3WQEA

D-threo-3-hydroxyaspartate dehydratase from delftia sp. ht23 complexed with d-allothreonine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHACATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords D-threo-3-hydroxyaspartate dehydratase
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
total genus 142
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqeA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqeA02
1NJJA 1SFTA 3AWOA 2ODOA 3UW6A 3E5PA 3WQFA 1KNWA 2OO0A 4PB5A 2PLJA 3N2OA 4ZGYA 3BTNA 4BEQA 3N29A 5GJPA 1RCQA 1HKVA 2VD9A 5FAGA 5BWAA 2RJGA 3C5QA 1QU4A 3E6EA 4V15A 2TODA 1XQKA 4XG1A 1L6FA 4PB4A 1VFTA 2NV9A 1D7KA 3NZPA 1XQLA 4A3QA 4XBJA 2DY3A 1VFHA 4BF5A 4BEUA 2J66A 3B8WA 3ANVA 3LLXA 1TWIA 5GJNA 2PLKA 2RJHA 1B54A 4KBXA 3CO8A 3CPGA 1XFCA 4QHRA 3S46A 3ANUA 3B8TA 1KO0A 1VFSA 3WQCA 4LUSA 3VABA 3WQDA 4DYJA 4ILSA 3HA1A 2P3EA 5IRPA 3WQGA 1HKWA 4LUYA 5FACA 3SY1A 4BHYA 4AIBA 3MT1A 5GJMA 4DZAA 1EPVA 1TUFA 2O0TA 2NVAA 2SFPA 4LUSB 7ODCA 1SZRA 3AWNA 3WQEA 1CT5A 4LUTB 4LUTA 3B8VA 3GWQA 2YXXA 4WR3A 3NZQA 1FTXA 1BD0A 4PB3A 2QGHA 2ON3A 1NIUA 3OO2A 1F3TA 3HURA 5FAJA 4FS9A 4ECLA 3KW3A 3B8UA 3N2BA 2VD8A 4Y2WA 3R79A 1W8GA 1L6GA
chains in the Genus database with same CATH superfamily
2BFGA 1Z44A 4JCLA 4XV0A 2HTMA 4UTHA 1D8CA 4AB4A 1J5TA 2ZRVA 3BV7A 3E0WA 5GJPA 2UWFA 2GUYA 1KW1A 2DW6A 2PGFA 2GOUA 1R9YA 1PVNA 3EEZA 2QUVA 1TVNA 3NQBA 2WKGA 1JFXA 3KFTA 4AZIA 4JIEA 2PTDA 1XDJA 1NP0A 4WK9A 2J6VA 5G4HC 3W7KA 1B57A 5GPRA 3KHJA 1P0BA 1XYZA 4C7DA 2DSKA 4EE9A 4IX2A 1NOFA 4OGZA 3APTA 2YCJA 3S46A 4WZHA 4U4MA 1E73M 2A3AA 4IQEA 4D8AA 4U31A 3WJZA 1UQYA 1W31A 4Z1BA 4BQ4A 3LCWA 2WSRA 2FMNA 1NELA 3PUOA 5TBOA 4H7ZA 5H6HA 5LIXX 5A6SA 4ADTA 4GI9A 3SM0A 3JZUA 5KZDA 3WKZA 4IPPA 2WMKA 3CIXA 2YXOA 5BRQA 1VEMA 2E25A 1AMYA 2IQTA 4HPGA 3WD2A 3IK2A 1MW3A 3WLTA 3OJGA 2Y5SA 3RPTA 4RV3A 2YDSA 3EBVA 3N3TA 5FJUA 1W8GA 5HNRA 3PZIA 2DH3A 5CGTA 1H09A 3H2CA 1JPKA 5D02A 3CH9A 1XRVA 2YB4A 2D3NA 4FLQA 2W66A 3UWUA 4HNLA 2X7WA 3O06A 2EAWA 2WPGA 4K37A 1EEPA 2RH9A 1KA9F 3VCCA 3MMTA 1JIBA 5AYBA 4UNLA 4G7FA 4J7RA 2DT0A 3NQFA 3KTCA 2RUSA 3TTYA 1OC7A 2HQAA 2CHRA 1D7KA 1R6WA 3P60A 2AMXA 1BTCA 3S9IA 1H1NA 3GAKA 3VK5A 3FDGA 1W32A 3FXGA 1WB0A 3UZWA 4KCUA 3NURA 4AYSA 5HJXA 4O1CA 1RHCA 1Q5MA 5XIMA 3G8RA 3MJYA 2YJQA 2G50A 3Q67A 2P3EA 1DE6A 1L6WA 5K7JA 4U2ZA 3JS3A 1A3XA 2ACUA 4Z1AA 4DJDD 3MP4A 3IJ7A 3WNMA 1YNYA 3SECA 3AZSA 1IQ8A 1BYDA 4W5ZA 3QHNA 5LKYA 4PUWA 4QISA 4X9SA 3FOKA 2OODA 2VGGA 3NYDA 5BROA 1BF2A 2CIPA 3TTEA 4GGHA 3E2QA 1AQ0A 4NI3A 1WO2A 3ZOAA 1EBGA 1CLXA 2DUAA 2OYKA 3ARUA 3NAVA 2AGTA 3WQVA 1SR9A 5FJRA 4FPSA 3S8HA 2BNJA 1OD0A 3WCZA 2WM1A 2DZUA 3Q37A 1W5MA 4IUOA 4NKCA 3S5ZA 2G97A 4HU3A 1NAL1 3DG3A 3VDAA 1ZFJA 3ATZA 1KCLA 5CLWA 1E9ZB 4PR4A 4AEEA 2E9MA 2FVMA 3DDMA 2VEPA 1OYAA 3MMWA 4H8HA 1SUXA 3RDKA 1H4PA 4UCFA 2PB1A 4BEUA 2VDGA 2XGZA 3RR4A 4TIMA 3SI9A 2J75A 1ADOA 1LT7A 4MDPA 4IFKA 3NGFA 3AIBA 1LLWA 1W3KA 4WXYA 2DSVA 1UP2A 1XRTA 1H62A 5HBFA 4JTGA 3AMKA 4X2RA 4D6FA 1R2TA 2P76A 3WDQA 2BWGA 4Z1CA 2I16A 2BMBA 5REQA 5XINA 3IS4A 4XAGA 1IEVA 3T0CA 1ODUA 1UZDA 5FA5A 4GVIA 4GUIA 2JBMA 3MANA 4O1AA 1MZRA 3KBVA 1SSDA 2F6UA 4TX8A 3KVJA 3TZFA 3ZR5A 5FEWA 4XKMA 4HU8A 2A7NA 2DJLA 2FZDA 3PZUA 4DJFA 3RITA 3W25A 1YX1A 1LOLA 1QPKA 1LUCA 3L5LA 1J01A 3R79A 5C9WA 2BGQA 1OGBA 2X30A 2ZA2A 3Q4DA 1VYPX 4PB5A 1DQUA 2I7GA 1RXOB 3EWDA 3NGJA 4OE7A 5J8LA 5D30A 3SGGA 3BWWA 3FHAA 1TPWA 2FHBA 3SUTA 4DBSA 4O18A 2D2JA 4TVCA 3MP5A 4V15A 1W1ZA 4E3TA 3P82A 4JTTA 1S2TA 1VFUA 2OB3A 2J7CA 3C86A 4IJRA 5LXEA 1U1HA 2WCAA 2WVTA 1JRBA 3IIXA 1AZ2A 1DKWA 3H7UA 2B0MA 4HU4A 1E51A 1B4EA 3W7RA 4E8GA 3GTIA 1Q7ZA 2VO5A 1ZALA 1IF2A 3IWPA 4L6DA 4CD8A 2VXNA 5C7HA 4ICNA 1LLZA 3EX1A 1W91A 3VIOA 1L2UA 4YL2A 3ZFHA 1YTKA 3M46A 1EXPA 1Q13A 3BOLA 4U2YA 1LYXA 2D2OA 4DXXA 2E8YA 3A3XA 1H5YA 3WLHA 4JTIA 1EDGA 1HP4A 3R6IA 4FIQA 4DXVA 3B0UX 3E2RA 3STCA 3GG0A 2Z2BA 4NXSA 3VAVA 5HAOA 4HHMA 4E5TA 1KR1A 2FVLA 2C15A 2Q01A 2QPSA 3L2IA 4TTUA 4Q4PA 3SFWA 2O9OA 5JH2A 3BLFA 5FJJA 3A4XA 1Q6CA 1VIZA 3MUAA 2FB2A 4LVAA 4Q8QA 8XIAA 2F6XA 1OBAA 1KLYA 1QO2A 2VEFA 3BK0A 4DN1A 1G6CA 3TP4A 3N9KA 4E0CA 4J2MA 2GVEA 4KT2A 5FL1A 4LV9A 2BTMA 3F1QA 3B9OA 5CPMA 5HUOA 2WPBA 2V3GA 1OG6A 2CZDA 3L5MA 3GC5A 4TQTA 1ZJHA 2ZRUA 4JBRA 3PJTA 1VFLA 3QXBA 3TR2A 3TYUA 3CMFA 3TN5A 2AQWA 1XPGA 3HO8A 1QBBA 5K4XA 2ZTJA 2Y6ZA 3G1XA 3LTYA 2ABBA 5FJTA 5LGXA 3RX2A 1BFNA 1RJRA 3VDBA 3QR1A 2X42A 1KGXA 3BCDA 2QF7A 1YBQB 4L65A 4JYFA 3OG2A 5JBFA 4GXMA 1E70M 4X2PA 3NUKA 3AWNA 5C7VA 3EX4A 3OBAA 4NZ5A 2ON3A 3K8KA 3QF0A 1VENA 1J0KA 4E6MA 2BZNA 1FFQA 4MFEA 1PJ9A 1ISWA 4QLLA 5D9OA 2D2HA 4V2XA 3GHTA 4UQBA 4Y7EA 1FWAC 4JFWA 5LNWA 1JL8A 1QASA 4LVBA 3VFCA 2J27A 1YEYA 2O4QA 3SB0A 3CJPA 3LV5A 4AF0A 1IR2A 4PTMA 2NV1A 1K8YA 4LTSA 3IIPA 4B4HA 1JZ5A 3I4KA 2TRSA 1D3HA 4UTWA 4JS3A 3RG6A 1TPDA 4CU7A 2V2CA 1A5BA 5ENLA 3TE9A 1J18A 5B7ZA 1Y8BA 3PK7A 2NW0A 3B06A 4IIBA 3W6MA 1W5OA 4Q32A 1KRBC 2PTYA 3EKLA 3C6CA 1KV5A 4LAOA 3LNMA 3VGDA 1XH2A 3DHFA 3OGRA 4N9EA 4QDWA 4ZFMA 3OZMA 2MNRA 3E49A 3EOLA 1GOQA 4MWAB 5CKSA 4DBDA 4AD2A 1Q4WA 2W4XA 5CAHA 8TIMA 4M6UA 3M07A 1H3GA 1DIDA 4YPJA 4JX5A 5EKYA 1DWHM 1JD9A 4GQ0A 1MFUA 3STPA 3TYEA 4C91A 3NQEA 3A47A 2YDRA 1ICPA 4RZBA 1V6VA 2HSAA 4AVFA 4AZCA 3NPVA 5F2MA 2AGKA 1DIKA 1XG4A 2X1RA 2ADAA 1ELSA 2H6RA 1VFTA 4RDVA 3G1RA 5CAKA 1XQLA 4XUYA 4D71A 3EXSA 1TPEA 1UP0A 1MUWA 3VXGA 2FYMA 3CUGA 3N2CA 3ARSA 4PUJA 3RLGA 2WKLA 4JNYA 4MLRA 1TMHA 1YYAA 1C3FA 2ISDA 1QWGA 3TTOA 4Q4RA 2OKOA 3RPMA 2BY2A 3UG3A 3GE7A 1HUVA 2PURA 4FALA 2NQ5A 1UBSA 4JIPA 4BQ5A 2AL2A 4W7UA 1B0IA 3GH4A 1QOPA 4QJ5B 4F2BA 2HXUA 1JCJA 3FA5A 3FKKA 2F8QA 3DCPA 3WUBA 4DI8A 4JCMA 3EOOA 2DZTA 3HN3A 4JIHA 2CEQA 4RX0A 1AJ2A 2Y7DA 4DJFC 1K7FA 4Q4QA 3E3HA 5CZKA 3LV6A 2ZDSA 1UOZA 2JIWA 4C6IA 1CBGA 2ZRWA 4FMVA 1YDYA 1YW1A 3VDHA 3UW6A 2V81A 4JDYA 5HPOA 7REQB 2NSXA 4KEZA 4IM4A 1ADDA 1SO5A 4WGXA 1PKMA 2FDMA 4P7QA 5HMSA 3EB4A 3VOJA 3S2LA 4BR1A 4BI7A 1A53A 2IW0A 4K1GA 5DT7A 5KITA 4WD0A 1JVNA 4AG0A 3BURA 4Y9AA 3IRSA 3VNMA 2G37A 1NTHA 1RJPA 1A80A 4DO4A 3NSMA 3CYJA 3HIJA 1IXOA 3W73A 3TTQA 1WZKA 3LTPA 2HCVA 1NDWA 5D33A 5E0FA 4Z1DA 3BG5A 1DXIA 3W74A 3O0KA 4U10A 1EC9A 2XIJA 1S2UA 3MZNA 3ALFA 1W1YA 4C1KA 4XD4A 4E38A 4IIEA 3WX7A 1XS2A 4WEVX 1V51A 2W27A 3ARZA 1JFHA 4ZA0A 1Z9AA 1AL8A 2RHGA 4PMUA 4HZ8A 4LC8A 3U4AA 5HMFA 3S2CA 5LHFA 4GZEA 3C8NA 2PGEA 4FF5A 2REQB 1A4LA 3VFLA 4PL2A 2NZLA 1LTDA 3HJEA 3KCLA 1NARA 2Z27A 4CCDA 1B3OA 1TPH1 1F73A 2WHMA 1S5MA 4PTWA 3WY1A 2D0FA 4Z2KA 4KWWA 1YTDA 1ZCOA 1KWKA 2Z1SA 1UJPA 3WEZA 2E0PA 1JAEA 4BWLA 4JPGA 5BXTA 3DFQA 3DI1A 2XFYA 1PTAA 2XDFA 3TSBA 3LEPA 3PPHA 4LRTA 2RDUA 1JR1A 1RD6A 2V69A 3P0XA 4PRRA 1YXDA 4RL3A 4EPKA 1FCUA 4AC7C 5HWMA 2V63A 4NNBA 1JYVA 3FJLA 2A6NA 5JH1A 5EMYA 4JTEA 3BAWA 2VZTA 3CV6A 2BHUA 1R30A 3TC7A 1V6UA 3ANVA 1ZP3A 2HXTA 3L0KA 3GTFA 4C5YA 3LN3A 4YYCA 3C0QA 1W37A 4KQNA 4H19A 2IPWA 1XW8A 1WXZA 1AJZA 3RFAA 5LNVA 3DOPA 3UYIA 5BCAA 4GX8A 3HQOA 1XSJA 2PTXA 3VE9A 1OWQA 1P0DA 1F9CA 5HWNA 3M44A 3CUJA 2VCCA 1EWEA 3PS7A 3I6EA 3QR0A 5LA2A 1JZ8A 1GHSA 1F6PA 2X0SA 3UWVA 1UWIA 1MW0A 1H11A 1DIOA 2WVVA 3RRAA 3DKJA 1Q6RA 3LK6A 3BAKA 3RX4A 5AC8A 3POCA 4WKAA 5BOFA 1V8EA 1GG1A 1BTMA 1TUXA 2G4JA 5HQLA 4B5SA 2E1WA 5D09A 3HB9A 4JQ3A 4IZGA 4LVDA 1M68A 4QJ3B 2YLLA 2PRHA 1ITQA 1ZCCA 3CL8A 3OZYA 5BWFA 2CLFA 1M65A 2VX7A 1UZ1A 1M7OA 5CZTA 5T26A 2ZTKA 4X9YA 4B5VA 4UTLA 3O63A 2NVCA 5FIPA 3ABOA 3R0UA 4GACA 3ZJKA 3SCVA 4K8EA 4LYQA 4MWAD 3WQOA 3UPWA 3R7MA 1L6YA 3BGJA 4F3HA 5CZ0A 2ZX5A 2GUBA 3FK4A 1SFLA 1GYNA 2OT1A 3OLDA 4IQLA 1XDMA 3FSTA 4UTWC 1TKKA 3REQA 1FWDC 4TTGA 3WBXA 2UV8G 2F2KA 2HJPA 2VR5A 4X60A 5JVLA 4YVXA 1ZZMA 1SW7A 1VPYA 1KRMA 6CGTA 3DU0A 4WR3A 3W7CA 1QOQA 1X7IA 1YPIA 4XD6A 3GNOA 4K7VA 2XVPA 3AHYA 3OIXA 1KFWA 1GG0A 1QI2A 3UZZA 4M82A 1EGMA 1JF5A 1BQGA 5EMLA 1Z69A 3EEGA 1JD7A 4EWJA 3VNKA 3N29A 3W76A 3C8FA 2PD5A 5D2TA 4NZCA 4ZCWA 1UZ4A 2ZC1A 4DNHA 1TQJA 1O94A 1VJIA 1AK5A 3P14A 3NNTA 1WKEA 1CEOA 1FDZA 2WC4A 3DZ1A 2ALRA 5DY3A 3DC0A 1G7UA 1KTBA 4K39A 3PNUA 3APGA 4JN7A 3N2TA 1RCXB 4HVXA 3KBJA 3MKCA 4GYFA 1HJXA 3T0AA 5C70A 2XIIA 2NXHA 1A0CA 3L4XA 1J0HA 1HW6A 2CFFA 3MI6A 1S2VA 1YXYA 4EP8C 5C9UA 2ZBTA 1YRRA 4GIYA 5EYWA 3RIKA 2EEXA 3LOTA 4QDPA 1NF0A 1S2AA 4Q7BA 4MGGA 2QJNA 4IWWA 2D0GA 5C8BB 3OYZA 5AN7A 4RDYA 4RNIA 1WQ5A 3MW7A 4JFVA 4CN4A 1UR3M 5AC7A 1CLVA 5EB8A 2WJZA 4GIEA 4FX6M 2PDBA 4TMBA 1GEQA 3ZJ8A 1EJUC 3TLLA 5M3WA 2D2GA 4DELA 4Y9OA 4LYRA 5D2WA 1W6TA 5BU6A 3GDLA 2HZGA 3A24A 4LX4A 2C13A 4O15A 1F4AA 4FNRA 3M5VA 4C6EA 2G3IA 1IEWA 3WELA 2QCLA 3W53A 4WSJA 1T6MA 1QHZA 1AW1A 1ZBKA 4MNLA 4CEXC 3DX5A 4UFHA 2GPTA 2Y8VA 4O11A 4GVHA 5IBXA 3V16A 4E4UA 2A21A 3YPIA 3VZXA 3PTKA 4E2DA 3LI1A 1UD6A 4GQQA 2DIKA 4GLEA 3W2KA 4LUSA 1M53A 3SUVA 1ECQA 4GNKB 2QCCA 3GK0A 4W86A 2DSUA 1HQTA 1XF0A 4WSHA 1MNZA 1JAKA 3SCUA 3U57A 4AQLA 4J3XA 2J47A 3FJNA 4ZO9A 2YBVA 1FWBC 5M5DA 4R85A 4WQ6A 1EYWA 3L23A 3MZ2A 1V6TA 3GR7A 4J28A 4A21A 4GQGA 2BDQA 3U7BA 1B30A 2YL6A 4B5TA 1ESWA 4RLIA 3PFRA 4BI6A 3G8EA 3KS6A 2XGBA 1P48A 1ZL1A 1R7AA 4BWLC 2OTDA 4OIFA 4MKNA 2C3ZA 3EA1A 4EAYA 3N4AA 3GDBA 1DHKA 1XC4A 4MNJA 3WL0A 3UESA 3GFXA 5AVNA 4XX6A 1PDZA 1KLZA 5TIMA 2HE8A 5DRCA 4HYVA 1M6JA 5A2CA 4AU0A 1XQKA 1ICQA 4I7VA 2V9DA 1WZAA 4UFIA 1TX2A 3BLKA 4ZQRA 1UWTA 1WOBA 4Z2HA 3UBPC 4LBUA 1OFAA 3TDFA 1K8CA 3M1ZA 4YCPA 5I78A 4I9MA 3M4HA 1OGGA 2C91A 2C79A 2C14A 2GZXA 2IQDA 3V1HA 1XYAA 3MDWA 1KKRA 2CLPA 1OINA 2VM8A 4B5XA 4AZ5A 4IFRA 2PMQA 1QCWA 1XLJA 1UR2A 4LBRA 1TZ9A 2CZEA 4OZOA 5KZ6A 1GYMA 4CLMA 2O9RA 1U5JA 4BQ3A 2GUUA 3U7VA 3AIEA 2BY3A 1IGWA 1ZJBA 1GZJA 1UIOA 4QM1A 4G7EA 1EPXA 2Y5EA 3ZWTA 4NG3A 1XX1A 2QIWA 4QTGA 1L9WA 4DUVA 1RVGA 1GOIA 1GVSA 3GU9A 3PBVA 3UGVA 1ZP4A 2VD8A 2PBOA 4WRHA 3AWOA 4M6PA 3BMVA 4M56A 1GQJA 1JZ6A 1EDQA 4H9MA 4YCOA 3WF1A 1T40A 1Q3NA 5I79A 4BFAA 2ISVA 3QHOA 4GI6A 2GQ9A 3L67A 4GYPA 2YA1A 2H3DA 4P7OA 2NX1A 4LNCA 2CETA 4WXZA 3WDRA 4HN8A 4CQ9A 4YTUA 3TZNA 1OD8A 1DIEA 2GFTA 2P8BA 4H83A 4I5XA 3G0XA 4QSHA 3UF9A 4S3AA 1KR0A 1RY0A 5AOUA 3LZ5A 4RW3A 1VRDA 4PE8A 2GDQA 2VMFA 1VFMA 4FO4A 1S38A 1KTNA 2F7FA 3BE7A 4DYJA 3UD6A 5I5RA 2BXZA 4GY0A 2WJDA 3G1SA 1XINA 3QFEA 1I9CB 1LORA 1E0UA 3H2MA 2ZXQA 2VEIA 5BXRA 3A4AA 3D6NA 4YYFA 1C91A 4DYKA 3PSWA 4QDMA 1F8IA 3PJUA 2NT1A 1ZS2A 3PWGA 1OIFA 3VKCA 3TQVA 3OTRA 4QE4A 2I9UA 1JI1A 4UFJA 2V3DA 1DQXA 2V2HA 1W9BM 4JTFA 1R9ZA 2WMIB 4FNPA 3A21A 3VNJA 2IPGA 4URIA 3SN4A 3RR1A 3S1UA 2GDVA 3FAWA 2BODX 4NASA 1DJYA 4FZIA 3BAJA 2ZA1A 3EKZA 4MY9A 5JQ9A 3LMZA 3EDFA 4HMNA 3CAQA 1PX4A 2QMKA 3L68A 3ZXWA 1SJCA 5IHSA 3VILA 2FZBA 1PBGA 3MBFA 3KOYA 2C8NA 2E6FA 1JF6A 3L4WA 4FLOA 3SCPA 3SO7A 2PF0A 4DO7A 1YDVA 3AU2A 1VIWA 1XFCA 1J6PA 1ZGDA 4DY1A 2R82A 3MMDA 1OF6A 5D9PA 4FNSA 3R8HA 2B31A 3BZJA 4L6HA 1E0VA 1I2QA 2CBJA 3UVIA 3OP2A 1W9UA 3H4WA 3RUBL 4F0MA 4IH3A 4QGCA 3VD9A 3S5SA 3B0PA 3IJIA 2J4GA 4S3CA 2FTPA 2ALDA 4JAWA 2ZUSA 3W3OA 2YZ5A 4XIAA 5AC5A 3DHPA 2VQUA 5I09A 3JU2A 4QFUA 1GOOA 4EXBA 4EPBC 2IMRA 1RQHA 1OT2A 2EF9A 4N4PA 3I10A 3AIVA 5E6YA 3N25A 1TJ0A 4WDUA 2Q6ZA 3BV4A 4O14A 4UOQA 3T42A 3VM7A 1EA0A 1AL7A 4LF2A 1O4UA 2VURA 3R94A 1Y65A 4M0XA 1CWYA 1GQKA 2XH7A 5HR6A 3UFYA 1BG4A 5HANA 3WENA 1C9WA 4PTXA 3BQ6A 2YL5A 3CQJA 4QE1A 2CZ5A 3ZIZA 4DAIA 6A3HA 5IBXC 4JIQA 3P6LA 1U5VA 3HGRA 3QSRA 3OVQA 1K6WA 4P8WA 3KRBA 4QXIA 2TPSA 4LGXA 1KXHA 4F0RA 3V36A 3VM5A 4D9PA 1UH3A 4XAFA 1W3TA 3AAMA 2W67A 1XBVA 2ZZ4A 4IJCA 1Q63A 3L12A 3PM6A 4ZL1A 4HMEA 1UR4A 1MUCA 3LCFA 7ODCA 1FXPA 1V6WA 5IDIA 4MUPA 1SM9A 1Q45A 3LHZA 3CHCA 3TU9A 2EPMX 3WD3A 3ORWA 1GJUA 3LHUA 1P7TB 3RU8X 3OO2A 5FF2A 2AAAA 2XH0A 4KEMA 4PMZA 4KPLA 1US3A 2P5NA 3EWCA 1ISXA 1QI0A 2D20A 4U33A 1EBHA 2J24A 2Z2UA 5E5CA 1HKVA 4Y8EA 2YIHA 4XBSA 2OZ0A 1WYIA 3L4ZA 4IL0A 4ADUA 1UWRA 3AISA 1V93A 3MSYA 4PUUA 1NY1A 2OR2A 1KC7A 2V30A 2BGSA 1H51A 1SZNA 3HMJG 1V3IA 1FWCC 4HTBA 3IARA 3TNOA 4JZ5A 3TNBA 1KXTA 1P6CA 3W1PA 3SR7A 4RNFA 1K9FA 2ZE3A 1ZPTA 2FKPA 2GSHA 3NO3A 1ZAJA 2UY3A 1G7VA 3TOPA 3M0LA 4M5PA 2EKGA 2ZX8A 4O13A 1VB9A 1Z41A 1Q6DA 3TVAA 1FWJC 1QPRA 3BCJA 1OCQA 1DWGM 4CQDA 4GABA 3VE7A 4HT3A 1OFPA 5D37A 3LDVA 2QAFA 5D4YA 3WLKX 3QW3A 1DJQA 2WMJA 3NWRA 2Z1XA 2ACRA 5AHIA 2GJLA 1FTXA 3PPGA 4XZHA 5T91A 3GHSA 1J96A 4NYYA 1O5QA 4P5UA 4WKFA 4ZVJA 1DVJA 1A5SA 2V2DA 3AMGA 2VC7A 2F6KA 2WYSA 1O7AA 2DIEA 4GUHA 1E6XM 2YOCA 4NRSA 2AL1A 2WZHA 3M5YA 3RU6A 3O6YX 1PCKA 5H8PA 1W1A1 2WXDM 2ASHA 4CUCA 3G6MA 3LSBA 4DF1A 4MZ1A 4DJFD 4MMWA 2PWDA 1HN1A 4LJ3A 1HKKA 1UQZA 5G4WA 3NPXA 2BHYA 3NM1A 4DPPA 3SCOA 2VWSA 1NP2A 1V02E 4A8RA 4ZE5A 2FH6A 3ANUA 2QDEA 4F0KA 1N2VA 2R1LA 4NIRA 2Q3RA 5D05A 5A6TC 3K1DA 4ML9A 4X0NA 4A05A 1XPYA 4M1BA 4GUGA 2XU2A 2CWNA 2Y0FA 1LRNA 2AL2B 3CXOA 4FX8A 1PO9A 1K77A 3V0UA 4ENLA 3LM7A 3THAA 1T96A 3UWWA 4GX9A 5A6JA 3MS8A 4UQAA 1MQQA 2XVNA 4ZOEA 3WLQA 3HV9A 2X1IA 1ONWA 5FF3A 4HU0A 5FI8A 2QCDB 4XZ9A 1UKPA 1LL6A 1IEQA 1R3WA 4YTTA 2FGLA 1WAWA 3AMDA 3ONBA 1J11A 1K9DA 4DJDC 3ABZA 3VD3A 3TAOA 1FCVA 4CU6A 5J5DA 1KM5A 2G3NA 4J2PA 2VI0A 2A7RA 4CQBA 1LOSA 5KINA 1XCFA 5AECA 3CMJA 1CXEA 3QGAC 2CERA 3C3NA 3VX1A 4AHQA 4Y90A 3TONA 3L4YA 1ONRA 2HS8A 4LF1A 4AAJA 3M0MA 4LH8A 2AKMA 3AS3A 1K8ZA 2NV9A 1OX4B 3DERA 2A3EA 1I0DA 4GIAA 5HDRA 2P8CA 1TIMA 3RHGA 5BOOA 1BAGA 1NQKA 1DJXA 1D8WA 4DF2A 4HN4A 3P8IA 3M5ZA 4WJXA 1V02A 2RDTA 4P8VA 1H63A 3HFYA 4BKNA 4MG4A 5I0DA 1TWZA 1A3WA 3F7JA 4BY3A 3IAPA 4KWOA 1F74A 4AHPA 3WJWA 3TX9A 4RXGA 3C2FA 1O95A 2J79A 2OQLA 2UZ9A 4JYEA 1XRSA 5C6MA 3K46A 6ENLA 4JQAA 4UQEA 1CGUA 4WOZA 3M0YA 4A3RA 3SY1A 1KXVA 1MEHA 4I6KA 1XIDA 1QK2A 4HNOA 2NQ9A 3B97A 4IXHA 3QKZA 1XYMA 2VFIA 1XLCA 2Z0IA 4IGSA 5AHMA 1DTUA 1KM3A 3G1VA 4YJ5A 4YWSA 1N8WA 2QNEA 4UTTA 2PFHA 1G01A 3WNPA 4O28A 1KBLA 3GDTA 4D2JA 4DWDA 3KW3A 3B8UA 3WLOA 4N42A 2BV9A 5HK4A 1UWSA 4AWSA 4IP5A 1ISZA 3BH4A 3PTDA 1OF8A 1A5MC 1S5VA 2EG8A 2QGYA 1S2WA 2ZXBA 2DIJA 2GJPA 5T8GA 1AODA 5TQLA 3G1DA 5BWAA 2VCAA 4C6MA 2DW7A 4R53A 4MB4A 4C1LA 1DJZA 4MYAA 4LYPA 2CKSA 1EX1A 1E9LA 3URQA 4CVUA 3VIFA 1IXNA 1ZSXA 4DUWA 1F3XA 1X6NA 4S38A 1JI2A 4IQJA 3URNA 2CLKA 3PUEA 2PC4A 5IFTA 1XCWA 3OG3A 3CAVA 1GVYA 1B9BA 1A5LC 4IL2A 4AEOA 3C2RA 3LHYA 1UD8A 3QKEA 4LV4A 1JEZA 4OBRA 3MYOA 1XFBA 2JKPA 4JKLA 1HIZA 2EPKX 2DP3A 3G1YA 1PV8A 3STGA 4JTHA 4JKMA 3UJ2A 2XZ9A 1I45A 2NUYA 1PB0A 4DHGA 1CGVA 2WZMA 3VCNA 1RBOB 1SMAA 3UPMA 2VGFA 2INEA 4IMGA 2D1ZA 2UBPC 2YDAA 1F8MA 2LLEA 3QQ1A 4R34A 2J7GA 4TX6A 1YXCA 2O4MA 1H7WA 1FUYA 3L66A 8RUCA 1UPPA 3T7VA 2Q8XA 3EWWA 1EB3A 3P7YA 1XHGA 1TPVA 1GHRA 4JFTA 5BW6A 1X98A 2VNCA 2WSYA 1DEDA 4HHHA 3GAYA 2VQTA 2XH4A 3UR5A 3POHA 3AROA 3W1LA 3OU8A 2Z29A 1REQA 4FB7A 4NVTA 1CYGA 3W07A 1PCWA 2OOGA 5FF7A 1S5WA 2PWFA 5CJNA 3LGEA 1TVLA 4W8LA 1WKFA 4MPQA 2OWCA 4NZJA 3TMQA 2D23A 5A6KA 5ABHA 1G9HA 1RK5A 2PZ0A 2PODA 2ZYFA 3EX2A 3PNZA 4B2DD 1QNSA 1UP3A 4TXEA 3H55A 1YBQA 1ISYA 3TFCA 3DG6A 1UUMA 4OOUA 1FOBA 4L6OA 3MWCA 4UFMA 4O12A 1XI3A 1CZ1A 4GKLA 1V0MA 2GWNA 2V38A 3VKKA 2WM0A 3HPFA 3TUUA 3EPOA 1S5NA 5HULA 1V5XA 1A47A 4Q8NA 3WLSA 2YFNA 3F5LA 5LHEA 1IIGA 4W5UA 4C6QA 1H2JA 2DORA 4YLWA 5FSEC 4OBTA 1OADA 1BKSA 4LRSA 3LD5A 1LDCA 3NDZA 1EO7A 2CZFA 5EFDA 4UMCA 4IF2A 2BBFA 4FA3A 3W2UA 3AXXA 3EDKA 3S6TA 2YL9A 2XHYA 3P5ZA 4HPNA 1H0GA 3W22A 2VKZG 3FVDA 1BXBA 2VJXA 3R8RA 3EMZA 4RDWA 3W87A 4HTYA 4JNMA 2YSWA 2ZC8A 4KCVA 3FEMA 5JBDA 3FA3A 2Z26A 4LANA 3CPGA 2WW5A 3W84A 2QVHA 4UMBA 3QV8A 3IGXA 3QGVA 3PR2A 3SQLA 3LXCA 3R1ZA 1OZQA 2J6XA 4MWAA 4NYUA 1EJ7L 1QXLA 4XVDA 3W28A 2WQDA 3ZO9A 4ERIA 2QCEA 2XJ7A 5EMKA 4DUOA 3K4DA 1FRBA 2R6OA 1TPC1 2CKRA 1LWHA 2R1MA 1OGSA 4PCPA 2WSPA 4PMRA 1W5PA 4C6CA 1EOKA 3WL1A 1P6BA 4RK8A 3NEHA 4PMDA 3LCXA 4NAFB 4CQCA 7ENLA 3DBNA 3C52A 1ITUA 1UR0A 1KM0A 4XZLX 1P6WA 4I5UA 2RGMA 4X0VA 3KBMA 1IWPA 2WC3A 2J62A 3RAOA 4CNTA 2X8RA 3AJ7A 4DEFA 2RJGA 1IE7C 4HNVA 1R3SA 3RM9A 3EYPA 3PWAA 3LENA 1O1HA 4MZ8A 1GPWA 2Y88A 1HJUA 1XKYA 2PWEA 1GVEA 3ZT5A 1SW0A 1K4GA 2NX9A 4A4AA 2PPGA 2QJGA 4B15A 1TE1A 1UD2A 3ABXA 3DI0A 1G4SA 1OC6A 1E1EA 2ZZ3A 4PFHA 1EZ2A 3GG1A 1AUSL 4LQ1A 3S5OA 3R2GA 5CH9A 4G8TA 3WEOA 1JDCA 1HO4A 5AZ0A 4E2VA 3IJ8A 4FSAA 2BY1A 1TZ7A 2Z7KA 3TTSA 3FGCB 2GK1B 4KRTA 3VZZA 4J3TA 3UXDA 4UR7A 4UCGA 3VUPA 1XGDA 4P61A 1LJYA 2ZRZA 4HJWA 4DZAA 3GU2A 2Z1WA 2RAGA 4B3LA 1VHNA 1UUOA 4N6EA 1M04A 2YGYA 4O54A 1KFLA 2DZVA 1Q7QA 1P4CA 1R2SA 5AYZA 1LROA 4W87A 2EPHA 1YNPA 3CB8A 4DWSB 4UTTC 3RF9A 3QOMA 1WX0A 2DZBA 4BF7A 2XIQA 3EKGA 1L6GA 3KZPA 1TCMA 3N6QA 4M1RA 1B3XA 1O6IA 4F66A 3WJSA 4P7NA 3QMSA 4GBDA 1G0CA 3PVFA 3THUA 2CLEA 4D6HA 3T44A 4JTCA 2Y7FA 1GVIA 1B3VA 1RH9A 3ZLHA 5I03A 4GNVA 2UY5A 2GGJA 1AVAA 5F1UA 4FOJA 1W2PA 3COTA 2CHNA 3XISA 2ATSA 4XAPA 4ADSA 3ARVA 2A85A 4ACYA 2G3JA 4PCFA 4U3CA 9XIAA 3WEMA 4UQCA 5LA0A 4AD4A 3WK0A 1LBMA 3V7PA 2OEJA 1Y5VA 1EXBA 4C6LA 2REQA 4KBXA 3AYRA 1NEYA 2OPJA 2YFOA 2ZUNA 2YW4A 3NTYA 3O7UA 2GJNA 1BF6A 2GQ3A 5CG7A 1QFEA 1GZ1A 2XH2A 2CBUA 1AZ1A 3AUJA 2XN1A 3PPCA 1IT7A 1JYNA 2GVGA 4QAWA 3CUIA 5I77A 3GR4A 3C0SA 3HMCA 3P61A 3A3WA 3IVUA 5CJ5A 3VGGA 2QLYA 1OFDA 1PTGA 3MSGA 1VBHA 1SJDA 3S2NA 4G7EB 4LY4A 3W85A 4NNCA 2CPUA 2GWGA 1FWTA 4JTAA 4MNMA 2VR2A 2W5FA 1S2CA 1QWKA 1ZJIA 3SRFA 3W7HA 3NVDA 1IYXA 4HOZA 3MUZ1 2Q09A 3MV11 5A6BD 4HD5A 2DZWA 3G18A 5C55A 4HA4A 2FFCA 3FYOA 4LXFA 3CLMA 3SQSA 5CEWA 4S3DA 4MDOA 3O16A 5CSUA 2HPIA 3NIYA 3HGJA 3WNLA 3UWYA 4HCHA 4NJGA 4K36A 2ATMA 5D2YA 1ZENA 3H53A 3AI0A 3WK2A 8CGTA 3TYZA 4TMCA 2EPNA 1EP3A 2BP1A 4ZZ9A 2X1UA 1FFRA 2BVWA 4PODA 2WCGA 4Z1YA 5K9XA 1GONA 1CNVA 3U3HA 3SIMA 4ZQOA 4QNEA 2PGRA 1CTNA 1JCYA 1OQFA 5DEZA 3ERPA 3LUTA 2GYIA 5EMJA 2Z7GA 3NQCA 1R86A 2PDMA 1AH0A 2NQJA 4UUIA 1YDNA 4GIRA 3V3WA 1ZUAX 5LNUA 4JN6A 2ANUA 2O0TA 3GUWA 1C8XA 1SZRA 2ZKMX 3D3FA 5F7UA 3UXAA 1HJVA 4Q33A 3H2OA 2GJXB 2J8GA 2DH2A 1KXQA 4GJIA 1E5NA 4US5D 1FWNA 1MEWA 3N2MA 2IKJA 4FS9A 1FH8A 3G0SA 1XL9A 2PDJA 2C6QA 4TVUA 4WDWA 3SY8A 4L1GA 3TOYA 5J04A 2FPVA 1UD4A 2X1SA 1H7OA 3PAOA 4QQ3A 3SCSA 3T8LA 3UG5A 3VVGA 5LZLA 1UCWA 5M03A 4O52A 3C5QA 4UBPC 5KETA 4UFLA 3NR0A 3M16A 3THQA 2A4AA 2OXNA 3CQHA 3JZEA 1BG9A 2VR4A 1XLDA 4A3QA 3WBYA 2OSYA 1CXIA 4GH3A 2R1NA 4UFKA 1FX6A 2FFIA 5K3VA 1BWLA 4IFOA 3QZAA 3WFAA 2XTKA 4B5NA 5GJNA 1PUDA 1T8QA 6TIMA 1J5SA 4CD7A 3BLIA 1XIBA 1FP8A 3MPGA 3HPSA 5A8NA 1E71M 2QDGA 2FMOA 3WDPP 2QJJA 4KGLA 2CLIA 4O17A 4LALA 3Q58A 2VFDA 4Q8TA 2YLAA 4MWAC 3S2MA 1BKHA 1Z7AA 1AW5A 3MCMA 3HG4A 3QLLA 4DLFA 4UTFA 3NPUA 1CENA 2VEMA 2OELA 1RV8A 4QS6A 3W2MA 4PSRA 1SYTA 4L64A 3GIYA 3WSUA 2XVLA 4M51A 1B3WA 2WC7A 2ZA3A 1GKQA 3C2OA 2WHLA 3R11A 1BPLB 3VOFA 5HQEA 3A4WA 4PMYA 5HR7A 1TV2A 5BU9A 3IV3A 1TB3A 3IIVA 1NVMA 1F3TA 3ARPA 4WDTA 2YBTA 3WYZA 5CPLA 3HZ3A 4EWND 3TN6A 5LXXA 3IK4A 3H2FA 3SRHA 1K70A 3UR8A 3RGTA 3TROA 1SU5A 5JBEA 5AHEA 3TCEA 1K02A 3VC5A 2WVUA 1TV5A 1V6YA 1E43A 1DBTA 2IXUA 1PS9A 2QPUA 2V68A 2AAMA 4EF8A 4PCNA 3SSZA 4MM1A 1LWIA 3O0FA 3IANA 3ITCA 1XIEA 2IUZA 4DWSD 3PHAA 2BLEA 2XVKA 5DXXA 3M64A 4MHBA 1P1XA 2XM1A 1EGZA 2DZPA 4NX0A 3H6OA 3IJLA 1LBFA 3KOXA 4H00A 3R89A 4FR6A 1X1ZA 2VC6A 1MXDA 2PP0A 4DO5A 5K4ZA 3OVRA 3E0FA 3VPLA 1EUNA 3IGUA 3H24A 3C3UA 3AZTA 5I3JA 1RZMA 3ZT7A 3T81A 3K2GA 3H21A 1QK0A 3BAXA 1J6OA 4RPPA 4JHZA 3S1GA 1VBUA 2QMJA 1SW3A 5CXPA 1E3ZA 3TN4A 4UNIA 4GQBA 1CXFA 3PF3A 2ZUUA 1KBJA 1OJXA 2QEZA 5D38A 3EGJA 3BANA 4PTDA 5CJMA 1NIUA 1TV4A 1EJTC 1I60A 1QOXA 5DLCA 4B92A 1FWFC 1WDDA 4QG6A 2DJXA 3KWXA 1VR6A 3SADA 1B5TA 3T0TA 1IZKA 4I5RA 2NWSA 4AW7A 1TSIA 3H8AA 4H2CA 1TTIA 3DFPA 3BTNA 2IXVA 3NQDA 2PWHA 4AUBA 5ABEA 3RX3A 3OIHA 1XBZA 1J93A 1QU4A 1H41A 1HZYA 1J0JA 1OEPA 3WQ8A 4A29A 3E74A 3ZWSA 4CQAA 3A22A 3CUXA 1MW2A 1C7TA 2XFFA 3OZPA 4H7CA 4W84A 3UZYA 2PGWA 3ZQ9A 2ZXAA 4Q7NA 3ABSA 1HVXA 5LNSA 1GPFA 4RE2A 4IGMA 4RXFA 5FJIA 1GVQA 2W3ZA 3GG8A 4H4IA 4UOZA 3NQ2A 1WAUA 1PWLA 4OV9A 3OOQA 1JDDA 3OA5A 4HNCA 3WQ5A 4AY7A 1GCYA 4LNYA 3WLLA 1K1DA 1KFJA 4U5IA 1FWGC 3CEUA 5GNYA 2Z1KA 3OPSA 1EZWA 4W7VA 4ROQA 4FXJA 1K03A 3DFHA 4AEFA 5HMEA 2WO5A 5BZAA 1ZAIA 1ZHAA 3WNOA 1N82A 4AD5A 2EXOA 1SFSA 2W0UA 4JFUA 1CIUA 1EP2A 4L80A 3THCA 2GOKA 3AMLA 2VDIA 1CGWA 3CQIA 3LCGA 3O05A 4GMEA 1CT5A 3UZXA 3N4EA 1FXQA 4R33A 1BYBA 3GH7A 4EF9A 3D46A 3KX6A 1QPQA 3CZEA 4AYGA 4WHBA 4I3GA 2R91A 4FXFA 1RSCA 5DN1A 3W7GA 1CX9A 3O3RA 3WG6A 1E56A 2E8ZA 5LSMA 2ODOA 2B81A 3NQVA 2VUNA 2NV2A 1XLGA 4Q8OA 3T2QA 3AXKA 4MY8A 5C71A 2IPJA 4Q8VA 1FHVA 4NU7A 4DB7A 4O19A 3MUY1 2HISA 2P50A 3G5EA 1XISA 4HOWA 3S4TA 1QRQA 4NY2A 2E7FA 3SY5A 2QCHA 5BRBA 1E9YB 3RLUA 3GLCA 2QT3A 1QAPA 4JTRA 1BXNA 4W93A 3R4IA 3LI0A 2WHKA 5HA7A 2YW3A 4JHOA 3RK8A 2WNQA 1C8VA 2BVYA 4ZOBA 4PMOA 1JGMA 1QNOA 3HG2A 1QTWA 4H04A 2X2GA 1OY0A 3W83A 3W2LA 4US6A 1U1UA 1M7JA 1F05A 2YZRA 4GK8A 1XIHA 1AH4A 1T0OA 2X16A 3GM8A 3GTHA 3TN3A 3I68A 1FWEC 3DFYA 4MAZA 1H60A 1UH2A 4XD3A 4AFYA 4LS2A 1TV7A 3UGRA 4F0SA 1VS1A 4NXKA 4IXXA 4NJJA 3IIOA 2X05A 3M43A 4S39A 1WDWA 1W5NA 3LZ3A 3R0KA 4O1FA 2PTWA 4XZIA 5AB3A 1ZBWA 4K6AA 3W1TA 4NJIA 2WWCA 2XIMA 5CC6A 2FHFA 2VWTA 4I9JA 2CZVA 4S1FA 2PDIA 5G5IA 2JFEX 5E1QA 3ZSTA 4MJMA 3S1WA 4EPDC 4HIBA 3WLRA 4UTMA 3N2XA 2PU0A 2I14A 1U22A 1OFOA 4GISA 3RMEA 2NUWA 5BOEA 2PWUA 4GQRA 1DYSA 3WLMA 1L6FA 1XCXA 4HMCA 2ZX6A 4DJEA 4FOKA 1YADA 4LY8A 4XBJA 4UB9A 4CNPA 3TA9A 1UMLA 4NI8A 1RP9A 1C9DA 4KS0A 3BW3A 3CO8A 3GXMA 3PZVA 3WBWA 4O8AA 1W3JA 1WE5A 1IZCA 4XIMA 3KCOA 3VOHA 3LS9A 2G95A 1LP6A 1QI3A 1YPXA 2POZA 3CUZA 3TYAA 3V0SA 3HQNA 4QBXA 2QCNA 3GXTA 4AZBA 4Z08A 1KWGA 2IPFA 4ROPA 4NJHA 2HVOA 5T9BG 1S3HA 1LM1A 3AC0A 3QFWA 2WMIA 3VD7A 4DXKA 1YTEA 1XSKA 4V1XA 6REQA 4PUNA 4M80A 3QMTA 3LGDA 2PCEA 3GNNA 4K7YA 2V67A 3U2CA 4J3SA 3PC0A 3EWZA 4ZQNA 3BO9A 1E55A 3LM3A 3TK7A 4G1KA 4ZTXA 3U2EA 3LRLA 1W1IE 4IP4A 5SWUA 3CIWA 3T2OA 3FA4A 3MSRA 3OVGA 2NQHA 5HJLA 3EB2A 1AJ0A 1OFBA 4PB4A 3LCLA 2CLMA 4REQA 1VHCA 2WK2A 2J9XA 4F9DA 5F1VA 3DHUA 1PKNA 5CBIA 4XZWA 2VRKA 4RPQA 1TWSA 4U28A 2BOEX 5C2XA 1J2BA 2HK0A 1UHVA 2WVSA 1QHPA 2DU2A 1WDRA 4I90A 3NA8A 4ZO8A 4H9YA 2E9BA 2OYMA 5AHLA 4NL1A 2ZX7A 3R5EA 1SZFA 1KD0A 4QG8A 4DNMA 2AQVA 1TO3A 3RNDA 1THFD 2OO6A 4AISA 3C0LA 3WK3A 2BVTA 3NPWA 1WUEA 4ZO7A 3SSJA 3L4TA 2V5DA 3BLEA 4G1NA 1UWQA 1CXLA 1UR1A 2DVUA 1YDOA 2QQ6A 4PMQA 3TCSA 2WLZA 5DFAA 2C0HA 1T8XA 3ZR6A 1W0MA 4RCXA 3ES7A 1HNYA 3PUDA 1BRLB 4HPHA 4Z42C 5LGZA 9RUBA 1PL9A 2JGQA 3GC2A 1EDTA 3PFMA 2WSQA 2JEQA 4O0QA 2DQWA 1KFKA 3E12A 3RMJA 2MUCA 3NJ3A 4CVWA 1JCTA 1YHTA 1NDZA 4ZODA 5JMUA 2HE5A 2WZEA 4KERA 5AFDA 1REQB 1KCXA 1ZRQA 6TAAA 3BCFA 3CH0A 1F6YA 1VGAA 3ITLA 3HPXA 4RZ6A 1XBXA 4B90A 4K68A 4XWUA 1DL3A 2Z6JA 3KCJA 5DMNA 1FBAA 1TPB1 5JIWA 3UCQA 1UKSA 2ISFA 3IUHA 4GUFA 1EJXC 2J7EA 1B54A 3V75A 4I8YA 4YTRA 4Z2IA 4Q3MA 1A5KC 3E9AA 4KEUA 2X1TA 3T55A 1VFSA 2ZWZA 4DPQA 3NQMA 3KOZA 4AXKA 2NXGA 4B9YA 2GLKA 4LUJA 3OHMB 3PUGA 3G77A 1P7TA 3UP8A 3BJFA 3N12A 2VCBA 3M0KA 4E8CA 5C2CA 1MRQA 2D24A 4L4MA 3S6OA 4XK2A 1V7AA 3S2JA 2XZ7A 4QRNA 1P0EA 2HVNA 4UR9A 4ZQCA 2XWDA 2DUXA 1I2RA 3CUFA 1DWIM 2POTA 3R43A 3T4WA 4BA0A 1R8LA 1Q6FA 3TQ0A 3U5YA 3A3HA 1VBRA 4HK7A 3S42A 1UKQA 1UOKA 3CV2A 4ZTYA 3S1XA 2OO0A 2HRWA 1ADSA 1RY8A 4FAMA 4WOQA 3GFYA 1RK6A 1K9EA 3IIZA 3R10A 4Z2JA 2INZA 2YA2A 4S3KA 1OVDA 3W7DA 3BL3A 1WOAA 4ZSUA 1GGOA 3WF4A 2RDXA 3URBA 2W9MA 1PIIA 3INPA 3R58A 2H9AB 4Q22A 3VYLA 1UC5A 2FDSA 3GVVA 2VEGA 3TV8A 5BYWA 3BMXA 2FJKA 1GEHA 4W7WA 3LMYA 1FHLA 3PJWA 4GZJA 3ZSSA 3PBWA 1Q2RA 4ZENA 1JZ4A 2Y63A 2GVYA 4R27A 4UTKA 1NU5A 4MKSA 4W85A 2Q8ZA 1GNXA 2J7BA 2J25A 5E6ZA 3MCOA 3N19B 7XIMA 4JFSA 5LIWX 1A50A 4PUKA 3ZR4A 1FH9A 5F4SA 3CHFA 3CWNA 4QQUA 4KCTA 4FEZA 1YE4A 1SO3A 1EPVA 4B2DA 5KTLA 1TUFA 1OSEA 4FIRA 3W1AA 1BWKA 4QLKA 4Y8FA 4EPEC 2R94A 3UJSA 1TJPA 3S9YA 1XLLA 4GBUA 1AW2A 2GDUA 1IGSA 1BGGA 4HB7A 5CSRA 1F07A 4W4QA 2PD9A 2PDNA 4RKAA 3SCWA 3N2BA 2GSJA 1KM6A 2YYTA 5AHNA 3V4BA 2PCQA 4CD6A 1O68A 1HL2A 2BASA 3IJ6A 3GYCA 3PZOA 1OIMA 3FFSA 1ENUA 5L6UA 4HK6A 4L9YA 1R5YA 3NQAA 1W3LA 1RCQA 3QTPA 4PBGA 1XWYA 1XD1A 4FXSA 1BEUA 3AIUA 1HX0A 4MB1A 1E6ZA 3O8AA 4N6FA 1OT1A 1RJQA 1XYLA 1Y0EA 1W17A 2EPOA 3UT0A 4LS1A 4NHVA 4NUWA 3DIPA 3ITGA 2B4GA 1JULA 1PKYA 2JF6A 3T09A 3SRDA 3CL7A 3MV01 1ZY9A 4ATDA 5EGRA 5ECUA 3G2GA 5G1TA 1R47A 2PF8A 4TUFA 2NWRA 3FS2A 4DYEA 5DMMA 3QPZA 4C6PA 2GGGA 2QCDA 3V18A 2OZTA 3BSMA 3MHGA 1VCVA 3PN8A 2DFAA 2PDCA 4BHYA 5FEPA 2FJUB 3WD0A 4GO8A 3WLJA 1QATA 4WUIA 3PG8A 3DESA 2XSAA 1WZLA 4OTKA 4NAEB 3GWQA 3EA2A 3LU2A 4H2HA 4Q4KA 2VTFA 3WDIA 8A3HA 1VH7A 2Z28A 3D47A 5FD0A 3W7NA 1EGVA 4HMDA 4RNJA 4ECLA 1U30A 2UY2A 3UG4A 4IG2B 1NJJA 3B9AA 2O92A 4E2OA 1K4HA 3QLDA 1OX4A 4JD4A 3GO2A 2Y8UA 3H4XA 2JGYA 2B7NA 2VD9A 3M9YA 1AQFA 3VKDA 4R7WA 3P74A 4GWEA 2EJAA 4J27A 1KM1A 1TA3A 1E6RA 1PYFA 4X61A 3CLWA 6PTDA 5AKQA 3PBMA 4Y9MA 1XGZA 3BAIA 5FCZA 1TCDA 1AH3A 2HBXA 2OQYA 1G4PA 5A94A 3GNPA 2QCGA 1QO5A 3T4CA 4PULA 3GTXA 4Q4SA 4FNQA 4FOUA 4L5ZA 5DRIA 2CITA 3LSCA 1QJWA 4C7GA 1XG3A 1Y7VA 5KZMA 1TQXA 3M0IA 3UXKA 5FF4A 4L56A 3B04A 3GNXA 2OVLA 3DXIA 1XYFA 5I24A 1GW1A 4FP1A 2H8ZA 3LHVA 3VABA 2CNCA 5H2ZA 4HYRA 3A12A 3F4WA 3AO0A 1HJQA 2NQLA 3JVAA 2JIEA 1I2PA 4IUGA 4IIFA 9XIMA 4IX0A 4KIEA 1LQ2A 4BZYA 4C65A 3UU0A 1UR9A 3NDYA 2GQ8A 4S3BA 2YXXA 2CESA 2ZUTA 3H12A 3TAKA 2QJIA 2A2IA 1PEZA 5MHBA 3QYSA 2HVMA 3MDUA 6ALDA 1G67A 1E1CB 2D22A 2X2YA 4PUMA 4UQ9A 4GD0A 3VMPA 1IWAA 2G3FA 5GNXA 3BG9A 2A0NA 4KH2A 1ZJAA 2P1FA 1VJZA 1V0NA 2FVKA 2J77A 1UMYA 3MHFA 1PX8A 3OVPA 4GYJA 3SCNA 3SUSA 3D5HA 4R88A 4RDZA 5KZEA 4AC1X 5JXQA 1OABA 1EUAA 1R3TA 3CTTA 4WF7A 1GOMA 3PSVA 2C1GA 3HGOA 3BSGA 3MB9A 4EXAA 1R46A 4ZFCA 5C5YA 3LXBA 1TRDA 4XTDA 1C8YA 1C8QA 5E9AA 3W00A 1BVWA 4OV4A 2W79A 3LQGA 3SAZA 3U4FA 2CWXA 2ZXDA 1TPFA 4PMNA 1BYAA 1TJRA 3FX4A 1VAHA 3EDDA 1K7EA 2OMAA 4TO8A 1HP5A 1GJWA 4JX6A 2E6DA 2O56A 3CPRA 4HZ6A 1UIPA 3B05A 1EFZA 2VZUA 3NZ1A 5L9FA 2ZZ2A 3QY7A 4N02A 1DPMA 3QZ6A 1IXQA 5IXEA 3N73A 5FF0A 3W27A 3B8VA 5G2WA 2CW6A 1JQVA 1WBJA 5AYXA 4HZMA 4GE8A 1VLWA 1XUZA 2ZWYA 4PRTA 1QNPA 3ITOA 4MZYA 5I07A 1CB2A 1EWDA 5BNKA 4DRSA 4WY0B 4DF0A 3PZTA 4DZIA 5F4WA 4BK9A 1P43A 4J5NA 3W1UA 3QQ0A 1WCGA 4WVXA 1RAKA 3M7SA 1MQRA 2YBUA 4TR9A 5A6BA 1DJGA 4UNKA 3A9BA 4L1XA 1YE6A 1JCXA 1EH9A 3P67A 4M24A 3L4UA 1SO4A 1R38A 4H1ZA 2V3FA 3QV7A 4S2BA 3DYMA 2O7QA 4W8BA 1VD6A 1OX5A 3LB0A 5D9NA 4LB4A 3M41A 2W91A 2ACQA 4N2YA 1US0A 2F38A 1X8CA 3VNDA 5G2HA 3AJXA 2EQDA 3LBMA 9CGTA 4S23A 4D6IA 3GDMA 1SZEA 2OZ8A 4R9OA 2E1DA 3P8JA 1VF8A 3WD1A 5F2LA 3QY6A 4O8RA 3WQWA 4QJ4B 3UERA 5EA9A 5IOBA 3WNNA 3NG3A 3R8GA 5HUPA 3SDOA 4W89A 2VRQA 3KAOA 3KRSA 4A35A 2WV8A 2A79A 3W6YA 2J8TA 2V5KA 4F2UA 4BS0A 4US5A 4LBSA 1KBBA 4PBEA 2WNNA 3V1PA 2XPKA 4TVDA 5I7GA 4JIIX 1AD1A 1HGWA 3TYDA 4Z0SA 4M7TA 1QNVA 4QCEA 1OC5A 2BX7A 1Q85A 2D3LA 3VNZA 4YN5A 3KL3A 1WKDA 2HS6A 1W1B1 1W1TA 1U83A 3B8SA 4DAFA 4ZB0A 3B0VC 1I75A 3LX9A 4I8DA 3H7VA 3V5OA 3WQGA 1DP0A 3PJXA 4JTKA 3L2LA 3WNKA 3ABQA 4NAFA 3VGHA 3FSUA 1IHIA 4ORIA 1X1OA 4H01A 1AMKA 2OOFA 1WNOA 5G1MA 1XR2A 2C1IA 4ZMGA 3VI2A 1JCMP 3EX6A 4IGNA 2PP1A 3VDCA 1JUEA 1VJSA 2FTYA 2EPLX 1TTJA 5HWJA 2J7FA 1E0WA 1UA3A 5HNTA 3LRMA 3IUIA 3QR3A 4IICA 2J8FA 1MUMA 3QPYA 3U2OA 3H7RA 1WDPA 5I3KA 4A2SA 1I1XA 1LG2A 2FPYA 3WQ6A 3PWIA 4CQ8A 2YB1A 4NNAA 2QW5A 2CXEA 3DN5A 3P0WA 4PTVA 3FGCA 4TU1A 2GK1A 1TMQA 4UTJA 3B8WA 4KWSA 3ID7A 2XVGA 3W82A 3JUGA 4WIWA 4QHRA 1PZ2A 5U4NA 3GDRA 3CWOX 2VX5A 1A5AA 3CK5A 2QCFA 3GB6A 1X38A 3DEQA 4KF1A 2WMFA 2VGIA 3M47A 4AD1A 1MSSA 4DWSA 3TYBA 1T5AA 3FEQA 3A23A 3DBPA 1Z3NA 4JR5A 3CU2A 3UJEA 3QYQA 3R25A 3BPWA 3R12A 2V5LA 2W92A 1ME8A 3FIGA 1NOUA 1CCWB 3MVTA 1E6SM 3KRZA 3LPFA 5LIUX 4MKVA 1O5XA 1JQXA 1KFBA 2BOFX 4C6NA 2R14A 4HJFA 1PZ1A 5PTDA 1J12A 1E72M 4YWIA 3W38A 3MUXA 4BF9A 4KKXA 4HA1A 3EPNA 4B3KA 1XIJA 1LL7A 2V82A 4O4VA 2YR1A 1JUKA 4YXGA 3WH6A 4O16A 1XXXA 3AIQA 4TV5A 4Y96A 2FZNA 1Q65A 3MHUA 3U5UA 4ERGA 4Q8WA 3URAA 3LERA 2VOTA 1SR0A 3KL0A 4JIRA 3UXLA 3CHVA 4IPNB 3QZEA 3WF0A 4IT1A 4MVAA 4L4OA 5LIYX 1JUBA 3QY8A 2IKGA 4V33A 2J9YA 2ESCA 1Q7MA 3UG8A 1LOQA 2AKZA 4OFCA 1I4NA 2V5CA 2QZRA 3VIHA 3GXPA 3OBEA 1W1VA 4GY7A 1D7FA 1UYQA 1E3XA 4XKYB 3IUDA 1KGWA 4IMFA 3F2BA 2KX9A 3H54A 4HPXA 2IKHA 3QH2A 1B3YA 3VMNA 3APYA 2QUNA 1UD5A 2XG9A 2WAGA 2V5BA 5AHFA 3S1VA 4HA3A 3VMOA 4F40A 3VX0A 4D8LA 1MDRA 2E68A 3MO4A 4HKPA 3KRUA 2WSKA 3KL5A 4XZBA 3HV8A 1H1YA 3G24A 4GOAA 2VELA 4F0LA 1OG0A 5E0KA 1YLVA 1FWSA 2A3LA 4AZ6A 4B9ZA 2VX4A 5U7SA 4Y9NA 3HF3A 3I6TA 1W1PA 3TR9A 3E02A 1IIHA 4IJBA 3AYTA 1E9IA 3W01A 1M9HA 2Q71A 4HNUA 1PYMA 2VFFA 3GSMA 1VRXA 2Q02A 3PBGA 1J4EA 2RJHA 1HF6A 4QP0A 3W02A 4Y6GA 4XISA 2B7PA 1V7YA 4OHQA 1ME9A 4BCEA 1AFSA 2PP3A 5A1AA 1TELA 4DBUA 3QC3A 1G4EA 1OK6A 1E6NA 4XUGA 2GJXA 3HA1A 4WX2A 5LYRA 5DF0A 1XLKA 4Q6JA 3KHDA 1JNEA 1VYSX 1W3IA 3CQ0A 4LUYA 5EMMA 3BGGA 4MPKA 4H9VA 1PAMA 4A3HA 4O0KA 4GXWA 3UNDA 3N4FA 2I5GA 4O1BA 1ZB5A 4K2SA 3UZ5A 1PX3A 2C19A 4G5DA 4LUTA 3VOCA 6REQB 3LCIA 2YCLB 5H8UA 3WD4A 3EDJA 2PDWA 1QUMA 1X97A 3V0TA 2EG7A 3HURA 3TJLA 1CXKA 2E40A 2GGIA 1DJWA 3QQWA 1W3NA 4Z2LA 3H23A 3MP3A 1UWUA 4OUEA 1MFVA 2GQAA 4J4KA 4GRSA 5G4EA 3OGVA 3O1NA 3AYSA 3BARA 1UW9A 3MU7A 3MQTA 4RJEA 1E4LA 2CC0A 3VKBA 1JNDA 3KBSA 5BMWA 4REQB 1P1MA 3SBFA 3BOXA 1S1PA 3T2PA 1UH4A 3HQ1A 2VEKA 3PZ9A 2I1OA 2VYOA 3MA8A 4C5ZA 1MI3A 1TG7A 3W1MA 3A9IA 4H3DA 2DZAA 4N4QA 3HPAA 1LF1A 1QNQA 3STFA 4GKTA 1SJAA 2PAJA 3W86A 5I3GA 3UYCA 1UBPC 1QPOA 2QXWA 4LU0A 3Q2DA 1JYXA 4ES4A 2WJEA 1W3HA 3B0XA 1H7XA 2OLSA 4EVZA 2L5HA 3UCDA 1CGTA 1V77A 4NZ4A 4M29A 2A3HA 3TYCA 1V6XA 4LEQA 3CZLA 4Z17A 1J0ZA 3UETA 2QCMA 4GFSA 3W2JA 3BGAA 5M1TA 1QT1A 3VIIA 4AHOA 3SEPA 3KM8A 2E5DA 2J7DA 2PEVA 3F4VA 4D6CA 3P84A 1UKTA 3ICJA 1BGAA 3NZPA 1XLHA 4DQWA 4JTLA 4FXRA 4GH1A 1HG3A 3WMLA 5TAOA 1LCOA 2AMGA 1H61A 4QX4A 1EA9C 1KQYA 4IMAA 4EKJA 3S5NA 3O6DA 3S47A 4KEVA 3OLEA 3DECA 3P81A 4Z2GA 4AZGA 2WB5A 4I6VA 5MKGB 4I9TA 4QG9A 3GIQA 3C2EA 3OW1A 4ILSA 3FXYA 2VT0A 2ZFAA 1QBAA 5CSYA 5IRPA 3HFTA 2B7OA 1J10A 4R7OA 4U3AA 3T78A 2UY4A 1BXCA 4AY1A 1XLEA 3P93A 4DWSC 1E5JA 3DFTA 1KV8A 3W2NA 2A1YA 1SMDA 1IXPA 3ZVIA 2INFA 2YYUA 3XIMA 2XN2A 4GCXA 3I7QA 1J2WA 2WHJA 4F2TA 1KRAC 2I56A 2PI6A 4IHCA 2NUXA 1UB3A 3GZAA 4PEKA 1JPDX 2HBVA 3LHWA 3DENA 2RKXA 1HVQA 2JF7A 4CCEA 2PDPA 3EXTA 3CB3A 4J1OA 1GZGA 2QF8A 6XIMA 3ANYA 1GOWA 1E0XA 5FAGA 4LFYA 3NSNA 3E6EA 3W71A 2QUTA 3K13A 3MYPA 3MCNA 3QSTA 2E4TA 4ASTA 3AQUA 4LEFA 2WNZA 4OKDA 3WF2A 1NFBA 1VBJA 4IIGA 4PN2A 4OJYA 3E96A 4GFIA 2XINA 1Z42A 1C7SA 3SGZA 2ZDRA 1G5AA 1TV8A 3I3DA 1GTHA 4AVOA 1IR1A 3KS5A 5DY2A 3TWAA 2YKKA 5A5WA 3GNRA 1D2KA 3B8IA 3GUGA 1KRCC 3UJRA 4V27A 4HSHA 4IPIA 1JPHA 1H5VA 3AHXA 5HXMA 4J40A 1UJQA 1GK8A 3G3DA 4WCJA 4HNTA 5IHRA 1Q6QA 2YX0A 3A5FA 5D04C 3LG3A 5DMYA 1EQCA 1GYLA 2DT3A 1VLIA 4JL1A 3RXZA 4DJED 1MDLA 4PUDA 4WGHA 4AIUA 1WUFA 1XLMA 2PDGA 3CC1A 4QLJA 4HYWA 2Y1HA 3C2VA 2X0YA 5TF0A 2ZE0A 5M17A 3WQ4A 4GYPC 2QDHA 1W9PA 5CG0A 4MYXA 3RJYA 3WH5A 1UUQA 1UKOA 4RNHA 3W23A 4FI4A 2ZQ0A 3E1F1 4LCSA 3E0VA 4XB3A 4ZSTA 5FL0A 3GHRA 1M1BA 1B1YA 3BG3A 3RLHA 4D6EA 1VQTA 3KZSA 3TIMA 3GW0A 2WANA 4YMZA 3L9CA 3MI3A 3PANA 4UZSA 1CGXA 3MBDA 1A5CA 3S0CA 2GVJA 3QTGA 4GZIA 3RM8A 1GKPA 3E0IA 1E15A 4JTQA 1FWRA 3U2ZA 3ARRA 1VP5A 1ZLPA 3ZVHB 3C4UA 4N9CA 1HKIA 1TTQA 3RM4A 3W26A 4GY1A 5D2VA 1X1NA 4ZBCA 1FQ0A 3NYZA 4J3VA 3U9IA 1ONXA 1QI5A 2Y61A 1VPQA 3B9DA 3MKKA 1Z6KA 3WFLA 1W56A 4W8AA 2ZUMA 3GU1A 4K8GA 4QS5A 2O7SA 4JGDA 1ZBVA 1Q6GA 3W7IA 7A3HA 4I7UA 2WWDA 4ZXLA 1UG6A 3I7SA 5CGMA 1B3ZA 2BGNE 3C56A 4E4FA 4H6KA 1FKXA 1X7FA 3O07A 1NDVA 3T0DA 1VCGA 1HKJA 4MAVA 3H2EA 4ORMA 3BICA 5C9RA 2P53A 1HGYA 4ACZA 4Q4MA 4TV6A 2XWEA 4H8NA 2JE8A 2PLJA 2EKCA 1E4MM 2QKFA 3MC5A 4HNNA 3VGBA 3DYOA 3PTMA 1LZOA 4HK5A 3ONCA 1PIGA 5FSDC 3FKRA 1W54A 3MTWA 3BXWA 1Y5XA 3AS2A 3QC0A 4S3FA 4JX4A 2KZHA 1TA3B 3DAQA 5C2GA 4KESA 1FHUA 1W9XA 1NSJA 3W7EA 4AZHA 1Z8AA 4PL1A 1TVPA 3GXNA 3P62A 3VIGA 3NL5A 3LTSA 3WJXA 4XTIA 3N04A 3LLXA 3WUEA 4H9UA 2FZ8A 4KW2A 3W7PA 1QNRA 3HU7A 3K8LA 3LPOA 3WFZA 4RZ4A 3NCOA 3B8TA 1P0KA 1MYRA 3VCRA 1HKMA 4B16A 4RV8A 4H8VA 5D03A 4D1JA 3B9NA 2GL5A 3CT7A 1EJRC 4GXPA 1PWMA 2QJHA 2IS7A 3VC6A 1HTIA 2CBVA 1XH0A 3CHDA 4PEEA 2Z1BA 4LW7A 3TQKA 2PLCA 3DHDA 4GGBA 4KWVA 2NQZA 3KTXA 3CQKA 4JTUA 3WN6A 4QEHA 3W37A 2R9RA 1BLIA 4G9PA 1UASA 3HGSA 4JNZA 3GTNA 5DBUA 3IACA 2PDYA 3F5JA 2CU0A 4PRWA 3EMCA 4J9JA 4DBEA 4B5WA 4QNWA 4LSBA 3SJ3A 4P7RA 4ZQPA 7TAAA 2DSZA 4XSLA 4NX5A 1QHOA 1EL3A 3KOFA 3MY9A 3GH5A 4IMDA 2GGHA 2RFGA 4GHRA 4D1IA 2VX6A 4MLJA 3QRHA 4PFMA 4LAUA 4KRUA 3WLPA 1JXJA 4M19A 1NM9A 4N7QA 4EIVA 4QR6A 2QAPA 3G22A 3TW9A 1HFBA 1D9EA 2FGZA 1O5RA 4RE3A 3CAKA 4HCLA 3HG5A 4O1DA 1QDSA 2H3BA 3N3MA 1JCNA 3WMBA 1EO5A 2ABAA 1XDLA 5CC5A 4G56A 4DX3A 1AQHA 4NZ3A 2VVSA 5T9CE 3AS1A 3W7JA 4PC8A 3NOEA 1OFQA 3NXFA 4UTIA 1NFPA 1RPKA 3TMLA 1R3YA 1E6QM 1Q6EA 1MXSA 1V3HA 1UD3A 2QV5A 2VZVA 4XO7A 2X09A 2OLAA 3W88A 3WK1A 1V4YA 5CZJA 3VIJA 4JDBA 1BRLA 3QGKC 2ZRYA 2W6RA 4E4PA 1IEXA 3WBEA 3VIMA 1F3WA 5HQMA 3SFKA 2QHAA 3ARWA 4PYSA 4M8UA 4A6GA 2KAUC 1DXFA 1MZHA 3UVAA 5ABFA 1F76A 4KFOA 1OCBA 3LHTA 2PSNA 2OZ3A 4U5KA 3OLIA 3SN1A 1B90A 5EL1A 2XIBA 2F2HA 2XSXA 5FAJA 3CM4A 3HG3A 1E4NA 4Y2WA 3CUHA 5XIAA 3O6AA 5TD4A 2C0AA 3N17A 3NQGA 3N9RA 4GINA 5A6MA 4E2BA 2R1KA 3P2VA 3IVSA 4H8UA 4F79A 1J0IA 4EOUA 1YIXA 2VOMA 3LNPA 2PE4A 3GXIA 1BWVA 1QW7A 1ODZA 4F9JA 1XLBA 4V28A 1WP6A 3O15A 4BI5A 3ZS4A 5K9DA 1I8JA 4OVXA 2YL8A 4B5UA 1WDSA 3HOJA 5I2UA 5A8PA 4YVVA 3NDOA 3DYPA 4XQ6A 3UEQA 1EC7A 4UR8A 3RCNA 1ZNNA 1PSCA 3PZNA 1XLAA 2ZVRA 3EWYA 3RRXA 1PXGA 1KCZA 4YVPA 4IP7A 3KP0A 1C93A 4V1YA 3THDA 4AIBA 3M5XA 2G8ZA 2R8WA 1F6KA 3I3EA 4GNJA 5E93A 3BUVA 3W9ZA 5BRPA 1IZJA 1RALA 2I5IA 1NDYA 4IISA 1HL8A 5D8ZA 1NF7A 4GC4A 3U48A 3C0JA 1FH7A 1ML1A 2E6AA 1Z48A 3TFXA 3XINA 3L0GA 1XIFA 1QW9A 2CXGA 2H90A 1SFJA 3NO1A 2H9AA 4LVGA 1CB7B 1A0EA 5I00A 5DANA 3W70A 4JXCA 2C16A 3FYYA 1RQBA 4PCTA 4AZ7A 3EWXA 2AQOA 1D3GA 1BQCA 4AD0A 2J9ZA 2FPTA 5F4XA 3GC4A 4JQ1A 3OGSA 1FCQA 4UIOA 3W1NA 1DQWA 1R85A 1J79A 2PWGA 3CV7A 3TSMA 4QAIA 1O12A 2OGJA 4ZE4A 3FNDA 3V5CA 3FVMA 4C6OA 4E8DA 2PLKA 2X40A 3FW6A 4AMCA 5A95A 1S3TC 2Y4SA 3BW4A 4H6QA 2WZIA 1V3MA 4GJJA 2Z25A 2W63A 3I65A 4QE5A 1A5OC 4HP5A 1I2NA 3LBOA 1SSGA 2FQIA 2A6LA 2PDXA 3RCMA 4J3ZA 2ZZ5A 2ZVIA 3NOYA 1M03A 3ATYA 4P8XA 4AVNA 2BS9A 2OSWA 1U1JA 1OCNA 4R9XA 2HK1A 3USBA 4IQDA 3F03K 1BHGA 1TRIA 4AD3A 4IIDA 5DELA 1DJNA 1SQ7A 1S46A 3OBKA 1PZ0A 4C6FA 1A5NC 1R7OA 2YCIX 1J9YA 2E28A 1T99A 3M0JA 4L61A 2PZNA 3VA8A 3SIZA 1O5KA 2ZZ7A 2Z2AA 4R3UA 3HJZA 2VL4A 2JQXA 3HBLA 4F8XA 1X6UA 2G0WA 3M7WA 1X6LA 4LUIA 4CKQA 3W4RA 3GVGA 4HBKA 1V79A 2Z6IA 5HNUA 3SJNA 3TLQA 4O50A 3LY0A 3K5XA 5I3HA 5CC7A 1O66A 5LA1A 1ECEA 1EJSC 4O0ZA 4ML4A 3ZZ1A 5H91A 1RPXA 1TR9A 3BZGA 3EPMA 4JQ2A 3TSDA 1GVFA 3A6OA 3D0CA 5DT5A 4HCDA 4UC5A 4CN6A 4GO9A 4KFNA 2O55A 2DEPA 2OGYA 3EX3A 3NZRA 1TIWA 4NAEA 1JPIA 3AS0A 3VOGA 2FZMA 1R3QA 4YTQA 3I4EA 1TFVA 2VUYA 2V3EA 3KE0A 1J0YA 2QPXA 4IG2A 3VDGA 3M6DA 3QJAA 1KBIA 1FWIC 1P0NA 2ZUVA 1XGEA 1H1ZA 3CZGA 2DGAA 1BSIA 5A8MA 4INFA 4CEUC 3PTQA 4MF4A 3IJ9A 2B7QA 3N13A 4KWUA 3A4JA 1FKWA 1ITCA 4GCAA 1W2VA 5F2GA 3E2VA 4N9BA 3DGBA 1FWHC 3W75A 3TQPA 5HINA 4DUXA 3UA3A 3STEA 1W8SA 1RLCL 1JZ3A 1G94A 2V8ZA 2DSWA 1XC6A 4N0RA 1UROA 3OLGA 3GYEA 4JL2A 4X3ZA 1KKOA 4MADA 1ZBCA 3EOUA 1I1WA 1PKLA 1B9ZA 7CGTA 3S9ZA 4HA0A 1KGUA 3W1XA 2PRLA 4YHGA 4ZXOA 5ECVA 2J66A 4RR4A 3K1GA 5C54A 5CLTA 3ELFA 4OBSA 4ZO6A 2A3BA 4A22A 4GYKA 4H41A 2ZZ6A 1VBGA 5RUBA 4UTUA 2QS8A 1K9TA 1Z32X 2P10A 1WXYA 4J35A 3TEVA 3CO4A 4WSKA 4CGTA 4FF7A 3TXVA 1XLFA 4NZFA 4H7VA 1RBLA 4AX7A 1E1CA 3BC9A 4IFKB 1CI1A 3UJFA 2Y62A 5KSWA 1DJIA 2WQPA 3GXFA 3M0XA 6XIAA 4CU8A 3DH7A 4F0HA 4MNKA 3FN9A 3TC6A 4PA8A 4M6VA 4X63A 4CD5A 3UZJA 4L9ZA 4P7LA 1C90A 4I7WA 1HJWA 2I9EA 2AOSA 4B4FA 2VP8A 5REQB 2Y24A 1I2OA 2F9RA 1M01A 5E9XA 1XD0A 1CECA 1LRTA 2CYGA 4S3JA 3RLVA 1OZMA 1Q6OA 1EHAA 3FV9A 1A5UA 1JYWA 3E5PA 1A4MA 2X41A 2YXGA 3FY1A 4C1NA 2HPMA 1LT8A 2VFEA 4GUJA 2ZCGA 4M6QA 1SO6A 1DXEA 3KUMA 3WIJA 4JICA 3AUOA 1VEOA 1V08A 3L21A 2V0TA 1LUCB 1POKA 4DJDA 4JOMA 3CASA 1UA7A 4AWUA 3CGTA 1W5QA 1CPUA 3BQ5A 3AHTA 5A3HA 1L0PA 4YHEA 3OB8A 2HMCA 3E2SA 4PBFA 1H49A 4KRZA 3C2YA 3BLLA 2XFWA 1SPQA 4ATWA 3VGEA 4JTSA 3GIPA 3PULA 3H2AA 3GFZA 2W62A 4WY0F 4HPJA 3H2NA 4AWTA 4XBKA 4L4LA 2EHHA 4WDXA 2YDQA 1L8PA 1GOXA 1KFCA 1XKJA 3RJXA 2J88A 2Z00A 3S5YA 3S6DA 3ARTA 3WJYA 4CNSA 2NVAA 1SVDA 3H26A 5IFPA 4MJZA 3GRIA 1E1FA 1OYBA 4LUTB 1E40A 4ALDA 4WY0A 3GR8A 1FP9A 5JUVA 3UR7A 4POCA 4PTNA 1TV3A 2A5HA 4MIMA 3LCHA 4IMEA 3VKAA 4X22A 3MWAA 4YU1A 3G0UA 4WKHA 1HXJA 2C18A 1CLKA 3R13A 1EJWC 3SQMA 3IJDA 1LQAA 4N9DA 1V3KA 4GZ7A 2FH8A 4J3WA 3FCPA 4EANA 4HQVA 2VHLA 3SUWA 3A5VA 3Q45A 1Q4NX 3VZYA 3VNYA 4GI8A 4FLRA 1XICA 1ME7A 5FKYA 5IDZA 3J7HA 3GNDA 4P8UA 5AZ1A 4C60A 1CDGA 3VO0A 3O2LA 1ISVA 3FHQA 3B9EA 1TWIA 3T40A 4AIOA 3V5FA 1DV7A 5D9MA 3ES8A 3CV1A 1N8FA 3EOSA 5G1YA 2PBGA 1PPIA 2YCEA 3WLNA 5DCBA 1PTDA 2BOGX 2CBIA 2CLHA 4ICCX 2NT0A 2BXYA 3P80A 4DIAA 2C1HA 2CHOA 2DQXA 1EEXA 2ZOXA 3AALA 4ATLA 4FK9A 4O57A 1JG9A 3VD5A 5A2BA 4C90A 2VZOA 2OX1A 1ZQ5A 1VYRA 5AC4A 1AD4A 1MMFA 4LC6A 3S83A 3T08A 3UY8A 1H50A 4R7JA 1GORA 4CNOA 1NFGA 5DBTA 3SCTA 1XP3A 3WQEA 4JQ4A 1WV2A 4EXQA 2RDWA 2VC5A 5DQPA 5D32A 3GD6A 3N6JA 1G4TA 3RCYA 3WMCA 3RO8A 1NWUA 1FCBA 3MKVA 4PB3A 3TWBA 4S2CA 5CPOA 1F5ZA 2G5WA 3ITTA 4HGXA 1GQIA 3ZMRA 1WDQA 5EMUA 3BLDA 2HV5A 2E77A 2QYGA 2FGBA 1S39A 3BW2A 1UPMB 2NX3A 1G1YA 5FOOA 3U6WA 1H7RA 2D69A 5CC3A 5B7YA 2J13A 1RUSA 4FNUA 1DWFM 1POJA 3DFOA 1KCKA 4W9TA 1M41A 4XG1A 1JDAA 2QDDA 2WJFA 3T9PA 5K2ZA 1UWAA 2FTWA 1FHDA 4A8IA 1SJBA 2X7VA 3TH6A 4PMJA 2ISWA 4DI9A 2J7HA 3GBEA 3LXAA 1CGYA 3B4YA 2DV0A 3NM3A 2VENA 3PB0A 3GVQA 4K1WA 2H8XA 2EO7A 1PHQA 1LRQA 2J74A 3WQPA 5JIPA 3DFSA 3VOIA 2PWVA 4AF0B 1KTCA 8XIMA 3BJTA 2YCKX 3NQ6A 3VIPA 2PA6A 4ZR8A 1XBYA 3MUCA 3OODA 3N9SA 3E38A 3KBNA 1AQMA 1XIGA 1RLDA 4H6EA 2XIOA 1R3VA 2XISA 4LPCA 3EWBX 2BVDA 5M2FX 5DMLA 4L7ZA 1E0TA 4YIWA 2IQ0A 4XVEA 2PTZA 3KLKA 4OT7A 1Z89A 2NLIA 1ICSA 1R0MA 4D6DA 5HOSA 1UC4A 1DORA 1H0IA 3UNTA 2OFJA 3B4UA 1L6SA 3S3GA 4C6DA 2OT0A 1TWWA 4F4RA 3QHMA 1Q2SA 3CZKA 1F7BA 1TX0A 2FLIA 2HWGA 3D3AA 4MOZA 5E0CA 4ZOAA 3KLLA 5F2IA 1YQ2A 1V03A 1NOWA 1EYEA 1GKRA 1RBAA 3W29A 5H1WA 2Y7GA 1IT8A 4DBWA 3ABRA 5TNVA 2F61A 3OQEA 4GVGA 3PP7A 1T41A 3ECQA 1XIMA 1A49A 1KQZA 4KIRA 3WUFA 1EJVC 4DM1A 4AZCB 2GGEA 1QW8A 3L2MA 4B91A 2Z1VA 1F3EA 2BG5A 3W81A 3WQCA 1G69A 4Q8MA 1FVPA 7PTDA 3W1QA 3WF3A 4Q8PA 3KDNA 3G6LA 1DWAM 3ZLGA 3UCCA 2DT2A 2PDQA 1IV8A 4RE0A 4KFPA 3N1AA 3NL6A 3RN6A 2VVNA 5HJYA 4LAZA 1PE1A 4JY8A 5BXPA 4XD5A 4PMVA 3LBCA 2ZUWA 4PZVA 1X8FA 2JK2A 2WBKA 3L0NA 4F48A 2OKTA 3SZ8A 3HM7A 4XZNX 4ZEPA 3PZMA 1V3LA 3G1AA 3W7QA 4WJ8A 3TW7A 1U5HA 1M3UA 3ZJ7A 3KVLA 1DE5A 4QROA 2V5JA 1FY6A 3O9NA 3F5KA 1KNWA 3CPUA 1ZU8A 2E5BA 3WZ0E 1R2RA 4R5EA 1Y5WA 2YA0A 2QR6A 1MWOA 2PDFA 4JEQA 1IWBA 1P5BA 5FJPA 1LLOA 3W72A 2Z24A 3BAYA 3CS2A 3OHIA 3OEXA 2BB0A 1VPXA 2VC9A 4MB3A 1J8VA 1MQPA 1LBLA 4XKYA 4MY1A 2G96A 4C6KA 2NLYA 1RA0A 3UWQA 1A3HA 3LPGA 1OCJA 3WO8A 3CZJA 3GVWA 3G1HA 4WLCA 5D8WA 2XUCA 2P0OA 4EX4A 3BLOA 2PDKA 5HNNA 2TMDA 3H4GA 3NFUA 2ZICA 2JEPA 5I06A 2Y85A 3T07A 3L4VA 4A8NA 4NF7A 4NSBA 1E6PA 2JALA 5BXSA 3VIKA 4XO6A 5GJMA 3AFBA 1TMLA 1WA3A 1GOKA 2OEMA 4C6BA 3ZYZA 2Z4GA 5GNZA 4L1WA 1RA5A 3NZQA 3FJ4A 4L9XA 2EG6A 4QCFA 3BOFA 3KTSA 1TWDA 2QGHA 3ZT6A 4O1EA 3Q94A 1I6NA 3PY2A 2XSBA 5GQBA 4JHMA 4ACZB 1H7NA 1BVZA 4S3EA 5DX7A 1OK4A 1TJ2A 3PAJA 4GPNA 4ONVA 5ABTA 3PZGA 2BHZA 5LNRA 3DUGA 4JYDA 5FESA 3BMWA 3KDOA 2P3ZA 4I9AA 3W7OA 1TPUA 4H9ZA 5HATA 3GS6A 1JGIA 2TYSA 4UMAA 4GG9A 1VFFA 3T05A 4D8ZA 1TR1A 1YMYA 3QOKA 3RILA 5G2IA 2QULA 1KM4A 5CZSA 2XYLA 3DGRA 3HTWA 3N14A 3T1GA 4K3ZA 1VCFA 1F4HA 3CBWA 3WQDA 4Q8UA 3ZM8A 1RCOB 2YCLA 1K6AA 1EHNA 1S5TA 2ZADA 2Y7EA 2QVNA 4H9TA 3BLPX 3N6HA 5AY7A 1QPNA 3IEBA 3T0BA 4AXNA 3ZLFA 1XJBA 2WMGA 2BXVA 4MUZA 4PMXA 5C9ZA 4C6JA 5EFFA 1UR8A 4A2RA 4NILA 4AH7A 5B80A 2OWWA 3AXIA 2OJPA 3AMCA 3BVJA 2PDLA 3M0VA 4K8HA 4CCCA 5A8GA 3KWSA 2E3ZA 2PDUA 1XH1A 2JKEA 2Y8KA 3WMSA 3IV8A 1XYBA 4PH6A 4BEQA 2WVVB 4ZB5A 3W0KA 1XUUA 1RVKA 5CBBA 3F4DA 2Q3OA 3I7RA 3P5YA 4JEJA 2E9LA 3VUSA 1XSIA 4H9XA 3NQ7A 3MJMA 4PUEA 4A8LA 4DVOA 3NL2A 2EBNA 3UQNA 5DCDA 2WKJA 5HMDA 1E4IA 3AHVA 4RW5A 3VGFA 1F61A 3GKFA 4KGJA 1JDFA 1LG1A 2OG9A 5J5RA 4LAKA 4GA8A 1MRAA 1R9XA 2ACSA 1XLIA 1MNSA 4XSMA 5MF5A 2V6AA 3EAUA 3NVTA 3NL3A 4HSOA 4OQVA 3B3DA 2WNWA 4PSPA 4QIUA 1HKWA 3IAQA 2PDHA 3QM3A 4JN8A 4AX6A 3QV6A 3QPEA 2DZSA 4QEEA 1GJPA 5A69A 3M0HA 3CAWA 5ABFB 1PHWA 4TX9A 3SURA 1QI4A 3AOFA 3KXQA 3REQB 3ZJ6A 4MWAE 3N15A 4YTSA 3E5BA 3QBUA 1RD5A 3DFNA 4XZMX 4EAMA 3HPZA 4ZOCA 1LL4A 3MI2A 3MUIA 3TJXA 2ISSA 2E67A 4UOJA 3WQFA 1VEPA 1EIXA 2J78A 4LVFA 4ZGYA 3LLFA 2VFGA 4UQDA 1EIBA 3GQYA 1RP8A 4NZ1A 5CQ1A 4E3VA 1EKOA 3LYEA 4QITA 2FHCA 1MXGA 1BVNP 5A8QA 2DVXA 2VZSA 4Q6XA 3CT2A 5CPQA 1GVOA 2PU1A 2TAAA 3V35A 5MKGA 1V0KA 1IT0A 4MTVA 3K8MA 1IEIA 3P3BA 3L7RA 4LYKA 2DY3A 1VFHA 2QJMA 1R87A 3IJQA 4FLSA 1V0LA 5E09A 3RO6A 4P2VA 1US2A 3UWEA 1OB0A 2A3CA 3K4WA 2OEKA 3FYPA 3WUGA 1B31A 4KMQA 4QJ1A 3KEHA 4WJEA 1Q8AA 4J3UA 3VTRA