4NIRA

Crystal structure of b. anthracis dhps with compound 6: 3-[6-(trifluoromethyl)-1h-benzimidazol-2-yl]propan-1-ol
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
274
structure length
274
Chain Sequence
b'MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate Synthase
publication title Identification and characterization of an allosteric inhibitory site on dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase/transferase inhibitor
total genus 102
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4nirA00
2Y5JA 2Y0FA 1F6YA 1AD1A 3H2OA 3TYEA 4C1NA 1TX2A 3H26A 1Q8AA 3TYCA 1AD4A 2OGYA 4S3CA 4DJEA 2DQWA 2E7FA 2YCJA 3H21A 5JQ9A 4O0QA 4NHVA 3TZFA 2BMBA 3TYZA 3V5OA 3H2FA 3NOYA 4DJED 3H2NA 2VEGA 1TWSA 4C1NB 4S38A 3TYBA 3K13A 3TR9A 4O1FA 2YCLB 2H9AB 3TYAA 4D8AA 4NL1A 4DJFD 1Q85A 4MWAA 4NIRA 4DJEC 1Q7QA 4DAFA 1AJ0A 4S39A 3TZNA 3H2EA 3H2AA 4MWAE 3TYUA 1AJ2A 4S3BA 4DJFA 2DZBA 4MWAD 1TWZA 1EYEA 4PZVA 4G9PA 3H2MA 3BOLA 1TWWA 2VEFA 3H22A 3H24A 4DJFC 2YCIX 1Q7MA 3TYDA 4DJDA 1Q8JA 3H2CA 2DZAA 4CCZA 3MCMA 1TX0A 4DJDC 4MWAC 4D9PA 4DJDD 3H23A 2YCLA 2YCKX 4S3DA 2H9AA 4S3FA 4DAIA 4S23A 1AJZA 1Q7ZA 4O1EA 4D8ZA 2VP8A 4S3EA 3MCOA 4S3AA 4NILA 4MWAB 3MCNA 2Y5SA 4DB7A 3BOFA 4HB7A
chains in the Genus database with same CATH superfamily
1J0KA 2Y0FA 1ZENA 1VFOA 3AIBA 1CPUA 2GDQA 2F2HA 5IDIA 3NQVA 2WKGA 4LVDA 3LX9A 5A6KA 4ZSTA 1YPXA 1L6WA 3BUVA 1UR8A 3NO1A 5CGMA 1XDJA 3VGEA 1UR1A 1B9ZA 1WPCA 4LH8A 2I5GA 1RJQA 3HTWA 1V6WA 1ISVA 1XPGA 1UR0A 4JOMA 4GHRA 1NAL1 3SCNA 3NQ7A 1G1YA 4HJFA 1YTEA 1HVQA 1X97A 3QSRA 4O13A 4LXFA 1I60A 2JF6A 1DYSA 2Z25A 1QW9A 2CIPA 4NAEB 3TOYA 4DXVA 3AU2A 2VFHA 1OX5A 4FX6M 1QPQA 3UG3A 3VFCA 3UG5A 3M0KA 2CHRA 2GSHA 4HPHA 4YMZA 1C8YA 4E8GA 3CEPA 1Q8JA 1VP5A 1A4MA 4GO9A 5AC6A 1V79A 3UA4A 3WDHA 2CZFA 1PHWA 3KRZA 4QGCA 3FVDA 1QK2A 2JF7A 2XH4A 1JI1A 3RF9A 5IFPA 1TTPA 1M3UA 1XLFA 1V0MA 1E56A 3D3AA 4LB3A 3WYZA 4NZFA 2YA2A 1B30A 1JL8A 3NL2A 3RGTA 2NWSA 3PUDA 1A5BA 3GU2A 4L4MA 2H8XA 4E3TA 1JI2A 4LW7A 4YWIA 4HZMA 1M5WA 3ZT6A 5FAJA 4JKKA 1ZJAA 5AYBA 3QBUA 4J28A 3W81A 4B5UA 5CZKA 4DJFD 2VC5A 3QF0A 4ERIA 3CC1A 3VIFA 1CYGA 3ZOAA 1ZALA 3BCDA 1T0OA 3U2EA 2YPIA 1W9BM 5I02A 1X39A 1S2WA 2DORA 1PEZA 1X8FA 1TA3B 2VC9A 1YE4A 1ZAJA 1IT0A 4GFSA 3C2VA 3DI1A 4HK5A 4QAIA 1AODA 4IZGA 2QPUA 1LORA 4DF0A 2QIWA 1A80A 4O12A 3E0IA 1TJ1A 3RO6A 1TWDA 1FFQA 4KGLA 2XGIA 4QP0A 3URNA 3M64A 1UZ1A 1J0IA 4DY1A 3ARUA 4OWGA 4H41A 3OIHA 3KLLA 1TPUA 4NSBA 3WK1A 2W66A 3KRSA 2BWGA 2G3IA 1R9XA 3VIHA 1DORA 3E12A 4MKNA 5I09A 5DT7A 4Z1CA 1BFNA 4O11A 1PKMA 2OKTA 1YX1A 4PYSA 1NM9A 2OT1A 3HPXA 4M29A 3IVTA 3WH5A 3FJ4A 1UA7A 3T0TA 1VYRA 1JPIA 1TV2A 1UZHA 4E2VA 1ZU8A 3PZNA 2IPWA 2Q01A 4LJ3A 2J77A 2VYOA 1VR6A 2XVGA 4KERA 4EAMA 1W5NA 3DHPA 3TFXA 4KFOA 3WLIA 3P82A 5FJTA 3UCQA 2XDFA 1L6FA 1UKTA 2CBUA 4CNPA 3EDEA 1ADDA 1KFKA 1QI5A 1HL8A 4MY1A 3G2GA 1TG7A 3MDWA 6ENLA 4OOZA 2JE8A 1JYVA 1PS9A 1NDWA 5CPLA 1FCVA 2HS8A 3VGFA 1ZZMA 1UROA 3IANA 1JAEA 1EPXA 3DBNA 4ORIA 4KEZA 3C2YA 4FMVA 5BXPA 1BF2A 2Z1SA 3R8HA 4GQQA 3AIUA 2DSWA 3I3DA 2EPHA 4D8ZA 4WJ8A 3M0ZA 4S3EA 4DM2A 2IQ0A 3EMZA 1W5PA 4F9JA 1QXLA 3ZJ6A 3CQ0A 3Q37A 4FALA 2J6XA 4F66A 4CKQA 4IUGA 3WL0A 3RPDA 2Z24A 4HU4A 1R47A 1S2UA 2V2CA 1HKIA 4FO4A 2Y85A 2QJMA 3HV8A 5K9XA 3Q94A 4D6EA 3CUZA 3A6OA 2CNCA 1UKQA 4AU0A 1JZ7A 3PANA 3U3HA 1LL7A 2B81A 4ML9A 4AXKA 5EA9A 4H3DA 1FWSA 1DQWA 3UF9A 1RALA 3BCFA 4MADA 4XO7A 1UJQA 4DQWA 1ISZA 1ZP4A 2HVMA 2XU2A 4R9XA 3MA8A 4UTFA 4ES4A 4PMVA 1SM9A 1Q7QA 2DSKA 5XIAA 1GJUA 3IIXA 5AY7A 4DJFA 2DH3A 4DO7A 2G41A 2PI6A 3EA1A 1VYPX 1VFUA 2VDGA 1CECA 1QNSA 2ZZ6A 1SR0A 3R7MA 3W01A 3SADA 1SMAA 4Y9PA 2Z1BA 2Z4GA 4CNNA 3UWZA 3MANA 4M80A 4J35A 3VNKA 2NT1A 1Y5XA 5A8PA 1RP9A 3ERPA 4MJZA 3DXIA 1J0YA 5TD4A 4WD0A 3B9AA 2TSYA 4Q4QA 4AUBA 4XZWA 4WQ6A 3WBAA 1EGMA 2FTWA 3B3DA 3RMJA 2OZ0A 1XWYA 2PDUA 1DWGM 5H6HA 2HVNA 4AXNA 3O0KA 3LPOA 5A8OA 2A3EA 2TMDA 3TJIA 5CZSA 3BJFA 4MTVA 1PZ1A 4RDWA 2NX3A 1QW7A 2WSYA 3WELA 4J2PA 4LUSA 1EJTC 3EWUA 1QK0A 3CH9A 3IRDA 4JHMA 3UQNA 4D6DA 2P88A 1KXHA 3LLDA 1W9XA 3KX6A 1OADA 3QR3A 3VIIA 1O5RA 1TV8A 2GJLA 4TUFA 1R7OA 4C1NB 4ECLA 3V16A 1KM0A 1TTQA 3A4XA 3NQCA 4ZEPA 5JU6A 3KHDA 4GBDA 3K1GA 2PTXA 3RUBL 5LGZA 3LBOA 3MS8A 3M0YA 2O56A 2B7OA 1QI3A 3BE7A 1QOQA 1QATA 1QI2A 4RZ6A 5HWMA 1F73A 1IEIA 2FTPA 3R25A 3TXVA 1EJVC 3L2MA 1D3CA 4RE3A 2GGHA 5ABEA 3S1WA 1H0IA 3UWQA 2WSKA 3W7LA 1IEXA 1XYCA 3CEUA 1O66A 4FI4A 3WD3A 4BQ3A 3M44A 4O1AA 3K5XA 4PUEA 4LYKA 4IPNB 4A8RA 1KGXA 3T07A 3CBWA 4GY7A 3WZ0E 3I10A 7ENLA 3SGUA 3GK0A 4DJDD 2HXTA 3OYXA 1KQZA 2Y5EA 4B91A 2FVKA 4HNUA 2F38A 2RUSA 3UNDA 2Z27A 3RU6A 1TCDA 3DN5A 5F2LA 3SJ3A 4B3LA 2E67A 5B7ZA 2Y63A 2ACSA 4FNQA 1VBUA 2ZC8A 1CXLA 3BG9A 1QBBA 3POHA 2I14A 3WNKA 4Q7IA 1E9YB 2DJXA 4UOZA 2OELA 2XN1A 3A9BA 4D72A 2JKEA 1QOXA 3STGA 1EJWC 2Z1KA 4V28A 5AOUA 3T6CA 2G8ZA 4ICCX 3AJ7A 3VE7A 1TR1A 3I65A 8XIAA 1S2VA 4IQJA 3OP2A 2DT2A 3V7PA 5PTDA 3TDFA 1W9UA 2Y6ZA 4IIEA 5HPCA 5C5YA 3GWQA 3O2LA 1O95A 4S1FA 1PZ0A 3AI0A 3UZ5A 4E8CA 3TYUA 4I5UA 3M6DA 2GUYA 1WBHA 1AQ0A 1KFJA 3LSBA 2E5CA 4L4OA 1TUXA 3MP4A 1UBSA 2BFGA 1B57A 3W1XA 3DFHA 3E2QA 2LLEA 4CCZA 1FXPA 3QSTA 5DXYA 4RDVA 1ADOA 2IKGA 1F3EA 2DEPA 2X1UA 1EXBA 2FGLA 4D6IA 4HQVA 2INFA 3M5XA 4H9MA 2BVTA 2Q8XA 2VP8A 1XYAA 3RILA 1K1DA 4BI7A 2E6YA 2VC7A 4JCLA 4JTRA 2V2HA 3CK5A 4IOTA 1ZJIA 2JALA 3HG3A 5T9CE 3BV4A 3LRMA 1E1FA 1D3GA 4LVAA 3E74A 2IPGA 2W3ZA 2V5CA 4R3UA 3UEQA 3P60A 4P8UA 2G50A 3CL6A 1TMQA 1CLKA 2CBVA 2QULA 3QM3A 5JBEA 1DQUA 1F3TA 2PLKA 3N3TA 3S2MA 4LV9A 2QZRA 5E0CA 1N55A 3IJ7A 1H62A 4CD5A 1KFBA 4L6OA 2WSRA 1B3YA 3KP1A 3SDOA 4JY9A 1T5AA 5K3VA 2QMKA 3P62A 1N82A 4IIFA 3CIWA 5CC6A 2NLYA 3CNYA 1ONRA 5EPDA 4OZOA 4XAZA 2VVNA 4BEUA 4XAFA 3HV9A 4XBSA 3T08A 4C6CA 3N73A 4KRZA 1K8YA 1YXDA 1MRAA 4CCEA 1FHUA 2XHYA 2J7DA 4DPQA 2O9OA 5CH9A 4HHLA 1V02E 4D9PA 2G3JA 5ABFB 5I3JA 2I16A 2BLEA 1FH7A 3AWNA 4JQ4A 1MUCA 4ZQMA 4AD2A 1C9WA 2DSUA 3VD7A 1RA0A 1E0UA 3NCOA 4ORMA 1EC8A 2F6KA 4AY8A 3LEPA 2CFFA 3LOTA 3L7RA 3TYCA 3N18A 3G1FA 3IJQA 4FR6A 1XICA 4GUGA 4HGXA 3CWNA 3KDNA 1YKWA 3S3GA 2PLCA 1VPQA 2BMBA 4HP5A 1M1BA 5A6MA 2X0HA 4EXAA 1HG3A 3QHNA 1AH3A 1DXFA 2W5FA 3N12A 2EPNA 4AISA 4KETA 4ADTA 3LCHA 1UW9A 2VFDA 4H7ZA 5A95A 3SZ8A 2XM1A 3ES8A 5DBTA 3REQA 1PIIA 1E0WA 3BW2A 1ZRQA 5E6YA 5AZ0A 3C4UA 3O07A 2XWEA 4RNFA 2A6NA 2YDSA 2QCDA 3R10A 4AIUA 4I9AA 3V5FA 3IK2A 3AMLA 3BLOA 3G1VA 4LTSA 2F8QA 3GXNA 3UESA 4DNMA 3KVKA 4DI9A 3O15A 1DXEA 1GG0A 2EPKX 4PBEA 3FV9A 3MSDA 2PDKA 1ITCA 4PMNA 4HPJA 1XD1A 1XBZA 4H9XA 1DJGA 1TX0A 3FS2A 4A35A 2RGMA 1O5KA 3OLDA 4OKDA 4BF9A 4PEKA 3W25A 4PBFA 4WY0B 4Z0JA 5D2VA 1ML1A 1A4LA 1TCMA 3OPSA 3HGJA 3ZJ8A 4GH3A 3W6YA 4YWSA 2I7GA 2OLAA 1M01A 4KIRA 4BF5A 3FIGA 3LM7A 1GEQA 3THDA 4IG2B 2GSJA 3D47A 4B4HA 3MBDA 4BCEA 3WK2A 5CJNA 4LY4A 2HSAA 2PCEA 3O8AA 1GOMA 4JTSA 4IXXA 5D9MA 2E9LA 3ECQA 5DANA 3W2KA 4KWOA 3GE7A 3CJPA 3PM6A 1TPEA 3WY1A 2P5NA 4IL2A 4X9YA 1XIBA 1GYLA 3TC3A 5KMYA 3CT2A 3PULA 1FKXA 3TXZA 5H8MA 4XSMA 1MZRA 1U5JA 2PDWA 2VJXA 2DZBA 3UWUA 1E73M 1R3RA 3GW0A 2PLJA 1W5MA 3TLQA 4UTMA 3D3FA 4RCXA 4C7GA 3LRKA 1K4GA 1KD0A 3EKGA 1XFCA 2YCIX 5CPMA 3SIZA 3VIGA 1BVNP 1J0ZA 1DJYA 1GYNA 1K9FA 1WUEA 1M04A 3N19B 4O15A 2D2GA 3ITCA 2GQ3A 4PUDA 5DRIA 3CASA 2OYLA 4OBSA 1IV8A 2WQPA 4YYCA 2BV9A 5EMMA 2R14A 3CZKA 1HJVA 4JTIA 2GVEA 3NEHA 1OBAA 1YBQA 4NILA 6TAAA 4PUMA 3RR4A 2WBKA 1LP6A 1QI4A 2WLZA 1LF1A 3HJEA 4YU1A 3BAXA 1JF5A 3DEQA 4OUIA 3GVWA 4XZBA 3WQ5A 2V3EA 4ALDA 4MNJA 2P8CA 2VDHA 2E6DA 4WRHA 3S5YA 1JXKA 1M65A 4AQLA 2WLYA 5FCZA 3AXIA 3PJTA 3ARYA 3GVRA 3IUIA 3K1DA 1IZJA 3LRLA 3CV1A 1J01A 1TE1A 3WUFA 2XIMA 6REQB 3B40A 3QTGA 3GNOA 3TR9A 1E4IA 1VYSX 4G1NA 2ZRZA 1H09A 4C6MA 5LSMA 2WCSA 4MWAA 1E1CB 1V4YA 3AYTA 3SAZA 3PN8A 4MNLA 3AHVA 2WVSA 1OX4B 2YX0A 1DPMA 4UR7A 3LHVA 3QKEA 3NNTA 1T8QA 5FJPA 1DWJM 1OF8A 1OZMA 5GQBA 4TX6A 3LSCA 4QCEA 1PDZA 1W2PA 1UKSA 2HBXA 3PVFA 4C6LA 3NZRA 4JIHA 1MWOA 3PTQA 3B0PA 3L5MA 2UY3A 1AW1A 1E0XA 1DJNA 4GE8A 4EWJA 4YIWA 3UZZA 2CXEA 4F2BA 7PTDA 1R3SA 4XQ6A 5LIWX 3NSNA 3R6IA 1IF2A 4AHOA 3KP0A 2Y8UA 1ENUA 3KAOA 3QZ6A 1R0MA 3WQFA 4TTUA 1KBBA 2OVLA 3NL5A 1TB3A 1P4CA 1VBRA 5HK4A 1HO4A 4FNUA 3MVTA 1CI1A 4N42A 3T81A 3PZVA 4WOZA 4N9BA 3HA1A 2VZOA 3W00A 3TP4A 4DO5A 3PC0A 3WKZA 2QCFA 2QQ6A 4P7NA 2OZ8A 3PZQA 1CTNA 4L6HA 2GVJA 3WQEA 1J96A 1ELSA 3BVJA 1UJPA 3DYPA 3RX4A 1XIHA 3VNMA 2A3HA 2HDJA 1CIUA 4UNIA 1DL3A 2A7RA 2DUZA 3G1DA 3AROA 1LLOA 3UZWA 4JFVA 4MAVA 3VIJA 4X0NA 1US0A 1E72M 4DO6A 2VD9A 3MY9A 2Q3OA 2J74A 4UTTA 2E3ZA 2DT3A 4H9ZA 2NUWA 1OC6A 3FX4A 3N11A 5BOEA 1JIBA 4WJEA 5T26A 4ZR8A 4M56A 1MVYA 4DELA 1TTIA 5HDRA 5DXXA 4LBUA 2HJPA 4EPDC 1U30A 1VLWA 4AIBA 3PZGA 3RCNA 2JQXA 3CZ8A 4L7ZA 2Z1WA 1A0DA 4CN1A 4W8AA 1BQGA 4S3DA 5I0DA 2ISWA 1YADA 3W4RA 1W3NA 1WKFA 1XLDA 4DBWA 3G1SA 2UWFA 3A3HA 7TIMA 3EZ4A 1JCLA 4JN7A 3KWXA 3APYA 1SW3A 2PWUA 3TTOA 2ZZ2A 1KGUA 3V1HA 4LAMA 1F7BA 4GJ1A 4IQEA 2V0TA 4XZMX 1HP4A 2G4JA 5EMLA 5D8WA 3GDMA 1A53A 1EP1A 1EEPA 4JPGA 2OZTA 2CESA 4NKCA 4YXGA 5ABGA 1TPC1 5C9XA 4P8WA 1LWHA 4LVBA 1XG4A 1Q65A 4TV5A 1A50A 1ISXA 3AMGA 1XW8A 2QDHA 1RBAA 3JS3A 2X05A 3TTYA 5CJMA 5IBXA 3EDKA 3ALGA 1WDPA 5G1YA 4M19A 1TJPA 4Q8TA 1XLEA 1DJHA 4DAFA 4LCSA 3NQAA 5JIWA 1FWNA 2PGEA 1SUXA 4ZO6A 3K4DA 4FLOA 4QE5A 2DFAA 4S3JA 2PS2A 3WQPA 1YXCA 3KTSA 4DJFC 3UP8A 3WF2A 3GR8A 3WNLA 4I9JA 3OU8A 1NP0A 4WEVX 2QT3A 1IT8A 2WZHA 1XDMA 5C9WA 1EH9A 1UWSA 3BAJA 1D7FA 2ZWYA 1AQFA 3S9YA 1NFGA 3MP5A 4BF7A 2JFEX 1AW2A 2BX7A 4UQAA 1KXQA 1XSKA 4PCFA 2ZXDA 1W1VA 1CDGA 3KE0A 4XO6A 4ATWA 2BOFX 2TAAA 3UZXA 4GQGA 3VZXA 4CQ9A 2FH8A 5HNNA 4PB5A 4K8HA 2QUUA 3T44A 4XTDA 3WDPP 4DLFA 4RXFA 3SURA 4RPQA 3WLKX 1IE7C 3E3HA 2QCDB 4US6A 4ZCWA 5A3HA 1FWGC 3OHMB 8CGTA 1XYFA 1UIPA 2KX9A 4J3TA 1UD8A 4ICMA 4UCGA 4OJYA 1NTHA 4HYVA 1X6NA 1Q5MA 4L1WA 4UQEA 1I2QA 3G18A 3IIOA 3TKFA 3LV6A 4LY8A 2OMAA 3OLEA 1EL3A 2D3NA 1GJPA 3N29A 1W1A1 1JQVA 2E4TA 3W3OA 5AVNA 3SFKA 3P7YA 1OF6A 4V15A 5E9AA 3UZYA 1PCWA 3LGEA 2O92A 2VZVA 5ECVA 1VQTA 5CJ5A 3EPMA 1OFDA 3O06A 3BAIA 1SQ7A 1UWIA 4NF7A 3HG5A 4PBGA 4CQBA 4KMQA 2V38A 1C91A 3DKLA 1CXEA 4NX5A 3G22A 5L6UA 1QU4A 1E9ZB 5JMUA 4KESA 1FH9A 3IRSA 1E71M 3NYDA 1IEVA 1S5VA 1Q63A 4JTJA 4F0KA 3VIKA 5C8BB 4LUTA 2RGLA 5FEPA 3ABRA 4DWSB 2FB2A 4O1EA 4A8IA 1DJXA 4LQ1A 4Z2HA 1FWTA 3GFXA 4NZ1A 3VMOA 2F7FA 5CSSA 3EA3A 4K1WA 4PMOA 6XIAA 1LOSA 2J27A 3AS1A 1H63A 2C16A 2P0OA 2DIJA 1VD6A 1I2PA 4H9VA 3GDKA 3WD1A 1AFSA 1P0DA 1JZ8A 4BQ5A 3FXGA 4RE0A 1TPDA 3UCDA 2D24A 2UY5A 2D22A 1BRLB 1KCKA 4J27A 3IVSA 3HN3A 2Q02A 1YBQB 2NV1A 3OGVA 1H7PA 3W6LA 1XQKA 3DCPA 1HT6A 4QDPA 4PULA 3MUXA 5REQB 1Q6GA 3LCXA 1LCOA 4TIMA 3HQPA 1XIIA 1S2AA 3DX5A 3NM3A 3PY2A 4IIGA 1UWQA 5E93A 2OT0A 2QXWA 4MM1A 1NELA 2OXNA 4MJ4A 4GY1A 5C55A 3S6TA 2WYSA 5DT5A 1Y65A 4DIAA 1EGZA 1PAMA 3M0XA 2QPSA 4E38A 4X3ZA 5CLWA 3GKFA 1MW2A 3B0UX 3IUHA 1BWKA 3BTNA 1RBLA 3SGZA 3VDHA 1RPXA 1B3WA 4TV6A 2EG8A 1KGWA 3ALFA 4MWAB 3SM0A 5L9FA 5DCDA 3C2OA 2XH7A 5EY5A 1D8CA 3SW6A 2V5KA 2YA1A 4PMDA 1V3LA 4KT2A 2DIKA 4XVEA 2XIIA 1P1MA 4RW3A 5F2GA 1V6UA 4U10A 3UGRA 3PAOA 4IGHA 5C9RA 3BSGA 4GC4A 2Q6ZA 4GZ7A 3MSYA 1JD7A 4PRTA 2BODX 3C0QA 2CLMA 3BV7A 1XKYA 4MNKA 4HBKA 3W07A 3H54A 4QLLA 3TAOA 4LT9A 3TK7A 3CAWA 3W88A 3MT1A 1O4UA 1Z8AA 3SRFA 1T40A 4QLKA 3LDVA 4GIYA 1X38A 2GJPA 2ZOXA 1BGAA 3LD5A 3QHOA 3VPLA 3O0FA 4CNTA 2J7HA 2ALDA 4O0KA 3OZYA 2F6UA 2E9BA 2F6XA 3GHRA 3VOJA 1DTUA 1KFCA 3O7UA 5H8UA 2CZEA 3FK4A 4XBJA 1Z44A 3GAYA 1R2TA 3ITOA 2YL9A 2UY2A 3S83A 3LNPA 3MMUA 3C56A 4KEMA 4QNWA 4H8UA 3LCFA 1C9DA 3NPWA 1EOMA 1LM1A 5FESA 1OFRA 4GXPA 3DFQA 1BWVA 3EX4A 1TPWA 3UY7A 3A4JA 2FKPA 1TZ9A 4LU0A 4F79A 4PCPA 4UTHA 4DVOA 3BW4A 5XINA 3BL3A 1AD4A 1C29A 2DQWA 4L5ZA 2XFWA 4PR4A 3RM8A 4L80A 4Y96A 1Q6FA 3GBEA 2NXGA 2QAPA 3KL5A 1WZLA 3B8SA 2DY3A 3TYZA 2WMGA 2VR4A 2Y24A 4GVFA 1QUMA 2PBGA 2G37A 3HGRA 2NSXA 4FNRA 1LOQA 5CC3A 3QVQA 4X63A 1J11A 4NG3A 1FTXA 1Q6QA 2FVMA 3OLGA 1NF0A 2HPIA 5I2UA 2VZUA 3QFEA 1YNQA 2PGWA 2IXUA 1XQLA 2X7WA 3GC5A 4XWUA 4BI5A 4ICNA 1UD4A 4IISA 1RV8A 3WDQA 4RV3A 2FLIA 3SBFA 4Z2GA 3DC8A 3S42A 5G2WA 2AL2B 3FDKA 5D2YA 1VLIA 3R11A 3HGOA 1H41A 2ZUSA 4OV9A 4HMCA 3LCIA 5GNYA 3QKZA 3GHTA 2E5BA 3ITVA 2W4XA 2VXNA 1B2YA 1T41A 3T8LA 1NSJA 4LWWA 4LOCA 4EX4A 1EP3A 4HIBA 3VK5A 4MY9A 5GPRA 1J10A 1KQYA 1FWCC 3WF3A 1JDCA 4AZ5A 2GGJA 1IR2A 1ZLPA 4KRUA 3LPPA 2H6RA 4Q4OA 3N3MA 4GKLA 3B9EA 3UVAA 1A5LC 2JBMA 1CGTA 1JDDA 1DJIA 1WXZA 1SO5A 3FLUA 3EX3A 4X2PA 3W7DA 3TYAA 4QSHA 2Z1XA 5TIMA 2JGYA 5KITA 5CAHA 4F0RA 1XH0A 4IPPA 2GVLA 4A29A 2GVGA 3C2RA 1EX1A 5MHBA 2C6QA 2ON3A 4TXEA 2FJUB 1QASA 2OYKA 5EMUA 4IP4A 2ZRYA 1K77A 3C86A 1A49A 2DZXA 4CCCA 1XG3A 3TLLA 1OSEA 1QOPA 1XXXA 4GD0A 4GVIA 5DEZA 3KL3A 2DPEA 1JR1A 1TELA 1V0NA 1M6JA 1WYIA 4AHQA 1GNXA 4HNVA 2GYIA 1W3KA 3LUTA 2WJZA 3NZPA 2ZRVA 7REQB 3FGCB 2C18A 3MSGA 1P7TA 1F61A 3W70A 3TSMA 1S39A 2QJGA 2FDSA 2J8TA 5A6TC 3AXHA 9CGTA 3UXAA 4AX6A 3GTNA 3LBCA 1Q6EA 2X0YA 1QPOA 1EDGA 1GTEA 3IS4A 2SFPA 5KZEA 1EJRC 3WUEA 3UXDA 4ZOEA 3BSHA 4WZHA 2D23A 1V93A 3FA3A 4ONVA 1L6SA 2KZHA 3AS3A 5AYXA 3T9PA 1EF2A 2Y70A 2RDTA 5GJNA 5HNRA 5BCAA 4D6JA 1FBAA 3B06A 2D2JA 5A2BA 4BJHA 4DJED 9RUBA 2Y4SA 3UERA 3W1TA 3W85A 3FY1A 4Y2WA 4F0SA 3PUGA 1P0BA 2HROA 2VQUA 3TW7A 4M1BA 4NJHA 4IIDA 1VENA 1VGAA 4ROPA 4UQBA 4FK9A 3W7HA 4DM1A 1E6ZA 2WNQA 3EPOA 3N04A 2V6AA 4N6FA 1NF7A 3TW9A 4FNTA 2VEKA 3IACA 1RVGA 3PHAA 3WUBA 2AGKA 2DZVA 4UTIA 5M1TA 1ODUA 1TWWA 4LNYA 4RXGA 3LK6A 1MW1A 4LVFA 4JTKA 2BY1A 1H7WA 3G8RA 1Q7MA 4DBDA 4B2DA 4PMZA 1EO5A 3PZMA 2WJEA 1ECQA 5DMYA 3CYVA 3VKBA 2YB4A 1NARA 2NQ5A 3BAKA 3WIJA 3W7NA 2A3BA 5CBIA 1TMHA 3M5ZA 1PIGA 2BY3A 4JY8A 1TR9A 4UOJA 5F4XA 5CZ0A 2NX1A 3F4WA 3GC2A 3U2OA 4KCUA 4J3VA 1HXJA 4U3CA 4MDPA 3ONCA 3GH4A 5A6AA 5D05A 4YTTA 1A5NC 2AQOA 4NI3A 3TYEA 2GL5A 1G4EA 4UBPC 5BWAA 3W28A 3AYVA 1DIEA 2VRJA 3G24A 5KZMA 3U0HA 4JIEA 3SB0A 3RLUA 4GKTA 4R5EA 2XIBA 5A8MA 1K9TA 2NSOA 3HU7A 2E77A 2QEZA 5D9PA 3LZ5A 4LV4A 3HPZA 1FWIC 3ZXWA 3G1HA 3C2FA 2DSVA 4GI4A 3BJTA 4NAFB 4GNVA 2AKZA 1L6GA 4AEFA 2VGFA 3L0NA 1XUUA 1VCFA 3PPCA 3QV8A 2P0IA 1DEDA 3LNMA 4I8DA 3GUWA 4B5WA 2ISDA 4H6KA 4X2RA 5CAKA 2J24A 4ZFMA 3UA3A 1F05A 1IWPA 4LUYA 3EOOA 3LHUA 2G3FA 5DLCA 1HJWA 4HK7A 3DHDA 4GYPC 4IQDA 1L2UA 3RJXA 3KM8A 1UCWA 4HSOA 3S5OA 1M7OA 3C3NA 3NDOA 2Z2BA 4HU3A 3W1MA 4L56A 3AMKA 7CGTA 5IXEA 2C1HA 2HK0A 3QFWA 4PCNA 1X7FA 3QQ0A 2QPXA 1OFOA 2NLIA 2CYGA 3BZJA 2VCAA 1L0PA 1CGXA 4O17A 1Q8AA 3TWBA 2R1NA 1UPPA 2YCJA 1ITXA 2OO6A 4IICA 1F2JA 1OYCA 3OBEA 2GQAA 1HKMA 3EDFA 2VTFA 1EJUC 2VMFA 3SFWA 1Z9AA 3B8UA 1TZZA 1S46A 4JYFA 3H2NA 1KBIA 3GYCA 4KWSA 1S2CA 2WOQA 2V3FA 1X1NA 4RE4A 5C2GA 1V7YA 1L9WA 1PZ3A 4GRSA 1S5MA 1QNQA 5D9OA 2XVPA 4LUIA 4NUWA 4AB4A 5AHIA 3NPVA 2GDVA 5A69A 5HA7A 4YTRA 1FP8A 2DZPA 1JZ4A 2OR2A 3CB3A 4C6BA 4CVWA 3N25A 1KV5A 3BANA 5KZDA 1Y8BA 1BLIA 2AOSA 8XIMA 4GIRA 4XTIA 2EHHA 3TN5A 3F2CA 1CEOA 3W7IA 1M03A 2OOFA 4A3HA 1AMKA 4HA3A 2X1IA 2INZA 4LGXA 5FF3A 1UIOA 3RPMA 1VH7A 3KTCA 3WK3A 3ANVA 1DKWA 4IMDA 4Z2KA 3UU0A 3MWAA 3ZLGA 2WMKA 2JK2A 5A6SA 3EPNA 3FJLA 2PDGA 3KUMA 2A79A 3F5LA 3U4AA 1GZGA 4AAJA 3MC5A 3ZIZA 2E9MA 1HIZA 3V5OA 4HYWA 2A7NA 5HNTA 1RCOB 4JKMA 3R94A 1VFLA 2VQTA 3VMNA 3WSUA 1CT5A 5D4YA 1VFTA 3FEMA 3W1PA 3VMPA 5M5DA 4XZLX 2VR2A 1ZUAX 3ZVHA 2VX6A 4R7JA 3CAVA 2RHGA 3MV01 1G69A 3SY5A 3R13A 4OHQA 4ZB2A 4DUWA 1TSIA 2D2HA 4GK8A 5BNKA 2GOKA 5FI8A 3UFYA 2V5BA 2PD9A 3W71A 4ROQA 3KCLA 2Y7FA 4AFYA 1EIBA 2WHKA 4WKHA 1KB3A 2ZDRA 1GVRA 4F0HA 4JIPA 1GJWA 4DBSA 1N8WA 2X2YA 2H9AA 1FXQA 3JVAA 3IJ8A 2QJJA 4XKMA 4X61A 3CV2A 5I24A 4LVGA 4PSRA 4NYYA 5D09A 3RJYA 3ARRA 3R43A 2PDXA 1GQIA 4N9CA 3R5EA 1FUYA 2X41A 4N9EA 2WZTA 3RLHA 3ZM8A 1VJZA 3GVQA 5F1UA 3T0AA 1OZQA 4MAZA 1P43A 1GT8A 3VKJA 1FA2A 1XIEA 4NRSA 5AKQA 2OX4A 3CHVA 4UMAA 1FWWA 1Y0EA 2OLSA 3NQ6A 3KBMA 4KIEA 3EB3A 3WENA 2XVNA 4G7EA 4NRRA 1ZSXA 3CV6A 4WSHA 1TJ0A 4GBUA 3SUWA 4LNCA 4CUCA 2CEQA 3VDAA 2RFGA 1NOUA 3ANYA 4O28A 1EJXC 1DQXA 2ZVRA 3IV3A 4V33A 3WMSA 3MMTA 1XPYA 4E4UA 2F84A 4NNCA 2VT0A 1XLKA 2NQHA 1I2OA 5T8GA 3FA4A 3C0LA 2WMJA 2ZZ7A 3FYYA 4H7CA 2X30A 2HWGA 5EBAA 1EWDA 5J8LA 2NT0A 3V75A 5H91A 4HPGA 4F2TA 3AXKA 4JHOA 3SCWA 4GYKA 1L6YA 1GVSA 3BMVA 4O57A 4XZIA 3WJYA 5BRPA 2R24A 4GZEA 2PTDA 3TQVA 3F4CA 1A5MC 4AC7C 1H51A 1KM4A 4NJJA 3OBAA 1W1IE 3M7WA 4M7SA 2G0WA 4NZJA 3UWEA 3C52A 1XGDA 5HJXA 3CWHA 3NZGA 3LS9A 3P14A 3QH2A 3OQ8A 3CHEA 4WOQA 1FWDC 1MXSA 2XJ7A 4MKSA 5HINA 2WJFA 3WFZA 1T7LA 1W37A 2GJNA 5AZ1A 2B7PA 3MTWA 4AYSA 4G2DA 3VO0A 3EXTA 1PDYA 4Y90A 1I6NA 1XSIA 1HZYA 3B97A 1QHZA 3BLEA 4Y9NA 1F07A 4N2YA 3UZJA 1GOXA 1Q6LA 1IGWA 3E9AA 4W4QA 2WVVB 2GJXA 4A3RA 2BSLA 3H2AA 4Q4MA 4BI6A 3HOJA 4Y8FA 2GPTA 5MKGB 3T78A 5LA0A 1KCXA 6ALDA 3PS7A 3BLIA 3S0CA 1E9IA 5CZJA 2YIHA 5ENLA 1FWFC 1XRSA 3HURA 1CXHA 3DFTA 3MJMA 3OVPA 2XIQA 3SQSA 4HA1A 3PPFA 2J75A 2TPSA 2PDLA 3VZZA 1W3JA 4IMAA 3UWWA 3O6YX 3SO7A 1V6XA 1RR2A 1UR2A 4U5IA 2WZEA 3PFMA 3ORWA 2R91A 1XGEA 2YZRA 2FDMA 1GPWA 1BF6A 1MMFA 3C0JA 5E09A 2BDQA 4PN2A 3E0VA 4MB1A 3KRBA 3W84A 1S38A 3EWWA 2QW5A 2J4GA 2BXVA 1TQXA 1XF0A 1JPMA 4XD6A 4GUIA 4KH2A 2WNWA 3U4FA 1QRQA 2PWDA 2FZNA 1KW1A 1C7TA 4K8GA 2NQLA 4QBXA 3EKZA 2EEXA 3CMJA 3W38A 4RZ4A 4LAUA 3NDYA 1MRQA 1EHAA 3LHYA 4MJ2A 3VINA 1R3VA 1CWYA 3E5BA 4GQRA 2PP0A 1BYAA 5HNUA 2EG7A 3I4EA 1WOBA 3QYQA 4ZL1A 1BYDA 1EBHA 1RJPA 3FAXA 1US2A 2ZUMA 5M03A 4B5NA 3VX1A 4IP7A 5I3KA 1CENA 4Q4SA 4MDOA 3VVGA 3CUIA 4JFUA 3QMRA 1HQTA 3NL3A 3SCRA 3I7QA 3LCWA 2D69A 2HS6A 3R12A 1OT1A 3B4UA 5JBDA 3L9CA 4XZHA 2OCZA 3LHTA 2PZ0A 3BW3A 4HJWA 4WSJA 1YDOA 4I9MA 3UJFA 3LZ3A 2ONEA 3R79A 4IHCA 4M7TA 1GQNA 3O6AA 2WC4A 1FHLA 3M47A 3ME3A 4EVZA 1B3ZA 5EU9A 1EF3A 1PYFA 4LUJA 3CUFA 1TTJA 3SN4A 3F4DA 5HQLA 1GOOA 4HNOA 1QCWA 4H83A 3MYOA 4RDYA 1RA5A 1AQHA 3P93A 2XISA 1Q45A 4ZO9A 1SFJA 4PMXA 1B5TA 3UETA 1EZ2A 3E6EA 2GOUA 1P6WA 1IEQA 2J7CA 1CXKA 2O7QA 2CWNA 2QCEA 3AXMA 4FXJA 4UXDA 3RM9A 4KRTA 3WQVA 1JJKA 1JRBA 1AG1O 1JG9A 2OZ3A 3DFYA 2PC4A 4QXIA 4NZ3A 3UBPC 5JXQA 1SMDA 5LNRA 4QG6A 2DP3A 4AD3A 4UQ9A 1GVIA 4HK6A 3WLOA 3W82A 2YR1A 4GISA 4U3AA 1WA3A 2C19A 2HZGA 1GVYA 2OEKA 4JYEA 1KBJA 4HKPA 4H6RA 1IXPA 2ATSA 4OBTA 1SJBA 2DQXA 2XIJA 3FJ6A 3BWWA 1IYXA 2C7FA 2J8GA 4QE4A 2Q8ZA 4K39A 4E8DA 4JDBA 3W74A 3A21A 2FHFA 3M0HA 3B0VC 4RPPA 3OYZA 1PHQA 4C6JA 3DYMA 4ZOBA 4EACA 2WBGA 4BQ2A 2A5HA 5C9UA 2HEJA 1BG9A 5AC8A 3B04A 3FDGA 1NFBA 3V18A 4PMRA 1E51A 2QNEA 2H3DA 2OU4A 4V1YA 3IJ6A 5I3GA 1T6MA 4C6EA 3MJYA 3L4ZA 3WEMA 5LGXA 4W7UA 3ZVHB 4WSKA 3AWOA 3VI2A 2DW7A 3GU1A 1FQ0A 2WMIA 1XCFA 4HN4A 2OB3A 2DZUA 3OJGA 3LM3A 4LC8A 2OEMA 2PUZA 3LI1A 1BTCA 3SCVA 1H60A 2XFYA 1R3TA 1V51A 2FPTA 2VX4A 3BAYA 5CPQA 3WLPA 2PDFA 3O16A 1W9VA 3OZPA 2NW0A 1M7PA 1EYWA 1B4KA 4MUZA 1AW5A 4MVAA 4U5KA 4AEOA 2H9AB 1GK8A 4KWWA 2C1GA 5FD0A 4NP7A 1GKPA 3GXPA 4L9XA 3BO9A 4S39A 3AZRA 5FACA 3NZ1A 3UYIA 1JYNA 3NAVA 1QBAA 3BLPX 1Q6CA 2CLLA 3ABZA 4JS3A 3PWGA 1SSGA 2WC3A 3ITXA 3UGVA 1PL9A 2CITA 9XIAA 3KBJA 1Z69A 3NFUA 4IL0A 4UFJA 4FXFA 2QR6A 3HG2A 1X96A 4G7EB 3B8TA 4TO8A 4IFKA 4R27A 3K4WA 3TJXA 3MUAA 4IMCA 4OFCA 4L61A 2YCLA 3VD3A 1XLMA 3BH4A 1UH3A 4GG9A 3EWXA 2V5DA 4H6EA 4AWSA 4H7VA 5K9DA 3PBUA 3MWCA 4FXSA 4Z17A 4DXKA 1P5BA 1UH4A 3LLFA 2CWXA 4ZQRA 3G3DA 3USBA 4WDUA 1QTWA 3ZZ1A 3GFZA 2AL1A 3GNDA 5H1WA 5J04A 1BKHA 1XX1A 1VFFA 1AH0A 2XG9A 3M1ZA 6TIMA 5A6JA 3S5SA 4W87A 3WF1A 2PAJA 1LUCA 5AVHA 4AHPA 2E6AA 1PB0A 1OK4A 5CXPA 2B7QA 1RQBA 1S2TA 5F4WA 2ZTJA 4QQUA 2OSYA 4L1GA 1DV7A 1W31A 3I6RA 2ZA2A 2CLIA 4DF2A 1H49A 3WX7A 4PUWA 4AIOA 4CGTA 1QVBA 3GO2A 3BG3A 3GXDA 1ME8A 1LRQA 2Y61A 4CLMA 4AF0A 3DU0A 5BROA 5AHFA 1W5OA 1XL9A 4YS1A 2V3DA 1UKPA 1ZL1A 2ZVIA 2Y7DA 3FXYA 3WNOA 3IAQA 4C5YA 3AYRA 1PPIA 5FA5A 1H4PA 1UWUA 1E40A 4OVXA 2Y88A 2DUXA 3P8JA 3WLQA 2BB0A 2Z6JA 4MYAA 1W54A 4JN6A 5FF2A 3I3BA 3EKLA 4N0RA 4FX8A 3SI9A 4A3QA 2VKZG 1K8CA 4U2YA 2PDYA 4W8BA 1IXQA 2VFEA 1LROA 4JDYA 3ZT5A 4ATLA 3Q45A 3NXLA 2QV4A 5AB3A 3WBEA 4C1KA 1OINA 3GH5A 5DELA 4I7UA 4LFYA 2OSXA 4CD4A 4KWUA 1R9ZA 2VEMA 1ZP3A 3GX9A 1N8IA 2PGFA 4GMEA 4HMNA 4XBKA 1EP2A 3M0MA 4PRWA 3TUUA 2FQIA 2YJQA 3F7JA 2WKJA 2QYGA 2CETA 2V5LA 4FOUA 3TN6A 5HMEA 4GIEA 3E2RA 3DZ1A 4D71A 3STEA 2VEIA 1GVQA 4QG9A 3LXAA 1E6XM 3M41A 3UW6A 4DJEC 3NVDA 4GX9A 4KCWA 4AD5A 1O6IA 1J0HA 2XUCA 3NQGA 4BA0A 3ZLHA 1JRCA 2W6RA 1W2VA 2NUXA 4P7OA 3UR7A 1KRCC 4QRNA 3NDZA 1X6LA 4K6AA 4DUOA 4V27A 4C7FA 1XIJA 5KINA 3G6MA 4A3UA 3S6OA 3PPHA 5A6LA 5BXRA 1G67A 3RFAA 1T8XA 2WSQA 4NQ1A 5K2ZA 3UPBA 3E38A 5EL1A 1XFBA 4O10A 1EKOA 2P3EA 3QN3A 1LBFA 4LBSA 1B3XA 2PDPA 4J40A 3CB8A 3W1QA 2BVYA 5DMMA 1WOAA 3W72A 3GKAA 4CQDA 5D9NA 4LRSA 5AHMA 3DECA 1RUSA 1FVPA 4GFIA 3TWAA 2ZCGA 3VX0A 1TIWA 1JCYA 3QY7A 3D0CA 3U7VA 1OC5A 4H8VA 2OGYA 4PTMA 2D2OA 3GG8A 2E7FA 3T2OA 1EC9A 3QR0A 1HO1A 4F4RA 1QPKA 5M17A 5I06A 4NT0A 3M5VA 2PPGA 3MI6A 1MQPA 5IRPA 4PMUA 2PE4A 1CGUA 3CUJA 3LV5A 5FJOA 3WLHA 4Q8MA 1Q6RA 3M7SA 1K6WA 1RH9A 3N2XA 1AMYA 2GK1A 2PB1A 1S5WA 3L4WA 1U83A 4HD5A 2J25A 3PJWA 4PMYA 1ZBWA 3PP7A 1KFWA 5BWFA 4WUIA 2QDGA 3W1NA 3QY6A 1K02A 4WHBA 1ONEA 3VYLA 4IUOA 5LZLA 4GO8A 3SCSA 3FA5A 1FWHC 1CCWB 1J2BA 4KEVA 4R85A 1K7EA 3RM4A 2XM2A 4LAOA 3MCMA 4UQCA 3POCA 3ABSA 3GS6A 1CW2A 4LS2A 2XGBA 2XZ7A 1JFHA 5LA2A 4WVXA 1OYBA 3W26A 4DAIA 4M81A 1A5SA 1BXNA 3PZOA 4B90A 1YNYA 1H7NA 1AL8A 3MO7A 1HX0A 2EKGA 2HISA 2JKAA 3XINA 2DGAA 5GJPA 3WJSA 1Q13A 1NOFA 3PWAA 3THQA 6PTDA 1A5CA 2NZLA 2VGBA 3CMGA 1SFSA 3UPMA 4O52A 1H7RA 3U48A 5LHFA 2R8WA 3H4WA 4YVXA 2RJGA 1AH4A 2QS8A 2X1TA 3EBVA 3H4GA 1XI3A 3P8IA 3BXWA 3PAJA 3BGJA 4H04A 1R2SA 4WLCA 1E55A 5K7JA 3BDKA 1VFHA 1A3HA 4OT7A 3TJ4A 3CHCA 4L4LA 1EBGA 4BFAA 3MQTA 1ZY9A 3T7VA 1BYBA 4XKYB 3IGHX 4R9OA 4KFNA 3VXGA 2KAUC 1AZ1A 2XFFA 5BXSA 1AVAA 1GZ1A 1WKDA 2YKKA 3HFTA 3BOXA 2A7PA 4ZFCA 4NY2A 3JU2A 1W6TA 3W76A 4ZB5A 1OEPA 4XSLA 3MHFA 3GD6A 1ICPA 1S5NA 1BSIA 4DRSA 1TO3A 2FFIA 5TQLA 1NWUA 3AIEA 4F3HA 4U28A 1EPVA 3ATZA 3TVAA 4XUGA 5BZAA 1KV8A 2OWXA 1XIGA 1XLGA 3BCJA 4J1OA 3KRUA 2CCRA 4EAYA 3P80A 3GNRA 4WCJA 4FA3A 3NQEA 5LNWA 2J7EA 3BZGA 2Y62A 3CZLA 4IX2A 2DT1A 2WW5A 2MUCA 1H0GA 4BK9A 2XYLA 1E6SM 4GPNA 1KXVA 1R8LA 1CZ1A 1REQA 9XIMA 1ZJHA 4EPEC 1E3XA 2YL6A 4PMQA 5HANA 4ACZA 2ZRXA 3EX1A 3L4VA 4AZCB 5A94A 2QMJA 3M0IA 1W0MA 2GWNA 4D2JA 1SO4A 3EDDA 3VDGA 1Z7AA 5EFFA 3VUPA 1Q2RA 1AK5A 1RK5A 3FJNA 3TOPA 1UBPC 4IFKB 3RRAA 4CNOA 2Z2UA 5AHNA 2YCLB 4QE1A 2TYSA 1ZAIA 4NL1A 2G96A 3VCCA 1IIHA 1QNVA 4HOWA 4B92A 4JN8A 5A6BD 1GOWA 4HOZA 1EJ7L 1O1ZA 1MYRA 5T9BG 3UXIA 5KSWA 2GQ9A 2GWGA 3OHIA 3OVGA 4PZVA 3SUSA 1KR1A 3EOLA 1TPVA 4HNNA 2YDQA 1SJCA 2YXGA 4EF8A 3URBA 1EQCA 3TYDA 5HUOA 2YOCA 1XYBA 3ZR5A 3W02A 1NWSA 4H2CA 3U8GA 3CZGA 2WO5A 4D8LA 5TNVA 3GW3A 1F6PA 1LUCB 3UCCA 4Z1BA 3GR4A 4O4WA 1KRAC 2VUYA 4HHHA 2FPVA 1UP2A 4WXZA 4UZUA 4P7QA 1FDJA 2WWCA 4NZ4A 2PWGA 2UY4A 3JRKA 4XD4A 1JYXA 3HGSA 1Z6KA 4KS0A 1RBOB 3L68A 3SQMA 4GOAA 4NX0A 3GR7A 3STFA 1ITUA 1F8IA 3ZQ9A 3AHXA 4MMWA 6A3HA 1E4NA 3R4IA 1G94A 3IJLA 3NO3A 4FPSA 2A4AA 5CSRA 1TREA 3KOYA 4WIWA 3DBPA 4F9DA 2VOMA 3H70A 1PX8A 5HJYA 4AC1X 2ESCA 3PJUA 3U5YA 5D2XA 4AD0A 5I00A 1PVNA 4S2CA 2OEJA 5KZ6A 3P61A 3UJRA 1E5JA 5LIXX 1OX6A 4IX0A 3KBVA 1VF8A 3E0WA 2POTA 4X22A 3PZUA 2VRQA 3MHUA 3NSMA 3OW1A 3PBMA 4QHRA 2D0HA 5FJJA 4HCLA 1O1HA 2R94A 4DNHA 1OIMA 2QCCA 2VO5A 4FS9A 4LCQA 3AIVA 2PDHA 3AYSA 1MSSA 1RXOB 3GUGA 5CLTA 1KNWA 3NG3A 2BBFA 2O9RA 3WLMA 2A21A 2PTZA 3AXXA 5CC5A 3N15A 3T1GA 3WQ8A 1XLAA 1EDTA 2Z00A 4N6EA 3SSJA 2OJPA 1YTKA 3ABXA 2WMFA 2ZZ5A 5K9CA 1F6YA 4XUYA 3VNIA 3M0VA 5DBUA 3T0CA 1P48A 2O55A 4EPKA 2W61A 4GUJA 4FZIA 2V2DA 4GC3A 4JFSA 2AAMA 3PBVA 3VKAA 4JHZA 2V67A 2JEPA 3DOPA 4JTHA 3ARQA 1XV8A 2GUBA 2WM0A 4LEQA 4IJCA 2J78A 3E1F1 2EQDA 2ACUA 2OQYA 3B0YA 4QSFA 1IEWA 3ZWTA 1I4NA 2CBJA 2BS9A 3GU9A 2ZUTA 1EZWA 4GGHA 3QY8A 1XYLA 4JTUA 1M68A 2ZX5A 4M6UA 4MWAE 1WKEA 3W87A 3ABOA 3QW3A 5CQ1A 4RW5A 3TV8A 5HUPA 3F4NA 4JTEA 3BOLA 2G95A 3B9NA 5CG0A 1KTBA 3EAUA 2DZSA 1F4AA 1X8CA 2C0AA 4C6FA 3QMTA 2XINA 3EB2A 3PTDA 4HCDA 1FCQA 5AYIA 1QPNA 4FNSA 2YFOA 1L8PA 1TPFA 3TQPA 4BEQA 3L0KA 3ZO9A 2VFIA 3N2BA 1UOKA 3W37A 2AMGA 2ADAA 4OE7A 1VAHA 4YL2A 1O60A 1F6KA 1DP0A 1LOLA 1GKQA 2YW3A 2E8YA 5E9XA 2VHLA 3TIMA 1V03A 4XZ9A 1IZCA 3KCJA 2Z6IA 4Y7EA 2HNEA 4ZQPA 3VGGA 4XV0A 1PX3A 1W8GA 2IUZA 1O12A 3EDJA 1F76A 4MG4A 5FJRA 1KBKA 1OFAA 4S2BA 5CSYA 1W1TA 4BY3A 1JGMA 2J9YA 4QR6A 4GX8A 5EMKA 2C91A 5D2TA 3PZTA 1DIOA 2J9ZA 3GTHA 2FMOA 4JCMA 3GLCA 3I7RA 1SJAA 5DMNA 1RPKA 3KOWA 2EPLX 4XD3A 4QNEA 2VWTA 3FHAA 4RX0A 1AJ2A 1XR2A 1B4EA 2RH9A 5CZTA 5E0KA 1RZMA 5EMYA 1GWJA 4MF4A 2J7BA 3LMYA 4MZYA 3CGTA 3M4HA 2IPFA 3H2MA 3HQNA 1FHDA 1IWBA 1RVKA 4QEEA 4JAWA 3RG6A 1H5VA 2W62A 2PWHA 4DJDA 8TIMA 1S3TC 1DWIM 2VZSA 4Q33A 1ZGDA 2C0HA 4F8XA 2HNHA 1H5YA 5H2ZA 1D8WA 5AC5A 2POZA 3I7SA 3VOFA 5I3DA 1DJQA 1V08A 1PJ9A 1YDNA 2ZX6A 1MFVA 4C1LA 4FEZA 3FKRA 5CPOA 3VDCA 3LMZA 4IMFA 2WSPA 3VDBA 1OG6A 4E2BA 4JICA 1DTNA 4PODA 5A8QA 1RLDA 3FCPA 3S5ZA 4KGJA 2NQ9A 1ZS2A 4K38A 3RITA 3W53A 1V6VA 4CQCA 3VKCA 3VOCA 4ERGA 2GGGA 4U2ZA 4GVHA 4NU7A 1QHPA 2MANA 5A2AA 4UTKA 2BHYA 2A0NA 1IHIA 1GONA 3S4TA 4MSSA 4J3SA 2CZVA 4RNJA 1UWAA 4PUNA 3VIMA 3UR2A 2J66A 2V9DA 4LYRA 5C7HA 5CBJA 3KOFA 4YLWA 3ZT7A 5G1TA 4ZGYA 4R34A 4JNMA 1V0LA 3LENA 4PGLA 4XAYA 3RPTA 3WN6A 4IFOA 4Q8UA 2IXVA 4ZQCA 1JDFA 2QVNA 1FFRA 2B7NA 1S3HA 1S1RA 3PBGA 4CEUC 4AG0A 3EMQA 4EPBC 2H3BA 1VFMA 1A5UA 3DERA 4QIUA 1XBVA 2V3GA 2H90A 4PEEA 2ZTKA 1HJSA 3M5YA 3E02A 3SRDA 3DH7A 3NGFA 1MUWA 1YPIA 4W9TA 4FNPA 4HYRA 1WKYA 2DUAA 3E96A 5FF4A 4ZZ9A 1XCXA 3HPAA 4D1IA 2NX9A 2VOTA 1KBLA 3SIMA 2R1MA 4MY8A 4X60A 4J7RA 3GIYA 1SZGA 2CLPA 4PA8A 1BG4A 1E0VA 1ZNNA 1NY1A 4UFIA 1A5KC 3ICJA 4PC8A 4Z0SA 1P0KA 4IJRA 3SJNA 3W7OA 4DZAA 3TTQA 5HPOA 4TVCA 3A9IA 3QC0A 5C0QA 2XH0A 3PZ9A 2WK2A 4LUSB 4B16A 1TJRA 3LPGA 4OECA 3LXBA 1WDSA 1P1XA 1S1PA 1VFSA 4K7YA 3QPYA 4ZENA 2C15A 1UQZA 1Y5WA 3SECA 2A2IA 3DG3A 2HCVA 3CUGA 3TFCA 3TE9A 4ATDA 1JDEA 1GW9A 3R0UA 1WP6A 1YMYA 3HMCA 3T0BA 1BEUA 4PMJA 3CHFA 4YTUA 3PSVA 4MJMA 1QWKA 2WM1A 1RJRA 2ACRA 3A23A 4PE8A 4RR4A 1JCMP 2GZXA 4P8VA 1VS1A 3ZVIA 1WV2A 1DE6A 5CSUA 5DCBA 4GUFA 1M41A 1O5QA 3E2VA 1OK6A 4FP1A 3ITLA 4EWND 2XH2A 1E9LA 3MUZ1 2D3LA 1WUFA 1JNEA 1DWHM 2Z1VA 1C93A 4G5DA 1TX2A 3DGRA 3EOUA 3FFSA 5FEXA 3PTKA 1F3WA 4FX7A 2Z26A 4AYGA 2PSNA 1G4PA 3N2CA 2QCLA 1SZFA 4QJ1A 1DOSA 3CIXA 4QG8A 3D6NA 3MZ2A 2FPYA 2FIQA 4J9JA 1H61A 4REQA 2PP1A 3N4EA 3EWYA 1G0CA 3G1XA 1Z3NA 4NNBA 4FLSA 4LALA 1ONWA 3WLJA 3LCLA 5C6MA 2WXDM 1Q66A 4B5SA 3MVIA 1GORA 1SZEA 3NQDA 1PZ2A 3IEBA 4IMGA 1N2VA 3VGBA 1W3HA 4I6KA 1JPDX 3I3EA 2HRWA 4RUBA 3C6CA 4HSNA 2BY0A 1UC5A 1BPLB 4W84A 2IMRA 4V1XA 3O3RA 3GH7A 3P0WA 4O16A 1LQ0A 3BURA 4GQBA 4XAGA 5G5IA 1SJDA 3W0KA 1H1YA 3TSBA 1JPKA 1U5VA 2EJ1A 2D0GA 2V30A 4KCTA 4JTLA 3UPWA 3D46A 1HN1A 1AJZA 5HWJA 3MZNA 3KS6A 4Q7BA 1JGIA 4NVTA 3RDKA 4DN1A 3WF0A 2B4GA 1FRBA 4AW7A 2EKCA 3MU7A 3ZWSA 4C1NA 4POCA 1OC7A 3WQGA 3ARSA 4NZ5A 1KWKA 2X1RA 4E5TA 3GY1A 3TQ0A 5DQPA 2CXGA 1U1UA 3SCUA 3AIWA 1J6OA 4KQNA 4AZ6A 3DFSA 1DHKA 2FVLA 4OTKA 4ZOAA 3KWSA 1ADSA 2E09A 3ZSSA 1HF6A 2FZBA 2ZC1A 1KO0A 4N7QA 1NDYA 2ZYFA 3MPGA 2NVCA 3QZEA 1RHCA 4GYPA 3GG0A 3IJ9A 4R7WA 5LIUX 1BD0A 3BJSA 2QCMA 2ZE3A 2WAGA 2ZXAA 3LQLA 4FXRA 3VM5A 2ZZ1A 4LSBA 2D73A 1FKWA 5DY3A 2CPUA 2ABAA 4JX5A 3NA8A 1NIUA 3GDRA 3WJXA 1EIXA 5M2FX 3NEVA 1KTCA 3EWCA 4UTWA 1PSCA 3T09A 1R3WA 1EFZA 1DE5A 1I8JA 1UZDA 3DUGA 5I5RA 4AZGA 3M16A 1PE1A 3BK0A 1FWBC 2ZE0A 3VU2A 2XN2A 3RX3A 3W83A 2Z29A 3A13A 4XD5A 2YZ5A 1V6YA 4M3PA 4AZIA 4HB7A 3TQKA 4GY0A 3WQCA 1SU5A 4OIFA 3GAKA 5C7VA 2ACQA 4K68A 5FL1A 1XJBA 3NPUA 3AMCA 1HP5A 3EEZA 1OYAA 1MFUA 3NSXA 3Q2DA 3W7EA 4DO4A 3KBSA 3W7QA 3BLLA 1E6NA 1XRFA 3GTXA 3PG8A 5BRBA 1OVDA 1THFD 3MMWA 3CU2A 1ME7A 3W29A 5JVLA 3URQA 1WDRA 1XLIA 2ALRA 2WVTA 1HKKA 2WPGA 1OFBA 4Z2JA 1FOBA 3S9IA 4F0LA 3ES7A 2NV2A 3VKKA 1MNSA 2WCGA 4JQ1A 3W27A 2V63A 1WCGA 2W79A 3A24A 4YVPA 2BVDA 1XHGA 1RK6A 2ZWZA 5DO8A 3IK4A 3PB0A 2PTYA 4H00A 3REQB 1RD5A 3QYSA 3VILA 4Q8WA 1NQKA 3UJSA 3DG7A 3S6DA 4HMEA 3W9ZA 2DSZA 3K8MA 1Q7ZA 2PDIA 3G3MA 1XH2A 3HBLA 1JQXA 3MCOA 1TV4A 5M3WA 4NNAA 4A22A 2BZNA 3TMLA 2WNNA 3RYSA 1NFPA 3AZTA 1OABA 1NDVA 4R7OA 3QMSA 2G5WA 3L2IA 1K70A 3WMLA 2YBVA 3AOFA 4HT3A 4RZBA 5JQ9A 1CXIA 3GB6A 3PF3A 3TN4A 3B9DA 1UP0A 3KBWA 3ARPA 5LIKX 4DZIA 1S5TA 5H8PA 3ZMRA 2C1IA 1T96A 2ZUVA 3BG5A 3N14A 3SRKA 3VUSA 5DX7A 5ABHA 1B0IA 4K2SA 4NASA 4G56A 3ITGA 4MYXA 1QAPA 1V6TA 1MXGA 3KVLA 1TV3A 1NWRA 1OB0A 1C7SA 4FF7A 4ERAA 2CLFA 3TCEA 5KETA 1JF6A 1PUDA 1Z32X 1TJ2A 3CS2A 1OD0A 3RCMA 1XLBA 2OSWA 2P10A 3H12A 5ABFA 1V3MA 3WQOA 1QI0A 5AYYA 3RK8A 3N1AA 3U5UA 2YYTA 3H24A 2IPJA 2BOGX 2NVDA 4IF2A 3WD4A 3WDJA 3U57A 4YTSA 1QMLA 2GDUA 3CHDA 4JIIX 4C60A 1HW6A 3WH8A 4TU1A 1LT7A 3KOXA 4ZVJA 3TNOA 4B5XA 2NXHA 2VGGA 2V69A 4KWVA 5JUVA 4Z1AA 1XC4A 3IPWA 5GNXA 3W7PA 4S23A 4Q4PA 2HE5A 2EPMX 4WDXA 3ZJKA 1L2QA 1PWLA 5DCEA 4U4MA 3SY1A 3T0DA 1HTIA 1N8FA 1PBGA 4DB7A 4IIBA 4JIQA 4FOKA 4ZE4A 1E3ZA 3H6OA 4I5RA 5CCZA 4ZB0A 2PRMA 3EA2A 2ZXQA 3R1ZA 3OGSA 1HUVA 1Y5VA 1YYAA 4W93A 2FYMA 4IT1A 2PDNA 2B0MA 3E0FA 1ME9A 3AC0A 1DIKA 4CNUA 5HBFA 1UP3A 3H2FA 4J2MA 4DUVA 3UD6A 3CH0A 4WKFA 2QAFA 3TYBA 4ADSA 1PCKA 1KCZA 1PKNA 4O54A 3NUKA 2E28A 3MV11 5I78A 3OZOA 5AHEA 1GVFA 5F2IA 2FZ9A 2V8ZA 1VHCA 2G4FA 4E3VA 3DENA 1KFLA 1NP2A 4ZOCA 3R58A 2R1PA 1OCNA 4GIAA 4RZ5A 3L4UA 1MW3A 1PTAA 4WY0A 3AUOA 1PV8A 2VR5A 1QHOA 3NIYA 5I7GA 4GNJA 4C7DA 3KCOA 1O7AA 3N9SA 1EUNA 3ZSTA 4X0VA 5J5RA 3MBFA 1GQKA 2YW4A 5AFDA 5D8ZA 5DRCA 3OQEA 4REQB 2PDMA 1QR7A 4IG2A 4ZODA 1PKLA 4INFA 4HN8A 4PL2A 2W91A 1UKOA 4GACA 3EB4A 2P53A 3UXKA 4GCAA 4W7VA 3QV6A 2BGNE 4AVFA 1UWRA 4S3CA 4UMBA 2EPOA 4B15A 5HMFA 3HF3A 4WXYA 1AQMA 3MHGA 4Z08A 3GZ3A 3QC3A 2GJRA 5IFTA 2VNCA 4H4IA 3CTTA 1CLVA 1H1ZA 1EA9C 1W3TA 1EQPA 1ONXA 4YTQA 3EYPA 3ATYA 3M07A 2X2GA 5EKYA 2X8RA 1C8QA 3V5CA 1RCQA 3LTSA 2HTMA 1OGGA 5FSDC 5AYZA 3WEOA 3OG3A 2RDWA 2IW0A 1LG2A 3TTEA 3H22A 1QPRA 4A2RA 3ARZA 1LG1A 3KDOA 4H2HA 3R8GA 3F5KA 4MKVA 1IXOA 5FEWA 4LYQA 4W5ZA 2Z7GA 4DJDC 3SUVA 2XVKA 3QPZA 4UNKA 5HAOA 3TX9A 1DBTA 3L23A 1WDWA 2PTWA 3WBWA 3FKKA 1LL4A 4KPLA 2E40A 4K1GA 3P84A 1TYGA 3A47A 2QGHA 3AIRA 3H7UA 3WNMA 4IM4A 3WFAA 4UFKA 3FSUA 1HFBA 6REQA 1PXGA 5HWNA 3AQUA 2J13A 3K46A 3L65A 3GXFA 3NURA 1DXIA 1KLYA 1E0TA 8A3HA 2PODA 1SPQA 1W3LA 1E1CA 4PCTA 1JZ2A 2O0TA 3WH6A 1V7AA 1JDAA 3NQBA 3U6WA 4A6GA 3MI3A 1OX4A 3GRIA 3BICA 1M53A 4S3KA 4CVUA 3WMCA 2NWRA 3P5YA 2PLMA 4BWLC 2A1YA 5IHRA 3BPWA 2VM8A 3RCYA 1Q85A 4GI8A 1UYQA 2YXOA 1WDQA 1OHLA 1E43A 1VRXA 2Q71A 4GI9A 3LPFA 3NQMA 1ISWA 3CAQA 3EXRA 3SUUA 1E1EA 4JEQA 4ZSUA 4QQ3A 2E8ZA 4DYEA 3ONBA 4L9YA 2X40A 5HXMA 2I57A 5JBFA 2QVHA 2PD5A 1TQJA 1YXYA 3ELFA 1FWAC 3A5FA 3A22A 1EDQA 4XX6A 4ZBCA 2PGRA 1KM6A 3MUIA 2ZUNA 1GG1A 4A4AA 3YPIA 1GCYA 3ABQA 4PFMA 2GFTA 4US5D 1SFLA 2BHUA 4CQAA 1D9EA 3N34A 1XIFA 3H55A 3N9RA 4PTDA 4UFLA 1WAWA 3MKCA 4NJGA 3S9ZA 1R30A 4Q8QA 4JEJA 1P0EA 3BAWA 4TMCA 3QLLA 1IXNA 1PTGA 1XM3A 3HZ3A 3ENLA 1TRDA 1MEWA 3PG9A 5BU6A 3CTLA 2FGBA 3VNZA 2FMNA 3W75A 3OZMA 3H53A 2WWDA 4P2VA 4CEXC 5I3FA 2OODA 3WQ6A 1JFXA 3FNDA 3RAOA 3C0SA 3O6CA 2FH6A 3H4XA 3MSRA 1B3VA 3KVMA 4RLIA 3LGDA 4C65A 1KKRA 4DWSD 3OB8A 4DHGA 2DVTA 3QRHA 3OLIA 2DT0A 4W88A 2P3ZA 3FOKA 2QDEA 1C8VA 4E4PA 3N6JA 4B5VA 2ZFAA 3I6TA 2QUTA 1SW0A 4H6QA 1ZB5A 5I77A 1CGVA 1F4HA 3KZPA 2Y7EA 4L64A 3CZEA 1GQLA 3CO8A 4LF1A 2YCEA 3KW3A 1RCXB 3IV8A 2NQJA 2V5JA 3AUJA 1JNDA 3NPXA 2WKLA 1XISA 3IARA 5KEZA 2X16A 2QUMA 3UXLA 3DESA 4EF9A 4D1JA 2OYMA 2YLLA 4LUTB 1FWEC 3M9YA 4LS1A 5EYWA 1O5XA 3FSTA 3ZR6A 1XSJA 2QCNA 4IGMA 2V82A 1VKFA 4BR1A 3UVIA 4M51A 1I75A 4O53A 4P61A 8RUCA 1ZBVA 7XIMA 1GQJA 2Z28A 1D3HA 1VEOA 5FOOA 4RDZA 2DJLA 1K03A 4O1DA 4FSAA 1P6BA 2PWFA 4MWAD 1HJXA 4XIMA 1LRTA 3K8KA 2UBPC 3A5VA 2F2KA 2JGQA 5LYRA 2CZDA 1W32A 3W2JA 2OG9A 3SUTA 3MB9A 5C2CA 1NH6A 3N6QA 3KS5A 1A5OC 2FZMA 3VIOA 4J3ZA 2ICSA 2ZBTA 2NXIA 3V36A 3AMDA 1I1WA 1D2KA 1YIXA 1H7OA 4J5NA 2GUUA 3K4AA 1I45A 5JH1A 4YJ5A 4US5A 3W6MA 3VAVA 4QS5A 1JVNA 2IKJA 3W1LA 1JUBA 1KWGA 3JZUA 4Q3MA 1W56A 6XIMA 3RRXA 2VGIA 3HJZA 4B9ZA 1OCJA 5K4XA 2QUVA 2OPJA 4IFRA 5LHEA 2VURA 1EEXA 2P50A 4JQAA 2XWDA 3SCPA 5DY2A 2VVSA 2AGTA 3LYEA 3A3WA 1E6QM 3G0SA 4NIRA 3T8QA 4D6HA 4PUJA 2PU1A 2XSXA 1MDRA 4HNTA 3AJXA 2YLAA 4I90A 4OUEA 1I2NA 4JL2A 4H9TA 3Q4DA 4P7LA 3S2LA 4I9TA 4DWSA 4F40A 1KXTA 1GVEA 3FEQA 4IXHA 4G7FA 1R85A 1XRVA 2OX1A 3XISA 2WHJA 1V5XA 2BGSA 3LU2A 1KLZA 3G0UA 3M0JA 4ZTYA 4UTWC 4DWDA 3UY8A 2RDUA 2YL8A 1V8EA 3I6EA 2FGZA 4MPQA 5B80A 1QJWA 3KBNA 3TC7A 3GHSA 5IHSA 4A8NA 3WFLA 1Q6DA 5FF0A 4A05A 5EGRA 4F0MA 2TODA 4HPNA 1UR9A 3GXMA 4DJEA 2ZIDA 2CBIA 1JXJA 1XH1A 3CAKA 5RUBA 3W7GA 1UZ4A 1BRLA 2PDBA 4KF1A 4PL1A 3M46A 3TH6A 3NOYA 2J88A 4N9DA 2YDRA 3KVJA 1NU5A 2PC8A 4CU8A 3P2VA 1EXPA 5REQA 4LF2A 3DI0A 4O19A 1IQ8A 3NM1A 2DVXA 4QISA 5BOOA 1HL9A 4YHGA 1G9HA 2ZRUA 2E0PA 1HKWA 1I2RA 3GVGA 3QGAC 4LAKA 1GOKA 4QS6A 3R8RA 1E6RA 1G01A 3W2NA 5I07A 3GXTA 4Y6GA 4LAZA 1GUVA 1JCJA 2AQWA 4M1RA 4ZQNA 1GOIA 3E0LA 5LNUA 1OT2A 3TW6A 5ABTA 4TOQA 2O9TA 4GINA 1WNOA 3PNUA 5D38A 2Z0IA 4RJEA 3VCNA 2DW6A 2BVWA 5FJUA 3C5QA 1V3IA 3DKJA 1R3QA 3OA3A 3H7RA 4N02A 1XYMA 4AVNA 5D02A 3RNDA 3W7JA 4AY1A 4YVVA 3QEZA 5CGQA 4QLJA 1W9PA 4AX7A 3PB2A 5C2XA 4FIQA 4IQLA 3WJWA 3ARXA 2CLEA 2XN0A 3WMBA 1FCUA 4K7VA 2ZXBA 1T99A 4ILSA 2YB1A 1IR1A 4UCFA 1EUAA 4O0QA 4GGBA 2OFJA 3V3WA 5JH2A 1VIZA 2I9UA 2WZIA 1A3XA 1HKVA 1ALDA 4L65A 5CPSA 3Q67A 1SZRA 4GUHA 2V68A 3T40A 3R2GA 4RKAA 4IP5A 3W7RA 1QNOA 4Z1DA 4DZ5A 3TTSA 4GABA 2JIWA 5CGTA 5A2CA 2R1LA 1HL2A 3GIQA 1XD0A 3FYOA 4PTVA 1XCWA 3LTYA 3M6YA 2J7GA 4C6OA 3L21A 5CPTA 4LYPA 3VD5A 1VJSA 3LTPA 3IJIA 3T55A 2OQHA 1UQYA 1B54A 3AISA 5E6ZA 4AZBA 3DG6A 3PBYA 1GHSA 1TPH1 2W67A 3VOHA 3A64A 2ZZ3A 3WG6A 3HO8A 2WCAA 2ZA3A 4ZA0A 5LA1A 2WZMA 3PR2A 3WBYA 1M7JA 4AD1A 4EKJA 1V02A 3TA9A 1PWMA 3TAKA 4B5TA 1CXFA 1GHRA 2NVAA 2CU0A 3EX2A 4QITA 2DV0A 1I1XA 2JEQA 3O9NA 3O1NA 2IKIA 3ZLFA 2PDCA 3J7HA 1C3FA 1MI3A 3MCNA 5U7SA 1WZMA 2EF9A 3E5PA 1LWJA 1XUZA 4UZSA 1DJWA 3T05A 4JTAA 3M43A 5LXEA 4U33A 4M0XA 1D7KA 2BNJA 1P7TB 3H21A 2D0FA 4FF5A 3V1PA 3WD2A 1VBGA 1E70M 1MQQA 2AKMA 3OTRA 1UR4A 3CUHA 4UWMA 4TTGA 1XBXA 3WQWA 1FHVA 2XTKA 1VPXA 3THUA 1DHPA 4MLRA 3LB0A 2QCGA 4A21A 5AC7A 3B4YA 3GG1A 5G2IA 2AL2A 3GYEA 1UWTA 4HA4A 2QCHA 4NZCA 3OBKA 1DIDA 1HKJA 4OU1A 2F61A 2CLKA 2PFHA 2HK1A 3I68A 1NWTA 1SVDA 2INEA 2YXXA 2C71A 2ZX8A 3TA6A 3Q58A 2BASA 1FDYA 3THAA 2EJAA 1YNPA 2V81A 1FH8A 2WB5A 1JUEA 5K4ZA 3W1UA 5E1QA 4GA8A 2EGZA 3VD9A 4RV8A 1ITQA 7ODCA 2VFGA 5BW6A 1J2WA 5CEWA 4E4FA 3DC0A 5LNVA 1R7AA 3QQWA 4Z42C 5IDZA 3RLGA 2ISFA 1QFEA 2YBTA 5HJLA 1UUQA 4C6KA 3LHWA 1WO2A 3VE9A 3AS2A 1FX6A 1LBLA 1H3GA 4ZO8A 1W1PA 3CWOX 4XISA 2QKFA 1KM5A 2XGZA 2QF8A 3CLMA 3SCQA 2Y7GA 4B9YA 3C3UA 1V0KA 2QF7A 5HR6A 4NXKA 3BGGA 3WEZA 1SGJA 4UC5A 2PU0A 4UFHA 2DIEA 1RQEA 3F5JA 4JQ3A 4U31A 1E4LA 1YQ2A 2A85A 3DAQA 3O6DA 3GDTA 1EOKA 1W1YA 2JKPA 4Z2IA 3AS0A 3KL0A 5AECA 1K3UA 1GKRA 1QDSA 2X09A 2ANUA 4O1BA 7REQA 2R6OA 3FGCA 1EYEA 2B31A 1UUMA 2QJIA 1L8NA 3B8DA 1ZFJA 1O94A 3EOSA 3MDUA 5JIPA 1O68A 4LBRA 4Z1YA 4AH7A 3C2EA 3VM7A 1UD2A 1JZ6A 1WB0A 5GNZA 2E1WA 1NOWA 1E6PA 1TVPA 1E4MM 2R9RA 3O05A 4G8TA 4WY0F 1SO3A 3QXBA 3WLNA 3GFYA 5DF0A 3MI2A 4N4PA 2C8NA 2DVUA 2QDDA 3CUXA 2Y5SA 3S2CA 3TZNA 4GVGA 2CC0A 3RX2A 1LJYA 1TZ7A 3O63A 1RY0A 1W1B1 3H26A 2PRHA 2E6FA 1OJXA 1Q4NX 4H8HA 4O14A 3IVUA 3QGKC 4UOQA 5I79A 1IIGA 3EXSA 4Q8PA 1VZWA 1OCBA 3RMEA 2CERA 1LZOA 3GBDA 3F2DA 2PA6A 1J18A 4JYDA 3GG7A 1AL7A 3UWVA 1X1OA 3LBMA 1WBJA 4JX6A 4J3WA 2OLHA 4XK2A 4AWUA 3MUCA 3GDLA 1ZHAA 4UIOA 5KTLA 1BVWA 1TWIA 3ARVA 1LDCA 1R87A 4S3BA 1WZAA 3L66A 2HV5A 3NTYA 5E5CA 1AUSL 1H2JA 1HNYA 3PZIA 1K6AA 2CKRA 2VFFA 2C13A 3V35A 4MLJA 2Q8LA 4EXQA 5C9ZA 3WLLA 3L5LA 2CZ5A 1HGYA 3G1YA 5HMSA 4Q4RA 2AQVA 3TROA 4IPJA 4Q32A 4L1XA 4AD4A 1G7VA 4W5UA 4PCSA 5HQMA 4G6CA 2Q09A 1BQCA 4DUXA 2GQ8A 3IJDA 4HVXA 3BGAA 4I3GA 1W91A 3N17A 3R0KA 4M24A 3WF4A 3V0TA 1EA0A 1EC7A 3H2OA 3W2UA 3AIQA 1LQ2A 4EK7A 2Y1HA 3ZFHA 4LS0A 1VCVA 4NAFA 4CCDA 5U4NA 3U2CA 5HMDA 4Y9MA 1SW7A 3B9OA 4FIRA 1TWSA 1IT7A 3NR0A 1F9CA 2Y89A 4FLQA 3XIMA 2WC7A 1UB3A 4IJBA 4ASTA 1H11A 1TUFA 4UFMA 1NJJA 4JXCA 3OVQA 4AZHA 1JCXA 3UR8A 1I9CB 4CNSA 4TMBA 1US3A 1RSCA 3NL6A 5BMWA 1Z41A 1QNRA 3WK0A 4OV4A 4ZXOA 3VIPA 2CKSA 1ZAHA 2ATMA 3P3BA 4GH1A 4GXWA 4BS0A 4EXBA 3KFTA 2PZNA 3DHFA 3GSMA 3WH7A 5HR7A 1HGWA 3GNNA 4GZJA 1GW1A 2DDXA 5FKYA 1TMLA 4I5XA 2EAWA 4ENLA 3B0XA 2ASHA 4OQVA 1R38A 3DIPA 1FY6A 3TN3A 1U22A 1W5QA 4PB3A 2HPMA 1G7UA 1C90A 3GVVA 1RAKA 1C92A 3BMXA 4C6DA 4DYJA 4FHAA 3VNLA 1JULA 1EJSC 2A3LA 4Q7NA 3BLDA 3G1AA 3QGVA 3W1RA 1EHNA 4X9SA 2RAGA 3OO2A 4HSHA 2EG6A 3EEGA 2HBVA 4BHYA 1UH2A 3T2PA 4C6QA 2FHBA 4M6PA 4V2XA 3HPFA 2YFNA 5F7UA 3EMCA 4EOUA 1ICQA 1K8XA 1SYTA 4AY7A 1CLXA 1KA9F 1QW8A 3RLVA 1KM1A 3ANUA 4LANA 2W63A 4WR3A 2AAAA 2J47A 4QX4A 3KZSA 1GYMA 5HATA 3LN3A 1DVJA 1HJQA 1OIFA 3TJLA 4R88A 4W89A 3AZSA 1J12A 3VOIA 2J9XA 2CHNA 3P6LA 2ABBA 3WL1A 3HG4A 3AO0A 1AA1B 2J79A 1UUOA 5FSEC 3CPRA 2FZDA 4WDTA 3AFBA 3FW6A 1XLLA 5T91A 1OCQA 3STPA 4XIAA 4B2DD 1P6CA 2IQTA 1VC4A 1VEMA 4A8LA 4O8AA 4DBEA 1OY0A 4W86A 1TVNA 2Y8VA 3ISIX 1W17A 5GJMA 5I3HA 1MEIA 4QJ3B 1M7XA 3HB9A 3MKKA 3FYPA 4KKXA 4UR9A 4QEHA 4CD8A 2X0SA 1OFEA 1EO7A 1WE5A 1ZBKA 3QHMA 2XIOA 4ML4A 5CBBA 3CPGA 1V3KA 1DWAM 2ZKMX 2OTDA 1MW0A 3EGJA 4WK9A 5C54A 4C6PA 2YYUA 3B8VA 3BARA 3LCGA 3H7VA 3VKDA 4C91A 4I8YA 3U2ZA 2E5DA 1U5HA 2VRKA 2NQZA 2VCBA 3W23A 3VOGA 1LWIA 3D5HA 2WPBA 1MEHA 1KRBC 4K3ZA 4FB7A 3AAMA 1J79A 3H8AA 1W9DM 3OGRA 1GOQA 3EX6A 1TE6A 2JIEA 5A8NA 3APTA 3QOMA 2W92A 4O18A 3VTRA 1LTDA 3WO8A 1G5AA 3SCOA 3WBXA 3AHTA 4K36A 4O50A 1R2RA 4DWSC 2X1SA 2GJXB 3RN6A 1XLJA 4PH6A 1GEHA 1OQFA 3HPSA 2I5QA 2WQDA 5G2HA 4HTYA 1KC7A 1UD6A 4GXMA 3W7KA 1VEPA 4KBXA 2PWEA 3SEPA 2BGQA 4PFHA 1UASA 4MUPA 2QHAA 4ADUA 2WMHA 3WUGA 1B3OA 3S47A 1VPYA 5F4SA 3W2MA 2QJNA 3A4AA 3THCA 1JEZA 3T42A 3LY0A 3CQHA 4JKLA 2ZUUA 3U9IA 4HHMA 1FDZA 3CPUA 2HQAA 3UR5A 3MMDA 4O8RA 4A2SA 4YYFA 4PTXA 2REQA 1A47A 4MB5A 3NJ3A 1XGZA 1MZHA 2C3ZA 1XS2A 1UC4A 2PURA 2ISVA 1RP8A 3LXCA 5CC7A 1POJA 2P1FA 4JIRA 2O4QA 1UPMB 4RL3A 1IWAA 3N13A 1I0BA 1G4TA 2ZICA 4IGNA 1AJ0A 3H2EA 2VX7A 3VC6A 1P0NA 1GPFA 3IUDA 3S8HA 4LCRA 5CKSA 1ODZA 3TEVA 3LG3A 4Q8VA 1TKKA 1W8SA 3K30A 2A3CA 2I56A 1XDLA 3ARTA 3VA8A 3QQ1A 2DZAA 1TVLA 5G4EA 1G6CA 1XLHA 4PRRA 2W27A 4MWAC 3GTFA 3KLKA 1WQ5A 5BU9A 2HE8A 5FIPA 2PBOA 2WNZA 3RIKA 2ZX9A 3APGA 1TFVA 3QV9A 4HTBA 3QOKA 4O0ZA 3VCRA 4C5ZA 5HOSA 4J3XA 4JTFA 2PMQA 4FLRA 5G1MA 1IZKA 4XB3A 3VD4A 4ZO7A 1LQAA 4IIHA 4MOZA 3A12A 3RXZA 4WKAA 1H50A 4ZTXA 2R82A 3WCZA 4KW2A 1Q4WA 2WVVA 5C70A 2EO7A 5ECUA 2YDAA 1TRIA 3W24A 2J6VA 2VEGA 4LPCA 5MKGA 3HQ1A 4GJJA 4S38A 3NZQA 3SN0A 1MXDA 3P0XA 3LLXA 2WVUA 4LX4A 1UD5A 5F1VA 4E6MA 3BC9A 4H1ZA 1TV5A 1LLWA 3KHJA 5AC4A 4AZ7A 1GGOA 1ZCCA 4K37A 4GJIA 4H9UA 3RO8A 2QGYA 3WQDA 1J0JA 3EWBX 4J4KA 2FHCA 1TWZA 4G9PA 2OOGA 4NYUA 3CL7A 3DDMA 2BXYA 3IWPA 1NDZA 4YNGA 4Q6XA 1XBYA 4QTGA 2E68A 2UZ9A 4A3YA 1BHGA 3KOZA 2BG5A 4WGXA 3CV7A 1R6WA 2BTMA 4OBRA 4LRTA 3VGHA 3PBWA 5HULA 4EE9A 4JZ5A 2XZ9A 3MUY1 3N4AA 1Y7VA 1X1ZA 3F1QA 5J5DA 3JR2A 4UTTC 4WJXA 3GNXA 1J5TA 4Q4KA 5BOFA 2OKOA 3WH9A 3HMJG 1RQHA 4JFWA 3WD0A 1LBMA 5DN1A 4YHEA 5DMLA 4HU0A 1R3YA 1JD9A 1UR3M 4RNHA 4DZHA 3PTMA 4JD4A 4TVUA 4J3UA 3G1RA 5E0FA 1Q3NA 4L6DA 3UWYA 4JX4A 1FWJC 1Q2SA 1OM0A 4TQTA 3WNNA 2TRSA 3S1VA 3ID7A 3NOEA 2WMIB 1OFQA 4RNIA 4DPPA 5IM51 2CLOA 4GYFA 4OGZA 3W86A 1V3HA 1DWFM 1SR9A 1RD6A 4TX9A 2X7VA 4Q22A 4O4VA 2WANA 5IOBA 5I6SA 3S1UA 3W22A 3CO4A 2P8BA 1KM3A 4AEEA 2IQDA 3PPGA 3P5ZA 2FJKA 3AHZA 1JCNA 3SGGA 1UA3A 2RJHA 5D32A 4QAWA 4IWWA 2WHMA 3OVRA 5FAGA 4JTGA 5BRQA 1UMLA 1M9HA 7A3HA 4M6QA 5IBXC 2G3MA 4HZ8A 2XPKA 2YCKX 3ARWA 3WLSA 1JUKA 2VENA 3IAPA 3E2SA 1B1YA 3OG2A 4EP8C 4AWTA 1XLCA 3LI0A 3PK7A 4OOUA 1IGSA 1JYWA 3PUOA 3ZS4A 3N4FA 3BOFA 3GNPA 3DFOA 4BKNA 1GVOA 4AIEA 3RHGA 4FR1A 3UG8A 4H19A 3T4WA 3STCA 5SWUA 5D30A 2CHOA 2QIIA 3INPA 1NEYA 5GVJA 3F2BA 3R0DA 4GLEA 4NHVA 1YHTA 4GQ0A 3AHYA 3QTPA 3I4KA 3WLRA 4GI6A 5TBOA 1UMYA 2W9MA 3L12A 1HVXA 3VNJA 5AN7A 5G4WA 2Y2WA 4D8AA 1J5SA 2J62A 4DF1A 1WXYA 3BLKA 2PF0A 1CB7B 4Q6JA 1CBGA 3NQ8A 3NVTA 1LL6A 1BYCA 4F48A 3LERA 1UHVA 5D2WA 3BQ6A 3JZEA 1QNPA 4M82A 1FCBA 4GYJA 1X7IA 3L2LA 4IGSA 3WLTA 3IGXA 2VC6A 1ZJBA 1AZ2A 4R53A 1BGGA 4CQ8A 1EB3A 3VZYA 1UD3A 4C6IA 4NJIA 3S1GA 1I0DA 4CN6A 1UOZA 1XINA 4TR9A 2PF8A 4R33A 4AF0B 3H23A 4HHPA 5CPNA 1GZJA 2QLYA 2CLHA 3NXFA 1QO2A 1KKOA 1ZQ5A 2OWWA 3SR7A 2ZA1A 3WQ4A 4HA0A 1JAKA 1YDVA 4HPXA 4O1CA 3VFLA 3ZR4A 3IGSA 4YN5A 1A5AA 3K8LA 5TF0A 3GM8A 2ZQ0A 3ITTA 2GGEA 2C14A 2I1OA 5B7YA 3L67A 3TCSA 3SQLA 2UV8G 3QLDA 1RLCL 1WAUA 3K13A 4CD7A 4PSPA 3N9KA 4P8XA 2O4MA 2VELA 4CD6A 1J9YA 2VWSA 3TC6A 3TSDA 4LC6A 4MNMA 2XVLA 3GIPA 3V0UA 5A5WA 3WNPA 2Q3RA 4M8UA 2YA0A 3S2JA 4IPLA 4QDMA 4UTLA 3JUGA 3DFPA 4LB4A 2P76A 4JNZA 2E1DA 1OD8A 4HNCA 1PTDA 1MQRA 4LEFA 2PDJA 1YE6A 2IS7A 3H2CA 2IKHA 1A0CA 4XZNX 1EGVA 4I7WA 2REQB 4L4PA 4I6VA 2PCQA 1JPHA 4N4QA 2MNRA 2CW6A 4DX3A 1FP9A 3II1A 1KR0A 2GVYA 4Z2LA 3MW7A 4XAPA 2PEVA