4QHRA

The structure of alanine racemase from acinetobacter baumannii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
355
Chain Sequence
MRQATVYIDRQALQYNLNRVKQLAANSKIVSMVANAYGHGVKDCLAALNASDAFGVACLQEGLEIRELGFEQPVTLIEGVFSEDEMPVAIEQKFECVIHHQQQFEWLIKHKQAYIAQGLKVWVKLNSGMNRLGFKDPEIIEVIKTLKSEGFTCVLAMHFANADVDHPLNEQQKQQFLHIKETCDPILASCCNSAAIFKWPELNFDYVRPGIMLYGASPFADKTVHDLDLKPVMTFTAEIIALNHIEAGEHVGYGSTFCAQQAMDIAIVSIGYGDGYPRAYVKQNFVAIDGKLCPVVGRVSMDMIAIDVTNTQVKLGTQVELWGNHRLVDDVAEANGTIGYELLCRLSSRPVRQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Alanine racemase
publication title The structure of alanine racemase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 120
structure length 355
sequence length 356
chains with identical sequence B
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4qhrA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4qhrA02
4A3QA 1B54A 3N2OA 3E6EA 2SFPA 2PLKA 3WQEA 3WQCA 3HURA 3VABA 4LUTA 2QGHA 1D7KA 3SY1A 5FACA 3WQGA 5GJNA 3C5QA 4ECLA 1SZRA 1KO0A 4XBJA 4LUSA 1QU4A 2NVAA 4PB3A 4FS9A 1BD0A 1CT5A 2O0TA 3AWNA 5FAJA 3B8WA 4ILSA 3CO8A 3OO2A 3GWQA 4BEQA 3LLXA 3N2BA 3MT1A 5FAGA 1W8GA 3WQFA 1KNWA 1FTXA 2J66A 1VFHA 3R79A 4LUTB 2OO0A 2NV9A 3AWOA 4ZGYA 1TUFA 3NZPA 5BWAA 1TWIA 4KBXA 3BTNA 2P3EA 1NIUA 2ODOA 1F3TA 1L6GA 1XFCA 5GJMA 2YXXA 1VFSA 3B8VA 4LUYA 4PB5A 3KW3A 3WQDA 4DYJA 2VD8A 3B8UA 2PLJA 4BEUA 2DY3A 2RJHA 3NZQA 1VFTA 3N29A 4LUSB 4V15A 4DZAA 1EPVA 1RCQA 1L6FA 2VD9A 1SFTA 3UW6A 5GJPA 1NJJA 1HKWA 3CPGA 1XQLA 4PB4A 4Y2WA 3S46A 3B8TA 3HA1A 4AIBA 5IRPA 1HKVA 3ANUA 4QHRA 4BF5A 3E5PA 4BHYA 7ODCA 3ANVA 2RJGA 2ON3A 4WR3A 1XQKA 2TODA 4XG1A
chains in the Genus database with same CATH superfamily
3MJMA 2HPIA 4AD1A 3WK1A 4LVGA 1GGOA 4TX9A 1FCQA 4ZQRA 4U5KA 1AW2A 1JAKA 2XZ9A 4NG3A 3H8AA 1OFPA 4KMQA 5EMMA 3NWRA 3WLLA 1BWVA 4ZODA 3WX7A 1JZ6A 3MUAA 2DQWA 1OK4A 4JQ1A 4ZZ9A 3BLOA 1XBXA 3W7CA 3SUVA 2G3JA 5CZTA 2VNCA 4C90A 1K02A 3GY1A 1TB3A 4A3HA 3RX3A 4LAUA 3TTOA 4TOQA 4ACZA 3CLMA 1OFEA 1GVQA 1WOAA 1F4HA 4BZYA 1ONRA 2WOQA 3HF3A 1CI1A 3STGA 1FXPA 2X1RA 3TP4A 3MB9A 4MZ1A 5ENLA 2J88A 5A6TC 2HNHA 1BKSA 2E1DA 5ABHA 1XLGA 5HPOA 4XZMX 5F2GA 1WA3A 3VIHA 2AAAA 3WIJA 3PNZA 3FGCB 3WYZA 2OX1A 1NOWA 3W4RA 1E1CA 3V3WA 1PHWA 4OFCA 2X16A 4BHYA 4J3ZA 3JVAA 4ZR8A 3SM0A 2A7NA 1Q6GA 4ASTA 1H3GA 3IJDA 1EWDA 5FI8A 4LCSA 3SCNA 4LX4A 1W9VA 3G1SA 3W81A 3KOXA 2WM0A 1FKXA 3VMPA 1XHGA 3DXIA 3FYOA 4FMVA 5CC7A 1POKA 2VFFA 3BV7A 3PPHA 3W0KA 3G1YA 4MHBA 5BXSA 1OHLA 1J0JA 1XWYA 3EWDA 3GWQA 3W88A 1UASA 3LGEA 3AISA 3GNNA 2GQ9A 5CSUA 1WDDA 4UFIA 4N02A 4OIFA 2FZBA 1RCXB 3UCQA 4FNTA 3RUBL 4EF8A 2A6LA 4XAYA 4ZB0A 2NV1A 2E3ZA 2R1LA 4K6AA 1R7OA 3HJZA 4U5IA 3VNYA 5HQLA 3HQPA 3AU2A 4MWAC 2P50A 2PWGA 1X39A 5E0KA 1NOFA 2GVJA 2J62A 4WY0A 3AYTA 1CXLA 4BQ2A 4PULA 3PR2A 2O92A 3OVQA 3QLLA 4Q4SA 2GUUA 5EU9A 2J9XA 4EF9A 1UR3M 2J9YA 2E67A 1BYBA 4YVVA 1EO7A 4Q4QA 3R8RA 4F0SA 3ZLHA 8XIAA 1GTHA 3FDKA 4DX3A 3PZUA 3OOQA 4GKLA 3ZR5A 3NQVA 3REQA 4JX6A 3DAQA 3S2JA 1KWKA 1J2BA 5K9CA 2Z24A 1JFXA 3GZAA 4JQ4A 4WOQA 3KFTA 4HBKA 3F5KA 3SRDA 5LSMA 1QI5A 3TJ4A 5G2IA 3ZZ1A 4Y9PA 3KVJA 4NX0A 4REQB 5EBUA 2YYTA 4H83A 1JZ4A 1CT5A 2TPSA 3VD3A 3BLDA 1OFAA 3PFRA 1W3LA 4WJ8A 6A3HA 1J2WA 3RMJA 1DJNA 4UWMA 1UP2A 1C93A 2PLMA 1S5VA 4DIAA 1XD0A 4FPSA 2QCDA 2ZICA 5LNRA 3W7GA 3IUHA 3RLUA 2Y7DA 4DAIA 1DJXA 1TA3B 3ARQA 1CYGA 2NVCA 3BOFA 1VF8A 3UCDA 3T6CA 1VYRA 3GHRA 4E38A 4UTLA 3W76A 4IL0A 5G2HA 4A8IA 3E02A 3WUGA 3WNMA 1FWRA 2XH2A 1PIFA 4BFAA 4CNOA 3GC4A 3P14A 4YWSA 5G1YA 6CGTA 3I68A 5DEZA 2GJRA 3KEHA 4V28A 2VEMA 1TX2A 3TXZA 4ERIA 2WNNA 1FRBA 1W3IA 4TMBA 1M65A 3TTEA 3ANUA 1BEUA 2O9PA 1B4KA 1WXYA 5CSYA 4QEEA 1MXSA 5I00A 3LTYA 5LIKX 2XUCA 3NSNA 1OYAA 4G56A 5CPQA 3GW3A 1SVDA 2INFA 5T9BG 4FX6M 1UQZA 1REQB 1XKYA 3RR1A 7ENLA 4B5SA 2ISDA 1R87A 3TTSA 4ML9A 3EDEA 3N3MA 4JTEA 4YU1A 3IAQA 1KGWA 1Q85A 3M47A 1GQKA 4JN6A 5CZSA 3CHVA 2QULA 4HK7A 1XCWA 1WOBA 2PF0A 4F0KA 2V2HA 2C6QA 2YA0A 5AC7A 1RV8A 4IXHA 5JIPA 2A79A 5I78A 2OLAA 3C8NA 2QGYA 3IIZA 1C8VA 1QXLA 5BWAA 4E4FA 3UG3A 1XH0A 1DXEA 3WQOA 1G9HA 3BTNA 1XBZA 4RE3A 3VDBA 3QN3A 1Q66A 3AMDA 4ZQOA 2BOFX 2OX4A 2O7SA 2ASHA 3T07A 2DP3A 4J40A 1Q6OA 1Z89A 3ANYA 2VUYA 1GPWA 4W5ZA 5I02A 2VUNA 2CPUA 3ABQA 2CZDA 1DJIA 4LNYA 3TN6A 2CLPA 3DUGA 4X9SA 2VEIA 1V0KA 1IXOA 2GWNA 3HGRA 5JBEA 3RJYA 1GW9A 1KFEA 4MNKA 4EWND 2OQYA 3G1VA 4LYRA 3CB3A 4Q7NA 2BTMA 3TONA 3EAUA 1Q7ZA 2CBJA 3KZPA 5CGQA 4DJDD 5F1VA 1FWHC 4H8NA 4V1YA 3SCTA 1GT8A 3GX9A 7A3HA 3THDA 5GJNA 2B4GA 3KS5A 1KM5A 3VIPA 2ZXBA 1TR9A 1BYCA 3CMJA 4DO6A 3EDKA 2AKZA 4ZL1A 3KLKA 4DF1A 2W61A 1KR0A 3M0YA 3CAVA 3WDPP 3LLXA 3EOEA 4PMJA 2IKIA 3AZTA 2RAGA 2VRKA 3QY8A 1M53A 1JF5A 1VQTA 3WF1A 1C9DA 1MNSA 4N9DA 4GVHA 2J24A 3WNNA 5DMNA 4YWIA 4AZBA 4ZCWA 4B5XA 5CPLA 1ICSA 4Z42C 4W93A 1K6WA 3MTWA 3OVRA 1TE6A 1SSDA 2XFRA 3SSZA 3SY5A 3DFQA 1B3YA 4S3DA 1IYXA 3KRSA 3OZMA 3V7PA 3UZJA 2G50A 3R0UA 1LL4A 2ZDSA 3AJ7A 5BZAA 2VWTA 4CCDA 3NXLA 3WJZA 1QOPA 1BRLB 4D2JA 4J3WA 1KC7A 4C1NB 3N12A 4C60A 5CZKA 4D72A 3TMLA 1VFMA 1TV3A 3LBCA 1KR1A 4LAMA 4B9ZA 1X7IA 2OEKA 1V02E 3PTKA 5G4WA 2F2HA 3S46A 3UPMA 4N0RA 3WD3A 2GQ3A 1XXXA 2B0MA 2C71A 1KW1A 2ZIDA 1Z8AA 4HMEA 3IRDA 1UOKA 3T40A 4DJEA 1VYSX 4GQRA 2C19A 5C0QA 1Y5WA 4WDTA 2QCMA 4ACYA 2GUBA 3DFSA 2J75A 2CZEA 3PWIA 2BGQA 2BBFA 4WXYA 3UD6A 4JQ3A 1O68A 3CGTA 1W3KA 3SJNA 3VD9A 1P1MA 1UWQA 4H00A 4JTKA 1P6BA 3LD5A 1RCOB 4TO8A 5AHIA 4Q8TA 4ZOCA 4GABA 3DFNA 1N55A 4B3KA 5HJLA 3DGRA 4J28A 3WBWA 1FA2A 1GNXA 2ONEA 4GGHA 3WLPA 2VGIA 3OYXA 4TTUA 3WENA 3EWUA 4AXKA 1J18A 1OY0A 2BGSA 2YBUA 3TYEA 4BF9A 2OU4A 5M5DA 2EEXA 4MLJA 1ZZMA 2WPGA 3PNUA 5C5YA 2D22A 1W1VA 2QCNA 2A21A 2OVLA 5RUBA 2G41A 1YADA 2Y24A 3H2MA 4XD6A 3KVMA 3LOTA 3OLGA 4DF0A 4NXKA 3E9AA 4G1KA 2PWFA 1R6WA 5IBXA 3WD4A 4XZIA 3H7RA 3WQ8A 4NAEA 3UPWA 3T08A 1WKFA 4BF5A 3CEPA 3W6MA 3E5PA 1XUUA 3D3FA 3K8LA 4AD4A 3TNBA 1W3NA 3THCA 3GR8A 3PY2A 2WMFA 4HN4A 4K1GA 4GO9A 2C1HA 2EJ1A 1XLAA 4FSAA 4HZ6A 1KO0A 4UQBA 1YE6A 4Y6GA 2HXUA 3V0TA 5E5CA 1Q7QA 3PJTA 5REQA 4ZOAA 1QPRA 1N82A 4NNBA 4ZXOA 1KNWA 1VJSA 1H0GA 4NJJA 4U2ZA 4O10A 3E1F1 3MQTA 1FP9A 1IZKA 1UHVA 5F4WA 3WLRA 5XINA 3IARA 3N2TA 3H21A 4B5VA 1L0PA 1LRNA 1N8WA 4RKAA 1X7FA 4YIWA 1WKEA 4Q33A 2GQ8A 3TJIA 3GYCA 4Q4PA 5DCDA 1GKQA 1O5RA 1IGWA 3JUGA 3S83A 1OT2A 2R9RA 2Z29A 3K1GA 4HPNA 5JBFA 3MHUA 4QQ3A 2E25A 1VBUA 4X63A 4AD2A 4AZ5A 2YCLA 4D9PA 4Y7EA 3UJEA 1DTUA 4JIHA 4ACZB 2FB2A 3L4UA 1S5WA 4IGSA 4IMDA 4GIAA 5FEPA 4O0ZA 3M16A 1UIOA 4N6EA 1KBJA 2G3NA 3HV9A 4JFWA 4U2YA 4BA0A 3NQEA 1J0HA 1YW1A 3BLKA 3ANVA 3F4VA 3W53A 4IFOA 3NQ6A 4ZSUA 1MZHA 1WBJA 3IWPA 5TD4A 1VJIA 3K8MA 1PV8A 1UZ4A 2RDTA 5HNNA 1QNQA 3DGBA 1UBPC 1K70A 2D3LA 3UR2A 3P61A 4GYFA 3W25A 3D0CA 1MWOA 1SZEA 1POJA 1LLWA 3TYDA 1GVIA 3C52A 1AH3A 1VRDA 5EMKA 5H2ZA 3GRIA 2PD5A 1D7FA 2FZNA 2AQVA 2ATSA 4HYWA 2VX7A 1RA0A 1D9EA 3VIIA 2FPYA 3NZPA 2HBVA 4HKPA 4HIBA 3MU7A 1GJUA 4PBGA 1KB3A 4N6FA 4N9CA 1EGZA 1NIUA 3EXTA 5D8WA 3W24A 3DG3A 1H62A 1Q7MA 2A3CA 5FF0A 1ZLPA 3VMOA 2B7QA 2HCVA 1C91A 3B04A 2D2HA 3W7OA 4GY0A 3P5YA 5TIMA 4GJIA 2EGZA 4Q3MA 1W1IE 1DXIA 4CD6A 3SEPA 4YHEA 1FWIC 1GPFA 4GZJA 3ORWA 3W28A 1UKQA 4AY7A 3GBEA 1E6QM 4S38A 1HKWA 1SPQA 3TU9A 1GCYA 3PZNA 3HMJG 1ZAIA 2E09A 2DEPA 2CLOA 4FI4A 3N9KA 2A3BA 1HKVA 4NL1A 1JDCA 3AZRA 2GJXA 1PKMA 3MMUA 4WY0B 3DIPA 4WR3A 3GC2A 3R12A 4A2SA 4CNNA 4UQEA 4R7WA 1OIFA 1J4EA 4IXXA 5LNVA 1H5YA 3OIXA 1EGMA 2X1TA 5JH2A 1GQNA 2VX6A 3C86A 1B2YA 2YCJA 4Y8FA 1UCWA 4XAZA 3ZYZA 4DQWA 4LWWA 2IS7A 2HBXA 1F05A 1EDGA 4PTDA 3SQSA 1DOSA 2JEQA 1WAUA 2EPHA 3F2CA 1BVZA 2Z1BA 3PK7A 3REQB 1UWUA 3N25A 3P81A 4K2SA 3WBYA 2Y89A 3NQFA 2C8NA 2V3GA 5JUVA 4J2MA 3WDRA 3WQ6A 5DLCA 5I5RA 3TR9A 1JZ8A 2OTDA 9CGTA 1ICQA 4C6DA 4S3BA 1BYAA 3BMVA 3IIXA 4AISA 1KGXA 4Y90A 1OD0A 2H3BA 2DIKA 3H7UA 3UNDA 2EQDA 1RVGA 2PDPA 2WMHA 3EBVA 3P82A 4MTVA 1CW2A 2QCDB 3BLIA 4QS5A 3EWZA 1JI2A 3L66A 3R11A 1IEXA 4PSRA 1W9XA 3W86A 2WSQA 1SR0A 1FFQA 1XYFA 1Q63A 5K9DA 1IV8A 3OZYA 1OX6A 3PBWA 4C5ZA 2DQXA 3DYMA 1PXGA 1YXYA 4XBKA 4RZ6A 4JQ2A 1KXQA 4ERAA 1H2JA 3MV01 1VBJA 4BI5A 3ECQA 4M6VA 3GU9A 2WLYA 4PCSA 3DYPA 2Q3OA 3K4DA 3JRKA 2PRHA 4A3QA 4GXMA 5BU6A 4GK8A 1Q13A 2Z28A 4F9JA 1G5AA 1TRIA 1N2VA 3VABA 3VIOA 5BROA 1IHIA 4XBJA 4S3KA 3NDYA 2ESCA 3S1XA 1E9ZB 1I6NA 3SCWA 2CLIA 3SRHA 3WBXA 3OHIA 2PE4A 4DJEC 5DCEA 2JKAA 1K7EA 1PBGA 5FA5A 3EOUA 1ZJBA 2AL2B 2WCGA 3VM5A 1TUFA 4FO4A 4CN1A 1QPNA 3RM8A 1MW1A 3GM8A 1VH7A 4IIFA 2V8ZA 3H22A 4PMYA 5C9RA 1THFD 2HQAA 1QFEA 5GJMA 3AZSA 3AMLA 5A6KA 2ZX6A 3EPMA 3K4AA 1OQFA 2PTWA 4LANA 4TX8A 2DVUA 2PDLA 4HTBA 2Y7GA 3EWYA 1QPQA 4Z2KA 4I9TA 3VM7A 1E9IA 1DWFM 2XIJA 4CD7A 1SFTA 2IMRA 1DWAM 1DIKA 1GWJA 3M0KA 2W63A 4LPCA 1PKNA 3O07A 4NJKA 2XU2A 1X6NA 3M0ZA 2X0YA 4PCPA 4GC4A 3OTRA 4R53A 4H4IA 2L5HA 1OVDA 3IUIA 3WFAA 3O05A 3A3HA 2B7PA 3S5OA 5C71A 2ABBA 5I06A 4HJWA 4M80A 3T7VA 4Z1YA 3B9OA 5EBAA 3L23A 3W7IA 4FXRA 2X05A 2ACSA 1JQXA 4US5A 2DW6A 4YN5A 1UQYA 1WDRA 5H8PA 4H9XA 4PMZA 5IBXC 1ECEA 1OFQA 1RQHA 3QEZA 4I5UA 3PTMA 4V33A 2VGGA 5AC5A 3N4EA 3OLDA 1KLYA 2HXTA 3L12A 4O8RA 1D2KA 1I2NA 4XBSA 2Y61A 1IT7A 2V82A 1QCWA 2DT2A 2IUZA 5IHRA 4O1DA 1IWPA 3JS3A 4ZQCA 3FW6A 1SZNA 3OGSA 3BOLA 3O1NA 1GVEA 1UUQA 4QE1A 2ZWZA 4EXQA 3TSDA 1EH9A 1F5ZA 5IXEA 3R10A 5JXQA 1YNYA 4MIMA 1VFLA 4TVCA 1XIJA 1XRSA 4R9OA 3AYVA 1EZ2A 3G77A 3AC0A 4XX6A 3TYUA 4EANA 1WZMA 5KTLA 2C1GA 3PZOA 3THAA 1MW2A 3EA2A 5AC8A 3SCSA 2H9AA 3T2PA 1G0CA 3G6MA 1LLZA 4XVDA 1EC8A 4LGXA 4PBEA 2HMCA 2BOGX 1K7XA 1KM3A 4YLWA 3IACA 1M41A 4Q8VA 3BW2A 4FNSA 3KTSA 3ABXA 3BE7A 4WJXA 1YTKA 4XZWA 3FJLA 3W70A 3B9NA 4LAOA 2DIEA 1LM1A 2CLKA 3TE9A 1JIBA 1BTCA 1O60A 3T44A 3DFHA 1AW5A 3GIPA 3K13A 1EP1A 1FY6A 2F6XA 3U9IA 2Z6JA 1V6VA 3RYSA 1SJCA 3UY8A 1E9LA 2W5FA 3DN5A 3O0KA 4LF2A 1CXHA 2YDQA 3R79A 4EP8C 4MFDA 1FHVA 2GSHA 1E0WA 2WSYA 4Y9MA 2IQTA 1Z6KA 2DPEA 1FHUA 1HF6A 1XLHA 1NELA 4MKVA 5D03A 1GOXA 1ADOA 1TYGA 5IOBA 3I4KA 3O06A 2ODOA 5BMWA 5C9UA 4RE4A 1Q2SA 4A3UA 3W7LA 1TMHA 4L1WA 3PTQA 3B8UA 1HGYA 5I0DA 4H8UA 1XYLA 4ZO8A 1NWTA 5DXXA 4HOXA 3BDKA 1RR2A 1VBHA 1PB0A 4FLSA 4Q8UA 3U3HA 2J7CA 1JVNA 2CITA 1XV8A 2BY3A 1EC7A 2A2IA 3EGJA 3TEVA 1NWRA 1H7PA 2VT0A 2F61A 4FZIA 2FFIA 3UXAA 2J6XA 1G4PA 3IIVA 1EF3A 2ICSA 3FHAA 4O50A 3SN1A 3QQWA 3W2LA 3NQMA 3P5ZA 2WNZA 3W2MA 2OWWA 1QJWA 4FAMA 3V18A 1KKOA 2FZDA 3A3XA 4RW3A 4M8UA 2YIHA 4PUEA 3CUHA 3MT1A 2FVKA 4NUWA 3LB0A 2WMKA 1LORA 3OODA 4OU1A 2QEZA 2VHLA 4LB3A 3WBAA 3W02A 5REQB 2YB1A 2FZ8A 3M41A 4G7FA 4PTMA 4KWVA 1W9BM 2PTYA 3BG5A 3ZWSA 3L0GA 3TYAA 1V0LA 1R8LA 3QHMA 5EMLA 2QAFA 3HGOA 4IQJA 4TQTA 3W27A 3U5UA 3S2LA 1ODZA 4Q22A 1ME9A 4JDYA 4JEJA 4HK5A 2IXUA 4C6EA 3LHVA 2W4XA 1S1PA 3MS8A 1JCMP 5FF3A 1W5OA 2WVVA 3UZYA 3MYPA 4KH2A 2Q8LA 5SWUA 3CK5A 2V5DA 4E6MA 5A6SA 1ZNNA 2JALA 1JCJA 5CPMA 3W2UA 4MM1A 2V69A 1Q6EA 2V5BA 3HPZA 3SO7A 4Z1AA 4QJ4B 4HQVA 1GZGA 5JU6A 1PIGA 1P0BA 4KGLA 4JFUA 1MUWA 3CBWA 3GHSA 1S5TA 2A4AA 3WQFA 4W5UA 4XK2A 2I57A 5EB8A 2HNEA 3EX1A 1WX0A 3W9ZA 4N42A 1A50A 2XN1A 2X1SA 1MXGA 3ZJ8A 2XPKA 1E4MM 1FWGC 4E2OA 3LPOA 2OT0A 4C65A 2FTYA 2Q6ZA 1B0IA 4M1RA 4PCTA 4BEUA 3K5XA 3FYPA 1ZPTA 2VDGA 2NSOA 3THQA 3HV8A 3WDIA 4YJ5A 4O1EA 4WIWA 4UIOA 3GTIA 3B05A 4M6PA 4B5NA 2O4MA 2WHMA 3AICA 2YL8A 1JGMA 1TMQA 3C2OA 2J7GA 3V5FA 3WBEA 2A3AA 4RE2A 2PWVA 2NWSA 1AH0A 4KRUA 8RUCA 2ZA2A 3GDMA 3WNKA 4ADTA 4RL3A 2VGBA 3ARPA 2FJKA 3FY1A 4XD5A 2W27A 1GQLA 1E51A 1EGVA 3AAMA 2EHHA 3S6OA 5AYZA 4GXPA 1PTAA 1FWEC 4OBRA 1CLVA 3G0SA 4S2BA 4AEOA 2GJXB 3W01A 3SGZA 3FDGA 4ILSA 3AXKA 3EKZA 3RLGA 2XIQA 2E6FA 3UETA 4MKNA 4DJDA 1WZLA 4D6CA 1TJ2A 2DFAA 3C0LA 4CQBA 1HJXA 4B91A 4PFMA 1UD4A 3PBVA 2DIJA 4L4MA 5D9OA 1JG9A 1XDMA 2Y7EA 1ZRQA 3V4BA 3T09A 1WZKA 4BWLA 3U57A 4HCDA 1N8FA 4ZENA 1D8WA 2IKHA 1RXOB 3GU2A 4WXZA 4NZFA 3GXTA 1W17A 2CNCA 3RO6A 3FXYA 1FCBA 3GNDA 5FF2A 2RDXA 3W7MA 1F6YA 3APTA 2B7NA 4LNCA 4W8AA 1CENA 1KBLA 3W7NA 5LNUA 3D5HA 4HGXA 4CD4A 1HKIA 4J4KA 3M6YA 1P7TA 3WLHA 3ME3A 1WO2A 3MI6A 1HGWA 3CZGA 3TXVA 3DI1A 3SCOA 3I6TA 1X6LA 4CQ9A 5HOSA 3SFKA 2GK1A 5A6BA 3KOWA 2W3ZA 3MUZ1 2ZZ3A 4P5UA 1C3FA 4Q4RA 3ARWA 3NDZA 2F9RA 3APYA 4HNLA 4JTFA 3S8HA 5CSRA 1QNRA 5I3GA 4X2PA 1LUCB 4FXFA 5ECUA 4AFYA 4PR4A 1V3MA 2QDEA 2D20A 3POHA 2JBMA 3I6RA 1SM9A 4DY1A 3CB8A 4O1BA 5EKYA 3F2BA 4AX6A 3VZXA 4LEQA 4AZCB 4DBWA 2PDMA 5BRPA 3BZGA 3V75A 3H2CA 4M0XA 3VC5A 3IGUA 2P3EA 4J7RA 4B92A 1V02A 1PDYA 3ITVA 1LF1A 1I60A 2Y63A 3UWWA 2CC0A 4GZ7A 4MDPA 3AIVA 4RPPA 3T81A 4N2YA 3LS9A 4BF7A 3SIMA 4HA3A 4FHAA 3AXHA 3LI1A 1KFCA 2HS6A 3KX6A 2FMNA 4MUPA 3GHTA 3VK5A 4M7SA 1EC9A 1V08A 1F73A 3ITLA 4B3ZA 3R8GA 2BVWA 1Q8AA 3HQOA 1ADSA 2ZCGA 2NSXA 4WHBA 3HMCA 4KRTA 1W91A 3AS2A 4C6MA 2HJPA 1Q8JA 1W8SA 3O6CA 2PPGA 3TAKA 4L6DA 3N11A 2OJPA 2GVYA 5A8MA 4JCMA 1Q6RA 3NNTA 5FL1A 5DELA 4MYXA 3NL5A 2GOKA 2NX9A 5T8GA 3UZZA 2DZPA 3GDKA 1Z32X 3KOZA 4WDXA 1LRTA 4JX4A 1TELA 1R3VA 2JFEX 4LB4A 3SDOA 1G6CA 4HU4A 2QDGA 3BICA 1RZMA 1CGWA 3OO2A 3CWNA 3N2BA 4DWDA 5C2GA 3S5SA 3VI2A 5A6MA 4WKFA 3OJGA 4NASA 1OCQA 3M5ZA 1A5SA 5D9PA 3C2YA 4QCFA 3UGRA 3ZVIA 1H49A 2TSYA 3ABOA 4IJRA 2WM1A 1XKJA 2A85A 3OU8A 1JUBA 3NQ8A 1DBTA 1TWSA 1Q6FA 2FYMA 3E5BA 1LT7A 1V3KA 2ZE3A 4XUYA 4PTWA 7TAAA 2A3LA 3WDHA 3LYEA 2X30A 3ZJ6A 4R27A 2XIBA 3IK4A 4IH3A 4V15A 2WJZA 3GG0A 4F48A 3W7HA 2BMBA 1KM6A 4KEVA 1H51A 2ZX5A 1U5VA 4RV3A 1HX0A 4LS1A 4B9YA 4LVDA 3LCFA 2HK1A 1YDOA 5CBIA 1ZALA 1GHRA 1RK6A 1DJYA 4H7ZA 1P0EA 1OX5A 3M07A 2HPMA 1OC6A 3R0KA 5F7UA 2CWXA 6ALDA 2O7QA 4CNPA 2H9AB 4LV9A 4MVAA 4EE9A 4B5TA 5D09A 2XN0A 5ABFB 4AY8A 1U22A 1G4SA 3KWXA 1GOKA 4IX2A 4JN8A 4M6QA 5DBUA 1QW8A 4E4UA 1PVNA 4MMWA 2RDUA 2RHGA 3TROA 3NPWA 5J5DA 5FAGA 1QOQA 2V5KA 3XIMA 3II1A 3RILA 4DVOA 3KOFA 4LF1A 5HR6A 4YVXA 2VX4A 1B90A 3IGSA 1EXBA 2WANA 4GLEA 2QUVA 2OYMA 4DWSA 1XYMA 4IJCA 3WLMA 2Z27A 2JIWA 4XZ9A 4RW5A 2VFEA 4UUIA 1VFSA 5ABEA 1MW0A 3L2MA 1UH4A 4KWSA 1TJPA 3N13A 1TIMA 3W22A 1S2WA 4Q8QA 3B8DA 1V8EA 1KM0A 2EG6A 1I2OA 3IPWA 3ARZA 1WV2A 4PGLA 2H8ZA 3QKEA 2Z25A 5C7VA 1RQEA 3TFCA 1V93A 4MLRA 3AJXA 3BH4A 3A4AA 4UTFA 1YDVA 3VTRA 2EKGA 5CAKA 3GW0A 1KCLA 3VIGA 4A6GA 4O13A 1YQ2A 3AYRA 3W71A 3ZJ7A 1B5TA 1WUFA 4Q8MA 4CQAA 1KXHA 3VZYA 1ZUAX 1SZFA 3W1MA 4IPNB 3CNYA 4WDWA 1E0VA 1VHCA 5AYBA 1M7JA 2AOSA 5D8ZA 1YPFA 3SRFA 1WKYA 3MCNA 3T78A 3U2OA 4ADSA 1TPWA 1AH4A 1L8NA 4ZFMA 3BAXA 4MZ8A 1QOXA 1VGAA 1ZSXA 3ICJA 4FNRA 8TIMA 4Z2JA 4S3EA 1W2VA 1S2VA 5HQEA 5F4SA 2ZZ5A 4QDPA 4JTLA 1PX8A 2DZUA 4FALA 2GL5A 4JTCA 1YNPA 1QR7A 3IK2A 2R82A 3B06A 4HHMA 4JNZA 3GNOA 4LRSA 4QXIA 1MYRA 2ZVRA 4DJDC 1XGEA 3STFA 2F7FA 1C90A 4Z2IA 2OB3A 1YBQA 3L4XA 1OF8A 4PUNA 1VPYA 1IIHA 2PI6A 3N1AA 1XLEA 3WF4A 1GVOA 1NJJA 5I3KA 4V2XA 3ZM8A 5DRIA 2QVNA 4BWLC 4GVGA 1VFUA 1LQAA 1JZ7A 1I2QA 4KS0A 3NQ2A 2Y88A 3CQKA 4WQ6A 2FB3A 3DKJA 4ZO6A 4UCFA 2DUAA 3AHZA 3URBA 3VIJA 4KKXA 4XKYA 5HATA 1AZ1A 3G3DA 4FS9A 1E6ZA 3BARA 2WVVB 2XGIA 2XVNA 1QT1A 4JFVA 1SO6A 4S3JA 1XG3A 1NQKA 4I6KA 1SYTA 1CCWB 4ZB5A 4F79A 2QT3A 2Z00A 4HMDA 4AMCA 2FGBA 4NZ4A 2QV4A 3TH6A 3WD0A 2X7VA 3T0TA 1LCOA 4YHGA 2DZAA 5BNKA 3PPFA 3VGHA 2JF6A 2OYKA 4HOWA 3R0DA 1QNSA 3RCNA 4JAWA 3W1QA 4RZBA 4MJ4A 1IZCA 2D73A 3ARVA 3E2VA 5EA9A 5E1QA 2VWSA 4HA1A 4UR8A 4HTYA 3M1ZA 2Q71A 3K8KA 3A64A 4QR6A 1LWHA 5BOOA 2YZRA 2VZVA 3R43A 2X0SA 5FEZA 5PTDA 3A12A 3QRHA 1W3HA 1EB3A 3NFUA 1CLKA 4XIMA 5DT5A 1W1A1 4PMUA 4PTVA 5FJPA 3AXMA 2OGYA 1M7OA 4WKAA 3LSCA 2F6KA 4LVBA 3MSYA 4FXSA 1MQQA 3KM8A 5A8PA 1W31A 1QI2A 1VCFA 2VR4A 4H7CA 1K4GA 4N4PA 2SFPA 1XH2A 4S23A 3DHUA 1VLWA 4O52A 5I23A 4BY3A 4EVZA 4ECLA 2WZHA 3RIKA 4LUSA 4O4WA 2DSUA 3VNZA 2WAGA 3ZIZA 2WMIB 2D0GA 5DT7A 2BHYA 1R38A 1P5BA 3URNA 3WSUA 3RLVA 4QCEA 2TAAA 2ACUA 3MW7A 1FWDC 3BAYA 4C1LA 2GDVA 1MUCA 4JL2A 3VD5A 3S9IA 2Y85A 4PRRA 1BPLB 2OT1A 3CV1A 3IV8A 3CV7A 2WPBA 3WQDA 4MDOA 3N4FA 2YGYA 4QX4A 3OBAA 1XIGA 5E09A 4AC1X 2QVHA 3F1QA 1FWTA 3G18A 3VFCA 2W0UA 1PZ0A 2OOGA 5C6MA 2W67A 1M5WA 2Y62A 1NWUA 3EMQA 3KBVA 4X3ZA 3CJPA 3CTTA 1SJAA 2CZVA 3PULA 3VILA 3OW1A 2PWEA 2PDBA 3DX5A 2XVPA 3RPDA 1IIGA 4JHOA 4WEVX 4JTDA 1JUEA 3EPNA 3EDJA 3C2EA 4OGZA 2JKPA 3ZSSA 3VOHA 3B0YA 4PUMA 1I1XA 1QWKA 1YTEA 2ZUWA 3ONCA 5FSDC 3KL3A 5GPRA 1YYAA 2C16A 1R86A 3FGCA 4AZGA 3GG1A 5KZEA 4ENLA 3DKLA 4OE7A 2OO0A 3EZ4A 1BSLA 4ZE4A 2MUCA 3WEOA 4DPQA 2D0HA 2ZX7A 1EJ7L 3IGHX 4HB7A 1P48A 1PYMA 5HWNA 3UY7A 3POCA 4DNHA 1JD7A 2BOEX 1VR6A 2FDSA 2GOUA 2OELA 3H2AA 3LV6A 1FDYA 1A0CA 3N29A 4C6LA 3R4IA 4JX5A 4DBSA 1DJWA 5AYIA 5EYWA 2JK2A 1J0KA 4HCLA 1A0DA 1EXPA 3VCCA 4URIA 2VRQA 1Z48A 4AIUA 4DO5A 3N34A 4GKTA 4B3LA 3KBNA 4CNUA 4PB4A 4C6CA 4EX4A 3FEQA 3FXGA 1OYBA 4L61A 2OQLA 3W26A 1FHLA 2WSRA 4C6PA 4DZHA 2W79A 4MAZA 4Q4OA 1CDGA 1XUZA 2R1NA 3FEMA 1PKLA 3JZUA 1F9CA 5E0FA 3SCRA 2F8QA 4KEUA 1AJZA 1Q4WA 1DE5A 2GGEA 1C8YA 4P8UA 4EPEC 3KE0A 3MO4A 2OGJA 3EMCA 1GOMA 1ITQA 1UR8A 4QJ3B 1B9BA 3P2VA 3Q67A 3VD7A 3VPLA 4AVNA 1XI3A 3WJYA 2EBNA 1S3TC 4ZGYA 1PZ1A 3WJXA 2YOCA 5H1WA 3VX1A 2C1IA 3H70A 1YKWA 3KVKA 3IJ9A 3HO8A 4DJFD 4UQAA 1F3WA 2HVMA 3L4YA 1TVNA 2VVNA 4RXFA 4NF7A 3ARYA 3GFYA 1PPIA 3ES8A 4QLKA 3UXKA 1BQCA 1ENUA 3QYSA 3BCJA 3ITGA 4LOCA 4W8BA 1TPUA 4IQDA 2C0AA 1JYWA 1J0YA 3H2EA 3AFBA 3NVTA 4M24A 1EEXA 4PUJA 1P1XA 3LGDA 5BOFA 3R89A 2CHNA 2JE8A 1TA3A 3SUUA 3CU2A 1I2RA 1XH1A 1V6XA 4WOZA 1GJPA 3TUUA 1VEOA 1XJBA 3C0JA 2V3FA 4FK9A 2XFFA 1DIDA 4GD0A 2XH4A 1NAL1 1ZBCA 1GVFA 2ZRXA 3PUEA 3NZGA 7TIMA 3GTHA 3L2LA 1LG2A 2BY1A 2DDXA 4LCQA 3QFWA 3E0FA 1AD4A 3MZ2A 1MI3A 3QZAA 5EPDA 4MG4A 1CPUA 2EXOA 1YDYA 1XLMA 2QIWA 2O9RA 4HZMA 1VENA 1S2UA 2VEFA 1MEIA 1K4HA 3DFTA 1X98A 3FA5A 5J5RA 2WKJA 4PUKA 3QJAA 2HE5A 1EZWA 2VC9A 1W5QA 3G1AA 1REQA 1BKHA 1NFGA 3ZMRA 1B31A 4IHCA 3LU2A 5AZ1A 1R85A 1EUNA 5A2AA 4H9UA 2OO6A 1HJQA 4J1OA 3AO0A 2POZA 3OZOA 2J77A 5B7YA 3B9EA 1W56A 1BVNP 3BVJA 1GTEA 2ZDRA 1ZHAA 2ADAA 5K4ZA 4TMCA 4GQQA 4W8LA 3B8TA 1V3LA 5IRPA 2I16A 3LHWA 3E3HA 1M6JA 4PSPA 1SQ7A 1QHZA 3APGA 3GVGA 3VOCA 1H41A 3TTQA 3MUY1 3CYJA 4CD8A 3CIWA 4O0QA 3UXDA 4DM2A 5LYRA 2BSLA 3BPWA 4YCOA 3PB2A 3O7UA 1FWFC 1WNOA 3STPA 4C7GA 3RCMA 3QC0A 2POTA 1PDZA 4MWAD 1ELSA 2QAPA 2NQ9A 2NXIA 1PHQA 3RCYA 2YJQA 3PBGA 3HPSA 3C61A 4IIHA 1IWAA 4G1NA 2W66A 3C3NA 9RUBA 4D6HA 1TJ0A 1X38A 3RO8A 3DENA 4OOUA 1ML1A 3A23A 4NZCA 3GG8A 1NDWA 4IMEA 1E0XA 1E0UA 4FB7A 1X97A 5AOUA 2NW0A 1CXKA 2Y5EA 4MPQA 1GKPA 7PTDA 5CLWA 1QHPA 4ZOBA 1K9TA 5D2WA 2ZZ6A 4GJJA 4L7ZA 4WSHA 5KMYA 4IMAA 1GW1A 1H61A 2Z6IA 2P3ZA 3I3EA 1MW3A 3NSMA 4DZIA 3UW6A 3LCGA 3H2FA 3U2EA 4C6FA 4IPIA 4AWSA 1L2UA 3UT0A 3TA9A 3EB3A 1KTBA 4HSNA 3KLLA 4YTQA 3BL3A 4JOMA 1YBQB 1VBRA 5DMYA 1TX0A 4H9ZA 3JU2A 4MB5A 3QVQA 2OWCA 1IZJA 4A3RA 1J5SA 1E3ZA 1QDSA 1DL3A 3P7YA 4D6EA 1JYNA 3D47A 2BNJA 4L80A 1BRLA 2ZXDA 1UWSA 3OYZA 3BJFA 4AMAA 1HL9A 3S3GA 3OVPA 5DCBA 4ZSTA 2PDIA 1XSIA 4OV9A 2QKFA 3VZZA 7CGTA 3PPCA 1FTXA 2J13A 1UC5A 1RALA 3NOYA 1O12A 4L6HA 3ENLA 1TWIA 3EWBX 5E70A 3IANA 1T41A 1W9UA 3P3BA 3H2NA 1FH9A 1H60A 2FHFA 2XTKA 1B3XA 3CC1A 1Q2RA 3VAVA 1MVYA 3RFAA 1XYZA 4GE8A 4IMCA 4D6FA 1ZBVA 3WNPA 3VYLA 4S3AA 3FFSA 5CBJA 3GDTA 2EG7A 3URAA 1Q45A 1B3WA 5DMMA 3UJ2A 1I2PA 3L7RA 2VOTA 2DT3A 3OG3A 4PFHA 2Q3RA 3UWEA 3WEMA 3VIFA 4H9TA 1H0IA 3NG3A 1TTIA 4PL1A 3QOKA 2X8RA 4YYCA 3M5YA 4UOJA 4K3ZA 3UERA 4WUIA 1S2AA 3N2MA 2ZA1A 1ZP3A 3W07A 1LBLA 1X1NA 2FPVA 2WJDA 4DBUA 5IFPA 3FJNA 4Q8OA 4KERA 2WQPA 4GJ1A 4H6EA 2FVLA 5JVLA 1LLOA 4DRSA 5FD0A 1Z41A 4BI6A 1F3XA 4UZUA 2WLZA 4LAZA 2D2JA 2WZEA 1UZ1A 3R1ZA 4IOTA 2BGNE 1RP8A 3EEZA 3PBMA 3SCVA 1TCMA 1F4AA 3WZ0E 3W1RA 1OG6A 1EDTA 2E28A 3B4YA 5E9AA 4IJBA 3NO3A 4B4FA 3M0MA 3NQBA 3TMQA 5D2XA 3NQCA 2QS8A 1NP0A 5LKYA 3B40A 4KEZA 2V6AA 4MJZA 4C6OA 4KQNA 4S3CA 1A49A 2FLIA 5I79A 3RN6A 5AFDA 1OK6A 2ZVIA 2E9MA 1SJDA 3G1DA 1RP9A 1Q5MA 1EHNA 2G8ZA 3OB8A 5D9NA 4F2UA 1ALDA 1GONA 3L0KA 4KWWA 2DJLA 3DC0A 4X0VA 3N9RA 3ZQ9A 2CCRA 1NP2A 1YHTA 3JW7A 2C14A 3HB9A 2Y5JA 4PTNA 2PWDA 1OFOA 2BG5A 1R30A 4IGHA 2DZXA 3T42A 2UY3A 4MZYA 4I9JA 1KTNA 1W5MA 3L4ZA 3WQCA 3EYPA 3E2RA 5HUPA 3VFLA 4Y96A 1CGVA 1HO1A 5AB3A 1AFSA 3W00A 3SR7A 3EX6A 3L5LA 1TPH1 1Y8BA 4S1FA 3V5CA 1BD0A 1OGGA 3WF2A 1Z9AA 4GQBA 3TZFA 1JAEA 4FX7A 3W7DA 1YE4A 2UV8G 1ITUA 1SFLA 1RY8A 3LNMA 3SY8A 4IIBA 4LYKA 1W8GA 4L9YA 3WLIA 1UMLA 4QNEA 3BANA 3WK0A 3HG5A 3A9IA 4Y9OA 1GOWA 4NYYA 1MZRA 1I9CB 3VGFA 3B3DA 1XPGA 3T55A 4JIIX 2PDYA 2FPTA 2I56A 1FBAA 3LDVA 1XC4A 1YXDA 4CQCA 1FQ0A 5AHFA 2YDAA 1JD9A 3VKJA 3UG4A 3MHGA 3TW9A 4U3AA 3N15A 4ZQPA 3ZXWA 1BXNA 4D6GA 4W89A 2E6AA 1TTPA 2PTZA 3F5LA 2J8TA 4C5YA 1UR2A 4NX5A 4B16A 3HQ1A 3LI0A 4GC3A 1BXCA 3MDWA 1ECQA 5C55A 1UKOA 1A80A 3HFYA 4GBDA 1O6IA 3VNLA 1U1UA 2I14A 1XD1A 1OM0A 3A4WA 5U4NA 2R14A 1GVYA 1UYQA 5HBFA 2BXVA 1EYEA 3SBFA 1C7TA 5E93A 2VYOA 4CCCA 4EOUA 3GK0A 1LQ0A 3CV2A 3N3TA 4HPGA 1RQBA 5BWFA 1GG0A 1T40A 4EACA 2YW4A 4TVUA 4EXAA 4GYJA 3VGDA 4GIYA 5DY2A 3KTXA 2DZSA 4JNYA 3O2LA 5A94A 1JPIA 2QDDA 5CG7A 4E2DA 2GUYA 2DSVA 1UW9A 2J7FA 2CLFA 1FWWA 3WK3A 4OVXA 3G22A 3U7BA 3DYOA 3SJ3A 4QG6A 2WMGA 4L64A 3INPA 2PRMA 1DJHA 2VVSA 3BOXA 1Q4NX 4W87A 1HP4A 5LA0A 1E6PA 1UZHA 2PWUA 1NDVA 2PP0A 1AQHA 4AHOA 1UD2A 3W3OA 2DW7A 3PSWA 5FKYA 1EF2A 1UWRA 4LXFA 2G4JA 1BXBA 3IJLA 4US6A 4D1JA 4IUGA 1I0BA 2KX9A 3KAOA 1TV4A 4J5NA 4JGDA 3P84A 2JF7A 3M5VA 5DQPA 3EOOA 1VRXA 3LPGA 3N4AA 1UH2A 3MCMA 4MY9A 2G0WA 3B8SA 4AB4A 4O4VA 2C13A 2WWDA 3LA4A 4P61A 4DB7A 3AHXA 1E43A 1OGSA 9XIMA 3UG5A 3SY1A 3KUMA 1TQXA 3C4UA 3CEUA 1PYFA 3QFEA 4RDWA 1BG4A 3SECA 5FF7A 4G5DA 2NWRA 3C2FA 3GXDA 3VU2A 4WRHA 4LU0A 5A1AA 4LBUA 5KZDA 1LL6A 3E96A 2EF9A 2PBGA 1KM1A 5EFDA 4CU7A 1SZGA 3TZNA 3GR7A 3GIYA 1N8IA 1PWMA 4XQ6A 1TJ1A 1L6GA 4NAFB 4RZ5A 1UD3A 1GHSA 2C18A 3XISA 2NQLA 3FSTA 3OIHA 5C2CA 3NOEA 2YX0A 3SIZA 4C6JA 2FVMA 3C56A 1H1ZA 5GNXA 1NU5A 4IMFA 3OLIA 1WAWA 4J2PA 5CBBA 3L67A 4GX9A 1QO2A 2AL2A 5BW6A 1EBGA 2WK2A 2QF8A 4MGGA 5DRCA 5IM51 1DWHM 3WLQA 1GEHA 3QHNA 3EX4A 2XFWA 2YR1A 2VO5A 1JR1A 5JBDA 2J8FA 1S46A 4KCUA 1XLBA 4UFHA 2WJFA 2GPTA 3KHDA 3MCOA 4C6BA 4OUEA 5HWMA 4QP0A 2XYLA 3MKCA 2UZ9A 2D2OA 3ONBA 2V67A 3VOIA 4QQUA 4AWEA 1E71M 4PYSA 3LZ3A 1AQFA 3FK4A 1U1JA 1EKOA 4MB1A 2DVXA 1BG9A 1EWEA 8A3HA 4JTRA 5LIUX 3CQHA 3ZR6A 1JPMA 4BKNA 4ICNA 5C70A 3KDOA 4E3VA 4X2RA 3PP7A 4PB5A 1GQJA 4JFTA 3GYEA 1JCLA 1H5VA 3BZJA 2IPFA 3U6WA 1VCVA 3L5MA 3MMDA 1EPVA 1GYLA 3O9NA 5EMJA 4MYAA 1VBGA 3QMSA 1EJUC 4K38A 4ZE5A 3A5FA 3NO5A 2FGLA 3TA6A 4XIAA 1M1BA 2QPSA 2NVDA 1LWIA 4IG2A 2VC7A 3RJXA 5LHFA 3DDMA 1CLXA 1CGXA 4AWTA 1R46A 1L8PA 2J47A 4E0CA 1LG1A 1JRBA 2DV0A 5G5IA 2ZUUA 1UIPA 4PZVA 3H55A 4CD5A 4Q8WA 2BWGA 3VXGA 2ZA3A 4MSSA 4JTUA 2OFJA 2YL6A 2R1KA 2PF8A 4UFLA 2NX1A 4O17A 3NJ3A 5IFTA 2XSAA 4O18A 1M9HA 1ME8A 2P76A 3T0CA 1CZ1A 4K36A 4GCAA 3PZ9A 4UMBA 4PMNA 3RAOA 1TG7A 4GBUA 2PAJA 1LYXA 3IAPA 2OLHA 3Q58A 3THUA 4DI9A 4DM1A 1T96A 3WQWA 5MKGB 4QSFA 4WX2A 5GQBA 2GDUA 4IP7A 1Y65A 1K8YA 3HN3A 3MZNA 1W2PA 3UWQA 1JPKA 1F8IA 1EBHA 1X1ZA 3HIJA 2PBOA 4R88A 1HKJA 3IS4A 1T8XA 1C7SA 4AHPA 3DFYA 4I7UA 4O11A 3HPXA 1FWJC 1TR1A 2OZTA 3S42A 5I3IA 1JDEA 1GK8A 1O1ZA 5T26A 3B4UA 3LPPA 3YPIA 1W1YA 4FA3A 1S2CA 3WH5A 1UH3A 1ZQ5A 4BJHA 1SU5A 4DZ5A 3I3DA 3G0UA 2NUXA 2WC4A 2E4TA 3TW6A 4OBSA 2X09A 2NT0A 1UA3A 3C8FA 2GVEA 5FL0A 5I3JA 6REQB 2OCZA 3NQDA 3QW3A 1HL2A 3MMWA 4P8WA 4AZIA 2QMJA 1B3OA 4ROQA 1M3UA 3H54A 3IRSA 2NLIA 2VTFA 2CERA 2R1PA 1T0OA 2C91A 4RXGA 2G3IA 3G3MA 4P7NA 4AYSA 4HZ8A 3ABZA 2NZLA 1GOOA 2C15A 2E7FA 3BW4A 1QW7A 3TAOA 1KFLA 4H9YA 1XX1A 2NUWA 3AROA 3D46A 4B4HA 1JRCA 3BW3A 4XUGA 3ARSA 4ZO7A 4ZQNA 4PC8A 4KETA 4U31A 4JY8A 1QI4A 3RPMA 2VD8A 2D0FA 1QI3A 4DUVA 4U3CA 2GJLA 4HA0A 3RHGA 5LZLA 2H3DA 2G4FA 1FH7A 2P8CA 5CGTA 3HOJA 3N14A 6TAAA 4DZAA 3P0WA 3KL5A 4PRTA 3UYCA 2XVGA 3E0VA 4DUOA 3Q65A 1J12A 2ISVA 3NIYA 3NL3A 3N73A 3SN4A 5L6UA 3LCWA 4DJFA 4W88A 3GBDA 4GZIA 4IPJA 3ES7A 3W6YA 5ABGA 3AIEA 3K30A 2WV8A 1QASA 3GTXA 1E70M 4C6IA 1IXQA 5A6LA 2Z2UA 3MBDA 1PX4A 1RHCA 1W5PA 2P88A 2R94A 2NLYA 1F76A 1A5AA 1TE1A 3WCZA 1PX3A 3LLFA 5EY5A 1KCZA 2I9UA 3MSRA 1TWWA 5LXXA 5HR7A 3SGUA 5FJOA 3G8EA 4F0MA 3STCA 4GWEA 4QG9A 1UP0A 3VA8A 1ITCA 3GS6A 2DZWA 3LXCA 4L5ZA 2VDIA 2QPXA 5AYXA 3VD4A 4C6KA 1ZY9A 1A3WA 1O7AA 4MY8A 4ICCX 3OVGA 4F0RA 3AS1A 2G5WA 2VR5A 1EJRC 1BGAA 5HK4A 1RBOB 1X8FA 1KWGA 1U33A 4AXNA 2VMFA 1XFBA 2CWNA 3PJWA 4WD0A 2AQOA 3SI9A 3I7QA 3CUIA 4QHRA 4Z08A 3W84A 1KCKA 4HNNA 4LS2A 2ZZ7A 3BAIA 5D05A 3H26A 3G1RA 1XDLA 5HJYA 1W9DM 1PZ3A 3U8GA 2H8XA 1TZ9A 3LRLA 1M01A 3V0UA 4E3TA 3LM3A 1PCKA 2CLHA 5M03A 1BF6A 4JD4A 4D6DA 1J79A 4H6RA 4W85A 5FJUA 4IFRA 3VNDA 5FAJA 4EXBA 3KP0A 1KQZA 5BCAA 5D02A 2YBTA 1EYWA 4KIRA 2DT1A 3FAWA 1UWTA 2DT0A 4XZLX 1H7WA 1G4EA 3UGVA 2WVSA 4JYFA 1SGJA 1VHNA 1H7OA 5D2YA 3T4CA 3MKKA 3W1NA 1U83A 2BV9A 3RMEA 1R9YA 4R5EA 1E4LA 2ATMA 3T05A 2AGTA 5KINA 4RCXA 1KXTA 2O4QA 2V5CA 1BSIA 4ZEPA 1IXPA 3EXSA 4NSBA 4MF4A 3FYYA 3HG2A 4N9BA 5K3VA 3PB0A 4B2DA 1AMYA 1F6PA 1AG1O 1WXJA 3HTWA 5H91A 2WVUA 4XKMA 1XLIA 2VM8A 4AVOA 1BF2A 3UA3A 1UKTA 2FHBA 5B7ZA 3SADA 1I1WA 4ZA0A 3H53A 2CKSA 3CAWA 1BAGA 2V3EA 3CL8A 3M0LA 1W3TA 4KESA 2EG8A 4AC7C 2QCGA 1MDRA 3EX3A 3UJFA 5HPCA 4M3PA 4GGBA 2VFHA 1K6AA 3GH7A 1OABA 4E4PA 1YPIA 2Y0FA 3IGXA 4R7OA 2VC5A 3AIWA 5AHEA 4GIEA 3W1XA 3TQPA 6PTDA 2A7RA 5CC5A 3GNRA 4KIEA 3KOYA 4QLLA 1OCNA 1RJPA 1E6SM 3KS6A 4JKLA 2E6YA 4LTSA 4Y9NA 4UQ9A 3FN9A 1M7XA 5E9XA 3WQPA 4G8TA 1UBSA 1XRTA 5MHBA 3M0VA 3BUVA 1NY1A 1KM4A 5LIXX 2PSNA 3IV3A 2VURA 3AMKA 1HW6A 3QY7A 4UTJA 1OSEA 4IQEA 2XG9A 5FJRA 2OKTA 4JTSA 5JH1A 4XVEA 4I90A 2V68A 3UP8A 4RPQA 4AF0B 1VP5A 1EA0A 2DY3A 3O15A 1E56A 1VFTA 2BB0A 1VCGA 3GHUA 1IT0A 1LUCA 2QJMA 1OF6A 3IIOA 2PCEA 1XIBA 2VGFA 4HMCA 2OG9A 1NF0A 2E8YA 3OP2A 3RGTA 4A05A 4Q7BA 2VJXA 1DPMA 4GIRA 2J7DA 1AL7A 4AZCA 4B90A 1R3SA 6ENLA 1FKWA 1NFPA 7ODCA 4K8GA 2RJGA 3VE9A 1AODA 3CMFA 3NPVA 4NVTA 3W83A 3FSUA 4CU8A 1XR2A 2BDQA 4LRTA 3LBMA 3QY6A 1BLIA 4CCZA 4FLRA 4PRWA 2PTXA 1F7BA 5J8LA 7REQA 4EPKA 4MAVA 5BXPA 2YFNA 1I45A 2AGKA 2QLYA 3PZMA 3CUFA 2C7FA 4HMNA 1WKDA 3RG6A 3EWWA 2HTMA 3QQ1A 3MY9A 3E12A 1XGDA 5K2ZA 2Z0IA 2RFGA 2PDFA 1RLDA 4UMCA 1ONWA 2BS9A 2C79A 1XYAA 3MP3A 4KFOA 3K2GA 1EJTC 4L1XA 3PWGA 5FJTA 1F3TA 3FKRA 2CXGA 4G2DA 1W5NA 2NUYA 3M9YA 4POCA 1OEPA 3G0XA 2QUUA 2CBIA 1W1B1 2QDHA 4ATDA 1V51A 3WH8A 4HK6A 3UVAA 6XIAA 4GNJA 1TRDA 3CMGA 1US3A 1PEZA 3UF9A 3TQKA 4G7EB 1OT1A 3ELFA 5TQLA 4JR5A 4Q32A 3S5NA 1SR9A 4XO7A 4YL2A 3TC6A 3TN3A 3M5XA 1CWYA 2NV2A 3B9DA 3ZOAA 1WQ5A 1I0DA 2PU1A 2B81A 3OA5A 1XS2A 2YA1A 4GYPA 3GFXA 3KTCA 1XW8A 3UPBA 1JULA 4F40A 1CEOA 2IPWA 4D1IA 4RV8A 5M1TA 2PP1A 3VKCA 1BWLA 2V38A 2HRWA 4LUTA 4RE0A 3GVVA 2ZUSA 3WQGA 4H8VA 4M1BA 4DJFC 4IG2B 1YDNA 4KCWA 3A6OA 5I3DA 5A8QA 1MFVA 1ITXA 4J3UA 4ZTYA 4PEEA 2QCHA 1QNPA 1S1RA 3E49A 3CT2A 4F0LA 4EKJA 1DQXA 3W2NA 4OUIA 1PIIA 2E6DA 4CVUA 3VOJA 3NSXA 5TNVA 3AIBA 1UJPA 1UA7A 1FCUA 3VE7A 1DVJA 2NQZA 3B03A 2MANA 2CETA 1V3IA 1KV5A 5ABFA 4JTJA 1AMKA 3W2KA 5D37A 1VYPX 1XGZA 3LXAA 3RM4A 1ISXA 4DBDA 2QJGA 3CASA 3BGGA 3A22A 4JFSA 3UFYA 3DCPA 2DUZA 3VOFA 2F38A 3KCLA 1V79A 3QM3A 3K1DA 3NPXA 3IJ6A 4LAKA 3SSJA 4K8HA 3M0JA 3TFXA 1D3HA 1XCFA 2X41A 3KBJA 4J3XA 1XIIA 2DUXA 4ORIA 3UU0A 1ZAJA 1J96A 1QPKA 3LHTA 4GA8A 5BRQA 3S1VA 4W7UA 2Y4SA 3CHCA 1GOIA 3M4HA 3ARUA 1TSIA 1H11A 4P7OA 4O14A 1ESWA 3QOMA 4AEEA 4NNAA 5I7GA 1D8CA 3W7JA 4HNUA 1ZJAA 3LGGA 1NWSA 2O9OA 4Q7IA 4UMAA 4JIRA 1LQ2A 3U4AA 2YCIX 3R2GA 3P80A 3MUXA 4H01A 4A35A 4JHZA 5E6YA 3DZ1A 3NEVA 2ISSA 2I7GA 5C9ZA 3VC6A 1K7FA 1ME7A 2VRJA 3LERA 4AU0A 1BFNA 2XM1A 4IM4A 3CIVA 4QGCA 4XAFA 5AY7A 2OLSA 3TX9A 3BURA 4QSHA 4IICA 3NZQA 4JHMA 3CUGA 3WJSA 2J8GA 4PCNA 1FHDA 3ZS4A 2OEJA 2OKOA 4CUCA 2CEQA 4DHGA 4X9YA 1E4NA 3ZJKA 1S5NA 1AQ0A 3CV6A 3CWHA 2BY2A 1LBFA 1JUKA 3NYZA 3MA8A 5AZ0A 4LC6A 1A3HA 4RDYA 1KFWA 1PZ2A 1HVXA 2I5IA 5H8UA 4ZQMA 3WMBA 3UR5A 3TOPA 3FA4A 4JKKA 1PSCA 3ARXA 3LCXA 2PP3A 2PLKA 1HO4A 3PG9A 3AYSA 2UBPC 3NTYA 4YYFA 4MPKA 4ZBCA 1EEPA 3LHUA 3WUEA 4TIMA 1K03A 1IT8A 2QPUA 3QV9A 3MC5A 1QBAA 1LL7A 3RRXA 4XZNX 2ZRUA 1XYBA 4H9VA 4A8NA 1PO9A 4H19A 1DE6A 4W7WA 1L6WA 3N6JA 3ZWTA 4JTAA 1SO5A 3WL1A 1DKWA 2D3NA 4A21A 4KWUA 3R5EA 4QBXA 4QNWA 2JEPA 4EAMA 3LBOA 1RBAA 3DG7A 4HU0A 1TPFA 2NQJA 8CGTA 4PODA 4NZ5A 2A1YA 2QR6A 4HHLA 3H4GA 5LGZA 3LCIA 4JCLA 4KW2A 1EX1A 9XIAA 1L6FA 1AZ2A 4AD3A 1W3JA 4ZOEA 4QRNA 3Q37A 4OTKA 4IFKB 1QBBA 5FCZA 3SRKA 3A9BA 4NP7A 1UWAA 3FJ6A 1AUSL 3PANA 2JQXA 2P0IA 5F2LA 2WSPA 3AALA 3KHJA 2GYIA 5XIMA 1I4NA 4MUZA 2KAUC 4Q8NA 4Q6JA 1VEMA 3LSBA 3MO7A 3GUGA 4LBRA 4WJEA 3CM4A 1XLLA 1XLCA 4HD5A 3TSBA 5A95A 3O8AA 4PEKA 2IKGA 2Q02A 4TUFA 4QISA 1JZ5A 4FLQA 1AQMA 1RBLA 4AX7A 3CAKA 4QM1A 2HDJA 3TQ0A 4QG8A 2CZ5A 2PURA 3I65A 4J27A 2G3MA 4UNIA 4F2BA 2PDNA 2J78A 3CQJA 1XM3A 1ONEA 3ITTA 3PBYA 1RPXA 1WDSA 1DEDA 2OR2A 1TTJA 2QF7A 5C9XA 1CTNA 4FOUA 3S5YA 3W38A 4UFKA 3BK0A 3KBWA 1OJXA 1QK2A 3PWAA 5A8OA 3LNPA 3ATYA 2GLKA 3GB6A 3ZR4A 2I1OA 3M6DA 2WMIA 1HJVA 1YPXA 4HVXA 4XD4A 2NQ5A 3LQLA 1U30A 3DESA 4R9XA 4OECA 2C0HA 3CPGA 1Y5VA 5EL1A 4O1CA 2Z2AA 4MWAB 4LQ1A 2WW5A 1QPOA 4AY1A 3RNDA 4UTUA 4QROA 2BHZA 4AWUA 4X61A 3CQ0A 1A5MC 4Z0SA 2HWGA 2FTPA 5I07A 1PS9A 1CX9A 1ZB5A 2X0HA 3NM3A 2E9BA 3QPEA 5HA7A 3LX9A 3ZVHA 4D8ZA 3WLKX 1PTGA 4CNTA 1FCVA 3PHAA 1H50A 4LCRA 4ICMA 3NAVA 3AWNA 3PAOA 4ATWA 4GYPC 2A3HA 2V5LA 5FIPA 2J6VA 1UROA 1S39A 2HV5A 1PE1A 3VX0A 1C8XA 1EOKA 1BGGA 1V5XA 1XIHA 3UEQA 3S9ZA 1JCXA 3KP1A 1FH8A 2VC6A 2O9TA 5G1TA 3ALFA 4JNMA 2EPNA 1EOMA 2XDFA 4CQDA 3TYBA 1LJYA 2PDWA 4LSBA 3UJSA 1PL9A 3A5VA 2PWHA 3GTNA 3I6EA 3LPFA 4DLFA 2GGIA 2ALRA 1E5NA 2WC3A 3C0QA 4HJFA 3WQ5A 2GJPA 1IQ8A 2PODA 5G4HC 2HE8A 3F7JA 3GD6A 1R2SA 1XF0A 2CKRA 1ZJIA 1G69A 4KFPA 4UTKA 3VVGA 2WHKA 4JTHA 3E38A 5A6BD 1JL8A 2FIQA 5HDRA 3CHEA 1E73M 4K39A 1KM2A 4Z0JA 4DUXA 2I17A 4IIDA 1JPHA 1HKKA 4Z2HA 4O57A 1NVMA 1QRQA 3E0IA 1P0NA 3E0WA 5M17A 3PJUA 1S38A 1WUEA 1VKFA 3W87A 3U48A 1YLVA 2NT1A 3PM6A 3CL7A 3TYZA 3F4CA 4QEHA 5I6SA 3UYIA 4X22A 5KEZA 5FF4A 3I7RA 2Z4GA 5DY3A 2V3DA 4C6QA 3M44A 4EIVA 1DJZA 4WY0F 7REQB 5I03A 2PMQA 1JFHA 3EA3A 2VEGA 1H63A 3WLSA 3DBPA 4DPPA 2OEMA 1H7XA 2BXYA 2EPMX 3HG4A 3FA3A 1TV7A 1GG1A 3B0VC 2CHRA 3WEZA 1A5UA 2FH6A 3VKDA 3LHZA 4QE5A 2PC8A 5HMFA 3I7SA 1A5OC 1W0MA 3RU8X 1JDAA 3W1AA 4KFNA 3CO4A 4WZHA 1FWSA 4UOZA 1M03A 2VD9A 2YBVA 3WO8A 2FDMA 2J7HA 1TQJA 3LM7A 4CN6A 1A4LA 1XLDA 2IW0A 1EO5A 3G24A 1GQIA 3HA1A 3V35A 1TPVA 4GVIA 3PZTA 1HVQA 3TKFA 3SCPA 3WMCA 3OZPA 4NRRA 3GR4A 1RK5A 1HL8A 1O94A 3FX4A 1LZOA 5DFAA 3FJ4A 4UCGA 1JCNA 1HP5A 3G1XA 2Y8UA 3S1WA 4R7JA 1MQRA 1E0TA 3QTGA 4V27A 2WCAA 3S5ZA 1YIXA 2REQA 3C5QA 1S5MA 2NVAA 4PB3A 3TK7A 3UXLA 3A24A 1OBAA 3GAKA 1J9YA 3KL0A 3ABRA 3ZO9A 5KZMA 1O5KA 3SCUA 1UR9A 4LUTB 4YS1A 1UUOA 1NDZA 2DH2A 3MVIA 4RNJA 5MF5A 2OMAA 3AQUA 1TJRA 1TV2A 2FTWA 4HCHA 4GFIA 3VINA 2I9EA 3L68A 1PTDA 2JGQA 3TNOA 2A6NA 4MJMA 2ZTJA 1R2TA 1VD6A 3GE7A 3CYVA 5CXPA 2XIOA 3KW3A 3CPRA 5CZ0A 3N6QA 1F07A 3LV5A 1WDQA 3W7KA 4QDWA 3R8HA 1VIWA 4UTTA 5F4XA 4NKCA 2IPGA 4WGXA 1KRCC 3QSTA 3N2CA 2XN2A 4MFEA 4CEUC 1XCXA 5FJIA 3DHPA 1ZBKA 3OEXA 3MSGA 3FNDA 1LTDA 1JZ3A 3F4NA 4PMOA 1CGYA 1UUMA 2WBKA 4XAGA 1TPEA 3SGGA 1ISZA 2Q01A 4AHQA 5CZJA 2GSJA 1A5LC 1D3GA 1RPKA 4NILA 1IEIA 4IIEA 4B5UA 3HJEA 2UY5A 4RZ4A 2O0TA 1GEQA 1U5JA 5D30A 1FX6A 4AAJA 2WO5A 3IVSA 4YVPA 1AK5A 1GOQA 2ISWA 1FUYA 1OYCA 4DWSD 4I7WA 3CZ8A 4Z2GA 1KV8A 1LOQA 1E1CB 1QATA 3QXBA 3WQVA 2Z1VA 3LG3A 3MWAA 3KDNA 2VCCA 4DI8A 3WH9A 3M43A 3IVUA 3RR4A 4DYKA 3QTPA 3GIQA 2OOFA 5BU9A 2WZMA 5A5WA 4FF7A 3TWAA 1FWBC 5AKQA 3O6AA 4P7RA 2G3FA 4IGNA 3SN0A 2CIPA 1KGUA 4KT2A 1WDWA 2ZZ2A 3VGBA 4MOZA 1RCQA 1R9ZA 4NU7A 5HINA 1E1EA 2P53A 5I24A 3WL0A 4AIEA 3NCOA 3TQVA 2OQHA 3B0XA 4GNVA 4ORMA 3SB0A 4A2RA 3D3AA 2WWCA 3M46A 3GVQA 3IUDA 1DORA 1IWBA 4M82A 1JNEA 4W9TA 3P8JA 4TV5A 1XSJA 1W37A 5BYWA 1TWDA 2PS2A 4RNHA 4QTGA 2H90A 1T6MA 1G67A 2YXOA 4JTQA 3HURA 1UMYA 2P5NA 4OJYA 1QNVA 3NL6A 3GG7A 4NT0A 5AHMA 1FP8A 4HYRA 1J6OA 4FR1A 2QNEA 1TREA 1XLJA 3MDUA 1UD8A 4KPLA 1H7RA 3WKZA 3FV9A 3QV7A 4Q8PA 1UOZA 2XGZA 4DN1A 1VAHA 3GDRA 3I4EA 3VUPA 4ZTXA 1VPXA 3EWXA 2DORA 4PMQA 3DI0A 3HGJA 1F61A 2Z2BA 2XINA 2FMOA 3L65A 2YB4A 1OCBA 3FVMA 3VDCA 3CS2A 1OZMA 5F2MA 3NO1A 3S4TA 3EB2A 1W1PA 4JIPA 4F9DA 5KETA 3KVLA 3VOGA 3CZKA 1DWGM 3BGJA 5HNRA 4LFYA 1UPPA 1VIZA 5D38A 3LN3A 1RVKA 4XWUA 4ZMGA 4NZ3A 2CXEA 3TYCA 3PSVA 3VCNA 3BCFA 4OKDA 3QYQA 1AJ2A 5TF0A 5CJ5A 3XINA 4CU6A 1CIUA 4UC5A 1H1NA 3WLNA 5HJXA 3GXIA 3LXBA 2VCAA 5KSWA 5AYYA 4H8HA 4DO4A 2QUNA 3ALGA 3CTLA 1EP2A 1VFFA 2QHAA 3USZA 1W54A 4C6NA 3PG8A 2WKGA 3MPGA 5CC3A 3AIQA 1DHKA 1R47A 4LEFA 2Q8XA 3N9SA 1WB0A 2GQAA 1HUVA 3P8IA 2QMKA 1LOSA 4C7FA 2QYGA 3WQ4A 3U2CA 1U5HA 3MJYA 4GH3A 4GY1A 5HNTA 3SURA 2D23A 3IJ7A 2R1MA 1Z69A 5BMXA 4L4LA 3WF3A 2Y8VA 3W72A 4TX6A 1T99A 1X8CA 2AMXA 3OHMB 1YEYA 4H3DA 4H7VA 1E6XM 4JDBA 4BQ5A 2GGHA 4CCEA 2FHCA 1Z44A 1XC6A 1S3HA 4IMGA 1FFRA 5CJMA 1JPDX 4XB3A 2V2DA 4RDZA 1O66A 1V4YA 1YTDA 2DZTA 5LGXA 3T2OA 4HSOA 1NARA 4H04A 4WCJA 1TWZA 1JJKA 2A3EA 3F5JA 1IE7C 1MDLA 2ZFAA 5U7SA 3MHFA 3EEGA 1RJQA 1Q6QA 2WC7A 4Y2WA 3LK6A 1E4IA 3QZEA 4WKHA 4CKQA 2BLEA 3F4WA 3LUTA 1K1DA 4E2BA 2Z1WA 3WH7A 3W23A 3VGEA 2C3ZA 3G1FA 2BVYA 3QGAC 3NUKA 3CIXA 2HK0A 1PWLA 3IEBA 2AQWA 4RR4A 2VZOA 2AKMA 3ITYA 1FDJA 2ZUNA 3MUCA 3EX2A 4N7QA 4MNMA 1QTWA 3Q2DA 3WNOA 5IHSA 3BJTA 4OOZA 2CFFA 3DERA 4AG0A 4JYEA 3A4JA 1OC7A 5T91A 2Z1KA 4D8LA 3W1TA 2PRLA 2ZRVA 4EK7A 4Z1DA 3ZVHB 4AUBA 1WP6A 4I9MA 2ZX9A 1GZJA 4GPNA 4HPHA 1PJ9A 3T2QA 3IIPA 4D6JA 4H2HA 3EKLA 3OA3A 1YMYA 2ACRA 1DQUA 1FVPA 1HJSA 4JY9A 8XIMA 4OBTA 4A4AA 2PEVA 1UPMB 2PLJA 1Y0EA 4F8XA 3VDGA 3A47A 3UBPC 1KFKA 1B9ZA 2EO7A 3TJLA 2R6OA 5E0CA 1D3CA 2FZMA 3H2OA 1XIEA 1EP3A 1XDJA 4UNKA 1DIEA 3MV11 1EJXC 1J0IA 3GUWA 4FIRA 5FEWA 1P6WA 1IEWA 4QIUA 4IZGA 2WBGA 1XRFA 5FESA 1JYXA 3C2VA 3FVDA 1U2YA 4L9ZA 2XJ7A 1Z3NA 3MVTA 2V2CA 3RF9A 4JS3A 4M29A 4YXGA 4GACA 5J04A 1C8QA 1E15A 1G7VA 2TODA 3UZ5A 4XAPA 1V3HA 2X1IA 3R6IA 3DH7A 3I3BA 1EPXA 4UTTC 3BAJA 4MNLA 4J9JA 3NGFA 4QLJA 5HAOA 5FOOA 1FXQA 2W92A 4KF1A 3S47A 4IWWA 1NTHA 4LV4A 1JGIA 1TUXA 2EPLX 2Y6ZA 3TCEA 4LW7A 3W7RA 5DO8A 4LVFA 3ITOA 2VFIA 4DBEA 4Z1CA 1SO3A 3T4WA 3GTFA 4GI8A 1VFHA 4I3GA 2GSEA 3E0LA 4Z1BA 4W7VA 1V6WA 3QSRA 4GRSA 3A3WA 2A5HA 4UQCA 3VNKA 3TCSA 3MUIA 4JXCA 4R33A 1XBVA 1KBIA 3HGSA 5D4YA 2CU0A 3EOSA 1XIMA 3DOPA 3O6YX 1JYVA 5G4EA 1QK0A 4O28A 1T5AA 3HM7A 3VNJA 4B5WA 3GZ3A 1OINA 2EPKX 4LH8A 3LMYA 1HG3A 4H1ZA 5LNSA 5M2FX 3NQAA 3AI0A 1Y5XA 3FS2A 3HBLA 1MRAA 4FF5A 4XD3A 1NFBA 3TN5A 2IXVA 3UCCA 3O6DA 2CLEA 1ZAHA 3B97A 2YFOA 3MI2A 1XINA 1FWNA 2D1ZA 5CPOA 2JIEA 2QCCA 2ZYFA 4IX0A 1DQWA 4XZHA 3VGGA 3ZFHA 5I3HA 4AD0A 4PMVA 2NXGA 3ID7A 3LRMA 4INFA 3LHYA 2YPIA 2PDKA 1TTQA 3E2SA 1DXFA 4Q6XA 1EUAA 5CH9A 4UTIA 5CPTA 3T1GA 4JQAA 4N9EA 3WDQA 4ES4A 4ALDA 2E68A 1AL8A 4FNPA 2WXDM 2PUZA 1VPQA 1V03A 4BEQA 3ZSTA 1LOLA 1E40A 2J66A 3W6LA 5A69A 1R0MA 4QJ5B 1YX1A 2REQB 2XIMA 5CPSA 2OSWA 4IPPA 3P93A 2GZXA 3CUXA 3PTDA 5AN7A 4NAEB 3DECA 4XO6A 1XYCA 2FGZA 1GJWA 4D6IA 1DTNA 2QUMA 2AMGA 4FP1A 5DF0A 1EJWC 3T8LA 4HNVA 4PH6A 1L6YA 3W82A 5HQMA 3QQ0A 2XIIA 1QMLA 3KBMA 1HKMA 2IKJA 1BYDA 1ZENA 1R3RA 3NPUA 4O1AA 4GYKA 3GNXA 3S2NA 5D9MA 1TV8A 1R5YA 2VKZG 3TV8A 1TFVA 2WHJA 5GVJA 2J74A 3A21A 4ERGA 1UG6A 3F4DA 3KCJA 3H7VA 3WG6A 1Z7AA 3QLDA 2MNRA 4CN4A 3PF3A 3DEQA 5G1MA 3OLEA 1P0DA 4O1FA 2VZSA 4QE4A 2A7PA 5HANA 1K9EA 2X40A 4GCXA 5HMSA 5HXMA 1KFJA 3LENA 5HUOA 4GUJA 1R3QA 4E8GA 4B15A 1XQKA 2J25A 2J7BA 2WNWA 1XP3A 1KTCA 4W84A 1EFZA 4DXKA 1SW0A 1T8QA 3JZEA 5D04C 4E8DA 4JL1A 4NAFA 1A47A 4UOQA 4M19A 4NQ1A 3COTA 4AW7A 2VZUA 1K3UA 3HFTA 4M51A 1MUMA 4H41A 4GUIA 4JYDA 5DMLA 1SW3A 4BI7A 2WNQA 1K8ZA 2VR2A 3HG3A 3EB4A 1KRBC 3AIUA 1VC4A 3P67A 3C0SA 4O53A 2YCLB 5HMDA 1JZ2A 3IVTA 3LZ5A 3UWYA 4DF2A 1LRQA 4PL2A 4E5TA 4HT3A 3M64A 4YTRA 4DNMA 3N18A 4X0NA 5D33A 5LNWA 4HP5A 3R25A 3PC0A 2VENA 2R8WA 1UJQA 2VXNA 2PDJA 2A0NA 4EAYA 4HPXA 3NXFA 4WGHA 1JCYA 3G2GA 4AZ7A 2LLEA 4J3VA 4IT1A 2WMJA 2YXXA 1BQGA 4MWAE 3C2RA 3WLTA 4JTGA 5A2BA 3Q4DA 3VDHA 3G8RA 4DXVA 5L9FA 1FWCC 3W7PA 4I6VA 2VELA 4K7YA 2QCFA 4O19A 1UKPA 1F3EA 4LYQA 5A8GA 4PA8A 3GSMA 3L5AA 4LJ3A 3NYDA 4XSLA 3SFWA 3TLLA 1B3ZA 2PCQA 3L4TA 4L56A 3SUSA 1UP3A 3KWSA 2WYSA 4TVDA 1TZ7A 1E3XA 3NQ7A 5CPNA 3FKKA 3E74A 3WQEA 1CB2A 4UTWA 1QVBA 2ZADA 2XVKA 1A5KC 1FWAC 1EDQA 4GXWA 1ZS2A 3W37A 4KGJA 4MADA 1O5XA 3WLOA 3QV6A 1RD6A 2VEKA 1JCTA 3F03K 3AUJA 4A8LA 1M04A 3IJIA 3CO8A 5B80A 1WYIA 1V6UA 5CLTA 4YTUA 4IIGA 4YMZA 4UZSA 4XSMA 5FJJA 3NEHA 1O1HA 3G6LA 3QR0A 3CHFA 4IQLA 3UVIA 1EJVC 1TPC1 3P62A 4DO7A 1DJQA 1W1TA 1U1HA 1E6NA 4XV0A 1HT6A 1QNOA 1DIOA 3GXNA 3QR3A 4JKMA 3HZ3A 1E1FA 3W1PA 3H24A 1WXZA 3RLHA 5LIYX 4IL2A 3TDFA 3PZVA 2RGLA 1ADDA 1K8XA 4CQ8A 5CJNA 3LCHA 3CZJA 4NRSA 3T8QA 3UZWA 3L21A 1OFBA 4OQVA 3Q45A 1OCJA 1CB7B 1IR1A 3MANA 3S6DA 4LT9A 4RNFA 2Z7KA 5GJPA 2Y7FA 2HEJA 3BV4A 1TPDA 1KXVA 3P74A 3AMCA 1I8JA 5C8BB 3CZEA 2PGRA 4HNTA 4WSJA 5MKGA 1K9DA 1ISVA 2HZGA 4Y9AA 3T0DA 4XG1A 3MBFA 2R91A 2Z7GA 4J3TA 2E5BA 1JXJA 2P10A 5CGMA 2IQDA 4TTGA 1QUMA 3WY1A 2WKLA 3UA4A 4X60A 1HZYA 1J6PA 3CUJA 3T9PA 3ARRA 5T9CE 2J27A 1R9XA 3KXQA 1EX5A 4GZEA 1NF7A 2WHLA 3AUOA 2PFHA 2X1UA 3C6CA 4HA4A 3UQNA 3N17A 5LHEA 1QI0A 4RK8A 2QXWA 3W75A 3R7MA 4M81A 3TR2A 4H6QA 2O55A 4A29A 2W6RA 3EPOA 3UWUA 3BO9A 1TIWA 4JZ5A 5LA2A 4HHPA 4CGTA 4MJ2A 4GQ0A 4ZFCA 1MQPA 2EAWA 6REQA 4WK9A 4DYJA 4RUBA 2XM2A 2RJHA 2PGEA 3STEA 4A22A 2V81A 4R34A 3OGRA 1TKKA 1TVLA 3LMZA 2WJEA 2XZ7A 3WUFA 2CYGA 1RSCA 3TOYA 4NYUA 4DYEA 1TVPA 1XQLA 1X6UA 4CNSA 3VKAA 2XVLA 5BXRA 3TN4A 4AIBA 5D32A 4JIQA 3DU0A 3WMSA 1ISWA 1J11A 3EA1A 5CG0A 1BTMA 3OGVA 4GNKB 5JMUA 5CKSA 2KZHA 4IP4A 1X1OA 3HPFA 3BG3A 3LTSA 3CT7A 5KZ6A 4FEZA 1MEHA 1R3YA 1LBMA 3P60A 4D8AA 4M56A 5FACA 2I5QA 4FIQA 1K77A 1QU4A 3WMLA 1MFUA 2AL1A 3BMXA 3GLCA 2GVLA 2CLLA 1O5QA 3JR2A 3L0NA 3WN6A 3CPUA 1SSGA 4HNOA 3UG8A 2UY4A 1CXIA 2YKKA 4JBRA 3UNTA 3LLDA 1UZDA 3S2CA 1PAMA 3URQA 1YXCA 2PC4A 2VOMA 2RH9A 4QJ1A 3WELA 3T0AA 3P6LA 4O0KA 2E40A 1AJ0A 1V0MA 2YL5A 5D2TA 1XRVA 4L4OA 1IEVA 4KRZA 2XH0A 3O0FA 4W86A 3PUGA 4ML4A 4F0HA 4K68A 1DWIM 1L2QA 1OFDA 2F2KA 4PN2A 5EMYA 3CXOA 5XIAA 2E1WA 1PUDA 3WLJA 2W62A 1P6CA 3CQIA 1NOUA 1P4CA 1W1ZA 1H4PA 3WK2A 1Q6LA 2ZX8A 3OBEA 4XZBA 2DZBA 3W29A 3KCOA 2BY0A 1WZAA 3UJRA 2VQUA 1NDYA 2HS8A 4U4MA 1OX4A 4H6KA 4UBPC 1B3VA 3GVWA 3VO0A 1B1YA 1A3XA 1VLIA 3MSDA 4U33A 4F4RA 3AHVA 4OWGA 2BZNA 4P8XA 1JEZA 1JNDA 2CLMA 4M7TA 2HROA 3WNLA 3A4XA 1RUSA 5CSSA 1A0EA 3NDOA 1H1YA 3AMGA 3WJWA 2OZ0A 4UR9A 2QJIA 1CNVA 3SUTA 4WF7A 2PDQA 3QMTA 1NEYA 3WF0A 4UTHA 2RGMA 2PGWA 2TYSA 3M7WA 1XSKA 2OWXA 2DSZA 2ACQA 1ZCCA 1MEWA 3RX4A 1K8CA 1CXEA 3U5YA 1BWKA 1XIFA 3GH4A 1SO4A 4H9MA 1F2JA 3KRBA 3HU7A 1E9YB 1V77A 4DLMA 1ZFJA 1TPB1 3AS0A 1OB0A 3E2QA 4LY4A 4ZVJA 4G9PA 5C7HA 2YA2A 2Z26A 3GAYA 1WBHA 1VZWA 4JPGA 4NI8A 1O4UA 2ZBTA 2CBVA 4FOKA 1Q65A 1SFJA 1QHOA 3G5EA 1BVWA 1WPCA 2QCLA 1KFBA 4GOAA 3TLQA 4IPLA 3GXPA 4LS0A 5A6JA 1R7AA 4HU8A 1J0ZA 4GUGA 2TMDA 1G01A 3HQNA 3VMNA 4OHQA 1PCWA 4LC8A 4JTIA 1FOBA 3IJ8A 5HWJA 3AS3A 2Y1HA 3H12A 5FSEC 3DC8A 3BSHA 4DUWA 2GJNA 3EDFA 3NM1A 3RXZA 4R3UA 5DN1A 1F6KA 4BCEA 2QCEA 2ZZ1A 4AZHA 3NVDA 1IR2A 3TIMA 5K7JA 3QV8A 2ZWYA 2X2GA 4FX8A 1ZCOA 4HNCA 3TW7A 2HSAA 3PZGA 3QF0A 3F2DA 1IF2A 5JIWA 4LUIA 1HXJA 2XWEA 3WH6A 3BWWA 3N19B 4UTWC 4RLIA 4A8RA 1C92A 2YZ5A 4AD5A 1UD6A 1P43A 2PLCA 3W1UA 5I3FA 4HN8A 1JQVA 3GVRA 3CL6A 4Z17A 2Y8KA 1G1YA 1ODUA 2YXGA 1ZU8A 1E5JA 4U28A 4AQLA 1XIDA 3M0XA 2QV5A 3GDBA 2J79A 3IJQA 1LWJA 2VP8A 2GFTA 4IP5A 3A13A 2CZFA 1XBYA 3WDJA 2BXZA 1OIMA 1CGUA 3BXWA 4GY7A 4KCTA 4YTSA 2XWDA 2UY2A 1VJZA 4PUWA 4PTXA 3V0SA 1DWJM 4C1KA 3BAKA 3DBNA 2DZVA 1TCDA 1H09A 2WSKA 3P0XA 2VDHA 2YW3A 3KRUA 3MMTA 2NQHA 2QUTA 5D2VA 3R13A 1ONXA 3L4VA 1A53A 2RKXA 4JICA 5JQ9A 2V5JA 1HFBA 4AF0A 2VFGA 1M68A 3UR8A 3CLWA 3BQ5A 5BRBA 3UWVA 4UR7A 2ZRZA 5FEXA 5BOEA 1JDFA 4XISA 2XFYA 5CC6A 1UR4A 4AEFA 3OQEA 2XSBA 2R24A 3AHTA 1RH9A 2O56A 1GYMA 4P7QA 2X42A 1F74A 1EA9C 1SUXA 4AVFA 5IDZA 2CHOA 1B57A 3RPTA 1RLCL 2J9ZA 4MKSA 5DX7A 4RDVA 3BSMA 2QQ6A 4QDMA 4LUYA 2B31A 2F6UA 2DJXA 1QAPA 1UC4A 4M6UA 2Z1XA 5CQ1A 4AYGA 3KRZA 4L9XA 3DHDA 3SQMA 2VFDA 2OYLA 3MKVA 2YDSA 2ZUMA 3FAXA 1HN1A 4DXXA 3BLFA 2IQ0A 5E6ZA 4ADUA 4QITA 1B4EA 4LALA 1WCGA 1V6YA 2BVDA 1OG0A 1LDCA 1AA1B 5AC6A 3B9AA 4IISA 5ABTA 4GINA 2G96A 1SMDA 3D6NA 4ZO9A 5A3HA 1GVSA 5CEWA 3N2OA 2ZZ4A 1HTIA 3USBA 2BHUA 3QPYA 2QJJA 3PJXA 3W1LA 2ZTKA 3BAWA 3L2IA 3C3UA 1SZRA 1KCXA 1EJSC 5HULA 3I10A 3Q94A 3RU6A 5AHNA 2HVNA 2ZC1A 2J4GA 4G7EA 2YCKX 5A8NA 2PA6A 5M3WA 1SW7A 3GU1A 3PZQA 2INZA 3GH5A 3CH0A 4S2CA 2PDGA 1F8MA 4GFSA 2OSXA 2NV9A 4FNUA 3SAZA 3W7EA 4QAWA 2TRSA 2OZ3A 4O54A 2BX7A 4J35A 4Z2LA 3QW4B 4WDUA 1R3WA 1V0NA 4OV4A 4I5XA 2NX3A 3BJSA 2ZC8A 4IGMA 3SCQA 1IXNA 2H6RA 2PDXA 4FXJA 2GWGA 1EIBA 3ZLFA 4RJEA 5DANA 2J7EA 1W9PA 3ARTA 4JTTA 4L65A 3WUBA 1EIXA 3EKGA 5EGRA 2E5DA 4HPJA 1KBKA 5AHLA 3S2MA 4Q4KA 1SJBA 2P1FA 4HSHA 4RX0A 4UB9A 1T7LA 2JGYA 4WVXA 4UFMA 2E9LA 1VEPA 1M7PA 1G94A 4KCVA 2Q8ZA 4UTMA 3S0CA 4MNJA 2GVGA 1A5CA 3W74A 4PMDA 1AD1A 2FH8A 1KRAC 2VL4A 4MY1A 4R85A 3K4WA 4I5RA 2ZXAA 1J93A 1QO5A 3VDAA 1A5NC 5AECA 4TV6A 4L6OA 4DELA 1XISA 3VIMA 1HNYA 3QGKC 3BMWA 2VQTA 3H4XA 4TXEA 3LRKA 1LT8A 4I9AA 4AIOA 2RDWA 4TU1A 1XLKA 4GUHA 3R94A 3GKAA 2RUSA 3VKBA 4UFJA 2X2YA 3L4WA 5H6HA 2YLLA 3BC9A 1A5BA 4O12A 3WD1A 1UKSA 1RJRA 1JF6A 3V1PA 1G4TA 4PE8A 4QS6A 5AC4A 1P7TB 3QMRA 1LROA 1VB9A 2XH7A 1J01A 2BP1A 3BQ6A 5I77A 1GORA 3AXXA 2GK1B 1RAKA 4HHHA 3GNPA 3PVFA 3B8VA 4AH7A 4DJED