA 2FPVA 4H9TA 4HKPA 4O53A 1NFPA 4ZB2A 4AVOA 5CG0A 3EWZA 2J74A 5ABEA 1ZGDA 3KBJA 4PZVA 3PR2A 2J4GA 1T96A 4M80A 4TR9A 5G4EA 2GQAA 4Q7BA 1GVQA 1JFXA 2QV4A 3EB2A 2BHUA 4WXYA 4OV4A 2YBUA 2Z00A 3GTIA 3M0JA 3CEUA 4BWLA 5K4XA 4Y9MA 3UGVA 4MKSA 1MUWA 3VIHA 4C5ZA 3N29A 4PEKA 4QCFA 4R85A 1ONXA 2Z1XA 1PX8A 5FESA 2NUXA 1VYSX 4DZAA 1VYRA 3AMKA 4HK5A 1G67A 4Y7EA 2PWVA 1UWRA 4PUUA 2IXVA 1DL3A 3ARUA 3R8RA 3ZT5A 3TYUA 1QTWA 5JBFA 1QWKA 5EBAA 4KIEA 3H54A 3CUJA 2VYOA 3E2QA 3A24A 4IOTA 1SZNA 4GGHA 4UR9A 4PUMA 1THFD 3ITOA 3MB9A 3VM5A 3MSDA 3CGTA 3FLUA 2GYIA 1QDSA 1ONRA 1QW9A 4OBRA 4TX6A 3RM4A 3CQ0A 4H41A 1AQMA 5LIXX 3NZGA 2J8FA 2J79A 3SCVA 4GK8A 4Q8PA 1IWBA 5LNRA 1WDQA 4IP5A 3EDFA 4MB1A 2X1RA 3KOXA 2DVXA 1YBQB 1CXFA 1EO5A 1E4NA 4JTDA 1CWYA 1Q6GA 3KWSA 5ABHA 3PK7A 3LI0A 3KOWA 3UWVA 3VGDA 1XRVA 4OU1A 4C7FA 2WVVB 1ICQA 1RQEA 3FAWA 2CBVA 1FCUA 5E9AA 3RMJA 1JRBA 5G4HC 2P8BA 1IWAA 3QOMA 1ZZMA 4QSHA 3TMQA 4R7WA 4B4HA 3TTSA 2GJLA 1HJQA 4HQVA 4K39A 3ZS4A 3KEHA 4PGLA 2R1KA 1KRAC 1XICA 4YS1A 3T0CA 3W81A 5FJPA 4HPJA 3CZEA 2QW5A 4IJCA 4HHPA 5EKYA 5FD0A 3WNKA 1E3ZA 5A6MA 3CLMA 5EMKA 1KV8A 3QVQA 4PCNA 1EX5A 2DVTA 3AC0A 2XN1A 3RX4A 2XYLA 1G1YA 1RP9A 1GNXA 3MT1A 4XTDA 1UD3A 3CB3A 4ICCX 2VX4A 3QOKA 1K9EA 2E3ZA 5G2HA 1A47A 3PUEA 4XUYA 1PVNA 3OLDA 1S3HA 2QJGA 2JIWA 2CEQA 3WDJA 1ISZA 4JOMA 2E67A 4W5UA 2FGZA 2QCFA 1IZJA 1DEDA 1RBAA 4C6IA 4IG2A 2FLIA 4A05A 1UWAA 3N9SA 6REQA 4W84A 3W7GA 4LBRA 1RZMA 5DMLA 1N7KA 3NQDA 3KTXA 1JZ2A 3WNLA 3QTGA 4J5NA 3ANUA 1WDWA 1QOQA 2H3BA 3L4TA 4YN5A 2E40A 2VVSA 1LRQA 2F6XA 3VNDA 3CQJA 3BCFA 3LK6A 4ERIA 3K8LA 4HCHA 1J9YA 3W1RA 1HTIA 4O13A 2PTZA 4LVFA 4LT9A 4FX6M 3HBLA 3KLLA 3C0QA 4XZLX 4CD5A 1JULA 5A94A 4FX8A 1E4MM 2QVHA 4LUIA 1XV8A 3W26A 3GFXA 4LS0A 3WL0A 3HG2A 1JPMA 1X1NA 3GHSA 3E6EA 2ON3A 1Y5XA 3C2EA 3K5XA 3VDCA 2LLEA 3LCIA 5CPNA 4Q4OA 3P3BA 3BJFA 4J3XA 4I9MA 1FWJC 1GQKA 5TBOA 5AOUA 2WLZA 4QLJA 3I3EA 3H2FA 2D0HA 3XINA 1OCBA 1X7FA 3ZZ1A 1KM4A 3FNDA 2YA0A 2CBIA 1CI1A 3GNOA 1C93A 3WK2A 3W1LA 4HZ7A 1ECQA 3ONBA 4AWUA 3AZTA 4QITA 1CGUA 4EOUA 5G1YA 2OO0A 1JAEA 1LP6A 1JEZA 4BJHA 3W24A 1XLKA 3OIHA 3MCNA 2G4JA 3KCLA 3NXLA 1B30A 2ZX9A 1G6CA 1PYFA 4J3VA 3GDLA 2O9RA 1TPWA 3I65A 2FFCA 2FZDA 3TR9A 4AVFA 2J75A 4O0ZA 3EGJA 3UZYA 3GRIA 2IKHA 1TE1A 3OHIA 1S38A 3PZQA 1CNVA 1BQCA 3KRBA 1RJRA 2VC7A 1KFBA 1OQFA 3AO0A 3AHZA 1YPIA 4HSHA 1M6JA 3NDZA 3ZVIA 1BYCA 2O92A 1US3A 5E0FA 5MHBA 2GJXB 1KO0A 1CLVA 1E0TA 1JFHA 5A8PA 5LXEA 1JCJA 2Y24A 2PC4A 4X9YA 3EDDA 1NU5A 4E4FA 5AC6A 4K8HA 1A5AA 3N2XA 3UXAA 1X96A 2ZYFA 4PFMA 2D0FA 3TN4A 1A50A 3ABOA 4ZO8A 1K7XA 1I0BA 2WMGA 1LQ0A 1KBLA 3SCUA 4KERA 1HVXA 1EFZA 5AC5A 4U3AA 2TSYA 2ASHA 5E5CA 3T7VA 1R3RA 3B0YA 1SFTA 4P7OA 2DEPA 5HUPA 1QWGA 3AUJA 3MMTA 4OQVA 5AZ0A 3O16A 1IGWA 3UR7A 3VMPA 3NPWA 4Q4KA 3MBDA 1V02E 3BW3A 1UKQA 4H7CA 3DUGA 4YYFA 5D30A 4CNOA 3THDA 4S3AA 5K2ZA 4I5XA 2QKFA 2G3IA 4JN7A 1X1ZA 1TKKA 3GBEA 2CZ5A 4JTHA 5DEZA 1Q6OA 3W6YA 4RNIA 3GNRA 4QJ4B 4IIEA 3R7MA 1TO3A 3NUKA 3UT0A 1WDDA 5LHFA 1EXBA 2VR5A 4XZWA 1JDAA 9RUBA 3S2CA 1FKXA 5I5RA 2DJXA 3RG6A 4GBDA 1RLCL 4WJ8A 1ZJIA 1P43A 2INZA 3TU9A 3T4WA 2GUYA 3NIYA 1PWMA 1FWEC 3GXPA 2WBGA 3NG3A 4B4FA 2NV9A 3BG9A 5HNTA 1PO9A 4H7VA 5B7ZA 4CN4A 4MPQA 4OV9A 2GDVA 2UV8G 1MRAA 5M1TA 3S1XA 3WLPA 4UOJA 5I03A 2I56A 3NZRA 3WDRA 2V5CA 4JKMA 4PUJA 3BLEA 4HSNA 5K9DA 3GU9A 5LNUA 2G95A 1S2CA 3A47A 4GWEA 1WOBA 3W2JA 4E38A 1PYMA 1HKVA 3MVTA 4IFKB 4GNJA 4LGXA 3BAJA 4H9VA 4FIQA 4G5DA 1SFLA 1WV2A 1TV3A 2ADAA 5A2AA 3P6LA 3W29A 3CLWA 2PLJA 2F61A 1R9YA 1W31A 8XIAA 4NP7A 1RLDA 1EGMA 2FKPA 4IX0A 5C7HA 1E6SM 1EF2A 2CZFA 1IT8A 1PTDA 3QJAA 2W67A 4IFOA 4LRTA 4NG3A 4Z2GA 4MMWA 1ZJAA 3CT2A 2DZPA 3RO8A 1JL8A 1A80A 3IANA 4GISA 2I5GA 4BQ4A 3S47A 4PRWA 2I5QA 4H9UA 1KFEA 4YVVA 3IJ7A 5IDIA 3QYQA 5I6SA 4KGJA 5K9XA 3E0WA 3SUSA 1IGSA 1BKSA 3DH7A 3MKKA 3PBGA 1A0EA 1GW9A 4IFKA 3UEQA 1YTDA 1C92A 1M01A 3S2NA 3TFXA 1D7FA 3FKRA 2D3NA 3SEPA 1AL8A 1F73A 1S2VA 5CPOA 2VT0A 4L1XA 4LW7A 1UZ4A 2OSXA 2DIKA 4LUSB 2IUZA 4QS5A 2OJPA 3PB0A 4A8LA 3URNA 1V7AA 4I9TA 2YL9A 1MWOA 1CDGA 1QW7A 1IIGA 3OZOA 1OFAA 3OTRA 4DLMA 3KZSA 4G56A 1DBTA 4ES4A 4RDVA 4XWUA 3H21A 4CLMA 1PS9A 1XLFA 1S5NA 1VFOA 3T55A 1Q7ZA 1KFCA 1OF6A 1DJGA 4W89A 4J3SA 4EX4A 1G9HA 2Y88A 5F2IA 4WSKA 1G4PA 2VJXA 3BZGA 3W76A 4A3RA 4NU7A 5MKGA 1E43A 1WB0A 1ZBWA 3R0DA 3EZ4A 1H60A 3ITYA 1LL7A 5A6LA 4GNVA 1Q6FA 2EPHA 1CIUA 4I8YA 3VNZA 2Y85A 2A1YA 1A0DA 2EPMX 4JBRA 4J7RA 2BDQA 3NPVA 4H9XA 2CFFA 1TTPA 2WNQA 4OIFA 1YXCA 3NSXA 3UP8A 1DE6A 3E0LA 4H8UA 2V3EA 4AZ5A 4LTSA 1R86A 3CUZA 4PA8A 3CHDA 4Y9PA 2PP1A 7A3HA 2FH6A 3ZSTA 1E9ZB 3RF9A 4RX0A 4FLOA 3VIMA 4TX8A 1IYXA 1ZL1A 2XSBA 3D0CA 2VQTA 5A8NA 1A5KC 1RY0A 3EOUA 3TWBA 3ITVA 1VCFA 1UP3A 3S0CA 4M51A 4IIBA 5CPSA 2GSHA 4O10A 3RCYA 2DGAA 2ZCGA 1T0OA 3EKGA 3WFLA 3FVDA 4FNRA 1O7AA 3QR3A 2X1IA 2GVEA 3LLXA 4N9EA 3ZT6A 3M0YA 3TTYA 4WGHA 5IOBA 1BWKA 1KQYA 4B3LA 2ZA2A 3MU7A 2VZTA 3EA1A 3VIGA 5DT7A 4DXXA 1FOBA 5CBJA 4GVHA 5D8WA 3AJ7A 3OZYA 4WHBA 2ACQA 3W72A 4MDOA 3QPEA 4WCJA 1I8JA 3KBNA 4RXFA 2FB3A 3WLHA 4XZNX 5BOEA 3MPGA 5DFAA 3DFHA 3M0MA 4XX6A 1FH9A 5TF0A 2ABAA 3GTNA 3OYXA 3K1GA 1X98A 3BH4A 1H41A 3JZEA 4HIBA 1HQTA 4P8UA 5C9RA 3B8WA 2UY4A 2Z4GA 1FCVA 2WK2A 4NT0A 3KTSA 3TKFA 1EA9C 1NWSA 4EWJA 4ZBCA 1JUEA 3QR1A 4U3CA 1ONWA 4RZ4A 1D2KA 4UZUA 2R1LA 5DRCA 4RDZA 4P5UA 4Y90A 4MY1A 3LBOA 3BV7A 1WBJA 5C5YA 1FFQA 1QCWA 1GVRA 1E71M 3V5CA 3WLMA 3MBFA 3KE0A 2BV9A 4HD5A 2BZNA 3PBUA 4BWLC 4K38A 4H6EA 4R88A 1R2SA 3GH7A 3N73A 1I60A 3CUFA 2PDLA 1DWJM 3TP4A 4DBWA 5HMSA 4KWSA 4UTWA 3CB8A 1KQZA 4JNYA 5I3JA 2NQLA 3HGOA 4I5UA 4Q8QA 1OM0A 1UWTA 3DFSA 3G1DA 1TJRA 4K1GA 1JQXA 3TSMA 4LY8A 4GCXA 7ENLA 3TJLA 1AW5A 3GX9A 3BMXA 3QBUA 1TVPA 4H6RA 2OB3A 2RJHA 1YDVA 2OCZA 2PBOA 3MUCA 2Z7GA 4RPQA 2PDNA 4YWSA 4EPBC 3CC1A 1BXBA 4UQBA 4JEQA 3WQ6A 2H9AA 2G5WA 1JDDA 2XDFA 1QNRA 3ARWA 2PTDA 1JYXA 1JCLA 3ME3A 1V93A 4BHYA 2ISWA 3VNLA 3BCJA 1OEPA 1UCWA 1HKKA 4Q22A 2PWDA 2UZ9A 2ZOXA 3UPMA 1T40A 4CVUA 3RRXA 4CGTA 3BLOA 3PZGA 3REQA 1W1IE 3I68A 4N42A 2QJMA 5JIPA 3UCCA 3UQNA 2Z25A 4S38A 3S1VA 4C1KA 1ITQA 4HOWA 4O8RA 2P8CA 3IGXA 5HJXA 1TUFA 4XZIA 3VIIA 2V0TA 1PZ0A 3N2BA 4HPXA 1FWHC 2OEJA 1NY1A 1F8IA 2F84A 3PWAA 3MDWA 1LYXA 4AEFA 2CZVA 1US0A 5IDZA 2G3JA 2X41A 2GJNA 5DRIA 4AIUA 3IUIA 5M5DA 3SFKA 1E9YB 4G9PA 2QJIA 3UU0A 4MNMA 3BPWA 2HDJA 4AYGA 3TNBA 1JZ5A 3TLQA 4GC4A 5FEXA 3WBXA 2C16A 3C0LA 1H3GA 1GPWA 4JGDA 4D9PA 5I3FA 4KWVA 3NEHA 2GOUA 3WH6A 2E9LA 3W7MA 1OGSA 3QRHA 2DUAA 4QE1A 1UB3A 2DH2A 1QNSA 4WSHA 1NTHA 3C6CA 3WF0A 3A23A 1BG4A 4DPPA 3E2SA 4EAYA 4GFIA 3U2ZA 4CNTA 2G96A 1JI1A 4AWSA 2AQOA 3EKLA 3W70A 3LLDA 4REQB 3NQAA 1TV8A 3SZ8A 5D2WA 1DJXA 4PMOA 1K1DA 4DF2A 3OQEA 4GXMA 4PTMA 4QEEA 3GR7A 4YVXA 1LOSA 1Q65A 2GUBA 3PSWA 4K37A 5LIUX 1EC7A 1RALA 4I7VA 4JTJA 5I3KA 1GKPA 4QM1A 4JCLA 3FFSA 5T26A 3MMDA 1JYVA 3SCSA 3W88A 2ZRUA 2QR6A 1IXOA 3ZJKA 3EA3A 4LAUA 5D2TA 3W7KA 3MYOA 1W1YA 4F2BA 1AA1B 3QSRA 3SIZA 4O57A 4MJ4A 2NQJA 2WWCA 3AWNA 1F2JA 1MNZA 3WY1A 1H7RA 3UPWA 4C6KA 5M3WA 4FLSA 1A4LA 2V63A 2YBVA 3AALA 3TXVA 1BRLB 4H3DA 2G3FA 3VKJA 4X0NA 4DJDC 1QW8A 5CSRA 2GGGA 3GC2A 1PDYA 1EXPA 1XQLA 2QNEA 2VQUA 3MSRA 2VCBA 1UG6A 5A8MA 2GWGA 1TX2A 3QC0A 4NX5A 5DN1A 1JCTA 3H7RA 4QISA 1PDZA 3E2RA 1CPUA 2V3DA 3AIWA 2QUNA 3BUVA 2I17A 1H63A 3S9IA 4PMDA 5CZTA 4NASA 4ZO6A 5AN7A 1HUVA 3WH8A 2XGZA 2ZX7A 1PKMA 3G22A 3VD4A 1YTEA 1DJIA 4Y96A 3L4YA 4HNOA 1Q4WA 3W38A 5HK4A 5CH9A 3S5ZA 4AQLA 3FCPA 1W2PA 4PRRA 4NQ1A 3CMJA 3JVAA 3MV11 3H2MA 3SSJA 3CTTA 3W7QA 4QNEA 5FJTA 1X1OA 3BLLA 3NOEA 4DUWA 2E77A 5AHFA 1VLWA 1S2TA 3GG1A 4PB3A 3CIWA 3GD6A 4LCSA 3N2MA 4LS2A 4Z0JA 3W7IA 1OGGA 2JGQA 2VX7A 3E96A 1LUCB 1GKRA 4IF2A 3ONCA 1NEYA 1XFBA 1E6QM 4Y9AA 1FTXA 1KXVA 4LNYA 3I6TA 3NQ6A 3OVGA 1TWIA 5FJUA 3QV9A 1NF7A 2PRHA 2ACSA 1GKQA 3I4EA 1GQJA 5E0CA 3QGKC 2VO5A 3UF9A 3VNKA 3WDQA 2CCRA 3USZA 2VD8A 4KRUA 2QCHA 1PIFA 1GTEA 2C3ZA 4PH6A 1J8VA 1R9XA 4ZCWA 2RJGA 1RD5A 1QO2A 5BOFA 1RP8A 3HZ3A 5JH2A 5AY7A 2AL2A 3Q2DA 4QR6A 3VO0A 4NZ1A 5BMXA 1O5RA 4ZXOA 1T99A 3IACA 4W8LA 2W3ZA 4R7OA 4POCA 2FIQA 3S6OA 4ZOBA 3HPFA 2J77A 3BGGA 2G3NA 2IXUA 2CITA 2YBTA 2A7NA 3WJZA 3GHUA 3EX4A 3RJXA 4WY0F 2FGLA 3W1AA 1XS2A 4CNNA 1EO7A 1HN1A 4D6DA 2PDXA 2NW0A 2HVOA 5DBUA 3GUWA 4IMGA 3W9ZA 4UFLA 4EF8A 1VFLA 3K2GA 3WLOA 5G2WA 3TVAA 1V08A 4JYFA 4LVBA 5K7JA 2J25A 2CYGA 3GDBA 1RY8A 4FR6A 3FAXA 1M9HA 4Q8MA 2EPKX 4MZ8A 5CPLA 4JX5A 1VR6A 4PMUA 2X05A 2YSWA 1JXKA 3HG5A 3G18A 3QPZA 3ZVHB 1ODUA 4QCEA 3WSUA 1YPFA 2BOGX 3W75A 4R27A 2HK0A 4D1IA 4MKVA 4UOZA 4DZHA 1QOPA 1YKWA 1EEPA 2E6AA 4JN6A 4GQGA 4AXKA 1QOXA 4M19A 1ZSXA 4LC8A 3LRLA 1DWIM 1XPGA 4NRRA 1OYAA 4ZMGA 3U6WA 1POKA 3TYAA 3V1PA 4JX4A 1H0IA 3TZNA 4PUEA 2VELA 1W1A1 1W3HA 7CGTA 2D3LA 1U22A 1TWDA 3L66A 4KCTA 4MG4A 3LV6A 2UY2A 4IICA 4C5YA 1A3XA 3QGAC 4IIFA 1DIKA 4D6CA 5ABFA 4D6JA 4UTTA 1LROA 4YTUA 1N8WA 3UWEA 2R6OA 3Q65A 2GGIA 3PJXA 4A21A 5EA9A 4DY1A 3W7CA 4L6OA 5BZAA 4E2OA 4GX8A 3DENA 3LGGA 4C6PA 1PKYA 3FYPA 3ABSA 2NXHA 3DESA 5BWAA 2R91A 4GVGA 4JIIX 4W88A 1YHTA 5CLTA 3GS6A 2AOSA 4IXHA 1TFVA 1BGGA 1UR3M 1FHDA 2DSZA 3T1GA 3TA6A 3LPGA 2OKOA 1OK4A 2Z6JA 3AHYA 2GGEA 3BSHA 4HK6A 1U5JA 4F9DA 1CBGA 5D02A 1G4SA 3VXGA 3OB8A 3W1QA 1FWAC 4OFCA 5ENLA 3G77A 4KQNA 3CZGA 3R10A 2RGLA 2HE8A 3NSNA 2G41A 3LCHA 1MZRA 1KRCC 3TMLA 3BANA 4WQ6A 2W62A 4G1KA 3HFTA 3KL0A 4UMBA 3OEXA 1MQRA 3WNMA 3PB2A 1JD7A 2DW6A 1GCYA 3BMVA 1DTNA 4YCOA 3QY6A 3M44A 4NJHA 5BW6A 4ROQA 4MHBA 4HMNA 2DP3A 1LT7A 1UWUA 4C1NB 5C71A 4XSMA 2ZTJA 4Q4SA 2PB1A 4UWMA 4U5KA 1HP4A 1O66A 5HAOA 1EJVC 1XRSA 3WYZA 2FPTA 2YA1A 2WZIA 4F4RA 1LL4A 2PE4A 3TYEA 3NQEA 3FJ6A 1D8WA 4W86A 2BY1A 1HJWA 2ZXAA 3DFTA 2PD5A 2YXOA 3DECA 5D03A 1FH7A 2DQXA 4WIWA 1CXEA 1DV7A 4U5IA 1H1ZA 3AMLA 4NZFA 2CNCA 1WDPA 1ZBVA 3CK5A 1ML1A 1HL8A 4KW2A 1UC4A 1BD0A 4O12A 2VFEA 3GU1A 3TE9A 5I24A 2X16A 1AQ0A 4MB4A 1RA0A 3NR0A 1AVAA 1ZNNA 1W37A 1NDWA 1XRFA 4KFNA 3NO1A 7REQA 3H4WA 1M65A 2VFHA 2CZDA 3CWHA 4A3UA 4NAFB 3O07A 2DSWA 1KR1A 2BASA 3PZVA 4Z42C 4ORIA 3TOPA 4JZ5A 1X6LA 3URBA 3BZJA 1Q7QA 3STGA 4F0RA 3BDKA 3T05A 1ZQ5A 1I2PA 2V5KA 1SSDA 2YR1A 2Y6ZA 2NVCA 4GUHA 4UZSA 3VC5A 4QDMA 3C0JA 3SCTA 3HB9A 4A35A 3BLKA 1UASA 1AD1A 1EUAA 3FK4A 3OJGA 1OIMA 3OA3A 5AKQA 2RH9A 4PMYA 1XG3A 1ISWA 3B97A 2DZUA 1QI2A 3E5BA 4H8VA 5AHMA 3ABRA 4HYRA 1EPVA 2X8RA 4J3UA 4ZFMA 3ZYZA 4H2CA 3STFA 1TUXA 4GC3A 1UHVA 1FWWA 1NWUA 3UZXA 1Y65A 3DBPA 3GLCA 1AMKA 3A3XA 3HO8A 1V4YA 1TE6A 1PL9A 2J13A 2CLIA 4J9JA 3P14A 3TX9A 3QW3A 3WMSA 1W3LA 2BTMA 3NYDA 3L2IA 1XBYA 3PFMA 1A5LC 2BHYA 3M6YA 4N9CA 2A5HA 4Q4PA 1ZP4A 3KLKA 1K3UA 3NQ7A 3SCWA 3N4AA 4GUGA 4HZ6A 2F2KA 2QUTA 3PBMA 5FJJA 3DHDA 2FFIA 4REQA 3TYDA 1ZB5A 3LM3A 3L5AA 4ONVA 2PWUA 2VENA 3GW0A 2TPSA 1S5VA 3N3TA 1FWRA 2I1OA 1M3UA 1KGXA 1PB0A 2ZTKA 1XYFA 4B3ZA 5DXXA 5AYZA 1TQXA 2A6LA 3A6OA 5LYRA 4CCCA 3MWAA 3VZXA 2ZRWA 5EMUA 4ACZA 3UBPC 4EK7A 3RXZA 1NP0A 3A21A 1MEIA 1Q13A 1P0BA 1O94A 4MLJA 3RLHA 4IPNB 3KOYA 1HFBA 1NOUA 4OHQA 2NSXA 4NL1A 3WLJA 3WUFA 5D9PA 1CYGA 2NWRA 5F1UA 4N4PA 1YDYA 5BXRA 1BEUA 2A3HA 1E72M 2Z2AA 3YPIA 4TOQA 1A49A 4GQRA 2BGQA 3BSGA 2WLYA 2XINA 4GINA 2V3FA 4DF1A 2QJNA 4IQJA 4JQ4A 1L6SA 3U2CA 1OK6A 3VIKA 4URIA 2PBGA 2ZC8A 4QQ3A 2VM8A 5HWMA 2V82A 3VDAA 3TW6A 3CUIA 1KBKA 1GQIA 4J27A 1VFFA 3ELFA 2VUYA 4AY7A 4F0HA 1V77A 3A4JA 2WM0A 1AUSL 3HGJA 4DN1A 3G0UA 4RKAA 4S2CA 3C3NA 1JI2A 3S9ZA 4NNAA 3M9YA 1RBLA 2W9MA 3FYOA 2VOMA 4GH1A 1FFRA 4JS3A 5FL0A 4M6QA 3UWQA 3EEGA 1MFUA 1VHCA 3MANA 4JHZA 1KTNA 4FZIA 2YL5A 4CQBA 3NSMA 3HPAA 3R0KA 2VEMA 3MKVA 1J0YA 3AOFA 2DDXA 2ZXDA 1GOXA 2OWXA 4UTKA 1G69A 3F1QA 1TVNA 5D4YA 2JKEA 1VH7A 3BL3A 4B2DA 3VMOA 1KM6A 1ZLPA 3P60A 1TTQA 1GVEA 1F5ZA 3KRUA 4XG1A 3C56A 3R79A 1F3XA 4TVDA 4LCQA 1QHOA 2OGJA 1E56A 4KWOA 3GR4A 4AF0A 1G01A 4R53A 1UUOA 1NF0A 4M24A 1LOLA 4BCEA 1R3QA 4ZOCA 1UW9A 5FF0A 3KBWA 1FDYA 5C9XA 3JU2A 3MSGA 1DORA 1PUDA 3CHCA 1CGYA 2GWNA 3R94A 2KZHA 3UFYA 1JUBA 3GXTA 6TIMA 3GVQA 4LYRA 3ZR5A 1KTCA 2YXGA 1CGVA 5FF4A 3MJMA 4XVDA 3UWZA 3W74A 2XVGA 3QW4B 2YFNA 1DWFM 2ZZ5A 3E1F1 5KEZA 1YPXA 2BS9A 1RH9A 1US2A 1W9PA 1NOFA 3ARQA 5A6AA 1FHLA 1RK6A 4AF0B 2PDGA 3IAPA 1UD2A 2WSRA 3H26A 5FI8A 2NVAA 1TRIA 4PB5A 4CQ9A 2Q3RA 1X6UA 3LCGA 1F74A 3AAMA 3P61A 2QHAA 4BFAA 3WF1A 2RDXA 4F2UA 2O9OA 3H23A 4R33A 5C9WA 4XAGA 1AODA 1KCXA 3KTCA 3SB0A 3SRFA 1J4EA 2FVLA 1C29A 1N2VA 4AHOA 3DGRA 4FB7A 4LAZA 5CPTA 3VOCA 4F79A 1K4GA 2G4FA 2B7NA 2DV0A 4NHVA 4F0MA 1H1YA 2W5FA 3A3WA 3MHFA 1HJXA 3R4IA 2OLSA 1KRBC 1Q6DA 3I3BA 2NLIA 4LH8A 5A6TC 3APTA 3O6DA 3ITXA 5A2CA 2XWDA 4CCEA 3EXRA 3PM6A 4CQCA 4A2SA 3KP1A 4TV6A 1WP6A 1JCYA 3UJRA 1E40A 4MNLA 1GZJA 2J7DA 1O1ZA 4DI9A 1TIMA 1AW2A 1RVGA 4MADA 3V1HA 2G37A 3P5ZA 3WLLA 3N25A 3WQPA 2D69A 1FP8A 3B0VC 3QY7A 2E6FA 3P74A 3FSTA 4IX2A 3ANYA 2OYKA 1EHNA 2O55A 4EKJA 5DANA 3DHPA 4DJEA 5EMJA 3A64A 5REQB 3MHUA 3MQTA 2J7HA 3NGFA 4MPKA 3USBA 2EPLX 4C6MA 3AS0A 1SMAA 3ZFHA 1BF2A 1PIIA 2HS6A 2I57A 3O9NA 2DT3A 4KFOA 1DE5A 4LV4A 2V81A 3PZUA 2G97A 1BXNA 3ZR4A 2ZA1A 2FJKA 2XN2A 4AD4A 4NJIA 3T40A 1M5WA 3S4TA 4M1RA 4AC1X 1W1B1 3AICA 3CAWA 3UJEA 3CV6A 4WKHA 3GIQA 3W82A 3LHUA 4GO8A 1CZ1A 3VC6A 1TMQA 4UFKA 1UH3A 1ITCA 4OBSA 2BY3A 4GIAA 1ITUA 1KKRA 1NQKA 4JTUA 4ICMA 2Y89A 4Q4RA 2YLLA 3EWBX 2WSQA 2V6AA 3WFAA 4MB3A 1XBZA 3CIVA 3LHWA 4JFUA 2A3LA 2XH7A 1H1NA 2RDUA 2QAFA 5F1VA 4QNWA 4MZ1A 3QPYA 4WR3A 3DKJA 4Q4MA 3U2EA 4S3BA 3G24A 3DFNA 4E3TA 3MI2A 3AHVA 4LX4A 3AZSA 3U48A 4A4AA 4HTBA 1V02A 4KKXA 5D05A 4ROPA 5HATA 2WKJA 4A3HA 4IPPA 2OXNA 1H61A 3UZWA 3TAOA 3TC7A 3HOJA 5CC7A 1B54A 3ZR6A 3T2PA 2XH4A 1W9VA 2R14A 4MSSA 1ME7A 3UCQA 5GNYA 3S8HA 2V2CA 4HHLA 5CZKA 1LWJA 3OG2A 1X6NA 1TB3A 5LSMA 3GIYA 5AHLA 1XYZA 3W85A 1E0UA 1GG1A 3H6OA 4AC7C 2E1WA 3B9OA 1V6VA 4GQQA 4F0KA 5C2XA 4HU3A 1I2RA 4HA4A 3UXKA 3DDMA 3VVGA 1QNVA 1TQJA 2E9BA 4GMEA 1RQHA 3T9PA 4K68A 1MQPA 1XG4A 4BF7A 4LOCA 3L5MA 1IR1A 5IM51 1PZ3A 2QF7A 3IRDA 4TUFA 5HQLA 2CU0A 3KVLA 3GIPA 1JPHA 3L7RA 2CLMA 3T0BA 3ENLA 2W66A 4D6EA 1N8FA 3KBSA 4TU1A 2W91A 1XISA 5D04C 1CXKA 2ZA3A 3WH7A 1UR8A 1PAMA 2YDRA 3CWOX 2Y8UA 1WUFA 1V3KA 4UNKA 5I78A 4F0LA 1BVZA 1HL2A 1XH1A 4JTKA 4JQ2A 3L5LA 1SZRA 5CJMA 2A79A 2YZ5A 1VS1A 3PPFA 4XB3A 3TTOA 1WKYA 3CQHA 3NL6A 4E2DA 3TQKA 4OT7A 4IWWA 1L2QA 4JNZA 4O0KA 3T8QA 4CQAA 4WDXA 2VFFA 2CXEA 3T2QA 1LBMA 2JEQA 1TA3A 3ALFA 3O06A 2JQXA 2YKKA 3IJ6A 2A3EA 2PWEA 4LRSA 5C54A 3DOPA 4OZOA 3PANA 3ABXA 3WL1A 2OG9A 1ENUA 3GZ3A 2JKAA 4HSOA 2E8ZA 1K8XA 1IT0A 2QMJA 1NDVA 1W1ZA 3F4VA 2VL4A 2CPUA 4U28A 4C6BA 4GVIA 2YX0A 2QDDA 1X8FA 3FY1A 1VD6A 4DB7A 2HSAA 4PUNA 2QDHA 2DORA 2VGGA 3RUBL 4OOZA 2E6DA 3PZNA 3L2LA 4HA0A 4X63A 1S39A 3OIXA 1DQUA 3LI1A 2QF8A 2WPGA 1A5CA 4IJBA 5I3IA 5JH1A 1H50A 1I9CB 1U1UA 4CQ8A 3CAKA 1R3VA 2NQ5A 3C4UA 3IEBA 3QZ6A 3FXYA 1OFQA 3L0GA 4PULA 2X1TA 4XZMX 3NQVA 1BVNP 2EG7A 4HB7A 4FHAA 4S3GA 1XBXA 2VX5A 3NVDA 1OC7A 3HMJG 1F9CA 3R12A 1XD1A 3CHVA 4XKYA 2GPTA 3GDKA 3IIPA 4BK9A 2Y5EA 2XUCA 3W1NA 3MO4A 4AIOA 4O54A 4NZ4A 1WDRA 2Y7EA 3TYBA 4YPJA 1O4UA 4ORMA 2PDHA 1VIWA 3W6LA 1YXYA 4IIGA 1NDZA 4RCXA 2MUCA 1GTHA 3W37A 4JTAA 1WKEA 4DAIA 1DJQA 1R46A 3NZ1A 4S3DA 5KMYA 3ANVA 1MW0A 3CAVA 2XH2A 6PTDA 1UD4A 2DT1A 3LCFA 1U5VA 3ABQA 4FS9A 3VOIA 1X38A 4JTQA 4XVEA 3SQMA 4PBEA 2ATMA 3M7SA 4K1WA 2HEJA 4ATDA 1S3TC 2GSJA 1TWSA 2DZBA 3ECQA 5HDRA 3CH0A 3DXIA 2Z1KA 1EOKA 3FA4A 2ZADA 3ITCA 1ZRQA 3WEZA 1R3WA 1UQYA 2ZRZA 4S39A 2CETA 3N18A 3REQB 3PN8A 3TYZA 4AZGA 4IPIA 3N3MA 4C60A 4IGSA 3F4WA 1GOOA 2R8WA 3R8GA 3S3GA 5FOOA 3V75A 3ZJ6A 4GPNA 4J3WA 1AJZA 1RXOB 3RK8A 3P8JA 2VGIA 4HNLA 3CUXA 5GJNA 4H4IA 3EX6A 3A9BA 3LHTA 1RK5A 1X8CA 3G2GA 3BAXA 2BVWA 4QLKA 2WANA 7TIMA 1QFEA 2FZBA 4LYPA 2Y62A 3HGSA 4FOJA 4NYUA 3DHFA 1TIWA 3FKKA 2ZE3A 2CLLA 3AISA 1QHZA 3PTKA 3RYSA 4W93A 4MUPA 3GUGA 1V0MA 2GFTA 3GE7A 3LPPA 3OZPA 5I09A 3UERA 3BAKA 2FVKA 3F5JA 3DFPA 3AIBA 1KBJA 3N2CA 5DQPA 3U5UA 4UUIA 1YE4A 1UD8A 1J93A 3G0XA 2Y8VA 4DM2A 4HU0A 3EDKA 3WK3A 4PBFA 1HL9A 4OKDA 1CB2A 1TPDA 3BLIA 3WG6A 5C2CA 3VE7A 4NYYA 2C91A 4U33A 1DYSA 3RMEA 3PUGA 3A9IA 4A2RA 4B5XA 1C3FA 2JEPA 1B9ZA 4AB4A 2VCAA 4DRSA 2J6VA 1DVJA 2FZNA 5EMLA 2ZXBA 3LERA 3F03K 1R9ZA 1FCQA 1OX6A 5AZ1A 3I6RA 1EQCA 1SGJA 2HXUA 3EPOA 4HA3A 3GW3A 4GI4A 3ICJA 3VKDA 2RFGA 3BURA 2WMJA 4ACYA 3B0XA 1F07A 4I6KA 4U2ZA 3W7OA 3M5ZA 4DBDA 1KM1A 1DJYA 2ALDA 5MKGB 2Q3OA 3VX1A 2I9UA 6TAAA 1IV8A 2C1IA 1W8GA 5AHNA 3OU8A 4QG9A 3GG0A 3B8VA 1HNYA 1K9TA 4BA0A 3HFYA 2CESA 2OTDA 3W1XA 3WLNA 4B15A 1A53A 4JHMA 4UXDA 1IZCA 4N9DA 3G1FA 2GVJA 3O0KA 1DWHM 2PD9A 4NJGA 3EWCA 2I7GA 5F7UA 2J7GA 2O0TA 4P7LA 1RR2A 3BOLA 3D5HA 5I02A 1P1XA 4O8AA 2WXDM 4EIVA 4GA8A 4S3EA 1GPFA 2P50A 3E9AA 1KCZA 1V6UA 2H8ZA 4BKNA 1FWIC 4XK2A 1UROA 3T0AA 2DIEA 5C9ZA 4EACA 5I23A 1EJWC 1M7OA 1UR1A 4XQ6A 1YNQA 4QRNA 2VX6A 4XISA 2V8ZA 1VGAA 3RLGA 2PS2A 3BV4A 1IT7A 1QK0A 2Y0FA 2Z28A 3L9CA 1T41A 2DT0A 5BU9A 4JIHA 3CHEA 5EFDA 1HW6A 3Q45A 2FZ8A 5CBBA 4ZQCA 1VPYA 4IIDA 1X7IA 1XQKA 2QYGA 5CBIA 4IJRA 2WVTA 3CHFA 5BXSA 1XINA 2YIHA 1PIGA 3RCNA 4AMCA 2INFA 2IQTA 2WJEA 3A22A 4XD6A 1E5NA 4JQ3A 4YCPA 2GJRA 3XIMA 4IL2A 4IISA 2PGRA 1Q4NX 1MMFA 1EA0A 3DYMA 4N4QA 2OLAA 1XIEA 3O05A 4GZ7A 3RX3A 3FJ4A 1LT8A 9XIMA 1GJWA 4L7ZA 2ISVA 4MJZA 1EOMA 2XFYA 3UJFA 1GYLA 4ZE4A 2L5HA 4O19A 3F4NA 3HV8A 4NF7A 3LTYA 3Q67A 1CGXA 4JTFA 3GVWA 4JFWA 4YWIA 1B3OA 4Z17A 2D2HA 3FA5A 4CN1A 1BTMA 1XKJA 4KCVA 3N9KA 5E93A 1MQQA 2OEMA 3CXOA 3V36A 3HMCA 1OINA 3V3WA 1GVSA 3IUHA 4WDUA 3DG6A 3CJPA 4MZYA 1KLZA 3PTQA 1F6YA 5LA1A 3CV7A 2NVDA 4NIRA 1WPCA 1EDQA 1X97A 3TR2A 1XXXA 1AFSA 4FPSA 4DO7A 5AECA 1QPOA 2PF8A 1D3CA 5HXMA 3DI0A 3KDOA 2PDBA 4GO9A 2FYMA 3EBVA 2YW4A 4QSFA 1W6TA 4PL1A 1XRTA 4MFEA 3P0WA 2P3ZA 2I14A 3Q37A 4BY3A 4PRTA 2A6NA 1TWWA 2AAAA 2C79A 4H7ZA 3M16A 5IHSA 1J0HA 3VD9A 3PNUA 3KFTA 1FWNA 1DWAM 5DCDA 3GB6A 3IIOA 3VDHA 1FWTA 2WHMA 2YB1A 1KWKA 4XTIA 3PFRA 4RUBA 1J01A 3WLTA 3DG7A 1Y5VA 2VGBA 3AHTA 5CGTA 4QTGA 1Z48A 1HO1A 1R7AA 4AZBA 1LG1A 3S5OA 3CT7A 2X0SA 3QLDA 4ENLA 4LVAA 5LA2A 4HT3A 3H4XA 4AEOA 4W7WA 3ZWTA 3FDGA 1REQB 1ICSA 2VI0A 4ASTA 1OFOA 2VEKA 4Z2IA 1XLHA 3Q4DA 4KFPA 3F2BA 1FHVA 3QH2A 1P1MA 3WIJA 4OWGA 1CENA 2PDCA 2PU0A 1B4KA 5I06A 1VRXA 1FDZA 1OIFA 3NA8A 3T44A 3JR2A 4IL0A 3JUGA 4XD4A 2DW7A 3GU2A 4I5RA 4G7EB 1Q6EA 4B92A 4LJ3A 2E6YA 2XFFA 2OSWA 2GGHA 2WCSA 2WJZA 2Y4SA 4Y9OA 2TYSA 2RUSA 3K8KA 4B9YA 3W87A 4O18A 1GOMA 4AUBA 4H6KA 5HOSA 1H0GA 3CMGA 1U2YA 1PJ9A 3BVJA 4NI8A 4XAYA 1CB7B 3OOQA 3BOXA 3AMCA 3GG8A 4LS1A 1VFTA 1ZFJA 3K4DA 4A3QA 3APYA 4F2TA 1A5OC 3RGTA 2E68A 3JRKA 1XIDA 4A29A 2OWCA 1MW3A 3IJDA 3LXAA 2PWGA 5H6HA 1OABA 2G50A 2VRQA 2EF9A 5FAJA 4CNUA 4AVNA 3PAJA 1BRLA 4IP4A 2Z1SA 2HBVA 4CEUC 1OZQA 3OQ8A 3ARPA 2V5LA 2ZRVA 3TZFA 1W0MA 1G7UA 1XGZA 4QQUA 1XD0A 5BRPA 3P8IA 4LALA 3OVRA 3VOJA 1Z32X 3UVAA 1TG7A 3KRSA 4WRHA 4BF9A 1XSKA 2Z6IA 4ZQPA 4I9AA 3MHGA 1E1CA 2VOTA 5BOOA 4MKNA 4QJ3B 2EKCA 2ZUTA 2QMKA 1FRBA 4UTFA 3AIEA 3VIPA 3B8IA 4GY7A 1I4NA 1S5TA 1M1BA 3W27A 5BCAA 5AB3A 4GY1A 4K8GA 2H8XA 1PKLA 3TSDA 3CAQA 3P93A 3GC4A 2Y70A 3MO7A 5AVHA 3XISA 4AW7A 5FCZA 5JIWA 1HGWA 2EG6A 2XGBA 2UBPC 4PMQA 1HIZA 4AD2A 1OVDA 3QR0A 3G8EA 5DY2A 4JIEA 2WNWA 1UJPA 3T78A 2I5IA 2W4XA 3TW9A 3NWRA 1RA5A 5LKYA 3O7UA 4S1FA 4GG9A 2ISSA 3ISIX 4C6CA 2PSNA 2JK2A 4GIRA 1OZMA 2ZVIA 4H6QA 1SM9A 5CZSA 4QE5A 5HWJA 4HMCA 7XIMA 2WZTA 4M1BA 3VGEA 4B5NA 3PZMA 3TN5A 1LLOA 2J7BA 1VP5A 4DJFC 3OODA 1O6IA 3QY8A 3BSMA 1O5XA 2TAAA 2F2HA 4XBKA 3OA5A 1OWQA 3WMLA 3N11A 1KM5A 1DPMA 1UWIA 3B4UA 1DJNA 1NIUA 2X0HA 4HVXA 1B4EA 3FYYA 3TNOA 2AMGA 3S6DA 1VYPX 4C6FA 5U4NA 5TAOA 3OZMA 2PFHA 2ZWYA 4PSPA 4DWSB 1XUZA 1UMYA 8RUCA 4HU4A 3EB3A 1E1CB 2F6UA 5BRBA 2GDUA 4RDYA 2O4MA 3BG5A 1XCXA 4Z2KA 2R1NA 4O50A 2EPNA 3PHAA 5CSSA 6REQB 3G1YA 4XAFA 3MI3A 4Y8EA 3C3UA 3RO6A 4GI9A 1NQ6A 4K36A 1QHPA 3WQEA 4YYCA 7ODCA 1EPXA 2WMFA 5ABFB 1ZAJA 1CGWA 1EBHA 3CM4A 2VEPA 1M04A 3NM3A 1HO4A 3DC8A 3N4FA 3OBEA 4JTIA 5BMWA 3GH5A 3O3RA 3OGVA 4DF0A 1L2UA 3G1AA 3SW6A 1TJPA 3E5PA 3CZ8A 1JZ4A 2GDQA 3QMSA 4UQ9A 1UBPC 5A3HA 1V3IA 1AQHA 1JCNA 5C2GA 4XSLA 1A3HA 4CQDA 5EYWA 1SZGA 2IQDA 1PCWA 5HNNA 4OUEA 2A7PA 4KETA 2YLAA 1Z8AA 3B8TA 4WF7A 3MSYA 3PWIA 3ZVHA 2C18A 3WJSA 4CU6A 1WZAA 4PTWA 3CUGA 3RCMA 4AWTA 2B0MA 2OZTA 4X2RA 5HQEA 4KS0A 3ARZA 3SN4A 2WOQA 3CO4A 1EDGA 2VEGA 2VC9A 2JGYA 3N34A 1J5SA 2Y63A 1UR9A 3WLIA 1OJXA 1VPQA 5JVLA 1NVMA 3BGAA 4OJYA 1KNWA 2C0AA 4LBSA 1SR9A 4ML4A 1U30A 3L68A 1HJUA 3N12A 4L1WA 1J2BA 3C8FA 3TQVA 4GE8A 2BP1A 4GXWA 1V79A 3O1NA 4DWDA 4ZVJA 4A8IA 4HPGA 1H4PA 1VFMA 2BVTA 1RUSA 1E73M 2C19A 4JNMA 1QJWA 3AYRA 1ZALA 1E6PA 1EHAA 2VWSA 3GBDA 3LD5A 3GNNA 1FA2A 1XYAA 4NAEB 3CV2A 5I0DA 1BKHA 2OODA 2EHHA 1P7TA 2XIQA 3LQGA 3HPXA 1W3IA 4Q8TA 3WD0A 1XYBA 4ZA0A 3P67A 2QCMA 1JUKA 4ATWA 2J8GA 1TV7A 3D3AA 5LGXA 3IK2A 3TEVA 1OYCA 2VHLA 3QMTA 1K02A 1ZAIA 1SU5A 4GNKB 2QCNA 1M7XA 2C0HA 3IV3A 1UPMB 1A5SA 2OPJA 2QPUA 4YTQA 4YL2A 3EDJA 4O1DA 4O14A 1QNPA 4Y8FA 4XD3A 1W1VA 1B1YA 4ZL1A 3SM0A 2CIPA 2B4GA 5A6JA 3G1SA 1J5TA 4NAFA 4Z2HA 3FSUA 1J12A 1J6OA 2GJXA 4EPKA 2IS7A 4XZ9A 3NQ2A 4M6VA 3QM3A 2C8NA 3TONA 5A2BA 2GVGA 4NJJA 4HOZA 4Z1AA 4WY0A 3BLPX 2HWGA 4JIQA 3BAWA 3RR4A 4M56A 3UJ2A 2NXIA 3K4AA 3GK0A 4ERAA 4FA3A 4J2PA 3HM7A 4O1CA 4DXKA 4EVZA 2W61A 1EC9A 4QJ1A 3TTEA 1Q3NA 3U4FA 2VDIA 4J1OA 3PG9A 5CZ0A 3RFAA 3RLVA 4B3KA 4HZ8A 5A8GA 2HJPA 4Y2WA 4AZ6A 1KCKA 2PDIA 2TMDA 5F4WA 2ZC1A 1F6PA 3H7UA 4ZENA 3LMYA 2CERA 2C1GA 1QI3A 5GJPA 3UR2A 4R9OA 5CSYA 2A85A 3GC5A 4Z1YA 1PX3A 2CKRA 4C6NA 1SJBA 4YVPA 1J2WA 4ZFCA 3AU2A 1E5JA 1PPIA 3E12A 3C8NA 1AG1O 1UIOA 1IEIA 3OGRA 1K7EA 4GFSA 4YHEA 5CEWA 3WQWA 5I3GA 1FWBC 3ZJ7A 1JRCA 2ZX5A 4GYPC 3WF4A 5T91A 1BYDA 3N6JA 1L6YA 1V51A 3CH9A 2PDPA 3FS2A 4GBUA 2NUWA 1EUNA 4V1XA 3SURA 3RPMA 2XGIA 3VCCA 4H19A 3E38A 3B4YA 4BQ2A 3LLFA 2DVUA 3SCQA 3W1TA 2F9RA 3UY8A 5EFFA 2J7EA 2GK1A 4MGGA 3LQLA 2G3MA 1K8CA 1W5OA 6XIAA 1AK5A 1TV2A 2BFGA 1TMLA 2ZE0A 1MYRA 1I75A 4S23A 4RL3A 3WBWA 1I45A 1SSGA 2VMFA 2PMQA 3LX9A 1VQTA 4MLRA 2FZ9A 3EX1A 2KAUC 4GH3A 3W71A 4ZGYA 2YCEA 5BXTA 4FSAA 5JBDA 4DO5A 4HPNA 1XLLA 2QCCA 2PCEA 1OFPA 2OFJA 1JVNA 4KRTA 1H2JA 3MWCA 1ALDA 2OX1A 2ZRXA 2X0YA 3GO2A 2A4AA 5AYYA 5C6MA 5CG7A 1UJQA 2Q09A 1WKDA 3G6MA 1DXFA 1S1PA 2PDJA 3R1ZA 1GW1A 3PZIA 4DAFA 1K70A 3W1UA 2WPBA 3W2UA 4XO6A 2J66A 4L65A 1V0KA 4O0QA 1R47A 3CO8A 1JGMA 1UKOA 3IJ8A 3FEMA 4EXQA 2ZUVA 3VGFA 2A3BA 4L80A 4OECA 4D6GA 2OOGA 1E4IA 1EDTA 5LGZA 4PYSA 3K13A 1S1RA 3UR5A 2YCLB 3WELA 2WWDA 2QCDA 3W2MA 4FNPA 4EPDC 1RCXB 2V67A 1C8YA 3O6AA 3CZLA 1W2VA 2Q02A 5HA7A 1G4TA 1FH8A 4IT1A 2WSKA 5ECUA 4RE3A 1TTJA 1IZKA 2P0IA 2WSPA 4W87A 3SUUA 1C90A 2WZMA 2H90A 4Q7IA 3R5EA 8TIMA 4V27A 4XAZA 1C91A 4B91A 1QI4A 3KM8A 2ISDA 5DCEA 1DQWA 3NAVA 4FOKA 2CHNA 2J27A 1WAWA 3QHNA 1M68A 4JPGA 1GVIA 1TYGA 2WMIA 3M64A 4AIEA 1ZBKA 1W9UA 3HU7A 3SN0A 4PTDA 1EIXA 3NPXA 2VTFA 3AQUA 1KD0A 5DCBA 3PSVA 4FAMA 5E6ZA 1QPQA 2EO7A 1EZWA 2WV8A 2DUZA 4QAIA 2J7CA 2VZOA 4A6GA 4FXFA 5CJ5A 3STCA 3A13A 1JF5A 4XZHA 5J5DA 3M5XA 3OW1A 1AW1A 1MFVA 4Z1CA 2BY2A 4AZHA 3WX7A 4M7SA 2QT3A 1XSJA 4I90A 2I16A 3ZIZA 4BS0A 1FDJA 4UQDA 4G2DA 4Z2LA 4PUDA 2PAJA 2WSYA 2ZXQA 1YTKA 3KS5A 4IGHA 5J04A 3EXTA 4JQ1A 2FTYA 1ECEA 2FB2A 1TRDA 4DJFA 4CUCA 1Z6KA 1ITXA 1PZ2A 1BAGA 3UG3A 3D3FA 3RLUA 3A5FA 5JBEA 5J8LA 2W27A 3VU2A 1S5WA 2IKGA 3WQOA 4WDTA 1AZ2A 4GUFA 3M0IA 2FPYA 2XIMA 3GSMA 1PKNA 3SJ3A 3OG3A 1W9DM 1W54A 2E9MA 4LVDA 4AZCB 3QC3A 1PTGA 1H5VA 3L67A 1B31A 1F61A 2CLOA 4FOUA 2J9YA 3TA9A 3MS8A 5LIYX 3IK4A 1FWGC 3E2VA 3DCPA 2IKJA 1H5YA 3T2OA 3ZWSA 4DEFA 2PRMA 4QG8A 1RPKA 3WD1A 3NDYA 3LENA 3LV5A 3CPRA 1BYAA 4WJXA 1LL6A 2OX4A 3THCA 2VGFA 1EJRC 1PWLA 3WUEA 3KCJA 4XAPA 2YDSA 2AAMA 3W83A 1MW2A 4LV9A 4DM1A 1P0KA 2V2DA 4AH7A 3HURA 3G5EA 3TROA 3PJTA 1JDCA 3M0KA 3WZ0E 4UTWC 3SCPA 2XIOA 4XO7A 1EL3A 2OWWA 2J7FA 4ZB0A 1JXJA 4W8BA 1C8QA 4NUWA 1DWGM 5HR6A 1OD0A 4O16A 1UA3A 2QJHA 3CU2A 3LGEA 4JDBA 2IPJA 1KW1A 4ZZ9A 1OHLA 3WBAA 3EB4A 4ADSA 1CW2A 1ZU8A 2YDAA 4M0XA 2GUUA 2E25A 2X1SA 3NGJA 4J35A 5M2FX 3WF2A 3N04A 4DJDD 2WC7A 2PDQA 3V18A 4P2VA 3DKLA 4Q8WA 4FO4A 3O6YX 1TJ2A 3ZMRA 4C6EA 4L5ZA 3MCMA 2HV5A 2E28A 4MWAA 3LHYA 3BK0A 2ZX8A 1WUEA 4UTIA 5D9MA 1Y0EA 2Z29A 3EWYA 3G1RA 1B3VA 4UTHA 2CKSA 3GTHA 1ICPA 2EXOA 1MSSA 2CHRA 4P8VA 4PCFA 3MMWA 5HMDA 1UA7A 3WO8A 3VUPA 2YFOA 4CCDA 2O7SA 4GYKA 3WJWA 1FX6A 4GRSA 4TTGA 1EQPA 4W5ZA 5CAHA 3AXKA 3NO5A 3R13A 1TPUA 1MDRA 3VILA 1TPFA 5I3HA 3LOTA 3AUOA 4QXIA 4D2JA 1E15A 2E7FA 3KW3A 3OBAA 2OQLA 4IMDA 2B7OA 5IBXC 5G1TA 1LOQA 2E5BA 2W92A 3VCRA 2BVDA 1AJ0A 1VLIA 4WX2A 4NRSA 4O11A 4KH2A 3PTDA 3ITTA 1FWCC 1NDYA 5KZ6A 1VEMA 2EPOA 1OBAA 3U2OA 4FEZA 1KGUA 4GOAA 4M5PA 3ZM8A 2QEZA 1SQ7A 4IZGA 3OLEA 1ME8A 4NNCA 1TELA 4JR5A 4ZB5A 3M0HA 2YPIA 2J78A