3PSVA

Structure of e97d mutant of tim from plasmodium falciparum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
246
structure length
243
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFDRRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Revisiting the mechanism of the triosephosphate isomerase reaction: the role of the fully conserved glutamic acid 97 residue
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 92
structure length 243
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3psvA00
1OG0A 4A2SA 4QIUA 2DZTA 4LT9A 1OFEA 3DI1A 2V2HA 2WV8A 2QCFA 3W7LA 5FEXA 1FWSA 1ME9A 2LLEA 1C29A 3HG2A 3STFA 4M5PA 4IOTA 4ZQPA 5HR7A 1SO3A 4N4PA 2OX1A 3NR0A 4O18A 4WUIA 3E9AA 4X3ZA 3UY8A 1JCMP 5K2ZA 3NL3A 5L9FA 3ZWTA 3ZFHA 2VFIA 2ZZ6A 3GX9A 3HBLA 4HNTA 3GNNA 3BVJA 3GKFA 2CLLA 1QNVA 4MYAA 5CPLA 1AW5A 1QFEA 4ORMA 4N9BA 3RMJA 4MVAA 3FIGA 4PFMA 5AHFA 3PB0A 1A5BA 3W72A 4Z1DA 2C19A 1C9DA 4AHPA 2D73A 4O54A 2WNQA 1GOXA 4LWWA 4DBDA 3PG8A 4Z0SA 3DHDA 3C2EA 5U4NA 1LM1A 3UWYA 3W23A 3W75A 2GJNA 3TROA 3L0NA 2EGZA 2WKJA 3MBFA 1ZNNA 1YDNA 4DF0A 4UMCA 3GXPA 1PS9A 4O17A 2BLEA 1TTJA 4AHOA 1XM3A 3TFCA 1WA3A 4UNLA 2GQ8A 2X1RA 4OGZA 3C52A 2JGYA 3O6CA 4KFOA 4NZFA 1NSJA 1TTIA 3TV8A 4XWUA 3LLFA 2ZRXA 3G1XA 2HS6A 3NQCA 1FWTA 4N2YA 1KW1A 3NPVA 5BW6A 1O95A 3E96A 1ONRA 1S5VA 5A5WA 3IEBA 3G8EA 5DCBA 2Z6IA 1V7YA 1FX6A 3TR2A 4BK9A 4JR5A 4IUOA 1SZNA 5LHFA 2NXIA 4E38A 1LBFA 2AGKA 4GFSA 1DORA 2XN2A 4O11A 2H90A 1P0KA 2FPVA 2FTPA 5FEPA 2QDGA 2ZA3A 1X6UA 5F4WA 3OHIA 2H8XA 1ME7A 2WSYA 2HTMA 1H51A 5DCDA 3GDKA 4O16A 1IXNA 3NQ7A 4X22A 1YPIA 1H7OA 4NX0A 3EX4A 3QEZA 5TQLA 3CIXA 4FNTA 2VOMA 3A24A 5G4WA 5AC6A 4LY8A 4MYXA 1I8JA 3M5XA 3HQ1A 4C1LA 3UY7A 4AB4A 2C3ZA 3NXFA 1GTHA 3TCEA 1LROA 5CPOA 1QCWA 1QDSA 1Z44A 2ZZ4A 4NNCA 3W1QA 4XTDA 5MHBA 4RJEA 2DJXA 1JQVA 1G4TA 2X2GA 5EBUA 1TV7A 2E5BA 2ISVA 5CPNA 4N6FA 1NVMA 4JTGA 3TQKA 4HHPA 4JXCA 3B04A 1H7RA 3LBCA 4JTLA 3TXZA 1KV5A 1QO2A 1DV7A 4M6QA 3HPSA 4IPIA 3FS2A 4NVTA 1PHWA 1E51A 1TTQA 1HO1A 1KBJA 3LHTA 1W3NA 1VRDA 4N9EA 4O14A 1DJQA 2FLIA 3M41A 4D2JA 4UTKA 4Q33A 2DORA 3EX3A 3GDRA 2HSAA 3NPXA 2NZLA 3P5YA 4O8RA 1KM3A 2ZRYA 3LHZA 3RLUA 1R46A 4QJ1A 1TREA 1EEPA 3LX9A 4QNWA 2B0MA 2J27A 2NUXA 3Q94A 3H54A 4IJBA 2B7NA 1OFRA 3W7DA 4JEQA 1Z41A 1EWDA 2VXNA 2GOUA 4EWND 2VEPA 6ALDA 1W5PA 1SO5A 1TCDA 3O8AA 4QQ3A 5D2TA 1IXQA 1QPQA 2H8ZA 3HO8A 5LNRA 3LGEA 1OABA 3SGUA 2ISSA 3QRHA 1GEQA 1CI1A 2BZNA 1F7BA 4GRSA 3QPZA 5HR6A 2VFDA 3UPBA 1EP2A 3M47A 4O0KA 1FCBA 2OZ0A 3HG3A 1EUNA 4OU1A 4LRTA 1G69A 3NM3A 1SO6A 4U4MA 1G4PA 1GWJA 4ZQRA 4FX7A 2QCNA 5J5RA 2CWNA 1RZMA 4PC8A 4K6AA 1WV2A 3W7NA 3OG3A 3JS3A 5KSWA 2QCLA 3QPYA 3QF0A 3W6YA 4RXFA 3TW7A 3OVQA 1F6PA 2OT0A 1TPB1 3IV3A 4QSHA 3W76A 3W83A 4Z08A 1YLVA 4A2RA 4AHQA 4Y90A 1F6KA 1VYSX 2QCDB 5DXYA 3W7JA 4PH6A 4HPXA 4UMAA 2C14A 1AW2A 4UFHA 3ELFA 3BO9A 3MUXA 3ZWSA 2QJGA 3BK0A 4MY1A 4C1KA 4GUIA 4RZ5A 3MO7A 1XBYA 2WJZA 4JYEA 1T99A 2IQTA 1FY6A 3FEMA 2Y88A 1QR7A 3UWUA 3M5VA 3DZ1A 1B4KA 2BSLA 1EX5A 1FBAA 1VS1A 3LV6A 1GG1A 1TPC1 2DU2A 3HPZA 5G1TA 3NQDA 1K03A 2E6YA 3G1SA 1IIHA 4BWLC 2PE4A 4QAIA 4NU7A 4YCOA 3KHJA 1F5ZA 3BGJA 1EB3A 1LORA 2ZRZA 3DAQA 2NV2A 1MEHA 2Y61A 3THQA 2GVJA 1M6JA 3O15A 3W7OA 2CZFA 3FJLA 3D0CA 2JBMA 1RQBA 1G7VA 4XTIA 1XCFA 3MI2A 3TMQA 5F2IA 4JTUA 5AHIA 4UFKA 3TFXA 4EVZA 3TK7A 5U7SA 1GVQA 3C2OA 3EWZA 3NM1A 2H6RA 1OYBA 3W2NA 2A7PA 5FEZA 1OFAA 5D30A 1O5KA 2Z2UA 4O52A 4O1BA 3L5MA 5D03A 4AF0A 4ONVA 1W8SA 4GJ1A 1W37A 4I7UA 5D2YA 1RV8A 1I2QA 3A5VA 1PIIA 1OHLA 3CEPA 3LV5A 3JR2A 3N9RA 3MI6A 2VEMA 3G1YA 1VHNA 4XKYA 2E6AA 1VJIA 3W1AA 3PAJA 1KA9F 1TMHA 2G5WA 3P5ZA 1F05A 1OF6A 2YPIA 1Z48A 3I7QA 3CLMA 3NQ6A 3HJZA 1OFBA 4H3DA 4LW7A 2YW3A 1L6YA 3L0GA 3LTSA 4CCCA 4LVAA 2CLIA 3QYQA 2H3DA 1H60A 1YXDA 3IVTA 3PUDA 2EHHA 1LDCA 3GR8A 3N73A 5D2VA 4OWGA 4OV4A 3TC7A 1VR6A 4AEOA 1SPQA 4EF9A 1Q3NA 1ALDA 5FF4A 3W85A 4MZ1A 4CQ8A 3ATYA 5SWUA 1HTIA 5CZTA 4JDBA 2CW6A 2VKZG 1KFEA 1I2NA 1MXSA 4JTFA 2A1YA 3TC6A 3NYZA 1OJXA 1KLZA 1I2OA 4JIQA 1QOQA 1Q6OA 4R33A 5AYXA 3KVKA 1K7XA 2V5BA 1SFLA 2UV8G 1KM5A 1F76A 4WY0A 3STEA 2Y6ZA 3P67A 2A2IA 1PE1A 3LCWA 3W87A 5D02A 4HKPA 4DF2A 3P7YA 4Y6GA 4BR1A 4FIQA 2FB3A 4ZVJA 4H6KA 2CZ5A 2OCZA 1FCUA 4OT7A 3RFAA 1BKSA 3P8IA 4M7TA 3CIWA 3Q2DA 1RQHA 1SU5A 4O50A 5G2IA 1HO4A 4JY9A 4FIRA 3TUUA 1F2JA 4CNNA 1VYPX 3NA8A 3IGSA 3B05A 4EOUA 4I7WA 5E93A 4XZ9A 3GB6A 4NXSA 3BW3A 3TE9A 3TSMA 5CZ0A 3AO0A 3B0PA 2FDSA 3FKKA 3KXQA 1WXJA 3SR7A 2QCMA 3S1WA 3G18A 4HNNA 3WJYA 4OQVA 4O1DA 4LVDA 4NJJA 5AHEA 2W79A 4O4WA 1AK5A 4UTWA 1TV5A 1K02A 4LUJA 4A22A 1ZAJA 4IMGA 2NWRA 4XUGA 4YLWA 4UFMA 3DHFA 5AC8A 2J88A 1IXOA 3QC3A 4TO8A 3FA5A 3SY5A 3NDOA 1MZHA 3E02A 2ATSA 2ATMA 3T7VA 4DQWA 5A8GA 1MSSA 5TIMA 1R2RA 1TIMA 3QMRA 4RCXA 1K8XA 3C8FA 1W5QA 4LUIA 3IGUA 1QPRA 1YXCA 1MO0A 3DKLA 3EB2A 3W2KA 2ZYFA 4M19A 3BG9A 3G1VA 3S5ZA 1XUZA 1ZCOA 2O7QA 3TA6A 3LCGA 4LRSA 4YCPA 4MKNA 1D3GA 5TBOA 5LNUA 4FXSA 3DU0A 3RK8A 1KFJA 2A4AA 1H7NA 3W7EA 4IWWA 5KINA 1SSDA 2ZZ1A 3EWUA 2CU0A 1G67A 5FESA 1QPOA 1LCOA 1HL2A 4IMEA 1GYLA 1KFLA 3NPWA 3S1VA 1N55A 3PULA 3FLUA 3C2VA 3CC1A 2NX1A 1H61A 3G3DA 1VCFA 4LVBA 5HUPA 3OA3A 5KITA 3LTPA 3UZJA 1YYAA 4NJGA 2B7QA 1RQEA 3DXIA 4MY8A 2E77A 3LERA 1PHQA 2ZZ5A 4LVGA 5E0KA 4X2RA 3HGOA 4JX4A 3R13A 1VCVA 4RX0A 3LRLA 3DI0A 2FFCA 1TRDA 2FQIA 2YFNA 4O1CA 2ZQ0A 4IX2A 3I7SA 4K39A 4QISA 3PBWA 1C8VA 1GVSA 4PCFA 2I14A 3W7IA 3L9CA 2CLKA 1N8FA 3W86A 4RK8A 2BX7A 1S5WA 4NJKA 2QAPA 3CWNA 3G0XA 2I1OA 5I3HA 1GVOA 2NUWA 5AYZA 2F7FA 1TB3A 4AXKA 3ANYA 4NNBA 1TV8A 3B06A 3UNDA 2OT1A 1NF7A 4OV9A 3TW6A 5G2WA 2ZCGA 3G0UA 1SW7A 3W7MA 3ABOA 4DO4A 1WOAA 3C2FA 4GUJA 5AHMA 3MP5A 1EP3A 3VFLA 5I3GA 1JRBA 1Q6RA 3B8DA 1IIGA 3GK0A 3VE7A 1FCVA 3P82A 5T26A 4LS0A 3TKFA 1OK4A 2QUUA 2GVLA 3W7CA 4UMBA 4NNAA 4MOZA 1R47A 3UD6A 4O15A 1KTCA 1CX9A 1UUOA 1JULA 2A6LA 3QMTA 4JYFA 1WOBA 5HWJA 3LHYA 5EKYA 5IBXA 2RH9A 4W9TA 4ZL1A 1OYCA 2GQ9A 3R2GA 4UTTC 1GT8A 4O13A 5CZJA 2YDAA 4K38A 5F4SA 1TSIA 3NZ1A 3SJ3A 2PC4A 3GR7A 3C4UA 5AB3A 1R2SA 2B7OA 2Y7FA 4K8EA 5DXXA 3TSDA 4RLIA 3R5EA 3PBUA 2A5HA 4ZQCA 1KM0A 2RDWA 1NF0A 1RVGA 3BLFA 3WJZA 4DEFA 1AMKA 3SECA 2V82A 3MHUA 3JRKA 1TJRA 2W6RA 5H91A 3LXBA 3QJAA 1LZOA 2E5DA 4FNSA 1J5TA 3HMJG 4M7SA 2DP3A 2C0AA 3NZRA 3G0SA 2X30A 1LBLA 4NQ1A 1TPWA 4FNQA 4GUHA 4LC6A 3S1UA 4LS1A 3HOJA 2ZTJA 5C54A 2Y7DA 2V2CA 3BW4A 4WOZA 1WBJA 3LHVA 4A3UA 2FPTA 1W5NA 4POCA 1FDJA 2QUVA 3W1NA 4YL2A 4HNVA 1DBTA 1GZGA 3I6RA 5AOUA 1KLYA 4O1AA 1TRIA 3W88A 2YGYA 4E0CA 4JX5A 7TIMA 3TIMA 2QJHA 2YYTA 5D2WA 1JUEA 1H62A 3WK1A 1AG1O 2XFWA 4MJMA 4HNUA 5AC7A 1OF8A 1ICPA 5D38A 1QO5A 4HIBA 3KRSA 2Z6JA 2R94A 1KV8A 5FF3A 1JJKA 2BWGA 2C1HA 2QUTA 1K3UA 3EXRA 1LYXA 4FX6M 3EWYA 3CWOX 4JYDA 3S6DA 1P0NA 4IMDA 2JK2A 5HWMA 1GQNA 3R12A 1JQXA 3P80A 4ZQOA 2JKPA 3LOTA 4O12A 5CKSA 3FYOA 2A85A 2AQWA 1QAPA 3SZ8A 1FXQA 3DKJA 1EWEA 5EMUA 2GJLA 3L67A 3W9ZA 2VFHA 3W73A 5C2XA 1TPEA 1TPUA 4AAJA 4PL2A 3QSRA 3WFAA 3P8JA 5HNRA 4JTSA 4P61A 4XBSA 3TMLA 2QDHA 2WSRA 4JTHA 5BRBA 1TPH1 5KMYA 3NPUA 3DFNA 4PEKA 3V1PA 4FEZA 4AH7A 1ZY9A 3LCIA 3O1NA 3MMTA 4NJIA 4MFDA 1QPNA 1LTDA 5F1UA 1V5XA 3M44A 4ICNA 3O6DA 3U8GA 3OIXA 2Q3OA 1XC4A 3LM7A 1QOPA 3NEVA 1TJPA 2VFFA 2B7PA 1X1OA 3S1XA 5L6UA 2B4GA 4Q32A 1VZWA 1W3TA 1LRNA 2PURA 4UCGA 3DH7A 1KFCA 3W2JA 1K7EA 3KX6A 2NX3A 1MEWA 1SO4A 1A5CA 1LOLA 4UIOA 2JGQA 1NFBA 3GKAA 4O10A 4ML9A 2YXGA 1UUMA 3LDVA 5I3JA 2ISWA 5ABTA 2R91A 4TIMA 3KFTA 2WO5A 2NWSA 3F4WA 3BLEA 1AL8A 3W7RA 1WAUA 3PS7A 3EWXA 3P74A 1R30A 2QCGA 3MJYA 3N3MA 3L0KA 4N6EA 1FQ0A 4ZZ9A 5G1YA 2CZDA 4R53A 4ZMGA 1IF2A 1G4EA 2CLHA 4O4VA 5LNSA 3ABSA 5LZLA 3HGJA 1JCLA 1LLZA 3FKRA 1W5OA 1FWRA 3E0IA 4YXGA 1FUYA 2P1FA 4K37A 4I7VA 2V30A 1JUKA 3PM6A 5DELA 4IXXA 1FCQA 2NXGA 3M5YA 1DHPA 1XDMA 4UNKA 1YDOA 1O60A 1HUVA 2AAMA 4O19A 3IIXA 5KZDA 3SI9A 2R14A 1L6WA 2JKAA 1YDVA 4K7VA 4JDYA 5FI8A 2YCEA 2VEIA 4Q4KA 3F03K 2ZBTA 3T78A 3ATZA 5D05A 3P81A 2A6NA 1TQJA 3GVGA 1BWKA 3S42A 1TPVA 2P10A 3A9IA 4AWUA 1Q6LA 5HJLA 4BFAA 4E2BA 2NV1A 1M5WA 2YFOA 3F4NA 5DCEA 3BPWA 3G1AA 1DL3A 3A5FA 1YTDA 4IMFA 3GXTA 3OEXA 1EUAA 2Y63A 1W3IA 1JCJA 2XN0A 4RR4A 2QCDA 1ZAIA 1N7KA 4BF9A 5CSSA 3DFSA 3I68A 1W56A 1WX0A 3NQ8A 2E09A 3LCHA 2P0OA 4WQ6A 4LNYA 1XUUA 4O28A 3EX2A 1SUXA 2OJPA 4CNOA 2DZWA 2V9DA 3OBKA 1PV8A 4G1KA 3O06A 3PBVA 3M5ZA 2OMAA 3EXTA 1H7XA 1G7UA 4MLRA 3C3NA 3M9YA 1WYIA 3A23A 1F73A 1H1YA 2YR1A 1OX4B 1VLIA 3BG3A 1KBIA 1UBSA 2YX0A 4MPQA 1IXPA 3LRKA 4DELA 4JX6A 4CCDA 3UPWA 3HG5A 6TIMA 5E1QA 2CLOA 5CGQA 3MP3A 3QM3A 5HMSA 3NGJA 3TQ0A 1PCKA 3SGZA 2X1SA 2ABBA 3ABRA 4Y96A 3V75A 1FWNA 2QKFA 4DPQA 1OK6A 1P4CA 1GYNA 1KTBA 4PL1A 1OVDA 3U2OA 3C0JA 4HT3A 3P60A 4K7YA 3L5LA 4LS2A 3LHUA 3W7KA 3IGXA 1BWLA 3UWZA 3P62A 4PODA 5EL1A 3GYEA 2V0TA 5K4ZA 5DY3A 1YTEA 4GNJA 1OFOA 3R89A 1VQTA 1X1ZA 4WY0F 3NQMA 1VHCA 3INPA 2FIQA 2WNNA 4FXRA 3NO5A 1OFQA 3EEGA 1BEUA 4MFEA 1OX5A 5D2XA 1OFDA 4S2BA 1LBMA 3M43A 3UWQA 4UFLA 3S8HA 3A21A 1DQWA 2QR6A 3NL6A 4UTJA 3VE9A 3AJXA 3O16A 3OVRA 4N9DA 2RDTA 2TMDA 4RV8A 3W1PA 3WK2A 3LBMA 2A7RA 2TPSA 1ZFJA 1UCWA 3DFTA 4UXDA 3TX9A 1XBXA 3IVUA 4JN6A 5DBTA 3EKLA 4MUZA 1EIXA 1H7WA 4FNUA 5DN1A 1EP1A 2DJLA 3M16A 1O5XA 5I3IA 2QAFA 3WJSA 2W0UA 2O7SA 3CT7A 4HSNA 3DFQA 5F2LA 1GG0A 2H3BA 3PG9A 4JD4A 3W71A 2QCHA 2F84A 4A29A 4DXVA 4UFIA 1UB3A 3GNDA 4DO5A 2CLFA 4IMCA 3PVFA 1SQ7A 3CU2A 2RHGA 3M7WA 4JTIA 3TQVA 4MLJA 3W7HA 3L66A 1P1XA 1DVJA 2VELA 3W1MA 1VGAA 1W31A 1ZJIA 2RFGA 4FO4A 4J9JA 1A5SA 1I4NA 1SW0A 3RU6A 3W3OA 3LTYA 1DOSA 1H5YA 4NXKA 3IIOA 1T96A 1KM1A 2QEZA 3E49A 5K3VA 4HSOA 3B03A 5D32A 2ZZ3A 1ADOA 3C6CA 3H53A 4BI6A 3W1RA 1RPXA 3G1DA 1LRQA 2A21A 1W5MA 3LCXA 1YPFA 2G96A 3GXNA 5DLCA 5LSMA 1ZENA 2ZA2A 2ABAA 2DZVA 1D9EA 4CQ9A 3NOEA 3FOKA 3GZ3A 2E68A 3UXAA 3ZR4A 5C5YA 3CTLA 1IGSA 5BMXA 3PSWA 1NEYA 4FNRA 3TJLA 3QMSA 3N2XA 4GXMA 3NQ2A 3O07A 3SW6A 2J9ZA 4N02A 4AWSA 3NNTA 1B9BA 1TPDA 4DPPA 3MYPA 2FPYA 1GVFA 5K9XA 1XXXA 1LLWA 2J9XA 4I9AA 4TMCA 1SSGA 3Q37A 1HG3A 3MHFA 1B3OA 1SZGA 2GPTA 1FDYA 3S9YA 4E2DA 2J24A 4ADSA 3BW2A 1LOSA 1D3HA 3W70A 3RLVA 4IGHA 5FF0A 1VC4A 2WNZA 4OBTA 3B0UX 3NQAA 5F4XA 2TRSA 2EPHA 5F2GA 3UXDA 1YXYA 3O63A 3STGA 1A5AA 3TH6A 4X9SA 3TSBA 1KM6A 4CLMA 3PB2A 2QCCA 1NAL1 3W74A 5EA9A 4FB7A 1PVNA 1K8ZA 4U28A 1ICSA 1XL9A 4RKAA 3EKZA 3C61A 1LOQA 4M6VA 1R2TA 4UUIA 2VEKA 3LHWA 4DO6A 3MWAA 1H1ZA 4Z1CA 3W84A 3EWBX 1M7OA 3L21A 1TPFA 2A7NA 2I9EA 3MI3A 4K8HA 4UR8A 2WPBA 2CLEA 3B4UA 5I3KA 4BI5A 3HF3A 4UFJA 1LRTA 4UTHA 3TXVA 2C15A 1ZALA 3UZ5A 2CZEA 3LI0A 2ZRWA 2V8ZA 3LXAA 2VC6A 3W07A 5FEWA 4UTWC 3QQ0A 2Y7GA 1XDLA 2DZXA 5AYYA 3W1LA 2J9YA 1OFPA 1RR2A 3K30A 3I7RA 3IIVA 5LHEA 2X1UA 3NVTA 3OVPA 3HPXA 2PCQA 1B57A 3RF9A 1J4EA 4GUFA 4YMZA 4JY8A 1W54A 4IPJA 3W1XA 2YZRA 4BWLA 4WXZA 2VFEA 1EA0A 3DBPA 3L68A 4R34A 5LNVA 1UASA 3ZS4A 5AFDA 1A50A 3TAOA 2G95A 4NX5A 4UTIA 4LVFA 4UTUA 2J6XA 1K8YA 2R8WA 2DZUA 1KTNA 2Y70A 3GAYA 5EY5A 1VCGA 1FDZA 2HMCA 2ZZ2A 4L4MA 3HB9A 3DFOA 3SSJA 3FFSA 3GIYA 3TU9A 3CB8A 1XFBA 4PA8A 1YTKA 1L2UA 5K9DA 2Y89A 1X7FA 2TYSA 5HWNA 1WQ5A 4IXHA 5BOOA 3NL5A 2C16A 3QSTA 2WOQA 4QITA 3UYCA 3QFEA 1VYRA 4LU0A 2GQAA 3BLIA 2Q8ZA 4PTNA 3GDMA 3DFPA 3Q58A 2FB2A 2XN1A 4JTKA 3WJWA 5CZSA 4XBKA 5D37A 3G8RA 3EXSA 2E6FA 4NUWA 4OE7A 5LGZA 3KOFA 4IX0A 3QH2A 2Y62A 1JRCA 4ADUA 3BGGA 2Q3RA 2ZFAA 1SFJA 1SW3A 4Z1BA 4KKXA 2BTMA 4O57A 4WZHA 3QQ1A 2ZDRA 3IIPA 4GWEA 2E1DA 3N19B 1SZFA 3N34A 5AHNA 3G3MA 4JS3A 3W2UA 1ML1A 2NLIA 3MP4A 4NJHA 1XBZA 3UWWA 5LKYA 5C6MA 3HG4A 1THFD 1G4SA 4N9CA 1PCWA 1H50A 1TYGA 2QF7A 2E5CA 3CEUA 4WJEA 3LI1A 4H4IA 5K7JA 4RZ6A 3PY2A 4MY9A 4UC5A 4LTSA 2KZHA 5I3FA 4S2CA 1X8FA 5AHLA 4OHQA 1FWWA 1QMLA 1XKYA 1GPWA 8TIMA 2WQPA 5BMWA 3KVLA 1ICQA 3HIJA 3P84A 5KTLA 4QNEA 3FJ6A 3BV4A 1AL7A 3EX1A 5F2MA 4AF0B 1SZEA 4LV9A 1W0MA 5IM51 3A22A 5IBXC 2GVGA 3TJXA 1S5TA 4MIMA 4O0ZA 4ORIA 1DQXA 4WOQA 2FJKA 3NG3A 2DZSA 5K9CA 4UTLA 3KRUA 5H2ZA 1T0OA 4XKYB 1M7PA 1T8XA 1I2PA 3QZEA 2PRMA 2CFFA 3LCFA 1UJPA 3THAA 1L6SA 5HINA 4N4QA 2ZZ7A 3S5OA 2CLMA 4LOCA 1B4EA 4O53A 1WBHA 3KAOA 4R7JA 1DJNA 1XBVA 4HN4A 5D33A 1I45A 4FF7A 3W2LA 4CCEA 3IVSA 3NQEA 4ZQNA 3G1FA 3I65A 2Z0IA 3IIZA 3MYOA 1JCYA 2NUYA 5CSRA 2ZTKA 1JUBA 3W7GA 3SIZA 2Q8LA 4KWWA 3HGRA 4Z0JA 1JR1A 3CPRA 1KFBA 2ZRVA 3MBDA 3STCA 3N14A 1P5BA 3EWWA 1ZAHA 1SR9A 3KVJA 4M6PA 3W2MA 3M6YA 5KZMA 3WJXA 2C6QA 4WY0B 1ZHAA 3T40A 4LV4A 1LP6A 4JTEA 2Y85A 1GVRA 5FF2A 3HGSA 3M1ZA 1Y0EA 3FYPA 3M0ZA 2V5LA 3SFKA 1AW1A 1KFKA 5C55A 4IQLA 4GBUA 5GVJA 1KM4A 4WX2A 1JVNA 5EYWA 3LB0A 1S3HA 3G24A 5F1VA 4A21A 3O6YX 2BXVA 1BTMA 3QW4B 1J2WA 2VFGA 3WK3A 1G6CA 2EF9A 3MW7A 3R8RA 1H7PA 1EPXA 1XI3A 5G2HA 4WXYA 3NQVA 3NAVA 5D04C 4CQAA 4WD0A 2RDUA 1HFBA 2A0NA 3ABQA 1OYAA 4EIVA 1TO3A 3EX6A 4Y8FA 1RD5A 1Z42A 1VLWA 5HUOA 3LCLA 3GDLA 4JTJA 5HULA 3T44A 3VNDA 3T4CA 2E6DA 1K7FA 3W7QA 1VH7A 1U83A 3E12A 4KWVA 4EF8A 1KM2A 5LGXA 4JICA 1PL9A 2TSYA 5CPMA 5KZEA 5K4XA 4XQ6A 3LXCA 3L5AA 2X16A 4UTMA 3C2RA 1Q6QA 4K36A 4QM1A 3NQGA 3TDFA 3PR2A 1TQXA 3F1QA 3MHGA 3CHVA 4DF1A 3G22A 4KFPA 3CM4A 5FF7A 4Y9AA 4B5NA 3W22A 3DGRA 4HPJA 1MEIA 3IRDA 5LNWA 1Q45A 4JNMA 3N9SA 1H63A 3W1TA 4YWIA 3L65A 3S0CA 2C18A 4MZ8A 2Y7EA 1O94A 4AMAA 3W1UA 3G1HA 5DBUA 3W7PA 3QW3A 4AWTA 3PC0A 2PRLA 3RNDA 3UQNA 3S5NA 2DZPA 4P2VA 3VCRA 2EAWA 1DKWA 2V2DA 3T55A 2V81A 4FX8A 2RKXA 1FXPA 2C13A 3GDTA 2VENA 4FNPA 3CQ0A 4TMBA 1A53A 1TTPA 3L2IA 3KVMA 2QCEA 2WSQA 3GAKA 2YSWA 4JTTA 3U6WA 4BI7A 1ME8A 3N2MA 5HQEA 3C56A 4UTTA 4TR9A 3O05A 3PBYA 4UR7A 3DENA 3NL2A 2QJIA 4TU1A 3WK0A 1OX4A 4CNPA 5G5IA 4RZ4A 4JIPA 4FHAA 1I2RA 1VPXA 4TX9A 3TNOA 2GUUA 4ZQMA 2HS8A 2G97A 3BG5A 1QWGA 4MZYA 2NXHA 2JKEA 1O4UA 5D09A 4ADTA 4GUGA 4AVFA 3PF3A 3LLDA 4NT0A 2ALDA 3KRZA 2Z1BA 1U5JA 5J5DA 1GJPA 3VKJA 2YW4A 4L4LA 3PSVA 4JGDA 1JCXA 1F74A 4S1FA 4NZJA 3YPIA 4ALDA 2EKCA 3H55A 3LRMA 4KFNA 4LC8A 5CG7A 4MJZA 1CW2A 3VI2A 3TAKA 5BNKA 1GTEA 5AN7A 3USBA 1JCNA 3PUEA 3GLCA 1L9WA 4DBEA 3PWAA 3S5YA 3UWVA 3P61A 1W1ZA 1WDWA 3PUOA 3B0VC 4RXGA 5EPDA 2ZA1A 4GC4A 2YYUA 2PRHA 3BARA 5DY2A 1YADA 3NQFA 4GE8A 1OX6A 2ZRUA 2NX9A 4Z1AA 5G4EA 2X1TA
chains in the Genus database with same CATH superfamily
3WLKX 1OG0A 3OU8A 4A2SA 1S1PA 4LT9A 2OPJA 3W38A 5FEXA 1NELA 1FWSA 4GZEA 4M82A 2E67A 4LUSB 4GGBA 1GOIA 4M5PA 3GTFA 5A8MA 2C7FA 2ASHA 2W66A 2OX1A 2NT1A 3E9AA 3TYDA 1RY0A 3FVDA 4KETA 4X3ZA 3CHEA 3GQYA 2ZZ6A 3HBLA 3VM7A 3GNNA 1DTUA 2HNHA 4J1OA 3QFWA 1QFEA 3DX5A 4PFMA 5AHFA 3TN3A 3PB0A 4FP1A 1TUFA 2D73A 4IUGA 3BAIA 3JZUA 1GOXA 2XGZA 1NFGA 2PUZA 1KD0A 3DHDA 3W23A 3UWYA 3W75A 4EPDC 2O9OA 3MBFA 4UMCA 3BDKA 1TV4A 4O17A 2VOTA 4U5IA 4AHOA 1XM3A 1WA3A 1E0UA 3C52A 2JGYA 3H7RA 3O6CA 4DYJA 2HRWA 4NZFA 5EFDA 1POKA 3TV8A 2W4XA 3LLFA 2ZRXA 3G1XA 3NQCA 3ARYA 1FWTA 4N2YA 7A3HA 5BW6A 1O95A 3GG8A 3FHAA 1ONRA 1S5VA 4RDYA 2OLAA 1FX6A 4IUOA 4F2TA 2NXIA 4GQBA 1QNOA 4E38A 1ONEA 1LBFA 4GFSA 3WDRA 1D7FA 4AWEA 4GY1A 3BAJA 2QDGA 3OHIA 2H8XA 4KWSA 2XM2A 4DNMA 5DCDA 4MWAA 3TJ4A 1CBGA 1IXNA 4XD3A 1EGZA 4X22A 4M8UA 3WFZA 1QW7A 3CIXA 4FNTA 3GNXA 3PWGA 3S6TA 3SY1A 2DSVA 3NXFA 4ZSUA 1QCWA 1OEPA 3TVAA 3F2DA 3W1QA 4RJEA 1G4TA 3AS2A 1TV7A 2ISVA 4KRTA 2X8RA 2XPKA 4EWJA 4N6FA 3M0KA 3CPGA 3ARWA 2INZA 2WNWA 1X8CA 4FXJA 3FGCA 4DNHA 1XLKA 1DV7A 4M6QA 3R0KA 3FS2A 4NVTA 1TTQA 1HO1A 3OA5A 3T05A 3GNOA 1BQGA 2L5HA 3VZZA 2YKKA 2E8ZA 2FLIA 1H11A 4D2JA 3WYZA 1W6TA 5HA7A 2DORA 3GDRA 2HSAA 3KZPA 2Z4GA 4O8RA 4QJ1A 4AC7C 2B0MA 4Q4MA 4Q7IA 5FAGA 4Z1YA 2VXNA 2GOUA 3SCWA 1YHTA 1SO5A 4OBRA 2C71A 3CWHA 3TTSA 2O0TA 4GRSA 1CI1A 1F7BA 1FHUA 5HR6A 2Y1HA 6A3HA 3UPBA 1O12A 4E3VA 4HU8A 2I16A 1FCBA 3HG3A 3AHTA 2QGYA 3BQ6A 4OU1A 3T2OA 4LRTA 2PAJA 5HATA 4U4MA 3PJWA 1GWJA 5E70A 2QCNA 1PZ0A 4QG8A 2X0HA 2QHAA 1WV2A 1D7KA 3KUMA 3W7NA 3AXHA 3N2OA 3KS5A 3TW7A 1F6PA 4A05A 1O7AA 4QSHA 4UQBA 2A79A 1YLVA 1W91A 4Y90A 4UMAA 4YTUA 2IKHA 4G7FA 2HXTA 2BY2A 5MKGB 4NL1A 4UFHA 4IF2A 3WLRA 3BO9A 3ZWSA 1XX1A 4AX6A 3MO7A 1XBYA 4H2CA 4ZTXA 4DRSA 3MUAA 1B4KA 2BFGA 2ZXAA 2UY3A 2CKSA 1UYQA 2PE4A 4ZOCA 3KHJA 1XGZA 3R8HA 1EB3A 3FAWA 1LORA 2XGIA 2J77A 2NV2A 1J0KA 3GM8A 2GVJA 1M6JA 3DG3A 3VIKA 3DYPA 1GPFA 2JE8A 2CZFA 3D0CA 2PDHA 2JBMA 1G7VA 5FD0A 4XTIA 3MI2A 2V3FA 5CPSA 3BQ5A 2IS7A 4UFKA 3TFXA 4EVZA 1W1TA 2CKRA 5JBDA 2IQDA 3TWAA 4OECA 1R0MA 1JYVA 4KGJA 2Z2UA 4O1BA 3MANA 4L4OA 4GMEA 1S2TA 4GJ1A 2ZX7A 2IKIA 2FFIA 5CSUA 1PIIA 4B9YA 1J01A 4NHVA 3N9RA 4EP8C 2VEMA 3GXMA 3RPMA 1VJIA 4KPLA 1LLOA 2E9LA 2G5WA 3P5ZA 2G3NA 5LIUX 5LXEA 5FJRA 3I7QA 1RJPA 5JU6A 2Z1KA 3MS8A 5GJPA 4AZCA 2D2JA 3LTSA 3L0GA 2G50A 1F3XA 4HP5A 1H60A 1YXDA 4NP7A 5AYIA 4I5UA 5D2VA 1W1IE 4WDTA 3CYJA 2OOFA 4G6CA 1QNSA 2FVKA 1O5QA 5BYWA 2WCAA 3FHQA 1ALDA 3ARXA 4MZ1A 2KAUC 3ARQA 5CAKA 1VEPA 3GHRA 4JDBA 2CW6A 1MXSA 4D8LA 2A1YA 1FWAC 3NYZA 1KLZA 3ZLHA 4MF4A 1Q6OA 3WLHA 3TTQA 3KVKA 1DJHA 1VBJA 2WHJA 4B3LA 1Y5XA 4GJIA 4H9UA 4L6OA 1XH1A 1UR2A 2C79A 2Y6ZA 5T9CE 4H6EA 3BLDA 4YS1A 4HHHA 2W62A 1UIOA 4GIAA 4HTYA 2FB3A 4ZVJA 2Z29A 4H6KA 3WLQA 7REQA 1H0GA 3EDDA 1CB2A 1BKSA 3O6AA 2VCBA 1VENA 2O9PA 4L1XA 1RH9A 4M7TA 1B3ZA 3CV6A 3Q2DA 3TYZA 4WVXA 4NRSA 3VINA 5G2IA 3MY9A 3TUUA 1PKMA 4ZEPA 3CAVA 3LPFA 3B05A 5E93A 2QULA 3BW3A 2PS2A 1P0DA 3L4XA 1WXJA 2QCMA 3S1WA 3DESA 4U33A 4GVFA 4LVDA 1LF1A 1PWLA 4AX7A 8A3HA 2XFYA 1PTGA 4O4WA 3I4EA 4IPNB 4A22A 1K02A 4WHBA 3K13A 7PTDA 2PP1A 3E3HA 1XG4A 1DIOA 2J88A 3REQA 3QC3A 3FA5A 5ECVA 4DXKA 2ATSA 3GTNA 4EE9A 1K8XA 4Q8PA 3HFYA 1W5QA 3B9NA 1U1HA 1M1BA 1OCJA 4L9YA 3W2KA 2PDNA 3HJEA 1I0DA 1ZCOA 4LRSA 1D3GA 3R11A 4HNLA 1ITXA 3R58A 1JAEA 1QNPA 4KQNA 1UG6A 1G67A 4C5ZA 1QPOA 3PULA 3CC1A 1VCFA 4C60A 5KITA 3OA3A 4QBXA 1YYAA 4B16A 1E9IA 1RQEA 1JD7A 4CVUA 1CZ1A 1BKHA 1V79A 4WSJA 4YU1A 2JALA 4P7NA 3B9DA 1NM9A 1PHQA 2ZZ5A 2CETA 4X2RA 4IJCA 4IMAA 2FFCA 1CXIA 1G0CA 4AZHA 5JVLA 4IX2A 4V1XA 3I7SA 1EDTA 4Q8VA 1IEXA 3S5SA 3L9CA 4C7FA 1A5KC 3W0KA 1S5WA 4NJKA 2PF0A 2PU0A 1GVOA 3ITYA 3AS0A 2BP1A 3K4WA 5AYZA 4AXKA 3ANYA 1K9DA 3B06A 5CPTA 2VTFA 4IJRA 3FW6A 4OV9A 3TW6A 3G0UA 1M9HA 4DO4A 1X96A 1JZ6A 1PAMA 5AHMA 3MP5A 1DWFM 4H9YA 2Y5JA 1Q6RA 1BVWA 3LQGA 3RAOA 3OZYA 3GK0A 4PSPA 4ATWA 3P82A 1J8VA 4GHRA 4F2BA 1A0EA 2QUUA 2WZTA 2GVLA 3OLGA 3O3RA 1KKOA 4TV5A 1RK6A 2OEMA 1UUOA 1CX9A 4O15A 3QMTA 4DN1A 4AZGA 3NDZA 1IT7A 4V33A 3CZGA 2GQ9A 5BOEA 4GYFA 4DVOA 1KWGA 4AFYA 4R5EA 3C4UA 1HJQA 3M0LA 4EPEC 3L4YA 5DXXA 3A4JA 3AXXA 1BAGA 2P3ZA 4UNIA 3V35A 1AQHA 5LIYX 3SECA 4JIRA 1EZ2A 3LY0A 3LSCA 3HMJG 2DP3A 3SAZA 3KL5A 3AIUA 1TJ0A 3GWQA 3A4XA 3EAUA 3HOJA 4JQAA 1EJWC 1XIHA 4WOZA 4XZNX 1W5NA 3UYIA 1VPYA 4W85A 4POCA 1FDJA 2PGFA 2OKOA 1E5NA 4PMJA 1DBTA 3VVGA 1V6VA 1GZGA 3KLKA 4IL0A 3W88A 1TRIA 3I3EA 4E0CA 5C9ZA 7TIMA 2QJHA 1B0IA 2D0FA 1DHKA 1AG1O 1P6BA 5AC7A 1EFZA 4UQDA 1CXLA 1QO5A 2J7FA 2QGHA 2Z6JA 2R94A 4BEUA 3P93A 1ITUA 3ERPA 1LYXA 1DQUA 4FX6M 4PGLA 3CWOX 4JYDA 2G0WA 2JK2A 2ZE0A 2GUYA 3CBWA 3TOYA 2A85A 2AQWA 3GXFA 1QAPA 4A3YA 3SZ8A 4GGHA 1EWEA 4EX4A 2Z28A 2VP8A 3W9ZA 4PL2A 1QXLA 2W5FA 4M51A 4JOMA 5A1AA 3MO4A 2QDHA 4JTHA 4JFUA 4QDPA 3SB0A 1XSJA 5KMYA 4P8VA 4PEKA 2FTYA 3KCOA 4FEZA 3ORWA 2VRQA 3O1NA 3ES8A 3A12A 4MHBA 1QPNA 1LTDA 4GX9A 3E38A 4DJFA 1JZ2A 1IT8A 2PWVA 3EOEA 1WPCA 4GZ7A 3U8GA 1PUDA 3T0AA 4XIAA 4MWAD 1XC4A 4GA8A 3LM7A 4V15A 4HU4A 2YCJA 2VCCA 2B7PA 1X1OA 3NO3A 5DX7A 3MV01 3CO8A 3WQ6A 1LRNA 1RPKA 1B54A 3KX6A 1ZP4A 2NX3A 3W81A 2E3ZA 1MEWA 1LOLA 1NFBA 1QT1A 2YXGA 1UUMA 3U7VA 1AJZA 4GI4A 4LYQA 4U3AA 2DIJA 1E9YB 2VMFA 4TIMA 3JUGA 1PX3A 2XH2A 3DHPA 5D8WA 3W7RA 4E3TA 1H5VA 5AECA 1W2PA 3N3MA 5BXSA 4A8NA 4N6EA 3SGGA 2CZDA 3AWOA 3OODA 3LG3A 4QROA 4R53A 3SDOA 4O4VA 4HK5A 3HGJA 1S38A 3E0IA 4YXGA 4H9VA 1FUYA 3EKGA 1DPMA 4IXXA 1FCQA 2A3AA 2NXGA 1XDMA 4UNKA 1RA0A 3WQWA 1K6AA 2MUCA 2VC7A 1L6WA 4K7VA 1ZLPA 3KOWA 1V6UA 4DWSA 4W8BA 2ZIDA 4HTBA 3T78A 5D05A 2A6NA 1QHPA 2WBGA 3CMGA 4XZLX 4DJED 5CH9A 1TPVA 4AWUA 4LUYA 5DMYA 1W8GA 4CNTA 4LX4A 3EA3A 2BVWA 4MDPA 1AMYA 5DCEA 3WQ8A 2F6UA 3GXTA 1M01A 1JCJA 2D2OA 1JFXA 1CGWA 4XBJA 1N7KA 3DFSA 3PNZA 1K9TA 3I68A 3CQJA 1PTDA 3NQ8A 2E09A 2E9MA 2P0OA 1D8WA 3BAWA 3ANVA 4LNYA 1W9BM 2HE5A 3ITOA 4CNOA 2DZWA 3OBKA 1PV8A 4I90A 2AOSA 3M5ZA 4R88A 3BOFA 3EXTA 3AMCA 1EC9A 1H7XA 4GNVA 5BROA 3C3NA 3LA4A 1WYIA 2V3GA 4HSHA 4RNJA 1OX4B 1VLIA 5I02A 1UBSA 3QR0A 4JAWA 1IXPA 4CCDA 5I7GA 3HG5A 1OCNA 5CGQA 3MP3A 2XINA 5A8NA 3TQ0A 1J11A 3UJEA 3PZMA 9XIMA 1TG7A 4GX8A 4DJFC 3KTSA 2ZE3A 2ABBA 1MW1A 4Y96A 1FWNA 1OK6A 4HHMA 1DXFA 1KTBA 2P53A 1E9ZB 2WMIA 1HT6A 4HU0A 4B3ZA 4K7YA 3N1AA 3L5LA 1S3TC 2NW0A 4GISA 3W7KA 3ARVA 1BWLA 1Y5WA 1KCXA 4I5RA 5DFAA 2RJGA 4I8DA 2MANA 1EHAA 1A0DA 2V0TA 4WLCA 1OFOA 2GQ3A 3QLLA 1V4YA 3R89A 1VQTA 2W91A 4WY0F 4XZBA 2OGYA 3DFYA 4C6JA 3WL0A 2WNNA 1F07A 1XYLA 1Z69A 3EEGA 1WUFA 2WAGA 1BEUA 3PTKA 3IJQA 4MFEA 4S2BA 3M43A 3UWQA 1VFUA 4FLQA 2GVEA 3S8HA 2QR6A 2PLJA 3BZGA 3O16A 3PBMA 4Y9MA 2TMDA 3WK2A 1GOWA 2A7RA 5HNNA 1ZFJA 1UCWA 4UXDA 1OC5A 4TVDA 1XBXA 4HK6A 9RUBA 3K4AA 1EIXA 1H7WA 1IQ8A 4FNUA 5DN1A 4IL2A 1EJVC 2G4JA 4HSNA 3CT7A 2CEQA 3DFQA 1GG0A 2H3BA 4JD4A 5JMUA 5I2UA 3DIPA 4P7LA 3PVFA 2ZX5A 1SQ7A 3UGVA 3TQVA 3L66A 4DWSC 3N13A 1OSEA 1W31A 2QJJA 5DQPA 2XH4A 2VVNA 3LPGA 1RLDA 1A5SA 4ZO7A 3QLDA 1UD4A 2FZMA 3E5BA 4NXKA 3SUVA 4QHRA 4L64A 3NTYA 2IPGA 1S2VA 1YPFA 2G96A 4AXNA 5LSMA 3VOJA 1ZENA 1VEOA 1X6LA 3L2LA 3RM8A 3GZ3A 3UXAA 3ZR4A 1VRXA 2J13A 3R25A 5BMXA 4I5XA 4HNOA 3DG7A 5HNUA 3QMSA 4ZFCA 3EOOA 4GXMA 5A6AA 4IFKA 4M80A 4JNZA 4AWSA 1TPDA 4DPPA 4GVIA 2VD8A 2F9RA 4QE5A 4US6A 2XIBA 2TAAA 3ZLGA 3MUY1 3PTQA 1Z9AA 1B3OA 1SZGA 4MWAB 2GPTA 2ZWZA 1D2KA 4E2DA 1WDDA 1V93A 1X7IA 1MQQA 4LYRA 4IIDA 2D2HA 1HKWA 1FKXA 5A8QA 1KCLA 3RLVA 3O9NA 2OO0A 4LCSA 4NIRA 4IGHA 2Q01A 5H8MA 3W37A 1EJXC 3IUDA 5F4XA 2TRSA 3OZOA 4H83A 3UXDA 3U3HA 3I10A 1KBLA 2WHKA 4CLMA 4CD5A 2BVYA 4IGMA 3AISA 5M1TA 5EA9A 3GD6A 4L56A 1CGUA 1XL9A 2XVGA 5LA0A 2PLMA 3U4FA 2O56A 4P5UA 2VEKA 1H1ZA 3FGCB 1TR1A 1T41A 4ZE5A 1M7OA 3QPEA 1DWGM 3WH9A 2W92A 3WL1A 1HW6A 4Q8TA 1ONWA 2F2HA 3PPCA 1XYFA 3B4UA 2PBGA 2HEJA 4BI5A 4LEFA 2FHFA 3UZ5A 4DYEA 2ZRWA 2V8ZA 1OBAA 3FVMA 2XVNA 2VC6A 3W07A 1UH3A 3VZYA 1XISA 3QZ6A 4JNYA 4MUPA 3K30A 1WDSA 2QIIA 1ELSA 5LHEA 2X1UA 3NVTA 3RF9A 4GUFA 4YMZA 3LEPA 3S9IA 1W54A 3L4UA 3DOPA 3VIMA 4BWLA 4WXZA 4CKQA 2VFEA 1YNYA 3L68A 4R34A 1PX4A 1C90A 3WCZA 1N82A 2G95A 1K8YA 3WKZA 2DZUA 1VJZA 4KCWA 4F48A 3GAYA 1O5RA 4ROPA 1VCGA 1FDZA 1PBGA 4PTVA 1GW9A 2CBJA 4GYKA 3V0SA 2CIPA 2X0YA 1E9LA 2Y89A 4XAPA 3V5CA 4GQGA 3VDGA 2TYSA 3RLGA 2D20A 5LIKX 2OODA 5BOOA 1P6WA 4DZAA 1AD4A 1RD6A 1VYRA 2GQAA 3S2JA 1RCQA 3I6EA 1JEZA 2TODA 3CXOA 3H7UA 1MQRA 2OTDA 1E70M 2YCIX 5E09A 3LMYA 4L4PA 4XBKA 5D37A 3CHCA 2BODX 4NUWA 4OE7A 4IX0A 4CVWA 2Y62A 1JRCA 3CMJA 5M03A 4AY7A 3NVDA 2Q3RA 3GVVA 3MC5A 5FJJA 1R9XA 4Q4RA 3QQ1A 4LAZA 3OZPA 3MVIA 1OGGA 5EMJA 1V0MA 3NQBA 3B4YA 3G3MA 1ML1A 3MP4A 3QN3A 3WF4A 2XG9A 4NJHA 3UWWA 1G4SA 1XLDA 1PCWA 4LSBA 2RUSA 2QVNA 1NQ6A 3P2VA 2HPIA 2PODA 3LI1A 4H4IA 5K7JA 3PY2A 4UC5A 5I3FA 4GVHA 4HPNA 3VGBA 1LT7A 4S2CA 3QR1A 4FOJA 1XKYA 3LN3A 1GPWA 2WQPA 2B31A 4RNFA 4ZR8A 3AQUA 5KTLA 3FJ6A 4LCRA 1AL7A 1RJQA 1MZRA 4DYKA 1JYNA 3MU7A 3TJXA 3WLPA 1WB0A 4XZWA 4YTTA 3NG3A 2DZSA 4JKMA 3KRUA 5H2ZA 1T0OA 4C91A 1I2PA 3KZSA 5D8ZA 4NZCA 2BOFX 2V5JA 3AZRA 3T2PA 3HPAA 3T8LA 4AZCB 4EPBC 2DSWA 1B4EA 3AROA 4R7JA 3OHMB 4IGNA 2INEA 1TX0A 1XBVA 4FF7A 1BGAA 4KCVA 4MAVA 1XQKA 3G1FA 4QCFA 2Z1XA 4C6QA 1LG2A 5CSRA 4DB7A 3PFRA 4TX6A 4D9PA 2WJFA 4KWWA 1L8NA 1JR1A 1P0EA 1A47A 1WZMA 1SR9A 3KVJA 1QOXA 4M6PA 4M3PA 3M6YA 3K4DA 3V4BA 3S3GA 3BLPX 1LP6A 1GVRA 2HBVA 5FF2A 3H7VA 2DZBA 1EGVA 5GVJA 3VD4A 3G24A 1ENUA 1PZ2A 4QSFA 5F1VA 2BXVA 1BTMA 4NAEA 7REQB 1J2WA 2GVYA 3RUBL 2DSKA 3V7PA 4XD6A 3N4FA 4WXYA 5D04C 4WD0A 1HFBA 4FR6A 1TO3A 2V67A 3U5UA 3C2YA 3EX6A 4EPKA 1R6WA 1RD5A 2YA1A 4DO7A 2X40A 1HP4A 4JTJA 4GJJA 3VNDA 1ZZMA 3V16A 4LFYA 1K7FA 3RX3A 3EB4A 4KWVA 4EF8A 3BJTA 1KM2A 4GZJA 4JICA 1PL9A 1FFRA 2OLHA 2ZC8A 3ZR6A 4XQ6A 3TTYA 1J18A 2X16A 1IEIA 1J5SA 1XF0A 4GCXA 2PC8A 4QM1A 1TMLA 3NQGA 3REQB 3PZGA 3PR2A 1TQXA 1UW9A 4DBSA 5I3DA 2YL8A 1HP5A 4D8ZA 5HPCA 4D6EA 1B5TA 4B5UA 1WDPA 1ONXA 1O1HA 4JL2A 3IRDA 3WN6A 4KCUA 1H63A 3W1TA 2XVLA 3UCCA 3S0CA 2Y7EA 2Y4SA 3W7PA 4AWTA 3MMWA 3RNDA 4PTWA 3S5NA 3UQNA 3VKDA 2EAWA 1DKWA 4GO8A 5E6ZA 3VX0A 3H2CA 2V81A 4US5A 3R79A 2C13A 1S2UA 3ID7A 3GDTA 1X6NA 4FNPA 3SIMA 4ZO9A 3M0YA 2NQ9A 1EEXA 3KVMA 1TWIA 3KDNA 5CGMA 4BI7A 1ME8A 1JDFA 2VRKA 4F0SA 3W6MA 3N2MA 5I24A 4XD5A 2GJXA 1UR1A 3O05A 4KWOA 2RDXA 3NL2A 5JIWA 3ARPA 4W7WA 1CGTA 5C9UA 4FHAA 1UP2A 3TNOA 3UJFA 1UP3A 2G97A 5ECUA 4RDWA 3KP1A 1QWGA 4MZYA 1JI2A 1TUXA 4ADTA 1BHGA 3THCA 4AC1X 4J40A 4TTGA 2Z1BA 3ZMRA 2YW4A 1ZBCA 3GH7A 5I78A 1JCXA 1F74A 2GGEA 1JIBA 4NZJA 3VNLA 4ALDA 3PBGA 1E1EA 2EXOA 3W28A 1C9WA 3CUXA 3EDKA 1TZ7A 4LC8A 4MJZA 1CW2A 3VI2A 1E4MM 4M6UA 1GTEA 2OB3A 1FWIC 4MG4A 3TZFA 3GLCA 4PB5A 1ZS2A 4A6GA 2HK1A 2X2YA 4WEVX 2EQDA 4XB3A 1XS2A 2RAGA 2V6AA 3OIHA 1PIFA 4IIGA 1IR2A 5DEZA 5DY2A 3NQFA 3COTA 2EG7A 3FSUA 1AQMA 3B3DA 3JZEA 4S3JA 3VDCA 1NP0A 3OP2A 3F2BA 5G4EA 3KBMA 2JIEA 2OU4A 1W1A1 2XWDA 1B3YA 1IT0A 3DI1A 3MSDA 1ME9A 2LLEA 2Z26A 1C29A 5MF5A 2ZXDA 2P88A 2DVUA 1XLMA 1VFLA 6PTDA 2PTXA 1EDQA 1I0BA 4QGCA 4FALA 4MM1A 5M2FX 1JPMA 4N4PA 1G01A 4C6DA 3NR0A 4WUIA 3B0XA 5K2ZA 1Q63A 2ZDSA 3MJMA 3ZWTA 2IKJA 3ZFHA 2VFIA 3HQOA 1T6MA 4CQDA 3W01A 4ACYA 2PDBA 1XQLA 2DQXA 1EJSC 3OTRA 4DY1A 8XIAA 4N9BA 3R0UA 3RMJA 3QYSA 1OQFA 1A5BA 3W72A 1C9DA 4AHPA 2WNQA 4LWWA 4DBDA 3PG8A 2D23A 4Z0SA 3SRFA 4QRNA 1JPHA 1LM1A 4BQ3A 2GJNA 3TROA 3L0NA 2EPMX 2EGZA 2WKJA 1ZNNA 5XIMA 1V77A 3S2LA 4G1NA 4S3AA 2GZXA 1TJ1A 4UNLA 2X1RA 3MZ2A 1VF8A 2ON3A 3SCRA 3T09A 4PYSA 1EBGA 3TCSA 4HBKA 1NSJA 4XWUA 5LIWX 5E5CA 4J3SA 1R3QA 1KW1A 3E96A 4R27A 5A5WA 8RUCA 1JG9A 2ZUVA 1J0ZA 1V7YA 2HDJA 4YYCA 2F8QA 1IWAA 4AISA 5EFFA 4O11A 2WVSA 2PDQA 5IHSA 1F3WA 5FEPA 4TQTA 2J47A 3IJIA 3UW6A 4CUCA 2XVKA 3M0MA 3RO6A 1UWRA 3B8VA 3GDKA 2PDXA 3E74A 2WC3A 1BD0A 3I3BA 2GLKA 4PMUA 2A3LA 4H9TA 5EBAA 3GC4A 2VOMA 5AC6A 3BOLA 3MMDA 3P0XA 4D72A 3U2EA 3WBYA 4C1LA 3S2NA 1YBQA 1UA7A 3IAPA 2EG8A 3WEMA 3CAKA 1QDSA 3V0TA 3VIGA 5MHBA 2E5BA 2J75A 1V6YA 4N42A 1EC7A 3NWRA 2CBUA 3WG6A 5BCAA 3TQKA 4H7ZA 4JXCA 1K4GA 2PWFA 4R9XA 3H23A 4G2DA 1IEWA 1KV5A 4PRTA 3GSMA 4HZ7A 3M0HA 3HPSA 1GK8A 1EJRC 3SBFA 1XRTA 1GQKA 1DJQA 1VIZA 4JKKA 4TTUA 2Q71A 3PPFA 2NZLA 4HZ8A 3Q4DA 3LHZA 3RLUA 3LX9A 4GQ0A 2J27A 7ODCA 4LGXA 1YPXA 2PEVA 3AS1A 5XIAA 2B7NA 1OFRA 3W7DA 3M46A 1MW3A 1Z41A 4EWND 4QG6A 1W9VA 1KB3A 2VEPA 3O8AA 3RCYA 3CB3A 3KWXA 1IXQA 1QPQA 2D0HA 4OFCA 3HO8A 3UGRA 4PUKA 3H21A 1XCWA 2WVTA 4XAZA 4AY1A 4UQ9A 4D8AA 3QRHA 3VC5A 4O8AA 5H8UA 4PCTA 1F9CA 1EP2A 3MT1A 3M47A 3C5QA 2WMGA 3TYAA 3XISA 4DWSB 1G4PA 4FX7A 1Q6GA 5J5RA 2FVLA 2HBXA 1R3RA 1J0HA 4K6AA 1DWIM 1F3TA 3QF0A 4ROQA 1TV3A 4U3CA 4Z2JA 2OT0A 1FH9A 2DGAA 3W83A 3AIWA 1V7AA 5DF0A 2H9AA 1F6KA 2WPGA 1VYSX 5DXYA 4A4AA 2OVLA 4HPXA 4PH6A 4PEEA 1A0CA 3ELFA 3MUXA 2QJGA 1HJUA 3A47A 1U30A 2J62A 2WJZA 3GXDA 2IQTA 3OZMA 4JL1A 3DZ1A 1FBAA 1GG1A 1Z8AA 1W3KA 3HPZA 5G1TA 1SMDA 2E6YA 2XDFA 2I57A 2WMFA 4NU7A 2NVCA 5A6KA 3B8UA 3BGJA 5ABEA 1MEHA 2Y61A 3D5HA 1CYGA 1MFUA 3THUA 3WEOA 1RQBA 2PD9A 4Y7EA 3UR2A 5I5RA 3TMQA 5A2CA 2WMIB 2BB0A 2VZTA 5AHIA 1YDYA 4LNCA 1X98A 3EWZA 3NM1A 2H6RA 1OYBA 2A7PA 1W3LA 1TZZA 5FEZA 3E1F1 1H4PA 1FH8A 4M24A 3SUUA 4B90A 5CJMA 4AF0A 4JFWA 2YIHA 1RV8A 3FX4A 1YQ2A 2O4QA 1OHLA 5BOFA 3JR2A 1ZBKA 4XKYA 5IRPA 3W1AA 2PWDA 3WDJA 2R6OA 3VX1A 1F05A 1OF6A 2BHZA 3K1GA 2I5QA 3UG3A 3UJSA 3NQ6A 3HJZA 4H3DA 4LW7A 2WSPA 1WZKA 4LVAA 3IJ9A 4LXFA 2W61A 1PYFA 4IP5A 4ES4A 4FLOA 3FA3A 4Q8WA 3NZQA 3PUDA 1LDCA 4HOZA 4OWGA 1PZ3A 2QPUA 3M0VA 1R8LA 3SM0A 1VR6A 3KP0A 3W85A 4Q8MA 3W02A 3DBNA 4CQ8A 4L6HA 3KOZA 1XLEA 2WQDA 1I2NA 4M81A 4JTFA 3TC6A 1A5NC 2NQJA 4GY7A 3S4TA 3R1ZA 3EDJA 3QY7A 4E8DA 4JIQA 4Z2KA 1QOQA 5AYXA 5I23A 2BOGX 1SVDA 2WC7A 2CWXA 1K7XA 2Z1SA 3VNJA 2UV8G 3RM4A 1KM5A 4Q3MA 2ZADA 3E2VA 3DEQA 1Q6EA 3E0FA 4C6PA 1PE1A 4S3KA 5D02A 4DF2A 1QK2A 3OOQA 1KO0A 3EMZA 4N7QA 3H22A 4MJ2A 1FCUA 2AAAA 3P8IA 1QWKA 3QC0A 1NH6A 1R7AA 4O50A 3HFTA 1E1FA 2EPOA 3UP8A 3C0LA 4CCZA 4EOUA 4OOUA 4E8GA 2R24A 4WSKA 3TE9A 1UWSA 1XD1A 2IPJA 5CZ0A 3AO0A 3VKCA 3RGTA 1KXTA 4FI4A 1YEYA 3FKKA 3AU2A 4IFKB 4GI6A 3WJYA 4NYYA 4M1RA 1KQZA 4XZMX 1AK5A 4KWUA 4LUJA 3L7RA 3HU7A 2NWRA 3VNKA 1RCXB 3GTIA 7XIMA 3CH9A 4YLWA 3GTHA 2IQ0A 3EPOA 3NDOA 1MZHA 4HN8A 4YIWA 4AZ6A 2ATMA 2ALRA 3C8FA 4LUIA 3IGUA 3FDGA 3HQPA 4UOJA 3KM8A 1OZQA 3EB2A 3G1VA 3OGSA 1XUZA 3LGDA 5DO8A 5C71A 1US3A 5LNUA 4ZO8A 1JPIA 1LWJA 4FXSA 4S23A 4IWWA 1SSDA 1ZP3A 4QAWA 2ZZ1A 3T0DA 3EWUA 3WENA 2CU0A 3GHSA 4IMEA 3J7HA 3F4VA 3G3DA 5B7ZA 4ZB5A 1UQYA 3H12A 3BXWA 5HUPA 1E56A 3EWCA 3KBSA 3LTPA 4NJGA 1VD6A 5JIPA 1JPDX 1K9EA 2YXOA 2VL4A 4MY8A 5AYBA 3VGHA 3LERA 3SCQA 3KW3A 3MUCA 1YIXA 1XINA 3FCPA 3DI0A 1E40A 3FA4A 2VYOA 3O2LA 3NZPA 3DDMA 6XIMA 5CLTA 3PBWA 1GVSA 1EXPA 2CLKA 1N8FA 3R4IA 4C6MA 4RK8A 4KH2A 3AI0A 2I1OA 1KWKA 4J28A 3W26A 1TB3A 5CSYA 1TV8A 3FJ4A 5FOOA 2OT1A 2P76A 4C6BA 1SW7A 5REQA 4IQJA 4XUYA 3W7MA 3WF2A 5CEWA 4QXIA 2DW7A 4DZIA 3VXGA 3KS6A 3B8DA 2PGEA 2VC5A 1IIGA 1WKFA 4HHLA 3WQOA 5CBBA 4WDUA 1L2QA 4LS0A 4K2SA 4NNAA 4MOZA 3B8TA 3UD6A 2A6LA 1WOBA 5HWJA 1XLHA 2PDJA 2GDUA 5FJUA 2PTYA 4D1IA 4ZL1A 3UBPC 3WD2A 4UTTC 1GT8A 2HE8A 3NZ1A 1E6QM 5AB3A 1QASA 1R2SA 1FWDC 1HKMA 2Y7FA 4K8EA 1ZJAA 3HURA 3N18A 5EGRA 4ZQCA 2RDWA 1NF0A 1RVGA 1ZJHA 3BLFA 4DEFA 1AMKA 3HN3A 3FJNA 2OYLA 2QIWA 2W6RA 3GG1A 3O0FA 5H91A 1LZOA 3G6LA 4M7SA 2GDQA 2PWEA 3TR9A 3ZJ8A 4E2OA 1HL8A 3NZRA 4F3HA 4NQ1A 2WC4A 3QOMA 1TPWA 2WVVA 3S1UA 4JIEA 1FWEC 5C54A 2Y7DA 5DT7A 1WBJA 3LHVA 2VX7A 2FPTA 3N4EA 4HNVA 3N2CA 2R82A 4J2MA 1RALA 1KCZA 1MUMA 1KLYA 4WKHA 3NCOA 3B40A 2YYTA 3PZ9A 4P8XA 5D2WA 1JUEA 4MJMA 1OF8A 1ICPA 1S39A 2QDDA 2V3DA 1QJWA 3KRSA 3WNKA 2OKTA 1XLGA 2D69A 3Q65A 1XR2A 2GYIA 1JJKA 3GNRA 2QUTA 1K3UA 4NAFA 3EWYA 3V1HA 1P0NA 1XDJA 4IMDA 3WUEA 1OZMA 3LOTA 5CKSA 3FYOA 1GUVA 4RE3A 5C2GA 3DKJA 1OCQA 4HQVA 3WLMA 2XIOA 5IDIA 3AZSA 2J79A 1TPEA 3LPOA 3QSRA 4ZOBA 3P8JA 2IPFA 2PF8A 3TMLA 5BRBA 2WSRA 2ZUWA 2QT3A 3BCFA 3BV7A 3V1PA 3QR3A 3BANA 4WDXA 3RG6A 3MMTA 3MMUA 1WZLA 1JXKA 4MFDA 4DI8A 2J8GA 4LAUA 3SRDA 4PUMA 4LPCA 1CT5A 3M44A 2WMKA 4FXFA 4JQ2A 2OQYA 2A3HA 5FCZA 2CBVA 3UFYA 1ZU8A 1QOPA 3NEVA 4HYRA 1TJPA 1R3WA 3CHDA 4ILSA 2VFFA 3NZGA 3S1XA 3MV11 2XFFA 5L6UA 2B4GA 1CPUA 1E6PA 4Q32A 2VR2A 3AHYA 1W3TA 5FL1A 4URIA 3PAOA 1P7TA 4KS0A 1K7EA 5JH1A 1VEMA 4NAEB 5TF0A 4O10A 1RY8A 4YPJA 4ML9A 2PDWA 3QQWA 1R38A 3B9AA 1VPQA 4GZIA 1Z7AA 4BKNA 5ABTA 2CC0A 4JTCA 2EPKX 2R91A 3SUSA 4L1WA 4P7QA 3AMLA 4S38A 3BLEA 4R85A 1CGXA 3WLOA 1ITCA 3N15A 3VNMA 1TWZA 5G1YA 3AMKA 4IICA 4ZMGA 1G4EA 5LNSA 1OC7A 5LZLA 3DYMA 4CQBA 2J7BA 1R3VA 2E40A 5G1MA 4J4KA 5CC5A 1FWRA 2CNCA 1AJ2A 3WZ0E 1R3YA 1ZBVA 2FZ9A 2P1FA 4K37A 4I7VA 1S2AA 4PMXA 5GJMA 1JUKA 3EPNA 3PM6A 3AOFA 4KBXA 5DRIA 3M5YA 1BYCA 3WEZA 3QXBA 1DHPA 2SFPA 4IFRA 1O60A 1MNSA 1UZHA 1KR1A 5KZDA 3SI9A 3SO7A 2JKAA 2VEIA 1ECQA 4W84A 3ATZA 1TQJA 3GVGA 2FZNA 1BWKA 3UG4A 3S42A 2P10A 4MKSA 4Z42C 4E2BA 3MUZ1 4X9YA 3G1AA 3GDBA 5D9PA 4IMFA 1LQ2A 2VZOA 4RR4A 3CGTA 1ZAIA 3PJXA 1WX0A 1Q4NX 3FXGA 2EPLX 1XUUA 4O28A 3QGAC 2R1MA 2V9DA 3CAWA 4G1KA 4DJDC 3W25A 1BG4A 3GC5A 1CXKA 3PBVA 4MNMA 2GJXB 1JZ8A 1G7UA 1F73A 3AMGA 1WKDA 2YR1A 5A6BD 2YCKX 3BG3A 4J2PA 1YKWA 2V38A 4MPQA 1FVPA 3UPWA 2ESCA 5E1QA 4R9OA 5HMSA 3NGJA 4OJYA 5IFTA 1VFMA 4WF7A 1B1YA 4DLFA 4ZSTA 3BC9A 4PL1A 1J10A 1G1YA 3G5EA 3C0JA 3GS6A 1W1PA 3P60A 3WNNA 4LS2A 2XM1A 3LHUA 4S3EA 2EBNA 3GH5A 1TMQA 4GABA 3VNYA 2WB5A 2ANUA 4PUJA 5I6SA 5K4ZA 3ITCA 1OY0A 1YTEA 4L1GA 3ZJ6A 3NQMA 1VHCA 2FIQA 4FXRA 1ZPTA 4WDWA 2PPGA 5AVHA 2FZBA 2BXZA 2PWHA 4I8YA 2WLZA 1DQWA 5HPOA 3VE9A 4B4FA 3N2TA 3A4WA 3OVRA 1YE4A 4JHZA 3FK4A 2RDTA 3H4GA 2OZTA 1CLKA 3LBMA 3OLDA 3PZOA 3R94A 3WDHA 3QGKC 3B8SA 3TX9A 3SQMA 3IVUA 4GVGA 5DBTA 3ARRA 4MUZA 3RU8X 3GU9A 4Q8NA 4W93A 1EP1A 2QAFA 3WJSA 2O7SA 1R85A 4PN2A 4AD4A 1GNXA 2QCHA 4JFSA 1WO2A 3ZSSA 1GCYA 4REQA 2CLFA 3U7BA 1DTNA 1EKOA 3SCTA 2XGBA 4JTIA 5ENLA 4JTAA 2QZRA 2VELA 3W1MA 3GBEA 1GJUA 1I4NA 3RU6A 3W3OA 3RM9A 3HM7A 4DAIA 1EF3A 3JW7A 2QEZA 1HJVA 3OB8A 3BMVA 4GI8A 2QMKA 3E5PA 3C6CA 3H53A 2VX5A 2YL6A 1XYCA 4S3DA 3WLNA 4BI6A 1UA3A 3IPWA 2DSZA 3LCXA 5DLCA 4CQCA 4LAOA 3C8NA 2ZA2A 2DZVA 3PHAA 3CV7A 4CQ9A 1XRSA 3NOEA 4OOZA 2ONEA 1IGSA 5JXQA 3PZIA 4FNRA 4P8WA 3QTPA 1FWBC 3TN6A 4HPGA 4N02A 3NNTA 1MWOA 3MYPA 1DJWA 2FPYA 1GVFA 2ISDA 4ML4A 3UJRA 5K9XA 1CENA 1XXXA 4ERIA 2DEPA 4I9AA 4TMCA 1NDWA 4EANA 1O1ZA 4HB7A 1FDYA 3K5XA 3TW9A 4ADSA 1MVYA 5C9RA 1LOSA 1D3HA 2ZUTA 3GZAA 4TVUA 3TP4A 1KRCC 1TWSA 1VC4A 1YBQB 5CC7A 4UQCA 4IIBA 1B2YA 1ISXA 1RSCA 2EPHA 4IG2A 3FEQA 3PB2A 3MKVA 1VBGA 4AUBA 2QW5A 4RKAA 5BU6A 1LOQA 3BZJA 1R2TA 5DMMA 1V3MA 4UUIA 4DO6A 3MWAA 4E5TA 4Z1CA 1Q2RA 4GY0A 3EWBX 2DH2A 4IZGA 4AD0A 2A7NA 1KXHA 2BV9A 4S3BA 3VABA 2V63A 4X0VA 1TWWA 4XZIA 4UFJA 2DUAA 1WKYA 5IOBA 3TXVA 2C15A 1ZALA 2CZEA 5LYRA 1UOKA 4BS0A 4UTWC 1XDLA 1MXDA 1J0IA 2DZXA 4RNIA 5AYYA 3W1LA 2AMXA 2WHMA 4JEJA 3HPXA 2PCQA 1XH0A 4WRHA 1J4EA 4J5NA 3BJFA 4BCEA 4IPJA 1X97A 2YZRA 5AC4A 1C8XA 5LNVA 2OYKA 5EMMA 3QHNA 1UASA 3ZS4A 5AFDA 1C3FA 3VDBA 4NX5A 4LVFA 4HK7A 1KTNA 3KE0A 2YA2A 1TKKA 2PI6A 1TVLA 2ZZ2A 4L4MA 3HB9A 3BAKA 3GIYA 1XFBA 1JYWA 3AJ7A 3CNYA 4C6FA 1A3HA 2FJUB 2YBTA 1YTKA 2ZVIA 4C7DA 3APTA 3VOIA 1A49A 2QPSA 3NL5A 1RBAA 3H2FA 2C16A 3QSTA 3LNMA 1E6SM 1XFCA 4LU0A 3C0QA 4W8LA 4LY4A 3OLIA 4PTNA 2H9AB 3FY1A 4J3UA 3OJGA 3Q58A 4TXEA 2FB2A 5FJPA 2PTDA 3VMOA 4JTKA 1IZCA 5CZSA 3EZ4A 3G8RA 2Y0FA 4AZBA 4ZE4A 4JQ3A 2XZ7A 2D3LA 1SR0A 3BGGA 4F8XA 4Z1BA 4WZHA 2E1DA 4YHGA 1C92A 3N34A 4W5ZA 2CHOA 2FDMA 3HPFA 1Q13A 2YLLA 1DIKA 4S3GA 1THFD 3WNPA 3EA2A 1EYWA 5BRPA 1TYGA 1A5LC 2E5CA 5LXXA 2HPMA 2D3NA 4LCQA 1EL3A 4GFIA 1AVAA 5HDRA 4C1NA 1WUEA 5JBEA 3R0DA 3RJXA 3CUHA 1NTHA 2JEQA 4JIHA 3QGVA 5AHLA 1FWWA 4ICMA 1QMLA 2BY0A 8TIMA 1UIPA 5BMWA 4PCSA 1ICQA 3U0HA 3P84A 4C90A 2HISA 4M0XA 2VGIA 3EX1A 4AF0B 5ABHA 5IM51 4MB5A 3AIQA 5IBXC 3IRSA 3U2ZA 3N6QA 2AQOA 4MIMA 2VNCA 3VM5A 1KBKA 5FSDC 2FJKA 3H70A 3N04A 5K9CA 4XKYB 1ISWA 4QEHA 3QZEA 1AODA 1L6SA 2XWEA 2ZZ7A 3QHOA 1KXQA 1H09A 1WBHA 3VO0A 4HN4A 4KMQA 2YL5A 5D33A 4ECLA 3OYZA 2I9UA 3NQEA 2Z0IA 1E73M 1Z89A 3MYOA 2PU1A 5ABGA 2NUYA 3BAYA 3UZXA 4WR3A 2O9RA 2FGLA 1ISVA 2ZX9A 3N17A 2Q8LA 3M0IA 3MBDA 2PLCA 1P5BA 3EWWA 3WQFA 3PZTA 1A4LA 4PSRA 3NXLA 1RLCL 1UBPC 3WJXA 1CECA 2Y85A 3HGSA 3M1ZA 1Y0EA 3CV2A 1E0WA 2V5LA 1AW1A 1KFKA 4IQLA 3NOYA 1XLFA 1KM4A 4WX2A 4A21A 1G6CA 1GEHA 2EF9A 3KHDA 1VIWA 1EPXA 1XI3A 3WIJA 4WIWA 1XYAA 5E9XA 1WDQA 3NAVA 4CQAA 3FSTA 2RDUA 3SCNA 1CTNA 4EIVA 2NLYA 4Y8FA 5JH2A 2XSXA 5HJYA 4UZSA 2E9BA 4GINA 5HUOA 3T44A 1CNVA 2IW0A 2ADAA 1UD8A 3ARUA 5J8LA 4HMEA 1T8QA 1V3KA 1VH7A 5T8GA 3E12A 1OCBA 3BGAA 1MQPA 2PBOA 5LGXA 1AQ0A 3TA9A 4IFOA 3TYEA 3LPPA 5K4XA 1JF5A 3GYCA 3L5AA 4YJ5A 3RX4A 5A6SA 4UTMA 3C2RA 3CZJA 1Q6QA 2GK1A 3I6TA 1KFWA 1AJ0A 1OD8A 4DF1A 2QJMA 4B4HA 1ADSA 4PBEA 3WBAA 4GKTA 3DGRA 4HPJA 2XIMA 3SRHA 5LNWA 3VD7A 1E6ZA 3AIRA 3N9SA 2BG5A 3IK4A 3U48A 4XIMA 3IGHX 3UA3A 4HZMA 1O94A 3W1UA 1EOMA 5D4YA 1S1RA 2VZUA 3QW3A 3PC0A 3SUTA 1VKFA 2Z27A 2QVHA 4AU0A 3ITLA 2XSAA 1OM0A 4BF7A 5TNVA 1FXPA 5FIPA 1UKOA 1GQLA 3CQ0A 4TMBA 1A53A 4D6GA 3IK2A 4KERA 3U9IA 2QCEA 4JTTA 5E0FA 3KLLA 1SJDA 1VFTA 3DENA 4TU1A 4B5SA 2P50A 4RZ4A 1BXBA 3PWIA 1I2RA 3KL0A 1JPKA 4FA3A 3ITVA 4U2YA 4ZQMA 3BG5A 2VQTA 4AYSA 4PMOA 3SCSA 5HMDA 1JDCA 3A3WA 2G3JA 4PBGA 1UUQA 5J5DA 4L4LA 4JGDA 4KEUA 3E2QA 3YPIA 4FR1A 3UZYA 2EKCA 3H55A 3LRMA 1FWCC 4MGGA 1UKSA 1I1WA 1QHZA 3USBA 1JCNA 3PUEA 4DLMA 1L9WA 3DYOA 5REQB 3PJUA 2IMRA 3E0WA 2X05A 4CNSA 3P61A 1UOZA 4ZOAA 1EO7A 4GC4A 2YYUA 3MVTA 3HV9A 3AS3A 3PZNA 1XH2A 2NVAA 4HJWA 1UD3A 4Z1AA 7ENLA 5D9NA 3RLHA 4XSLA 2ICSA 2XIQA 3WBXA 3WNOA 5A6TC 4QIUA 3EWDA 1E4LA 1OFEA 2V2HA 2EO7A 1BFNA 3GVRA 1BVNP 3V5OA 4BA0A 3HG2A 2VD9A 3S6OA 3STFA 1Q6DA 1M7JA 4QFUA 5HR7A 1TWDA 3WQCA 2QV4A 3MCMA 3T2QA 1F4HA 2R1NA 1JCMP 3H2EA 4OIFA 2Z7GA 2D2GA 2VRJA 2G3FA 3GX9A 4CD8A 4KRUA 1GOMA 1BG9A 4HNTA 3H6OA 3JVAA 3ZR5A 2CLLA 3UXKA 4LAMA 4BJHA 2CLPA 4H1ZA 1V0LA 2WVVB 4MVAA 3FIGA 4DBWA 4O54A 2A3EA 3B0YA 4IIHA 1GZ1A 3CQIA 4DUOA 3C2EA 4F4RA 1FFQA 4DF0A 1YDNA 3GXPA 1PS9A 2E4TA 4A8IA 2CESA 3TFCA 1FWHC 5GPRA 1WXYA 3DCPA 1JYXA 4WK9A 1JDAA 1TTIA 5BU9A 4GOAA 2C1IA 3WQVA 2HS6A 4Q7NA 3ZJKA 3EOLA 4IPPA 3NPVA 2YDQA 5DCBA 3VIFA 4BQ2A 4E4FA 2Z6IA 1PO9A 3TR2A 4BK9A 2AKMA 1GGOA 1SZNA 4NAFB 3MSYA 1XRFA 2AGKA 1DORA 2XN2A 5A3HA 1P0KA 4MTVA 1DWJM 4EAYA 1ME7A 2WSYA 1AQFA 2HTMA 1H51A 4O16A 1IEVA 1XLCA 4JTDA 1H7OA 1JD9A 1F6YA 3QEZA 5TQLA 3HQNA 3A24A 3ALGA 4LY8A 4MYXA 3CL6A 3M5XA 3UY7A 2PB1A 3NSXA 3MWCA 1GTHA 2OGJA 1LROA 4XG1A 3H24A 2P0IA 1JGIA 1Z44A 2DJXA 3IUIA 3WMBA 4IQEA 2V3EA 1UPPA 1VBHA 4BEQA 3ICJA 1GONA 1QVBA 4HHPA 3B04A 3W6LA 3LBCA 4JTLA 4AZ7A 2OYMA 5RUBA 4Q8UA 2REQA 1QO2A 3BSHA 1P7TB 1JCTA 4IPIA 1NWUA 4HA0A 1RUSA 1E51A 3SRKA 5KEZA 1UROA 4M56A 2BDQA 4DI9A 3UT0A 2HXUA 1VRDA 4Q22A 4LUTA 4O14A 3QV6A 1EBHA 2UY2A 8CGTA 3MCOA 3NPXA 3P5YA 1JL8A 2ZRYA 1R46A 3AFBA 1M68A 4AY8A 1EEPA 4QNWA 2OZ8A 4GIEA 2J74A 1KRAC 2NUXA 3Q94A 3H4WA 4MWAE 1A5MC 2PDYA 3GIQA 4IJBA 1UKPA 2XU2A 3T42A 1VAHA 4PRRA 2FHCA 4RL3A 6ALDA 1W5PA 1TCDA 4QQ3A 1SFTA 2H8ZA 5LNRA 5TAOA 2VX6A 3SGUA 3MDWA 2ISSA 4MAZA 1GEQA 4AVOA 2VFDA 3BLOA 4IQDA 4O0KA 4ZODA 3OVGA 2OZ0A 1EUNA 3SCOA 3NDYA 1LUCA 4V27A 4GG9A 4P8UA 4UCFA 1G69A 3NM3A 1SO6A 5CC3A 5CXPA 2ZVRA 2CWNA 1RZMA 5EB8A 4RE0A 4OBSA 1XKJA 2WANA 3EMQA 5KSWA 2QCLA 3W6YA 3RR4A 5HBFA 4CEUC 3OVQA 4H19A 3AXKA 1TPB1 3ARTA 4A35A 3KDOA 1CXHA 1HXJA 2XYLA 4A2RA 3DUGA 4H00A 3A4AA 3B97A 4EXAA 2C14A 3QVQA 1AW2A 4Y8EA 3RPTA 1V03A 4GUIA 5CZKA 4RZ5A 3VMNA 2Y8VA 1T99A 4I3GA 4H6RA 1QR7A 3UWUA 3M5VA 4BY3A 1KRBC 1GKPA 3M0JA 1VS1A 2I5IA 1TPC1 2I17A 2ZX8A 2ZXBA 3NQDA 3M07A 3CZ8A 2EJ1A 2F2KA 3RILA 2WK2A 3GC2A 3GFXA 3F7JA 4LBUA 3P3BA 1UWAA 3GXIA 2ZRZA 1NIUA 5XINA 4UQAA 4LANA 3VC6A 2PGWA 4BF5A 3RDKA 3TJIA 3CQHA 3T0BA 3KWSA 3TK7A 3ECQA 3C2OA 1XIEA 4CU6A 4ZB2A 3H26A 3JU2A 1QU4A 3GW3A 3M0XA 4HU3A 3W2NA 5I79A 4H9ZA 2FYMA 4H7CA 1OFAA 5D30A 3NSNA 2IXVA 4O52A 3L5MA 2PDKA 5HQLA 2GJPA 2J25A 4QLJA 1W37A 4I7UA 5D2YA 3F2CA 1I2QA 3IS4A 3A5VA 4YVXA 3CEPA 3G1RA 3SQSA 1VHNA 1KA9F 1TMHA 3ENLA 1DE5A 2YPIA 1Z48A 5I00A 2V5CA 3CLMA 3UG8A 1OFBA 3D6NA 3VILA 1L6YA 4CCCA 1DYSA 2WSKA 2CLIA 1BSLA 3IJ8A 1JNDA 3TTEA 3UCQA 3IVTA 4PMVA 3VIOA 1JZ7A 1UZ4A 3N73A 3TC7A 4OV4A 4JBRA 4B5XA 2P5NA 3AICA 4W8AA 1SPQA 2VZVA 3GY1A 4EF9A 4C6IA 5DT5A 3ZJ7A 2CITA 3ATYA 4JCLA 5SWUA 3SQLA 2VKZG 1KFEA 1QATA 3H2NA 1OJXA 1I2OA 5C9WA 4R33A 4RE4A 3GVWA 4REQB 5ABFA 1R9YA 4OZOA 2Z1VA 1F76A 1S5MA 4D6JA 1NDVA 1A3XA 2A2IA 3LCWA 4ATDA 3P7YA 4BR1A 3WUFA 2W9MA 2OCZA 3VKBA 1JNEA 4QX4A 3UVIA 4AD2A 1NWSA 1ZB5A 3TLLA 3A64A 1F2JA 4K8GA 3NA8A 2PZ0A 3VOGA 3IGSA 4LAKA 3BLKA 2W63A 4I7WA 3GB6A 4NXSA 4IT1A 3VNIA 5JUVA 1AA1B 2FDSA 4Z2HA 1SJBA 4QJ4B 3R43A 4PTDA 4TOQA 4HNNA 1F61A 2CXEA 2OX4A 2X0SA 2XVPA 4MPKA 3D47A 1QBAA 2X41A 4Q6JA 3NEHA 4PE8A 1ZAJA 1DIDA 1W9XA 1MRAA 2OZ3A 2CZVA 1UP0A 4XUGA 4TVCA 3DHFA 2D0GA 4TO8A 5A6JA 3E02A 3F4CA 1H1NA 5TIMA 1R2RA 1TIMA 3QMRA 4RCXA 4GNKB 3T6CA 1SJAA 1QPRA 1YXCA 3RMEA 1V08A 4HNCA 1CXFA 1EDGA 4IG2B 3BG9A 2EG6A 3WLSA 2O7QA 3TA6A 3WF1A 6ENLA 2XISA 4MKNA 3DU0A 1UJQA 3RK8A 4XKMA 1FKWA 1KFJA 1WP6A 2A4AA 1I6NA 1EJUC 3IJ7A 4GQQA 4LQ1A 4AIOA 2D22A 1XLJA 3VA8A 1BSIA 1LCOA 2GGHA 1HL2A 1BYBA 1XPYA 3BE7A 1GYLA 3S1VA 1N55A 1PPIA 2VT0A 3FLUA 2NX1A 1H61A 4LVBA 3UZJA 1KBBA 1XW8A 1RK5A 5DRCA 2B7QA 3CUZA 3NIYA 1KQYA 1U33A 4CN1A 4WKFA 4LVGA 2XIJA 4D6IA 4JX4A 3V18A 3R13A 1VCVA 3LRLA 1TRDA 2FGBA 2ZQ0A 4K39A 4IGSA 3QBUA 1C8VA 1JAKA 4Q8OA 4PCFA 3W7IA 3ITGA 1A5UA 3SEPA 1W2VA 5HXMA 3OGVA 3CWNA 1V6WA 3UA4A 5I3HA 1HVXA 3UNDA 3BJSA 2GOKA 1UD2A 1LQAA 2ACRA 5G2WA 2VWTA 2ZCGA 5DMNA 4AZ5A 3C2FA 4DAFA 4GUJA 2CXGA 1T7LA 4GO9A 4Z2GA 5I3GA 1JRBA 2PP0A 2J6VA 4AYGA 3WF3A 3VE7A 1FCVA 3CHFA 5T26A 4JN7A 3TKFA 1UC4A 2J7EA 2OSYA 3W7CA 3H8AA 3UXLA 5HJXA 1AH0A 3G2GA 3BMXA 4GXPA 3LHYA 1XV8A 2RH9A 4C7GA 1UKQA 4EKJA 1MUWA 2XH7A 3A3HA 4QJ5B 4J27A 1YE6A 2ZUUA 5F4SA 3T8QA 2PC4A 2INFA 3GR7A 1NU5A 2ACQA 3IJLA 2C91A 4B5VA 3K2GA 1I75A 4RLIA 3TSDA 3R5EA 1REQA 1UWUA 5GNZA 5H1WA 1RCOB 1KM0A 3ARZA 5PTDA 2V82A 2OO6A 3CPUA 3QJAA 3URQA 4FNSA 1J5TA 2X30A 1LBLA 1W9PA 6REQA 3GU2A 4FNQA 4GUHA 4LC6A 2G8ZA 3VUPA 2WMHA 1NFPA 2ZTJA 2V2CA 4Y9OA 5CBIA 1XSKA 3E0VA 1NP2A 6CGTA 2E25A 3XIMA 4C1NB 3I6RA 1H41A 1XC6A 4JZ5A 1BYDA 2YGYA 3W53A 4JX5A 2RJHA 3B8WA 2DT0A 4JHOA 3MTWA 2UY5A 1H62A 3WK1A 4J3ZA 1ISZA 3WQPA 4HNUA 5D38A 4HIBA 4HA1A 4W7VA 3LGGA 5FACA 1GJWA 1J0YA 1KV8A 4W4QA 3PZUA 5FF3A 3CZKA 2C1HA 1GHRA 3DHUA 3EXRA 3VK5A 1DXIA 1HX0A 1MDRA 5FJIA 1GQNA 4ZXOA 4F66A 1JQXA 1BTCA 4O12A 3VIHA 5I03A 2WVUA 3LZ3A 5CCZA 1PB0A 1V0KA 3E6EA 1FXQA 2VDIA 5EMUA 3WD1A 2OG9A 2WWCA 5C2XA 1TPUA 4S3CA 3WFAA 5HNRA 4OKDA 4DJEA 4XBSA 1L8PA 3EEZA 1XYZA 3DFNA 3PZVA 4U31A 1ZY9A 3LCIA 1SGJA 1XIJA 3WSUA 3FNDA 2GJRA 4QG9A 1V5XA 5FL0A 1XWYA 3L12A 4KW2A 1BF6A 4ICNA 3OIXA 3FN9A 4H2HA 2QV5A 3G77A 2C8NA 4XVDA 4R3UA 1R3TA