2R9RA

Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel) in association with beta subunit
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Atomic structure of a voltage-dependent K+ channel in a lipid membrane-like environment.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 120
structure length 326
sequence length 326
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2r9rA00
3CASA 2PFHA 1T40A 3R43A 4JTDA 2I16A 1US0A 3M4HA 3Q65A 4FA3A 2IPJA 4IJRA 4XZLX 2INEA 2PDPA 5AZ1A 2IKGA 2PDJA 3GUGA 2ACUA 1ZSXA 3UFYA 2PZNA 4JTQA 1MI3A 3G1RA 4PRRA 3GHRA 1JEZA 2PDIA 4JQ2A 1LWIA 1EL3A 2I17A 4XO7A 4WDWA 2FZBA 4L1WA 1AH4A 4QR6A 4DBWA 4PRTA 2IS7A 4LAZA 4NKCA 2HVNA 5LIKX 3V0SA 1ZGDA 3UZZA 1M9HA 2R24A 1Z3NA 1Z9AA 2DUZA 1XJBA 3DOPA 2PDGA 4JQ4A 3V0UA 2PDUA 1IHIA 5AZ0A 2PDFA 1HW6A 4R9OA 4XK2A 3LEPA 4XZIA 3UWEA 5LIWX 3WBYA 4ICCX 4JIHA 2WZMA 2INZA 3LQLA 4GQGA 4WDUA 3V0TA 2PDKA 4XAPA 3EB3A 2ACSA 1PWLA 2CLPA 3S3GA 1FRBA 3F7JA 3CAVA 3WCZA 4FZIA 3H7UA 2PDMA 1PWMA 4GACA 4DBUA 3GHTA 2R9RA 5LIXX 1S1PA 1R38A 1AZ1A 4YU1A 4XO6A 1QWKA 2PEVA 4JTAA 2PDXA 3H4GA 3NTYA 3R7MA 2DV0A 3V35A 2BGQA 1GVEA 3DN5A 1MRQA 3BCJA 1XF0A 1QRQA 3LD5A 4ZFCA 1PZ1A 2PDYA 4DBSA 4LBSA 4PUUA 1OG6A 2VDGA 3C3UA 4AUBA 4LAUA 1T41A 3R8HA 4QX4A 4YVVA 3UP8A 1UR3M 4QXIA 3KRBA 4EXBA 2PDQA 2F2KA 3N6QA 2FVLA 4XZHA 1Z8AA 1XGDA 4XVEA 3LUTA 3WBXA 3COTA 3UGRA 3ONBA 4DZ5A 2IKHA 2BGSA 3U2CA 1ADSA 1VP5A 3UG8A 4L1XA 4OTKA 4WEVX 4RPQA 1ZQ5A 1ZUAX 3ONCA 2IPFA 1AH0A 2IQDA 4LB3A 2PDBA 5M2FX 3LN3A 4HBKA 4ASTA 3N2TA 1PYFA 2IKJA 5HA7A 2PD5A 3R94A 3WG6A 1IEIA 1Q13A 1YNPA 3O0KA 5HNTA 1AZ2A 2HDJA 1X97A 1A80A 3Q67A 3WBWA 1LQAA 3G5EA 3UZWA 3H7RA 4I5XA 5HNUA 3RX3A 1Q5MA 2IQ0A 4H7CA 5LIUX 2ACRA 2PDCA 2IKIA 4XVDA 4JQ3A 3LENA 2DUXA 1HQTA 2ACQA 3R6IA 5JH1A 1X98A 2HE5A 4H8NA 1AH3A 1YNQA 1AFSA 3CMFA 3UZXA 2WZTA 1RALA 2PDNA 4WGHA 4JQAA 3CV7A 3V36A 2IPWA 4IJCA 1PZ0A 4HMNA 2P5NA 3R8GA 2HV5A 4WRHA 4GCAA 4F40A 2FZ8A 3B3DA 1YE4A 4PUWA 4LBRA 3BURA 2HEJA 3LZ5A 3FJNA 4IGSA 1K8CA 3BV7A 4WDXA 4GA8A 4GQ0A 1RY0A 2A79A 4XZMX 2PDWA 3FX4A 3EAUA 2BP1A 3T42A 4YVPA 3MC5A 3CV6A 3MB9A 2PDLA 4WDTA 3QKZA 2QXWA 3LQGA 1J96A 4JTCA 3RX4A 2PF8A 5KETA 3GHUA 3UZYA 5LIYX 3LBOA 3O3RA 3BUVA 4LB4A 1EKOA 4QBXA 1S1RA 2NVDA 1S2CA 4MHBA 2FZ9A 2IPGA 2PDHA 3M0IA 4GIEA 3LZ3A 4G5DA 3LNMA 3P2VA 3R58A 4YVXA 2FZDA 5DANA 2PD9A 2ALRA 3GHSA 1EXBA 4JIIX 1VBJA 5C7HA 3ERPA 3RX2A 4JTRA 2HVOA 2J8TA 3M64A 4JIRA 1MZRA 5JH2A 2C91A 2AGTA 4GABA 1YE6A 1EF3A 2HE8A 4Q3MA 1RY8A 4EXAA 4Q7BA 3UYIA 1X96A 2FGBA 2F38A 2NVCA 4PR4A 3D3FA 4PMJA 4JQ1A 3CAQA 4FAMA 1SM9A 4YS1A 4XZNX 3EB4A 1C9WA 4FALA 3VXGA 1Z89A 2ISFA 1S2AA
chains in the Genus database with same CATH superfamily
3R43A 1TYGA 3HV8A 4GFSA 1ZJBA 5I78A 4NJHA 3LM3A 1M7OA 2ZXQA 3KWXA 4YTQA 2ZUWA 3KL0A 3GBDA 4U3CA 4DELA 5F2LA 1TRDA 3SCTA 1HP5A 2A1YA 3VNMA 1FWCC 5I3IA 4PE8A 4TOQA 1HKMA 2CBVA 1JZ2A 5JQ9A 1LF1A 3UFYA 3K8LA 2PZNA 4MADA 3W25A 3WFLA 3QVQA 4Q22A 5C2CA 3GHRA 2ASHA 3R0KA 4C6LA 5DBUA 1K4HA 1VPQA 4H01A 5LNRA 2VJXA 4QDMA 3WDHA 5B80A 3I10A 2CW6A 3KCLA 4LAZA 2DY3A 1ICSA 5CSYA 3XINA 1Q4WA 4GIYA 2ZFAA 1JD9A 5M3WA 5CLWA 3OHIA 4S3KA 4J28A 1UCWA 3BCDA 4G6CA 4B92A 5LNVA 1YKWA 1AG1O 1XLAA 5CC3A 4C7GA 2OSXA 4XZIA 3OW1A 3TU9A 4D71A 3SEPA 3ABOA 1LG2A 2QDDA 3RLHA 5H8UA 2NQZA 2WZMA 4ORMA 2AL2B 2ZADA 4Q4PA 3W2MA 5FESA 4D8AA 3V0TA 1TWWA 2XYLA 4DWDA 2ZTKA 1EHNA 1SFTA 2RDTA 4P8XA 2CLPA 1AJ0A 4AZ7A 3LMZA 4HQVA 5E5CA 4I6KA 1OD8A 1DHKA 4ZFMA 1IWBA 1F7BA 3ARPA 5BOOA 2E4TA 1BGAA 3UXLA 1CWYA 5A8OA 1B2YA 4WR3A 1MXDA 1LROA 3TKFA 4HT3A 1MYRA 1EX5A 1JPHA 2RUSA 4ML4A 3LERA 1XLIA 3M7SA 1VRDA 3OG2A 3K1DA 4N02A 3TWAA 4JTUA 1E3XA 2BY1A 1DTNA 4QJ1A 4B5UA 5I3HA 5BROA 3F4WA 1BGGA 2PDYA 5EKYA 1C91A 1H2JA 3QLLA 1XLEA 1AW1A 5EFDA 4D6GA 1JPIA 1J0YA 3GIYA 3MKVA 2JEPA 2WCSA 3P5ZA 2J7FA 3URQA 3B9AA 1FFRA 1W91A 2WVUA 4M29A 3W1AA 3AYRA 4PSPA 3VABA 3CIVA 4B5TA 1AODA 3M41A 3BLEA 3NR0A 2YR1A 2RH9A 1MWOA 5I3GA 1UD2A 1JUBA 2YBTA 4ECLA 4LQ1A 3PBWA 5G5IA 3N6HA 3B8WA 2Y4SA 3GH7A 1D9EA 3W4RA 4Z2HA 5FEPA 5HULA 1QO5A 2EPNA 2Z1VA 4LY4A 3UJFA 2J62A 1IWAA 1JUKA 5M2FX 2VZVA 1P43A 3LPFA 3VGDA 4AISA 2PD5A 1B0IA 2J25A 3MW7A 1LRNA 2HDJA 3KHDA 3I7QA 5K9CA 2Y63A 3CT2A 4I5RA 3OOQA 2YLAA 4CNPA 3NQMA 4IUOA 3VX0A 2OX1A 3SSZA 4IX2A 2Z6IA 3BMWA 4XAYA 5HNUA 3ZVHA 3AUJA 3TJLA 4UB9A 4ATWA 1PHQA 2Y24A 3OZOA 1CB7B 2WLYA 1WB0A 4F79A 1E9IA 3OGRA 3PTKA 3BAXA 3OPSA 1JIBA 1RCXB 3HPFA 3ITTA 3WF2A 1REQA 4ZE4A 4N42A 5BRPA 4LYQA 5HXMA 1GQIA 4DYEA 1Q2SA 1Z69A 4HK6A 3ZFHA 1S5NA 1GKRA 2YL8A 2BZNA 2XVLA 4IMCA 3DHPA 1A5BA 4I8YA 3MUXA 2QMJA 4HNNA 3DERA 3C56A 4YYCA 2YDSA 4C6OA 2I1OA 4FNTA 5BOEA 1XX1A 3HGRA 2ZZ6A 1R3VA 1EIXA 4Y9PA 2WCGA 2YJQA 1TPEA 4A29A 4NYUA 4B5NA 3RIKA 4B16A 3KX6A 4NILA 2WHKA 3NQAA 1U1JA 1Q7ZA 3W7HA 3LYEA 4IMEA 3RM4A 4F40A 3BOXA 3EOUA 1YE4A 3T81A 1R3QA 1W2PA 4L1GA 1NJJA 4QE1A 3BURA 2HEJA 4IGSA 1KCLA 3ZLHA 4KRZA 4KCVA 2V3FA 4W9TA 2YCJA 1UZ1A 1VCVA 3GU9A 4PCNA 2Y5EA 3T2QA 2D0FA 1XHGA 1XRTA 3HJEA 4YVPA 1EGZA 3EDKA 1VS1A 3SFKA 4OKDA 2UY3A 2OODA 1O12A 4C6PA 3RYSA 7TAAA 1X1OA 3EXRA 1UP2A 3L5AA 2R1LA 3ITVA 4XKYA 4GKTA 3ZYZA 1Z32X 3G1XA 2NVDA 2ZWYA 2IPGA 3C6CA 2J8FA 1KFKA 1E6XM 1JZ3A 3CXOA 3P2VA 1VYSX 1QUMA 1I1WA 4O50A 4HNCA 4LCSA 1JI2A 5A8NA 3DKLA 4PFHA 4A3YA 4XIAA 4LX4A 3HJZA 3DFNA 3M64A 3RFAA 5CEWA 1ZBCA 4RCXA 1ME9A 4H3DA 1Q6DA 3P8JA 2V5DA 5DELA 4Q3MA 3TONA 3UW6A 4E38A 3S0CA 2O7SA 3VKCA 1GPFA 1NM9A 2QUTA 4F48A 5I07A 4Q8QA 2WBGA 4O15A 4Q33A 3T0BA 1FUYA 3AS0A 4JIQA 3G22A 4YS1A 2PWDA 1V0NA 3LHYA 2B81A 4NG3A 6A3HA 1PYMA 1XXXA 4Z08A 1SZRA 1OHLA 3S6TA 3UD6A 4QP0A 1QI4A 2NT1A 1JI1A 3T9PA 1BYCA 3DCPA 1LT7A 4GJIA 3HZ3A 1Q65A 1DIDA 4XAZA 1MXSA 3R10A 4XZLX 3WLLA 3CPGA 3BLPX 1AW2A 3NZ1A 3QYQA 1CTNA 3QV6A 1E6ZA 2O7QA 3F5KA 5GJPA 3PAOA 3DUGA 2YXXA 2HXTA 3T8QA 4M6VA 2F9RA 3T0DA 2BV9A 3EEZA 4XBSA 3BAYA 4MWAD 3RPTA 3UPWA 1QK2A 3S9IA 1W9PA 3NQGA 2QF7A 1F74A 5EU9A 2W4XA 1WBHA 5GJNA 1HJXA 3GM8A 4PUJA 1DQXA 4AD5A 3OODA 2OEMA 3QR1A 2BXYA 5DRCA 4B15A 3AMGA 1FX6A 2QGYA 1JGMA 1HF6A 1IHIA 1OEPA 2GOKA 1HW6A 1QATA 5C7VA 4R9OA 4F2TA 2ZTJA 3BZGA 1T8QA 5LIWX 3TIMA 3EPMA 3AMLA 1XV8A 3VCCA 2ZWZA 3VNZA 2JGYA 3TJIA 4UTIA 5MHBA 1XIIA 1RJPA 4FP1A 2PDKA 1KB3A 3AHTA 3T8LA 2ABAA 1EPXA 5AVNA 5LYRA 1TR9A 3WQPA 5AB3A 1B3XA 2FH8A 3THQA 1S1PA 1B5TA 1QT1A 4UTLA 3RPDA 2ZICA 2O0TA 2WSKA 4IG2B 2C0AA 4E0CA 2HNEA 1EGMA 4N6FA 3WEOA 3H4GA 1TE1A 2XIOA 3FOKA 3KBVA 3F4DA 1ICQA 3IJDA 5LNWA 1TTJA 5A6TC 3VX1A 4PCFA 4NHVA 1CENA 3N9SA 1F2JA 3WUBA 1OC5A 4ZGYA 3SCWA 1NU5A 3NUKA 1KWKA 5ABGA 3M6YA 3PPHA 3HG5A 3GR7A 2G3MA 2VDHA 3HN3A 5L9FA 5F2GA 1VGAA 4CVUA 4EXBA 3A23A 5EMLA 4DN1A 4KWUA 1EJ7L 2NW0A 1A3XA 4XVEA 1VRXA 1BKHA 3SCRA 3U7VA 1EX1A 2VL4A 1QOXA 4OUEA 4EPBC 5C9UA 1R46A 4ZA0A 1MEWA 3N2CA 4I3GA 4DIAA 2DEPA 2VD9A 3KM8A 2R14A 3O6CA 4W7UA 2YDRA 2PWHA 1K70A 3GC5A 1E0WA 3CHVA 4UFLA 3UR2A 3RJXA 1VEOA 2EJAA 3SW6A 2XFWA 2VQUA 3OIXA 5LA1A 3MKCA 1NAL1 4UTWC 4LTSA 2C15A 4ZL1A 1K8ZA 1VPXA 2F6KA 1PYFA 1JCYA 3WK3A 5HQEA 4WJXA 1PIGA 3TC3A 4PEKA 5E9AA 2VR4A 3G6MA 2PS2A 3MI2A 1A5SA 3F4CA 4JTLA 2DSKA 3IIZA 2HTMA 4PBFA 2GGHA 4BY3A 2WO5A 5MF5A 4AEFA 3CS2A 3RX3A 3MHGA 2ISVA 4AZGA 1WAUA 4XZBA 1Q6GA 1BFNA 4LBUA 3FIGA 4CQDA 3CWNA 1TPB1 4JFSA 3IEBA 3WDPP 1X98A 6XIAA 4Q8NA 1WZAA 1FWTA 3TTSA 3CMFA 1ITQA 3W27A 2X41A 1XICA 2W0UA 4HMCA 2QIWA 4KPLA 3CUFA 3OG3A 3VCNA 4IMDA 2IPWA 2HK0A 2V3GA 4W89A 1B3ZA 2QEZA 1KV5A 1AK5A 1BAGA 1E1CB 2OMAA 3L7RA 1DWAM 2ZZ2A 2ZXAA 4F2BA 3E3HA 3ZT5A 3GDKA 4CU8A 2UY2A 5DBTA 1H1NA 5REQB 1DXFA 5A6KA 1QHOA 5J04A 3WLOA 3B0PA 4WK9A 1GOMA 3FJNA 5PTDA 3G0UA 3N4FA 1RY0A 5KZDA 4IP7A 3SBFA 3W1XA 3PPFA 4Z1BA 1W2VA 2G97A 4Q8WA 4H9UA 1UD8A 4KW2A 2D2HA 3MKKA 2FIQA 3OBKA 5FF2A 4Q4OA 3NM3A 4NL1A 2JKPA 4WDTA 3QKZA 1J6OA 2NX1A 4NF7A 2Z0IA 3DDMA 1W32A 4NXKA 4J3UA 3ANUA 3O3RA 4HU4A 3WNPA 4LB4A 3AQUA 3WH5A 3PJUA 4FOUA 1YTDA 3ALFA 1TTQA 4HMEA 1GYNA 4H2CA 4XZ9A 4QDWA 3TYDA 3WLSA 3OVQA 1EEPA 3GDBA 1R7OA 2FZDA 2GUYA 4DJEC 5HNNA 2BHZA 1H7OA 4MOZA 4R53A 3PM6A 1OF6A 1TCDA 2GL5A 2VD8A 4QHRA 3PTDA 1OFEA 4HU0A 3ZR5A 4JDBA 3EDEA 4C6IA 4QQUA 3VOCA 4UNIA 3H6OA 3SUVA 1RY8A 1VYRA 4AY8A 3W38A 4Q7BA 4UQBA 2ZVRA 3W86A 4GY1A 3D3FA 1GVOA 5T9CE 4FAMA 4DO6A 3SCVA 3U2OA 3MS8A 3DZ1A 5L6UA 4LU0A 5EMYA 5CBIA 3L4XA 4EXQA 4K8EA 4ADUA 3VXGA 1S2AA 2YSWA 5U4NA 1PL9A 2VENA 3TYUA 4PTDA 5CBJA 5AY7A 1CNVA 2I5GA 1NWUA 4JXCA 4TR9A 4XWUA 6CGTA 3W74A 1XDLA 4I5UA 3IRSA 4ICMA 1KFEA 3B9OA 1Q4NX 2BOFX 2PDPA 5E0FA 3UQNA 3CZKA 3NQBA 2J8GA 1F3TA 4GUIA 5DT7A 4P61A 2BOGX 1ZSXA 3H23A 2ZCGA 2ZRZA 2OG9A 1EP3A 1W3TA 3QPZA 1TTIA 1QPQA 3VD4A 4MB3A 4JEJA 3M0MA 1HJUA 1LWHA 2PWEA 1BYBA 1XLJA 1HL9A 4DBWA 2X2YA 1PAMA 3GZ3A 4O8RA 3S5YA 3W1NA 4PEEA 4WUIA 5HJXA 1EC7A 1NOFA 3LHVA 3VE7A 3O7UA 2J27A 3HQPA 1HKVA 3FGCB 3IANA 4Z1AA 5DQPA 4AYSA 4U31A 4E4UA 5D9NA 4CCZA 4E3VA 3W7MA 4MJ2A 1EQPA 4JIHA 4PODA 3TP4A 2E8ZA 1TWIA 3AIQA 4WY0F 1XLKA 1TE6A 3C0JA 2WC4A 4QG8A 4UOZA 3CAVA 3APGA 1WZKA 3U0HA 1PXGA 1EZ2A 3PTMA 4CD8A 1UYQA 5HPCA 2V38A 5CAHA 3D47A 2PODA 2VX7A 5H1WA 1B57A 3PP7A 4RXFA 4YU1A 3DBPA 1KXVA 5G1TA 1L8NA 3ZR4A 1MZHA 3SUSA 3WDQA 1IZKA 4Q4MA 4AD3A 4MUPA 4AHPA 2G3JA 3PFRA 2FGLA 1UP3A 1XH1A 4ZQPA 1P4CA 4DYKA 1QRQA 1UD5A 3ANYA 3V75A 3V16A 3UPBA 1P6CA 2GSJA 2P1FA 1JUEA 5CSUA 1FP8A 4AUBA 4LAUA 4UC5A 4RZ5A 2WMIA 1A4MA 2NQHA 3RGTA 1CX9A 4I7WA 3WF3A 2QT3A 1BEUA 3QLDA 4TU1A 3GXNA 3SR7A 2XWDA 4IL2A 3AAMA 4UTHA 1GYMA 2JGQA 3BICA 1EB3A 4O1CA 3L4ZA 1UZHA 1XLDA 4DUOA 1BPLB 1GG0A 3EOSA 4HK5A 1S5WA 3TSMA 4U3AA 3ZVHB 4IICA 3UGVA 3S5NA 2V3EA 3MSRA 3ONCA 1XIJA 3SY5A 1L6SA 1YPXA 5C9WA 4NYYA 2Z2AA 1EDTA 4EWND 5CZKA 3FJLA 3R94A 2QCHA 3KBJA 4CD7A 4TV5A 3VE9A 2H9AA 3CYJA 3KEHA 3SURA 8XIMA 1PCKA 1TJ2A 4C7FA 1TCMA 3TSBA 4AZCB 3WY1A 1XR2A 5BMWA 1KM0A 2IKIA 4AVFA 1OY0A 3BTNA 2RDXA 3LV5A 2YL6A 3ELFA 3M0KA 1A5KC 2BVTA 2V3DA 5CSRA 2J4GA 2GYIA 4L65A 4PMQA 3QMSA 1XG3A 2PBOA 1ML1A 4OV4A 2VOTA 4ZSUA 4M6QA 3D6NA 3GK0A 7REQB 4J3VA 5AHMA 3PUEA 3GVRA 1NP2A 2AGKA 2HS8A 4G7EA 3O6DA 2Q3OA 1JR1A 1LQ2A 1KBLA 4TVCA 4YCOA 4WZHA 1NWTA 3CV2A 4AIEA 4EANA 2OQYA 3AMKA 1KCKA 4KFPA 3V5OA 1OABA 4XZMX 4GVIA 4TUFA 3CZEA 3NEVA 1GVIA 1U83A 2FTWA 3GVVA 1P5BA 5AOUA 1CLXA 3L4VA 3APTA 1E0VA 2FJUB 4Y90A 1CYGA 1DXEA 1T99A 4NZFA 3HV9A 3G77A 4CN4A 4D8LA 1RQEA 1VFFA 4FPSA 1XCFA 3QW3A 3H26A 3VKDA 1F3XA 2QCLA 2V2DA 1S39A 4UFIA 5FSDC 2EPMX 1GVSA 3A21A 2A4AA 4A21A 3R58A 5AECA 7PTDA 3IJ9A 5FJJA 4I7UA 4HSNA 1PEZA 1EZWA 3TC7A 1JAKA 3AZSA 3BAJA 4F0MA 5KZEA 5H91A 1T5AA 1XSIA 1UQYA 1FXQA 1J6PA 4C6MA 1H7WA 4OJYA 3OA5A 3PHAA 4HHHA 2PE4A 4LAMA 4D6JA 4UNKA 1E6PA 3DESA 3T44A 3KHJA 4R7WA 2X7WA 2ZQ0A 1TREA 3WJYA 3W1LA 4OUIA 3VIHA 2ZC8A 3V4BA 5F1VA 1SM9A 2EGZA 1UP0A 3OB8A 3LTPA 5DX7A 5AFDA 1M41A 1KCXA 1X6UA 2J6XA 1JCMP 2J78A 3CHCA 3CMGA 2XWEA 5CZTA 1H41A 1T40A 3YPIA 1FHLA 1E6SM 2WPGA 2X1UA 1FWBC 2OELA 3ZLFA 2PMQA 1UWRA 1R8LA 5BW6A 5IFTA 3W7KA 1TJRA 4N9CA 3R25A 3M07A 3U5UA 4LV9A 3A5VA 3DENA 3E6EA 2ACUA 3BSHA 1E4IA 4O10A 3V18A 3BANA 1W3NA 1S5VA 1NWRA 2AAMA 3F4VA 4W84A 8TIMA 3EYPA 1S2TA 1UOKA 5CGQA 1H61A 5I24A 2IS7A 4UCGA 5A8MA 3BGGA 3G1YA 2D3LA 3WH7A 4ERGA 4QG6A 1D3CA 1G6CA 1HKKA 1J01A 4NNCA 2W66A 3AIEA 3RPMA 3L21A 3WLJA 5HUOA 1LORA 1Z3NA 1O5RA 3QZAA 4C5ZA 2HROA 3E2RA 4HKPA 5BXPA 4S3BA 1S2VA 1OX4B 1QWGA 4U10A 3RAOA 1L6WA 1FWFC 1J0KA 1V51A 4TX9A 3FSUA 4KF1A 3KWSA 5I3KA 1F4HA 1SGJA 4LUTA 2V5LA 2VO5A 1CCWB 4GQGA 2J7BA 3UG3A 4CCCA 3MMTA 1TPFA 3EB3A 4KEUA 4W88A 1W9VA 5CBBA 4IPIA 2OQLA 2Y89A 2BODX 2O56A 4O57A 4EK7A 3ABZA 3QR3A 4IXXA 5D2YA 1C8YA 1UD3A 3HMCA 3BLFA 3AS2A 2REQA 1OSEA 3H7VA 3LSCA 1AQHA 3MYOA 5A2AA 2PEVA 2QHAA 3C5QA 4TVDA 4FMVA 4PMYA 2PLCA 4K36A 2TYSA 1DJHA 2C18A 3AU6A 2E67A 2WMKA 3LLXA 3VIJA 1MRQA 1KBKA 2W62A 4IMAA 4Q4KA 4MJZA 5K3VA 4LBSA 3SCOA 4PUUA 1F5ZA 4RE2A 2BWGA 4DWSA 3FVMA 3BMXA 1UR8A 3IIXA 6TIMA 1K6AA 3KRBA 4IL0A 1YQ2A 3S9ZA 7ENLA 3W3OA 2BDQA 1Z8AA 1FWNA 1SZGA 4NX5A 5CLTA 2F6XA 1H1YA 3OLDA 2J24A 3W82A 4Z0SA 2NUXA 4C91A 3TQKA 1ONEA 1KTNA 1MNZA 1DWIM 1VFMA 1YBQA 1DWHM 5D8ZA 1PX4A 4AB4A 2KZHA 3WQ6A 4M82A 4NU7A 1DIKA 5C70A 4S3AA 3B0VC 1U2YA 3UCDA 2V68A 4X9YA 3UWZA 4QIUA 5CC7A 4MJMA 3QSRA 1JDEA 4N9DA 2XM2A 1XLFA 3ARWA 4HBKA 3WD3A 4XKMA 3IIVA 3N2TA 3MP5A 3VZZA 1Q13A 2Z1SA 2NT0A 3VGGA 1ECQA 4ERAA 4J3SA 5I6SA 1GOXA 2J6VA 4F0SA 2WNNA 2C19A 3M5ZA 4BQ5A 4HN4A 3ABQA 1YADA 3ES7A 5LXXA 3FN9A 4M81A 1DPMA 3M0YA 2VP8A 5HUPA 4HNTA 1NWSA 4P7OA 5IBXA 2XG9A 2AMGA 2D3NA 5CQ1A 3W7GA 3U5YA 5DMLA 2PGEA 1FDYA 2V5KA 4GI6A 2VQTA 4CCDA 2VC5A 1EQCA 1JFHA 1I2OA 3GDRA 2BG5A 3H4XA 2OKTA 4FHAA 1M3UA 2UY4A 9XIAA 1A5UA 4ZXOA 2ZX7A 3W6YA 3BMVA 1BRLB 3VK5A 3GU2A 3EX3A 1RK5A 1EYWA 4AVOA 5AHIA 4WRHA 1W56A 3WO8A 4H04A 5BU9A 3TN4A 2VR2A 4UQAA 2V2HA 4C6BA 1FCVA 5D2VA 4DYJA 4ZQNA 4GD0A 1K8CA 2CIPA 1UR1A 5XIMA 2WWDA 1MFUA 4H19A 3LM7A 3FX4A 1YPFA 2PTDA 4HVXA 4D9PA 3VKJA 1W1A1 2BS9A 2GQ3A 3TQPA 3DG3A 3E38A 4FK9A 3QYSA 2QNEA 2A0NA 1DJIA 3A5FA 1A5LC 2NZLA 5CC6A 3IAQA 3RM9A 1RXOB 1AA1B 1V7YA 1N82A 1H50A 1VIZA 3P74A 3P7YA 5FJPA 1FWJC 3ICJA 1W54A 1YPIA 1QNRA 4AXNA 2XPKA 3W7CA 4GO9A 3GHSA 4XX6A 5IXEA 1I2NA 1HFBA 2A3BA 3ERPA 5F2IA 3S42A 4JTRA 2J8TA 1XYLA 1DWJM 3BG3A 4J4KA 4O52A 2AGTA 3CUZA 1JVNA 3WH9A 2E1WA 4NY2A 1GPWA 2PAJA 3MCNA 4MM1A 4EWJA 5FSEC 2C79A 3DU0A 4H83A 4LVAA 2HSAA 2NVCA 2XHYA 1NSJA 3CAQA 3EMQA 2POZA 1ZJIA 1DTUA 1PZ3A 1LG1A 3FEMA 5A1AA 4RPPA 1K9EA 3M43A 4D2JA 1F07A 1UR9A 2QPSA 5CPSA 1GHRA 4UNLA 1UBPC 2CLIA 2OJPA 3A13A 3PUOA 3CBWA 4NZ4A 3TLQA 2DZWA 1LP6A 1JYXA 5AC6A 1PSCA 2EKCA 1EH9A 2C7FA 2WVVA 5DY2A 4AW7A 3M0ZA 1XLHA 3PJTA 3VNYA 1LWIA 2I17A 3KS5A 5I06A 1O66A 3W7LA 1X7IA 1FP9A 4EPEC 3TZFA 1QPOA 4PL1A 5TF0A 1J4EA 3CAKA 3EWWA 4EPDC 3V1HA 1XJBA 1EJVC 3IGUA 2HBVA 2GVEA 2X1IA 4A05A 5D9OA 5HMSA 3TDFA 2OLAA 3M0JA 4UFHA 4YHEA 2A5HA 5MKGB 3LTYA 3NVTA 3IJIA 4DBDA 3QPYA 3A4AA 1MQPA 1PKMA 3ZS4A 4XD6A 3G3DA 3TCSA 1GYLA 4AD2A 4WDUA 2GJXA 1AJZA 4UR9A 3KVMA 2B7OA 1I9CB 2WYSA 1PWLA 2V0TA 3ZVIA 1X1ZA 3HGSA 3DECA 1SO4A 4RE4A 4RNIA 1TX0A 4NZ1A 3E02A 3RCMA 1EUNA 2ZXBA 3JZUA 4GWEA 3BARA 2DVTA 3R1ZA 4B3LA 4DRSA 4AWTA 1AW5A 4JX5A 1LJYA 2JE8A 3OZYA 2WMIB 2G41A 4RW5A 2DH3A 1XL9A 2YYUA 3SGZA 1W5MA 1K8XA 3FSTA 3KP1A 4M1BA 2G96A 5BRQA 3QFWA 3QOKA 1E4MM 2Z26A 3I4KA 2B4GA 4ZQOA 1LDCA 3TN3A 4LALA 4IQLA 5CG0A 4GZJA 3AU2A 3CHDA 2O9PA 4PL2A 3FAXA 3GXFA 1NQKA 1W3JA 2BHYA 4CD6A 3C3UA 2VDGA 1DHPA 2O92A 4UTFA 3EWYA 3BQ6A 2FMNA 2OPJA 2QV4A 3WKZA 3RMEA 4Q8TA 3RUBL 4GI9A 1ITCA 3TC6A 2PGWA 1HG3A 3MUCA 1PO9A 5LHFA 4GH1A 3IGHX 2QCEA 3I6EA 2F2KA 4LNYA 2X0SA 1VFUA 1KTBA 4C6JA 2NQLA 3CM4A 4I8DA 3LUTA 2GUBA 3UA4A 1ISZA 3WBXA 3POCA 4LUYA 2GDQA 4BF7A 3S2JA 3WNMA 2BGSA 2G5WA 4KWSA 3WEMA 3E0WA 2Y1HA 3FY1A 4AXKA 5FF7A 1ZUAX 2NQ9A 3TYEA 3FYPA 3TK7A 4LF1A 4K39A 3SY8A 3W72A 1Q6CA 2VGGA 6REQB 3LN3A 2WK2A 3C52A 4W8BA 5HA7A 1ZBWA 4M6UA 3GX9A 2PCEA 3MP4A 2A6NA 4XZWA 1UPPA 2GPTA 3WLPA 2NXGA 2ESCA 7ODCA 3ZWSA 4KEVA 5CZ0A 2X40A 1VBRA 4YPJA 3LI0A 4AD4A 3O6YX 3TW6A 1SJBA 2QR6A 2BFGA 3A24A 1UKQA 5DMYA 4XVDA 1IEQA 3ITYA 4L6OA 4OQVA 1XYFA 1UIOA 3QPEA 3A12A 3NL3A 1P0EA 4XUGA 1LWJA 4WXZA 1TV8A 4RL3A 3QTPA 1O5XA 2RAGA 1W5QA 2C71A 2VC9A 2HPMA 3XISA 1AFSA 2DIEA 1KRCC 4PMVA 4GYPA 4O13A 2IW0A 1V8EA 3BG9A 2O4QA 1XH0A 4P8VA 2NV2A 3OVRA 4LUSB 3WFZA 2WHJA 2J79A 2B0MA 4JGDA 2VURA 2RKXA 3FXYA 3S83A 1G69A 3NYZA 5HK4A 4F4RA 3CUXA 1VHNA 2GDVA 5LNUA 4RNHA 5ABTA 5BYWA 1J93A 2GGGA 1FFQA 4ACZB 2G4JA 4HJFA 1P1XA 3SRHA 2E68A 1CXHA 2XUCA 4JHZA 2HPIA 1FCQA 5C54A 2V82A 3CPRA 1ZPTA 3GRIA 1EXPA 4OU1A 5IM51 3TH6A 1HTIA 3L2LA 3VINA 3TFXA 4HNLA 4U5KA 2DSZA 2PDLA 1TTPA 4GKLA 4GRSA 4IPLA 3LQGA 3NCOA 3QC3A 1OIMA 1ISVA 2XH0A 3D0CA 2CETA 2ZUNA 2WV8A 1OWQA 2R1NA 4JPGA 3P60A 3B9EA 3KL5A 3M0IA 2Y85A 5D8WA 3BW3A 1E9LA 1TQJA 4QRNA 4MNKA 1H0GA 4L64A 4L6DA 2CLLA 1MRAA 2CYGA 3G0SA 3T4CA 1JD7A 1E4NA 2XSBA 3E2QA 2QCMA 3AI0A 3PPGA 1F6KA 2CXGA 3P5YA 5D2XA 3GNRA 1U5JA 4UXDA 2TRSA 3TV8A 3FJ4A 3R11A 3BOLA 3VGEA 1YEYA 3RRAA 4IF2A 4Z2JA 3SRKA 1X96A 1AQMA 1K03A 1QHPA 2YOCA 3CQKA 3O2LA 1XIDA 4MWAE 4PMJA 3EX2A 3T2PA 3EB4A 3CUGA 3KTSA 4RK8A 4BWLA 1HKIA 3MCMA 2ISFA 2AL2A 1BKSA 4GYKA 3GTFA 1JCTA 3UYCA 4FA3A 1ICPA 4IJRA 1NDYA 3VM7A 3N6JA 2ZUUA 2CERA 5AZ1A 1RD5A 3WYZA 1QDSA 5FCZA 3W01A 5T8GA 2XSXA 2IKGA 2WM0A 3W00A 2DZVA 2YA0A 3HF3A 1E9ZB 2WBKA 4WLCA 2NV9A 4WOQA 2GSHA 4PRRA 2PDIA 3P93A 4GBDA 2CLKA 3FCPA 2I9EA 4WX2A 2VFEA 5HQLA 4QR6A 3PB2A 4IPNB 2DJXA 2WMHA 3VIMA 2VX5A 3NPUA 3V0SA 2VRJA 3E0FA 1WKDA 2XGZA 4O1BA 5G1YA 8A3HA 1A5OC 2PWFA 1E0TA 2Z25A 4EKJA 3T09A 3WNLA 2NLIA 2J88A 4J40A 2ZE0A 3TR2A 1B31A 3V5FA 5D32A 2Z7KA 1ZFJA 4YMZA 6TAAA 3DFOA 3VMOA 3A22A 1ZJHA 4GZEA 2PDMA 3HU7A 3EBVA 2FYMA 3S2NA 4W4QA 1IE7C 1DJNA 1XW8A 3W1PA 1TG7A 5HR6A 5A6AA 3ITCA 2PLJA 1V0MA 5D05A 3GR4A 3VTRA 2G50A 1PBGA 3IJQA 5A94A 1QNSA 2ZDSA 1UJPA 3AHVA 1T8XA 4JL2A 2CU0A 4G9PA 2BGQA 3NFUA 3C3NA 2JK2A 3MY9A 3SB0A 1JDCA 5DLCA 3PG8A 4ZFCA 4PCPA 3QTGA 3DFTA 3B8IA 1Q6EA 3AROA 3DBNA 1W1B1 1V03A 4DZIA 1CGYA 1T41A 5C55A 3VU2A 2E5BA 1DV7A 1W1ZA 3OJGA 1AL7A 1SUXA 2CLHA 3AHYA 4MFEA 4H1ZA 1JYNA 2DQXA 4GK8A 5G1MA 2PLMA 5I7GA 3WDIA 3WNOA 2BX7A 2O9TA 1RV8A 1JRBA 3RLGA 2YDQA 4AC1X 3CUHA 2A7PA 1HVXA 3KBNA 3H55A 2R91A 3NWRA 5IRPA 3GKFA 4XTIA 2J75A 1OZMA 2YIHA 3AJXA 1JCLA 3H2AA 4QJ5B 4MKNA 3UBPC 1FWIC 5H8MA 2DORA 5HBFA 5KEZA 1CEOA 4QSFA 4A2SA 2QULA 3TSDA 4PUKA 2GGEA 2GJRA 1IT0A 3VKBA 1MUCA 2TPSA 3S2CA 2IKJA 2UZ9A 5D30A 3K1GA 2FVMA 3SN0A 1TV5A 5HNTA 1ME8A 5FL1A 5AHEA 3TJ4A 1PTGA 1VB9A 4CN6A 3LLFA 3VC5A 2QV5A 2VCAA 1BVWA 3GXPA 2ZRVA 3SRFA 4C6CA 2P76A 4QGCA 1VEMA 4N6EA 4HB7A 1KGWA 2VTFA 2Q8LA 1Q6OA 3QZ6A 2FH6A 5E1QA 1LT8A 3SJNA 1Q6QA 2GJPA 4ZZ9A 4GGBA 3UPMA 1NFBA 3BC9A 3H21A 2VWSA 3LI1A 3R6IA 4FIQA 4FOJA 2VUNA 3UZXA 1E4LA 3SUUA 9RUBA 4GIRA 4S38A 4WGHA 3HG4A 1IT7A 2Y70A 3GH4A 1FH7A 4TMCA 4RDVA 4TX6A 1H5VA 5G4WA 3AS1A 4G56A 3V5CA 3W75A 5C0QA 1RHCA 2CKRA 3PBUA 1SYTA 4WXYA 4RUBA 1UKSA 2GWNA 3LHZA 3AXXA 3H2CA 3TA9A 1V02A 2V63A 1U1UA 2A3LA 3N19B 4DF2A 1WOAA 5CGTA 2WSQA 3KZSA 2ZRXA 4PUWA 3TTYA 2ZUMA 1HX0A 4JKKA 5HOSA 2WQPA 4UFMA 3BV7A 4BKNA 4J3XA 3BSMA 3PZOA 1RH9A 4HCHA 1GEHA 5EGRA 2XTKA 2ZRWA 1UR0A 1WDSA 3STCA 2L5HA 3K4DA 1RLCL 4UQEA 2MNRA 4HA0A 1QI5A 4UFJA 2AKZA 4QCFA 2Z27A 4C90A 1BF6A 1Q7QA 3OVPA 1XH2A 3VIKA 3GAYA 3NG3A 4JTCA 4JTFA 2PF8A 3GHUA 2ON3A 4CQ9A 1BTMA 3U2ZA 2XIJA 4KWVA 1QCWA 3WK2A 3TOYA 3IUHA 4JIPA 4P5UA 4MHBA 2Y2WA 3ZT7A 1QR7A 4K8GA 3N4AA 4BWLC 3C0QA 3CAWA 4LYPA 4ZMGA 1PDZA 3LPGA 3CIXA 4IP5A 2PD9A 3THAA 4LUJA 2OZ3A 3A4JA 1RJQA 2GSEA 2X30A 4KFOA 2MANA 2YL9A 4X3ZA 5FF0A 4RZ6A 1XIGA 3N15A 4S3JA 3TWBA 1FCBA 2HVOA 1EHAA 8CGTA 4RZ4A 2D1ZA 1JPMA 1MW3A 1JCJA 2PP0A 3WD2A 4B5XA 1OK4A 5XIAA 1IZCA 2P50A 2CKSA 2FJKA 2RJHA 4JQ1A 2QVHA 3I65A 4H6QA 4KEMA 4JEQA 4X2RA 3HQNA 5A6JA 1IXPA 1JZ7A 3GWQA 2GGJA 3W7DA 4AQLA 3CASA 4Z2GA 2CWXA 2RGMA 3OZPA 2G8ZA 3T6CA 1B3OA 4NAFB 3WBEA 1E71M 4RV8A 2AOSA 3R4IA 3MT1A 2XIMA 1BD0A 4KBXA 2WQDA 3WMSA 4PCSA 2FVKA 3URNA 2EPHA 2TAAA 4AX6A 3U2EA 4IG2A 4HOWA 3AICA 3FK4A 5HJLA 1CGWA 2C3ZA 1TIWA 2D0GA 2XDFA 3O07A 1W3LA 4WSJA 2GJXB 4KIEA 2PGRA 3OP2A 4I6VA 4DXVA 4WHBA 3VD5A 1Y5VA 3Q2DA 5T26A 4W5UA 3B8VA 1GOQA 2Y6ZA 4JNYA 3KE0A 2YXGA 1H63A 1WO2A 4XD4A 1QHZA 1VENA 3S8HA 4HZ7A 4P2VA 4EAYA 3HGJA 2Q6ZA 4L80A 1I0DA 4JQ4A 3DKJA 1JPKA 1JDAA 4EPKA 3WJSA 5EMKA 3R0DA 3NZQA 3W6MA 1H7XA 1E51A 2BGNE 3KBMA 5TD4A 3N4EA 3ARYA 2NUWA 5A2CA 3EDJA 1UA3A 3CQHA 4BQ3A 2ZZ7A 3BV4A 4M19A 3GD6A 1SZFA 3O15A 5K2ZA 2J77A 2VFIA 5FA5A 2ACSA 1M6JA 1QNOA 2JF6A 3UU0A 4FF7A 3P61A 1FTXA 3KDNA 2EG7A 1XS2A 2XH4A 2FHCA 2EHHA 4CGTA 2F8QA 4TQTA 1R38A 3KZPA 4HYWA 4RJEA 1G5AA 1TSIA 1HGWA 2VC6A 1U30A 4JTAA 1OINA 4YTRA 1Z7AA 2OCZA 5GNYA 4XBJA 4HOXA 4M7TA 4PMNA 3DN5A 3H2OA 3ITXA 3R13A 5E93A 3EX6A 4ATDA 3ARXA 4L61A 3W81A 4HZ8A 3UA3A 1UROA 4YJ5A 1PZ1A 4GYJA 1EJRC 2VWTA 4MDPA 4ZEPA 4YHGA 4US6A 2WPBA 4DWSD 1HZYA 3OBAA 4N4QA 2PTWA 3DG7A 5M5DA 3UP8A 3WD0A 3JR2A 4GX8A 4DO7A 4OV9A 4UCFA 2DZXA 1PKYA 2V81A 2FVLA 3ZOAA 2PP1A 5AVHA 1TA3B 3NQ7A 3THCA 4OFCA 4AZ5A 4JN8A 3S1UA 4BI7A 1KV8A 4J2PA 2WHLA 3L4WA 4AYGA 3OLEA 3QV9A 4HMDA 2VC7A 2SFPA 3W2LA 5A8GA 1E5NA 3FS2A 5G2HA 4W93A 1E1CA 1UKTA 1XD0A 2IQDA 3F2DA 2JKEA 3BQ5A 3QGAC 3N2XA 3GNDA 1I6NA 2ICSA 4O0ZA 2WVSA 3W7RA 1HNYA 5REQA 1XD1A 3MJMA 3ZJ6A 2F6UA 3UXAA 1UKPA 4WCJA 1WDRA 3ZT6A 3AYTA 2PTYA 1QI2A 3KS6A 3NL2A 1DJWA 4GE8A 3TMLA 4WY0B 3UWWA 4DAIA 3FV9A 3KOFA 4S3DA 3EWDA 5E0KA 4F0KA 2E9LA 5DXXA 4HU3A 1R9XA 4FXRA 3I4EA 2DT0A 4US5A 4B9ZA 4Q8VA 3C61A 3WQWA 1XC6A 3H24A 3TN6A 1F3WA 2C1HA 5ABFB 1IV8A 3M0XA 2PDCA 2Z1WA 3MA8A 4HHMA 1MUMA 2Q3RA 3AXMA 2DIJA 2VUYA 1SPQA 3F1QA 1HQTA 1I2QA 2YW3A 1EA0A 1G9HA 4G1NA 3ZSTA 3HM7A 3VZXA 2PF0A 1YNQA 1W1YA 1NARA 1JULA 4HCDA 4AZHA 2WM1A 3S47A 2PDNA 3U7BA 1TMHA 3M6DA 3M7WA 3QW4B 1EIBA 2E77A 2WZIA 4A8RA 4BF9A 1IEXA 1HVQA 4L9YA 8XIAA 3A64A 4DJFA 3N04A 4C6QA 1SW0A 3W6LA 3PNZA 2E40A 2UV8G 4DEFA 3PUDA 2PC8A 2WJEA 3NEHA 1F3EA 4HZMA 2VFFA 3HBLA 3T4WA 4JICA 4EAMA 2A79A 1QW9A 3HFYA 3GC4A 1N8IA 4QDPA 3EAUA 1FWWA 4H9TA 1ADDA 1E6NA 2JEQA 2W27A 5EL1A 3NQFA 3U6WA 2EPLX 2VCCA 3WMBA 2VEPA 1E55A 1I1XA 4LJ3A 3LHWA 4H6KA 2PGFA 1J96A 1NDWA 1OVDA 4S39A 3QEZA 1GNXA 4IMGA 1LOLA 3UJ2A 2ZZ1A 3HB9A 5JIPA 2VFGA 4O0KA 3L4YA 3LGDA 5KZ6A 1GOWA 4URIA 2QJHA 1JZ8A 3AIVA 4O8AA 2VGBA 1XIBA 3BZJA 2X05A 1PTAA 3TA6A 4YVXA 4OVXA 4O12A 4GQBA 3MZNA 2VM8A 3DG6A 1EXBA 1FH8A 2ZUVA 2ZZ4A 3CU2A 4NIRA 3SCUA 1A3HA 3S46A 3FDGA 4JBRA 4HA4A 3AUOA 2Y7GA 3UJEA 3FEQA 3GG0A 1VJIA 3A4WA 4AC7C 3FKRA 3BAWA 3GTNA 1YHTA 3VYLA 3T40A 4C6KA 2VZUA 3C0SA 4DBEA 4UQ9A 1MVYA 4O17A 4CU7A 4DZHA 3BAKA 3GNOA 3FGCA 3P82A 3W87A 2BLEA 3BH4A 1DEDA 3LBCA 4AMCA 3CH9A 2BBFA 4ZODA 5AC8A 3EOEA 4GVHA 2WLZA 3ALGA 2FZMA 1ALDA 2OGJA 4BI5A 5A6LA 4AH7A 4UQDA 1RSCA 2V9DA 1XLCA 5FJRA 2BXZA 3TE9A 5CG7A 2NSXA 5CJNA 1RVGA 2V6AA 4NXSA 2J7EA 2VFDA 1W1VA 2WOQA 1H11A 3T78A 2QMKA 4X60A 2PC4A 5E6YA 4QROA 1H60A 2WHMA 5HATA 4G2DA 2WAGA 1DORA 5CH9A 4AAJA 1AQ0A 2EEXA 4QISA 1Q6RA 3MVIA 1PX3A 3C0LA 4PMDA 2HMCA 4PRTA 3RR1A 4H6RA 2E25A 4PH6A 3MBFA 1R87A 2FDMA 2NUYA 4U5IA 1LL4A 4XAFA 4XTDA 5IOBA 3T0TA 1MO0A 4AX7A 1UH3A 3VC6A 5HMFA 4E4PA 3INPA 2H90A 4OGZA 3C2EA 5E70A 4Y8EA 5K4XA 2Z29A 2EJ1A 4B5WA 3SIZA 4CNTA 2WJDA 4B91A 4AF0B 3GUWA 2DUAA 4PFMA 3TR9A 4UOJA 5DN1A 1QBAA 1RCQA 4NAEB 3NM1A 4DXXA 2J9ZA 3N29A 1PX8A 3RLVA 4HYRA 3NXFA 5EFFA 2FZNA 3TQ0A 1DJQA 5CPQA 3IAPA 4DBUA 2VZOA 3VD3A 4A8LA 1UIPA 5K9XA 3W02A 4NI3A 4MNLA 4XO6A 3P84A 1HN1A 4UUIA 4GO8A 4JTHA 2PDXA 2GQAA 1KR1A 1D2KA 3NGFA 4QJ4B 2GLKA 4UMCA 3ANVA 3BVJA 4NRSA 4E4FA 4UTWA 1YTEA 2Y8KA 2ZZ5A 2FB2A 4RE3A 2QCFA 1ZHAA 1LCOA 4ADTA 1IR2A 3BCJA 4NX0A 4C6FA 4IPPA 4JD4A 3PJXA 4EP8C 1OZQA 1A0CA 3S6OA 4ILSA 2W61A 3CMJA 4AZCA 3UNDA 4ONVA 5LA0A 4GOAA 4O18A 2W9MA 4CNNA 4ML9A 3GFYA 3VNKA 2J7HA 3SAZA 4MDOA 3IJ7A 4XZHA 1M1BA 3W73A 2QGHA 4ZOAA 4FS9A 3COTA 1ZP3A 4NZCA 3WN6A 1J10A 4FLQA 7REQA 4BQ4A 1G1YA 1TFVA 1S46A 3LHUA 4E8CA 2WC7A 3PWIA 1QJWA 1BXNA 3PZNA 5FIPA 4FF5A 3SQMA 1T6MA 1KFJA 5HMEA 3UY7A 4Y6GA 4A4AA 3GS6A 1JL8A 4GQQA 3VI2A 2HBXA 3REQB 1MDLA 3VMPA 3BXWA 4JTSA 2W91A 1BXBA 2ZX8A 1JG9A 4GUFA 1CB2A 1AZ2A 4O0QA 1K7EA 3VOFA 1HJVA 1B3WA 1X6NA 3MSYA 1KM5A 2F2HA 2GGIA 3TEVA 4DJFC 3PFMA 5HANA 3EWBX 3G5EA 1RBOB 3UZWA 3PBYA 2DZSA 5BWAA 5CKSA 1G7VA 3OGVA 3SCQA 1OFDA 2IQ0A 1OT1A 4PYSA 5DFAA 1P6BA 3O0FA 3LENA 3LBMA 3GXIA 2ZRYA 2D0HA 4PCTA 3S5OA 1SFJA 1SW3A 1KD0A 3ZSSA 3D5HA 5JH1A 2RHGA 4H8NA 5KTLA 1UH2A 2VEMA 3J7HA 1OG0A 4FXSA 1I75A 4LS1A 4D6DA 4HK7A 1XLLA 3STEA 5FJIA 1UASA 3LLDA 3BPWA 2OOGA 4QE4A 4DJEA 1V93A 3QY8A 4ACYA 3UWYA 3BOFA 3KAOA 3B3DA 3JRKA 3VNLA 5CPLA 2BY3A 2A21A 1XBZA 5AYXA 1YXDA 4JYDA 3W76A 2WZEA 1EWDA 2QCNA 2YKKA 5ABHA 1P0NA 3JVAA 4JFVA 1VFOA 3T42A 2R8WA 4ALDA 3T05A 1ZAIA 4BEUA 4QAIA 4UR8A 4J35A 1K02A 4ZOEA 1JZ5A 4O16A 1RZMA 3G18A 2H6RA 1AD4A 1TX2A 1OCJA 4Y9NA 2EQDA 3BUVA 3CQJA 2XGBA 1UUMA 4GXMA 2WMFA 1US2A 4X61A 2WMJA 1UJQA 3URAA 1WUFA 3P6LA 2X16A 5FD0A 4ZSTA 3F5JA 4LH8A 2PDHA 2F7FA 5K9DA 2OEKA 3LNMA 2QDHA 4Y2WA 3E9AA 3VAVA 1KLYA 4YTSA 3W23A 3QV8A 2Z2UA 5AYIA 1H3GA 3DYMA 3N3MA 2EO7A 3RCYA 5IFPA 2CEQA 5D2WA 3B8DA 3HOJA 1QNVA 2ZDRA 4GVGA 1V6YA 1H49A 5F2MA 3OEXA 3BE7A 3WLKX 4DB7A 5KZMA 5DMMA 3RM8A 2AAAA 3WLIA 4W8LA 1C8QA 4N9BA 3ITLA 3O16A 4HNOA 4P8UA 1E72M 4F3HA 1UC4A 2ZZ3A 1OX4A 3CC1A 3LSBA 3EDFA 3G3MA 1SMDA 5C71A 1I4NA 2OSWA 4MIMA 3HMJG 3LRKA 2C1GA 4HYVA 5TQLA 5HWJA 4AMAA 1KGXA 3K46A 3WL1A 2NLYA 1FWSA 1G7UA 4C1KA 1UR4A 2QKFA 3IPWA 3DFSA 5D4YA 1ENUA 1XYMA 3TCEA 5A6MA 1RAKA 1UOZA 3GNPA 4PRWA 1W6TA 4Q8PA 4GLEA 1WP6A 1R85A 3W1RA 1R9YA 1NOWA 1JXJA 5I79A 3MUY1 3I6RA 5D37A 2YCKX 3H70A 4QITA 4K68A 1JCXA 2QJMA 3AIWA 3DI0A 3QF0A 3GB6A 3MTWA 2IXUA 4GI4A 4DNHA 3ABRA 4HHPA 3VD7A 1KA9F 3OTRA 2G95A 4ERIA 3UZZA 4LY8A 4AHQA 4TTGA 2YFOA 4QFUA 4AEOA 3UF9A 1G4EA 3V0UA 1KXHA 1TWZA 2PDFA 1K9FA 4H9ZA 3LEPA 3W7IA 2PI6A 3G8RA 3W1MA 3KVJA 1UWUA 4ICCX 2ATMA 1S2WA 4MPKA 1V3JA 2E6DA 1J5SA 1IWPA 1B4KA 4TIMA 1M53A 4LNCA 3PWAA 3M47A 4AD0A 3ARVA 3N2BA 4RLIA 4GCXA 5FJUA 4P8WA 2X7VA 3DYOA 4Q7NA 3L12A 2OWCA 1RBLA 3KCOA 1VQTA 4Z2LA 3WH6A 1US3A 3PZTA 1LRQA 1A49A 4W7VA 3MVTA 3GFZA 3ABXA 5HJYA 2VEIA 4FXFA 3FYYA 1B1YA 1NDVA 4A6GA 4EIVA 1LBMA 3PUGA 2VZTA 2VHLA 4QM1A 3UWQA 4IJBA 1F6YA 3W53A 1PS9A 3DHUA 4IPJA 4LVDA 1TKKA 4F2UA 1OYCA 2AQWA 1W3IA 3EMCA 3JW7A 1XBXA 1KO0A 1H0IA 1UH4A 1EC8A 3L5MA 3O9NA 3VDGA 2NXIA 3LRMA 4QX4A 3IVUA 4DVOA 4MPQA 4WSHA 5DCBA 1R0MA 3W7NA 1F8MA 5EMJA 4GNKB 5JMUA 4JY9A 3H2NA 4Q32A 4AHOA 1O1ZA 1UR2A 4MB4A 2CLFA 4DZ5A 1E6QM 4TX8A 4W8AA 2FDSA 3AXHA 1AUSL 4I90A 3NQ8A 1KQYA 4RZBA 3OYXA 1ECEA 1JAEA 3NVDA 1XSKA 2W67A 4C1LA 1W37A 4OTKA 1K7XA 1SU5A 4FNRA 1AD1A 1AMKA 1XPYA 4XSMA 1LOSA 1V6WA 2HVMA 3DHFA 2IPFA 1FWHC 4U4MA 1BRLA 4PSRA 3USZA 3VZYA 2Q01A 2WNZA 1NVMA 3O06A 1BVNP 2RDUA 4ZQRA 2E6YA 2ZVIA 3HURA 4L6HA 1UMLA 2A3EA 4XG1A 4MY1A 2PRLA 1IEIA 4UTJA 3S6DA 5HAOA 5FKYA 4K37A 1KFCA 1WDQA 1A5MC 4Z42C 4MAZA 1W5OA 3H7RA 5FI8A 1I2RA 3KDOA 4MB5A 1PZ2A 2CBUA 2B7QA 1Q5MA 3RMJA 2Z1BA 3PBMA 3AS3A 5LZLA 1P7TB 2D24A 1BYAA 2I5IA 4JQ3A 1J79A 1RVKA 2UBPC 2ZX6A 1UWQA 1TVPA 1UUQA 1OADA 4F0RA 1LRTA 3GYEA 3PZMA 3OLGA 3VUPA 1C9DA 3GBEA 2XIBA 1MEIA 3EKLA 1SO3A 5LGXA 4JFWA 5AC7A 3ID7A 4PTVA 3MANA 3BWWA 4GPNA 4L56A 2VEFA 4C1NB 4HPXA 3DC0A 4R9XA 1VR6A 1NIUA 2BVYA 1LUCB 2GOUA 3CQ0A 4MYXA 1SMAA 4LBRA 4J9JA 1WDPA 1YX1A 4WKHA 1PB0A 4MMWA 3PTQA 3BGJA 1XISA 2ADAA 2YGYA 4DM2A 1XG4A 1H62A 3QM3A 1C8VA 3VDAA 3FKKA 4K6AA 3MB9A 2QQ6A 3L2MA 1UQZA 4K3ZA 2CZDA 4JS3A 1V0LA 3U3HA 3PF3A 4I9AA 1EDQA 4XD3A 1D7FA 3RX4A 1IZJA 1WYIA 1WXZA 1KFLA 3M16A 2PWUA 1I45A 3UEQA 4FR6A 3L9CA 4QBXA 4HPJA 3KLKA 3CIWA 2CESA 3MUAA 1UG6A 1X6LA 2H3DA 2E3ZA 4F8XA 1Z48A 3B04A 4K8HA 2VMFA 4MAVA 3N13A 1JDDA 4WJEA 1P0BA 1EP1A 1VJZA 2ALRA 3L66A 2J13A 1UD6A 4JTEA 3LA4A 1TJ1A 2P8BA 3LCHA 4YTUA 5DF0A 3IACA 2CNCA 5JBEA 5C7HA 1CGUA 3DI1A 3UWUA 3L67A 3WNNA 3KOXA 1OF8A 2ISDA 3CUJA 1VFLA 3GTIA 2YFNA 4GABA 1HGYA 1YDOA 4WOZA 4GH3A 4R5EA 4TO8A 1M7XA 2QUUA 1VCFA 1A5AA 5HNRA 2YX0A 4EVZA 2F38A 1ZJAA 1MUWA 1PUDA 6ENLA 3W71A 3VOJA 2KAUC 3NIYA 4GMEA 4JTJA 3GNNA 1FA2A 3W7PA 1CXFA 4O1EA 4L9ZA 1GK8A 3ARQA 3F2CA 4FB7A 5MKGA 4HHLA 4GHRA 3LCGA 1C9WA 3MMDA 3B4UA 1Z89A 3QQWA 2FFIA 3AYSA 4ZB0A 4RW3A 2DSVA 5EY5A 3LPOA 1OX5A 1BXCA 4JX4A 4NNBA 3VDHA 1EJUC 4IFKB 1LLWA 2LLEA 3K5XA 3LOTA 4I9TA 1M01A 1MW0A 3LCWA 5FAGA 1JCNA 1DVJA 3TJXA 1OD0A 1HUVA 1KTCA 2PDJA 2VRKA 3OA3A 1BWKA 4JTQA 3CB8A 3TYZA 3I6TA 2OX4A 4UTUA 5AYZA 1J8VA 4OIFA 2PRMA 3WNKA 2WXDM 3VGHA 2AQVA 4ORIA 1QK0A 3U8GA 3S1XA 2OWWA 5KMYA 3HO8A 1FWDC 1W5NA 4MLRA 2JF7A 2B31A 3W0KA 2I57A 4NKCA 3KUMA 3CZLA 3IGSA 4GY0A 1N8WA 1MFVA 3NL6A 5CGMA 3UXKA 1O7AA 1Y5XA 1Z41A 1X8CA 3IVTA 3RCNA 2YCLB 2UWFA 4XK2A 4LEQA 4DO4A 5BWFA 3TW9A 3VM5A 1ZS2A 2XVKA 2H8XA 3B05A 4EF9A 2DPEA 3T55A 1ZZMA 3WBYA 1YXYA 4YN5A 1FWAC 5DO8A 1ZCCA 4Q4SA 3MQTA 4V15A 3LQLA 4DI8A 3UG4A 3ZXWA 2VVNA 1LL6A 1BYDA 3C2FA 4AZBA 1QO2A 1FRBA 1F61A 3H7UA 1JGIA 4OT7A 3EKZA 1PWMA 4MZ1A 3R2GA 3E0IA 1W8SA 4MB1A 3USBA 1M04A 4B2DA 1E0XA 2QCCA 3NL5A 4I7VA 1F4AA 5BZAA 3WUFA 1K9DA 3VIGA 3R7MA 3QGKC 3W84A 1SW7A 4MWAB 6REQA 4IOTA 1JNEA 1FH9A 1J18A 4GIAA 5F4XA 2CLMA 4JDYA 4H2HA 1OK6A 3URBA 3N18A 3FVDA 3NQVA 4QJ3B 1RPXA 1XF0A 4F0LA 2D22A 2EF9A 4GY7A 2FHFA 4XB3A 3RLUA 4HNUA 3IJ6A 5DT5A 3RG6A 2I56A 4OOZA 1FVPA 2VI0A 5I3FA 3NJ3A 2V5CA 3SY1A 3TAOA 4J3WA 5J8LA 3U4FA 4RX0A 3N73A 4CNOA 1VFTA 1C90A 2D20A 3W7OA 1E5JA 1YW1A 3PR2A 3SRDA 4XUYA 1JRCA 3VDBA 2V8ZA 1X39A 1LLZA 3NDZA 3L4UA 2AL1A 4C7DA 2VDIA 3T0CA 3U2CA 1GVFA 4LUSA 3B0YA 4JL1A 3WQ5A 1Z44A 4KCTA 5G2WA 5D9MA 1RUSA 1SJAA 3AO0A 1OCBA 4LB3A 4MGGA 2A7RA 3PPCA 1VAHA 2XINA 1DWFM 1R5YA 3T0AA 4ACZA 1GTHA 3WLRA 4REQB 3XIMA 1GWJA 3RHGA 4FLSA 1W1PA 4NJKA 3U4AA 1R86A 3GDLA 1X97A 2JFEX 5CJMA 2YDAA 2CHNA 4M6PA 2VT0A 4L4PA 5A6BA 1TMLA 3NQDA 3LHTA 4US5D 1DQUA 1M7PA 2VNCA 3ITGA 2QYGA 3SFWA 1UWTA 4BEQA 2YYTA 1WCGA 3P67A 2Q8XA 2E6FA 3GQYA 1TJPA 4DZAA 1BLIA 1HXJA 3GTHA 2IUZA 1RP8A 3BAIA 1YIXA 1NTHA 4MSSA 4ZO6A 3C4UA 3MSDA 3DH7A 2R1PA 4YYFA 1QVBA 2FQIA 4JQAA 4HSHA 1Q45A 4JR5A 2CCRA 1D3HA 3BK0A 4B5VA 4DJFD 3K8KA 2VELA 4I9MA 4K7YA 4MF4A 2PRHA 2YL5A 1XSJA 3RJYA 3T08A 4KWOA 5J5RA 2CLEA 1E40A 3I3DA 2HV5A 2OXNA 4W87A 1YNYA 1DYSA 1GZ1A 4NJJA 1ZENA 2QDEA 3UR7A 4F9JA 4IIEA 1XLMA 3HQ1A 4FI4A 3QZEA 4Z0JA 4B5SA 3P62A 2DZUA 2PDWA 3QH2A 4FOKA 3EWZA 5AHFA 1L2UA 4R7JA 2BSLA 3AISA 1GKQA 4FNPA 2VZSA 2GDUA 1R3RA 5CPTA 3H54A 4DF0A 1EPVA 2Z1KA 4DQWA 4JTTA 5KETA 3TVAA 1XYAA 3FA3A 3Q4DA 3W1TA 1O5KA 1S1RA 3W2JA 5D02A 1F73A 3MDUA 1ZCOA 4V1XA 2POTA 2FZ9A 1E56A 4IIDA 4GIEA 1EJTC 3CLWA 1WBJA 3KRSA 4OECA 1RQHA 1N55A 4GZ7A 1JYVA 1TV7A 3Q37A 3QMRA 5A8QA 1GZJA 3BJFA 4J3TA 3EXTA 3F2BA 5I0DA 3QN3A 3VDCA 2Y88A 1ODZA 1S3TC 4AZIA 1XYZA 3K30A 2VVSA 4JZ5A 1VCGA 4JIRA 4Z1CA 4FSAA 3D46A 4P7QA 1OFQA 4DHGA 3MO4A 4ZB5A 1A5CA 5I3DA 2XH7A 4KESA 2NWRA 1VYPX 3PZGA 4BJHA 1XKYA 4GBUA 2OR2A 3EZ4A 1ZP4A 3EX1A 5M1TA 2D73A 4IX0A 4MZ8A 4QNWA 6PTDA 2XM1A 3IIOA 1CZ1A 3QHMA 4XZNX 5EA9A 3OVGA 4LT9A 1YDNA 2QUVA 4IZGA 5I3JA 3BJSA 5IDZA 4QLJA 1HP4A 4EX4A 1TUFA 2P88A 2PFHA 3Q45A 2YB1A 5EMUA 5D9PA 2GZXA 3ARTA 5FF3A 4GUGA 2GVYA 2PU1A 3RR4A 2XISA 1WKFA 4CCEA 1VZWA 3WLHA 3W7QA 5IHSA 2DW6A 1E9YB 4HP5A 3UG5A 2X1RA 5C2GA 1L2QA 2FPTA 4GNJA 2XVNA 4H8UA 1E43A 4S3CA 3M9YA 2OQHA 1JEZA 1OFPA 2PZ0A 4KGLA 2J9XA 1HIZA 2GK1B 3CTLA 1A3WA 3SGUA 4IQJA 2FMOA 2YW4A 5A69A 2HJPA 2YPIA 4Z17A 4WJ8A 1BWLA 5JBDA 5BMXA 3WELA 4HA1A 1RA5A 3MWCA 3STFA 3M1ZA 4O4WA 4WF7A 4K7VA 4M8UA 1CXKA 3II1A 3H53A 1TV4A 1TWSA 1M03A 3UWEA 1FBAA 1JPDX 2GJNA 1R3YA 2INZA 3WQOA 2BNJA 2PWVA 3TYCA 1K6WA 4IMFA 1K3UA 2Y5SA 4GXWA 1ZTVA 2VGFA 3UY8A 1VHCA 3GU1A 3WFAA 2OB3A 2DIKA 3WCZA 4ZO9A 2PUZA 3CH0A 2XH2A 5JU6A 4L7ZA 1B90A 2CITA 4E8DA 3CQIA 1XDMA 1UWSA 4DUVA 5JUVA 3RO6A 3E49A 3QSTA 2QUNA 1XCWA 3MI3A 1Q6FA 1UW9A 2ZKMX 3TFCA 4LVFA 3KBWA 2HRWA 2Y8UA 3QY7A 3TOPA 3DC8A 4OBSA 3RU8X 3CB3A 1QI0A 1G01A 3RITA 1WUEA 4P7NA 3M5YA 1OG6A 3BCFA 2OTDA 1KRBC 4GFIA 1RLDA 4YVVA 2JIEA 4TMBA 3A9IA 4KCWA 4YLWA 3EXSA 1KFWA 2PDQA 4IIFA 1KM2A 3N6QA 3O1NA 4PUDA 4ZXLA 4IISA 4X0VA 4H9VA 4W85A 3ORWA 1IXQA 3FHAA 3ONBA 3LMYA 3CEUA 4E2VA 5HR7A 2IKHA 3IGXA 2E8YA 3BLLA 3NNTA 5CSSA 1B9BA 4QEEA 2HCVA 4LW7A 3B0XA 3WQ4A 1Q63A 1J0IA 4NVTA 4EOUA 1GVQA 1F76A 3RRXA 4PB4A 4XSLA 2YBVA 2Z00A 3UVIA 3TQVA 4BR1A 3NZRA 1OBAA 2D23A 2WZHA 1M5WA 3SZ8A 2Q71A 3PBVA 1MXGA 4NUWA 1L6GA 5BU6A 2GVJA 1Y7VA 2ZXDA 3GXDA 5FEWA 1NFGA 1K7FA 2ZUSA 4GISA 4AIOA 1P48A 3FA5A 4J27A 1E0UA 3CJPA 1R2SA 4PMZA 4X2PA 3CV1A 3MSGA 5K4ZA 4H7CA 5LIUX 3VFLA 1CXLA 2ABBA 4AEEA 3QV7A 1VEPA 4UOQA 3DYPA 1VFHA 1VIWA 2YCIX 3R79A 3TTOA 4MYAA 2HE5A 3SECA 5IHRA 3DGRA 4ZENA 4UR7A 4GI8A 4CNSA 3WQFA 3OIHA 1DJZA 1RALA 4Q4RA 1R3WA 5A95A 4IIBA 3IIPA 4B3ZA 4AD1A 4NJIA 3CV7A 4C6EA 3NURA 4HPNA 3T1GA 2CZ5A 1WAWA 5A8PA 2Y7DA 4DJED 3A9BA 3WF1A 2VOMA 3ARZA 4W86A 5D2TA 2RJGA 1WX0A 4KWWA 3GAKA 4UZSA 4NT0A 1ZB5A 3NGJA 1X8FA 2G3NA 1W9BM 3LY0A 2XIIA 2X2GA 4OE7A 1NOUA 3WQDA 2J66A 2J47A 4A3HA 3L2IA 3E74A 1ADOA 2X0HA 3MYPA 5ABEA 1YDYA 3CV6A 5F7UA 3G1SA 5JXQA 3A47A 3TNBA 1J5TA 3GC2A 5D38A 2WC3A 1M65A 5A3HA 1OQFA 2NVAA 1VF8A 5H2ZA 1ONXA 1S38A 3UZYA 1QXLA 1SJDA 4YNGA 5E0CA 2VYOA 3TX9A 1Q7MA 1JZ4A 4NAFA 1V6XA 3BDKA 3CO8A 4ZTXA 1C92A 1ZBVA 3NO3A 4IQDA 1IGSA 3CHEA 4HPHA 3L0GA 2FTPA 3MMUA 3E2SA 3GVWA 3P0WA 4AWSA 3NZGA 3EGJA 1EJWC 1QNPA 5GNZA 3LDVA 3RX2A 3AC0A 4DY1A 2VR5A 3SCNA 5C9ZA 1F8IA 2KX9A 3AXKA 5FL0A 3WD1A 2C91A 3R0UA 4KEZA 3IK4A 4MLJA 1I8JA 5D09A 4H8VA 1I0BA 2BASA 3WBAA 2VKZG 4R33A 1HJQA 4PR4A 1PCWA 3A4XA 4LFYA 2HISA 3SSJA 1JQXA 1OC7A 4QG9A 1C93A 3TMQA 3MO7A 2RFGA 5F4SA 1SSDA 1CXEA 5HWMA 4OZOA 4AY7A 1J0HA 3CL6A 4KERA 3OHMB 2QW5A 4M7SA 2ZBTA 3NSMA 1AJ2A 2VEKA 1CDGA 3NO5A 4K1WA 5LGZA 2INEA 4TTUA 4JNZA 6XIMA 3GUGA 3WSUA 3MP3A 4BI6A 2CZFA 5C2XA 4Q8OA 2X1SA 4JNMA 1IYXA 4JQ2A 3FJ6A 4LS0A 2FZBA 1ISYA 4DUWA 1AH4A 1AQFA 1GUVA 2XGIA 2Z24A 3PK7A 1MW1A 1POJA 2EPOA 3IARA 5CPOA 1XQLA 2HVNA 1FDJA 2V69A 3VIOA 1ZU8A 1TPH1 3L68A 3UVAA 3DOPA 3O6AA 4R88A 4A3QA 2CPUA 4AZ6A 5AZ0A 3EDDA 1JYWA 3MWAA 1FXPA 3WJZA 1WV2A 3DFHA 4LCQA 1XCXA 1UA7A 1P0DA 1VKFA 4C65A 4IM4A 4A8IA 2HQAA 1K1DA 3PN8A 1YTKA 1TA3A 1RQBA 2CLOA 1N2VA 4UTMA 1RA0A 3S2MA 3S3GA 5ENLA 1OCNA 4FZIA 1LM1A 1B4EA 3SDOA 1QFEA 4ZE5A 1BQCA 2QJIA 2F61A 1A50A 2YB4A 1A0EA 2IXVA 5EMMA 2ISSA 1GJUA 4LYRA 2WSRA 4E3TA 3ITOA 4MG4A 3QRHA 2I14A 2WNQA 1FCUA 5FEZA 1SSGA 3GIQA 1OJXA 3GVQA 1QOPA 1PIFA 4PMOA 2QIIA 4HSOA 3V35A 1KRAC 2YA1A 3NPXA 3AYVA 3ZWTA 2VRQA 1E73M 2DZAA 2X0YA 2V5JA 2Y62A 2XJ7A 4WY0A 4Z1DA 3LK6A 2DH2A 1W9XA 3B40A 2F84A 4M56A 4NZ3A 5HQMA 3BGAA 1H09A 4WQ6A 1ESWA 1DBTA 2J7GA 1E1FA 2W6RA 3NXLA 1TV2A 4YTTA 4KCUA 5ABFA 2FLIA 5HWNA 3F4NA 4PULA 3ZMRA 2C13A 3M0VA 2BTMA 4FNSA 4E6MA 2NV1A 1OFRA 2E7FA 2J74A 3A6OA 1YYAA 1QASA 9XIMA 3UERA 7A3HA 1TUXA 1QBBA 5FJTA 4N7QA 3AOFA 1B3VA 1CLVA 3VPLA 3LCIA 3F5LA 3VO0A 1RJRA 2J7CA 3MV11 3AIRA 4PBEA 3WJXA 1NFPA 1EBHA 2ZOXA 4KRTA 3E0LA 4X0NA 1TVLA 5EB8A 2QAPA 3KP0A 1PV8A 5HMDA 5H6HA 4H7VA 4DUXA 3W1QA 4JY8A 3WENA 5I02A 4JFUA 2VXNA 2C16A 5DMNA 5FJOA 4DI9A 1V08A 2RDWA 4JAWA 1UHVA 1O94A 2BVWA 2QCDA 2E28A 4D6IA 3PJWA 3BW2A 4HA3A 4U33A 1OT2A 4JTGA 3PG9A 1TZZA 3W83A 3WJWA 1QI3A 1A0DA 4V33A 4KKXA 3NA8A 3CZGA 3NQEA 1XLBA 1PE1A 4Y9MA 2ZC1A 4FEZA 5XINA 3C2VA 1TELA 3GY1A 1TIMA 4DM1A 3SGGA 5LKYA 2JALA 4PUEA 3V7PA 1DQWA 4GVFA 1FWRA 4YIWA 5M17A 3MBDA 4Q8UA 1LOQA 3B8SA 3T2OA 4IWWA 3CT7A 4D1IA 4HGXA 3HTWA 1NP0A 3WF4A 2C0HA 3R12A 5BCAA 5BNKA 4NP7A 1C29A 4GCAA 3OZMA 2FZ8A 1XIEA 4DPPA 3C2YA 1XYCA 4GUHA 4LF2A 5IDIA 2FHBA 1BSIA 1TB3A 3JZEA 3N3TA 3I7RA 3WZ0E 1HL2A 4F66A 1KM3A 3N12A 4GQ0A 3R8RA 3VILA 1G67A 2Q02A 3QJAA 2DFAA 3IVSA 1QNQA 2BP1A 3LXBA 5I23A 1EWEA 3P8IA 3HIJA 3W24A 4W5ZA 5K7JA 4XV0A 2QXWA 1WKEA 2PWGA 3BG5A 3OU8A 5C6MA 1S5TA 2XN2A 2OU4A 3NDOA 3GW3A 1REQB 1G4PA 1UWAA 4LSBA 2WANA 4B90A 1O68A 1EKOA 1BHGA 3KRUA 5LXEA 5KITA 3QFEA 3DEQA 3IUIA 1ZAJA 1S2CA 1BG9A 3M0LA 3R89A 1CI1A 3LZ3A 4G5DA 1XBYA 2E9MA 2EBNA 1WDDA 1IEWA 1SJCA 5DANA 3OO2A 2FB3A 3FA4A 2XVGA 3VGFA 3G1DA 1VBUA 3LV6A 3TAKA 3MU7A 1JDFA 1JF5A 4V27A 2EKGA 2OYLA 2X42A 2WKJA 5JH2A 2GQ9A 5EBUA 4ZCWA 1AMYA 1EF3A 3SUTA 3QXBA 3VKKA 4S23A 1Q8AA 4LRSA 5A2BA 2O4MA 4JHMA 1EYEA 1CBGA 1GOKA 1XYBA 2DSWA 1D8WA 1RK6A 3O8AA 3WDJA 3VA8A 4BCEA 1ZL1A 1ISWA 4PGLA 4FO4A 5BRBA 3G8EA 1N7KA 3BO9A 2DZPA 4QAWA 4AF0A 3IJ8A 4F9DA 1EA9C 3M4HA 4M80A 2IPJA 4MTVA 4YL2A 4FIRA 4NAEA 4AG0A 1OGGA 1YLVA 1HO1A 5KINA 4XKYB 4N4PA 4K1GA 3CLMA 4JIEA 3FAWA 1PTDA 4MUZA 1NY1A 3AHXA 2BXVA 3W28A 3E1F1 5A6SA 2W79A 3VFCA 4RDYA 3PZIA 2XN0A 1HJWA 4KETA 3THUA 3EB2A 4BZYA 4OBRA 3SN4A 3SJ3A 3W22A 3FNDA 4FXJA 4BK9A 3EMZA 3QR0A 1EL3A 3G24A 1NDZA 2O55A 1W8GA 3APYA 1ZY9A 1L9WA 1DWGM 1KM4A 3PBGA 3Q58A 3K8MA 4LVGA 2OT1A 4WSKA 2FPVA 3G1HA 4G1KA 4CQAA 2D2GA 1M9HA 2ALDA 4DJDA 2JBMA 2OZTA 2R24A 3IWPA 3UXDA 1RP9A 4CD5A 4O19A 1A47A 4B4FA 3RNDA 5AN7A 5AYBA 4UIOA 3VMNA 5AHLA 1ITXA 5AHNA 1JFXA 4CQCA 1KRMA 3WLTA 4AIUA 5I00A 2OOFA 4PC8A 2P3EA 2ISWA 4NASA 2O9RA 3LCFA 1XKJA 4H9YA 4D6EA 3CEPA 1JXKA 1LZOA 3WMCA 1PPIA 3GXMA 4LVBA 4HNVA 1GJWA 4AVNA 4B2DD 4BF5A 2R9RA 2A3AA 1FOBA 3OQEA 3AIBA 2V2CA 1QWKA 4O54A 3WQCA 1WE5A 3REQA 1SZEA 1LYXA 1GVEA 5CPMA 1PDYA 4GYFA 4J7RA 3T7VA 3PULA 4I9JA 2OT0A 2W63A 1W9DM 1ZRQA 3LD5A 2JIWA 3LXAA 4GJ1A 4CLMA 4N0RA 4U2YA 2OKOA 1GQKA 3EEGA 1HKWA 1B9ZA 4JCLA 2EG8A 5E6ZA 2E6AA 1IF2A 4O28A 1P0KA 2QJNA 3ZJ8A 3HGOA 2E0PA 3BLOA 5I03A 3GFXA 4NQ1A 1EGVA 1J2BA 1GW9A 2YBUA 3K4AA 2B7PA 4B9YA 5D33A 4PMRA 3UZ5A 1GQJA 3EOLA 3EA1A 5E09A 3R5EA 3W88A 2OVLA 2W92A 3DHDA 3PZVA 3GW0A 1TPDA 3OYZA 2YLLA 4KFNA 1IXOA 4PTNA 4D1JA 2WB5A 3CTTA 4DNMA 1V4YA 3W07A 4V28A 4X63A 1ADSA 3UG8A 3UESA 3CL8A 3WK0A 4BQ2A 3QQ0A 4RPQA 4AU0A 3N11A 4IUGA 3G1VA 1J9YA 1O60A 3KOYA 3VOGA 3NSNA 2JQXA 3KW3A 4JFTA 4MJ4A 4U28A 4IXHA 4PMUA 2IMRA 3NOEA 2ZRUA 2W5FA 1YNPA 1EOKA 2C1IA 1QW7A 1V6UA 1WNOA 3GO2A 1A80A 3ZJKA 1IXNA 3KOWA 4KT2A 5A6BD 3UXIA 2P10A 3N2MA 3KFTA 5F1UA 4MKSA 2CFFA 2G3IA 4C6NA 4I5XA 4Z2KA 1V02E 4DF1A 4M5PA 3U57A 2NWSA 3S5SA 1E70M 1ELSA 2QDGA 3FXGA 1KC7A 3O05A 3U48A 3G1FA 3AMDA 1CXIA 2X8RA 3AHZA 3GG7A 1DJXA 4J5NA 1U22A 4NNAA 3RU6A 4J1OA 1AL8A 3MUZ1 3MHFA 2XZ7A 1FHVA 3DFPA 3RXZA 3AXIA 4D6CA 3IS4A 3WL0A 3AWOA 2I7GA 2XIQA 2V30A 4LAOA 3W1UA 4G7FA 1Y65A 2Y8VA 3DFYA 1LQ0A 2Z7GA 1MW2A 2Z28A 4R3UA 3V36A 1WKYA 4Q6XA 2DZTA 1NF7A 4E2OA 1W0MA 3GG1A 5ECVA 4EE9A 2HK1A 4O1AA 4Y7EA 5DRIA 5E9XA 1PKNA 2P5NA 5GPRA 3F03K 3R8GA 2ZA2A 4QCEA 5KSWA 4YWSA 1XRFA 5I77A 3W2NA 1UD4A 2Y0FA 3WLNA 3WUGA 4ADSA 1V77A 3P3BA 4WDXA 2XVPA 4GA8A 3PANA 4ROPA 4DO5A 1XUZA 4QS6A 3VOIA 3TTQA 1W5PA 3KLLA 2QCGA 3ABSA 1OC6A 1WQ5A 1IIGA 3I3EA 1O95A 2OYMA 2DGAA 5D03A 3BLDA 3VIPA 1NH6A 3UT0A 1OB0A 4RDZA 4PTMA 3NDYA 3SO7A 4A3RA 4GGHA 1CT5A 3B9DA 3ZR6A 1TRIA 3LBOA 2DJLA 4ROQA 3NSXA 4H8HA 1VBHA 4JHOA 1L6YA 3C8NA 5LA2A 1W3HA 3H2MA 1HKJA 3NYDA 2DT3A 4KS0A 4S2CA 2B7NA 3WQEA 3WD4A 4JTIA 4V1YA 4ENLA 4OWGA 1EJXC 2D69A 1P6WA 1BWVA 3PSVA 5FOOA 1J0JA 4JCMA 4ICNA 4JIIX 3Q94A 4Q8MA 1IQ8A 1XIHA 5SWUA 1ZAHA 2Y7EA 2WMGA 1MZRA 4HD5A 2C14A 1T0OA 3TUUA 1XLGA 4R27A 1DIEA 1Y0EA 1XDJA 3UNTA 4E5TA 4Y9OA 3ZO9A 3PY2A 4EXAA 1GZGA 4J2MA 4A3UA 3A3HA 4LYKA 3WX7A 2WKGA 4WIWA 1BQGA 1VC4A 1Q6LA 3TYBA 3WDRA 4FR1A 1KNWA 3KTCA 4DPQA 3EWCA 1CW2A 3LGGA 4B4HA 5CXPA 3B8UA 1D3GA 4WVXA 4ZR8A 1FWGC 2HZGA 1EO7A 2GQ8A 1ISXA 4HU8A 2ANUA 2I16A 4DJDC 4QLKA 1H7RA 4JX6A 1SO5A 3ME3A 3PZQA 3CUIA 3WQGA 4A2RA 1GVRA 2OO0A 4RR4A 3CYVA 4PB3A 3H4WA 3HPAA 1T96A 4IHCA 1H5YA 4BS0A 3MDWA 5TIMA 2AMXA 1GG1A 1GOOA 1BTCA 1Q3NA 2OWXA 2RGLA 3LX9A 3S1VA 1MI3A 4D6FA 2HNHA 5H8PA 2XFFA 1U33A 4LRTA 4XO7A 3VOHA 4UBPC 2PTXA 1KBJA 1RBAA 1PIIA 4Y96A 2DT2A 1ZLPA 1ZBKA 4XQ6A 4HTBA 4QE5A 3IV3A 4Y8FA 3QGVA 4LAKA 4A22A 2OSYA 5DCDA 1Z9AA 1YMYA 2H3BA 2V5BA 3A3XA 5GQBA 3P81A 3HFTA 4O53A 1EC9A 1LTDA 4JYFA 1GTEA 1GONA 5CC5A 1BVZA 2OEJA 1K9TA 4N9EA 3B9NA 2R82A 3RN6A 4AWUA 1NQ6A 3W29A 5C5YA 3V1PA 4IIHA 4QEHA 5HINA 4CNUA 4S1FA 3EA3A 3AMCA 2BHUA 1DXIA 2VX4A 4GNVA 1RR2A 1EJSC 2GUUA 1IT8A 2YCEA 3GDTA 3LTSA 2WJFA 3NPVA 4M51A 3GHTA 3LCXA 2BY0A 1K77A 3GLCA 4LWWA 5B7ZA 1O5QA 2QZRA 4RNFA 2WSPA 1KKOA 2XU2A 3NTYA 3SUWA 3N9KA 4J3ZA 4A8NA 1TQXA 3PNUA 1PVNA 3G0XA 4O1FA 1XUUA 3UJSA 1HJSA 3QOMA 1TZ9A 1LLOA 4MNJA 5T9BG 4DBSA 3W26A 2CBIA 5BXSA 3M46A 1H1ZA 4L4LA 1EFZA 2PURA 3M5VA 1GW1A 1P7TA 3ARUA 3VNDA 3WQ8A 3BLKA 3MJYA 3S1WA 2DDXA 4IT1A 3KVKA 2HWGA 4P7RA 3BW4A 5B7YA 1R2TA 2QS8A 1QW8A 4S2BA 1WA3A 1BF2A 2BY2A 4KMQA 4C5YA 2FGZA 2CZEA 3QHNA 5TNVA 1ONRA 1R7AA 4TV6A 3UETA 2OLSA 3BL3A 3N25A 5G2IA 1R47A 2QCDB 4C1NA 4PZVA 4X9SA 3N1AA 2PDBA 1LBLA 2I9UA 1LUCA 1O4UA 1XQKA 4FNQA 3STPA 5BXTA 1FKWA 3TTEA 1WZMA 4X22A 1FY6A 1Y8BA 3W7EA 4CU6A 1SFSA 1FHUA 1YXCA 2ZA1A 2EG6A 4CQ8A 4PTWA 3PB0A 3Q67A 2A3CA 3CHFA 2INFA 4CKQA 1J0ZA 1W1IE 4DWSC 4EACA 4QQ3A 2PPGA 3ZM8A 3ZQ9A 1JZ6A 1JNDA 2XFRA 4IGMA 5F4WA 4CQBA 1XPGA 2YXOA 2XN1A 5DCEA 1DIOA 3LNPA 2WCAA 1R3TA 3NO1A 4IQEA 2DUXA 1V6VA 4LCRA 2CZVA 3DIPA 5HDRA 2YA2A 4B3KA 3C8FA 2HS6A 2P0OA 1LL7A 3KOZA 1IEVA 4Y9AA 2A3HA 2J7DA 3MHUA 3FW6A 1DE5A 1IIHA 1TPC1 3VD9A 2WSYA 2BMBA 4IJCA 4HMNA 5FAJA 1MMFA 3WH8A 1Q8JA 1TZ7A 3EWUA 3GDMA 1DJGA 2CHOA 3WEZA 4GX9A 4OHQA 2TODA 1DJYA 4S3EA 1A5NC 3WUEA 3WLMA 1EP2A 3MUIA 2H9AB 2C6QA 3M44A 3TLLA 4XBKA 3WIJA 1QPKA 3ISIX 4BA0A 1GJPA 1GHSA 2E5CA 1H7NA 3LCLA 4M3PA 3KL3A 3MC5A 1V7AA 1O6IA 3B4YA 2NQJA 1GGOA 1H4PA 3JS3A 3KCJA 5IBXC 5LIYX 3OGSA 2QJJA 4OOUA 4GXPA 4IFKA 4E2BA 3GYCA 2XSAA 2Y7FA 3UCQA 4LEFA 4AIBA 3UR5A 2WNWA 1IR1A 1Q66A 2DZBA 2OLHA 3EX4A 3QY6A 4JKMA 4DAFA 4KRUA 3N14A 4RNJA 5FACA 1KBIA 3CK5A 3SIMA 3HPXA 3MPGA 4KH2A 1DP0A 1CIUA 2G3FA 3P80A 2ZX9A 3GKAA 3N2OA 5DEZA 5M03A 1VBJA 1CGTA 4G7EB 3NZPA 1RPKA 4ZVJA 1V3HA 3CNYA 3ZLGA 2GJLA 3UCCA 2ZE3A 4ZO7A 1JJKA 4U2ZA 4HOZA 5GNXA 2NQ5A 4PUNA 3C2OA 1OYBA 2Z6JA 2PCQA 1R3SA 3CGTA 4GINA 1WDWA 4WGXA 1VLWA 1TJ0A 2FPYA 5JVLA 5CAKA 2YCLA 1OM0A 2OZ8A 3W70A 2Q09A 9CGTA 3IJLA 4TXEA 3FYOA 4CEUC 3AIUA <