2V3GA

Structure of a family 26 lichenase in complex with noeuromycin
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
273
structure length
273
Chain Sequence
GLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSWGSQWQSFDQVFSRAYQALASINKPIIIAEFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-Glucosylated Derivatives of Isofagomine and Noeuromycin and Their Potential as Inhibitors of Beta-Glycoside Hydrolases
rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE H
total genus 110
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2v3gA00
2WXDM 4NZCA 1HNYA 1KQZA 5A8QA 2ZUTA 3AS0A 4B3KA 4PN2A 1CDGA 5C71A 4FLRA 1HIZA 4GQRA 4UQBA 4HPHA 1UWIA 2DEPA 2W61A 1UD8A 1VFMA 1NOFA 3MMDA 1I75A 2DT3A 3DYMA 3CHDA 3VD7A 1C91A 2W62A 4UFKA 1VAHA 2XG9A 4UQEA 1TUXA 5E09A 3EDDA 5ABFB 4PMZA 3CZ8A 2ZWZA 2VJXA 1TMQA 3AIRA 1XYZA 1W3JA 1C8XA 1ISYA 5EFDA 2JIWA 2E4TA 3RJXA 1LL7A 2XVKA 4CD6A 3AI0A 4ACZB 4PUDA 4UTFA 3CMJA 4LYPA 1HVQA 3WENA 1E6NA 1GOKA 4OJYA 1C7SA 4DWSB 2YDQA 3VGFA 4AEFA 4TVCA 1KXTA 3WNOA 4F9DA 2CBJA 1MYRA 1H11A 4XUYA 4DUVA 1BF2A 1E6PA 1J0JA 2PBOA 1GUVA 4IPLA 5BYWA 4W7WA 1JD9A 4CKQA 3RCNA 2BHUA 1J11A 3PZNA 5CPQA 4D6HA 2BXYA 1DWAM 1J9YA 4GIAA 4U3AA 1LLOA 1US2A 3U7VA 1XGZA 1A3HA 1DWHM 1CGUA 1E1FA 1E6ZA 1E0VA 1CLVA 2BFGA 1XYFA 3WD3A 1BVZA 4WLCA 3WNKA 1GZJA 1NM9A 1B3XA 2XHYA 3J7HA 5BRPA 1H5VA 1YHTA 3K8MA 3KL3A 2WANA 5HPCA 1OBAA 2Y5EA 3T2OA 4AWEA 3NDYA 4MJ4A 4RL3A 3LPOA 1B9ZA 2G41A 4M81A 1M53A 4PUEA 4BCEA 5CSYA 2CHNA 1BLIA 5D9MA 2EPKX 3HJEA 2Y2WA 1V6YA 1WPCA 3AROA 3EDJA 1QPKA 1E4IA 2X1IA 5HOSA 1W91A 2FHFA 3ARWA 1W1YA 1CGYA 2XSBA 3ARSA 4AD3A 4W85A 2V5DA 1BAGA 3U5UA 2DSVA 5AYIA 3CZJA 4UCFA 1V3KA 4UQCA 2BVTA 2D3NA 3ZR6A 3TTQA 1JGIA 3SCQA 1BYAA 1E4NA 5CG0A 1ITCA 4TVUA 1QI5A 3MU7A 2QMKA 2WSKA 3BCDA 2CXGA 2WC3A 1E56A 2G3IA 5LA1A 2GK1A 3WSUA 3T0BA 1G9HA 4UFJA 4D6JA 5AC5A 4J27A 2X0HA 4H2CA 1JIBA 4HU0A 1ZJBA 1B3VA 1QW9A 1TA3A 4EK7A 1PEZA 2WMJA 1UKOA 3W26A 2W5FA 4U5KA 5JIWA 3N17A 2V38A 1KGWA 1BG9A 4F8XA 4JZ5A 2VCAA 5DT5A 3L2LA 1OSEA 5AY7A 3VUPA 5D9PA 1OCQA 3VD3A 3WQVA 1US3A 3MV01 5I2UA 5A6JA 3UETA 1HKKA 3LPGA 1WE5A 3WEZA 2PWDA 2QHAA 4GI9A 3NIYA 1CGWA 3POCA 4Q22A 1PX3A 3AIWA 4YHGA 3VOCA 3GM8A 4UOJA 1BYDA 3F5KA 2EPOA 2WVVA 4KGLA 1MQQA 1V6VA 3AMLA 1K9EA 2VNCA 1H09A 4PSRA 1B3YA 1WAWA 1DHKA 2DH2A 2DSZA 3AMGA 2E9LA 2YA2A 3APGA 4PTVA 4HOXA 2WNWA 5D9OA 1PAMA 1H49A 3ARVA 2WC7A 3UR7A 1MW2A 5IHRA 1HL8A 1OD0A 5A8OA 1AVAA 2HISA 1UH4A 2YDRA 3L4ZA 4BS0A 2VOTA 5AYBA 1FHDA 3SUWA 3WKZA 3K46A 3WIJA 4DM1A 2WK2A 4H04A 2ZXDA 5I6SA 4MJ2A 5EMYA 1XH2A 2DSWA 5DFAA 4AZBA 4XX6A 3GXDA 3MMUA 2WZEA 2XGBA 4AC1X 4PMOA 1UD6A 4YPJA 3WUBA 2O92A 4HA1A 7TAAA 1QI3A 1JYXA 3G6MA 2PWEA 1UD3A 4JKKA 3CUHA 4PMXA 1Q4NX 1D2KA 2ZUWA 3VIKA 1NOUA 3K8KA 2D2OA 1TFVA 2WMKA 3ZQ9A 3OIHA 4C7FA 1B2YA 3SCPA 1RPKA 3BAKA 1ODZA 5ABEA 2JEQA 4D6DA 2VX4A 1KR1A 1HP4A 4JFSA 2QPSA 5E0FA 2ZUMA 1RP9A 3AICA 1UR2A 4XZBA 3VPLA 1GOWA 4MAVA 1KGUA 3MSDA 2DPEA 1LG1A 1NARA 4BF7A 1HX0A 2O9RA 1CXHA 3VIPA 3MMWA 3GH4A 4PMQA 2BVYA 2GSJA 3ARPA 3AHTA 4P7NA 4CU8A 4U33A 1V6WA 5A2BA 4UFIA 1JI2A 5ABGA 2YA0A 1HJXA 3NUKA 2E0PA 1W9DM 5JIPA 5FD0A 1G94A 3CZKA 2E9MA 5IDIA 2DQXA 1SYTA 1H0GA 2CKRA 3VGGA 3WBAA 4B3LA 4C7GA 4KMQA 1EDTA 1VB9A 1VBRA 2VURA 3N15A 2OWXA 2DH3A 1JZ7A 3A47A 1NWSA 2Y8KA 3JUGA 3KZSA 4WKFA 4JFTA 5DT7A 2J7EA 3QHOA 3WQ6A 2CESA 1WDQA 3E1F1 2XJ7A 1JNDA 2F8QA 3FAWA 3OZPA 1VEOA 4JKLA 1JZ8A 2D23A 4HZ7A 1E40A 3CMGA 4M80A 1GQJA 3AZRA 3WUEA 4MB5A 3CHEA 4MPKA 1B0IA 4JL1A 3TA9A 5I23A 2J7DA 3WH7A 3GXMA 1OIMA 4UFLA 2E8YA 5FOOA 1BYBA 1IZJA 3W27A 1KCLA 2J75A 3W82A 2OYKA 3S6TA 5M17A 1H0IA 1CPUA 1V3JA 2VZSA 4R27A 4QLJA 4MDOA 5I79A 3T09A 4V2XA 1XHGA 3SCRA 2GVYA 4J3XA 2ZXBA 3IANA 3N1AA 2C7FA 4ACZA 1UH2A 2VQTA 2XWEA 4Z2KA 4PBGA 5A2CA 3WF1A 4H7VA 5A6BA 3A3HA 1JZ4A 5D8ZA 1JDDA 2VO5A 3MV11 3VIOA 4DUWA 2VRJA 1FP9A 2VUYA 2BY2A 2B31A 2WWCA 3WQ8A 1ZS2A 3GNRA 1KQYA 3BH4A 5DO8A 2WVTA 4PMDA 4UQAA 3UG4A 4QCEA 2A3CA 3RM8A 5BROA 1H41A 1TZ7A 3WF0A 5FL0A 1GQIA 3AMCA 3WQ4A 4CVWA 3BLKA 3VD4A 4J3VA 1DWIM 2YKKA 3ZSTA 2DT2A 2VTFA 1M7XA 2QMJA 3WN6A 1ISWA 2O9PA 1PPIA 3BSGA 2XM1A 3SCWA 3VILA 1CXKA 3VDHA 4PMRA 1QI0A 1MVYA 1FA2A 3L2MA 1QOXA 1R7OA 3AMKA 4D6CA 1I1WA 3PN8A 1V03A 4QDMA 1JYNA 2ZXQA 2PWHA 2J8FA 3NYDA 4MDPA 4D72A 1W9UA 1PIGA 1E5JA 2UY4A 1KXQA 3PTKA 5IXEA 3WDPP 2W67A 1MW0A 1NWRA 4Y7EA 3MUIA 5A69A 1Q6EA 3AJ7A 1U30A 1H3GA 3BAJA 3CGTA 3AHYA 1V0KA 1O6IA 4C7DA 2ZX7A 4TTUA 1GOMA 1K9DA 2J7CA 2FH8A 1HXJA 3VM5A 1JZ5A 2VX6A 4FLOA 2CPUA 4N42A 1N82A 3PZTA 1UKPA 1NWUA 3B9AA 1FFQA 2ZOXA 1E6QM 3W0KA 1HL9A 4NSBA 3CTTA 1EDQA 2VX5A 1UD4A 1EOKA 3AZTA 4GI6A 3WNMA 1V3LA 4FK9A 1B90A 4H8HA 1V6XA 3L4VA 2O9TA 3ZT5A 1CXLA 1J0KA 3FAXA 1TR1A 2EPLX 4UFHA 3VIIA 1GOOA 4GPNA 3N11A 4EE9A 1MQPA 1JXKA 3VGEA 4FLSA 5A6BD 1WZAA 1KFWA 3FY1A 3RDKA 1OIFA 2ZUSA 1EGZA 3O2LA 2NT1A 3MKKA 1PBGA 2E9BA 5ABHA 1G0CA 4LYRA 5DEZA 3MUAA 4OOUA 5A3HA 4V27A 4TX8A 2ZWYA 1J01A 3W37A 4D6EA 3W38A 1HVXA 5A6MA 2JF7A 5I0DA 2YL6A 4OBRA 5HXMA 2CCRA 2VVSA 3B8SA 5FCZA 1QNQA 5I78A 2MANA 4YN5A 3L4TA 3VGDA 4D1IA 1ESWA 4JFUA 2GFTA 3EMZA 4B9YA 1KXHA 4J3UA 3CUIA 3HU7A 1TG7A 1ISVA 4M56A 2YL5A 3BMWA 4PSPA 3NSXA 2EBNA 1D3CA 3AHZA 1E70M 2FH6A 3M07A 1EXPA 2X05A 2J4GA 3GZAA 2FHCA 3VX0A 1NP0A 5A2AA 4AISA 5DF0A 4AZ6A 3TTOA 3AS2A 3M46A 1Q6GA 1IZKA 5BWFA 3ECQA 1JDCA 2RGMA 1XSKA 1JYVA 1ZL1A 4Z2HA 3N9KA 2WM0A 9CGTA 8CGTA 4P7OA 2WSPA 5BRQA 3CH9A 2RGLA 4DWSC 5JBEA 1W32A 4AIOA 4CN6A 2C8NA 2JALA 2BY3A 4TTGA 3W25A 3SURA 4HMEA 1JD7A 3CUJA 2BHYA 1NP2A 3ZT6A 4HPGA 1UR8A 4RE2A 3BXWA 3KL0A 3GH7A 4MB1A 5IHSA 1G01A 1E71M 4MNLA 3OB8A 4QLLA 4QCFA 1EH9A 1CGVA 3IK2A 1W3LA 3W24A 3AYRA 2F61A 5E9AA 1UR0A 4X9YA 3K4DA 1E4MM 3BAXA 2A3AA 2YIHA 2WBGA 2WVUA 4MTVA 1HN1A 4UOZA 3G6LA 4F66A 1O7AA 1PX8A 2PC8A 1W3KA 2Z1KA 3WEMA 4P7QA 5CLWA 2ESCA 4HU8A 2NT0A 1EO7A 3BMVA 3RJYA 3TTSA 1XCWA 3BAIA 1EO5A 1E73M 4B16A 1JYWA 2WHKA 2DT0A 5EFFA 2XIBA 5A6AA 3QR3A 3QGVA 3AXXA 2CEQA 2A3EA 3IJ9A 3THCA 4GQQA 1OT2A 3EDKA 2D24A 1ECEA 4AYSA 4H41A 5A94A 5I3DA 1MXDA 2WMHA 3ZSSA 5TD4A 4GZIA 1UYQA 4AD4A 2XVGA 1KGXA 3UESA 1B31A 1F4HA 3SCVA 4BQ3A 4PYSA 1GHRA 1UD5A 5BXPA 4UNIA 3VIFA 1E6XM 2D3LA 1J0IA 1XRVA 4W8BA 4QP0A 6A3HA 2FDMA 5HBFA 5GPRA 5E6YA 1E6RA 1GJWA 3OLGA 3K4AA 4JL2A 3SUUA 4GO9A 3N12A 4UZUA 3EYPA 1B30A 4ACYA 4ATWA 5I5RA 4HMDA 4B15A 2UY5A 3OBAA 2BY0A 1J10A 1VJZA 1UKTA 2XIIA 1HT6A 2VCCA 3MUY1 4IPNB 2OSXA 1PIFA 4PRWA 5CQ1A 3SCTA 3ZM8A 1ISXA 1XCXA 2XVPA 4JFVA 2YA1A 1W1TA 1FH7A 4LQ1A 3F5JA 2E8ZA 2G3NA 2VRQA 3M6DA 2JIEA 1TVNA 1K9FA 2G4FA 3QOKA 1JI1A 2CETA 1PZ3A 4AD1A 3WDHA 3WH8A 2Z1SA 1C7TA 3CZGA 1SMAA 3ZJKA 3IAPA 5D4YA 3RM4A 2CERA 1UQZA 2J78A 1L0PA 2D20A 1EQCA 1H1NA 3CIVA 1CECA 2J7HA 3CHCA 1OWQA 1XSJA 2FGZA 3AZSA 1BGAA 2JE8A 5C70A 1CGXA 1HJSA 2G3MA 1CZ1A 2XUCA 3VIJA 1JZ6A 1VFOA 2WVVB 3AXIA 2UY2A 1MW3A 2OYLA 3VD5A 1AQMA 4TVDA 4P8UA 2OYMA 3ZJ8A 4WIWA 4TXEA 1JAEA 1QHOA 2CBVA 2GDUA 4X0NA 3B9EA 1V3HA 3POHA 4KWUA 2QV4A 4HMCA 3AISA 3OG2A 3OGSA 1KWGA 5CJ5A 2BY1A 3T0AA 1UD2A 2QLYA 2WMFA 1KWKA 2WWDA 2XFYA 3W6MA 5GNXA 4ATLA 1X6NA 3QOMA 1WO2A 2J77A 1WZKA 1C90A 3AIQA 3ARTA 4FMVA 4GXPA 4KRTA 5C8BB 1ZB5A 4ZENA 5KZ6A 1PJ9A 3WNLA 1HKMA 4AIUA 1XH1A 3UG3A 4W8AA 2VC9A 4PEEA 4CU6A 1BQCA 4B9ZA 4ZE4A 1BTCA 2WCAA 3PZVA 5ECUA 3WD1A 2CKSA 2ZX9A 5AC4A 3UR8A 3IJ8A 2J25A 4UQDA 2AMGA 2BS9A 2ZX6A 2VL4A 1UA7A 2EEXA 1UWRA 1GORA 2FGLA 3GBDA 4A4AA 2EXOA 3L4YA 3SIMA 4QFUA 4JHOA 2DSUA 5A6SA 1MXGA 5FL1A 1CWYA 2VR5A 4IISA 3MSGA 1WDPA 2VQUA 4KRUA 1S46A 4W5ZA 3SEPA 4WJXA 5HNNA 4V28A 1E1EA 1FH8A 4ZXOA 1SR0A 1QNSA 1U33A 2ZUUA 3IAQA 3W53A 3AOFA 3FXYA 1EHAA 1HJQA 4AZCA 1UH3A 4W7UA 3VD9A 1KCKA 5M5DA 1WDSA 1NWTA 4J28A 1G1YA 1CENA 3VGBA 4ATDA 2WZHA 1IT0A 2DSKA 1W2PA 3GYCA 1WCGA 3PZGA 1FOBA 3PTMA 4TX6A 3HN3A 1UA3A 3MO4A 1PZ2A 3OLEA 1BG4A 1EA9C 3AYSA 1KB3A 2JEPA 4CCEA 3T08A 2YL8A 1UWQA 3EDEA 1J12A 3EBVA 1WZMA 2WVSA 3F5LA 4CCCA 2VT0A 4R5EA 1ZU8A 4QLKA 4WK9A 2D22A 4GKLA 2Y4SA 1TE1A 2XVLA 1E15A 4M82A 3WEOA 1ZBWA 2GUYA 3FHQA 3VU2A 2UWFA 1EOMA 3HMCA 4E8CA 1M03A 1CXFA 1EDGA 1XV8A 2WHMA 3CUFA 3DHUA 4Q7NA 1MFVA 2OWCA 1ZBVA 1W3HA 2VZOA 3BGAA 3WF4A 4ZE5A 2XSAA 4DM2A 1EIBA 1J0ZA 2DT1A 3VM7A 3WNPA 1J18A 2XWDA 2VRKA 3AIEA 5A1AA 1XH0A 4TOQA 1LWHA 4FF5A 3GH5A 4P8XA 3SCUA 3ARXA 2ZX8A 3RO8A 3VDCA 1J0HA 2V5CA 3PZ9A 1DWFM 1UR9A 1WP6A 1X1NA 1RH9A 5JBFA 5FKYA 1Q6FA 1QBBA 2J7BA 4OOZA 3CBWA 5GNYA 3UERA 2OLHA 3THDA 1QNPA 1QVBA 1JF6A 2V3FA 1JNEA 5KEZA 1GJUA 1LWJA 3ARRA 1TCMA 2X0YA 1J0YA 1E55A 2CBIA 1F4AA 3WL1A 4OIFA 1UG6A 3W28A 4TUFA 4UOQA 1DP0A 3WDIA 5A6LA 2J74A 4XV0A 3ZIZA 3VTRA 1JG9A 4EKJA 4CUCA 3UEQA 3SCSA 1UWUA 4U31A 5CSUA 1GW1A 3S2CA 1VEPA 1I1XA 1B1YA 1UKSA 1OT1A 4CD4A 1GOQA 2EPNA 2DIJA 3WH6A 3PZMA 1CTNA 2ZIDA 1DWGM 3MUZ1 1BHGA 1WKYA 1QHPA 3L4XA 2AAAA 2PWGA 3D3AA 1NOWA 2ZUNA 1SFSA 4DUXA 1UZ4A 3A6OA 1BPLB 3GXFA 4PCTA 3U5YA 7CGTA 1WNOA 1QNRA 1H4PA 3CZEA 4P7LA 4HP5A 4MNJA 4JCMA 1LG2A 3AFBA 3VGHA 3OGVA 3PZUA 4PTWA 4LYQA 3ARUA 1GPFA 3T0DA 3BLPX 3WBEA 2C0HA 3WH5A 3GNOA 4W84A 1KBKA 3KWXA 2PF0A 1ZJAA 2CIPA 3A4AA 1QHZA 4PMNA 5CXPA 1OD8A 3ARQA 3CO4A 3BAYA 5A8PA 1CXIA 4HA4A 2WAGA 1VJSA 3LPFA 2VR4A 3ARZA 3DC0A 2CNCA 5E70A 2Y24A 3VIGA 4W7VA 4AY1A 1E9LA 2J79A 3NDZA 1BFNA 4J3TA 5GNZA 1BVNP 3SCNA 4ZEPA 3GBEA 4ZXLA 3K1DA 1BYCA 2X8RA 4E8DA 1QNOA 2W91A 3OZOA 2PBGA 5I24A 3WUFA 2CBUA 2PB1A 1K9TA 4AW7A 1E43A 2J7GA 3II1A 3OLDA 3WD2A 4N0RA 4J3SA 3CLWA 1JAKA 1FH9A 4AZ7A 3WDQA 2DGAA 4WSJA 4GZJA 1W9BM 5A6KA 3TONA 2OWWA 1V3IA 2VZUA 2IXUA 4WKAA 3EDFA 3T2PA 2XFFA 2VVNA 2ZX5A 3DYPA 2ZXAA 5IFTA 5CZKA 2ZICA 3QHMA 2XFRA 4RE4A 2DIEA 2VZTA 4Z2IA 2YJQA 2W66A 5EBAA 4JAWA 3T2QA 1E6SM 1BGGA 3CHFA 2WCSA 4AZCB 4UZSA 1ODUA 3U7BA 1CEOA 2D1ZA 5LA2A 2IUZA 3MS8A 3VNYA 1HF6A 1MFUA 2YOCA 3I3EA 1GHSA 2DDXA 4F9JA 4PMUA 5A95A 3AS3A 4D6IA 4PTMA 3RM9A 5BXSA 5ABFA 3WF2A 4CCDA 1EQPA 4Z2LA 1JZ3A 4DWSD 3WF3A 4CD8A 1LL6A 1CIUA 4PMVA 2WHLA 4W93A 4P8VA 3ZO9A 3ZOAA 3SUTA 1V6UA 3VIHA 4MAZA 4KGJA 5HPOA 4AMCA 4OKDA 2ZUVA 3ZT7A 2GJPA 1W9XA 4NF7A 3KE0A 3RIKA 3SCOA 4AZGA 1TA3B 2XPKA 3OGRA 1UWSA 4K68A 3BCFA 1E72M 4PCSA 4Z2JA 3WL0A 1WB0A 3L4WA 1Z32X 4J7RA 2WHJA 3CZLA 2J62A 1E3XA 1AQHA 3M7SA 1UQYA 4L4PA 2WKLA 4M29A 4AZ5A 2EQDA 3BSHA 3EMQA 3TP4A 1UOKA 4CGTA 4F79A 4D71A 4OBSA 1JFXA 2NSXA 2YLAA 1CYGA 3WY1A 3FHAA 3VVGA 4L4OA 1HJUA 2GJXB 4AXNA 5HDRA 2XYLA 3VKKA 5GQBA 2E40A 4A3HA 1ISZA 2VMFA 3O6AA 2XVNA 4CD5A 2V3DA 4P8WA 3CPUA 1GCYA 1OM0A 1V0LA 1E5NA 3F4VA 3UG5A 3VIMA 2XGIA 3N04A 1C8QA 3NSNA 4UFMA 5E6ZA 1U2YA 3CUGA 5JBDA 4CVUA 5BXTA 4XZWA 1JF5A 4BA0A 3MANA 3ZJ7A 2D0FA 3AXHA 5IFPA 1LJYA 4W8LA 5LA0A 4YHEA 4W88A 7A3HA 4X0VA 4MB4A 1VFUA 1UZ1A 3WMSA 3L4UA 1NH6A 3AIBA 1MW1A 5I77A 2A3HA 1CLXA 4JFWA 1QI2A 5CLTA 1B3ZA 3N18A 5CPSA 3VDBA 4H8UA 2ZE0A 3D5HA 1ZBKA 3RMEA 5M3WA 4S3JA 3U57A 6CGTA 4ML4A 1VIWA 1WDRA 4AZHA 3BC9A 3WQ5A 3W4RA 1Y7VA 3VNZA 1W1PA 2G3JA 2D0HA 1C3FA 2X09A 3DECA 3WDJA 4HZ8A 3SUSA 4W5UA 4AIEA 4JCLA 1UHVA 1UR1A 3VMOA 4RE3A 1EHNA 1KR0A 4UR9A 3W6LA 4CN1A 1FFRA 1G5AA 2V3GA 1LF1A 1V0MA 1XD0A 3WH9A 3FN9A 1P6WA 1VRXA 1RD6A 2CHOA 8A3HA 5CGMA 2EJ1A 1V02A 4WKHA 4HZ6A 5FIPA 1VBUA 2X2YA 3ALGA 2XTKA 4PTXA 3IJ7A 2J7FA 1DWJM 2GJRA 1Q6CA 3TTYA 1CXEA 3NSMA 4LX4A 2WMGA 5A8MA 1C93A 1OGSA 2JF6A 4EANA 2O9OA 6TAAA 4CU7A 4AZIA 1K6AA 4GINA 2QF8A 3WMCA 3ARYA 4ZFMA 3RPMA 3KL5A 4U2YA 3AMDA 3AHVA 1V02E 1LQ0A 1R87A 4NRSA 1C92A 3NCOA 5EB8A 4CN4A 1R7AA 4URIA 3WFLA 1GVYA 2YBUA 2YDSA 2CITA 4IUGA 4JKMA 4J3WA 3UCQA 4D6GA 4LPCA 3VINA 1RP8A 3DYOA 3N13A 3WQWA 3PZQA 2EO7A 1KXVA 5LYRA 2BHZA 3LPPA 1V0NA 4GZEA 5A8NA 2WYSA 1H2JA 3GXIA 4BQ2A 3WFZA 2GDVA 1V08A 4U3CA 2WCGA 3WD0A 1E0XA 2TAAA 2Q8XA 2HVMA 4AEEA 2YBTA 3AQUA 2QPUA 1M01A 1W1VA 3LMYA 4MB3A 2GK1B 3VO0A 3AS1A 3RILA 2WPGA 4AD0A 1R85A 4JHZA 1D7FA 4P7RA 3GTNA 1MWOA 2WMIA 1JZ2A 4FLQA 3PZIA 1JXJA 2WBKA 1HKJA 3B9DA 3A4WA 1JL8A 4LXFA 3W81A 3AHXA 3GDBA 1W9VA 1L8NA 2VI0A 3GNPA 4M24A 2AOSA 4HTYA 2A3BA 4E4PA 4DWSA 1C8YA 2YLLA 3OLIA 5D8WA 4BZYA 3VMNA 4QAWA 3QHNA 3O9NA 2BXZA 3WD4A 2GJXA 4U2ZA 4KH2A 2NW0A 1Q6DA 2WB5A 2G8ZA 2BVDA 3SUVA 2OSYA 5DMYA 2VZVA 2IXVA 1OINA 4BQ4A 1YQ2A 1UWTA 2J47A 4HOZA 5M03A 1VENA 3I3DA 3EMCA 3FNDA 2YL9A 1R86A 3WDRA 2CYGA 4AD5A 3ALFA 4OUEA 3A4XA 2PWFA 1AMYA 1GQLA 3OA5A 1ITXA 2EPMX 3FW6A 2PI6A 1HJWA 3KEHA 2VX7A 4M8UA 4D6FA 3I3BA 4GO8A 1CNVA 4JIEA 1UR4A 4AD2A 1E0WA 2VCBA 2Y8VA 4HOWA 5F7UA 1MQRA 4WSKA 1DEDA 3PTQA 2J8GA 1JDAA 2XM2A 1E4LA 4UQ9A 1E3ZA 1B3WA 1W9PA 4MADA 4W87A 2WLYA 4A3YA 1KBBA 3K8LA 4NRRA 1FP8A 1WZLA 1JFHA 2UY3A 1GONA 5JUVA 4PMYA 1R8LA 1HKIA 1X6LA 2F2HA 1GOIA 3VX1A 1AQ0A 1M04A 1GVIA 1QBAA 1IV8A 2W92A 4W86A 2WMIB 3WUGA 1OGGA 4EAMA 2E3ZA 1BSIA 1LL4A 1HP5A 1UKQA 4LGXA 3ZR5A 3NJ3A 3PBGA 4S3KA 2D0GA 1VEMA 4CD7A 3WMBA 1HJVA 2WZIA 3ZJ6A 5CGTA 1GNXA 4Z2GA 3ZMRA 1QW8A 4U5IA 1CBGA 1QI4A 4E2OA 4D1JA 2WW5A 1CGTA 1W2VA 2BV9A 1DTUA 1XD1A 1XC6A 4BQ5A 3BAWA 1FHLA 2WLZA 4OZOA 1TVPA 1VF8A 3VDAA 3PHAA 1PX4A 4W89A 4XB3A 5E0CA 5BCAA 4MNMA 2BNJA 5CPTA 1GQKA 1OB0A 1SMDA 4H8VA 2W4XA 1XSIA 4WF7A 1NQ6A 3W29A 3VMPA 1UUQA 4NI3A 2JFEX 2W63A 2WC4A 1ZBCA 1V3MA 4HA3A 4IM4A 2V3EA 1OGBA 3WNNA 4M1RA 1VFFA 3AIVA 1A47A 3TOPA 4MNKA 2WKGA 5D9NA 3DHPA 2FHBA 3WELA 4GI8A 5BXRA 2OSWA 3PZOA 3AIUA
chains in the Genus database with same CATH superfamily
1HNYA 2V0TA 4B3KA 3WLKX 5C71A 4FLRA 3EKZA 5K4XA 1XX1A 5AB3A 4HPHA 1UWIA 3C2FA 3WQPA 4UNLA 3GC2A 3R0DA 1VFMA 4LS1A 1CW2A 1I75A 4JXCA 3UPMA 3VD7A 2ODOA 2YZRA 3H26A 1VAHA 2XG9A 4Q8WA 3HGSA 1OX5A 1VBJA 2ZWZA 1Y5VA 3IUDA 3AIRA 2DZAA 1XYZA 3IIOA 1XICA 1ISYA 3KRZA 5EFDA 1XRTA 4U10A 2E4TA 3RJXA 1YXYA 4C6PA 2XVKA 1T0OA 1OFOA 1MEIA 2VR2A 1S5WA 1HVQA 3CWNA 3WYZA 4K7VA 3HGOA 3H4GA 4XBKA 1MYRA 5HAOA 5D38A 3CQIA 3CB3A 4OE7A 4DO6A 1E6PA 2V30A 4GCXA 3MUCA 4CKQA 5CPQA 3PZNA 2P0OA 3U7VA 1WUFA 1XGZA 4NJKA 4OBTA 1DWHM 1CGUA 5KINA 1OYAA 1E0VA 1CLVA 1XYFA 3UFYA 1XUUA 4D9PA 2XHYA 1H5VA 3PWIA 3KL3A 4QDPA 3RLHA 3GFXA 3I6EA 3UNTA 4FXFA 4RL3A 1VLWA 3IK4A 3WBYA 4L65A 4HVXA 3B0VC 3BW4A 5D9MA 2EPKX 3IGUA 4IGSA 1EGMA 4E8GA 4IJBA 2X1IA 5HOSA 3ARWA 1CGYA 2B7NA 2NV9A 3ARSA 2Z4GA 4AX7A 1G4TA 4W85A 3L68A 1BAGA 5G1TA 2QW5A 1V3KA 4UQCA 2GUBA 1HO4A 3TTQA 1JGIA 3AU6A 3TVAA 3OU8A 4ICNA 1BYAA 1E4NA 3O15A 3MU7A 1WOAA 2E6FA 2WSKA 3UGVA 2WC3A 1XC4A 5LA1A 2NWRA 1NDWA 4O52A 3VZZA 2OODA 4MYAA 3T0BA 2FTWA 2V69A 4O4VA 3OVGA 1RVGA 4N9DA 4D6JA 3TW7A 4HNCA 4J27A 1JIBA 1GYLA 1QW9A 1Q65A 1FVPA 1QPRA 3AAMA 3DFNA 3W26A 2W5FA 1EJRC 3N2OA 4E4UA 3W86A 2V38A 3BJFA 3W85A 2VD9A 2YW3A 3N6QA 5DT5A 4RLIA 5SWUA 1GK8A 3VD3A 3WQVA 1S3TC 2Z24A 4PZVA 1BWKA 3PB2A 8RUCA 4S38A 3O8AA 1OX4A 2QJHA 3AJXA 2IKHA 1I2OA 3BW3A 3LI1A 1JEZA 1H62A 1EYWA 3F5KA 2R1LA 2EPOA 2I9UA 4NP7A 1V6VA 3JW7A 3NR0A 4PL1A 3H53A 2QT3A 1SFLA 4A6GA 5EMKA 3TJIA 1B3YA 2HPIA 4FPSA 3OZMA 1DHKA 1IXQA 3CMFA 4HNTA 3NO3A 4O8RA 3U0HA 1H49A 2WC7A 2CC0A 2Z2AA 4DXKA 1AVAA 3GIQA 1HG3A 4PA8A 2YDRA 4ZTXA 1FKXA 2C71A 4Y6GA 2HMCA 2WSRA 1JRBA 3W1PA 5EMYA 2DSWA 4AFYA 1GTEA 4XUGA 2ZBTA 3GXDA 3A9BA 3ZZ1A 1UD6A 4CNSA 3E6EA 4GACA 1QI3A 3L65A 3AXMA 2I17A 3IJLA 1UD3A 3CM4A 1Q4NX 3EWYA 3PG9A 1D2KA 3H2EA 1S2WA 2ZUWA 3ZVHB 4LF2A 5C6MA 3IGSA 1UUMA 3HG4A 3P80A 4KEVA 3SCPA 4JN8A 3EA1A 4WJEA 2JEQA 2EHHA 4S3CA 3EWXA 3NYZA 4FOKA 2QPSA 1SUXA 1V7AA 5E0FA 2ZUMA 2VGBA 1EZ2A 1RP9A 1VCVA 4YMZA 4XZBA 3BWWA 3MSDA 1LG1A 3NQAA 4J5NA 2TYSA 1HX0A 1RLCL 3AUJA 1SO4A 3TAKA 3L67A 1GWJA 1QMLA 3VIPA 3TCEA 3EGJA 3GH4A 2BVYA 4R7OA 4DB7A 4P7NA 4U33A 2VUNA 5A2BA 4QITA 1JI2A 1H61A 4CQAA 1W9DM 1GKQA 4LVGA 2Q09A 3VCCA 1FUYA 3ELFA 4JIRA 3VGGA 2ZZ2A 2GSHA 4KMQA 1EDTA 1VB9A 4ONVA 2OWXA 2DH3A 2PDKA 4GXMA 4DN1A 3JUGA 5B7YA 3QHOA 2HTMA 4IGNA 3JRKA 1WDQA 3E1F1 5FI8A 3SADA 1T99A 1OK6A 2ZVIA 5LIYX 2FPTA 4A21A 2D23A 1O1ZA 4HZ7A 3AZRA 3LHUA 4MPKA 5U7SA 5I23A 2GQ3A 3PS7A 2J7DA 1TX2A 1K4GA 2G0WA 2DUZA 3WH7A 5EL1A 2E8YA 1PKMA 1TELA 4UNKA 2OZ0A 1KCLA 1TPDA 3S6TA 3W7RA 1V3JA 4IOTA 1L8PA 1O5RA 2XIQA 3SAZA 4O4WA 4S2CA 5I79A 3OOQA 1WDDA 1XHGA 1TPEA 4J3XA 4OTKA 3IANA 4XZIA 4ACZA 1J93A 2VQTA 5FJJA 3RCMA 3FLUA 4PBGA 4PCNA 5A2CA 5T26A 3FA5A 3WK3A 3A3WA 1R30A 2QCFA 3VIOA 1S2CA 2AMXA 2VUYA 4GA8A 3C2VA 2PTWA 2B31A 2F6UA 4IMEA 5D05A 3N29A 5DY3A 4Q8NA 3BH4A 3VCNA 2WVTA 3UG4A 2A3CA 1PDYA 3BGGA 1H41A 1TZ7A 3WF0A 1GQIA 3AMCA 3GXTA 4CVWA 9RUBA 4IIHA 2Y1HA 1Y65A 2DT2A 2VTFA 4WXZA 2J8TA 3M0YA 1QOQA 1PPIA 1K1DA 4KWWA 4MSSA 1QOXA 2Z1WA 1J79A 1KM3A 3AMKA 4D6CA 4F2UA 3PN8A 1SZNA 1V03A 2PWHA 1CCWB 1OG6A 3ABSA 1S1PA 1B4KA 4IIEA 3AJ7A 4B5NA 3CGTA 2OU4A 3G5EA 4GQGA 5FJOA 1GOMA 4ASTA 1K9DA 1D7KA 4JTSA 1GEQA 2GYIA 1ZCOA 2A79A 1Q3NA 2VX6A 2CPUA 4H9MA 4N42A 3KOWA 4K38A 1POKA 2CLOA 5TNVA 3O07A 5D2VA 3CAVA 2FJUB 2BWGA 4ALDA 1FFQA 2ZOXA 3DC8A 1HL9A 4NSBA 2R1NA 1NELA 3CTTA 2RHGA 1V77A 3E49A 4GHRA 4XD6A 2HBXA 1AZ1A 3CQ0A 1UD4A 4GC4A 3AZTA 1TV2A 4GI6A 3WNMA 1V3LA 7ODCA 2FZ8A 1J2WA 4RUBA 4HGXA 4H8HA 1P6CA 4I9AA 2RDTA 1KBIA 1V6XA 5CGQA 3FDKA 4LOCA 4XSMA 3ZT5A 3SRHA 3QVQA 2EPLX 3TC3A 2XIJA 4UTWA 3R6IA 4LUTB 5A6BD 1JRCA 3B05A 1K8CA 3LNPA 1VCFA 2BGQA 3CASA 2EGZA 1UCWA 3O2LA 3Q67A 4PFMA 1QCWA 3G24A 3CQKA 4N4QA 3KW3A 3ZXWA 4DVOA 4F48A 3DBPA 4OOUA 1A5MC 3S42A 3G8RA 3BPWA 2VM8A 4MHBA 4GUJA 3W38A 2IQDA 5AVHA 3OODA 3HTWA 3MDUA 1Z8AA 2JF7A 3FIGA 2YL6A 2A5HA 1JPHA 3HZ3A 4ZL1A 1HKVA 3HGJA 4GABA 3P62A 2O0TA 1BVWA 3DHFA 2GFTA 3GHSA 5T9CE 3SQMA 1PXGA 2CHRA 3UXIA 4J3UA 3G1FA 1TG7A 3N25A 3BMWA 3NSXA 1D3CA 4ZO9A 5C54A 4WRHA 3WQGA 3DG7A 4ZOCA 3GYEA 1UZHA 2J4GA 1AJZA 3VX0A 5E9XA 1NP0A 3WQFA 4AISA 3BUVA 3TTOA 3M46A 3FYOA 4ROPA 4KFNA 4DRSA 3R0UA 3BLFA 1C29A 5D2WA 2PWUA 4Z2HA 4JEJA 1LLZA 4LTSA 4WQ6A 4P7OA 5BRQA 2PAJA 2RGLA 4YVVA 3ZWSA 4MLRA 1LLWA 1W0MA 2YR1A 3GG8A 5F2MA 2BY3A 3MJYA 6REQA 3SURA 1Q85A 4Y9AA 3W1MA 1NP2A 3G8EA 3S5SA 4A8IA 1DIOA 3LD5A 1EBGA 5CC6A 4MNLA 2WJEA 3VAVA 1GG0A 1I0DA 4GGBA 1M7OA 2F61A 1FWSA 3PVFA 2ZQ0A 5DXXA 1HUVA 3XISA 3FX4A 2YIHA 3M5ZA 4UOZA 2F6KA 1O7AA 4PGLA 2PC8A 3MY9A 4C6OA 3S5ZA 2BGSA 4OT7A 4GY0A 3T8LA 2ESCA 2NT0A 3R10A 4AH7A 3BV4A 1LROA 4E3VA 1EO5A 2TODA 2QF7A 2DT0A 3URQA 5EFFA 3LXCA 1M7JA 3AXXA 4NNCA 2CEQA 3IJ9A 4H2HA 3THCA 1OT2A 3KS5A 4UCGA 2Q3RA 4AYSA 3UYCA 1MXDA 3EX6A 1VKFA 2YYTA 3PJWA 2OQHA 4DAFA 3CYJA 2A1YA 3SCVA 3CL6A 4PYSA 3WZ0E 4AHQA 3ZVHA 4AX6A 4GXWA 1UD5A 4RXGA 3VIFA 1W8SA 3DDMA 5LNSA 1E6XM 3W7NA 3W7LA 1J0IA 1XRVA 4PC8A 4QP0A 5CBBA 3UBPC 4LAMA 4WJ8A 4JL2A 1DQXA 4KPLA 4AUBA 1K4HA 3LXBA 4HMDA 3EB4A 1J10A 1UKTA 3MUY1 3NAVA 3QR0A 1PIFA 4NG3A 4LV4A 4DJDD 1XCXA 2XVPA 2W9MA 3PPCA 2VRQA 2G3NA 3M6DA 3PBWA 1TVNA 4GH3A 5HK4A 2VC7A 3H6OA 4IQDA 3UGRA 1PZ3A 4R7WA 2GWNA 4Q7BA 4Y9NA 3SJNA 1GVQA 2PC4A 3R79A 1VYSX 1XBXA 2CU0A 3CAQA 3DGRA 1EFZA 5D4YA 3RM4A 7XIMA 2CERA 3C0LA 2GOUA 1SFJA 1EQCA 5I07A 4CNOA 4A29A 2J7HA 2NXHA 3CHCA 2FFIA 4X61A 3SB0A 3W7QA 3NPUA 3H4WA 4IFRA 2JE8A 1LOQA 3JS3A 1HJSA 2G3MA 1CZ1A 3QMRA 2E5CA 3AXIA 1LM1A 1MW3A 2OYLA 2ZRUA 4TVDA 3G3MA 1QO2A 4DJDC 3C0SA 4WIWA 1EF2A 1X96A 1YDYA 2OVLA 4X0NA 1QR7A 3CV6A 3PF3A 5CZ0A 4K1WA 1MI3A 3W1XA 3HQPA 1XYLA 3T0AA 2QLYA 3L0NA 2ONEA 5GNXA 3M0LA 1KFCA 5C7VA 3IEBA 4ZZ9A 1T41A 1WO2A 2DVUA 3V7PA 1C90A 3D6NA 1E9IA 1FY6A 2Y85A 3CO8A 1ZB5A 3SGUA 3OW1A 3WNLA 4DBEA 2Z6IA 3IPWA 5HNRA 4AIUA 2PGRA 3B97A 1TWIA 1UUOA 2VC9A 4PEEA 2IPJA 2ZX9A 2DZXA 2G50A 3T44A 2AMGA 1DQWA 2BS9A 2ZCGA 3MVIA 3MVTA 3TX9A 2VL4A 1G7UA 1UWRA 1AODA 1GORA 4A4AA 4DXXA 4XO6A 4C6BA 3GB6A 1CWYA 4EX4A 2WJDA 2VR5A 3MSGA 1JDFA 1WDPA 3QKZA 4KRUA 4WJXA 5BOFA 2QUNA 3AU2A 1G69A 1MZHA 4JN7A 1SR0A 1QNSA 2ZUUA 2QQ6A 3AOFA 4Y9PA 4US5A 1HJQA 4AZCA 3GFZA 4J28A 3UWWA 1CENA 2OPJA 1K8XA 3VGBA 4H19A 1IR2A 5CBJA 3PZGA 5CSSA 3QXBA 1XLBA 5I7GA 2VWSA 3HN3A 3CIWA 4CCEA 1ZGDA 3W72A 4L6HA 3ATZA 3AYTA 2I1OA 4X60A 5GJPA 1WZMA 2WVSA 4WY0B 2ZZ1A 5MHBA 1R3SA 1V6TA 2CZDA 4WK9A 5LGZA 2D22A 1Q63A 2Y4SA 1TV4A 1CT5A 1KC7A 2Y63A 1E15A 1XIIA 2DVXA 1TTPA 4H1ZA 2GUYA 3FHQA 2H9AB 2UWFA 5G4HC 3EPMA 2BG5A 1LRTA 1XV8A 3CUFA 1LP6A 1MFVA 1DIKA 2OWCA 2POZA 1ZBVA 1W3HA 5U4NA 3UW6A 1NDZA 2XSAA 2Z25A 1QXLA 4AHOA 1KFLA 1J18A 2W6RA 1RV8A 1DOSA 1LWHA 3GRIA 2WM1A 4MKVA 1OX4B 4KKXA 4QAIA 2ZX8A 3VDCA 1Y5XA 1J0HA 2YBVA 2V5CA 3UYIA 1UR9A 3M6YA 1X1NA 1ML1A 2HSAA 3U48A 1Q6FA 2A3LA 1QBBA 3H24A 1LOLA 4O1EA 3SO7A 1A3WA 3UERA 1JF6A 2V3FA 1AJ2A 3QJAA 3TAOA 4ADSA 1GJUA 2PRMA 3ARRA 1YXCA 4JYFA 1F4AA 4TUFA 4UOQA 1TB3A 3QC0A 5K9XA 5LIKX 4XV0A 3ZIZA 3RR1A 4CUCA 3P8JA 4X3ZA 5CSUA 1GW1A 1I1XA 1OT1A 1V4YA 1UOZA 1N8FA 1CB7B 2EPNA 4H9TA 2DIJA 3WH6A 3PZMA 4S2BA 1WKYA 4Z17A 2XU2A 4POCA 3GVWA 4YWIA 2FKPA 7TIMA 3D3AA 1NOWA 1S5NA 4RNFA 1UZ4A 1BPLB 4PCTA 3U5YA 4HNLA 1YNQA 4MPQA 1QNRA 5LKYA 4HNVA 1H4PA 2BDQA 4GIEA 2IS7A 4HP5A 3NQ7A 4PB5A 3OGVA 3BGJA 3T0DA 3KM8A 1ONXA 2C0HA 4N2YA 3WH5A 4L64A 1KBKA 3GR7A 2NZLA 3QY8A 4ZQOA 3QMSA 1LRNA 2BX7A 4PMNA 5CXPA 4XVDA 3Q94A 1FRBA 3ARQA 1THFD 1WKFA 2CLFA 2IKJA 1CXIA 2O4QA 2VR4A 1OADA 4N9CA 3E74A 3M0MA 3QLDA 3LV5A 4GG9A 2XH7A 5E70A 5AYXA 3VI2A 1US0A 1BKHA 4S3BA 3E9AA 5I3KA 1M1BA 4R33A 4W7VA 4XQ6A 3SY8A 4C65A 1IGSA 2CFFA 2V2CA 5I3HA 3QKEA 3OO2A 3CV2A 1BYCA 4A8RA 4JTGA 1TZZA 3PUGA 2PBGA 3L5MA 3UCDA 5I24A 4WEVX 2ZKMX 5IM51 2BZNA 3ZWTA 1VPYA 3DFTA 4N0RA 3CLWA 4GKTA 1JAKA 4M3PA 4JDYA 2DGAA 3SR7A 3GG0A 2OEMA 4B5UA 2OWWA 2VZUA 3NNTA 3T2PA 4RR4A 2VVNA 4ZB2A 1Z41A 2ZXAA 5CZKA 2NUYA 3QHMA 3NGJA 3I7SA 4L1GA 1QDSA 2RDWA 3T2QA 1E6SM 5JU6A 3U7BA 1CEOA 5LA2A 1RXOB 1XWYA 4OFCA 1AW1A 3IJIA 4ZCWA 4NHVA 3BSMA 3I3EA 5A5WA 1DJHA 1YE4A 2DZTA 2BXVA 2DDXA 1EPXA 3VKJA 3AS3A 3RM9A 4IFKA 1W31A 1DE5A 1P0EA 3LN3A 1CLKA 4Y8EA 1R46A 4CCDA 1EQPA 1B3OA 2PD9A 1LL6A 1CIUA 4PMVA 1G4SA 3SUTA 2Q01A 3VIHA 4DO5A 2PDUA 3M16A 4KWOA 1A5SA 3VOGA 4Q8VA 4IGHA 4R88A 3KRUA 4NILA 4AZGA 5AFDA 4K37A 1FHUA 1K3UA 1UWSA 5HULA 2WQPA 4WOQA 1F5ZA 2R8WA 3DBNA 1O4UA 3WCZA 4MUZA 3PJUA 4AVNA 1UW9A 3L2IA 4J7RA 2G97A 3G1XA 3CZLA 3GUWA 1R47A 4I9MA 1RA0A 4AZ5A 4D8LA 3G1RA 1LUCA 3BSHA 3TP4A 4C1LA 4QSHA 4IMAA 1AD4A 1OFEA 2REQB 4TV5A 4UIOA 3VVGA 2GJXB 3S0CA 2XYLA 1L2QA 2L5HA 3H23A 1RJRA 1VYPX 2VMFA 2V81A 1R0MA 1Y8BA 4CD5A 2OLAA 5I3FA 1ADSA 3VC6A 3TN6A 3T1GA 3F4VA 3UG5A 3C86A 5G2WA 1TIWA 4UFMA 1U2YA 1MEWA 3FJ6A 4US6A 4JD4A 4XKMA 1JUBA 4NZ5A 3PG8A 4W8LA 5LA0A 4YHEA 4W88A 4DQWA 4OWGA 1VFUA 4JS3A 1KRAC 1CLXA 1REQA 2A3HA 5CLTA 3QPYA 4MUPA 1B3ZA 3N18A 9XIMA 1GKRA 3W75A 5AZ0A 3D5HA 5M3WA 4S3JA 3VNJA 4MY1A 5HWMA 2QJMA 2YCLB 3BC9A 2ABAA 5CC5A 4JCLA 2H8ZA 3VMOA 1JCXA 4GLEA 4UR9A 1G5AA 2V3GA 1NFBA 4UTLA 1V0MA 4B5WA 3TLQA 1VRXA 4RDWA 2YCEA 3R4IA 2CHOA 3RN6A 4JHMA 3G3DA 3UWYA 1V02A 3O16A 3GDRA 1VBUA 2XN2A 4PL2A 4HPJA 5HWJA 1KV5A 3R0KA 4F2BA 1DWJM 2I5GA 4YTUA 1CXEA 4J2MA 4OQVA 2Y88A 3CL8A 3D46A 1OGSA 3UPWA 2ZA1A 1O5KA 2FMOA 4H3DA 1HL2A 1BQGA 1OFPA 3USBA 3EOSA 4AZIA 2QF8A 4PTDA 3TNBA 1Q6LA 3VDGA 3DOPA 1GGOA 3KL5A 2VFIA 1A5KC 2Y7EA 4KIEA 4E2DA 5EB8A 1P5BA 2OEKA 4CN4A 4URIA 3WFLA 3FYPA 4Y2WA 3VK5A 2YDSA 4JKMA 3NM1A 4ERAA 1RP8A 3LHZA 3RU8X 1M7PA 2E5DA 1HW6A 3W84A 3TQ0A 1TWWA 2UZ9A 2INZA 4JOMA 3STEA 3HQNA 1H2JA 5AC6A 4FXRA 4U3CA 2PGFA 4JIHA 1DJIA 3V35A 3WD0A 1A3XA 1E0XA 2Q8XA 2HVMA 4AEEA 3BV7A 3AQUA 2QPUA 3DFSA 4QXIA 1S5VA 1WQ5A 2PDWA 3RILA 5LNWA 1R85A 1G4EA 4P7RA 2HNEA 2WMIA 1FWHC 2FB2A 4IZGA 2YPIA 1WOBA 5TF0A 4LUSA 3A4WA 1JL8A 4KEUA 3AHXA 1L8NA 2A3BA 4E4PA 1C8YA 4G7FA 2YLLA 5F1UA 3BMXA 3VMNA 4NI8A 4QQUA 4I5XA 3G0SA 4XIAA 3QC3A 3AO0A 2NW0A 2D2HA 1S5MA 2VZVA 2VKZG 5AOUA 3DEQA 3U8GA 3DENA 5DY2A 3TFCA 4INFA 5FSDC 4MGGA 2YCIX 4Y8FA 3W7OA 1UWTA 4HOZA 2AKMA 3I3DA 3EMCA 3NPWA 3LQLA 1R86A 1X98A 1F8MA 1IHIA 3A4XA 4D8AA 1EA0A 3G1YA 1AMYA 3FW6A 4JYEA 2ZRVA 3C52A 3WK1A 2VX7A 2VDHA 2XN0A 2NSOA 3EEGA 2DW7A 4LUYA 4BEQA 1R5YA 3LBOA 4AD2A 1NIUA 3S5NA 5F7UA 4WSKA 3PTQA 3K5XA 1W6TA 3S9ZA 1E4LA 2DQWA 4MADA 1EKOA 4C1KA 4LF1A 1EPVA 3C6CA 1FDYA 2WLYA 4IIBA 4NRRA 1GONA 3WLIA 3TYAA 1PHWA 1R8LA 4GVFA 3KBSA 1Z3NA 4HU4A 1RBOB 3ZLGA 1LL4A 1UKQA 3NQ6A 3PBGA 2D0GA 1VEMA 5I3IA 1VPQA 1HJVA 1JCNA 3LLFA 1XLKA 1XYMA 2E68A 3ITOA 1XP3A 4HN8A 4JPGA 3CHVA 1PCWA 2BV9A 1XD1A 3OIXA 5D2YA 2WLZA 1TVPA 3N2TA 3TOYA 1W17A 1ICSA 2RAGA 3CH0A 4W89A 4Q4PA 5E0CA 1C9WA 4MNMA 2BNJA 5BCAA 1SMDA 2W4XA 3MWAA 4FZIA 2CZ5A 2F2KA 4WGXA 3E0FA 4IM4A 3LM3A 4CLMA 2V3EA 5EPDA 4M1RA 3N73A 1VFFA 4UTKA 1TV7A 4RZ4A 5D9NA 4GI8A 4O0QA 1X1OA 3CV1A 3PZOA 1JJKA 1KQZA 3WBXA 4PN2A 4YXGA 1HKWA 3O0FA 1HIZA 3ITVA 4GQRA 4UQBA 3WLRA 3R25A 1UD8A 1NOFA 3MMDA 3KUMA 2DT3A 3DYMA 2OJPA 3CHDA 3UU0A 4MFDA 5FJTA 1W3NA 2W62A 3KOYA 4H9ZA 5ABFB 5I00A 3BICA 2VJXA 3GY1A 4CEXC 1K7EA 3JR2A 1GT8A 4US5D 3PANA 2JIWA 3E2QA 1XCFA 1VR6A 4FNTA 1GYMA 4PUDA 5K4ZA 1MEHA 4H9XA 4LYPA 4DYEA 2Y5JA 3RMJA 4OJYA 4DWSB 3VGFA 2CLKA 4PODA 1KXTA 5C55A 3NGFA 2PF8A 2CBJA 5CZTA 7REQA 3CK5A 3NPVA 3M5YA 4IHCA 4Q8OA 3ES8A 1J0JA 1FBAA 5BYWA 4W7WA 1A3HA 1E1FA 1PZ1A 4ECLA 1BVZA 4YVXA 1NM9A 4BEUA 2OCZA 4UR8A 1UZDA 5BRPA 1YHTA 3K8MA 3ABQA 4PCPA 5HPCA 2OMAA 1E1CA 3LUTA 4AWEA 2IW0A 4MJ4A 4RV3A 1MXSA 1M53A 4PUEA 5CSYA 1MDRA 3P3BA 4NXSA 1GVRA 5LIWX 2VEIA 1FWWA 2VD8A 1V6YA 3EDJA 1QPKA 3QV6A 1DJQA 3S5YA 3UA3A 1W91A 3V5FA 1UWAA 3F03K 2XSBA 3LZ3A 2ZVRA 4ENLA 1LDCA 2DORA 1O94A 2V5DA 2F38A 3N4AA 3U5UA 4K8GA 2QXWA 2BVTA 3ZR6A 3SCQA 3CYVA 3FEMA 5CG0A 4TVUA 3D47A 3EXTA 2PRHA 4XZ9A 1GZ1A 2G3IA 3IJQA 1F3WA 3C4UA 4IPJA 2YXGA 5AC5A 3E02A 2TPSA 4H2CA 4HU0A 1ZJBA 5ENLA 3M0ZA 1R6WA 4EK7A 2WMJA 3G1DA 3P93A 3SFKA 4U5KA 1TIMA 4WY0F 4QS5A 1O60A 1BG9A 1F74A 2NVAA 2VCAA 4QRNA 3L2LA 1D8CA 1W54A 3CWHA 3U9IA 4MM1A 1ICPA 1OCQA 4PRTA 3TQKA 4H6EA 5A6JA 1GKPA 2PLKA 3LLDA 1HKKA 3PC0A 4EVZA 4I5RA 1BSLA 3WEZA 3S9YA 3W74A 1CGWA 3AIWA 4E38A 3C0JA 3TA6A 2HPMA 3NOEA 4Q4RA 3GM8A 1LT7A 1BYDA 1ZRQA 2CLPA 3ITLA 1MQQA 4FSAA 4KGLA 5F2LA 3ZFHA 3AMLA 4MIMA 2VNCA 5J5DA 5T8GA 3AMGA 1UMYA 4B90A 3SBFA 1PAMA 1TV3A 3FGCB 5A8OA 4L1XA 3UP8A 4XTDA 4DNHA 1NAL1 3NQFA 1UH4A 3EWBX 3L4ZA 2VOTA 1FHDA 3SUWA 1TVLA 3BZJA 3K46A 1VGAA 3DI0A 4DM1A 1VZWA 4GYPA 3LTSA 1WXJA 4H04A 5AC7A 1SFTA 4MJ2A 4AZBA 1UIOA 2BGNE 2BP1A 3MMUA 3TIMA 4PMOA 1FWNA 4YPJA 3NQ2A 4HYWA 4DBWA 4HA1A 1ADDA 3WJZA 2QAFA 4IWWA 1JYXA 3KP0A 4XZLX 4BHYA 2I5IA 3IARA 1HGWA 3C56A 4PMXA 1DJXA 2ISDA 3VIKA 3M7WA 3TR9A 3CUZA 5AHFA 1BXCA 2C13A 5TIMA 1D9EA 3LERA 3OIHA 4O50A 1B2YA 3Q65A 2OG9A 3FSTA 1W37A 5ABEA 2X1UA 2VX4A 1UR3M 2FDSA 3BG3A 1HP4A 1GVOA 1VC4A 3DFYA 5AYZA 3SRFA 3GR4A 3VPLA 2QUMA 1ZPTA 1JPDX 1SO6A 5LXEA 2VFFA 1XI3A 4BF7A 3T81A 1QWGA 4HNUA 1D3HA 5BRBA 1XKJA 2GSJA 1K8YA 2I57A 4CU8A 3M0XA 2DZVA 4UFIA 3R7MA 2YA0A 3NUKA 4QHRA 1KD0A 3R2GA 1W1A1 3CZKA 2E9MA 3FJNA 1UP2A 4L9XA 5IDIA 2DQXA 3BCJA 1SYTA 1A5BA 2CKRA 4YYFA 4LV9A 3WBAA 4PH6A 4B3LA 1R3VA 4RW3A 3C8NA 1VBRA 3A47A 1FWIC 4GUFA 4R85A 4LCSA 3PWAA 5DT7A 1A49A 2BLEA 2J7EA 4FR1A 2FZDA 1GVFA 2KAUC 1QRQA 4GYFA 2NX9A 3TA9A 3RYSA 4FF7A 3GU9A 5IBXA 3HG2A 3KCLA 1SPQA 4QE4A 5AHIA 2WPBA 3GXMA 4KEMA 3UJRA 5DN1A 4JTTA 3LTYA 2J75A 3CU2A 3SJ3A 2VZSA 3GTXA 2ALRA 4MG4A 3T09A 3LYEA 2NQ5A 2ZZ7A 3M1ZA 1ZTVA 2C7FA 1DXEA 1UH2A 5AHMA 1NQKA 1TRDA 3W7JA 4H7VA 1A5UA 3VOIA 1RQEA 5I09A 2VRJA 3UA4A 5CPLA 3L12A 3PSWA 3Q37A 4WD0A 4MY9A 4YTQA 3FGCA 4DF2A 4V1XA 1EX5A 4LVFA 1ZS2A 5DO8A 2A7PA 4UQAA 3RM8A 3VD4A 3U6WA 3NQ8A 1DWIM 3ZSTA 3GXPA 4GVHA 2E25A 2PGWA 4HSOA 3A5FA 1FCBA 5G4WA 4G2DA 3WN6A 3LBCA 3BSGA 1IEVA 4A8NA 3V16A 2PEVA 2CLMA 3QPZA 3SCWA 4JTLA 1QI0A 3UWUA 4KESA 2AGTA 1NDYA 2R82A 5BOEA 3N2MA 3LTPA 1X38A 1I1WA 4HZMA 2J8FA 3BLIA 4MDPA 1QK2A 8XIMA 2O7QA 1W9UA 1PIGA 1N8WA 1KM4A 1WYIA 1NWRA 4FB7A 1Q6EA 1U30A 1H3GA 4KERA 3BAJA 3AHYA 1V0KA 4HHMA 4NL1A 3TYEA 2J7CA 2FH8A 1HXJA 3LZ5A 1N82A 1J5SA 1NWUA 3NQVA 3N4FA 3R13A 4JTCA 2CWNA 3B9AA 4G8TA 1WDWA 4IPIA 4IP5A 1E6QM 3W76A 1JUEA 4O0KA 1IZCA 2OEJA 3TSBA 2Z28A 4EPEC 3VFLA 4FK9A 2OKOA 4LNCA 4HBKA 1OVDA 3NEVA 5JMUA 1UMLA 5K3VA 1JR1A 3EPNA 3FKKA 3L4VA 1M5WA 4YIWA 1ICQA 2O9TA 5AN7A 2ZA2A 3G22A 5D2XA 4MWAD 4IX0A 1TR1A 1RY0A 4H9YA 4UFHA 3VIIA 3N11A 4WXYA 3R94A 1FDJA 5CEWA 4CNTA 3EWUA 3AWNA 4RE0A 3RDKA 1OIFA 2ZUSA 3W2UA 1IWPA 4ZQMA 3MKKA 1PBGA 5ABHA 3P74A 1CI1A 3MUAA 5A3HA 4UTJA 4GISA 3DFOA 2QCCA 2FMNA 1OC7A 1AK5A 4JIPA 2OZTA 4RPPA 4LEQA 1YDNA 3O7UA 3ZYZA 1PCKA 3IWPA 3MP4A 3P60A 5I78A 1MRAA 5BU9A 4KWVA 3G77A 1ESWA 4B4FA 3EMZA 2FB3A 4ERGA 1G67A 3BO9A 3F1QA 1LZOA 3CUIA 3RHGA 4YTSA 3HU7A 5AHNA 1ISVA 2Y7FA 3GUGA 3NO1A 3R43A 1VBGA 3A24A 1E0UA 4LBSA 4XKYB 4HYRA 1Z9AA 1EXPA 4X2PA 2X05A 1P1MA 1SZFA 3UNDA 5A2AA 3KCOA 5DF0A 1IZKA 2VEMA 3ECQA 2X1TA 5BWFA 1JDCA 2RGMA 3UJ2A 2Y70A 2P3ZA 4B4HA 4HTBA 1M3UA 3SGZA 3N9KA 4XISA 8CGTA 3LEPA 3UR2A 3EXSA 4AIOA 1R2TA 1A0CA 4CN6A 1SVDA 2VGGA 2JALA 2HVOA 1DJWA 2E1DA 3SDOA 1RJQA 2R24A 1GZGA 1JD7A 2XGZA 4DZ5A 1YPXA 4IL2A 3QTGA 1V8EA 1IGWA 3DXIA 5IHSA 1GOXA 2FFCA 2YW4A 3B03A 1XPYA 3NXFA 4QLLA 4QCFA 2E7FA 5CJMA 1EH9A 1Y5WA 3IK2A 3W24A 5D32A 1L9WA 3K4DA 3R11A 4XBJA 4MWAA 1B9BA 2A3AA 2WVUA 3I65A 2GVLA 3G6LA 3G0XA 2Z1KA 4C60A 4P7QA 4NYYA 4DIAA 3IV8A 2PLMA 3BMVA 3EXRA 3VKBA 3BAIA 1ZAHA 3FDGA 3WLTA 4B16A 2WHKA 3UVAA 3GD6A 2GGHA 2Q6ZA 3CNYA 3QGVA 4A35A 5A6AA 2A3EA 4GQQA 1F07A 2QCEA 2D24A 5A94A 1UROA 2ACRA 4GZIA 1UYQA 4AD4A 3IJDA 2XVGA 4A2SA 4L61A 2WNQA 5HMEA 3UESA 2ZC1A 3O63A 4H9VA 1GHRA 5BXPA 3O05A 5FACA 3MBDA 4GY1A 4F4RA 4K2SA 4W8BA 2VDIA 3PAOA 5F1VA 4DXVA 2CWXA 3K4AA 4GO9A 2QNEA 4EXBA 3N12A 6TIMA 4RKAA 1B30A 4ACYA 1ME7A 1EJUC 2XIIA 1HT6A 2VCCA 1ISXA 2OZ3A 4O13A 2YA1A 3DKJA 3QM3A 1FH7A 3F5JA 3QOKA 2CETA 3DZ1A 2Z1SA 3PBUA 3TYBA 4UWMA 3CQJA 3ZJKA 3IAPA 4IPPA 2J27A 2INFA 5A8GA 2C18A 1H1NA 4IG2A 4JIIX 3BLOA 2FGZA 4IGMA 3S3GA 3SI9A 5C70A 1CGXA 4G1NA 5C2CA 1W3IA 3O06A 2GZXA 4JQ1A 3VIJA 3S1GA 1JZ6A 1JQVA 3GXNA 1I2PA 3I7RA 1N55A 4HKPA 4BWLA 1H1ZA 3QGAC 1QK0A 1QHOA 2Y5SA 3P61A 3TWBA 4IIDA 2GDUA 3N6HA 1QPOA 1UIPA 1FWRA 3OGSA 4ZQRA 1UD2A 4DX3A 3QQ0A 3NZ1A 3W6MA 3WMLA 4ATLA 1XW8A 3B8DA 1U22A 4LNYA 1WZKA 4RNJA 1VIZA 2DVTA 3ARTA 4JX5A 4ZOBA 1PSCA 4KRTA 4LU0A 3CPRA 1N2VA 2WJZA 5KZ6A 1PIIA 1GJPA 3FOKA 1HTIA 3RRAA 1R38A 4UTTA 3UG3A 2YFNA 5DMNA 4CU6A 1OFQA 1MNZA 4B9ZA 4XZHA 3GFYA 4ZE4A 3MCMA 3WD1A 3PZVA 4MWAE 2BVWA 5ECUA 3RRXA 4Z0SA 3N9SA 3L0KA 1AL8A 1HQTA 1JPMA 3KX6A 2ZRYA 3IJ8A 2J25A 3NZPA 4WZHA 3GZ3A 4R9OA 4R7JA 2EEXA 4HMNA 4MFEA 4K8HA 1N7KA 4JHOA 3M41A 3ES7A 5A6SA 1WKEA 2ATSA 5EY5A 4QTGA 2HROA 4QM1A 4RDZA 2Q02A 3F4DA 4W5ZA 3B0XA 3KVMA 1FH8A 2GQ8A 3T78A 4ZXOA 3EWDA 3W1AA 2HJPA 3TEVA 1Z44A 4HHLA 4S3FA 1EXBA 3FXYA 1EHAA 1TTQA 4PUJA 2WQDA 5M5DA 1NWTA 4LCQA 4S3EA 2VENA 3H21A 4ATDA 2WZHA 1W2PA 3LRKA 3SZ8A 2I14A 1YNPA 1TJ2A 2FTYA 3GYCA 1WCGA 3U2EA 1PWLA 4TX6A 1BG4A 3AYSA 4W4QA 4JN6A 1OFRA 2QEZA 5EYWA 5CSRA 4EF8A 2YL8A 1UWQA 3EDEA 2FGBA 3GDLA 4CCCA 3LSBA 2BSLA 4DBUA 5LIXX 1RD5A 4R5EA 3HV9A 1H7WA 4QLKA 3DN5A 5IBXC 2CZEA 3W01A 3T6CA 1P43A 4ZFCA 4KFPA 3VU2A 1VPXA 4E8CA 3CT7A 1CXFA 2B0MA 1EDGA 1IWBA 1KTNA 4XTIA 1W5PA 5F2GA 1NDVA 4QNEA 1EIBA 2FQIA 1J0ZA 3DFHA 1TWSA 2VRKA 3MHUA 1L2UA 4TV6A 3AIEA 2ACUA 4FF5A 3GH5A 3SCUA 5CAKA 3ARXA 1AW2A 3KCJA 4AWTA 3PZ9A 1DORA 3S1XA 2INEA 1Y0EA 5JBFA 2PP3A 3RFAA 4FIQA 4OOZA 3MQTA 3CBWA 3QRHA 5GNYA 3R89A 4N6FA 3M0JA 2OLHA 1QNPA 3SRDA 4DHGA 4HD5A 5REQB 3HPFA 1TCMA 1J0YA 3WL1A 4F2TA 1UG6A 3W28A 4ZTYA 4GUHA 3WDIA 3Q2DA 4EWND 2J74A 4HB7A 3S47A 1P4CA 3LK6A 1X8FA 1UWUA 4YTRA 1SM9A 4WHBA 5TQLA 4QEEA 3KBWA 4L1WA 4M6QA 1H7NA 4CD4A 5KSWA 4UTHA 3W1NA 4E6MA 2ZIDA 3N9RA 2QIIA 3MUZ1 3NL5A 3F4NA 3QR1A 1QHPA 4QNWA 4AY8A 3BG5A 3ITCA 3EOUA 4AC7C 1UP3A 3GTHA 4Y9MA 3T8QA 1DE6A 4O1CA 1SW3A 5E93A 1HFBA 4YVPA 1RZMA 4Q4SA 1UB3A 4DBSA 2A7NA 4MNJA 4R9XA 1TPB1 4ZVJA 4GYPC 4LYQA 5EKYA 1SGJA 4OUIA 3WBEA 2Z1BA 4QIUA 3RPTA 1UPPA 3GNOA 3GVGA 4YWSA 3KWXA 2GVJA 1ZJAA 1XIHA 1QHZA 4H00A 4DJDA 3FEQA 5C9XA 1UC5A 3CO4A 3MP3A 1TTJA 1REQB 4U28A 4HA4A 1KRCC 1WXZA 3ABRA 4JBRA 3VZXA 4FS9A 3U2OA 3IUIA 5M1TA 4AWSA 2Y24A 3VIGA 3NA8A 1E9LA 1GTHA 1VS1A 2J79A 3H2AA 1RCXB 4WDUA 3TKFA 1PVNA 3HFYA 5C0QA 4ZQNA 3K1DA 4JNZA 4DI9A 4FO4A 3H4XA 2JGYA 1NEYA 2CBUA 2PB1A 5CH9A 3SY1A 3MT1A 3BTNA 3BANA 3GIPA 1MUWA 2J7GA 4AW7A 2C1IA 4J3SA 3L9CA 4AZ7A 3WDQA 4FNQA 1TCDA 1K03A 3HJZA 5H1WA 1P6BA 4WKAA 5DLCA 5IFTA 5CZSA 2DIEA 3SFWA 4AG0A 3LBMA 1V7YA 2YJQA 4LUSB 4AZCB 1ODUA 3VKDA 2IUZA 3MS8A 3VNYA 1HF6A 5BNKA 1NJJA 4NNAA 4PMUA 3UJSA 5BXSA 2OELA 4L4LA 5ABFA 1XIEA 1BTMA 4Z2LA 4DWSD 3WF3A 3E5PA 4CD8A 4I9TA 3HB9A 4P8VA 5REQA 2HV5A 4Q8PA 2BTMA 3GWQA 5HPOA 4H4IA 1SO5A 5T9BG 3ZT7A 2XH0A 4IMGA 4GY7A 4NF7A 2PDLA 1HO1A 3R58A 5KMYA 4KQNA 3INPA 3BCFA 1PTDA 3NFUA 1SJAA 3O1NA 3FYYA 1WB0A 4GYKA 2J62A 3M7SA 4L4PA 2QVHA 4NZFA 3TJLA 4C90A 1M6JA 2A0NA 3EMQA 1UOKA 4CGTA 3TXVA 4GJIA 1JFXA 2NSXA 3W22A 2YLAA 1CYGA 2DY3A 3FHAA 1XBZA 4L4OA 4ICMA 4MMWA 3URBA 5HDRA 4G5DA 4K36A 3VKKA 4MWAB 5GQBA 3E0IA 4GVIA 3VABA 4Q8UA 1IIGA 1YIXA 2V3DA 4NASA 1RA5A 1GCYA 1V0LA 1E5NA 3VIMA 3S6OA 2XGIA 1H5YA 3N04A 3E0WA 1S2UA 1OK4A 1BWLA 3UZYA 5BXTA 1Q7QA 4UTUA 1TSIA 4BA0A 5HMFA 2D0FA 1H50A 1LJYA 1P0BA 4G9PA 3HBLA 7A3HA 2HS8A 1F61A 3WMSA 1ELSA 1NH6A 4PB4A 5I77A 3QQWA 5CPSA 3GVVA 1XLJA 4M6UA 2BOGX 2CZVA 3QMTA 3FS2A 3C61A 1IE7C 3HIJA 1VIWA 4ZOAA 1OFDA 1VD6A 4AZHA 3WQ5A 4WDWA 3W4RA 4FX8A 1EP3A 3N34A 1MRQA 2VGFA 1FWAC 3NO5A 4AIEA 1UHVA 3B0UX 1UR1A 4RE3A 4R53A 5D02A 3W6LA 4RZBA 4CN1A 1FFRA 2G37A 1W1IE 1FCQA 3WJYA 1Q13A 4O1BA 3QV9A 3F2CA 2XZ7A 4S3GA 4I90A 2WKJA 4A2RA 1RD6A 3UWVA 8A3HA 1W1ZA 5HJYA 4BK9A 5FIPA 3ALGA 2MUCA 4JTEA 5I3JA 3MKVA 3IJ7A 1MZRA 3DFPA 3GE7A 2GJRA 3ANVA 4NVTA 3NSMA 2FLIA 3DGBA 5A8MA 2ATMA 4EANA 3BOXA 3LY0A 3W71A 1S2AA 1U1JA 1XUZA 6TAAA 1K6AA 1JCJA 4WUIA 3F4CA 3WMCA 5MKGA 1S38A 2JQXA 3VNDA 4BY3A 4QJ3B 1V02E 3RAOA 1EJXC 1R87A 3UQNA 1QASA 1R9XA 1C92A 2FZBA 3DG6A 1MUCA 2I5QA 1V93A 2HVNA 4O11A 2CITA 4IUGA 3UCQA 1BEUA 4LPCA 3WFAA 1OF6A 4B5XA 4DZAA 3S4TA 3T9PA 4I6KA 5EMUA 5LYRA 3W1TA 3H2OA 3LPPA 3QQ1A 3N3MA 4GZEA 3T55A 3C8FA 1R3WA 2QCMA 4KCWA 4AXKA 3OQ8A 3WFZA 3IIZA 2C1GA 5DX7A 2WCGA 3LHTA 5A6TC 4LAZA 3XINA 3STPA 2NQZA 1V79A 3LMYA 2FZMA 4MB3A 2H90A 2J9ZA 2GK1B 3VO0A 1TE6A 3AS1A 4AD0A 4JHZA 2Z29A 1KTCA 1TPFA 5KITA 1MWOA 3FKRA 2WBKA 2OB3A 3KVLA 1HKJA 4TO8A 3S2NA 3NQBA 2V2HA 3W81A 3GDBA 5FEPA 4P5UA 4HTYA 4JQ4A 3BL3A 4DWSA 1DV7A 3IRSA 4BZYA 2BXZA 4U2ZA 2X42A 4MKNA 3MP5A 1Q6DA 2G8ZA 2BVDA 4LT9A 3SUVA 1QTWA 2OSYA 4ILSA 4NX5A 4B5VA 4GQBA 2IXVA 4BQ4A 1MMFA 4GNVA 1NU5A 2FZ9A 3LRLA 5FSEC 3K4WA 2J47A 1VENA 2JGQA 3G1VA 1LRQA 2CYGA 3OYXA 3PULA 1FWEC 4OUEA 1XQLA 2PWFA 1ZUAX 1VCGA 2EPMX 3LSCA 2E77A 1HJWA 4Q6XA 3M0IA 4D6FA 1O66A 1CNVA 1TPH1 1E0WA 1LWIA 3LCWA 5FF3A 5FA5A 1XIGA 1YE6A 1MQRA 2QYGA 4O17A 1JDAA 3TNOA 4KWSA 4UQ9A 1E3ZA 4XAGA 1V5XA 2PLCA 3OVRA 3UVIA 3GKAA 3O6YX 2DZBA 1WZLA 3HPAA 1JFHA 2Y6ZA 4PMYA 1HKIA 1X6LA 3I68A 1XLCA 5HJLA 2F2HA 4Y96A 1GOIA 4NAEB 1EB3A 1M04A 1AQ0A 4GNKB 2GUUA 5D33A 2VC5A 4W86A 2WMIB 4O1DA 4EAMA 3EB2A 2FJKA 4P61A 4YLWA 1XLIA 4LGXA 5DBTA 5BMXA 3NJ3A 4S3KA 2PSNA 4LCRA 2FVKA 2WSQA 2WZIA 3AXKA 1GNXA 4Z2GA 3BDKA 3RLVA 3ZMRA 1KFKA 2VFDA 4U5IA 4DPPA 2RDXA 3VKAA 3T42A 4D1JA 3QY6A 1W2VA 4FP1A 2OFJA 3QY7A 5H91A 3VDAA 1PHQA 3JU2A 2G95A 4XBSA 2YYUA 4XB3A 5CPTA 1QJWA 1OB0A 2SFPA 4H8VA 4R34A 4DNMA 2JBMA 1KRMA 1XSIA 4B2DA 1AFSA 3S1VA 4NI3A 1UUQA 2WC4A 3LI0A 3TR2A 3KBNA 2DU2A 3DKLA 3W1QA 4CEUC 4KW2A 4HNNA 3AIVA 4RV8A 3KRSA 4UB9A 2WKGA 2YZ5A 2FHBA 3WELA 4WCJA 3A9IA 3M47A 2QS8A 2WXDM 4NZCA 5JH2A 2ZUTA 1CDGA 3NQCA 3SQSA 1JCLA 1Z42A 2DEPA 4O53A 2W61A 4QX4A 3E2RA 1VFLA 2VEGA 2P3EA 4DBDA 1C91A 4UFKA 2R1PA 3VNMA 4L6OA 3GVQA 4PMZA 4BWLC 1MNSA 1VFHA 1TMQA 3I4EA 4WY0A 4AMAA 2VDGA 3URAA 4ACZB 4Z1BA 4UTFA 4A8LA 1XFCA 5L6UA 4I6VA 4QDWA 2D2JA 4D8ZA 1E6NA 1K70A 3WLNA 1MSSA 2OQYA 2YDQA 2NVDA 2C79A 4K8EA 1G7VA 3UF9A 4Q32A 1TJRA 2YFOA 3BARA 4E2VA 1E9ZB 2V5JA 4DUVA 3DESA 2VGIA 3EWZA 4HA0A 4IPLA 1JD9A 2BHUA 1BKSA 4A3UA 4D6HA 4GIAA 1LLOA 3L23A 2VELA 1X8CA 1K77A 3WD3A 5DRCA 5EGRA 4WLCA 2FPYA 3WNKA 3VNIA 5FF0A 3AWOA 1RVKA 4JTQA 3W2NA 2YCLA 2WANA 1CX9A 1FDZA 3S2LA 2Y5EA 3NDYA 4DF0A 3WO8A 2E6YA 1B9ZA 2G41A 4F0RA 1XPGA 4BCEA 2CHNA 1BLIA 2Z27A 3HJEA 2Y2WA 4HK7A 3AROA 3TYZA 2FVLA 1KO0A 1RK5A 3VFCA 2OXNA 2GOKA 2X41A 1EIXA 1BXBA 3U2CA 2V63A 4AD3A 4FNPA 3A3XA 4RDYA 2CXEA 2DSVA 1ENUA 1SZEA 2XINA 3CZJA 1TJ0A 3GDKA 4UCFA 3WJWA 1XINA 2Q3OA 4ZO6A 4HIBA 1QI5A 2QMKA 2Z1VA 1E56A 3STGA 4QBXA 5LHFA 2GK1A 1VH7A 3PFMA 6REQB 3LGEA 4XD5A 1OFBA 1XISA 3YPIA 2OO0A 4NUWA 3VCRA 1PEZA 3G2GA 2AQVA 1YTEA 5JIWA 3FSUA 1I45A 1W5OA 4JZ5A 1R9ZA 2VHLA 4MOZA 1OSEA 2R9RA 1W5NA 4H7ZA 4XIMA 5AY7A 2W27A 2H3DA 2H3BA 1US3A 2IPFA 3QSRA 3VA8A 2ZZ6A 2Y0FA 2AGKA 4YS1A 3W83A 2C14A 1WE5A 3LU2A 3FV9A 1ZAJA 3NIYA 4Q22A 4JTFA 2PDJA 5DCDA 4UXDA 2QCGA 3GKFA 1AJ0A 5GJNA 3LXAA 3A21A 3WLLA 1TTIA 2NQJA 1F3TA 3H2FA 1H09A 1IXOA 1JVNA 3FCPA 3MKCA 2DH2A 3ATYA 2DSZA 3PBVA 2E9LA 2PCQA 3UZJA 1XDMA 3APGA 4PTVA 4G6CA 3ARVA 1YTKA 3UR7A 4Q7IA 5IHRA 1WX0A 5C2GA 4GWEA 3MO7A 2E6AA 4ZODA 3G1SA 3H2CA 4BS0A 5AYBA 5HINA 3WIJA 3M5VA 3S6DA 2WK2A 2ZXDA 5I6SA 2QDHA 1XH2A 2KZHA 4S1FA 4AC1X 2WZEA 1B57A 2O92A 1PV8A 7TAAA 1XM3A 1M65A 4UTIA 3NZRA 5FF7A 5F4WA 4JKKA 3EWCA 3VE9A 2QV5A 3FVDA 1NOUA 1SW0A 3BJTA 2D2OA 3ZQ9A 3DCPA 1J4EA 4B5TA 3ORWA 1EX1A 4C7FA 1RCQA 4UC5A 4AB4A 2PUZA 2V5BA 1JCMP 1ODZA 1SU5A 3RX2A 1NFGA 1KR1A 4IMDA 1ADOA 4JFSA 3DFQA 4NQ1A 5B7ZA 1LQAA 3AICA 3PY2A 3Q45A 1KGUA 2DPEA 3MHFA 3IV3A 1VBHA 3RK8A 4BKNA 3I6RA 1GYNA 3M0HA 2O9RA 1CXHA 1QAPA 5BU6A 3MSYA 4PB3A 4KCVA 3GSMA 2G3FA 5LNRA 3RNDA 4GOAA 4C6CA 1ME9A 3KTXA 2VYOA 5ABGA 3TMQA 1HJXA 1R9YA 4IQEA 1DVJA 5FD0A 2Z2BA 1H0GA 3V5OA 3EKGA 2VURA 3N15A 5G1MA 1JZ7A 3GC5A 4HK5A 3UR5A 3ONCA 4WKFA 5DELA 1A80A 1OZQA 2BOEX 3UXKA 5DMLA 3FAWA 4F40A 3OZPA 4BJHA 1JZ8A 2ZZ4A 1E40A 3CMGA 4M80A 3WUEA 4JTAA 3CHEA 1B0IA 2Z00A 4JL1A 4MJZA 4JY9A 2NWSA 4N6EA 4FAMA 5C9ZA 4JDBA 1BXNA 4UFLA 1EBHA 1UP0A 1DHPA 1IZJA 4JIQA 5T91A 4H6RA 4S3DA 1OCJA 2OYKA 2C19A 5M17A 1FTXA 1CPUA 3W07A 2HZGA 4HT3A 4QR6A 4MDOA 5AHLA 1BF6A 2GVYA 2ZXBA 1YPIA 1T8XA 3EB3A 1XLDA 2PDHA 2VFHA 1A5LC 2I7GA 3WF1A 3W23A 3QBUA 3WX7A 5D8ZA 2VO5A 1H1YA 3LCLA 4DUWA 5D37A 3ZS4A 4NKCA 1SZGA 2BY2A 3WQ8A 3DH7A 3GNRA 5C2XA 2A6LA 4RZ6A 4QCEA 2G4JA 1DJGA 2EAWA 1H7PA 3MWCA 3IIPA 4J3VA 1U5VA 3BJSA 4L56A 3MI6A 2F9RA 2PDFA 1RHCA 2KX9A 1M7XA 4JTKA 2DV0A 1ISWA 2O9PA 1OCBA 3OG3A 3K2GA 2XM1A 3VILA 4PMRA 4XKYA 3KHJA 1FA2A 5EA9A 3B8IA 1R7OA 3NVTA 1UPMB 4QDMA 2ZXQA 3W70A 3SGGA 3NYDA 4D72A 4DY1A 3DI1A 5ABTA 1SO3A 3REQA 1E5JA 5KETA 1KXQA 2TRSA 3PTKA 3WDPP 2GLKA 3MUIA 1I60A 1DYSA 1XLAA 3CXOA 3D0CA 4ORMA 2RJHA 4C7DA 2ZX7A 4IICA 1TJ1A 4LJ3A 3T7VA 3VM5A 4FLOA 3B3DA 5HMSA 3SW6A 4DJFC 1WUEA 3PZTA 5GVJA 2XN1A 3PBMA 4C5YA 5EU9A 4O16A 4GRSA 3W0KA 2Y8UA 2GVEA 3APTA 3KBVA 5LHEA 3BQ5A 3OHIA 1EOKA 1VLIA 1B90A 2PP0A 3TLLA 1XLEA 4WDTA 1F2JA 2WJFA 4ZB5A 2FZNA 1E51A 1RR2A 1CXLA 1EUAA 3FAXA 2CW6A 3MYPA 3PTDA 1IR1A 3ONBA 1GOOA 4GPNA 1Q6RA 1O1HA 1JXKA 3E12A 3JVAA 3KOZA 1KFWA 5HR7A 3FY1A 1I2QA 1EGZA 2ANUA 4I3GA 4Z08A 2NT1A 4JQ3A 4FHAA 2E67A 4LYRA 3P81A 1WA3A 4MY8A 2C16A 4NJGA 3VOFA 5C9WA 4TX8A 4J1OA 4PRRA 4NYUA 4JTHA 3CQHA 1ZP4A 5GJMA 3VNKA 3T05A 4N02A 4Q4MA 4LVDA 4C6QA 3UPBA 2OGJA 5HXMA 2CCRA 2VVSA 5FCZA 2XISA 1K7FA 4H9UA 3L4TA 3VGDA 4D1IA 4JFUA 1XDLA 2BB0A 3V4BA 3B8WA 4NIRA 1R3QA 5HR6A 5H2ZA 1E0TA 2YXXA 4E3TA 1E70M 3M07A 3GZAA 2FHCA 3I7QA 4NNBA 1DQUA 3TMLA 3AS2A 3CUXA 1TPC1 1O95A 3VOHA 3KAOA 3P8IA 1JYVA 1ZL1A 3UT0A 3V18A 3QF0A 2WM0A 3MI2A 9CGTA 4EXAA 2WSPA 3TQVA 4DWSC 3KBJA 5JBEA 1W32A 4EF9A 4HSNA 2NXGA 4LC8A 2HK0A 1Q8JA 1VHCA 2B7QA 5F4SA 1WBHA 2ISVA 1JUKA 3C5QA 1BWVA 1UR8A 3F2DA 3V75A 3BXWA 3KL0A 2X7VA 4LAOA 4MB1A 3KVJA 2C3ZA 4ES4A 2H6RA 4A22A 3OB8A 3PSVA 4I8DA 3BZGA 3JZEA 1OZMA 1W3LA 5E9AA 1UR0A 3QZEA 2QIWA 1Z69A 4UTWC 1DJYA 4DF1A 3UXAA 4MTVA 1HN1A 1F76A 2ISSA 4F66A 1W3KA 4AF0B 4EXQA 1W1B1 1EEPA 4LUJA 2GJLA 4CQ9A 4NU7A 4QG8A 4HU8A 1EO7A 3ANYA 3RJYA 1OC6A 1E73M 3P84A 1VRDA 1JYWA 1XLFA 2XIBA 3SSZA 4LUIA 3ME3A 1KM2A 2JK2A 4RDVA 3TZNA 1ECEA 4H41A 5I3DA 2JKAA 2TSYA 4XO7A 3NM3A 1KGXA 1F4HA 4CNNA 4NAFB 4UNIA 4GFIA 4NZ1A 3RX4A 2ZDSA 3IIXA 2Z6JA 3KTSA 3MCNA 1XLGA 6A3HA 5HBFA 3H7UA 3B9NA 5E6YA 2PODA 1GJWA 3UWZA 3HV8A 4BI6A 3OLGA 3STCA 1Z48A 3SUUA 1EEXA 2ICSA 4Q3MA 2XIMA 2J66A 2QGYA 4ATWA 2F6XA 5XINA 4M7SA 2UY5A 3FK4A 4D2JA 1VJZA 4GQ0A 2HDJA 3NQEA 4JFVA 2QZRA 1W1TA 4ORIA 4LQ1A 4A05A 1B54A 3ZR4A 1PKYA 1XLLA 3WH8A 4QG9A 4C6NA 2ADAA 1QOPA 1C7TA 1KLYA 3MTWA 1SMAA 1DIDA 4N4PA 5I03A 2QULA 3NTYA 2ZC8A 4AQLA 1UQZA 1L0PA 3T4CA 1AD1A 3TTEA 1OWQA 1PUDA 5KZMA 1XSJA 4FOUA 3KTCA 1QUMA 2OT1A 3AZSA 1BGAA 2XUCA 3MC5A 3T07A 2WVVB 4HYVA 2UY2A 4PUNA 2OR2A 3O0KA 3VD5A 4KBXA 1AQMA 2HWGA 4RCXA 4Q8QA 2OYMA 1Q45A 4TXEA 2CBVA 2PD5A 3NZQA 2H8XA 1R3TA 1J6PA 2QCLA 4DJED 3B9EA 2ACSA 3POHA 1IXNA 4KWUA 1OYCA 1AH3A 4GFSA 4WVXA 1KWGA 5CJ5A 1B4EA 4J9JA 2BY1A 2WZTA 2WMFA 1KWKA 3TV8A 2XFYA 3KLLA 4PR4A 1F6PA 1OEPA 2W0UA 2J77A 2FTPA 2EPHA 1ZAIA 2XIOA 2P50A 4JGDA 4G1KA 1SJCA 1XIJA 3AUOA 1PJ9A 5FEWA 4O12A 1KCXA 1ZQ5A 3CIXA 1QFEA 1OF8A 1XH1A 1T40A 3TYCA 1BTCA 4Z42C 2WNNA 4XD3A 2CLEA 3BLEA 2J9YA 1DPMA 1PTGA 5AC4A 3LGDA 2X40A 2CLHA 4OECA 3M9YA 1MUMA 1GVEA 2ZX6A 4B5SA 3C3UA 5AECA 2GWGA 3GTFA 2WOQA 2EXOA 3R5EA 3RXZA 3SIMA 4DEFA 3BLDA 1F9CA 1YADA 4IQJA 2YDAA 2DSUA 4L7ZA 2YCJA 5FL1A 1TPUA 5CKSA 1H60A 4IISA 2VQUA 1J96A 3LQGA 3SEPA 4NY2A 1E1EA 1AH0A 1O12A 3SN4A 3K30A 3W53A 3V36A 4DPQA 4C91A 1UH3A 3VD9A 3GW0