3WQEA

D-threo-3-hydroxyaspartate dehydratase from delftia sp. ht23 complexed with d-allothreonine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHACATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-threo-3-hydroxyaspartate dehydratase
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
molecule tags Lyase
total genus 142
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqeA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqeA02
3WQEA 1VFTA 1D7KA 3N29A 3BTNA 4Y2WA 1FTXA 1L6FA 1BD0A 4A3QA 1HKWA 4XG1A 4PB5A 3E5PA 4QHRA 2ON3A 1SZRA 1CT5A 2QGHA 3UW6A 5FAGA 1F3TA 5GJPA 4FS9A 3CPGA 1KNWA 2VD8A 3WQFA 3LLXA 4BEQA 3N2BA 2PLKA 2DY3A 1B54A 3S46A 4LUTA 5GJNA 1KO0A 1NIUA 3NZPA 5FAJA 4V15A 5FACA 1XQKA 4ILSA 4BF5A 1VFHA 2PLJA 1VFSA 2VD9A 2RJHA 2J66A 3B8WA 3VABA 3AWNA 4ECLA 4LUYA 3GWQA 2SFPA 4WR3A 4LUSB 2RJGA 1EPVA 4KBXA 3SY1A 3HURA 5IRPA 2ODOA 4XBJA 4BEUA 1HKVA 1TUFA 5BWAA 4BHYA 1QU4A 1XQLA 1XFCA 2OO0A 2P3EA 2TODA 3C5QA 1W8GA 3B8TA 3E6EA 1RCQA 3WQGA 3R79A 3ANVA 3AWOA 3B8UA 4LUTB 4ZGYA 3OO2A 3WQCA 1TWIA 7ODCA 1SFTA 2O0TA 4DYJA 1L6GA 1NJJA 3WQDA 3NZQA 3HA1A 4AIBA 3ANUA 4DZAA 3N2OA 5GJMA 3CO8A 4LUSA 4PB4A 3KW3A 2NV9A 2NVAA 4PB3A 3MT1A 3B8VA 2YXXA
chains in the Genus database with same CATH superfamily
4PE8A 1KTCA 1K9DA 3SGZA 1JRCA 2ABAA 4F2UA 3BJSA 3ZVHB 2I57A 6REQB 2V68A 3W24A 3DH7A 3VDHA 3RUBL 3CHVA 4F9JA 4ZQRA 4JTLA 3QN3A 5GJPA 4QRNA 1LBFA 2QT3A 1KNWA 3ENLA 3L5AA 2HPMA 3EXSA 3THUA 1ZJBA 4J28A 1W91A 1XICA 4HNLA 1NFPA 1EQPA 4O10A 4TV5A 3DUGA 1RALA 1AW1A 4KGLA 3MMWA 2O56A 3VM7A 4KPLA 3AFBA 5D2TA 4RE3A 3HJEA 5BRQA 1DWAM 4HK5A 2WAGA 3SJ3A 1XD0A 3FSUA 3FJ6A 1XV8A 4DLMA 3VDGA 3HGRA 3AZRA 1RA0A 2CLMA 3T42A 1VB9A 2Y7FA 4FIQA 1RQBA 4CNPA 1PCWA 2YCJA 3QY7A 4ZB5A 4LYRA 2AMGA 4D6CA 2XVPA 4S3DA 3GXNA 1PKLA 3DYPA 4ZTXA 3CMJA 1O5XA 2W3ZA 4CQDA 4J9JA 2DT1A 4GZIA 1AQHA 4ZGYA 3BARA 3FLUA 1DIDA 3PZVA 3W70A 3WIJA 2D23A 1FWTA 4C90A 3LDVA 1XBXA 3CZ8A 2IPJA 3C2RA 3TC3A 1EO5A 4JAWA 3NUKA 4HJFA 2GGEA 1J2WA 5G4EA 1NWRA 4GZ7A 4KFOA 3UWEA 2C79A 5D32A 3BJTA 3PAJA 4IXHA 1ALDA 1Y8BA 2DIEA 3EB3A 2OJPA 1I9CB 2OGYA 3GH7A 3MBDA 2PCEA 1Q13A 2P88A 3SY8A 3TW6A 5ABEA 3M47A 2GJXA 5TF0A 1SZGA 3LD5A 2WMGA 4C60A 4DX3A 2VZVA 2ZXAA 4WJEA 2VX6A 3N2MA 1XYFA 1IWBA 1UZ1A 4BZYA 3SUSA 4G5DA 2GQAA 4JOMA 3MW7A 1JUKA 4ALDA 1G7VA 3WY1A 5HJYA 2HBVA 1R38A 3SGUA 4GRSA 3W7OA 5D02A 4LRTA 4IPLA 2HBXA 3DBPA 3S6DA 3C2VA 4AXKA 3P0WA 3LK6A 1GQIA 4BKNA 4JHMA 1EO7A 2PDLA 2X2YA 3RN6A 3LRMA 4LQ1A 4B9YA 3U7BA 3REQA 3CC1A 3LGEA 3R79A 2VEPA 3EYPA 1AH0A 3H7VA 2EHHA 4JTQA 2FGZA 3DCPA 1M04A 2WC4A 5AHNA 1ML1A 3MCNA 5CKSA 2J25A 1TX2A 3K8MA 4ZSTA 1MZHA 3T78A 2P8BA 3M5VA 1E1EA 3EWCA 1XH2A 4JKLA 4MM1A 4AG0A 5I3DA 2J9ZA 1VYPX 3VGBA 2MANA 3PZTA 2J24A 4DXKA 4E8CA 4CD7A 1LQ0A 5T9BG 5T9CE 4HOXA 5AKQA 1RY0A 3ABRA 2NUYA 4AZCA 3KS5A 4NYYA 2YB1A 2FTPA 1S2CA 1GVRA 1EIBA 1JNEA 3TR2A 1MXDA 3M0LA 3ARWA 4Q4QA 3ATYA 2PAJA 4QJ1A 3HGJA 3M5ZA 3NQEA 3ABOA 1UMLA 3DN5A 2OKOA 1NVMA 1V3KA 4LCRA 2VOMA 4YNGA 4UQ9A 1JG9A 1R2SA 1XH1A 4MZ8A 4JICA 2Z28A 3LGDA 3ZT7A 5DLCA 3U7VA 2XZ7A 4B90A 3RRXA 3AJXA 4X2PA 4QTGA 5G1MA 3ES7A 4LF2A 1K7XA 3KP1A 3LXBA 3DYMA 2BGNE 1GG1A 4ATDA 4ZB0A 3RRAA 4LS0A 4NVTA 1C9WA 4N9CA 1CYGA 2EPOA 4CD8A 3S5NA 1Z7AA 3LQLA 4HA0A 4OVXA 1WBJA 3PZIA 2HTMA 3B9OA 5CJMA 4GIYA 4H41A 5BNKA 1DXFA 4JHOA 3VZYA 2Z6JA 3AYTA 1ZENA 1O1HA 2GJLA 1W1ZA 4RCXA 5DMMA 5HUOA 3WLIA 3VKCA 1W1B1 4IWWA 3MCOA 1AQ0A 3U57A 2VYOA 2QDEA 4ML9A 1OX6A 3M64A 2WZIA 2JKPA 4LV9A 2WMJA 1MFUA 4NJHA 3ZT5A 2WHKA 3PUEA 1V0KA 5EA9A 1QCWA 3ZWTA 1W54A 3WNMA 3W02A 3VABA 1K77A 2ZWZA 4WGHA 4QSHA 1TQXA 3UXIA 4NT0A 3ZWSA 2DT0A 3TCSA 3KTSA 1JCMP 4JNZA 4QLJA 3B0VC 3O0FA 1PUDA 1RBOB 1XYCA 3VFLA 3WMLA 1EX1A 3AALA 5C5YA 2JEQA 4ZB2A 3VA8A 3EKLA 3HG5A 1PWLA 1Z9AA 3HOJA 3TZFA 1GEHA 5FJUA 2XFFA 4BF9A 2P3EA 2GVGA 3FDGA 1US2A 4O0QA 5C7VA 3O15A 1GHRA 1DVJA 2VWSA 2DSKA 4DM1A 1S5MA 4I7WA 5I78A 3HF3A 4R88A 1GQNA 1ZL1A 1AZ2A 2R1KA 2AAMA 1QHPA 1PKMA 3K8KA 3CGTA 1QWKA 3T0TA 3GXIA 5XINA 5FESA 1JZ5A 3LCGA 1XCFA 2RUSA 2YCLB 4OUIA 3SCSA 5DBUA 4IQLA 2NXIA 1J8VA 1XRSA 1QI5A 3CZGA 1U1HA 3WDPP 3KRUA 3P93A 3E3HA 2BX7A 2OSWA 3S9YA 3I3BA 3C2FA 3WLKX 4CKQA 1IF2A 3CQIA 1EDTA 5I2UA 4Q8QA 4Q8PA 2BBFA 2E3ZA 1SO5A 4UTUA 3UD6A 3T08A 3GIQA 4HNTA 3IEBA 1XUUA 1IEXA 4C5ZA 4S3AA 3IJ6A 3ZJ6A 3GFYA 1KGXA 4CNSA 2PDIA 1P1XA 4JIRA 4X0VA 1JJKA 5KZDA 2VL4A 1ZPTA 1YADA 5MF5A 4AF0A 3AHZA 1TPEA 4LANA 5EMUA 2VDIA 1A5NC 5MKGB 3NNTA 1E51A 2VZUA 5I3GA 4EF8A 3VC6A 3UJSA 3L9CA 1OC5A 3WLMA 2CCRA 4US6A 1P0NA 1ZJHA 5EGRA 3ES8A 4GBUA 5AHEA 1H7RA 2PDGA 4O14A 2PTDA 4D2JA 1V0MA 2V6AA 1EYWA 3N1AA 3LHTA 4KKXA 1KM0A 5C71A 5JH1A 2Y0FA 2HE5A 4DUXA 2BS9A 3QGAC 1BSIA 4BF7A 1OF8A 4Y7EA 1DHPA 4OU1A 5D37A 2CLKA 3A12A 3OIHA 4V33A 3QZAA 3KE0A 5BU9A 3THQA 2RHGA 3RM9A 4ZCWA 1XKJA 1XC4A 1LQAA 2IMRA 1FY6A 3MQTA 4W8LA 1G94A 3OBEA 4GQGA 3LNMA 2OMAA 1KXQA 2CLIA 3OHIA 4M5PA 4AB4A 5HNTA 1TJRA 1UHVA 1OT1A 3N04A 5LHEA 4IGMA 1Q6LA 2V63A 4RNJA 2JKEA 1VFHA 2E1WA 4WOZA 3M6DA 1V03A 4CLMA 5I5RA 2BVYA 4XVDA 3SSJA 4UQCA 2SFPA 4L5ZA 4W89A 4XAYA 3A24A 3ZFHA 2D3LA 3IIZA 3G77A 3GVVA 3L67A 4J3UA 2XVKA 3N9KA 4UFJA 3VGEA 4BEUA 3W7NA 1DL3A 3IUHA 1JDEA 2Y85A 1YDOA 3N25A 3R6IA 3BG9A 3OG3A 2OLAA 4DF0A 3OEXA 1EGZA 4RDYA 4WDWA 1NEYA 1E4MM 3DHFA 4L9XA 2FVLA 3APTA 4DI9A 1GKPA 1UOZA 3WDIA 4Q22A 2INZA 2OX1A 2WVUA 1H60A 1E15A 3W1LA 1JUBA 1P0EA 3BJFA 4Y8EA 4NILA 2WNZA 1EJXC 3QHNA 4AEEA 1WX0A 1KB3A 3U2OA 3KL3A 3XINA 3EWXA 2O4QA 4MJZA 3T0CA 3TR9A 3G1FA 4PUKA 2PDBA 3VX0A 5U7SA 3HO8A 2IS7A 4Y9OA 2PLCA 4TQTA 2OLSA 3JS3A 1VJSA 3ZLHA 3AYSA 4RDZA 2POTA 5HQLA 3PTKA 4FR1A 4L6HA 3L23A 4UNKA 1TMHA 1W5MA 4A22A 2YLAA 2C1HA 2G3FA 5HMEA 2OKTA 4UTHA 4H9UA 3EMCA 4P7NA 2YA1A 4HCDA 1UWQA 2CLEA 4IICA 1XINA 3H70A 4UC5A 3DESA 1NDZA 2XIBA 5DCBA 1XIBA 4O4VA 3DG7A 3WNLA 3H2FA 4XWUA 1HJXA 3RG6A 4QE1A 4AW7A 5IHSA 4UNLA 3PNZA 5LGZA 4IXXA 3VIPA 1OEPA 4QLLA 5AECA 5AC8A 1H7WA 2C14A 1NARA 1BHGA 1FXPA 3VZZA 1HX0A 1VEMA 1H3GA 2Z1WA 1HJWA 3O6AA 1PL9A 2GK1B 1CB7B 5D03A 1ZBVA 1Q85A 5K9CA 3VCNA 1F7BA 2E4TA 4HNUA 4DPPA 4LVDA 1XLGA 4M1RA 3LLFA 4QDMA 4MY8A 3L4UA 1P6BA 3IUDA 3WD0A 5F4XA 2NXHA 3VOGA 1TPUA 1MNZA 3ARYA 2AL2A 4DF1A 4EPKA 1F5ZA 4ZL1A 1NY1A 4JZ5A 4RPPA 3F4NA 1PBGA 1GHSA 3TCEA 2EJ1A 4CQ8A 3T40A 2WBGA 2O55A 5BU6A 1K4HA 4DY1A 3DYOA 2C8NA 3H53A 3VDCA 1CENA 5CC5A 3OLEA 4Z2HA 2DJLA 1RD6A 2IPWA 5M03A 1GOKA 3MB9A 1KFLA 4XVEA 4LAZA 2A3AA 3PBGA 4WR3A 4KFNA 3OP2A 1B3YA 3G0XA 3MI6A 3WZ0E 4N9DA 4HMCA 4EANA 1VIWA 4JDBA 5IBXA 4GX8A 2JIWA 2OSYA 2P10A 3N3MA 5FJIA 3V0SA 3T44A 1H09A 4HMDA 1XDJA 4XD3A 1WA3A 1OK6A 3GVQA 1GZGA 3W2JA 3AS0A 2YKKA 5LIKX 3NQGA 2R91A 4ZOAA 4QS5A 4HIBA 2GQ9A 4UQAA 1IEVA 2WNNA 7REQA 4CQBA 5E9AA 1WOBA 4ML4A 4HSOA 4LC6A 3W0KA 2EPHA 4FXRA 4NAEA 4PR4A 4PUJA 3PPHA 3UR8A 1MFVA 1UCWA 3HQOA 4ROPA 4WXYA 1QNSA 2JF7A 5AHIA 4N0RA 1QPRA 1HVQA 3EDFA 1DJXA 3ZJKA 3W75A 4J35A 8RUCA 5AFDA 1TVNA 3F5LA 1EYEA 1CBGA 1E6XM 1UD4A 4KERA 5IFTA 3KUMA 1BKSA 2JE8A 1H11A 4Z42C 3KM8A 2YPIA 3TN4A 4K3ZA 1ADDA 4LFYA 4AH7A 4UR8A 4MB5A 1K8ZA 3UGRA 5BROA 2E7FA 4Y6GA 1KQZA 2ZX9A 1Y5WA 3WD3A 2TMDA 4UZUA 2XU2A 2WW5A 4JTEA 3NQDA 3DG6A 3FOKA 1B9BA 1XXXA 2OGJA 1RJPA 1QPOA 4P8VA 1XLLA 9XIMA 3BAYA 5A1AA 3VO0A 3H4GA 4NKCA 1M41A 2DV0A 3VIJA 3RR4A 4D1IA 4FNRA 1Y5VA 3IJQA 3NXFA 3E74A 2HDJA 4FNPA 3VI2A 1VZWA 3CEUA 4RUBA 2E6YA 1T96A 1SW3A 3P7YA 2WLYA 2HEJA 2BFGA 3W23A 3QZEA 3B8SA 4NIRA 5LA0A 5FJTA 3D5HA 2A0NA 3NGJA 1EP1A 1EZWA 1XLFA 1W5OA 2OOFA 4JTCA 4BY3A 2ZQ0A 1V8EA 2EPLX 5CPSA 4J3ZA 4PUMA 3ABQA 5DY3A 4UOQA 3WQ5A 4B4HA 3VCCA 2WK2A 1JCNA 1WKYA 3CO8A 1ZAIA 3OG2A 3EKZA 4IIFA 3THDA 4JCLA 4XQ6A 3EX3A 1V4YA 4GVGA 1NSJA 2AGKA 2P5NA 1O5RA 4QEHA 2ZX6A 1H0GA 2A5HA 2CXEA 2QJJA 1H1NA 2PA6A 1EA0A 3M0XA 3KBSA 4LVGA 1VJZA 4TMCA 1JZ6A 4LVBA 3II1A 4PMNA 4LUTA 4DRSA 2OZ0A 4OV9A 1JRBA 1G4SA 3AS3A 3W27A 2VVSA 1UUMA 1XIJA 3S2LA 1MW3A 4AD0A 2GUYA 6XIAA 4Z1DA 4HCLA 3DFNA 1O68A 2WMIB 3WBYA 5EMKA 5K7JA 1YX1A 3TTOA 1A5UA 5C9UA 2X0SA 4CQAA 4KW2A 3URAA 1OF6A 2J8TA 4IPNB 5LXXA 3ARZA 4U3AA 4RLIA 4DJFD 3ABSA 2GGGA 7ENLA 3BMVA 1LWHA 2PGRA 2R24A 1IXNA 1TTJA 1FVPA 3VOHA 3WEMA 3P60A 1JYWA 1D2KA 2YDAA 2OELA 4NZFA 5CJ5A 3TN6A 1ITXA 4ZQMA 2AQWA 3ITXA 2XVGA 4FLRA 4AZIA 1EOKA 5T26A 1KBLA 4C1NA 4GOAA 3LCXA 3N29A 1SUXA 3HPZA 1RBLA 2PDJA 2Q3RA 2Y1HA 1FWFC 3S2JA 3CUGA 1OHLA 4I5RA 5A6BA 2WJEA 4A6GA 4R3UA 1XBVA 1RHCA 5CPMA 4A29A 1Y65A 2C71A 5I6SA 3WQFA 1WKEA 4ACZB 1TPH1 2X1UA 5C6MA 1J5TA 1J96A 2A21A 4UMCA 4UFMA 5EMJA 3XIMA 3GSMA 4U3CA 1FHLA 4HU4A 1GOOA 1VPYA 1N7KA 3STGA 3E0IA 4TTUA 1R3YA 2NUXA 4Q8WA 3K1DA 1ZUAX 3NEVA 4LUYA 7TIMA 1TMLA 1A5LC 1N55A 3RLVA 2GZXA 4ZXLA 3PZQA 3FYYA 3MUCA 3WQ4A 2GUBA 3KP0A 1NDVA 1YE6A 1E6ZA 1IQ8A 2TAAA 3MO4A 1RPKA 2OOGA 4JN6A 4ZZ9A 4IUGA 1LWJA 2OEKA 2PGFA 5LHFA 2P1FA 3CLMA 3KHJA 1QDSA 1A0EA 4LW7A 5FOOA 3TFXA 4L65A 4N4QA 1TJ0A 4C6FA 4GZEA 1KBIA 3U4AA 4BFAA 2ISFA 2DZSA 3M0JA 3HN3A 3PTMA 1E4NA 1EF2A 1AK5A 2Y61A 3WQEA 1DBTA 1UD8A 3PBYA 1HP4A 1CI1A 2QJMA 4AIEA 3UYIA 3TXZA 2V2CA 1X6UA 1MW0A 4B16A 5U4NA 1F3TA 3NQ7A 4DNHA 3U48A 1LBMA 3BCFA 3RX3A 1TCDA 2J62A 3W76A 2J8FA 3ZSSA 1M53A 3M5XA 1J10A 4OBRA 1GYMA 4UTJA 2ZC8A 4V15A 4W88A 5HJXA 2ZZ2A 4GI4A 1P7TB 2NQHA 1FWWA 5FI8A 1W9DM 4C6IA 3BL3A 2PC4A 7PTDA 3TOPA 5CLTA 5D09A 1KWKA 4ZVJA 1U5VA 3CUHA 1V6YA 4O4WA 2TSYA 3WDRA 3MMTA 1B3ZA 4NRSA 1XLMA 1LORA 1EDGA 3VKBA 5AYIA 1ISWA 2Q6ZA 2J4GA 4Q8TA 1OADA 4Q8NA 3SCVA 3FIGA 1ISVA 3FJNA 5HMFA 1XFCA 5E09A 4PTVA 1LL6A 3H2MA 4ZTYA 2C6QA 1GTEA 3ZR4A 4LRSA 1GVEA 3ZLGA 5TIMA 3TVAA 1SW0A 2C1IA 3KTCA 2NV1A 4MADA 4N4PA 2JQXA 1UB3A 1C29A 4GMEA 5FF2A 5HPCA 3PB2A 3S3GA 3U5UA 3URNA 1WZLA 3IK4A 3A22A 5HR6A 2Q8ZA 4ROQA 4JIEA 1A4LA 4TU1A 3D0CA 5CPOA 1OX4A 4PCNA 4B9ZA 1J11A 2X42A 3AHTA 4URIA 3NQMA 5AYYA 9RUBA 5FAGA 1U33A 2ZADA 3AXMA 3W1RA 1LUCB 3TP4A 3KRSA 5CGMA 1D8CA 1QMLA 2GGJA 4O1EA 1OFEA 1G69A 5D4YA 1PX3A 2NXGA 5CZJA 3W6LA 2UY4A 2HCVA 3VKDA 2A6NA 4L61A 1XGDA 2AAAA 1W9PA 3TJ4A 4A2SA 4GIRA 4H6EA 2WO5A 1YDYA 2Y70A 3L4YA 1U1UA 2WSYA 2DGAA 4MYAA 3KEHA 2NQ9A 3SCOA 3TJLA 1XYLA 1UD2A 3IJ8A 3ZOAA 6REQA 3AMDA 1J2BA 4MAVA 3TOYA 3P81A 1ZTVA 3G1YA 3GNPA 4R5EA 2LLEA 2BLEA 3G6MA 1TTIA 1YXDA 3CHEA 1KM1A 3VIKA 1SJCA 3QY6A 4P7QA 3W3OA 1SSGA 1J0JA 3DEQA 2REQB 4MDPA 3LCIA 2WMKA 4AWSA 3OPSA 1IWPA 3OZYA 3VMOA 3W1UA 3L2MA 1MQRA 5HAOA 1OT2A 3SAZA 1YXCA 3UEQA 1EX5A 1UQYA 1TVPA 1LL4A 1EGVA 1BGAA 4PMRA 2PDHA 1IIGA 3LRLA 1AVAA 4DI8A 4UR7A 1XLEA 1POJA 2KX9A 4KWVA 2UV8G 2NQZA 5B7YA 2XIMA 2VEKA 5JXQA 4R53A 3E5PA 3G0UA 1WNOA 3W26A 3BLPX 7XIMA 3R58A 1ISYA 5FL0A 3KL0A 1HKJA 3YPIA 3M9YA 4JTRA 3O1NA 5HNRA 2XINA 4H00A 2OWCA 3IRDA 2YR1A 4PMVA 3E0WA 1WYIA 2Y8KA 4IZGA 4CEXC 3H2OA 4UUIA 3CWHA 2YSWA 2ZCGA 2EXOA 2A3LA 3DGRA 3PPFA 2VGBA 1F6KA 5I3KA 4O16A 1LG1A 1R7AA 3UA3A 1BQGA 1EP3A 4NF7A 1HJQA 4ZQNA 4E2VA 1EPVA 3UZWA 5JIPA 4JEQA 1SM9A 3LMZA 1D9EA 3CL8A 1A5SA 3W6MA 1L2UA 4MLRA 3JU2A 4NXKA 4XAFA 1XPGA 3CH0A 1Q3NA 3VD4A 1WV2A 3RPMA 1ZAHA 3G1XA 3LENA 1XQLA 5DQPA 3WUBA 3KVJA 4JYDA 4OOZA 3GVRA 1XW8A 3UWQA 3MCMA 1M1BA 2EPMX 3CHFA 1BXNA 3SEPA 1E3ZA 2XG9A 3IIOA 3RM8A 3K46A 3K4DA 2NVCA 4MB3A 3N12A 2FZDA 1IV8A 2G95A 4IF2A 4LYPA 2QCLA 3SCRA 1LOLA 4QJ5B 1J18A 1KW1A 3LQGA 4XAPA 1MMFA 1EZ2A 3AISA 1JNDA 1ZSXA 2WYSA 3OVRA 4QG6A 4MNJA 1O94A 1W1TA 2F38A 3ARPA 1J0YA 4FX8A 3APGA 4M6VA 2A3HA 1BAGA 3L68A 4GBDA 3WD4A 2QLYA 2XSXA 3TX9A 4GZJA 4ILSA 4W7VA 4FX7A 4DO6A 4HOWA 1TV4A 3O6CA 4H8HA 1JYXA 3CUXA 4IFOA 2ZOXA 3ALFA 3GO2A 1H61A 1UPMB 3CL7A 3M07A 4LUJA 3SW6A 9XIAA 2Z4GA 1XHGA 5J5DA 1I0DA 4V2XA 4LY8A 1OCQA 4MFEA 3H4XA 5HNUA 3N4EA 5KZMA 1CEOA 2VZOA 1LQ2A 4JTUA 5EY5A 3MUY1 3VOCA 4LSBA 1TVLA 3BW3A 5AC6A 2WMHA 1OCNA 1FH9A 3FJLA 3EAUA 2YGYA 2NSOA 1JCYA 3DGBA 1K6WA 1GZJA 4KEZA 3T2OA 4ADTA 4JKMA 1TRDA 1UZ4A 4AIUA 1I2OA 1OBAA 2W27A 4WQ6A 4IGHA 3CH9A 3MUIA 4NJIA 1DIOA 1W2PA 1SJAA 2DZXA 2C13A 1CXLA 2DUAA 1P43A 3FEQA 2YW3A 3WFLA 4GVFA 4KWSA 2CFFA 3UPMA 2FHCA 4DJDA 3AHYA 4BWLC 4LJ3A 4HA1A 4YHGA 3C0QA 4NZ5A 5AHMA 5D05A 1Q6OA 1I60A 5LIWX 1HF6A 4B5TA 2Y2WA 3GDMA 2CHNA 2OQYA 2IPFA 1I75A 3Q65A 2RDUA 2NX9A 2ZUWA 1JD9A 2RJHA 1R8LA 2BOFX 3W72A 1GOMA 3B9AA 2A3CA 3STPA 2R1MA 1H5YA 1OB0A 2VRJA 4WK9A 4MAZA 5FF4A 3ZJ7A 3KOFA 1S3TC 3CUJA 3VUPA 4RPQA 2D24A 1QPNA 3TK7A 1BGGA 4UTWC 3BURA 4KGJA 4C6QA 3R8RA 1TUFA 5HR7A 3ZR5A 2BHZA 3OVPA 3WDJA 4NXSA 4XZWA 2EGZA 4IJBA 1PE1A 5C2GA 3MA8A 2EJAA 4CU8A 2ZZ1A 4DQWA 3QLLA 1S2TA 1KLZA 3VC5A 1EFZA 4W85A 4FZIA 1FDZA 4H7ZA 3KOWA 5HWNA 3A21A 1TB3A 4ERGA 2ATMA 4XSMA 1SFSA 3W29A 4MJ4A 2V5KA 4LB4A 3AIWA 4M8UA 3MUXA 3B4YA 4CEUC 4M6PA 2XIIA 3MC5A 2DUXA 3V0UA 7TAAA 1C7TA 1UKQA 3VD5A 1TE6A 3U8GA 2XTKA 2CITA 4XZIA 5FACA 4ZE5A 1JXJA 3BLDA 1FKXA 1BYBA 1S2AA 1GVYA 3BSGA 3LI1A 1G4TA 1VEOA 3O16A 2GDQA 4XZBA 3UG8A 2VJXA 5FL1A 4GY1A 4LYQA 2BTMA 3N17A 1W1VA 4HN8A 3RAOA 2BGQA 5GPRA 2O7QA 2YCLA 1NFBA 1RCOB 2DJXA 3UWUA 2H6RA 2WC3A 2WM0A 2E68A 1MDLA 2FPTA 1VJIA 3BCJA 3PULA 3FXYA 1UPPA 2AGTA 4HD5A 2QMJA 2QF8A 3I4EA 4HU3A 4BI6A 1UR8A 3M0HA 3M44A 3OVGA 1N82A 4PMUA 4WSJA 2PCQA 6CGTA 1QNPA 4ZO6A 3SM0A 3LHZA 3KBNA 3NQ6A 3OVQA 3W7LA 4DBEA 1W5QA 1H63A 1QHOA 3WBAA 2I7GA 4JD4A 1DJWA 4ZQCA 2QNEA 1D7KA 3SRHA 2B4GA 3FY1A 4XD6A 3WNKA 5KZEA 3PZNA 4O1AA 3UFYA 5MKGA 4UCGA 1PZ1A 2PSNA 3U2EA 1CT5A 1TWWA 1DQUA 2A3EA 3SRKA 2GLKA 5CC3A 4OWGA 5CBBA 1BVZA 3W7HA 4JTDA 2ZVRA 3NQAA 1E6RA 3EX6A 3SCUA 1Z6KA 1J79A 4LNYA 2V0TA 2A3BA 1UWRA 2QYGA 2ZX5A 4B5XA 2X1IA 2BXYA 4Z1BA 5A8GA 3NSMA 2YL8A 4PN2A 1X38A 3Q2DA 1ZBKA 2HJPA 4HNNA 2WANA 3T4CA 3QC3A 4ZOBA 4IP4A 1AW5A 4MB4A 3V36A 3EKGA 4GLEA 2V5LA 5LIUX 4G2DA 2VDHA 2ZUNA 5JU6A 3PPCA 3PFRA 4LVAA 3LBCA 4PGLA 2C0AA 3A4XA 2QCEA 2ZX7A 4DYEA 4N42A 4XUYA 4W84A 2ZE0A 1US3A 1PJ9A 4XIAA 4DUOA 3PWAA 3VGDA 3W22A 5DANA 3FA4A 1E73M 1F07A 4LF1A 4E2OA 1J93A 5LSMA 3GM8A 3NTYA 4QSFA 3VMPA 3W73A 5ECVA 4H4IA 3C2EA 3UETA 3QTPA 4Q3MA 5D30A 2FZ9A 1VLIA 3P0XA 4H19A 1JZ4A 2ON3A 1BVNP 2FVKA 3NQVA 4S2CA 3R10A 2XZ9A 3WG6A 1Q2SA 1DTUA 1PHWA 1QOXA 3ZMRA 2CHRA 2VZSA 1ITQA 3C2YA 3BWWA 4GJIA 4KCTA 1CXHA 3EWBX 3P3BA 1XYAA 2VFGA 5KSWA 1K1DA 1BKHA 2VFHA 4CNNA 2FTWA 1UUQA 4UFHA 4WLCA 4AQLA 3LYEA 1DWHM 1VS1A 2QW5A 4HB7A 1WAWA 2Z2BA 2HPIA 1X8FA 2BHUA 1LOQA 5F1UA 1HKVA 4IGSA 2XWDA 3MI3A 3LM7A 5G1YA 3SRDA 3TLLA 1L6SA 4NX0A 4FB7A 3TH6A 1U1JA 1ONXA 1CNVA 1R2RA 4EXQA 3HGSA 1UWSA 3W86A 4CVUA 2I14A 3IJDA 4WSKA 3UWWA 1F4HA 3P67A 3EA1A 3TN5A 1PAMA 3TQKA 4O17A 1OY0A 3BMXA 5HNNA 1LL7A 2DZPA 3G6LA 4IFKB 2Y89A 5TNVA 3QFWA 3W7QA 3R0DA 3S1UA 4EOUA 4OBTA 4XISA 4RV3A 2VWTA 3LXCA 1GTHA 3ZYZA 2XFWA 1LF1A 3WF3A 1IR1A 3PUGA 1REQA 3O07A 3A5FA 1GOIA 2XN1A 4RR4A 3LM3A 1Z3NA 3RX2A 1ELSA 1XRTA 3CO4A 6ALDA 2HXTA 3QYSA 3O63A 4GIEA 1XFBA 3PBVA 3N2BA 3LRKA 3CLWA 4GQBA 5CCZA 1KGWA 1G9HA 3N11A 1GVQA 3UVAA 3GBEA 2GK1A 3G3DA 1SQ7A 1KXVA 4BF5A 1TR1A 3QR0A 2P0IA 1QBAA 4CGTA 2PFHA 5AHLA 2G3IA 2DH2A 4JTSA 4R7OA 1WDRA 3EB2A 3KVKA 2POZA 3CQ0A 3DENA 3QPYA 4LT9A 1ZRQA 3VX1A 4X9YA 4GYFA 3TLQA 2Z1XA 2WNQA 4GH1A 1VCVA 3RPDA 3Q37A 5C9ZA 1XIDA 3MHFA 1XCXA 2BDQA 3WH7A 3WQGA 4XSLA 1HJUA 2XVNA 4QCEA 4M3PA 3PZGA 4KS0A 1V6XA 2D0GA 3RO6A 1K8XA 2FZ8A 2XUCA 4XB3A 3VGFA 2PBGA 5FEWA 1L2QA 2PLMA 4K2SA 4ERIA 3BPWA 4P61A 2PWEA 3G0SA 1R5YA 3E0VA 1VFOA 4QNWA 4C6EA 2OEMA 5AC4A 2ZFAA 1BD0A 4W93A 4XG1A 3BLLA 1PB0A 4J7RA 4PUDA 2A79A 2PRHA 4H9VA 3TYZA 2FB3A 2GSJA 3CV6A 5C9XA 5A6BD 1IT8A 5EB8A 5HWMA 2GUUA 1FWCC 3OB8A 5A2BA 3CB3A 3GZ3A 5DMNA 3TYAA 5DELA 3QTGA 3HU7A 2FMNA 2BSLA 1JXKA 1XIHA 1QPQA 3UPBA 4R9XA 2XDFA 4K6AA 2CLPA 4Z17A 1Y5XA 4IM4A 3RF9A 3W4RA 3CV2A 2BY2A 3HBLA 3CUZA 4G7EB 1V77A 1EC7A 3JVAA 4ZO8A 5DBTA 3M0ZA 1F8MA 5E93A 3VMNA 1JQXA 3WFAA 2ZA3A 1Q6EA 2NX1A 2YJQA 5DF0A 3NM3A 1OCJA 5K2ZA 4LYKA 5TBOA 1Q6DA 5ABHA 3MSYA 2MUCA 2DT3A 1EUAA 4GFIA 3SADA 2YZ5A 1HT6A 4X0NA 3A4WA 1GQLA 3GBDA 3BO9A 3G22A 4QJ4B 3SB0A 3KBWA 4BI7A 2QUVA 4J4KA 4PB4A 1NU5A 2ZA1A 2A2IA 3MBFA 2ISSA 3M7WA 2YXXA 1V3MA 1YTDA 5MHBA 5H8MA 1XH0A 3CT7A 3C4UA 1E6SM 5DRIA 1H4PA 1THFD 3N6HA 4PTNA 2HRWA 3VZXA 4NP7A 4LAKA 3IGUA 3R43A 2E09A 4DJFC 4TX6A 2ZRUA 2WPGA 3GXFA 2JALA 4XZ9A 3V1PA 4W5UA 3SUWA 3POHA 3MWCA 3QSRA 4I6KA 5BW6A 4NNBA 3AICA 4GC4A 3CBWA 1C90A 3E49A 1ZZMA 1X6NA 2R14A 4PA8A 5HINA 4CCDA 1FWJC 3MSRA 5FA5A 1QATA 3T2PA 4B91A 4CN1A 2W6RA 3BLKA 1DWJM 3FCPA 3HG2A 5CSYA 4DEFA 1TWZA 3R5EA 4GINA 4ASTA 4OIFA 4BHYA 3F2BA 3TTQA 3QC0A 2EG8A 3OJGA 5CPQA 1TCMA 4HKPA 2TODA 1RD5A 1FOBA 1JPMA 1YXYA 1Z32X 4M1BA 2GDUA 3WLOA 2RFGA 5FF7A 5BRPA 5DXYA 4E38A 3AZSA 2Z1BA 4IISA 5A8NA 1WUFA 2AL1A 3ANUA 3MI2A 2WMIA 3QV8A 3B8IA 4IJRA 3AYRA 5J5RA 4PMJA 4AHPA 1VAHA 1OGBA 3MYPA 1A47A 3VCRA 1OYAA 2OYKA 3D3FA 1VBUA 1PZ3A 3M16A 3U5YA 3MKCA 4L4MA 2OTDA 2ZUUA 3UW6A 3NIYA 3S5OA 1V02A 4MF4A 4EPEC 1I1WA 5I09A 3HPXA 1G7UA 2RDXA 2BGSA 3CPGA 3GR4A 3ZT6A 3A4JA 4S3GA 2QHAA 1FWSA 1XLHA 1ZNNA 3KHDA 2GSEA 1Q5MA 4NZ4A 1TJPA 1OFBA 4UWMA 3UXKA 4NG3A 4H3DA 1KRMA 2CC0A 1C8VA 3S1XA 1JPIA 1RPXA 1XGZA 3F1QA 2C1GA 1X97A 3CT2A 3ITTA 1AODA 2X7VA 1MRQA 5CC7A 3AHVA 1V5XA 4DUWA 4LPCA 2FDMA 4W86A 1KR0A 4DZHA 1XLDA 4CCEA 3EX2A 2ZA2A 3KOXA 2ACUA 2C7FA 3P80A 5DXXA 3M1ZA 3A23A 4GYPC 2WVVB 5KITA 4AYSA 2YB4A 4MKNA 3EWDA 4ACZA 3FEMA 2VNCA 4HK6A 5ABTA 1KCLA 3GZAA 3KDOA 3BAIA 1EB3A 1R87A 4M51A 3GG1A 4I9MA 5C9RA 2E25A 2PF8A 5RUBA 2BVTA 3FHQA 3V4BA 4N02A 3ELFA 5IXEA 3HV9A 4HN4A 3TDFA 5LXEA 4FIRA 5A5WA 2YL6A 1EKOA 4UB9A 2CEQA 1CPUA 1NH6A 2O92A 4CU7A 3G1AA 2WQDA 4Q4MA 3QF0A 1OFAA 3R2GA 1TPDA 2YCEA 3CYJA 1UD5A 3DHUA 1NQ6A 1C9DA 4M81A 4A3QA 1TA3B 2UY5A 1F05A 1MO0A 1V6VA 3NDYA 1QNQA 3D3AA 2D22A 3TYCA 4H04A 1MQQA 1W9BM 3V0TA 4PUEA 1UR4A 2P76A 3E02A 4I3GA 4H8NA 1XWYA 4IX0A 4LC8A 1XRVA 2GQ3A 1S3HA 4L6DA 5E5CA 2ESCA 4CCCA 1IGWA 3BVJA 4H7CA 4FX6M 5HUPA 3KFTA 4GVIA 1H50A 4H9TA 4RJEA 5HOSA 2EAWA 4O52A 3B9NA 3CWOX 1E1CA 1ZJAA 2C3ZA 4X63A 3GXPA 2JFEX 3KWSA 1AQMA 1KRAC 1ZBCA 1HG3A 2PRLA 1XG3A 3ME3A 1LWIA 3XISA 3VDBA 3TYUA 3B8UA 2J7DA 2Z7GA 3A47A 2QCHA 4WX2A 3QV9A 4Y9AA 4TIMA 4YTRA 2DZBA 3AROA 1P7TA 3CQHA 1DJHA 1VH7A 3PC0A 2DT2A 3WQDA 2GWNA 4M82A 5GJMA 3R8HA 3W1NA 4NRRA 2TYSA 5C54A 4AD2A 2PP3A 2I5IA 2V3EA 2E8YA 1XD1A 1J9YA 3VKAA 4E6MA 5KMYA 4PSRA 4MZYA 4HHMA 3UJFA 2NQ5A 4AAJA 4OTKA 1POKA 3N6QA 2CZDA 3AS1A 3CHCA 3BLFA 4IOTA 1RLCL 3CAWA 3T9PA 5E70A 1BQCA 1UJQA 3GXTA 6ENLA 2AQOA 4XK2A 2OSXA 4ZEPA 3SDOA 3FGCB 2Y4SA 3BQ6A 4LNCA 4WY0A 5I00A 3LZ5A 3QOKA 3GTFA 3GE7A 3MS8A 1GVIA 4XBJA 1SPQA 1UH4A 1LUCA 1EA9C 3T55A 4FLSA 2QCDB 1XISA 2FGBA 4K8HA 3WYZA 5M2FX 3T0DA 4TUFA 2J27A 3WJYA 3WBWA 1XM3A 1IXOA 1JGIA 3M43A 1QJWA 1VLWA 4IH3A 2NX3A 3BLEA 1X8CA 4GPNA 4HA4A 4WXZA 5A8MA 3QKZA 2ZZ6A 1E5NA 3WJZA 4JNYA 4F3HA 3EA3A 4TX8A 1AA1B 1CGUA 3P5ZA 4AY7A 3BSHA 5G2HA 3TW9A 3QR1A 3EWUA 4KF1A 3WN6A 2Z27A 2XISA 2BG5A 1MYRA 1TIWA 5EYWA 3ALGA 3GC4A 4O1FA 3MDUA 1V93A 4DJDD 3T1GA 3UR5A 2REQA 3VD3A 3LUTA 4C65A 1Q8AA 2ALRA 3W84A 3DFHA 3V7PA 4MHBA 3AXXA 1OYCA 4UTMA 1QHZA 3NWRA 3R12A 2E5CA 3JRKA 2J66A 3W2NA 1NOUA 5XIAA 4DO5A 2QXWA 3IVTA 5TD4A 4L9YA 1FFQA 3L0NA 5HXMA 4QX4A 4YTUA 5BOEA 1TJ1A 3TMQA 3L4ZA 3B8DA 4MNLA 3AIVA 1GOXA 1HGYA 4RW3A 5AZ1A 1V3LA 3GW3A 3PWGA 3PAOA 4PUWA 3AQUA 1M03A 3W1PA 4YYFA 2OEJA 4UBPC 1XX1A 1S5WA 1PX4A 4Y8FA 4AWUA 3ZXWA 4PMXA 1CECA 2CBVA 4NL1A 4DUVA 1HP5A 2G96A 3LSBA 2PDCA 4X22A 2F7FA 3E0LA 4W7UA 1B1YA 2F2KA 3C8NA 3ANYA 1FDJA 4S3KA 1IYXA 3NZRA 1ADOA 1GQJA 4HU8A 2WHLA 2YL5A 2JBMA 3KOYA 4BK9A 5I03A 3WQVA 3MHGA 4H6KA 2PF0A 3USBA 4HVXA 1HFBA 2NVDA 4A3YA 4AD3A 4WSHA 2DSWA 2DZTA 1G67A 3CZJA 3S2CA 2VO5A 4BR1A 4KEUA 3W2LA 4GXWA 1KM3A 5H91A 5HQMA 3GYEA 2IKIA 3TQVA 4YTTA 4HP5A 4O57A 1RP8A 1I4NA 1H2JA 1Q6GA 1S5VA 3A6OA 4HNCA 2VCBA 1OFPA 3W1XA 1B57A 1LT7A 1XPYA 3S0CA 3P6LA 3VOFA 2GOKA 2OXNA 2VM8A 5BYWA 1VQTA 1LLOA 1YQ2A 1VBJA 2D0FA 1KCZA 1YMYA 4RL3A 1KV5A 2P0OA 5I77A 2WC7A 4MB1A 1EP2A 3QMSA 4HQVA 3WK3A 2V2HA 2F61A 3M6YA 1BEUA 4JIQA 3FAWA 3HFTA 5CBJA 3BE7A 4FXJA 1SR9A 1ECQA 5TQLA 1DXIA 4RKAA 3TWBA 2Q71A 3EOSA 4IMAA 1P0BA 3D46A 2BY0A 4R7WA 4OZOA 4O8AA 2Q09A 2OZTA 3OO2A 4XX6A 5CH9A 1GVSA 3W7DA 4MJMA 3A4AA 1R3QA 1DEDA 4EVZA 1BRLB 2CU0A 1KWGA 1CXKA 1V0LA 1Z8AA 4HZ7A 5CPNA 3URQA 1G6CA 1DJYA 3ZJ8A 1V7YA 4S1FA 5C2CA 2QS8A 4WD0A 2V8ZA 3T09A 2UY2A 1Q6QA 4Q4OA 4WZHA 4DJEC 3ZSTA 4QXIA 1UG6A 1I0BA 4OE7A 4PCTA 4PRTA 2CIPA 3UYCA 3TTSA 1XLAA 3NQBA 4GQQA 4IL0A 2XSAA 2DEPA 3D47A 4N6FA 2ZUMA 2Z24A 4LUSB 2F9RA 2RGLA 2QJHA 3GHUA 4QDWA 1I2PA 3LXAA 3BXWA 4WJXA 3W7CA 4MY9A 3NO3A 3KOZA 2VEIA 3H7UA 2IKJA 3F4CA 1XBYA 4EAYA 1XYBA 1GVFA 4ADSA 2QUNA 1IZCA 2XH0A 2Y5EA 1AD1A 2HNEA 1XIGA 2J7GA 2VURA 4GNKB 1AMYA 1CGVA 4XTDA 3WDHA 1F6YA 2WJDA 2WNWA 3PWIA 5IOBA 3RCMA 2ZTJA 9CGTA 1RUSA 1NJJA 3NQFA 1GCYA 1XLKA 1OIFA 2ISDA 2J13A 3RO8A 3PP7A 2I9UA 5FSDC 3E2QA 4S3CA 3KVMA 3UR7A 3NL5A 2WV8A 1GYNA 5C55A 1C91A 3T81A 4O0ZA 1RY8A 2AMXA 3NXLA 1UROA 3R8GA 1OZMA 4BCEA 1E9IA 4GWEA 3SY5A 3F5JA 3SUVA 3ZR6A 4FS9A 4B15A 1RV8A 1T99A 4OUEA 3MANA 4TMBA 3GVWA 4Q6JA 3T0AA 3Q4DA 2HK1A 3VE7A 1JCLA 2OZ3A 1WPCA 4LBRA 4I7VA 5D33A 2FJUB 2PEVA 2OLHA 3H4WA 3WSUA 1TTQA 4LUIA 2AKMA 3F2CA 4QLKA 4X60A 1HXJA 4ECLA 1JPKA 3DHPA 2X16A 4KETA 5CZ0A 3IVUA 1EJWC 3AIRA 1YDVA 1UUOA 1TZ9A 1MW2A 4OKDA 1FWIC 2DSVA 1GW1A 4INFA 1W32A 4K37A 2KZHA 3DFPA 1DPMA 3DC8A 2FLIA 3CMFA 2PTZA 4GGHA 3VGGA 3B8TA 3B97A 1RCQA 3LS9A 4XKYB 1KKRA 5CXPA 2CZ5A 1SJDA 3MKVA 5H8UA 1IEIA 1H7NA 1FA2A 1MUWA 1YLVA 1EXPA 2W63A 1PIFA 4CCZA 5G2IA 1MUCA 3LNPA 3BAKA 2W5FA 4JTKA 4IMGA 4EPDC 3BLIA 2QCCA 3MT1A 1YHTA 3TU9A 3SUTA 4MWAA 1ZY9A 5K9DA 1KFCA 4PTMA 1EPXA 4H2HA 2XWEA 3WLHA 4PZVA 3B04A 1FWBC 4KIEA 2A1YA 3TMLA 1FXQA 1UC5A 3UY7A 4A8NA 2E67A 3AXHA 3PN8A 4A4AA 2VR2A 3SSZA 1J0KA 4MGGA 3E1F1 4FOKA 2HK0A 2PLJA 1GG0A 1LJYA 1XLJA 4DWSA 4JS3A 2PWFA 3N9SA 2X05A 3L66A 3PS7A 3MKKA 1HJVA 1KFEA 1EJ7L 2PWUA 4H9XA 1LG2A 3IUIA 1WDPA 2BMBA 2C0HA 3MVIA 1QI3A 1P6WA 3KL5A 1V51A 3TZNA 1H0IA 1ZP3A 1OVDA 3AZTA 1VFLA 3TC7A 4HMEA 4I6VA 3W07A 1ONEA 3IGSA 4GE8A 4AHOA 8CGTA 2QV4A 5JBEA 1ICQA 1W3TA 3TC6A 1IXPA 4TTGA 1PVNA 1FP9A 4D6DA 1JYNA 3GLCA 2FB2A 4GA8A 4MKVA 2EBNA 2YA2A 1YRRA 3GIYA 3KBMA 4AZ5A 4AMCA 3WO8A 2IKHA 3O9NA 2FHBA 4KCVA 4E4FA 4DWDA 5A2AA 4JQ2A 5FEXA 4DBUA 4HNOA 4KQNA 2PMQA 2QCGA 3UP8A 3EDJA 3GXMA 2XVLA 3PHAA 3OOQA 2YBUA 5B80A 4F4RA 3H6OA 1IEWA 3BMWA 1OX5A 5F1VA 4YTQA 2VD9A 1UWAA 1NM9A 3LY0A 3GNRA 5HULA 4H83A 1BXCA 1E4IA 3SFKA 4DIAA 3NSNA 1E9LA 1HTIA 5EFDA 3UR2A 4A3RA 3NVDA 1JUEA 2GOUA 3RMJA 1MZRA 1CWYA 3COTA 1BVWA 2QQ6A 1R7OA 4DF2A 1VC4A 5IRPA 2ODOA 3VKKA 3AIBA 4XBSA 1LRNA 2DZAA 1UOKA 4DM2A 4HSHA 1HKMA 3ERPA 3M4HA 3CUIA 5FEZA 3UCQA 1F2JA 5DCDA 2B7QA 4XTIA 4LWWA 4BWLA 1YPXA 3BW4A 2CLFA 3L12A 2PD9A 4ZFMA 3WH6A 1DV7A 3PY2A 2VENA 2ADAA 4GO9A 3ZS4A 1E0UA 2HS8A 5EBAA 1CXIA 2QULA 5K3VA 3I3EA 2X1TA 5BZAA 1ICSA 3QYQA 4AZ6A 2Q8XA 4EXAA 3MVTA 4PBEA 1UWTA 5CG7A 3WL1A 3E2RA 3BSMA 3EOOA 2R6OA 1SR0A 2PS2A 3BV7A 2C19A 2YDRA 5D2VA 4D6FA 3L7RA 1VFMA 1XS2A 4HGXA 2Y62A 4G56A 4NQ1A 5B7ZA 1I8JA 4S39A 4H1ZA 3WF1A 4TV6A 1YIXA 2DY3A 1N8WA 2H8ZA 1TPB1 3OZMA 4DXXA 2WMFA 4C6KA 3HMCA 5DCEA 2VI0A 1PHQA 2FFCA 1TV7A 3DHDA 4F40A 3B06A 4EKJA 4XUGA 1NOFA 4GUHA 4IFKA 1L0PA 2ZDSA 3BGJA 3IV3A 3PBMA 4IG2B 3OLDA 3UERA 3AWNA 1OZQA 2G41A 4G7FA 4EACA 2Z0IA 1CLXA 1BG4A 1W2VA 1XLBA 3BG3A 3V16A 3UZ5A 1V3IA 3FKKA 3UF9A 5FJOA 3I4KA 2ZICA 4HZ8A 2ZXDA 1A4MA 1MSSA 5H1WA 1XKYA 1G5AA 4V28A 3LCHA 3AWOA 1YE4A 2OU4A 3MPGA 3GDKA 3QSTA 4MFDA 3ZQ9A 1R3SA 4HPHA 3EPNA 1WE5A 3HQPA 3FV9A 3ID7A 2Y5JA 1HL9A 4UIOA 4WEVX 4MZ1A 1BTMA 2OCZA 2IQ0A 4Y9MA 2Y6ZA 2GDVA 1NF7A 2J7BA 1EWDA 2WSPA 3JZEA 3MSGA 2BY3A 4D9PA 4JXCA 3TTYA 4H8VA 5ABGA 2A85A 2IPGA 3W7PA 3SUUA 1I1XA 1GJPA 3EX4A 4ZE4A 1K6AA 1A5CA 4V1YA 3WLLA 3S46A 1GKQA 1SGJA 4NU7A 2QUUA 4F9DA 3FNDA 1UJPA 5JVLA 4EX4A 2H9AB 4GABA 1OC6A 2DUZA 4LS1A 1BLIA 4YPJA 1T8XA 1LCOA 2B31A 3EPMA 3FN9A 3ONCA 1JZ2A 2HROA 5A6TC 1LDCA 4Q33A 3FS2A 1D3HA 5HJLA 1E5JA 4OV4A 4IUOA 1E0VA 4C5YA 4R33A 2FPVA 4GIAA 2RDWA 1GOWA 2TRSA 3STCA 4KH2A 4K36A 4LB3A 4GI8A 1FQ0A 5L6UA 1Q65A 1W6TA 4PODA 2P50A 3LTYA 2R82A 1TELA 4G7EA 4GC3A 3BQ5A 3DI0A 1L6WA 2W61A 3W7RA 4Z2LA 5FF0A 2H8XA 5JIWA 4HJWA 4N2YA 4G8TA 2PU0A 4YN5A 1QWGA 1ZU8A 4PMYA 5E1QA 3U6WA 4YXGA 5D8WA 2PDUA 4AX6A 1EOMA 3VE9A 4OOUA 1A3HA 4GO8A 4P7LA 4L80A 3RXZA 4LU0A 3A5VA 4JTIA 1B54A 1KBKA 3DC0A 4HPXA 1C93A 2BB0A 2UY3A 2VFFA 4JIHA 3CPRA 1RK5A 1BWVA 3P74A 1LT8A 2OQLA 5A69A 3A3XA 2EKCA 5F7UA 3BOFA 1JFXA 1U30A 1ZCCA 3LN3A 3TKFA 3IV8A 3QQWA 3PJTA 3KAOA 1DTNA 1CCWB 1D8WA 1FCQA 1LRQA 2CKSA 3L21A 1ISXA 2DFAA 2ZWYA 1ITUA 5AOUA 1PTDA 1T40A 1XSKA 2Y7DA 3FA5A 4YLWA 4R27A 3N34A 2QCMA 3QPZA 2XN2A 2WJZA 3N18A 4F0RA 1W31A 2IQTA 1ONRA 4K1WA 2VUYA 4HSNA 3LCWA 4AD4A 3BCDA 4M7TA 2FJKA 1TV8A 2D2OA 3T7VA 4MUZA 3E2SA 1R30A 2GJNA 2GJRA 4UNIA 3GIPA 1HVXA 1KM2A 3LG3A 4YJ5A 3H2NA 1SZEA 3QOMA 4JL1A 5KTLA 2CWNA 4JFSA 1VBRA 2CKRA 1ODZA 4PB3A 5T91A 4HBKA 2PDPA 4UTLA 3R4IA 2GVLA 3ATZA 7A3HA 3P82A 4EPBC 3GD6A 5I02A 2DH3A 3VFCA 1QOQA 4D6IA 2O4MA 4MIMA 1F3XA 3L4VA 2WZHA 1E0TA 1QW9A 2G3MA 2QV5A 4NI3A 4RNIA 4WKAA 4M6UA 2Z1VA 4ORIA 3CZKA 4AX7A 1V7AA 1TO3A 3QGKC 4J27A 1Y0EA 5JBFA 2FHFA 2I1OA 4RNFA 3T07A 4GCXA 5A3HA 2WM1A 3OZOA 4E8DA 1UA7A 4ZO9A 3GH5A 2CETA 1XYMA 3SY1A 1GK8A 3W25A 4RX0A 4F2BA 3WJXA 3BZJA 1TSIA 2ZUSA 4AYGA 2YDQA 1YNPA 2QAFA 2CPUA 3QHOA 4EF9A 2NLIA 2PURA 3C6CA 2NT0A 4W7WA 1VFFA 1L6YA 1AL8A 5XIMA 4PFHA 4ZOCA 2PUZA 4QEEA 3CZEA 3UZZA 1VP5A 1LBLA 3K30A 4GJJA 4KCUA 2X41A 1OFQA 3KRZA 3WD1A 4NSBA 1UP0A 2WVVA 1PV8A 3FX4A 3WQOA 1UP3A 4HK7A 4B3KA 5FD0A 1Z41A 3QW4B 4TVDA 4DYKA 4HZ6A 2CWXA 3BANA 2JGYA 1HGWA 4ZOEA 1HW6A 1FWDC 2DZUA 4K38A 1VIZA 3UJEA 3MSDA 3WLNA 1JDCA 2G37A 3WLSA 5CLWA 3G5EA 2VELA 2OG9A 5A8OA 2B7NA 2HV5A 2VX5A 4MPQA 3W7KA 3GAYA 2YFNA 3EDEA 5FAJA 4W9TA 3UWYA 1GNXA 2VVNA 3ARXA 1SFLA 3HIJA 3C8FA 1IWAA 2X1RA 1PPIA 1SZNA 2J7CA 2E5DA 4J3TA 2OYLA 3PZOA 1KV8A 4H9YA 3TFCA 2XM1A 1TA3A 3L4WA 4RNHA 1VBHA 3TUUA 3C3UA 4UTKA 3UBPC 4JL2A 2Z1SA 4XAGA 4Q7NA 4X61A 4DBDA 1E72M 3L4TA 3IIXA 1O66A 4JEJA 1HO1A 2ALDA 4WDXA 3CL6A 2WZTA 4RE2A 5REQB 2I5QA 4J3VA 3M41A 3MV11 3IRSA 2E6FA 1KLYA 5LNRA 1SFTA 4IPIA 3S2NA 2PGEA 4ICMA 1DE6A 4O13A 4A2RA 3GG8A 4CUCA 3M0IA 4IHCA 4IMDA 3F4WA 2DSUA 1EJSC 2I56A 1W1YA 3VIMA 1IGSA 1P5BA 1XLCA 1UIOA 1UMYA 2WVTA 5CGTA 4JFUA 3GDTA 3EXRA 3CASA 4U5IA 3WLRA 3PBWA 3SURA 4YYCA 4FNUA 5ABFB 4JGDA 2YOCA 3VIOA 1JCJA 1HO4A 3VAVA 3M46A 1R3VA 1TPWA 3TV8A 2NQJA 3GDBA 3R89A 1ZBWA 3KRBA 2PI6A 3ZIZA 4NAFB 1MRAA 2E8ZA 1UYQA 3FYOA 1L9WA 3G1RA 2CZVA 3S1GA 2HVOA 2NV2A 3M0MA 4ONVA 2GGHA 2E0PA 2UZ9A 3LPFA 2AKZA 1VFUA 3WUGA 2R9RA 5HA7A 1XF0A 3SN4A 4B3ZA 1OGSA 4QROA 3O0KA 2L5HA 4NY2A 3LV6A 4FXFA 3F2DA 1OABA 3BW2A 2XIQA 4AC7C 1SO6A 2FMOA 4GYKA 2QDGA 3L5MA 8A3HA 4UQBA 4P8XA 4DJDC 4HU0A 1EUNA 1GGOA 2W66A 3WENA 4X3ZA 2WHJA 3S83A 1K03A 4IP5A 3L5LA 1OX4B 4KEMA 1UR0A 1XUZA 2UWFA 3FGCA 1RSCA 3AAMA 4GACA 1JAEA 2TPSA 1QASA 1XIMA 2AQVA 1FKWA 1GUVA 3RLHA 1VKFA 3LU2A 1WDDA 2XN0A 4IPJA 3WX7A 2E77A 2WSRA 4GISA 1XL9A 1WKDA 2PTYA 2WCAA 5LGXA 1JZ3A 2I17A 3NPUA 1JVNA 4JHZA 2OT1A 1O6IA 5I3HA 2WPBA 4JFVA 4YVPA 2BV9A 4H9MA 1X1NA 4KFPA 3G1VA 2ATSA 3BICA 5FKYA 1LOSA 2J6VA 1MXGA 5AY7A 4JR5A 1XG4A 4GUIA 3S5ZA 3VDAA 4Q6XA 4GKTA 2WQPA 2V82A 5HATA 3S6OA 3MP3A 3DXIA 3MMUA 4KBXA 2YYUA 4PBGA 3FHAA 4GNJA 3MJYA 5J04A 4QQ3A 2WOQA 3S6TA 1MWOA 1XR2A 2H3BA 4RDWA 1B5TA 4XBKA 4I90A 2GVYA 1OJXA 1OQFA 3QR3A 1NDYA 1PS9A 2W67A 2PODA 2QR6A 1OD8A 2BY1A 4N9BA 4OJYA 1FHUA 1OYBA 3HTWA 4N7QA 1SVDA 4J3WA 1H5VA 3W9ZA 1Q45A 1BYCA 1XSIA 3MUAA 3NJ3A 2VEMA 1KBJA 2WSQA 1AUSL 2V3DA 3R0KA 4FOJA 4L56A 3C56A 3RGTA 1SYTA 3NGFA 5KZ6A 1O5QA 1SZFA 3S5YA 3BOLA 3DDMA 1DHKA 5DMLA 3ABZA 3QZ6A 3NL6A 2CBUA 3NDOA 1UC4A 1TKKA 1A0CA 3D6NA 3ZZ1A 3L0KA 4EP8C 4IIGA 4AFYA 1BG9A 3SCQA 4KRUA 4GYPA 5A2CA 4LTSA 2Y5SA 1C8XA 1TTPA 3OU8A 3WK2A 1CLKA 1RP9A 4JQ4A 3R13A 3KCLA 5G4WA 1RXOB 3NDZA 1K8CA 5I23A 4ZFCA 2H3DA 1F76A 1CGYA 2O9TA 2PBOA 2YXOA 3EWWA 4H2CA 5DMYA 5HANA 4FOUA 3WNPA 2I16A 2YW4A 3CAVA 1NP0A 1WZKA 1W9VA 2UBPC 3Q67A 3ABXA 4Z2GA 1HQTA 1KFWA 1RCXB 1MUMA 1QU4A 3SQLA 2OO6A 3DAQA 2OFJA 4W8BA 4CNOA 1UZDA 3E6EA 3QV6A 3NVTA 5M5DA 2YCIX 1X39A 4AMAA 4XZNX 3TSMA 4WGXA 1CDGA 1JQVA 4D72A 4DYJA 3TQPA 1KM5A 3LOTA 4D6JA 1GQKA 3QMRA 3BAWA 3GNOA 3IIPA 5F2LA 4H01A 1SSDA 1WUEA 5D9NA 3W7IA 2BXVA 3S1VA 1F3EA 1UBPC 3WQWA 1E70M 3N19B 1PZ0A 2IQDA 3P62A 3QMTA 4D71A 1LZOA 2OYMA 4MWAD 3WLTA 3APYA 2WWCA 3CQKA 5EBUA 4LXFA 3C86A 2BZNA 4Q8OA 3TAOA 1W3KA 2CLLA 2DDXA 1RZMA 1Q6CA 4UOJA 3KXQA 3OODA 3ZVHA 1R9XA 2FKPA 2GGIA 1LRTA 4X9SA 1R85A 3AMCA 3TTEA 5AB3A 1GKRA 2J8GA 2VGFA 4PCPA 1DKWA 1W1A1 3EGJA 3B8WA 2CXGA 3PSVA 2BP1A 1LLZA 2V2DA 3W71A 4BQ3A 1QNRA 4J2MA 1F8IA 3TA6A 4DWSD 1BRLA 6A3HA 2V30A 2VX4A 1VHCA 4FNQA 2VRQA 1N2VA 4UTTA 2CLOA 5C8BB 1BWLA 4Z2KA 4HZMA 4L4PA 1ZLPA 1XIFA 4REQB 3EEZA 4O15A 2ZXQA 1G01A 3ITLA 3NA8A 4KRTA 2X1SA 3UZJA 4QNEA 3MZNA 2VDGA 3FVMA 1U83A 2PDWA 1S5TA 2BOGX 2W62A 3L0GA 4AVFA 2VHLA 3W53A 2J47A 4LUSA 3T6CA 1R3RA 1ZS2A 1YW1A 1TFVA 2WLZA 3VTRA 1CXEA 1DXEA 5C0QA 2ZRWA 4Y2WA 4YVXA 4QITA 1FCBA 3S42A 1B4EA 4ATWA 3HPSA 4JTTA 3NYZA 3RCYA 3PZMA 3B3DA 5GNYA 2VC6A 3SGGA 2PLKA 2A4AA 3VOJA 1ONWA 3EWYA 1KTNA 3CWNA 5E9XA 3W7JA 2ZUTA 2FYMA 1ZP4A 4DXVA 4FI4A 5LA1A 4YCPA 4ICNA 3B0YA 3S9ZA 1JGMA 2NSXA 1NWTA 3WELA 1K9TA 3WQ8A 3PFMA 3E96A 1W1PA 1L8PA 3RLGA 5E0KA 4B5UA 1AZ1A 2VX7A 3ORWA 2ZZ7A 2OQHA 5E0FA 2E9LA 3C3NA 3N6JA 3R25A 3WFZA 2XGZA 3I6EA 2ZDRA 4RW5A 2VQTA 3RX4A 1ZHAA 2YYTA 3HZ3A 3K8LA 4FLOA 1S2WA 3CB8A 1KRCC 1RK6A 1US0A 1A80A 3R0UA 1S1RA 5A8QA 5J8LA 3MJMA 5AVNA 3NM1A 1FDYA 4W5ZA 1FH8A 3WBXA 2DU2A 3HPAA 1C7SA 1GVOA 5LIXX 3K5XA 2PZNA 1KTBA 1XIEA 2P53A 3P84A 4FMVA 4PRRA 1MQPA 4S38A 2VCAA 1E4LA 3ISIX 3AJ7A 3O6YX 4IFRA 3LEPA 1A5AA 3PF3A 2X09A 2YZRA 3QJAA 1FRBA 4C6BA 4X2RA 5BMXA 2J77A 4XKYA 3MUZ1 1PSCA 4GY7A 4Q4RA 3NPXA 5FEPA 3LPGA 3AMGA 4JTGA 4WUIA 2PDMA 1ZFJA 3VNKA 2QDHA 5CZSA 4TVUA 3HB9A 5BWFA 3UWVA 2FZMA 1EBHA 4E4PA 3LI0A 1GYLA 1AQFA 2INFA 3P5YA 1ENUA 1QPKA 3THCA 3WLPA 2Z1KA 4O54A 4E5TA 1E56A 1FWGC 3HPFA 4FXSA 4UR9A 3ECQA 2Y63A 1ZALA 1VD6A 4WKHA 2Z6IA 3UNDA 3NYDA 4ZA0A 3C0JA 5E6YA 2J88A 3RILA 4TX9A 3UY8A 3E38A 3W83A 4D8AA 2BXZA 3N2TA 3GH4A 1MW1A 3VNZA 3G24A 4GUFA 1C92A 3F7JA 3SI9A 3LHUA 1Q7MA 3PM6A 4G1NA 1ITCA 1RQEA 1EJRC 3LA4A 2F8QA 2XYLA 5E0CA 4I8YA 4K39A 2QUTA 4F8XA 3G8RA 4JQ1A 4QFUA 4QHRA 2GQ8A 4XAZA 2EG7A 1R86A 4KMQA 1EXBA 3VU2A 5DRCA 4S3JA 3I65A 3ARUA 4QGCA 2XSBA 3DFOA 1GT8A 1HNYA 1CIUA 4DPQA 4XD5A 4PCSA 2C15A 3AMLA 3H24A 3MMDA 4FF5A 3I6RA 4HYRA 3MU7A 3NZPA 4B5VA 3B40A 2W79A 1C8YA 3TYDA 4AWEA 1O5KA 3TJXA 1G4EA 3W28A 1ME9A 5CBIA 3QRHA 4K68A 4U28A 5HMSA 5GQBA 1VHNA 3LERA 4GI9A 1M7XA 4NZCA 5JQ9A 2HVMA 1RQHA 4PMDA 4IIHA 3GW0A 2ZBTA 1S38A 3VYLA 3HM7A 2ONEA 4RZ6A 2RKXA 3T4WA 4S3FA 1K9FA 3QVQA 5LNUA 4AY8A 3DECA 4CNUA 1OK4A 1NELA 1XBZA 4C6JA 5I07A 5F4WA 1LP6A 1ZGDA 4UXDA 2X2GA 1KCXA 3RPTA 2CERA 1IZJA 3MY9A 4AXNA 2ACSA 5I7GA 4JN7A 4DJEA 1Z44A 3UJRA 4D8LA 1B3WA 2PDNA 4KRZA 1YEYA 4MNKA 2EEXA 4FHAA 1V08A 5LZLA 3AOFA 5BCAA 1T5AA 1E0XA 4O12A 3MO7A 2HE8A 3GDRA 4ZSUA 2YBTA 4YTSA 2X30A 1EEPA 3IK2A 2J7FA 3WBEA 3H2AA 1D3CA 5C2XA 3OTRA 5CGQA 1W3JA 4L1WA 2QVHA 2X40A 3VD9A 3VM5A 3EX1A 4US5A 4QISA 3P8JA 4JTAA 1YBQB 3PTQA 3M0YA 2WVSA 3R94A 3RIKA 4U5KA 5CZTA 1FP8A 2ZRVA 1MEHA 1PZ2A 3PVFA 1A5OC 2VC5A 2WKLA 4CD5A 4TOQA 1BYAA 2OR2A 1UW9A 4PEEA 4H6RA 5D04C 1AFSA 3VNMA 2GFTA 4YHEA 1PTAA 1S2UA 4I8DA 4UMAA 1TV2A 4BA0A 3S8HA 1RR2A 3E5BA 2WZMA 2QJGA 2A7PA 4HTYA 1EJTC 2PDXA 3LPPA 5F2MA 1P0DA 4XD4A 3V18A 1PIIA 3WF2A 4J1OA 3W6YA 4E0CA 4F0HA 4IG2A 1F4AA 4KWUA 1REQB 2FVMA 3UA4A 4IX2A 4Q32A 4AHQA 2HZGA 4F48A 4U33A 1X96A 3QLDA 4C6NA 1UBSA 2BVWA 4KCWA 4O53A 4IJCA 2XIJA 1BSLA 2V5DA 2QPSA 2I9EA 3H2EA 2ANUA 1YNQA 4HMNA 1GPWA 1FTXA 1H7PA 4WRHA 4PMQA 1K7FA 1YYAA 4E2BA 2QGHA 2PWHA 3IGHX 1E0WA 3U3HA 2IW0A 2PZ0A 2Y8VA 4M24A 2Y7EA 4WDTA 1VPQA 1PTGA 1NOWA 3CNYA 1WQ5A 4P7RA 1JPDX 1KC7A 2GWGA 3OLGA 4R7JA 4O11A 3GFXA 1EC8A 4CN4A 1WBHA 5K4XA 2YL9A 4C91A 1KXTA 1EQCA 4JYEA 3RM4A 1TG7A 3T0BA 4LEQA 2YCKX 3K13A 5CG0A 3WF4A 4U2ZA 2G50A 3W2UA 3WUEA 1UKTA 1H7XA 5BXRA 1EJVC 2HS6A 5IHRA 3N4AA 5BWAA 2C91A 5H6HA 2G4JA 3DI1A 4I9JA 2X0HA 3KLLA 4UZSA 1VF8A 3GNXA 2H9AA 1Z89A 3IJLA 3VNLA 2O0TA 5LKYA 4YS1A 4AWTA 2OZ8A 1R47A 1RH9A 3H8AA 3L2IA 3NQ8A 5LIYX 1X1OA 1YTEA 4AZ7A 4CNTA 2NVAA 3W7GA 2D69A 6PTDA 2V38A 1M7OA 5EU9A 1XJBA 3SZ8A 1PX8A 2YXGA 3W2KA 3W88A 4JTFA 1B9ZA 4FP1A 2XIOA 3H7RA 1SMAA 4PEKA 5H2ZA 4B2DA 4ES4A 3A9BA 1RVGA 3B05A 4XKMA 2OWWA 4BEQA 1N8FA 2OT0A 2DIKA 3GYCA 1A50A 3LGGA 2OODA 1S1PA 3B4UA 4GXPA 3W1QA 1E9YB 3E9AA 1QI2A 2CZFA 2ZXBA 3OIXA 4WVXA 4O1CA 1R6WA 1UKOA 1DJQA 2PP1A 3SCNA 1V6UA 1FWRA 2FTYA 3K4WA 4PL1A 1KFBA 1A49A 3HURA 1JR1A 5HDRA 4ACYA 4NNCA 2V81A 2J78A 3KCJA 3ARVA 4OECA 4WF7A 4NZ1A 4C1KA 1W3LA 4C6DA 3GTHA 3AHXA 5JMUA 3CV1A 3LCLA 1QUMA 1RAKA 3WD2A 3G2GA 1EF3A 3MDWA 3EDDA 4Y90A 4RE4A 2P8CA 4Q7BA 3MHUA 1WZAA 3GY1A 1EIXA 3BAXA 3LB0A 2ZX8A 4GXMA 1FBAA 5CSUA 1T6MA 4AD1A 1B4KA 1PCKA 4K7YA 1Q4WA 2ZZ4A 4MYXA 5A6MA 3A13A 4NJKA 2BASA 4IIDA 3KZPA 2YFOA 4C6CA 5D2WA 3CAKA 2PPGA 2FZBA 5JBDA 2ZRXA 5DO8A 2X8RA 5FSEC 1FCUA 1U2YA 1F61A 1YTKA 3VIFA 1TPVA 2B7PA 1B3VA 1XYZA 3M7SA 2J74A 4E4UA 3DKLA 4AUBA 3WNOA 5LNWA 1GORA 2VZTA 3S2MA 2QUMA 1RVKA 4RE0A 4P2VA 3DOPA 3N73A 4EXBA 1RJRA 3PUOA 5AN7A 2FIQA 2Q01A 3CQJA 1MEIA 1OC7A 3KLKA 5A8PA 1DJGA 2B7OA 3NO1A 1A3WA 1OGGA 4BS0A 4E2DA 3IAPA 3EA2A 4WJ8A 4KT2A 1BXBA 2DZVA 3MP5A 4IL2A 3W85A 3A3HA 2DVXA 5F4SA 3HGOA 4S23A 4B3LA 4HPNA 3CMGA 1K70A 4WIWA 5I24A 2E9BA 1NTHA 5ENLA 1CXFA 4LOCA 1NFGA 4I5XA 5A6SA 3W37A 3NFUA 3TSBA 4AEOA 3IARA 3LCFA 1VBGA 4OBSA 2QCNA 1WKFA 3EDKA 2W9MA 2NUWA 1C8QA 5CAKA 1OIMA 3OGSA 3SQMA 4Q4SA 3TONA 3PNUA 4H6QA 3C52A 3PPGA 4MUPA 5HWJA 1UR1A 2FQIA 3K4AA 4UFIA 2V69A 5CJNA 1AJ2A 3L2LA 4OGZA 1Z69A 1O1ZA 3QGVA 2HQAA 4RZ4A 4O19A 4F0KA 1HJSA 2ICSA 2VT0A 3I7RA 1Q4NX 1E9ZB 1W56A 3CEPA 3WJSA 4Z2JA 4PMZA 1H41A 1GJUA 1WXJA 4TR9A 2Z00A 1J0HA 4ICCX 4GG9A 1VRXA 1M68A 4LBUA 1P6CA 3EWZA 2CYGA 1WZMA 4NZJA 4PULA 5D9MA 1YPFA 4W8AA 1A5MC 3FVDA 4Q8VA 3IWPA 2NV9A 3VOIA 5AC7A 5A94A 1RA5A 4XO6A 3S5SA 1E55A 1AD4A 2Y7GA 2ASHA 5DFAA 1FFRA 1PWMA 1V02E 1ZCOA 1TQJA 4JX5A 1VRDA 2Z2UA 3IACA 4L7ZA 4XIMA 1QW7A 3RJXA 2YIHA 1QFEA 5REQA 1BF6A 4BI5A 1FHVA 2QJNA 3P2VA 4N6EA 1H7OA 3UXDA 1XQKA 3DFSA 1E1CB 3VIHA 5D38A 3LZ3A 1F6PA 1UKSA 1KQYA 2ABBA 2YDSA 4GQRA 3MP4A 4LAOA 4UTIA 5CQ1A 4PFMA 4S3EA 4AVNA 3WK0A 1V3HA 2NT1A 4ZXOA 3DU0A 1KD0A 5DT5A 2J7EA 3HQ1A 1FCVA 2Z29A 3W87A 2BODX 4B92A 1WB0A 5ABFA 2QJIA 3OZPA 4DBSA 1J0IA 4ENLA 1UR3M 1XDMA 3TWAA 1QR7A 1KA9F 1UR9A 4UFLA 4NAFA 1KFKA 1HL8A 4IQEA 4HOZA 1KGUA 3TNBA 1QOPA 2Z2AA 4PCFA 1KR1A 1TWIA 1DJNA 2VGIA 1DWFM 3UG4A 4QG8A 5EFFA 4TXEA 3TYBA 3N2XA 1UR2A 4P8WA 1M7JA 3BC9A 4F0LA 4QQUA 3VXGA 2PWDA 5CC6A 4RV8A 3KZSA 4K7VA 2Z7KA 1SMDA 1PEZA 2VFEA 1X7IA 2PTWA 1JAKA 4MJ2A 1XLIA 3M5YA 1X7FA 3WLQA 3B0PA 1GONA 3GQYA 4JN8A 1R9YA 3UCDA 2XH4A 3THAA 4WY0B 1BYDA 3QFEA 4AVOA 1O95A 1PYFA 2IUZA 1B90A 3TW7A 2ZE3A 1J0ZA 2ZZ5A 3B0UX 1QI0A 3SECA 1E3XA 2VMFA 1DQXA 3ONBA 1CGTA 4LH8A 1T0OA 5SWUA 1Z42A 4IT1A 4JQ3A 1JZ7A 2WBKA 3EEGA 4Q7IA 1SFJA 3UT0A 2G5WA 1T8QA 1CTNA 4FNTA 1K7EA 4HT3A 3RITA 3WF0A 3B0XA 4L1XA 2ZYFA 3H22A 4O1DA 1Q6RA 1B31A 3NZ1A 4NNAA 3CIWA 2PDYA 2G3NA 2OVLA 4F79A 3OBAA 1X6LA 3E0FA 2WB5A 3KW3A 2E1DA 4S2BA 3GHTA 4DO4A 4Z08A 3ICJA 4FALA 4EE9A 3I10A 3LBOA 3A3WA 3VKJA 3U4FA 3NEHA 2JK2A 1A3XA 1VR6A 1XGEA 2CW6A 4RK8A 5EMYA 1FWEC 2G4FA 5IFPA 3H2CA 1PXGA 1ADSA 4Z2IA 1FH7A 3MV01 2W92A 1F74A 3KBVA 3GVGA 1QAPA 4AIOA 1WDSA 4O18A 1LM1A 1E6QM 1C3FA 5K4ZA 1AH4A 2ZIDA 3WMCA 3A9IA 4R34A 4JNMA 3G8EA 3V75A 4J3SA 1MEWA 3BAJA 4CD6A 5L9FA 5FJRA 1SW7A 3QQ1A 1PDYA 4MWAC 2G97A 3WMSA 1HL2A 2XFRA 3VUSA 3NPVA 1E1FA 4JTHA 3SCWA 4DELA 3AUOA 3GKFA 4BQ2A 3G1HA 4C6OA 4JX4A 1EJUC 2ZTKA 4J3XA 3CM4A 3LMYA 3AC0A 4UMBA 3S1WA 2GYIA 5C7HA 3PSWA 3MYOA 5JUVA 2CHOA 3KTXA 1D7FA 4IIBA 3R7MA 3U9IA 4NX5A 2VP8A 2FH6A 4XZHA 3KVLA 5CSSA 1V3JA 1VYSX 4DWSC 1QO2A 1X98A 3GNDA 4LCQA 4IGNA 2Q8LA 4EWJA 4HTBA 2F6UA 3GFZA 3I7SA 1TREA 4C7DA 4DN1A 3FXGA 4QP0A 3WEZA 3IVSA 3FDKA 2VC7A 4O1BA 3HG4A 4UOZA 3OQ8A 1IT7A 3FSTA 3CAQA 4YVVA 1OWQA 4WOQA 1UQZA 2D2GA 3KCOA 1H51A 3Q45A 3B03A 4D1JA 1RLDA 3S4TA 3GKAA 3OBKA 4HA3A 2G8ZA 3USZA 1PKNA 1A5BA 4W4QA 1UD3A 3PTDA 4P7OA 3SJNA 3NOYA 2DQXA 3BOXA 4C1LA 3HG3A 4GYJA 3QHMA 4HYVA 3M0KA 1TV3A 4M19A 1NWSA 3ZLFA 3GXDA 3GNNA 4TO8A 3CXOA 4QG9A 1EWEA 3V5FA 4IPPA 3VIIA 1I2RA 3ITVA 1M01A 2DPEA 2EPKX 3QXBA 4IMEA 2PC8A 3VK5A 4K8GA 2VEGA 1JL8A 1DIKA 4GCAA 4C6LA 1JI2A 1DIEA 1KM6A 2DW7A 3WQCA 5D9PA 3W74A 3ARRA 4BQ5A 3RK8A 3URBA 3NCOA 4JCMA 1OFOA 4KEVA 3NQ2A 4M56A 3AIQA 1Q7QA 4ZR8A 4CN6A 1JIBA 1KXHA 2O9OA 1EHAA 1M5WA 4S3BA 1DJZA 3TAKA 2ISWA 3O3RA 3N13A 2PDQA 3FJ4A 3BDKA 3SQSA 2VR4A 2JF6A 1CGXA 1DJIA 2JGQA 1VENA 4REQA 4ZBCA 5G4HC 3DBNA 2VD8A 3GRIA 2Z25A 2XM2A 3BH4A 3U2ZA 1A0DA 3GU1A 4I5UA 4FF7A 2VKZG 3SN1A 3T8LA 4ORMA 4L6OA 2XH2A 3N15A 3O06A 4YWSA 4J2PA 1G0CA 3GUGA 1AH3A 5I06A 4A21A 2NWRA 4M7SA 1W8SA 2V5BA 1WXZA 1JDFA 2OB3A 3GTXA 4Z1YA 2XGBA 1MXSA 2QKFA 4PBFA 1I6NA 5GVJA 2R94A 3WH5A 3B9DA 3WUFA 2GPTA 5C70A 2VCCA 1HUVA 1VYRA 1T41A 4DVOA 4GD0A 3VIGA 3JW7A 2F6KA 3N9RA 4QE4A 3FW6A 5AHFA 4PRWA 1PKYA 1M6JA 4DB7A 2GJXB 1H49A 5M3WA 1W3NA 5IM51 1L6GA 4QAIA 2V5JA 3HQNA 4DZAA 1K8YA 1O12A 3HFYA 4FEZA 3ZVIA 3INPA 1UH2A 1ESWA 5AYXA 2Q3OA 5D2XA 4DJED 1O4UA 3TNOA 2JEPA 3F5KA 4QCFA 4NUWA 3RU8X 1Z48A 1EH9A 4L4OA 4RZ5A 4M6QA 2PDKA 1TYGA 2ZC1A 4DO7A 4NJJA 4HPGA 1IR2A 3I6TA 2ZKMX 1S5NA 3T8QA 5GNZA 4Y9NA 1P0KA 1BPLB 1WDWA 3PK7A 4K1GA 3REQB 1CZ1A 1JCXA 3RJYA 3UJ2A 3LTPA 1JDAA 3O2LA 1XRFA 1NIUA 1KO0A 4JIPA 5LNVA 2P3ZA 3CK5A 3G18A 4LBSA 3EOLA 3POCA 5AYBA 4US5D 1WDQA 1JCTA 3E2VA 4JTJA 2D3NA 3NL3A 2MNRA 1R0MA 3JUGA 2EG6A 1XI3A 4XO7A 5FJPA 2CZEA 2F84A 1CLVA 1PO9A 5D8ZA 2QGYA 1S2VA 2VTFA 3BZGA 4I7UA 3GU2A 1A5KC 1F9CA 1XCWA 4GY0A 4CU6A 1U22A 5DEZA 1Q2RA 4F0MA 5A95A 4WHBA 1GWJA 3H12A 1ZJIA 3PUDA 4PSPA 2E5BA 1I2QA 2PWVA 1N8IA 3G3MA 3PZ9A 2E28A 4L4LA 2QVNA 4UQDA 3R11A 1WO2A 3MTWA 3EMQA 4AZCB 3OW1A 1K3UA 4JFTA 4M29A 3QQ0A 1IIHA 4EAMA 1EEXA 1QO5A 4GI6A 2EKGA 5AC5A 1OCBA 4YMZA 4ZQOA 4MWAB 4LEFA 1BFNA 1J4EA 4FPSA 1W1IE 4PTXA 3N2OA 1X1ZA 4JKKA 3T2QA 3QW3A 1TPFA 1Q8JA 4PH6A 3UQNA 3TXVA 2EPNA 1P1MA 3AI0A 3P61A 2QIIA 3PBUA 3IAQA 2DVUA 4UQEA 2HVNA 1SZRA 3GX9A 4MG4A 1MI3A 4AZHA 1Y7VA 1IZKA 1KKOA 1CX9A 1J12A 8XIMA 3VD7A 1QXLA 1R3TA 4B5NA 4DWSB 2X7WA 4GUJA 5GJNA 4ZODA 4LALA 4ZENA 1F73A 4XZMX 3ARSA 3TIMA 1QVBA 3TQ0A 3DFQA 5HMDA 3GWQA 4QAWA 4YU1A 3RFAA 1SO3A 4U4MA 2RJGA 2IKGA 5F2GA 1NF0A 3NURA 2O7SA 2H90A 2FDSA 1TMQA 4QBXA 2D1ZA 2O9RA 4A05A 4R9OA 5EKYA 2QDDA 1R9ZA 1IEQA 3U0HA 3OGVA 1V6WA 5I3JA 3WDQA 3ITGA 3AS2A 3TN3A 1UASA 4C7GA 2OO0A 3UCCA 1W8GA 3HMJG 1EHNA 3GAKA 2HISA 3NQCA 4JY8A 2ACRA 3J7HA 2PB1A 3RDKA 3NR0A 5G1TA 3NZGA 1ECEA 3CIXA 3FAXA 2WSKA 1CB2A 2D73A 4PL2A 2DW6A 1AG1O 3RLUA 4O0KA 3EB4A 4MWAE 2CLHA 4JY9A 4D6EA 4IIEA 3AO0A 1JF5A 1YPIA 1VFTA 4GKLA 3Q94A 1NQKA 1L6FA 1UKPA 4LAMA 2E6AA 5AZ0A 4C6MA 4ERAA 3QKEA 4O50A 3S47A 2DVTA 3LTSA 3BK0A 3ARTA 3OA5A 4B2DD 4NYUA 4TVCA 3CTLA 3NAVA 2BWGA 3PJXA 4AC1X 1IE7C 3WQ6A 2EF9A 4FLQA 3OQEA 4D6GA 3GHSA 4L1GA 1Q7ZA 1W37A 3GG7A 2ISVA 4MPKA 3GUWA 2JKAA 3PJUA 2PD5A 2PGWA 2VR5A 1RBAA 1DOSA 1UA3A 1WOAA 4WDUA 4A8LA 3PANA 4ZO7A 2J9YA 3RR1A 1J6PA 1E43A 3DERA 3W1TA 4RXFA 1TV5A 1BWKA 3QH2A 1YBQA 2W91A 4ATLA 3JZUA 1TZZA 2HXUA 1HKKA 1UP2A 3KX6A 2G0WA 2V3GA 3O6DA 5BXPA 5LA2A 3VGHA 1QW8A 2GSHA 4Z1AA 4IQDA 1XP3A 5IBXC 4AIBA 5D2YA 1FWHC 1JEZA 1CGWA 1UD6A 3VNJA 3BLOA 4AY1A 5CPTA 3WKZA 1EBGA 3UZXA 5FIPA 2J9XA 3LV5A 2Y8UA 1E71M 3RCNA 3RYSA 1JFHA 4AF0B 3AU2A 4QR6A 1QI4A 1F3WA 1P4CA 4F0SA 1PYMA 3MZ2A 2ZRYA 1HIZA 3STFA 4QE5A 4K8EA 1VCFA 1DWIM 1TIMA 1ZQ5A 4QS6A 4GH3A 1ZB5A 3BGGA 4D8ZA 2Y24A 1GPFA 1G1YA 2KAUC 3N3TA 3AUJA 2G3JA 3UXLA 2E9MA 2VOTA 1S39A 1OINA 2WXDM 5CZKA 1HN1A 3RHGA 2BNJA 4V1XA 3QEZA 1R3WA 3TROA 2QPUA 3IJIA 3KBJA 5PTDA 2VC9A 4OFCA 3W01A 3VVGA 1TJ2A 1ICPA 5LNSA 1T7LA 1M65A 2ZRZA 1OSEA 3SIMA 3N2CA 1SJBA 3WEOA 4WY0F 3ITYA 3ITCA 3UZYA 3SFWA 2CBJA 5BRBA 1TRIA 3GU9A 5CPLA 4QDPA 3W7MA 4HHHA 3PJWA 5EMLA 5BXTA 2XFYA 3GTNA 3N14A 1H62A 2J6XA 4PTDA 2VFDA 4B4FA 1B30A 4YL2A 1TR9A 5FF3A 3C2OA 3FA3A 4GHRA 2GVJA 2ACQA 3GR7A 3QBUA 3C0LA 3MWAA 1IT0A 5DT7A 1P48A 5EMMA 2D20A 1OD0A 2R1NA 1U5JA 1UZHA 2DQWA 2DIJA 1EGMA 1FUYA 1Q66A 2YLLA 4CQCA 3VNIA 3KS6A 4WCJA 3ITOA 3PZUA 4KWOA 1UWUA 4W87A 1QK0A 3WH8A 1EL3A 1W0MA 2FH8A 4A8RA 5JH2A 3AMKA 4AU0A 2BHYA 2EO7A 3FKRA 2QPXA 2V5CA 5DX7A 2QMKA 3QY8A 3W82A 3R1ZA 3RNDA 1EDQA 1E6PA 3LBMA 4U31A 1SU5A 1WCGA 3E12A 2OWXA 2Y88A 3PG8A 4HYWA 1PIGA 1GEQA 3CPUA 3EBVA 4GVHA 2GJPA 3C0SA 3UNTA 2BVDA 3LX9A 2J79A 3SR7A 1U5HA 4UCFA 3T05A 6TIMA 1K9EA 2QZRA 3W2MA 4U10A 4CD4A 3CHDA 4U2YA 1IHIA 1QNOA 2EQDA 2QAPA 1ME7A 5A6JA 3QPEA 4AEFA 4YCOA 4RZBA 4UTWA 3WLJA 3B8VA 4HNVA 1VPXA 3L65A 5M17A 4N9EA 5HK4A 4LCSA 3F03K 4LX4A 3DFYA 3OA3A 1WXYA 1KCKA 4LVFA 2DZWA 5ECUA 3STEA 3WNNA 2F2HA 3VINA 2IXVA 2RAGA 2D2JA