4QHRA

The structure of alanine racemase from acinetobacter baumannii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
355
Chain Sequence
MRQATVYIDRQALQYNLNRVKQLAANSKIVSMVANAYGHGVKDCLAALNASDAFGVACLQEGLEIRELGFEQPVTLIEGVFSEDEMPVAIEQKFECVIHHQQQFEWLIKHKQAYIAQGLKVWVKLNSGMNRLGFKDPEIIEVIKTLKSEGFTCVLAMHFANADVDHPLNEQQKQQFLHIKETCDPILASCCNSAAIFKWPELNFDYVRPGIMLYGASPFADKTVHDLDLKPVMTFTAEIIALNHIEAGEHVGYGSTFCAQQAMDIAIVSIGYGDGYPRAYVKQNFVAIDGKLCPVVGRVSMDMIAIDVTNTQVKLGTQVELWGNHRLVDDVAEANGTIGYELLCRLSSRPVRQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of alanine racemase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Isomerase
molecule keywords Alanine racemase
total genus 120
structure length 355
sequence length 356
chains with identical sequence B
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4qhrA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4qhrA02
2PLJA 1B54A 1TUFA 1KO0A 1SFTA 2ODOA 2P3EA 3CO8A 5GJPA 3B8TA 4QHRA 3HURA 2NVAA 1XQLA 1FTXA 3VABA 4V15A 1VFTA 3ANVA 4ZGYA 3SY1A 5GJMA 4Y2WA 3B8WA 4LUSB 2RJHA 2YXXA 3WQCA 4FS9A 3CPGA 1HKWA 3MT1A 5BWAA 4KBXA 4DYJA 5FAGA 4LUTA 2OO0A 1HKVA 3B8VA 3LLXA 1NIUA 1SZRA 4BHYA 3E6EA 1CT5A 3WQDA 1XQKA 3BTNA 5IRPA 4XBJA 1XFCA 2SFPA 3WQGA 4WR3A 1VFSA 5FAJA 5GJNA 3R79A 2O0TA 4XG1A 1NJJA 3AWNA 4LUSA 1L6GA 1QU4A 4ECLA 4PB5A 1F3TA 5FACA 3WQEA 3N29A 4LUTB 3AWOA 3B8UA 4BF5A 2QGHA 1W8GA 4A3QA 2J66A 2DY3A 2TODA 1KNWA 3OO2A 2PLKA 2VD9A 4AIBA 7ODCA 4DZAA 3N2OA 1TWIA 1D7KA 3NZQA 4BEUA 3C5QA 3S46A 4BEQA 3WQFA 3UW6A 1VFHA 1RCQA 3N2BA 4PB4A 1BD0A 2NV9A 3NZPA 4ILSA 4LUYA 3ANUA 3E5PA 1L6FA 1EPVA 2VD8A 3GWQA 3HA1A 3KW3A 2ON3A 4PB3A 2RJGA
chains in the Genus database with same CATH superfamily
4GQQA 3W1UA 4PA8A 1UD2A 2HNHA 2PP3A 4P7LA 4AC7C 1CDGA 4DBSA 2QDEA 5GQBA 5A2BA 1B3OA 5EMMA 3N73A 1W5OA 2YA1A 4XKMA 5HOSA 2D3LA 4NHVA 3NQCA 3LERA 4MB5A 2QPSA 2B7OA 2OWCA 4JQAA 3IGUA 3GR4A 3WO8A 1OSEA 5FJTA 1UOZA 2VZSA 4N9CA 2P8CA 3R7MA 1KGWA 4JNZA 1ZCOA 5SWUA 4WF7A 3VGEA 4F0SA 3CZEA 3HPFA 3K5XA 4KQNA 1BYBA 3FCPA 4JTHA 4QIUA 1GGOA 5BWFA 2FPVA 4F40A 2GOUA 4XZBA 2C6QA 3VYLA 4M7TA 3BLOA 3PK7A 4QS5A 5I79A 5D9MA 2AMXA 3EX4A 1GCYA 1S38A 3W1AA 4D1JA 4R33A 1W1TA 2UY2A 3O7UA 3T9PA 2PDUA 1A5CA 1T6MA 3C2RA 4EANA 1J0ZA 4GI9A 1LP6A 3ZVHA 1RVKA 1DJGA 5D8WA 4FA3A 1RPKA 2HZGA 3GU9A 1KB3A 2INEA 4PBEA 4DF0A 1LLWA 1E1CB 1PZ0A 3I4KA 4NQ1A 2GVJA 3M0JA 3SCOA 1H63A 4GC3A 1OX5A 4J1OA 3UWZA 2CERA 4QHRA 4DRSA 2WB5A 2PI6A 1Q6OA 1UA7A 9CGTA 2NWRA 3AU6A 1BRLB 1QFEA 2HS6A 4YCPA 3JZEA 3T1GA 4DUVA 1TFVA 4MJ2A 3UJSA 1ZGDA 4DJFD 3GZAA 2VVSA 3UZXA 5CSRA 1BVNP 1QDSA 2BXZA 3CIWA 2NV1A 3ZXWA 2WCAA 4LUSA 3W53A 4LS2A 2ZRVA 3CIVA 3THQA 3TE9A 3E2VA 4JQ3A 5FF4A 2ALDA 4GNJA 3SIMA 2J9XA 5LIYX 2HPIA 4MHBA 1WYIA 4IFKB 4ZBCA 1IZJA 3P3BA 1OX4B 4HSNA 4AF0A 1UMLA 2HXUA 2Y5JA 4D6JA 2OX4A 3ANUA 1P6BA 4LYQA 4IQLA 3GU1A 1YPFA 3H24A 4CKQA 2I17A 1TPH1 1HQTA 1B31A 3S5YA 4KWWA 1LRNA 2NZLA 3OQ8A 3EOOA 5REQA 4AZ5A 5I24A 3BAWA 5K9XA 2FHCA 3IANA 1IIHA 4OOUA 1IF2A 2AQVA 4IP4A 4JKMA 1TJ2A 3GXPA 1P0BA 3FHAA 3TN5A 1ZAJA 1HG3A 3MUIA 2HXTA 1DWIM 4F0LA 2BXYA 3SECA 4HZ8A 1QMLA 4LCSA 4MYXA 3CYJA 4PBFA 2W4XA 1E0TA 3HOJA 2VC6A 1PIIA 2YFOA 4JIEA 4X0NA 1YE4A 2WZEA 4WIWA 4WR3A 3QV7A 2CIPA 1UQYA 3BZJA 4PMQA 3WJSA 3TAOA 1JIBA 4XAPA 1XYZA 4XAYA 1VENA 1GQKA 4GOAA 1JXKA 1RSCA 3HU7A 4ACYA 5IDIA 5CPSA 4XO7A 4DJDA 1ME8A 3TW7A 1DJWA 3TTSA 4M82A 1WKYA 4BEQA 2WCGA 4DO4A 1VBGA 2XGIA 1XDMA 3USZA 2QW5A 1QATA 1R9ZA 3SGGA 1E72M 2DW6A 4B5UA 3APTA 3W2NA 3ZR4A 1BPLB 5LYRA 3S2LA 4KMQA 1WBJA 3LPOA 5KTLA 2XFWA 2WKGA 3ES7A 2E9LA 2OYKA 2EGZA 2E0PA 5FCZA 3KFTA 1X8FA 3HURA 5CSSA 4NAFA 2ATSA 3WQ8A 3RM4A 2QCGA 1QI0A 5FSEC 2G37A 3WY1A 1W3JA 3DYMA 1QT1A 1LT7A 3PC0A 3F5LA 4BQ3A 3WCZA 1UD6A 4GI8A 1HT6A 3R13A 1TV8A 3BMWA 4M24A 2WPGA 3W4RA 1E6NA 4LS0A 4OECA 5A6AA 1R2TA 1EGVA 2X1TA 1RJPA 3D0CA 4FNTA 1V02E 3MVTA 4WGHA 5T8GA 5AVNA 5H8PA 3FY1A 2J9YA 3GSMA 3STPA 4AUBA 4BI6A 1K8YA 4LVAA 1EEXA 1T99A 5G2IA 3B9DA 3RPMA 2H8XA 1JPIA 1IWAA 2GJXB 3IIPA 1AFSA 2R24A 3GD6A 1SMDA 1ZFJA 3AJXA 4CLMA 2QUNA 2VEMA 1QNRA 4K7YA 3LHWA 3N2OA 4ZOAA 4CD4A 1R85A 2FH8A 1FFRA 1G94A 3TFCA 1MSSA 3E5PA 3PP7A 2D2OA 3TR2A 5LXXA 5B7YA 1DL3A 2YJQA 4ALDA 5I77A 4F0RA 2OVLA 2EKCA 4ZQMA 3V0SA 1R7OA 4CU6A 5BU9A 4JX5A 3BW4A 3F4DA 2YDAA 1IEQA 4HTBA 1BSIA 1W3HA 4K68A 3ZJKA 1SPQA 1QTWA 3TW9A 1AQHA 2Z26A 4FNPA 4D6FA 3HPZA 4TVCA 4MJMA 4QRNA 3AZRA 4A21A 5CAKA 2A3LA 4HB7A 1OBAA 1OADA 6ENLA 4DYJA 3B40A 2EJAA 3RX4A 3KRBA 3WLJA 3LB0A 3RK8A 2J8TA 3ZOAA 2IPJA 3PNZA 2ZZ4A 2BTMA 2E1WA 1AW5A 3KVJA 1IXNA 4IL0A 1F3TA 3MWAA 2VUYA 2VR4A 3N29A 3C2OA 5FJIA 1BYCA 2CZ5A 1O66A 5D8ZA 4PMJA 1H1ZA 4UFMA 3DFQA 1Q85A 2ZUNA 3SUWA 4R7JA 1TX0A 5M03A 3ABRA 1GVOA 3U0HA 1EJ7L 2YW4A 4RZ4A 3S1VA 4GY0A 4JTUA 1QR7A 4DZHA 4ILSA 4WDXA 1OX6A 1KC7A 5I3JA 3JW7A 3AJ7A 1GHSA 3WUFA 3W1PA 3CUGA 5HINA 1UMYA 1I45A 4CN6A 2HEJA 2IKGA 1Z42A 3LENA 4TV5A 4DELA 3O07A 1B54A 1MW1A 1TUFA 1Q2RA 2P3EA 1A5LC 5M3WA 1OM0A 3AMLA 5CLTA 2V3DA 3EYPA 1DP0A 3VPLA 3BCJA 4R85A 4IG2A 1NQKA 1R7AA 1AJZA 3CWNA 3HN3A 5FI8A 1PDYA 2EPKX 1RV8A 1J01A 2WC3A 2VDGA 5AN7A 1UD5A 5C9WA 1EJRC 1YTDA 2CLMA 3E0WA 4IX2A 3FXGA 3TR9A 3POHA 2ZX5A 4O19A 4I9AA 2XGZA 3WJZA 2O7QA 1LQ0A 4GVHA 5FJJA 3M5XA 1LBFA 1UWAA 1NH6A 3O9NA 3CU2A 4O52A 4YU1A 1BVZA 2BG5A 3EWBX 1EP2A 1R2RA 4PMRA 4TX9A 3S2CA 3OJGA 3UWWA 3R11A 1REQA 4HU0A 3FOKA 2WC4A 3BPWA 3LBCA 2HQAA 3ARUA 2QULA 5MKGB 3FKRA 5JH1A 3WLMA 5KMYA 3S1WA 3PJUA 3A12A 4J3ZA 1AW2A 3WUEA 4BS0A 3B8IA 3KWXA 3VD7A 3RN6A 3LPGA 5E6ZA 4M19A 1F3XA 2VOMA 4D8AA 2XN1A 1TCDA 1W3LA 3W7JA 3N14A 5BROA 2DVUA 4JOMA 5D2YA 2F7FA 3EKZA 5D03A 1N7KA 3KL5A 3G0XA 4B92A 1NSJA 3NSMA 2IQ0A 1UD3A 1UKTA 3W7QA 1W2VA 4TXEA 1OT1A 4B3LA 3TC3A 5GNXA 5U7SA 3I7QA 2BSLA 4JL2A 1MXSA 1BAGA 5F2GA 4ZGYA 4JDBA 1H50A 2E6YA 4C6FA 3E0IA 4DO6A 2DORA 1ODUA 2WYSA 4H2CA 4L6HA 3BAJA 3DHPA 4V2XA 4Z1AA 9RUBA 1DWGM 4JYFA 4XBJA 1NF0A 1UR0A 4J3UA 1FRBA 3TXZA 1G4SA 3T09A 3CUIA 1VCGA 2NUYA 4B5VA 4FO4A 5D4YA 5DANA 2F6KA 2VZTA 3LBOA 3GNXA 3SB0A 2FPTA 2PC4A 4O8RA 4FX7A 3S3GA 4AAJA 1EHAA 3B06A 1BQCA 1W9UA 3P82A 3HQ1A 1MZRA 2VX4A 2G96A 3MKVA 1KFLA 3VM7A 4QCEA 1NAL1 1OB0A 2FVLA 1U5VA 4JIRA 4J5NA 1QCWA 4KRZA 1P0NA 1HN1A 2OG9A 1VS1A 3TZFA 4DNMA 2FFCA 5LIXX 1PEZA 4NXSA 3SRHA 3L66A 4WD0A 4AMAA 3PB0A 1CXHA 3EBVA 3HG4A 4K6AA 1OIMA 3QVQA 2FKPA 3GAKA 1PBGA 3LDVA 4O14A 1YNYA 3WD1A 1CGUA 3EWXA 2C8NA 5D2WA 2ZXAA 3KDOA 2Y88A 3BOFA 2JIWA 3EAUA 2FGLA 1E56A 3F4WA 4AHQA 2E3ZA 4M3PA 3C6CA 4FLRA 1KCLA 3MZNA 5LIKX 1UBPC 1JL8A 2X0YA 2IMRA 1BXCA 4GLEA 3AS0A 3EDJA 2QKFA 3NL3A 1R3SA 4E2DA 2D24A 4O13A 1ZY9A 2OO6A 2QDDA 4CQ9A 1HFBA 3C52A 2Z1VA 1U2YA 1UB3A 4U31A 3CWOX 7REQA 2GDQA 1AL8A 3QKZA 5ABFB 4JY9A 4S3FA 2CHRA 3LHYA 3TXVA 3LEPA 3QR3A 4HCHA 4DBEA 4AF0B 1V51A 3CB3A 3M6YA 4JKLA 1EHNA 2BVYA 1D7KA 1TPFA 2CZEA 4DF1A 1TPB1 2Z4GA 3C3UA 3QV9A 2GK1B 1R3YA 3WQPA 2Q71A 4ATLA 2VCCA 3N11A 1WOAA 4PZVA 5DMYA 1P4CA 2B7QA 3H8AA 3LOTA 4HT3A 1XUUA 3W7LA 1S5TA 3ARWA 4H6QA 1S2AA 2PC8A 1UC4A 3C3NA 2PWHA 3VD9A 2DH3A 4GVIA 4HKPA 4AZ6A 3JZUA 2NWSA 4ZR8A 2X40A 4GGBA 1EIXA 5IFPA 1SJAA 3KTCA 3G8EA 2XWDA 3ARQA 2OOGA 4NZ1A 3WENA 2AL1A 3RR4A 2XGBA 2OQLA 4OVXA 3AFBA 1F05A 8A3HA 2VCBA 3TSDA 3ZR5A 5IBXC 3QV8A 1G67A 5LIUX 4D72A 2NVCA 4O1BA 3H54A 2PDKA 3SSZA 3VMNA 4DX3A 5TBOA 3MCOA 4WEVX 2WLYA 1N2VA 2I9EA 2TRSA 4FLSA 1G0CA 4CU8A 1FWEC 1R3RA 1ZBCA 3MUXA 1G4EA 3QBUA 1K03A 3PTDA 5G1MA 4WY0F 3VIOA 4FB7A 4DLFA 4WXZA 4ZSUA 3SW6A 4ZZ9A 1TV3A 4IP7A 4JFVA 3NQFA 4UXDA 3BW2A 2WQDA 3DG6A 1HZYA 1E1FA 7ODCA 3LHVA 4IPLA 3LU2A 2DUAA 2A6NA 2ZIDA 1RA5A 2X1IA 4JBRA 4QLKA 1H11A 2YB4A 4X3ZA 4QP0A 4ASTA 1KXVA 2DZWA 3OG2A 4JFUA 1PCKA 3Q67A 1I2RA 3DFOA 1MZHA 2BOFX 4LB4A 5LA1A 2WVVB 3WH8A 4O16A 1DEDA 1J0JA 2PLJA 4B5WA 1V93A 7XIMA 3NOYA 1YTKA 1YADA 4H9TA 3MDUA 4QE1A 5CBBA 1KR1A 1LG2A 4EX4A 4OUIA 3TYCA 3V0UA 1ZPTA 4Q7BA 2WSKA 3NQBA 3LM7A 3UPMA 2YYTA 4UCGA 3OTRA 2ZRYA 2XIOA 2NQJA 3WH6A 1DJHA 1GK8A 4ADUA 3W88A 4UTIA 5F4SA 1LWHA 2F8QA 1C8VA 4QS6A 3S5OA 5IRPA 2OKOA 1EPXA 3BAYA 4A8LA 3UT0A 1DQWA 5XIAA 1RK6A 2FZMA 4HZMA 3NTYA 4URIA 3NWRA 1XWYA 2FPYA 1G9HA 4FALA 4OOZA 4YJ5A 3HM7A 3VKCA 4PUWA 4PB5A 1TZ9A 1DXIA 2Q3RA 4NY2A 2ZA1A 1JYWA 2BOEX 2OEKA 2CLOA 3UJFA 3RX3A 5AC5A 1TE6A 4PCTA 4OHQA 3B9OA 1XIJA 4UQAA 4EXQA 1NDZA 2C0AA 3S46A 1TPDA 1WKEA 3M47A 2WLZA 3QPYA 3JS3A 3GTXA 3TROA 3RR1A 1E5NA 2YLAA 3A3HA 2D0HA 4LBRA 4AZIA 2DZBA 1H60A 3N04A 1H41A 3BW3A 1O94A 3DC8A 1V3LA 1TZZA 1Q65A 3QKEA 1PX8A 3S83A 3NEVA 1DWHM 1JXJA 3SGUA 2DUXA 4YCOA 3O6DA 3HQPA 5CEWA 2QF8A 1WDQA 1QHZA 2DFAA 3F5JA 3GH4A 5IBXA 3TSMA 4DWDA 1TQXA 1UR8A 1VHCA 2I57A 2XUCA 4X9YA 1GKRA 2YR1A 1KGXA 3NQEA 4KIRA 1PPIA 4ZFMA 3VKJA 5HQEA 1XQKA 3CYVA 1WA3A 1U30A 5E0KA 3HV9A 1VZWA 1RD6A 5EGRA 3H4XA 2E6AA 3RUBL 1EA9C 4LRSA 3VTRA 4MB3A 3O0KA 4DWSB 3PTMA 3WUGA 7TIMA 3QGKC 2AOSA 3GNRA 3VD5A 1V6TA 4HHLA 2NQ9A 3LV6A 1JCYA 4GD0A 1H2JA 3G24A 1IT0A 3FSUA 3WDQA 1OVDA 3UY8A 5BOOA 1M7PA 2FTPA 2VR5A 2DQWA 3PJXA 2R1LA 4GISA 3AIRA 5A6MA 1A5BA 3RNDA 5ABEA 3H2AA 1CI1A 3EMCA 1I75A 3CQIA 1LQAA 3NDYA 4PYSA 3KVLA 5H1WA 3TQ0A 1UWSA 4RZ6A 1ODZA 2WMKA 2BLEA 1RBAA 2QT3A 4W7WA 3CB8A 5TQLA 2D2HA 4Z1BA 2PZ0A 2VX5A 1JPDX 1VFTA 2CHNA 1TPEA 4WJ8A 5MHBA 1I60A 4G8TA 5C6MA 3GDMA 5ABFA 4KERA 4JCMA 2XTKA 2JQXA 5CJ5A 4H4IA 4ZO7A 4FS9A 4HNTA 1E1EA 3KE0A 1GG0A 2ISSA 2OO0A 1MEIA 2Z28A 3R0DA 1W5PA 3CUJA 1P1MA 1GWJA 4NUWA 1GT8A 1ZUAX 5FAJA 1HJQA 4X22A 4AEFA 1UZ1A 3WF2A 2TYSA 3PG9A 3S1XA 3B8UA 1Q4NX 3W27A 4ML9A 3SCUA 5DT7A 1G01A 4BEUA 3VFLA 3H53A 1FUYA 3OIHA 4GX8A 4DJEC 4MLJA 1C7TA 1DWJM 1ZB5A 5C0QA 4S3JA 3FYPA 2ZX7A 3N2TA 1V0MA 1XSJA 4IF2A 1F6KA 4HHHA 1G7VA 3UGRA 4JN8A 1UOKA 3VGHA 1SFTA 2QCEA 2GLKA 3MI3A 1IGWA 1SW7A 3EDFA 4YS1A 3S2NA 2G3IA 3R0UA 1VYRA 1GZJA 4GIYA 4V15A 1XLJA 2ZRZA 3VDCA 1C92A 2YDQA 4MFDA 3OB8A 1YX1A 2E28A 3HJEA 4GO9A 1CW2A 4KIEA 3S2JA 3R10A 3LK6A 3P67A 4XSMA 3NL5A 1ALDA 3OBEA 3EB4A 3HPXA 5I02A 1BFNA 2C7FA 3N19B 4GBDA 1IHIA 4O53A 3A9BA 1V5XA 4NAEA 1W1IE 3COTA 1US3A 3AIQA 1IEXA 1F8MA 2PDNA 4Z2JA 3PPGA 4QJ4B 1AZ1A 3SJ3A 1NFBA 3VOHA 4Z08A 3CZKA 4AISA 2ZDRA 5I03A 1XRFA 3RMJA 2RDXA 3GYCA 5AC8A 1UQZA 4AIOA 1S5MA 1A53A 4YHGA 4UFIA 3U3HA 1XBZA 5F2MA 3W2KA 3H21A 2ANUA 3UP8A 3TA9A 3NXFA 3VINA 3TQPA 3BO9A 2WMHA 3OODA 2BX7A 4WSJA 1OFOA 1UUMA 3VIFA 3WFLA 1JCNA 1XBXA 1OYBA 4CGTA 3NQDA 5H8MA 1JZ4A 5D2XA 3BVJA 1XLDA 1ZQ5A 4JTCA 2Y7FA 4NI3A 3DFSA 3CT7A 5A6TC 4KT2A 1J6OA 4Q4MA 3M41A 4R3UA 1PB0A 3GVWA 4CNPA 3G8RA 3KHJA 2OZ0A 3GHSA 1JCXA 2C3ZA 1JRBA 3MJYA 1MNZA 4NYUA 1XH2A 4IGMA 5A8PA 3UJEA 1CXLA 1SZRA 1IR1A 3WMCA 1F8IA 1FVPA 4HNCA 2Z6IA 1U1HA 4RNFA 4PCFA 5HWNA 2IQDA 1P5BA 1MEHA 3GO2A 3LGGA 3CUXA 1JJKA 3CHCA 2YDRA 3AIUA 3VZZA 3EA1A 1SJCA 3F2BA 2XISA 4BQ2A 1FHDA 1JI1A 4D6DA 4W86A 2CW6A 3WLIA 1UWIA 2YL5A 3LBMA 4EF8A 1BXBA 1S2WA 5HA7A 2NSOA 4OV9A 2ZX6A 3IJIA 3PUDA 1FDZA 5HK4A 4KFPA 1AD4A 1IYXA 1SO4A 1Q6GA 3UWVA 2F9RA 3BGGA 2OMAA 2VEGA 3A21A 3NG3A 2E77A 1V03A 3DFPA 1T0OA 1Q6LA 1R5YA 1ICPA 2I14A 4EVZA 3GKAA 3AMGA 4US6A 2RUSA 8TIMA 1OD0A 2EG7A 2H3BA 4CNOA 3WMLA 3CPUA 3UVIA 2WWCA 4NILA 2GGEA 3C4UA 1Z69A 4F0MA 3E74A 5ABTA 1B9BA 2ZUMA 3PUGA 2EAWA 2PDIA 1WDRA 3GRIA 2PDHA 1QJWA 1LORA 2BY0A 3BJSA 3HGJA 2R8WA 1MUMA 3RCNA 3W1RA 2QVNA 3NO5A 4C1NA 2HMCA 2RAGA 3O1NA 4Z2GA 3N12A 3F7JA 2JF6A 3OA3A 2H3DA 5H8UA 4O54A 4BK9A 4XSLA 5FESA 3BG3A 1NEYA 2FTYA 1OT2A 2J7GA 4E38A 5D30A 1Y5VA 3A13A 2GWGA 4I9MA 1E3XA 1QW9A 5E5CA 3SCQA 1W8GA 4C1NB 5I07A 2F61A 1RD5A 1EC8A 3AHYA 3WLPA 9XIAA 1ZRQA 3OO2A 3GLCA 3D5HA 3GBDA 2OQHA 2X8RA 2Y7DA 1QAPA 4OBSA 3AIWA 1TRDA 2WHJA 3KBWA 2ADAA 3L21A 1J5TA 3N2BA 4J28A 2AGTA 2Z1WA 1OCJA 4KWVA 4AZCA 1BWLA 4QFUA 3TTYA 2E9MA 2BHZA 3OA5A 5M5DA 5TF0A 4PODA 4B15A 1ZP4A 4XQ6A 5FJPA 1G69A 4GIRA 3CL8A 1EXBA 2CFFA 3QFWA 2Z2UA 5ECVA 1DVJA 4MZYA 2DH2A 2YFNA 2H6RA 2GL5A 5G5IA 3CHEA 3FNDA 3T4CA 1V08A 2YX0A 2J7DA 4AX7A 3CK5A 3QRHA 4MPQA 3EB2A 1KW1A 3LLFA 2HVOA 4NX5A 2PDJA 4RV3A 5IDZA 2VMFA 3W1LA 4UQEA 3KRZA 3ARTA 3W2JA 1UZHA 3MW7A 2BVDA 5I3KA 4DYKA 1M04A 3GXFA 1NQ6A 1XF0A 4BA0A 3M1ZA 3K8KA 3C2YA 4WKAA 3R79A 3KVMA 4EAYA 4AYGA 5LZLA 1GJWA 1RBOB 3QF0A 4F79A 4V28A 5KZMA 4L64A 3WK3A 4M56A 1F6YA 4ZTYA 2ABAA 1F5ZA 4AYSA 1DTUA 4QSHA 1JDDA 1WZMA 4ZVJA 4PMYA 4L56A 4LJ3A 5K9DA 4S3KA 4QEEA 4BY3A 4KWOA 1FX6A 3QHNA 3R1ZA 4Q7IA 1G6CA 4LC8A 2V5DA 4MWAB 3LPPA 1K1DA 3V18A 1B30A 3IJ9A 4U3AA 3C0SA 1GPWA 4WSKA 2PGWA 2B7NA 4HA0A 4YL2A 3V5FA 2B7PA 1S5VA 5JH2A 1KRBC 4AZHA 3HQOA 1Y8BA 4ENLA 3MVIA 4KGLA 4GE8A 4I9JA 3A9IA 2CPUA 2D20A 4ERIA 4PMUA 2EPHA 1FCBA 3GQYA 3R12A 3LZ5A 2CKSA 4HU8A 2DZPA 2Y89A 2BB0A 1GTEA 2W9MA 1ADOA 4LUTA 1P1XA 1CLXA 2CESA 1UKSA 3VAVA 3ZQ9A 1W3KA 4UQDA 4UTFA 1GW1A 1XC4A 1S2CA 3MPGA 3N18A 3MO7A 1QNVA 2FMOA 3TV8A 1E9IA 1EWDA 4WLCA 3Q94A 2OYLA 3AZTA 4NF7A 3UCQA 2WV8A 1QI2A 3P5YA 3W72A 3CQHA 3OVQA 4Y9NA 2CLPA 4GQ0A 1B3VA 2R1PA 1JZ3A 2PEVA 4NP7A 3MB9A 1J6PA 4QG9A 1LL7A 3A64A 4HBKA 4O1CA 4AWUA 2C71A 3FXYA 1DWAM 4XWUA 2PF0A 3L4YA 3GXMA 4MWAC 2P3ZA 3ITXA 1PYFA 3EEGA 4P5UA 4N6FA 1J8VA 1V8EA 3VOJA 1XCFA 2YBVA 3ZT6A 4EPBC 2E40A 1XBYA 3REQB 3AI0A 5CH9A 3FJNA 1MUWA 3WLLA 5AHIA 3VKKA 1QWKA 7ENLA 5LGXA 5FD0A 4XD3A 2H9AB 3M5ZA 5HPCA 2E09A 1ICSA 3VGGA 1AZ2A 4G2DA 4JR5A 1TIMA 3VA8A 1ZHAA 4B4HA 2IKJA 1FTXA 5AHMA 3DBNA 4PTDA 2P76A 3TJ4A 5G4WA 5B7ZA 3OGVA 1H7WA 3IGHX 3IPWA 2OLSA 1GYLA 2CNCA 1UROA 4NSBA 5FJOA 2QYGA 3UZWA 1N82A 4F0KA 1KLZA 2EG8A 2ZA3A 4KEUA 4V27A 4MG4A 3G3MA 1EFZA 5L6UA 2BODX 4IFOA 1KWKA 1A5AA 1XLMA 4GNKB 3LQGA 1YDOA 1OFQA 2HCVA 2NQHA 2OWXA 3E49A 1V6UA 4IISA 1EX5A 2CC0A 3PUEA 2HK0A 4XBKA 3R8GA 3KCOA 2QCLA 3WQEA 1PL9A 3W6LA 1XPYA 3W86A 3LXBA 5REQB 2X05A 1A5NC 2XH2A 3CAKA 4JHMA 4O0KA 2FZDA 4O1EA 1OABA 1MMFA 5IM51 3SR7A 3RCYA 4D6HA 4UTMA 1BRLA 5DELA 4IQDA 3ITLA 1W1B1 4INFA 2QXWA 3BV7A 5AYBA 3PSWA 5CPTA 4CNSA 1SSGA 3BICA 3PULA 5EB8A 4CEXC 1NFPA 4DJED 3B0UX 3W7IA 4MGGA 3VGDA 4ZA0A 3BLFA 5CZKA 3HTWA 3DHDA 2PGEA 2E5CA 5BW6A 1HTIA 5DO8A 2G3FA 1GVYA 2J27A 3ZM8A 1W1PA 4J35A 2V81A 3MJMA 5ABGA 4IUGA 2OEMA 1CGYA 1OGSA 2Z27A 3LXCA 3WYZA 3V0TA 1MW3A 1NWUA 1BGAA 3N9SA 3CNYA 4QSFA 3EDKA 3CEUA 3PZUA 5TAOA 1MQQA 3GDBA 1J2WA 4AD1A 3VM5A 1VJZA 4GYKA 4AFYA 3H4GA 4I8YA 1M5WA 4XKYA 1V3IA 3LS9A 1Q8AA 5C2XA 2YBTA 2DIEA 3WJYA 1FH8A 1E3ZA 1W3TA 2WSQA 3NNTA 1F2JA 3UYCA 1T41A 1B3YA 1KBLA 1ECQA 1IV8A 2CBIA 1UH3A 3KBMA 5I3IA 4WDWA 1N8WA 4YTQA 3DUGA 3TU9A 4G1NA 3THCA 4LC6A 3KAOA 4A3YA 3TCEA 1RALA 1VFMA 2VEIA 2X1UA 3T81A 2P0OA 4JCLA 4NJJA 3MKCA 4PMXA 5K9CA 2YCIX 5BCAA 4JX4A 1SVDA 2EHHA 2ALRA 2PTDA 1AH4A 2WCSA 4Y96A 3H2MA 4MVAA 1X7FA 2X7WA 3FJ4A 2VCAA 3O3RA 2Q8LA 4B5TA 1XL9A 1RXOB 2VZUA 4UMAA 2J7EA 3CASA 3HG5A 5J5DA 4X2RA 1PXGA 3ARYA 3I3BA 2WO5A 2WOQA 1WDPA 2OFJA 1ZS2A 4YVPA 2WJEA 3G1AA 3U6WA 2ZZ6A 3UD6A 2R1NA 4MWAD 3WF1A 2GJXA 2D23A 3ITVA 4Q3MA 3VNMA 3SUUA 2VZOA 1LBLA 4HOWA 3WDIA 3G0UA 2VQTA 3VDAA 4NNAA 1J0HA 5FEWA 3UR7A 4I9TA 3TK7A 4GKLA 4GCXA 3U5UA 3K8MA 1THFD 3W2MA 2WNZA 4UTWC 3J7HA 3GDRA 2J7CA 2CWXA 1MDLA 1QWGA 1HGWA 1XISA 1GYNA 1QNOA 1H1YA 3V36A 3VIKA 1EC9A 1P0EA 4E3VA 2YSWA 2P10A 5DEZA 3N4EA 4QJ5B 3NQMA 3WQ5A 1LWIA 3W38A 1XRSA 1NM9A 1BKHA 3AMDA 4Q8NA 3U2EA 1L2QA 4ZQRA 2BS9A 1RPXA 3NURA 3WSUA 1ZNNA 3W70A 1KM0A 4C60A 1NDYA 1OGGA 2V63A 2FLIA 3AYTA 2X1RA 4P2VA 2ACUA 3B8DA 2VGFA 2YLLA 4J27A 2BHUA 1MW0A 3GNNA 3E96A 2OWWA 1PHQA 2OCZA 3VUSA 1GEHA 4DJFC 2FB3A 5BWAA 5CGTA 1RH9A 4NXKA 2VVNA 3I7RA 4IXHA 4CD5A 4FNQA 2YA2A 4DUWA 1M3UA 3HFTA 1KTNA 4UOJA 2GOKA 2WQPA 4CVWA 2ONEA 4O8AA 1S5WA 4IPIA 3M0IA 2A6LA 2TPSA 2HVMA 3BLIA 1JZ5A 3QV6A 3N6QA 5AHNA 3KZSA 4FF5A 5FACA 3UJ2A 4RXGA 4LAMA 3MY9A 4MTVA 1SR0A 1FWJC 3H2FA 5DRCA 4C6DA 3N17A 3NFUA 3M5VA 1AG1O 3MUY1 5AC7A 3SSJA 2W0UA 1CXFA 1QRQA 4IIEA 3IUIA 2X41A 1AODA 5C7VA 4M6UA 1YYAA 2QUUA 2XDFA 3GXIA 1ONWA 2NX1A 1J12A 1EGZA 1OFPA 1V3HA 4LY4A 4LVBA 3E02A 3LHZA 1YDNA 1RBLA 2A3EA 1IXPA 2OZ8A 1L6WA 5K4ZA 3G1XA 2BVTA 3LTPA 4JTKA 2OX1A 4CNUA 1NY1A 3VDHA 1EJXC 5DQPA 1K9FA 1PJ9A 3AYVA 2NQ5A 3V4BA 1SW0A 1A50A 1D2KA 1XCWA 4XD5A 5CSYA 2IUZA 2VC5A 4QEHA 4FX8A 2O0TA 2PB1A 4O50A 3W07A 1G4PA 1WKDA 3W74A 1K4GA 4GIEA 3VO0A 3PNUA 4QR6A 1SO6A 4ZXOA 3UZYA 4JTFA 5A6JA 3CT2A 3ZSTA 4DNHA 2OSWA 4G1KA 2ASHA 1VAHA 4DWSD 4XAZA 3ZYZA 4FEZA 4RJEA 3PBWA 5CPMA 3V3WA 5DF0A 4B2DD 3DGBA 2FYMA 5U4NA 4HTYA 3KL3A 2WNNA 6REQB 3SRFA 4K2SA 1NELA 4EE9A 1XD1A 1N55A 1FKWA 3U2OA 3M16A 6TIMA 3TYAA 1XP3A 3UF9A 5A8QA 3WD2A 3M64A 3B4YA 1UR1A 2BOGX 1QOXA 4D9PA 3BL3A 2FDMA 3CC1A 4F0HA 4Q8TA 1FWNA 1EEPA 4U4MA 3JVAA 1SO5A 4LOCA 2ACSA 4S2BA 2R14A 1DPMA 2X7VA 2I5GA 4CCCA 4RDVA 1PUDA 1ICQA 2HBXA 4UFJA 4HHMA 3W7OA 1HKWA 2VI0A 4JXCA 1RAKA 3CQ0A 1I1XA 1GQJA 1W1ZA 1VBHA 2ZZ3A 7A3HA 4RR4A 5HJYA 6XIMA 2JKAA 3TX9A 3W2UA 5GJNA 1KV5A 1W1YA 3QC0A 2O92A 4WOQA 4Z2IA 2H9AA 3ABSA 1IEWA 4H9ZA 5EL1A 4H7ZA 4UR7A 1H7OA 3VC5A 1M68A 3UVAA 1AW1A 4GJ1A 3USBA 1FHUA 4AEOA 3IGXA 3SFKA 1WDDA 2BY3A 3GW3A 3NL2A 1TMHA 4A22A 1BSLA 1YTEA 1ZBWA 2ZVIA 3FAXA 2FH6A 3M07A 2E8YA 2LLEA 5E6YA 4B4FA 4ZMGA 2DT3A 4AZBA 2XZ9A 1O5QA 2X0HA 4FNSA 5I2UA 1FWWA 3XINA 4X60A 1DE5A 3WK2A 3NPXA 2PRLA 5K3VA 2R1MA 5HBFA 1YW1A 4DJDC 3MUZ1 1I2NA 4XIMA 4ROPA 3EPNA 4HJFA 2RDUA 3N1AA 4P7RA 3GTHA 4KW2A 1Z44A 4NNCA 3S9ZA 3FA5A 4ERGA 3G5EA 3WBYA 5AB3A 1WXJA 2PWVA 3W1QA 3BDKA 4DAIA 5EA9A 4DUOA 1OGBA 1QPOA 5A1AA 2O7SA 3LZ3A 4GWEA 2PGFA 4F3HA 1EF2A 4HA1A 1QHOA 1DJZA 3WNKA 5C70A 4IFRA 4LNCA 1W32A 3L4ZA 1OYAA 1HVXA 2GDUA 3WNOA 2Z1XA 2GJNA 1X38A 1EXPA 2BXVA 3OBKA 2KZHA 1TO3A 2P0IA 1XGDA 1WX0A 4G7EB 4ZSTA 2QDHA 1FWTA 3CV2A 3VE7A 3UR2A 4Q4PA 1FCVA 3O6CA 1HL2A 2E5BA 1HP4A 4KCWA 2A1YA 2QPUA 4M81A 4QQ3A 4WKHA 3ZZ1A 3T0BA 5CC6A 1EJSC 1PX3A 1DYSA 3FKKA 5HULA 5F4WA 3QQ1A 2W5FA 1ZJHA 3MYOA 1Z48A 3RXZA 1C8QA 1DIKA 5AYZA 1IIGA 4TTUA 3SIZA 3AIBA 3MP4A 5GPRA 3DDMA 3OVGA 4CVUA 3FK4A 3PJWA 4QQUA 4IGNA 1P6CA 5DCEA 4BF9A 3OQEA 3W7RA 2W6RA 3OW1A 3RCMA 5FL1A 4OTKA 3FX4A 2VHLA 2YXGA 2DZXA 3VIGA 4LX4A 3CAVA 4HPGA 4UQBA 1UWRA 2HROA 3ECQA 3AXKA 3A4JA 3FA3A 4C6BA 3KOYA 3GBEA 4RDWA 1EP1A 2PSNA 4FOUA 3O6AA 3AICA 1ZZMA 1VFUA 3CV1A 5EYWA 3ARSA 1SYTA 2A79A 2PDLA 4UFHA 1WKFA 1NFGA 2WNQA 1X98A 3F03K 1C9DA 2A7NA 4C65A 5LNSA 4IMGA 1XFBA 2BZNA 3CAQA 5D38A 3BLKA 1T8XA 2HPMA 3DFTA 1ML1A 3B0PA 1CNVA 3KEHA 2ZUSA 4F48A 1QPRA 4UNIA 3FDGA 3W2LA 3T42A 4A2SA 1L6SA 4PCPA 5H6HA 1A3XA 2QHAA 4F66A 3DGRA 3R0KA 3VX1A 3EOSA 4DYEA 3SEPA 3ITTA 1JDAA 1AMYA 1UWUA 2UY4A 3CHFA 5F2IA 3SJNA 1IXOA 1E6ZA 4CU7A 2J77A 4PGLA 3KOWA 4J3XA 4AEEA 1EDTA 2AAAA 1E9LA 3BLDA 4NX0A 3GIYA 5FOOA 4IWWA 5D04C 3GVRA 3NEHA 3E0LA 2XM2A 1Q6QA 4ATDA 3STCA 3AALA 3W3OA 1I8JA 3E0FA 3GFYA 3A24A 2DZAA 1MRAA 4B3ZA 3IV3A 3VDBA 3WEMA 3LLXA 4ZO8A 3R43A 2WZMA 4AY1A 1OC7A 1PIFA 4OBRA 4JTQA 1JCJA 2CBJA 1EOMA 1CLVA 4LW7A 4EOUA 5C5YA 3PBUA 3AWNA 2GSHA 1W31A 2PODA 1L9WA 2B0MA 3GDLA 1ONRA 1MFUA 4HNVA 2XFRA 4IXXA 2I1OA 2DY3A 3W76A 3G1SA 2VTFA 3UZZA 4DQWA 2CWNA 3FA4A 1SR9A 4DXKA 1R38A 1Q6RA 2D0FA 1SJDA 3GZ3A 3MZ2A 4DZAA 3WLRA 3SZ8A 3KM8A 1KQYA 4DM2A 3DOPA 4EAMA 2ZADA 3P61A 1M6JA 1Q45A 2C79A 4N4QA 1NTHA 3TC6A 3ZO9A 4PMOA 3RO6A 2JKEA 5B80A 2V8ZA 1N8IA 4L61A 3SCPA 2F6XA 4AH7A 4KCUA 2CZFA 2PDWA 4NZCA 1KLYA 1Y0EA 3T78A 4TIMA 4MMWA 4ZEPA 5JIWA 2OSXA 4Z17A 1J5SA 4KWSA 4CCZA 1M7JA 2G5WA 3L9CA 4MYAA 2V30A 3WF0A 2V2DA 1OFRA 1TMQA 1UWTA 1DXEA 4I3GA 2EPMX 1G1YA 2ZICA 5BOFA 2OR2A 3BGJA 4C7DA 4GYJA 2Q3OA 3HMJG 3IS4A 5KEZA 4J4KA 2BP1A 2WHLA 4C6KA 2QMKA 3MMWA 1W8SA 4V1YA 1E55A 4HP5A 2FJKA 4LY8A 1W54A 1TR9A 1CCWB 4JN6A 2YYUA 2Y63A 4TQTA 4R27A 1PYMA 4Q4RA 1TJRA 5T9BG 2PPGA 1H49A 1HL9A 4UTUA 1M01A 2G50A 1CGTA 3AHVA 1V0NA 1XDLA 4FHAA 3SUSA 3U57A 4L80A 1W9DM 2ZE3A 3U7BA 5DCDA 4UOQA 4MWAA 5C9ZA 2GZXA 5DXYA 1PS9A 2GSEA 4C6PA 2Y85A 3BSMA 3LCHA 1RJRA 4DY1A 2ZC1A 5AOUA 4H7CA 5EMYA 8RUCA 3W37A 3RLVA 4WKFA 3T40A 4TVUA 2RKXA 3DU0A 1ZJAA 3TDFA 1UWQA 1RVGA 1YMYA 1E0XA 1XSIA 4J3TA 3CAWA 3P60A 2QIIA 4NZFA 1IT7A 2F6UA 2Y8UA 4AMCA 1QBBA 1LT8A 2CETA 4ZODA 3PTKA 3G6MA 2BGSA 2D69A 3N2XA 2EBNA 2GVYA 4GVFA 4EKJA 3VNYA 3SDOA 2AL2B 1VIZA 3P6LA 3I6EA 2PRMA 1OFAA 4IG2B 2H8ZA 3TLLA 1Q4WA 1X97A 4IPJA 4JS3A 4AW7A 4JNMA 1H09A 1XCXA 3S0CA 4BI7A 1J10A 1TCMA 4JEQA 1A3HA 2PDXA 1I2OA 3S5NA 4CUCA 1A80A 5FF7A 3THAA 1AUSL 1DQUA 2ZBTA 4PRWA 2VP8A 4JHOA 5AC4A 3UCCA 3ITCA 1DJXA 3INPA 2PE4A 3HPAA 4IJCA 4PBGA 3B04A 3CH9A 2R91A 1WDSA 4HQVA 1LM1A 1UH2A 1WXYA 2WKLA 3UNDA 3PBGA 1UW9A 2XIQA 1CYGA 4LPCA 2IPWA 4ROQA 3UWYA 4LYPA 3Q45A 4RZBA 3IIVA 4UOZA 5LA2A 4QDWA 4W8LA 1X8CA 3QHMA 4KEVA 4N9EA 3A5VA 4KF1A 2Q09A 1HP5A 5FJRA 3I10A 4LAUA 3HZ3A 1CXKA 1M9HA 4BJHA 1VEPA 4Y7EA 3C0LA 3W6YA 3N13A 2OODA 1KA9F 3M46A 2VFEA 2A3AA 4U3CA 3LNPA 4I5RA 4PMZA 1PAMA 3OBAA 1JULA 1EDGA 3U2ZA 1CB7B 3TZNA 1QI5A 3IAQA 3W1MA 1R87A 3S5ZA 1AQ0A 1TYGA 4QROA 2HNEA 3VOCA 4KPLA 3Q2DA 4Y9MA 2WNWA 4DPQA 2J78A 1EGMA 3GHTA 4HNOA 5CQ1A 2YB1A 3DBPA 3STFA 1BWVA 2WSRA 3IVSA 5E93A 4W8BA 3K13A 4S1FA 5G2WA 3UR5A 4UQCA 4LYRA 4P8WA 3SQLA 4UTLA 3L0NA 3AHZA 2HSAA 3BZGA 2CXGA 4I7WA 3WBWA 2VO5A 2J9ZA 1KBIA 4YNGA 4K8HA 2DVTA 3NSXA 1Q8JA 3K1GA 1OFEA 5I3DA 1ZSXA 1PWMA 3FGCA 3PG8A 3BH4A 5AHEA 2WZTA 3R8RA 2VELA 3D3AA 4IPPA 1R9XA 3GFZA 3GKFA 1S2UA 2RDTA 2VT0A 3RU6A 3W82A 3M0HA 3VOGA 2Y1HA 3S1UA 3TYZA 3Q37A 3WLOA 3VU2A 4HVXA 3NJ3A 3VD4A 1BD0A 1DJYA 1YDYA 3Q58A 3VMPA 4NI8A 2J88A 3SFWA 3GG8A 4HPHA 1GOMA 2BGQA 3W1NA 3KBSA 2PU1A 3G1RA 2RJGA 4AZCB 2QJHA 4JICA 3R58A 3DAQA 4H6KA 2QCHA 2FIQA 3WFZA 3PAJA 1KM5A 4LEFA 3S6OA 4ZOBA 3WDRA 5A8NA 2NV2A 2OZ3A 1PZ3A 4F2UA 5EMLA 5IXEA 3NQ7A 2GJPA 4LS1A 3TONA 3W7HA 4GUIA 5C9UA 1XHGA 1E1CA 1KFKA 3QSTA 1KFCA 1H0IA 3W71A 2VFIA 4FP1A 4U10A 2V3GA 2R9RA 2NXGA 3P8JA 1TRIA 3PZOA 5A2CA 1WXZA 4AWTA 5I0DA 1TELA 3SCSA 3NXLA 1OZMA 2ZRXA 4ZQOA 1VH7A 1L6GA 2JE8A 2GQ8A 1R47A 1VQTA 5A8MA 4BI5A 2WK2A 1ISXA 1FH7A 4FR6A 2REQB 4YIWA 3CQKA 3RM9A 1GVFA 1EO7A 5C55A 3KS6A 4UFKA 8XIAA 4P61A 4GZ7A 5D37A 2C1HA 1HXJA 2WJDA 1K02A 3W1XA 1XIMA 3C5QA 3T2OA 5A6KA 2XH0A 2QAPA 2V68A 4R9XA 2V5KA 1J11A 2ZXQA 1DHPA 4C91A 3B03A 3TN6A 1OY0A 2CCRA 4R7WA 3VXGA 2W91A 4LUIA 3KW3A 4QISA 3W7DA 2NX3A 4Q33A 5BRQA 1ZAIA 5EBAA 2G3NA 3NYDA 4HPJA 2ZKMX 2XIMA 3KX6A 3AISA 2XFFA 4JTGA 4C6IA 1XYCA 2V3EA 1AMKA 1G7UA 3RDKA 1SFSA 1XIEA 2XVKA 5CBJA 3VABA 1B2YA 2CLEA 1JDCA 3ATYA 4CD7A 4WHBA 4RV8A 5JQ9A 1X7IA 2WHMA 1FXPA 5BNKA 3MTWA 2PGRA 2J25A 5CJNA 4N0RA 1MVYA 3GNDA 1V3KA 3BSHA 1JNEA 3ISIX 4OFCA 3LNMA 4AB4A 4HCLA 3GIQA 3HIJA 4HOZA 1DE6A 3EOEA 3W84A 1VLWA 4LU0A 3HPSA 4S3CA 1TVNA 3WBXA 4K1WA 3S9YA 3NUKA 4GY1A 1SZFA 3B0XA 3G18A 1XKJA 1KFEA 2VYOA 3UWEA 2VX6A 3VNDA 2V69A 2WBGA 3EWZA 3P7YA 1ESWA 5AFDA 3AHXA 3ARVA 2ISDA 1TJ0A 5E9XA 1QPNA 5BRPA 6ALDA 1Z89A 2PWFA 3HFYA 3U2CA 3TTOA 1Q66A 1V6XA 1GUVA 4OQVA 4ADSA 1CX9A 1D8WA 2GSJA 3N2MA 1ONXA 2G4FA 2WKJA 2GGIA 3WK0A 1Q7QA 2RDWA 1EF3A 4NZ5A 4UTTA 3LY0A 4JPGA 5FSDC 2JBMA 4NAEB 2AKZA 4LBSA 3ZVIA 4IM4A 4LAOA 3ENLA 2QDGA 1UR9A 2CLIA 4K8GA 4XIAA 4I5XA 3FEMA 4GQRA 3ANVA 3L4XA 4FX6M 3QMSA 1EA0A 1DV7A 4D6CA 4BQ5A 1O5KA 3TNOA 4A6GA 3URAA 3VNJA 5A3HA 3TTEA 1TWZA 3I3EA 1OCQA 3EA2A 3CQJA 2VUNA 4E8GA 1GVIA 4RW3A 3MSDA 2P1FA 2DPEA 5LNWA 3RAOA 3CL7A 3C61A 4MKSA 4H9YA 4OWGA 4O28A 2FGZA 2O9PA 3NM1A 4AVOA 4QCFA 4L6OA 2QGHA 3KZPA 4WZHA 3RRXA 4MADA 1VKFA 4AWSA 4PN2A 4UUIA 4WJEA 3VOIA 4M1BA 4F4RA 1ISVA 4UZSA 2XZ7A 4PL2A 4HIBA 1F07A 3PZIA 2P88A 2HV5A 1ZBKA 2GUBA 4IICA 1GONA 4DLMA 2XN2A 3UA3A 1V0KA 1XLCA 3W29A 4IT1A 4X9SA 2PDPA 2EXOA 2WW5A 3ANYA 3M44A 1OEPA 4UFLA 3IJ6A 3KWSA 3AZSA 3QYSA 1JVNA 5HJXA 3WIJA 1JFHA 3CO8A 1UP2A 1CENA 1C8XA 1OFBA 3PPCA 4WRHA 3EMQA 1JG9A 5G4HC 4GHRA 3EOLA 3MHGA 1AVAA 1DJIA 3AHTA 1TTIA 2ZYFA 2Q02A 5A6BA 3EXSA 3PHAA 2W3ZA 1OZQA 3M4HA 4KBXA 5C71A 3PUOA 2IKIA 1YQ2A 2QVHA 5F1UA 2G3MA 4W87A 3T2QA 1FWBC 3EX6A 2BNJA 3LCGA 3UYIA 1PZ2A 2WSPA 3AXHA 4UCFA 2QCCA 3F5KA 3FN9A 4M7SA 1XH0A 1EDQA 2Z7GA 3GNPA 3FYOA 3KS5A 2E67A 3DG7A 2OLHA 2UBPC 1YKWA 3H6OA 1TA3B 3NZRA 2GVEA 1BF6A 4LUTB 5I00A 4FZIA 5JBEA 1RCOB 3ES8A 2J66A 3CHVA 2YW3A 3FS2A 1ITXA 2Z1KA 3EPOA 2QLYA 4Z1YA 1VRDA 2POTA 2GGHA 5CG0A 4RW5A 3QN3A 3VI2A 1XLHA 2DZVA 3RYSA 3EEZA 4E4FA 2C0HA 3WQVA 4MLRA 1IWPA 3MP3A 1TPVA 3KXQA 3R89A 1VBUA 4PCNA 1C93A 1UZDA 2HK1A 4LGXA 2VDHA 1X6NA 3ZT7A 1OJXA 4FXSA 3P5ZA 4YYFA 1GNXA 1IZCA 1U1UA 5D2TA 3L4WA 2ZUWA 5HWMA 4JYDA 2DP3A 3OZYA 1VYPX 3PANA 4XZHA 1VHNA 2E68A 3SCNA 4KCVA 2Z6JA 3GH5A 3PFRA 1WOBA 4JTLA 3THDA 4KH2A 1AH0A 1M1BA 3I3DA 3VZYA 3P0XA 4H9MA 5FKYA 2Z1BA 3M6DA 1GG1A 1NOWA 3QZAA 4W89A 4NU7A 2PP1A 4MY1A 5AKQA 2QUMA 3CWHA 1WAUA 2GGJA 4GACA 3A23A 1JDFA 4QJ1A 3E3HA 4O15A 1JF5A 4PRRA 1W5NA 1JD7A 3VIPA 4B90A 1RZMA 3PZMA 5J5RA 4ECLA 3UGVA 4PTXA 1UD4A 5HNUA 3U4FA 4CQCA 1XYMA 4C6QA 4Q8MA 1JYNA 3UG5A 3H22A 4XVEA 4RX0A 2ZX9A 1H7XA 1BYDA 2ZZ2A 5EY5A 4ZO9A 2IW0A 4A05A 1NP2A 4Y8EA 1ME7A 4FI4A 3VIIA 1EKOA 1BVWA 3EZ4A 3G3DA 2IPGA 1IQ8A 3EKLA 3QQ0A 3AO0A 2IXVA 2QZRA 2X42A 1L6FA 1AQFA 4CN1A 4IMEA 1KRCC 2VC9A 4K39A 1CTNA 4HSHA 3O15A 1KM6A 3R6IA 3CZJA 1C8YA 1JRCA 1S2TA 4X0VA 4D1IA 3IJDA 2Z7KA 1SO3A 3B8TA 2V2CA 4K38A 2J24A 4YWSA 1QPQA 4MKNA 4HK5A 2O55A 4TOQA 5KETA 1XLGA 2NX9A 2OOFA 4XZNX 4WDUA 3LRLA 2NVDA 4YVVA 4C6EA 1GVQA 4OU1A 2EPLX 1IEVA 4PUEA 5DFAA 4D2JA 3N6HA 3CIXA 1EUNA 3WK1A 3B8VA 4QXIA 1UASA 3VKAA 4JTEA 4WJXA 4U2YA 3APYA 2EQDA 1XLKA 1F4AA 4AU0A 2GVGA 2W79A 2PTYA 1GOKA 2QF7A 2VFFA 3E38A 3QY7A 1QI3A 3BXWA 3GVQA 4Z2HA 2GQ9A 1K7XA 3T8QA 3KOXA 3QHOA 4D6EA 3EA3A 3FHQA 2XSXA 3ZFHA 2PLCA 2YZ5A 3KDNA 1PWLA 4XTIA 3PWAA 2B31A 3JR2A 3TJIA 2DUZA 1HL8A 2PDFA 3DFYA 4A29A 3T0DA 1P48A 4JEJA 5A69A 1EYWA 3D47A 4NJKA 1R30A 1RLDA 1FBAA 2X16A 5T91A 1QXLA 2GK1A 3UXDA 4UTHA 4O1AA 4S3GA 4QAWA 4WGXA 4UMCA 1YIXA 4PL1A 4FMVA 1EUAA 1L8NA 1RP9A 2QJIA 4NYYA 3CLMA 2G97A 1QI4A 3CMGA 1NDVA 2C1GA 5FF0A 2JKPA 2PS2A 2DQXA 4IIDA 4WVXA 3WQ6A 2I56A 1E6PA 2HE5A 3BARA 3TYBA 1TPUA 4PRTA 4QNWA 1MYRA 3BMVA 3A4WA 3P62A 3RMEA 4Q8UA 1I0DA 2QR6A 2XIBA 3PM6A 2WMGA 3P8IA 1K8ZA 4TU1A 1XIDA 4Y9AA 3MT1A 4DJDD 1B57A 3WLQA 1US0A 3BQ6A 3GIPA 1Q5MA 3IJ7A 1LJYA 3KBVA 3L0KA 1GVRA 1K7EA 2OGYA 3MDWA 1E0UA 2C1IA 4W93A 3PJTA 3VKDA 2PDYA 2NW0A 3LI0A 1PKNA 3OHIA 3H2CA 5J8LA 3OLIA 4JTTA 1VFSA 1TB3A 4XG1A 1KRAC 4LV9A 4OT7A 2NSXA 4LH8A 3AXMA 1GKQA 3W0KA 1GHRA 1W91A 4AY7A 1ADDA 2DDXA 3OGRA 2PCQA 4L9ZA 1EL3A 4CD8A 3DG3A 3GY1A 1LOQA 3QOKA 5F4XA 2VFDA 3RG6A 1VEMA 2Y5SA 3QZ6A 5A95A 3WLKX 1QUMA 1V7YA 1ITUA 5DMMA 4DBWA 3R4IA 3GWQA 4AVFA 4S38A 3UA4A 3HG3A 5GNYA 1D3HA 1QNQA 3APGA 5DLCA 4N9DA 4GXWA 1EC7A 4LF1A 2V5LA 2FZ9A 4ZXLA 1I0BA 3IGSA 3TEVA 4M29A 2WWDA 3DHUA 1MFVA 2I16A 1A0EA 4TUFA 1BWKA 4PEKA 3KL0A 4HU3A 3VC6A 3KOFA 2HTMA 2OTDA 4WY0A 3WNLA 4RPQA 3CM4A 3VILA 4G5DA 1VD6A 3N2CA 3CPGA 4RKAA 3H4WA 1DOSA 4HA3A 2JGQA 2CHOA 4K37A 4MM1A 1SUXA 1W5MA 2VEFA 3VNKA 1LBMA 4HYWA 1RHCA 7TAAA 1VIWA 4CQAA 1GW9A 2F2KA 2V9DA 2Y4SA 3MV11 4PUJA 1S3HA 3GFXA 4AD4A 3FW6A 4C5ZA 1L0PA 2Y8KA 3G1FA 4Q4KA 4BF5A 3TIMA 1MO0A 4AHOA 5I78A 4UQ9A 2QUVA 1JI2A 5M2FX 3A47A 2DJXA 4MFEA 1QPKA 5CKSA 1E9ZB 1Q6DA 4KETA 4I6KA 4O1FA 3DX5A 5HPOA 1ADSA 5HDRA 3M5YA 4C1LA 5E09A 4JHZA 1WE5A 3P74A 1TA3A 4K1GA 2AMGA 4NJHA 5F2LA 3V5CA 2E6DA 4J2MA 2YKKA 3SO7A 3QZEA 4GC4A 4X2PA 3QTPA 3ZJ8A 4C5YA 3WLSA 2ODOA 3G77A 3QSRA 1OK4A 3FJLA 1SFJA 2ZUUA 4N42A 2QCNA 4RE4A 3D6NA 4NVTA 1OCBA 1PV8A 3STEA 3AQUA 1OINA 3O0FA 4XZ9A 3RPTA 2Z2BA 2A3CA 4UMBA 3H23A 4Y2WA 1FFQA 4PTWA 1XLLA 2YDSA 2PUZA 3VIMA 4H9UA 4O57A 3L68A 4AY8A 1OWQA 3MHFA 1F73A 4GK8A 5I23A 1XR2A 3BTNA 2BMBA 1LL4A 3T05A 2VFHA 3VE9A 2WHKA 3WLHA 1BXNA 3W81A 1LCOA 3HV8A 3W7NA 1PKYA 3V7PA 1IXQA 3LSCA 3FJ6A 2YCLB 3KRSA 4RE0A 3SGZA 1FP9A 3UCDA 1VFFA 1LL6A 3OYZA 4IJRA 4CNNA 4Q6JA 2VQUA 2ISVA 1RCQA 1EYEA 1B3XA 3ALGA 1A49A 2XVGA 4BFAA 4QDMA 1Z32X 4ZOEA 5AY7A 1W37A 1B3ZA 2BY2A 5CGQA 4XB3A 1CGWA 3AUJA 3DEQA 5LIWX 3SY8A 4GBUA 1SZGA 4A3RA 3W7EA 4DO5A 2V67A 2UV8G 4HPNA 3BUVA 3ZSSA 5AYXA 4OE7A 5HQMA 4X61A 2DT2A 3E2RA 3CGTA 4Q8VA 2D2GA 5HUPA 1WO2A 4GH3A 3TOPA 6A3HA 3MSYA 4LQ1A 3CXOA 4A35A 1H5VA 5DBTA 2XSBA 4GZJA 4S3BA 4MNMA 4CQ8A 3W73A 3QEZA 2AQOA 2VRQA 3DENA 2FGBA 4A8IA 4LCRA 1DXFA 1LWJA 4PUMA 3ERPA 4ZENA 5EBUA 3QOMA 2G4JA 5KITA 3QPEA 2ZTJA 4G9PA 4YLWA 2J6VA 1JAKA 4W84A 3CEPA 2Y24A 4MPKA 1Q3NA 3DFNA 3N34A 3DERA 3U5YA 1JQVA 4IIGA 4RNJA 4HA4A 4QTGA 3VNIA 4DZ5A 3W23A 3ZJ6A 1UKPA 3L67A 2QUTA 1BF2A 2DGAA 4D6IA 5I3FA 1DJNA 1S2VA 2DVXA 1NWTA 3BLLA 2EG6A 1UZ4A 4DN1A 4PTVA 4XX6A 3P14A 3PVFA 5LKYA 3T2PA 3BCFA 4Q8WA 3VIJA 3DIPA 3O8AA 4MY9A 4L4PA 1UR3M 1R86A 3CMJA 3RJXA 1XV8A 3WJXA 3WEOA 4OGZA 1P7TB 1FCUA 4RLIA 2ATMA 4DXVA 3AIEA 4GI6A 5HWJA 1R6WA 2GUUA 2DSVA 1JPHA 1CIUA 5C8BB 2XN0A 2GVLA 1GPFA 1BG9A 1VGAA 1TTJA 1ISWA 3FAWA 3EWUA 3LHTA 3W9ZA 1M53A 3NVDA 1MXGA 2J13A 4FNRA 4H19A 4PUKA 5AYYA 1XLAA 4CNTA 4YWIA 4B5NA 2FZNA 1KWGA 2EEXA 4FNUA 2XU2A 3M7SA 3UETA 4RL3A 3O06A 2VGIA 3EWDA 3L2MA 2DSWA 3L5AA 5JXQA 2BASA 1E0VA 4W5UA 1FA2A 1RQEA 3BK0A 1P43A 3WUBA 2NXIA 1GJUA 4W9TA 3TWAA 5LNUA 2BWGA 4RZ5A 1ONEA 4WDTA 1WBHA 1US2A 3TMQA 1TWIA 1XG4A 4JDYA 4ZQNA 5EMJA 2KX9A 1TPC1 3UFYA 4Y9OA 1WDWA 2OB3A 1A4LA 4ORMA 4AVNA 1SZNA 5D9NA 3SM0A 1WPCA 4XAGA 3MKKA 2QCMA 3E9AA 4HJWA 1V79A 5CXPA 3NDZA 3H26A 1UJPA 4PB3A 1EH9A 2WM1A 4LEQA 1U5HA 2XG9A 3MCNA 3T6CA 1JYXA 3GHRA 1TV4A 4S3EA 5E1QA 3BJTA 3KLLA 4E4PA 5HNRA 1NVMA 3P0WA 4HYVA 2HDJA 2F2HA 3UWUA 4C6OA 1IT8A 1MRQA 5T9CE 3ABZA 2QJMA 1KFJA 3REQA 4E0CA 3WG6A 1Q7ZA 1H3GA 4JIHA 2R82A 1T96A 4H01A 3A22A 2PMQA 1CXIA 3BC9A 3O16A 3UPWA 1LRTA 4L9YA 5DXXA 2OU4A 1EQPA 1LTDA 3CBWA 4R88A 3OHMB 1FWAC 3IACA 2CEQA 1CGVA 3NO1A 3TW6A 2L5HA 1Y5XA 1P7TA 2F84A 2PWUA 1A5UA 4E8CA 5ABHA 3OLEA 3ARZA 4L6DA 5A94A 5C2CA 1LF1A 1LQ2A 2A0NA 4TX8A 3QY6A 5E0FA 5LHFA 2VR2A 1LROA 2PRHA 4GXMA 4J3VA 2PWGA 4Y8FA 5KINA 3V5OA 1UIOA 1W9XA 3FDKA 1YBQA 3DI1A 4TR9A 1TMLA 2INFA 4DBUA 1JZ8A 2O9RA 3E2SA 3K8LA 1FDJA 1ZU8A 4WCJA 1JUKA 4AX6A 3NA8A 1J0YA 2R6OA 3ICJA 4GY7A 1J79A 1OFDA 1JPMA 1VF8A 4GXPA 3ELFA 2A4AA 3KTXA 3M9YA 1VBJA 3MHUA 3GTNA 3UXKA 4PSPA 1KV8A 2QV5A 1PTDA 3GXNA 3GHUA 3GYEA 2FZBA 4H00A 1RK5A 3MS8A 1FWHC 4IH3A 1HKVA 3QLDA 4XTDA 3OZMA 2PDQA 3L65A 3RGTA 1J96A 2OPJA 3O2LA 3W24A 1D7FA 1CZ1A 3GG1A 1U1JA 1S39A 1XRVA 1KBBA 4LWWA 4AHPA 3T55A 1YXYA 1ITCA 3C56A 3G1HA 4H1ZA 1X1OA 4MSSA 3WD0A 2J47A 1R3WA 1DKWA 5KZ6A 4L1GA 3MA8A 5LSMA 3M0ZA 2C91A 3PZ9A 1O60A 2A85A 4ZQPA 2AGKA 3PBVA 5M17A 1O7AA 1J93A 3U4AA 1AJ2A 4L65A 3T7VA 1VCVA 1A4MA 5GNZA 2D0GA 4UBPC 1T40A 5CZTA 1V6VA 1A0DA 1H7RA 1LYXA 4GG9A 7PTDA 1E70M 3WDJA 1M03A 2R1KA 1FDYA 4Q8QA 1UYQA 2X0SA 2NUXA 1PZ1A 1KO0A 1EX1A 1AK5A 1HKMA 4Q7NA 2PBGA 2NVAA 3OZPA 4AD5A 4YTSA 3I6TA 4Y9PA 4Z2KA 2QS8A 1VEOA 1KFBA 3QPZA 4FIRA 3SY1A 3IWPA 1FWCC 3LYEA 3B3DA 2AL2A 4ML4A 1RP8A 3AMKA 1R0MA 3WNNA 5EU9A 3W28A 3ARXA 3JRKA 4HNNA 2CLKA 3K2GA 1JDEA 3PSVA 1Y5WA 5CC5A 2Q01A 4Q4QA 1F76A 4IMCA 4MUZA 2TMDA 4DEFA 1FHVA 3SURA 3PAOA 4ATWA 4E8DA 4US5A 3NR0A 1OYCA 4NIRA 4JY8A 4KESA 1XG3A 1D3GA 2FVKA 4OV4A 4QG6A 3QFEA 4GNVA 1Q13A 1A3WA 1FKXA 4R53A 5FEPA 1TUXA 3VMOA 1C90A 3MMDA 2ZUTA 5RUBA 4B9ZA 3SY5A 1QK2A 5LGZA 3S2MA 2XH7A 4GABA 4B3KA 3UR8A 3W6MA 1T8QA 3URBA 3HQNA 3S1GA 3HF3A 4H6RA 3CJPA 2CLHA 2OQYA 2OSYA 4XZWA 2ISWA 4M6PA 4RK8A 2JK2A 4WSHA 2VDIA 4REQB 1TIWA 1GZGA 2H90A 4Z1CA 2IXUA 3KHDA 4F2BA 1GQNA 3DKLA 1KRMA 2ICSA 3PZQA 1WUFA 2YIHA 4YN5A 3CLWA 3W7PA 2OXNA 3MMTA 3M0YA 2YZRA 2NLIA 4QITA 3L23A 3OIXA 2FDSA 4JX6A 2V38A 4TV6A 1JZ7A 4B2DA 2FVMA 5HAOA 1V4YA 4KRUA 4Q8OA 1QOQA 5T26A 2YOCA 1HO1A 1HJUA 1AL7A 3W7CA 4HHPA 4S39A 3R25A 4GUJA 1NJJA 3G0SA 2V3FA 3HGOA 3WH5A 1E43A 1BLIA 1HW6A 1F3EA 4QBXA 1WQ5A 4PMVA 1VBRA 3SQSA 2HWGA 4NNBA 4LF2A 4PTNA 1SMAA 1O1ZA 4NZ4A 1H62A 4XD4A 3WQ4A 5BXPA 4ACZA 1I2PA 4DI9A 3VZXA 3K4WA 4J40A 1GZ1A 3TNBA 3WX7A 2PA6A 4PUDA 3QR0A 3VIHA 3JU2A 2WMFA 2A3HA 4ZO6A 3RHGA 1EP3A 4G7EA 4E4UA 4HMCA 2A5HA 1AJ0A 4BZYA 4H8HA 1JNDA 4QE4A 2C14A 4XO6A 3TC7A 4YMZA 3D3FA 3HMCA 1PX4A 4G56A 1XYFA 3VKBA 4CD6A 4Z1DA 2VKZG 4GKTA 4W7UA 1JZ2A 4LBUA 5DCBA 4UB9A 4N7QA 4PE8A 5G1TA 4CQDA 3AIVA 4K8EA 1LLZA 5A6LA 4S3AA 3EOUA 1NU5A 3W25A 2GJLA 4DPPA 1D8CA 2V5JA 1V3MA 3UQNA 5CLWA 3SCVA 1FY6A 4IX0A 3FEQA 4UZUA 5JBDA 1I1WA 3EWYA 3LCLA 4RNIA 1FCQA 2J7BA 3GH7A 3UPBA 3WELA 2YXOA 2VXNA 4HSOA 1WZAA 2PDBA 3LCXA 4LAKA 3LM3A 1HO4A 2PWDA 1GQLA 3BE7A 4P8XA 1NOUA 4DUXA 3CV6A 1JZ6A 4GJJA 2VWTA 3W01A 3VUPA 4NL1A 1IZKA 1KNWA 5HATA 2BGNE 4HNUA 3ABXA 1RUSA 2ZRWA 1PIGA 5CPNA 2G3JA 3I6RA 1UIPA 3C8NA 4GPNA 2BV9A 3SRDA 5XIMA 4UNKA 2Y7EA 1A5MC 3OG3A 1UR2A 3NQAA 2EF9A 4UIOA 3AYRA 4LCQA 3TQKA 2PURA 2Z29A 1NF7A 1EJUC 4QNEA 3GC4A 4MWAE 3RJYA 4GZIA 4EIVA 3SUVA 3BQ5A 3A6OA 5BXTA 4LSBA 3GX9A 4IL2A 3E0VA 3PWIA 4L7ZA 2TAAA 4PULA 4IZGA 3E1F1 4HK6A 1AD1A 2YGYA 1Q6FA 4KEZA 4Q8PA 4UR8A 1W1VA 3EWWA 2HE8A 3F2DA 5CJMA 1Z6KA 3QQWA 1V6YA 3QGVA 1W3NA 3LTSA 1W56A 1HX0A 4ZB5A 4RDZA 1UJQA 3T07A 3W7MA 2VL4A 5F7UA 1XYBA 1H4PA 4B16A 3AYSA 4YXGA 3K30A 3PB2A 4DZIA 3SI9A 3BLPX 4GUHA 1OC5A 4MJZA 2XHYA 1ME9A 4MY8A 2VENA 3PTQA 2JALA 4PMNA 2YPIA 1ELSA 2P5NA 1E6RA 1YXCA 3TKFA 3NGJA 3RLGA 2QV4A 3LLDA 4Q32A 4ONVA 5DY3A 2DSZA 3LMYA 3BGAA 2P8BA 3CV7A 4NRRA 4W85A 4F9JA 5HR7A 1DJQA 3NDOA 3OVRA 3WDHA 4ZB0A 1KTBA 1O68A 4XK2A 3S6DA 1Q63A 3GUWA 3M0VA 3MSRA 3EX2A 4TO8A 5GJPA 1BGGA 3N15A 3RPDA 2CKRA 4N9BA 3L2IA 2G8ZA 2C18A 1PE1A 3GC2A 1F7BA 2NT0A 2QMJA 3N3MA 1QNSA 1K9TA 4JTIA 3AXIA 3LV5A 3OU8A 4LVFA 1HKKA 4M6VA 3PZNA 4QDPA 3IJ8A 3LA4A 2I7GA 4MZ1A 1X6LA 1W0MA 3WF4A 1YNPA 1EIBA 5DRIA 3TYDA 3L5MA 3M0LA 4IGHA 4DIAA 4LRTA 5EFFA 3THUA 3EXRA 1XGEA 4MF4A 4LV4A 4RE2A 1HJSA 4GYFA 3K46A 3GXDA 1VPQA 1VLIA 5AHFA 3QC3A 2Q8ZA 1NWRA 3UU0A 1V02A 2QGYA 2WXDM 4MAZA 3UY7A 2GJRA 1E73M 4W4QA 3GAYA 3S8HA 4C6JA 1V3JA 2Q6ZA 4GIAA 3CTTA 5C7HA 3KBNA 1QHPA 4GJIA 1YPIA 2IQTA 4NAFB 1O12A 4TMCA 1WNOA 5JVLA 4DF2A 4AIEA 4TX6A 3MCMA 4NZ3A 1XSKA 4NASA 3YPIA 2EPOA 4MDOA 1E4IA 3BANA 3V1PA 1E4MM 3H70A 1T5AA 2G0WA 2VEKA 2DT0A 3HA1A 1CB2A 4PUNA 4QJ3B 5HANA 4H8VA 4IPNB 4ZB2A 4I6VA 4DXXA 4JZ5A 2VFGA 1RA0A 1HJXA 4XVDA 1XQLA 4UR9A 2XJ7A 1LUCA 3K1DA 2Z0IA 3WH9A 3KCJA 3WD4A 3SUTA 3NYZA 4PEEA 4AXKA 4WUIA 4Z0SA 1E6SM 3B9AA 3A5FA 1ISZA 3D46A 3VVGA 4BF7A 1B5TA 1B4KA 4JIIX 1TJPA 1HVQA 1FXQA 1YBQB 1NDWA 4I5UA 3PS7A 1O5RA 3OP2A 3W83A 1G4TA 3Q65A 3TMLA 1J2BA 2R94A 1KFWA 3RLHA 1NARA 3PN8A 3GVGA 3IIXA 1XX1A 5EMKA 2QNEA 1U33A 2BDQA 1VYSX 1TV7A 1XIHA 4IOTA 4EK7A 3P2VA 3W7KA 5G4EA 3XIMA 2YCKX 3MV01 4Y6GA 3KCLA 4YTRA 1TV5A 1MEWA 1RLCL 1YEYA 2D73A 3S5SA 1VFHA 2J79A 3WMBA 1B9ZA 2GFTA 2ZOXA 1YXDA 2W63A 5A2AA 3NZ1A 3LN3A 4KGJA 4IIHA 2X09A 3ZR6A 3N4AA 3FIGA 1VJSA 1EWEA 1E6QM 1OCNA 4TMBA 1CBGA 2V82A 2CLFA 5HMEA 5JIPA 2PP0A 1W9PA 4IGSA 4FAMA 1TWSA 2E6FA 3NIYA 4YVXA 4M5PA 1XGZA 2RFGA 3GVVA 4C6NA 3SRKA 1TTQA 2XYLA 1XRTA 1QBAA 5K4XA 3GS6A 4NG3A 2W61A 2UY5A 3LSBA 1X39A 1H5YA 1R3QA 2O56A 3H2OA 4I8DA 3TOYA 3AOFA 5BZAA 4BR1A 4HYRA 4AC1X 4O17A 4P7QA 1VB9A 1XIGA 1CT5A 2J7HA 2HRWA 4B91A 2DIKA 3NPUA 4N6EA 4TVDA 5C9RA 1A5OC 4IIFA 3F2CA 1W9VA 4M6QA 1XINA 3IIZA 3UESA 1QNPA 1OHLA 1MW2A 2PU0A 1TKKA 1O4UA 3PBMA 4FXRA 3DESA 4MUPA 4O11A 2ZVRA 4FOKA 3MSGA 2ZE0A 4KS0A 2WANA 2D3NA 2PDCA 1LDCA 4GUFA 2DIJA 3F1QA 2ZZ7A 5I06A 3N9RA 2EO7A 1W2PA 1K9DA 2VD8A 4L4LA 1KCZA 3K4DA 1BTMA 3BV4A 3L5LA 1JEZA 3POCA 2I5IA 2OLAA 3DFHA 1SU5A 1HNYA 1PSCA 4HN8A 1GVSA 5ENLA 1E40A 1K3UA 3SCRA 5IOBA 3OVPA 4G7FA 2WMJA 3RIKA 3SN0A 5CZJA 2YL9A 8CGTA 2A2IA 1EJVC 1XIBA 3CZGA 2PZNA 3T0TA 5EFDA 2WC7A 4FR1A 1LUCB 1R46A 4GYPC 3B9EA 1JR1A 5C54A 2FFIA 1XD0A 3UG4A 5FA5A 1K6AA 2IKHA 1W9BM 3B0YA 2WAGA 4AZ7A 2YL6A 3CZLA 2Z25A 3CHDA 2OEJA 4H6EA 1WCGA 3B97A 1TV2A 1YE6A 2VGBA 1VPYA 1LOSA 1K9EA 2B81A 1EBHA 1OK6A 5IHSA 3AWOA 2ZXDA 1BTCA 3KTSA 3AMCA 4V1XA 2J8FA 7REQB 2Z24A 1E5JA 3HBLA 4C6CA 1CPUA 3AUOA 4N2YA 4DO7A 4E2BA 3RM8A 3UW6A 4RXFA 2X2YA 1X1NA 4R9OA 3DH7A 3GUGA 4PH6A 1KBKA 2RGMA 1XH1A 4DVOA 1W1A1 3OZOA 3N3TA 3TN3A 4US5D 4D6GA 4HD5A 4DB7A 1Q6EA 1HUVA 3EKGA 1OD8A 3M7WA 3TJLA 2OZTA 1H0GA 3A4XA 3OYXA 5LHEA 4UTWA 1FP8A 3S42A 1KQZA 2BY1A 2PD5A 3PZGA 1OF8A 3U8GA 2GGGA 4S23A 3MUAA 4C7FA 3NAVA 4PSRA 5FIPA 1M7OA 5DBUA 3KOZA 5D09A 4AWEA 2A3BA 4MDPA 3QR1A 2QJGA 4KFNA 3W00A 3QJAA 3R8HA 2YBUA 1XJBA 1TR1A 1J0KA 4L1XA 2XIIA 4K3ZA 4H04A 2PTZA 4LVGA 4WX2A 4JIQA 4Q4SA 2DEPA 2FHFA 1H61A 1VRXA 1UUOA 4J2PA 1VC4A 3N6JA 4P7OA 3PPFA 4ICMA 2D2JA 3S9IA 4OZOA 4E2VA 1O95A 1I2QA 3GXTA 1S1PA 2E7FA 5HR6A 2ACQA 4W8AA 3IARA 3LCWA 3MBFA 4DJEA 5A8GA 4YPJA 1DBTA 4X63A 3VK5A 3AS3A 4J3WA 1XLFA 3NZQA 4UTTC 1JGIA 4O0QA 1ZENA 3WFAA 2HBVA 1OG0A 4ZFCA 2HS8A 3WL1A 2E9BA 2NLYA 4QGCA 4IHCA 4W7VA 3O63A 4TTGA 1WZKA 4GCAA 4RE3A 4EXBA 2QIWA 3MI2A 5AHLA 4LALA 2ZC8A 3TSBA 2J4GA 2DJLA 1XBVA 1WZLA 3QW4B 5HQLA 4A3UA 3PZTA 3BAIA 1DORA 1JGMA 5BMXA 3FSTA 3W02A 1GJPA 1WV2A 3BG9A 1U5JA 2E25A 1I4NA 4C7GA 3UXAA 2VX7A 4FLOA 4PFHA 3SAZA 1JAEA 5DMNA 4BQ4A 2VWSA 3PF3A 5A6SA 1RQBA 3WQGA 2DZTA 3I68A 2YCLA 4F9DA 4RPPA 3CTLA 5CZ0A 2PWEA 3P93A 4A8NA 2VRKA 2ZFAA 4OUEA 1DIOA 2ZWYA 1V77A 1E0WA 1XXXA 3S6TA 3TWBA 2ZXBA 4L1WA 3A3XA 4JTJA 1DHKA 4H3DA 4NKCA 4PB4A 4GA8A 4S3DA 3NM3A 3IRDA 3WBAA 3ITGA 3B05A 4IUOA 1K8XA 2WBKA 2HISA 4JGDA 5JBFA 3LXAA 2WMIA 3U7VA 2C13A 3CS2A 3MYPA 3A3WA 3M0KA 4BWLA 2BFGA 4XD6A 5CPQA 2ZZ5A 4HNLA 1YPXA 1GTHA 4JTAA 4N4PA 4MB4A 5CG7A 5GVJA 2J75A 4CQBA 2ZTKA 3MBDA 4HZ7A 1JCMP 4XZMX 4WOZA 2A7RA 1BHGA 2ZA2A 3ONBA 2YL8A 1LRQA 5BXSA 4YTTA 3BJFA 5A5WA 4HMEA 3MANA 4LUSB 5LXEA 1K4HA 2UY3A 5FAGA 2X30A 4E2OA 1Q7MA 1NIUA 3DCPA 4WQ6A 3EMZA 3WL0A 1GKPA 3VGBA 3RU8X 4M0XA 4AD3A 3HG2A 3UWQA 5BYWA 1ECEA 4JNYA 1JD9A 3ZMRA 1CLKA 2WM0A 1UPPA 1DWFM 4EF9A 5I5RA 2JEQA 4HMDA 2CYGA 4KWUA 4AD2A 1SJBA 2G41A 2OT1A 4H9XA 2QEZA 4A3QA 3G1VA 4ACZB 1B1YA 3I7SA 1KM3A 1D3CA 3ZWSA 2QJJA 4DHGA 5I09A 3ZWTA 4MIMA 1RQHA 6PTDA 2Q8XA 1JUBA 5EPDA 6TAAA 3H2NA 2HJPA 3IK2A 5H91A 4O12A 1YRRA 4YTUA 3CUZA 1W3IA 2WVTA 2JIEA 2P53A 3TYEA 3N9KA 3HO8A 4P8VA 2D22A 1XUZA 4GINA 3GB6A 2PTWA 4HGXA 2FJUB 4OIFA 3L2LA 2GQAA 3TQVA 1QASA 3EX1A 1WP6A 4O18A 1XICA 1MXDA 5I6SA 3XISA 1PKMA 1QVBA 5DMLA 4JD4A 2EJ1A 1PHWA 4AG0A 3LPFA 3W7GA 1XLEA 2YXXA 1QO5A 2ISFA 1WUEA 2J62A 3VX0A 1AH3A 3FVDA 1GOOA 4GZEA 3B0VC 3H12A 3IIOA 1A5KC 1QW7A 3LTYA 2Z00A 1V6WA 4LB3A 4UTKA 4A3HA 1ZCCA 4LVDA 1TTPA 3WEZA 1VR6A 9XIMA 3GC5A 3HGRA 1O1HA 2DT1A 3NGFA 5CSUA 1N8FA 2CXEA 3MP5A 2WVUA 3GTIA 5AVHA 3IVTA 1H7NA 3R2GA 1BYAA 5D05A 5FJUA 4GQGA 4HN4A 3WNMA 3WQWA 3H2EA 4DWSC 3TUUA 3ZLGA 3IAPA 1XPGA 2DW7A 2JEPA 2XVPA 2OT0A 3O05A 5DY2A 2Y61A 1IWBA 5E9AA 1ISYA 2ACRA 2VRJA 2Y6ZA 1RJQA 3EDDA 4XKYB 1C9WA 4JAWA 5KSWA 3GM8A 1UKOA 4L9XA 3BMXA 4P8UA 2IS7A 3ITOA 4E6MA 3F4CA 1B90A 3WMSA 2JF7A 3TCSA 4IMDA 4LT9A 4B9YA 5XINA 4D71A 3OEXA 4PC8A 3A4AA 3FGCB 2PDGA 2RHGA 4UWMA 2DZUA 1D9EA 2AAMA 1K77A 3EPMA 2E1DA 3NZGA 2CLLA 1XDJA 4H41A 4C6MA 2ZZ1A 3RILA 2X2GA 3WLTA 2O9OA 5LNVA 1BG4A 5LNRA 1FH9A 5BRBA 3DYPA 5AC6A 1BEUA 3WQOA 1X96A 1MDRA 4BWLC 1PCWA 4R34A 1X6UA 2Y0FA 4RNHA 3AAMA 2FB2A 5DT5A 1MQPA 5CGMA 4F8XA 4FXJA 3UG8A 3FFSA 1Z7AA 4NT0A 4H8NA 2AKMA 1UC5A 3VCCA 2Y7GA 2WMIB 1ZP3A 2D1ZA 1OIFA 2BVWA 4PR4A 1TG7A 1GQIA 1E6XM 2CZDA 4HCDA 1YHTA 3HJZA 1E4LA 3LMZA 4FPSA 3NQGA 4Q4OA 5KZDA 3RRAA 4MB1A 4O10A 3BAXA 3T08A 3QMTA 2I9UA 3IV8A 2GQ3A 1GOXA 1WB0A 2INZA 5DN1A 3OGSA 3V16A 3CL6A 3GK0A 1XKYA 1A0CA 3M0XA 3C0QA 1HGYA 1O5XA 4AQLA 2B4GA 4KCTA 2J6XA 2V2HA 2JFEX 1W6TA 3SADA 4QX4A 3VDGA 3QH2A 4FK9A 3NSNA 1HKJA 1R3VA 4JQ4A 1LLOA 5CCZA 2RH9A 3WQCA 3WF3A 1A5SA 3JUGA 3EWCA 4JQ1A 3TA6A 3C86A 1B4EA 4L4MA 2WVVA 2XM1A 4OJYA 3MC5A 2O4QA 1F9CA 5FF3A 3ARRA 3LG3A 1VJIA 3QY8A 4ICCX 5JMUA 2Y62A 4E5TA 1HF6A 5CPLA 3OPSA 3EDEA 2QQ6A 3ABOA 3TP4A 2OELA 2PDMA 5A6BD 1YNQA 4BCEA 1XS2A 3B4UA 3TVAA 4JKKA 4XUGA 3LHUA 2CZVA 1EBGA 1T7LA 2ZCGA 5I3GA 3ITYA 4LNYA 3LGEA 5IHRA 1M41A 1IR2A 3NPWA 1PDZA 4A8RA 1J0IA 4W88A 2NUWA 4G6CA 4HOXA 4NZJA 3PZVA 1JCTA 4YHEA 3N4FA 4NJIA 1KTCA 3UEQA 3T8LA 1NOFA 1C7SA 2G95A 1CXEA 4ZCWA 4M1RA 3C0JA 2QAFA 5H2ZA 4QE5A 4O1DA 2NXHA 3OOQA 3RFAA 1UD8A 4QG8A 3ZIZA 1ZJIA 2VURA 5CC7A 4J9JA 3VOFA 1XW8A 2PFHA 5F1VA 4AXNA 2A7PA 3WQDA 3II1A 2ZDSA 1R2SA 1P6WA 4GYPA 1C29A 1UG6A 3GNOA 5BU6A 3MWCA 4PTMA 3PPHA 3VFCA 3NO3A 1DTNA 4FF7A 4P7NA 4FSAA 4U5KA 8XIMA 1ITQA 4LTSA 4LUJA 1GOWA 1W17A 1QW8A 3VCRA 1KKRA 3C2VA 3GR7A 2XIJA 3P80A 6REQA 3MQTA 4GQBA 1E9YB 4E3TA 1F6PA 1M65A 2Z2AA 4L5ZA 1UHVA 3WZ0E 4LXFA 2MANA 4I7VA 1XYLA 3FVMA 1XM3A 3ARPA 4GRSA 3NZPA 3GR8A 4WY0B 1F3WA 1TQJA 5CZSA 3WH7A 1LZOA 2GPTA 3OLGA 3IJQA 3NPVA 1HKIA 2O4MA 1BKSA 5D9OA 4KFOA 4MZ8A 3SN4A 1SFLA 4V33A 4OKDA 2TSYA 1XIIA 3MU7A 1JF6A 2DU2A 1MWOA 3QGAC 3W75A 1ZL1A 1C91A 1Y7VA 2E5DA 4HZ6A 1DQXA 3L0GA 3PFMA 2FMNA 2JGYA 1HJVA 4MKVA 1X1ZA 3BG5A 1FWRA 4MNLA 3HGSA 2QCDA 4GGHA 4PFMA 1S3TC 2Z1SA 2CITA 1TPWA 3DI0A 3TN4A 3KBJA 1K8CA 4EPEC 5HJLA 2PD9A 3TJXA 4JTSA 4JQ2A 2NQLA 1E71M 5EKYA 4CEUC 5BMWA 4N02A 2VOTA 5HMFA 3SCWA 4O0ZA 5K2ZA 1SQ7A 1P0DA 2W27A 3ZT5A 3UERA 1FWIC 2EKGA 1VCFA 1BQGA 4JN7A 1FWFC 3NOEA 3AROA 1OC6A 5TD4A 4CCDA 3DKJA 3PY2A 1XI3A 4UTJA 1MNSA 3W22A 4U33A 4Q22A 1QK0A 3UBPC 4ERAA 3ORWA 1P0KA 1KKOA 3MMUA 3DECA 4XUYA 4DWSA 3NCOA 3AC0A 3WD3A 1CEOA 1FWSA 2DSKA 4Z42C 2AQWA 2OKTA 3QLLA 3FLUA 3URNA 3ME3A 3HB9A 4Y90A 4A2RA 4GVGA 4C6LA 4DAFA 3NQVA 4S2CA 3I4EA 1R8LA 2WJFA 1L8PA 1MQRA 1WAWA 2PBOA 1REQB 4IJBA 3C2FA 5HXMA 2J74A 3B8SA 4J7RA 1EOKA 4ES4A 4R7OA 3C2EA 3F4NA 2WVSA 4K36A 4GFIA 2CU0A 4GX9A 1OF6A 2W67A 3ZVHB 5D33A 1PVNA 3LCFA 5G1YA 4DBDA 3H7UA 2BBFA 3DYOA 1RY0A 1TSIA 3K4AA 4GI4A 1JCLA 1AQMA 4AD0A 5PTDA 1ZBVA 2Y2WA 1GOQA 2REQA 1ZTVA 4I7UA 3RX2A 1XLBA 5FEZA 2CBVA 3V1HA 3SCTA 4IFKA 5ECUA 2PTXA 1XIFA