2V3GA

Structure of a family 26 lichenase in complex with noeuromycin
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
273
structure length
273
Chain Sequence
GLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSWGSQWQSFDQVFSRAYQALASINKPIIIAEFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE H
publication title D-Glucosylated Derivatives of Isofagomine and Noeuromycin and Their Potential as Inhibitors of Beta-Glycoside Hydrolases
rcsb
source organism Clostridium thermocellum
total genus 110
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2v3gA00
4DWSA 1M7XA 1QI0A 3PZUA 3VD4A 1BSIA 2WMIA 4V28A 2WVVB 1QW8A 4R5EA 4AC1X 3MV01 5A6KA 3CO4A 1EH9A 4AZCB 3CMJA 4P8UA 5BRPA 1UD3A 2VCBA 1CXEA 1FOBA 2WB5A 1H41A 3VGGA 2PB1A 1B3ZA 4GZIA 4HMCA 4Q7NA 1VFUA 4UR9A 4CU7A 4DUWA 5IHSA 1W3HA 1SMDA 4DWSC 3WN6A 3W37A 1TCMA 5EB8A 2CERA 4WIWA 3WD3A 1CYGA 4AZGA 2A3AA 4OOZA 5D9NA 2UY3A 4UOZA 1LG2A 1V0KA 4W8BA 2VC9A 3ZJ7A 2BXZA 3T0DA 1CGXA 4TVUA 1LL6A 2WVTA 2G3MA 3VIJA 1UR1A 1Z32X 2EBNA 2WMHA 3ZO9A 3PZ9A 1DEDA 2EPLX 3AFBA 5GNZA 1J9YA 1JDAA 3UG3A 3WH5A 4C7FA 3QHNA 1ZBCA 3AXHA 5I0DA 3AXIA 1M01A 3QHOA 1JYVA 1HJUA 2BHUA 1E6ZA 1ECEA 4BQ5A 4UZSA 1EDTA 1OD8A 4JHZA 1EGZA 2WHLA 4AZ5A 1NM9A 3M6DA 3AMLA 3VOCA 1QNOA 2OYMA 3CUHA 3AS3A 1GONA 4P7LA 1ZBKA 1QHZA 4JFUA 5DF0A 1UA7A 1HKIA 1E40A 3AIBA 4RE2A 5EFDA 3VIGA 1DTUA 3A4WA 3NIYA 4EKJA 5D9MA 5DT5A 2WZHA 3WF1A 3HJEA 4D72A 1JYNA 4PMQA 3O6AA 4WLCA 3T2OA 3THDA 3IJ8A 5D4YA 4D6FA 2ZXBA 1US3A 4IISA 1E6SM 3BSGA 1MW3A 3EDDA 1QNQA 1WDPA 5GQBA 3GM8A 1EXPA 4GI8A 3POHA 3W28A 1CGYA 2ZX6A 3AICA 2WZEA 3MMDA 1R86A 5FL0A 3W27A 4AW7A 2AMGA 1HN1A 2WMGA 1QI2A 4AIUA 1FFQA 3SUUA 3ZMRA 2UWFA 4PYSA 3KZSA 4JL1A 1KGUA 4KMQA 5FIPA 1W1PA 2O92A 1FP9A 3PZMA 1NWRA 5ABFA 5M03A 4PMZA 4KGJA 4GPNA 4PEEA 5A6SA 2J74A 4UQCA 1CGUA 1VAHA 2J77A 4XZWA 4W7UA 4QCEA 2D22A 2A3BA 4QFUA 1DWHM 3VDHA 1NWSA 4CVUA 3EDKA 4ATDA 4EE9A 1QHPA 1WZAA 3CZLA 2FHBA 2YLLA 1CXFA 1SMAA 1W3KA 3SCVA 3AISA 2VTFA 4W84A 3WDIA 2C0HA 3W0KA 3CMGA 1A47A 4PBGA 1ODZA 3PTQA 1YHTA 2VZOA 4DM1A 1LG1A 3DC0A 7CGTA 2G41A 3CPUA 1PZ2A 4X0NA 5A94A 3WDRA 5A6BA 4GXPA 2BNJA 3AIWA 1GJWA 4DWSD 1GQIA 1KCLA 2DDXA 4AYSA 3AMDA 1GJUA 1M04A 2CKSA 1V6UA 2XJ7A 3CUFA 1AQHA 3AHYA 4P8XA 4D1IA 5C71A 2J7FA 2NSXA 1R7AA 1PZ3A 4XV0A 3VO0A 4ZEPA 4MJ2A 3W6LA 4UFIA 5I6SA 1E71M 2FGLA 3U5YA 2GJRA 3LMYA 1RH9A 5BRQA 1EOMA 4W93A 4MB4A 4JKKA 2WBGA 2VQUA 1UHVA 4HMEA 5I78A 1ZBVA 3SCQA 2XWDA 3EYPA 1BLIA 2AOSA 1PX3A 3F4VA 1Q6GA 4B9YA 4UFKA 1JZ5A 1V08A 3AOFA 3AI0A 3MANA 3W82A 1HX0A 1CIUA 2EO7A 5A6MA 3IJ7A 2J7BA 2IXVA 2D1ZA 3WD4A 2Y2WA 1XGZA 3VKKA 5AC4A 1V3LA 2FGZA 4PTVA 3RJYA 2ZUMA 3W25A 3GH5A 2VURA 4PRWA 2EEXA 5HPCA 2CNCA 1B9ZA 3RO8A 2NW0A 4QLJA 3WIJA 1IT0A 3SURA 2OWWA 1BVZA 2XSAA 3A4XA 4LPCA 4DUXA 2J75A 2WMKA 2BY1A 4D6IA 3CUGA 3FNDA 4URIA 2FHCA 4U2YA 1E6RA 2WYSA 4PCTA 1HL8A 1W2VA 3OGSA 2YBTA 1UKSA 4JFVA 3VMOA 1J01A 1BYDA 3VX0A 4GQQA 4GI6A 1E70M 2OWXA 5FOOA 5BCAA 2JEQA 3O9NA 4MB5A 1GW1A 1VEPA 4U33A 1C92A 2PBGA 4YHGA 4CU6A 2XSBA 3QR3A 1JXKA 2E8YA 4H2CA 4N42A 1HXJA 3WDHA 2WC7A 5CPQA 5CQ1A 1CENA 1W91A 5E6YA 5GPRA 2OLHA 2X0YA 1QHOA 1UWIA 3AMGA 1L8NA 1C91A 5A8QA 1J0HA 1U30A 1G01A 1BGGA 2E9MA 1OIMA 3PN8A 3K4DA 2BHZA 2BVDA 3AROA 3WQ8A 4EK7A 2BY0A 2J78A 2QMKA 4Y7EA 1DWGM 2WK2A 4D71A 4M80A 4PMDA 4ZENA 1VFOA 4J7RA 1BYAA 5EMYA 5AYBA 4BA0A 3UG4A 3SCSA 3RM8A 4H8VA 3AHVA 3VGBA 3SCUA 1ISYA 1XRVA 2CKRA 2O9TA 5HNNA 3VD3A 4HA4A 1CLXA 3RDKA 4UTFA 3ECQA 4V27A 2YL6A 2CBIA 2Y4SA 3TONA 2WCGA 2J79A 1PX8A 1LL7A 8CGTA 4BF7A 2HVMA 1RP9A 3VGEA 1W9PA 4D6JA 4H8HA 4GIAA 3UERA 1GPFA 3BGAA 1BVNP 4J3TA 3EMZA 1UKTA 2DPEA 3WQ4A 4AIEA 1F4HA 5E09A 3ZOAA 2J62A 5M5DA 3RM4A 1E0WA 5A6BD 4ACYA 1D3CA 2JF6A 3K8LA 2GK1B 3KE0A 1CGTA 3MS8A 3BLPX 5D9OA 1GUVA 3ALGA 1GQJA 4AD0A 2OSYA 1Q6DA 3VM7A 1PBGA 4AY1A 3WMBA 1JL8A 1GQKA 2F8QA 1ODUA 3GDBA 2VO5A 1DWAM 3J7HA 2ZUUA 4UFMA 1KXVA 1M53A 2DH3A 4WJXA 4AZ6A 1UA3A 4E8CA 4AD2A 3ARZA 2JIEA 1PX4A 4W86A 3WF3A 1P6WA 2E0PA 2YKKA 4QLKA 2V3FA 1FH7A 4TVDA 2W63A 2XGIA 3WH7A 4ATWA 4A3HA 3ZJKA 1I1XA 3WNMA 4ZXOA 4E2OA 3NSNA 1B0IA 3EDEA 3WELA 1GVIA 2VR4A 5LA1A 6A3HA 2WLZA 1FP8A 1R87A 1OWQA 3CTTA 2Y8VA 2PWFA 1UQZA 2D0GA 2WCSA 1WZMA 3RPMA 4FLRA 1CTNA 2EPNA 3WD2A 2DSWA 5ABEA 3OLGA 3PHAA 5FCZA 2WVSA 1WDRA 4PMUA 2ZUTA 4Z2HA 4BCEA 3D3AA 3VPLA 2GSJA 1H11A 1K9DA 2VZTA 4H41A 1VEMA 2OSWA 2WKLA 1JAEA 4UFLA 4NSBA 3N12A 3ZSSA 4PUDA 2YA0A 2JFEX 4GQRA 1GOKA 1VJSA 2WM0A 4OUEA 5CG0A 1B30A 1CBGA 3DHUA 2GFTA 3G6LA 1XSIA 4W89A 5A6AA 4KH2A 3OGVA 5JBEA 5E0FA 3WNNA 1EA9C 2VOTA 3A3HA 3AMCA 5DFAA 1VJZA 1JF6A 2BVYA 2O9OA 1FH8A 2VT0A 1MFVA 3AS1A 4M1RA 1EHAA 2VR5A 4LXFA 4PMVA 2GJXA 3NDZA 2QV4A 2WWDA 1E4NA 5D8ZA 4FF5A 4E4PA 1FA2A 3AYSA 2YJQA 1SYTA 3PZGA 1LWHA 3FAWA 2YDSA 3OIHA 3WNLA 3AJ7A 2VZUA 4AIOA 1OBAA 3GXFA 4XZBA 1NOWA 3BAWA 3T0AA 3DHPA 3WUGA 4MTVA 5A8NA 1AQMA 1Q6EA 2YL9A 4RL3A 3VNZA 5I5RA 1W32A 2VQTA 1JDDA 2G3JA 2WVVA 3FAXA 2YDRA 2XM1A 4AZCA 4IPLA 1DWIM 2JIWA 4CN6A 3AMKA 4Z2IA 1CGWA 4X9YA 1HL9A 2UY4A 1W2PA 3B9DA 1EDGA 1OT1A 4GI9A 2CBVA 2VL4A 1JZ7A 4UQDA 2DT0A 1KQYA 1C8XA 4ZFMA 1E5JA 5JBDA 1JD9A 1HJVA 3SCWA 3UEQA 5CGTA 2QHAA 5JIWA 2DSKA 3A6OA 1E6NA 1JI2A 4TUFA 2GUYA 2QPSA 3AHZA 2ZUWA 1HVQA 1UYQA 4OIFA 2ZXDA 4UZUA 1MXDA 3MSGA 5CLTA 3FHQA 1H49A 5A2BA 1Q6FA 3IANA 3K1DA 3WFLA 5E70A 3AZRA 4QDMA 3WH6A 4Z2LA 1UKQA 2WAGA 4MNKA 3ZJ8A 3N17A 5CPTA 2FH8A 3UESA 1K9TA 3IJ9A 1GOWA 4JZ5A 6TAAA 5TD4A 1BAGA 1HJSA 2JEPA 4DUVA 1K6AA 1HT6A 4Z2GA 3NUKA 1V6XA 3GNOA 3PZQA 1WKYA 5IFPA 2CPUA 4LQ1A 3WQ5A 4H04A 1WP6A 4WKAA 1QI4A 1PJ9A 1E1FA 3OLEA 1OGBA 3MUZ1 1QNPA 2WHJA 5FD0A 1ZL1A 3T0BA 4S3KA 3M07A 3OB8A 1HF6A 5ABHA 2DIJA 1B2YA 5FL1A 4Z2JA 1GQLA 1HJXA 3AZSA 4XB3A 3WL0A 1J18A 5IDIA 4M29A 1JD7A 1X6LA 4HZ8A 3DECA 4TTUA 4TX8A 1JXJA 4PTXA 2V5CA 1NARA 4YHEA 2OYLA 2VVSA 2BY3A 4KRUA 4HPGA 1MW1A 2ZOXA 4D6DA 1Q4NX 5E9AA 1CXLA 3VIIA 1MW0A 1UWSA 3CHDA 4H7VA 1VF8A 2WC3A 1XYFA 4HZ6A 3ARWA 1J12A 1H4PA 4J3XA 4NRSA 2VX5A 3VU2A 1WZKA 1UUQA 4PN2A 2DQXA 1GORA 2EJ1A 3OZPA 3ZJ6A 3OG2A 2J25A 1LWJA 1HKJA 3SUTA 4PSPA 2XG9A 4MB3A 3WDQA 3DYPA 2D0FA 4AEFA 1EDQA 3CHFA 1NH6A 1H09A 3GNRA 4PSRA 3WBAA 1GCYA 2BXYA 1UR9A 4HOZA 4CU8A 3GNPA 1IZJA 1E56A 4U5IA 5M3WA 1KGWA 4UQAA 5KZ6A 3OLIA 5A8OA 3GZAA 1WNOA 2YA2A 1UKPA 3KL3A 1KBKA 1J0KA 2DH2A 3UG5A 2X8RA 2WPGA 3CZEA 4JL2A 3HN3A 4HA3A 1UZ1A 1EOKA 2XPKA 2Z1KA 3ZIZA 4WKHA 1MYRA 3T08A 1VIWA 1CEOA 2VVNA 1HVXA 3ARSA 5DT7A 1MVYA 4CGTA 1QVBA 5AY7A 1UG6A 1NP2A 4P7RA 3PZNA 1OB0A 2V3EA 1VRXA 4QP0A 1G5AA 2XVGA 1UOKA 1BGAA 1E55A 3B9AA 1I1WA 1M03A 2VX6A 1EO7A 3MO4A 1GHSA 4PMOA 2JF7A 5D9PA 1J0ZA 5M17A 1BF2A 1C90A 2AAAA 3S2CA 3HMCA 3WEMA 4D6HA 1GOOA 1JIBA 4NRRA 1G0CA 1WO2A 4MAVA 1N82A 3GH7A 3OLDA 3MU7A 1UKOA 2B31A 2OYKA 3ARTA 3RMEA 2BVTA 2CBJA 3CUIA 4YN5A 1AMYA 1U33A 3EDFA 5A6LA 2XTKA 2XWEA 2YIHA 1KWKA 4M24A 5BROA 2WHKA 4P8VA 3BAXA 4OJYA 1XD1A 1KXTA 3B8SA 1UD8A 4BQ2A 3S6TA 2G8ZA 2WZIA 4TVCA 3WENA 1UR0A 5LA2A 1TA3B 3OGRA 1LJYA 3ARXA 3WUBA 1E6XM 3CIVA 3ZR6A 3SCOA 1WE5A 4B3KA 1B3VA 2E9LA 5DO8A 2VZVA 3VUPA 1VBUA 4HMDA 7A3HA 5BWFA 1AVAA 4D1JA 4F8XA 5I24A 3BAYA 2VI0A 2X05A 1OSEA 4IUGA 1HJWA 3NJ3A 2X0HA 2BHYA 3WDPP 1E43A 4AD1A 3AIQA 3BXWA 4U5KA 1R8LA 2XUCA 1JFHA 4OZOA 4FLOA 1K9FA 4AEEA 1JZ6A 4J3VA 3SEPA 5IHRA 1E6QM 4P7NA 1I75A 3OBAA 2XIBA 5JBFA 5KEZA 1U2YA 4ACZB 4HU0A 3W29A 4AISA 3WSUA 5C8BB 4LX4A 3VIOA 2FDMA 1XCWA 6CGTA 4W7VA 4UOQA 1VFMA 3NSMA 1HP4A 4ML4A 5ABGA 1ZB5A 5JUVA 3M7SA 4QCFA 4FLSA 2UY2A 5JIPA 3TP4A 4AXNA 2F61A 4L4PA 2XFFA 2ZX8A 1EIBA 1CWYA 4J3UA 1UH2A 2CITA 4S3JA 1XH1A 1HKKA 1ZS2A 2YBUA 2ZX9A 2CHNA 3EDJA 3BAJA 3VDBA 1C8QA 4J28A 5DMYA 4KRTA 2VRKA 1NOUA 4RE4A 1E3ZA 1KB3A 4U3AA 2WANA 1CPUA 3K8KA 1QBBA 4UQEA 5BYWA 3L4YA 4HU8A 4QLLA 4LYPA 1JZ3A 3MUAA 2X09A 4NI3A 4LYQA 3WNOA 3WMCA 3QGVA 4CCCA 2PC8A 4OKDA 5CZKA 2ZWZA 2GK1A 3CZKA 1V3HA 1XH2A 1ITXA 1EQCA 1NP0A 5IFTA 1V0NA 3CHEA 3ARPA 4L4OA 1OT2A 4M82A 1ZJAA 4JKMA 3VTRA 4BS0A 4MJ4A 4K68A 1MQQA 3WMSA 2VRQA 2YDQA 9CGTA 3QOKA 2PWGA 2YOCA 3GXIA 3KWXA 1YQ2A 3WQ6A 3EMCA 1DWFM 3W26A 1J11A 2CETA 2WBKA 1XSJA 3TA9A 2XYLA 2WWCA 1B1YA 1EQPA 4GO9A 2BS9A 4BZYA 1JGIA 3MMWA 1W3JA 1JNEA 1Y7VA 1KWGA 3AQUA 5CJ5A 1US2A 4TOQA 3WNKA 5CSYA 4MPKA 4MDPA 3VINA 3ZT7A 1JYXA 1UWUA 4IPNB 3VMNA 4RE3A 3WF4A 3L2LA 2TAAA 2BFGA 1XC6A 2Y8KA 3AIRA 3U5UA 3F5KA 1UR2A 3UETA 4CKQA 5HBFA 1W9UA 2C7FA 2DT1A 2X1IA 1E6PA 1R7OA 4F79A 4NZCA 4CUCA 3VIPA 3OZOA 4JCLA 3WD1A 3GBDA 1GVYA 2D0HA 1OINA 1AQ0A 3JUGA 5BXTA 2DSZA 3N04A 4MNJA 4HP5A 2XVKA 2ZXQA 1MWOA 5AYIA 1G94A 1V0LA 3K4AA 2JE8A 1UR8A 2ZUSA 1EHNA 1PAMA 1E4MM 2QF8A 4B15A 3PZVA 3VGHA 5ECUA 4MNMA 2RGMA 2QLYA 4CD4A 4Q22A 4WSJA 2A3HA 3VIKA 4CCEA 5EBAA 3A4AA 4ZE5A 4F9DA 2D3NA 1DWJM 1QI3A 2YL5A 2XVLA 1KR1A 2EPKX 2W67A 5DEZA 2XFYA 3L4XA 3RCNA 3QHMA 1S46A 1TVNA 4U3CA 3AHTA 3DYOA 1UR4A 3BSHA 4JAWA 5I2UA 2VX4A 2A3CA 1BFNA 1TG7A 3MKKA 1UD5A 1WDQA 3ZT5A 3BCDA 4QAWA 5E6ZA 3KL0A 4C7DA 1V03A 1UH3A 2ZUVA 3ZR5A 4W87A 3AS0A 2J7DA 4DWSB 2VMFA 2WMIB 1V3JA 2E40A 1K9EA 1JAKA 3A47A 1JZ2A 2PWDA 2WNWA 3WBEA 3SCPA 1KXHA 1CXIA 4P7OA 4EAMA 1WAWA 4KWUA 4M81A 3ARYA 3PTMA 2J47A 1J0YA 1WZLA 2J7GA 3FN9A 7TAAA 1XHGA 4AD4A 1VFFA 2G3NA 2NT1A 2V3GA 4ATLA 4AD5A 3VILA 5D8WA 4C7GA 3AYRA 4XUYA 2Q8XA 4TTGA 1HJQA 4PMYA 3K8MA 1G9HA 4PTWA 4KGLA 1CXHA 3FHAA 2MANA 2J7CA 3WUEA 2D20A 3I3EA 2J8FA 1H3GA 2W61A 3LPGA 2V5DA 1DHKA 2E3ZA 3L4TA 5A8PA 2WMJA 2UY5A 1JYWA 1UQYA 3ARVA 1TE1A 2XVPA 1OM0A 1X1NA 3ARUA 1NWTA 3KEHA 3N18A 1QNRA 2Y24A 4OBRA 1PIFA 4J27A 1E72M 4P7QA 2CCRA 2J7HA 3NCOA 1WB0A 2CHOA 3N1AA 1OCQA 1OGSA 4LYRA 3N9KA 3VM5A 5CGMA 2YA1A 4W8AA 3BLKA 1HKMA 3SCTA 4JHOA 1H1NA 1C8YA 1KGXA 2FH6A 4AZHA 1TFVA 2WHMA 4DM2A 1XYZA 4OBSA 3CGTA 2CESA 1PIGA 3RM9A 2QPUA 2ESCA 2ZE0A 3U7BA 1D7FA 5C70A 1UWTA 4UFJA 1ZJBA 3UR8A 1QOXA 3TTSA 1R85A 1SFSA 2W62A 2O9RA 3VD7A 3O2LA 4W88A 4WSKA 3VX1A 1E4LA 2WSPA 3SCRA 3LPPA 3GBEA 2XIIA 1BQCA 1TUXA 3AIVA 2D24A 2EXOA 1TZ7A 1Q6CA 2E9BA 2EPMX 3RIKA 2EQDA 5ABFB 4AZIA 2WMFA 4JFWA 1FHLA 3AS2A 3L4WA 2DGAA 1MW2A 3PZIA 2XFRA 3BC9A 1OGGA 2RGLA 1C93A 1NQ6A 3VDAA 3QOMA 2VJXA 5A95A 4MDOA 1TR1A 1ZU8A 5HOSA 1UZ4A 4CD6A 1B3YA 1V3IA 4HZ7A 1V6WA 3VDCA 3WH8A 1RPKA 3NSXA 1HNYA 1V0MA 1G1YA 4B16A 4UFHA 3T2QA 5A69A 3VIHA 1JZ4A 5A2CA 4LGXA 3L2MA 4MB1A 3WEZA 4JFTA 1JI1A 2XGBA 2Z1SA 1CDGA 4IM4A 5LA0A 1CGVA 1KQZA 5I79A 1E0VA 3VGDA 5CLWA 1ISVA 1BPLB 4HPHA 2ZIDA 2BV9A 1W1YA 4W5ZA 5A8MA 2V38A 4W85A 1LF1A 2WCAA 2VUYA 3VMPA 3PBGA 3EBVA 5AC5A 3WQVA 1KFWA 2WC4A 1JF5A 5A1AA 3WD0A 3BCFA 1V6YA 2DT3A 3TOPA 1KBBA 1V3KA 2ZICA 2BY2A 2VNCA 1W9XA 1RP8A 4HA1A 5HDRA 5I77A 2J4GA 4JFSA 3TTQA 1W9DM 3KL5A 3WF0A 3WDJA 2J8GA 3ALFA 1CECA 4GKLA 5A3HA 1WPCA 2WXDM 1UD6A 4PCSA 2ZX7A 1O6IA 1B3XA 1LLOA 2IUZA 4EANA 4WF7A 3AIEA 1ISWA 4CD8A 4D6GA 3APGA 2W92A 4MAZA 4CVWA 1UD2A 3I3DA 4F9JA 1UWQA 4UOJA 2CYGA 2NT0A 1L0PA 1FFRA 4GO8A 5E0CA 1E3XA 1A3HA 3UR7A 3THCA 1KXQA 1QBAA 3NDYA 2EPOA 4NF7A 3TTYA 3WH9A 3AZTA 1XD0A 1JDCA 4AWEA 1ISXA 5I23A 3CUJA 3PZOA 1H5VA 5HPOA 1ISZA 4ZE4A 3VD9A 3BH4A 1B90A 4H8UA 1TMQA 3CHCA 3PZTA 2VRJA 3VGFA 1VB9A 1C7SA 1LL4A 3F5JA 3WKZA 2WVUA 3N11A 4HTYA 3WY1A 3WUFA 2GDVA 1HIZA 3AIUA 4UQ9A 4UCFA 3IAQA 2CXGA 3VVGA 2E4TA 3NYDA 4XX6A 4M8UA 1GOIA 2ZWYA 2VZSA 2D23A 4CD7A 4X0VA 5EFFA 2CEQA 1PEZA 4P8WA 1GZJA 3W53A 4B3LA 1WDSA 3N13A 1TA3A 4M56A 1XV8A 4PUEA 2IXUA 3BMVA 4GINA 5BXSA 4F66A 3VD5A 5HXMA 1W9BM 1OD0A 3W4RA 3T09A 2W4XA 4PMRA 1QNSA 2E8ZA 4U2ZA 1E5NA 4GZJA 3RJXA 2YL8A 2PI6A 1GNXA 3ZQ9A 4HOWA 3FY1A 2VCCA 3WNPA 1V3MA 1J0IA 2GVYA 4MNLA 2ZXAA 1W1VA 5GNXA 8A3HA 1PPIA 4J3WA 4WK9A 3L4UA 3I3BA 2PWHA 3W38A 4V2XA 3F5LA 3MUIA 4TXEA 3U57A 3D5HA 4AMCA 2VCAA 4BQ3A 4ACZA 3VIMA 1XCXA 3N15A 3E1F1 3SIMA 3LPOA 1V02A 1TVPA 1W1TA 2OSXA 1W9VA 3WQWA 1H0GA 3SUVA 3BAIA 1CXKA 3UCQA 3EMQA 1ESWA 3RILA 3SCNA 1MFUA 4CD5A 4WKFA 2YLAA 3GH4A 3ARRA 3GYCA 2F2HA 1UWRA 5F7UA 2PF0A 1JZ8A 4TX6A 4UNIA 4N0RA 2OWCA 1H0IA 1DP0A 2WSKA 3CZJA 3ZT6A 3VNYA 3CBWA 5GNYA 1E9LA 4OOUA 3OA5A 3AXXA 5FKYA 2WLYA 4PTMA 3U7VA 1BYCA 3G6MA 1E1EA 4R27A 1J10A 1XSKA 3PTKA 4AZ7A 3HU7A 1CZ1A 1FH9A 1ITCA 4D6CA 4AD3A 2WKGA 4W7WA 2V3DA 4HOXA 1MQRA 1BYBA 2J7EA 2GDUA 4W5UA 3FW6A 3IAPA 1IV8A 2XM2A 5LYRA 2JALA 4U31A 4CCDA 1GOMA 5I3DA 2Y5EA 1FHDA 2G3IA 3WF2A 1BG9A 3BAKA 1EO5A 1D2KA 1NOFA 1ZBWA 1W3LA 3BMWA 3ARQA 3VIFA 2QMJA 3FXYA 5BXRA 1MXGA 1SR0A 3B9EA 1CNVA 2XVNA 3WEOA 4AZBA 2DSUA 4Z2KA 4GZEA 3MMUA 1E0XA 1JFXA 1WCGA 2CIPA 3CZGA 4JKLA 3W81A 2CBUA 2DIEA 3MUY1 3SUWA 1O7AA 5CXPA 4FLQA 2XHYA 3SUSA 3WFZA 1GOQA 2DT2A 2W5FA 1X6NA 4CN4A 1VEOA 2GJPA 1B3WA 3II1A 2W91A 3CH9A 3CZ8A 3GXMA 3ZSTA 1UH4A 2D3LA 4J3SA 2WW5A 3M46A 1E73M 4YPJA 1QW9A 1V6VA 4CN1A 5CSUA 1BHGA 1E15A 1RD6A 3L4ZA 1BG4A 1VBRA 3MSDA 2ZX5A 1C7TA 4PMXA 4BQ4A 1QPKA 3DYMA 3IK2A 1VENA 4JIEA 2HISA 3L4VA 3WL1A 1GHRA 1F4AA 3TTOA 4FMVA 1JNDA 1B31A 3T2PA 2FHFA 4D6EA 4ZXLA 4B9ZA 2PWEA 3GTNA 3POCA 1LQ0A 1KR0A 3CLWA 2DEPA 3MV11 1CLVA 2G4FA 4UQBA 4W8LA 1IZKA 2GJXB 2A3EA 4A3YA 4FK9A 4PMNA 3W24A 4MADA 1J0JA 1UD4A 2X2YA 3ZM8A 4E8DA 5A6JA 1V02E 3AHXA 5A2AA 1C3FA 1H2JA 3K46A 1KCKA 1JG9A 3W6MA 4JCMA 1XH0A 5BXPA 2W66A 2C8NA 3GXDA 2VX7A 5IXEA 3LPFA 2O9PA 2PBOA 1BTCA 1HP5A 1OIFA 1NWUA 2ZUNA 5CPSA 2D2OA 4A4AA 1QI5A 2DSVA 1MQPA 1E4IA
chains in the Genus database with same CATH superfamily
2C79A 2GZXA 4V28A 1ONRA 2CLKA 3FLUA 3DIPA 1QW8A 4R5EA 1OEPA 4AC1X 4NAEA 5A6KA 4IPJA 4AZCB 3WZ0E 3N34A 1KC7A 5LIKX 2GGGA 5AKQA 3NZGA 4GZIA 4YMZA 4Q7NA 3EWXA 1XRFA 1MZRA 3SRKA 1SMDA 5K9DA 2NVAA 2RDWA 2AGTA 2J13A 3E49A 3W37A 1TCMA 3IGHX 2CERA 4K8GA 2ZQ0A 2VGIA 2PU0A 1EGMA 1HFBA 3E2VA 4DRSA 4ZQPA 1SGJA 1KBIA 2GQ9A 4ZB2A 3S42A 1UR1A 2EBNA 2BTMA 3V18A 1H7RA 2G50A 1JDAA 3UG3A 3BLEA 4NZ3A 4CNTA 3EA1A 1UBPC 1QO2A 3W1QA 3QHOA 4JY9A 4UZSA 2CLFA 4JHZA 1EGZA 2AAMA 3LCGA 3UT0A 3M6DA 1O94A 1VPXA 4NZ1A 4PL2A 2OYMA 4P7LA 1ZBKA 1K1DA 5EMMA 5DF0A 1FWAC 1UA7A 1FCVA 3AIBA 4RE2A 2WSYA 4A8NA 3C52A 5EFDA 3L0GA 2I7GA 5D9MA 4D72A 4LH8A 2QVHA 4FR1A 4WLCA 3SN1A 3IJ8A 2Y62A 1I2QA 2ZXBA 1US3A 1R2TA 1MW3A 3EDDA 2E6DA 1K70A 3TN5A 4GI8A 3POHA 3HPFA 1A5CA 3RR1A 3W28A 1CGYA 1DQWA 2ZX6A 4O57A 3MMDA 1R3SA 1R86A 4AW7A 3R7MA 1FFQA 2C1IA 3SUUA 1EWDA 3ZLHA 3WBYA 1H61A 1OFDA 3VNMA 3GUWA 4I6KA 5FIPA 1OFQA 4KGJA 3WLNA 4LF1A 5MKGB 1CGUA 2J77A 4XZWA 3UFYA 4W7UA 3DGRA 1OCBA 1JDFA 2Z7KA 1VFHA 2D22A 4TMCA 1DWHM 3O07A 3E2SA 1NWSA 4DQWA 4Q8NA 1FWSA 4ATDA 4FOJA 4EE9A 1QHPA 1WZAA 4QR6A 3CZLA 3TC3A 1MSSA 3NPVA 4TX9A 3CL7A 5AHIA 5F1UA 3E0WA 4ZO7A 4PUNA 3N2CA 1X96A 2WM1A 3TW7A 1A47A 8XIAA 4PBGA 5EPDA 3PTQA 1TQXA 1YHTA 4DM1A 1I45A 1VGAA 4XUGA 3M0YA 1JPMA 3LZ3A 1XFCA 3JVAA 4KWOA 4X0NA 4D9PA 3BE7A 3W1LA 4IOTA 1DJHA 3AIWA 1ZY9A 4DWSD 3LSCA 1VBHA 4A29A 1Q5MA 3HGRA 4PULA 1EX1A 3NQMA 2YW3A 3AMDA 2VP8A 3R94A 3BG3A 2RH9A 4IPIA 3ICJA 3TKFA 4IP4A 5G4WA 3NZQA 4MJ2A 4Z0JA 1NIUA 4E5TA 1E71M 2FGLA 3PWIA 3KOFA 3B0PA 3LERA 4XKMA 1AG1O 1XKJA 4YXGA 3O06A 4MB4A 1JEZA 2WBGA 3LBOA 3WMLA 2FFIA 5C9XA 5I78A 5HJYA 3GU2A 2X30A 1Q6GA 4B9YA 2FVLA 4Y9AA 3MANA 2PCEA 2EO7A 1JPIA 1SR9A 4K8EA 2J7BA 2R1PA 2D1ZA 1EJUC 3H2MA 3VKKA 1MRQA 1MNZA 4PTVA 3RJYA 4B5TA 2ZUMA 4ZMGA 2VURA 3K5XA 2EEXA 3FGCA 3SIZA 3UZZA 4X63A 1B9ZA 4DF2A 3RO8A 1IT0A 1V7YA 1BVZA 3N6QA 2EG7A 4XO7A 1FWIC 3FSTA 1UIOA 1ZJHA 3CUGA 2OEMA 2E67A 3FNDA 4U2YA 1E6RA 1VR6A 1I0BA 1HL8A 2G37A 2W27A 1HTIA 1LORA 4B2DD 4OFCA 1J01A 1VH7A 3NXFA 1SSDA 1E70M 2OWXA 1GPWA 3NDOA 3UXIA 5BCAA 5FOOA 5B7YA 1GW1A 1LT8A 2PBGA 4CU6A 2Y7FA 4N42A 4KWWA 3M64A 1S1RA 3WDHA 1YW1A 4IF2A 5CQ1A 1K7FA 2HVOA 1CENA 5DRCA 1QHOA 1UWIA 3AMGA 4GRSA 3ANYA 4DYJA 4BJHA 1C91A 5A8QA 1J0HA 1BGGA 2VFHA 3K4DA 2PDPA 4EK7A 3RO6A 3CQJA 4RX0A 2J78A 3NM1A 4Y7EA 1RVGA 1DWGM 4HYRA 3TYCA 3HQNA 3K13A 1SZRA 4XZMX 1X38A 3RLGA 4D8ZA 2BSLA 3LLDA 3OYXA 1KFKA 4ZENA 4J7RA 4FIRA 5AYBA 3T07A 4BA0A 3UG4A 4EF9A 3VGBA 1YYAA 3KXQA 1KFLA 4H9YA 3SFWA 1VIZA 5AHFA 1QPRA 5FJUA 1IR2A 4ERIA 3RDKA 2TPSA 4PBFA 4V27A 1EP1A 2Y4SA 1PWLA 3GHTA 1F8IA 4HA0A 2REQB 2YXGA 2A4AA 6PTDA 2PTXA 4LBUA 3P5YA 2D73A 4GGBA 3RNDA 2J9XA 1NTHA 3TVAA 1D3CA 1R3WA 2DP3A 1N55A 3M47A 3KE0A 4HN4A 4JICA 5D2WA 1GUVA 4IL0A 3TWAA 4AD0A 2HBXA 4QRNA 5EGRA 4R7JA 2YFOA 2DFAA 4XSMA 3VM7A 4AY1A 2Z6IA 1TTPA 3W7MA 1R3QA 4AU0A 3CWNA 3LM3A 4WJXA 1X39A 3WQEA 4E8CA 3ARZA 4JTLA 4GMEA 4IIGA 3W76A 1XQKA 2WV8A 4C6BA 3VC6A 2IPGA 2YKKA 4IX2A 1FH7A 2XGIA 4ATWA 4A3HA 3DEQA 3WNMA 3EGJA 4E2OA 1B0IA 3WJWA 3EDEA 4Q8QA 1FP8A 4RZ6A 1R87A 3UJRA 3BOXA 4PUWA 3R1ZA 1LTDA 1WXJA 1EBGA 1RVKA 2D0GA 2WCSA 4U4MA 2QCLA 3A4JA 2BVWA 3ABZA 1ZFJA 4KQNA 2WOQA 4EPDC 3PF3A 3E96A 4JR5A 2R8WA 5HNTA 4FR6A 3AU2A 1W5OA 4LC6A 4KIRA 4FX8A 4AX7A 3ID7A 4JX6A 1IT8A 1LRQA 3M16A 2ADAA 3W1PA 1YE6A 1DXEA 4Q4RA 4H41A 2DUAA 2XH2A 4QE4A 4NSBA 4NL1A 3BDKA 4PUDA 4L56A 5HINA 2BG5A 4GQRA 3TYZA 1GOKA 1B30A 3N2XA 3S9ZA 3GHRA 4F48A 3OGVA 5E0FA 4IIEA 1EA9C 3GRIA 3AMCA 5DFAA 6XIAA 1TRIA 3O6YX 2VT0A 3IIVA 4M1RA 1EHAA 2VR5A 4H1ZA 3ZS4A 3W9ZA 4Q3MA 3USBA 1TIWA 1UUMA 3G1HA 1DIKA 3LNPA 2WWDA 3G0XA 3AYVA 5D8ZA 1AW5A 1SFJA 5G5IA 4Y9NA 3FAWA 2V8ZA 3PUOA 2IQTA 1RJQA 4XBSA 3NO5A 3TA6A 1NSJA 4BR1A 4AIOA 3KW3A 2GOKA 4XZBA 4DBSA 5K4ZA 6TIMA 4IQLA 3BLDA 3VNZA 1R30A 1XLEA 5M2FX 1W32A 2FIQA 3DBNA 3NOEA 2WSRA 2Y1HA 2G3JA 3KRSA 2CLMA 1OYBA 3TH6A 1F5ZA 2X1SA 2B7PA 4IPLA 1WBJA 2JIWA 4O50A 1GWJA 2PTZA 4RDYA 1JUKA 2UY4A 3QMSA 1W2PA 2XGZA 4OVXA 2CW6A 3LXAA 3LMZA 4FNQA 3E74A 4UQDA 5L9FA 4ZFMA 3SCWA 1X6UA 2DZWA 3TX9A 5CGTA 2P76A 2Y6ZA 1FVPA 3ABSA 4LYKA 3PPHA 3ZVHB 3HTWA 3BJFA 1JJKA 3AHZA 1GKPA 1HVQA 1AFSA 3NQBA 4L9YA 4OIFA 3H24A 3MCOA 4RNJA 5A2BA 1Q6FA 4A8IA 3SRDA 1UKQA 5CAHA 3N17A 2FH8A 4O0KA 3VCCA 2YCLA 3KHJA 2Q8ZA 4KFNA 5HMDA 2G5WA 4DUVA 4V1XA 1OC5A 3AUOA 1PB0A 3LTPA 3UWZA 3WQ5A 3XINA 1WP6A 2A7NA 4H01A 5D30A 4JDBA 5T9BG 2FPYA 2JGQA 4IP5A 4POCA 1QNPA 4XD4A 4GA8A 5FD0A 1OHLA 4JPGA 4C60A 1ZL1A 4LCQA 1M7PA 4S3KA 2QUTA 5DMMA 1HF6A 2DIJA 2FB3A 4NAFB 4B90A 3UW6A 1BVWA 4GYKA 1J18A 3HM7A 5IDIA 5LKYA 1BRLA 3S2JA 2CXEA 4Z1YA 4GABA 3EZ4A 4HZ8A 2PLMA 4PTXA 1MRAA 4GYJA 3P74A 2YPIA 4WUIA 3IVTA 4HPGA 3TQVA 1ITUA 1Q4NX 1CXLA 4DJDA 1VYPX 2WJDA 3BWWA 3RPDA 2WC3A 3O0KA 4HZ6A 2OR2A 4I5XA 1A5NC 1DORA 1ME9A 4S3DA 1WZKA 2QIIA 4LVFA 2A2IA 4IJCA 4DB7A 4MG4A 4HHPA 4DUOA 4Z0SA 2NX9A 1H7PA 4PSPA 3WDQA 3LCFA 3WX7A 3TYEA 3KUMA 1XDLA 1BWKA 1H09A 2TMDA 1YTEA 2PLKA 2BXYA 3AALA 3QTGA 3NA8A 2Y8UA 3EKLA 4U5IA 2A1YA 5HATA 3GZAA 4L7ZA 5HJXA 4MZYA 4EXQA 2YA2A 2E25A 2DH2A 2QF7A 3UG5A 3LK6A 4RZBA 3HN3A 3LNMA 2FPTA 3IIOA 2DZVA 2I5IA 1W1B1 3P80A 1ZJIA 3KCLA 2VUNA 2Z1KA 1GYNA 4Z1BA 3QQWA 4WKHA 3GDRA 2VVNA 4J40A 3FA5A 4GVFA 3PK7A 4F0LA 1NP2A 3R6IA 1PS9A 1OB0A 2V3EA 1PO9A 2I1OA 1I2RA 3MB9A 4LCRA 1I1WA 2PDXA 1EO7A 1GHSA 3MWAA 4UTIA 4I9AA 4RZ4A 4U10A 5D9PA 1J0ZA 4GH1A 3CU2A 3QVQA 1FDJA 1TE6A 3ERPA 3TK7A 3VUSA 2FJKA 3S9IA 4NRRA 1UKOA 2VYOA 2X2GA 2CBJA 5A6LA 1U33A 3G3DA 1Z69A 2YIHA 3HG2A 1CB2A 1EP3A 1QTWA 3C8NA 4P8VA 2WSQA 3BAXA 5DY2A 3LHUA 4XO6A 1XD1A 4GD0A 1KXTA 3QSRA 5DXYA 4TVCA 4XIAA 2QQ6A 2HS8A 3UJFA 2O0TA 1TA3B 1VBGA 1XM3A 1FWEC 2I57A 3C5QA 1VS1A 1U5HA 4LAKA 2OPJA 3ZR6A 3HIJA 2V6AA 2OG9A 1XIDA 3W02A 1WE5A 4NZ4A 4OTKA 4LS0A 5DO8A 1LT7A 1VBUA 1V7AA 4HMDA 1ENUA 4WY0B 3W7QA 4F8XA 1WOBA 1RCOB 1OSEA 4IUGA 3BLFA 2RDTA 3L2IA 3W70A 3WDPP 1AJZA 1RLDA 2FMOA 4UR8A 3LV6A 1R8LA 1JFHA 1OFBA 1K9FA 4J3VA 2DQWA 3EPMA 4C6DA 2XIBA 1U2YA 3W1RA 1AL8A 4FP1A 4IHCA 4AISA 4YIWA 1W3NA 4LX4A 4MWAD 3QKEA 4W7VA 3NSMA 1QNVA 5ABGA 1PDYA 1ZB5A 3LRLA 3M7SA 4QCFA 4OT7A 3UY8A 4E3TA 4F2UA 4PTNA 4X9SA 2F61A 4L4PA 1KO0A 2XFFA 1EIBA 2Y7EA 1UH2A 1XH1A 3BV7A 7ENLA 3NQ8A 1HUVA 1FCQA 3GR8A 3EDJA 1YLVA 4IICA 2INFA 1C8QA 4J28A 5DMYA 3R13A 1S2TA 4RE4A 1NDVA 3UA4A 1YBQA 3PNUA 1FXPA 1MDLA 2BOEX 2X16A 3L4YA 4RDVA 2HDJA 3MUAA 1TV5A 4NI3A 3ITVA 3WK0A 2OZ8A 1PZ1A 1W1IE 3WBWA 1Q4WA 3QGVA 4PRRA 3IJLA 4DAIA 3CZKA 3T6CA 1NP0A 3QBUA 4L4OA 4DYKA 2WJEA 1XLHA 4BS0A 4MJ4A 3KDOA 1POJA 1MQQA 4DEFA 3KOZA 2YDQA 3B04A 3FKRA 2PWGA 4G2DA 3M0IA 4H6KA 3KZPA 4YU1A 3AJXA 2ISDA 3T05A 3NQCA 1XSJA 2WWCA 4QG9A 1JGIA 3MMWA 1R3RA 1RJPA 1V51A 2HE8A 3WLJA 4FNPA 4JEQA 3D0CA 5FEWA 3O6DA 3R8HA 1JYXA 4H00A 1RAKA 3UXDA 5FAGA 3NO3A 4RKAA 1R5YA 1PKYA 4M19A 3OHMB 2TAAA 1OJXA 2BFGA 2Y8KA 5BOFA 1PKMA 4CKQA 5K3VA 3LOTA 1E6PA 3VZYA 4F79A 4CUCA 3VIPA 3PVFA 4EVZA 3GBDA 2GPTA 3FCPA 3JUGA 3R4IA 1JULA 3N04A 4JTCA 4MNJA 4R3UA 1MWOA 3MA8A 3HG3A 3K4AA 4H9XA 1UR8A 3MTWA 1ZENA 4B15A 2RGMA 2DJLA 1QJWA 4J4KA 4AX6A 4CD4A 4Q22A 3MSRA 3VK5A 5TNVA 1HGWA 4H83A 3BL3A 3VIKA 4CCEA 4PEKA 3D6NA 4ZE5A 2YX0A 3HQ1A 4F9DA 2DVXA 1DWJM 3UNTA 5KTLA 3LCXA 2Z26A 1JCLA 1H7WA 2DJXA 1S46A 1TVNA 3RITA 3S9YA 3BSHA 3KBNA 3B0XA 2I16A 3WG6A 2BXVA 2C19A 1Z44A 3THAA 1LOSA 1WDQA 4QAWA 1LUCA 1V03A 3ITTA 1XF0A 1VLWA 3TC6A 2DZSA 2ZUVA 3R11A 3AS0A 4N9EA 3XIMA 1V3JA 3CO8A 5D2YA 1JAKA 5KMYA 2PDIA 3S1UA 5C0QA 1R38A 3KTSA 1P5BA 1Q7QA 4E3VA 3URQA 3RFAA 3ITOA 3E5BA 3LTYA 2ZA2A 4KWSA 4M81A 3LGGA 3TFXA 5TF0A 3PTMA 5XIMA 3WJZA 1WQ5A 1WZLA 2V3GA 3EX1A 3V0TA 5F2GA 3O8AA 4UTLA 4JNMA 3TUUA 1NY1A 1NAL1 1CX9A 3AYRA 2Q8XA 1RQEA 3VZZA 3K8MA 4FX6M 3HQOA 1CXHA 4BF5A 2J7CA 4ZBCA 3A13A 2D20A 2J8FA 5H8PA 3H2EA 3LPGA 4KF1A 4RW3A 1DHKA 2VWTA 1UR3M 5A8PA 3H6OA 2OLAA 3DOPA 1UQYA 3ARVA 3GZ3A 4LVAA 1YTKA 1X1NA 3C2OA 1KFBA 1YDVA 5AC7A 2J7HA 1OCQA 4JYEA 2UV8G 3S2LA 4L6DA 2OOFA 5D04C 1GKQA 5CSRA 4HNCA 5AZ0A 1XYZA 3CGTA 1PIGA 2ZE0A 4EPEC 4Q6JA 5HMSA 1D7FA 1FDYA 3G3MA 3QRHA 3CAKA 3UGVA 1RCQA 5DCEA 1JCMP 4W88A 1WKEA 2P88A 3LZ5A 4EP8C 4I6VA 5AHMA 3VX1A 3OHIA 3BARA 2ASHA 1BQCA 1TUXA 3UY7A 4ZOCA 2E9BA 2EPMX 3RIKA 3P0XA 2WMFA 5AYZA 3C61A 2X7VA 3AS2A 4Q8OA 3C2EA 1TZ9A 4QROA 3BC9A 1DKWA 1YDOA 4RPQA 3VZXA 4DJEA 1NQ6A 1CT5A 4DVOA 1ML1A 5HOSA 3KM8A 1J79A 3ANVA 3S0CA 2OQLA 4HZ7A 3VDCA 1RPKA 2CLEA 1FRBA 4INFA 5U7SA 4JTSA 1HNYA 3WK3A 4AG0A 3DC8A 2BGSA 1PDZA 4DJDC 1SZEA 3M43A 2F84A 5IBXA 3FYPA 2NQJA 1E0VA 3REQB 4PA8A 1BPLB 2W79A 4HPHA 1BWVA 5BMXA 2V38A 1C8VA 1LF1A 1TCDA 2WCAA 3VMPA 3PBGA 5AC5A 1KFWA 3GG0A 1JF5A 4K39A 3RCYA 3BCFA 5I3FA 1R46A 3TOPA 1D9EA 5H91A 2BY2A 1M41A 2L5HA 1RP8A 3DFTA 4HA1A 1DJNA 2J4GA 5D37A 3WF0A 2J8GA 4KCTA 3ALFA 1CECA 1TQJA 2WXDM 2MNRA 2IQDA 2ZX7A 4H3DA 4UTWA 1O6IA 3TJLA 4WF7A 1NQKA 2ANUA 2PURA 2HE5A 3INPA 3LQLA 3WLKX 2DW6A 2P0IA 2XH4A 3APGA 2W92A 1UD2A 4UXDA 2C13A 1GK8A 5F4WA 4UOJA 2Y7DA 1X97A 3U48A 3GX9A 2CYGA 4Q4QA 1IGSA 4WY0F 3W88A 1E3XA 2PFHA 1A3HA 4XAGA 1KXQA 3R0UA 1QBAA 3IJIA 4HKPA 4OGZA 4C6NA 4LV4A 3SRFA 1XD0A 1JDCA 4AWEA 3DFQA 3CUJA 3LGEA 3P8IA 5HPOA 1R3YA 3VD9A 1MEHA 5FJOA 4H8UA 1TMQA 3E5PA 1GZ1A 3CHCA 4JIRA 3C2YA 4GQBA 3PZTA 5C9ZA 1DQXA 4QNEA 1Q3NA 3L66A 3EEZA 2WVUA 3N11A 3WY1A 3BOFA 4Q8PA 5CZTA 3KTXA 2GDVA 1KM6A 3AIUA 2E4TA 1UJQA 4F2BA 1TV3A 2E5CA 2ZA3A 4X0VA 2J27A 3M6YA 3CUXA 2PDJA 1OYCA 1LWIA 3USZA 1XV8A 4BKNA 5HR6A 4MKVA 1MUCA 1WUEA 2IKIA 1W9BM 5HXMA 5DCDA 3ITGA 4PMRA 2GUBA 2Q8LA 1QNSA 2E8ZA 3RJXA 2YL8A 3AC0A 1EJVC 1GNXA 3RG6A 2OTDA 2QCDA 3PPFA 3OEXA 1TYGA 1UP3A 4GC3A 3IRSA 4WDXA 2W9MA 3IEBA 2ZXAA 3W87A 4WK9A 3DN5A 3I3BA 5HUOA 4DO7A 4UMCA 4AMCA 2VCAA 1S2AA 3AWNA 3LPOA 1W1TA 1W9VA 2CLHA 3WQWA 3N2OA 1H0GA 2B0MA 1A0CA 1CXKA 5ENLA 3RILA 3ARRA 3M5XA 5LIWX 1JZ8A 4MZ1A 4UNIA 4N0RA 4W4QA 1QOPA 3VNYA 5GNYA 1E9LA 3W1MA 4PL1A 2FZ9A 1OABA 1E1EA 3G6MA 4R27A 1J10A 3HU7A 3R79A 3TSMA 1TJPA 1ITCA 4PODA 4D6CA 1U1HA 4UIOA 4JTJA 4GFIA 1NJJA 4HOXA 1ZUAX 1BYBA 4LUJA 4W5UA 2Z00A 3IAPA 5LYRA 3H2OA 2JALA 4XD5A 4C6QA 4CCDA 1GOMA 4YLWA 5C5YA 1V93A 4AHQA 4H9VA 1BG9A 3I6EA 4P2VA 3NG3A 1P1MA 4H6QA 2V30A 2QMJA 1SR0A 3CAWA 2VDIA 3B9EA 1AW1A 1TUFA 2P5NA 3MMUA 4Q4PA 3CZGA 1OX4B 3LBMA 1O7AA 5CXPA 3STCA 1RHCA 4N9CA 2RFGA 5K9CA 3IV3A 4RNIA 1GOQA 3B8TA 3CASA 2DT2A 5E0KA 5FF3A 1FCUA 1W5QA 3OQ8A 2R9RA 3MSYA 1I6NA 2WQDA 1Q65A 5EMLA 3CZ8A 1UH4A 2XH0A 4J3SA 4DBEA 3ABQA 3B8IA 4JTKA 2HS6A 4KETA 4HMNA 1QW9A 2Z2AA 3GVRA 3O7UA 4LNCA 4HPNA 3L65A 1KBJA 3BGJA 3L4ZA 4YCPA 2F6UA 3GXTA 2FGBA 2ISWA 3TMLA 1C7TA 4HK6A 4RK8A 1QPKA 3DYMA 4JIEA 2HISA 3L4VA 2QGHA 4AHPA 3I68A 3WL1A 1GHRA 4FXFA 2FHFA 4H9ZA 3W72A 4B9ZA 2PWEA 4RCXA 1EJTC 5F4SA 3MV11 4GVHA 1CLVA 4ZGYA 3QKZA 3WK2A 1IWPA 3GAKA 2GJXB 3CB3A 4G1NA 3L5MA 1TO3A 2PTYA 3SAZA 1XBYA 3KBWA 1RUSA 2B81A 1J0JA 3S3GA 2X2YA 3QR1A 4S2CA 5A6JA 2ZVIA 2OFJA 3BVJA 5A2AA 3K46A 1KCKA 2OO6A 2W66A 2C8NA 4Y6GA 1Q2RA 5J8LA 2RUSA 3GKAA 5LNUA 4IGHA 4UB9A 3QMTA 4A4AA 1QI5A 5CBJA 4DWSA 3A9IA 1QI0A 4LALA 4JX4A 3VD4A 2WMIA 3FJNA 3E2RA 4QS5A 2WVVB 2QNEA 4GUJA 1PKNA 1IEWA 4P8UA 5BRPA 3CEPA 4NQ1A 3CT2A 3KBJA 1Q7ZA 3GR7A 4YWIA 1XLKA 3RX4A 1H41A 2PB1A 1B3ZA 3GNXA 4HMCA 3GSMA 1VFUA 3I7QA 1GTHA 1S2VA 1W3HA 2QJMA 4DX3A 5AHLA 1CCWB 5EB8A 1XRTA 3W2MA 1G4PA 2OZTA 3M0MA 5CPNA 1CYGA 4AZGA 4DBUA 3V35A 4UOZA 2VC9A 3ZJ7A 3ATYA 4TVUA 2G3MA 4NASA 4HHLA 5CPLA 2EPLX 3AFBA 3GDTA 1BKHA 4TO8A 1XKYA 4E2VA 1XQLA 2HPIA 4C7FA 4PUKA 1ZBCA 4MFEA 4N9DA 2Y85A 1W56A 4MSSA 3UPMA 1HZYA 4BFAA 1E6ZA 1A5OC 3GW0A 4BQ5A 3CTLA 4Z1DA 1FWBC 1W1ZA 3FEMA 2XIQA 4AZ5A 1GOXA 4HYVA 2V5KA 4MJZA 1ZALA 4C65A 1QNOA 4L5ZA 2Y0FA 3CUHA 1GONA 4B2DA 5G2HA 3UWWA 1B54A 3PWGA 3VIGA 2AL1A 1DTUA 3S5SA 2VEMA 3WJSA 4EKJA 2QJJA 2WZHA 5HWMA 1E9ZB 3O6AA 3QYSA 2ZZ2A 3T2OA 3THDA 2XZ9A 4XZ9A 3HGSA 5D4YA 4IISA 1HGYA 3BW4A 1QWGA 4DXVA 4XD6A 2NV2A 1UB3A 3PY2A 2B7QA 5IOBA 1FKXA 2ZKMX 2WMGA 3BJSA 4KFOA 3QZAA 5CG7A 3ZMRA 3CK5A 5LXEA 3ZLGA 2YZRA 3BO9A 4CQ8A 3U2EA 3Q67A 4J2MA 3ANUA 1NWRA 3PZMA 5ABFA 5M03A 3RK8A 2HMCA 4GVGA 4PEEA 5A6SA 2J74A 3OODA 1T8XA 3T81A 4GX8A 1VAHA 1B4KA 1Q45A 4O4WA 4QFUA 1R2SA 3DUGA 2YLLA 4HSHA 1DXFA 5D2VA 4M7TA 3AISA 3P81A 3A5FA 3NPXA 4W84A 2BOGX 1TB3A 1FKWA 1IR1A 1J4EA 2C0HA 4XWUA 4MIMA 3KVLA 3CV1A 1AD1A 3NM3A 1LG1A 3MCMA 7CGTA 3CPUA 4BHYA 3ZZ1A 4YL2A 5T8GA 1GJWA 2EG8A 2ZBTA 4KW2A 5IBXC 1QOQA 2OXNA 3GUGA 4MUZA 1PHWA 3NQEA 1AQHA 5IRPA 4D1IA 1CLKA 1PZ3A 4XV0A 3VO0A 3EX4A 1IXOA 3FV9A 5I6SA 3UGRA 1F07A 1RH9A 5BRQA 1L2QA 5RUBA 4NX5A 4N02A 4GVIA 2VQUA 1UHVA 1IYXA 3IGSA 4LVBA 1ZBVA 4ZFCA 2XWDA 2V0TA 3F4VA 1V08A 4WGHA 3AI0A 4F40A 4DY1A 1W0MA 1FWRA 2Y2WA 1TX2A 1XGZA 4S39A 1XLAA 1KNWA 3GH5A 5HWJA 2GVGA 1S38A 2CNCA 2FMNA 2FYMA 2GUUA 2NW0A 3SURA 3CL6A 4QQ3A 2OWWA 5B7ZA 3VC5A 2XSAA 2VXNA 3A4XA 2A85A 2WMKA 4URIA 2WYSA 2TSYA 4PCTA 4XZNX 3MJYA 3G1FA 3L23A 3BQ5A 2PA6A 4FXSA 4JFVA 2ATMA 3UJ2A 4RLIA 4F0SA 4GI6A 4LB3A 3UVAA 3O9NA 1VEPA 4Z1AA 2E5DA 1JXKA 4H2CA 3KRZA 5CPQA 3EEGA 3CAQA 3S5YA 4DPQA 1XIBA 2O7SA 2VGFA 5GPRA 2X0YA 1L8NA 4Q8TA 3OG3A 1G01A 2C15A 3T78A 2BVDA 3WQ8A 1GYMA 3MUCA 4O52A 2WJFA 3FX4A 3GY1A 2WK2A 1ALDA 4E4UA 3URBA 2QR6A 3Q58A 3H26A 1VFOA 3EOSA 4GUHA 2ALDA 3AHVA 2QULA 4PCFA 1V77A 5BRBA 5AHNA 2PTDA 2O9TA 3A5VA 1N8WA 1W5MA 4RW5A 3PJTA 1XR2A 1QR7A 4AF0A 4HNVA 3TONA 4J3ZA 3Q65A 1PX8A 2V9DA 4CNSA 2BODX 4NZJA 8CGTA 4BF7A 1RP9A 1W9PA 3H2FA 3HV8A 2QV5A 4GIAA 2F6KA 3EMZA 3U4FA 3TYBA 3WQ4A 1F4HA 2J62A 4A21A 4UTTA 3OZYA 5A6BD 1SW7A 3VOJA 3KLKA 1RD5A 3MS8A 1JPDX 1J8VA 3I7SA 2OSYA 2Q02A 4IMGA 4QIUA 5KZEA 1A80A 4HGXA 1SO5A 3WMBA 4RDWA 4EIVA 1JL8A 1TWIA 4B92A 1ODUA 3G5EA 2NVCA 3J7HA 1P0DA 2XH7A 2ZUUA 4AZ6A 1UA3A 4I9MA 5HJLA 3V5CA 5LZLA 1PX4A 1TPH1 3SM0A 1FHUA 2FQIA 4JTTA 4IMCA 1P6WA 3BTNA 2PDGA 2BOFX 5FACA 3PJUA 3B8DA 3BURA 5HMEA 3CWHA 4B5SA 4MKNA 4ZXOA 5BW6A 2VR4A 2WLZA 2XSXA 3ABXA 4C6OA 2P0OA 3C56A 4NJIA 2Y8VA 2C6QA 2AL2A 5FA5A 1LROA 3GTFA 2UZ9A 1UQZA 1TPVA 3CUZA 4G56A 4O18A 3RPMA 2DSWA 1M1BA 1A0DA 4QEEA 2ZUTA 1TJRA 1I9CB 1IHIA 2ZC8A 1ZP4A 1TV2A 1XXXA 1LBMA 2GSJA 4JTDA 3DG7A 1EJ7L 4ONVA 3W22A 4A3UA 1K9DA 3K30A 4FIQA 1VEMA 3MZNA 2OSWA 4UFLA 2B7NA 1FX6A 1I8JA 1RK5A 3BLLA 4JS3A 3BG5A 4LS1A 2JFEX 5CG0A 4CQDA 3TNOA 1SQ7A 3NQGA 1XIIA 4O1BA 1M5WA 1XSIA 1IZCA 4FXJA 4KH2A 3LCIA 5JBEA 3SQSA 3UYCA 1S5MA 2QUUA 3EOEA 4ZOAA 1Q6QA 3A3HA 2XFWA 2E6YA 2SFPA 1VJZA 2RJGA 4CQAA 5KINA 1TPWA 4MLJA 3SECA 1JF6A 4AB4A 1FH8A 1PSCA 4KESA 4UBPC 1V5XA 1P7TA 1Y5XA 3SSZA 1Q7MA 3TLQA 4GBDA 4LC8A 3W7IA 1AD4A 3DERA 2R6OA 3EA3A 2OELA 4O4VA 3V3WA 4I5RA 4XAFA 3AJ7A 4OWGA 2VZUA 2HXUA 5EY5A 3GXFA 1IE7C 1M68A 1P0NA 4ZTYA 4LS2A 1TMHA 3T0AA 3DHPA 3WQCA 4MTVA 3WUGA 3GD6A 5A8NA 5D2XA 1Q6EA 3HG5A 3QW4B 4ZZ9A 1IEQA 5TIMA 3S8HA 1TX0A 3FAXA 2YDRA 3PJXA 4AZCA 4IQEA 4CN6A 1CGWA 1FTXA 1WKDA 3O6CA 4X9YA 3I6TA 3BPWA 2QDEA 2OX4A 1F3XA 2GOUA 4ADTA 3S83A 3PAOA 1XIHA 1LQ2A 4GI9A 1JZ7A 3WLIA 3MI3A 3MKCA 3PBYA 2Q3RA 1JD9A 5DCBA 2HROA 4LU0A 1SJDA 3SY5A 5JIWA 3BZJA 1E6NA 1E1CB 2QPSA 2ZUWA 7XIMA 3V16A 2H6RA 5CLTA 4HNLA 3GWQA 4X60A 3WFLA 1SPQA 3IRDA 3AZRA 4QDMA 3WH6A 4Z2LA 4FALA 5CPTA 5FEXA 1DJYA 3IJ9A 1GOWA 4JZ5A 3AAMA 4WOZA 1XYBA 1O5KA 1MXSA 1HJSA 2PDLA 1NFGA 4RXGA 1V6XA 3GNOA 3PZQA 1WKYA 3V75A 3FA4A 1VCFA 4G6CA 4R33A 3VA8A 1E1FA 1FWCC 3LN3A 2QAFA 1GVRA 2WZTA 4K1WA 2OQHA 4RDZA 2PGFA 2QUMA 4JN6A 1XG3A 3NZ1A 1B57A 3H53A 3T0BA 2TODA 2QS8A 4DI9A 4Q8MA 5A6TC 1B2YA 4ZSUA 4EAYA 5FL1A 4ZOEA 4Z2JA 1HJXA 3GHUA 3AZSA 3HPXA 1YEYA 3WLTA 1DJZA 5KSWA 4M29A 1XBXA 3GNNA 3MI2A 5K9XA 3SZ8A 4HN8A 2C91A 1G4EA 2PDMA 2HJPA 3R0KA 6REQB 4NIRA 4TX8A 1JXJA 5E5CA 4HQVA 3W2JA 4WQ6A 2V5CA 2OYLA 3AU6A 4RV3A 3GS6A 1SUXA 1T99A 2CZVA 4MWAA 2PU1A 4D6DA 3T8QA 3TIMA 3JW7A 3LHYA 2PSNA 3CHDA 2HSAA 1XYFA 3ARWA 4HIBA 3VOFA 1J12A 2QJIA 3ZFHA 3E0FA 1V8EA 2X7WA 5MKGA 4HB7A 4WHBA 5AB3A 3MC5A 4FX7A 1QPQA 2V2HA 1WA3A 2PD5A 4C6IA 3ZJ6A 3OZPA 4LRTA 4OU1A 1LWJA 1TJ2A 1HKJA 2XG9A 2QW5A 3K4WA 3GNRA 5AHEA 4S3FA 1BD0A 1V4YA 1UR9A 3SJNA 4IIHA 4CU8A 4MUPA 1QFEA 3GNPA 5KZ6A 1QMLA 3KL3A 6ALDA 1KBKA 1GTEA 4JIQA 1J0KA 2HTMA 4GYFA 2WPGA 3GDLA 3GG1A 2EF9A 2PDYA 2C71A 4LUTA 1GEQA 4OHQA 1UZ1A 1EOKA 1L6SA 4BI7A 5LIUX 1XBZA 3ZWSA 4AEOA 1CEOA 3TMQA 1FWJC 3DKLA 5AY7A 4IQDA 3IJ6A 3PZNA 2Z1WA 1BQGA 3VXGA 3AUJA 1UOKA 4KEMA 1KW1A 1AA1B 1E55A 3B9AA 2C16A 3QC3A 3MO4A 3HMJG 3I6RA 2JF7A 3IVUA 3T55A 3STEA 2AAAA 1GOOA 3W1NA 1WO2A 1N82A 3OLDA 3MU7A 2B31A 4IJBA 2BVTA 4YN5A 3QLDA 1AMYA 3BUVA 4ASTA 4HNOA 2YXXA 2XTKA 1KWKA 4AVFA 2WHKA 3HGOA 4OJYA 1DV7A 5D2TA 3B8SA 1UD8A 1OCNA 4ZL1A 5DANA 2WZIA 2CZDA 3WENA 3HFTA 4PB3A 3BOLA 3H22A 2B7OA 3O16A 3CPRA 4L1XA 3PBMA 3H2CA 3F1QA 2PGRA 1TIMA 3PR2A 4HK5A 1B3VA 4U28A 3VYLA 4JN7A 3TQKA 7A3HA 2FDSA 3DAQA 1ZRQA 4X2RA 3IIZA 5I24A 5AVHA 2ABAA 4UNKA 1HJWA 3NGJA 4XVEA 2I14A 2VWSA 5I7GA 4U5KA 2XUCA 4FLOA 1P4CA 5D33A 3ZWTA 2OZ3A 4P7NA 3HURA 3OBAA 4R9XA 4W9TA 5JBFA 3E3HA 2PPGA 3F4DA 3U9IA 4LUIA 3W1AA 1FUYA 5KEZA 5C8BB 5BU6A 1W31A 4ICNA 3WLRA 3HPAA 5AFDA 3IARA 7ODCA 1VFMA 1HP4A 4ML4A 1ZLPA 3T9PA 3N3MA 4XAPA 2V82A 2ACQA 3M0VA 5I03A 1ITQA 2OQYA 1P48A 3LBCA 1CWYA 4J3UA 1FQ0A 1SJAA 1H51A 1YBQB 1T6MA 1SM9A 2YBUA 3URAA 2CHNA 3VDBA 3BAJA 1XLJA 3P5ZA 1OZMA 1R9ZA 1HL2A 1UP2A 1Q85A 2WANA 2REQA 3VKBA 3N4FA 3U6WA 4HU8A 4LYPA 4CQBA 4C1KA 2X09A 1ME8A 2OMAA 4GIEA 4LYQA 4IMFA 2QIWA 3WMCA 2AQOA 4H8NA 4CCCA 2Z2BA 1ITXA 5IFTA 1RK6A 1V0NA 2PDKA 4M82A 3AXKA 4JKMA 3VTRA 3WO8A 4K68A 1PL9A 2VRQA 1X7FA 1S5TA 1PIIA 4Q4MA 5H8MA 3QV6A 1LBFA 3GXIA 3KWXA 1YQ2A 3EMCA 4ZO9A 1DWFM 1J11A 2WBKA 1XL9A 3GVGA 1SU5A 4GO9A 1W3JA 1NEYA 1KWGA 3WQGA 3AQUA 4D8LA 3KWSA 4TOQA 3TYDA 2NQLA 2OEKA 5CSYA 3WNKA 3ZT7A 2V5JA 3AWOA 5GJNA 3M5YA 4B5XA 4HYWA 1UWUA 4RE3A 3WF4A 1L6YA 4QISA 3UETA 1OC7A 3AIRA 3UWVA 2OX1A 2DT1A 3IPWA 2E77A 2HWGA 1R7OA 3NPWA 4NZCA 3H7UA 4HSNA 3WD1A 3GU9A 4QITA 1GVQA 2ZZ5A 4L64A 3I4EA 2NV1A 2XVKA 2ZXQA 5XINA 5ECVA 5CZ0A 2EKGA 1A5MC 3PZVA 2QLYA 4GH3A 3B05A 1QPNA 4F0RA 4O8AA 4BWLA 1DIEA 3CIWA 3M44A 1IWBA 5C2GA 4QX4A 4DJFD 1AMKA 3R89A 2PLCA 2WZMA 3A4AA 1UROA 2ZDSA 4X3ZA 2D3NA 4L1GA 1KR1A 2EPKX 1R3VA 4K1GA 4K7YA 3YPIA 2XFYA 3TSDA 3Q37A 3SSJA 1H60A 4WJ8A 5KETA 3ES7A 1LYXA 4JAWA 1TTQA 9XIAA 2A3CA 3QPYA 3Q4DA 1TG7A 5IDZA 3MKKA 1XRSA 5E6ZA 5EYWA 1UH3A 3ZR5A 2J7DA 2VMFA 5J04A 2RHGA 1OK4A 2E40A 2QDDA 5C7HA 4KS0A 3N2BA 1K9EA 3A47A 4V1YA 2WNWA 4US5D 3VABA 3BLIA 3WBEA 3H8AA 4ERAA 3A22A 3W1XA 1KXHA 1CXIA 1DL3A 4EAMA 3ITXA 4A05A 1FWDC 4KWUA 2V81A 3NL2A 3IK4A 4KBXA 2PS2A 3QY6A 1J0YA 5REQB 3L12A 3JR2A 4MOZA 3FN9A 1XHGA 4J35A 4K37A 4JQ1A 1S5NA 3UWUA 3VILA 4QBXA 1ADSA 2QJGA 2P3ZA 4XUYA 4C6EA 2HXTA 3VKAA 1XS2A 3LU2A 2MANA 4XBJA 3I3EA 3IUDA 2V5DA 3DHFA 3HPSA 3MJMA 4FOKA 3MW7A 3AXMA 3MBFA 4ZO6A 3GE7A 3KTCA 4EXBA 1EJXC 2YCIX 3ZVHA 4PUJA 1IEIA 1OM0A 3ARUA 4QE1A 1NWTA 1VBJA 3KEHA 1DJQA 2Y24A 2GDQA 4P7QA 3NCOA 3WLMA 1WB0A 3N1AA 1FDZA 4YTUA 3EWZA 3CEUA 4LYRA 5BMWA 1NF0A 4NNBA 4W8AA 2PE4A 4JHOA 4ERGA 1H1NA 4JDYA 5LNSA 2DZAA 3MWCA 4AZHA 1L8PA 4QDWA 4OBSA 2CZEA 2QPUA 1AL7A 1QT1A 4REQB 5J5DA 2NXHA 3COTA 1T5AA 1UWTA 1Z9AA 4UFJA 1NDZA 1K4GA 1SFSA 2W62A 1JPKA 4JX5A 1E4LA 3G1RA 4CNPA 4MY9A 3HB9A 2D24A 1TZ7A 3H4XA 4LSBA 4AZIA 4NAFA 5LNRA 4YYFA 1EIXA 3UPBA 3M0KA 1C93A 3GNDA 3VDAA 1MEWA 3QOMA 4OBTA 3CXOA 4MDOA 1TR1A 1ZU8A 2VFIA 4HHMA 1TRDA 3SADA 1V3IA 4LRSA 3WH8A 3NSXA 4WD0A 4UFHA 1HKWA 3T2QA 3GAYA 2CHRA 5A2CA 1UC4A 4MWAC 5FAJA 3WEZA 1IIHA 4F3HA 2ZFAA 4MKSA 1OVDA 4DZIA 4HNNA 3UCCA 5LA0A 2GL5A 2Y88A 1JRCA 3WJXA 3H7VA 3SR7A 3DHDA 3VGDA 5CLWA 4WDUA 1FCBA 5A8MA 4KT2A 4MPQA 1PTDA 2YW4A 4GLEA 3F4WA 2OEJA 3G1SA 2GGHA 2DT3A 3W7PA 3IVSA 1KBBA 1V3KA 3QF0A 2VNCA 1SZFA 4I3GA 3CL8A 1W9XA 3TYUA 3M0XA 1W9DM 3S2MA 1XUUA 2V5LA 1RV8A 4CEUC 1RJRA 3DI1A 1WPCA 1UD6A 1PV8A 4PCSA 1B3XA 4EANA 5FJRA 1ISWA 2V69A 1EFZA 3FS2A 1JR1A 3A3WA 2OLSA 3PBUA 4CVWA 2Q01A 1K8YA 4F9JA 3RF9A 2O4MA 2NT0A 5D02A 1FFRA 2GWNA 5LGZA 2E68A 5C6MA 3I65A 1Z89A 2EPOA 4O1CA 5DRIA 4FA3A 3TTYA 2AMXA 4FNTA 1JCJA 4EPBC 1PZ0A 1TKKA 4WX2A 5K7JA 1ISZA 4ILSA 4ZE4A 1B90A 4GUFA 1BXCA 4FXRA 2VRJA 1VB9A 3FJ6A 1C7SA 4DNMA 1EYEA 3VNKA 1W5NA 1B5TA 3WKZA 3L67A 4HTYA 5ABTA 3MYPA 4O8RA 4GOAA 4G9PA 4RNFA 4UCFA 4L61A 3RRXA 4YCOA 2ZADA 4HBKA 2GLKA 3VVGA 3NYDA 4XX6A 3RPTA 1GOIA 3H4GA 3LM7A 3P60A 2VEPA 3VFLA 4B3LA 3JU2A 2HV5A 1YADA 1TA3A 5CZJA 3OVGA 4GX9A 3BMVA 3QLLA 5HWNA 1Q13A 4OV9A 1K8CA 1OD0A 5HMFA 3W4RA 3QFEA 2G95A 4DI8A 1EWEA 1GKRA 4R34A 3WJYA 3JRKA 1EGVA 4WY0A 3UD6A 4WDWA 3W3OA 2UBPC 1Q63A 3ZQ9A 4DBDA 3FY1A 1O4UA 3KVMA 3VKCA 4E38A 3T44A 1FWHC 1J0IA 2GVYA 5CPMA 2FLIA 8A3HA 2CLOA 3L4UA 3O05A 1TREA 2GGEA 4TMBA 4TV6A 3W38A 1P0EA 1DE5A 3N15A 1TVPA 2OSXA 6XIMA 3TW6A 3THQA 2ZZ4A 4Q32A 1O66A 3BAIA 5DXXA 3EMQA 3WBXA 4WKFA 1H5YA 3GYCA 2F2HA 3SGZA 3TXZA 5CC5A 3U8GA 2IS7A 3W01A 4C6PA 2QCNA 3GFYA 1DP0A 2WSKA 3CZJA 4OOUA 3FKKA 4MYAA 3A64A 4ZVJA 5I3KA 2PDNA 3MMTA 4GGHA 1X1OA 1CZ1A 3DFSA 4XTIA 1NELA 5XIAA 2CLPA 2C14A 3OBKA 3M5VA 3QC0A 5FF7A 4F0MA 1IV8A 2XM2A 3NTYA 2HQAA 5JVLA 1DOSA 2ZTKA 1XIMA 1REQB 3C0LA 4LBSA 4U31A 5I3DA 3CYVA 1EO5A 1D2KA 1NOFA 1A5AA 1ZBWA 3PBVA 4JQ4A 3VIFA 3FXYA 2Y89A 5AYYA 1CNVA 2XVNA 4ZODA 4ZA0A 1F73A 3IJDA 3WEOA 3UWQA 4GZEA 1E0XA 4DYEA 4JKLA 7PTDA 2CBUA 2DIEA 3MUY1 1TMLA 3PS7A 1A3XA 1X7IA 2XHYA 3B97A 1A5KC 3GXPA 1AZ2A 3TN3A 1SJCA 4ROQA 2W5FA 3CB8A 4CN4A 1D7KA 2GJPA 3LCLA 3GXNA 2GQAA 3II1A 2W91A 4Q4KA 4CQCA 3DH7A 3M46A 1J96A 4YPJA 1KRAC 4O1AA 4GCXA 2EPHA 3CS2A 1FHVA 4FI4A 1Q2SA 4XAYA 2ZX5A 3SN0A 4JGDA 4PMXA 1S39A 1EPVA 3EX3A 2V63A 3CQIA 4FMVA 1O1HA 1JNDA 3T2PA 2DZTA 4ZXLA 4IFKA 1IT7A 1KR0A 3E9AA 2DEPA 3MBDA 1LRTA 3W83A 3P0WA 4KKXA 3T1GA 5CBBA 1IZKA 4O1FA 4R53A 1XFBA 4ZTXA 4MADA 4LAUA 1NF7A 4E8DA 1V02E 4IFRA 2G97A 1C3FA 3W6MA 2YB4A 3F2CA 1B3OA 3B0VC 3EPNA 1WBHA 2VX7A 5IXEA 3LPFA 3B40A 1XI3A 2PBOA 4GY7A 2VDHA 1OIFA 4JOMA 3A3XA 3APTA 1NWUA 2CFFA 2DUXA 2ZUNA 3G77A 2DSVA 3B8WA 4GXMA 4JTEA 3DG6A 1M7XA 1U22A 4ZSTA 2NQ9A 3PG8A 3MV01 3CO4A 3BG9A 3CMJA 2VCBA 4J2PA 2WB5A 2IMRA 4NYYA 3VOHA 1NU5A 4KFPA 3G1VA 3VE9A 2CWNA 3QYQA 1VQTA 5FJTA 1GEHA 4DZHA 3WN6A 3UG8A 4GE8A 3NR0A 2F2KA 1J6OA 4WIWA 4S3AA 2Z28A 3NFUA 2A3AA 3KS6A 4OOZA 1H7OA 3CM4A 4DIAA 1RLCL 2O56A 1LG2A 1V0KA 4HPXA 1P0BA 3T0DA 2BXZA 1CGXA 1LL6A 2WVTA 1F74A 1Z32X 2WMHA 3HGJA 3PZ9A 4WXZA 4QXIA 1T40A 1M3UA 5GNZA 3LLFA 1J9YA 4KWVA 3C0QA 2FZDA 5SWUA 1H62A 3UJEA 3AXHA 3MDUA 3NPUA 3FYOA 3EAUA 3AXIA 5I0DA 1M01A 4IMDA 3WQDA 1I4NA 3NOYA 1TPDA 2Z6JA 3BLOA 4TR9A 3I10A 3OZMA 2XDFA 1UPPA 3AMLA 5LGXA 4S1FA 4Y8EA 4JFUA 3C0SA 2ZA1A 1X98A 3M4HA 3A4WA 3NIYA 3UWYA 4PB4A 5DT5A 4LFYA 3FIGA 3MY9A 2Y63A 1JYNA 1VFSA 2W0UA 5CKSA 1E6SM 2A7RA 4GY1A 5BWAA 1LLWA 5GQBA 3GM8A 1EXPA 3O15A 4PCNA 5G1TA 3ES8A 2WZEA 3W27A 4Q6XA 1QI2A 4AIUA 1VHCA 2UWFA 4JL1A 4DLFA 5LSMA 2RDXA 3RU6A 5BOEA 2IKJA 4GPNA 1TV4A 3S4TA 2VEGA 4UQCA 2W3ZA 4M0XA 2ODOA 3CNYA 5HK4A 5F2IA 3VDHA 2Y61A 2J8TA 4CVUA 3EDKA 4C1LA 2FHBA 1CXFA 1SMAA 1WKFA 5DBUA 1W3KA 2FB2A 1EPXA 1HKVA 3SCVA 3ZXWA 5CCZA 3WYZA 1XPGA 2E7FA 3PUGA 1EP2A 2VTFA 4HK7A 4GI4A 1ICQA 3TU9A 2WNQA 3V0SA 7REQB 3DBPA 4A2SA 5CC3A 5PTDA 2Z1XA 3CMGA 5EL1A 2IQ0A 2GVJA 4HJFA 2G41A 1EZWA 1PZ2A 4F2TA 5A6BA 3REQA 3GVWA 4RNHA 3D3FA 2BNJA 5U4NA 1GQIA 2DDXA 3LXBA 5H1WA 4AYSA 2QCMA 1GJUA 2F7FA 3R8RA 3G2GA 2JGYA 4GHRA 4NXSA 5AN7A 3H2NA 2XJ7A 3CUFA 4P8XA 1RSCA 2NSXA 1R7AA 4WRHA 2CLLA 4Q8WA 4ZEPA 3OIXA 4UFIA 5LIXX 1T0OA 3LMYA 2J66A 4IXHA 1NDYA 4H19A 4W93A 3DESA 3LRMA 5E9XA 4ORIA 4HMEA 2ZZ1A 3N29A 3EYPA 1RCXB 4J1OA 1PX3A 1UCWA 1HX0A 5A6MA 3IJ7A 5LXXA 3WD4A 1K03A 4XK2A 2HK1A 3OYZA 5AC4A 1V3LA 2FGZA 4XISA 4S2BA 4AMAA 1ME7A 3IIPA 3W25A 5LNWA 4Q7BA 5AOUA 1UBSA 3UQNA 5I3JA 3CH0A 1XGEA 4O54A 3T4WA 4NKCA 1K02A 3PPCA 1W3IA 4IX0A 2POTA 2J75A 2BY1A 4D6IA 1TWSA 2H9AB 1Z48A 4PUUA 2FHCA 1RY0A 3W6YA 1FXQA 4NI8A 4UMBA 4JEJA 5D05A 1DQUA 5TBOA 4LUSA 1UKSA 3QH2A 2PP0A 3VMOA 5HQEA 2ZRYA 4FEZA 3TJXA 1BYDA 3VX0A 4GQQA 5JH1A 2BGQA 4Y9MA 1J2BA 2IKHA 4YHGA 2NQ5A 2XSBA 3QR3A 4ZQMA 2ATSA 2E8YA 1HXJA 1YIXA 2WC7A 4DPPA 1J6PA 1YRRA 2E1WA 5E6YA 2OLHA 4IG2B 4YJ5A 3QR0A 2J9YA 4FOUA 1VD6A 5EMJA 1OK6A 1U30A 3EWCA 1L6WA 3PN8A 3AROA 4QE5A 3FOKA 2BMBA 1QRQA 3MUXA 4EXAA 3N9RA 2QMKA 4M80A 4O16A 4PMDA 5I06A 3T42A 3DFNA 1HQTA 3RM8A 4H8VA 3VNJA 4O1DA 4MVAA 2H3DA 3D47A 4C6LA 4HSOA 4LEQA 4UTFA 4WCJA 4HCLA 2CWXA 2J79A 1LL7A 5HQLA 2YYUA 2HVMA 1K8XA 1I60A 4D6JA 2J24A 4H8HA 4LY4A 3UERA 2WPBA 3KX6A 2G0WA 2KAUC 2A21A 1Z7AA 2R1LA 3BGAA 1VC4A 3A23A 2Q6ZA 4J3TA 1UKTA 1XINA 4AIEA 5EKYA 2YGYA 5E09A 4Z17A 2PRLA 5M5DA 3RM4A 5LHFA 4LVDA 4ACYA 2JF6A 2GK1B 1SO3A 4DNHA 3W7NA 2OB3A 4EOUA 3RX3A 3BLPX 3EWUA 5D9OA 1H1ZA 4AWSA 1TTIA 4O53A 2IPWA 3U0HA 2VO5A 4UR7A 1X8CA 5AVNA 3EOLA 3SI9A 3QW3A 3U2OA 2DH3A 2ACRA 1Z3NA 4QJ4B 5FSEC 1WAUA 2JIEA 3B03A 3QM3A 4W86A 2GQ3A 3WF3A 3TZNA 4QLKA 3GLCA 4LY8A 4XKYA 4TVDA 2AL2B 1QPOA 3G24A 3ABOA 3WH7A 5L6UA 3V1PA 1I1XA 2D2GA 2J6VA 1GVIA 5LA1A 4FO4A 6A3HA 1EA0A 1OX4A 4N2YA 2NUXA 1OWQA 3TJ4A 3CTTA 3PFMA 4IFOA 1WZMA 2FFCA 1VLIA 2R14A 1CTNA 4FLRA 3L5AA 2O4QA 3PHAA 2HCVA 4GQ0A 1WDRA 4PMUA 3TCEA 4YVXA 3EB4A 2PDHA 2ABBA 2ZRVA 4Z2HA 1UJPA 4BCEA 2PWVA 5HULA 1M7JA 3HOJA 3VPLA 3EKZA 5T91A 3N12A 4B5WA 4YVVA 2YA0A 2PDFA 4DHGA 3G6LA 5DLCA 3DFHA 4PUMA 2DY3A 3WNNA 4K38A 2VOTA 1TSIA 3QV7A 1FWNA 2PCQA 3GK0A 2BVYA 2O9OA 1A0EA 1MFVA 3C3UA 3SGGA 3KRUA 4LXFA 1R0MA 2F9RA 4GJIA 3NQVA 3NYZA 4UTUA 3FA3A 2GJXA 3HA1A 4A22A 1FWTA 2QV4A 3RUBL 1E4NA 4E4PA 3AYSA 3QSTA 3URNA 1K7EA 2AGKA 3WNLA 4UTMA 1E51A 1N7KA 4NXKA 1NOWA 3BAWA 3OJGA 1AQMA 4G7EB 3RGTA 4MHBA 2R1KA 2YL9A 2HNHA 1AUSL 4Y8FA 2NV9A 3NQ7A 3UZYA 2WVVA 2ISVA 2BBFA 2XM1A 1S1PA 1XLMA 1DWIM 3TFCA 1TWDA 5FEZA 1RPXA 1EC8A 1S2CA 5JMUA 1HL9A 1KCXA 2TYSA 2JK2A 3B9DA 1CB7B 3GDKA 4C5ZA 3GIPA 3LI0A 3WK1A 1P43A 3PB0A 1V6TA 4RR4A 2GJLA 2CBVA 2DT0A 2A5HA 1KQYA 5JBDA 4LEFA 4UMAA 1HJVA 1F3TA 4JD4A 2QT3A 2DSKA 3A6OA 2GUYA 1JRBA 4AUBA 1MO0A 3QQ0A 1UYQA 1GG1A 3OVQA 1TR9A 2PTWA 2WAGA 4MNKA 4L1WA 3MKVA 3SFKA 1K9TA 1DIOA 5G4HC 5TD4A 1BAGA 3HBLA 3THUA 3GTXA 2HBVA 4NJKA 1DIDA 4IT1A 1K6AA 1HT6A 2YCKX 3A12A 3BICA 4Z2GA 3FEQA 1YXCA 4QQUA 4E6MA 3Q2DA 4LQ1A 4H04A 3UF9A 1QI4A 1PJ9A 2NX3A 3OLEA 1OGBA 2WHJA 3DFYA 4ZR8A 1AODA 5C9WA 1S5VA 1JQXA 4AYGA 3M07A 3NQDA 5HA7A 2OGJA 4L80A 4ALDA 5F4XA 4QJ5B 2ZZ7A 4MWAB 1JD7A 3GC4A 3M9YA 3TDFA 3KBMA 3NQ2A 1H7XA 1X6LA 3HQPA 4WGXA 3DECA 4TTUA 2WQPA 3R12A 4HPJA 4YHEA 3A9BA 2VVSA 3BW2A 2BY3A 4NNAA 1MW1A 3UR5A 2ZVRA 2ZOXA 2DZXA 4I7VA 1P6BA 5E9AA 1UWSA 2PMQA 4H7VA 4N9BA 3B3DA 1H4PA 4QS6A 4J3XA 1T8QA 3MT1A 3QJAA 3QN3A 5CAKA 4PN2A 2DQXA 9RUBA 1RALA 1GORA 4PRTA 2B4GA 2P53A 3RHGA 4R85A 4C6MA 3DYPA 2D0FA 5JU6A 1EDQA 3CHFA 3QY7A 2E5BA 4N4PA 1NH6A 1KKOA 3GQYA 4YNGA 3WBAA 2O55A 1RQHA 3M5ZA 1OG0A 4IGSA 4LUTB 1IZJA 1E56A 2CLIA 3UPWA 1KGWA 4UQAA 5A8OA 4TQTA 2VOMA 4PE8A 3QMRA 1AH3A 4JNZA 1IEVA 1VP5A 2X8RA 3TR9A 5AC6A 2A79A 3PM6A 3C8FA 4HA3A 1EYWA 1UMLA 4M51A 1U83A 3PJWA 4ZB0A 1MYRA 3W2KA 1TPB1 5C9RA 1VIWA 3N73A 1HVXA 5DT7A 3IUIA 1UG6A 3PB2A 4WEVX 1W5PA 4P7RA 4KRZA 4NZFA 3EXTA 4QP0A 2XVGA 2O7QA 2PC4A 1XUZA 1SVDA 2VX6A 4CNNA 3W1UA 4B4HA 3DKJA 5MHBA 3P82A 2X41A 4PMOA 1VRDA 1W37A 2BLEA 5M17A 1BF2A 3LCWA 1C90A 4M6VA 4QJ1A 3DFOA 3S2CA 3TQ0A 2ZZ3A 3E02A 4D6HA 1JIBA 1G0CA 3GH7A 2OYKA 4QSFA 2NLIA 1E0TA 3V5FA 3EDFA 4YVPA 4PFMA 5DQPA 1VYSX 2XWEA 4M24A 5BROA 4HU4A 1DXIA 1ECQA 3TLLA 4V33A 1CI1A 1UW9A 2QPXA 4WDTA 1TVLA 1AZ1A 3DDMA 3EB2A 1EZ2A 2PDWA 1T41A 5TQLA 3MZ2A 5AYXA 1MNSA 1ICPA 3NQAA 3UVIA 3E38A 3WUBA 3JS3A 1WDDA 3CIVA 2YYTA 1S2WA 4PC8A 4ENLA 1HO4A 2NUYA 3SCOA 5H8UA 4DJFA 4PH6A 4B3KA 2E9LA 2VEFA 4JN8A 3VUPA 5BWFA 1AVAA 1MMFA 3UCDA 4D1JA 3VOIA 3GU1A 3BAYA 3VE7A 3ORWA 3NJ3A 1QCWA 1SZGA 2EKCA 2X0HA 2BHYA 4Q4SA 1E43A 4AD1A 3N6HA 3E0IA 2HPMA 3MPGA 3C6CA 2E09A 2Z4GA 1JZ6A 3NURA 1XICA 4DELA 1E6QM 4ACZB 1IF2A 3W29A 1O5XA 3QTPA 3VIOA 2FDMA 2C0AA 5A8GA 4UOQA 4BK9A