4NIRA

Crystal structure of b. anthracis dhps with compound 6: 3-[6-(trifluoromethyl)-1h-benzimidazol-2-yl]propan-1-ol
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
274
structure length
274
Chain Sequence
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and characterization of an allosteric inhibitory site on dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate Synthase
total genus 102
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4nirA00
4S3EA 4D9PA 4C1NA 2H9AA 4O1EA 3H26A 1Q85A 3TYZA 3MCNA 2DZBA 3NOYA 3H2OA 2VEFA 2VP8A 4S3AA 3H21A 2VEGA 1EYEA 3MCOA 3TYCA 3H22A 4C1NB 4S3DA 1F6YA 4S3CA 3TZNA 3H2MA 2YCJA 4PZVA 2DZAA 1Q8AA 2YCIX 4DJFC 4NIRA 3V5OA 1TX2A 2Y5SA 4S38A 4MWAD 4D8AA 3H23A 2OGYA 3H2CA 4DB7A 2E7FA 4DJEA 1AJ2A 4DJDC 4CCZA 4HB7A 2YCLA 3TR9A 3TYDA 1TWSA 2H9AB 3TYAA 4S23A 4MWAA 3BOFA 4DJDA 3H2AA 3K13A 5JQ9A 4S3BA 3TYEA 4DAIA 4O0QA 4NL1A 3H2NA 1AD4A 3TYUA 4D8ZA 4DJDD 1TX0A 1Q7QA 1AJ0A 3MCMA 4DJED 2Y0FA 4DAFA 4S3FA 4DJFA 1AJZA 1TWWA 4DJFD 2YCKX 3BOLA 3H24A 2DQWA 2Y5JA 4O1FA 1Q7MA 1Q7ZA 4MWAC 4G9PA 1Q8JA 1TWZA 3TYBA 2YCLB 4NHVA 4MWAE 4MWAB 4NILA 4S39A 4DJEC 2BMBA 3H2FA 3TZFA 3H2EA 1AD1A
chains in the Genus database with same CATH superfamily
3HG5A 2ZDRA 1KGUA 3UY8A 1ME8A 2C15A 1K8YA 1X39A 4O1BA 2Q3OA 2D23A 1EGMA 2PRLA 3T0BA 4UWMA 2ZOXA 2Y8KA 3DERA 4IP7A 2EPLX 4XWUA 4H9VA 3L0GA 3C2FA 2Z1BA 4DBEA 5HINA 3ANYA 4NY2A 3APTA 3EOUA 1JF6A 4MB4A 4JHZA 3SCVA 1QI5A 4BJHA 4XTDA 1NFPA 1N8WA 2SFPA 4A2RA 4QGCA 2XIBA 4B3KA 3H4GA 1BRLA 5A6KA 3NDZA 4GI9A 4JFTA 2FGLA 2YBVA 3IJ6A 3U9IA 1BTCA 3S6OA 2XM2A 1IXPA 5DBUA 3URAA 1UD2A 2C7FA 3M6YA 3UWVA 3WKZA 5FEPA 4B92A 2J6VA 4HSNA 2A3LA 3OVRA 1ZP3A 3NQDA 5CBBA 2BX7A 1OYCA 3GRIA 4CCCA 4JQ4A 2QJIA 1Y5WA 3QMSA 1A5UA 3GUWA 4E8GA 4J3TA 3T81A 4XTIA 4UTJA 4ZQNA 3W1XA 1AH3A 4OIFA 1XBVA 2G8ZA 3G5EA 1J11A 1AD1A 5DMMA 4A3QA 4ZFMA 4JEJA 5CC5A 3S5NA 2WZEA 4YLWA 2JGYA 4LCRA 3TWBA 4UFJA 2WVTA 3AS2A 3CBWA 4HVXA 2OG9A 1DJYA 1REQA 5FEXA 1LBMA 4PMRA 2VC6A 2VDIA 3TYCA 3WEZA 1UH2A 3BURA 4W4QA 4K8HA 1XHGA 2Z7GA 3N2XA 2E5DA 3ZM8A 9XIMA 3RGTA 5J5RA 2V5KA 5HJXA 1GJUA 1J0KA 1W32A 1QPNA 3EKZA 2VC9A 2OQHA 1DJZA 2PP3A 3QGKC 1UKPA 1VB9A 4S2CA 2NQHA 4JIRA 2VRKA 3VK5A 3E2VA 1EBGA 2XVKA 3D6NA 1J93A 3VDHA 3LV6A 2XH2A 5IFPA 1OF8A 1Q6GA 5AFDA 3NWRA 3TE9A 3O7UA 1KXVA 5IDZA 3E2SA 4X22A 2UBPC 2BG5A 3WK2A 3UCDA 3N9KA 4LVBA 3BJTA 3SW6A 3GY1A 1QO2A 4AXNA 3R43A 5LNWA 3A3WA 2JFEX 3WMBA 4H9XA 1KM6A 4AFYA 3QTGA 3VILA 3MBFA 3DI1A 4HU0A 4HJFA 4MHBA 3W7NA 2OZTA 1TRIA 4BI6A 1I2QA 3NQGA 3RMEA 1KM3A 3I7QA 3U48A 5G4HC 3EKLA 3S0CA 1JPIA 3W0KA 1VBJA 1E0TA 3UD6A 3TLLA 1IE7C 4OUIA 1V79A 3PZTA 4XAGA 3W24A 1XX1A 1PYMA 3Q94A 3CUJA 3CAQA 1F74A 3LBOA 2I7GA 3TWAA 3G1YA 1M01A 8TIMA 2PLKA 1CGYA 5KETA 1MUMA 1W0MA 4HZ6A 3FA4A 4M8UA 5CGTA 3LS9A 3A5FA 2DZXA 2QGYA 2CKSA 4ZGYA 3Q4DA 5I5RA 2ZE3A 3OBKA 4H3DA 3KDNA 4FLQA 3HGJA 1YE6A 1FCUA 3REQB 1XPGA 4J4KA 3TTOA 3MVTA 2P0OA 1ZAHA 4XQ6A 1JFXA 1RY8A 4YN5A 5LNVA 2QCFA 4UTFA 1BYBA 1NDYA 1HGYA 2Z7KA 1IR2A 3RRAA 4UR7A 2PTDA 5CCZA 2G3MA 1JPMA 4TMBA 2ISDA 5DELA 4U5KA 4Q8WA 4DUXA 4H19A 3G1FA 1V4YA 1NTHA 4FXFA 4JTLA 2F84A 3LRKA 2E68A 2FYMA 9XIAA 1GJWA 3LCXA 4S3AA 3AS1A 4XAFA 1UMYA 4W86A 4G2DA 3PB0A 1R3VA 2P53A 1A3HA 2G3FA 5M2FX 3OZYA 4IF2A 2G3NA 2PDFA 2Y7GA 3WMLA 4DWSC 1H63A 1UBPC 2GQAA 5EMLA 1JNDA 1WZMA 3ORWA 5LXXA 4MUPA 2HCVA 1W9XA 1JCTA 5T9CE 1DORA 3AMLA 4ZE5A 2ZX8A 3L67A 1F05A 4JQ3A 3A3HA 2BHZA 1LOQA 1UR8A 4IG2A 4FO4A 4JIPA 2D0GA 1D8CA 1XCFA 2WZTA 5CEWA 1TV4A 2QYGA 1C3FA 4I7WA 4DJFD 3LG3A 5LGXA 1PL9A 4P61A 2HZGA 2I16A 4B9YA 3GDMA 1VBHA 4C6CA 1YNQA 4LAZA 4M6UA 1WV2A 2ZRYA 3WQVA 2FLIA 2UWFA 4I9TA 2P10A 4EPEC 1LCOA 2CZ5A 2CKRA 3U5YA 2GSJA 2ZRXA 4YHEA 4D2JA 4MKSA 1E4IA 1N82A 2QXWA 4ILSA 3VNIA 1B3XA 1QBBA 1BYDA 4J35A 3TQVA 2QPUA 3OGRA 1LL6A 3POCA 1EYEA 4G6CA 4V1XA 4MSSA 4XD5A 2NWRA 4QLLA 3QV8A 4IXXA 4WX2A 4NXSA 1YLVA 1R9ZA 1WX0A 4C1LA 2BDQA 2I17A 2NUWA 2DQXA 1WDSA 3MZNA 3NUKA 3FX4A 4ZQMA 4YTUA 1KBIA 4IGMA 2GJRA 5U4NA 3FCPA 4I7UA 1U33A 1FWNA 4NF7A 3N4EA 3L4TA 1SO3A 1KKOA 3MSDA 4M51A 3UESA 3N12A 4HP5A 3BW4A 3HFTA 3D3FA 3N34A 2HPIA 4X0VA 2X30A 3B9EA 3LHTA 1BRLB 3MVIA 1ISVA 1EZWA 4F2TA 3ENLA 3UZWA 1EPXA 2EKCA 3NM3A 3REQA 4AG0A 5D2YA 3HGSA 1FWHC 3DHUA 3LN3A 2HXTA 2CLFA 1MFUA 1XYBA 1OCBA 3TU9A 2Z2UA 1YX1A 2G37A 4HHLA 3RILA 2QJNA 1I6NA 1OX4A 1REQB 5CZSA 1UCWA 3E2QA 5D05A 4ZTYA 1C90A 2R91A 3G18A 1XLEA 4G56A 5CPLA 3IRSA 3W2UA 1WE5A 1EKOA 1RCOB 2VUYA 3CZKA 1TSIA 3CL7A 3TV8A 5AC5A 3MMUA 1HKKA 1YE4A 3UPBA 5LIUX 4IIDA 3FN9A 3FY1A 3WUEA 4AF0A 3CV1A 3VCRA 1GTHA 1DE5A 1EDQA 2HNHA 9RUBA 1OQFA 4LGXA 2FZDA 3IRDA 3NQ7A 2ZYFA 1ZGDA 3S5ZA 3QPYA 4Q8QA 3WNNA 1Y0EA 2RJGA 4QQ3A 4DJDD 1VYPX 2YA0A 3BG9A 4A3UA 3B0PA 3G0UA 3VOJA 3WDRA 3L65A 3WYZA 3HO8A 1ZTVA 3ECQA 3VNLA 1PE1A 1OFOA 1QPKA 1EYWA 4PB5A 3VNMA 4CNNA 2CCRA 3EGJA 3ARVA 4C91A 3PP7A 3AXMA 1E72M 1VS1A 3NQVA 3TSMA 4O18A 4ALDA 4S39A 3GXTA 4Z1YA 4GFIA 2FPYA 4IM4A 2TYSA 2VEIA 2DSVA 1PYFA 2E8YA 4D9PA 5IBXC 2VT0A 4H01A 3EAUA 3NM1A 5C0QA 1W3KA 1P1MA 3ITXA 1XINA 4D6CA 5JH1A 3TKFA 1OY0A 1UIPA 4L4PA 2X2GA 5A94A 4GABA 4ADUA 5HXMA 3MKVA 5CPNA 4I3GA 3PJWA 3STCA 1R7OA 5DXYA 3BG3A 1F73A 4FNQA 3MJMA 3I3EA 3E38A 1QI2A 3VX1A 2W79A 4QE4A 2A79A 3JZEA 3WUGA 3QSRA 4AY1A 2PPGA 3QSTA 3GH4A 5D4YA 3GR7A 4AY7A 3PANA 4OBRA 4WEVX 3RG6A 2VR4A 3W81A 1GUVA 2F8QA 3NPWA 1P5BA 1TPB1 5HR7A 4DNMA 1DPMA 5F2IA 4HPHA 4IOTA 1GVQA 5GVJA 3VOIA 4MJMA 1WNOA 1PDYA 3C52A 4WHBA 1H11A 2JKEA 4QNWA 4DBWA 4M80A 4WSJA 1Z89A 1X96A 2QUUA 2XIIA 5A2CA 3CASA 4WDWA 4XAZA 2WNQA 3OPSA 4G5DA 2PF8A 5CSSA 1KTBA 3E9AA 3M0JA 2XGIA 3T2PA 3RO8A 4FOUA 1XUZA 5E0FA 3PB2A 2PDHA 1V02E 4MDPA 4O1EA 3MSYA 1XLLA 2ISSA 5FJPA 5JIWA 4U28A 3BCJA 3QMTA 4CKQA 5GJNA 1KCLA 3H70A 4IQDA 3GXDA 4RDWA 4DHGA 3I10A 5HOSA 5KZDA 4JFWA 4NYUA 3KX6A 1ZJHA 4BQ3A 3HOJA 4BWLC 4R5EA 3GDKA 5LA0A 2BXYA 5CZKA 4Q8VA 1VQTA 2O9TA 1G6CA 3SRKA 3UZZA 1FRBA 3O07A 3IIZA 3K13A 1GZGA 2Z0IA 3DFTA 4CLMA 6REQA 3MI6A 1LZOA 1MMFA 4P8UA 2FDMA 2QIIA 3AIQA 4QQUA 1GPFA 3ZVHB 2J77A 3WD3A 3EOOA 4L9XA 4JN7A 2V3DA 1XSKA 4S3FA 4Z0SA 4W89A 3PPCA 3VC5A 3VABA 4DO4A 1JCJA 4ZB0A 2RH9A 3HG4A 4LWWA 1P7TA 2FZ8A 4ROQA 3NR0A 2D2OA 1PJ9A 2QJHA 1THFD 2XN1A 3BO9A 2ISFA 3ABQA 2XJ7A 5ABHA 3N18A 1C7SA 1O60A 1X1ZA 4O1AA 1WXZA 1XD0A 5D8WA 5E5CA 2VZVA 3LY0A 3RM4A 1SZFA 4C6JA 1E15A 1K7XA 4QE1A 4URIA 4UFLA 2X1UA 1TPEA 3AIRA 1V6XA 1HFBA 1BQCA 1Z7AA 4R9XA 1QPQA 4ZQRA 4MY1A 4D71A 4GH1A 1FHLA 4J27A 3TR2A 1OD8A 1SR9A 3A23A 2BOGX 2H8XA 1XIHA 3RU6A 3CIXA 3U7BA 1NAL1 4DIAA 4GE8A 3KL5A 1I4NA 3UR2A 3ZWTA 2DZAA 3D47A 3USZA 1KRAC 1IEVA 1MXGA 3PSWA 5GNYA 3FAWA 1EP3A 4MWAD 3QOKA 1M7XA 1RA5A 2YDRA 5FKYA 4HTBA 3ES8A 1C91A 4C6PA 1JYVA 1Q6DA 3TW6A 4QR6A 1EXBA 4AVOA 3U2EA 5D30A 1QPRA 4W93A 2OELA 1CGUA 3M0KA 3O05A 3BICA 1K77A 2RGLA 2ZDSA 2P0IA 5ABFA 1UZ4A 3RJYA 4GLEA 5LZLA 3MWCA 3NSXA 3EWUA 4PBFA 4I8YA 1K8ZA 1UZ1A 1SW3A 3WMSA 2GVEA 4DO5A 1OEPA 4DZAA 4F0KA 4R34A 4B15A 1VIWA 3M0ZA 3LUTA 3CPGA 2EKGA 4AZ6A 2OEKA 2Y89A 4Q8OA 3P62A 3KW3A 3UZYA 1L8NA 2XM1A 1ECEA 3TA9A 1FDJA 1CTNA 1X98A 4J3XA 2TRSA 4MFEA 1FBAA 4QEHA 5E0KA 3DGRA 3W71A 2VKZG 2PDBA 3DECA 3WF3A 4JKLA 3PTMA 1N55A 3BAKA 1S1PA 4IGHA 3LBMA 5IBXA 7REQA 1F6YA 4A3YA 2J13A 1UJQA 1SJAA 3N4AA 1QHZA 5HJLA 5D9NA 5EB8A 1TVPA 3KVJA 2WBKA 4MZ1A 4ZOEA 1E4LA 4QEEA 4MY9A 1B1YA 1V0LA 4NP7A 2A6NA 1PZ1A 1ML1A 1UWTA 2J79A 4NVTA 2XYLA 3VD4A 3H12A 2V2CA 3WNOA 1JDCA 2FFIA 2PLJA 1NY1A 2WSKA 5HWMA 2DPEA 3DKJA 4M7SA 3B0YA 4A6GA 5C9WA 3FHAA 3QR3A 3W76A 3KM8A 3OLEA 1F2JA 4PRRA 1LQ2A 1MWOA 4EE9A 4YNGA 2OT1A 1EXPA 2W5FA 4FALA 3TN4A 2PURA 4N02A 2PU0A 1ZJBA 4DVOA 2WCAA 1XICA 2PDYA 4M82A 4KERA 3BJSA 3ZMRA 1HJSA 3H26A 2VWSA 3LOTA 3RDKA 1UD4A 5H6HA 4H1ZA 1GTEA 1E9YB 3CO4A 1UIOA 1GZJA 3T44A 3RCNA 1TPH1 3S5YA 1RA0A 3SAZA 1VGAA 2PSNA 1NU5A 4NRRA 3DYMA 1FXPA 1SPQA 5E0CA 1WDDA 5CC7A 1OD0A 4DZIA 4YVVA 1OFEA 3WBEA 1EGZA 3NAVA 1VD6A 2E6YA 2GJXA 4KH2A 1W17A 1XRSA 2IXUA 3P7YA 1YHTA 4WF7A 4DXVA 3IPWA 2VTFA 5BNKA 3ZFHA 4H83A 4OU1A 3BSMA 4EP8C 7XIMA 1W9UA 4TXEA 1KR0A 4PFHA 3BTNA 1XXXA 4AYGA 1W3JA 4I5UA 2W92A 1W1TA 1F3TA 3BOFA 3M5VA 3EX4A 3MO7A 4UQ9A 3QGVA 1DE6A 1QCWA 2WVSA 4XG1A 5I00A 1WOBA 3CZ8A 3TYUA 3B8TA 1U30A 4LVAA 1BGGA 5CJ5A 2BXZA 4DYJA 2PWFA 4KFPA 4O53A 2IKIA 1OT2A 4IUGA 1MI3A 3HQPA 2ZZ5A 2OQYA 3DAQA 2EBNA 1M9HA 3C3UA 1E3ZA 1E1CA 1Z9AA 4FLOA 3HPZA 3F2BA 1BG4A 4KWVA 3GK0A 4RNJA 2WMIA 4IPIA 3KBSA 4B2DA 1NWSA 1EJXC 2FZ9A 1OGGA 5FF2A 1ALDA 3ZVIA 3VIMA 3AYRA 5DQPA 1ISWA 1EJRC 1EIBA 2QIWA 4S3KA 2P5NA 1UD5A 3VUPA 1VCGA 4N9EA 3Q2DA 3TC7A 2DJXA 2D2JA 4H9ZA 5G5IA 3Q67A 4L7ZA 1U5HA 1ICSA 2PODA 1J10A 4Q3MA 2YCLA 4MB3A 1CGWA 3BAYA 1XLIA 3MZ2A 2H9AB 1PUDA 4DJDA 3G0XA 1GG0A 2A2IA 4ATWA 2RFGA 5G2IA 3AMGA 3NEVA 5U7SA 4D6FA 1K02A 4JYFA 5RUBA 1IV8A 4S3JA 3W85A 2ZXAA 5EPDA 3SFKA 2QHAA 5TNVA 1S3HA 3FS2A 5KITA 3N2TA 3TW7A 1MZHA 3UWZA 4OJYA 1B9ZA 2PE4A 1Z69A 2OEJA 4GRSA 4H6RA 3FVDA 2NVCA 3CAKA 4ZTXA 1BD0A 3DU0A 2BVWA 1K6WA 3RU8X 4NAEA 4J28A 5L9FA 3E02A 1KRCC 4XZIA 4IP5A 3SBFA 4BF9A 4TVUA 1QPOA 3CQKA 3QMRA 2VX4A 1VYRA 3W53A 1T5AA 1LLWA 4XAPA 2A3CA 3GDTA 1EHNA 3GE7A 4P7NA 2EPMX 4LVGA 1BYCA 3JVAA 1Q63A 1VIZA 4XO7A 1GHSA 1GNXA 4OE7A 3N14A 2Z1KA 1ENUA 1R3SA 2CBVA 3IIPA 3E96A 3NSNA 1VC4A 2YCIX 2CXEA 3EPMA 4NSBA 3R79A 1FX6A 3Q45A 3UXDA 1GORA 4Y2WA 3PBVA 1KFEA 4S38A 4PUUA 3CWNA 4DJEA 5HULA 3NPVA 4FX6M 3U7VA 1B4EA 5LKYA 2ZA1A 3OJGA 4MWAA 1PV8A 1UBSA 3DHPA 4LC8A 2VWTA 5FESA 1SW7A 1QNVA 5J04A 4YVXA 1T8XA 2GJLA 1BF2A 4IPNB 4Q8PA 3P74A 3GO2A 2HVNA 4NAFB 5F2GA 1BGAA 2VFEA 2VUNA 5CAKA 2VEPA 2WZIA 4HSHA 4AZ5A 2WMFA 3UT0A 1RD6A 1KCXA 3GZ3A 3LQGA 5D09A 5I3JA 4DWDA 4U4MA 3AHVA 3WQFA 4LAMA 3THQA 4EOUA 3VE9A 1EL3A 1LQAA 1J12A 1D3HA 4M56A 2CHNA 4JTHA 2XHYA 1WKFA 5D2VA 5XINA 1CBGA 2IQTA 1UD6A 5DLCA 4GXMA 1DKWA 4YHGA 1E0WA 1K9TA 2DVXA 1JRCA 4HMCA 5I09A 1H1ZA 4TQTA 2YR1A 4FK9A 5A95A 3EOSA 3U2ZA 4XZHA 4GGBA 4IICA 2RAGA 4NYYA 2YDSA 1FCVA 5HMDA 2OWWA 1D3CA 1B3YA 3M5YA 1CB2A 2VR5A 1KBKA 3N4FA 3UEQA 6A3HA 3CLMA 5CZ0A 4ZQPA 3DFOA 4AZ7A 1EUAA 3VM7A 4D8AA 4RZ6A 3H23A 2NVAA 5I6SA 2OXNA 2WWDA 1UWRA 5TBOA 2ODOA 4C65A 4Z42C 5GNXA 3UJEA 4H2CA 4L1WA 1FXQA 2HWGA 1XL9A 5FJOA 2GWNA 4YVPA 1FTXA 1R3QA 3W38A 4Q8TA 2DT3A 4QAWA 3KWXA 4JNZA 2J62A 2HE8A 1B31A 1SMDA 3A9IA 1C29A 1S38A 2G4FA 4MNJA 4GJIA 2WSPA 1O95A 2Z6JA 2POZA 5BOFA 1PTGA 1T8QA 4IIBA 4DI8A 2OSWA 3QYSA 1TV5A 4J40A 3P8IA 4NG3A 2ZZ4A 5M1TA 1W54A 2EPOA 3T4WA 3VCCA 3LRLA 4S3GA 4Q4OA 2VGFA 3POHA 4RNHA 4KCVA 3BQ5A 3ME3A 1US2A 2FMNA 3AWNA 3F4DA 4GQQA 4IFKA 3CPUA 2Z26A 1OWQA 3P3BA 2X41A 4LSBA 1C8QA 1OIFA 2R14A 5EFDA 3CGTA 4AX7A 2GUUA 4R7WA 1JYWA 4EACA 1WDQA 4LQ1A 4WSKA 2ZUUA 2X1IA 5H8PA 3V4BA 3L2LA 1JDEA 4XBSA 5EMMA 3N6JA 3TVAA 2J7EA 1V08A 3WUFA 3OLGA 1M65A 4DQWA 3C2RA 1DJWA 1BYAA 4H8UA 1K8CA 5HWJA 1OT1A 5I78A 5HAOA 4RE2A 3M46A 4ZB5A 1M41A 4C7FA 1DIDA 4DF1A 5BYWA 4LPCA 5AZ1A 2E77A 3IJ8A 1Q6OA 3OLIA 4UTKA 4D72A 1TV8A 2Z1WA 3PBYA 3M6DA 4B5VA 3ARXA 2PZ0A 1EJSC 4IQJA 1VYSX 3HM7A 4NILA 1EB3A 3PBGA 3AISA 1T99A 3QM3A 5D9OA 3C6CA 1MXSA 1S1RA 5MKGB 1VLWA 3N73A 4AXKA 4LC6A 4R88A 4OZOA 3TYZA 5DXXA 4QBXA 1DHKA 1LBFA 4G1KA 1VJZA 4JTDA 1KNWA 1KLYA 2NXIA 1Z32X 3GIPA 3LXAA 4IX2A 4QLKA 1CI1A 3GNOA 3EWWA 2G3JA 5MF5A 2PDWA 4UC5A 5FD0A 1UC5A 4B2DD 1KXTA 3BOXA 5CSRA 3CTLA 2CNCA 3FJ6A 4DEFA 2E6FA 4X9YA 2RDUA 4NJJA 3VINA 1NM9A 4WR3A 3LSCA 3AOFA 1SJCA 4DWSD 1ZFJA 1UJPA 3VU2A 1HL8A 4Z17A 2PCQA 1JUBA 1ODZA 5M5DA 1WO2A 2E9LA 2ZX5A 4HB7A 3S2MA 4CU8A 3AU2A 4GYKA 4RV8A 3MKCA 3A47A 2GFTA 3HA1A 2BP1A 4AZCA 2XSXA 2Y61A 5G1TA 4O0QA 4P7RA 4HHPA 1XGZA 4O11A 5DMLA 4DUWA 5AKQA 4O0ZA 3L0KA 3CIWA 1W1VA 3RX4A 1W1A1 2J9XA 3AU6A 4TV6A 2UY3A 4N2YA 2WVUA 2C0HA 4ZVJA 4WJEA 2QJMA 4GH3A 2R1MA 4H04A 1OCNA 3CMFA 2VQUA 1XCWA 2JALA 3SR7A 3QW4B 2EJ1A 3W82A 5HATA 4IMCA 4DLMA 2IQ0A 2PWHA 5KSWA 1CGTA 3DOPA 1OGSA 3I4KA 1U5VA 5JU6A 4QITA 3IV3A 1A47A 2TODA 3A4XA 3K8MA 3VX0A 1POKA 3MPGA 5TQLA 4V27A 1JI2A 4Q22A 1I60A 2BV9A 3TCEA 3WF4A 1TVNA 3VGGA 3AUOA 5H91A 5IFTA 2AQOA 5LNUA 2RDWA 3ZYZA 1XDJA 3ITYA 1J0JA 5LYRA 4OOUA 3SGZA 1R3WA 1NSJA 1V3HA 2PP1A 3FGCA 2ZICA 3BLKA 5HMFA 3CL8A 3OG3A 2A3AA 2FVMA 2O92A 4HKPA 4NUWA 3ANVA 1DJNA 3A4AA 3IGSA 3N3MA 3RXZA 2Z27A 1TA3B 4QNEA 2INEA 4PMNA 2WNWA 3NL2A 2YLLA 4FR6A 2DZWA 3P60A 3ZJKA 1HJQA 2OLSA 1JAEA 3II1A 3GC5A 1V0MA 1W9DM 5CGQA 4B16A 3S6TA 3H4XA 2WJDA 2ZXDA 3LA4A 4TX6A 3PULA 1WZAA 1L6WA 3B9AA 4LANA 2E9BA 2F2HA 4HPNA 3LEPA 3QV6A 2ZFAA 4LS1A 2VRJA 4PR4A 1E6QM 1XH1A 2QUVA 1JXJA 2X0HA 1ZALA 2FFCA 4M81A 3NNTA 4QJ3B 3ZSTA 3ZJ8A 3N17A 3SUUA 4ICCX 3B03A 3F5KA 4Q8MA 3P61A 3GSMA 1YNPA 3NQAA 3HTWA 3CMJA 3K8LA 1TIMA 4GZ7A 3GUGA 4E3VA 4ZEPA 1MXDA 1XI3A 3WJYA 1JCXA 3MHGA 6PTDA 4CNTA 3S1GA 1BXCA 2BZNA 4ZR8A 4ZO8A 4JCMA 5CXPA 2VHLA 1V8EA 3DBPA 4E8CA 1FWDC 4U31A 4LW7A 3S46A 2ZRWA 1MYRA 1F6PA 2TSYA 2I5IA 1QW8A 4V33A 2X7WA 2WXDM 1JZ2A 1SZRA 4DBSA 3M0LA 1OABA 5CSUA 3I7SA 2WC4A 3S9YA 2AAAA 4Q7IA 5D9PA 1Z8AA 3T0CA 4HD5A 1JAKA 2B7NA 2DSKA 2V3FA 2FZBA 1HTIA 2W67A 3FYPA 4JX5A 3LI0A 4JIHA 3MYPA 3TQ0A 3CZEA 3GXNA 1UWIA 3DG3A 1A5CA 4M29A 3W23A 4PCSA 4GY0A 3R8GA 4RZ4A 3KCJA 2OYMA 1M53A 2PDIA 1ICPA 3GTNA 1JYNA 3EWZA 2PP0A 5G2HA 2JF6A 2YW3A 3N13A 4Y7EA 1IT8A 1LG1A 2DZBA 4KF1A 3TJ4A 3LLXA 1EX1A 3DGBA 3UR7A 3J7HA 4HU8A 3S1UA 2CZFA 4AD3A 1GYNA 4LY4A 3MT1A 3BGAA 4PULA 4CD4A 3GYEA 1FCBA 1QK0A 1FCQA 4JHMA 5E70A 1ITCA 1JDAA 3T9PA 4FSAA 3AROA 2WMHA 3ITVA 4WOZA 4H8HA 2WBGA 2REQB 3WD2A 3HMJG 2QAFA 2FQIA 4F0HA 3TA6A 2Y85A 4FF7A 2X1SA 2PRMA 4KFOA 1UMLA 3EMQA 5A2AA 3WK1A 3UG4A 3WLRA 5EBUA 2HNEA 2WLYA 3SCWA 2CLEA 1QOXA 3LBCA 4AD1A 1S5MA 2V63A 4HN8A 4DM1A 1CT5A 1PPIA 1TELA 1S5NA 3ALGA 3LB0A 3MUIA 1UH4A 1D2KA 1GHRA 1EO5A 3LENA 4L1XA 4A35A 2QF7A 5FEWA 2PEVA 2W0UA 4XZLX 2YBTA 1K70A 2OKOA 3NTYA 3UVIA 1XR2A 1V0KA 4O12A 4L65A 4PMYA 3PFRA 3C0QA 3FEMA 3PNUA 1FWBC 4HT3A 2OOGA 1YBQA 1LUCA 1PSCA 3IV8A 5BU6A 2CEQA 1QWKA 4NJHA 3W1TA 4XD3A 3OW1A 3G2GA 1M5WA 4O17A 4A2SA 4JD4A 2F7FA 4DY1A 4YS1A 1BWLA 8XIMA 4RNIA 2DZTA 1GYLA 1O66A 1QMLA 2VZUA 1E0UA 3SCUA 2A4AA 2NQLA 4CQ8A 1KXQA 1FKXA 3OBEA 1K4GA 4JS3A 4LBRA 1ZPTA 4AC7C 1H0IA 3R0KA 1YRRA 4MAVA 3DC8A 1LJYA 3LI1A 1VH7A 3LGGA 2Q09A 4UNIA 4J7RA 3R5EA 3WD4A 3B0XA 4ICNA 4D8ZA 3LPOA 1AJ0A 3GIYA 4KRTA 3TXVA 2AMGA 4GVIA 4HZMA 1BF6A 5D8ZA 1WZLA 3BAWA 1O12A 1K9FA 3LGDA 1N7KA 1AJZA 3V35A 3NYDA 1XYLA 1SW0A 3IWPA 4XZNX 3L0NA 1QOQA 3N1AA 4BQ2A 2BHUA 3TSBA 3CH0A 1A5LC 1U22A 2CXGA 1O68A 3G8EA 4Z1CA 3FYOA 3PWIA 3W1PA 1X8FA 1ZZMA 2VGGA 1BFNA 2YDAA 4TVCA 2PDCA 2VX5A 3TC3A 1NFBA 1NQ6A 7ODCA 1SU5A 4ACZB 3AHXA 4LJ3A 4HOWA 1EEXA 3T2OA 5EKYA 2QZRA 3WJXA 4GO9A 3EB2A 3MCNA 3GTHA 3RK8A 3GXIA 4LS2A 4TV5A 3VGEA 2XFYA 3UY7A 4IIHA 1ONWA 1V5XA 1YTDA 4I9JA 1CGXA 1XRFA 5AC6A 3M07A 5EYWA 3BARA 4K8GA 4OVXA 2Q01A 2FB2A 4ATDA 4G7EA 4BEQA 2VR2A 3WLHA 4CEUC 1YXCA 3TNBA 4MDOA 3S5SA 4X2PA 5CPTA 4F0MA 1UKOA 5TD4A 4UTLA 1R38A 3L23A 1XUUA 1KFLA 1WKEA 1TTQA 1EX5A 3EXSA 4LTSA 3S2JA 3MANA 2BGQA 2GDUA 3EB3A 2J9YA 3W2JA 4ZSTA 1RCXB 4BR1A 1XKYA 2VFIA 3P6LA 4GIYA 3WNPA 3STEA 4Q7BA 3BLOA 4JX6A 3AMKA 3AIUA 1W3NA 2VFDA 3B9NA 2BSLA 4LF2A 1DVJA 2GQ9A 5CC6A 1TA3A 2CZDA 1YPIA 3LZ3A 5CQ1A 3KBJA 4FI4A 4CN1A 4QHRA 1RQBA 3CEUA 1LBLA 3PZNA 3WDHA 4H8NA 2C13A 4U3AA 1QBAA 2G4JA 2E9MA 4PUMA 5J8LA 4AY8A 3PY2A 4ECLA 1QTWA 4UTHA 3CIVA 5JBFA 1E0VA 2NSOA 3MP5A 1BVWA 2J74A 4I90A 4GUHA 3ABZA 2PC4A 2CERA 4UBPC 2E25A 3T42A 1VFMA 2V9DA 2IPFA 1SYTA 1ZNNA 4UTMA 3NEHA 3QEZA 4JTTA 3VGDA 4O16A 3C2OA 4UQBA 1IEIA 3JW7A 3N25A 3U0HA 3W1MA 3L5MA 1SZGA 4BS0A 1X8CA 3F1QA 4FPSA 3MQTA 3I6EA 1D7FA 1XLHA 5D2TA 4JQ1A 3ARTA 4K39A 4I7VA 1KFBA 4WOQA 5A5WA 4D6EA 2E09A 1US0A 4WVXA 4UQDA 3E3HA 2XFWA 1PVNA 2XGBA 3MUY1 2ESCA 4C1KA 2Y1HA 3W00A 2VCCA 3HU7A 1HKJA 2YL6A 3K1GA 3FKRA 3OYXA 3EDFA 1A5AA 3VDBA 3MP3A 1TJ2A 3IUDA 2XIMA 3ONCA 1FHVA 3MV11 3LTYA 4WZHA 1H7NA 1DHPA 3QYQA 2Z2AA 3W7OA 4NJKA 4OV9A 1XYZA 2E5BA 4AIEA 4GQGA 2G0WA 4WJ8A 3BLPX 3L12A 3UYCA 1OC6A 3VOHA 3UJSA 1YW1A 1FA2A 2YA1A 4MVAA 3CQIA 1H3GA 1NARA 1D8WA 4Z1AA 3QZEA 1TJ1A 4L4MA 2GK1A 3KBNA 1HKWA 4Y8EA 2I1OA 4GPNA 1QI0A 5I03A 2YYTA 1E55A 2GVLA 2VDHA 1J2BA 1G5AA 1ZBWA 4NT0A 3LD5A 1UR4A 2QAPA 2G5WA 3VD5A 4Z08A 3LMYA 3CO8A 1JYXA 3R11A 3W7PA 3P82A 4D6HA 1AFSA 3MUCA 4LH8A 1OX5A 1Q8AA 4AQLA 4QG9A 4NZ4A 2QCLA 3INPA 4LAOA 3KRSA 2VZTA 2OZ3A 3FYYA 3O06A 3OLDA 3SCRA 2VEKA 4J3ZA 3NPXA 1JD7A 1H61A 4CGTA 4DZ5A 3EMCA 2HVMA 1ZSXA 2XH0A 4W88A 1LRNA 3FLUA 3ZJ7A 1GOKA 4KEVA 3IACA 1E4MM 3SUTA 4IUOA 4L9YA 5ECVA 3T4CA 4O54A 5BCAA 2ZQ0A 5FJUA 3OVGA 1P48A 2ZZ6A 3WBYA 5C9ZA 1RALA 3RLHA 4DBUA 2F2KA 3SUWA 1JZ4A 4GZJA 2XIJA 5E6ZA 3UPMA 1PX4A 4H6KA 3ZT6A 4TIMA 2RGMA 3W86A 5BU9A 1E6ZA 1PKYA 1TZ9A 2DVUA 3E1F1 4FIQA 1N8FA 3PZVA 3QRHA 5EMKA 4FP1A 4IWWA 1O1HA 3NO5A 5PTDA 2NQ9A 1L6GA 5FF4A 3S4TA 2FTYA 3PBWA 2INZA 3VUSA 1EEPA 3CZGA 1WDWA 4PMUA 3GC2A 2Q02A 5BXSA 4NI3A 1GPWA 1VCVA 2Y8UA 4WJXA 2WK2A 4W9TA 4JFUA 3PFMA 2NVDA 3T05A 2DUAA 4JTFA 2PS2A 3DHFA 5LHFA 2FGBA 4NAFA 4FR1A 5AECA 1GVIA 1WKDA 2CW6A 3F4VA 1XLMA 1UOKA 3ZVHA 4FX8A 4RK8A 2J7HA 5DF0A 4Z2GA 3N2OA 1TO3A 4S1FA 1TTIA 2EEXA 1LORA 3PUOA 2V5DA 3VIPA 3MP4A 4AD2A 4DUVA 3JR2A 2QS8A 5DRIA 4FNSA 5HQMA 5K2ZA 1WUEA 4HBKA 4JN8A 1NDWA 1ZRQA 3OBAA 3EZ4A 3NQCA 1PIGA 4O14A 3WX7A 1F4AA 4F79A 3L4YA 3MA8A 1TPWA 1H49A 1VBGA 1X6UA 3UZJA 1A4MA 3V5CA 1IYXA 1CIUA 3R8HA 1V6YA 1AW5A 2Z6IA 1PHWA 2WV8A 1ONRA 1IQ8A 1VEOA 3UJFA 4EXBA 1B90A 5AHEA 3VDCA 3HG2A 2QMJA 4G7EB 2V8ZA 2VGIA 2I5QA 2ACUA 1DJQA 1TMHA 3CMGA 1W56A 3TP4A 1ZAJA 2PDXA 2W62A 2C1GA 3UWQA 2RHGA 3URQA 4M3PA 2OYLA 4W85A 1MNZA 4EKJA 4XUGA 1FP9A 2GGHA 2V38A 3GG8A 4XO6A 4GK8A 5IHSA 2WNZA 5D04C 2QR6A 2VX6A 1C7TA 1DJGA 5F2LA 4B3LA 1AQHA 2VEMA 4E4UA 3SRFA 3W87A 3S2LA 4MYXA 1P0DA 3WDPP 4PL2A 2FGZA 2A7RA 2CLLA 2CZVA 5I23A 3BCDA 3B4YA 1TZ7A 3DFYA 1IT0A 2ZRVA 1V7AA 4DBDA 3HF3A 3GVRA 3TDFA 4GVHA 1VRDA 3G1RA 1SFTA 2WO5A 3EOEA 4P8VA 3V3WA 3CUIA 3VNKA 2TAAA 2QGHA 4DUOA 4GUGA 3W7QA 1TE1A 1CXLA 3S1WA 4MF4A 1VP5A 1P0NA 4DELA 3PTDA 5KZEA 4KMQA 3WD0A 1K7FA 1OG6A 3KS6A 6ALDA 1R85A 3TYBA 1E6PA 1H5VA 3NGJA 4GUIA 1OYBA 4GI8A 3Q65A 1Q66A 1MDRA 6CGTA 1J5SA 4RV3A 3USBA 4FNTA 3CZLA 3IIVA 1Z3NA 5I3HA 3QJAA 1BXNA 2GK1B 1DWAM 3CYJA 4JGDA 3G3MA 3SCPA 3CJPA 2BHYA 3V0UA 1TV2A 3AS3A 1E0XA 3TW9A 2W6RA 3RCMA 3AZSA 1RHCA 3BANA 4E6MA 5EY5A 3UZXA 4Y9OA 5T91A 2F6XA 4A8NA 4MPKA 2CETA 3WENA 1RAKA 1ZU8A 3OB8A 1WA3A 4N42A 4CCZA 3SCSA 4BQ4A 3BH4A 1E6NA 3ABSA 3NGFA 1QNSA 4UFKA 2H3DA 4IL0A 1YPXA 2XINA 4N9CA 3GKAA 3ZWSA 4ZE4A 1FWJC 3KS5A 1AW1A 1PKMA 4QCEA 3K4DA 4KCWA 3K1DA 2OKTA 3WNLA 1KR1A 3NO3A 1E3XA 4QM1A 4F48A 3C0JA 1GZ1A 4HNOA 3UW6A 3B3DA 1M6JA 3FNDA 3PSVA 3SIZA 3V75A 3HZ3A 5GJMA 2B0MA 1MEIA 5K3VA 3YPIA 5HPCA 3L68A 1R9YA 3QZAA 4N9DA 3B05A 1PTAA 3LLDA 5BMXA 4KPLA 3WH6A 2BVDA 3A64A 1TTPA 2DUXA 2O7QA 5A8GA 4F8XA 5HMEA 1BQGA 1PS9A 2YX0A 3RPTA 3D3AA 2VP8A 3QW3A 5CZTA 1KWKA 2VD9A 3K30A 2BOFX 4IJRA 3P5YA 1R8LA 4NKCA 4UTTC 4D8LA 3KBVA 3STPA 3DBNA 4AC1X 3H2MA 3CUHA 3COTA 3MWAA 1RH9A 4A22A 2E28A 2UV8G 3QQWA 3IVTA 2WPBA 4EF8A 4Y96A 1R86A 2AGKA 4MM1A 2HK0A 3KRBA 4IIFA 2H90A 2BB0A 3E5PA 1B0IA 4R9OA 1TJ0A 1I2PA 5MHBA 3TOYA 2QULA 2XG9A 3NYZA 4J3VA 4JTIA 4Q4RA 1NDVA 4LB3A 3NXLA 4ZXOA 4IQLA 4O13A 1AD4A 5D37A 4C90A 4OWGA 4BZYA 3MB9A 1I75A 1VEMA 4KCUA 3OHIA 3R12A 4B91A 5HDRA 1EJ7L 3S9ZA 1B3VA 1IWPA 1Q5MA 1ZBKA 3GAYA 7TIMA 3CUFA 5M03A 2KX9A 2EO7A 2GWGA 1A5NC 3EMZA 1HJVA 4HGXA 4H6QA 4IFKB 1RBLA 2ACRA 3ZT5A 3LDVA 2EJAA 3AICA 3IJDA 4YU1A 5H2ZA 4K37A 1LDCA 1NWUA 1JD9A 4HSOA 4AF0B 3VNYA 5F2MA 3R4IA 5BXPA 4M19A 2C91A 3VNDA 4E4FA 3THDA 2EHHA 4NZ3A 3BGGA 3UERA 3BXWA 3KZSA 4PTNA 5FL0A 1YDYA 2X05A 3ABRA 3BLFA 4L4OA 1KCKA 2WVVB 2WMIB 4TTGA 1NP0A 4DYKA 3T0TA 3GVGA 1CX9A 3ZQ9A 4CUCA 1BXBA 2DZSA 2E8ZA 5A69A 4LX4A 1GQKA 1XRVA 1EDTA 3RR4A 3CUGA 5A6MA 2W3ZA 2D0HA 1ZP4A 5FIPA 2WMGA 1IZJA 5DCEA 4WCJA 4MTVA 4PGLA 4LALA 4JIIX 3TYAA 4PCNA 3E5BA 4K3ZA 2JEQA 2ZZ3A 5AYIA 2WJEA 3WO8A 1CCWB 3C2YA 3UR8A 3PPFA 2DW6A 1P6WA 2OYKA 3HQOA 3E6EA 1UZDA 1NOWA 1H7OA 1A0EA 4FHAA 3EA3A 3MCMA 4EVZA 3FSTA 4LUTB 4A8LA 3BUVA 1G94A 3TX9A 4X2RA 1QNRA 3AO0A 2IS7A 3RHGA 1F3WA 2WZMA 2DIJA 5CJNA 3QPZA 1RR2A 3WQ4A 3HV9A 4IXHA 2PWDA 3T0AA 3B4UA 1EBHA 4PCFA 4C6NA 4JHOA 4B5TA 4B5XA 2ZWYA 4C6QA 4C6OA 4MLRA 4O4VA 1EF3A 2NLIA 3OZMA 1VFLA 1R46A 1TQXA 5F1VA 2I57A 3BK0A 1R9XA 1M04A 2BS9A 1V7YA 5AYXA 4J2PA 3FW6A 3ABOA 4HMDA 3LGEA 4ZSUA 1XIIA 1IEXA 3MDWA 1HF6A 2OWXA 3SN4A 4N4PA 1R2RA 1UUQA 2QUMA 3KTSA 4AWTA 1XGDA 5A6SA 5M17A 1HZYA 1JPKA 4Z2IA 2FJUB 3WF2A 1S2VA 3ARUA 1T96A 5TF0A 2V2HA 1L0PA 4QLJA 2PWGA 2E0PA 3ZIZA 3K4AA 1CXEA 2P3ZA 4S3BA 4C60A 1FWEC 4BF5A 4ACYA 3N04A 3LQLA 1IT7A 1SVDA 1V02A 2FVKA 1Q3NA 4H41A 3B06A 1RD5A 5FL1A 3C56A 4TO8A 4GBDA 2R1NA 1F9CA 1TWWA 4PBEA 3CL6A 1GT8A 1FHUA 1V77A 3LK6A 3P2VA 4IJBA 2A3HA 4B9ZA 3GR8A 4TOQA 4EANA 1EA9C 4LVDA 3IEBA 2HEJA 1PB0A 5GPRA 1V3IA 1TV3A 1XLBA 2GSEA 3M1ZA 4ZOCA 3W88A 3HN3A 4FZIA 2IKGA 1G4PA 3T6CA 2GJNA 2JQXA 4LRSA 3SUSA 2ZUMA 3TROA 3LNPA 3GHRA 1XH0A 1BEUA 3VIHA 1L2UA 1P6BA 2OJPA 1VPYA 1TPC1 2BFGA 3SI9A 3T7VA 3T07A 3GG0A 4NZCA 4BI5A 3HQNA 4OBSA 3N9SA 2NXGA 3V5OA 3MU7A 4F0LA 3HFYA 2C8NA 1BG9A 1VLIA 2X0SA 1JZ3A 5BW6A 2QMKA 4KQNA 4Q4SA 1VJSA 4NNBA 4PRTA 2FHFA 3W3OA 4PSRA 1J79A 2POTA 4B3ZA 2VFGA 1B9BA 2GL5A 1G9HA 4C6MA 3EEZA 1W9VA 3PZOA 1XGEA 5M3WA 2FIQA 1NF7A 1W9BM 2BODX 3CWOX 3EWDA 2L5HA 1UR9A 1TR1A 3ZS4A 3AXXA 5I0DA 3G0SA 1MW2A 4ZBCA 3G1DA 4UTIA 4HNUA 2X09A 5G4EA 4PFMA 2Y4SA 2VX7A 1QK2A 5FI8A 2D2GA 3V16A 3A9BA 3S1XA 4HCLA 3AHTA 1TFVA 1F5ZA 4DJEC 1GVSA 3I3BA 4LOCA 5AHMA 3H2FA 3B8SA 3QLDA 3AZRA 3PWGA 2PD9A 2J66A 3FKKA 2O7SA 2C79A 1XIJA 2P88A 3WLMA 1L6SA 4AHQA 4ERGA 5DN1A 3GVWA 2NLYA 1SSGA 2VCBA 3LPGA 4DO6A 4ZODA 3NL5A 1UUOA 4F0RA 3UGRA 4E8DA 1V6TA 1IXNA 2PU1A 4GQ0A 3UQNA 3VAVA 2DH2A 1W2PA 4RKAA 3GWQA 2DUZA 4HNTA 1EP2A 3QR0A 4NNAA 3JU2A 4UQEA 4JYDA 1ELSA 3AALA 1SGJA 1ONEA 2B4GA 4DM2A 3FK4A 1P4CA 1DQWA 4WLCA 5A6BA 2R8WA 4GX9A 2E7FA 4O50A 1EFZA 2PF0A 1RSCA 2AQWA 1P7TB 1MVYA 2WPGA 1AZ1A 4AD4A 4D6GA 1X6LA 1E40A 4RPQA 3GTXA 4EAMA 1JR1A 1XSJA 4IIGA 2A0NA 3FGCB 2X16A 1TPVA 1VAHA 3GS6A 2O9OA 3QHOA 3WQ8A 3GW3A 4IMAA 2OSXA 5SWUA 4FNUA 4O8RA 3PZ9A 4XD6A 1TWIA 1PO9A 2PDUA 4JY8A 1ZY9A 2Z4GA 1MO0A 1Q4NX 2A85A 1KRMA 3VKDA 4XD4A 4Z2HA 3F2DA 1PBGA 3WH7A 1UC4A 1VFHA 2PB1A 4UMAA 1LG2A 1GVRA 1EJVC 2E6DA 2QUNA 3BW3A 4GWEA 3NL6A 5CG0A 1KM1A 3T8LA 3KOWA 1C8VA 3OTRA 2E40A 2NV1A 1MRAA 4D1JA 1XBXA 4KWSA 1C9WA 2DZPA 3ZSSA 1W5MA 4LYRA 2YXXA 4O57A 3XISA 1AMKA 3WQDA 1TV7A 3SB0A 2ZC8A 4CU6A 3MBDA 4GNKB 1AL7A 5T9BG 2V0TA 3EB4A 2JKPA 1I0BA 3E0WA 4LAKA 2HDJA 4QDWA 1ADOA 1I9CB 1Q45A 2HVOA 4MKVA 2DZUA 4BEUA 3LRMA 3WCZA 1JGIA 1DJXA 4YTQA 1FWWA 4PRWA 3ZR5A 4XV0A 3L4UA 3SGUA 4M5PA 5ECUA 4AZGA 1TPDA 3TJLA 2NZLA 2VL4A 5KEZA 3SQSA 3BE7A 4NASA 4UOQA 4GINA 3FXYA 2JE8A 3QH2A 5LNRA 3S2NA 4JAWA 2FTWA 5E09A 2O55A 4H7ZA 4RE3A 3KLKA 5LSMA 4IGNA 3I68A 3WQCA 3WDQA 2VELA 2OZ0A 5CSYA 3A5VA 2GJXB 2J27A 4G8TA 3URNA 1KM5A 3APGA 1E56A 4QSHA 4LYKA 4O8AA 1TKKA 3MUZ1 3NVTA 3OYZA 3AXKA 5A2BA 3NQEA 2CYGA 4YL2A 3OZOA 2JF7A 4PYSA 4W5UA 1B54A 5C7HA 3ZJ6A 3S42A 2XISA 1V3JA 1JG9A 2XWEA 4GFSA 3ZOAA 3RF9A 1UP0A 3SFWA 3QY6A 2DY3A 4RZBA 1YXDA 3HBLA 1FWRA 1A53A 3NQFA 1AJ2A 2G50A 1HIZA 1XLJA 2WM0A 1V3KA 2NV2A 4I5XA 4O0KA 3O8AA 1JZ6A 2YJQA 4PTDA 2WCGA 5BMWA 4GXPA 3R89A 3RIKA 4JL2A 1GYMA 3DUGA 3UXAA 3H2NA 3EDJA 3W37A 3IVSA 4NNCA 2ABAA 1JCNA 2D0FA 2Y0FA 4DAFA 1IGSA 4P7LA 3VKAA 2DT2A 1YYAA 3SUVA 2ACQA 1ZBCA 5HMSA 1PDZA 3PR2A 1LP6A 2YL8A 2Y5JA 3W6YA 2WSRA 3NZQA 4GGHA 3CU2A 2WW5A 1EOKA 2Q6ZA 2Q8LA 1MNSA 4POCA 3K5XA 4CD8A 1KV5A 3WLLA 1XG4A 1HO1A 1KW1A 3NQMA 1GEQA 1S5WA 3TOPA 1DBTA 3STGA 2B81A 3M7SA 2H9AA 2OODA 3WDJA 1V51A 3F2CA 1KD0A 2OGJA 3N29A 1XDMA 2EAWA 2W63A 1ISYA 2P1FA 4CN4A 4KWOA 1UKSA 5DMYA 5C9XA 3KL0A 4KW2A 1YKWA 3IJLA 4MKNA 4V28A 3T2QA 1FWGC 4F2UA 2J8FA 1CW2A 3GNXA 4YYCA 2QCHA 1SO5A 4FX7A 1XQLA 2XU2A 3VIFA 2CLKA 4I8DA 1K3UA 3HURA 3TTEA 3URBA 5A6LA 3FAXA 3W1NA 2NX9A 1KM4A 3OEXA 5C2XA 2OR2A 1H0GA 1W3LA 1CGVA 3KUMA 2GDVA 2VC5A 2BWGA 3BSGA 2H6RA 3D46A 3CT7A 2O9PA 3OU8A 4M24A 3GB6A 1GWJA 4YMZA 1IZCA 3GR4A 2O9RA 4UUIA 2IXVA 2QLYA 1O5KA 3JRKA 4OOZA 2PDLA 3NZ1A 3QY7A 4HQVA 4G9PA 2GPTA 2PGEA 4OECA 3CQJA 2WQPA 3CZJA 3WD1A 1ADDA 4XIAA 3VKBA 1E43A 1ISZA 1XWYA 4WKHA 1B3WA 3WNMA 3AC0A 4GC4A 1DEDA 3TMLA 3B97A 4ATLA 4E2VA 1DP0A 1PAMA 3VIIA 4HNLA 3GBEA 1P0KA 1GQIA 1S5VA 2FZNA 4IMDA 5HQEA 1U1UA 3V7PA 4C6IA 7ENLA 4K6AA 2Z2BA 5H1WA 4JTSA 4UIOA 1RY0A 3VD9A 2FHCA 1CPUA 5G4WA 5TIMA 4IL2A 2AKMA 1V3MA 3H7VA 3U2OA 4TR9A 1SO4A 4AWUA 3EDEA 2Q8ZA 3L4XA 3UPWA 2GUYA 3RLUA 1KFKA 1FH7A 4JIEA 1GGOA 3DFSA 4XVDA 1Y7VA 5D9MA 3SY1A 2UY5A 3S83A 3GX9A 2CLPA 1E4NA 2YB4A 3E2RA 3K2GA 3S6DA 2FKPA 5LGZA 2FDSA 4QDMA 2Y5EA 5HANA 1TWDA 1Z6KA 2FH6A 3N19B 1KBBA 3CH9A 1FWFC 3OA3A 1PEZA 3T0DA 3JZUA 3MYOA 3W2NA 3LV5A 4JNYA 3KOFA 4PEEA 1W3TA 5FF7A 3R8RA 5BXRA 4GC3A 1D3GA 3G1AA 2GGJA 1O5QA 1J0ZA 3R25A 2YOCA 3ATYA 3PAJA 3U3HA 2J75A 3CB8A 4X61A 1L8PA 2PC8A 3P81A 8XIAA 2D24A 3KHJA 3QTPA 4PMVA 3R1ZA 2PCEA 4S3CA 4E38A 3LPPA 4JY9A 2XIOA 5F4WA 4A8IA 1FY6A 3BAXA 3BV7A 1LTDA 4LNYA 3HGRA 3RUBL 2ZC1A 2NV9A 5C7VA 3ARPA 5REQB 1F76A 4RR4A 2GOUA 4WKFA 4RUBA 3T1GA 2X42A 1XW8A 1TUFA 3P93A 4WSHA 5HK4A 1KM2A 3ITLA 2ATMA 4RXFA 2Z29A 3MKKA 4FA3A 4P5UA 3RFAA 1UR3M 2Q8XA 1JQVA 2G3IA 2E1DA 1E51A 3GDLA 4MPQA 1A5SA 3LPFA 3NJ3A 2NW0A 3KZPA 3CB3A 3WDIA 1H62A 2HJPA 3GFZA 4YWSA 4NHVA 1MEHA 3GU1A 3W6LA 3WFLA 2DT1A 3PZIA 6TAAA 3QQ0A 3SM0A 2PDGA 3VKCA 4WIWA 1Y65A 3NOYA 3G1XA 2PTZA 2WVVA 1IR1A 1UWAA 3KDOA 1WXJA 3I7RA 2P8CA 3VOGA 2WHKA 4PEKA 4TU1A 5AC7A 3G8RA 4WRHA 3HB9A 3HJZA 4OTKA 3U5UA 1XJBA 1V03A 4LEFA 4W87A 4QJ1A 2WKGA 3HJEA 1JUEA 4PN2A 1YEYA 1D7KA 1TQJA 4UNLA 1HGWA 1N8IA 2P8BA 2WC7A 3RJXA 1GQNA 2OLAA 3RYSA 3DHDA 4EAYA 3DFQA 3PVFA 3WLQA 2GQ3A 4FOKA 4FB7A 5HNRA 2XGZA 3M0XA 4Q7NA 4Y9PA 4OGZA 5K9XA 2YA2A 3MW7A 4QX4A 2Y63A 3ITGA 1E6RA 7CGTA 2PDMA 4LCSA 5HPOA 1F4HA 2G96A 5F7UA 2RDTA 2ZVRA 3UCQA 4XZ9A 4JIQA 3F5JA 2PWUA 2ICSA 2V5JA 3VZXA 5ABTA 3BLLA 1M03A 2EGZA 3FVMA 3VYLA 1AQFA 2G95A 2LLEA 2W4XA 1VFTA 3OQEA 5LXEA 3BWWA 4L80A 4HPJA 3TSDA 3KL3A 2Y24A 1WQ5A 2J7BA 1X1OA 1JDFA 1DTUA 3ARWA 2PGWA 3WH9A 3VIOA 1TJRA 3PBUA 3QBUA 3GKFA 1W8GA 4Z1BA 3KEHA 1L9WA 3THUA 1S2AA 5L6UA 1WDRA 3WQ5A 4ADTA 3H2AA 5FF0A 3MI2A 1MW3A 5H8UA 3DYOA 3UXKA 4KRZA 1V6WA 2EXOA 1HT6A 5LIWX 4GYPC 3LERA 1XS2A 2XIQA 2VI0A 1XFCA 5EMJA 1OFRA 1RUSA 3M47A 2XH4A 3EDDA 2IPWA 3P14A 5K4ZA 1YPFA 1RLCL 4RL3A 3KBWA 3LHWA 3W07A 4HOXA 2QDEA 4KEUA 2JBMA 3UWYA 1FH9A 1GONA 4PB4A 8A3HA 2DGAA 1QFEA 3SCTA 1UH3A 1VBRA 1LOSA 2C71A 1K03A 5I79A 3R0UA 3G77A 2PTYA 2OEMA 3V36A 4EF9A 2G41A 3PUGA 1EQCA 1QI3A 4M6QA 3AZTA 1BKHA 4S2BA 2ZRZA 3W70A 3IJ7A 4GKLA 3EBVA 3WSUA 1GVEA 2W61A 1Z41A 1EJWC 2QPSA 4GZIA 3CHEA 4KEMA 4E5TA 3C86A 2PBOA 3FA5A 2VGBA 2BY0A 5C71A 5FACA 1O5RA 2UY2A 4IG2B 1GOIA 5CKSA 1OX4B 3ANUA 4XZMX 3W7CA 3WQGA 4L4LA 4FXJA 1VFOA 2CHOA 3TCSA 1TREA 2QCNA 3W25A 2VNCA 5BRQA 2WAGA 1GOQA 4Z2JA 4IT1A 1XFBA 3PZMA 2YXOA 4MG4A 1E6SM 1FFQA 1Y8BA 4XUYA 3APYA 1KQYA 3GZAA 1T6MA 2R1KA 1RLDA 4R3UA 3FDKA 4GXWA 4ML9A 1RCQA 3NVDA 1FUYA 1P6CA 1IWBA 3UG5A 3ICJA 1CXKA 4PUDA 4IPLA 1U83A 4YWIA 4MGGA 4XIMA 2X40A 1KGWA 4P2VA 4BY3A 3XINA 4O1FA 1GQLA 1JJKA 4UQCA 5I3DA 2BLEA 4H9UA 1VPXA 2WJFA 3CAVA 5HBFA 1B30A 4F9DA 4V15A 3UF9A 4BCEA 4FLSA 3TH6A 1A5OC 1XD1A 2OZ8A 3MMDA 3P8JA 3MI3A 4Q8NA 3W1UA 4UOJA 4ROPA 4J1OA 3E74A 2HV5A 1HP5A 4EPKA 4Q8UA 2QPXA 4NU7A 5AC4A 3LU2A 4A3RA 4HYVA 4CQBA 1ONXA 4O1DA 3W22A 1RJRA 2VURA 9CGTA 2E1WA 5GQBA 4H8VA 4HA0A 2DT0A 3U6WA 3SEPA 3UXLA 3W7EA 3DEQA 4PH6A 4TX8A 2V5BA 1KV8A 2QVNA 1RK6A 1KLZA 4NX0A 3W1QA 1U5JA 2BVYA 3SURA 3BDKA 2AGTA 4UFHA 4E2BA 1XC6A 2DIKA 5JBDA 1FWAC 3OVQA 4PUEA 3P80A 4UNKA 4QJ5B 4PUNA 3PTQA 4AAJA 3N2CA 4TTUA 2Y6ZA 3VOFA 1EP1A 3ZLGA 5T8GA 2IPGA 3H6OA 3B8WA 4DWSA 1IZKA 3SRHA 1ZL1A 4N6FA 5DY2A 4CQAA 3AIEA 4MZYA 2WZHA 4GCAA 5LIKX 2NT0A 2OT0A 3O16A 3GTFA 1QUMA 4JYEA 5K9DA 1LOLA 1OZQA 3AYSA 4WUIA 3S3GA 1RJPA 1EC9A 2FMOA 4CNOA 4KBXA 2OCZA 1S39A 2WB5A 4UB9A 2HBXA 2YL9A 1XIEA 2ABBA 2NQJA 3F4CA 5IOBA 1W1ZA 1C9DA 4BWLA 1OK6A 2QKFA 1C8XA 3CC1A 1QNQA 3ZLHA 1OF6A 1UOZA 1K7EA 3IUHA 3VXGA 1NELA 3PM6A 3WLJA 4MIMA 2YKKA 3L21A 4NZ5A 2CU0A 3R2GA 2V68A 1A5BA 3VTRA 2J24A 3R7MA 3KWSA 5I3GA 1B5TA 2JIWA 3RPDA 2VEGA 4UZSA 3AHYA 1G69A 2PDPA 4U33A 3BLIA 5ABEA 2CC0A 3R0DA 1SMAA 3VZZA 1NF0A 1KXHA 5A6AA 1IGWA 1HVXA 4DPPA 4NIRA 3N11A 5AB3A 3AJXA 5XIMA 2CBIA 3CUZA 1OCJA 1XDLA 4LB4A 3G3DA 1E5NA 1JZ8A 3WBAA 5BRPA 2EG8A 1YTKA 3LX9A 3QR1A 1IF2A 3WJZA 2QUTA 4F9JA 2BVTA 4IMFA 8CGTA 1RK5A 2D69A 1WKYA 5EL1A 4U3CA 3L2IA 4RDZA 1UQZA 4HA3A 4HK7A 3WQOA 3WBXA 3WLPA 3H7RA 5AN7A 3SN1A 3WQ6A 1ZCOA 3T40A 2IKHA 4AIUA 1XLKA 3D0CA 1HKMA 1XC4A 1ITUA 4HK6A 3SRDA 3LTSA 3TZFA 2VFFA 3OIHA 3PHAA 1LWJA 3KFTA 4JFSA 3AFBA 2JKAA 3UZ5A 2WYSA 4N6EA 3KCLA 3LCIA 3IARA 1OGBA 3TTYA 5LIYX 4O10A 1JRBA 3VFLA 4LFYA 4ERIA 4PE8A 4C1NB 1AW2A 3GQYA 3RLVA 4C6LA 4LAUA 3E0LA 2FVLA 4REQB 3IIXA 3WLTA 2HBVA 1CEOA 3VMPA 1OFDA 3IAPA 4WY0A 3RN6A 1XP3A 1QVBA 4TMCA 4B5SA 4B4HA 3E0VA 2C19A 4XAYA 1ZQ5A 1XSIA 5FAJA 3PN8A 4PUWA 3QKZA 3VNZA 3WH5A 1CZ1A 1MFVA 4CCEA 4GIEA 5JVLA 1HKVA 4ZMGA 4FXSA 2XFRA 2Y2WA 4M0XA 2ZX7A 2BASA 3Q58A 1Q6LA 5HR6A 3M5XA 1P43A 1ZB5A 3WQEA 3GG1A 1FWTA 2QCEA 1GW9A 1GOMA 2OMAA 1MQQA 1NEYA 4K1GA 5AYZA 1JCMP 1T40A 2HK1A 4JN6A 2QVHA 1W1IE 4XKYB 4HNVA 3L4WA 4HJWA 1TPFA 3M4HA 2J7FA 4UOZA 3MHUA 3CM4A 3GDRA 1AH0A 1XF0A 4JTCA 1LLZA 1NIUA 6TIMA 3LM7A 5CLTA 5I7GA 4G1NA 4GYFA 4YXGA 5JBEA 1NP2A 3ZLFA 3HV8A 4PTMA 4AYSA 4A21A 4OUEA 3F4NA 3FJLA 2YCJA 4WY0B 1BWVA 4QIUA 4QAIA 5DT7A 1E5JA 3WY1A 7REQB 4OQVA 1PZ3A 2V30A 3O2LA 2IW0A 3KP0A 2J7CA 4WD0A 1RVGA 3B8VA 3ITOA 3L5LA 3VDGA 1PHQA 1HW6A 2J47A 1FOBA 2OPJA 3BLEA 2ZE0A 1IIHA 1ITQA 3QGAC 4AZBA 2PGFA 3DG6A 4DJFA 3EA1A 3PNZA 3UG3A 3PTKA 4LCQA 2XN0A 4FIRA 1G7UA 1H60A 2VVNA 1HN1A 1VF8A 5E9AA 3TN5A 4AEOA 4D6JA 1NDZA 4EWJA 3QQ1A 4YTTA 3UWEA 4AEEA 2J25A 1F7BA 3RLGA 1EZ2A 4YCOA 3O6CA 1RV8A 3B8DA 5EA9A 3TNOA 3W28A 2YZ5A 1K4HA 3M7WA 2Q3RA 1YDNA 3GXMA 2NX1A 3LLFA 4L56A 4TX9A 4CD5A 5C9UA 5K7JA 4UCFA 2HQAA 3GNDA 3VKKA 3IUIA 3DFHA 2HMCA 5G1YA 4MNLA 4ORMA 4UFMA 3GFYA 1X6NA 5IXEA 3FA3A 1UG6A 2VVSA 2QF8A 3G24A 1W91A 4MMWA 1GKPA 2GJPA 2AL2B 5AYYA 3VMOA 1Q6RA 4F3HA 5A8NA 1UYQA 5I24A 2BXVA 3K8KA 3EXRA 1BPLB 3TAKA 1JDDA 2MANA 2ADAA 1UHVA 2FPVA 4Z2LA 2ATSA 5CBJA 4KIEA 3W1LA 3T09A 1XIMA 1E9IA 2KAUC 1GJPA 4DF0A 3EEGA 5DT5A 4ZO9A 3WLKX 2ONEA 4YPJA 3KOYA 1EJTC 1J18A 3AYVA 1EOMA 2DQWA 1KFJA 2DP3A 5FJTA 1C93A 1TR9A 1QJWA 2ZTJA 1F3EA 2OO0A 1W9PA 4R7OA 1QATA 1YIXA 4CCDA 5K9CA 2CITA 1YDOA 2QV4A 3GFXA 2VRQA 4D6DA 1XLDA 3TN6A 2PFHA 1T0OA 1B4KA 2BGNE 4UTWC 2EQDA 1QWGA 1G0CA 4FNRA 3H54A 1J9YA 3KOZA 1DIEA 4LV4A 3EWCA 5FCZA 4K8EA 5A8OA 3H21A 4HPGA 2Y70A 3WL1A 3O0FA 4Q4PA 1QHOA 4G7FA 5HQLA 1V3LA 2F38A 2V6AA 1TMQA 4H7VA 4LEQA 5CG7A 5ABFB 1A4LA 4XZBA 3BQ6A 1KTNA 4IHCA 3RAOA 3E0IA 1BHGA 1XLAA 4ZQCA 4NI8A 4K38A 4LT9A 4UTWA 2B31A 3L9CA 3RCYA 4PTXA 5D32A 1I1XA 4HPXA 1DL3A 2WKLA 3ZR4A 2GGIA 3F7JA 4DAIA 3OIXA 4Q6XA 4DXKA 2XUCA 4FXRA 4HA1A 1ZCCA 2ZIDA 3MC5A 4GHRA 3NFUA 1QXLA 2D1ZA 3PG9A 4GZEA 2WHLA 2QCDB 4H6EA 1F61A 4WQ6A 5CAHA 4GIAA 1OM0A 3KOXA 3BW2A 4ENLA 3N2MA 4M1BA 2XTKA 1NOFA 5CPOA 5F4XA 2XDFA 2X2YA 2WANA 4AD5A 3CXOA 3IJIA 4K7YA 3LMZA 3TN3A 1KRBC 1S2CA 1NJJA 1NWTA 4JEQA 4PUJA 1ZAIA 1GVOA 1EDGA 3IK4A 4R85A 1AQMA 1JEZA 3LCGA 1MQRA 3TZNA 4RCXA 1BTMA 1TUXA 4FMVA 1H4PA 1ADSA 2ZUSA 3QC3A 5AHIA 4FOJA 2GUBA 4TVDA 5I77A 3SJNA 5HNTA 3SN0A 2VXNA 5A6BD 4RXGA 1LYXA 4AX6A 5I3IA 3NURA 1LL7A 3UNTA 4QTGA 2VOMA 4US6A 3LYEA 1Q4WA 3KHDA 3QOMA 4IFRA 1UA3A 4B5UA 4NL1A 3GNNA 3C0LA 1JVNA 3W9ZA 3EXTA 2DFAA 4N4QA 1J0IA 1TVLA 5E1QA 2J6XA 4I9MA 4H9MA 2A7PA 4RW5A 1UP3A 5JUVA 5EMYA 1QW9A 1TIWA 1SJDA 3E49A 1DOSA 3NZPA 3THCA 5IM51 2JGQA 3RPMA 3M9YA 3W1RA 2REQA 1W5OA 3SCQA 4AISA 4JCLA 1Q13A 2OLHA 1IXQA 1A3XA 1DWFM 2VYOA 2PWVA 4Q4QA 4AZIA 4JQAA 5C2CA 3SADA 1VJIA 4H7CA 3PPGA 4AH7A 3RO6A 3W7HA 3CYVA 4I6VA 3QLLA 4C7DA 1J8VA 4AWEA 3DKLA 3HPAA 1DIKA 3QY8A 4ERAA 3L2MA 4LYQA 4PMQA 4GJ1A 4S3DA 3ZZ1A 1HVQA 5HUPA 3R6IA 1LWIA 4E0CA 4JOMA 4C6EA 2EF9A 1ZJIA 3O6AA 3S8HA 2ZZ2A 4M1RA 3EYPA 4PCPA 1VZWA 5BZAA 4GVFA 4I9AA 1XYMA 3RM9A 3B0VC 4NAEB 3WLOA 3BMWA 2R1LA 2ZX9A 4P7QA 4H4IA 2P3EA 4HMEA 1H7XA 1EA0A 3HGOA 3FIGA 2I5GA 4LUYA 3W7IA 1S2WA 1RVKA 3E12A 1OSEA 1H5YA 4JKKA 1POJA 1W31A 3GBDA 4MAZA 1Q7QA 4W7WA 3V0TA 1R30A 3AUJA 4IIEA 5AHFA 4C6FA 3QV9A 3SDOA 4RDYA 4D1IA 4JDYA 3WL0A 4GNVA 4ADSA 3JUGA 4MUZA 4J5NA 1XKJA 4BHYA 1GOOA 4NRSA 3TUUA 1KWGA 3CK5A 5DCBA 5IHRA 4MY8A 3WIJA 3SJ3A 4CD7A 3W74A 2PDQA 1FVPA 4W84A 2TMDA 1JCLA 4ML4A 3QF0A 3SCOA 2IKJA 1XIDA 4GYJA 4N0RA 4ZCWA 4HTYA 1AL8A 3G22A 3VVGA 2NWSA 4LRTA 2YLAA 3LHYA 4HN4A 3R10A 2INFA 4CEXC 4PBGA 1JZ5A 4HYWA 2D3LA 1QW7A 4NZ1A 4QP0A 2BNJA 2YB1A 2OQLA 3A4WA 4FLRA 3CLWA 1KFWA 4NZJA 3W7MA 3SY5A 3L7RA 1DJIA 4JICA 4CU7A 2IMRA 3OVPA 4WK9A 5E6YA 3SQLA 1SFJA 1XH2A 2DIEA 3FOKA 3TR9A 3ONBA 5BXTA 4UZUA 2ZUWA 1ESWA 3N3TA 3N2BA 1PIIA 1I2OA 3KLLA 3C61A 1SZNA 4CVWA 5HNUA 2VM8A 3M43A 3UFYA 4DLFA 3AAMA 2PDJA 1MUWA 3W26A 3IJ9A 1K9DA 3SSJA 1LM1A 3FDGA 3P0WA 1MEWA 5CC3A 5FOOA 3BPWA 1HL9A 2DW7A 4L6OA 5K4XA 1WXYA 4LUTA 1O6IA 1R87A 1UWUA 4CNPA 3MSGA 3C2VA 4M6VA 4DI9A 2E6AA 1TWZA 1VHCA 4QROA 4U2ZA 2ZXBA 3C5QA 1PWLA 3KVMA 4WY0F 1GOWA 3C3NA 3DDMA 3GC4A 4YIWA 4FEZA 2VOTA 1UD3A 1Z48A 4QG6A 2F6KA 3RMJA 3MDUA 3M0MA 1XLGA 1I2RA 5HUOA 5JH2A 3QHMA 3CUXA 1CXIA 2XN2A 4WDXA 2Z1SA 1M68A 3W7DA 1WYIA 4Y9NA 5MKGA 3PBMA 2ZADA 4RNFA 1W6TA 1KQZA 4HMNA 5BRBA 4KFNA 2D73A 3TMQA 5IRPA 1TCMA 3BG5A 3BLDA 1H51A 2BOEX 4MNMA 2ASHA 2V69A 3KVLA 1TWSA 1ZLPA 4W5ZA 4F0SA 1H7PA 3BL3A 1OFAA 3A24A 3SIMA 1UW9A 4P8WA 1CLXA 4XZWA 4YCPA 2OX4A 1UWSA 2Z1VA 4LS0A 1EC7A 4KT2A 2FPTA 1RQEA 5A8PA 4RW3A 3NZGA 3U57A 5TAOA 1R6WA 4L6HA 3LXCA 2DJLA 1BVZA 4MLJA 2XZ9A 4HU4A 1Q2SA 5JXQA 3B8IA 1JPDX 1AODA 2J88A 3CPRA 3IANA 2G97A 1R3RA 4RZ5A 1DV7A 5D38A 4X63A 4WDUA 4KCTA 2CPUA 5DRCA 2YBUA 2YFOA 2QJGA 4UXDA 3OGSA 5HA7A 1A5KC 2J78A 3W1AA 4ES4A 2XWDA 4KWUA 1HJUA 3VKJA 5IDIA 1A0DA 1TMLA 1P0BA 2R94A 3SECA 3P5ZA 1TYGA 1XLCA 1CLKA 2CLOA 1R0MA 2ZVIA 5CPMA 1X1NA 1YADA 1DQXA 5AHNA 3L4ZA 1BVNP 3IS4A 3EOLA 3KTXA 4ACZA 2JEPA 3HPSA 1NWRA 3ITTA 2OB3A 4HIBA 2XSBA 1S2UA 3RX2A 4IPJA 4GUFA 2HPMA 4XSLA 1WZKA 5DEZA 4XK2A 4IMEA 1HX0A 4R53A 2HS6A 3GHSA 2OU4A 4KKXA 2DEPA 4MB1A 1EO7A 4N9BA 1QDSA 4DYEA 2D3NA 4AIBA 3U8GA 1KBJA 2OO6A 2X0YA 2DDXA 4F40A 3RX3A 4DN1A 3MSRA 5EU9A 4H9YA 1L2QA 5EBAA 1RBAA 3ELFA 4K2SA 3MO4A 2NSXA 2O4QA 1IXOA 1RZMA 4ZO6A 1XLFA 2YL5A 1E70M 1QHPA 3UJRA 3AXHA 3F03K 4X0NA 3WFAA 3CEPA 1XIGA 2CFFA 3GIQA 1MDLA 3VMNA 4BA0A 1J5TA 4FS9A 4RPPA 3OA5A 4WGHA 3C2EA 5ENLA 1B2YA 1Q7ZA 4LUSB 2PRHA 1DXFA 3ZT7A 3H8AA 5KTLA 1O7AA 3LHZA 1RP9A 4GQBA 4MFDA 4KIRA 4UMCA 3W2MA 2EPHA 1AA1B 2W9MA 4AUBA 1DQUA 3KP1A 3DESA 3WH8A 1LT7A 3VO0A 1JULA 3W7LA 4CQDA 5C8BB 3G1SA 1HQTA 3FJNA 1DWIM 4F66A 1YQ2A 1WBHA 1OFPA 1OC7A 2XH7A 4HZ7A 5C70A 2C6QA 3MCOA 1HP4A 4JQ2A 1J0YA 1W8SA 3CQHA 2ACSA 4PUKA 3AYTA 2BY2A 3HG3A 3KRUA 5A6TC 1C8YA 2ZA3A 2HROA 3IGXA 1A50A 2Y7DA 2Y5SA 3SQMA 3VIGA 4BI7A 4Z1DA 2VQTA 4LBUA 3FJ4A 1PX3A 2NX3A 2P50A 3WF1A 1ODUA 2WMJA 3NOEA 4JTRA 5I3KA 3ARZA 2ZKMX 2AMXA 3S5OA 4ZOAA 1G01A 3VCNA 2WHJA 3NL3A 2NUXA 3BMVA 3SZ8A 4Y8FA 1V93A 3QV7A 1JXKA 1ZJAA 2DORA 2PUZA 1V0NA 3H55A 4XB3A 4A05A 1WAUA 1OVDA 1E1EA 1EWDA 1H1YA 4LV9A 2ISVA 4I5RA 1WCGA 5CPSA 3GVQA 2MNRA 4PC8A 1Q65A 1BLIA 3LNMA 3OODA 4LF1A 4BK9A 3WUBA 3GVVA 5FJIA 1ZBVA 4K7VA 1HL2A 4GYPA 5REQA 4HK5A 2B7QA 4YJ5A 2ZA2A 1IIGA 5GNZA 3NG3A 4J9JA 1EUNA 2RDXA 2FTPA 4A8RA 3P84A 1LWHA 3VGFA 3LCLA 2CBUA 3MY9A 3UVAA 3AWOA 1YNYA 4GA8A 2PWEA 1G7VA 3FEQA 4WXZA 1WBJA 4LY8A 3GXFA 2O4MA 3MMTA 4GVGA 4KGJA 5DCDA 2VEFA 1NFGA 3GH5A 3OO2A 3W4RA 3VA8A 3GNRA 3KCOA 5E9XA 3HPXA 3QXBA 3VC6A 1M3UA 2J7GA 1SZEA 3IJQA 1Y5XA 4EPBC 4JTJA 2C14A 4HYRA 5AVHA 4CN6A 1A5MC 2QDDA 4L9ZA 4DWSB 3DFNA 3WELA 2HTMA 5GJPA 4CNSA 4IMGA 4H2HA 4F2BA 2XZ7A 1R3YA 2V3GA 1OFQA 4ASTA 3FSUA 5A6JA 1GCYA 3O3RA 4GQRA 1T41A 3AIWA 1ISXA 2WHMA 3EWXA 4CNUA 2XVPA 1A80A 3LCFA 4DXXA 1TRDA 1VR6A 1UR0A 1EC8A 2WOQA 1WDPA 4OV4A 3CHCA 2NQZA 4NJIA 4ONVA 3NDOA 4UTUA 2YIHA 4CD6A 1CNVA 1X38A 1JPHA 5CH9A 2XVLA 5EFFA 2PZNA 1O1ZA 4QFUA 1OFBA 1UD8A 3TJIA 4IPPA 1PCKA 3W29A 3W2KA 4GD0A 4JZ5A 5DX7A 3W7RA 3IK2A 4XVEA 2YFNA 5B80A 3SY8A 1ZUAX 2BMBA 4YTSA 4P8XA 3RITA 4I6KA 4QISA 2WCSA 1R2TA 2VMFA 1VRXA 2DSUA 2PD5A 4DZHA 4NJGA 3TXZA 1S3TC 1M7PA 3VZYA 3OP2A 1GVYA 1R2SA 2Z00A 5BWAA 2AL1A 1WUFA 4OFCA 4JX4A 4AWSA 1R5YA 3I4EA 4KETA 1R7AA 5B7YA 4TUFA 1Z42A 3GW0A 3H22A 1OB0A 2GSHA 4US5A 3Q37A 1JF5A 1H2JA 1I45A 3EA2A 3TC6A 3GDBA 3T8QA 2QDHA 4OT7A 2ZXQA 3H53A 3QKEA 3PZUA 1G1YA 4C6KA 4C6DA 3T08A 2V67A 2EG6A 3QC0A 4X3ZA 1D9EA 5DANA 1HJXA 1FDYA 2GVJA 4B5WA 3O6YX 6ENLA 4PMOA 3IIOA 3U4FA 1UROA 4XBKA 3PZGA 4L64A 4JTAA 1QOPA 1TX0A 1R47A 3CV6A 2DSZA 4R33A 2WWCA 5AZ0A 2CWNA 5JMUA 3DH7A 1MSSA 1A3WA 3UWWA 2FZMA 3GYCA 1MRQA 4GO8A 2YCLB 2X8RA 1Y5VA 1KO0A 3V18A 1DWJM 4IZGA 3DX5A 1RP8A 1GVFA 1UR1A 2Y7EA 4INFA 4MZ8A 1TCDA 4B4FA 3A3XA 2FB3A 1GK8A 4UTTA 2A7NA 4AU0A 1UQYA 1JGMA 1TTJA 3I6RA 1XPYA 3BGJA 3LTPA 2GDQA 5DMNA 1J96A 1K1DA 4XISA 3CWHA 5CJMA 4C5YA 5BOOA 4AIOA 1DWHM 4OHQA 7A3HA 3PWAA 3FHQA 4Q32A 1H41A 1W1PA 3TIMA 2O0TA 5FSEC 3MTWA 3ERPA 1J6OA 1OC5A 3KRZA 1QR7A 2VC7A 1TX2A 2VJXA 3W84A 3K4WA 2C3ZA 3ZR6A 4PA8A 3VM5A 5CGMA 2QV5A 2W91A 1H7WA 1UASA 3C0SA 1KBLA 3UU0A 2I14A 3TFXA 1UKTA 2QCMA 5JIPA 3AXIA 5T26A 3LXBA 5FEZA 2C0AA 2R1PA 3BMXA 1UWQA 3NQ6A 1PX8A 4C6BA 2CLMA 2O56A 4REQA 4RE0A 1VFSA 1JQXA 4QS6A 1JUKA 3OG2A 4X60A 4AEFA 3CHFA 3MJYA 2WLZA 3PAOA 3RNDA 3QHNA 4GY1A 1KFCA 1UP2A 1KB3A 4H9TA 1X97A 3QZ6A 3WZ0E 3JS3A 2BTMA 4Y6GA 2V81A 4LXFA 2DVTA 3EKGA 1YMYA 3BAJA 4DNHA 2C18A 1W3HA 2VCAA 2ZUNA 3IVUA 4JTKA 3PS7A 5LA1A 3WFZA 1BAGA 2ALRA 3QVQA 1M7OA 2TPSA 4B5NA 1O4UA 1JZ7A 5LNSA 3DIPA 5C5YA 3L5AA 4BKNA 4MJ4A 1RBOB 3I3DA 3GHUA 3BCFA 2VZOA 3UETA 3ZO9A 2F61A 4AHPA 4J2MA 4AMCA 2W27A 1WAWA 2QT3A 4JL1A 3LCWA 1W5QA 4A29A 4ZQOA 2B7PA 4PZVA 4FF5A 2BY3A 4GCXA 1AMYA 4W7UA 2XVGA 1PCWA 3VOCA 3ID7A 3WLSA 1PKNA 3CHVA 3W6MA 3OGVA 2YCEA 1V6UA 3VD7A 4AD0A 2E3ZA 3M41A 3UG8A 2QJJA 4U2YA 1PKLA 3TYEA 1ZHAA 1LROA 3LZ5A 3PG8A 1NH6A 1GKRA 4E2DA 3UR5A 1M1BA 4O4WA 3W72A 4GG9A 4FNPA 3WEMA 1UPPA 5CZJA 2A3EA 1E1CB 2D20A 4CQCA 1XCXA 1XIBA 1JFHA 3UP8A 1OK4A 2X1RA 4C5ZA 3VIKA 3GHTA 3DYPA 3G1VA 3VFCA 3STFA 3OHMB 3WLNA 2CLHA 2OWCA 3GU9A 4GIRA 5A1AA 1EGVA 4JTEA 1ME7A 2HRWA 1MZRA 5DFAA 3VE7A 5HWNA 1SFLA 2V3EA 4KEZA 3C4UA 4QDPA 2QW5A 1S46A 1Q85A 4W8LA 4LU0A 1E6XM 1E9ZB 4V1YA 4DPQA 2VFHA 3ZXWA 1F6KA 1EJUC 2UY4A 3F4WA 3WN6A 4DF2A 3KVKA 5BOEA 2VZSA 1XBZA 1HKIA 2C16A 2WMKA 1OX6A 1U1HA 3FXGA 2BGSA 1HNYA 2YYUA 1PIFA 3A13A 4JDBA 3BZGA 1XYAA 2Y8VA 4WXYA 1B3ZA 1PZ0A 1PXGA 2C1HA 2V5CA 2WJZA 1G4TA 2OGYA 3W02A 3NZRA 4NQ1A 3DCPA 2E5CA 1PZ2A 2QDGA 3AQUA 1XM3A 3MS8A 4JFVA 2YW4A 1DXIA 3NCOA 4JXCA 1SUXA 1TG7A 4L6DA 3ATZA 3I6TA 4V2XA 2WKJA 3A21A 5AHLA 1IEQA 4O52A 4HZ8A 5E93A 1OADA 4QRNA 5I02A 1CYGA 1EPVA 4OKDA 3NQBA 5C2GA 3DXIA 2RUSA 3OZPA 4ZENA 3BAIA 3PJXA 4M6PA 2GZXA 4KWWA 3S9IA 1P0EA 3M0YA 4GMEA 3UJ2A 5LHEA 2ZWZA 3BJFA 2ZX6A 4QS5A 2PTXA 2ALDA 1K8XA 3WK3A 3AMDA 5LIXX 3WQWA 3M64A 3PF3A 3PJUA 3W2LA 4E3TA 1AG1O 4GI6A 3CT2A 3P67A 5FAGA 4F4RA 4HCHA 3KAOA 1X7IA 3PC0A 2BBFA 1F07A 5KMYA 2OFJA 5D2WA 2Y62A 3WLIA 1QASA 2XVNA 2HXUA 3G6MA 3TQPA 3A6OA 1AZ2A 5KZMA 2XFFA 3GNPA 3UBPC 1VENA 1AVAA 1IHIA 1Q6CA 3PUDA 7PTDA 5KINA 1UZHA 4JTGA 3W83A 4PMXA 2JIEA 2YXGA 2YSWA 1UA7A 1XYCA 2DV0A 2XPKA 3FV9A 4IX0A 1LUCB 2A3BA 4HHHA 5D2XA 1H1NA 1SSDA 1VCFA 2F9RA 4DB7A 1FH8A 1TB3A 2VDGA 3WQPA 3ARQA 2CESA 1OG0A 1J01A 2NQ5A 2NXHA 2B7OA 3UA3A 3TEVA 1FWIC 4QE5A 4LUIA 1XG3A 1OJXA 5G1MA 4X9SA 2OVLA 4JNMA 1B3OA 4IP4A 4DO7A 4EPDC 4D6IA 4ICMA 1GW1A 1A0CA 1AK5A 6REQB 1U1JA 4HOZA 3T78A 4CVUA 3QFEA 1OYAA 1Q6EA 1K9EA 3EX2A 2RKXA 1OHLA 2Z1XA 1RXOB 2YGYA 2PGRA 1KTCA 1UR2A 3KTCA 3UXIA 3NPUA 3AS0A 3B40A 4MB5A 4GOAA 2ZTKA 3ES7A 2E4TA 4FAMA 4L61A 3VIJA 2Y7FA 3BSHA 4AB4A 1OBAA 3SGGA 4UMBA 3UGVA 1U2YA 3VNJA 5I2UA 3H2OA 4L1GA 5DBTA 4ZO7A 1EF2A 1EH9A 1Q6QA 1WB0A 2V2DA 3P0XA 3CV2A 1MW1A 5BWFA 3EX3A 4IISA 2Q71A 3DZ1A 4PMDA 1VKFA 3A4JA 3TLQA 3NQ8A 3XIMA 1CECA 1G67A 2F6UA 1I0DA 3DG7A 4O19A 3CHDA 3FFSA 3LM3A 1EHAA 1CDGA 3SO7A 4U5IA 5I3FA 3MUXA 3R58A 3AJ7A 3M5ZA 4JR5A 5F4SA 5AYBA 4PODA 1A49A 4EX4A 4O15A 4QCFA 1AQ0A 3LHVA 1W2VA 4Q33A 5G2WA 1PTDA 4Z0JA 1L6YA 1F8IA 2VENA 1TJPA 4PMJA 3DN5A 1UB3A 2Z24A 4H00A 5FJRA 3EWYA 3UYIA 1FWCC 1J4EA 3NQ2A 1QNOA 1FP8A 5BROA 1DJHA 3QFWA 4MYAA 1FQ0A 1HUVA 1LL4A 2J4GA 3ITCA 3EX1A 4ZOBA 4IQEA 2PA6A 4Y9MA 3O63A 1OZMA 1ICQA 3GAKA 1XRTA 3NSMA 3UWUA 2YPIA 4Z2KA 2OTDA 3PZQA 2V5LA 1Q6FA 2HS8A 4JTUA 2QCGA 1ME9A 2J7DA 4NXKA 3DFPA 3WJSA 3GU2A 1T7LA 1TZZA 1DTNA 2DZVA 2D22A 3EDKA 4US5D 1DYSA 4PTVA 3NIYA 3TTSA 4W8BA 2R24A 3PPHA 1F8MA 4E4PA 4GJJA 3VGHA 1IEWA 4ZZ9A 2I9EA 2PDKA 4PSPA 3B9DA 1BWKA 4AZCB 1JNEA 1E1F