3PSVA

Structure of e97d mutant of tim from plasmodium falciparum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
246
structure length
243
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFDRRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Revisiting the mechanism of the triosephosphate isomerase reaction: the role of the fully conserved glutamic acid 97 residue
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 92
structure length 243
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3psvA00
3BGGA 3KVMA 1I45A 4GC4A 2HS6A 3P80A 5KZEA 3LXCA 4UTLA 2DZUA 3HIJA 2IQTA 5HUOA 3UWYA 1X1OA 1R46A 2G97A 1WBHA 5I3FA 4XKYA 3FYOA 3FS2A 3NL5A 5D02A 3LOTA 3IIOA 3N9RA 2G5WA 2E68A 1LCOA 4DEFA 1A5CA 4MVAA 5EA9A 1OYAA 1GWJA 2BSLA 1MZHA 2VFEA 3QYQA 1AL7A 5D2XA 4I7UA 2QCDB 3BGJA 1SZNA 4K7VA 4IMCA 3C52A 3INPA 1JUKA 1WYIA 4LVFA 2V5BA 4YWIA 2AAMA 5HINA 3W2MA 3G0XA 1SFLA 1X8FA 1K02A 4R34A 4X3ZA 4JTLA 1SU5A 4O50A 4BF9A 1JCYA 5G4EA 2H8XA 3PB0A 3RMJA 6ALDA 3TDFA 1VLWA 3GAKA 1O5KA 4JYEA 1KM5A 3FKKA 1KM6A 1I2NA 2A7PA 2YR1A 4O4WA 4AF0B 3TROA 4QAIA 3NQDA 5HULA 3W7KA 3UPWA 5IBXA 3LBCA 4PL1A 3LLFA 2E09A 4MY1A 3W7NA 5KSWA 3C2EA 4AHQA 1SO6A 4JS3A 3G1YA 4O1AA 5AC8A 2O7SA 1KV5A 3Q37A 4ZZ9A 1OF8A 4NZFA 3KXQA 3A23A 1JQVA 4NJGA 1E51A 3W1NA 4WQ6A 4BFAA 2AQWA 1O4UA 2QKFA 3QC3A 1UJPA 3N3MA 5CPOA 1T96A 5BOOA 4WUIA 2QCFA 4UTMA 4AWTA 4HNUA 2ABBA 1C8VA 4R33A 4UTHA 3LTPA 3CPRA 1ZFJA 3TAOA 5F4SA 3M5XA 5DXXA 1BTMA 3M43A 3W1QA 3G8EA 2EGZA 2E5CA 2FIQA 3P7YA 1DJNA 1PVNA 1IF2A 1PS9A 4O1DA 4ZL1A 2NWSA 2JGYA 3B0PA 3QW3A 2TMDA 5GVJA 3W75A 4AHPA 4MIMA 4UFHA 3NAVA 2Y85A 1CW2A 3O1NA 4JDBA 4DELA 4FO4A 3KX6A 3W6YA 1T0OA 3W7MA 5D09A 3MI2A 5D2YA 4O16A 5HR7A 5EYWA 3GR7A 4A3UA 4O54A 2X1TA 3ANYA 3I68A 3S1XA 3L67A 2J27A 1KTNA 4IPJA 3HGJA 4RZ6A 1JUBA 1ME7A 4FNPA 4AXKA 3LCWA 1V5XA 3PY2A 4JX4A 4LVBA 1TSIA 3OEXA 3SJ3A 4POCA 4EVZA 4NU7A 3DBPA 3K30A 2CLLA 3HPZA 3W86A 3SR7A 4UFIA 1FWNA 1TRIA 3E02A 3NL6A 3GVGA 2RKXA 3PBWA 4UTKA 1L6SA 1A50A 1OJXA 3W1XA 4AB4A 1YDOA 3R8RA 2FPTA 4LRTA 1G7VA 2JKAA 3HOJA 2GPTA 4WX2A 1OYCA 1LOSA 4NQ1A 3A22A 4S1FA 1L2UA 3C2RA 3W7RA 3QMRA 3MHFA 4CCDA 2CZDA 5EPDA 1S5WA 3GX9A 4PH6A 2X2GA 5IM51 1LRNA 1QWGA 1VGAA 2DP3A 3L65A 1VYRA 4MYAA 4OT7A 4BR1A 2NWRA 4M6PA 1DHPA 4GNJA 4M19A 5D33A 3G1FA 3NGJA 3WK2A 1OFBA 2NV2A 3O6CA 3H55A 2Y88A 3IVSA 4O8RA 4JGDA 4O4VA 2E5BA 1UUOA 1FWWA 2WKJA 5EL1A 2ZZ7A 3G22A 3P5YA 3RU6A 2YW3A 1AK5A 1K03A 3A24A 1KM3A 3N34A 1DOSA 2DZWA 3WJXA 2C19A 2VFGA 4XKYB 1EA0A 2WJZA 3M5ZA 4X2RA 3W74A 1W56A 1M6JA 4HHPA 3NL3A 3QZEA 4GUIA 3UZ5A 4YCOA 4AWSA 2CZFA 2YDAA 3PF3A 1S5TA 2H3DA 4IOTA 2Y7FA 4JDYA 3TSDA 4O10A 1Z44A 1IXQA 1H7XA 4DF1A 4DXVA 4KKXA 5D30A 2YCEA 1ZALA 5FEPA 2CLMA 2Y7EA 5FEXA 1EPXA 1GG0A 1EP1A 1I4NA 4XBKA 1WXJA 1PHWA 3O16A 3T7VA 1OHLA 3MHGA 3TQKA 3MYOA 1UUMA 3G24A 3CWOX 3MHUA 4UFJA 3W70A 5EBUA 1OK6A 1I8JA 3DI1A 2WSYA 4AAJA 3PULA 3TR2A 3LBMA 4B5NA 1SW3A 3EWYA 3P82A 3STGA 5TIMA 1R2SA 4N9BA 3EXSA 1TPVA 3LHUA 4IX2A 3UWQA 4LUJA 1D9EA 4H6KA 3NPWA 5TQLA 1UASA 3DFSA 1H62A 1P1XA 5A8GA 4YMZA 3GB6A 3GLCA 3T78A 2H90A 3G18A 4UTTC 4DPPA 4MY8A 4XTIA 2V81A 5LNUA 1YADA 1YTEA 5DBTA 3OVQA 1GZGA 3U6WA 2A85A 4Z0SA 2DZSA 2ATSA 1Z48A 1NEYA 3HPXA 3NL2A 4GFSA 2ZA3A 1P0KA 5E1QA 1XFBA 4Y9AA 1C9DA 2WSRA 5AHEA 1TTIA 3UXDA 5KTLA 2CLEA 3MBDA 2NX9A 4ADTA 1DQXA 1JR1A 1P5BA 3G1VA 5G4WA 3DXIA 3W2JA 2F84A 3S8HA 4P61A 3EKZA 4UMAA 1LBMA 1TTJA 3PB2A 3A21A 3UD6A 2YSWA 3CLMA 3TC7A 3TE9A 4NXKA 1KFEA 2C16A 3DH7A 5BRBA 2YPIA 2XN1A 1W5MA 2OT0A 5I3JA 2ZZ6A 3S5ZA 4A22A 1P0NA 2X16A 3P81A 3W1RA 3G3DA 1SO3A 3NQCA 3I65A 4WZHA 1LZOA 4R53A 3UXAA 5BMXA 4FX7A 2V9DA 3KAOA 3LCXA 4GBUA 4YXGA 2NX1A 2A2IA 1LOLA 3LXAA 2QR6A 2R14A 2YFOA 2VKZG 1LYXA 3M44A 4AEOA 4CNPA 4I7WA 2GJNA 3BLEA 1X7FA 4BWLC 3GDTA 4CCEA 2GQAA 3TKFA 5FF7A 3QQ1A 1GTEA 4QJ1A 3W87A 5CKSA 1OFOA 3LM7A 3N2MA 5D05A 3W7QA 4LUIA 5G1YA 4MLRA 2NXGA 2Y61A 2ZBTA 1QPOA 1RR2A 2EHHA 5L9FA 5FF2A 4K37A 4GUFA 2KZHA 1LROA 3R12A 5AHLA 4RV8A 1YXDA 4Z1AA 3W2UA 2C6QA 5HUPA 2FB3A 4M6QA 4CQAA 4BI7A 1SQ7A 4LU0A 2GUUA 4LC6A 4PTNA 3W1PA 1Q6LA 3UYCA 3NNTA 4LOCA 3P62A 1SZEA 3W88A 2H8ZA 1RVGA 3C61A 4UC5A 4AWUA 3S0CA 1WX0A 4WY0B 1QR7A 4UXDA 4EF9A 1KV8A 1TV8A 1WDWA 3BW2A 4M5PA 4M7SA 2BWGA 4N2YA 3C8FA 4HNTA 4Q32A 2YW4A 2TRSA 3CTLA 3S6DA 4ZQRA 3M1ZA 4OV4A 3G0UA 3C3NA 4ML9A 1FWRA 3LHYA 4DF0A 5H2ZA 5K3VA 2Y63A 1W5OA 3NQ8A 1QFEA 4YCPA 1SSGA 2OCZA 1LLZA 3GXPA 4MJMA 5AC7A 1F74A 4IXHA 3R89A 4NNAA 2CW6A 3ZR4A 3W72A 3EWBX 3L21A 4IMDA 2GVJA 3EEGA 4U28A 2CLHA 3RFAA 3UWZA 1OFEA 4NNCA 4KFPA 1B4KA 1ZY9A 3R13A 3NZ1A 1W3IA 4JICA 3LTYA 5DN1A 3TSBA 4HIBA 1XKYA 1QNVA 4N9EA 4ZQMA 4ALDA 4ORIA 3T4CA 3N73A 2Q3OA 2VFDA 2Y70A 3NOEA 1O60A 1WOAA 2WV8A 2C3ZA 1ZAJA 3S1WA 1GVFA 4RX0A 1GEQA 4TIMA 1FCBA 3R5EA 3A9IA 2BXVA 3CC1A 3RF9A 1DVJA 3BV4A 3IEBA 3S42A 4DO6A 1EUAA 3NDOA 3PSVA 1G4TA 1YPIA 3VNDA 3F4WA 5KZDA 3UPBA 2V2HA 5CSRA 4KWVA 1F7BA 3SGZA 4JTHA 2VEPA 4LC8A 2YX0A 4W9TA 4JN6A 2P10A 3OVRA 4FF7A 4N4QA 4O57A 2ZRUA 2YYUA 3W73A 2C13A 3O07A 1LTDA 1ML1A 3TU9A 5G5IA 3TXZA 4O12A 4N9DA 4LTSA 1KA9F 1RD5A 3GK0A 1OG0A 4FNUA 1TRDA 3G3MA 5FF4A 2Z6JA 4NJIA 3I7QA 1F73A 1AMKA 1I2OA 1SO4A 4JR5A 4ADUA 3W7PA 1EWEA 4ZQPA 4UR7A 2ZRVA 1FXPA 1XM3A 4DO5A 5LGXA 3DZ1A 4FNQA 2QJGA 3IV3A 3LERA 3LV6A 2OMAA 3PUOA 4Y8FA 3W07A 4CNNA 2ZZ1A 4HN4A 5DY3A 1TCDA 2R8WA 4S2BA 1ZAIA 4WY0F 1GVOA 1WV2A 1EB3A 2Z1BA 3KVKA 3LCLA 4JTJA 3GZ3A 1AL8A 1NF0A 4RXGA 3WJZA 1OF6A 2E5DA 1Z42A 3M9YA 5C54A 2GVLA 3GXTA 4TR9A 1OX4A 2CZ5A 3TAKA 3SSJA 1JVNA 4IMGA 4QITA 1IXPA 2V5LA 4NT0A 4IJBA 4LWWA 1XBXA 4I7VA 4XUGA 1H7RA 3SZ8A 4MJZA 2ISSA 4RJEA 3OIXA 1K7XA 3VFLA 3E0IA 1G4PA 2QCHA 1DL3A 3OG3A 3LX9A 5G2WA 4IUOA 4NZJA 1LDCA 1GOXA 3STCA 2A0NA 4HNNA 3PG8A 2C14A 4MZYA 4HSNA 4FIRA 2ZFAA 1J2WA 1Y0EA 1KFBA 4WJEA 4EOUA 4O1CA 4Z1CA 1FWTA 6TIMA 2ZTKA 1ALDA 5BMWA 4IMEA 3CHVA 4LV4A 1ICQA 2NXIA 1A53A 1TTQA 4PEKA 1OVDA 2DORA 3S5NA 2W6RA 1KM4A 4K8EA 3YPIA 4WOZA 2CLKA 2J88A 3EB2A 2QCNA 1XCFA 3MYPA 4RZ5A 2NZLA 4OBTA 3IIPA 2HMCA 1DORA 1OFPA 2A7RA 1L6WA 1XUUA 3W7LA 5D2VA 5DCDA 3GXNA 1I2PA 4ZVJA 3O05A 1TPH1 4Y96A 4S2CA 4ZQOA 1QOPA 4OV9A 3U8GA 1JCNA 3GAYA 4WXYA 1XL9A 3F03K 1A5AA 5D2WA 3TC6A 4FX6M 4X22A 4R7JA 4DO4A 1HTIA 3QQ0A 2FTPA 4N6FA 1QAPA 3Q2DA 3LRLA 1NSJA 4QNWA 4WD0A 1TQXA 2ISVA 3MP5A 3N14A 5FEZA 3W2NA 1W31A 1FBAA 3EX4A 1KLYA 5C6MA 3AO0A 3SI9A 2NV1A 2HSAA 4H3DA 3BG9A 1TPWA 3CT7A 5L6UA 2ZRWA 1AG1O 1W0MA 3EXTA 4YLWA 2CZEA 3IIXA 5DY2A 4G1KA 3DAQA 2WOQA 1K7FA 3TQVA 4UTTA 2QDHA 4ICNA 2ABAA 5DCEA 5CPNA 3LCGA 3S5YA 3UY8A 1TMHA 3CEUA 3TSMA 2VENA 1DJQA 1F05A 4K36A 3NQGA 3HG2A 3BK0A 3G0SA 3ZS4A 2HS8A 4LT9A 2DJLA 2TYSA 3GDMA 4AVFA 2E6DA 3S9YA 4TMCA 4RKAA 3BG3A 4N4PA 5AN7A 1TPEA 2DJXA 1JCMP 1R2RA 1FDZA 2GQ9A 3LGEA 5LHEA 3L0GA 3LCIA 3TH6A 1JRBA 3TXVA 3LHZA 2YYTA 4QIUA 3MUXA 1F76A 3NQ7A 4NUWA 5HWMA 3EWZA 1LBLA 1QPQA 1SSDA 2RH9A 1R47A 4TO8A 1DQWA 1N8FA 2WO5A 3G1HA 4WY0A 3GKAA 3LHTA 5AHFA 3BG5A 1Q6OA 5D03A 1FY6A 3HPSA 2E77A 3L0NA 4NX5A 5D37A 3V75A 2FDSA 1SFJA 5DCBA 3A5VA 1R2TA 4ADSA 1YXYA 5HJLA 3GIYA 3L68A 1L9WA 1TPB1 3L9CA 3AJXA 1MEWA 4K8HA 3T44A 4O52A 3M6YA 4GE8A 2CLFA 1XDLA 1XC4A 1ME9A 3DHDA 4HKPA 3W7JA 1LOQA 2J9YA 3FJ6A 3WFAA 4RZ4A 1LP6A 1K8XA 4UTWC 1PCKA 3IVTA 4BWLA 3C56A 3N9SA 3GYEA 5HWNA 2QCMA 3P67A 1XBVA 4HPJA 4QISA 5CPMA 2J24A 5J5DA 3WK1A 2FQIA 4TU1A 1MSSA 1PCWA 3CM4A 1OX4B 3W7CA 3TNOA 5DXYA 4N6EA 3LHWA 4RLIA 3R2GA 1Q6QA 1D3GA 2Y62A 4UCGA 3IIZA 3VCRA 1L6YA 3QMTA 1X1ZA 1R30A 4M6VA 1EX5A 3W7IA 3ZWTA 2NX3A 1LBFA 3DI0A 3LLDA 2B7NA 4E38A 2J6XA 2EF9A 1JJKA 3MW7A 3TX9A 3LRKA 1WQ5A 3Q58A 1BKSA 2J9XA 4O1BA 3IRDA 3CEPA 4LW7A 5G2IA 4TMBA 3DFTA 3TJXA 5K2ZA 1M7OA 5FF3A 1VCFA 4LNYA 2BTMA 3HF3A 3PG9A 2A21A 1HG3A 3C2OA 4IPIA 3P5ZA 5AHNA 4UUIA 3KRZA 1ICPA 1FCQA 2XFWA 1VC4A 3B4UA 4LV9A 4O15A 5HMSA 3M7WA 2B0MA 4LS0A 3W83A 1K8YA 1YTDA 1TQJA 2YFNA 3DKLA 3LCHA 5DLCA 3HG3A 2C1HA 1VR6A 3BW3A 3FLUA 4O0ZA 1VQTA 3PUDA 3UWUA 2EKCA 1SZGA 2A7NA 4O19A 5I3HA 1I2QA 2X1SA 3QM3A 1F6PA 4JD4A 1P4CA 1JRCA 1H1ZA 2NUXA 3PWAA 5AOUA 1UBSA 3WJWA 4CNOA 5FI8A 3TW7A 3IIVA 3RLVA 3THAA 1GVSA 1SW0A 3SGUA 3W1MA 2P0OA 4HNVA 2G96A 3HGRA 4OGZA 2C0AA 3B06A 4Y90A 4PC8A 4Q33A 3QFEA 1TIMA 1D3HA 1UCWA 1H7PA 5DELA 2CLOA 5T26A 1GJPA 3DHFA 3M0ZA 2B7OA 4FNSA 1QDSA 2V82A 1H63A 1FCVA 4N9CA 5HQEA 4AMAA 3DFOA 4FXRA 1THFD 2QAPA 4A21A 4ORMA 3TQ0A 2QDGA 5E93A 3PUEA 1ZENA 2DU2A 1WA3A 3HBLA 5D04C 2HTMA 3KHJA 4JY8A 3NYZA 3PM6A 1ADOA 3W7OA 4Z08A 2OT1A 3C4UA 1KFLA 1Q3NA 2I9EA 3E12A 3DFQA 4NXSA 5F2IA 3QH2A 1G4SA 5F4WA 3QRHA 2FFCA 4JEQA 3GNNA 4LVDA 2X1UA 5BW6A 3DENA 2UV8G 3NR0A 2VC6A 4JTGA 4C1LA 3W7EA 1J4EA 2W0UA 4ZQNA 3G1AA 5E0KA 4LY8A 5EY5A 1CI1A 3LI0A 3B05A 2C15A 4PCFA 3EX6A 3BARA 3IVUA 3NVTA 1OYBA 4XWUA 1IXNA 1LRTA 3W3OA 3I6RA 2A4AA 2C18A 3CB8A 4JIQA 2ATMA 1K7EA 4WOQA 4C1KA 3B0VC 3W9ZA 4FXSA 1XBYA 2NUYA 3QEZA 3WJSA 1ME8A 1NAL1 5I3GA 2PE4A 3QSTA 4O28A 4E2DA 1MEHA 4BI5A 2ZRZA 1OX5A 3UZJA 1BWLA 1TPUA 4O14A 1C29A 2ALDA 2E6FA 1VYSX 3HGSA 2ZZ5A 1V7YA 1G7UA 2FB2A 2DZPA 1W5QA 4LS1A 2VEIA 3QW4B 1RQHA 1TJPA 3KRSA 3O15A 4X9SA 4XZ9A 4QM1A 5AYZA 2LLEA 1TJRA 5K4XA 1MXSA 4UFKA 2RDUA 2WNNA 4AH7A 4JTEA 1CX9A 2V30A 3H53A 3O63A 4UFMA 1EP3A 3W7GA 4UFLA 3TFXA 3USBA 4DQWA 3PBUA 2E1DA 2Q3RA 2VFHA 3L0KA 3OVPA 5LGZA 5AFDA 2RFGA 3E96A 1YLVA 3T40A 2QCCA 1PE1A 1RV8A 4MLJA 3MP4A 1GPWA 1PV8A 1YDVA 4GWEA 3PSWA 1DV7A 4NNBA 5EMUA 2ZRXA 3L5LA 1FX6A 1A5SA 4MZ8A 1HO1A 5CZTA 2Y7DA 1RZMA 4K6AA 3ABQA 5F2GA 1VRDA 3M47A 4CCCA 2OJPA 3KVLA 5I3KA 1OFDA 3NPXA 3LB0A 5K9CA 1LLWA 1XI3A 2ZCGA 2O7QA 3I7RA 3KOFA 2WQPA 3CWNA 3DKJA 1Z41A 3GDRA 2I14A 2QCLA 2W79A 1Q45A 5AHMA 3V1PA 5C55A 1GYNA 3HB9A 3B04A 4PODA 5BNKA 1IGSA 3QMSA 3QPZA 4UTUA 2TPSA 5LNVA 3UY7A 3ABRA 4Z1BA 3LCFA 3L5MA 3N2XA 3QJAA 1G6CA 4A2SA 3DFPA 4JX5A 1KTCA 1ZJIA 2GQ8A 3E49A 3PBYA 4GUGA 4HPXA 4FX8A 1M5WA 1QO5A 3LDVA 4FNRA 4CQ9A 2VXNA 3CU2A 1HL2A 1HO4A 1PHQA 3LHVA 3GDKA 3WJYA 2QCGA 4JX6A 2Y7GA 3CQ0A 2QUUA 3STFA 5F2MA 4O0KA 3W1UA 3THQA 3M5YA 3MMTA 5AC6A 3DFNA 1FDYA 3O6YX 5LSMA 3EKLA 3P8IA 1VCVA 3EX2A 4UMBA 2B4GA 2D73A 3DGRA 3GDLA 1H5YA 3S1VA 3FEMA 2PRHA 3NQFA 4ZMGA 2OZ0A 1MO0A 4IMFA 2DZVA 2V0TA 4RR4A 3O8AA 3MI6A 3SECA 1AW5A 2ZQ0A 3LRMA 3VI2A 2ZDRA 1GT8A 3UWWA 2ZA2A 2GOUA 2QEZA 4GUHA 1BEUA 2VEMA 5KMYA 1KFCA 1TV7A 4L4MA 3NQEA 2A6LA 4HT3A 4MZ1A 1QOQA 4MFDA 4H4IA 1W5PA 2B7PA 3S5OA 1ONRA 3BW4A 1VPXA 3HJZA 4OU1A 3EWXA 3S1UA 2Z6IA 1HUVA 4JXCA 1B9BA 4YL2A 2JBMA 3G1DA 4UTWA 2J9ZA 3HO8A 1KBJA 4MOZA 5A5WA 2A5HA 3CIXA 1KFJA 4KFOA 2FJKA 1ZHAA 3TA6A 1TPDA 1RPXA 4AHOA 1PIIA 4MUZA 1TO3A 3G1SA 5SWUA 2P1FA 1MEIA 4UTIA 4DBDA 4XBSA 1JCJA 5CGQA 3W1AA 1UB3A 3PR2A 3MP3A 4JNMA 1ZCOA 8TIMA 2JKEA 4KWWA 1FDJA 3I7SA 1JUEA 1GVRA 1FQ0A 5AYYA 4K38A 1NF7A 1NVMA 4ONVA 3IGSA 2WNQA 2RDWA 3EX3A 2FPVA 4LS2A 1FCUA 4QQ3A 1A5BA 3NQVA 4JTTA 1G69A 1VHCA 4JTSA 3BPWA 1W3TA 3BLFA 1H61A 1OFRA 3OHIA 2E6YA 4JTIA 3C2FA 3EWWA 1AW1A 3Q94A 2OX1A 3FJLA 2WNZA 2WSQA 3VE9A 3EX1A 3ABOA 1F6KA 2PURA 4XQ6A 1H50A 1YDNA 4HSOA 3PS7A 4OHQA 3VE7A 4EIVA 1KM2A 3LV5A 1QPRA 1H1YA 1WAUA 4JYDA 3PAJA 3KFTA 4OWGA 2Z0IA 1W8SA 1YTKA 3O6DA 2ZTJA 3TCEA 2E6AA 3L66A 3HGOA 1VZWA 4Z0JA 3WK0A 1N55A 4UIOA 1H60A 4L4LA 3W71A 4GXMA 4O13A 4MY9A 4GUJA 4JTUA 1KBIA 4P2VA 2EPHA 5FF0A 2TSYA 3C2VA 5MHBA 3NPUA 2ZA1A 3NQMA 1F5ZA 3F1QA 3B0UX 3TFCA 1SPQA 1TV5A 3VKJA 1W5NA 3HG5A 1YYAA 3P60A 2GJLA 3P61A 2VEKA 1FUYA 1EP2A 4PFMA 1KW1A 1OX6A 1WOBA 3FIGA 2WPBA 2ZZ2A 3GNDA 5CZJA 3NPVA 1G4EA 5IBXC 5HR6A 2PCQA 4K7YA 4MYXA 1KLZA 1T99A 3NM1A 4QNEA 1LORA 3CIWA 3W2LA 1O5XA 1Q6RA 3JS3A 2RHGA 3RK8A 1F2JA 2V2CA 4ZQCA 3L2IA 5CPLA 1K8ZA 1W54A 3LTSA 1GTHA 2ISWA 1EEPA 5LZLA 2NXHA 3TMLA 1KM0A 2F7FA 4CLMA 2JGQA 4FNTA 3NQ6A 5KITA 2FPYA 5KZMA 3W85A 1GVQA 4DF2A 4FEZA 2ZZ3A 3ZWSA 3P84A 3DU0A 5F1VA 3B03A 2A1YA 1X6UA 3SIZA 1TREA 2QJIA 2Y89A 5CZ0A 3MJYA 2Y6ZA 2PRMA 4UNLA 1ICSA 1JQXA 3PC0A 1H7NA 4FIQA 4IX0A 4Z1DA 3NXFA 1SUXA 5K4ZA 1DBTA 3KVJA 4D2JA 4I9AA 5FEWA 1VS1A 3M16A 4E2BA 2GVGA 3W76A 3W84A 5DBUA 1SW7A 4LVAA 4TX9A 3RLUA 2DZXA 3MO7A 1PL9A 3FFSA 3TMQA 5I3IA 3IGXA 5U4NA 2X30A 2RDTA 3EWUA 5C2XA 1S5VA 4DBEA 4PA8A 4M7TA 3UQNA 4A2RA 3NEVA 1EIXA 1QMLA 4RK8A 2V8ZA 4RCXA 5F4XA 5ABTA 5HWJA 2YGYA 7TIMA 4A29A 4BK9A 4EWND 2DZTA 1XDMA 1T8XA 2VELA 4UTJA 1G67A 1U83A 1W1ZA 1TYGA 2QF7A 3W7HA 4IGHA 1ZAHA 3MBFA 1VH7A 5K7JA 2VOMA 3NM3A 4OQVA 2H3BA 5HNRA 2CU0A 1IIGA 2CLIA 4MPQA 1YPFA 1H7WA 2A6NA 4GRSA 3PBVA 1JCXA 5EKYA 1TPC1 4O53A 4NJKA 4CQ8A 3WK3A 2R94A 1WBJA 2VFIA 2QUVA 4FHAA 1U5JA 2ZYFA 5CG7A 3GKFA 3G1XA 4N02A 4E0CA 3P74A 1SO5A 1IXOA 4EF8A 3W1TA 1IIHA 4NJHA 5AB3A 3A5FA 3FYPA 3W2KA 5LNRA 2QUTA 4O18A 4WXZA 1AW2A 3SY5A 5D32A 3TK7A 1TTPA 5CZSA 3FA5A 4J9JA 2PC4A 3NQAA 2QCDA 3M41A 4FB7A 4NX0A 2ZRYA 2NUWA 2BZNA 2QJHA 1BWKA 2BX7A 4QSHA 5CSSA 3OBKA 3JRKA 4U4MA 1N7KA 1SR9A 2X1RA 3U2OA 3C6CA 4IXXA 2Z2UA 4JY9A 5LNSA 2QAFA 5TBOA 1M7PA 3JR2A 2XN2A 2AGKA 1GYLA 2BLEA 3NQ2A 1KM1A 2NLIA 1B57A 2V2DA 5F2LA 2Q8ZA 3UWVA 1GQNA 4KFNA 1XXXA 4PL2A 4AF0A 1VHNA 1S3HA 4XTDA 1EWDA 4OE7A 5AYXA 1HFBA 1OFQA 1GG1A 2QCEA 4MFEA 3ATZA 1B3OA 4O11A 5G1TA 3NG3A 2H6RA 3HMJG 2PRLA 1O95A 1QPNA 5LHFA 4LRSA 3TV8A 3NZRA 4UR8A 1XUZA 3SW6A 2R91A 3M5VA 3W22A 3G8RA 5KINA 1H51A 2JKPA 5LNWA 4BI6A 5C5YA 1K3UA 3MWAA 3BLIA 4UMCA 5AHIA 5G2HA 1FXQA 3QPYA 3B8DA 3MI3A 4NJJA 3HQ1A 5LKYA 5FESA 1B4EA 3FOKA 3D0CA 3IGUA 3OA3A 2EAWA 3W23A 1VJIA 3ELFA 3W7DA 4MKNA 1ZNNA 1KTBA 5D38A 1FWSA 3STEA 1OFAA 1DKWA 5H91A 1LM1A 2YXGA 4JTFA 4NVTA 3NO5A 1TPFA 3LXBA 3QSRA 2FLIA 3TIMA 3GR8A 4UNKA 1JULA 2XN0A 3KRUA 4K39A 3QF0A 2I1OA 4DPQA 3HG4A 1H7OA 2CWNA 1OABA 4LVGA 4IWWA 3BO9A 4GJ1A 3TJLA 1I2RA 2G95A 1VCGA 3O06A 3TW6A 3EXRA 4Y6GA 2JK2A 5F1UA 3N19B 5D2TA 3F4NA 1QCWA 1W3NA 1RQBA 4O17A 3LI1A 1KFKA 3SFKA 2CFFA 5J5RA 4JYFA 5K9DA 4RXFA 3ZFHA 1LRQA 3NA8A 1W37A 1VLIA 1SZFA 1RQEA 3W1LA 4Q4KA 2Q8LA 3FKRA 3T55A 3UNDA 2B7QA 1OK4A 4JTKA 1J5TA 1O94A 5K9XA 3E9AA 3PVFA 3C0JA 3ATYA 3RNDA 1JCLA 1VYPX 1TB3A 3H54A 3TUUA 1QO2A 3BVJA 1YXCA 2VFFA 2ZZ4A 2YZRA 3ABSA 1EUNA 1NFBA 4JIPA 3L5AA 3P8JA 1XBZA 4IQLA 5U7SA
chains in the Genus database with same CATH superfamily
3SB0A 3DHUA 3KVMA 2FKPA 5DRCA 2HS6A 5KZEA 3KS6A 2RUSA 4U3CA 4UTLA 3ORWA 5TD4A 1HX0A 2PDWA 2E1WA 1XRFA 2PP3A 4HZMA 3AMGA 2OEKA 1Q66A 4XKYA 1EDQA 2OEMA 5M1TA 5JXQA 4QLJA 1LCOA 2YBTA 1CECA 2HQAA 5D2XA 4OUEA 1Q7QA 3ICJA 1V3IA 4R3UA 4K7VA 1SZNA 1JUKA 1K9EA 5HINA 5TAOA 1KC7A 1ZRQA 1X8FA 1J0YA 1K02A 3KS5A 1XD0A 2L5HA 1PJ9A 4ZODA 3EAUA 1SU5A 5D9NA 1JCYA 6ALDA 1UHVA 1EHAA 3AU6A 3LSCA 2YR1A 4O4WA 4WCJA 4QAIA 1HJVA 1G1YA 3SRKA 3C3UA 3LBCA 2E09A 3W7NA 3VIHA 4QCEA 2FHCA 3G1YA 4O1AA 1KV5A 2R1LA 3CH0A 2Y24A 2PTYA 1PZ1A 3QKZA 4WQ6A 2AQWA 2QKFA 1UJPA 3RU8X 1DE6A 4KMQA 2VURA 4WUIA 4UQEA 4UTMA 1XFCA 2XFRA 4UOJA 2ABBA 1C8VA 3TAOA 3CGTA 2VRKA 4ZXLA 4CD7A 3M5XA 2ISFA 3UR2A 1RBOB 1W9UA 1DJNA 3GH7A 4AIBA 1LL7A 1QI3A 1E1FA 4O1DA 1GOKA 3W27A 3K4DA 1UQZA 3TZFA 1RK5A 3MUAA 2Y85A 2BG5A 4C7FA 1I6NA 4FO4A 3KX6A 3LPGA 5JU6A 1GGOA 4PRRA 2OLHA 1P1MA 5D2YA 4RNIA 4L9XA 1JXJA 2PDQA 3NXLA 1UKOA 1DJWA 3I68A 1WO2A 3IJ9A 1KTNA 4RZ6A 2BVDA 4HU0A 1V5XA 3PY2A 1UD5A 4NU7A 2GDVA 1YEYA 1HXJA 4D6FA 3K30A 1W3HA 3WFZA 2Z1WA 1XQLA 3JU2A 1S1RA 3SSZA 3PBWA 3DYOA 3GHSA 1L6SA 3H2EA 4KERA 1YDOA 3R8RA 3N1AA 4LRTA 3MANA 2JKAA 1XYBA 4UQAA 3ZQ9A 2GPTA 4WX2A 1OYCA 4S1FA 1L2UA 1ZBKA 3C2RA 3FW6A 3MHFA 3LK6A 1VJSA 5GJPA 3CUZA 1HN1A 1QWGA 1VGAA 3L65A 5XIAA 3WLMA 2X40A 5BXSA 1DHPA 4M19A 5LIWX 1MWOA 3M0LA 3HPAA 4KETA 1MYRA 3VAVA 2Y88A 1REQA 4WSKA 1FWWA 2D23A 3KTCA 3AOFA 3RU6A 2YW3A 1V02A 5FACA 2C19A 4LBSA 4XKYB 3W28A 3CB3A 3M5ZA 3W74A 5I78A 4WF7A 1NU5A 3NL3A 3AC0A 2VEFA 3B9NA 5DQPA 2H3DA 4IOTA 2Y7FA 4HNLA 4GHRA 4JDYA 4IPNB 1IXQA 3WQ8A 4KKXA 3R58A 2BY0A 5FEPA 1EPXA 3TYBA 1ZP3A 1HW6A 3T7VA 3O16A 4OFCA 5DT5A 4H6EA 3W70A 3MKKA 2WSYA 1UKQA 2YLAA 4PGLA 1SW3A 3ARYA 3E6EA 4MJ4A 2Z29A 4N9BA 4IF2A 3ZLFA 4YS1A 2G3IA 4LUJA 2CETA 5BWFA 5BOEA 1UASA 4P7NA 3PNZA 2I57A 2HXTA 4PTMA 3GTFA 1ISZA 2WWDA 3G18A 4M1BA 4UTTC 5LNUA 2FHBA 5DBTA 3L4TA 4QGCA 3KBWA 5LXXA 2UY5A 4Z0SA 3TYAA 1HP5A 1BXBA 2DZSA 4HD5A 4HPNA 1Z48A 4GFSA 5JH2A 3GVWA 5A6KA 3NO1A 1XIHA 1FWGC 3FAXA 4Y9AA 1C9DA 3E5BA 3KBVA 4HGXA 1IEIA 1P5BA 1TV2A 4FLRA 3S83A 3GNXA 3JVAA 4REQA 2HROA 4DJEC 3TE9A 2C16A 3DH7A 2YPIA 1Z89A 2OT0A 1FTXA 1SMAA 3P81A 1EBHA 2VDGA 4FP1A 1SO3A 1Q6CA 2QUMA 1IT8A 3H2AA 3OZPA 3L4VA 3VD9A 5A94A 2NQ5A 2WC4A 4QE4A 5FKYA 1QNPA 3LCXA 3WQDA 4YXGA 1YIXA 2NX1A 2A2IA 2QR6A 4QR6A 2R14A 2YFOA 2VKZG 1WXYA 1WKFA 3PPCA 4I7WA 3WF2A 3M0YA 2G0WA 4JTQA 1TMLA 5FF7A 3QQ1A 2PLJA 3W87A 3SADA 3PZIA 5D05A 3TVAA 2Y61A 2ZBTA 1QPOA 2J75A 2EHHA 3GNRA 4FLOA 4QLLA 2KZHA 2ZDSA 5H8MA 4Z1AA 2QPSA 3W2UA 1BHGA 3GM8A 4XZMX 4HCHA 4MWAC 2FB3A 5HUPA 3V1HA 1SQ7A 1XSKA 5D9PA 1TZ9A 1XYZA 4PTNA 1C3FA 1S2WA 2NT1A 4DXKA 3FJNA 1KNWA 3C61A 3S0CA 3URBA 1JDFA 5E0CA 4UXDA 4KIEA 3HFTA 1YNQA 1E56A 3BW2A 3CZKA 2YW4A 1REQB 3V4BA 2PDHA 1FWRA 5H2ZA 1W5OA 3NQ8A 4YCPA 3H7VA 1SSGA 3M0KA 1RAKA 1LLZA 4MJMA 4GI8A 4IXHA 4NNAA 4ENLA 2P50A 4E4FA 4RDZA 4H41A 1UWTA 1R87A 4IMDA 2GVJA 2CLHA 3RFAA 3UWZA 1B4KA 1VFUA 3P2VA 1ZLPA 4JICA 3H4XA 4GY7A 2OX4A 3CWHA 4AD5A 4ALDA 4ORIA 2VFDA 3E74A 4P7RA 3AZSA 2C3ZA 1ZAJA 4O8AA 2HISA 4TIMA 2GQ3A 2BS9A 2PLKA 1W9VA 1HJSA 5A8MA 2FZMA 4EPEC 1UJQA 1EUAA 1C91A 3NDOA 3VNDA 5KZDA 3UPBA 2VCCA 4KEMA 1XH0A 2NV9A 4MPKA 4WDXA 2YCKX 4W9TA 4QS5A 1EXBA 1NH6A 2W91A 2YA1A 4FI4A 2DSVA 4O57A 6PTDA 2PDKA 3ARRA 5G5IA 4DXXA 1RD5A 4NF7A 4FNUA 5LA2A 1M41A 1JYVA 5GQBA 3EPNA 2WMKA 1AMKA 2Q6ZA 4IJRA 1BQGA 4ZQPA 1Q13A 4UR7A 2ZWYA 3AS2A 1FXPA 1XM3A 5JUVA 1AH3A 3A6OA 3PUOA 4Y8FA 3UR8A 5GJNA 4Z17A 5I24A 4REQB 4HN4A 3WEZA 2IPGA 3GD6A 1DIEA 1HIZA 5JBDA 1TCDA 2R8WA 4AIOA 4WY0F 3F5JA 2BMBA 1WV2A 1EB3A 2Z1BA 3CAQA 2QHAA 1RUSA 3GZ3A 3NCOA 3VZZA 3WH8A 3UT0A 4CNSA 4ZBCA 3QY7A 5TNVA 2YL6A 1FWCC 5HATA 2E67A 4W86A 3TAKA 1W1TA 3R7MA 2VGGA 3K1DA 5IDIA 4LWWA 1NP0A 5HMEA 4XUGA 1H7RA 5CC7A 4CUCA 1ZBCA 3RN6A 1DL3A 5G2WA 1KD0A 3E0FA 1LDCA 1GOXA 2QNEA 3STCA 3UVIA 4LGXA 3OIHA 3CK5A 3AUOA 3TZNA 1MFVA 1HZYA 2WVSA 4H2HA 1KFBA 3BJSA 4EOUA 4O1CA 1JEZA 2ZTKA 1ALDA 3GY1A 4IMEA 3GC4A 2NXIA 1OVDA 4FSAA 3CO4A 4V1YA 3YPIA 1Z6KA 3SN1A 1J5SA 4C6NA 4XAYA 3EB2A 4PMUA 1C8XA 3PUGA 1XCFA 2CBUA 2PGEA 2VD9A 2OSXA 5T9CE 1GHSA 4L61A 1Z8AA 4TXEA 3GXNA 3N4AA 1I2PA 4ZVJA 4ZQOA 2YL5A 4OV9A 3U8GA 1DJZA 3ALFA 2W63A 3WDRA 3MUZ1 1T8QA 4LSBA 1ZSXA 1A5AA 3TC6A 4JIRA 2E0PA 6REQA 4QNWA 3ZOAA 1JF5A 7ENLA 3U2CA 2AAAA 2H9AA 5FEZA 1FBAA 3SM0A 4PMQA 4UQCA 5EU9A 3RHGA 3SI9A 3DC8A 5C6MA 4D6GA 2UY4A 1CGUA 1TVLA 5L6UA 3S46A 3OQ8A 3MSGA 4GO8A 1F9CA 4OECA 4G1KA 1PEZA 4C6IA 1FRBA 1OD0A 3VNJA 2E28A 3TQVA 2YOCA 3H2FA 4EP8C 3LQGA 4Q7IA 3UY8A 1QNOA 3TSMA 2VENA 5KZ6A 4MG4A 1JAKA 2RGLA 1E4NA 4AVFA 1SJBA 2BP1A 1RALA 5AN7A 1KXVA 2GQ9A 5LHEA 4PMJA 3TH6A 2OR2A 1ISVA 4XISA 2IUZA 2AOSA 4GQBA 1HGYA 3R1ZA 1F76A 2V38A 4JCLA 4B9YA 3JUGA 1TWZA 5IDZA 1N8FA 2WO5A 3CPUA 1TFVA 2OWCA 2FDSA 2DT1A 1KQYA 2E25A 1R2TA 2F2HA 4A3YA 3GIYA 1TPB1 4RNHA 2Z4GA 2EG8A 3GUWA 1MEWA 4HMEA 3M6YA 4GE8A 1PYFA 1ME9A 3DHDA 4HKPA 1XLJA 3MC5A 3BSGA 3VINA 2J9YA 3AMCA 1GQKA 4PYSA 3WFAA 5C9ZA 1LP6A 1GQJA 1PCKA 1H5VA 1OWQA 3VIMA 4HPJA 5CPMA 2J24A 2V5JA 4ZFMA 3KBJA 2CC0A 2FQIA 1GKQA 1PCWA 4PEEA 3VDAA 4U31A 1J0ZA 3M0IA 3ECQA 3R2GA 3QGAC 3CV2A 1GNXA 3GH4A 1DJHA 3M64A 4PCPA 5FJIA 4HOZA 4HTYA 3A4XA 3QMTA 1R30A 2VCBA 3ZWTA 2G50A 1XIMA 3GHUA 2B7NA 2J6XA 4GPNA 3MW7A 4FPSA 3LRKA 3Q58A 2J9XA 1IE7C 1VD6A 3MMWA 2DUZA 4Q8TA 2FH8A 2XIBA 1I1WA 2BTMA 2POTA 1BYBA 4B91A 4EE9A 5AHNA 3QV7A 1FCQA 4O15A 2A79A 3QPEA 4LS0A 3GTIA 2O0TA 1HL8A 3R25A 1A3WA 3HG3A 2IKIA 4WKFA 4EANA 5I3HA 2X1SA 3S2CA 4JD4A 1R7AA 1UR8A 2NUXA 1H1ZA 4WDTA 3FCPA 3WNOA 2HK0A 5FI8A 2OYKA 3O0KA 3NTYA 2C79A 2G4JA 4N7QA 3RLVA 1SW0A 2ZUWA 2G96A 3HGRA 6REQB 1Q63A 1SM9A 2C0AA 4DJDD 1X97A 1RHCA 3T05A 4H7CA 3DHFA 3M0ZA 2XH0A 2B7OA 1TZZA 1OCBA 3BWWA 2VD8A 3S6TA 2V82A 3DOPA 1FCVA 2WVUA 3CS2A 2ON3A 3GNPA 4N9CA 2WMFA 2EQDA 4D6DA 3TQ0A 4B5TA 4IL2A 4ERIA 2O9OA 1AZ1A 2BXYA 4QTGA 2UWFA 4LYKA 4W7UA 3UG8A 3HBLA 3ZT6A 4JY8A 2VC7A 3VGGA 2OT1A 4L4OA 3OO2A 4GOAA 3E12A 1NWRA 3QRHA 4LVDA 4GIAA 2NQLA 1KWGA 2DUXA 2UV8G 2VC6A 3ES7A 3GBEA 3BOLA 4ZQNA 3G1AA 1JI2A 4NI8A 2C15A 1S46A 4QBXA 1B9ZA 1C7SA 3VVGA 4RDWA 4XBJA 1FWAC 1SJAA 4JAWA 3NVTA 4LQ1A 4YVVA 2A4AA 2ATMA 3ARVA 3B0VC 4FXSA 1UWSA 1XBYA 2P5NA 3QEZA 2OWWA 4D1JA 1S1PA 3TN6A 2WC3A 2WZMA 4PMNA 1C9WA 2ZRZA 3V16A 3UZJA 3GG0A 1BWLA 3KL3A 4O14A 1TKKA 2XUCA 3HGSA 1G7UA 2DZPA 1EC7A 3QXBA 4LS1A 2VEIA 3KRSA 3O15A 4QE5A 4QM1A 1Z7AA 3ITGA 4UFKA 4F48A 2RDUA 2ZWZA 2V30A 3H53A 3NSMA 1KWKA 1FWJC 1PX4A 1R6WA 2HZGA 4DQWA 2DIKA 2E1DA 3G77A 1EF2A 1JXKA 4DJFC 3NOYA 2RFGA 4A8NA 3PTKA 4URIA 2ZUMA 1DWFM 2XDFA 2WJEA 1TJ0A 1PE1A 4Q6XA 4DI9A 3AZTA 2PDMA 3LU2A 1UH4A 4GMEA 3AXIA 4YTSA 3GRIA 3E2VA 5EMUA 3BOFA 1A5SA 3S2MA 3TCSA 1V0KA 5CZTA 3H26A 1A4LA 3CMFA 3EMZA 2NQHA 4P7QA 4K6AA 2AL2A 5C71A 3GVVA 1MI3A 2XPKA 4NASA 5I3KA 3CO8A 3NPXA 3M0JA 1P6WA 1XI3A 4DM2A 3I7RA 2PFHA 3VM5A 2I14A 3IUHA 1EKOA 4DX3A 1RLDA 5AHMA 1KGWA 3FHAA 3V1PA 1GYNA 4F8XA 4PODA 2OSYA 1IGSA 1OZMA 3E3HA 3QMSA 4ERAA 4UTUA 1E4LA 3SQSA 3UY7A 3ABRA 1R3SA 1E6ZA 3LCFA 3L5MA 1PDYA 3WF4A 3CUJA 3GIPA 3WEOA 2P3ZA 4HMDA 4C6PA 4J3UA 2GQ8A 4DBSA 1JYNA 3GUGA 2YDSA 4LPCA 5CGTA 1XIJA 2G3MA 4X9YA 1V3HA 1Q7MA 1HO4A 3I10A 2PAJA 1Q6DA 1MMFA 3STFA 3NUKA 1PKMA 4L65A 2OELA 2QVHA 3MMTA 3L4UA 2I5QA 5AC6A 4Q22A 2EPNA 5GPRA 3P8IA 3WBYA 3GDLA 1P0EA 2GZXA 3F5LA 5ECVA 2OZ0A 1Q6FA 2DZVA 1ONEA 2P3EA 3O8AA 3DN5A 3MI6A 1XH1A 3OG2A 2J7EA 3WNKA 1GT8A 3WQWA 2F2KA 3H23A 4DNHA 4GUHA 1BEUA 1BVWA 3LNMA 1IEVA 2OG9A 5C2GA 3RDKA 4W88A 3UFYA 2FZDA 4HYVA 1Q2SA 3OU8A 3FDGA 4HT3A 4WRHA 1MQRA 2D69A 2NVCA 3UJ2A 3S5SA 1I0DA 3BW4A 4OU1A 1TA3B 2ODOA 3EWXA 3S1UA 4GX9A 4YL2A 2IXVA 2JBMA 3E2QA 4C6LA 4JN8A 5CJMA 4AEEA 4MAZA 1ZJAA 4NL1A 1CLVA 1KFJA 5GNZA 4MNKA 1PAMA 2PI6A 1TPDA 4DAFA 4E6MA 2XSBA 1DJXA 4PE8A 4F0MA 1H41A 5FOOA 1DJYA 2XIQA 1Y5XA 4GH1A 4RV3A 4UTIA 3GTNA 1BWVA 1JCJA 3B9EA 5I0DA 3RIKA 3UA3A 3ITTA 2WM1A 4JNMA 1BYDA 3OJGA 3I7SA 1GVRA 4PUKA 5AYYA 3KL5A 3AAMA 4ZO8A 4ZO6A 3NSNA 2RDWA 5CBBA 1YNPA 3TN5A 4JTTA 4MB1A 5EMYA 4O1EA 2VR4A 1V79A 1W3TA 1IR2A 1H61A 5KETA 3TA9A 1WDQA 2PWGA 1R3YA 4AX6A 1AW1A 2W67A 2WNZA 3GS6A 5D4YA 3VE9A 2VR5A 4UNIA 1IZKA 4JNYA 2XVPA 3ABOA 1F6KA 4LANA 3DBNA 1H50A 3VE7A 4QJ4B 2AL2B 5FJJA 4EIVA 2WW5A 2UBPC 4FMVA 4JYDA 3KFTA 2ZTJA 1QU4A 4Z0JA 1EJTC 4B9ZA 3CPGA 2O4MA 2ZVRA 4NYUA 4NKCA 3LPFA 3ANUA 4H9TA 4JTUA 4DZIA 4P2VA 5FF0A 3SJNA 3KCLA 3WLTA 3NPUA 1LL4A 1F5ZA 1YYAA 2VEKA 3A47A 2FGZA 2WPBA 2Y5SA 4IHCA 2WVVA 3KP1A 3WBXA 4DUOA 2FTWA 3OGSA 1T99A 4QNEA 3W2LA 3PBMA 3FVDA 4DAIA 4FAMA 3JS3A 6XIAA 3RK8A 3HQOA 1F2JA 3WL1A 2DIEA 5CPLA 1XX1A 1W54A 1AD4A 3SCUA 1CCWB 1BD0A 4C1NA 1OC7A 2PDLA 3FXGA 4C5ZA 4J5NA 3ITOA 4DF2A 4FEZA 1CYGA 3GSMA 1UD4A 3WL0A 4IISA 3PJXA 3P84A 3RPTA 1R5YA 3DU0A 1BXNA 2A1YA 3SIZA 1XINA 2Y6ZA 3QHOA 3PC0A 4B2DD 1OM0A 1EJSC 1H7NA 4IX0A 4Z1DA 2Y4SA 3UJRA 3NXFA 5AYBA 1DBTA 4I9AA 4JN7A 1VS1A 5FAGA 1LWHA 1PB0A 2VQTA 4HBKA 3WD1A 5DBUA 1SW7A 1FWBC 2QVNA 4HYWA 3UJFA 1PL9A 1F4HA 3A12A 1EGVA 3L2MA 2DPEA 2HWGA 3TMQA 1JPDX 5AVHA 4PFHA 1ZBWA 2YLLA 2VX7A 5I7GA 1F61A 3EWUA 5A6LA 1S5VA 5C2XA 4H7VA 2XSAA 2GGEA 4LBUA 1C90A 2C1GA 1EIXA 1QMLA 3IAPA 2V8ZA 4RCXA 5F4XA 5ABTA 2JEPA 4BK9A 2BODX 2IQDA 2DZTA 1T8XA 1PKYA 1PYMA 4I8YA 4DNMA 2WQDA 4IGHA 4MM1A 1ADDA 1VH7A 4DUVA 2ZUSA 4GA8A 5HNRA 3UG4A 3AS3A 4H8UA 5IRPA 4FLSA 1WKEA 5EKYA 3GC2A 4B2DA 5HPOA 1JD9A 3WF0A 1HJWA 1XG3A 1XGZA 3BDKA 2VFIA 4XZWA 2D20A 4FHAA 1WZMA 5DRIA 3DG7A 1IXOA 4XZHA 3APTA 4PCTA 5AB3A 3H2MA 4MB5A 4WXZA 1XP3A 1EYWA 5D32A 4AZBA 2E9BA 4EKJA 2IXUA 1UR1A 4FR1A 3WLNA 1ZQ5A 5LA1A 2QCDA 1L6GA 1EQPA 4J3VA 4HNCA 1FFQA 1ONWA 2PF8A 1CXEA 5LNSA 1M7PA 4ZO7A 1TWSA 1JZ6A 3M7SA 3VKDA 3PK7A 5ABFA 4KFNA 4PL2A 4XTDA 1EWDA 1PIFA 3E2RA 2DFAA 2BGNE 2DQWA 5MF5A 3ONBA 1B3OA 4O11A 4L1WA 3B0XA 4W7VA 3UP8A 3NZRA 1ODZA 3FEQA 3SW6A 3UW6A 4DIAA 3UETA 1H51A 1ZU8A 4F0HA 2XFFA 2J7HA 1PZ3A 4C7DA 3MWAA 3QVQA 1E71M 2INZA 1YHTA 4US5D 4B5XA 1EEXA 1FXQA 2WVVB 3MI3A 4NJJA 1G01A 1JGIA 3IUIA 2PTXA 3FOKA 3RRXA 4MWAE 4QJ5B 3ELFA 4A3QA 3LQLA 1OCJA 4MKNA 1ZNNA 3MSRA 1KTBA 1A5MC 3AUJA 4AVOA 3ITVA 4C1NB 1DKWA 3BCFA 1KB3A 2YXGA 1FP9A 3LXBA 3RR1A 5BWAA 4UNKA 4WDUA 3D6NA 1XF0A 3FA3A 2ZXBA 2I1OA 2CWXA 1CGTA 2J8FA 4ZR8A 3BO9A 3GBDA 2X8RA 1VCGA 4I6KA 1C8QA 1QI4A 1MW2A 3KBMA 2JK2A 3N19B 1QCWA 5HMDA 3WNLA 1NP2A 1ZTVA 5ECUA 1Q2RA 1KFKA 1EH9A 4WGHA 5J5RA 4JYFA 5K9DA 4JFSA 5HNTA 4QXIA 4ROPA 1K9TA 1YPXA 3S9IA 3W1LA 4Q4KA 3UNDA 1J5TA 1F8IA 3OBAA 3RNDA 3L4YA 1TB3A 2QPXA 3SCQA 1YXCA 3WNNA 2ZZ4A 1CPUA 2X7WA 3ZR5A 1KGXA 3VNLA 1E0TA 3TWAA 1TR9A 4S3AA 3STPA 2GJPA 1LT8A 1FKXA 3A3HA 3N6QA 2FDMA 3CMGA 3P80A 4ZGYA 2WHMA 2DZUA 3LA4A 1DIKA 1SVDA 2IQTA 4INFA 4OBSA 2WJDA 3UWYA 4S3FA 1W91A 5AKQA 3D3FA 3WQVA 4OJYA 1UROA 3OGRA 3DYPA 5I3FA 3SCWA 4F3HA 2ASHA 1UUQA 2GGHA 3NL5A 1XIGA 4H6QA 2QYGA 4B92A 1LUCA 3EWCA 3IIOA 3N9RA 3WF3A 2VX4A 4CVUA 4GYPC 4DEFA 1G94A 5A95A 1OYAA 1GWJA 3CUHA 5A3HA 2EEXA 4IFOA 1AL7A 2W61A 1JDDA 2WSPA 3W37A 4I7UA 2QCDB 3BGJA 3FAWA 1BRLA 3N6HA 3VNKA 4Q7BA 2V5BA 1EJRC 4YWIA 1VBUA 3H21A 4IJCA 1WKDA 1XLBA 4X3ZA 3P3BA 4O50A 3SCPA 1BKHA 1VLWA 1PKLA 2DW7A 1O5KA 4P7OA 4JYEA 1AUSL 4AISA 1OT1A 1KM6A 5A2AA 1I2NA 1UMLA 3W7KA 3UPWA 5IBXA 1VBJA 4PL1A 1V51A 1XSJA 4JTDA 4D6HA 4MNJA 4AHQA 1SO6A 3OB8A 4IP5A 3CL7A 1OF8A 3GH5A 1BYAA 1IEWA 3AIWA 1JQVA 1AJ2A 1GVYA 4BFAA 2EPLX 1S39A 3K4WA 3QTPA 1KBKA 1T96A 1T40A 3FGCB 1K70A 4WLCA 2WKGA 4M29A 4AWTA 4CNTA 3D3AA 3FXYA 4HNUA 4UTHA 3LTPA 4D8LA 3CPRA 2EKGA 3MCNA 3VGHA 4GYKA 5DXXA 3F2CA 1BTMA 3W1QA 3EMQA 3W25A 3RMEA 2FIQA 3L2LA 3P7YA 1ENUA 1IR1A 1IF2A 4ZL1A 1Y65A 2NWSA 1GPFA 1JL8A 3E5PA 4Q8PA 5HJXA 2JGYA 2YCIX 4EWJA 3B0PA 2TMDA 1C93A 5GVJA 3W75A 3W6LA 1XCWA 4KW2A 3TYEA 4PMDA 1N2VA 4ZTYA 4LAKA 4XZNX 4O0QA 1N8WA 1T0OA 4R7OA 1D3CA 4DZHA 5HR7A 4Y2WA 2X1TA 3ANYA 1XYMA 4WJXA 4IPJA 1FVPA 1ME7A 4FNPA 4UOQA 4AXKA 3LCWA 4LVBA 3T1GA 1X1NA 2PLCA 4EVZA 2XM2A 3MA8A 1DTNA 9XIMA 3HPZA 1IT0A 3H7UA 4ZCWA 3Q45A 1Q4WA 2VR2A 3CBWA 1TRIA 2RKXA 3KEHA 5FJOA 3HURA 1A50A 4KWOA 2XWEA 4W84A 1VBHA 4GXWA 3W1XA 4AB4A 2O55A 4H8VA 4NP7A 3HOJA 3W0KA 2G3FA 4M82A 3W7RA 5A8NA 4JHOA 1S5WA 2VZVA 3GX9A 3EDJA 2VDHA 1E1CB 4MYAA 4BR1A 1M65A 4W93A 2NQ9A 5D33A 3G1FA 5BROA 3NGJA 1QHOA 2NV2A 3B3DA 4MGGA 3IVSA 4JGDA 3EGJA 2E8YA 1UUOA 5I77A 1DP0A 1AK5A 1K03A 3A24A 3AIBA 4Z1YA 1KM3A 3H2CA 2VFGA 4Y9MA 2WMGA 4X2RA 1M6JA 1LUCB 3QZEA 4XVDA 3UZ5A 2YDAA 3PF3A 1S5TA 3KOYA 1WDDA 3LD5A 1CT5A 4HMNA 5D30A 1ZALA 1A3HA 4WK9A 4XBKA 3BZJA 1POJA 5FCZA 3MHGA 3TQKA 4UFJA 2WJFA 1I8JA 3PULA 5EMKA 5LIKX 3A4JA 2VEGA 2OO0A 5TIMA 1XDJA 7ODCA 4UZSA 3LHUA 3BUVA 3QOKA 1D9EA 3NPWA 5TQLA 2INEA 1P1XA 4YMZA 3GB6A 1CGWA 3GLCA 3BICA 5JVLA 1GORA 3SCNA 2IKJA 2YCLA 2V81A 1YADA 1YTEA 4C65A 2F6UA 4JTRA 2QT3A 2WCAA 1GZGA 2A85A 4GI9A 3WQEA 2ZOXA 1EO5A 4HN8A 4LF1A 3BAJA 4AD3A 4BF7A 3OZYA 5KTLA 2NX9A 2EPMX 3CUFA 5G4WA 1U5HA 3W6MA 3G1RA 2F84A 1J0IA 4CU7A 1Q7ZA 3S8HA 4P61A 2AKZA 1TTJA 4NXKA 1KFEA 2NSXA 5I3JA 1QT1A 1NDYA 2E40A 4A22A 1P0NA 3MS8A 3O9NA 3G3DA 2WLZA 5BMXA 2D0HA 3UXAA 4ZB0A 3KBNA 3MB9A 5D9OA 4GBUA 4J7RA 4GVGA 3C0QA 1GW9A 4FOJA 5AY7A 4D72A 1LYXA 3M44A 4CNPA 3GU1A 3BLEA 1X7FA 4BWLC 3N2TA 2GQAA 2YXOA 3TKFA 4QJ1A 5CKSA 1OFOA 1EGMA 4Y9PA 4D6IA 5L9FA 4R7WA 3SRFA 4GUFA 4FXFA 3SCOA 3VPLA 5AHLA 4M6QA 1NY1A 2W9MA 4AC1X 4CQAA 4B15A 2BHYA 3OW1A 4LU0A 2GUUA 4LC6A 3PJWA 5C9UA 2I5IA 3UVAA 1QJWA 3LM3A 4HTBA 3P62A 1SZEA 3W88A 2ZUUA 3UR7A 1WX0A 3MV01 3Q65A 1EZWA 2GDUA 3WLLA 3ITCA 3MSDA 3VDGA 4Q4RA 1QR7A 5BXRA 1UC4A 1XYAA 4S3BA 3UXIA 2JALA 4KH2A 3AIEA 2WCGA 1KV8A 1TV8A 1WDWA 4GQGA 1RCOB 3WSUA 2BWGA 3HJEA 1JF6A 3C8FA 2Y0FA 4Q32A 3I6TA 2TRSA 3CTLA 3DIPA 4Q4QA 4ZQRA 3M1ZA 2BY1A 3WDPP 2V3DA 3DDMA 3V35A 5K3VA 3GXPA 3MUY1 4B90A 5AC7A 1F74A 8A3HA 3R89A 4CD5A 2DVXA 3L7RA 1TIWA 4DUXA 2G41A 4HPHA 3W72A 6TAAA 4QLKA 1FWIC 4W4QA 4S3GA 4S38A 3R13A 3LTYA 1UH3A 1XW8A 4JOMA 4AWEA 3R6IA 2BGSA 3N73A 2Q3OA 4QG6A 3VMOA 3S1WA 1WDRA 4RX0A 1GEQA 4MHBA 5CH9A 3CC1A 2VZOA 3ME3A 3RF9A 4DWSC 3S42A 3PSVA 4CNUA 4ATWA 1DXEA 4GZIA 1NDVA 2V2HA 4Q8NA 1VFOA 3F7JA 1F7BA 3BAKA 4K8GA 2VEPA 4PTVA 3O3RA 1JDEA 2YCLB 3OVRA 4N4QA 4KBXA 1P0BA 3VNIA 2ZRUA 1ELSA 2YB4A 1LTDA 5FL1A 4I9JA 2Z6JA 5AECA 9RUBA 4LAOA 3KWXA 1TWWA 3PZVA 3WH5A 1VB9A 3LGGA 2XIOA 2ZZ1A 1RLCL 1R9YA 3MUIA 1V6VA 4ROQA 3KVKA 3LCLA 4K1GA 4I90A 4ICMA 1AL8A 1NF0A 3EOEA 3WJZA 3KUMA 2PGRA 1OF6A 1QUMA 4MNMA 5C54A 4PUJA 2QUNA 3H4GA 4I5RA 1O12A 2PDUA 1JVNA 4IMGA 2XFYA 1IXPA 1XGEA 3AXMA 4NT0A 4KESA 4C6CA 4I7VA 4PTWA 3F4DA 3SZ8A 4MJZA 2ISSA 1K7XA 1G4PA 1SZRA 3LX9A 4NZJA 2A0NA 3GU2A 3BAXA 3PG8A 3AS1A 4FIRA 2ZFAA 2Y1HA 2GUYA 1Y0EA 4X0VA 2D24A 1E0WA 1GONA 3MCMA 3CHVA 2YDRA 1UZDA 4WOZA 2FH6A 2E7FA 1F3EA 4Q4PA 3MYPA 5I00A 4DN1A 1DORA 1KRBC 1MVYA 3W7LA 5D2VA 1JYWA 3USZA 4CU6A 2J13A 3PP7A 4Y96A 3NYDA 4YTUA 1JCNA 4WXYA 1XL9A 3F03K 4KS0A 2FGLA 4X22A 1DTUA 3QQ0A 1HVXA 3UGRA 3Q2DA 4WD0A 5HDRA 5FSDC 5CCZA 2ISVA 3MP5A 1JD7A 1C7TA 3N14A 1W6TA 1UBPC 1RSCA 4DJED 3EX4A 1KLYA 4HNOA 3WH7A 2WZHA 3FYYA 5C9XA 3AO0A 2NV1A 6CGTA 4FXJA 1TPWA 3CT7A 3AIUA 1AG1O 1W0MA 3VIGA 1HKWA 3M0VA 3N2BA 2P8BA 2DEPA 4KCUA 3OLDA 3DAQA 5CPQA 1K7FA 4HZ7A 4UTTA 2VZSA 5DCEA 5CPNA 2GWNA 3LCGA 3S5YA 4H83A 1TMHA 2DV0A 4DWDA 4K36A 3HG2A 1CGXA 3CQIA 1VENA 2HS8A 2PP1A 2UY2A 2DJLA 4D6EA 3GDMA 1V8EA 2E6DA 4AIEA 4N4PA 4B4FA 1FDZA 2HE5A 1RY0A 1LQ2A 1JRBA 4KWSA 1E1EA 2BVWA 5CC3A 4QSFA 2DT2A 3NQ7A 5HWMA 3EWZA 1LBLA 2WMIA 1QPQA 4DJEA 1SJDA 4A4AA 1SSDA 3GW3A 4MWAD 1H09A 3RJYA 2J4GA 3S9ZA 3G1HA 2VVSA 4WY0A 1G0CA 3GKAA 2JF6A 4I8DA 1Q6OA 2WKLA 5D03A 3CZJA 2E77A 4G56A 1SFJA 3WQ6A 1E9ZB 4QEHA 4ADSA 5M03A 1MQPA 3AQUA 1X39A 4P8UA 1L9WA 4O52A 3I4EA 1XC4A 3NSXA 5DANA 2ZUNA 3BURA 1LOQA 2PS2A 4JQAA 4GBDA 4RZ4A 5E9AA 4UTWC 1FH7A 3A9BA 3IVTA 5KEZA 3GYEA 3GE7A 1XBVA 4QISA 4U2YA 3WK1A 3THUA 4J3ZA 3VGBA 1O68A 2XGZA 3W7CA 3HV9A 2PMQA 4N6EA 3S2JA 3LHWA 4F0RA 1MFUA 3GVRA 1RY8A 1XLEA 1D3GA 2PBOA 1V3KA 4MWAA 2Y62A 4R9OA 2ALRA 3T9PA 3VIOA 2I7GA 3V0TA 1EX5A 4ERGA 4DRSA 1TE6A 4E38A 2EF9A 4AZ7A 3RM4A 3TJ4A 4LW7A 4ATDA 3DFTA 5K2ZA 2PGWA 1CENA 4CVWA 1VCFA 5AVNA 4LNYA 1UPMB 3HF3A 3CYVA 1HKJA 3LBOA 1MQQA 3BLDA 1O7AA 2C7FA 1PUDA 4C60A 1ICPA 3CZLA 5HMSA 4LV9A 3HV8A 3M7WA 1JZ5A 2YFNA 3DHPA 1UMYA 3LCHA 1GQIA 2GJXA 3TNBA 2YCJA 1VQTA 3PUDA 2ZE0A 1W1B1 3TTEA 1SZGA 4O19A 3QM3A 4GO9A 1GJUA 1P4CA 4AQLA 1JRCA 1UPPA 2I56A 1VPYA 4XD4A 3N29A 1RP9A 4CNOA 1UKPA 3W00A 1TJ1A 3TW7A 3IIVA 3N2CA 1GVSA 2P0OA 4QQUA 4GCXA 1G9HA 1SYTA 1Z32X 2CLOA 4W7WA 5T26A 3TWBA 1PZ2A 3TC3A 2PC8A 1MNSA 4FNSA 4HU4A 2PP0A 1H63A 1JNDA 1CGVA 5JH1A 4AMAA 4FXRA 2QAPA 4A21A 4ORMA 2QDGA 1MUWA 5E93A 3APGA 1ZENA 2DU2A 2XZ9A 1WA3A 2J62A 5CXPA 2HTMA 4MJ2A 4IIEA 3PM6A 4YHEA 4Z08A 3W7OA 1KFLA 4QDPA 3KOXA 4M56A 3DFQA 5F2IA 3GNNA 5M2FX 1QBBA 3VDBA 5BW6A 1BVZA 2BY2A 1M68A 1U22A 3W7EA 3QLLA 4TVUA 5FJUA 5T8GA 2VTFA 5E0KA 1CI1A 2J47A 2F8QA 2YA2A 5DMMA 2OO6A 4PCFA 5H8PA 1DQUA 4YVXA 1OYBA 2PDJA 4XWUA 1IXNA 1LRTA 2C18A 2VM8A 2WMIB 3H70A 1UWAA 4C1KA 4UQ9A 3AROA 2P88A 1V7AA 3WJSA 1NAL1 2VC5A 2QJNA 2ZXDA 5I3GA 1E0UA 1JDCA 2D3LA 1FA2A 1MEHA 3VIIA 1OX5A 3GHRA 3C0LA 5LYRA 1TPUA 5FJTA 1UD8A 1C29A 1W1VA 2ALDA 4IPLA 2E6FA 2ZZ5A 4J28A 1OZQA 3WMBA 3DGBA 4HZ6A 1RQHA 1TJPA 4B3ZA 4X9SA 4H1ZA 4FS9A 5AYZA 5K4XA 1QK0A 4RZBA 2WZEA 4V15A 4AH7A 4KF1A 3G5EA 4UFMA 1YBQA 3W7GA 4OOUA 4UFLA 2YKKA 3IJDA 1A5UA 4F0SA 2PBGA 2VFHA 3L0KA 5CZKA 3AMDA 2F61A 3VM7A 5ENLA 4HK5A 2GDQA 1YLVA 1JAEA 1V6UA 3AHZA 3V5FA 1GPWA 1YDVA 4MWAB 1EJ7L 1J0KA 4GKLA 1RA5A 4MZ8A 1FHUA 3ARSA 4CN6A 1ZPTA 4IIBA 3UWEA 4B4HA 4DBWA 3HU7A 1JZ2A 3CT2A 1BPLB 1WDPA 2OJPA 1RCQA 4J35A 1IQ8A 2PDCA 3LB0A 1P0DA 1W9BM 2ZCGA 3DECA 3VILA 2NLYA 4EACA 1UP2A 2OGYA 3K8MA 3CJPA 3CWNA 5EFFA 4UOZA 2A3HA 4A3RA 2GJXB 1CB2A 3M0HA 2EBNA 7CGTA 3DC0A 3B04A 5BNKA 1YRRA 3QPZA 2TPSA 3N3TA 1PBGA 3N18A 3N9KA 3QJAA 1KKRA 1G6CA 4DJDC 4A2SA 5FJPA 4W89A 4JX5A 3C8NA 3PAOA 3PBYA 4GUGA 5DO8A 4HPXA 3B8WA 1LG2A 1JI1A 3HN3A 4Q7NA 2DSUA 3LDVA 4FNRA 2EO7A 5ABHA 4CQ9A 3SRDA 2WWCA 1PHQA 3LHVA 3GDKA 1NOFA 4JCMA 3TW9A 4JX6A 3SY1A 3CQ0A 3UZXA 4O0KA 3W1UA 4AUBA 1TE1A 3DFNA 3MU7A 2OEJA 2V3GA 3AISA 1VCVA 1H5YA 4UWMA 3WY1A 4QCFA 2PRHA 4HA0A 3GFYA 3AIVA 3S1GA 2V0TA 5I79A 3BJTA 2JIEA 3SECA 3LRMA 2ZDRA 1R85A 5CEWA 3OGVA 3UWWA 3DEQA 2ZA2A 2QEZA 4ECLA 4ZEPA 1NOUA 5KMYA 1TV7A 4L4MA 3NQEA 3NGFA 5C2CA 2A6LA 1VJZA 4OOZA 1YKWA 4JQ2A 4MFDA 4GGBA 4H4IA 3AYVA 2GL5A 2YJQA 3S5OA 3W81A 2MUCA 1BG9A 3PZUA 1VPXA 2B81A 2J7FA 5CC5A 1B9BA 4PMRA 3BQ5A 1ITUA 3WUEA 3D47A 1XH2A 2J9ZA 1B0IA 1ZJBA 3HO8A 3NURA 4MOZA 4GIYA 4DLFA 1A5OC 5IXEA 2A5HA 1UWRA 3CIXA 1M7JA 1J96A 1RPXA 3UERA 1PIIA 4MUZA 1TO3A 4XAGA 4ATLA 1UZ4A 3CL8A 2HDJA 4QFUA 2J7DA 2JEQA 1EQCA 4ZE5A 3DFYA 3MP3A 4YJ5A 8TIMA 4RPQA 1Q8AA 2EJAA 3FA4A 6ENLA 2YBUA 1NVMA 4ONVA 3IGSA 5EMJA 2WNQA 1NQKA 1IHIA 2FPVA 1VKFA 1YBQB 4QQ3A 3OZOA 1A5BA 3WBWA 2GUBA 4IZGA 5XINA 1WNOA 4BJHA 2B31A 3SCRA 3BLFA 1UA7A 3EOLA 2EPKX 1E9YB 4TVDA 3F2DA 2GWGA 4XVEA 5A8PA 4J2MA 1TR1A 3UCCA 3DCPA 1WE5A 2HPMA 4OIFA 2PURA 1WP6A 1IZJA 4HSOA 1PZ0A 1KM2A 1K4GA 2ZKMX 1BTCA 1H1YA 1WAUA 3PAJA 2WHJA 3UJSA 3TCEA 5EBAA 3L66A 3WK0A 1IWAA 1N55A 3AHTA 3QC0A 1J6PA 2FZ9A 4JQ3A 4WGXA 3PZQA 7PTDA 3RLHA 4UQBA 4D8ZA 2OVLA 3AZRA 2Q8XA 3ZJ8A 3CAVA 5MHBA 2XTKA 3NQMA 1E6NA 3TFCA 1TV5A 4TOQA 1B54A 3HG5A 3F2BA 2ONEA 4IM4A 1EP2A 2PDNA 4PFMA 3FSTA 3FIGA 2ZZ2A 3C86A 3VCNA 1G4EA 4BY3A 3PPGA 4MYXA 1KLZA 3NM1A 4DVOA 1Q6RA 3HMCA 1ZL1A 2RGMA 3RO6A 3ZM8A 2DH3A 5A69A 2PDYA 3C2YA 5F7UA 2QV5A 2V2CA 3L2IA 4RNFA 4XD5A 2OOFA 3UNTA 2J79A 2IPJA 3LTSA 3GG8A 2ISWA 2ICSA 3TMLA 3OYXA 1EJWC 3NQ6A 2FPYA 1P6CA 3GHTA 2ZZ3A 4YVPA 4DJFD 2J74A 3R43A 1QNRA 1H3GA 4J3SA 1OGGA 4AZ6A 1X6UA 1TREA 3F5KA 3MJYA 1ZZMA 1ICSA 3NDZA 1UH2A 4GIEA 3WMLA 1V6YA 3LZ5A 3MVIA 2CHRA 3PPFA 4E2BA 3K8KA 1R3TA 4ZOCA 4F2BA 4W85A 5CQ1A 3MTWA 4M1RA 3ZXWA 3BSMA 1W1PA 3OA5A 4NRRA 2X30A 4L64A 2RDTA 1MDLA 5BU6A 3UQNA 3TOYA 4I9MA 4PRWA 5E0FA 5HWJA 2YGYA 5I02A 3MDWA 1US0A 4XSLA 1AQMA 2FVMA 1XDMA 4EWND 4GGHA 1A0EA 1G67A 3LMYA 4EPDC 4DJFA 1VRXA 3ARZA 1ECQA 4EPBC 2PTWA 3EOSA 4KEZA 3NM3A 4OQVA 2J8GA 3SCVA 2O9RA 1IIGA 2CLIA 1XLGA 1H7WA 1YPFA 1GHRA 2A6NA 4JZ5A 2W66A 2GLKA 4O53A 3B8UA 4NJKA 3QOMA 5M3WA 3WENA 2R94A 3U4AA 3O2LA 3V0SA 2P0IA 2R1MA 5CG7A 3GKFA 4QJ3B 3G1XA 3GXIA 2BOFX 3LGDA 4N02A 5E5CA 1W9PA 3P74A 3VA8A 2WMJA 4ICCX 4PMVA 4EF8A 4YWSA 3A5FA 1AW2A 2PA6A 1UG6A 5MKGA 3MUCA 4J9JA 4Z2KA 3NQAA 3APYA 3M41A 1QW8A 4NX0A 2BX7A 4QSHA 5CSSA 3RPDA 4NZ3A 3OBKA 2J7CA 1SR9A 3O6AA 3U2OA 3C6CA 3NDYA 4M6UA 4NSBA 4RW5A 2QAFA 3A3XA 1VF8A 3NQ2A 3CHFA 2NLIA 1LF1A 2V2DA 5F2LA 3WFLA 2Q8ZA 5AZ0A 1E55A 1GQNA 2CCRA 1XXXA 4AF0A 3LENA 3VO0A 2WLYA 4CQCA 3W24A 3WQ4A 4TQTA 1OFQA 1JPMA 2R24A 2QCEA 2HV5A 3RCNA 3TYCA 1GKRA 5HQMA 2QPUA 5B7YA 3V36A 2H6RA 4CQBA 1O95A 4M51A 1I9CB 1VIWA 3TV8A 1XUZA 1BQCA 4NIRA 3M5VA 3G8RA 5KINA 2XGIA 4BI6A 1RH9A 4R85A 3R10A 2D0GA 1U5VA 3AJ7A 5HANA 4GZEA 3HA1A 4AD0A 5AHIA 3U2ZA 1XYLA 3UJEA 3WLKX 3WLPA 2YL9A 1J01A 4V27A 3HQ1A 2Y5EA 3L23A 3VKKA 5LKYA 2PDPA 1U33A 1XRTA 3V7PA 3AALA 2C8NA 3RO8A 5D38A 3TLQA 2ANUA 1OFAA 4CD8A 3RUBL 4JTFA 4NVTA 3BOXA 3NO5A 1KBLA 3QSRA 3TIMA 4AZGA 1M01A 1JULA 4J3TA 2IW0A 1YE4A 2CWNA 1NELA 4LVGA 3VTRA 1J93A 1BVNP 4GJ1A 2G95A 1UR0A 1FKWA 3GTXA 2Y5JA 5F1UA 5D2TA 4JKLA 2VWSA 4P8VA 4TVCA 3RITA 2DVUA 4QP0A 4JL1A 4IIFA 3NA8A 1QK2A 3B8IA 1VLIA 2VL4A 3T55A 1IV8A 1O94A 1HGWA 4GQ0A 2NVAA 4F66A 5K9XA 4EXQA 3E9AA 3PVFA 3ATYA 1NQ6A 1JCLA 7XIMA 1JPKA 2Y8UA 1E15A 3RYSA 4LUYA 3ABSA 3CZEA 4HOWA 4JIPA 3P8JA 3QY6A 2R82A 5U7SA 3BLKA 2ISDA 1I45A 3U57A 3IJQA 3RAOA 3LXCA 3CL6A 2BXZA 1JZ3A 3AYSA 1LQ0A 3GR4A 4X2PA 4ACZA 1R46A 3VK5A 2G97A 1WBHA 3IJ6A 4MB4A 2GVEA 3FS2A 3FYOA 1OIFA 1XRVA 5D02A 3CQKA 1DWAM 2E68A 4XZLX 3BAWA 4EXBA 1UD2A 3WLJA 1A5CA 4MVAA 3QY8A 1UW9A 4IGMA 4MUPA 1MZHA 2CPUA 4PRTA 5LIUX 1F3WA 2PDFA 2OZTA 1LWIA 5ABGA 1QI0A 3ES8A 1R3WA 3QYSA 2ACSA 4IMCA 3C52A 4AMCA 1WYIA 4LVFA 5GJMA 1OB0A 2AAMA 3W2MA 4YPJA 3VOGA 1Q6GA 1LT7A 4H9VA 3ZVHA 4XK2A 1A0DA 3ABZA 4JTLA 4BF9A 2X05A 1RBAA 5G4EA 5I09A 4A8RA 2H8XA 4F2UA 3PB0A 1TX2A 3RMJA 4NI3A 3GAKA 1RK6A 3TN4A 2ACRA 3UEQA 3W53A 4AF0B 4F79A 3NQDA 4WHBA 2FYMA 5HULA 2R6OA 3LLFA 1UR2A 5KSWA 4JS3A 4MB3A 5AC8A 4Y9NA 3V5OA 3Q37A 4ZZ9A 3KHDA 4NZFA 4L6OA 3KXQA 1V77A 4DHGA 4GJIA 4NJGA 4IFKA 1E51A 3W1NA 1KO0A 3UCQA 1O4UA 3QC3A 5CPOA 4XKMA 5BOOA 3O0FA 3VABA 1DEDA 3T6CA 3PZGA 1A0CA 1VAHA 2F38A 3OYZA 1OINA 2VGBA 4CKQA 3IV8A 2D2OA 4RE4A 1H11A 2E5CA 3N13A 1PVNA 1PS9A 1RP8A 4XAPA 4GH3A 1MRQA 2REQA 4AHPA 3VOCA 4MIMA 4D9PA 2VZTA 4JDBA 3B9AA 1KXTA 1T41A 1W3JA 3W6YA 3P6LA 5D09A 1DWHM 3GC5A 3GG1A 4HHMA 4A3UA 3RLGA 3L67A 2J27A 4H00A 1JUBA 1KGUA 2BY3A 3OEXA 1XISA 3SJ3A 4MF4A 4POCA 3DBPA 1CXIA 4CEXC 1XC6A 3W86A 5JMUA 4LALA 3QR3A 1D8WA 4UFIA 1FWNA 3E02A 3NL6A 2J7GA 1ISWA 3GVGA 3POCA 4UTKA 3I3BA 3T0CA 3CZ8A 1OJXA 1UIOA 1S5NA 2Z24A 4H9UA 2XWDA 1UQYA 2CKRA 5PTDA 1WUFA 1LOSA 3A22A 1K6AA 1BFNA 4TV6A 3QMRA 4CCDA 2BASA 5EPDA 3VX1A 1KCXA 4PH6A 1JDAA 2X2GA 2I17A 2DP3A 4OT7A 3WQPA 4GNJA 3LUTA 5C7VA 3MWCA 3O6CA 4O8RA 1VFFA 2D22A 2E5BA 2ZZ7A 3G22A 3P5YA 4GYJA 1P6BA 4CD6A 3BH4A 4ACZB 2X2YA 2DZWA 3WJXA 2OB3A 3KTSA 1RD6A 1OCNA 2WJZA 1J9YA 4HHPA 4GUIA 5DT7A 4YCOA 4AWSA 2CZFA 2ZX5A 3MJMA 1TVPA 4O10A 1H7XA 4V2XA 4DXVA 4H9ZA 3ZMRA 1O1HA 1L0PA 1B90A 1H0IA 4PB4A 1GG0A 1EP1A 1WXJA 3IGHX 4UB9A 3MYOA 1CZ1A 3CWOX 5EBUA 1OK6A 3AI0A 4B5NA 3EWYA 1N82A 3STGA 1R2SA 1TG7A 4QE1A 3EXSA 1TUXA 4IX2A 3VUPA 2XH2A 2WZTA 1H62A 5A8GA 2DY3A 3RG6A 3T78A 1JZ4A 3P0WA 4AD4A 4MY8A 3PWGA 3TLLA 4YYFA 1GYMA 3RRAA 4BF5A 2ATSA 1U30A 3Q67A 4PBFA 1K77A 1NEYA 3CMJA 5B80A 2OQYA 1B3WA 3L12A 2D2HA 5E1QA 1XFBA 5AHEA 3GXDA 4PMYA 2CLEA 3TYZA 4ZB2A 3MBDA 4HA3A 1JR1A 3G1VA 3VOIA 1GOOA 4BQ3A 3OVGA 1XG4A 3EKZA 4UMAA 3U4FA 1LBMA 2WM0A 2QGYA 3A21A 2YSWA 3TC7A 1FOBA 5BRBA 1W5MA 3EA2A 3GDBA 4S3JA 3V0UA 3CTTA 4V33A 2ZZ6A 1V0MA 2PD9A 4KRTA 2H9AB 2X16A 2REQB 1RJPA 2CXGA 1L8NA 3R11A 4WZHA 4R53A 4FX7A 2V9DA 2PWDA 2OLAA 3KAOA 4F2TA 3UESA 3H2NA 1LOLA 3D5HA 4Q8OA 1DE5A 4AEOA 1JNEA 4OBRA 4ZOAA 4AY1A 3GDTA 4CCEA 5BZAA 1GTEA 3CASA 3CUGA 3LM7A 4KGLA 3U48A 3W7QA 4YN5A 4LUIA 5G1YA 3BMVA 4LUSA 4Q8MA 5J04A 2NXGA 1Q8JA 1KKOA 4IP4A 1O5QA 4GVHA 5FF2A 4U3AA 4D1IA 4K68A 5GNXA 1AFSA 4RV8A 1YXDA 2C6QA 4GNKB 1QI5A 3W1PA 3S4TA 3UYCA 2PEVA 1V6XA 3OLIA 4H8HA 4AWUA 3BSHA 4TTGA 3PJTA 4GYPA 4E2OA 4EF9A 2O56A 5A6BD 3PZOA 4M7SA 3PFMA 4N2YA 4HNTA 1R8LA 3WEMA 3W26A 4UTFA 3S6DA 1VEPA 4OV4A 1K9DA 3C3NA 3QV6A 4ML9A 1DJIA 3LHYA 3N11A 3VMNA 3RX2A 2Y63A 5BRQA 3MKCA 4GG9A 1ITXA 5A2BA 3CH9A 3UU0A 3H24A 3WUFA 3EWBX 3L21A 1UP0A 3N15A 4LEQA 4U28A 3VNZA 1E9IA 4NNCA 3N2OA 1ZY9A 2PB1A 3NZ1A 3VGDA 3WQFA 3ISIX 4QRNA 4N9EA 4ZQMA 2XYLA 3T4CA 1XIIA 4NZ4A 1RXOB 3NOEA 3HPFA 3HQPA 1N8IA 1HF6A 1C8YA 3WQCA 5HMFA 1X6NA 1FCBA 1ECEA 3BV4A 4DYKA 5A6BA 3MZNA 4DO6A 1YPIA 3KLLA 3FY1A 4BQ5A 3N4FA 2IPFA 4QG9A 2XSXA 2QLYA 5CSRA 4KWVA 4GVFA 2HVOA 2IS7A 4EAYA 1VFHA 2RJGA 2P10A 4FF7A 4XX6A 2AQVA 2C13A 3O07A 3W73A 3VGFA 2D2JA 4KQNA 5CPSA 1OY0A 4O12A 4N9DA 4G8TA 3GK0A 1OG0A 3G3MA 1XICA 3AIRA 3MMDA 1FHDA 3WDQA 3B8SA 4NJIA 3T8LA 3I7QA 3ZLGA 1F73A 3AICA 3BLOA 5E6ZA 1I2OA 1SO4A 4ADUA 2QMKA 1I0BA 3B8VA 2OQHA 4J3WA 3U5YA 5H8UA 2I9UA 2ZRVA 3QGVA 4J3XA 2W4XA 3LV6A 4B5VA 1X7IA 2X0SA 4S2BA 4LYQA 3T0TA 2QDEA 1ZAIA 1GVOA 2C91A 3S2LA 4JTJA 4LAMA 5HNNA 4E4PA 5C70A 1L8PA 4A8IA 4X0NA 2E5DA 1AMYA 5FD0A 2GVLA 3B97A 3GXTA 1JFHA 3AHVA 2CZ5A 4KCVA 4WDWA 1B3XA 4QG8A 3SSJA 1NM9A 3MQTA 4IJBA 2UZ9A 2FFIA 5HPCA 3BCJA 2FVKA 3OG3A 4PUMA 4IUOA 3SCSA 1UD6A 1NIUA 4HNNA 4AX7A 2C14A 4ZXOA 3NWRA 1ADSA 3SAZA 1P43A 1S3TC 1MXGA 4LUSB 4Z1CA 4H7ZA 1KCZA 2I5GA 1GOWA 1FWTA 2VVNA 6TIMA 5BXTA 2VC9A 3CYJA 2WC7A 1A53A 1TTQA 5I06A 1KM4A 1WZLA 4XZBA 2CLKA 2J88A 3IUDA 2R1NA 4NRSA 4PMXA 2QCNA 1PDZA 4PB5A 5CC6A 4JNZA 2A7RA 1XUUA 1FWEC 1UZHA 1QOPA 2CEQA 1UOKA 4DO4A 5REQA 4KRZA 5HBFA 4PUUA 1VPQA 4N6FA 1QAPA 3LRLA 3ARTA 1TQXA 4K3ZA 1J12A 1PKNA 1WPCA 3W2NA 1W31A 1EHNA 2DUAA 3VIKA 4ZENA 1QW9A 4C6OA 2HSAA 4H3DA 4G9PA 4AFYA 2IPWA 3NJ3A 4H19A 3T2PA 1SFSA 5DMNA 2CZEA 3DESA 3IIXA 4QDWA 5DY2A 3T0DA 1IEXA 2WOQA 3CHCA 3KLKA 1CB7B 2QDHA 3E0LA 4ICNA 2ABAA 1E5JA 1FH9A 2IMRA 3CEUA 1DJQA 3NQGA 3KW3A 3BK0A 4WSJA 3ZS4A 2QDDA 4LT9A 3S47A 1HKMA 2TYSA 3GU9A 3W01A 2EG6A 3BG3A 5E09A 2G3NA 1JCMP 1EC9A 2WHLA 3ARXA 3C0SA 3E38A 3L0GA 5BXPA 3KL0A 2E9MA 3N17A 3LHZA 3T4WA 3SUTA 4QIUA 3H2OA 1UP3A 4GFIA 3BE7A 3CHEA 3LLXA 1OSEA 5EMLA 4F0LA 3MVTA 1R47A 2Z1KA 3IWPA 1XHGA 4K2SA 2XIMA 5AHFA 3LHTA 3BG5A 1QNSA 1HKIA 1FY6A 3HPSA 3L0NA 2ZIDA 4Y8EA 3V75A 2CNCA 3A64A 3TTOA 2E8ZA 1MW3A 5HJLA 3L68A 1BGGA 2QW5A 1AH4A 3OQEA 3AJXA 4K8HA 2CLFA 3QHNA 1A5KC 1T7LA 3VKCA 3W7JA 1WZAA 3TONA 3V18A 3ZR6A 3FJ6A 3RPMA 3K13A 1HVQA 4BWLA 3C56A 4WJ8A 5HWNA 2QCMA 5JIPA 3P67A 3JW7A 5J5DA 2OSWA 4L6HA 3M0XA 1TJ2A 1NOWA 3WLHA 4IGSA 3TNOA 5CAKA 2BNJA 1PWLA 1KFWA 1RCXB 2R1KA 1Q6QA 4NZ5A 1J0JA 1QPKA 3NZPA 1H49A 3IIZA 3VCRA 1L6YA