3WQEA

D-threo-3-hydroxyaspartate dehydratase from delftia sp. ht23 complexed with d-allothreonine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
379
structure length
379
Chain Sequence
b'QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHACATGAQFPAYQALAADGSVQTWERLHGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-threo-3-hydroxyaspartate dehydratase
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
molecule tags Lyase
total genus 142
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqeA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqeA02
2SFPA 2ON3A 2J66A 4ZGYA 3WQCA 2RJHA 4BEUA 1XQKA 3VABA 1TUFA 2QGHA 4FS9A 4ECLA 3CO8A 1QU4A 1HKVA 2RJGA 4XG1A 5GJNA 4PB4A 3R79A 5GJPA 4LUTB 1SZRA 1D7KA 4WR3A 1BD0A 1F3TA 4XBJA 1KO0A 5FAJA 7ODCA 3E6EA 1VFTA 2O0TA 2NVAA 4AIBA 2P3EA 3B8UA 1NIUA 4LUSA 5FAGA 3B8WA 4PB3A 4Y2WA 3AWNA 1L6GA 3N2BA 4LUSB 3HA1A 4BF5A 2VD8A 1L6FA 3B8VA 5BWAA 4A3QA 5GJMA 4V15A 5FACA 3WQGA 4BEQA 1CT5A 4DYJA 3LLXA 2VD9A 3GWQA 3N29A 3C5QA 2ODOA 3ANUA 4ILSA 1HKWA 3KW3A 1RCQA 2PLKA 1VFSA 3MT1A 2DY3A 1XQLA 1FTXA 3CPGA 3NZQA 3BTNA 3AWOA 2PLJA 1XFCA 2NV9A 3E5PA 4KBXA 4PB5A 2TODA 2YXXA 3OO2A 3NZPA 4BHYA 3UW6A 1KNWA 1W8GA 2OO0A 3N2OA 3HURA 1EPVA 3WQFA 4LUYA 4DZAA 5IRPA 3WQEA 4QHRA 1NJJA 3S46A 4LUTA 1VFHA 3ANVA 3B8TA 3SY1A 1TWIA 3WQDA 1SFTA 1B54A
chains in the Genus database with same CATH superfamily
1R0MA 2Q3RA 1BKHA 1JZ8A 3UZ5A 2BXZA 3NFUA 2EJ1A 4XUYA 2BHZA 1VCVA 4KIEA 3LX9A 1IT7A 4K8GA 5BZAA 3BJSA 3PFRA 1Q7MA 2PUZA 4JTEA 4M1BA 3K5XA 4A3HA 5FSEC 2PTZA 3U57A 4XIAA 1J0HA 4PCSA 4EANA 3WUBA 1PZ3A 2OWCA 4ICMA 4WSJA 3OYXA 3PB0A 3N13A 2A3AA 4GNVA 3BOXA 2DW6A 2CZVA 3SW6A 4I8DA 1UBSA 1MZRA 3HG4A 3CB8A 3E2QA 3PZMA 5JQ9A 5GPRA 2XIQA 2CKSA 5CJ5A 4HK7A 4ILSA 4GIEA 4ZO7A 2J47A 1E0WA 4R9XA 3TWAA 3Q94A 1H4PA 5I3FA 5C9ZA 1VYSX 2W92A 1LORA 2B0MA 4JTSA 4RXGA 3M0MA 2WMHA 1FWTA 3GUWA 3N2OA 4IJCA 2D2HA 1K6AA 3WQFA 2PI6A 1ME9A 4D9PA 1NSJA 2EPNA 4GIRA 2QXWA 4MYXA 3F4CA 3ANVA 3KZPA 3DFNA 1OFAA 3LS9A 4C6OA 2J75A 1E1EA 1HVXA 2PDLA 1ZU8A 4H9UA 3GXNA 2FVLA 4J40A 3W02A 3NEHA 1UB3A 2PF8A 3CT7A 3R4IA 2J13A 4E2OA 1G69A 3SCTA 5I03A 5C2GA 1N8WA 2YB1A 3ZMRA 4IL2A 5BXSA 4Q8TA 3FJLA 1WAUA 3ARZA 2IPFA 3ZSTA 3HM7A 2AL1A 1EWDA 4E8DA 4FNTA 4LF1A 4JIEA 4FO4A 3C0JA 3W28A 2NUWA 3EMQA 4K38A 1KWKA 4ICCX 1UD3A 2PGEA 4NI8A 3M16A 4G7EA 1M3UA 1CGXA 4K8EA 2ZTJA 4WVXA 4V15A 4GGBA 4F79A 2OOGA 5MKGB 2NVDA 2VFIA 1PKYA 4IIDA 2CPUA 1H7OA 1RCQA 2OZ8A 2P0OA 1Z8AA 2O56A 5DX7A 1W3KA 1LZOA 3EB3A 2IQTA 3LQGA 4WY0B 3FXYA 4QEHA 3TSBA 4OUEA 3STPA 5E09A 2EPLX 3HG2A 2YCIX 3RMJA 1W6TA 3ZS4A 3T55A 1ZRQA 2GJXB 2J8FA 1OX4B 3CLWA 2CEQA 1AW5A 2PMQA 2DVUA 3OLDA 1F4HA 1RQHA 1SW0A 3TMLA 4EIVA 3BCJA 4X60A 3TFCA 2JEQA 1ZTVA 1B3YA 5D2WA 3W01A 1V3JA 1XC4A 2JQXA 3ZXWA 4EF9A 4GUIA 1Q2SA 1IXNA 1V7YA 3GTHA 2OQHA 3PANA 5HANA 4NZ4A 2J77A 2Q02A 2WB5A 3BQ6A 2CCRA 2R14A 1F3WA 5LGZA 1TWZA 1JRBA 4YLWA 3CAVA 2WKGA 5FEWA 1OM0A 1VPQA 2WCGA 3W72A 2G50A 3JW7A 1YE4A 3PAOA 1KFLA 3VIIA 2CLOA 4IG2A 1B57A 3VI2A 4L6OA 1YPIA 3OLEA 3W27A 3CL8A 4GI9A 3FJ4A 3PZVA 1P0DA 2WPBA 4I7WA 3KLKA 4O0ZA 1AJ0A 4IQEA 4PTXA 1OSEA 3MI6A 2NQZA 2RH9A 3GTIA 3M47A 3GDTA 1QJWA 1UQYA 3MTWA 3SSZA 2WJZA 4EOUA 2ZCGA 4J3UA 5HPOA 4QCEA 1UUOA 2YCJA 4FX7A 1EP1A 4RE3A 1OBAA 4M29A 1GK8A 1S5TA 2Y62A 1J96A 1YDOA 1EH9A 2BVYA 1EPXA 3TJ4A 5DY3A 4AD0A 1HP4A 1TPH1 3ARRA 4HNTA 4WSHA 1DE5A 4JFSA 1JGIA 2DUZA 4HGXA 4MDPA 3CZGA 3LXBA 4IMAA 2ATMA 4AZGA 4NU7A 2EO7A 3CHEA 1JDDA 1GVFA 1O4UA 1JCNA 4XQ6A 2AMGA 1YADA 1V93A 2XH0A 4J3WA 1E55A 3SAZA 3EKGA 2X7VA 4DJEA 4N9EA 2INEA 1NDVA 3QY7A 4PMOA 3CT2A 2QCCA 3ITYA 3LD5A 4PUUA 3SUWA 1E70M 3VIKA 3S1UA 1UC4A 1NEYA 1P6CA 1WE5A 2J8TA 4K37A 4HJFA 1AQ0A 4PBFA 2OXNA 4O17A 7CGTA 4ZQRA 4JX4A 2XH2A 2I9UA 3L5AA 4BWLC 4JAWA 1A5SA 3FY1A 4M7SA 4A8IA 3PNZA 3CUZA 4C6QA 4RW3A 5CC6A 4US5A 1LM1A 3WK0A 2DY3A 2PP0A 3TAOA 2FMNA 1S2WA 2R9RA 3TTEA 1F4AA 2DORA 8A3HA 2OZTA 4H9TA 1T0OA 3EA1A 4JKLA 1OQFA 4B91A 4WQ6A 2ZOXA 4MPKA 4HZ7A 2WMKA 3GR8A 2DSUA 1XIFA 4QG9A 1YXCA 4JTUA 5DCDA 4RLIA 3AZRA 4H3DA 5FF3A 1E9ZB 4ROPA 2ZX6A 4S3AA 4ECLA 5GNYA 1VRXA 4GH3A 3GFYA 5C7VA 3KCLA 1T8XA 3LEPA 1D7KA 3S9IA 3CS2A 5FAJA 1XRSA 5B7ZA 1H1NA 4PA8A 3UR2A 1O5KA 3HQPA 4UTKA 1A0CA 4FX8A 3WH8A 4DVOA 1XLAA 4XZHA 3GC2A 1S39A 4MF4A 3NDYA 3N4AA 1SJBA 3H6OA 1PIFA 3HA1A 4N7QA 3QYQA 2IW0A 4UQEA 3VKJA 1TSIA 1V6YA 2XGBA 4XSMA 1XIEA 2VGIA 3F5KA 3PZQA 4AIUA 3H7VA 3CUGA 4PBEA 1NH6A 3MMDA 2WVVB 1MUWA 3LXAA 4HP5A 4W4QA 1L9WA 4HYRA 2WJFA 4UNLA 1W1ZA 3L4WA 5I5RA 4HZMA 2PLJA 1KBJA 1TX2A 3UF9A 2ZUWA 4E5TA 3ZJ8A 3A4XA 3NG3A 3HURA 4XZNX 2DSKA 3OP2A 4PMNA 2GLKA 3MYPA 3QFWA 2X7WA 3VX0A 2ZDSA 4D6EA 3WQWA 3OLGA 3T2OA 1XGZA 3HMCA 1WXYA 2P88A 2X8RA 3SRKA 4S3EA 3M07A 1RP8A 1RBLA 2J9ZA 5HR6A 1DIOA 4U33A 2J24A 2VX4A 2Q8LA 3QHNA 4F3HA 2D2GA 1JYVA 1QHOA 4DWSC 3QSTA 1AH4A 3UY7A 2EPMX 3KXQA 2NT0A 3PZUA 1IE7C 2BGQA 2XHYA 4YMZA 1BWVA 5DRIA 1U33A 3W1UA 3O63A 1KV8A 4UR7A 3UWEA 2QCNA 3MVIA 1QO5A 4D2JA 2VC7A 3CEPA 1MXSA 2FMOA 2ZC8A 3OIHA 1DWJM 4JTAA 5LSMA 1VLIA 1ZLPA 3QOKA 4GO9A 5CPLA 2Z2UA 2IPWA 2YKKA 1YRRA 3VK5A 4C6PA 1XSKA 1VC4A 3QMTA 4LJ3A 4IFRA 2PD5A 2VI0A 3C5QA 1KV5A 4JCMA 3GDKA 4RCXA 2X05A 3G1XA 5ABGA 2BP1A 3ZWTA 3PZ9A 4M56A 3QN3A 3GE7A 4C6BA 2OFJA 3TU9A 5GQBA 1TZ7A 3KDNA 4XK2A 3PWGA 2A3BA 3DEQA 1YHTA 4HOWA 1V3KA 2UY5A 4Y8FA 1TWIA 1H49A 1BYDA 4YJ5A 2O4QA 4B9ZA 4D72A 1ITCA 1TV5A 2V67A 4HNOA 2ZE0A 3PR2A 5EU9A 1V5XA 1TUXA 4S2CA 3W9ZA 4YYFA 2OO6A 3EAUA 1LCOA 1XH1A 3IIPA 1F6PA 3BLIA 3K8LA 2QYGA 3GG7A 1MFVA 5JBDA 1KA9F 4LUTB 1SZRA 4JYEA 1CIUA 2YX0A 1GKRA 1MUCA 3RMEA 3KOFA 4L64A 2RAGA 2QIIA 3NQMA 5LA1A 3WJWA 3RK8A 4O57A 4KCUA 4UTMA 5I24A 3SRDA 1PKLA 2TSYA 1UBPC 1X7FA 3TYEA 1KM3A 1HJVA 3I7RA 4JIQA 1XICA 1TR9A 2E5CA 3KVJA 4LUJA 4Z1CA 5CH9A 1F5ZA 4E8GA 5CPNA 1M7XA 4JTLA 4LAOA 4XTDA 4WKAA 3MV01 1OK6A 1HKWA 2Y5EA 1R7OA 4JFTA 4XBKA 4GUJA 4CD8A 5AHEA 3DYMA 1VF8A 2JGYA 2O55A 3GBEA 1Z41A 3WH5A 1XLDA 3XISA 4NY2A 2OSXA 5A6MA 1SO3A 4MAVA 1OD8A 4DO6A 3DHFA 5HMEA 1W3NA 3BLOA 4XKMA 3AFBA 1PZ0A 4GVHA 1A3XA 1H5YA 3PTQA 4BI7A 1FA2A 1C8XA 2PRMA 2YYTA 3AUJA 4L65A 2C3ZA 5EA9A 4F9JA 3SBFA 2ZVIA 3GXIA 2FGLA 3FSTA 1LWHA 4GYKA 1LLZA 3A22A 3I7QA 1OF6A 1MEIA 1PX3A 2QGHA 4Q8VA 4J35A 1XPGA 4PODA 1KXTA 3I4EA 2BX7A 2W5FA 3SZ8A 3G2GA 1EOKA 1ONEA 3U3HA 5FJTA 4GYPA 5CC3A 2Z25A 1OFQA 1RA5A 3G0SA 4B4FA 3PUOA 3H22A 4H7CA 1H62A 2NSXA 3LERA 2QDHA 4AD3A 3MHUA 5REQB 3EX2A 3MQTA 4KESA 1PTDA 3EX4A 2PD9A 3MWCA 4WGHA 3EWWA 4RW5A 3WQ6A 4QE1A 1X96A 1SMAA 3WBYA 5K9DA 2HTMA 4L4MA 3TA6A 4F48A 4BI5A 2PDKA 1NQKA 3B4UA 2DPEA 1BSLA 4DJDD 3E38A 1JCYA 2PDXA 1T8QA 4LUYA 3IUIA 1JNDA 1M03A 3N9SA 1EEXA 1GWJA 2WQPA 3TSDA 1NDWA 1T40A 3LHWA 1SR0A 3LHZA 4V1YA 2QEZA 3QTGA 5H1WA 4AD1A 4UOJA 4H41A 1AQHA 2P10A 3W2LA 3TNBA 2F9RA 3GNXA 1KRBC 2P3ZA 3GVWA 3HQOA 1ONWA 4PEEA 1E1CA 2VTFA 3CV1A 1ZPTA 1FWRA 4I5UA 1K7XA 1JDAA 4IJRA 4Q8OA 1TJPA 3ISIX 1B9BA 4AH7A 5CSYA 1TTIA 4IMGA 3DERA 3DAQA 4ASTA 2PCQA 4J3VA 4MFDA 4XVDA 3ZLGA 5I3JA 3LCHA 3PK7A 4ZMGA 4KCTA 2WBKA 1NDZA 4JN8A 5EMYA 3BDKA 3IWPA 3SY5A 3R11A 3MMTA 2WVTA 3DGBA 1L2UA 3IIZA 3BURA 1CYGA 2EPKX 4BQ5A 4Z08A 1OG6A 4LB3A 4LEFA 1YDNA 4KRUA 5DXXA 3G3DA 4M51A 4O1BA 1G6CA 1BF6A 4JDYA 2LLEA 1S3TC 4W5ZA 1RV8A 3DIPA 3UW6A 3LTYA 4UMAA 4DRSA 1HO4A 4Q8MA 3UG3A 3H54A 2QPUA 3HIJA 1FXPA 5G4WA 2ZRVA 4CEUC 2GGEA 1V6WA 5M3WA 1UWSA 2XDFA 2AOSA 2H6RA 3RNDA 3EDDA 3CNYA 3EXRA 3LHYA 1X8FA 5KETA 4DBDA 1FWCC 1ZAJA 3AHVA 1A5AA 4MNKA 2YBUA 5KSWA 4AU0A 4C6MA 6REQB 1F3TA 1UD6A 3GIYA 4JY9A 3BMXA 2XVKA 3CK5A 3IVTA 3SCRA 4AZ6A 4UWMA 1OGSA 4BF5A 4M81A 3VNLA 1UWAA 5G4EA 4MKVA 3NR0A 3PWIA 1KXQA 2W4XA 2E8ZA 3WH6A 7TAAA 4GISA 4LCQA 4AIEA 3W25A 3U7VA 1WXJA 2VD9A 1PXGA 1IEIA 2WCSA 2BHUA 1AJ2A 3OEXA 2WVUA 4H2CA 2GWGA 1R7AA 4WK9A 3TUUA 5LGXA 3TLQA 4BI6A 4QSHA 3FNDA 2PDUA 3ITCA 1N55A 4FK9A 4Q4OA 2XIJA 4O53A 2ZIDA 1LBLA 1U1UA 6ENLA 4Q32A 3TC3A 3P61A 2GL5A 2VELA 4IISA 3VGEA 1YXYA 4H8VA 1F76A 2DQXA 4R34A 2VFDA 5AOUA 4U28A 2WSQA 4RL3A 3W7JA 3O7UA 4RPPA 3LTPA 2BXYA 4HT3A 1PCKA 3NQEA 3GSMA 3TIMA 2CIPA 2C18A 3ELFA 5I77A 2QUTA 2IMRA 5U4NA 1UKSA 4JIRA 1RHCA 3M0YA 4LPCA 4XKYA 4L61A 4CD6A 2OLAA 2GGHA 1BEUA 5F2LA 3AMDA 3R79A 1G4SA 3W7KA 4DWSB 1DP0A 3RF9A 4PMXA 4W8LA 4AY7A 1A5NC 3WNLA 2A4AA 1DL3A 3USZA 2V5JA 3TLLA 3LHVA 3RU6A 3LMZA 3BW4A 1WDPA 3KFTA 1XD1A 3R89A 2D3NA 1K9DA 2CXGA 1DKWA 3RHGA 2YXGA 3UA3A 2PTDA 1IHIA 4BQ2A 4IXXA 3THCA 4GI8A 4UNIA 3VPLA 1EBHA 2E6FA 3BW3A 4MNLA 2WM0A 3EWZA 3WH7A 1EHNA 4CCCA 2NQHA 1E43A 2Y6ZA 4O19A 1POJA 3E0VA 1S46A 5D2XA 3T78A 5CZKA 3VZYA 4XBSA 3WH9A 1ZCOA 1S2UA 2QJGA 2PGRA 3G1RA 4FI4A 4JD4A 4QTGA 1TPFA 2PEVA 3S3GA 3BH4A 4W84A 4AD2A 3ORWA 4LNCA 1MI3A 1CECA 4YIWA 2DZBA 3O06A 3MCNA 4IUGA 4MFEA 3A3XA 3NDZA 1KXVA 3NQFA 4O1DA 4LNYA 1ADDA 3M7SA 2I17A 1R85A 4HPXA 5LHFA 4REQA 5CZ0A 1HJXA 3ARQA 4XG1A 2CU0A 2HE5A 4JN6A 1AQMA 3UZJA 3Q67A 3L12A 3ZM8A 3S42A 4WR3A 1ZENA 3W6MA 4XWUA 1VBHA 3LK6A 4GI4A 2VO5A 4DX3A 2X42A 5BRPA 5D4YA 4H1ZA 1J11A 2CZDA 2XG9A 2YCEA 2J7CA 1FUYA 4A3QA 3MUAA 2Y4SA 3B06A 3WJSA 3GXFA 4WLCA 4WDTA 1DWGM 2EBNA 1OVDA 3ES8A 5A2BA 1B30A 4JEQA 3C52A 2VEKA 3ZO9A 4Z0SA 1H1YA 1JJKA 1NWRA 2OEJA 3N6QA 3W1PA 2XYLA 1P48A 3ARPA 5KTLA 1AUSL 2Y1HA 4W5UA 1KCZA 2AKZA 3URNA 4IG2B 3W1MA 2GUBA 4P5UA 6XIAA 3UXLA 3CQJA 3IJ9A 1TG7A 1KBLA 3THUA 4KGLA 3VDCA 2XN0A 2CBUA 1ZY9A 1V08A 3SN4A 1FOBA 1H61A 3VD9A 2QCMA 2GQ3A 3RX2A 4L4LA 2FPYA 4ZSUA 3W84A 3SRHA 1DXEA 1F05A 4H6KA 3T0CA 2FHCA 1SQ7A 2V38A 4MJ2A 2JEPA 3H4GA 1MQQA 3APGA 3PUDA 2VENA 1ECQA 1JZ6A 6PTDA 4Q8PA 5E0FA 5EMJA 3AIWA 1PX4A 1FX6A 2PE4A 2Y8UA 3NQ7A 3BK0A 3OHMB 4YN5A 2QDEA 1MW0A 2C14A 5LIYX 1IF2A 1OT2A 3WMLA 1Q8JA 2BHYA 2VXNA 3QR3A 2PP3A 4UTTC 5AYZA 3V75A 3A9BA 1YDVA 3BMWA 3BAKA 1ICPA 2PCEA 3GU1A 1CT5A 4WKHA 2L5HA 1NF0A 1R3YA 3CZEA 3L2LA 1S1PA 4O10A 4TV5A 1JRCA 1QOXA 2HS8A 3VD5A 2PDBA 3AICA 1B0IA 2CW6A 2QMJA 3G0XA 3LN3A 5A94A 4GPNA 3PJXA 3GS6A 3DI0A 4GX8A 1P7TA 1FCQA 1LF1A 4HZ6A 3UEQA 4HD5A 3B05A 1W17A 4FLRA 3TN5A 1W5PA 5JH1A 2VFHA 3R0UA 1QHPA 4TMBA 1QW9A 1BHGA 2ABBA 1LUCA 4R5EA 4N2YA 1B54A 1GVQA 2QT3A 3I3BA 3IARA 4CQAA 1C8QA 4MJMA 1EZWA 3URBA 4LXFA 2QCLA 5AZ0A 1HGYA 5BU9A 3NSXA 3GYEA 2VNCA 1TR1A 1Y0EA 4O8RA 5H6HA 4R7JA 3WLPA 2YXOA 4B5WA 1BD0A 2WHJA 4QM1A 4OQVA 1EB3A 1NM9A 3QW4B 5FAGA 1R3WA 3FEMA 1XGEA 2FPTA 2FZ9A 5XIAA 3SGGA 3VFCA 3UU0A 3G1HA 3GVVA 1JDEA 2A7NA 5E0KA 4QE5A 1BPLB 3TONA 1SJDA 1CBGA 4I9TA 1Q6OA 4DYJA 1Y5VA 1DOSA 2Y5JA 1H0GA 7ENLA 3P0XA 5F4XA 5JIWA 3GR7A 4GINA 3L5MA 3F2CA 1FFQA 4IPJA 3S5OA 3LSBA 1EUAA 3GTNA 2V3EA 4RJEA 3NIYA 2XVGA 2PSNA 2QMKA 4QROA 3BCDA 3EEGA 1CLVA 3UVAA 2PLMA 1WNOA 5HNNA 1XYCA 4TTUA 3FHAA 2YYUA 1KFEA 2C1HA 2YA1A 6XIMA 4RE4A 1IGSA 1TPWA 2V5BA 4H8NA 4C7FA 3V3WA 3NQAA 2C16A 4LEQA 3WF3A 3WDQA 2QJIA 4CKQA 5H8PA 4NHVA 2RGLA 3NL3A 4J1OA 4P61A 4FLQA 4N0RA 5C9UA 1WDDA 1IR2A 1FWFC 4NSBA 2W9MA 4TUFA 1SMDA 4NJIA 3ZLFA 4G9PA 2X40A 5D9NA 4DUOA 4XBJA 2E9BA 1I2RA 4FF5A 4UTHA 2CBJA 1CPUA 3WJYA 3KE0A 4LOCA 1VCFA 3N3MA 2O0TA 2NWRA 4TO8A 3AC0A 4UTIA 4HOZA 2DDXA 3OIXA 1K9TA 3G1SA 3GC4A 3N2BA 1P0NA 1J0YA 3ITXA 2UY3A 1W91A 3NL2A 4PTMA 3B8VA 2BY1A 3CHDA 3TQPA 2V5KA 5KZ6A 2PDJA 2VVSA 1KGWA 3DI1A 2B31A 4FIQA 1YYAA 3HV9A 3B0VC 4I8YA 1EYWA 3P62A 4LQ1A 4IPIA 2OKOA 3GG1A 1JDCA 3EDKA 1NWTA 3UPWA 3XIMA 2ZRYA 2Y70A 4HHLA 2G3JA 1CB2A 4GIAA 1UPPA 1GHRA 1JZ5A 1EX5A 1JPKA 1Z7AA 1OC5A 3U6WA 1NP0A 3RLUA 1PHWA 1UOKA 4XD6A 3F03K 5EFFA 2AQOA 4LRSA 3B40A 4AYSA 4QDPA 3AZSA 1BXCA 1KR0A 4KRTA 3AIQA 1CGTA 3M7WA 3KL0A 1Q85A 4D1IA 3JZUA 3WO8A 3BLEA 4B5XA 1IWBA 2IXVA 4Y7EA 1BKSA 1L0PA 5DT5A 3RM9A 3UESA 4NL1A 1MEWA 4ZOAA 1KM5A 2YFNA 1OCNA 3WY1A 3TQ0A 4FXRA 3B8UA 5IXEA 4OU1A 2D0FA 2F2HA 5DQPA 3OZMA 3K8MA 1TPVA 4MADA 3ZT6A 1U30A 2ZC1A 1VYRA 4GQ0A 4UFIA 3ZFHA 2DUXA 1KCXA 2Z7GA 2INZA 3WSUA 4L6DA 3PB2A 3ZZ1A 3C4UA 3WLIA 5CEWA 1WZMA 3S5SA 2X1UA 1NWSA 4DLFA 1HXJA 2YBVA 1GOKA 1MQRA 1XYFA 1R3RA 4DYKA 1R46A 5GVJA 4X63A 3LMYA 4IPLA 4DUXA 2QJHA 4UTJA 2WJDA 4J3TA 1BWKA 2ONEA 5HULA 5FD0A 1QR7A 3VC6A 3MBDA 4QAIA 2OT1A 2VMFA 1DE6A 3QR0A 3TOPA 1WKYA 2NWSA 3GVGA 4IZGA 5JVLA 4TU1A 4WKFA 3O6DA 3V1HA 2V69A 4KS0A 4UTLA 3C2YA 1WBJA 2PDNA 1UKTA 2INFA 2P76A 4GYJA 4XISA 1DJIA 3S1WA 2ZX9A 5I06A 3DCPA 5SWUA 4S38A 4QISA 5M2FX 4OT7A 3DG3A 1AD1A 4XZWA 1O5XA 5D30A 3OBKA 1GHSA 3LLDA 2PWVA 1NIUA 4S3CA 3M43A 5ENLA 1VAHA 3IJIA 1I8JA 4HTYA 4WF7A 2ADAA 2WMIB 2X1TA 4DAIA 5T91A 2ACRA 3WDRA 1UP0A 5BCAA 4RDWA 1FWIC 3W7QA 4TOQA 3SR7A 3OYZA 3VE7A 3TNOA 3GTXA 4DF0A 5C55A 4RDVA 4RK8A 3BAJA 8TIMA 3VOIA 4O4VA 1MZHA 1O1HA 1OX5A 3C2RA 1M65A 1R3TA 3MU7A 3ZIZA 2EG7A 1BXBA 4GVGA 4FNPA 4CD7A 1YKWA 4XZBA 2E09A 4PMQA 3GAKA 1KKOA 2VR5A 2VCBA 3MZNA 3T0DA 4QS5A 3P5YA 1PV8A 3OGSA 3W29A 4LCRA 3GVRA 7REQA 1SJAA 2OPJA 3NWRA 2YZRA 3PG8A 3M6YA 1HKIA 1H41A 3KLLA 3T6CA 3VINA 4PTWA 1C9DA 1J6PA 5AN7A 4MB1A 4PL2A 2J74A 1WO2A 2UBPC 2ZDRA 1GZ1A 3SM0A 1Z42A 3N9KA 4LH8A 3FDGA 1MUMA 4J3ZA 1Q5MA 3B8IA 4Z1AA 2FGZA 2ISWA 3AXHA 5I09A 1ZBKA 3CZJA 4GGHA 3OG3A 1E1CB 7TIMA 1HJUA 1VD6A 2VC6A 1WDSA 3C86A 1R47A 3PBMA 4KCVA 1TA3B 1AH3A 4F0RA 1E56A 3KVMA 3ANUA 2OT0A 1OFEA 4WOQA 2OWWA 5EKYA 3N2XA 2F8QA 3B8SA 1P4CA 1KFCA 4UTWC 1VBRA 1OINA 4DJFD 4JKKA 1XUUA 3UJ2A 1FQ0A 2POTA 4S3KA 3QEZA 3H23A 3UA4A 1K7EA 5H8MA 1O1ZA 3KBJA 4LS0A 1RR2A 1TMHA 1X38A 1SZFA 1LG1A 2X1SA 4XAZA 1V7AA 4UQBA 1BSIA 1K03A 3RR4A 5FI8A 1K02A 1AQFA 2JIWA 3P0WA 2ZRXA 4GY7A 3UYCA 3QHMA 4C7DA 1IZJA 4WUIA 5DMYA 3CUFA 4WXYA 3GC5A 4JX6A 4Z42C 1JVNA 3P74A 1P43A 4CEXC 4RZ6A 1UC5A 2V5DA 2WSYA 1O95A 2X30A 3ZQ9A 4DUWA 3RDKA 1UD2A 1UW9A 4ZBCA 1OZQA 3W22A 2PTWA 4ACYA 1A5BA 1R9YA 1JAEA 2BASA 1JFHA 1N82A 1XLKA 4AZCB 2W62A 4JTKA 3LCFA 3CU2A 3A4WA 2PDMA 1VRDA 3W2KA 5ABFA 3M0JA 3DHDA 1WB0A 3USBA 4A22A 2CLFA 4QBXA 3EA2A 4IF2A 3K30A 4YYCA 1UKQA 4JZ5A 1VS1A 2AQWA 2IKHA 1J5SA 3QGVA 4JNYA 3T0TA 5CSSA 4J9JA 2EXOA 1J10A 1HG3A 4ZQCA 1NFGA 3FOKA 3ZJKA 4DELA 4ZQNA 2C6QA 3W0KA 1UR8A 2YDAA 2WW5A 2YGYA 2XPKA 3CXOA 2UY4A 2Q09A 4MWAA 3GK0A 2F2KA 1QPKA 3C56A 2VUYA 4GFIA 4DBWA 2PWFA 1UCWA 3VZXA 3W1LA 3BAXA 3NTYA 2VOTA 2A3LA 3CO8A 4UB9A 1XLBA 2RJGA 4RE2A 2JF6A 3WUGA 1HP5A 1V6VA 3UFYA 1VFOA 5LIXX 2VR4A 2B7OA 3DFOA 1KO0A 1EJWC 1I45A 3E96A 4YVXA 3H2OA 1SO5A 1W0MA 4PN2A 2GDUA 1Q6QA 2IKIA 4N9CA 2B81A 4WJ8A 3M0LA 5CZSA 4XKYB 1K1DA 3URQA 2OLSA 4DXXA 3VD4A 1W31A 2H3DA 5E9AA 3MJYA 3N29A 5JBEA 1EC9A 3E2VA 3ZVHA 3BAWA 2Y0FA 4FNRA 1RVGA 3MHGA 5C54A 4PUMA 3W1RA 3KP0A 4CQCA 3T7VA 5K9XA 2QNEA 4ICNA 1W56A 5FOOA 3AJXA 3OO2A 2H90A 2ZTKA 4XZLX 4LSBA 4YWIA 1V6UA 4HA3A 3A5FA 3QGAC 2J79A 3VGGA 1D3HA 2TAAA 3JRKA 2F38A 5B80A 1ZBCA 1DJQA 1DEDA 1WAWA 4H9ZA 1XWYA 4NAEA 1GQNA 2V3FA 4DWSD 3TR2A 2Y7GA 4ZSTA 4AWTA 1J4EA 3EMZA 5CZTA 2KX9A 5D38A 3GKAA 1W9BM 3TXZA 3NZRA 2JF7A 4ZQPA 3AIEA 1ZJHA 1XD0A 3LBCA 4AHQA 1RBAA 1YBQA 3A6OA 2ZXBA 3OA3A 1UR3M 3OZYA 3VIGA 1RQBA 3F4WA 3D0CA 3FEQA 3DXIA 4HMNA 1BYCA 5AC8A 2QULA 1NARA 4LUSA 2NLIA 3NO3A 3RU8X 2E1WA 1TPUA 4GI6A 3AWNA 4B5TA 5CPOA 1OFPA 4UQ9A 3G5EA 1QNPA 4D8LA 3EEZA 3BV7A 4PEKA 4REQB 3KP1A 1F07A 2X2GA 1JZ3A 3WBXA 1UHVA 4MY1A 4I5RA 3UETA 2PFHA 4C1NB 4C6JA 3G22A 3UR7A 3E5PA 1TTJA 1RXOB 3CUJA 1U22A 3K8KA 3RRXA 4FOKA 2WC4A 1V4YA 1CNVA 4F8XA 5A6BA 4L9XA 1LL4A 1XG3A 4LRTA 1TJ2A 1LWJA 3P8IA 4G5DA 5LA0A 1DTUA 2UV8G 1L6WA 3GH5A 1J12A 4GMEA 5F1VA 4HBKA 3CUXA 1OX6A 1XLIA 2RDXA 3VDHA 4CVWA 5HK4A 3EOEA 4HU4A 3WQCA 4UOQA 2PBGA 1HJQA 4O50A 1I1WA 3UWUA 1L8PA 4N6FA 3WD2A 4OHQA 1OWQA 4P7QA 1XV8A 1XS2A 4KPLA 4KETA 3R8RA 3IUHA 4X22A 1Q8AA 3KS5A 4TV6A 4F9DA 3TZNA 1OCQA 2CLIA 5LNUA 4CU6A 1O60A 1XRFA 5A6LA 1QNRA 5KINA 1E3XA 2YDRA 3FGCA 4ZTXA 1TJ0A 3A5VA 4IP7A 1TZ9A 1EGMA 4HHMA 2IPJA 1EP3A 1LT8A 1UJPA 3W2MA 5CPQA 3OODA 4H6RA 5DBUA 1TMLA 4JQ4A 1AH0A 1EYEA 4IQDA 3L4UA 3AS1A 4UFMA 7XIMA 3TYUA 3B4YA 5KZDA 2VZOA 2WBGA 3T1GA 4OUIA 4JIPA 3MT1A 4LUIA 4U3CA 4UCFA 4D6DA 2QKFA 4UQCA 1Q6GA 1XJBA 3AXMA 1OFOA 1XFCA 3PSVA 5F2GA 2BXVA 3B9AA 4JTIA 2GOKA 4RZBA 1O68A 3W1NA 2CLMA 1IEVA 3NO5A 3B0UX 2D20A 2DZSA 5J8LA 2D1ZA 3QQ1A 1CXHA 2SFPA 2FVKA 5J5DA 4WGXA 3E0WA 3H26A 3HN3A 4GYFA 1G7UA 2HK1A 4X0NA 1ZB5A 4AZIA 3I6TA 3GH7A 5HNTA 4EF8A 3SCSA 3UWQA 1JI2A 3POCA 4F66A 2KAUC 1LQ0A 2HNHA 3WLQA 2ZVRA 2BY0A 4MWAE 4Y8EA 4DBEA 4NG3A 1KQYA 3TVAA 3CZ8A 4QCFA 2QCHA 3S1GA 5E9XA 3G6MA 5AHIA 3CEUA 4MY9A 1UR9A 5C9RA 1XW8A 4DJED 1AJZA 3N19B 3A3WA 1KBKA 2PB1A 3H2EA 4D6IA 4ALDA 1FDZA 1JXKA 1D3GA 2BVWA 2F6UA 3VM5A 5HAOA 3W2UA 5PTDA 1BYAA 4IT1A 1UKPA 4JFUA 1V02A 4YTRA 4BEQA 1M6JA 3SGUA 4L5ZA 4NJJA 2Q3OA 1O94A 2HZGA 2NV2A 3AMGA 1M68A 3OJGA 4HA1A 3ZYZA 3MMWA 1FTXA 2FTYA 2CBVA 3CPGA 1XI3A 1I2QA 3UP8A 4US5D 1H7XA 4DNHA 1DIEA 5A8GA 3BLFA 4Z1DA 3E2RA 2WAGA 1QVBA 4AYGA 1U5HA 1W37A 3LGEA 2R94A 4ZE5A 2E5DA 4AMCA 4GXPA 4LYRA 3PWAA 2TYSA 2Y61A 4U5KA 1EA9C 1QI4A 5E0CA 3UJSA 3G8RA 2BBFA 5DF0A 3KTXA 3PJWA 2Y88A 5D03A 1HTIA 1RLDA 4J27A 1ZS2A 1V6XA 4AMAA 3W7OA 1PDZA 4N9DA 3L4YA 3KOYA 3IV3A 5DO8A 3EKZA 3AHZA 3D6NA 1ZZMA 4G2DA 1M7PA 1NELA 1BQCA 1YNYA 1TX0A 5AHFA 2P8CA 3SFWA 5IOBA 3FYOA 1YE6A 2HJPA 3LRLA 3T42A 3S1VA 4GZIA 1XINA 4C91A 1V8EA 1J9YA 3A24A 1VFTA 3WD1A 1J2BA 4PFMA 2BMBA 4F0SA 1TE1A 2WZIA 3BOLA 4R88A 2Z4GA 2J4GA 3VXGA 2QAFA 2VQUA 3W3OA 1L6FA 4CN6A 4ZTYA 2O9RA 4FNQA 1JF6A 5M17A 1XIBA 2QW5A 3BXWA 1XKJA 3WUFA 1UP3A 3AIBA 1XL9A 4W7VA 3CQIA 4GO8A 4MLJA 4AC7C 4HSOA 1T7LA 1WZAA 3ZR4A 3PJTA 2DJXA 3HFYA 4W9TA 2AGKA 3C0LA 2VCCA 2GQ9A 3M1ZA 2V5LA 1PHQA 3GXPA 1C7SA 3SUTA 4DZHA 2GGIA 4CNNA 2HSAA 3N2MA 5LKYA 1XLFA 1XUZA 3WQEA 3UBPC 1E3ZA 4GKLA 1XCXA 1WZLA 2HCVA 3KOWA 1UMYA 3VX1A 1JCXA 2VRJA 3WELA 1EA0A 1R8LA 3PHAA 1Q66A 2V30A 3OVQA 3L4TA 2WNQA 2HBVA 4YNGA 1EXPA 1I9CB 2BY3A 4LF2A 4H6EA 1AW2A 3UVIA 4NNAA 4DPPA 2PDYA 2IKGA 3BPWA 4HYWA 2Z1KA 1E5JA 4GRSA 3PJUA 1TRDA 5ECVA 3INPA 1VCGA 4Z1BA 3ABRA 4WSKA 2PWEA 3E9AA 3WF2A 1Q2RA 5KEZA 3SECA 2P5NA 4Z1YA 4AB4A 4D8ZA 2NX9A 8CGTA 1UWTA 2R8WA 3IAPA 3BJTA 2QVNA 1EXBA 4WDUA 5E70A 3U48A 4JHOA 2CXEA 3LCIA 3MUZ1 3R5EA 5G1MA 2D2OA 4AX6A 5D33A 3ABXA 4JTQA 2DZAA 3VIPA 5LNRA 4LVGA 3G8EA 2BNJA 3AXIA 2O9PA 3ABOA 4KT2A 3VIMA 1E5NA 1AMKA 1XIIA 5BRQA 3OVPA 1TV8A 3MWAA 1YLVA 4ZVJA 1F9CA 5CZJA 4DB7A 1SFSA 1FCVA 3QKEA 1W9UA 3DC8A 4DF1A 3W38A 3PTDA 1GKPA 1W9PA 3E5BA 5ABHA 5J5RA 2YL8A 4FXSA 2GGGA 3S47A 1ZALA 3SFKA 5CG0A 1FWDC 4XTIA 1W5OA 1C8VA 4NIRA 4MHBA 1DJZA 2RDUA 2E1DA 4C6NA 1TQXA 1Z6KA 3RPMA 3S6DA 3W7GA 3E6EA 1GT8A 3UZYA 1QI3A 4HB7A 3CHFA 4QLKA 1X97A 2BGNE 5DMMA 3UJFA 4LYKA 1UWQA 1THFD 4GWEA 4HHHA 1XSJA 1Q4WA 4PBGA 4AXNA 4G56A 1N2VA 1W1TA 4HA0A 3CMJA 3AU2A 4DBSA 4TVCA 2WSRA 2ALRA 1PCWA 2PDIA 3VNKA 1K7FA 5CKSA 1BF2A 4HTBA 4L6HA 3EX1A 1IIGA 4MKNA 4LBUA 1P5BA 4L7ZA 1RCOB 1V02E 3KEHA 3NZGA 2Y89A 3AS2A 4PMVA 3W23A 2D22A 3BLKA 3L23A 4V2XA 4HNUA 1QW7A 4Z2JA 3UZWA 4D1JA 5C9XA 3KUMA 3F4NA 3KTSA 5HNUA 3QMRA 3WQ4A 3NPWA 4URIA 1QWKA 5LYRA 4MAZA 3TW9A 3SN1A 3TTYA 4JEJA 1LT7A 3L4ZA 2BFGA 4OBTA 4DJDA 3I10A 3WCZA 1ITQA 4HU8A 2VJXA 3IIXA 1BVWA 3ANYA 3E0LA 3U4FA 4X2PA 1RALA 3DG7A 3SI9A 4NUWA 2Z7KA 2Z0IA 1FHLA 3C0SA 4HCDA 3IV8A 1EWEA 2PDGA 2YCLA 1GNXA 2OYKA 4KIRA 2A85A 5DCEA 2ZBTA 3Q37A 2OR2A 5F1UA 4LC8A 4OZOA 2O92A 1A5UA 1QPRA 3LG3A 4JL1A 4KF1A 2JALA 3VMPA 3H24A 4PSPA 2VGBA 1QNQA 4GQBA 4XO7A 1HJSA 3PBWA 1P0EA 3POHA 5C0QA 3E12A 5BWAA 5CLTA 3VDAA 1Q7ZA 3BGJA 3BJFA 3N4FA 3GW3A 3T44A 2FPVA 3TEVA 4JTGA 4A3RA 4JFWA 2XU2A 1DJYA 3LBMA 3Q2DA 3W7HA 4UTFA 4G8TA 2Q8XA 1C93A 3NZPA 3KOXA 4OTKA 4M7TA 3D3AA 2DZTA 2IXUA 1NQ6A 3RN6A 4AW7A 3G1DA 3WNOA 4WY0F 4Y9MA 1OEPA 4F40A 2QCGA 1EJTC 4NXSA 4KFPA 3TH6A 1PDYA 4CNUA 1UD5A 1EJRC 3C61A 4PTDA 3BGAA 3TN3A 4YCOA 4OBSA 2AAAA 2PDCA 2A2IA 3V36A 3EB2A 1F6YA 2XZ7A 4GZJA 4B3ZA 2P53A 4IMEA 2DIKA 4KEZA 2J6XA 3H8AA 1UR4A 4OECA 4O54A 1FH7A 3M0HA 5IFTA 1EDQA 2ZZ2A 3OVGA 4Q4RA 2NSOA 4XO6A 4CNOA 1UD4A 2IQ0A 2OYMA 4A35A 3APYA 5LZLA 2D0HA 3MPGA 4N9BA 4GIYA 3FN9A 4F0MA 5HOSA 2P3EA 1UROA 5CC7A 2V82A 3TJIA 4JQ3A 1FKXA 1AL7A 1JCMP 4LS1A 4Q4SA 4AWSA 1Z32X 4E6MA 4LY8A 4XD4A 4I7VA 2OTDA 1TTQA 4L9ZA 1WP6A 3R13A 3CTLA 3B04A 5IBXA 4GBDA 3GDBA 2QGYA 2XGIA 2ZUMA 5DFAA 3FDKA 4OJYA 2AMXA 3RJYA 1DIKA 1MXGA 1FHVA 4NKCA 5HNRA 5AFDA 2DUAA 3BMVA 3OQEA 3AWOA 3NQCA 4XX6A 3VM7A 3VUPA 4I9AA 3WQVA 1ZAIA 4O16A 3M9YA 1X7IA 3HPZA 1X1NA 2ZE3A 1BG9A 1JDFA 2VRQA 1ODZA 1M9HA 2QUNA 1ZHAA 2E68A 3GDRA 1F73A 9XIAA 1H1ZA 1QASA 2FTPA 1XXXA 2BGSA 1F7BA 3WK3A 4GVFA 4X3ZA 4ZQOA 5AECA 3BW2A 5JMUA 1C3FA 1GG1A 1PUDA 3S2MA 4QJ3B 3S4TA 2DVTA 3NVTA 3VIFA 3UT0A 4XSLA 4E4PA 1CB7B 3ZR5A 1S2AA 1C9WA 4U5IA 4GCAA 4ACZA 4MZ1A 2ZZ1A 3M5VA 1RSCA 1BGAA 2XTKA 1TYGA 2ZZ3A 4QE4A 5AC6A 2W63A 1YNQA 2ZXQA 1SZGA 2BVDA 2Z1WA 3LB0A 1XRVA 1MDLA 2G95A 1DIDA 1QHZA 3AO0A 4MWAB 2GPTA 3CQKA 4XAYA 3TQVA 3DKLA 3VOHA 3T81A 5LNVA 1XKYA 3W70A 1R2TA 3OGRA 1CCWB 5E6YA 4LVBA 4NZCA 5BU6A 3UJEA 2D69A 3S5NA 1R87A 4QR6A 1PIIA 3JR2A 3W1AA 3FVDA 1YXDA 4AZBA 4BQ3A 1QNVA 4P7RA 1VR6A 4EAYA 3FJ6A 4GXWA 3M4HA 5FA5A 4B3LA 3KWXA 4AZ5A 1VYPX 4HNNA 3EWXA 3BSMA 2RHGA 3GXDA 3WJXA 5FESA 3ES7A 3HMJG 5HINA 2ZKMX 3T8QA 1R38A 2V2HA 4TX9A 4QJ5B 8XIMA 1QCWA 3NQVA 2E9LA 4HJWA 3IGUA 4M6QA 3S5ZA 4S39A 1DBTA 2GJNA 3ZVHB 2GVJA 4E2VA 2ZADA 1ZP3A 4U2ZA 1BYBA 4RXFA 4E38A 1TV3A 1JPDX 5BRBA 3LM3A 5E93A 4HNLA 4ZO8A 4F2BA 3ONCA 1CGYA 4IM4A 4EP8C 2F7FA 1TCDA 3U5UA 4MLRA 4IIBA 1DJXA 3NOEA 3DYOA 3NL5A 4RNJA 1B4KA 4ORMA 3B3DA 3MS8A 3ARXA 3QMSA 5FF0A 3OBEA 4IX2A 3N2TA 4JL2A 3LYEA 3L2MA 3OG2A 3VCNA 1T41A 3E3HA 5MKGA 2GK1A 2C91A 1OGBA 4JTHA 4E2DA 3TSMA 2BV9A 3H53A 4TIMA 3LUTA 2R1NA 3L68A 2TRSA 3QV6A 2ODOA 3F4DA 1I60A 4DJFC 1XDLA 3K4AA 3BV4A 1PTAA 1M7JA 1HVQA 2E4TA 1Q6FA 4UXDA 2I16A 4FSAA 3QJAA 4XAGA 4DZIA 1A0EA 3E0IA 2QCEA 2XINA 2GJXA 2PU1A 1OX4A 4DNMA 3KM8A 3TP4A 4BF7A 3KCOA 2OB3A 3EB4A 3NGFA 5HJXA 4XZIA 3S46A 3AHYA 3O05A 5AVHA 5K7JA 4C60A 3UR8A 2NQLA 2PP1A 3U9IA 1KCLA 4C7GA 1IZCA 5M03A 1CXIA 5AHMA 1MEHA 4O0KA 4AVOA 2PTYA 4ONVA 1DHPA 2X2YA 2XH7A 4WCJA 2TPSA 4KFOA 3WD4A 1BRLB 3V4BA 3LI1A 1MVYA 1CXFA 1J18A 4ZB0A 1W3JA 1J0IA 4D6GA 2D73A 1H7NA 2WKJA 1A5MC 1FWBC 3DECA 3J7HA 3WEOA 3A21A 5HQLA 5CJNA 3M5YA 4ZB2A 1F6KA 3NSNA 2Z26A 4PMRA 3C2OA 1OABA 1H7WA 4XZ9A 1FDYA 3HGOA 2PWUA 2QJJA 3G18A 3FS2A 4A8NA 2W91A 1YEYA 2P8BA 1O5RA 3QPYA 1E0XA 1HT6A 3SCVA 2C8NA 1PYFA 4NAFB 1XIHA 3MKVA 4QSFA 3M44A 2J27A 2YA2A 3VUSA 3HQNA 4MYAA 1A80A 2YB4A 3R43A 4QRNA 1E1FA 3SIMA 1ELSA 4B92A 1RY8A 3N6JA 3TTSA 4HOXA 1LLWA 1VB9A 4CCZA 4ZL1A 3TTQA 2E3ZA 2A6NA 4L80A 5AYBA 3CUIA 2AGTA 3W07A 1D3CA 4R33A 1OHLA 4HVXA 1XPYA 4B16A 2REQB 2X0HA 3YPIA 3KBMA 3BG5A 3VIOA 1C90A 5DRCA 1FDJA 1UP2A 1SW7A 3URAA 3A3HA 6TAAA 1HNYA 4BJHA 5A95A 5CCZA 2XSAA 3CIVA 2FYMA 4UUIA 1Q45A 3IEBA 2GVEA 2VGFA 5C6MA 1DJHA 1TMQA 3UWZA 2DZWA 3B8WA 4Z2GA 1QNSA 2OMAA 1L6GA 4S3GA 1AK5A 9XIMA 4PYSA 1VPXA 2ZZ7A 4Q3MA 8XIAA 1IT0A 2WZTA 2GVLA 3WDPP 4IMDA 2B7NA 4JQ1A 1Q6RA 4W93A 2BVTA 5U7SA 1H63A 2J7DA 3S83A 2ZRZA 2WMFA 1D2KA 3CASA 1LG2A 2VM8A 3W00A 4JTFA 2YR1A 4DQWA 4MMWA 4I90A 3B0PA 3LNMA 1TJRA 3EOOA 3EZ4A 4WD0A 4Y9AA 3GFXA 2BZNA 3PZGA 4PUDA 1W8GA 2DT0A 5EMUA 4GH1A 3PN8A 4G1NA 1RK6A 3K2GA 4M6PA 3AXKA 1U83A 1TB3A 1W1VA 1JCTA 3P84A 7A3HA 4QNEA 3ME3A 4GE8A 4GNKB 3QW3A 4QJ1A 1F3XA 3AS0A 2VFGA 4B5UA 1TIMA 3KRZA 1UZDA 3MUCA 4QDWA 4O12A 2Q01A 3P7YA 1WDRA 2PURA 1XBXA 3TK7A 2H3BA 2VDHA 1L6SA 1R2RA 5KMYA 1CEOA 5A8MA 4IUOA 1XYAA 2WVSA 3FXGA 3VAVA 2ZA3A 2NXHA 2CKRA 3IK4A 1V51A 1V0MA 2FKPA 5FF2A 3MSYA 2ZX7A 3V18A 1PZ1A 1A4LA 3GB6A 2YPIA 3KL5A 1K8XA 5D2YA 1GW9A 2NLYA 1OF8A 4AVFA 5LXEA 4FZIA 4H9MA 5HXMA 2XFYA 3W83A 1IGWA 3ARUA 2QR6A 3VCCA 3WK2A 4R53A 4NYUA 3WENA 1WA3A 3MHFA 3A47A 3GH4A 1KFWA 2QUMA 3HPXA 5EMKA 1FBAA 4Y9NA 4CVUA 1RY0A 3GQYA 4Q7NA 3NVDA 2J25A 3C2FA 3R8HA 4JQ2A 3DYPA 1XLMA 3WLHA 1PSCA 5HA7A 3I6EA 4GCXA 3CLMA 1OFBA 4W88A 1I2OA 2FHBA 4DWDA 2AKMA 3FIGA 2A3HA 1NY1A 3C3UA 2ASHA 4WZHA 4ZB5A 5F4WA 3GIPA 4GJIA 5FKYA 3SGZA 1F74A 2VEGA 4CU8A 4BA0A 2Q71A 1ZFJA 2HS6A 4PZVA 3IIVA 1NOUA 4IMFA 4O14A 2QF8A 1JQVA 4IQJA 3HZ3A 3ICJA 5CGTA 1OCJA 5JH2A 3LCGA 2ZUSA 1FWHC 3GKFA 2ICSA 2HPMA 4HYVA 2OEMA 3AISA 1NAL1 4M8UA 3M6DA 4HMDA 3AUOA 1UUMA 3DC0A 4QDMA 3WUEA 3RAOA 2NUYA 1A3WA 3VVGA 1EBGA 3QYSA 1B3VA 1K77A 1JPIA 4RNHA 2XSXA 1AG1O 2CHNA 5I3IA 1AFSA 4MOZA 3AMKA 4C6IA 3V0SA 4QITA 5EFDA 4DZ5A 3AIUA 4PMYA 5T8GA 4QIUA 5G2WA 4BFAA 4KWUA 4Q4QA 1SFTA 3T0BA 1J0ZA 1DXFA 4B90A 4K68A 1I0BA 2ZX8A 2O4MA 2VWTA 3UY8A 1L6YA 1LQAA 4Q33A 3O0KA 1NU5A 5I02A 4H00A 5DLCA 1FWNA 3PZTA 4GQRA 2A21A 4BK9A 3TAKA 3G6LA 1Z48A 1V03A 3UGRA 1GGOA 3GNDA 3P14A 3W6LA 4DJEC 4N4QA 4IIHA 3DGRA 3P8JA 3SURA 3S9ZA 1I2PA 3WLTA 1ECEA 4M5PA 3FAWA 3S2CA 3WKZA 4X2RA 4DXKA 4HK5A 5FL0A 4IX0A 4KERA 5D9PA 3CWNA 4IP4A 5AC7A 3REQB 4FALA 1DYSA 4PMJA 4O11A 3BG3A 3CAKA 1LQ2A 1BTMA 4K2SA 2HDJA 1O5QA 2DP3A 3QQ0A 4LVFA 1FWWA 4A8RA 4N4PA 4X61A 3VKDA 4XD5A 2E40A 4MNJA 4A4AA 4O1CA 1YQ2A 1XBVA 2VDIA 3NNTA 4F0KA 2WC3A 5FEPA 4LX4A 3UPBA 4Q6JA 2JK2A 4OVXA 5TAOA 4E3VA 1UZ1A 3ECQA 4DUVA 1BXNA 3SADA 3B9NA 1E6SM 1T6MA 4MUPA 1WCGA 3W7LA 4M19A 1JULA 3W1QA 2ZUUA 4P8VA 1PBGA 4UC5A 1W1B1 2E77A 4AF0B 3PZNA 3R0DA 3DKJA 4GQGA 4QG6A 4IIGA 2XIIA 2QCDB 2RJHA 1UUQA 2PTXA 2XM1A 3Q45A 3IS4A 4Z2IA 1DVJA 5CC5A 2GGJA 4F2UA 1AA1B 3SSJA 3W37A 2R1PA 3ALGA 2VEIA 4YHGA 1T96A 4ZENA 1WV2A 3KRUA 4XV0A 1EP2A 4PMUA 5I7GA 5FJUA 1HO1A 1DORA 2VKZG 4J2MA 4LAKA 2G0WA 3FA5A 1W3IA 1DV7A 5A6TC 3EX6A 3CAWA 3QHOA 4KWWA 3OGVA 2OEKA 4WXZA 3H2MA 2NX1A 2OWXA 1XBYA 3MV11 1E4MM 1Y7VA 3MI3A 2QV5A 4CD5A 4WJXA 4FR6A 4EK7A 4GY0A 5H8UA 1Z9AA 2VC5A 3KW3A 3WEMA 1RPXA 3GX9A 2DT1A 3L2IA 3TJXA 2ZX5A 3ENLA 3HJEA 3PAJA 3DX5A 2WXDM 1F3EA 1XIDA 5M1TA 2NQJA 3EBVA 2GSJA 4C90A 1B4EA 4KH2A 4J7RA 3CWOX 1XX1A 1OD0A 1XP3A 2OKTA 2XFFA 2NXGA 5DCBA 4UBPC 3PM6A 3S2JA 1FP8A 4LWWA 4AZHA 4IFKB 1W3HA 1VIWA 3HPSA 4HSHA 4DI9A 1MDRA 3EWUA 1QBBA 2J7GA 1B1YA 4I7UA 1B2YA 3WEZA 4HPGA 3HU7A 1GQJA 1EIBA 3WZ0E 3KBNA 1V6TA 4QFUA 4JNMA 1QNOA 3BANA 1HJWA 2FQIA 1HUVA 3O2LA 5IDZA 3MDUA 1K8YA 4GY1A 2NT1A 2I7GA 2ZA2A 4MJ4A 3RRAA 5FJPA 4H4IA 1J8VA 5E1QA 3V0UA 1XIJA 2C7FA 1VBUA 4WDWA 1YDYA 1CGWA 2XGZA 3GNNA 3PPGA 3IJLA 2I56A 3STEA 1OC6A 4BWLA 1Q4NX 3ALFA 3PPFA 1TVNA 5HWNA 2EPHA 1REQA 4B2DA 1E9LA 4JGDA 1E6ZA 3FYPA 2JKEA 4C6CA 4RUBA 3NXLA 2NV9A 3OBAA 2ISDA 2JBMA 2B7PA 4R85A 4B4HA 3HF3A 3OHIA 2Z24A 1RJPA 1S2VA 2E6DA 1EFZA 4DAFA 1UWUA 4JTJA 4MY8A 3SCWA 4W85A 5HMDA 3VD7A 2WHLA 3BQ5A 2ON3A 2FZ8A 2DH3A 4Y6GA 4LB4A 3H55A 3IANA 3WIJA 3T0AA 2EEXA 3TYCA 3VMOA 2PA6A 1UR0A 1RPKA 3UNTA 4W7WA 2W3ZA 6REQA 1WXZA 1DXIA 1J5TA 3LPGA 4TR9A 4WEVX 1DWFM 1S2TA 3UWWA 1VHNA 1MNSA 1US3A 4L4PA 2YOCA 1UR1A 2DQWA 3PC0A 1HIZA 4PB3A 5H91A 3UCCA 5GJMA 2CFFA 4ACZB 2PDFA 4G7EB 1IZKA 4PSRA 3GHRA 4O0QA 2PC4A 3M46A 4PL1A 4QGCA 4EPDC 3BTNA 5MF5A 2ZRUA 3W7EA 3TYZA 4H04A 4AHPA 1WKFA 4V33A 5MHBA 4LT9A 3S6OA 4IH3A 1SSGA 2CNCA 4JXCA 3QF0A 2DW7A 2YFOA 2Y8VA 3QZAA 3PPCA 3TZFA 3CMGA 3MSGA 1A5KC 5IRPA 3KL3A 4H6QA 4JIIX 3V5CA 2PZNA 3KX6A 4S3FA 1T99A 3KWSA 5L6UA 1FHDA 3M0XA 1VPYA 4UIOA 2Y2WA 4J4KA 3N04A 5A2AA 3W7IA 1CGVA 3G1YA 1B9ZA 3TW7A 2P1FA 3ZT5A 4MWAD 3BZGA 3DFYA 1Q6LA 4Y9PA 2EKGA 1EGVA 3DBPA 1XYMA 4DWSA 3W7NA 1G4TA 5D09A 3N18A 1MQPA 4R7WA 4A3UA 1OFDA 3EOUA 4CQ9A 1VIZA 3GG8A 2D23A 4GYPC 4AEOA 3QGKC 1R86A 1QT1A 4GKTA 2D24A 5JUVA 1SVDA 4PRTA 1OZMA 1TWDA 3UXDA 3SB0A 1Y5WA 3M0ZA 4P7OA 4GOAA 2C1IA 2QUUA 3M64A 1FCUA 2PC8A 4DO4A 5AC5A 1BTCA 1A53A 4ADUA 3GUGA 4P2VA 3CZKA 3IACA 4OKDA 1PZ2A 1IXQA 3ONBA 2HK0A 4O13A 5HBFA 3M0VA 1FP9A 1W1YA 4IXHA 2GK1B 3NQDA 4JNZA 1JNEA 1EPVA 2G8ZA 3KBSA 4NX0A 1W1A1 2J9YA 5CG7A 3WLKX 5A5WA 1AMYA 3AQUA 4WIWA 4MG4A 4YL2A 3LENA 2DSZA 1EO5A 1XC6A 3MMUA 1ZQ5A 3N34A 4ZGYA 3T4CA 1XHGA 1IXOA 3JUGA 4NX5A 1DWAM 2POZA 1PIGA 1IT8A 4IJBA 1SO6A 1XLEA 2NV1A 3HQ1A 3N9RA 1G01A 4PB4A 1W3LA 3LHUA 3RG6A 3UXKA 4MZYA 1WDWA 1KW1A 2ACUA 9CGTA 2QDDA 3MY9A 2PU0A 2IPGA 4B5SA 5F7UA 1EUNA 3EWBX 2WZHA 1SW3A 3OB8A 2WLYA 4QAWA 2GYIA 3WN6A 4FOUA 4KWSA 4C6KA 2FH8A 1CWYA 1OYBA 2XWEA 4I9MA 4Z2KA 1A5CA 1VH7A 4ZOCA 4XZMX 4CN4A 2ACSA 4OFCA 5I0DA 4RNIA 4H2HA 3L67A 2EKCA 3PZOA 2YL5A 1EZ2A 1SSDA 1GVOA 1Q6EA 3XINA 1TO3A 3LPPA 4PUEA 3R25A 1P0BA 1E4LA 3MP4A 2OO0A 2W61A 2FFCA 2OLHA 4GUGA 3WL0A 2OQYA 1W54A 4Z17A 1LOQA 2WOQA 3UCDA 3GD6A 4K1GA 4KW2A 5A6BD 3O16A 3QBUA 4NP7A 3F2DA 1RD6A 4BCEA 3L4XA 3CV7A 5I3HA 3TDFA 3M41A 3TW6A 4O28A 1ZCCA 5JBFA 5DY2A 3VABA 1GQKA 4NRRA 4O8AA 3W4RA 1UH2A 1ML1A 3S1XA 5CBBA 3IJQA 1EDTA 3TX9A 4DO7A 3W26A 3EDJA 5IHSA 4QNWA 1JPHA 2VX6A 5AZ1A 7ODCA 3WDJA 2FJUB 4LTSA 3C8FA 4AXKA 1SPQA 4NYYA 2PS2A 4ADSA 4B3KA 5BMXA 4S3DA 1ADSA 1MXDA 1UJQA 3FFSA 1GVRA 4M6UA 1R9ZA 1W9DM 3VMNA 4L1WA 3SIZA 3UNDA 1FFRA 3AS3A 1E72M 4LVDA 1XIMA 2GOUA 4L4OA 3TKFA 2WV8A 4AVNA 1G94A 1HL2A 3L4VA 1R3SA 1XLLA 2NX3A 1TVLA 2ZICA 1QUMA 3PUEA 1VLWA 2OU4A 3NZQA 1ITUA 1ISWA 1JD9A 2VYOA 3A4AA 3I65A 3VGHA 2ZZ5A 1L2QA 1TE6A 3WMCA 3TN6A 4FP1A 3L65A 3F5LA 1M5WA 3CM4A 2G4JA 1KR1A 4LW7A 1RCXB 1B90A 1SFLA 3PS7A 3F2BA 1GVEA 2PZ0A 1A0DA 3CH0A 3ITVA 1X6NA 4AEEA 3TWBA 4Q7BA 4GBUA 4M82A 3VNJA 3II1A 5ABEA 3GYCA 3F1QA 3S5YA 3PFMA 1B5TA 3LBOA 2B7QA 4Q4MA 4Q22A 4I5XA 5EB8A 4GACA 4TVUA 1JGMA 3UZZA 4ZA0A 5AVNA 1LRTA 2FB3A 2RDWA 1L8NA 2E25A 3OVRA 1HF6A 1S1RA 3A64A 1IEXA 3N14A 4W89A 4GHRA 3JVAA 2W0UA 5DANA 1VJSA 1TKKA 1PVNA 3WLLA 2P0IA 1TPEA 1PS9A 4JTRA 3AYRA 2CITA 5EL1A 3WLRA 3NQBA 2BODX 2VL4A 1KWGA 1V0NA 3KTCA 3VA8A 2XSBA 3ITGA 1NTHA 4KCWA 4OBRA 5CGMA 2R6OA 3QXBA 4GUFA 2VZUA 4K1WA 2J7FA 4GABA 3TTOA 4N6EA 1KRMA 1PPIA 3BVJA 9RUBA 2BTMA 3DOPA 3DFHA 3C2VA 4QJ4B 1NWUA 2PGFA 4E2BA 4ENLA 4B9YA 4K7VA 3FX4A 3RPDA 4BKNA 1JZ7A 2ZZ6A 3G0UA 2Y63A 1GOXA 1ZBVA 1PAMA 5C2XA 1JCJA 1W1IE 1V77A 5C9WA 3F5JA 1DPMA 3W85A 3SEPA 3WMBA 2XH4A 3AHTA 2QLYA 3RGTA 2FDSA 3AJ7A 2BLEA 4MDOA 1QAPA 5A6KA 2DZVA 1EQPA 3VDBA 1TELA 3VO0A 4E4UA 5FJOA 4C65A 1UA7A 3C2EA 3E49A 5AHLA 3QSRA 5D2TA 4GFSA 1E6XM 5CAKA 1JUEA 3LA4A 1GKQA 2G3NA 2PBOA 1AZ2A 1VENA 3P81A 2VGGA 4A2SA 4JR5A 3NEVA 4TX8A 3W2NA 2I1OA 1J79A 3IVSA 2WPGA 4DXVA 3ZJ7A 2YJQA 5G2IA 5A8OA 1GUVA 2I57A 4X9SA 1E73M 1F2JA 1W9VA 3QR1A 1MYRA 2OODA 1IXPA 1PKMA 4BY3A 4IGNA 5D32A 1I0DA 3NPUA 1D7FA 1PTGA 1P6WA 5FF7A 3THAA 3ARYA 2X1RA 2GUYA 3U2OA 2PF0A 4IHCA 1FY6A 1W5NA 5E6ZA 1GJWA 3P82A 4MIMA 1W3TA 3IGXA 3SQLA 1XLCA 3WNNA 3HO8A 3LZ5A 4Y9OA 4AX7A 4NNCA 2PWHA 1EJ7L 3W53A 3KDOA 4L56A 4JICA 3B03A 1VBGA 1NVMA 3AAMA 4AG0A 1ZJIA 3AU6A 1ZSXA 1W5QA 2FVMA 1IEWA 3FJNA 2C13A 4KMQA 4F4RA 2VX7A 2YDSA 5D8WA 1E0UA 2V68A 1GVSA 4XD3A 3SRFA 3K1GA 2F6XA 3D3FA 3NSMA 2HEJA 1UIPA 3GHUA 5BYWA 1TWSA 1K6WA 2BDQA 4Q4KA 3AMCA 3FK4A 4C5ZA 3G1VA 4ES4A 1P6BA 3H7RA 5HQMA 1LLOA 1YIXA 2HWGA 1DQUA 3KCJA 3AZTA 5A6SA 4PMZA 4MNMA 1KFKA 1RA0A 3BC9A 5HJYA 2XIBA 3MO7A 4L1GA 3BLLA 3KBVA 2GUUA 2A7PA 1QI2A 3GFZA 2XWDA 1SR9A 1Q6DA 1SO4A 3EX3A 2FFIA 5AY7A 4CQDA 3BO9A 4RKAA 3ZLHA 7PTDA 4IPNB 1TV4A 1A47A 4G1KA 2XZ9A 2WMGA 2O7QA 1Z44A 4P8XA 3HG3A 3WQOA 4RV8A 2NW0A 2AL2A 3LCLA 1W1PA 3Q4DA 4PC8A 1HW6A 4DYEA 1YX1A 5AC4A 3EDEA 5FSDC 1VFLA 4IIFA 1K9EA 2YCKX 1P1XA 2X0SA 4BQ4A 4EWND 3GO2A 5I00A 4US6A 2X1IA 4WX2A 1WUFA 2VRKA 3HBLA 1OIFA 2G41A 4O1AA 4YXGA 1R3QA 3VGDA 5FCZA 5JIPA 2C0AA 1KCKA 3B8DA 4A3YA 1H7PA 2QUVA 1EJSC 1EC7A 2DH2A 3NA8A 1V3IA 3MCOA 1QOQA 2XN1A 1TJ1A 3LHTA 2FZBA 1BAGA 4ZO9A 4D71A 8RUCA 5BWFA 3ATZA 3EPNA 3N17A 3WBEA 1QWGA 3FV9A 4PH6A 1J01A 4PCPA 1DJNA 4AIBA 2HISA 4H7ZA 1G1YA 1J0JA 2WMIA 2O7SA 3ARSA 1RJQA 1NP2A 1Q65A 3QRHA 3DFTA 2BY2A 3NO1A 1QATA 1M7OA 3U2EA 4DO5A 2NVCA 5GNZA 1LWIA 4KEMA 3QC0A 4WOZA 3GTFA 5H2ZA 3RYSA 2CLLA 4S1FA 4IQLA 3A12A 4Q4PA 3P5ZA 2B4GA 2QIWA 3VOFA 5IHRA 3MKKA 4S3JA 3VD3A 3MJMA 2WM1A 1BG4A 2ZXAA 1S3HA 2DIEA 2X41A 2A5HA 5CPTA 4C1KA 1ICQA 3LCWA 3WLSA 1KNWA 2JIEA 2DVXA 1IV8A 1GTEA 2WWCA 3WJZA 2QPSA 1OK4A 1C8YA 3L0GA 2ZFAA 5CQ1A 1OYAA 5HATA 1JYXA 4ATWA 1X1ZA 3H7UA 3V16A 2WWDA 3W76A 3KZSA 4X9YA 2Y7FA 1VJIA 3SJNA 1WQ5A 1S5WA 2V9DA 2PDQA 2I5QA 4NXKA 5C8BB 1W5MA 3G24A 3V1PA 2VEMA 1PJ9A 2JKPA 5I78A 1NFPA 2IKJA 6ALDA 3HPAA 4PUNA 5D2VA 5I3KA 2E5BA 3M5ZA 4OV4A 2H8ZA 3H2NA 3W75A 3RX4A 1E9YB 2HXUA 4PRWA 1FVPA 4D8AA 3ZR6A 2QVHA 1KC7A 2OYLA 4BF9A 3ATYA 4ERAA 2JGQA 4NI3A 4UTTA 1TA3A 1E0VA 3RLGA 5IDIA 5FF4A 4YTSA 4B15A 1UASA 2OVLA 3ITTA 4GNJA 1JAKA 1Q7QA 2WO5A 3STGA 2C19A 2VFFA 3KHDA 3LSCA 1HX0A 3VILA 3IJDA 2I5IA 3W1TA 3OZPA 2CZEA 3I68A 2NZLA 3S2NA 2E6YA 2CHRA 2CHOA 4AWUA 3GNRA 3ITOA 1ISZA 2E67A 4KWVA 5CXPA 4B5NA 3FA4A 4E4FA 5A2CA 1CLKA 3UWVA 1LBMA 3QM3A 3STCA 2ZUTA 4K7YA 1KM1A 4RE0A 3SCPA 4EE9A 1QW8A 1TPC1 3BICA 1REQB 3CO4A 1P0KA 3MSDA 3WLMA 4NVTA 5LA2A 3GNPA 1X6LA 1R6WA 2OZ0A 3TV8A 4L9YA 3S0CA 4PCNA 3H2CA 5CAHA 3W7PA 3C3NA 3L66A 4R9OA 1EF2A 4AC1X 1GW1A 2VZVA 1XIGA 3GRIA 1UPMB 4K3ZA 2NVAA 3UYIA 3O15A 3GLCA 3O0FA 2NXIA 2VVNA 3SCNA 1W9XA 4Y2WA 4L1XA 3V35A 3NUKA 2C0HA 4ZOEA 1JL8A 1NDYA 4AZCA 1JUKA 3F7JA 3M5XA 2CLEA 4A6GA 3SN0A 3AI0A 5FACA 1VZWA 2GDQA 5F2MA 1Q6CA 3JS3A 3STFA 2GJPA 4EVZA 4S23A 4HPHA 4Q7IA 5HWJA 2BB0A 2BOEX 5T9CE 3PNUA 4JYDA 5GNXA 4U10A 3NQ6A 1UZ4A 2ZYFA 4J2PA 1CDGA 3CIXA 2YLAA 5CBJA 1TWWA 2KZHA 3CMFA 4BHYA 4EAMA 3V7PA 3MUIA 2EPOA 1IWAA 1I2NA 1ME7A 4D6FA 4PTVA 4H7VA 4DPQA 2YW4A 4AAJA 1B3ZA 3ARVA 3GAYA 5TIMA 2E0PA 1EOMA 3R1ZA 3R2GA 3RITA 3W7CA 3KBWA 1H09A 1UYQA 2J66A 4DHGA 1WDQA 3L21A 4RZ4A 3W73A 4Z2HA 4YTQA 4QS6A 4PTNA 4C6DA 5ABTA 1QU4A 2DZPA 1HL9A 2ZA1A 4AWEA 1XGDA 1KQZA 4NZ3A 4TMCA 1LYXA 1QMLA 1LRNA 3DDMA 1GOIA 5JXQA 2WLZA 1X6UA 3G1AA 2YL6A 2ZZ4A 1JYWA 2R82A 4E8CA 4FHAA 1R30A 1WKDA 1EO7A 1PX8A 4JN7A 5A8PA 1BFNA 2R24A 2P50A 4C6FA 5T26A 4EPKA 1PO9A 4GUHA 5BOFA 2Z1BA 5AYIA 4TXEA 2Z1SA 5FJJA 1JG9A 5FJIA 3WNPA 3D46A 4AY1A 5BNKA 3WQGA 1VEOA 3WDHA 1OT1A 1OFRA 3RCMA 4JOMA 4B5VA 3ABZA 1X98A 2BG5A 2WNWA 3KRSA 4JDBA 3IVUA 3DHUA 4O1EA 3B0YA 1FH8A 1RUSA 1H0IA 3NQ8A 3PBGA 4KBXA 1AZ1A 5I6SA 2Z1VA 2UY2A 4LAUA 4HCHA 4UMCA 1XFBA 1XF0A 4PCTA 3PBYA 2J7BA 2WMJA 1JF5A 2CBIA 1JI1A 4TX6A 3H4WA 1WOAA 2OCZA 4UR8A 3W88A 3N15A 4ERGA 3MBFA 4D6JA 2VCAA 3T40A 4F0HA 4ROQA 2WZMA 2OGYA 5HQEA 3FLUA 3L0NA 4JKMA 4UCGA 5TF0A 4XIMA 1TCMA 2YLLA 1MW1A 4MGGA 3RIKA 2CLPA 5G5IA 1A5OC 2WK2A 4V27A 3IGHX 4D6CA 3E1F1 1O12A 2A1YA 4YTUA 1GVYA 3MP5A 3SCUA 2F61A 3ZVIA 5D9OA 2HRWA 3TN4A 3KHJA 3BE7A 4ZE4A 2J8GA 3GXTA 3AXXA 2DJLA 3LGDA 1EJUC 4I6VA 4YVPA 1E40A 4C1NA 1LDCA 1B3WA 5A6JA 1KKRA 5G2HA 4AQLA 1JPMA 2HBXA 3ZSSA 4R3UA 4EXBA 5CLWA 1OB0A 4EKJA 3NZ1A 3L7RA 4ZR8A 3H12A 4H8UA 3E2SA 3TROA 1ENUA 3D5HA 1HL8A 3VNMA 4PGLA 3K1DA 3NJ3A 1FKWA 4X0VA 1RQEA 4QP0A 2HVNA 4POCA 3JZEA 1XYBA 4JHZA 4O18A 5EYWA 1P7TB 4M3PA 3T05A 4OV9A 3RO8A 2DFAA 4LGXA 3U2CA 3PZIA 1VFUA 1K3UA 4HZ8A 2HV5A 5FEZA 2FLIA 4LYQA 3VDGA 4CLMA 1JXJA 1LUCB 2C1GA 4J3XA 1J2WA 3SJ3A 5M5DA 2NQ5A 4XUGA 3CV2A 3TA9A 1YPFA 4Z0JA 5BOOA 5D05A 5I23A 3CBWA 4XVEA 1SJCA 2FGBA 3E0FA 1LJYA 1YMYA 1QBAA 3EOSA 1NF7A 3FAXA 3O07A 3MANA 4UFJA 5EMMA 1PWLA 4RV3A 1RZMA 2QHAA 3NXFA 4ZZ9A 1H5VA 1Z3NA 3UWYA 2VHLA 2WJEA 2J62A 4MSSA 5JU6A 1NOWA 1XDJA 1JZ4A 2J7EA 3CL7A 4KRZA 3OZOA 1WBHA 3PY2A 1XH0A 4GK8A 3UR5A 3R0KA 4ZODA 3VFLA 1K8ZA 2HE8A 4ZQMA 5LNWA 3GG0A 1XYLA 1QRQA 2RUSA 4MZ8A 2QJMA 1UD8A 1E6NA 2XIMA 3L9CA 4HSNA 2ANUA 3I7SA 2TODA 1X1OA 2OSYA 3BUVA 1WZKA 1XCFA 3NAVA 2Z6JA 3QC3A 3RM8A 3FSUA 1PKNA 3T2QA 3GBDA 1VFHA 5A1AA 2DZXA 4JBRA 4RR4A 3BL3A 3GU9A 2J7HA 4EXQA 3THQA 4YTTA 4MWAC 3OQ8A 1HN1A 2RDTA 4LU0A 2WSKA 3N3TA 1E4NA 4YU1A 3TCSA 3RXZA 3ITLA 1W8SA 4FIRA 5I2UA 5GJNA 5J04A 1E15A 3UG5A 3OW1A 4JFVA 5B7YA 3MKCA 1JZ2A 4LV4A 3ZOAA 3VNIA 5I07A 1AVAA 1GOMA 1KRCC 1SYTA 3C6CA 1EQCA 3NURA 1IIHA 2HQAA 5G1YA 2J6VA 3VC5A 1DTNA 1UH3A 3NOYA 4MM1A 3RUBL 3P67A 4LS2A 2F84A 2XFRA 3FYYA 1D9EA 5FIPA 4C5YA 3KOZA 1V0LA 5BOEA 4NZ1A 3FCPA 1E0TA 3GU2A 3DN5A 1B3XA 2VDGA 3AIRA 3L0KA 4UTWA 4MVAA 3AIVA 4Q8NA 3TYBA 1K4HA 5EBUA 1UA3A 1KGUA 3HB9A 3MZ2A 2Q8ZA 5TQLA 1G0CA 1HGWA 2EHHA 4LVAA 1RJRA 1H60A 1FWGC 3T4WA 5KZMA 3LRKA 4GVIA 3MDWA 4NJGA 1EDGA 1PL9A 4S2BA 3CHCA 3I4KA 1SZNA 2FZNA 3AROA 5AYYA 1U1JA 1HKMA 3NM1A 4YCPA 2ZUVA 5HJLA 4GJJA 3QZ6A 1MNZA 2CETA 1TUFA 5FL1A 1G4EA 2WKLA 3N11A 2E6AA 1QI0A 1R5YA 4P8WA 1WKEA 1ZUAX 2G97A 2V3GA 5I3DA 4WDXA 2PLCA 2YSWA 1CLXA 3SUUA 4JTCA 2YDQA 4I3GA 2CZFA 1GYNA 1YTKA 2O9TA 4LYPA 5DMLA 3EKLA 1CENA 3R94A 3AMLA 1JUBA 1VKFA 1GCYA 4BR1A 1MRQA 2EGZA 2W67A 5G1TA 3WLNA 1A4MA 2X09A 4W8AA 2C15A 2GSEA 4HA4A 1EIXA 4GG9A 4WRHA 1E71M 1EF3A 2R1KA 1BQGA 4RX0A 4UR9A 2J78A 3CJPA 3QV9A 4CD4A 5TNVA 2VQTA 5HUPA 1JD7A 3WYZA 4NNBA 1BVNP 4NRSA 2G96A 3QY8A 2GQAA 2XIOA 4UQAA 3EDFA 5LHEA 4UOZA 3D47A 3GIQA 1KGXA 3WBAA 1E4IA 4QLLA 1OG0A 1VFMA 4A29A 1ODUA 1XBZA 3A23A 3LTSA 4XAFA 4M0XA 3N12A 3KS6A 4IMCA 4IOTA 1E6PA 4MB5A 3MB9A 4KFNA 3WLOA 1I4NA 1JQXA 2WNZA 1DJWA 2ZWZA 2QS8A 2G3IA 3GXMA 3VU2A 3I3EA 3O6YX 4FXJA 3GY1A 4XB3A 1DQWA 1XDMA 4NJHA 2WYSA 1FH9A 4YVVA 1TTPA 4FLSA 2QAPA 1TRIA 3A9IA 1POKA 2WZEA 5F4SA 3PPHA 1A49A 3IIOA 3OPSA 4GLEA 2G5WA 1OADA 3WFZA 3BLPX 4A8LA 3O1NA 4MUZA 2CLKA 4QG8A 1RBOB 1KBBA 3N1AA 5BXRA 3E74A 2I14A 1NFBA 3MC5A 1UKOA 3B9DA 1M04A 4CNTA 2VD8A 2D3LA 5AHNA 5C2CA 3NM3A 3A4JA 4V28A 1KFBA 4LBRA 3U2ZA 3K4DA 2EJAA 4GC4A 4HPNA 1GOQA 2E7FA 2Y24A 2ISSA 1RAKA 4LY4A 1IEQA 1UWRA 1ZBWA 5CGQA 3WMSA 5K9CA 1ONRA 3H2FA 1KBIA 3TXVA 4RPQA 4BS0A 1KLZA 4DN1A 3PP7A 3WF1A 2VURA 2YZ5A 3W81A 2FDMA 3R7MA 3VOCA 4PB5A 1A50A 3T08A 3VIHA 3CQ0A 4LBSA 4CN1A 4C1LA 1CTNA 3CGTA 4RNFA 1PB0A 2UZ9A 2V0TA 4GD0A 2F6KA 2Z2BA 2VR2A 3TE9A 4ZXLA 4CQBA 1LROA 3LV5A 4HK6A 4H9YA 1HKJA 2VFEA 5EGRA 1BLIA 3GHSA 5C71A 4Y96A 5AB3A 2Y5SA 3BLDA 1HFBA 3VKCA 2QDGA 3K13A 7REQB 2AL2B 4BEUA 3FW6A 3HG5A 1B31A 2PODA 3CV6A 2YA0A 1GYMA 4HHPA 4PULA 4GA8A 2FZMA 1OC7A 4OE7A 2J88A 1I75A 2V2CA 4DBUA 1YPXA 4MTVA 1F8IA 5A8QA 5GJPA 3IJ8A 5TD4A 4PCFA 4HCLA 3PBUA 2WSPA 4JQAA 4S3BA 2AQVA 2D0GA 4A05A 3DU0A 1TREA 3LCXA 4GX9A 1MW3A 1KFJA 1KLYA 2W6RA 1RLCL 4INFA 1SU5A 3QFEA 4ZO6A 3PF3A 4K39A 3W1XA 3PTMA 3HGSA 4KEUA 2FJKA 2GQ8A 4QX4A 4UFHA 5BW6A 4RDYA 4RDZA 3NQ2A 4F0LA 4UFKA 1EJXC 4I9JA 1S5NA 1GOWA 1TPB1 1XLHA 4FB7A 1EHAA 3UZXA 2OG9A 3KRBA 1SUXA 1M1BA 1GEQA 1UQZA 2PWGA 3CB3A 3DZ1A 3CIWA 1M41A 1O7AA 4TTGA 1ZGDA 5IFPA 1GZJA 3GZAA 3W2JA 2MNRA 3W6YA 4KGJA 4QQUA 2CWNA 3BAYA 5HUOA 2HPIA 1GG0A 1Y8BA 1QXLA 1XM3A 2QJNA 5T9BG 3NDOA 1US0A 4EWJA 3NPVA 3EWYA 5FJRA 1M01A 1JR1A 4PR4A 3LPFA 2HMCA 2H9AA 5DXYA 3CPUA 4IGMA 4HNVA 1A5LC 1H7RA 2A6LA 1V3LA 2EF9A 5D8ZA 5EBAA 3OU8A 4OOUA 2R1LA 5A8NA 2I9EA 1P1MA 2RKXA 3U0HA 1GVIA 4I6KA 2XM2A 1FWEC 3DENA 4DEFA 4Q8WA 2CESA 2PPGA 5AKQA 3LQLA 3V0TA 2WNNA 4K36A 3H70A 1KTCA 4U3AA 1N7KA 1Y65A 1GZGA 2XVPA 3WD3A 1LOLA 5D02A 4FLOA 3UD6A 1KM0A 2V8ZA 2PDPA 3F4VA 3WD0A 3DESA 4YS1A 4AUBA 5ABFB 4Q6XA 1WYIA 2YXXA 6TIMA 4G6CA 3VOGA 1K8CA 3IPWA 1GONA 4K6AA 1XRTA 1YW1A 1PYMA 3PVFA 4U4MA 3TJLA 5XINA 1YTDA 3BOFA 3O3RA 3CUHA 3MO4A 3RCYA 4GXMA 3ERPA 3EPOA 3DFQA 1YTEA 1TPDA 4H19A 3CWHA 1U5VA 3TYAA 3RILA 2ZRWA 1KD0A 2FHFA 3QPZA 3A13A 2D2JA 1XG4A 3QY6A 3EWCA 3CQHA 1MMFA 1GJUA 2DV0A 3VKKA 2GFTA 3LZ3A 4HU3A 5D9MA 3EYPA 1LOSA 2EG6A 3P80A 2ZQ0A 2PDHA 3CTTA 3RO6A 4Q8QA 1B3OA 4R7OA 4IWWA 3GDMA 3SCOA 3BCFA 3P2VA 5TBOA 2DU2A 2WC7A 2GJRA 4H83A 3HGRA 3U7BA 4ML4A 5DT7A 1UG6A 3PUGA 1F8MA 3AALA 4HN4A 1FRBA 1QFEA 4LAMA 2A0NA 3K4WA 4M24A 1CX9A 1FCBA 4ERIA 1EGZA 3M0KA 1ZL1A 4P8UA 1ALDA 1GOOA 2DIJA 1N8IA 2V2DA 1IWPA 1GQIA 2CERA 1VFFA 1A3HA 4B2DD 4EXAA 1RD5A 1AD4A 4FOJA 2HXTA 4UQDA 3UQNA 2V3DA 2H8XA 2HNEA 1G7VA 1UZHA 1NOFA 1XSIA 1QK0A 2FB2A 3P93A 4MB3A 4IGHA 2Z6IA 3W24A 4EPEC 2EAWA 2PRHA 5K4ZA 4EACA 1S38A 2OOFA 3PULA 1TIWA 2VT0A 3EOLA 3B97A 3NCOA 5C7HA 3MUXA 4NAEB 2VOMA 1GYLA 4M1RA 1J6OA 4NZ5A 4F2TA 1UIOA 2DSWA 3H4XA 2IS7A 2A79A 1OCBA 1GQLA 3HFTA 4FS9A 2VZTA 4WJEA 4JPGA 1E9IA 1HKVA 5AYXA 1RH9A 2NUXA 1H51A 5F2IA 3S2LA 3N6HA 3IRDA 3VCRA 3PG9A 2UWFA 1VHCA 2E8YA 1YBQB 1N8FA 3U5YA 4WY0A 5HPCA 2ZXDA 4WHBA 4ATDA 3O6AA 1IR1A 4PUKA 3ZWSA 4AISA 1R9XA 4MB4A 3ABSA 1YNPA 1E6QM 4LUSB 2Z27A 4QEEA 3Q65A 3WQ5A 4ML9A 3V5FA 3BGGA 3LNPA 4CCDA 3EXSA 1RP9A 3MUY1 2DSVA 1KRAC 2HVMA 2PDWA 4JX5A 1KTNA 1TQJA 1CZ1A 3W82A 2YIHA 2GVGA 3WFLA 4XAPA 3T2PA 1GJPA 1DQXA 2Z00A 4PMDA 2Z2AA 3OOQA 1AL8A 4NZFA 3MSRA 3JU2A 3BSGA 2WQDA 1ZP4A 4M80A 1SFJA 3DUGA 3NL6A 3QV8A 1AODA 4TVDA 1GEHA 4CNPA 3UPMA 1SM9A 3I6RA 3GVQA 4KQNA 4DM1A 1MSSA 1WUEA 2GWNA 4DJDC 3RX3A 3R8GA 1FXQA 4NZJA 4HMCA 2JE8A 3EPMA 4FXFA 1EEPA 3UG8A 3UXAA 1EC8A 4LAZA 4HNCA 1K9FA 4LCSA 2G4FA 4LANA 4OIFA 5DBTA 3SY8A 1H11A 1PWMA 2XJ7A 5LIWX 4K8HA 5HR7A 4PRRA 4H01A 2Z1XA 1RVKA 5LIKX 1LL7A 4CU7A 3WLJA 3LU2A 1KM2A 3FGCB 4C6LA 3WBWA 3WX7A 3IUDA 3N4EA 4UZSA 4ZXOA 1VEMA 5DN1A 3IJ6A 3HTWA 3GW0A 2RFGA 2VEPA 3P3BA 3WNKA 2WHMA 1FHUA 4H9VA 3TC7A 5HMFA 4AY8A 1ZJBA 3UERA 3GR4A 1UMLA 4AIOA 5BXTA 2CWXA 3MYOA 3SO7A 1XQLA 2JFEX 3WQPA 5KZEA 1AW1A 2CZ5A 3FVMA 2VUNA 1X39A 3EXTA 2PRLA 3CC1A 3IAQA 1W2PA 3KAOA 4GQQA 2G3MA 4DLMA 1ISXA 3NPXA 4PE8A 4A2RA 3DG6A 2PAJA 4CGTA 3GM8A 3QLLA 3VOJA 3BARA 3CYVA 3VZZA 4N42A 2DZUA 3SUSA 4KEVA 2DT3A 1XCWA 1D8CA 1LRQA 5XIMA 1MFUA 3P60A 5HMSA 4CCEA 2Y7DA 4YHEA 3RM4A 4FPSA 4PUJA 2DT2A 1F61A 4FEZA 3H2AA 2PGWA 4U31A 4V1XA 1DWIM 3N25A 4O15A 1BRLA 4A21A 5CBIA 3QLDA 4HQVA 1KXHA 2VX5A 3LRMA 5DMNA 1QI5A 4IIEA 2XUCA 4NASA 4IP5A 4ZFCA 3S9YA 1DWHM 3ID7A 4OOZA 3KVLA 3LI0A 3H21A 1EKOA 3S8HA 3VKBA 5RUBA 1ESWA