2V3GA

Structure of a family 26 lichenase in complex with noeuromycin
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
273
structure length
273
Chain Sequence
GLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSWGSQWQSFDQVFSRAYQALASINKPIIIAEFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE H
publication title D-Glucosylated Derivatives of Isofagomine and Noeuromycin and Their Potential as Inhibitors of Beta-Glycoside Hydrolases
rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 110
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2v3gA00
2W4XA 4JFVA 2PB1A 4ZENA 1X6NA 1W3LA 2PBOA 1ISZA 5A2BA 3WNOA 5DMYA 4U5IA 3ZJ7A 1H3GA 2J7EA 5BXPA 2CKRA 4GI8A 1OBAA 4U2YA 2NSXA 3WNPA 3SCSA 4PMYA 2W5FA 1HP4A 4W8LA 3SUWA 4Z2LA 4GI9A 4MJ2A 1N82A 1JZ4A 3I3DA 3L4YA 1GVIA 3F5KA 1VENA 1VB9A 2ZX7A 1DWIM 1JNDA 4LQ1A 3ZO9A 1W9PA 2PWGA 3L2LA 1FHLA 1H49A 5HBFA 1HF6A 2D1ZA 1AQ0A 2NW0A 3VILA 2OYKA 1VFFA 2WBKA 3WIJA 2DH3A 3RJYA 1WPCA 3SUVA 1E6SM 1JXJA 2UY3A 4M80A 5BROA 1UD4A 1H09A 4ACZA 4J28A 3TTOA 1TMQA 4MDPA 2WC3A 2Z1SA 1CXFA 1MVYA 2DEPA 2WMFA 3AROA 1UKTA 4GIAA 2CHOA 4W89A 1FFRA 4CN4A 1ZL1A 4CD7A 3NDYA 4PTMA 3WFLA 4V2XA 3KEHA 2NT0A 1CZ1A 3BGAA 3KL5A 4M24A 5D9OA 3CUJA 2EPLX 1W1TA 1C8QA 4GQRA 1JF5A 1G0CA 1OGGA 1AVAA 3WH7A 1NOWA 2YA0A 4QCEA 1G5AA 4QFUA 1X1NA 1SFSA 2XVPA 3GYCA 2WMHA 1W9DM 4AZCA 2CBJA 4OBRA 3NIYA 4ML4A 1HVXA 1TZ7A 5FL1A 3PZQA 3EDKA 2YKKA 4H41A 4ATWA 5ABEA 3CHEA 1JAEA 1BYDA 4DUXA 4FLRA 4B3KA 2WLZA 5IHSA 1E4LA 4WK9A 3AIWA 4JFWA 3AZRA 4D72A 4NRRA 1M01A 4D6HA 1WDRA 3CUIA 4K68A 3E1F1 5BYWA 3WDIA 3VX1A 4GZJA 4W8BA 1GONA 3ARPA 1C3FA 4BZYA 3CZ8A 2VOTA 5A8MA 1ZBWA 2V3EA 2VVSA 4WLCA 3MUAA 1ITCA 3MSGA 4PMXA 1R85A 3WQ4A 4H2CA 5LA0A 4IISA 1E4MM 4X9YA 2C0HA 4JFSA 1UWUA 2BY0A 3OIHA 4E2OA 1J10A 4GQQA 1E3XA 1FP9A 5LA2A 1C91A 4XUYA 3FAWA 1UR4A 4P7OA 2GUYA 1KBKA 1K9FA 1UR1A 4V27A 4BQ5A 1Y7VA 2Q8XA 3L4ZA 1CEOA 1B3VA 1EQCA 3GTNA 1ZBKA 4IPNB 3WMBA 3TONA 2CBUA 4HPGA 2EO7A 4J3SA 3CBWA 2X8RA 3WNMA 2BHYA 2YDQA 9CGTA 1NWSA 4KH2A 1VEMA 3TP4A 2CYGA 1TG7A 4OZOA 1V0NA 2GFTA 1F4AA 2JALA 1CTNA 1E1EA 2D23A 4DUWA 2XWEA 1JIBA 2E9BA 4D6EA 1GHSA 2WMJA 1OB0A 1UH3A 1LLOA 1U2YA 1OGSA 5I0DA 4PTVA 1B3XA 3TA9A 8A3HA 4M8UA 1V6WA 1OGBA 3W6MA 5BRPA 1HL8A 4WKHA 4AIUA 3WNNA 1ISYA 3O9NA 1UR8A 1E15A 1HJQA 4QLKA 1V6YA 3VIMA 2BHZA 2ZIDA 4AZIA 1C7TA 1E4IA 1MQPA 3EMZA 2VRKA 1UKQA 1NP2A 2D3LA 3SUUA 4Q7NA 2DIEA 2QMJA 4J3UA 2JF6A 5CPSA 4C7DA 2D24A 2BHUA 1OCQA 2DGAA 4AIOA 2ZICA 1JXKA 1E6NA 3PN8A 4PMVA 2GJPA 5IFTA 3UG4A 1BVNP 3L4WA 5C71A 1HJUA 1W1VA 2VCAA 4UFJA 1HN1A 1HKMA 2WNWA 2XVNA 1UD3A 1W3KA 4YHGA 4D1IA 3SCNA 4LXFA 4RE2A 4CUCA 2ZXAA 3FY1A 4PTWA 3N1AA 4JCLA 4GZEA 2UY5A 1GORA 3GXFA 4GKLA 4TX6A 1UHVA 1GQJA 1Q6DA 4U33A 5A2CA 2VR5A 4Z2GA 5I78A 5M5DA 2YL9A 5CGMA 1V3HA 4D6IA 2VZSA 1DWGM 3GM8A 3N17A 3FW6A 4J27A 4AEEA 4PCTA 2Y5EA 1XYFA 4HOXA 3BAKA 1WE5A 3TTSA 1CXLA 3CZLA 2AAAA 2DSWA 4RE3A 4URIA 5EMYA 4S3KA 1OWQA 2FHCA 4U2ZA 3VD5A 2VO5A 5JUVA 1HIZA 1QBBA 3WL1A 4BS0A 2JIWA 1E5JA 2A3BA 3THCA 4UOQA 1QBAA 2WHLA 1I1WA 2FGLA 3ARXA 2YL8A 2XSAA 1NARA 1SR0A 4H8VA 4W87A 1LJYA 3PZIA 1PX4A 3CH9A 3G6LA 1BYBA 2A3AA 4CVUA 2DSKA 1UKPA 2PWDA 2VC9A 2J77A 3T2PA 4W88A 5A6KA 2J7BA 5A69A 1HNYA 3WH5A 3WMSA 1IV8A 2OWXA 4YHEA 2ZXDA 3AMKA 1BFNA 3M07A 2G3IA 4LPCA 1KGWA 2MANA 4XX6A 2QV4A 4N0RA 2A3HA 3PZ9A 1FOBA 4B16A 1CGUA 4YN5A 3QOKA 4L4OA 1H4PA 3AHVA 3ZT5A 2WYSA 3W28A 4CKQA 3THDA 1RPKA 4HZ7A 1XGZA 3U5UA 3VIOA 3VGDA 4R27A 1JAKA 5DT7A 2OYLA 1BGGA 5TD4A 4ZXOA 1QW8A 6TAAA 4HA4A 1KQYA 3BAWA 3ZJKA 3FAXA 1OD0A 1KXHA 3KL3A 1PEZA 5E09A 1UWTA 2ZUTA 2G3NA 4PCSA 1BTCA 1HJXA 5ABFB 3MS8A 3BXWA 4M1RA 3OGVA 3LPFA 1W2VA 5DFAA 4P7QA 4PUEA 3W4RA 2YJQA 1CGWA 3CZJA 2XSBA 1XSKA 7CGTA 3AS2A 4ATDA 1DHKA 2YL6A 2VJXA 2XGBA 3WF4A 1JDAA 4UQDA 1UD5A 3T09A 3BMWA 3WUGA 5CSUA 1BAGA 1M53A 1BHGA 3AS0A 1CGTA 4J3VA 3T0BA 4CVWA 1C90A 4MPKA 5CZKA 3UG3A 5BXSA 1JD7A 3VIPA 1Q6GA 1V08A 3ECQA 4WF7A 3SCVA 3II1A 3UCQA 3EBVA 3GH5A 1BG4A 5D8ZA 3VIKA 1R87A 3GZAA 5I24A 3CIVA 2YA1A 2QMKA 2BY1A 1IZJA 2EQDA 2BVDA 1GOQA 1IZKA 1KB3A 4U3CA 2WWDA 1UUQA 2F8QA 1NH6A 1BSIA 1JF6A 3QHNA 4ZXLA 4HMEA 1K9EA 1BGAA 1KWKA 2TAAA 5IDIA 2WWCA 3AOFA 4PRWA 5A6SA 4H8UA 2C8NA 1XCWA 3DYOA 2CCRA 2EXOA 3WL0A 1ISXA 4U31A 3W6LA 1C7SA 2VZVA 2XM1A 4PSRA 5EFFA 1TA3B 3MKKA 1XH0A 3GH4A 3M46A 2O92A 4UQBA 1E43A 1GQIA 3VGFA 3DECA 4Z2IA 1GVYA 4AD4A 4JL1A 2BY3A 4L4PA 3NCOA 3PHAA 4ZFMA 2VCBA 3DYMA 1JYWA 1O7AA 5A8QA 3BSGA 1UD8A 4WSJA 4OOUA 3IJ7A 3GBDA 2X2YA 1BVZA 3UETA 1HXJA 2ZUVA 4HA3A 1TE1A 3W82A 3K4AA 3MO4A 1NM9A 1UD2A 4QCFA 3BC9A 2ESCA 3PZGA 3RM8A 1EDTA 1IT0A 4EANA 2Y2WA 3D3AA 3N04A 3CUGA 2J7GA 1OT2A 1PX8A 1BPLB 2V3DA 2E8YA 3WH6A 5C8BB 4AD2A 1ZJAA 2Z1KA 1W3JA 3UESA 5CPTA 3SCTA 4J7RA 3GNPA 3QR3A 4JCMA 1JYVA 1GZJA 2EPMX 3CMGA 2OSXA 4GO9A 1RD6A 1G1YA 1JDCA 2CEQA 3K4DA 6CGTA 3BH4A 1W1YA 2QPUA 3BLPX 1UQYA 3WQWA 1US3A 5JBDA 3OGSA 3TTQA 2EEXA 2GJXB 2YIHA 4P8VA 1V3JA 4TXEA 1WO2A 4UOZA 1ESWA 1GHRA 1VEOA 3DYPA 3W37A 4UFKA 1JZ5A 3WD1A 4QP0A 2E8ZA 4UFHA 4CD6A 5HOSA 4IPLA 1KR1A 1DWHM 2WVUA 1E55A 1XD0A 3VIFA 2VR4A 3ZR5A 1HJSA 1TUXA 1WNOA 3LMYA 1E40A 1CENA 2WZEA 1NWTA 2QHAA 4CCCA 4NI3A 2ZWYA 2G3MA 3L2MA 4WKAA 5A95A 3GXIA 2VQTA 2V38A 1JZ2A 3VMNA 2E40A 1R86A 3WF3A 3EMCA 4MAZA 1DWAM 5I6SA 1B0IA 3SUSA 3B9EA 5ABHA 2QLYA 2WKGA 1UA3A 2WAGA 3OB8A 2OYMA 4W5ZA 4YPJA 2ZXQA 3A4WA 1JZ3A 2BNJA 4PMQA 3M7SA 1MW3A 2DT3A 2GVYA 2YBTA 1UWIA 3AJ7A 4HMDA 3FHQA 4PEEA 1EO7A 3ZJ6A 2WSPA 5A6BA 2E9LA 1E72M 2A3EA 1CXKA 2RGLA 3WDQA 4Z2JA 3CZKA 3WH9A 4HZ6A 1HJWA 1MFVA 3WENA 3RO8A 1W1PA 2D22A 2YOCA 1E9LA 3SIMA 1V3LA 2WMGA 1WP6A 1V3IA 4M56A 1OSEA 2CKSA 3FXYA 4P8XA 2YBUA 3RMEA 3WY1A 2J79A 3WDRA 3W27A 5A8PA 4KMQA 1WZMA 4JFUA 3AS3A 4NRSA 1UYQA 2WCGA 3VTRA 4M81A 5GNXA 1C92A 3AMDA 3L4UA 3F5LA 5CPQA 2W63A 2IUZA 2V5DA 1V6UA 1D7FA 2WCAA 1I1XA 2PBGA 4TX8A 4HOWA 1D3CA 4PMZA 1ZU8A 3BLKA 5GNYA 4MB5A 1GOIA 2VX7A 3ARVA 1GPFA 1W32A 3WN6A 5A8OA 1FA2A 2EJ1A 1TR1A 2V3FA 3VPLA 3GBEA 1LL4A 2VRQA 4JKMA 1DWJM 1HKKA 1VIWA 4AY1A 3W53A 2G41A 3S6TA 2ZUUA 2WHKA 1TVNA 1EO5A 1UA7A 4IUGA 1KXVA 4AZCB 4X0VA 4D6CA 4TTGA 3BCFA 4MNLA 3OZOA 1VRXA 2C7FA 2PWHA 4AC1X 4EAMA 1Q4NX 3GXDA 1JFXA 3MMUA 3TTYA 3AS1A 1EDGA 5I3DA 5BXRA 3VDBA 3WFZA 1UZ4A 3SCPA 4DWSA 3B9DA 2CNCA 2CETA 1B30A 1JI2A 2J8GA 1V0MA 1CXEA 2CPUA 3T0DA 1B3YA 2GDUA 3NSXA 4AZ6A 3AFBA 1E1FA 2FDMA 5DEZA 1UD6A 1PJ9A 2VVNA 3EMQA 3I3EA 3S2CA 2D0FA 5IHRA 2W62A 2CERA 3CLWA 4PTXA 1CLXA 2DT0A 1QNOA 4AIEA 2BVTA 4UQCA 2E9MA 3VU2A 2WVVB 3WNKA 3SEPA 3IAPA 1B3ZA 2DH2A 3FN9A 3FHAA 2XWDA 3A47A 1WZKA 2J78A 2W92A 4E8CA 4NSBA 4W86A 2VURA 4W84A 1WZAA 3CO4A 4AWEA 3N9KA 5KEZA 1J18A 1PPIA 1AQMA 4W7UA 4FLQA 4P7RA 3GNOA 3K8MA 2EPNA 3AI0A 2NT1A 5I5RA 4OJYA 2ZWZA 1K9DA 4KRTA 4CCEA 3AXXA 3SCQA 1HJVA 2X0YA 1WCGA 1J11A 2BV9A 3VDHA 4CCDA 5GNZA 1LWHA 5CG0A 8CGTA 2ZUWA 3K1DA 4UOJA 4TUFA 5D9NA 2WM0A 1KBBA 2XFRA 2BVYA 5FL0A 1MW2A 3DC0A 2JFEX 1E3ZA 4J3XA 1M04A 2XFYA 4AMCA 3SCWA 3QHOA 4GO8A 4D6FA 3CZEA 5D4YA 4F9DA 5A3HA 3ZT7A 1VFMA 3UR8A 3VDCA 2J7HA 5E70A 4CGTA 2WMIA 2XPKA 1PZ3A 3CHCA 1NQ6A 2FHBA 3IJ9A 5C70A 4CD5A 2W66A 3MUIA 2XVKA 3VOCA 2VZTA 4UNIA 2VI0A 1QI4A 2DSUA 1A3HA 1W9XA 4DUVA 5JBEA 2W91A 4UFLA 1KGUA 1EA9C 3VX0A 4H7VA 1V3MA 3VMPA 3JUGA 2DT2A 5M17A 2XJ7A 1HT6A 4JAWA 3VIHA 4F66A 1GNXA 5CGTA 2ZUMA 2Y8VA 3OGRA 1KGXA 4W7VA 3AIBA 2G4FA 1CXHA 1A47A 4D6DA 3WELA 3AISA 3WD3A 1EGZA 5BCAA 1UWRA 1KWGA 2VUYA 3ZSTA 1KCLA 3AIRA 5GPRA 1ZB5A 1B9ZA 4XZBA 4PSPA 1EH9A 4U3AA 1GOWA 1EDQA 2XUCA 4GZIA 3VNYA 1FH8A 4WJXA 4JIEA 4DM1A 1XSIA 1NOFA 1KFWA 4HOZA 4WSKA 2FH8A 1UWQA 3MU7A 4AD5A 3VIGA 4WIWA 1XRVA 1J0JA 3PTQA 3RM4A 1CYGA 3BSHA 4FMVA 1QHPA 3EDDA 4HA1A 1HKIA 2WVTA 1G94A 3WNLA 1DP0A 2WC4A 4W5UA 2VX6A 1EXPA 1W9VA 5I23A 1ZBCA 4U5KA 3WD4A 3F5JA 2D0HA 1Q6EA 4LX4A 4C7GA 1VJZA 3CPUA 2X09A 1CIUA 1Q6CA 4UQ9A 2JIEA 4GPNA 4HMCA 3CGTA 1PBGA 1EHNA 1PZ2A 2F61A 4MNKA 3HU7A 2ZX9A 3WDJA 1EIBA 3WSUA 3T2QA 4CU6A 3VIJA 3HJEA 3BAIA 4BA0A 3T2OA 1EOMA 1WKYA 4D6GA 4D71A 3APGA 1UWSA 2VT0A 4M82A 5HXMA 2XG9A 1QHOA 3RILA 1BYAA 1JI1A 3PZUA 5FCZA 3WBEA 5HDRA 5A1AA 5CLWA 3AIEA 3VD7A 1LL7A 3AIUA 3RDKA 4Z2KA 3NJ3A 4BQ4A 3KWXA 4F9JA 1CECA 4QLJA 1J0KA 1JYXA 1ECEA 2J62A 3OLEA 3ARUA 2A3CA 3ARZA 1VBRA 3ARRA 3N13A 1ODZA 5EB8A 4B9ZA 2EBNA 1H5VA 3CHDA 5E9AA 4UFIA 3WUBA 1JG9A 1DWFM 2O9OA 1OM0A 4MTVA 3QGVA 3U5YA 1R8LA 3ALGA 2J7FA 3O6AA 1GQKA 2ZUSA 5D9PA 1RP9A 3AHYA 1QW9A 3MUY1 2VCCA 3UEQA 1QI3A 4MB4A 1ITXA 1TFVA 4BQ2A 3WEOA 1B31A 1BF2A 3MV01 1JZ7A 3L4TA 1Q6FA 3OA5A 2J25A 1FHDA 4TOQA 3WMCA 4CN1A 1KXQA 5CSYA 1MQQA 3RCNA 3AYRA 7TAAA 1KCKA 1UH2A 5F7UA 4AD0A 3W25A 1C8YA 1X6LA 2DSZA 4FLOA 1MW1A 1UR0A 5A6BD 4UQEA 7A3HA 3WUFA 1R7OA 3NUKA 4LGXA 3VKKA 1W2PA 3N11A 2XM2A 4R5EA 3MMWA 4J3TA 4CU7A 2D3NA 1K9TA 2WW5A 5CQ1A 1GJUA 3WEMA 1S46A 3WQ8A 1GW1A 3O2LA 4Z2HA 4ZEPA 4S3JA 1V0LA 3WQVA 2GK1B 1CNVA 4HZ8A 3ARWA 4OIFA 3WF1A 1JYNA 3K8KA 1VBUA 2VX4A 3AXIA 2J4GA 2CITA 1DTUA 1E0WA 4FF5A 2J74A 4AZGA 1QNRA 1E73M 2ZE0A 4UCFA 1E4NA 5KZ6A 4OBSA 4RL3A 3IJ8A 1V02E 1MWOA 3EDFA 4XV0A 2XTKA 3CMJA 1H11A 2OSWA 4GINA 4OUEA 4KGLA 3A4AA 1NOUA 4ZE5A 3LPOA 4AD3A 1OT1A 4F8XA 4HP5A 3VIIA 4PYSA 3VD4A 2XGIA 2XHYA 4X0NA 3U7VA 4H04A 1C93A 2GDVA 5CLTA 4GXPA 2VMFA 2O9PA 2JEQA 3N15A 1LF1A 1GOKA 3W26A 3A3HA 2X05A 1RH9A 2UY2A 3A4XA 4P8UA 3VGBA 3SCRA 2V5CA 2WC7A 2HVMA 3RPMA 1U33A 2CBIA 2O9RA 3EDEA 1QI2A 1XHGA 5GQBA 1CBGA 1SYTA 4Y7EA 4DWSD 1JZ8A 4M29A 4HPHA 1E0XA 1XYZA 4NZCA 1JNEA 1UR9A 2ZXBA 1OIMA 1GUVA 3KL0A 5FOOA 4B15A 3HMCA 3ZR6A 1MW0A 1TVPA 2QPSA 3G6MA 3L4XA 3AMGA 3CUFA 2GJRA 5HPOA 2XVGA 1W9BM 1ISVA 5CXPA 5EFDA 1UQZA 1E70M 1H1NA 2WBGA 2IXVA 2D0GA 3DHUA 5CJ5A 3T08A 4AW7A 5FD0A 4OOZA 4PUDA 4ACZB 3NDZA 3AHZA 2W61A 3WBAA 5E6ZA 1BQCA 2J7CA 1XD1A 1XC6A 5ABGA 1UR2A 3GNRA 3PZOA 3UR7A 1E6PA 3VM5A 2E4TA 1EHAA 2WKLA 1JZ6A 2WCSA 1E0VA 4FLSA 2Y24A 1OINA 1WDPA 2OLHA 5HPCA 2XIBA 4MNJA 4MJ4A 3PZNA 3EYPA 2CBVA 3MMDA 3ARYA 4MAVA 5E0CA 2WVVA 1AMYA 2VZOA 3OLGA 1K6AA 5LYRA 1PX3A 3QHMA 1E6ZA 1CLVA 4HU0A 4NF7A 3RIKA 3OZPA 2BS9A 3ALFA 4EKJA 3W29A 5A6AA 4AZHA 4AYSA 1E71M 4LYQA 4ZE4A 4DM2A 3POCA 1HVQA 2WPGA 3POHA 5A2AA 4AISA 3K46A 1I75A 2J8FA 4TVUA 4AXNA 4JKKA 4Q22A 3IK2A 5JBFA 3WQ6A 4BQ3A 1O6IA 2X1IA 3WF0A 4MADA 1H41A 3WEZA 4PBGA 3ARSA 1U30A 1JL8A 2WZIA 2W67A 4JFTA 4HTYA 4MNMA 1BG9A 4CD4A 2ZX8A 1SMDA 2VRJA 1VJSA 4P7NA 1QI5A 3VVGA 4KGJA 2UWFA 3OLIA 1FP8A 3MUZ1 1E6RA 3F4VA 3A6OA 3M6DA 2PF0A 5DO8A 3QOMA 3NSNA 2PWFA 3AHXA 5AC5A 2CESA 3VD3A 1CWYA 1MFUA 1NP0A 3KE0A 4B3LA 1FFQA 5E0FA 5FKYA 2DSVA 2WHJA 4UZSA 1PIFA 5FIPA 1M7XA 3LPGA 4RE4A 5A6MA 1CXIA 1EQPA 1P6WA 4TVCA 2B31A 5M3WA 2DPEA 3D5HA 4JL2A 3DHPA 2WANA 1QNSA 4FK9A 3WH8A 2VZUA 4PMRA 2JF7A 1QNQA 1CDGA 4UR9A 1ZJBA 4BF7A 2J75A 2DIJA 2OSYA 2Y4SA 2YL5A 2BXZA 3SUTA 3VGGA 4D6JA 1MXGA 4MB3A 1JFHA 1TCMA 1QOXA 4DWSB 3MV11 1ZS2A 3KZSA 2YA2A 4GI6A 1G01A 3N18A 3CZGA 4CU8A 5ECUA 1FH7A 5BXTA 1LWJA 1E5NA 3IAQA 4EK7A 3BMVA 4AZ7A 1CGVA 1NWRA 3ZOAA 2YDSA 1CGXA 4LYRA 4JZ5A 1QVBA 1GOMA 3PZVA 2VL4A 2D2OA 4MB1A 3OBAA 2WHMA 2OWWA 2JEPA 3AQUA 1LG2A 4TVDA 4QDMA 4ACYA 1UG6A 3GDBA 4TTUA 3L4VA 1DEDA 1SMAA 2WB5A 4EE9A 3CTTA 3RJXA 2WK2A 4ATLA 2OWCA 2G8ZA 3WUEA 4JHZA 5ABFA 1OD8A 2FHFA 3ZIZA 4H8HA 3SCOA 3ZQ9A 4E4PA 2ZUNA 3N12A 4LYPA 4PN2A 5I2UA 4E8DA 1LL6A 4CN6A 4AD1A 3B8SA 4J3WA 4XZWA 1V0KA 1WZLA 2BFGA 2O9TA 2AMGA 1BLIA 1ODUA 5IXEA 3ARQA 4JKLA 5HNNA 1VFOA 4A4AA 1PAMA 1XSJA 4C7FA 3ARTA 1J9YA 3WF2A 5E6YA 1WDSA 2WMKA 4QAWA 2WXDM 3WD0A 1J0YA 2RGMA 3AICA 3ZSSA 4CD8A 2ZOXA 5I77A 1WB0A 3PBGA 3MANA 1MXDA 5BRQA 3U57A 1D2KA 3UERA 2VQUA 2ZX6A 4P7LA 1YQ2A 3BAYA 2UY4A 3AMLA 3AZSA 2EPOA 5A8NA 4WKFA 2V3GA 1MQRA 4W7WA 3AIQA 1YHTA 3NSMA 4XB3A 3W38A 2VTFA 1OIFA 5D8WA 2D20A 3PZTA 1KXTA 1JGIA 1V6XA 2FH6A 1H2JA 1UOKA 1AQHA 3GXMA 2PWEA 2WMIB 3NYDA 3W81A 1J0HA 1Z32X 1W3HA 3BAJA 4PMOA 1TA3A 1W91A 1JD9A 3VMOA 4V28A 2J7DA 3FNDA 3CHFA 4A3HA 1C8XA 3AHTA 3K8LA 1R7AA 3ZM8A 4JHOA 1B2YA 2WSKA 3J7HA 3LPPA 4W85A 1LG1A 4MDOA 3GH7A 1CGYA 1QPKA 4UQAA 3T0AA 1GJWA 4W8AA 1WDQA 3U7BA 1M03A 4BCEA 1E6QM 3AZTA 1XCXA 3WKZA 1F4HA 3VM7A 1QHZA 4QLLA 3WD2A 3VDAA 1H0GA 2GSJA 1HX0A 2XFFA 3B9AA 3ZMRA 2YLLA 3ZJ8A 2XYLA 3SURA 1J01A 3I3BA 1HL9A 4IM4A 2HISA 2XIIA 4AZBA 1B1YA 3PTKA 1PIGA 1KR0A 2CIPA 1VAHA 5M03A 1VFUA 3MSDA 4D1JA 5EBAA 2JE8A 3WDPP 2EPKX 3HN3A 3VO0A 3AMCA 1UKSA 4PMUA 1VEPA 2G3JA 5A6LA 3OG2A 4W93A 2BXYA 1ISWA 3AXHA 3W24A 5A6JA 2AOSA 3WQ5A 1GQLA 2XVLA 2WLYA 5A94A 1UKOA 3IANA 5JIWA 5AY7A 3AYSA 1V3KA 2X0HA 3VGEA 2WZHA 3UG5A 1US2A 3AIVA 4B9YA 1XV8A 1L8NA 1UH4A 3VD9A 2DQXA 2FGZA 6A3HA 2GJXA 1J0ZA 5AC4A 4UTFA 1UZ1A 3VNZA 1W9UA 1WAWA 1NWUA 1HP5A 2BY2A 5D9MA 1CPUA 1KQZA 1E6XM 1FH9A 1J12A 5DF0A 1GCYA 2E0PA 2GK1A 2QF8A 3ZT6A 1XH2A 1MYRA 4UZUA 1RP8A 3SCUA 1G9HA 4UFMA 2CXGA 1H0IA 4F79A 5IFPA 1V6VA 1XH1A 4PMNA 5DT5A 2PI6A 1B90A 1E56A 3VINA 4AZ5A 4A3YA 4AEFA 3OLDA 2YLAA 1QNPA 2CHNA 1VF8A 1ZBVA 5LA1A 1J0IA 3BAXA 5I79A 5AYBA 2IXUA 3BCDA 2DT1A 1V02A 4PMDA 2YDRA 3WDHA 2PC8A 2F2HA 2WVSA 2VNCA 4KWUA 3RM9A 4P8WA 1JDDA 2ZX5A 4HU8A 5BWFA 1HKJA 3EDJA 4DWSC 3PZMA 3TOPA 1B3WA 4KRUA 1GOOA 3VGHA 3VUPA 3PTMA 5AYIA 1L0PA 2J47A 5JIPA 1LQ0A 1BYCA 2Y8KA 1QI0A 3W0KA 4N42A 1EOKA 3CUHA 2DDXA 1V03A 4OKDA 2VX5A 2E3ZA
chains in the Genus database with same CATH superfamily
3H24A 4M6VA 4E6MA 2PZNA 4ZENA 1XL9A 3LXCA 4CQBA 1OBAA 3JW7A 4UB9A 3WNPA 5CSRA 5C9RA 4N2YA 3EWCA 3B0VC 3PJTA 4FNQA 1T0OA 1DE5A 4K8GA 5SWUA 3V1HA 4XG1A 3F5KA 3UT0A 2EF9A 4UTLA 2V63A 3T55A 3UYIA 2V6AA 4XZHA 1WBHA 4UTTA 1W5QA 5K7JA 3VILA 2EKGA 2WBKA 1PB0A 2POZA 3KVMA 1E6SM 1JXJA 2EAWA 4XIMA 5BROA 4J28A 2HXUA 1TMQA 4MDPA 3W1QA 2Z1SA 1MVYA 2DEPA 4ZQMA 3P67A 4W89A 4QROA 4ASTA 3IIVA 3T0CA 3KEHA 2NT0A 1CZ1A 3KL5A 1WUFA 4M24A 3CEPA 3NWRA 1C8QA 1VYRA 3LD5A 3ITVA 1A53A 1G0CA 2ZZ5A 3W2MA 4DN1A 3QYQA 1AVAA 3L5LA 1NOWA 3LOTA 2YA0A 1KM3A 4QCEA 1Z69A 3NM1A 4X3ZA 4QFUA 2DZXA 1QW7A 3GYCA 2XIOA 2R94A 2CBJA 4GVHA 2Z28A 1E9IA 4ML4A 5FL1A 2QAPA 3PZQA 2J6XA 2YKKA 3IJQA 4EX4A 3GG0A 3CHEA 3LBCA 1JAEA 1AUSL 4A2SA 1E4LA 2NX1A 4DO6A 1X1OA 2NQLA 1ELSA 3AIWA 1QOPA 2QJNA 4D72A 4NRRA 5CZTA 1OG6A 3E2RA 3H23A 4W8BA 4Y6GA 3ISIX 4BZYA 5REQB 3ZWSA 4LUSB 4XD4A 2VOTA 1ZBWA 3H6OA 3OYZA 5HNTA 3HPSA 2VVSA 1XW8A 1DKWA 3NQAA 2GOKA 2FPVA 3AAMA 1THFD 2D2JA 5LA0A 4IISA 1E4MM 4GYPA 1UWUA 1E3XA 5LA2A 1C91A 3TLLA 4A3QA 3SI9A 3FAWA 5LNWA 3C0SA 4YIWA 4DIAA 1KBKA 1K9FA 3NO5A 4RDZA 1O66A 1B3VA 4MPQA 1XLFA 3TONA 4HPGA 4MM1A 3CBWA 2X8RA 3WNMA 2BHYA 2YDQA 2ZC8A 4KH2A 2QUNA 1VEMA 3TP4A 3DESA 1NJJA 2HE8A 1KLZA 5EMLA 3UVIA 1F4AA 3UZJA 1OJXA 2JALA 2GUUA 1KKOA 4L1XA 4GOAA 1NFPA 4NASA 2E9BA 4XBJA 1WQ5A 1OB0A 1JUBA 1LLOA 2C1GA 5I0DA 5HJXA 4PTVA 1KRCC 1B3XA 3TA9A 2QDEA 4M8UA 1V6WA 1TTJA 2PODA 4AWSA 4LT9A 5LHFA 3O9NA 1XUZA 2Y70A 1HJQA 2BHZA 3QYSA 4Q8VA 1C7TA 1MQPA 2Z26A 4CNSA 4J9JA 3FKRA 5CPNA 2JF6A 5CPSA 3NEHA 2D24A 2BHUA 2DGAA 1GQNA 4PMVA 2GJPA 5IFTA 4KETA 4AQLA 1JCMP 4LS0A 3OVGA 1DJZA 3IARA 4YHGA 2P3ZA 3IACA 3W76A 4HHHA 2WSQA 4IP4A 2ZTJA 3FIGA 1KTCA 1FWIC 1XIJA 3FY1A 4UC5A 4FX7A 4FR1A 1K6WA 2EKCA 1I2NA 2HS8A 1GQJA 4HJWA 1Q6DA 2DZUA 5A2CA 4Z2GA 3FDGA 1NDZA 2YL9A 5CGMA 1TB3A 3GC5A 1DWGM 3WLIA 3CS2A 4H01A 3GM8A 3M7WA 4INFA 1K7FA 1X1ZA 4F48A 1WE5A 1XPGA 3BZGA 4REQA 1CXLA 3MVTA 3SGUA 3O63A 3CZLA 3ABRA 2J24A 1OWQA 2QT3A 1TV7A 3VD5A 5LNRA 3C2RA 1QT1A 1HIZA 3WL1A 2JIWA 2A3BA 4UOQA 2WHLA 1ZAHA 2OX4A 1NARA 3H70A 3N2XA 3F2CA 3FFSA 2A3AA 4JYDA 4CVUA 3TMQA 3IUHA 1P0KA 1DJNA 3WH5A 3VNKA 3WMSA 4Z0JA 2OWXA 4CQ9A 1O4UA 4BHYA 4IIDA 4WDTA 2FTPA 2G3IA 2Y6ZA 2R14A 4WGXA 1KGWA 1M3UA 1TX0A 3IV3A 2MANA 2OXNA 3VNJA 3BCJA 1IT7A 5HATA 5I3HA 3TJXA 3VOFA 4X63A 1JRCA 1K02A 3QW3A 3FOKA 3PVFA 3P74A 4G5DA 4CKQA 1ICSA 3THDA 4GJ1A 4HZ7A 3WK0A 3U5UA 4R27A 5TD4A 1X8FA 1A5NC 6TAAA 7PTDA 1JDEA 3GB6A 3PAJA 2ZUTA 4PCSA 2QIWA 4F2TA 4H7CA 4N9DA 5I3IA 3ONBA 5FESA 3BXWA 3NPUA 3OGVA 2PDGA 4OBTA 4E0CA 1W2VA 1LP6A 3SN1A 4MY8A 4HYWA 2YJQA 1CGWA 3CZJA 7CGTA 1DHKA 2OCZA 2VJXA 4XWUA 3WF4A 2I5IA 4NZ1A 1ZSXA 1JDAA 1TMLA 1SO3A 4O54A 3T09A 4V1YA 1ITUA 1M53A 2VGIA 5CZKA 2FDSA 1WBJA 1SO4A 4MUZA 4GUHA 3W7EA 4O57A 3G0UA 3P93A 5G1TA 2F7FA 4S2BA 3SCVA 2YCJA 3UCQA 3VCNA 3EBVA 3GH5A 2F2KA 1BG4A 3B3DA 5D8ZA 3PULA 1R87A 5HWJA 3IGXA 4O8RA 2QMKA 2ZFAA 2BVDA 1ML1A 2V2HA 3LM3A 3TYEA 2F8QA 4H6EA 1JDFA 1BSIA 3EPNA 3Q37A 2P88A 1R2RA 1BGAA 3D46A 2TAAA 3DHDA 2BGQA 7TIMA 4C5ZA 3E9AA 1TPC1 3DYOA 1ISXA 4U31A 3KTCA 4N02A 4YTRA 1C7SA 2XM1A 3DN5A 1PTAA 2PDHA 3M46A 4L4LA 1O1ZA 5BU9A 1E43A 3V5CA 4NYUA 2C15A 2H9AA 3LM7A 2P3EA 3C2VA 2OR2A 2A4AA 3DYMA 3PS7A 1O7AA 4Q32A 1J96A 1UD8A 4WSJA 4OOUA 3ZZ1A 3FVMA 4J2MA 3BLOA 3STEA 3UETA 4LNYA 5ECVA 4AWTA 4HA3A 1TE1A 1HFBA 3IIZA 1QFEA 3MO4A 4LALA 4QCFA 3PZGA 2O56A 1IR2A 3CQKA 3GFYA 1OT2A 4EIVA 1PX8A 3IRDA 1KV8A 2Z1KA 2J9XA 3UESA 4RNIA 1GJPA 1Q63A 4J7RA 3GNPA 2PSNA 3QR3A 4QJ4B 4JCMA 1GZJA 3USBA 4J3ZA 4GO9A 1RD6A 1G1YA 4JBRA 6CGTA 4XAFA 4P61A 1XG3A 1UQYA 1WOAA 2X42A 4JPGA 4UNLA 2EEXA 4WDWA 4JTJA 1OFAA 1V3JA 4TXEA 1WO2A 4US5A 4XAYA 4HK6A 3DYPA 3W37A 3UWQA 5G1YA 1JZ5A 2RFGA 1NDYA 2NQJA 1VIZA 5HOSA 4DYKA 3HQOA 1KR1A 4HNVA 1V51A 1H50A 3DFOA 3ZR5A 1HJSA 2FLIA 3NZPA 1AL7A 3TROA 1TUXA 2R6OA 3QGKC 4JTIA 3KOYA 3FVDA 2BASA 5CC3A 2WZEA 2DJLA 3CIWA 3H7RA 1NWTA 2E5DA 3GW3A 2I17A 3LXAA 4KWSA 2VQTA 1JZ2A 3I68A 2E40A 1XQLA 1J5SA 5AC8A 1B0IA 3OHIA 4JX6A 3FCPA 1TUFA 3SUSA 4Q8OA 2GDQA 2BLEA 3EX2A 5CZ0A 1TRIA 2QLYA 3I7SA 4J40A 1LM1A 2RJHA 3UJEA 3HGOA 2ZXQA 2C13A 2BNJA 1ECQA 2FZDA 1L6YA 2YCKX 3PB2A 4NVTA 1OYCA 3CAWA 1F61A 5HJLA 2GVYA 1XLJA 2YBTA 1CB7B 4S3FA 1SZFA 2RGLA 3S3GA 1MFVA 3WENA 1OG0A 2OZ3A 4K8HA 1W1PA 1HZYA 1FWCC 1BKSA 3QV8A 2BB0A 1V3LA 3FDKA 2MNRA 2WMGA 5C9XA 1V3IA 1TV5A 4IFOA 3UJ2A 4P8XA 1P1XA 4DYEA 3WDRA 1O5XA 4DUOA 2BODX 4A8NA 1WZMA 4NRSA 3TOYA 1K8YA 3HIJA 3F5LA 4L1WA 2W63A 2WCAA 4PUWA 1PDZA 4TX8A 3TTEA 4HOWA 1D3CA 3ZVHB 5GNYA 4MB5A 1S2TA 3SY5A 1AW5A 1GPFA 3N73A 2QV5A 1XR2A 1W32A 1J79A 4K38A 1TR1A 3VPLA 3GBEA 2VRQA 1L2QA 2HK1A 2O4QA 2IKHA 2YPIA 1UP3A 4AY1A 5I3FA 3HJZA 2G41A 3A4JA 1LRTA 2ZUUA 2Q3OA 3MBFA 1RA0A 1EA0A 3GIYA 3M47A 1UA7A 2R8WA 1GEHA 4AZCB 3T1GA 4X0VA 4GIYA 4Q8NA 1S38A 3S1VA 2NQ9A 1VRXA 2PWHA 4K3ZA 4AC1X 4EAMA 1G7UA 1F3EA 1KFLA 5FEXA 3GLCA 5F1VA 3WBXA 1QUMA 4A8LA 3TN4A 5ENLA 3WFZA 2ATSA 1JQVA 1HW6A 2CETA 3WLQA 2J8GA 3K2GA 2CPUA 2F84A 1IXOA 2XSXA 1EWDA 1PJ9A 5CBJA 3I3EA 4AX7A 4HVXA 2D0FA 5IHRA 3T6CA 2W62A 4DYJA 4PTXA 4ROPA 4H6QA 3CO8A 3TEVA 1A4MA 2DT0A 4US6A 4AIEA 2BVTA 3I4EA 2XISA 4ZBCA 3T8LA 3VU2A 4IQEA 4W9TA 3SEPA 1DJYA 3NXLA 3KLLA 1J93A 2NX9A 4RJEA 1LUCB 1AJ2A 1IEIA 4E8CA 1QPQA 4NSBA 1WZAA 2ZYFA 1VBGA 1J18A 2D2GA 2QCDB 3S6OA 3KVJA 4JIPA 4IFRA 3AI0A 4QS6A 4XD5A 2HVOA 4FNPA 4I5RA 1A5UA 5C55A 4OJYA 3W87A 2YX0A 3SCQA 4I9JA 1W56A 2BV9A 4QG9A 3GE7A 1PS9A 4UOJA 4TUFA 4YYFA 1SJCA 2QCLA 3MBDA 3GR4A 3LBOA 4LY4A 1N2VA 4Q6XA 5FL0A 4Q7IA 1XIFA 2JFEX 3SCWA 2OKOA 4K8EA 3V16A 3VC5A 4A8RA 3RX2A 4MUPA 4JN6A 4GABA 3ZT7A 1KNWA 3ONCA 3TR9A 3W2NA 4QAIA 1PZ3A 3CHCA 2FHBA 4RNJA 1MMFA 4GJJA 4OHQA 1LT7A 5HUOA 4RW3A 1FWAC 4XZIA 3VZZA 1YE6A 4ZQPA 4MWAE 2VI0A 3IS4A 3H2EA 3DFSA 4YJ5A 2W91A 4C6BA 2GLKA 4DJED 3LTYA 5MF5A 2WZMA 4G6CA 4XAPA 2E5BA 3W7RA 3D3FA 2DT2A 2BGNE 2Q3RA 4JAWA 2QZRA 3VIHA 4F66A 3NL6A 3OGRA 1KGXA 3S46A 1A47A 1FCQA 3IK4A 4ML9A 4M6QA 5BCAA 4S3EA 1UWRA 3QTGA 1P6BA 2VUYA 5IDZA 3AIRA 1ZB5A 1ZLPA 1B9ZA 4XZBA 4PSPA 4L9ZA 2GVLA 4OECA 2XUCA 4IGMA 2G50A 1KFEA 5LXXA 4PCNA 1J5TA 1K1DA 4OFCA 4LUIA 4UTTC 4DM1A 1NOFA 1OX4A 4WSKA 1KM6A 5U7SA 1LLWA 2RHGA 4PB3A 3G1RA 3VIGA 1ZJHA 1J0JA 1HG3A 3QH2A 3PWIA 4GYFA 3RM4A 3OTRA 1TTIA 4ZQNA 4A3UA 6ENLA 3BGJA 2JKEA 2WVTA 5I3GA 1DP0A 2VX6A 1EXPA 1W9VA 4S3DA 1PTGA 1M5WA 5I23A 2WNNA 4I7VA 4LX4A 4C7GA 3R1ZA 4WD0A 3GDMA 2EG8A 4UQ9A 1H7XA 2LLEA 4HSOA 3UNDA 2YZRA 4GK8A 2OX1A 2EHHA 3WLMA 1PZ2A 4MNKA 2PLCA 2ZX9A 1EIBA 3T2QA 2F38A 2Z1VA 1U5HA 4QHRA 4BA0A 3T2OA 1EOMA 1CI1A 4ADSA 3APGA 3Q67A 3VKBA 1TE6A 2E67A 5HXMA 1BYAA 3PZUA 1R3YA 3PP7A 1KFBA 1P7TB 4C1LA 3AIEA 4OWGA 1IWAA 1MEIA 3C3NA 4F9JA 4JQAA 5D2TA 1TYGA 1CECA 1J0KA 1DJIA 2Y61A 4NILA 4CQDA 2J62A 3OLEA 1AMKA 1ODZA 5EB8A 3CHDA 2VWTA 4X2RA 5AN7A 3O16A 3AU2A 4G56A 2O9OA 3U5YA 4C6FA 4KT2A 2J7FA 3PJXA 1NU5A 5D9PA 3DFTA 4GYPC 1A0DA 2VCCA 2VM8A 3IEBA 3LQLA 1ITXA 4BQ2A 3MUCA 2E68A 3JZEA 1R3SA 1JZ7A 1Q6FA 1HL2A 3W75A 2J25A 1FHDA 4TOQA 3TNOA 4JR5A 4R88A 1KXQA 3W70A 2VC6A 2X0SA 3QV9A 2Z29A 3W25A 1OEPA 4IG2A 4FLOA 1MW1A 1PCWA 2YBVA 1M1BA 4UQEA 3STPA 4IMFA 2WJEA 1R7OA 3NUKA 3BV4A 3PR2A 3RRXA 4LGXA 1W2PA 4R5EA 4CU7A 2NUWA 5CQ1A 4IF2A 1GJUA 1GW1A 4D2JA 1V0LA 3WQVA 2GK1B 1CNVA 3EOUA 4FOJA 3S5ZA 1UUOA 3G0XA 1RALA 4A05A 3WF1A 4JTFA 2VX4A 1OVDA 2J4GA 1FHUA 3AXIA 5FJPA 1E0WA 4LB3A 2A21A 2J74A 3CC1A 2AQOA 3C8NA 2AMXA 1E73M 1XBYA 3QJAA 2E28A 4UCFA 3R8GA 5KZ6A 1H7RA 1YTDA 1K7XA 4IOTA 2XTKA 1H11A 3L2IA 3IUIA 4GINA 4HCHA 5DN1A 1NOUA 2Z0IA 3GNDA 4G7FA 4ZE5A 1OT1A 4F8XA 1QXLA 5E9XA 5LXEA 3NGJA 3MP3A 3PBUA 3B8DA 3GTIA 3QMTA 3U7VA 1C93A 3W7JA 1XLKA 2GDVA 4GXPA 3MC5A 3ITGA 3CLMA 3L7RA 3N15A 1FWWA 3PC0A 2QDGA 3A3HA 2HROA 1OYBA 1T8XA 3GHTA 4Y9NA 4JHMA 3BK0A 1EGMA 1AZ1A 3SCRA 2V5CA 4Z1DA 1ZQ5A 1U33A 3MUXA 2PTZA 8TIMA 1QI2A 2XFWA 1SPQA 3EX4A 2AGTA 3O0KA 4LYKA 1SQ7A 1SYTA 4Y7EA 3BLLA 3S4TA 1XBZA 1YMYA 1RY8A 1F7BA 1GUVA 4K37A 5FOOA 3HQPA 3BV7A 1TVPA 3G6MA 4ZO6A 4YWIA 5HPOA 2XVGA 1ISVA 5EFDA 1H1NA 1XLMA 5CJ5A 3GX9A 4J1OA 3T08A 4AW7A 3PBVA 5FD0A 1T5AA 1U1HA 2W61A 2GL5A 3H8AA 4L7ZA 4HN4A 3GDTA 1CX9A 3GNRA 2QYGA 1F5ZA 4O1BA 3TJLA 2AKMA 1ADDA 5DMLA 4NP7A 3T07A 2A3LA 2Y24A 3VCCA 2YR1A 2FTWA 4EOUA 5HPCA 1R47A 3UWWA 2XIBA 1OC6A 3NQFA 1Q7QA 1R30A 3MMDA 2PGWA 5DBUA 1K7EA 1YPXA 3TMLA 4MAVA 1L6SA 1GOXA 1VFTA 4MJMA 2I56A 5LYRA 4E4UA 3AO0A 4LAKA 1CLVA 2ZA2A 4NF7A 4I8YA 2PDBA 3S1XA 3PFMA 3ALFA 4AZHA 2RJGA 3IVSA 3UZZA 4ZE4A 1LRQA 2REQB 4F2UA 4DBSA 3LTSA 1Y5XA 1F05A 1HVQA 3STGA 2VEIA 1I75A 4DPPA 3LQGA 4JKKA 4Q22A 3MTWA 3WF0A 4MADA 1X38A 3B8VA 4JD4A 3R8HA 1U30A 4ZA0A 4EPEC 4ZZ9A 3O6YX 3SZ8A 1LDCA 1HGWA 1QDSA 1KRMA 4MKSA 4K7VA 3G1SA 1QI5A 4KGJA 1NY1A 1ZP4A 3F4VA 3EB3A 2PF0A 3JRKA 3S5YA 5AC5A 1NP0A 2L5HA 3KE0A 1FFQA 1Z6KA 4GH3A 4YVPA 1VZWA 4GC4A 3SQLA 4KCTA 1PIFA 1M7XA 4RDVA 5A6MA 1QCWA 1P6WA 3N4AA 2B31A 3E2SA 2X2GA 1EP3A 2GVGA 1TPUA 2E1WA 2G3FA 3O7UA 3WH8A 1XLDA 3M0KA 2JF7A 1CDGA 5E5CA 4JYEA 4BF7A 2OSYA 1P4CA 3CAQA 4R34A 4MB3A 2E6YA 1F07A 3MWCA 1FH7A 3G3MA 4MWAA 5I09A 1E5NA 4O14A 5HNUA 3BMVA 1EBGA 1CGXA 3W07A 3NGFA 4RDYA 5FF2A 5A8GA 2G96A 5AYYA 1PV8A 3AQUA 4M7TA 1LG2A 3GDBA 4TTUA 2ACSA 2YW4A 1DEDA 5HWMA 4DY1A 4ATLA 2E5CA 4JHZA 1I2OA 4UBPC 2FHFA 4H8HA 3ZQ9A 4MGGA 4PN2A 4MY9A 4AD1A 4I9AA 3UJFA 1V0KA 2J8TA 5FJIA 1EJTC 3ARQA 2AL2B 3H12A 1ONRA 2OELA 1AG1O 2PDMA 2NQZA 4A4AA 3D47A 4C5YA 3WF2A 4PL2A 3GNXA 3WJYA 3WD0A 1XLAA 3VOGA 5LGZA 5I77A 1WB0A 3E96A 3BJSA 1GVSA 2NZLA 4QSFA 3PTDA 1MXDA 1QAPA 3NQ7A 4M6UA 3WZ0E 1ONXA 3G22A 2ZX6A 1S2WA 5H8PA 4REQB 2EPOA 5A8NA 3AXMA 1R2SA 4NAFB 3WYZA 2V3GA 3EA1A 5JH1A 3UF9A 1MQRA 4FNUA 3AIQA 3W2KA 4RW5A 3ATYA 3U3HA 3AXKA 1I60A 3PZTA 1S1PA 4IMEA 4B2DD 1LORA 5I07A 4JTCA 4WGHA 2WMIB 1K8CA 3BAJA 4GMEA 5J5DA 4RXGA 3VMOA 9XIMA 3CHFA 1LOLA 1TZZA 2CWXA 1R7AA 4JHOA 1B2YA 6XIMA 3T0AA 3IIOA 5CBBA 3MSYA 3NO1A 1M03A 1NF7A 4M1BA 3C0JA 4QTGA 2YXOA 3T42A 4M7SA 3P8JA 4ERAA 1HX0A 2ZC1A 4XKYA 4O0QA 2XYLA 3SURA 5L9FA 1W5NA 1UBPC 3U6WA 4NL1A 5I03A 2HISA 3PTKA 4HQVA 4H1ZA 3MSDA 1GVOA 5EBAA 5AVNA 3RITA 1NELA 4ZOCA 2EPKX 2C6QA 3AMCA 4H2HA 4PMUA 4EPBC 4W93A 1FUYA 2H8XA 3THAA 3PWGA 3E0FA 3EZ4A 2FFIA 4UTWA 1S2UA 1V3KA 5C7HA 1XYAA 3FA4A 1US2A 1JVNA 3LY0A 3MKVA 1UH4A 3VD9A 3MI3A 1F3WA 3CL6A 3QLLA 1NWUA 2Y5SA 4IMDA 1CPUA 1KQZA 5D9MA 1E6XM 4GI4A 5BZAA 1J12A 1EC8A 2FMNA 1TWSA 1ME7A 2PTXA 5LNVA 3GDKA 3TUUA 1ZALA 1A4LA 4UZUA 3KRZA 3SCUA 4UFMA 4I9MA 5DMMA 3SSJA 1DJQA 2CXGA 4YMZA 1H0IA 3KBJA 5IFPA 1B90A 4YVXA 3EKGA 3FGCA 4B5UA 4IUOA 2CHNA 3KBWA 4KESA 3W1AA 3BAXA 4PC8A 1Q8JA 2XIMA 1XKYA 5AYBA 2IXUA 3BCDA 4GLEA 2TSYA 2DT1A 4LC6A 2A1YA 5BRBA 2QCFA 4XD6A 1TRDA 1RA5A 2WVSA 5AHLA 1TJ1A 4O0ZA 1JDDA 4HU8A 5BWFA 5T26A 3BOFA 4C6MA 1PZ1A 1DPMA 3VUPA 3PTMA 1S5WA 2UV8G 2I1OA 1QI0A 1SSGA 2DU2A 3CUHA 3G1VA 1V03A 4JTEA 2E3ZA 2W4XA 3IUDA 5IM51 2PB1A 1KM2A 2PBOA 4ZSUA 2PWUA 3NQGA 2NSXA 3SADA 2ZA3A 5FJOA 3O6DA 3W1MA 4PMYA 5HJYA 2W5FA 5D2WA 4W8LA 3W1NA 3UWVA 1JZ4A 2BVWA 1I0DA 3L4YA 1GVIA 2RAGA 5CCZA 3A12A 1HTIA 2DQWA 4IIEA 2ZX7A 1JNDA 4LQ1A 2PWGA 3L2LA 1GZ1A 3BDKA 1FHLA 1H49A 4DWDA 3UFYA 5HUPA 2QNEA 5HBFA 4JTAA 2OYKA 1VFFA 3WIJA 3XIMA 4O53A 5KMYA 4IIHA 2UY3A 4B5VA 2XU2A 3WJWA 1H09A 1TVLA 3TTOA 3SRFA 1ADOA 2WC3A 3UPMA 1FWTA 4XTIA 4PUUA 1DV7A 1ZL1A 4CD7A 3NDYA 3GIPA 3VUSA 3S5NA 3BGAA 5CZJA 3TW7A 3ITTA 3LLFA 5D9OA 2YCIX 3CUJA 3TH6A 2EPLX 5KINA 4GQRA 3TXVA 2PE4A 4H3DA 5I02A 4S3CA 2XVPA 3KLKA 3LG3A 5KETA 4O1FA 3N2TA 3LN3A 3TYCA 1TZ7A 1MDRA 1S2CA 3EDKA 1PKLA 3SY8A 1LOSA 4QSHA 3R25A 2VR2A 3TSBA 4DUXA 3AJXA 4S39A 2G97A 2PRHA 2ZKMX 3HG4A 5B7ZA 3FA3A 1FKWA 2YCLA 3KVLA 4D6HA 1WDRA 3BW4A 4JYFA 4DX3A 1A49A 1V7YA 3CWHA 3KXQA 3VX1A 1E0TA 4AFYA 3R58A 1H1ZA 2PLKA 3CZ8A 2Z24A 2BDQA 2X7VA 5HQMA 4Z1CA 1Q2RA 4WLCA 4AVFA 3DH7A 4JN7A 1P0BA 3MSGA 1R85A 4FALA 5I3KA 3TV8A 4IIGA 3W2LA 1YIXA 4PFHA 2C0HA 5T91A 1EF2A 1NQKA 3BOLA 4GNJA 1TIMA 1FP9A 1XYBA 1KTNA 1UR4A 8XIAA 2ALRA 3G8RA 3A64A 1DJHA 2Z4GA 1RLCL 3BL3A 4NAEA 2CBUA 3QM3A 2EO7A 1PCKA 2CLFA 3NQ2A 4M6PA 1SJAA 4IPIA 2R1MA 3TQPA 2CYGA 3M0XA 3C0LA 4GACA 4XKMA 1NSJA 2GFTA 4Q8UA 5KTLA 3QXBA 1LBLA 2VDGA 2X41A 2V5JA 4KERA 1CTNA 5G1MA 1F8MA 3RR1A 1XLCA 1Z41A 4DUWA 3QPYA 1QWKA 2OEMA 2WMJA 3EX1A 5T8GA 1OGSA 1QJWA 5DLCA 4Z0SA 1OGBA 1ISYA 2XZ9A 3U4FA 3DFNA 3FYPA 2ONEA 7REQA 3HFTA 4A2RA 1E15A 3MVIA 5EMKA 1W37A 4AZIA 1IR1A 1E4IA 3EMZA 1UKQA 4FPSA 2D3LA 2FJKA 4LB4A 2DIEA 1GT8A 5H1WA 4C7DA 4Q7BA 3EWWA 2P5NA 4DZHA 2ZRUA 4AIOA 5L6UA 2DZWA 3L4WA 1HJUA 2VCAA 5IBXC 4Q33A 1ZTVA 4QISA 4UFJA 3LU2A 4LBSA 4C90A 5H8UA 3SCNA 3FJNA 3N1AA 2W3ZA 4GZEA 1XDJA 1SZNA 5CC5A 3P8IA 1R0MA 3KAOA 3M5VA 4KPLA 3GR7A 1TX2A 4GKLA 4N9CA 2NXGA 1SZGA 2C3ZA 4TX6A 5I78A 5M5DA 3S9YA 1CCWB 4ZOEA 2VZSA 2RDXA 1WYIA 3FW6A 3N6HA 1XYFA 4FNRA 4URIA 1DOSA 5EMYA 1NDWA 4U2ZA 3VE7A 2FGLA 2YL8A 1SR0A 4K7YA 4H8VA 2F6XA 4K36A 3G6LA 3CJPA 3PWAA 1EJVC 2VC9A 3NQDA 1IEWA 2PP1A 1P5BA 3VOIA 5A69A 1TMHA 1HNYA 4PA8A 1IV8A 1A3XA 3LSCA 4YHEA 3AMKA 2JGQA 3SGZA 1TELA 1PWLA 3F4WA 3SO7A 4JEQA 1KBLA 4JGDA 4XX6A 3UXKA 7ENLA 4N0RA 4KBXA 3RO6A 4L6OA 2KAUC 1GEQA 1QPRA 3Q4DA 3UR5A 5AFDA 3UPWA 2WYSA 4IJBA 1EP1A 3ABXA 4XZMX 1JAKA 5DT7A 4RPQA 1BGGA 2IKGA 2ZBTA 5DX7A 4ZXOA 4HA4A 1KQYA 3P6LA 3FAXA 1EZ2A 4XK2A 1OD0A 2XN0A 3KL3A 1UWTA 3FYYA 2G3NA 2NWSA 3BLIA 1BTCA 3KM8A 4IFKB 1U5JA 2PGRA 1DIOA 4DVOA 4PUEA 3A23A 1XWYA 1CLKA 3AALA 2NVDA 4HT3A 2B7OA 4UQDA 3WUGA 5CSUA 4QE5A 1BHGA 4F2BA 3E0WA 1CGTA 4CVWA 1C90A 1VCGA 2PDCA 4JDYA 5BWAA 3P14A 3LCFA 4LH8A 1V08A 4WF7A 2CLIA 3ZXWA 3Q58A 4MZ1A 4QEHA 2YA1A 4FAMA 3G2GA 1WDWA 3JS3A 4DAIA 1X6UA 2P76A 5K4ZA 3BQ5A 1IZKA 4U3CA 3NM3A 2WWDA 3LLDA 1EX1A 5K9DA 3G24A 1OX4B 1NFBA 1K9EA 3QQ1A 4HMEA 1KWKA 2ZRXA 4O19A 3DX5A 4PRWA 3DGBA 3G1FA 4RZ6A 3WX7A 3EWBX 3OIXA 4M5PA 2EXOA 3GS6A 3WL0A 4LU0A 4AF0B 4MJZA 1RJRA 5AVHA 4HNOA 3W6LA 2VZVA 5EFFA 1TA3B 1G6CA 4FHAA 3ZLFA 3UXAA 3LHVA 3MHFA 4JTTA 1ME8A 4JS3A 1B3OA 4ZFMA 1RBLA 3TQKA 3TFXA 3BSGA 1Q8AA 3GBDA 3W7NA 1OC5A 5XIMA 4C6EA 4M0XA 2CZ5A 2QJIA 3OZYA 5DY3A 5G2IA 2ZUVA 3N3MA 3LHZA 4WEVX 2QJMA 3NFUA 3RM8A 4EANA 1QK2A 3M4HA 1EXBA 1XINA 3N04A 3A3WA 4KEMA 3T40A 5C8BB 1OABA 2C91A 4Q4SA 4MG4A 5KZMA 3PAOA 1VKFA 5CPTA 3VNIA 4JDBA 1G4TA 5H6HA 4UTHA 2OSXA 1JDCA 3BH4A 3CTLA 3PSVA 1W1YA 1XIHA 3WQWA 3UZWA 1US3A 3OGSA 3R11A 5DBTA 2OT0A 3W83A 1TPEA 2GJXB 2RUSA 2YIHA 4RV8A 2JK2A 5EKYA 1AD1A 4P2VA 1IEXA 4JTUA 2FVKA 4PZVA 4KFNA 2DZSA 3OEXA 4MY1A 2POTA 3L0KA 2IMRA 3ANVA 2Y7EA 1XD0A 4XO6A 3WQEA 3MYOA 1WNOA 3LMYA 3B0UX 2OJPA 1E40A 3HG5A 4BJHA 2B7PA 3T44A 5CAHA 2ZWYA 3L2MA 5AHFA 5H91A 4AH7A 5A95A 5AYZA 2V38A 1TZ9A 3ZYZA 1XFCA 1FWNA 1EYWA 3EMCA 2INEA 1JQXA 2PPGA 3H2AA 5ABHA 1UA3A 3WLRA 4FX6M 4LUJA 3QW4B 2PUZA 3TCEA 4W5ZA 3QY7A 4NNBA 4PRRA 4AU0A 4RE0A 4GXWA 3BG5A 2G5WA 3BTNA 3M7SA 4QJ5B 2HNEA 1UWIA 3AJ7A 5E93A 3KHJA 5CPOA 1FXPA 3ZJ6A 2E9LA 1E72M 4IL2A 2CXEA 4AHOA 3CZKA 2ALDA 4HZ6A 2DZAA 2D22A 2YOCA 1E9LA 4I7UA 1JCNA 3K4WA 5EA9A 1WP6A 3VKDA 4M56A 1OSEA 3C61A 2CKSA 4NHVA 1X97A 3UGRA 4QDWA 3S47A 3RMEA 3WY1A 1WV2A 2DZPA 1MZRA 3BLDA 2V8ZA 2DUZA 4KMQA 4O1AA 3SJNA 2X1SA 4C6PA 3TCSA 4DZAA 3GZ3A 3LI0A 4M81A 1C92A 1F3XA 3AMDA 3C5QA 3NZQA 3L4UA 1JCJA 1VPYA 4ECLA 2V5DA 1V6UA 1OQFA 3W23A 3LV5A 1ZU8A 4MKVA 3BLKA 1GOIA 3ARVA 2PDQA 3WN6A 1TPWA 1U1UA 5A8OA 2FJUB 2VDIA 3UW6A 3INPA 1H1YA 3B4UA 1EEXA 1A80A 2PDXA 2V3FA 4QJ1A 4YTQA 5FEZA 3ZR4A 1VIWA 3CL8A 4S3BA 3RNDA 1JUKA 2DV0A 3QV6A 4ZCWA 3FX4A 1J6PA 1P0DA 1CT5A 1GG0A 4IUGA 1TV3A 2GGJA 4JOMA 3OO2A 3LK6A 3N9SA 3OZOA 3P60A 3FK4A 3GXDA 4L80A 3TTYA 5D37A 2DUXA 5I3DA 4OQVA 5BXRA 3IRSA 3VDBA 2Z7GA 2DVUA 1UZ4A 4DWSA 1REQB 3RRAA 1UR3M 3AUJA 2GDUA 1EUNA 4Z1AA 1H62A 3NO3A 5DEZA 2E6DA 3EMQA 2VVNA 1UWAA 3S2CA 4HNCA 4HZMA 3UY8A 2CERA 5HMDA 3CLWA 4NQ1A 1Y5WA 3BLEA 3UNTA 2V5BA 3MI6A 3R0KA 1SW3A 4Y9AA 1ZY9A 3V5OA 3IAPA 5HANA 1KM1A 3FHAA 3EOLA 2FTYA 2CHRA 3A47A 1LT8A 1WZKA 2J9YA 2R1NA 3BARA 3MMTA 4YYCA 5J8LA 2V81A 4ALDA 4S38A 4W86A 2VURA 4W84A 3ITYA 4UR7A 1M7PA 1LBMA 2JQXA 2P8BA 4AWEA 3N9KA 5KEZA 1PPIA 5C6MA 4RNHA 3LCIA 4RCXA 5BU6A 3K8MA 4BI7A 3HOJA 1OCNA 1VYSX 3CASA 4LNCA 3RK8A 3KUMA 2HTMA 4AX6A 3AXXA 1HJVA 2X0YA 4GA8A 2ISWA 1FQ0A 5DCBA 4CCDA 5GNZA 2ZADA 4PL1A 2TRSA 3UD6A 4WSHA 4PCFA 8XIMA 3B0XA 4Z1YA 4HHPA 1Z8AA 1E3ZA 4LCQA 4JQ2A 2INFA 3HG3A 5DELA 3A13A 1VFHA 3IJIA 1FDYA 3CZEA 5D4YA 4EF8A 4F9DA 1TREA 5E70A 3A5FA 2Q8LA 2OKTA 4CD5A 1EB3A 4PTDA 1YPFA 3MUIA 2XH7A 4K39A 3QN3A 3W22A 1WXJA 3K1GA 3ZVIA 3DCPA 3KP1A 2DSUA 2NLYA 3IJLA 1XIIA 3C6CA 1KGUA 3VX0A 3W74A 2OZ8A 2OQYA 1V3MA 3UY7A 3QV7A 5AHNA 3JUGA 2VHLA 1W0MA 4M3PA 5LIWX 2MUCA 1I6NA 5FF4A 2Y8VA 4W7VA 1DXFA 3MYPA 3LB0A 3QZAA 3H26A 3AISA 3PNZA 3OYXA 1KWGA 3GRIA 3TA6A 5D32A 4Q8MA 5GPRA 5EU9A 5C7VA 1Q6QA 1B54A 4O1EA 2VEMA 1GOWA 1EDQA 3GVVA 4H4IA 2FZMA 3VNYA 4WJXA 4JIEA 2X1TA 4O8AA 1ZRQA 3LS9A 3A21A 2TODA 2FH8A 5HAOA 5JVLA 1UWQA 3FJLA 1S5VA 4LTSA 2V68A 1XRVA 2IPFA 2OZTA 1LQAA 3PTQA 4OV9A 4MKNA 3PUGA 3BSHA 4FMVA 2Y7FA 4FF7A 4JY9A 3FSTA 3BJTA 1L6FA 4IQJA 2B81A 3TWBA 4GFIA 4W5UA 1YDVA 4U5KA 3C2EA 3F5JA 4KFPA 3KBSA 3EWZA 2JIEA 3GKFA 4GPNA 4IGNA 3QZ6A 2NQHA 5FJUA 3HPAA 2VEFA 1PBGA 3QF0A 3V3WA 2F61A 4US5D 3TC7A 4LCSA 1EFZA 1I2QA 3W3OA 3H2NA 2WOQA 4C1NA 4D6GA 1PUDA 1UWSA 4CEUC 1V79A 2V0TA 2XG9A 1QHOA 3WBEA 2NVCA 5CLWA 1LL7A 3AIUA 3RDKA 4Z2KA 1NDVA 2B7NA 3PY2A 4GY1A 2B7QA 4ZB0A 4QLJA 5CGQA 1VRDA 4CQCA 1JYXA 3ME3A 4HK7A 1XIBA 2IQ0A 3N13A 2EBNA 1H5VA 5E9AA 1UJQA 4UFIA 4AY8A 3WUBA 1TJ2A 3QVQA 1JG9A 4AG0A 1OM0A 4K6AA 3GXTA 2HBXA 3GYEA 1F8IA 1RP9A 3H53A 3M1ZA 5LIXX 4O4WA 3I7RA 4PULA 2GWGA 3TAOA 4MB4A 5K9XA 3WEOA 1B31A 1BF2A 3MV01 2A2IA 1WKFA 5CJMA 3WMCA 4CN1A 4EPKA 3UG8A 1MQQA 4FX8A 2FZBA 1KCKA 1UH2A 3SSZA 2A5HA 2C71A 3C2YA 4PUNA 1X6LA 2DSZA 1D8CA 2QCHA 2PDWA 5FACA 3CIXA 3CT2A 3CWOX 3FYOA 2XM2A 3NQBA 3UZXA 2GSHA 3VKAA 2VD9A 3WEMA 1S46A 1YNPA 1UROA 5PTDA 3M0YA 4ZEPA 4PTNA 3SDOA 4S3JA 4M51A 1DJXA 1JYNA 2CITA 3BQ6A 1LOQA 4LY8A 3FGCB 1QNRA 3P3BA 5E1QA 1D9EA 3TR2A 1F9CA 1I8JA 1E4NA 1XLLA 1EJUC 4OBSA 3BG3A 1DVJA 1V02E 3EDFA 3IJ8A 2AGKA 3OVQA 3KFTA 2A6NA 5I00A 4OUEA 3A4AA 4NJJA 1RCXB 3DU0A 4RXFA 2I5QA 1GKRA 4XVEA 4PYSA 2XGIA 4X0NA 1EUAA 4NUWA 5BMWA 3RN6A 2HNHA 4H04A 1O12A 1QATA 1N8WA 3RX3A 2W27A 5CLTA 4GZ7A 2VMFA 1EP2A 4DO7A 2JEQA 2PP3A 1LF1A 4PB4A 1QR7A 2UY2A 1SJBA 4P8UA 3VGBA 4GRSA 5DCDA 1NF0A 2HVMA 4AY7A 5REQA 4LUSA 2ODOA 5BOEA 2O9RA 1IGWA 3V5FA 1TPFA 3HPXA 4TR9A 1Q85A 4E2BA 4FA3A 3T4WA 1GYMA 3KL0A 3LBMA 4LAUA 4B15A 3C2OA 1XFBA 2QPSA 2QDHA 3S9ZA 4V33A 3OBEA 2GJRA 3QQWA 3KRUA 1T96A 2QS8A 3EA3A 3IVUA 3S1UA 1K70A 2IXVA 3HZ3A 1OFPA 3M6YA 3DHUA 4LF1A 1EPXA 1E9ZB 3E12A 3N4FA 2AL1A 1UB3A 5FJJA 3AHZA 1YRRA 2HRWA 1R9YA 2J7CA 3IV8A 4FOUA 3C86A 5ABGA 3RXZA 3PZOA 3N25A 3UR7A 5HQEA 1W1A1 1A0EA 3WLOA 1JZ6A 4FXJA 1RZMA 4FLSA 1GWJA 2WJZA 3P61A 2ISFA 4IPPA 1MO0A 2OLHA 4DF2A 4H83A 4MJ4A 3SBFA 3EYPA 1MEWA 2CLEA 1HUVA 4Y9OA 2VFIA 1Y5VA 1NAL1 1YBQA 4YXGA 5E0CA 4EXBA 2VZOA 3OLGA 1K6AA 2XIJA 1E6ZA 4J5NA 4EWJA 4HD5A 4E8GA 3OZPA 3W29A 4IXXA 1H7PA 4HA0A 4LYQA 4B5XA 4O1CA 3LHTA 7XIMA 3MQTA 3URBA 3SJ3A 2GJNA 3POHA 3W73A 4AISA 3K46A 1U5VA 4AXNA 4H7ZA 3IK2A 5JBFA 3R13A 4BQ3A 4PBGA 3ARSA 1XGEA 4H9UA 4JIIX 1LWIA 4DHGA 3IVTA 1JCTA 4FNTA 1A0CA 1OCBA 2E6AA 2OB3A 5I7GA 2QVNA 5EMJA 4MYXA 4P7NA 1LQ2A 2CLOA 1C29A 1FP8A 2TPSA 3KCLA 2CZDA 4ORMA 3QOMA 3NSNA 3CM4A 1CWYA 5HULA 3W02A 1A5KC 3PPCA 1TTQA 5E0FA 4QG8A 3NOYA 3GU2A 2WHJA 3LPGA 3VNDA 3OVPA 3CUZA 4LAOA 2PEVA 3VABA 4X9SA 1F2JA 1QNQA 1KRBC 1GPWA 3UXIA 2BXZA 4D6JA 1MXGA 2PWVA 5TAOA 1KM4A 1SM9A 2CLKA 2W9MA 1AL8A 1MDLA 1TCMA 1YW1A 3LRKA 3MV11 1ZS2A 2V67A 2W79A 3KZSA 5CZSA 3CZGA 2QUTA 5AYXA 4NI8A 2BXVA 4YTUA 5BXTA 2Z1XA 4EK7A 2GWNA 2WO5A 1NWRA 3W85A 2YDSA 2J88A 5K3VA 4GUGA 3SY1A 1QVBA 3EAUA 3PZVA 3TE9A 1PDYA 2W0UA 1I0BA 3NVDA 3MP5A 3OBAA 3XISA 2WHMA 2JEPA 4XAZA 1ZAJA 4NJIA 3MCOA 3GC4A 4EE9A 4RR4A 5DMNA 2J27A 4NZFA 1UMLA 3OOQA 4XBKA 4IWWA 1IEQA 2ZDSA 2I57A 4E4PA 4LYPA 5I2UA 3EGJA 3QKEA 4E8DA 1LL6A 2Y5JA 4G1KA 4J3WA 2C0AA 2E6FA 3STFA 1WZLA 1A50A 4RZ5A 1BLIA 1ODUA 5IXEA 3TAKA 4JKLA 1XF0A 1VFOA 4TU1A 1DIEA 4LWWA 3PB0A 1XSJA 4UMAA 4XSLA 1MUCA 1J9YA 3DKJA 3KS6A 3NQVA 5BOFA 1WDSA 3R2GA 4ZO9A 2WXDM 4Q4PA 3BO9A 2PTWA 3OBKA 1J0YA 1O68A 4CNOA 3P7YA 2ZOXA 3RAOA 1K8ZA 1PKNA 4FP1A 4ZSTA 3PBGA 3EA2A 3PBMA 4QGCA 5GJPA 1W1ZA 2BMBA 3G5EA 4P7LA 3DENA 4HGXA 1BXCA 4CQ8A 3V0SA 3NEVA 4DQWA 3H55A 1FVPA 4LFYA 4P5UA 3T7VA 1KKRA 2WM1A 4DO4A 2ZRWA 3U48A 1IYXA 2Y89A 3GIQA 1XYMA 1YHTA 3V0TA 3VE9A 4IMGA 2VTFA 2QCNA 1V6XA 3EPMA 2FH6A 2TMDA 1UOKA 2PDPA 3GXMA 3H4XA 1Y0EA 1AH4A 2PWEA 3MDWA 3NYDA 3W81A 1Z32X 1W3HA 4I7WA 4LANA 1J4EA 1C8XA 1Y65A 4W85A 1S1RA 1LG1A 3GH7A 1CGYA 4Q3MA 4PUMA 4EF9A 3VKJA 2Z6JA 4G2DA 3NQ8A 4W8AA 1WDQA 3U7BA 4DBEA 3AZTA 1FX6A 1Z89A 1F4HA 1QHZA 3W1TA 1JPDX 2PZ0A 2CLHA 4RZ4A 2XFFA 4BWLA 2YLLA 1K03A 3ZJ8A 4JTDA 2X1UA 1J01A 2PA6A 1TO3A 1HL9A 4IM4A 1VHCA 2XIIA 4LUYA 4ORIA 2GVJA 4C6KA 3Q65A 1PHQA 1TQXA 4EACA 3LHUA 1VFUA 1RJQA 1S5NA 2JE8A 3BE7A 3RPTA 3NL3A 3WDPP 1Z3NA 4E5TA 3VO0A 1NFGA 2PDIA 2VENA 3VAVA 1UKSA 1YE4A 5A6LA 4O18A 4JNMA 3OG2A 2I14A 1ISWA 3AXHA 3W24A 5A6JA 3O0FA 3WQ5A 4ADTA 1OK6A 3TSDA 2XVLA 1XISA 2FGBA 4DELA 1CW2A 2WLYA 5AHEA 5JIWA 1XLGA 2P50A 5AY7A 3G1AA 1OFQA 3VGEA 3KBMA 1L8NA 1J0ZA 4C6CA 3QSRA 3RU8X 1WAWA 2IW0A 3N14A 3SN0A 1W5OA 2Q02A 4OUIA 1XH2A 1RP8A 3VOJA 4E3VA 1SU5A 3BICA 5LIUX 4PMNA 2PI6A 3VINA 2O55A 4AEFA 2YLAA 1QNPA 5TNVA 1VF8A 4JIRA 5CC7A 3IWPA 1I4NA 4WJ8A 1J0IA 3F03K 5I79A 4F0RA 4ZODA 3NA8A 5U4NA 3WQFA 1V02A 1KTBA 2YZ5A 4ZMGA 1HKJA 4IH3A 4R85A 3VK5A 7ODCA 4DO5A 4KCVA 4DWSC 3PZMA 3TOPA 4XSMA 1GOOA 5AYIA 2J47A 4O1DA 2Y8KA 1A3WA 4LAMA 4N42A 3SR7A 1KRAC 3PANA 4L6DA 4GYJA 2VC7A 2VX5A 4LVGA 3ABSA 3WLPA 4JFVA 3WCZA 1W3LA 3N29A 5A2BA 5DMYA 4Z42C 1SO6A 1H3GA 3QBUA 1M7JA 4U2YA 3WBWA 3WQCA 3SCSA 1HP4A 1XIMA 4X22A 4MJ2A 3I3DA 1OF8A 5C2CA 3EWDA 4WDXA 3U4AA 4MIMA 3UJRA 3ZO9A 4TV5A 1HF6A 2D1ZA 1AQ0A 1Z48A 4IP7A 2NW0A 1J2BA 2Z25A 2HEJA 3S6DA 4JN8A 1WPCA 3R5EA 4GNKB 3SUVA 4M80A 1UD4A 3SFKA 2YW3A 5ABTA 3P5YA 1RJPA 3L0GA 2WMFA 1UKTA 3LLXA 2CHOA 1XI3A 3W7KA 1FFRA 3HB9A 3ORWA 2EGZA 3ZVHA 3W7MA 1OFRA 3WFLA 4V2XA 3TVAA 1W1TA 2B4GA 2HBVA 3C52A 2ZZ1A 1V7AA 3BGGA 3W7CA 3DBNA 4I6KA 4JTHA 4S3GA 1OGGA 5HMEA 1UC5A 1G5AA 4O4VA 1X1NA 1FWJC 1SFSA 2WMHA 4AZCA 5DRIA 4AHQA 4OBRA 1DTNA 1HVXA 1GYNA 2PAJA 3NOEA 4HSHA 4RZBA 4ATWA 4Y9PA 1BYDA 3SGGA 4ZVJA 4B3KA 5IHSA 2A7NA 2AAMA 1AD4A 1VPXA 3GXPA 1M01A 2V30A 3ABZA 1UC4A 1YDOA 3CUIA 2VGGA 4DRSA 2XGZA 4MHBA 4GZJA 4GISA 1GONA 3ARPA 1L6WA 1O5QA 5DXXA 3O05A 3CYJA 3G77A 1ITCA 3N4EA 1BWKA 4PMXA 3WQ4A 2CWNA 1EZWA 1U83A 1LUCA 4X9YA 4E2OA 3OIHA 4MWAD 1AJ0A 3UWYA 5EMMA 3JVAA 2YFNA 3MA8A 3SECA 4P7OA 2GUYA 1H7NA 2ZZ2A 4MLJA 2Q8XA 3L4ZA 1CEOA 1GVFA 4ZTYA 2QCDA 1EQCA 4JIQA 4IPNB 3TU9A 3VI2A 4JNYA 4WXZA 1Y8BA 3DI1A 2OODA 4HN8A 4O12A 4UTJA 3B9OA 4N6FA 1I2PA 1V0NA 2PU0A 3ANUA 1E1EA 3O8AA 2D23A 3MO7A 4LSBA 2HXTA 2XWEA 4IMAA 4WQ6A 4D6EA 1RUSA 2PP0A 1TJ0A 3OG3A 3NZRA 4U10A 5D38A 4Q8QA 1RQHA 1UH3A 1L8PA 5EPDA 2CC0A 3E0VA 8A3HA 1M68A 1Z44A 5BRPA 1SW0A 1HL8A 4WKHA 4AEOA 2VEPA 4QLKA 3VCRA 1R3RA 3R0UA 4FB7A 2PDYA 2VRKA 1NP2A 4MSSA 1WOBA 5C54A 1OCQA 3I10A 3PN8A 3UG4A 1BVNP 1X98A 1HN1A 1HKMA 5CPLA 4O28A 2X16A 2WNWA 1UD3A 4NJGA 3M5YA 4XAGA 3R12A 2O0TA 3EKZA 3T05A 3ZLGA 1TV2A 4MF4A 2ZXAA 4PTWA 3GHRA 1PIIA 3ZS4A 1IZCA 4G8TA 2UY5A 4TIMA 1B57A 3S9IA 4Y8EA 3SIZA 3GXFA 5DCEA 3GR8A 1UHVA 2PCEA 4JX5A 4C6OA 2DW6A 4D6IA 4LEFA 4J27A 4YCPA 4PCTA 2DZVA 4FXRA 3BAKA 3TTSA 2DSWA 4WOZA 3AWNA 4DBWA 4S3KA 1YEYA 4CNTA 3OP2A 3EWUA 2VO5A 4JTSA 1BWVA 3EWYA 2OPJA 2HZGA 3WLLA 1E5JA 3THCA 3QC3A 1QBAA 6XIAA 1I1WA 3KTXA 3RUBL 1AFSA 2XSAA 3DG7A 1LJYA 3CH9A 3JR2A 2J77A 3W7OA 4W88A 2A79A 2J7BA 4ZTXA 1TPB1 2Y85A 4H9MA 1YPIA 3M0MA 2XN2A 1JCYA 2YCEA 2FKPA 1BFNA 3M07A 3SRKA 5EGRA 3FJ6A 3NAVA 3LDVA 3GAYA 3BG9A 4RDWA 2A3HA 4MZYA 3EXRA 6REQB 2ACRA 4B16A 1CGUA 3QOKA 4L4OA 3W28A 4GBDA 5T9CE 1OYAA 1RPKA 4IIFA 1XGZA 3VIOA 2C18A 3WMLA 2OYLA 4C6DA 2BOGX 4HBKA 5E09A 3NURA 1NEYA 1DBTA 5ABFB 2GSEA 1R5YA 5FF3A 4CNPA 3E2VA 4P7QA 3AUOA 2CLPA 1P7TA 4M19A 4E2DA 2XSBA 1Q2SA 3LNPA 2YL6A 3RYSA 1LROA 3W72A 2XGBA 3W6YA 1FWFC 3DC8A 4S2CA 1HQTA 3BMWA 3AS0A 2WPBA 4R53A 1UIOA 3A9BA 3NNTA 5BXSA 2IQTA 2QCCA 1JD7A 5JXQA 2O7SA 2Z7KA 3II1A 2GPTA 3GZAA 3HPFA 4UMBA 5I24A 3CIVA 5RUBA 1QNVA 2BY1A 1IZJA 2EQDA 1RCOB 2RH9A 1E1CB 5D04C 3EPOA 2ZVRA 2VFHA 1QO5A 3H2OA 2G37A 5EY5A 2INZA 3R8RA 4NJHA 3THUA 5MKGA 3MHUA 3PBYA 3RX4A 1NH6A 2PDNA 3TYDA 1JF6A 1SZEA 1MEHA 4XISA 3QHNA 3KCJA 4CEXC 2OLAA 3BUVA 4R9OA 4DF0A 2WWCA 2QCEA 3EX3A 3AOFA 4H8UA 4EWND 3WLKX 4L65A 3B8WA 1ZUAX 3W88A 3F2DA 4IX2A 3B03A 1UASA 2YYTA 3MKKA 1XH0A 3GH4A 1XRTA 2O92A 4F3HA 2FIQA 4B5TA 3DECA 2GJLA 2DY3A 4Z2IA 4AD4A 3W1RA 2BY3A 5IBXA 2VCBA 1JYWA 2E25A 4FR6A 3TWAA 1GVEA 3G1XA 3DKLA 3DDMA 3TK7A 4BI5A 3A22A 3ZLHA 5FA5A 2VFDA 1G69A 1DL3A 4GCAA 1P0NA 3K4AA 1I45A 1GKQA 2PGEA 3L12A 3OQ8A 1UD2A 3LCLA 4ZFCA 3E5BA 3OODA 4G7EB 2ESCA 2V2DA 1IT0A 1V8EA 4KW2A 2Y2WA 3D3AA 4ZQOA 2J7GA 2RDWA 3BZJA 3QC0A 2C1HA 3VZXA 3F2BA 3IGUA 2C16A 2V3DA 2E8YA 2PMQA 1ZJAA 1W3JA 1UCWA 4RK8A 5BW6A 1JYVA 2EPMX 2ZVIA 3CMGA 3NZ1A 3N19B 5F4SA 3SB0A 2CEQA 3V75A 1FXQA 3BOXA 4N4PA 1CB2A 1IXQA 1XUUA 3PPHA 2QPUA 3BLPX 2H6RA 4B5WA 2OFJA 3S8HA 1H61A 3TTQA 4LUTA 2Y7DA 4P8VA 4G1NA 4UOZA 4BF9A 2G4JA 6ALDA 3D6NA 1ESWA 3RFAA 4UTMA 2R1PA 1ME9A 3LEPA 1EGVA 3C8FA 5D2XA 4BR1A 1N8IA 4UFKA 3WD1A 1YTEA 3TN5A 4QP0A 1KM0A 2E8ZA 3TFCA 3S2MA 4CD6A 9RUBA 4F0KA 2WVUA 3QKZA 2VR4A 1HGYA 3P82A 4NXSA 4O10A 1BRLB 4J2PA 4XUGA 1Q66A 4IZGA 1CENA 1IEVA 1KFJA 2QHAA 4NI3A 1OADA 3R6IA 4W4QA 3GXIA 3V35A 2OG9A 2Q6ZA 4A29A 3BW3A 4YTTA 1R86A 4MAZA 4NZ4A 2RKXA 1D8WA 2X7WA 3B9EA 4YNGA 3TDFA 4FO4A 4FXSA 3OB8A 4GQBA 1ZPTA 4JXCA 2J9ZA 4I9TA 1PVNA 3G8EA 3W00A 1DORA 3A4WA 2I7GA 4PMQA 4V1XA 3MJMA 3GNNA 4UWMA 3O6CA 2HJPA 1FWBC 1KC7A 5DXYA 1MW3A 4R7WA 1XBXA 2Z27A 3VFLA 2H3BA 5EBUA 4I5XA 1JUEA 4PEEA 5KSWA 4L9XA 5A6BA 1CXKA 1VFLA 3GDRA 3QZEA 5CEWA 2NUYA 4WDUA 3W1UA 4L56A 1HJWA 1VC4A 2G95A 3R7MA 3QFEA 3QR1A 1VJIA 4YVVA 3GKAA 2GYIA 2REQA 2ZE3A 3DFQA 4KFOA 3FXYA 3MDUA 1S39A 2YBUA 3W27A 1PZ0A 4JFUA 3AS3A 1UYQA 4AAJA 1WX0A 1M41A 4HU4A 5GNXA 5LNUA 1IT8A 1PYFA 3B97A 3LZ5A 1OF6A 2P53A 4E4FA 2YSWA 1W8SA 1D7FA 1I1XA 5EL1A 2PBGA 1YTKA 3V1PA 2VX7A 2OU4A 3AU6A 1JULA 3PJUA 4WXYA 2OQLA 2QUMA 4O13A 4F0SA 1EJXC 1XDMA 2Y88A 4GKTA 1EC7A 1N7KA 4GUFA 4DAFA 3TQ0A 2QGYA 2YFOA 5F4XA 3LYEA 1M7OA 1EO5A 1PYMA 3HG2A 3N2CA 5BOOA 3GTHA 3TNBA 1F6KA 5DY2A 1R9ZA 2QF7A 3BCFA 4MNLA 2WQPA 2ZZ6A 1RAKA 3LRLA 4N9EA 4AB4A 2C7FA 5EMUA 4NZJA 3SRHA 4XBSA 3MMUA 5FEPA 4KEVA 2Z00A 3AS1A 3V36A 1MNZA 3KRSA 3B9DA 2CNCA 3KRBA 1JI2A 3SAZA 1V0MA 1IXPA 3S1GA 3T0DA 4I6VA 1B3YA 4AZ6A 2FDMA 1UD6A 4FI4A 1KM5A 3OZMA 4BWLC 1CLXA 1YBQB 4UQCA 2E9MA 1IGSA 3WNKA 1B3ZA 2DH2A 4WHBA 3RLGA 1WA3A 3S2JA 4HK5A 2VDHA 4ZL1A 3B05A 4K1WA 2PGFA 1BQGA 3KX6A 4ROQA 1Q6LA 3CO4A 2D69A 2F9RA 1AQMA 1OX5A 1RSCA 4W7UA 1XJBA 3CAKA 4P7RA 5CJNA 3GNOA 3H2CA 4QNEA 2EPNA 2AL2A 2Z2BA 4CNNA 1KD0A 3G18A 5I5RA 5B7YA 4B92A 1EEPA 1OFDA 2ZWZA 3KDNA 3MJYA 2I9UA 2Y7GA 1K9DA 1RBAA 4KRZA 4KRTA 4AMAA 1WCGA 3LGGA 5F4WA 1J11A 1RK6A 2CZVA 3VDHA 4KEZA 1H51A 3BANA 4GVGA 2PDUA 4CNUA 4HCDA 8CGTA 1L2UA 1SSDA 3RCMA 5D9NA 4FNSA 1XC4A 5LKYA 4Y9MA 3I6RA 1SFLA 2FZ9A 4GGHA 3KBVA 2WM0A 1KBBA 4NAFA 2FFCA 1IWPA 1WKEA 4JNZA 4C91A 4GVIA 2XFYA 4AMCA 2ACUA 4IX0A 3TJ4A 3QHOA 4JTQA 4WJEA 1EL3A 4GO8A 4D6FA 1BKHA 1XS2A 4DI8A 4JY8A 3VNLA 3MCNA 3DFHA 3VFCA 3VDCA 2E1DA 4CGTA 2WMIA 4Q4MA 3E6EA 1NQ6A 3IJ9A 3NQ6A 5C70A 1TWDA 3VOCA 1TJPA 2VZTA 5AHMA 3S42A 1QI4A 1A3HA 1W9XA 4DUVA 5M1TA 3TW9A 3WLTA 3UXLA 5H8MA 3KTSA 1BD0A 3EEZA 3RLUA 4H7VA 3VMPA 3WLSA 5AC7A 1TWWA 5FEWA 2XJ7A 4O0KA 5CGTA 2ZUMA 5GJNA 3AIBA 3PSWA 3K30A 1CXHA 4D6DA 1J2WA 2OQHA 4DJFA