4FXRA

Crystal structure of the mutant t159v.r203a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSVRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGASIYLADNPAAAAAGIIESIKDLLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 80
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fxrA00
4WOZA 3C2FA 3LTYA 2E09A 1G6CA 3WJSA 1DBTA 1G69A 1EUNA 1QR7A 3CTLA 2BXVA 1G4TA 1NF0A 5C6MA 2DZXA 4BI7A 1PIIA 3GAYA 5F4SA 3PM6A 3DI0A 1TMHA 3I7SA 3O05A 1GJPA 1JVNA 3W1TA 5FF0A 2QJIA 3LHYA 3T40A 1IIHA 4AEOA 4A21A 3LERA 1ZAJA 3W1QA 2QCNA 1GWJA 4NJIA 4ORMA 3TFXA 2FJKA 5D2VA 4ADSA 5DLCA 2ZTJA 5AN7A 3B8DA 1ICPA 4O18A 4O19A 4WQ6A 1JQVA 4JR5A 2V5LA 1H50A 3G1SA 2NX9A 1KTBA 3NVTA 4JTTA 4EVZA 3NPUA 1CX9A 2A7NA 5FEWA 3NR0A 2B4GA 4Q33A 1GZGA 2E5CA 4ML9A 4A2SA 1F74A 1GOXA 1DVJA 1C9DA 3UYCA 3KAOA 4MY1A 1WA3A 1I2OA 2OCZA 2JBMA 3TV8A 3PBWA 4XWUA 3QMRA 3HF3A 1XL9A 3CB8A 1YTKA 1Z42A 1Y0EA 3B0PA 4NNCA 1OFQA 3N2MA 5K9DA 4RJEA 3TUUA 1GT8A 3EWXA 3KHJA 1H7RA 2VENA 1OFRA 4JIPA 5K7JA 2ATSA 1BWKA 2E5DA 3P61A 4K7YA 4X2RA 2BLEA 2WKJA 1W5PA 4RKAA 4FXSA 4MVAA 4AB4A 2C15A 4UTWA 3U2OA 1VYRA 4U28A 2XN0A 4G1KA 3C52A 6TIMA 3W7RA 1KTNA 4Y90A 3W1RA 3VFLA 1WX0A 1LORA 3G1FA 4MYAA 2I1OA 3M5XA 2Z0IA 3LCIA 2VKZG 4N2YA 1QDSA 1A5BA 3B0UX 3W7HA 3W73A 1G7UA 4NJKA 2ZRWA 3W2UA 2G96A 1T99A 3ABQA 4NVTA 1XC4A 2X1UA 5D32A 3IGUA 1FWWA 3ZWSA 4JN6A 5D05A 3O1NA 4K8EA 4HNNA 3OHIA 1TPWA 3GDLA 4JIQA 1XBZA 3DFPA 3NQFA 1BEUA 3G1VA 5CZTA 1TPUA 4E0CA 3CM4A 2PC4A 2DORA 1TJPA 4EOUA 4MLRA 4Z08A 4XTIA 3QF0A 3CPRA 2A6NA 4I7WA 5LZLA 4D2JA 4UTLA 5DY3A 3SGZA 3NQCA 4UTJA 3GXPA 5F4XA 4R53A 3OVPA 3KVLA 5AOUA 5KMYA 5CSRA 2GQAA 1VR6A 3NGJA 4IGHA 3W1XA 3OG3A 1W31A 1IXPA 3BK0A 3BG5A 3C4UA 1QO2A 2JKEA 3G0XA 3MUXA 5BW6A 4AMAA 4LUJA 2G95A 4LVBA 1FCVA 1DQWA 3T44A 1IXOA 1WBHA 4K39A 3IIPA 3NL6A 2E5BA 2QCLA 3LV6A 3STEA 3STFA 3DZ1A 5CGQA 2E1DA 2VEPA 5CZSA 1TO3A 1XDMA 4JS3A 1L9WA 4Y6GA 3IIVA 1K8XA 4Z1BA 5BNKA 3NNTA 4N6FA 4UFJA 4JX5A 3P8IA 3PVFA 1XXXA 2C1HA 1N8FA 2BWGA 3P8JA 4NU7A 1YLVA 2FTPA 1IGSA 1QAPA 4O53A 4BFAA 5AYYA 3GLCA 3W22A 3YPIA 2DU2A 3PUEA 5J5RA 1T8XA 3GKFA 4MFDA 1OYCA 4GUHA 1QWGA 3GB6A 3M47A 2O7SA 5FI8A 2EHHA 2C3ZA 2D73A 1ME7A 3MP3A 4UFLA 3W1AA 4RZ4A 4P2VA 2RDUA 2VELA 3DFNA 4O0ZA 3LDVA 5LNRA 1ICSA 3G1AA 3SECA 4MYXA 3UXDA 3CEPA 4OGZA 3O16A 4K38A 1JCJA 1G7VA 1L6WA 2B0MA 5U7SA 3QYQA 1ZCOA 3HQ1A 1K7EA 3HGRA 5IM51 5U4NA 4S1FA 5F2LA 3M5ZA 1H7NA 4NXKA 1TPH1 1U5JA 1H60A 2VFEA 1J5TA 2W79A 1A5AA 1EUAA 3S1UA 1UJPA 2A85A 3P80A 4TO8A 2C19A 1I4NA 3BG3A 1PL9A 3HGJA 2AAMA 4JTJA 1TQXA 1VC4A 3EB2A 2CW6A 5AHFA 4O4WA 3MHUA 2J9ZA 2HS8A 5D09A 5CPLA 4GUFA 1BKSA 1JRCA 2ZFAA 1UB3A 3EXTA 4E2BA 1W5MA 1NF7A 4A29A 3NM3A 1RZMA 5G2HA 1CI1A 3FJLA 4RV8A 4LS0A 1XBYA 4UMBA 1WV2A 3TJXA 3MW7A 2CLEA 2DJLA 3BW2A 4LTSA 1W1ZA 2GJNA 5BMXA 3G0UA 1S5WA 3M0ZA 3B03A 1SZFA 1F76A 4CQ8A 3C0JA 2HSAA 1SO3A 5FESA 5E1QA 4NNAA 2YYUA 4AXKA 4M6QA 1LBLA 3EWBX 4NXSA 4PEKA 4MZ1A 1T0OA 1H7XA 1C29A 3LLFA 4NNBA 1IF2A 2V81A 3VE7A 1BWLA 3L9CA 1TCDA 2GVGA 3P67A 2B7QA 5TIMA 4FXRA 1Q6LA 4GBUA 4N9DA 5C5YA 3EWUA 5CZJA 4CCEA 2ZBTA 3PY2A 1FWNA 1SO4A 1X1OA 1OX4B 4O13A 3LXCA 2QUTA 2H8ZA 4JTIA 5DELA 4ZQOA 2XFWA 1O60A 3ABOA 3EX4A 3MBDA 1TB3A 1FCUA 3Q2DA 4Z1DA 1KA9F 1FDJA 4RXGA 2ZA3A 4N02A 1U83A 3P5YA 3NQVA 1YYAA 2C16A 4YLWA 3C2OA 4UUIA 3NOEA 3NM1A 3B4UA 1KFKA 3KRZA 3LHVA 3VKJA 2J27A 1YDNA 1WAUA 2V2CA 5AC8A 4FX6M 3WJWA 1X6UA 1DKWA 1KW1A 3PF3A 3FOKA 2FB3A 1OABA 4FO4A 2WNZA 3ELFA 3S5YA 5F4WA 4UFMA 5F1UA 4O52A 3FIGA 3W71A 3BVJA 1D3HA 1G4SA 1AMKA 1DOSA 3DHDA 4AF0B 3O06A 5C2XA 3NQ7A 2ATMA 4TIMA 4FNPA 4UMCA 1EX5A 3B06A 4NZFA 1P4CA 3EX2A 4X3ZA 3W1NA 2VC6A 3O6CA 5L9FA 2OX1A 4IX2A 4RK8A 3DFOA 3GDKA 5KITA 2JK2A 2FLIA 5D2WA 2EAWA 3LCWA 5AHMA 4JYFA 4PC8A 4TU1A 3GIYA 1MEWA 4LRTA 3UPWA 3N14A 3W76A 1TV8A 3L0KA 5TQLA 3KOFA 3PB0A 2V5BA 2Z6JA 3ZFHA 5F2MA 1TRDA 1YXCA 4PFMA 3AJXA 5HR7A 3VNDA 2CLKA 4WXZA 1XBVA 2C0AA 5I3HA 3W2MA 3HG4A 1AL7A 3WJXA 3F4WA 5I3GA 3EEGA 5LNUA 3NO5A 3A22A 5J5DA 1OF8A 2XN2A 3KVMA 3A5VA 4N4QA 4LWWA 5DY2A 5I3FA 4DO6A 4YWIA 2J24A 5HQEA 2Y62A 3L65A 1EIXA 3U8GA 5EY5A 3WK2A 2GVLA 1W56A 5G5IA 5DXYA 3W07A 1WBJA 3G3MA 1JJKA 1UUOA 3HO8A 4OQVA 4JTHA 3I7QA 1EWEA 1ML1A 4RCXA 2H90A 5CSSA 1GVOA 3N34A 2GUUA 4UTUA 1SFLA 1PHWA 4R33A 3NQ8A 4N9CA 3GKAA 4AHQA 3S1VA 4JYEA 4AWSA 1O5KA 2FPTA 4UTMA 3DU0A 3U6WA 1F05A 4S2CA 3W75A 4S2BA 4ZQMA 3LHZA 2ZZ7A 3P74A 3TW6A 2A7RA 1XBXA 3SW6A 1XUUA 5G4EA 1TV5A 5FEXA 3MMTA 3TW7A 5C55A 3W23A 3E02A 4NZJA 1S5TA 2WNNA 4XTDA 2R94A 3M9YA 2WSQA 2VFHA 4EIVA 1I2RA 5DCEA 3B05A 4YCPA 1OFDA 3OEXA 2ZA2A 1TYGA 3MI2A 3BO9A 2QCHA 3O63A 5DBUA 4LRSA 1SW0A 3NQ6A 3THQA 1LCOA 5CZ0A 3RU6A 1F2JA 3S8HA 3QW3A 3G8RA 2GJLA 4XBKA 3KFTA 3CT7A 3NPVA 2GOUA 4WX2A 3LCGA 4MFEA 4JTKA 4GUJA 1FCBA 4RLIA 1VCVA 4GJ1A 1ADOA 1RV8A 4LVAA 3NPWA 1RD5A 3S5ZA 1GTEA 1WQ5A 4U4MA 2Q8LA 3G8EA 4MY9A 2DZVA 5FF4A 4IX0A 4JICA 3R2GA 4R7JA 5FF7A 1UCWA 4Q4KA 3W7MA 5HNRA 4QJ1A 2QJHA 2PURA 1ZAIA 3LOTA 4AVFA 2NXHA 3LCHA 4J9JA 3IVTA 2V82A 4OE7A 3NA8A 2ZZ6A 1SO5A 2HTMA 1J2WA 4OHQA 4HNTA 3IIXA 4N6EA 3P7YA 4O50A 3G24A 5CPOA 3SIZA 1JCYA 1Q45A 4GRSA 3M41A 5DCBA 4YMZA 3H55A 4UNKA 4O16A 1GVSA 5I3IA 1GYNA 1SO6A 1KTCA 5EMUA 3L0NA 1R2TA 1GVFA 3CHVA 3EX3A 1L6YA 2A21A 1LROA 4WJEA 2YXGA 2C6QA 4ZVJA 5EBUA 2ZRVA 4GE8A 4E2DA 1CW2A 4O17A 3BGJA 3GDRA 5KSWA 3NG3A 4O57A 1GG0A 3SJ3A 3N2XA 2VFDA 4HHPA 4MY8A 4Y96A 2NXGA 1QNVA 5D2XA 1KLYA 1MSSA 3EXSA 4AWUA 3I68A 4TMCA 3B0VC 3QRHA 5G2WA 3CU2A 5AHEA 2YCEA 4PL2A 1R30A 4NX0A 3BGGA 1TREA 4BK9A 3CIXA 4WUIA 1XUZA 5LGXA 3QPYA 2XN1A 1ZALA 2NUWA 4JTUA 3BW3A 1I2QA 1V5XA 3C2VA 1KV8A 1PS9A 3QQ1A 4JGDA 4AHPA 4ZQCA 3A9IA 5IBXC 1MEIA 1Z41A 4KWVA 3TQ0A 4JTEA 1LP6A 1R2RA 4IUOA 1R46A 4MZ8A 2VFFA 3UWZA 3W7PA 1RQHA 2GQ9A 1RQEA 2FB2A 2FFCA 3TCEA 1E51A 1JUEA 2YX0A 1GVRA 3MHFA 4NT0A 2A1YA 1PVNA 1W54A 1VQTA 3FA5A 4GC4A 3W7NA 3P60A 1EEPA 1P0NA 5A5WA 4X9SA 1LRNA 1M7PA 3W74A 1G4PA 3PB2A 3GDMA 1H51A 3SR7A 3P5ZA 3O8AA 4I9AA 4IXXA 4WZHA 2KZHA 4DQWA 2YZRA 3S42A 1W8SA 1DL3A 2J88A 5CG7A 3TSMA 4AH7A 3EWWA 4FEZA 1D9EA 5H91A 2RHGA 2YFOA 3C8FA 1QMLA 3W7CA 3T7VA 3JR2A 4ORIA 4ZQPA 3L5LA 3HPSA 2CZFA 3G1DA 5BRBA 1X8FA 3LXBA 2A0NA 2QJGA 1SSGA 3P81A 3W7DA 2X16A 4UNLA 5L6UA 5AC6A 1IXQA 4O1DA 1KM4A 2VOMA 4M5PA 2RFGA 4MLJA 5D04C 2C13A 2J9XA 5HUPA 1H7WA 3W70A 5AHNA 3NQEA 1NFBA 2WNQA 4LT9A 2EF9A 2ZZ2A 4PH6A 4NJHA 3S5OA 1Q6QA 4K36A 1XFBA 2FPVA 2VXNA 2Z1BA 1B4EA 2Q3RA 3EX6A 4LC6A 4FNTA 4EWND 1SU5A 2A6LA 2RH9A 3VI2A 4DO5A 3LTPA 4Q32A 1EB3A 1B3OA 5HWNA 3FYPA 4JTGA 3PS7A 4LNYA 2GVJA 2H6RA 3M6YA 1ZNNA 3NL3A 4QIUA 1Q6OA 2ABAA 5HMSA 1R47A 2Y89A 1AK5A 3V75A 1H7PA 4WY0B 1QFEA 4BR1A 2YR1A 4UTTC 1K03A 5LSMA 5KINA 4LV4A 1WOAA 3NQMA 5G1TA 1A5CA 4BWLC 2WQPA 3SFKA 1HO4A 3QZEA 5D38A 5LNVA 2ZQ0A 4KFOA 3MI6A 3C61A 3FJ6A 4KKXA 4PL1A 5K9XA 2VEMA 1F73A 4K7VA 5HR6A 4K6AA 4ZQNA 3UPBA 3WFAA 3EWYA 3GR8A 4BI6A 4L4MA 4XZ9A 3PBUA 5H2ZA 4QSHA 4HT3A 3LBCA 4LS1A 3HGOA 3N9RA 1TPB1 4EF9A 2G97A 2QDHA 3KVJA 2GQ8A 1SFJA 1FQ0A 4UFKA 3TSDA 3DFTA 3NQ2A 2AQWA 3ATYA 2OT1A 3QC3A 4O1AA 1UUMA 6ALDA 1FWRA 4RXFA 3HG2A 2DZUA 4UTHA 5FEPA 3ATZA 1TJRA 3E96A 1XCFA 5E93A 2ISWA 4Z1CA 4UR7A 3UXAA 1Z44A 5KZMA 4RZ5A 5F2GA 2Y7EA 2ZA1A 2FPYA 1JRBA 3LCXA 4MZYA 2IQTA 3L68A 4ADUA 4DPPA 1LOQA 3LI0A 1AW1A 3R8RA 1FUYA 2BZNA 2J9YA 4O1BA 2GPTA 4DO4A 3UD6A 3PWAA 1MEHA 1P1XA 2JGYA 1OYBA 3GXNA 4FNSA 3QMSA 1LTDA 4GUIA 3TJLA 5KTLA 3MBFA 3PUOA 3HOJA 4WY0A 3TU9A 3TX9A 4NJJA 1LLWA 1P5BA 3MWAA 1TTIA 1HG3A 4UTWC 1XDLA 2DZPA 2ZDRA 4HPJA 1VCGA 3TC7A 3FEMA 5MHBA 1OK6A 1OF6A 3R89A 1EWDA 4CLMA 3A21A 2JGQA 4H4IA 1TPVA 3BPWA 2WV8A 3G3DA 2A5HA 1NVMA 4QISA 5FF2A 4IMGA 5HJLA 1I2NA 1TRIA 3BLFA 5BOOA 2QDGA 1HO1A 2FDSA 4DEFA 2V30A 4WXYA 4YXGA 4IQLA 2W0UA 2H3DA 5HUOA 1W5OA 2DZWA 4LW7A 4MJZA 5AB3A 2QCGA 5T26A 4GFSA 4YCOA 1DJNA 1QCWA 2J6XA 3TKFA 5LHEA 3TROA 1EP1A 4LV9A 1DJQA 3W86A 5K4ZA 1N7KA 2R91A 1LRQA 2QF7A 3KRSA 4QNEA 3W1LA 4EF8A 3UZ5A 3IGXA 1I8JA 2OT0A 1G4EA 1W5QA 4QNWA 1VCFA 5G4WA 3MYOA 2Y88A 2TPSA 1GVQA 3THAA 1QPRA 1QOPA 5E0KA 2ZYFA 2A4AA 4JDBA 3TQVA 5DXXA 4OV4A 3G1HA 1DQXA 5D30A 4IJBA 4FNRA 1TQJA 2Y85A 3W87A 2VEIA 3GZ3A 1OK4A 2V2DA 3A23A 3T55A 4N9EA 5TBOA 1ME8A 1ICQA 1JQXA 3SY5A 4QAIA 1SZNA 3C2EA 1ZENA 4Z1AA 5D03A 3SI9A 1OYAA 2EPHA 2QCEA 4NQ1A 1RQBA 1OX4A 2Q3OA 1H62A 1WXJA 2RDTA 3P62A 1TTJA 2TRSA 1KBJA 3SZ8A 1YDOA 3L66A 2DZSA 4O0KA 1I2PA 1GEQA 2QR6A 4DF2A 1VLWA 2QCFA 5K9CA 3NYZA 4FNUA 4MJMA 1LYXA 3W2LA 4BF9A 4LU0A 3O6YX 4JTLA 1HTIA 4CCCA 3GXTA 3C3NA 3N73A 3W7KA 3CQ0A 1DV7A 3PR2A 3TSBA 4O8RA 1KFBA 1JCMP 1DORA 3MP5A 4K8HA 1KM5A 3IEBA 4FF7A 1W5NA 3NDOA 1MXSA 3E0IA 2F7FA 3S0CA 4NUWA 3TMQA 5A8GA 3W7QA 1OJXA 1TSIA 3AO0A 3UWUA 1KBIA 4AHOA 2CU0A 3A24A 3I7RA 3LRLA 1YXDA 3RNDA 1KM6A 4DBEA 3DFSA 4RZ6A 1PHQA 3DH7A 2RKXA 1I45A 2CLLA 3EKZA 4ICNA 4XKYB 2EGZA 4AF0A 1IIGA 2NLIA 3DHFA 4RX0A 5DBTA 1XM3A 3G22A 1BTMA 2I14A 1KM1A 1ONRA 1HFBA 3INPA 4HIBA 3NZ1A 4HKPA 2TSYA 1SSDA 4I7VA 4LVDA 3BLIA 4JDYA 5AHLA 1OFEA 1K7FA 2ZTKA 1TPC1 4UTIA 3W3OA 3STCA 3IV3A 3GNDA 4OWGA 3MYPA 4O10A 5EA9A 3RMJA 4LVFA 1H63A 1SZGA 1SQ7A 1VPXA 4PTNA 4DF1A 3T78A 3QEZA 1KFJA 4UTKA 2BSLA 1G67A 5EL1A 5K2ZA 3R5EA 2R8WA 1L6SA 3C56A 3W83A 3GYEA 3S5NA 4PA8A 5LNWA 3OVRA 3W7EA 1A53A 2W6RA 4N4PA 1OG0A 3LHTA 5LHFA 3M44A 3TE9A 1VHCA 1K7XA 2X30A 4LY8A 3HMJG 1ZHAA 4GWEA 4ZZ9A 3DXIA 4UR8A 2I9EA 1KM3A 3UQNA 1VS1A 3M5YA 1DHPA 4LVGA 2WOQA 1AW2A 1KM0A 5C54A 2PRHA 2NV2A 4RR4A 4O14A 1RVGA 2QAPA 1TPFA 4IMCA 4DPQA 4WD0A 3W7IA 5AYZA 5AHIA 1X7FA 2Q8ZA 1SZEA 1K3UA 1SR9A 3HJZA 2ZZ5A 3FYOA 1VJIA 3I6RA 1FDYA 3WJYA 4DXVA 4MUZA 1P0KA 2E6YA 1PCKA 4GNJA 3ABSA 1Z48A 3TXZA 4K37A 1B57A 4XKYA 1O4UA 2CLFA 4M7TA 3W84A 3TA6A 3CWNA 4OV9A 5D33A 1O95A 1F6PA 1H61A 3CWOX 1YTDA 1GG1A 5CPNA 3OBKA 4UC5A 1VH7A 3O6DA 3L5MA 1UBSA 1KLZA 3M5VA 3EKLA 3UWVA 4A2RA 3L5AA 4P61A 1FBAA 4XBSA 5G2IA 1NSJA 3PC0A 4JTFA 5K3VA 4FX7A 3G18A 3LGEA 3MJYA 2CZEA 3CC1A 3HB9A 1SW7A 4POCA 4UFHA 1FWSA 3NXFA 2YW3A 4C1LA 1V7YA 4ZL1A 3LCFA 1SPQA 4IPIA 3QJAA 3GDTA 4FIRA 3W7JA 3W1UA 2ABBA 2QCMA 5HWMA 3PBYA 4H3DA 5BMWA 2A2IA 3S1XA 2OMAA 4O28A 3BG9A 3H54A 3LCLA 1FXPA 1WYIA 1YXYA 2B7OA 4ZMGA 5AFDA 3H53A 2E68A 3G1XA 3QQ0A 3P82A 5HULA 1EPXA 4L4LA 4DELA 2E6AA 2DZTA 3SSJA 2CLIA 2AGKA 3LV5A 1OFOA 2CWNA 3GX9A 4UFIA 3W1MA 1MZHA 4QITA 4M19A 2PRLA 3ABRA 1VGAA 5LKYA 3FFSA 2E6FA 1J4EA 3MP4A 1VYPX 2V8ZA 5F2IA 4MKNA 2YW4A 4UXDA 2H8XA 3W88A 1KM2A 5DCDA 3W2NA 1A50A 3LTSA 2Z6IA 3TH6A 1TTQA 1ZY9A 3TQKA 3UY8A 2Y7DA 3TAKA 3QM3A 1W3IA 4A3UA 2FQIA 4LC8A 1EP2A 3HG5A 2X1TA 2YPIA 2JKAA 3KXQA 3G0SA 3E12A 1RR2A 4X22A 3V1PA 3DKJA 3RFAA 3LRKA 2G5WA 4ADTA 2OZ0A 1B9BA 3L21A 1QPQA 4O1CA 4JTSA 1HL2A 1OFPA 1QOQA 2VEKA 3N3MA 4JX6A 1IXNA 2CLHA 3N9SA 1KFEA 4W9TA 2UV8G 1WOBA 3UY7A 1TV7A 3LX9A 5D37A 4FX8A 2ZRUA 3W2KA 4OBTA 5EKYA 3IIZA 1KFCA 3NQGA 1SUXA 2R14A 1TPDA 3WK3A 2CZ5A 1VRDA 2Y7GA 2OJPA 4HPXA 2B7NA 3QH2A 1F6KA 3PUDA 1A5SA 2YGYA 1FY6A 3F03K 2ISVA 2ZRXA 1Q3NA 3NPXA 1KV5A 3HBLA 3TK7A 4AWTA 1D3GA 1K8YA 3DI1A 4A22A 5FEZA 3EWZA 3VE9A 2QCDB 1VYSX 2ZZ4A 2HMCA 3TXVA 3UWYA 4CNPA 4TR9A 2JKPA 3DGRA 2DP3A 2FIQA 4IMDA 1THFD 2C14A 3GK0A 3ZWTA 3LBMA 1NEYA 5D2YA 4HSOA 3WK0A 3LB0A 1FX6A 2NWSA 2B7PA 2YDAA 3GAKA 5KZEA 1EA0A 4HN4A 3HPZA 2V9DA 2Y61A 3PG9A 3WK1A 3PG8A 3MI3A 5AYXA 3IRDA 3P84A 3TMLA 1LOSA 3O07A 1PCWA 2V2HA 3USBA 3W7GA 1M5WA 3HG3A 3W2JA 1W37A 1YPFA 4HSNA 3TFCA 1OVDA 4FB7A 4OT7A 4MPQA 5LNSA 3FKRA 2PE4A 1QPNA 2QUVA 1FDZA 3F1QA 3KVKA 1GTHA 2PCQA 2QCCA 3UNDA 3PAJA 4CQ9A 1C8VA 1TPEA 2PRMA 3QSTA 4ZQRA 2ZZ3A 2QKFA 3M43A 2F84A 4C1KA 5CPMA 2EKCA 2ZZ1A 1OFAA 2NX1A 4BI5A 4O11A 5I3JA 2BTMA 5KZDA 3R12A 3UWQA 2CFFA 3RK8A 1W3NA 3JRKA 3IVUA 4KWWA 1H1ZA 5CKSA 5D2TA 3E9AA 2Y70A 1TTPA 2NUXA 4TX9A 2A7PA 4R34A 3C6CA 3D0CA 4JEQA 4UMAA 1YDVA 2DJXA 3A5FA 3W72A 4JYDA 2P1FA 3W6YA 4JX4A 3LXAA 1S3HA 2V0TA 1VZWA 3W85A 4O54A 3Q94A 2TYSA 3TNOA 2YSWA 7TIMA 2CLMA 4ALDA 2Y63A 5D02A 2WSYA 1RPXA 3MO7A 3T4CA 2P10A 1WDWA 1YTEA 3I65A 4WY0F 3DFQA 3TDFA 3W7OA 3IVSA 1YADA 2X1RA 3B04A 4PODA 3FS2A 4E38A 4YL2A 1LOLA 1LM1A 1PE1A 4M6PA 8TIMA 2QCDA 3M7WA 4IMEA 2X1SA 4KFNA 5F1VA 3JS3A 3LHWA 4OU1A 4H6KA 1ME9A 1S5VA 3M1ZA 4IOTA 2ALDA 5FF3A 4M6VA 3W1PA 1T96A 1YPIA 1GYLA 1M6JA 1VLIA 2Y7FA 3LI1A 3QPZA 2RDWA 1F5ZA 3BW4A 4TMBA 1LZOA 3KRUA 1MO0A 2NXIA 4DF0A 5DN1A 3GR7A 1LBMA 4FIQA 2NV1A 3PBVA 4CQAA 4QQ3A 3ZR4A 4GXMA 3OIXA 5I3KA 1EP3A 4CCDA 1JR1A 4N9BA 3S6DA 2BX7A 4MIMA 1AL8A 4NX5A 3NQDA 3PSVA 1X1ZA 2WJZA 2QEZA 4HNVA 5ABTA 4JY9A 1QO5A 3EX1A 3L2IA 2ZCGA 4JXCA 3BARA 4LS2A 3S9YA 4LOCA 1UASA 1XI3A 1XKYA 2QAFA 4HNUA 3C2RA 3RLUA 5IBXA 3GVGA 3BLEA 3CIWA 1OX5A 1AW5A 5EPDA 3LLDA 1JULA 3DKLA 3TR2A 3DAQA 1SW3A 4AAJA 1LDCA 3OA3A 4B5NA 3M16A 3QW4B 2C18A 2WO5A 3HPXA 4WOQA 1LRTA 3O15A 1AG1O 3QSRA 3DBPA 1GQNA 4UCGA 1R2SA 1ZJIA 4FHAA 2QUUA 3FLUA 1W3TA 1H1YA 2CZDA 3QMTA 1OHLA 3W7LA 1ZFJA 3HIJA 3CEUA 4QM1A 1JUBA 1JCNA 1O94A 5EYWA 2YFNA 5SWUA 3RLVA 3TC6A 2YYTA 2ISSA 2H3BA 3NL2A 4IMFA 1TIMA 3QFEA 4LUIA 3TIMA 1F7BA 3Q58A 2ZRYA 2WSRA 3NEVA 3WJZA 1M7OA 2Y6ZA 1O5XA 5GVJA 1JCXA 2WPBA 4O12A 2VFGA 5HINA 1VHNA 2ZRZA 3NQAA 1B4KA 3NZRA 4IXHA 4CNNA 4IWWA 3E49A 3L0GA 3TAOA 3SGUA 1NAL1 1QPOA 3IGSA 1FWTA 4KFPA 4Z0SA 2X2GA 2P0OA 3OVQA 4PCFA 3CLMA 5HWJA 2HS6A 1LLZA 3DENA 1N55A 3PULA 3KX6A 3FKKA 4XUGA 1L2UA 2NZLA 1PV8A 1ALDA 1JUKA 1LBFA 3EXRA 4NJGA 2Z2UA 2NX3A 2E77A 3K30A 3PSWA 3UZJA 2NWRA 5LGZA 2CLOA 3F4NA 3BV4A 4O4VA 1GPWA 1FCQA 5AC7A 4UIOA 3NAVA 1OX6A 1OFBA 1Q6RA 3LM7A 3W9ZA 4Z0JA 3LHUA 3RF9A 2TMDA 3UWWA 3HGSA 4Y8FA 1ZAHA 1K02A 3S1WA 1W0MA 4GUGA 4I7UA 3NL5A 3STGA 4DBDA 4XQ6A 4CNOA 2NUYA 1JCLA 4UTTA 2VFIA 2O7QA 4FNQA 3N19B 4MOZA 4O15A 3IIOA 3MHGA 4BWLA 1H5YA 3VCRA 3R13A 4Y9AA 4JNMA 4JY8A 1H7OA 2E6DA 3Q37A 3LRMA 4IPJA 3GNNA 4JD4A 1KFLA 5G1YA 3G1YA 1HUVA 3ZS4A 1FXQA 4ONVA 1K8ZA 3ANYA 5K4XA 2LLEA 4M7SA 3L67A
chains in the Genus database with same CATH superfamily
1OD0A 3LTYA 1DBTA 1E56A 1G69A 2V63A 3FJ4A 1NF0A 2NV9A 4BI7A 3GAYA 3RO8A 2ZUVA 3O05A 1JVNA 3W53A 5FF0A 3T40A 3PZMA 1JAKA 4PB5A 4H9ZA 4HA3A 1ZAJA 5DRCA 2OQHA 4C65A 4ADSA 4IT1A 2XZ9A 3STPA 1FFQA 1FFRA 5CAHA 1BG4A 4JR5A 1OC7A 2X09A 1TVNA 3G1SA 2DSZA 1UP2A 4CEXC 5FEWA 1UKQA 2AAAA 4A2SA 1F74A 2OEMA 1Q13A 4R7WA 3UYCA 1M7XA 1I2OA 1O5RA 4QHRA 1BSLA 1OCJA 3TV8A 1UKOA 4V27A 3HF3A 1WDRA 3CB8A 4X0NA 5LA1A 1OFQA 3PPCA 3FW6A 1BLIA 1JDCA 4JIPA 2XIJA 3K1GA 3VFCA 1BWKA 4S38A 4X2RA 2R6OA 1W5PA 4FXSA 5I03A 5HMFA 3U2OA 1QRQA 3GS6A 4M1BA 2PU1A 4Y90A 4L9YA 3VFLA 1WX0A 2F2KA 1TMQA 3G1FA 1MFVA 3PFRA 3A3XA 3AXIA 2I1OA 1SYTA 3LCIA 4AFYA 2VKZG 3K8LA 4M56A 3WQDA 4AIOA 1G7UA 1M41A 3MY9A 1TMLA 1DTUA 2G96A 1T99A 4MKVA 1KC7A 2AL1A 1TZZA 3O1NA 4RE4A 4K8EA 4XIAA 1Q2RA 1TPWA 3KE0A 3DFPA 3G1VA 1L8PA 3EPNA 1TPUA 1J0YA 3UG3A 1GOQA 2I9UA 1GQKA 4E0CA 3CM4A 4KWUA 1AJ2A 2PEVA 2XM2A 2DORA 3IRSA 4MLRA 4Z08A 1QK0A 1V6VA 4J3XA 1EOKA 5CJNA 3DOPA 5MKGB 3QF0A 1RAKA 4D2JA 2I5IA 3DHPA 3ZVHA 5A69A 3VD5A 3BANA 3WLSA 3L4XA 5A2CA 1XIJA 4U10A 2ISFA 3CUZA 2PWVA 3QHOA 4PZVA 3G6MA 4J28A 3G0XA 5BW6A 4HD5A 4AMAA 3DX5A 4C6QA 4LUJA 1E3ZA 2C91A 4CNSA 1XDJA 4Q8MA 1IXOA 1WBHA 3ZVIA 4Q7BA 4W7WA 2Z00A 1NQ6A 3MO4A 3P6LA 4J3WA 2INEA 2GJXB 2I5QA 3DZ1A 1HJVA 3B9DA 3LNMA 4Q8OA 2E1DA 2PZ0A 3MPGA 4LUTB 1SMDA 4Y6GA 3MMWA 4OVXA 4X60A 2VDHA 1J18A 3LPGA 1LWIA 3URQA 4KESA 5EMJA 3PVFA 2G4FA 2HISA 4JTQA 1YLVA 2FTPA 3AQUA 3DG7A 4KPLA 4O53A 3DC8A 4BFAA 4WGHA 4EPDC 3YPIA 3XISA 3GKFA 1VEPA 3KEHA 4MFDA 1SJBA 4RZBA 1W3JA 4LCRA 4GUHA 1VF8A 2D73A 2E9LA 4YTSA 2RDUA 3EA1A 5LNRA 4P7RA 4MYXA 3UXDA 4OGZA 4DJFD 4K38A 1P7TB 3L4YA 3GBDA 1L6WA 5U7SA 3QYQA 3NUKA 2GDUA 3HQ1A 1TZ7A 2D1ZA 2BY3A 2J7DA 3HGRA 1R3VA 1A5NC 4S1FA 4ATWA 3OPSA 3LY0A 3N12A 2GVEA 3K4DA 4H83A 2C19A 1XLGA 1I4NA 1PL9A 5XINA 1FKXA 1C7SA 2WSKA 5CPLA 4HQVA 4TVDA 2WZTA 1DIKA 1NF7A 3WELA 3SN4A 1N2VA 4PMDA 3U57A 3WF3A 4F9DA 2FTYA 1MW0A 1NWUA 4PRWA 4QLJA 2GJNA 1BYDA 2XVKA 2OQLA 2WM0A 3M0ZA 1WCGA 4CQ8A 4P8XA 2VC9A 2DVUA 4EK7A 2HSAA 1SO3A 5E1QA 1J9YA 4AXKA 4M6QA 4WCJA 4AZGA 3LLFA 4DWSD 1ZU8A 2V81A 3FEQA 2DFAA 1TCDA 3P67A 1MXDA 4JIEA 3OBAA 1CXFA 3CHDA 3S46A 2VX7A 2DSKA 5CZJA 1HF6A 2ZBTA 3PY2A 1EKOA 2GSHA 2H9AA 1SO4A 3A9BA 4O13A 2QUTA 3AZSA 2H8ZA 1S38A 4ZQOA 3BC9A 4CQBA 4MNJA 4Z1YA 3VNJA 3DFYA 4UZUA 1P6CA 4PUMA 3EX4A 3MBDA 4Z1DA 1FCUA 4C60A 4Q8TA 3ZYZA 1XYMA 2ZA3A 4LCSA 3NQVA 5HATA 1YYAA 4AYSA 4YLWA 3C2OA 3NOEA 2XHYA 3H8AA 5LA0A 4K68A 3B4UA 3RX3A 4KCVA 3SQLA 3P0WA 2BV9A 2V2CA 5EFDA 1EDGA 1X6UA 1DKWA 1KW1A 1XLAA 4B5TA 1GZ1A 3WF1A 5CC5A 3ELFA 1QI2A 4LUSA 2HVMA 2B81A 2DZBA 2YCKX 2R1KA 2OU4A 3VGBA 2WQDA 4URIA 1JZ7A 1UWAA 3AHTA 2HNHA 3O06A 1LQ2A 3IAPA 1EX5A 2XWDA 1FHUA 4W5ZA 2ANUA 1P4CA 1JXJA 3UJSA 4AD1A 4CN6A 3O6CA 5ABFA 3OODA 5KETA 1AQ0A 3CASA 1TR9A 2CZVA 3WLLA 2FLIA 3ARRA 2WWCA 1HKVA 1UP3A 3UG4A 3LCWA 4JIRA 3R8HA 3GIYA 3T07A 3N14A 3W76A 1TV8A 3L0KA 5TQLA 3PB0A 1XRSA 1LF1A 5F2MA 4DI8A 3GWQA 3HG4A 1AL7A 3WJXA 5MF5A 1J93A 3F4WA 3H2EA 4PTWA 5REQB 3EEGA 3A22A 2YOCA 5IDIA 3S6TA 4XX6A 3A5VA 5CGMA 4QCFA 5A8NA 2POTA 4GKLA 2PB1A 4GD0A 4B4FA 1QW8A 4MKSA 2CITA 3U8GA 2GVLA 1W56A 2VQUA 4L4PA 5BU6A 4HB7A 3AWNA 1UUOA 1JZ3A 3W38A 4QR6A 3GQYA 2H90A 1GVOA 5TNVA 4ACZB 2EPNA 4C91A 3S4TA 1SFLA 1UR8A 3BQ5A 4AVNA 4R33A 3G1RA 2D2HA 1LG1A 4H8UA 3S1VA 2FPTA 1F05A 1V6WA 1E6QM 3LHZA 1P48A 4OOZA 2XFRA 1F3XA 2A7RA 1XUUA 4J1OA 1TV5A 4AVOA 2FVMA 5DQPA 3MMTA 2QV4A 4AW7A 1W3KA 1H1NA 1Q66A 5HOSA 3WH5A 2R94A 3OQEA 5EFFA 2VFHA 4W87A 4ZODA 3SCNA 4EIVA 5AC5A 1I2RA 1ONWA 4DZIA 3LLXA 5DCEA 3SCTA 1OFDA 1EHNA 1SW0A 2GLKA 1UR3M 2HE5A 1R85A 1A3HA 3WUGA 3S8HA 1V7AA 4XBKA 4A4AA 3KFTA 1RA5A 2GOUA 4WX2A 4MFEA 2PCEA 5I79A 3JU2A 4LVAA 3OYZA 1R5YA 1KB3A 3S5ZA 1V4YA 1MYRA 3WLKX 3G8EA 5FF7A 3W7MA 3MTWA 2QJHA 2CPUA 2PURA 1ZAIA 3GTHA 5BOFA 3VDBA 1EJXC 4PEEA 1NFGA 3TTOA 1J2WA 2W92A 3IIXA 2YL8A 3ITOA 4H7ZA 4B3ZA 3P7YA 4O50A 2XH4A 3B8TA 3SIZA 4GRSA 4O16A 2VQTA 1VJSA 1ZBCA 3VVGA 1KTCA 3B0YA 4KWOA 1R2TA 1RBOB 4D6CA 1GVFA 5ABGA 2GGEA 2OO0A 2V3GA 1BHGA 1MVYA 1E9LA 3VMPA 1I1XA 2XSXA 3KCLA 1EOMA 4E2DA 5HNTA 1QHPA 1ONXA 1CW2A 3LPPA 3AS2A 4XZBA 2DUAA 2ZC8A 4NHVA 7ODCA 4Y96A 1KLYA 3EXSA 4CD7A 3QRHA 4P7QA 1LG2A 2V3DA 1PWLA 2HPIA 4NX0A 4BK9A 3CIXA 1XUZA 1XSIA 4PTDA 3NCOA 3CWHA 3WFLA 5LIWX 1BSIA 3BW3A 3AJ7A 1XG4A 4C6CA 4QJ4B 3VA8A 4GY7A 3A9IA 4ZR8A 3PTDA 4KRUA 1MEIA 3ZR5A 2G4JA 5HA7A 1QHZA 1LP6A 1R2RA 4MZ8A 3IK2A 3W7PA 4GYFA 3UEQA 1BXNA 2XIIA 3FA5A 3W7NA 4XVDA 8XIMA 3F7JA 4LBSA 1LRNA 3WO8A 3GDMA 1H51A 1RCXB 1R3TA 1UJQA 3U5YA 2YL6A 3WIJA 2JIEA 2ZADA 4ERAA 5H91A 1RK6A 2RHGA 4XD5A 2YFOA 1KO0A 3PZQA 3W7CA 2DT2A 1E6PA 3JR2A 2CIPA 3U48A 4HHLA 5I7GA 1ISZA 4GIAA 1X8CA 2QJGA 1OADA 1SSGA 3P81A 2X16A 3APTA 3SADA 1UROA 4MLJA 3NZQA 3L4UA 4W8LA 4GABA 3VD9A 1R87A 4CVUA 2B31A 1XD0A 3RO6A 2GSEA 4JQAA 1D8CA 3LMZA 3GC5A 1Q6QA 3H26A 2VXNA 4DWSB 4GPNA 1B4EA 3EX6A 1W9DM 3RR4A 3Q65A 2QNEA 4QRNA 2RH9A 3VI2A 1EB3A 1B3OA 1BYCA 4W8AA 5HWNA 3FYPA 1IWAA 2GK1A 3AYRA 3NL3A 1U2YA 2ABAA 2XZ7A 2W4XA 3OOQA 1JFXA 3V75A 1H7PA 4WY0B 3GZAA 3TTEA 4UTTC 3IJ7A 5KINA 4LV4A 1WOAA 3NQMA 5G1TA 3PUGA 1HO4A 5D38A 1M53A 2ZQ0A 4KFOA 3MI6A 2E28A 3AS1A 4RE2A 1F73A 1NDWA 4ZQNA 3EWYA 2D2OA 4L4MA 3PBUA 2P8BA 4NAFB 3N4EA 4F0SA 3LBCA 4W5UA 3PJUA 4F2BA 1ZUAX 1SFJA 3QV6A 4AD2A 3QR1A 2NVDA 1UQYA 3DFTA 4PN2A 3NQ2A 3QY8A 2AKMA 2UZ9A 1F4AA 5EGRA 5E6ZA 4H8NA 1J12A 2DZUA 3VUPA 3WLRA 4UTHA 4DNHA 3B8VA 1AODA 4E8DA 3ZSTA 1GKPA 1TKKA 5KZMA 2X7VA 1O12A 1XHGA 1GQJA 2PDLA 2Y7EA 4QDPA 1UW9A 3CHEA 3KL0A 2IQTA 4JQ3A 4ADUA 4QAWA 4QP0A 3QKEA 3B0XA 4O1BA 4FALA 4OJYA 2GPTA 4AZCB 5ECVA 4BS0A 1QOXA 1P1XA 2XVGA 3AISA 2J13A 5CPQA 3P0XA 2R24A 4GUIA 1E9YB 3TU9A 3HOJA 1BG9A 1PYMA 4NJJA 3VOHA 4JOMA 1P5BA 1ITQA 4DLMA 1HG3A 1DWHM 1P43A 3G6LA 4PMNA 3FHAA 4HPNA 4CCZA 4M82A 1Q2SA 3BPWA 3RR1A 3G3DA 5C8BB 3BURA 1NVMA 1RK5A 4IMGA 5HJLA 1I2NA 4PMJA 3KM8A 3WF4A 1KCLA 2ZICA 4MJZA 5AB3A 1Q63A 5T26A 1QTWA 2WMFA 4GFSA 3TKFA 3T2OA 1DJQA 2WHKA 3BL3A 3GG0A 1GVYA 1LRQA 3KRSA 2CCRA 3TEVA 3H4WA 2FZNA 4A8NA 4EF8A 2FZMA 1EQCA 4HCHA 4QNWA 3DEQA 2Y88A 4ZXOA 3UCQA 1QOPA 3REQA 1G1YA 2P3ZA 2REQB 4JKKA 2PD9A 3CQJA 4JDBA 3S2LA 1CECA 4B5XA 3H2OA 2BHUA 3WG6A 1TQJA 2E67A 3GZ3A 2V2DA 1DWFM 2ACUA 4DIAA 1TUXA 1GORA 3VOFA 1JQXA 3I3DA 1ZENA 3MS8A 4Z1AA 1OYAA 3E1F1 1KR1A 4PR4A 2EPHA 6ENLA 2ZWYA 2QCEA 4QJ3B 4LYRA 2RDTA 1T8QA 3V3WA 1YDOA 1GEQA 2QR6A 2MNRA 1QNPA 3ZXWA 1EJUC 1W1PA 3GH5A 4RDZA 3W2LA 3O6YX 4BEQA 4XAPA 3GXTA 7REQA 3CQ0A 3FA4A 1IEQA 1DORA 3EA3A 3MP5A 3VC5A 1JGIA 2HE8A 3H22A 3CHCA 4NUWA 4H8HA 4U33A 4B5UA 4IM4A 1ZRQA 3AO0A 3UWUA 3UZYA 4XISA 1MDLA 2ZKMX 1K8CA 3THDA 3UETA 3BJSA 2E8ZA 1X6NA 3DFSA 3GH4A 4H9VA 1W6TA 3E38A 2E3ZA 2EGZA 3MWCA 2VWSA 2W61A 5DBTA 6CGTA 1B30A 3VKBA 1XM3A 4WJ8A 2Z28A 4XO7A 3F2CA 2I14A 2ZUSA 4GX8A 4A8IA 1XH1A 3DECA 1S2UA 5C9UA 4HKPA 3C0LA 2CESA 1IT7A 3MT1A 1SSDA 4LVDA 4JDYA 3WX7A 5FJUA 1K7FA 2ZTKA 3W3OA 3KTCA 3F4CA 3KDNA 4GYPC 4O10A 5EA9A 3N4AA 4LEFA 4PTNA 3K4WA 4XD4A 4DB7A 1G67A 4V2XA 5JQ9A 1XIGA 1Z3NA 4PA8A 5LNWA 1W1TA 5DO8A 5TD4A 3VIHA 4N4PA 3LHTA 3UWEA 5I3DA 4Q4RA 3TE9A 4KW2A 4DNMA 1ZHAA 4ZZ9A 4CQDA 1XWYA 2W27A 3VIKA 1AW2A 2J66A 3EOOA 3CMFA 4RR4A 4XZNX 4QJ5B 4AIBA 1BTCA 5AYZA 3W7IA 5CGTA 1K3UA 1U1JA 5A8MA 2ZZ5A 2BVWA 1LJYA 2PAJA 4LAKA 4H9TA 1FDYA 2IMRA 1WKFA 3ICJA 3AC0A 4GNJA 4DI9A 3ABSA 2J62A 1B57A 2V6AA 4M7TA 2ZWZA 3CWNA 4OV9A 1O95A 1H61A 1W9XA 1XD1A 4DJDA 4V15A 1IR1A 1GG1A 5CPNA 1EH9A 2A3LA 4UC5A 3SUTA 3BMWA 4CU7A 1KLZA 4A2RA 3VNKA 2EJAA 3RAOA 1FBAA 2D2JA 5G2IA 3PC0A 4H2HA 3UZWA 2HVOA 1RBLA 3LPFA 3TN4A 3RLHA 4L1GA 4UFHA 1E55A 3L2MA 2YW3A 5BXPA 3E2RA 4IPIA 2PLKA 3W1UA 2ABBA 1U1UA 4UNIA 2QCMA 5I24A 2X7WA 3PBYA 4H3DA 2QXWA 2EJ1A 3IUHA 4D6EA 2OMAA 4O28A 3BG9A 4L7ZA 3OTRA 1FXPA 4GFIA 3QOMA 3SBFA 4YU1A 4AMCA 4IUGA 3GBEA 3F5LA 2ZXBA 2MANA 2E68A 2YCLA 2BODX 2WVVB 2E6AA 3EMZA 2DZTA 2CLIA 4AU0A 4F66A 3RM9A 3GX9A 1MZHA 4AQLA 2PRLA 3SCPA 3CB3A 1RCOB 1VGAA 4B91A 3FFSA 5LKYA 3ONBA 1S46A 1VYPX 4FMVA 5ABEA 2CEQA 2QDDA 3GTIA 4NAEB 4C6MA 1D2KA 2H8XA 3M64A 2VEFA 3FVMA 4GVIA 3A3WA 1EYEA 3VIOA 3TH6A 5LXEA 3TQKA 3QM3A 3GTNA 3RX2A 1UPPA 2QDEA 2PGWA 4B92A 2J8FA 1W3IA 2NSXA 2FQIA 2F61A 4LC8A 1EP2A 1ZB5A 3KXQA 3KRBA 3UT0A 1RR2A 2G5WA 2XSBA 2OZ0A 2C79A 2Z1VA 4HOZA 3D3AA 1H5VA 4MJ4A 4G7EB 5FJOA 1KFEA 1G01A 2UV8G 1WOBA 3LX9A 1O66A 4PMOA 3WH9A 4S3AA 1EDQA 2D3LA 2ZE3A 3IIZA 1HJXA 3NQGA 1TPDA 2HBVA 2PWFA 3NSNA 4L1WA 2B7NA 3M6DA 4KGJA 3EWCA 1DYSA 1TV2A 3PUDA 1A5SA 1FY6A 1Q3NA 3W29A 4AWTA 1K8YA 1SJCA 2VC7A 3VIPA 3R0UA 3VZYA 1E73M 2DP3A 1OT1A 2FIQA 2C14A 4C6OA 2PDFA 2VEGA 5DFAA 1X1NA 2YDSA 4DM2A 3GAKA 2O9OA 4HN4A 3TYBA 3K8KA 1XW8A 5FL0A 3HPZA 4GOAA 3CO8A 3WK1A 3CTTA 3MI3A 1LOSA 3IWPA 2DIJA 3GTXA 3UFYA 1NOFA 1RBAA 3USBA 5CCZA 4WIWA 1M5WA 4PSPA 4IHCA 1W37A 1YPFA 4NRRA 5FAGA 1GOMA 4MPQA 5LNSA 1UOZA 4XV0A 1K6AA 4G2DA 4PBFA 2QUVA 4DUOA 1GGOA 4F9JA 5LIUX 3UNDA 4ATLA 3PAJA 1TPEA 2BVTA 1TELA 2XVLA 4ZQRA 3M43A 1XP3A 3URNA 1R8LA 2A3AA 4GH1A 1HZYA 4C6PA 2EKCA 1LUCA 1OFAA 5AYBA 4IJRA 3R12A 1XQLA 2P88A 2PWHA 4LBRA 2PDCA 3EWDA 3T0BA 5CKSA 1ZP4A 1TTPA 2A7PA 5A6SA 4UMAA 2DJXA 3LMYA 1JI1A 3LXAA 3G5EA 4PUNA 1LT8A 1XG3A 2E0PA 2YSWA 2CLMA 4JFWA 2Y63A 3POCA 4S3FA 3UESA 3MO7A 1K4GA 1YTEA 3WQGA 3IVSA 1YADA 1LOLA 5HJXA 1E43A 4M6PA 8TIMA 1UPMB 4KFNA 2BOFX 3LHWA 4H6KA 4W89A 3GXMA 3L12A 3WN6A 3AS0A 5FF3A 3ARYA 3W25A 3CAWA 2WVTA 1Y65A 4IG2B 3WQ5A 2Y7FA 2VL4A 2WMIB 3LD5A 3LI1A 3QPZA 2RDWA 1F5ZA 3IJQA 1Q6FA 4OZOA 3CO4A 1LBMA 1ZTVA 4DBSA 4QQ3A 3TR9A 1X38A 4W84A 5I3KA 1F3WA 2GGGA 3FYYA 1VENA 3S6DA 2BX7A 4MIMA 1AL8A 2V69A 3NQDA 3VILA 3WNKA 4H1ZA 5A1AA 2WJZA 4HNVA 1O1ZA 4KRZA 4JY9A 4R27A 5I00A 2ZCGA 4LB4A 3TWBA 2PDXA 1UASA 7TAAA 3U5UA 1XKYA 3IS4A 1SJAA 2QAFA 2GYIA 2WVSA 5IBXA 1E0TA 3RCYA 3CIWA 1AW5A 1DWJM 3H2FA 1KKOA 3TR2A 3DAQA 3BAIA 3P2VA 3BQ6A 2YCIX 1UUQA 4OOUA 4B5NA 3M16A 2MUCA 2C18A 3QW4B 4JIIX 4Q8VA 4WOQA 1LRTA 4Q6XA 4F2UA 1AG1O 2OKOA 2PTYA 2V68A 1W3TA 3QMTA 1ZFJA 3CEUA 2ESCA 3LA4A 4KT2A 3HV8A 1W91A 4LUIA 3TIMA 1F7BA 4JN8A 3HPAA 4CN1A 2CYGA 2J7EA 5CSYA 2VCAA 2BXZA 2WZIA 2VI0A 3CYVA 4LQ1A 1XYLA 2WPBA 1VHNA 2ZRZA 4DUXA 1Z89A 2DIEA 2X0YA 2BS9A 3TAOA 3PK7A 4Z0SA 2DT0A 4S3EA 4PCFA 3CLMA 4ZOCA 4GI4A 3W6MA 4D6GA 1BWVA 3DGBA 2VP8A 4NJGA 3EXRA 3K30A 3CUHA 2R1NA 3R11A 1K70A 4O4VA 1FCQA 5AC7A 4UIOA 1HT6A 4Q8WA 3HZ3A 2VZVA 3NGFA 5A8PA 4IGSA 3UR7A 3LHUA 2TMDA 3HGSA 4BQ5A 3TVAA 4H41A 4HJWA 1OCNA 3R94A 3NL5A 3QTPA 2NUYA 1WPCA 2J7HA 2V67A 3GC2A 2OLAA 4O15A 5BXTA 1J11A 4M3PA 3DG3A 4ECLA 1JYNA 1A4LA 4JY8A 4R9XA 1H7OA 4C7FA 3RMEA 2E6DA 3Q37A 4JD4A 3G1YA 1HUVA 2J7CA 3F5JA 5XIMA 4Q4SA 4GIRA 4I6KA 3GFXA 1TWSA 3ZT5A 4WOZA 3C2FA 4HPGA 1G6CA 1HIZA 2BXVA 1G4TA 1U22A 2ZX6A 4L9XA 1OB0A 5F4SA 3DI0A 2OZ3A 4M51A 1X7IA 1V3KA 4S3JA 1UD8A 5AYIA 3VKKA 3I7SA 1CXHA 3N6JA 2PODA 4PBGA 1S2VA 3OGRA 4A21A 3LERA 2QCNA 4NJIA 3T8QA 3IJ6A 3V16A 3L2LA 2PBGA 5BWAA 5DLCA 2ZTJA 4A8LA 4DWSC 3ZVHB 1VIWA 3AAMA 3B8DA 3CS2A 3AYSA 4O18A 1O6IA 5HDRA 3PJXA 1HP4A 5CSUA 2V5LA 2WXDM 4U2ZA 3NVTA 4JTTA 4EVZA 4E5TA 2V3FA 1WXZA 3NR0A 2B4GA 2ACRA 1C9DA 4C90A 2OCZA 1IYXA 4E4FA 3AIVA 3MSDA 1CENA 1Y0EA 3B0PA 4Y9PA 2FYMA 3TUUA 3FX4A 1PO9A 2QJJA 2VENA 2BOGX 4OUEA 4CQCA 1H4PA 3P61A 1U33A 2BLEA 4B9YA 1DE6A 3KCOA 4UTWA 1VYRA 2XN0A 3C52A 1KTNA 1OSEA 1O68A 1LORA 4MYAA 1IT0A 3CGTA 4ATDA 2Z0IA 1ZLPA 1R9ZA 3AHXA 1NY1A 1FH9A 1XISA 1QDSA 1AD1A 3B0UX 1J2BA 3H2CA 3B8WA 2FZDA 1TJ0A 3ABQA 5IOBA 4LSBA 3MVTA 5D32A 4GZEA 1E9ZB 1FWWA 3ZWSA 5D05A 1EJRC 1R3QA 2Z1SA 3GDLA 4JIQA 3NQFA 3ZT7A 1NOWA 1C91A 3VINA 5CZTA 2FHFA 5D8WA 2PC4A 2OO6A 3HFTA 4XTIA 4TQTA 3WCZA 2A6NA 3LG3A 3H2AA 3NQCA 4UTJA 4MB5A 3OVPA 3KTXA 5KMYA 3E2SA 5CSRA 3BGAA 3GTFA 3FDKA 4K1GA 4EKJA 3BK0A 4JHZA 3DFHA 2QW5A 3C4UA 4YJ5A 1VAHA 2JKEA 2VC5A 2PTXA 1XLMA 2G95A 3M07A 4LVBA 4BQ4A 1FCVA 3T44A 1VFLA 1Q4WA 2NQZA 3AIEA 3TLQA 3BSGA 3NL6A 1V77A 2QCLA 5A6TC 3KLLA 1WZMA 2W66A 3QGAC 5CZSA 2FGLA 4JS3A 1PZ1A 2XGBA 3IIVA 1K8XA 4Z1BA 1R38A 1O5QA 4HVXA 2BG5A 3UG5A 1TA3B 4JX5A 3ITYA 4H8VA 1N8FA 2BWGA 2OEKA 4A6GA 3P8JA 4WLCA 1QAPA 3WFZA 1A0EA 3W22A 2WMKA 4YS1A 5C9RA 1PJ9A 3PUEA 1R3RA 2PSNA 5KZ6A 1EBHA 3VUSA 4H6EA 2TODA 1JYXA 4YTUA 1FWDC 1QWGA 3M47A 2YXXA 1HGWA 3QFWA 4IPNB 2OG9A 1EJ7L 1CDGA 4GY0A 1PIFA 1ME7A 3MP3A 4IMAA 4UFLA 3VTRA 4ZFMA 4O0ZA 1IEWA 2IS7A 1ICSA 3NSXA 3T42A 3N13A 5A94A 1KCXA 3RCMA 2RUSA 4PCNA 1MW2A 2EXOA 3K4AA 1NWSA 3H7UA 3B97A 1ZCOA 3SEPA 2VT0A 4Z2IA 1CBGA 5U4NA 3WEMA 1NIUA 3WDPP 1U5JA 1J5TA 2W79A 1EUAA 1WZAA 4ZOEA 4HP5A 2VCBA 3PJWA 3P80A 4TO8A 3WDIA 2HVNA 2YLLA 2WCSA 1HKWA 2AAMA 3CUJA 1JEZA 8RUCA 4H2CA 3VIIA 4O4WA 3B3DA 4US6A 3MHUA 4D72A 5D09A 1VD6A 5C2GA 4PGLA 4JTCA 1UB3A 3SRHA 3SQSA 1VBHA 4A29A 1DJYA 1WV2A 1F9CA 3BW2A 4LTSA 1ZBKA 3FXGA 4EXAA 5I0DA 4YN5A 3G0UA 1GOKA 3PPGA 1SZFA 3C0JA 1TFVA 4UQ9A 2PP0A 1W1VA 1PB0A 3EWBX 4NXSA 1LT7A 1UBPC 1BVWA 4NNBA 3W37A 3PN8A 4FXRA 4GBUA 4N9DA 3VIJA 5HQLA 3KOZA 5FACA 1J0ZA 2I17A 5F7UA 3TLLA 2J47A 4DJEA 4U31A 4FSAA 1FWNA 3M0IA 5A95A 1XH2A 3OVGA 1Z6KA 4QCEA 2XFWA 1RSCA 3H2MA 2YB1A 1TB3A 1ISWA 1W17A 4N02A 3P5YA 4UUIA 4DO7A 3NM1A 3CH9A 1KFKA 3WYZA 3LHVA 2J27A 3VC6A 3AUOA 1HNYA 3WJWA 1A47A 1EC7A 1OC6A 1OABA 3VOIA 2WNZA 1V79A 3IUIA 3SCWA 3QV8A 3WQEA 3FHQA 5F4WA 4UFMA 2R82A 2PTZA 2CKSA 1DPMA 3FIGA 4LX4A 3W71A 1G4SA 1XRTA 1Y5WA 2WZMA 4JL2A 3DYPA 1DOSA 3NQ7A 2G3NA 4TIMA 3EKGA 3B06A 1E71M 4NZFA 4DY1A 2GL5A 3EX2A 5JUVA 4AEEA 1UA7A 1H11A 5J04A 4YVVA 4ZE4A 2OX1A 3GIQA 1LLOA 4NP7A 2JALA 3DFOA 5KITA 2JK2A 5D2WA 3QVQA 2EAWA 4Q4OA 1NM9A 5AHMA 4JYFA 5A6MA 3UPWA 3HFYA 3CUFA 2V5BA 3GYCA 3WNLA 1R7OA 1TRDA 4HGXA 2Z26A 4TV5A 1XBVA 4LUYA 3MA8A 5LNUA 1XLKA 4V1XA 5J5DA 1OF8A 4S3GA 3IV8A 2PDWA 4LWWA 5DY2A 1BQGA 3UU0A 1JZ8A 4DBWA 3FDGA 2J24A 2Y62A 2VOTA 1WKEA 4JKLA 4XAFA 4EX4A 3L4TA 1WBJA 4JFUA 4QE5A 4ZO9A 4XAGA 4F2TA 2GUUA 3VO0A 3IJIA 4UTUA 3FA3A 3PAOA 1IGWA 2P3EA 2WHLA 2NSOA 4AHQA 1E4NA 1J0IA 4JYEA 2Q8XA 4UQCA 1O5KA 2I16A 2PF8A 4UTMA 2OGYA 4W4QA 2PI6A 3DU0A 4S2CA 4ZQMA 3GNXA 4WR3A 4IQJA 3DG6A 3SW6A 3O2LA 4EXQA 3TW7A 5C55A 3E02A 1IWPA 2WNNA 3M9YA 5JVLA 1QASA 1PBGA 3ANUA 4YCPA 3BAWA 3PNZA 2ZA2A 1TYGA 1BF6A 2QCHA 2PLJA 5EMKA 3O63A 1P0DA 5DBUA 3THQA 4UQDA 3QHNA 1F2JA 1JDAA 2DGAA 3NPVA 2INZA 3LCGA 4JTKA 3N2BA 4RLIA 4QDWA 4EPKA 3P3BA 1Y8BA 1FKWA 3BDKA 3CL8A 3NPWA 3ANVA 2Q8LA 4DWDA 2DZVA 2QUNA 4IX0A 4JICA 1UCWA 5HNRA 1RP9A 3I4EA 3ZJKA 4F3HA 4L6OA 4AVFA 2NXHA 3IVTA 5IXEA 4C1NA 4OE7A 1ZPTA 3NA8A 4MTVA 2HTMA 1M03A 4DHGA 3U2CA 4N6EA 4Q8QA 5CPOA 4RNFA 1JCYA 3T0AA 3VU2A 3DUGA 3H55A 4UNKA 4IQDA 2YL5A 5EMUA 1L6YA 1E5JA 2ZXAA 3EX3A 3T9PA 4ZVJA 1PKYA 4G5DA 3K1DA 3M7SA 2WBGA 3MJMA 4LPCA 4O1EA 1R7AA 2QJMA 2VFDA 3WBWA 5D8ZA 4BHYA 5D2XA 3V0UA 4AWUA 3ECQA 4S3CA 3IJ8A 3AI0A 1BGGA 1ZCCA 1N8WA 3CU2A 1W1YA 1B0IA 4WUIA 2G41A 3QPYA 2IKHA 4JTUA 3WUFA 1WDDA 4FS9A 5HBFA 2WKGA 2BASA 1QATA 2WSPA 3V1HA 2GWNA 1KV8A 4HOWA 4RV3A 1V3JA 1JGMA 4GQBA 4IF2A 1OEPA 4JTEA 3TQ0A 2DIKA 3DESA 5HMEA 1RQHA 2FB2A 1JUEA 2YX0A 1PDZA 4M0XA 1VQTA 4GC4A 1P6BA 1GEHA 2HXTA 1M7PA 1G4PA 3PB2A 3GVQA 4IXXA 3UJ2A 2VX5A 1J96A 4D9PA 4MWAA 3S42A 1HKMA 5D9PA 4F8XA 3RN6A 4ZO6A 1HX0A 1D9EA 4LAOA 1QMLA 4P7NA 3RCNA 3T7VA 3VPLA 4ORIA 4DZ5A 3HPSA 3EPOA 2EBNA 5JBFA 2A0NA 2VZOA 2NT1A 2PGFA 1OQFA 1GVIA 4J3VA 2VOMA 4CNTA 1S1PA 5C70A 2RFGA 2WMJA 5D04C 2C13A 4RUBA 5C71A 5HUPA 1H7WA 3W70A 4FF5A 3USZA 3NQEA 4CU8A 3OBEA 1UMLA 1QBAA 2VNCA 2EF9A 2ZZ2A 2QF8A 3O6AA 2D0FA 1XIEA 1XFBA 3VKDA 5BCAA 4A8RA 3SRKA 2ZC1A 3HTWA 4H00A 4HA1A 4EWND 5HPCA 3HQPA 4DO5A 1KGXA 3LN3A 3ITTA 4JTGA 3PS7A 1YPXA 4E3TA 2OQYA 1ZNNA 3M6YA 4KRTA 1DIOA 5HMSA 2VUNA 2Y89A 5LIYX 1OZMA 1F3TA 3N29A 1QFEA 2YR1A 3U3HA 2XJ7A 3PTMA 3WBAA 4YWSA 1HJUA 1A5CA 3SFKA 5MKGA 3UGRA 4HK6A 5K9XA 5HR6A 3MDUA 3WFAA 2OZTA 3GW0A 4UQAA 4UOZA 4GI8A 5H2ZA 4QSHA 1S2TA 4HT3A 5EMMA 3HGOA 1B3XA 3N9RA 2IKIA 2VGBA 3W4RA 3CZGA 2GQ8A 1FQ0A 1Z69A 2XVNA 2WBKA 1ZZMA 2QPSA 5E70A 3BXWA 2AQWA 3ATYA 2CLPA 2F38A 4O1AA 4C6KA 2WHMA 2GJXA 3AWOA 1DIDA 2WJFA 2UY5A 4F0KA 4IGNA 3EOUA 4JPGA 5AECA 3IJLA 1PZ2A 4AX7A 5FEPA 3ATZA 3U4AA 3PNUA 4KCWA 4RDYA 2ISWA 4UR7A 1Z44A 2HK0A 1HL8A 5F2GA 1EFZA 2FPYA 3IPWA 4KCUA 4GK8A 4PCSA 3LCXA 2V5JA 1XH0A 3L68A 2PWDA 1OG6A 2BDQA 4DPPA 1QT1A 2XM1A 3R8RA 1FUYA 3SCQA 3PWAA 1E40A 3W02A 1VKFA 1LQ0A 3PWIA 1XYCA 4GXPA 3VKAA 3ZR6A 3QMSA 2A3EA 3MBFA 1PWMA 3W0KA 3GO2A 2AMXA 2OSWA 4GQQA 1MI3A 3CPUA 4C6DA 1XIHA 1P7TA 4C5ZA 5AY7A 4PTXA 4C6BA 2ZX9A 5I77A 3TA9A 4U5KA 1CWYA 3MDWA 1BF2A 1M01A 5CPSA 2UWFA 5B7ZA 1FHLA 3BLFA 2QDGA 1HO1A 5I02A 2RJGA 1NWTA 2V30A 1F8IA 2H3DA 2OELA 2DZWA 3GE7A 4GINA 2FZ8A 3TROA 2OEJA 4E4UA 1US2A 1GOIA 4DZAA 4S39A 2J79A 2BGQA 3R7MA 4V1YA 3DHUA 3WD4A 1EJWC 1MRQA 4KEVA 4QNEA 2XIMA 1M7JA 1I8JA 2OT0A 1W5QA 4P8VA 3ALGA 2Y5EA 3MYOA 2TPSA 3THAA 3DDMA 3APYA 3UJFA 3B8IA 3KOYA 3TQVA 2Z2AA 5DXXA 3G1HA 5HNNA 2C1GA 4IJBA 1Z32X 1C8QA 4FNRA 5GJNA 3W87A 1US0A 4R3UA 3TOYA 1GUVA 1OK4A 2QPXA 4AEFA 1L6GA 3T55A 4F4RA 4N9EA 3CUXA 5E09A 1ICQA 3ARPA 1DE5A 2PDJA 3SI9A 3RILA 1Y5VA 4L6DA 5CLTA 3WMCA 1RXOB 4B4HA 1XYZA 3L66A 4DX3A 1VLWA 3F4DA 4FNUA 3KP1A 4ZB2A 4LU0A 4NIRA 4CEUC 3C3NA 1V8EA 3W7KA 4GISA 4GCAA 4YTQA 1JCMP 1QNQA 1GKRA 4K8HA 5DMYA 1XIBA 1G0CA 4FF7A 1ITXA 1RP8A 1W5NA 3UCDA 3AZTA 3A3HA 1J10A 3K46A 4BEUA 1V3HA 3FAXA 1XLBA 5A8GA 2JF6A 3W7QA 2O9TA 3I10A 4AHOA 3OJGA 3I7RA 1YXDA 1S5NA 3CH0A 2W63A 4QLKA 3K2GA 2RKXA 1JDFA 4G1NA 3EKZA 4ICNA 2DW6A 1UR4A 1A3XA 4RX0A 1W9UA 1WDPA 3KW3A 3SGGA 4F0HA 5A6JA 2RGLA 1R3WA 1UZ4A 3VNZA 3EDEA 3S2MA 1ONRA 3WL1A 3BAXA 4NF7A 1QBBA 5FJIA 3EAUA 4OBSA 2TSYA 3TW9A 4FLRA 3BLIA 4I6VA 2BP1A 2HPMA 3WDQA 1TWZA 1NDYA 1UR9A 4AUBA 1UR1A 3THCA 4D6JA 3EDFA 3MU7A 4ZO8A 1TPC1 3VDCA 3MYPA 1C8XA 1SZGA 3Q67A 1SQ7A 4H7CA 3GXFA 3PZOA 3L7RA 3KOXA 2Y24A 3SN0A 5K2ZA 3C56A 3GYEA 5DMNA 4NG3A 2W6RA 1FWCC 5LHFA 2VM8A 1CGUA 3IGHX 5FKYA 1VHCA 2HNEA 4HHMA 3AYTA 3RM8A 3W26A 2IPJA 1E1FA 1T5AA 4XK2A 4JNYA 2UY2A 1KKRA 5M1TA 4ACZA 2NV2A 4B16A 3E0LA 3SB0A 4RDVA 4DPQA 4WD0A 1B3ZA 1E6RA 2Q8ZA 3RJYA 1VJIA 5EB8A 1DP0A 4NZ4A 3I6RA 4DXVA 5HK4A 4C6JA 3URBA 1Z48A 3CK5A 3TXZA 4K37A 4XKYA 3W84A 3TA6A 3VGGA 1UIPA 3L4WA 3FSUA 3OHMB 4UWMA 3S5SA 2AL2B 2HDJA 2E9BA 3OBKA 1XF0A 4HZ6A 3O6DA 1UBSA 1YE4A 1HVXA 4JBRA 4P61A 3R4IA 1NSJA 4HU3A 4JTFA 4FX7A 1B1YA 4KWSA 3E2VA 1WZKA 2UY3A 5BYWA 3S3GA 3WQOA 3CC1A 5IHRA 1PXGA 1KRCC 1FWSA 4C1LA 3GUGA 5D4YA 4ZL1A 4UOQA 3CV2A 1Q4NX 3GDTA 3W7JA 2O92A 3BSMA 4O8AA 5HWMA 1PX3A 5BMWA 1VBGA 2BVDA 3H54A 5B7YA 4CKQA 4J3ZA 1WYIA 2PDMA 3THUA 4ZMGA 4UCFA 1JXKA 1XLDA 3G1XA 5HULA 4GQGA 1ECEA 1PTAA 4HA0A 4A3QA 4ZENA 2YA1A 2P8CA 3ABRA 1YNQA 3MP4A 1NWRA 2Y8KA 2PU0A 5F2IA 4MKNA 3MV01 3W88A 4YTTA 1CIUA 5DCDA 3W2NA 2F6UA 1V03A 1TTQA 1ZY9A 4HK5A 3JZUA 3TAKA 2WWDA 4OBRA 3TN5A 3VOCA 3QHMA 1MUMA 4S23A 5FSEC 2DQWA 3V1PA 3DKJA 4I9JA 3PZVA 2WMGA 4ADTA 4S3BA 4REQB 4O1CA 4JTSA 1FOBA 1N8IA 1HL2A 3N3MA 2VEKA 4JX6A 5EBAA 3UVAA 5HJYA 4QEEA 1IEIA 3N4FA 5T91A 1R0MA 2JIWA 4DYEA 3DERA 5D37A 4FX8A 1RLDA 2ZRUA 3OGVA 4AZHA 4BKNA 5JXQA 4C6NA 1SUXA 3WK3A 2Y7GA 4HPXA 1J01A 4D1IA 2YGYA 3PZNA 2NW0A 5M17A 1OINA 3LNPA 1PX8A 3D47A 4DJFA 2P0IA 4INFA 4A22A 3F4VA 3EWZA 1E15A 3TXVA 4MJ2A 3ZWTA 3DYOA 2X2YA 3GFYA 1V0LA 1FX6A 1UHVA 2NWSA 1J8VA 2AQVA 3TZFA 4GNVA 2EG8A 4KIRA 3RDKA 2QPUA 1DQUA 4ROQA 2OYLA 1PPIA 4GG9A 4WKAA 2QMJA 2V2HA 4IP5A 3SY1A 4PTMA 1B2YA 4JAWA 1Q6GA 2D24A 2EQDA 3ONCA 5JH2A 1OVDA 4FB7A 1FWHC 4FLOA 3TWAA 1W3LA 2PE4A 4H6QA 5CC7A 2GWGA 2GGJA 1FDZA 3ARQA 2PCQA 5GNZA 4CQ9A 1LQAA 1Z7AA 1RLCL 3QSTA 3FGCB 1GW9A 4A3YA 2PTWA 2PWGA 4CD8A 2NX1A 4BI5A 3M4HA 4O11A 5I3JA 4J40A 2BTMA 5KZDA 4MMWA 2CFFA 1W3NA 3IVUA 1PUDA 1H1ZA 2PGRA 3RXZA 2NUXA 4TX9A 2P50A 2Q01A 2GSJA 3D0CA 4JEQA 3U2ZA 4MGGA 3W72A 3W6YA 4MPKA 4JX4A 1GKQA 4DJED 1S3HA 1VZWA 4O54A 3PANA 3Q94A 4ALDA 5I78A 3OP2A 2ZUMA 4WY0F 2OSYA 4AC7C 4FOKA 4P8WA 2X1RA 2PFHA 4ICCX 1Q6EA 1SVDA 4E8GA 3OW1A 4IICA 1CXIA 1E70M 2X1SA 1S2WA 2QHAA 2ZIDA 3JS3A 5LA2A 1ME9A 1A80A 1S5VA 1KBKA 1T96A 4NAFA 1GYLA 4Q4PA 4NASA 3BW4A 4TMBA 3KRUA 3E0FA 3KWSA 2WC3A 1NU5A 4MAVA 4I90A 1EP3A 3PPFA 1UWRA 2CBVA 4N9BA 3N9KA 3CLWA 1X1ZA 3T81A 3NIYA 2HJPA 3MKVA 4XD3A 1Q8AA 3S9YA 4LOCA 5I09A 1XI3A 1W1IE 3RLUA 3VNIA 4HYWA 3GVGA 3BLEA 3BV7A 3WNPA 1E4MM 3NEHA 1OGBA 1OX5A 5EPDA 3DKLA 3TONA 3MUIA 2OVLA 4AAJA 3CAQA 1TG7A 4B15A 3HPXA 3WLHA 1XFCA 3H12A 4UCGA 1R2SA 1NDVA 4FHAA 3E0WA 4AZCA 2CZDA 4OUIA 3W7LA 5T9BG 1JUBA 5B80A 1JCNA 2PD5A 1O94A 4HTBA 3RLVA 7PTDA 4IMFA 1WB0A 4CD4A 4GIYA 1X6LA 1S5MA 2ZRYA 3LGDA 3NVDA 2WSRA 5HPOA 3HM7A 1U1HA 1GNXA 3EMQA 1PTDA 1KQZA 3AU6A 5BWFA 1R86A 1VFUA 3S1GA 4OECA 5HINA 2VFGA 4RPQA 2Z29A 4IXHA 4IWWA 1AQHA 3O0KA 1NAL1 1QPOA 5EMLA 3OU8A 3IGSA 1BXBA 4WSHA 2RDXA 2YZ5A 3NDZA 2X2GA 2P0OA 1WDQA 1XSKA 4WJXA 2X41A 3WD1A 3DENA 4GY1A 4W86A 4H9MA 5JH1A 3PULA 1QWKA 4L1XA 5CBBA 2OWCA 1L2UA 2PWUA 3LQLA 4RE0A 1AZ2A 4BCEA 1AD4A 1JUKA 1TE1A 4U5IA 2Z2UA 2E77A 2CLOA 3F4NA 3BV4A 1ITUA 1CPUA 3BCDA 2PA6A 1OX6A 1OFBA 3TYDA 5D9MA 3UWWA 2FH8A 4Y8FA 1ZAHA 2PP1A 2QV5A 1JZ5A 4AD5A 1ITCA 2ZX8A 3S1WA 2REQA 4GUGA 3GVVA 1JCLA 3WL0A 1YBQB 2VFIA 4MOZA 1NDZA 3IIOA 3MHGA 4BWLA 3VCRA 3R13A 4D8LA 2DEPA 2VCCA 1KXTA 3LRMA 1VB9A 4H9UA 1KFLA 5G1YA 2AGTA 2CBIA 3AMCA 3W82A 3EOSA 3KWXA 3ZS4A 1FXQA 5C9WA 2FJUB 4JQ2A 5K4XA 3LSCA 3URAA 3QC0A 4MNMA 1SR0A 2V5KA 5DX7A 3L67A 2PDUA 4PE8A 3MC5A 1V02A 3WJSA 3C2YA 1QR7A 2VWTA 5C6MA 2WB5A 3S47A 3SCRA 2DZXA 4I9MA 1PIIA 1W3HA 4ZB0A 1DEDA 2EEXA 1TCMA 3CMGA 4M1RA 2WC4A 4Q7NA 2QJIA 2GDVA 3A6OA 1IIHA 5JIPA 5IHSA 2ICSA 3BLKA 3WH6A 1A49A 1H3GA 2IXUA 4Z17A 2PDYA 1GWJA 4ORMA 2FJKA 5D2VA 3WBYA 3L23A 5AN7A 1V3MA 1JL8A 1W9VA 3E6EA 4WSJA 1A5KC 2L5HA 2W9MA 3CV1A 4O19A 4Q8UA 2GDQA 2YDQA 1JQVA 2EPLX 4WQ6A 1HQTA 1H50A 1CCWB 2NX9A 4BQ2A 1KTBA 3EGJA 1HJSA 1M68A 3L4VA 3NPUA 3PP7A 1CX9A 3WDJA 2E5CA 4ML9A 3I3EA 4PMYA 4XZHA 2JBMA 4HBKA 4CVWA 3PBWA 4XWUA 3QMRA 3CQKA 1XL9A 3BMXA 4WDXA 5CG0A 4KEZA 3L4ZA 1CGWA 1Z42A 2XINA 4RJEA 4CUCA 1GT8A 2NT0A 3KHJA 1CLVA 5A3HA 2QGYA 1I60A 2NVCA 5K7JA 1WUEA 1E9IA 2ATSA 2I57A 2E5DA 4ZSUA 2PDQA 4MVAA 3T2QA 3WNMA 1H2JA 2FHCA 3RYSA 1WKDA 6TIMA 2FMNA 3W7RA 3W1RA 1CGTA 3LSBA 4IFOA 1F6YA 3C86A 1VRXA 4N2YA 1UOKA 3J7HA 1A5BA 4UQEA 1Q5MA 1F4HA 3NSMA 4NJKA 2ZRWA 3WD0A 2A79A 4LAZA 3IGUA 2D0HA 3OHIA 1EEXA 2QIWA 4PCPA 1BEUA 1C92A 2RAGA 1L8NA 3PFMA 1TJPA 4EOUA 2Z27A 3HPFA 3I3BA 3CPRA 1VEOA 3ERPA 1AH4A 2CNCA 4UTLA 2DSUA 5DY3A 3GXPA 4HNOA 2FZBA 4MWAD 5F4XA 4R53A 3NJ3A 3KVLA 3HV9A 2GQAA 1JFHA 1LL6A 1C8YA 1UIOA 4IGHA 3W1XA 3OG3A 1IXPA 3ZJ6A 3BG5A 2VHLA 4K2SA 3MCOA 4TVCA 4GYKA 4AZ6A 3BE7A 1DQWA 4YIWA 1LWJA 4K39A 3B9NA 3GW3A 3D3FA 3IIPA 2WW5A 2BMBA 3STFA 4FR6A 5CGQA 2VEPA 1BQCA 4ROPA 4H19A 4I3GA 1TO3A 4JTRA 4QSFA 1L9WA 3OLIA 3WLPA 3GM8A 3F2DA 4I8DA 3AMKA 1D7KA 2NQ9A 5BNKA 4RNIA 4G6CA 3SY8A 3P8IA 8XIAA 2XG9A 3GG1A 4IP4A 1WE5A 2C1HA 2ZOXA 3M0MA 3HA1A 3ZIZA 1KRMA 3CL7A 3HN3A 3QZAA 3NURA 2BVYA 5AYYA 3GLCA 3QOKA 2DU2A 5J5RA 1T8XA 2CERA 3QLLA 3BAYA 3GB6A 4E4PA 1XJBA 2EHHA 2X42A 3M46A 1JAEA 3W1AA 2Y5SA 4RZ4A 4JFTA 2VELA 2VR5A 3WLIA 3DFNA 3LDVA 2F8QA 3WF0A 1POJA 2WYSA 1EF3A 3N6HA 2WVVA 2YBVA 4BZYA 4JHOA 3GHSA 3GRIA 2OLSA 2FGBA 3PJTA 3A4JA 1B90A 4ZOBA 1GQIA 1K7EA 5EU9A 5IM51 4DYKA 3K13A 5F2LA 3M5ZA 1H7NA 4NXKA 5BZAA 1TPH1 4GCXA 2VFEA 4NAEA 2OODA 3RRXA 3S1UA 1E6ZA 3MKKA 3T1GA 2R9RA 4F0MA 3EB2A 4Z2KA 1TVLA 5XIAA 2CW6A 2J9ZA 3MVIA 2VZUA 4GUFA 1BKSA 5EMYA 2HXUA 2ZFAA 1XLFA 3KTSA 4E2BA 4FP1A 5G2HA 4LAUA 2PLCA 2OGJA 1XBYA 3TJXA 3MW7A 2DJLA 1E6XM 4HNLA 4M24A 5BMXA 4A35A 1S5WA 4F0LA 3B03A 4G7EA 2W5FA 2OX4A 3AROA 2ALRA 5FESA 4NNAA 1M9HA 2JEPA 1Z8AA 1LBLA 3ZJ7A 2V5CA 1T0OA 1H7XA 1C29A 3PHAA 4TV6A 1IF2A 3SN1A 4Q7IA 3VE7A 3VGDA 3L9CA 2GVGA 2Z1KA 2B7QA 4L80A 1Q6LA 3OZPA 3Q4DA 2HBXA 1PIGA 4QROA 5H8MA 2FTWA 4V28A 2Y5JA 5C5YA 4L64A 3H4XA 4DJDC 3VDHA 3JVAA 1X1OA 3PBGA 1OX4B 1US3A 5IFPA 5ABHA 2XH0A 4KBXA 4DZHA 3VIMA 1YMYA 1XGEA 3UW6A 3VMOA 2YA2A 1EBGA 4IPLA 1QNSA 5DMLA 5A6AA 1U83A 3MUAA 2Q09A 1FRBA 3N18A 3AU2A 2VUYA 3KRZA 4J2MA 1YDNA 1WAUA 4FX6M 4MWAE 3PF3A 1SJDA 1HP5A 1OCQA 3S5YA 5CJMA 1L6FA 3D6NA 1B3VA 5F1UA 3ARXA 2C1IA 3MQTA 1D3HA 2WANA 1WUFA 4AF0B 3WF2A 5C2XA 2FDMA 4UB9A 4FNPA 4UMCA 1T7LA 3VKCA 4LXFA 2FMOA 5AZ1A 4X3ZA 3W1NA 1KQYA 4JEJA 1HKIA 3WKZA 4HMEA 4RE3A 5L9FA 4RK8A 4AISA 3GDKA 2JEQA 2PPGA 1C93A 2PC8A 1W32A 2OLHA 1CYGA 4TU1A 2X0SA 4LRTA 3ALFA 2XYLA 3KOFA 4QG9A 3ZFHA 3AJXA 3VNDA 1CTNA 2CLKA 2VX6A 5I3HA 3W2MA 3UJEA 2PWEA 3N6QA 4MB4A 3KUMA 4ZXLA 2BHZA 3KVMA 4JZ5A 3EPMA 4H9XA 2ZUNA 5I3FA 1H09A 4YWIA 1EJSC 1E6SM 5HQEA 1DJGA 3BOXA 4IG2A 1XICA 2WMIA 3G3MA 1JJKA 4OQVA 3ZMRA 4JTHA 4XUYA 3I7QA 1EWEA 3CZ8A 3QXBA 3N34A 4P8UA 1PHWA 1UR2A 4U3AA 1B3YA 4E8CA 3G2GA 1G94A 1UH3A 3LGGA 4WGXA 1QW7A 1A5UA 4FI4A 2G3FA 4AWSA 3EDKA 3VIFA 3U6WA 1UD4A 3MV11 3VYLA 3TW6A 4XO6A 3AHVA 4M80A 1KCZA 4ZO7A 4KERA 3W23A 3UA4A 3VABA 4XTDA 3GU9A 3S2NA 1JD7A 1CNVA 1KXQA 2WSQA 3FNDA 2ACSA 2XIQA 1VFSA 5A6BA 2OFJA 4A3RA 2O4QA 3OEXA 3ITCA 4ZB5A 3WDHA 1OWQA 3RU8X 2RJHA 4W85A 3UZXA 3WBEA 4OKDA 3NQ6A 2UY4A 1LCOA 5CZ0A 4PUJA 2E1WA 1UG6A 3G77A 2WAGA 4GJ1A 2XIBA 3BZJA 4Y9MA 5BXRA 1I0DA 1RV8A 4IL2A 1VBUA 1RD5A 1GTEA 1WQ5A 1BYBA 3H7RA 3B8SA 2X0HA 1E0XA 2VGIA 4Q4KA 2VD9A 4QJ1A 3LOTA 3LCHA 4MWAB 1HJWA 4NY2A 1P0EA 2ZZ6A 4HMNA 1SO5A 3CIVA 4OHQA 2OXNA 3GIPA 2Z1XA 5CBIA 2XUCA 3AXKA 3G24A 4AZ7A 4J5NA 5JMUA 5FJPA 3A13A 1Q45A 1M04A 4YMZA 4FOJA 1GVSA 5I3IA 1IEVA 3RITA 4ZFCA 1SO6A 5FCZA 3CHVA 2A21A 4AD4A 4QG6A 1V6YA 1YHTA 2C6QA 1CT5A 5EBUA 4GE8A 4O17A 3BGJA 3GDRA 3VM5A 3B9AA 4DAIA 3NG3A 4F0RA 1GG0A 4L65A 3N2XA 3CV7A 4LNCA 4KIEA 4KS0A 2NXGA 4C7DA 1MSSA 2D0GA 1MDRA 3SSZA 4B5VA 2FFIA 2JE8A 1R30A 1KXHA 1MUWA 2XN1A 1NELA 3T6CA 4HYRA 2DVTA 2G8ZA 3TNBA 4GX9A 5BOEA 1Y5XA 3TP4A 2PGEA 5ENLA 3C2VA 1XYAA 3QQ1A 2QVHA 4JGDA 4AHPA 2DV0A 4ZQCA 4NZ1A 5IBXC 1NP0A 4GIEA 2AMGA 3AUJA 4JFSA 4GGHA 4IUOA 1R46A 2VFFA 3UWZA 2FFCA 2GQ9A 1E51A 1GVRA 3R79A 4EAMA 2A1YA 1UKTA 3P60A 1EEPA 5A5WA 5G4HC 5GQBA 3SCVA 3W74A 3SR7A 3O8AA 4MF4A 2DH3A 2J75A 4I9AA 4RDWA 2KZHA 4DQWA 1KD0A 1EHAA 1UZDA 1HKJA 3TSMA 3EWWA 2C8NA 5A6KA 1J0KA 4PUWA 4MB3A 4PMXA 3L5LA 4X9YA 2QQ6A 4Q8NA 3LXBA 1V3IA 1REQA 2VO5A 1I6NA 4BJHA 3UR8A 4O1DA 3AIRA 3SUUA 4M5PA 3APGA 3RUBL 3ITLA 5AHNA 1O7AA 5JIWA 1NFBA 1WP6A 1ZSXA 4CN4A 3UVIA 3LUTA 1DHKA 3N2CA 4RL3A 1UD6A 4NJHA 3VCNA 2A3BA 2VRQA 3S5OA 3PBMA 2QGHA 2CWXA 3FSTA 4K36A 2FPVA 2Z1BA 1V3LA 4FNTA 3VZZA 2A6LA 3LTPA 4Q32A 3ZM8A 1XSJA 2C71A 2H6RA 5CXPA 1Q6OA 3V4BA 2NQJA 2XIOA 4L5ZA 4DN1A 1AK5A 4BR1A 4DLFA 3QTGA 1K03A 5LSMA 3OQ8A 2WQPA 3JUGA 4QFUA 5LNVA 2Q6ZA 3ABZA 3C61A 3FJ6A 3MSRA 4PL1A 2VEMA 3EOEA 3GVWA 3POHA 1BRLB 3UPBA 3GR8A 4BI6A 2ODOA 3N17A 1ADDA 4QEHA 3C8NA 1XQKA 4C6LA 2XH7A 6REQB 2Q71A 4TTGA 4LS1A 3N2TA 1A3WA 1TPB1 4EF9A 2G97A 2QDHA 4OIFA 3KVJA 4UFKA 1E1CB 1JD9A 1QI5A 4PUDA 4LCQA 4JN7A 3V5FA 3T8LA 3SCUA 5H8PA 2OT1A 2XSAA 1XPYA 1EO5A 4HTYA 4QE1A 4PFHA 3KBNA 3E96A 2PDBA 1KBLA 4L56A 1XYBA