4QHRA

The structure of alanine racemase from acinetobacter baumannii
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
355
Chain Sequence
MRQATVYIDRQALQYNLNRVKQLAANSKIVSMVANAYGHGVKDCLAALNASDAFGVACLQEGLEIRELGFEQPVTLIEGVFSEDEMPVAIEQKFECVIHHQQQFEWLIKHKQAYIAQGLKVWVKLNSGMNRLGFKDPEIIEVIKTLKSEGFTCVLAMHFANADVDHPLNEQQKQQFLHIKETCDPILASCCNSAAIFKWPELNFDYVRPGIMLYGASPFADKTVHDLDLKPVMTFTAEIIALNHIEAGEHVGYGSTFCAQQAMDIAIVSIGYGDGYPRAYVKQNFVAIDGKLCPVVGRVSMDMIAIDVTNTQVKLGTQVELWGNHRLVDDVAEANGTIGYELLCRLSSRPVRQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of alanine racemase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Isomerase
molecule keywords Alanine racemase
total genus 120
structure length 355
sequence length 356
chains with identical sequence B
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4qhrA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4qhrA02
1BD0A 2QGHA 4A3QA 2DY3A 3CPGA 3E5PA 3MT1A 4QHRA 4PB5A 3B8TA 3ANVA 2VD9A 5FACA 5FAGA 4XBJA 3NZPA 1TWIA 3WQGA 4ILSA 1VFTA 2P3EA 4KBXA 4Y2WA 3S46A 3N2BA 3UW6A 4FS9A 1XQLA 4XG1A 1XQKA 3GWQA 4ZGYA 5GJNA 3E6EA 3ANUA 2TODA 2PLJA 2OO0A 3R79A 3N29A 4LUTA 3LLXA 4AIBA 3WQDA 1SFTA 3HURA 3N2OA 3B8UA 2J66A 4DZAA 4LUYA 3B8VA 1HKWA 1CT5A 5GJPA 4ECLA 3C5QA 4DYJA 2RJGA 4PB3A 4BF5A 1L6FA 3SY1A 1B54A 4LUSA 1HKVA 3B8WA 5FAJA 2SFPA 3NZQA 1F3TA 2NVAA 7ODCA 2VD8A 1NJJA 1SZRA 3AWNA 3WQEA 5GJMA 1NIUA 3HA1A 5IRPA 5BWAA 1RCQA 1FTXA 4WR3A 1D7KA 3WQFA 1KO0A 1TUFA 4BEQA 3KW3A 3AWOA 4BEUA 2PLKA 1KNWA 3VABA 1EPVA 1VFHA 3OO2A 3WQCA 3CO8A 3BTNA 1W8GA 4BHYA 2ON3A 1QU4A 4LUTB 2ODOA 1XFCA 4LUSB 1VFSA 2YXXA 4V15A 1L6GA 4PB4A 2O0TA 2RJHA 2NV9A
chains in the Genus database with same CATH superfamily
3BJSA 1UW9A 4M6UA 4ADUA 5A2CA 4S3GA 3EX6A 4GVHA 5E6YA 2ZZ5A 3L5AA 4PULA 4QTGA 4EPBC 1V0NA 3HGRA 3THDA 5AHFA 2RDTA 5HXMA 2Z24A 1GOKA 1K4HA 2VOMA 1VFTA 3W1LA 5F2GA 4GJ1A 3S6DA 1E15A 1W1A1 4DZIA 1KC7A 4GY7A 1NVMA 1BYCA 1C9WA 5LIYX 5C70A 3K30A 2ACRA 4GI9A 3P5ZA 2J9YA 4AY7A 5EA9A 1JR1A 1S1RA 5U4NA 3KLKA 4RZBA 4UTWC 1HUVA 3CPRA 4U5IA 1LP6A 1OSEA 4PUEA 3SCUA 1EWEA 4EOUA 4FMVA 2OLSA 2WPGA 4RJEA 1KR1A 4UR8A 4CEUC 2BLEA 2QVHA 3LHVA 3LA4A 4NZ4A 2WSYA 1OFOA 3OJGA 2V81A 1VEMA 1TA3B 4ZB0A 1HJVA 3UA3A 2FZ8A 1LZOA 3CL6A 3RPTA 3MV01 2AQOA 3P60A 1XRSA 3S9ZA 3EWWA 3M5YA 1NDZA 2ZRYA 4WUIA 1WAUA 6REQB 2HE8A 5D2VA 4RCXA 3ZVHB 4PEKA 1G67A 2YFOA 3THCA 4O57A 1B3ZA 2X7WA 2AQWA 3CTLA 2GDUA 4PMDA 1CI1A 4A3YA 2J88A 3BSMA 3RCMA 3KRBA 4LAMA 4V27A 5AB3A 5HMEA 2E6YA 3VMPA 5EYWA 2BS9A 1TWDA 2FGZA 3P3BA 1MQRA 3EAUA 4PMJA 2VZOA 3ITGA 3U5UA 1UMLA 2CXGA 2PF8A 4A35A 2C15A 4Z1AA 3WBAA 1R2SA 4ZQRA 1M68A 3UPBA 1XDLA 2B7NA 1MYRA 1UP0A 3ISIX 3MMDA 3I68A 1P4CA 3LS9A 4KF1A 4YN5A 1RPKA 2Y62A 1MW3A 1XLIA 4AMCA 2QJJA 3ZQ9A 1T40A 2E6DA 3KTSA 4OBSA 1P0KA 1Q63A 2AL2A 2FPTA 2V2CA 1B30A 2BFGA 4Y8FA 3VMOA 1H0GA 4F4RA 4JTCA 2QQ6A 4HMCA 4AVOA 3GIYA 2CW6A 3TFXA 1F07A 1ODUA 4O8AA 1UD4A 4OU1A 3BLEA 3KOWA 1CTNA 1E0UA 4KEZA 1XG4A 1B1YA 3R0DA 4UTKA 2G3JA 2EF9A 1FBAA 2G3MA 3DECA 1B3YA 4NJJA 3N11A 2J8FA 2VHLA 5EGRA 1CDGA 4H6RA 4IMEA 3WQ5A 4R53A 3EA2A 2GQ8A 4NX0A 4JTAA 2VOTA 1UJQA 4RZ6A 3W1PA 4Q8NA 4H8NA 2UZ9A 1ITQA 5BOOA 2FMNA 3O05A 2UY5A 4MNMA 3H8AA 1I75A 2Y7DA 1IGSA 3I4KA 3M7SA 4B5VA 2POTA 1Q3NA 4RV3A 2OSYA 3UZJA 3GFXA 4WJXA 3LPPA 5I3GA 3URBA 4MZYA 4XSLA 1TYGA 2XFRA 2JE8A 3NCOA 3GR8A 2PTXA 2XHYA 2VCCA 1XISA 1TRDA 2D2HA 1EZ2A 3E9AA 3VU2A 3S4TA 4HNTA 1Q6RA 4L9XA 3MTWA 2IKGA 2FH8A 3MW7A 4Z08A 2YL5A 1KTCA 4GQQA 1QPKA 1FWGC 3K4DA 3NL2A 5HWJA 3UR5A 1UIPA 2CLEA 3SCSA 1U22A 1VYPX 2GVEA 5HMDA 2YCKX 4DO7A 5JUVA 4ZO7A 3AQUA 2XSAA 3DG6A 3F4VA 5BMWA 4JHZA 2WMGA 2WVSA 1HJWA 3NEHA 4HQVA 1B9ZA 4XIMA 2QVNA 2Y24A 3Q67A 4H8HA 3CAQA 1J79A 1OCBA 2VEGA 4AY8A 3PPCA 4YL2A 1RVGA 2VCBA 3QRHA 4EXBA 1UPPA 4G1KA 4LNCA 1JF6A 2JQXA 1CXEA 3MSYA 5BXSA 2WAGA 2ZVIA 3GNDA 3B9OA 4US5D 4Q8TA 2WZEA 3G18A 4K1WA 4AZCA 1K7EA 1E3ZA 3VC5A 2HBXA 3GVRA 1WKDA 5A8NA 2FTYA 1H0IA 4XAGA 1P6CA 3M44A 1ZZMA 1A5UA 3FAXA 5D38A 1VYRA 1OD0A 1P1MA 2NXIA 4IM4A 4GYKA 2NXHA 3L4UA 2CFFA 4HU8A 4ADTA 2PS2A 2GJXB 3ZYZA 3AXKA 5C5YA 4KKXA 4PH6A 2X09A 4H00A 3A64A 4M29A 2QDHA 1JCXA 4LVBA 4XSMA 3VC6A 2IW0A 4NIRA 3WD4A 2XFYA 2GPTA 3CUHA 3CYJA 4WXZA 4O1CA 2SFPA 3KL0A 1LLZA 3TP4A 3VINA 3LLDA 4AZIA 4PMOA 4DZHA 5E09A 4JNZA 2WQPA 2VFIA 3E2RA 4F79A 3KL5A 2J78A 3HPAA 2JIEA 2IQTA 4TX9A 1IGWA 1RBLA 1W37A 4U3AA 4MY8A 4AWTA 5ECVA 1PCKA 1SZFA 3ICJA 3M9YA 4IP5A 3DUGA 1IT0A 2VEKA 1Y5WA 3UG8A 1X8FA 3K8LA 3WEOA 4CD4A 2QJMA 3CQHA 1ADSA 5LHEA 3LTYA 1KGUA 2AGKA 5A6TC 3TJIA 3LB0A 1KFWA 5LSMA 2PTYA 3N9RA 4JHMA 2ZUVA 3KOZA 3CH9A 1OC7A 3QC0A 3GU1A 2OGYA 1AQMA 4HVXA 3GXIA 3TH6A 4ZSTA 1WXJA 5I0DA 2AMGA 3GHTA 3OG3A 2CYGA 4D8AA 4O12A 3TQPA 4KIRA 1EC8A 4ZOCA 2XGBA 3NQMA 3L67A 5LZLA 2P0OA 1C90A 1SGJA 4RNJA 1UH2A 2DJXA 2NQ9A 4KESA 3EDFA 5KETA 2XWDA 4KWUA 3SSJA 2VWTA 2WMFA 2RJGA 1I60A 3D0CA 3TZFA 3G1AA 2R24A 2QEZA 1TWSA 1EUAA 4PMNA 1FHLA 3TUUA 1H50A 3NQGA 3LUTA 3KS5A 4PMQA 3R5EA 4R3UA 4XZLX 4QJ1A 2VYOA 1X98A 3UG5A 4HMEA 3C56A 3VIOA 1RP8A 4EWJA 2WC7A 3NIYA 4RW3A 3MWCA 4Q4RA 3HGSA 3NSMA 2PRMA 3BGAA 2AOSA 5LYRA 1JCYA 3M0IA 3UWYA 1RY0A 3O9NA 4F0KA 4ACYA 2GQ9A 3OHMB 3MBDA 4FXJA 2PFHA 1JCMP 2XSBA 4XTDA 1I1WA 4LFYA 3UNTA 3QFEA 2PLCA 1YNYA 3TXVA 1TWIA 4C6EA 3GY1A 3T8LA 3ARYA 3GUWA 3GE7A 2EG8A 3PANA 3R11A 3U6WA 1UQZA 4LB3A 5CBJA 3MSGA 1TB3A 2JF7A 3ALFA 4I7UA 3QHMA 1R3QA 4O28A 1EKOA 3WLQA 1FWSA 5CPNA 1CXLA 2CZFA 1A4MA 1SFTA 2WNQA 5DEZA 5CC7A 1A50A 3TYUA 4DM1A 3L12A 4TQTA 1W5MA 3QOKA 4Q8QA 4HP5A 4DYJA 3S83A 3MKCA 3R6IA 4A2SA 4P7NA 1V4YA 4CLMA 4Y7EA 4H8VA 4MWAD 5A8QA 3VM7A 1PS9A 3KX6A 4XZMX 3CIWA 1GKQA 4E4FA 5D32A 2Y85A 1CGTA 4B91A 4RE4A 4FX7A 4H04A 4JTTA 1ICQA 2V3GA 3W72A 3FDGA 1F5ZA 3B0VC 4GIYA 4K7VA 1GORA 3W7IA 3QF0A 2O9PA 3S6TA 2W91A 4NYYA 3OLDA 1JUEA 4IIDA 2PZ0A 2E28A 1ADOA 2I1OA 3P80A 3M0VA 3TKFA 5G2WA 4WD0A 1S5NA 1EA0A 3LXAA 1W5PA 1CXKA 1XKYA 4D6CA 4E2VA 1GZGA 4IX0A 6ALDA 2NLIA 3WF1A 5I24A 5C2XA 3GU2A 4UTUA 2A7PA 3VGHA 1DE5A 5ABFA 4C6BA 2HMCA 2OFJA 1G69A 4C7FA 1A53A 1WXZA 3RIKA 3IUIA 3TC3A 2GGGA 5I6SA 3TQVA 4AY1A 1DQXA 2XG9A 1O6IA 3TW7A 2QCLA 1CZ1A 3OBKA 4P7LA 2GL5A 3NQCA 5D33A 4F2TA 3WDRA 2BVTA 1Q4WA 1FWRA 2WZHA 2Y8VA 1I6NA 2ZUWA 2D20A 1B2YA 4ZBCA 3CV2A 3FOKA 5HNTA 3Q45A 4LCSA 3O8AA 3AHZA 1U33A 2J7FA 4K3ZA 2V0TA 1W2VA 4O0QA 1ICPA 3OYXA 2J25A 1FWDC 2GSHA 1QPNA 1VQTA 2OWXA 4ZB2A 4FEZA 3U2CA 3WF2A 1TZ9A 4NZFA 4PCNA 4D6HA 3UD6A 2XVGA 3DFTA 2PLKA 4KIEA 2D73A 2VVSA 4AD4A 2PB1A 3LYEA 2GOUA 1MFVA 1F3WA 1KM3A 3CZKA 3N4EA 3H26A 4YTQA 3RMJA 3A4XA 1SO6A 5HUOA 1JPHA 4TU1A 1IT8A 3IJDA 2PD9A 1S3HA 4GX9A 3HBLA 3CPGA 1J6OA 3ZOAA 4Z1DA 1D8CA 3NQBA 4W9TA 4RDVA 5FACA 4HHMA 1Q6GA 4GABA 4NP7A 3TA9A 2FJKA 3P67A 4L9ZA 4MFDA 3AYRA 3PNUA 3UWZA 2X0YA 3R2GA 3WLPA 3ZT5A 3UJ2A 3E6EA 4PFMA 3WDJA 4DZ5A 3UJEA 3W00A 2VR5A 3SY8A 1NP2A 4LJ3A 1IZKA 1XSJA 4H7VA 1QDSA 4MZ8A 3CB3A 1MW0A 1OC5A 3HGOA 4PTDA 4Z17A 5BOFA 4D6EA 4PMZA 4K2SA 3IUHA 4F66A 5LGXA 3G6LA 1KM2A 3MCMA 2OOGA 3VILA 3SR7A 4RV8A 2QPUA 1LQ2A 3SO7A 4RE2A 4LUSA 2VDGA 1FHDA 3QR0A 3EWXA 5JXQA 1JZ8A 5KEZA 3KBJA 3WD2A 1X6UA 4H9XA 1D3CA 1TJ2A 2MANA 3QGKC 3BZJA 3WUBA 2HS8A 8A3HA 1OF6A 1F61A 4OTKA 1CIUA 1LUCB 5LNWA 3IJ6A 4K36A 1Q6OA 3G0UA 1KM4A 4J1OA 4ONVA 3LHWA 2DZWA 1E72M 1US0A 3O0FA 2P0IA 1XIGA 1XWYA 1ME7A 1WBJA 2XIOA 1M04A 4QDWA 3EKGA 2GDVA 5EPDA 1JPKA 4KH2A 1RCXB 2VP8A 1E1CA 1QNPA 3WLKX 2Y8UA 1IEXA 1E4NA 5D2TA 4M7SA 3WQVA 4AF0B 2VEPA 3KAOA 2WK2A 3V0UA 3D46A 2RFGA 3U7BA 4ZEPA 4V33A 2KX9A 4HZ7A 1RLCL 2BTMA 1KM5A 1T0OA 1W3TA 3GW3A 4P8UA 4M6QA 1C8YA 3AIWA 1W1ZA 5J5DA 3GG0A 3CU2A 4IF2A 4LUTA 5AY7A 5I5RA 3VX1A 3U7VA 1FWHC 3BW3A 4TX6A 3USZA 4W8LA 3L0KA 1JXKA 4V2XA 1XLCA 5GJPA 3CS2A 4MVAA 4HZ6A 2YA0A 2YBTA 4HPXA 3VE7A 1XGDA 4XD6A 3OQEA 4DXVA 1F3TA 3VKJA 4F0MA 1SZRA 4ZSUA 1BWLA 1UR0A 2V3DA 4GUHA 3BCFA 5TQLA 5A6KA 2AL2B 2CKRA 4W5UA 1XRTA 1XUUA 3FA5A 1ZCOA 3UGVA 2FYMA 3TZNA 2J7HA 2Z4GA 2YDQA 4B4HA 3OEXA 2WZMA 1HG3A 3RPMA 1BAGA 5AYXA 4Q7BA 1AODA 2Z25A 1S2VA 3ZVIA 2FKPA 1H3GA 1O1HA 3YPIA 1AL8A 1WOBA 1OT2A 1G4EA 2Q3OA 3PC0A 3AIQA 2CZEA 3L4VA 5GPRA 1IIGA 2YFNA 3RF9A 2X40A 4E3VA 5JH2A 4QGCA 3GKAA 3ZSSA 1DTNA 3WBXA 1KW1A 4O19A 4MM1A 2Q02A 3UY8A 4I90A 3ES7A 1R9XA 5GVJA 3ZJ8A 4DXKA 2WHKA 3QPEA 1TTJA 3EZ4A 3SCWA 4C6OA 3GH4A 4UQAA 4ERIA 1W5NA 1XYMA 2QJNA 1AFSA 5G4WA 1RP9A 1VF8A 5CG7A 1ZJIA 2ZZ4A 1QWKA 1SR0A 3LLFA 4LX4A 1KFKA 2OZTA 2JGYA 1EEXA 1QASA 3IVTA 4H9MA 5AN7A 1IZCA 3K8MA 3VIJA 4RX0A 2D0HA 3C86A 3IJ8A 3NR0A 2TPSA 4L6OA 3E2VA 2BB0A 3AS0A 4HSHA 4FIRA 1Y8BA 1YDNA 4KWOA 1EFZA 5GJMA 3SBFA 4UR7A 4DWSB 2Y1HA 1WPCA 1TUFA 3PAJA 1IT7A 4YCOA 2ZOXA 4J3UA 3T0DA 1SVDA 2VFHA 3ITTA 1FKWA 5K9CA 1V51A 3CNYA 3DERA 1H1YA 2HE5A 2OODA 3GG7A 1X6LA 2ZUNA 4GACA 5EMYA 2EG7A 4HTYA 1QXLA 3O06A 2WV8A 2DQWA 3OGSA 1DOSA 1G9HA 4QHRA 4Y9PA 4S2CA 3OP2A 1VJZA 5FAGA 3AHYA 4REQB 2PDCA 4JGDA 4P8WA 4L64A 1JF5A 3LNMA 3MYPA 3MUY1 4TV5A 3ZWTA 3MMWA 5KSWA 3WSUA 3HM7A 1V6YA 3ZJ7A 5B7ZA 3ANUA 4BWLA 2X7VA 1F8IA 3SJ3A 3HMJG 4FP1A 4I9MA 1CLKA 2OO6A 3TQKA 3WQDA 1AD1A 3CXOA 4LT9A 5CGMA 1IHIA 2IKJA 2PMQA 3TN4A 1KM1A 1T41A 3V75A 5DCDA 4DBSA 2G8ZA 2ISVA 3SCRA 4B5NA 3QN3A 4L4OA 1A5SA 1BYBA 3LBCA 2WMIA 1G7VA 4MAZA 4WGXA 5BNKA 3SY5A 3R0UA 1WKYA 4HJFA 3ITYA 2J7EA 4E3TA 5EU9A 4R7OA 1UCWA 3WF0A 2C0AA 4R7JA 5DO8A 3RO6A 2Y8KA 1A0CA 1YNQA 3QH2A 1U5JA 1QVBA 3HV9A 4LUTB 4C90A 4EX4A 1G94A 2GJPA 5AVHA 2RUSA 1KR0A 3VYLA 1NH6A 5GQBA 2VTFA 3CIXA 3G1XA 1W31A 4LRTA 1XIMA 3E5PA 4LALA 2B4GA 1HJUA 5I00A 4XAPA 3QYQA 1WDDA 1EYEA 3GRIA 4GVFA 1FFRA 1VEPA 2AL1A 2INEA 3S5YA 1XG3A 2BY2A 3M7WA 4YTSA 4ZL1A 3NO3A 2DEPA 4IL0A 3SQLA 3BW2A 4Q33A 5HMFA 1OCJA 3EDEA 1D3HA 2PE4A 2VZVA 2YKKA 4LW7A 1SPQA 2D0GA 4U4MA 3G3DA 1WKFA 3LLXA 2BHZA 1A5OC 3MSRA 3O2LA 4GPNA 4YPJA 5C9RA 5D05A 2Z1BA 4ZCWA 3STFA 5D02A 3UZXA 1VKFA 3DENA 1CXHA 3RX3A 3AMGA 3QHNA 3P84A 1WZKA 4C6LA 2DT3A 4Q8PA 2GUUA 5L9FA 4U3CA 7ODCA 4QG8A 3ENLA 1HL9A 3MA8A 1OEPA 7REQB 4NJHA 7XIMA 4QDPA 2YDSA 3TMLA 2Q8XA 3IGHX 3A23A 1HP4A 2ZX8A 3T05A 1E9LA 2TAAA 3CUIA 4G8TA 4L4LA 5EMJA 1M01A 1CLXA 4G7FA 1WOAA 4KMQA 2VCAA 3OW1A 1JNDA 1NY1A 3GTXA 2ZXBA 1UZDA 1XPYA 3WDHA 3M0YA 3RJYA 2QGHA 3MP3A 3L68A 1V0KA 5FD0A 3GNRA 2NV1A 1A5LC 4FNPA 3WLLA 1HGWA 1YBQB 4ICCX 3B0PA 1GZ1A 1OF8A 5I06A 2A1YA 3FA3A 3SN0A 1GKRA 3DG7A 2E9MA 2YL8A 1NOUA 3CT2A 1PZ3A 4DYEA 3VZXA 1AA1B 4QLKA 4TR9A 1S46A 5CBIA 4E2OA 3MJYA 3BOXA 4F0HA 3H2CA 3W74A 4Z0JA 1W1B1 4HNOA 2C79A 1E0WA 4MDOA 2BXVA 4ZMGA 2HVNA 3RLHA 3R7MA 3W22A 3GHSA 3N2TA 1VENA 3AXXA 3PY2A 4Q8WA 3S5ZA 2QDGA 3WLIA 4KRTA 3TONA 1E0VA 3N9SA 1FXQA 4L61A 4F2BA 3TYCA 2OCZA 1EF2A 4CN4A 5M1TA 4EP8C 5T8GA 4HU0A 3M0HA 1W8GA 3S5SA 4ROPA 4FI4A 3VIIA 1LTDA 3HG3A 1GQKA 3UP8A 2BHYA 6TAAA 1P43A 4GJJA 4JFSA 2XN2A 3BLDA 1IR2A 4HHHA 2XVKA 4P7RA 2QF7A 1I2OA 1TPFA 4H83A 3IJ9A 4E8DA 3VE9A 2PDJA 1NQ6A 5XIAA 4UTMA 1XGZA 2XH7A 4OJYA 1K9EA 4DI8A 4EPDC 3NM3A 4DY1A 3TOYA 4LF2A 3BCJA 3RRAA 1HW6A 1UZ4A 3MP4A 1XSIA 1T6MA 3EWCA 4RE0A 1FWWA 3WUGA 3T9PA 4AU0A 3EWZA 2G96A 4EF8A 4PMRA 4GYFA 4D2JA 2DGAA 3OZMA 5HANA 1LOQA 4MJ2A 1XC6A 4AIUA 3CZ8A 1NWUA 1MUWA 2BVYA 3N3MA 5ECUA 2BVDA 1EDGA 2YBUA 5A69A 2P10A 2XVLA 4DLFA 4KCTA 2CETA 5CPQA 1RJQA 1MXSA 4D8LA 2VDHA 1EJSC 1UROA 1JCJA 1WB0A 2QV5A 1TJRA 4I5XA 1BEUA 1PVNA 3FJNA 5ABTA 1J96A 3W7KA 2E4TA 1E6RA 1OG6A 3CUFA 4JTEA 2DZSA 3C8FA 4PRRA 2HSAA 1QR7A 4FLQA 3PJTA 4H9VA 2RGLA 4TOQA 6PTDA 2HZGA 3CH0A 3OVRA 1MDLA 4PUKA 1Q4NX 1K6AA 1V3LA 1OX4B 2VX4A 3T6CA 3RUBL 3W7NA 2H8XA 4HPNA 3N2BA 2A3BA 2BXYA 2DSKA 3WMCA 1R0MA 5CQ1A 4G6CA 4UTFA 1TMQA 3MKKA 3SCOA 4N2YA 3CAKA 2CLMA 2VWSA 3KBNA 4J2MA 3AYSA 1KTNA 1ZGDA 1E55A 4LCRA 4W84A 4P2VA 3VNYA 3WL0A 2CLOA 3T7VA 5C55A 3G6MA 1TZ7A 4CN1A 2XH4A 2W3ZA 2O55A 2OTDA 1WNOA 4HOZA 4UTTC 2Y0FA 4HIBA 5FJUA 4UXDA 4ZXLA 1LLOA 4D6FA 4IQEA 4H6EA 4CD5A 5HOSA 2G37A 1XGEA 2GVYA 5FF7A 1BYAA 1QO5A 4HCDA 4JTLA 3G24A 2DZAA 3LZ5A 3BAKA 1LWIA 1JZ2A 3VABA 1DJGA 1AW2A 3R25A 3B4YA 3QY8A 1S5TA 3AFBA 5CCZA 2GVGA 1HT6A 3SRHA 4C7DA 1EL3A 4IQLA 2RKXA 1S39A 1W17A 2QMJA 3LERA 3G2GA 3FCPA 4LAZA 3KCJA 2XFWA 4HKPA 3AROA 3PFMA 1LL7A 3ERPA 1Q45A 2QJGA 1XINA 4PR4A 1DJXA 2P1FA 3IAQA 4K1GA 2V69A 5FF4A 3I7SA 4FALA 1ZAIA 3C2VA 2YSWA 3C2RA 8XIAA 3NQAA 2R8WA 3W7OA 3OZPA 4DN1A 4J3VA 4UTHA 4C60A 4LVAA 4PBEA 3RAOA 1OCQA 2C6QA 3E2SA 3JW7A 3BQ5A 2EPNA 4X22A 1IXPA 2Z1KA 1E1FA 5F1VA 3KWSA 1QW9A 2W5FA 1FKXA 3QHOA 1GT8A 4HZ8A 5HR6A 4IMDA 3ABOA 3VFCA 1SSGA 4NAEB 2W4XA 3W0KA 3BH4A 6ENLA 3FAWA 3M46A 3WQOA 3RMEA 2R14A 1HKMA 1FDJA 5JMUA 1TWWA 1S2CA 4CNUA 1QHZA 4JL1A 2E9LA 3D3AA 4XK2A 4LUIA 1TRIA 3NA8A 1FVPA 1FWIC 4GLEA 3LV6A 2WNNA 2YW4A 3UJSA 3UCQA 3ZFHA 4XWUA 1CX9A 4CCCA 2W66A 1E73M 3SGGA 3HQPA 5DFAA 1GTEA 4IPJA 3PZQA 3TJ4A 4GQRA 4S2BA 4L5ZA 1CYGA 4NRRA 2OWWA 2OMAA 2QHAA 1TFVA 2GZXA 1M3UA 3OG2A 4Z2IA 1UJPA 3N13A 1J5TA 2XFFA 2WVUA 4MY9A 2JEQA 1SU5A 3EWBX 3RR4A 3HURA 4KW2A 1CGUA 1RQBA 1V6VA 3SDOA 2EKCA 5ENLA 1EH9A 3EKLA 1GUVA 4KFNA 1E4LA 4AZCB 1BVZA 2Y7GA 3T4CA 3PZNA 1RK6A 3GDTA 3AHVA 1X39A 3UR2A 1GVOA 1I2QA 3ARZA 4D6GA 3WJSA 3BLIA 3GDBA 4ZQPA 2QCEA 3EB3A 3QR1A 2G0WA 1E71M 4IT1A 3B40A 1BQGA 3WQPA 3KL3A 4FOUA 4HJWA 2VZTA 1MDRA 1L6WA 3EDKA 3BANA 3NGFA 3QY6A 4W8BA 4J3TA 1GVSA 3WFAA 3SCVA 4HHLA 3MB9A 4GNKB 4MADA 3WF3A 3FGCA 4GK8A 3ARTA 2QCDB 3M1ZA 3GNNA 2XYLA 1OFAA 2G4JA 4J3ZA 1ICSA 1ZBVA 3VI2A 3GWQA 1MFUA 4HMNA 3A3HA 1ME9A 4FR1A 2V5CA 1F7BA 2NT1A 1YEYA 4GNJA 2P53A 1XUZA 4R5EA 2YR1A 4IXHA 4Z1BA 5DCEA 1FH9A 3LCFA 1EO5A 5HWMA 1BRLA 3WYZA 3W25A 1DHPA 3AOFA 3DHDA 5CZJA 2A7NA 4FIQA 3I6RA 3P82A 4JQAA 4X9YA 2CXEA 4JEQA 3VGDA 2Q8ZA 1FQ0A 2IQDA 4AHPA 4BF9A 4RNIA 4PL1A 5BZAA 3QV8A 2NQZA 1JD9A 2VFGA 4UMCA 2MNRA 4DPQA 4RK8A 2YB4A 2YL6A 3H2OA 4KETA 1A4LA 2PWVA 1ZAJA 3N19B 4H7ZA 4CQ8A 2J7DA 4DBDA 1DL3A 1ZRQA 4KEUA 3F03K 3CWHA 4PC8A 4UQCA 1Q65A 2CZDA 3K5XA 1PHWA 4JTUA 4PCFA 4X61A 4FA3A 4LWWA 1FH7A 1R46A 2F2HA 3U2EA 4Q22A 1HF6A 5IHSA 5FI8A 3TLLA 1I45A 1XIEA 2NV2A 1QI4A 1MQPA 2BOGX 1CBGA 4L6HA 3W2LA 4AFYA 1YXCA 3TIMA 1D3GA 1G5AA 1G01A 3PUOA 1QK2A 1YNPA 5CGQA 5GJNA 3GAKA 4UC5A 3W4RA 4OT7A 3H53A 1J11A 1QJWA 3II1A 2OZ3A 1QWGA 3BL3A 4MF4A 4ADSA 1Q6FA 1AQFA 3BOLA 4R9OA 1JPMA 4J40A 2OYLA 2PDLA 3C52A 1G4SA 9CGTA 1ISVA 2YW3A 1ZL1A 5E0CA 4JTIA 1AMKA 4NAFB 2QIWA 1LRQA 1U1JA 2DQXA 2YBVA 1CGXA 3ALGA 4HSOA 3N34A 3WK3A 2HDJA 1NIUA 3L9CA 1UWAA 3H6OA 4MMWA 5E1QA 3KS6A 2PGEA 1ENUA 2QZRA 4ENLA 1J12A 4P7QA 3AXIA 4IGHA 5D37A 3VKAA 4LOCA 2H3DA 3KTXA 3W53A 4N02A 1RJRA 4QSHA 2INZA 1NARA 4UQEA 3G1HA 3BXWA 3CMGA 1KCZA 2ZUMA 4O13A 3QGAC 1SMDA 3PTKA 4PE8A 5FCZA 2PP1A 4EXQA 4JN6A 1BXBA 2R94A 3A13A 3STEA 2YJQA 2E09A 1A0EA 1EGMA 4XG1A 1J2WA 5A8PA 3SECA 1A5AA 2ZWZA 1B3OA 3FYPA 5DT7A 3QW4B 4LRSA 3INPA 4NNBA 1Q6QA 3MHUA 3OODA 1VEOA 5AHMA 4CNTA 1I4NA 3PHAA 3M41A 1HKWA 3LCIA 3TQ0A 1Z41A 3ARVA 1JYXA 3O6DA 9RUBA 5DBUA 3PWGA 2VGBA 3DOPA 1ESWA 4OZOA 3WQEA 4DBEA 3DBPA 3DC8A 3ARQA 4GFSA 2Y88A 3MSDA 2UBPC 3LHTA 3KP0A 3WENA 3UFYA 4IGSA 4AWUA 4Z2KA 4CQDA 3OO2A 3UU0A 1W5QA 2VGFA 4CCDA 1V02E 3LGEA 4BQ5A 3O6AA 3ECQA 3G8EA 3KOFA 3NUKA 3RCNA 5C9ZA 3GNXA 2G97A 1OIMA 1EGVA 1E0TA 7CGTA 4I8DA 1B0IA 3GM8A 1AL7A 4H3DA 3MKVA 4R27A 4R9XA 4JTKA 4WKHA 1W9XA 1UWUA 3L4XA 1OYCA 1GGOA 4A6GA 1W54A 4NJKA 5CSUA 3EYPA 4AUBA 3QTGA 3MDUA 1KBKA 3R0KA 4N9BA 5C7VA 3VTRA 5K2ZA 1UMYA 2WLYA 2WKJA 3O0KA 2WVTA 1ODZA 1ZLPA 2FZ9A 2Z26A 1SZGA 1FDYA 4QDMA 4U2YA 3L2MA 1CXIA 1V5XA 4M0XA 2A21A 1LWHA 3GBEA 4GZJA 4YJ5A 1ZUAX 3NWRA 1XIBA 1KXQA 3GFYA 1U83A 3BZGA 5C7HA 3GSMA 1EUNA 4OOUA 4Q4MA 3M0LA 2FMOA 4C6NA 1WZAA 3WDIA 3W3OA 3WJZA 3M0XA 4TV6A 1JDEA 1UD8A 2CCRA 3EOSA 1NFPA 3VNLA 5FEZA 1FWJC 2J47A 4BHYA 1UHVA 1S3TC 3E0WA 4DBWA 3CLWA 3V1HA 3HV8A 1U30A 1Q2SA 1HNYA 4IG2B 3S2NA 1JUBA 1ZSXA 2VFDA 4IFRA 4B5TA 4IWWA 1TKKA 4JIQA 2LLEA 3DFYA 2XM1A 1F4AA 5AKQA 3MT1A 5EFFA 3T07A 4G7EA 4O15A 4YMZA 5M5DA 1OYBA 4QG9A 1ZCCA 5CSYA 3NL6A 1XBXA 2X1RA 2GFTA 2ALRA 3IIZA 4WY0B 2ATSA 2IKHA 5M03A 3W71A 3WL1A 3GNOA 3HU7A 1A5MC 2HCVA 5BRPA 3LRKA 4B9YA 4UZUA 3WIJA 4B90A 4ZVJA 2PP0A 2PPGA 2GQ3A 3RX4A 4YVXA 3VXGA 3B9EA 4IHCA 4S3JA 3T78A 1XD0A 3LCLA 2QAPA 1W3IA 2ZADA 1SW0A 3TTOA 5CPTA 3NQVA 3NXLA 4JBRA 4GIRA 2OYMA 2OQLA 2GJNA 3W84A 4H9TA 3ARPA 1YHTA 5HQLA 1MEWA 2NUYA 3P14A 4M7TA 1SFLA 1UASA 3ZLHA 2DVXA 4P8VA 1IR1A 2HRWA 1ZB5A 4F9JA 4XAZA 1K8ZA 2P88A 1ONWA 1HJQA 3WD1A 1EBGA 2H6RA 1UUQA 5I2UA 1O7AA 1VCFA 4JQ2A 4MWAB 4NU7A 2ZVRA 4DHGA 1EO7A 1WKEA 2JF6A 4NYUA 1AJZA 4LAOA 4AG0A 4D1JA 4CD7A 2PGWA 4AD0A 1A49A 2XH2A 3NO5A 2WNZA 2VKZG 1OFRA 4HT3A 5LGZA 1LQ0A 3UZZA 4BWLC 1JRCA 3T2OA 1UQYA 3GC5A 2FTWA 3QZ6A 3RLUA 4H01A 2L5HA 4MGGA 2GGJA 3C2OA 4F3HA 5BU6A 4C65A 2YDRA 3I7QA 2HXUA 3LK6A 1ML1A 1W9BM 1NU5A 3NL5A 4MFEA 4MWAC 3HPSA 3LGDA 1C8QA 4I9AA 5G1YA 4IMAA 3TYEA 1RZMA 3GBDA 1JXJA 6TIMA 4GYPC 3SZ8A 3VIMA 2JIWA 1ZALA 4W7WA 4WSKA 3IIOA 5XIMA 1T96A 2NSOA 3FN9A 4NQ1A 2NW0A 2WHMA 3RO8A 3GDMA 4ATWA 2BASA 3TC7A 2VMFA 3W1AA 3G1VA 2R82A 4CQ9A 3MQTA 1QI2A 5EMLA 1M5WA 1CCWB 2VRKA 4H2CA 1M6JA 3M64A 1UKQA 3UCDA 2ZZ7A 3MI2A 4J7RA 5JBEA 1XIFA 1PZ1A 3HA1A 1MO0A 1P0NA 3FDKA 4MKVA 3ZIZA 4CQAA 4JYDA 5KINA 4E4UA 4GKTA 5D09A 5LKYA 1UKOA 1TVNA 1M9HA 4IXXA 2D2OA 4NAEA 1LG2A 2WSRA 2Y5SA 3VKKA 3BDKA 2Y7FA 1FWEC 3O6YX 3LXBA 4FNQA 3HQ1A 1QTWA 4JTQA 1DWGM 4NZ3A 3WH9A 4I7WA 1O95A 3V16A 1TTIA 1H5VA 2ISFA 4ZOAA 3SEPA 3UPMA 4BQ4A 4PCTA 4QROA 2BX7A 3EEZA 2PDNA 3A9BA 5FJOA 3T08A 1RALA 4GGBA 4GUIA 4IPIA 2NX3A 4LPCA 3NGJA 2DPEA 3QBUA 1QUMA 1AK5A 5BCAA 1X1ZA 5DY3A 4U33A 3PBYA 1KM0A 2WXDM 3DGBA 1KWKA 2PDHA 2OZ8A 2H3BA 3WQWA 1DWAM 3KOXA 2BOEX 1J6PA 1O1ZA 5JVLA 4I5UA 1XH2A 4TVUA 3RCYA 1JFXA 4V1YA 3SY1A 1B54A 1XIHA 1K77A 4MOZA 4JPGA 1K03A 3AWNA 3W7MA 3GH7A 1YQ2A 3SAZA 2QCHA 1N8IA 2PDYA 2ZYFA 4HPGA 2OG9A 3PN8A 3C2EA 1C8VA 1UD3A 4BS0A 1UC4A 1KM6A 3A3WA 3W9ZA 3SADA 3IWPA 1WZMA 3U5YA 2X1SA 2A3LA 3C61A 4PRTA 2W0UA 3PZUA 2F38A 4DWSC 1H1NA 5HJXA 4GXMA 2BY3A 4V15A 4DWSD 1GZJA 1IXOA 2HPIA 3WFLA 1SO4A 3W82A 3WLRA 4P8XA 1XLEA 3W6YA 1POKA 1TUXA 4UFIA 3VD3A 1KBJA 4A3UA 4TXEA 5D9NA 2OVLA 1RSCA 4JYEA 1RVKA 1PHQA 3TSBA 5TNVA 2WCSA 1KGWA 3ITCA 4GVGA 3W73A 4BQ2A 2NZLA 3N12A 5FJTA 5CAHA 3GVWA 2QPSA 1GHRA 1TV7A 5H91A 3CWOX 4QNEA 1REQA 3REQA 1Y65A 1ME8A 2ISSA 1WV2A 4XTIA 1JFHA 2WKGA 4JIHA 1B3WA 1QI3A 1E4IA 2PDXA 2PC8A 3N6JA 1NWSA 3UBPC 1QT1A 3U8GA 3R1ZA 1UBPC 4H6KA 3RHGA 4FB7A 1EJWC 4LVDA 1K8XA 3T44A 1HXJA 1WDPA 3TN5A 4PTWA 2H90A 2CBIA 3ITVA 5MKGA 1ISXA 1QPOA 2CU0A 1ZP4A 2VC6A 1EWDA 3BMVA 4LC8A 4OOZA 3MMTA 3VDHA 1V08A 2PDPA 3GZ3A 2GK1B 2Q71A 1V6XA 2GUBA 1HZYA 2HNEA 4GOAA 2C91A 2O7QA 1ITCA 3ZR6A 5HPOA 3ME3A 2OKOA 3W1TA 2QGYA 3B9DA 3GIPA 3RM4A 5CSSA 4QR6A 3EX2A 4PMXA 1F73A 2F2KA 3DFPA 1BD0A 4RR4A 5TIMA 1N55A 3AALA 4PCSA 4AB4A 2V5BA 4RDWA 2FFCA 3QQWA 1UB3A 3NYZA 4C6MA 1XV8A 2BG5A 5CZSA 1TVLA 2WZTA 4QS6A 4A8LA 3VKDA 1Z32X 3PNZA 1SFJA 1F6YA 1J2BA 3LHZA 2CHRA 2VRQA 4GCXA 3NPXA 3W1NA 1QATA 4IMFA 4LVGA 2VRJA 2A6LA 4MB3A 3J7HA 4GQBA 2GJRA 4GINA 1TIMA 2PWGA 3KFTA 1A5BA 4GWEA 1FWBC 1U1UA 4JTDA 4NL1A 3RG6A 1XLJA 4MYAA 1WDWA 3VNDA 2QDEA 1PPIA 2YYUA 4XZ9A 3IEBA 3GU9A 3IACA 3IVUA 2Y70A 3EDDA 3EX3A 3O7UA 1JCNA 2CWXA 1O60A 4KFOA 3EKZA 1X6NA 1O68A 1MNZA 1LF1A 3KVKA 4LXFA 3PULA 4XISA 3IUDA 1XCXA 1EQPA 1KWGA 3KW3A 3DYOA 1EPXA 2R6OA 3L4TA 4DJDA 1H4PA 1OGGA 1MZHA 1FHUA 4GBUA 4IJRA 5FJJA 2ZQ0A 3HJZA 2KAUC 3CLMA 4UCFA 3GW0A 1LRTA 3ZM8A 3K13A 2DSUA 2TRSA 3GO2A 1ZJHA 1TQJA 4K6AA 3MUCA 2D1ZA 3FHAA 1TMLA 2ALDA 3TV8A 1LLWA 3RILA 1GQJA 2J8TA 3W7JA 4YS1A 2YYTA 1GOQA 4XZWA 1OCNA 1DVJA 1DWIM 4FOJA 4AX7A 5CLWA 3CUXA 4HNNA 4D6JA 2V2DA 3CO4A 4JTGA 4RNFA 5IM51 3FXYA 4L9YA 3GIQA 1RXOB 4QRNA 3FEMA 4IPPA 4YYCA 4LAKA 4ECLA 1W3JA 1Q7QA 3CUJA 1K8YA 4H9UA 2HXTA 1UR1A 1U1HA 5M3WA 5FAJA 2Y63A 2J77A 4NSBA 3AIVA 3E96A 3ZVHA 4JL2A 3PWAA 3G1DA 2I7GA 4JN7A 3FY1A 1IYXA 4IGMA 5GNYA 3Q58A 1E1EA 3RRXA 3CV6A 1XJBA 3HB9A 2F61A 3T4WA 3ARUA 1AUSL 3EXRA 4F40A 4KT2A 4MNKA 1XDJA 3WUEA 1NOWA 2PCQA 3GXPA 1TPDA 3ZJ6A 4M56A 4QCEA 4O0ZA 3DFOA 4UFKA 5JIPA 1XM3A 2DT1A 4L65A 1XD1A 4BCEA 1SW7A 1JAKA 1V8EA 1IQ8A 1V77A 3IJ7A 4PMUA 1OM0A 4AEEA 2E8YA 2X2YA 2XIQA 3PPHA 3LPFA 4JTSA 4UNKA 1FCUA 1JCLA 3KLLA 4I3GA 1WDRA 4HK5A 4O0KA 1DKWA 5FESA 4EF9A 2GDQA 3PUDA 1HKKA 5I78A 3S2JA 3PB2A 4RL3A 3CQIA 3R13A 4Q4PA 2Y5JA 3HPZA 4X2PA 3FJ4A 1D7FA 3UJFA 1NQKA 3VOCA 1OX4A 4JQ3A 1V3HA 1NOFA 1YMYA 2W9MA 2WNWA 4QLLA 2IMRA 3H23A 4J28A 4R88A 1MZRA 2GUYA 2DIJA 4HPHA 4BKNA 1OG0A 3QW3A 3LU2A 4J35A 4AHQA 1PTDA 3AI0A 3M0ZA 4ICMA 1T8XA 3G1FA 4PYSA 4UMAA 4LF1A 4HOXA 4FZIA 4HSNA 5C0QA 3LCWA 1EDQA 2PCEA 1DJNA 1PDZA 3N1AA 1VZWA 4YTTA 1I2NA 3ZLGA 3L2IA 1ZTVA 1S2AA 1YBQA 4PA8A 1BKHA 5FL0A 5HBFA 5K9DA 4S38A 4ILSA 1KCKA 4JDYA 2HWGA 4P5UA 5LIKX 3ORWA 1PZ2A 4QG6A 4AQLA 1UWIA 1YPFA 1Z89A 3VIKA 4XQ6A 2OQHA 1OFDA 4BI7A 5KZMA 4DUOA 5CJNA 3C0LA 3BJTA 3TW6A 1YTEA 2A85A 3LRMA 1AH0A 4Q4OA 5AECA 1QO2A 3G22A 4HCHA 1E51A 1O66A 4CUCA 4H1ZA 5CPOA 5KMYA 2DUXA 1GKPA 4JKLA 3GXTA 3KBSA 1O12A 5DELA 3S1XA 4PEEA 2DZVA 1QMLA 2OQYA 4WSHA 2YCEA 3G8RA 3DGRA 5G2HA 1XICA 4XBSA 4QQ3A 1LOSA 4NASA 3T0TA 4JICA 5G4EA 2V63A 4LYKA 3UG4A 4HN8A 2OX1A 1C92A 3SRFA 4E8CA 3WQ8A 5EMMA 1H49A 2WC4A 3AYVA 5HQEA 3UG3A 1MXGA 1E0XA 2ZICA 3AZRA 2OZ0A 1VBHA 4O54A 1R5YA 6A3HA 3BLFA 5KITA 1WE5A 3C0SA 2PU0A 4BA0A 2YIHA 3O6CA 4YXGA 4G9PA 3NEVA 2C14A 3VGFA 2NVDA 5J04A 3ZR4A 3W88A 2OB3A 1W1IE 3LTSA 2GGIA 4PB5A 1MXDA 2WSQA 2PU1A 3LEPA 3ONCA 1KFBA 2I9EA 1Z6KA 2P76A 2A79A 4NZ1A 3B03A 3RGTA 3I3BA 1KV5A 3COTA 3CHFA 3TC6A 1J18A 1Q85A 2X42A 5HNRA 2FPVA 3K4WA 3LG3A 3C2YA 3MVIA 2YZRA 3GB6A 4N9EA 4F2UA 2AMXA 3FK4A 1XR2A 1G1YA 2PSNA 1VHNA 4EXAA 4WEVX 1CT5A 1GJUA 4OFCA 1K7FA 4FNUA 4MAVA 4A29A 2OKTA 3EMCA 5LNRA 1H41A 2Z2BA 4NT0A 1JUKA 2VUNA 1DIDA 1E70M 3GFZA 3C8NA 3TW9A 5AC7A 5BW6A 5AZ0A 3QYSA 3IVSA 3RITA 3IJIA 2C13A 3LNPA 1DHKA 3GC2A 1PYMA 4KRZA 2OOFA 3IIPA 4ZO9A 4UFLA 3WH6A 5IOBA 4B2DA 2HEJA 1GPWA 4XVEA 1H11A 2C3ZA 2G3IA 3TAKA 1R85A 5BRBA 4YVVA 2NXGA 3MBFA 1MRAA 2V5JA 2P8CA 1VFSA 1JPIA 1E43A 3NURA 3H21A 4GQGA 2VUYA 1JDDA 2YCLA 3B0XA 2QUTA 1V7AA 1AQHA 3DFHA 4L7ZA 4GG9A 3C3UA 5IXEA 3BMWA 3W2KA 4C6IA 3DEQA 5B80A 1US3A 3VD9A 2QULA 5D9OA 1O5KA 1TPC1 2DIEA 2DV0A 3LBOA 4GUGA 2IKIA 1NWTA 1QRQA 3S46A 3OPSA 1VCGA 3XISA 4GIAA 3R89A 3ANYA 5I07A 2ZWYA 3ATYA 3L4YA 2BNJA 5DXXA 3GG8A 1V6UA 1YTDA 3NO1A 1K4GA 1DIKA 3BG3A 1R3RA 3TLQA 4M81A 3W1XA 4WY0F 2GSJA 3P7YA 1VRXA 2XGZA 4ML9A 4S3AA 3VIPA 1A80A 4TMCA 5AOUA 2E67A 1OY0A 2Z1VA 1PKMA 3VDBA 2P3ZA 1E6QM 3VNKA 1GW9A 4M80A 1FH8A 3E38A 4S1FA 1L6FA 3HMCA 3QEZA 3L65A 4IIBA 1FUYA 4Q7IA 2OLAA 2Z28A 1Q5MA 4CU6A 5C9WA 4N42A 1H7NA 4NRSA 4CU8A 2VL4A 4KQNA 3V36A 1N2VA 2RDUA 1LBLA 2NQLA 3CGTA 1HVXA 3A4JA 3QLDA 4PSRA 2POZA 4C6PA 1J0JA 3WD0A 1W1TA 2D23A 1BF6A 4LUSB 1B9BA 2A3CA 4ML4A 5FF2A 2DT0A 4MPQA 1P6BA 4XB3A 3WK1A 3KDNA 3GQYA 1GVYA 3ARWA 5AFDA 4JDBA 5AC4A 5LXEA 2NUXA 3NXFA 4Z1CA 2PDUA 1WQ5A 1F6PA 2FHBA 1HO4A 1LCOA 3SFWA 1K8CA 2WJEA 4ZO6A 2BXZA 1A47A 4JFTA 1EHNA 3GH5A 3WLTA 4NG3A 1I0DA 2VGIA 3FSUA 1M7XA 3FNDA 3RYSA 3QXBA 3F2BA 3WDPP 4UNLA 2VGGA 2NWSA 1VYSX 2GOKA 1AW5A 1QPRA 3N2CA 1BG9A 4HNCA 4AF0A 1P7TA 5D30A 2PUZA 3H2EA 3W7PA 3P0WA 4WK9A 1UD2A 3FS2A 1GW1A 2ZFAA 4HB7A 1KRCC 1MW2A 3QPYA 4XO6A 4ZFCA 1BHGA 1AVAA 3S1GA 5IDZA 5A8OA 2CNCA 3MZ2A 3F2DA 1F6KA 3AU6A 3QOMA 4IFKA 4HNVA 2DVTA 1F3EA 3KVMA 1EJTC 1T99A 5E6ZA 1UR8A 3WEZA 5DBTA 1ZPTA 1KBLA 4UTIA 3BQ6A 2ZZ6A 2J24A 1KLZA 1TJ0A 2W79A 5CSRA 3PS7A 3PZIA 2VJXA 3W75A 4KGLA 5CEWA 4S3KA 4YNGA 5CC3A 2XH0A 4MWAE 4QE5A 4A3QA 2OELA 5AYZA 2OSXA 2CLIA 4FR6A 4LU0A 4XUYA 2FHCA 4W7UA 1RA0A 4N7QA 3CQ0A 4GZ7A 4AXNA 4GUFA 1RAKA 3V18A 3QZAA 1EXBA 3PPGA 4FAMA 1XC4A 3IANA 3BWWA 1LG1A 3DBNA 2V2HA 3DFQA 5KTLA 3F4CA 4ZENA 4OECA 5AC5A 1UIOA 4XD3A 3N6QA 4O4WA 3W85A 3LOTA 2PLMA 2X8RA 4WLCA 2X05A 1GTHA 2Z7GA 4EKJA 2Q3RA 2E6AA 4FXSA 3VOHA 3UGRA 3N2OA 4AC7C 3ZXWA 3B8VA 3EXTA 1QNVA 1MW1A 4ZA0A 1P1XA 3VKBA 2JALA 3EXSA 4O1BA 3W6LA 3NL3A 1UKPA 1R9YA 2DW6A 2YCIX 1CB7B 4DF2A 5I3HA 3QR3A 4GBDA 4XZIA 1TO3A 3NG3A 1AZ1A 4FF7A 2X1TA 4DIAA 2Q09A 1F74A 4AAJA 3RJXA 5DX7A 3R12A 5JIWA 2BV9A 1QU4A 1VJSA 4NVTA 1TPEA 2WBKA 4ZOEA 5FF3A 2NQJA 2Q6ZA 3RDKA 3O3RA 5A8MA 2XZ9A 4OVXA 1X97A 1PYFA 1LT8A 1RHCA 2EPLX 4ZR8A 1RQHA 1TR1A 3UF9A 3OTRA 1CXFA 2CPUA 4F0LA 1ZQ5A 3BOFA 4WKFA 4MY1A 5FEPA 1WDSA 4EACA 1K02A 4WGHA 3NDOA 3E02A 2TODA 3MCOA 3UQNA 3OQ8A 4RXGA 3IV3A 4C7GA 3ZLFA 2PDBA 4N9CA 3D6NA 4NXKA 4PSPA 1TQXA 3TR2A 5DQPA 2I5QA 2OXNA 2J8GA 1OBAA 2PODA 4XKYB 3HF3A 1H09A 3R10A 5I79A 2Y7EA 1EHAA 2ZKMX 2FJUB 1TIWA 1PX8A 4XZHA 3VD4A 2FGBA 1P6WA 3VDCA 1CEOA 2GGHA 2DVUA 2E77A 5A6BA 3HG5A 4WR3A 4H19A 1DEDA 1WP6A 3P0XA 3TTQA 3STGA 4L4MA 2ICSA 1RD6A 4UQ9A 5I23A 5DMLA 1VB9A 3TXZA 2Z2UA 1LL4A 4QSFA 1YX1A 3T55A 3KHDA 4D6DA 1C91A 3U4FA 1THFD 1DJQA 1NWRA 4HN4A 4PB4A 5C2GA 1KKOA 2Z1WA 5M2FX 4Z2LA 3W83A 3TU9A 3DH7A 4RLIA 4QJ3B 4CCEA 3PG8A 1VFFA 1GQIA 3IARA 3CV1A 4R85A 1PL9A 3UVIA 1PIGA 3IV8A 3WLOA 1E4MM 1XBYA 3DESA 1BSIA 1GK8A 3VNJA 4NZ5A 1FXPA 5KZEA 3NOEA 3ABSA 4RW5A 2XISA 1VFUA 2XM2A 4HGXA 4UMBA 1AJ2A 3JRKA 1QHOA 2PBGA 5GNZA 4DQWA 2DUAA 1QBBA 2GWGA 2J62A 5EY5A 4DF1A 3TAOA 1MWOA 1EJUC 5T9BG 4UTLA 2D0FA 2ZX6A 5K4ZA 1V3KA 1XS2A 1TPVA 1KQZA 2YX0A 3JS3A 1VS1A 2B7QA 3ZS4A 3M5VA 2RGMA 1BPLB 4IUOA 4HOWA 1QOPA 4W93A 1PAMA 4QJ4B 5A2BA 4DPPA 2HTMA 1X7IA 1UPMB 5BYWA 5I03A 3PZMA 4GC3A 3QZEA 2GVJA 5HINA 2X41A 1PIIA 1XX1A 1LORA 2ZRWA 4DM2A 1K3UA 4ASTA 4K8GA 3CIVA 2YXXA 4RXFA 4A4AA 3WK2A 3DYPA 4AW7A 5DF0A 2YLAA 5A6SA 3ARXA 3F1QA 4JTJA 4R33A 3QGVA 4P61A 3A6OA 1Y7VA 4QAIA 4GO8A 3VUPA 2X0HA 3MC5A 3BG9A 2DSWA 2WSKA 3GUGA 4I7VA 4US5A 3WBYA 2WQDA 3N9KA 2F6XA 1B3VA 1SUXA 1EP3A 4QEHA 1OC6A 3QQ1A 3V0SA 3DU0A 3BK0A 4MLRA 2E68A 1I2PA 1RV8A 1TE6A 2IUZA 1V3JA 2REQB 3MVTA 5E0KA 1KKRA 1W3KA 5EL1A 3WLMA 4PUNA 4JX4A 3AMDA 1P0BA 4OQVA 2BODX 3WQ6A 3H70A 1QNRA 4AZ7A 2YLLA 4YYFA 4RNHA 2NSXA 4FO4A 2YCJA 5D9PA 4KPLA 1OABA 4JQ1A 1MMFA 3P61A 4IL2A 1FWAC 1KTBA 1EBHA 4JZ5A 3F4DA 3UY7A 1EDTA 3GYEA 3BC9A 2H9AB 1V02A 1Q6CA 2D3NA 3AICA 1MRQA 2WJFA 3TYAA 1P5BA 1XH1A 1KRMA 3PJXA 3VVGA 2DFAA 5MF5A 3RXZA 3MDWA 2WMKA 2E6FA 1EF3A 4FNTA 5K4XA 3OIXA 3FEQA 3OYZA 1AZ2A 5MHBA 2A3AA 5C71A 1PX4A 1TSIA 4Q4SA 1U5VA 3LPGA 4MG4A 3EPOA 5HMSA 3CBWA 3FXGA 1GNXA 4O1EA 1BG4A 2DZUA 2GYIA 2XU2A 3RM9A 3UXLA 1OFEA 3GZAA 4WVXA 1M7OA 4HA0A 1Q6DA 2V3EA 2YGYA 4GVIA 3H2FA 3JUGA 3MPGA 5C2CA 3W27A 4GZEA 2CKSA 2RAGA 2EEXA 1UP3A 3W7CA 3P62A 3L7RA 4US6A 3W26A 3BLOA 2RH9A 3K46A 3TMQA 2EQDA 5IRPA 1D7KA 1NF0A 3RNDA 1E5JA 2I14A 4AD2A 3N6HA 3OB8A 3CUZA 4IH3A 3E2QA 2FVLA 2XUCA 3SIMA 3WQCA 1Q13A 4AWSA 1P0EA 4PCPA 3VZZA 1V0LA 1YE6A 1W1PA 4M6PA 4LY8A 3UWVA 1MNSA 3BUVA 3JR2A 3IGXA 3DC0A 1S2TA 2ZCGA 3V3WA 5D2XA 3TN3A 2QUUA 2ZX9A 3BPWA 4N0RA 1VBJA 3AS2A 3BW4A 4HNUA 7TIMA 1HJXA 1OWQA 3S5OA 5DCBA 4GD0A 4Z42C 1BGAA 4G1NA 1GVRA 3A5VA 1QK0A 2GLKA 3MUZ1 1GQNA 4TVCA 1XQLA 1W2PA 3KVJA 1SR9A 3H7RA 1EZWA 3AMLA 1OZQA 2BHUA 2P5NA 2C8NA 2EPKX 2ZZ3A 3IGUA 3KCLA 3W28A 4BY3A 3WO8A 3W7EA 9XIAA 4GUJA 5A94A 2PDGA 7REQA 4PFHA 1RLDA 3OBEA 3VOFA 3ABXA 4Q4KA 4M8UA 2E40A 4C1NA 3E0IA 2D69A 2VQUA 3FLUA 5T9CE 1NSJA 5A1AA 3RK8A 3PZTA 3SCPA 3BO9A 4Y6GA 2Z1SA 1PXGA 3G0SA 2DDXA 3ABRA 5DRIA 3IIXA 5EMUA 1CGYA 2DH2A 1KGXA 4O4VA 2PA6A 2BVWA 3TTSA 4LCQA 4GY1A 4RPQA 1RJPA 4H9ZA 3PB0A 4B2DD 4C6FA 2FVKA 2G95A 3BAJA 2REQA 1KXVA 1FOBA 1SYTA 3PVFA 2JKAA 2QCFA 3PPFA 2PDWA 1CNVA 1EYWA 2UWFA 5PTDA 4GI8A 2V67A 1VRDA 3EOLA 3NZPA 3AO0A 4WDTA 5BXRA 1KFCA 3DFSA 3CM4A 4Z2GA 1EQCA 5HNUA 2CWNA 1LL6A 4DBUA 4H6QA 4D71A 4OGZA 2DJLA 3AIUA 5AHEA 2PRLA 4LBRA 4X9SA 1W0MA 1TCMA 1XYCA 2X1IA 1SO5A 3G1SA 2VO5A 2QUNA 5JBFA 4Y8EA 3PTMA 2ZA2A 2FZMA 1Q8JA 3HO8A 1WA3A 2VELA 3C5QA 4B4FA 3NQ7A 1R2RA 2TMDA 3TTYA 8TIMA 3TJLA 1H63A 4M1BA 1ZP3A 5LA0A 1Y5XA 5BRQA 4ZZ9A 3GR7A 4UIOA 1GVIA 3AWOA 2BMBA 1TVPA 4DF0A 1ZJBA 3VGBA 9XIMA 4IMCA 4AD5A 4L4PA 1M53A 1TA3A 3NSXA 3I6TA 1JRBA 3WDQA 4KGJA 1LBFA 3VKCA 1OINA 1UKSA 4O18A 1FX6A 4Q3MA 4FNSA 3T09A 2W61A 7ENLA 1S5MA 3MHGA 4LS2A 1EC9A 3PP7A 3AAMA 4J27A 1W3HA 1X8CA 3MUIA 4W8AA 2FFIA 3NQ6A 4F0SA 2ACQA 2NT0A 3BCDA 5LXXA 3W86A 1PV8A 4LV9A 1JGMA 1T8QA 3CUGA 4JN8A 1KXTA 2XIIA 4UUIA 1K1DA 2A0NA 4B5SA 1HX0A 3KRZA 1EJXC 3UJRA 2ONEA 2WLZA 6XIMA 3EMQA 4FLSA 4G5DA 3NPUA 3EB2A 1UOZA 1Y5VA 2ADAA 3DI1A 2PLJA 1RCOB 1L9WA 3E0FA 4C6JA 1LT7A 3L4WA 1IIHA 4D72A 4WDUA 3HQNA 1A0DA 1LROA 3UPWA 4HK7A 3GXDA 3SB0A 3AYTA 3LY0A 3FFSA 4QNWA 1VGAA 3PAOA 2W6RA 2W62A 3BARA 3OA3A 3SCTA 4HZMA 4WDWA 3SUTA 5LIWX 1OGBA 3VAVA 1G7UA 3QKEA 1YDYA 1EXPA 4MDPA 4E6MA 1W91A 2XSXA 2OEJA 3BV4A 3I65A 3STCA 3KZPA 5CLTA 3HGJA 3T2QA 4JAWA 3BTNA 1JD7A 3SJNA 2BDQA 1HL2A 1R3TA 1MEHA 1V79A 3QFWA 1BWKA 3UZ5A 3RPDA 4XAFA 3LI1A 3CPUA 2XN1A 3SN4A 2AQVA 4Z0SA 3V35A 1XBZA 4IFOA 4AMAA 1I0BA 4TIMA 5E93A 2FZDA 1T7LA 3S1UA 1K70A 5BWFA 4MSSA 4W86A 3MS8A 5CGTA 1TV5A 1VBRA 3T0BA 3LCGA 5A95A 3U3HA 4GQ0A 2V6AA 3VNZA 4GY0A 4WOZA 3VDAA 2OEKA 3AJXA 2QUVA 3VCCA 1PCWA 1GG0A 3URQA 5EB8A 3TWAA 3LSCA 3B0UX 2JK2A 3B9AA 5CKSA 1HVQA 6CGTA 3M0MA 5FSEC 4A3RA 4ORIA 1I2RA 2PWEA 4NZJA 4L1XA 3UWUA 2ZA1A 4AYGA 4ZTYA 1R3YA 1C7SA 3KEHA 1KCLA 1EX5A 3VDGA 4F8XA 2PDMA 3PWIA 5FJRA 5MKGB 1ITXA 4ES4A 3ITOA 1J0ZA 3DCPA 4FLRA 4Q7NA 3LTPA 2PGRA 4JYFA 2Y6ZA 3R43A 2WSPA 1XIIA 4ACZA 1FHVA 4HTBA 1UOKA 1YTKA 4B16A 2J6VA 4DUXA 1RH9A 3AZSA 1FCBA 1HIZA 2YZ5A 4GX8A 1LYXA 3ES8A 5DMYA 2W92A 1VHCA 1M41A 3LDVA 1C9DA 1ONRA 1PKYA 3EOUA 3T40A 1NFBA 1DBTA 4Z1YA 4DJED 3S47A 2XWEA 4E38A 4MTVA 3B8TA 2OWCA 2WVVB 3ANVA 4CD6A 4LAUA 3S2CA 4AD1A 1ZNNA 4QX4A 4FX6M 3JVAA 1QHPA 2OGJA 3TN6A 4U31A 3CC1A 1HJSA 1FA2A 4EWND 2BOFX 2QCCA 2UY3A 2EG6A 4ZGYA 2E1WA 5I09A 1KFEA 1PB0A 3S9IA 4JY9A 1AH4A 4IP4A 4DXXA 5HK4A 4ZQOA 2G5WA 2ZC8A 4CQBA 3NQDA 3KHJA 5G1TA 4UTTA 4CU7A 3LX9A 1RBAA 3W24A 1M65A 3B06A 2DZXA 3BAIA 3UESA 4B92A 1TV4A 2VZUA 3FYOA 3HFTA 3BICA 3VFLA 3OOQA 4CVUA 1R7OA 4FX8A 1LQAA 2NVAA 4UOZA 5JBDA 5CC6A 2VC7A 3WF4A 1YDVA 5E9AA 4LUJA 1K6WA 5EKYA 1FDZA 4WDXA 2O9TA 3R8RA 2WCAA 3GLCA 4XV0A 4DB7A 1TWZA 4J5NA 1NM9A 1DXEA 3ABZA 2YL9A 2ZRVA 3PUEA 2EBNA 4CQCA 3NQEA 1FWFC 3U9IA 1UC5A 1K7XA 2FB2A 1FP9A 2WYSA 2XVPA 1FRBA 3GTNA 1J9YA 5BXTA 1VCVA 4C1KA 1GYLA 4NXSA 4DVOA 1JYVA 3GVVA 1HKIA 3PBVA 3VNIA 1QAPA 5AYBA 1W3LA 4REQA 1KFJA 3CZJA 2NWRA 1H1ZA 3G1YA 3S6OA 4IISA 4DO4A 3GKFA 4HMDA 2C16A 3G1RA 1XLMA 4AH7A 2OYKA 4BK9A 1JQVA 1JDCA 2DZPA 3S1VA 3PBWA 3OBAA 5SWUA 3VZYA 3UZYA 3P6LA 1UBSA 4DJFD 1J8VA 3N04A 3GXMA 4LUYA 4W5ZA 1KA9F 4JNYA 4H41A 1G6CA 4U2ZA 1SFSA 6REQA 1ZS2A 4L56A 8XIMA 5D03A 5CAKA 5HA7A 1Y0EA 3BGGA 2EJAA 3KM8A 2E25A 4V1XA 1DV7A 2V68A 1ISZA 3U2ZA 4E2DA 3IAPA 3HG2A 2CLLA 1FTXA 1S2WA 1BVWA 2P8BA 4RZ5A 5BROA 3KVLA 2R9RA 1IXNA 3MUAA 3XIMA 4JTHA 3FGCB 3PJWA 1H51A 4PMYA 3Q94A 1LDCA 2FB3A 3SCNA 1OX6A 2XIJA 2IPFA 1HL8A 1TJPA 1Z69A 2JFEX 1D8WA 3CHDA 1H60A 2ZE0A 3HG4A 4OV9A 3TROA 4ZODA 4Y90A 1BXNA 1T5AA 3BE7A 2CITA 1A3HA 4TUFA 1E9YB 3GHUA 3L21A 4DYKA 3DI0A 3MJMA 3WJWA 3W02A 4FNRA 4J4KA 1CLVA 4QLJA 4XBJA 2CZ5A 2F7FA 1SO3A 1OADA 2DW7A 3TE9A 4IG2A 5FJIA 4Y2WA 4NX5A 3S5NA 1PKNA 1UUOA 1KCXA 4AZHA 4KRUA 3LQLA 4OIFA 3IPWA 4FXFA 3MY9A 2CLKA 1TTPA 3VCNA 1OX5A 3FJLA 3FX4A 4KERA 2AGTA 3CQJA 2ZX7A 3UETA 3UXIA 4DJEC 3K1DA 3WD3A 1OVDA 2YCLB 5FEXA 1GONA 5XINA 5A6MA 4BF5A 4BI5A 3CAWA 4QEEA 4IP7A 2Z6IA 1JAEA 3CK5A 3K2GA 3PBMA 3WH7A 1F76A 4CNSA 2Z0IA 2PWDA 1NDYA 3S9YA 1H7PA 3W2NA 5I02A 4WCJA 3AIEA 4OBRA 1F8MA 4LQ1A 4IJBA 5AC8A 2CBUA 2CLHA 4DJFA 2WWCA 2YA2A 2QJHA 4I6VA 3U0HA 4WX2A 3PZGA 3F5LA 4MYXA 3KRSA 2HVMA 3LI0A 3NNTA 2OEMA 3TCEA 1OFQA 3CT7A 1YPXA 4QBXA 4O1DA 1IWBA 4GH1A 1XHGA 3CMFA 1BGGA 3L2LA 3R94A 1XP3A 3H12A 3KZSA 3MANA 2A5HA 2O4QA 2B31A 4E0CA 1Q7MA 3DHPA 1DIOA 1L0PA 2W27A 2IPWA 4LBUA 3PFRA 6XIAA 1GOMA 1PUDA 3WKZA 2QW5A 4IGNA 1H7WA 3L4ZA 3WMBA 1B4KA 5TBOA 4GISA 3PTDA 4NAFA 2E5CA 4L1WA 1RD5A 3MWAA 1QPQA 1C29A 1B31A 3W2MA 3HN3A 2VR4A 3LHUA 4BF7A 3GTIA 1QNOA 1RPXA 4IIFA 1SJDA 3VD5A 3N4FA 3UYIA 2OSWA 1VAHA 2F84A 1UYQA 1R2TA 1TELA 3THAA 2J79A 3BV7A 1EJVC 1JQXA 2WWDA 3LN3A 5LHFA 1F05A 3BAWA 2PEVA 3LHYA 4M5PA 3UT0A 4JFVA 2R1NA 4O50A 2FDMA 3Q2DA 2EPOA 5JH1A 1O5QA 1XRFA 2OLHA 2VFEA 4C1NB 5H8MA 3SM0A 1KD0A 1Z9AA 2PC4A 3IRSA 3W6MA 3VIFA 3F2CA 1RK5A 2FH6A 4XKMA 1WAWA 1GOWA 4FF5A 4AXKA 3KBMA 4Y96A 4C6CA 3NDYA 2X1UA 3GDRA 1ONEA 4JIIX 2JKEA 1HQTA 4S3EA 1NFGA 4HA4A 4MJZA 2AKMA 1UUMA 3CZGA 2C19A 4XBKA 1VFMA 1RR2A 3HOJA 1VC4A 1Q6LA 4K37A 5M17A 4GNVA 4U5KA 3M0KA 3QLLA 4H7CA 1E6XM 4FOKA 1DE6A 1LOLA 4FLOA 2Z6JA 4Q8VA 4DWDA 4A3HA 3W7HA 3QMSA 1L8PA 2Z2AA 5I3IA 3TK7A 3OLEA 3KP1A 4S3FA 3QVQA 1CWYA 1A3WA 1WDQA 3K8KA 4M19A 5CPLA 1DORA 3T1GA 3A12A 2FGLA 4AWEA 1WBHA 2A3HA 3PUGA 4LY4A 1C93A 1QCWA 2XJ7A 3O07A 4FHAA 3E3HA 3WQFA 1YLVA 1KO0A 1QW8A 4UOJA 4AVFA 1IEWA 3BVJA 4ZOBA 3UXAA 3WELA 4ROQA 2OT1A 1BSLA 2ANUA 1TV8A 3W2UA 5J5RA 1V7YA 3M5XA 3EX4A 1AMYA 4GMEA 4M82A 3B05A 1B90A 3UWQA 4OV4A 3QMTA 2WO5A 3O16A 1XLHA 3S42A 5ABHA 2O9OA 3ABQA 4PTVA 1PX3A 1ONXA 1W3NA 4MUZA 1D9EA 3UWWA 1MQQA 4W88A 4NUWA 1LWJA 2P3EA 2BGSA 3VD7A 3VIGA 3OVPA 4LYPA 2CBJA 4MHBA 3DKLA 1ISWA 1GWJA 3W7LA 1DJZA 4X0NA 1I9CB 1DWFM 3SCQA 3FV9A 4DEFA 4GXWA 1TV3A 4UFHA 1UD6A 3B8SA 3WJXA 2QPXA 3T0CA 3DDMA 1V93A 2ZTJA 2J66A 5BU9A 4ATLA 4B5XA 3ARRA 1ZAHA 3R4IA 2H8ZA 3HJEA 4AZBA 2WJDA 4S39A 1H7XA 1O94A 1MVYA 3EPNA 3UWEA 4QFUA 1X96A 4U28A 1YADA 3CWNA 4LBSA 3LRLA 2ZRZA 4GA8A 1HP5A 2A3EA 2CBVA 4KWWA 4GHRA 4WXYA 1R47A 4PUWA 2ZA3A 2VX5A 3B8DA 2VENA 2V30A 3TYZA 1SSDA 4FXRA 4NILA 4N9DA 4GO9A 2QJIA 4CNPA 3W1UA 3NZRA 3GDLA 3TVAA 1AQ0A 2Z27A 1Z44A 5BXPA 1W1VA 3IS4A 3VA8A 2FZBA 4DAFA 3SUWA 3O15A 5DRCA 2GK1A 4HU4A 1U5HA 4K7YA 1NELA 1PTAA 1V6WA 2VD9A 2ASHA 4PUJA 3C2FA 2XIMA 3TYBA 3A22A 3FYYA 1LM1A 1L2UA 1K9FA 3M47A 1UR9A 2W63A 5REQB 3PSVA 5CC5A 1W9PA 3AUJA 5DXYA 1GYNA 5EBAA 4ATDA 1H5YA 3N18A 3MO7A 3SGUA 1YXDA 3GC4A 2TSYA 4PTXA 2E5DA 4L6DA 1YXYA 3LM7A 2ABAA 1XL9A 5E9XA 3M43A 4WRHA 4TTUA 2DZTA 4DI9A 3W7DA 3UCCA 1HKVA 1XYZA 2XPKA 1A3XA 1SJBA 3QY7A 3AHXA 3ZSTA 2PWFA 4Q8UA 3CJPA 3POCA 4OE7A 5FF0A 5AHLA 3T0AA 4HD5A 2C0HA 1A5NC 1J4EA 4CD8A 5LIXX 4QITA 1KRBC 4O53A 1VFHA 4JCMA 1JIBA 1BTMA 4KWVA 1W1YA 2EPMX 1PBGA 4PTNA 4W7VA 3A21A 1QFEA 2QCNA 1R30A 4LTSA 5RUBA 3TR9A 4GFIA 5J8LA 1A5CA 4A22A 4IOTA 1GOIA 1UKTA 3H2MA 3OGVA 2WPBA 4EANA 2DY3A 5G2IA 3USBA 2I16A 4WSJA 2P50A 4XIAA 1K9DA 4JTFA 3F5KA 4KCWA 3FKRA 3CTTA 3O63A 3KBVA 4DJDC 2O92A 1TE1A 2VEFA 4IIEA 4A8RA 3M5ZA 4W87A 4PL2A 2DORA 3CHVA 4UTJA 4NJIA 5L6UA 4QIUA 4GJIA 1V0MA 5U7SA 3TA6A 3B04A 5LNUA 2WVVA 4Y9AA 3NQFA 4I9JA 5IBXC 4OUIA 2VT0A 1YKWA 3NYDA 1E9ZB 3FA4A 3Q4DA 1QNQA 2W67A 3UERA 1JI1A 4GZIA 2DP3A 1XFBA 3SURA 2XIBA 4UZSA 4ZTXA 1TREA 3KE0A 2B81A 3QKZA 2HPMA 1YIXA 2WB5A 4JXCA 1WYIA 2GVLA 4A21A 2E1DA 1RY8A 1EOMA 2J74A 5JU6A 3MU7A 5JQ9A 1W9VA 4D6IA 3QJAA 1PKLA 2ZUUA 4Y9NA 3FSTA 3SFKA 1ZFJA 1B5TA 3VIHA 1BVNP 4DJEA 1C8XA 3MYOA 2X2GA 3P5YA 1B57A 5BMXA 1E6PA 3FHQA 1R3SA 4O10A 3QTPA 3WH5A 2PTZA 2WM1A 2CZVA 2PDIA 5E5CA 3PR2A 2IPJA 4LYQA 4GI4A 3Q65A 2R1PA 4Q8MA 5CJ5A 3BSGA 2RDWA 5A6AA 1W9DM 2AAMA 2QDDA 5H8PA 3LMZA 3H4XA 3FW6A 1XLGA 1XQKA 3KBWA 1JNEA 3RLVA 2ZX5A 4QS5A 2Z7KA 3WNKA 1N8WA 1H7OA 1BRLB 4LGXA 5T91A 2YXGA 4MZ1A 3EEGA 4MB5A 3VOJA 2ZC1A 3WZ0E 4N6FA 3FJ6A 2C71A 5FJPA 4AZGA 4ALDA 1QOXA 2QCMA 1LUCA 2Y2WA 1XLAA 3M4HA 4B15A 1D2KA 4V28A 4LVFA 2PF0A 4RPPA 2E5BA 4Z2HA 4LH8A 4ZE5A 3DKJA 5GNXA 4H4IA 3DHUA 1J0IA 2XZ7A 1A5KC 2O7SA 4Q6XA 1XI3A 3W7QA 3UZWA 2FVMA 4DUVA 3KXQA 4NF7A 5D9MA 3LZ3A 4WIWA 3W81A 3WQ4A 2J7BA 1OYAA 3TWBA 3RN6A 3WJYA 1PSCA 1SJAA 4IX2A 3CV7A 1JZ3A 5KZ6A 1DXIA 2QT3A 1HTIA 2G3NA 3O1NA 3V5FA 1V6TA 4YCPA 1CGVA 1JYNA 4LS0A 1VBUA 2I56A 3QSTA 1BLIA 3CASA 4H8UA 1R87A 4ICNA 4DNHA 2UV8G 3Q37A 2NVCA 3QV9A 5AVNA 1GHSA 2AKZA 3THUA 2EGZA 4QXIA 3ID7A 4YIWA 1KQYA 4HYVA 4XD4A 3CZEA 3WNPA 2A7RA 2RHGA 3OU8A 3SRKA 3EWYA 3ZT6A 3BLLA 1TX2A 2D2JA 1LBMA 3B97A 4ORMA 2V38A 2NX9A 4S3CA 1GOXA 4UB9A 3R8GA 2J13A 1J0YA 4F9DA 1XLLA 4ZQNA 2CESA 1SZEA 4JR5A 3IJLA 1F4HA 3C3NA 3DN5A 1SW3A 5TF0A 2XINA 2A6NA 3APYA 3EB4A 4WZHA 3TYDA 3LPOA 3WNOA 3LGGA 1XBVA 1OD8A 1XKJA 2FHFA 3V0TA 3ZJKA 3A47A 5HPCA 1JULA 3DFNA 4G2DA 2QCGA 2F9RA 1IWPA 1JCTA 4MNLA 1K9TA 1OK6A 1YE4A 4EAMA 4WJEA 1OQFA 3E12A 4EAYA 1Q2RA 1CECA 3NZGA 4UR9A 3VCRA 2QYGA 3EWDA 3VM5A 1KXHA 1V03A 3ITLA 4KFPA 4M6VA 3T42A 4DLMA 5AYIA 1BXCA 4FS9A 5A8GA 3DZ1A 3K4AA 4IQDA 4PRWA 5I3KA 5AHIA 1WUFA 1NAL1 3WFZA 4MJ4A 2X16A 1XRVA 2YB1A 5HDRA 3DAQA 3CHEA 1JDFA 5F4WA 5C6MA 2NQ5A 3RX2A 1PE1A 1GJPA 1UWQA 4M1RA 4DWSA 4R34A 3UYCA 5EFDA 4ZQMA 2BY0A 3A4WA 2ZTKA 2G41A 3N2XA 4JY8A 1VBGA 1W8SA 1FP8A 3OLGA 4C6QA 1DTUA 4HPJA 1JZ6A 4UQBA 1CPUA 4JTRA 2O9RA 2QF8A 4KCUA 1R7AA 3H2NA 4O17A 5BWAA 1DYSA 3T2PA 1OIFA 5CXPA 1POJA 4IPNB 5F1UA 1IEQA 1M03A 3LXCA 5K3VA 1TMHA 2GGEA 4WOQA 3W37A 1G0CA 2VM8A 1JVNA 5CZTA 3SRDA 4S3BA 3OHIA 3KRUA 3W01A 2C7FA 3EX1A 2OJPA 1VPYA 3RFAA 1ISYA 4GE8A 3RLGA 2R91A 4CGTA 3B4UA 2J7CA 4JKMA 1G4TA 4KEMA 1WCGA 3WG6A 5A3HA 2QV4A 2BGQA 4JKKA 4AX6A 1EIBA 1GQLA 4BI6A 3SN1A 1KB3A 2QKFA 3A3XA 3ELFA 3HFYA 3EA1A 3CAVA 1UG6A 1ZBCA 1R3WA 1PIFA 2YPIA 2IPGA 2OO0A 1F2JA 3R79A 5TD4A 3MI3A 3EOEA 4NI8A 4K39A 5ABGA 3H55A 4K8EA 5H2ZA 1NF7A 3OIHA 3THQA 3S8HA 4HNLA 5G4HC 1Z8AA 2ZE3A 3EGJA 3NSNA 4YVPA 3OZYA 3BMXA 4DRSA 1NDVA 2J9XA 2ZDRA 3G0XA 4TTGA 3SUUA 4HYRA 4BQ3A 2WHJA 3GTHA 5FSDC 4AZ5A 3IRDA 4NZCA 4A2RA 4AEOA 1MUMA 3NZQA 2UY4A 2WC3A 3V1PA 3NQ2A 1PTGA 2CHOA 2I9UA 3EDJA 5LIUX 4N4QA 2E7FA 3M0JA 2VEMA 3S2LA 2WCGA 1IEVA 1EPVA 3TEVA 4JHOA 2DSVA 2FTPA 1Q66A 4MUPA 1FWTA 7PTDA 1EGZA 1R3VA 2J27A 4YHGA 1I8JA 1EJ7L 2IS7A 4LSBA 3RM8A 3TX9A 5H8UA 3UXDA 4MJMA 3BAYA 3TSDA 5D4YA 3CYVA 1BFNA 1KBIA 3DX5A 3TTEA 1XYFA 4AZ6A 4QM1A 1ECQA 2YXOA 5HQMA 4XVDA 3NZ1A 5F2LA 1VLIA 1TCDA 5DN1A 3NQ8A 3NVDA 2D2GA 4B5WA 3OA5A 4LANA 3LCHA 2ZXQA 4PGLA 4WY0A 5FA5A 3OVGA 4PZVA 4GKLA 1FWNA 2PURA 2ESCA 4Q32A 4E5TA 4CVWA 1EJRC 1R8LA 1R9ZA 2FQIA 2XTKA 1N82A 3PBUA 2WBGA 2EPHA 1Z48A 1MEIA 2QAFA 3VNMA 2WMJA 4HA1A 4DZAA 2R1MA 2BP1A 3N2MA 4BFAA 4CN6A 3I7RA 3F7JA 2XVNA 4GRSA 4W85A 4ZFMA 3W29A 5BOEA 1B4EA 5LNVA 1H7RA 4DNMA 2DZBA 1AW1A 5C54A 4HA3A 3A5FA 3LM3A 1XDMA 3BG5A 1CENA 4DAIA 1GOOA 5ABEA 5F2MA 2CERA 1BWVA 4IPLA 2PP3A 3SUVA 1UH4A 1X7FA 3VGGA 3PK7A 2GJXA 3A4AA 2BSLA 2J75A 1XFCA 1JYWA 2X30A 5AHNA 3MMUA 4X63A 3PF3A 3W1QA 3BAXA 2NV9A 4GCAA 4ERGA 3CL8A 3UEQA 1HN1A 1XPGA 3K1GA 3HQOA 3WMSA 2ZRXA 4CNOA 2Y4SA 3EWUA 4A05A 2VQTA 3GK0A 3WQGA 4L1GA 4M51A 3STPA 3KTCA 4GH3A 2D22A 1RUSA 3PSWA 4KWSA 2BGNE 1ZENA 2FDSA 3ZT7A 1JDAA 3MO4A 1US2A 2QLYA 4O1FA 1TG7A 5C9XA 2GJLA 4CKQA 1WUEA 4E8GA 2NX1A 1DP0A 4DJFC 3OVQA 5H6HA 3LMYA 4QISA 1DXFA 1E6NA 3U4AA 1J01A 1Z3NA 1VIZA 2QMKA 4LYRA 2CC0A 3ZMRA 2GSEA 1AJ0A 2WM0A 3I3DA 5REQA 3UR8A 2ZZ2A 3CEPA 2WMHA 1GCYA 1IF2A 1PEZA 3NDZA 3SUSA 4UCGA 4DUWA 5I3FA 3WLNA 2J7GA 4DX3A 1TPB1 1XIJA 4NNCA 4GYJA 3P93A 1BQCA 3GX9A 4JFWA 3PM6A 4QE4A 3HTWA 1YDOA 1KRAC 4IIHA 5LA1A 3GD6A 1ZJAA 5G5IA 2OPJA 2F8QA 2ACSA 2QNEA 2Y61A 4BR1A 3WLHA 4YWIA 4AYSA 4OWGA 3M16A 1DWHM 2ABBA 3RR1A 4JNMA 1VP5A 3B0YA 3AMKA 4BZYA 1J0KA 2PD5A 3LD5A 1JJKA 3W23A 5DMMA 1CW2A 3W70A 3L0NA 4K38A 1O4UA 1X1OA 4B3KA 4YLWA 3DIPA 4WJ8A 4CEXC 4IZGA 2VXNA 3E0VA 1WX0A 2Y89A 3E49A 3ATZA 3AC0A 3URNA 8RUCA 5DANA 2Q8LA 2ISDA 2QCDA 4O11A 1P48A 2EXOA 4O16A 4AIBA 2V8ZA 4HHPA 4YU1A 4OBTA 3FKKA 2TYSA 4S3DA 1PO9A 1H61A 2EJ1A 3N14A 2HK1A 5HWNA 4O14A 1AG1O 3QSRA 4JFUA 3APGA 5CBBA 4Q8OA 1JPDX 1VR6A 1XSKA 2J4GA 1IE7C 5IHRA 2I5GA 4NY2A 4MIMA 3JU2A 3WNLA 3I6EA 1ELSA 4KEVA 1S38A 4BJHA 3AS3A 2JGQA 4XAYA 2JBMA 4XUGA 3IIVA 2B0MA 4JOMA 1HO1A 3LSBA 3AXMA 5HUPA 3D47A 4KS0A 3C4UA 3HIJA 2VX6A 4C5ZA 2HISA 2ON3A 1L8NA 3G3MA 1S1PA 2X0SA 3F4NA 1E9IA 3CEUA 3FIGA 2OU4A 1AD4A 2HS6A 1RQEA 1GYMA 4QCFA 1XH0A 4L80A 1Q6EA 4D1IA 4RE3A 2JEPA 1H62A 1JZ5A 4I5RA 3GS6A 4GC4A 3VGEA 2QIIA 3WLSA 2VVNA 3BLKA 4B3LA 4K68A 2V5KA 3VOIA 2E9BA 3NJ3A 2F6KA 5I3JA 3VMNA 1NEYA 3C6CA 3WNMA 3MUXA 3S1WA 2QR6A 1C3FA 4TVDA 3JZUA 1QNSA 1IWAA 1KBBA 1EOKA 3OGRA 3SIZA 7A3HA 1QOQA 3PJUA 3AIBA 3W1RA 3PZVA 2PTWA 1YW1A 3BSHA 4W4QA 4QP0A 5FKYA 3WMLA 1J5SA 1DJYA 2C18A 4XZBA 4UNIA 3WLJA 2WZIA 4RZ4A 3V4BA 4PUUA 3V5OA 3U48A 2VR2A 2GWNA 2HK0A 3L23A 4NKCA 3APTA 2CLPA 4D9PA 4XKYA 4MPKA 1J10A 3W38A 1XLBA 2HROA 1WZLA 1SM9A 3RU6A 2Y5EA 3PG9A 4GIEA 2CLFA 3H7UA 3NOYA 1EX1A 2RDXA 3WCZA 3F4WA 3WH8A 4A8NA 5DMNA 1BTCA 2ZIDA 4MKNA 1X1NA 3ZO9A 4LEQA 3W1MA 3QV6A 4PUDA 4W89A 3QV7A 2IQ0A 1EA9C 4QJ5B 4EVZA 4DELA 3VUSA 4PODA 2I5IA 4WKAA 1KFLA 3A9IA 4LS1A 3VO0A 1V3IA 4ERAA 2WANA 2HBVA 4J3XA 2PI6A 2WW5A 1HGYA 4YTRA 3B3DA 2VDIA 4IFKB 3EBVA 5HJYA 2VX7A 3ZWSA 5IFPA 2IXVA 3GVQA 4C1LA 3E74A 5FOOA 1OFBA 3LENA 5A5WA 2DH3A 3P8IA 1GVFA 3ZZ1A 2A4AA 5T26A 3TNBA 4F48A 3UXKA 2VZSA 3N73A 3W2JA 1N8FA 1OB0A 2C1IA 5EMKA 4AVNA 1HFBA 1VFLA 5AZ1A 1E56A 1OJXA 4WQ6A 2AAAA 1ZBWA 5EBUA 1RCQA 3CZLA 4U10A 1PWMA 1EEPA 4WF7A 3HPXA 5DLCA 5DY2A 5A6JA 3PZ9A 4TMBA 1LJYA 3R58A 3BLPX 3W7GA 1J0HA 1TV2A 1OFPA 3CL7A 4MKSA 1XLFA 3IGSA 2ODOA 4DJDD 5TAOA 5D2YA 2FZNA 3GXNA 3SW6A 4LC6A 4OUEA 3AHTA 3TSMA 3U57A 1EP1A 3WY1A 4C5YA 1TPUA 4Z2JA 4PBGA 2CEQA 4ZQCA 4HYWA 4DO5A 1PJ9A 4AD3A 4J3SA 3SI9A 1W56A 4JIPA 3UW6A 1VPXA 4ZB5A 7TAAA 1XYAA 4XO7A 1DJHA 4HK6A 3P74A 4IJCA 2E8ZA 3H4GA 4PUMA 4UBPC 1TR9A 4NI3A 5CZ0A 3MP5A 4E2BA 1UR2A 4JIRA 2QUMA 3WNNA 1CB2A 2OR2A 4O1AA 3SQSA 3MZNA 1UWTA 2DUZA 3E5BA 4A8IA 2EO7A 5C8BB 5D8ZA 1XYLA 1E1CB 3N3TA 3CHCA 5AYYA 3T8QA 1R38A 1S5VA 1IEIA 4RUBA 1JI2A 1DQWA 2V3FA 4PMVA 3GVGA 3QM3A 1R6WA