2R9RA

Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel) in association with beta subunit
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Atomic structure of a voltage-dependent K+ channel in a lipid membrane-like environment.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein, transport protein
total genus 120
structure length 326
sequence length 326
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2r9rA00
3G5EA 1EXBA 2BGQA 3T42A 3NTYA 2IPJA 3R43A 2I17A 2PDLA 4XO6A 3M64A 3LBOA 5HNTA 4DZ5A 1ZUAX 2PD5A 4XAPA 1XGDA 4F40A 1YE6A 4JQ3A 4QBXA 3R7MA 1LQAA 3BUVA 4XZMX 1IEIA 4XVDA 1HW6A 3LENA 5HA7A 3V0TA 3GHUA 3H7RA 3LQLA 2PDNA 5LIKX 4GIEA 4YVVA 2PFHA 4H7CA 5JH2A 2FVLA 1EF3A 1C9WA 4GQGA 3V35A 2QXWA 4R9OA 4QXIA 1JEZA 1QRQA 1XF0A 4G5DA 4IJRA 4YVPA 4XZHA 3O0KA 4L1WA 2IQ0A 2ACQA 3BV7A 2A79A 2FGBA 3UP8A 2HV5A 1RALA 3V36A 3B3DA 4XZIA 4GCAA 2DV0A 4XO7A 2IPWA 2PDYA 4XZLX 1PYFA 2ALRA 3GUGA 2IPFA 4LAZA 5LIUX 1US0A 1IHIA 5DANA 2PDHA 4ICCX 1M9HA 4LBSA 4DBSA 1AH0A 3R94A 4RPQA 5LIWX 2IKJA 1PWLA 3WBWA 4PUUA 4ZFCA 3H7UA 4PUWA 1RY8A 5HNUA 2R24A 1ZGDA 2ACUA 3CV7A 3LEPA 4NKCA 1X96A 1MZRA 4L1XA 4JTCA 3UZWA 2PDFA 1EKOA 3LZ5A 3BURA 4JQAA 4XK2A 1PWMA 3EAUA 1YNQA 2PDPA 3UFYA 3DN5A 1ADSA 2AGTA 2ACSA 3UGRA 2DUXA 3LNMA 3DOPA 2INZA 2IKHA 1T40A 5LIXX 1Z9AA 1PZ1A 4WRHA 3ONBA 2R9RA 2CLPA 1VP5A 5C7HA 1K8CA 1SM9A 3LUTA 4IJCA 3RX2A 2C91A 4JIIX 4FA3A 3LD5A 2IKIA 1Z89A 4LAUA 4GABA 4QX4A 2FZ8A 5JH1A 2PDXA 4LB3A 2ACRA 5KETA 2P5NA 2IQDA 2HE8A 4MHBA 2BGSA 1UR3M 3KRBA 4GQ0A 3Q67A 1XJBA 1YNPA 2DUZA 1S2AA 4Q3MA 1Z3NA 3RX4A 3WG6A 3EB4A 2PDBA 4YU1A 2HVOA 4YS1A 3WBYA 2PDCA 2FZBA 3CASA 2IKGA 4JTAA 3ERPA 2FZ9A 1EL3A 3CAVA 2VDGA 2BP1A 1VBJA 2IS7A 3UZYA 2I16A 4HBKA 5AZ0A 2INEA 4GA8A 1X97A 3U2CA 4JTQA 1S2CA 3M4HA 4FALA 2NVCA 3M0IA 4JTRA 2PDGA 3D3FA 1Q13A 2PDWA 3MC5A 4IGSA 3GHSA 4WGHA 1YE4A 4PRTA 4PMJA 4LBRA 3RX3A 3C3UA 4QR6A 1A80A 2PDQA 4ASTA 3F7JA 4WDTA 1J96A 2PD9A 3UYIA 2PEVA 2WZMA 3P2VA 4WEVX 2J8TA 2NVDA 3V0UA 5M2FX 4DBWA 2HE5A 5LIYX 3WBXA 4WDWA 4JQ1A 3G1RA 3Q65A 3UG8A 4GACA 1Q5MA 2FZDA 1AZ2A 3FX4A 4XZNX 1LWIA 1RY0A 4I5XA 3GHRA 1MRQA 2HDJA 3N2TA 3WCZA 3O3RA 1AZ1A 1AH4A 3LQGA 3FJNA 1R38A 4Q7BA 1Z8AA 2PDMA 3R58A 1HQTA 3COTA 1T41A 3VXGA 2PDIA 2PF8A 3ONCA 3CMFA 3UZXA 3EB3A 2PDUA 4LB4A 3CAQA 3CV6A 4H8NA 1S1PA 2PDJA 2F2KA 1OG6A 4JIHA 2PZNA 4FAMA 3R6IA 3MB9A 4JQ2A 3BCJA 4WDUA 1S1RA 4JQ4A 4JIRA 1AH3A 3GHTA 3LZ3A 1FRBA 4YVXA 1AFSA 4JTDA 3UWEA 4AUBA 3S3GA 3QKZA 4EXAA 4FZIA 4PRRA 4DBUA 2WZTA 1PZ0A 1ZSXA 1ZQ5A 3H4GA 3R8GA 4WDXA 3LN3A 4EXBA 1MI3A 3R8HA 3N6QA 1X98A 2ISFA 4HMNA 2HVNA 4XVEA 1GVEA 2PDKA 3V0SA 5AZ1A 2IPGA 4OTKA 3UZZA 1QWKA 4PR4A 2F38A 2HEJA
chains in the Genus database with same CATH superfamily
2WO5A 2IPJA 1TWSA 3T0AA 1FXQA 5D32A 3AYRA 4JKKA 2XUCA 1V3IA 1XQLA 3U7VA 1DORA 3HQNA 3RF9A 3OBAA 1EJTC 2BS9A 4DB7A 3MSGA 3VCRA 3QY7A 4QSHA 3CTTA 1JGMA 3VK5A 2J77A 3WLQA 3FGCB 3GHUA 1A50A 1IT0A 4GJ1A 4NRRA 3VUSA 4W84A 1JFXA 6XIMA 2YCLB 2POTA 4D9PA 4NG3A 3G1SA 3BWWA 2OODA 4AYSA 1Q6GA 5IXEA 3IUHA 5AC6A 2RHGA 4K8GA 4DPQA 4YVVA 4H7CA 4QRNA 3W74A 5AC5A 4UTMA 3O6CA 1J93A 2X1RA 3TQVA 3QFWA 5FD0A 2P76A 3GG8A 3UWYA 5K9CA 3EX6A 4IWWA 3PBGA 4L6HA 3SSJA 1LG2A 4RCXA 3A9IA 2XG9A 1B9ZA 4QAIA 3NQAA 5DO8A 3RJYA 3BAWA 4LALA 2OO0A 4XAGA 3GTIA 1UHVA 3AXXA 3O15A 3TX9A 5A6SA 3G1FA 3QEZA 2G3JA 5D9MA 1X6LA 2JEPA 3ABQA 2W79A 3S6OA 1PO9A 1BGGA 4MLRA 1OZMA 2GK1A 1TE1A 1NFBA 2CYGA 3OZOA 4ACYA 5K2ZA 1LQ2A 3F5KA 1XDLA 3CK5A 4UTFA 2BOGX 3CMGA 1EP2A 1T96A 2QF7A 3VDHA 2NV2A 5AHEA 1H50A 2BNJA 1AD1A 1P6WA 2E1WA 3N2XA 2VURA 3ABZA 4M82A 1JG9A 4RPQA 3IJ7A 1PKMA 2V9DA 3W81A 4KH2A 1E0XA 3TV8A 3H7UA 4XAFA 3ARWA 5D38A 1XIIA 4I9JA 1H2JA 2JGQA 1DHKA 4MB1A 1XIDA 1ZGDA 2JKEA 4DHGA 1LF1A 1J0HA 4NKCA 3W23A 3CUIA 4L1XA 1TV3A 1VHNA 4WGXA 4YL2A 1UWRA 3OG2A 1CTNA 1YXCA 4XK2A 5FAGA 4FXFA 1YNQA 2GLKA 3KXQA 1F73A 1L9WA 4MM1A 4CNUA 3LCWA 3DN5A 1ZFJA 3VMOA 1Z44A 1JZ3A 1OX4A 3WK2A 1XC6A 1O95A 3QYSA 1NSJA 1J10A 4CU7A 3TYZA 4OWGA 1U83A 2C13A 4X3ZA 3W01A 1W3HA 1I1WA 1FP9A 2B81A 5A8NA 1CXIA 1JXKA 5ABFA 4AEFA 4C1LA 2CERA 1KO0A 3HJEA 5D9NA 1Q7MA 3BMWA 2EJ1A 4JY9A 4B92A 1M7XA 3KTXA 1IR1A 2VJXA 3W1XA 4H6EA 2PDXA 4OUEA 4UNKA 3RCYA 1V6WA 4GK8A 1QNPA 4ZSUA 2HE8A 4ILSA 1DXIA 2HXTA 4LVGA 1ITXA 1GTHA 2I9UA 4IIGA 2WPGA 3WDQA 2YGYA 1TMQA 1CECA 1Z3NA 4DYKA 3JU2A 4LNYA 1IXNA 1BQGA 2QQ6A 5HMEA 2BVYA 3E38A 1PKLA 2FHCA 1WUEA 4MTVA 3MBDA 4E2VA 3OTRA 1FDZA 4Z2HA 2D0FA 1CT5A 3PJWA 3BW4A 4O0ZA 3VZXA 5EMLA 3SAZA 5FEWA 1A0EA 8A3HA 1FWRA 5EFDA 4MKNA 1Q8AA 3WJXA 4H9ZA 1XSJA 3UY8A 3RCMA 1K9FA 4HGXA 4L6OA 1TPWA 3SUSA 4AZ7A 2F2HA 1V5XA 3D3FA 2J7HA 1LG1A 2PDWA 1XC4A 1UP2A 3CQHA 3N9KA 3W85A 4LUSB 5H1WA 4ZXOA 4J7RA 4CQBA 3QR3A 4RE2A 4A3HA 4A4AA 3GNDA 4RDVA 4AIUA 4E0CA 3TQKA 4CCCA 3UJEA 6PTDA 1Q63A 4I90A 1UWQA 4GKTA 1A5SA 3DG7A 4L1GA 3NA8A 1UA7A 1L6SA 4U3AA 1NFGA 2GSEA 1ODUA 2Y7EA 4K36A 2BXZA 3AROA 3GDRA 4N4QA 1CLKA 3MDWA 5EMJA 5LIYX 3CBWA 4P7RA 4L65A 4XZ9A 4GACA 3STPA 2FB2A 3SCRA 1EJRC 5AVNA 4HCDA 1GKPA 2CWXA 4O8RA 1PZ3A 4AZBA 4XD3A 4DWDA 1BAGA 3P62A 3VNZA 4EKJA 3NPXA 4G56A 1W32A 4WOQA 4DPPA 2NXIA 3CPUA 1JFHA 3NYDA 2Y5JA 3O3RA 4XZBA 1J2WA 2VWTA 1OFEA 1CCWB 4TX6A 4EX4A 4FXRA 2WANA 1CB7B 1Z8AA 2WMHA 1MWOA 2A7RA 2O9PA 3GLCA 3VTRA 3VXGA 4JFUA 2DGAA 3GB6A 3MI3A 4QEEA 3KDOA 4B4FA 3DI0A 4EWND 1A5AA 3QC3A 4P5UA 2GGHA 4LB4A 1CI1A 5TIMA 5AKQA 3I7RA 4PFMA 1F05A 3E3HA 2H3BA 3NYZA 1HJUA 4MDOA 1PTGA 4DUOA 1RXOB 1S2UA 2YR1A 3RIKA 1TVLA 4P7LA 1TIMA 4GNJA 1DL3A 5AECA 4LQ1A 4X63A 2QCNA 4KIRA 4KPLA 4GWEA 1FVPA 1MI3A 1D9EA 3LCIA 3BH4A 1W3IA 4Z2GA 3GKFA 4UOZA 3VIMA 3UJSA 3SJ3A 4BKNA 2WJEA 3UZZA 1C92A 1T6MA 1NWRA 1TUXA 4MFDA 1RBLA 1JCYA 3U2ZA 4DZIA 4LUIA 1SFTA 3N2MA 5BRPA 1UQZA 4GBDA 3CUGA 4B3ZA 1T99A 7REQB 5AYIA 1LT8A 1JZ4A 4IPLA 2BV9A 3LGDA 1UR9A 3I68A 1GOIA 2D0HA 1MO0A 3PNZA 4J2PA 2PLCA 4XB3A 4I5UA 4LSBA 3EXSA 1SJCA 1EEPA 4QNWA 2PMQA 1TV8A 3LHUA 3H2MA 3W2NA 1JF5A 5A2CA 3VNKA 3N3MA 3CHEA 2VZSA 2AAAA 3N3TA 4GQQA 1P6BA 4J27A 2GWGA 4P8WA 4HPJA 2YFNA 2JF7A 4YTQA 1LRTA 4PODA 1HX0A 4MIMA 2I5GA 2XH4A 4MNMA 4ACZA 5FOOA 1OHLA 1W0MA 3UJRA 4MMWA 3MP4A 1PIFA 3BLPX 3QHNA 1GKQA 1GPWA 4O1FA 3BVJA 3L2IA 3O0FA 2V81A 4PC8A 1JDFA 5LA1A 1PCWA 3HF3A 1T5AA 4MNLA 2VHLA 4GMEA 3CB3A 4GZ7A 1IEXA 1YRRA 2ZZ2A 1QOQA 1AMKA 1PYMA 3SM0A 3ZWTA 1HGWA 2X1TA 4JAWA 3GYEA 3ZVHB 3A47A 4H9TA 2FQIA 1IEWA 1NOWA 3AXIA 4QISA 1DIDA 1B57A 3PZGA 2QCGA 2OGYA 1QOXA 1XDJA 4I9TA 1RPXA 1AD4A 1RCQA 1YDNA 3H6OA 4FXSA 3WO8A 1PWLA 2JFEX 4QJ1A 3A4AA 1XD0A 1DWJM 3GDMA 4PUWA 3W73A 3VNDA 4A05A 2QIIA 4NZFA 3EWZA 4JTCA 4XIMA 4FLSA 4O57A 1HJVA 1W3NA 3W1UA 4IQEA 1CXLA 3FK4A 4J3VA 3UFYA 2SFPA 4GNKB 4UTWC 2G96A 3LNMA 1VENA 3AIRA 2W6RA 1UIOA 1U5HA 4FNPA 2V3FA 1EQPA 4W88A 1J0JA 1ENUA 3J7HA 3O06A 5IFPA 2WM0A 4Z2IA 2YA2A 2XDFA 4ZSTA 5MHBA 3BAYA 1ALDA 3CB8A 1VAHA 2VGFA 1RR2A 3I7SA 4AVNA 1FKWA 2GZXA 5SWUA 1KM3A 4IUOA 3ITGA 2A3BA 4GABA 4G6CA 4IIHA 4ZQOA 2NQ5A 3WY1A 5A6TC 3AYVA 4C6JA 3RUBL 3ITOA 3P60A 4GY0A 3OB8A 3SGUA 1R46A 3NR0A 3UF9A 2BDQA 3VX0A 1K6WA 1H41A 2TPSA 3QVQA 5I3KA 4L7ZA 1L0PA 4JTHA 2FMOA 1JL8A 4W8LA 3ZLHA 3GDBA 4F2TA 4J4KA 3VNMA 4H9XA 5XINA 2O55A 5CKSA 1NU5A 2NQ9A 1HF6A 1RUSA 3GK0A 4HTBA 2BLEA 1EGMA 4K3ZA 2B7PA 4X0VA 2XIIA 3S1WA 4GLEA 1ZBVA 4YCPA 4EANA 3DC8A 2QUVA 1EBGA 6A3HA 2H9AB 4LS2A 1P6CA 3EA1A 3RDKA 4GGHA 5EMYA 1QAPA 2Z1WA 2WC3A 1RHCA 3UD6A 3G3MA 2VGGA 1DIKA 1US2A 5H6HA 3FGCA 1VBRA 1VYRA 5HOSA 4Y6GA 4JS3A 3WNPA 3BW3A 3UXKA 1OCQA 2FJUB 4RE0A 1XH0A 3U4FA 1TMLA 1OVDA 1A53A 1OK4A 2D2OA 3PSWA 4QE4A 3TOYA 1M5WA 3FN9A 8TIMA 1E70M 1UPMB 4ONVA 2DZXA 4GXPA 4YNGA 3BOXA 3N04A 4IISA 3WCZA 3E0FA 2VC7A 3PZNA 3TAOA 1RQEA 3N12A 4MB5A 2DVXA 1O1HA 4AWTA 3CH0A 1XLCA 5CC7A 1HJXA 3BAIA 3LXCA 3H2CA 3VDGA 3T9PA 4ORIA 4DJFC 2A0NA 1V3JA 1A5MC 5I0DA 3JUGA 4MWAE 1XLGA 2PBOA 1TJPA 2FH6A 1OG0A 4DWSB 1XIFA 3A3XA 4WDUA 2PI6A 4GQBA 3TAKA 4GC4A 4CD4A 3RCNA 3M7SA 1RVKA 3L4TA 9XIAA 3UG5A 4AC7C 3S3GA 4BQ2A 2YXXA 2OR2A 3HMCA 3MS8A 3WX7A 1MYRA 4PRRA 1LORA 4HTYA 2XIOA 3FJ4A 2VDIA 2Y0FA 1XRSA 3WLIA 4C91A 2C0AA 5LHEA 1SZEA 3EDDA 3N6QA 4H6KA 4MUZA 3EX1A 3O9NA 4AMCA 3NO1A 4ATWA 4KQNA 1KA9F 2WOQA 1A5UA 3MZNA 3TYEA 3G6LA 3QFEA 3SIZA 1MXSA 1I60A 4OTKA 1U33A 2PSNA 1JYNA 4GPNA 3IK2A 1PX8A 2OSXA 3GXPA 4O50A 4C6MA 1HP5A 4H83A 3CYVA 5E70A 4LUTA 2C1IA 5CBJA 4N6FA 2ZXBA 3WLPA 1W1VA 3HN3A 4S3BA 4P8VA 6ENLA 4WXYA 5E6ZA 4URIA 4HNVA 5FEZA 1VF8A 2QYGA 1G7VA 2J88A 2Q3RA 1PDYA 4KKXA 4ZBCA 5F1UA 4XVDA 4L4PA 3LENA 3RRAA 1XRVA 5A8OA 4M19A 1ZBKA 1HJQA 1MNZA 3QZAA 4ZODA 4ATLA 1QNVA 3WMCA 1S2TA 2YLAA 3W6LA 1NFPA 1XP3A 4DF2A 1P4CA 2PC4A 3E5BA 1ZJAA 3FJ6A 1CNVA 5FF0A 4XBKA 1FP8A 1EQCA 4A2SA 5I3HA 4C6FA 4F2BA 1QI5A 1H0GA 1H62A 4GZJA 2GQ9A 2GVJA 2WZEA 2Z0IA 3DGBA 1ZL1A 3AIVA 4YVPA 4XZHA 1R30A 2HROA 3CC1A 1YMYA 3NJ3A 4B5UA 4F8XA 1GNXA 2DSKA 4YCOA 3RPDA 5DMNA 1O12A 1HXJA 3VI2A 2PDYA 5D02A 2L5HA 4FI4A 8RUCA 2WC7A 3A6OA 3FJLA 3M5ZA 3KZPA 4JZ5A 3LTYA 3VE9A 2WZHA 3JZUA 4K1GA 2E28A 1DEDA 1IHIA 1LRQA 1GOWA 5BRQA 4GXWA 3T55A 2OZTA 3W1NA 3E6EA 1EC8A 5B7ZA 1XBVA 3BV4A 5FJJA 3T44A 1XM3A 1Z42A 3R13A 1PUDA 1D7KA 2NXHA 1QR7A 5DT5A 5M03A 4XBSA 1M7PA 4GUHA 1E0UA 3W4RA 3B0VC 2QDDA 4XKYB 1UASA 2R24A 1SMDA 4B5XA 1RSCA 3WLNA 2YA1A 3CV7A 1YEYA 3WL1A 2PDFA 4KCUA 2NV9A 1MQPA 1KTBA 1KLZA 4ZQMA 1J4EA 3BAXA 3KTCA 6REQB 1OINA 3GZAA 3M0XA 4KFPA 4XUYA 5CJNA 3DOPA 4BHYA 2WMJA 3VGGA 2A3AA 3HBLA 3NOEA 1AG1O 3BJTA 3AYTA 3OLEA 5HULA 1JDAA 1HZYA 2CZVA 7ODCA 1U30A 3GYCA 2VZVA 4WR3A 4FLRA 5E6YA 2W62A 1K9TA 3MVTA 5EYWA 3PSVA 1E6PA 2JEQA 5G4HC 5FJRA 1TE6A 4AVFA 3LCFA 3DX5A 2OLAA 2JF6A 4ZB2A 2XWEA 4JIQA 3VC6A 3NCOA 3TSDA 1TVNA 3QZ6A 1YX1A 4ZO8A 3PZOA 2YYTA 1S5WA 3ARSA 4HNTA 1W91A 1E9YB 1ONXA 6CGTA 1JDCA 4I7WA 1YNPA 1F4AA 4Q3MA 3TXZA 3MO7A 2PDBA 3SBFA 4DO7A 2AOSA 3E96A 4B91A 2Z1BA 4Q4PA 4YWSA 5BNKA 3STEA 2POZA 3SQMA 3NL5A 2NXGA 5RUBA 1LP6A 4IOTA 4ZCWA 3URNA 4M6PA 3IS4A 4PBEA 4J3UA 1R7AA 4B15A 1OABA 1K9EA 4XISA 3VGFA 3NQBA 5FIPA 2RJHA 3PF3A 5JBFA 3THDA 3KP1A 2DZVA 4KFNA 4A3UA 3VDAA 3PWIA 1DE5A 4DM1A 4ADSA 4LCQA 3THQA 1V3KA 3OODA 4XAYA 5ABGA 5EMUA 4NU7A 4PMJA 3QV6A 1S38A 3D0CA 4Q7IA 1TPB1 1VRDA 1AJZA 1V7YA 3IARA 1JYXA 1TPUA 5AN7A 2PRLA 1K1DA 1WA3A 5T8GA 2YLLA 3TH6A 5I23A 3ZT7A 2YKKA 5HINA 3URQA 3STFA 2QW5A 1XISA 4ZB5A 2J8TA 2NVDA 1EHAA 3DCPA 1LM1A 4UUIA 1H7NA 1Q7ZA 3FYOA 1ONWA 4DBWA 5BWFA 4IXHA 2FB3A 5I07A 5C9RA 1XSIA 5AHMA 2X41A 3L4ZA 4JQ1A 3W7MA 2F6KA 4F48A 3BAKA 2XJ7A 4UTKA 3CHVA 2ZFAA 3RK8A 5A6LA 3HG2A 2P8CA 3I4KA 1JRBA 3ZVIA 3T09A 4DI9A 5T26A 1DWHM 4X0NA 4XZNX 4G1NA 2EG6A 5A6AA 5HQLA 3R2GA 2VENA 1ISXA 4WF7A 2OKTA 2BTMA 3VFLA 1KM5A 4GYPC 1BSLA 1EC9A 1JGIA 3AMGA 3OQEA 3GSMA 5D4YA 1NP0A 2QR6A 1UWSA 2WMIA 4LS0A 3VIHA 1TMHA 3GG7A 5DCEA 1C93A 1RVGA 4O4VA 1I0BA 4YTRA 4S2CA 4M6UA 2QMKA 2VCCA 4DZAA 2ZTJA 4ERGA 4IH3A 5DX7A 3CGTA 1SUXA 2WC4A 3JVAA 3WELA 4GGBA 1HVQA 3OHIA 1N7KA 2G37A 4RDYA 4ML4A 3MW7A 3RITA 1KR0A 4W5UA 3FXGA 5F7UA 3PZVA 2Z29A 3WLRA 1JD7A 1KD0A 2Y7GA 2B0MA 2WZTA 3PZ9A 1ZSXA 1S2WA 1ZQ5A 1HO1A 2DIEA 4LOCA 3ALGA 4ZFMA 1B9BA 4EXBA 3F1QA 3FEQA 5HMDA 3AAMA 2Y7DA 5ECUA 2V2HA 8CGTA 5F2LA 2CLMA 2HVNA 3KWXA 4AFYA 1B3ZA 4V33A 3I65A 3GNRA 3WLHA 4AY1A 4BI5A 3EGJA 4DUWA 3LM7A 5CZTA 3VD5A 3ABXA 1EXBA 2YB1A 4LAOA 3T42A 3NTYA 3SRHA 1E9LA 4J40A 2WSKA 2GYIA 4BJHA 5DELA 3B97A 4MNJA 2REQA 3M64A 1LLZA 1BF6A 4IIBA 1ITQA 3TN4A 2J47A 4MOZA 1ZUAX 3M0YA 1FOBA 2PCQA 4HHMA 1XGDA 3QW4B 4M7TA 3FIGA 3IWPA 1QNSA 5A6JA 3BUVA 3QTPA 4XZMX 2BWGA 1OGBA 3G8RA 1QUMA 4JOMA 1HW6A 3ZMRA 1M41A 3OQ8A 3FAWA 4E38A 3PUGA 2YBUA 1FCBA 1B1YA 4IXXA 2YX0A 1WKYA 1EJVC 4GIEA 2EGZA 5D2WA 3HO8A 3TTYA 2QV4A 3RM4A 1UC5A 5C7VA 1EF3A 1DJIA 4PB3A 3PZMA 4Z08A 4TXEA 4WJEA 5D9OA 3UEQA 3NQCA 4UQEA 3TJLA 1K7EA 5HR6A 3MJMA 5I3JA 2QCEA 5G5IA 3SIMA 3UR2A 2VZUA 3PTKA 3CO8A 3CIXA 2FGBA 2ABBA 1UP3A 2OQLA 3V18A 3IIPA 2R94A 1RALA 4X2PA 3I6EA 1QPKA 5IDIA 5F2MA 1CXHA 3AWOA 3EWUA 4E4PA 3ITXA 1H7WA 3W88A 3GZ3A 3FW6A 4AIBA 1RCOB 5AYYA 1PYFA 3AS0A 1J8VA 3WQDA 2J13A 3VM5A 1ZP4A 2A7NA 3KOXA 4UCGA 4E4UA 3MP5A 4LH8A 2ZZ6A 1Q45A 2DUAA 4M5PA 2BY0A 4UFJA 4GUGA 3KBVA 4FX8A 4IL2A 4K39A 1XRFA 4Y8FA 1XHGA 2OX1A 1JXJA 2NX3A 4NZ3A 3CL7A 1B31A 3T05A 1EJ7L 1NOFA 1PKNA 2OX4A 2VOMA 4TX8A 3UWZA 4MFEA 4JX6A 2IQTA 2R91A 3HPFA 4HNLA 3RJXA 4GINA 1EX5A 2VD8A 3GTXA 3E12A 4H9MA 1WZLA 3OVGA 5U4NA 3A22A 4JKMA 4DJEA 2XH2A 4CU8A 1BG4A 2RH9A 3UY7A 1VFLA 5A94A 2X8RA 3LHWA 1JCTA 3APGA 1GGOA 1ISVA 2A3EA 4RXFA 1SM9A 4MVAA 1IGSA 3W02A 2LLEA 4OE7A 2IW0A 4HNCA 4JIIX 4B3LA 1E3ZA 2XGZA 5I79A 5HXMA 3WH9A 1E6ZA 2EAWA 5FJPA 3HGSA 5CBBA 1QNOA 5JH1A 4H41A 2WVUA 2FPVA 4FPSA 1GVYA 3NO3A 1D7FA 1UUMA 5CJ5A 1REQB 4F3HA 5F2GA 3IVUA 3LBMA 2OLSA 1R7OA 3CAKA 5M5DA 2XH7A 1E3XA 4RV8A 4W8AA 1QCWA 4YU1A 2HVOA 4YS1A 3W84A 4M6VA 5I7GA 4WKAA 3GE7A 1ZP3A 3WBYA 2NQZA 3SQSA 5G1YA 3JW7A 3FAXA 4H2HA 3ARRA 4Q8QA 1FWTA 2ZOXA 3F2CA 3GXDA 1X1NA 3XINA 1EL3A 3W3OA 3UG3A 1EOKA 1KRBC 4DI8A 1V7AA 4ZE5A 4TOQA 1GCYA 4DUVA 4ZEPA 3KBMA 1HKVA 3M6DA 1JUEA 2VFHA 3M0IA 3CPGA 1N8IA 1MMFA 1Q6EA 4Q4MA 3UA4A 1NQ6A 1J01A 4GJJA 4EPKA 4X2RA 3QQ0A 3MUIA 2XFFA 3RGTA 1C29A 2BOEX 1A80A 2PDQA 5EU9A 2J24A 1BEUA 4DO4A 3F7JA 5B7YA 3UXIA 4L4MA 1J96A 5T9BG 1WYIA 3MI6A 4FXJA 1SO5A 5C2GA 2Y1HA 4AWEA 3P80A 5M2FX 3GVQA 4CQ8A 2E6FA 5D2YA 4KGJA 3GBDA 4Z1CA 3NSMA 3BLOA 1PVNA 1IXPA 3QGAC 2QJJA 4R88A 3LG3A 2DVUA 1DE6A 2WZIA 4PUKA 3RO8A 3KVMA 2FPYA 2YW4A 1QJWA 2QMJA 3LOTA 4P8XA 1AW2A 4RE4A 3QM3A 2XFRA 3AYSA 1GT8A 1R38A 3TC6A 1K8YA 1QO5A 4Q8UA 1TPEA 2GWNA 3DC0A 5HR7A 4I7VA 3V75A 4G2DA 4DO5A 2QUNA 3W22A 3UZXA 4ZTXA 2PP1A 2W67A 2XIBA 3GXMA 1S1PA 4C7FA 5FACA 2QPUA 2ISVA 4RXGA 1XFCA 1XI3A 1MW3A 1QBBA 4GYPA 1D8CA 3AS1A 3O05A 5C9UA 3M43A 1A0CA 3DFHA 4A8NA 5EFFA 3E0VA 1EO5A 1W9DM 1WBJA 3WQFA 3R8GA 4WD0A 2Q8ZA 3RM9A 2H8ZA 3GTHA 2ESCA 1UKOA 4OOZA 5AC4A 3KCOA 4DXKA 3BXWA 2F61A 3W2MA 3ZJ7A 3H2EA 3U8GA 6REQA 2B31A 2HNHA 3OLIA 2FLIA 2D0GA 3MTWA 1UH2A 3PPGA 1LOQA 4J28A 4NF7A 3M5VA 7A3HA 1ISYA 2YPIA 4AMAA 1LT7A 3ABRA 1IZCA 4FB7A 3IPWA 4LUJA 1FH8A 1V93A 2KAUC 5DLCA 4L61A 3PZUA 1FX6A 1S46A 1JYWA 4LF2A 1B54A 3BCDA 4S3EA 4RNIA 3B9AA 4BF5A 4CQAA 2V2DA 1I2QA 3SCNA 5FL1A 4IG2B 5DXYA 1JUBA 2ZX6A 3R5EA 3T2PA 3PBMA 5HUPA 1DPMA 1BWKA 2WKGA 3R11A 1GG1A 1A5BA 2A4AA 4GQRA 4IZGA 2YCIX 3EWDA 1YQ2A 2AGKA 3KHDA 2VRKA 2VM8A 2ZX7A 4PBFA 2O0TA 4WIWA 4XSLA 4D6GA 1EYEA 1ML1A 1JPDX 1SMAA 1XCWA 3TC7A 3OHMB 4QXIA 1QRQA 2V3GA 1G4EA 3WDIA 1U1UA 4H01A 1N8WA 1X6UA 2YL5A 4AF0B 4OBRA 1BYBA 5LSMA 4KS0A 1EJXC 4DNHA 3TSBA 1SZGA 3GM8A 4K68A 1XBYA 3W0KA 4GCAA 3BMXA 3KAOA 2WCAA 4Z0JA 7CGTA 3MANA 1HN1A 1MW0A 5CCZA 4CN6A 2EPHA 3ATZA 3EOLA 1PIIA 5HJXA 1SZNA 3BG3A 3OA5A 3W37A 3B40A 3EA2A 3W83A 1E4MM 2Q3OA 5CXPA 4YN5A 3V5CA 3VUPA 3NSNA 1AUSL 1UROA 2DP3A 2R1MA 4FOUA 2O7SA 1W56A 3T4CA 3DYMA 4HHHA 1E4LA 2CZ5A 3S4TA 3EOEA 3WDHA 3W86A 4RW5A 5BU6A 2JQXA 3WBWA 4GRSA 1Y8BA 5LXEA 1KGWA 3WD1A 3O07A 1EDTA 2W0UA 4RL3A 1OT2A 1RJQA 1XR2A 2C3ZA 5IBXC 3AO0A 4YMZA 2XIQA 5CBIA 3TW6A 1LL4A 2AMXA 1X96A 2CLFA 2RUSA 4WCJA 2A21A 3VPLA 1PWMA 3EAUA 2WBGA 4J5NA 1CPUA 2QDEA 4O4WA 2IKHA 2G4FA 4O12A 2E25A 4K8EA 3FV9A 5C70A 3P93A 3EA3A 3KUMA 4UMBA 4D1IA 1E9ZB 1RQHA 5EBAA 2CLPA 1TWZA 3W7JA 3SFKA 3F5LA 3HQPA 5TBOA 4AZGA 1R86A 5CLTA 2R1PA 3NQVA 3S2JA 4HCHA 4NZJA 3QV7A 1YYAA 4YHGA 2DSWA 1XRTA 3TUUA 1XYZA 2GJLA 4H8VA 5CSSA 2ZDSA 1XJBA 3VX1A 3UETA 4NRSA 1GHSA 4DELA 2X2YA 4GJIA 2V3DA 1I0DA 2A85A 3W27A 2R1LA 2FTPA 2ZX9A 1ZRQA 1CW2A 1NJJA 3E0IA 2YL9A 3SECA 1JDDA 4HK7A 1HO4A 2FZMA 3EBVA 4Z1AA 4PMQA 4JL2A 4MUPA 2FHBA 2HPIA 1VPQA 1M04A 3G8EA 4RR4A 1FHUA 2P8BA 2P10A 3LNPA 1A5OC 1FY6A 3ZSSA 1GG0A 4V27A 3S9YA 4GA8A 1KC7A 3NURA 4U31A 3UXAA 2FKPA 3MSRA 2HNEA 3RR4A 3GAYA 2B7QA 1HKKA 2WXDM 4HHLA 4DLMA 1XIGA 5FJIA 3GC5A 4WGHA 4D8LA 1XICA 3MDUA 1FWSA 3LRMA 1VIWA 3MCNA 4LCSA 3HV8A 4L9XA 4BF7A 4WY0A 4ASTA 2ZA1A 2A7PA 4Q32A 3SCUA 4KCTA 3PY2A 5C6MA 2DEPA 3CO4A 4XBJA 2E8ZA 2PEVA 3T0CA 1H1YA 1NWSA 4MGGA 3MUXA 1BRLB 1SSDA 3D5HA 3ALFA 1R9ZA 1ISWA 4BWLC 1EEXA 3HFYA 3AIWA 3BLKA 3V7PA 3Q65A 1V02E 3WDRA 2V5DA 3N9RA 3ABSA 1LBMA 1XIHA 2QCFA 1GVOA 1GKRA 2BHUA 2OYMA 2HDJA 2UWFA 3GDLA 3C0QA 2OWCA 4IPJA 4FNTA 4IF2A 3WUFA 2PDMA 3JS3A 1QW9A 1T41A 2XVPA 3CZLA 3L4WA 3VU2A 3GVVA 3UZJA 3EB3A 2VT0A 3ZZ1A 3PZIA 5FF7A 2HMCA 4I9MA 2VX4A 1QFEA 3GVGA 4NILA 2DZPA 3G1AA 1XGZA 3CHDA 4BEUA 3C2VA 2FFIA 4E8CA 2VX5A 2BY2A 3R0KA 4G7EB 3E2RA 4TV5A 5G4EA 1KCKA 3EWXA 5GVJA 5M1TA 5I3IA 1QPQA 2CU0A 1ZBWA 7ENLA 2A6NA 3CQ0A 4H4IA 2VGIA 1QK0A 2W63A 4PUNA 1AH3A 4I3GA 3T8LA 4DX3A 1UR8A 3SJNA 4AEEA 3A3WA 3DENA 3AIEA 3NUKA 3MZ2A 3N11A 3N2CA 5C71A 1Q4NX 4IMFA 4JN7A 2FGZA 2JALA 3TSMA 5A8PA 2Q02A 3TQ0A 1OSEA 1UCWA 2WHKA 2J7GA 4MZ1A 4KFOA 5TF0A 4NAFA 4JTTA 2O7QA 2EJAA 4W7UA 1J0YA 1OF6A 2BGQA 1JQXA 3R43A 1Q6CA 2GDUA 1C8XA 1R0MA 2CXGA 5DMLA 3EWCA 4A3QA 3PB0A 3QQWA 4HA1A 3CUHA 3VKBA 4AYGA 1C8YA 5HANA 3LGGA 2PCEA 1IWAA 3BLFA 4K2SA 2G3IA 4QFUA 4PGLA 3R7MA 3G6MA 5CSYA 3KDNA 4ROPA 1A3XA 1DJYA 1VHCA 1TV2A 3OIHA 1EHNA 1VJZA 1YKWA 1REQA 3MMUA 4P7OA 1K03A 3NQ6A 3FHAA 1VLWA 1OC6A 4O13A 3PP7A 1WX0A 3NQMA 4ZO7A 1S3HA 1Q7QA 1FWJC 3B0UX 3W7GA 1IF2A 2PFHA 2P3EA 5DRIA 3GS6A 2AQVA 2Z26A 1UWAA 4AZCB 3P5ZA 4JN6A 4XQ6A 1PX3A 2J66A 1RJRA 4JDBA 4NJJA 4BK9A 4UTJA 4FOJA 3SW6A 5HQEA 2QF8A 3BLDA 3O0KA 2TRSA 4H9UA 4HZ6A 2HTMA 4PTXA 1JPKA 3UESA 4U2ZA 2E8YA 1S5MA 3UP8A 2NX1A 4HMEA 4CVUA 4PB5A 3VIGA 3VINA 2D73A 4GI4A 4XZIA 3W1PA 2PA6A 3LMYA 1B90A 3FY1A 3W7KA 3H54A 3M0KA 5CPLA 1XDMA 4MSSA 4IGNA 3BAJA 5AYBA 2WSPA 1JI2A 1FXPA 1YADA 4IP4A 1CIUA 5A2AA 4HNUA 3TEVA 1E6RA 1M9HA 1X8CA 3LERA 3AU6A 3JR2A 3WMSA 3SY5A 1JPMA 2WM1A 4AX7A 1TZ7A 1Y65A 3CV1A 2E77A 4O1BA 4IIDA 1JZ6A 2XVKA 3KCJA 4DQWA 1DVJA 4IMDA 5EKYA 4K6AA 4UR9A 2J75A 1J6PA 3KL3A 4N42A 1NDZA 5DBUA 3D3AA 3VGDA 4S2BA 1KM1A 3S9ZA 1ADSA 1OIMA 3CEPA 4KWWA 3CUFA 3B05A 3UGRA 3TOPA 3R0DA 1IEVA 1SVDA 1IV8A 3WQ5A 1BTMA 3U5YA 3A5FA 3GVWA 3RXZA 4KW2A 4JBRA 1CXKA 1EP1A 3DG6A 4ICMA 1K4GA 2Q09A 4JTGA 4C6OA 3LUTA 3JZEA 2PTZA 4O1AA 3VMPA 4A6GA 5FEPA 3L0KA 3MUZ1 1MXDA 3DKLA 4IIEA 3PR2A 4HB7A 1WZKA 4ERIA 1ZCCA 3NZRA 1MUMA 3TZNA 1Q66A 4PULA 3W70A 1JNDA 3BSGA 4UMCA 1MEWA 4GQ0A 3FDKA 3H24A 3M9YA 3N17A 3LCXA 3D46A 3RX4A 3RU6A 3KRZA 4GOAA 3HA1A 4ZOAA 1FUYA 3DYPA 1NVMA 5BU9A 4M6QA 1J9YA 2FZ9A 4HA0A 1JAEA 3QTGA 2R14A 1H61A 2BP1A 9CGTA 3NQFA 1LWHA 3NXLA 2GGEA 3S1GA 3ABOA 1VFTA 3N6JA 3B8DA 1WZAA 2UY2A 3EPNA 3MC5A 1BXCA 3PTQA 1OB0A 2IXUA 3CHCA 3W7CA 5D09A 3KOWA 1RD6A 5DFAA 3OOQA 4QR6A 3IJ8A 2V67A 4AD0A 1ZNNA 1UUQA 4AH7A 5CAHA 5IHRA 2XSBA 3ZR6A 2OGJA 3L4XA 4GO9A 3P74A 5AB3A 4Z42C 1EF2A 4C1NB 4FK9A 1H63A 2VYOA 5D8WA 2VUNA 5JVLA 2ZZ3A 3QRHA 1WO2A 4P2VA 1UZ4A 3PTDA 3SUUA 4ZE4A 3EDKA 1WAUA 1LOSA 3GVRA 2QAFA 4O0KA 1QASA 1Q6OA 2D3NA 1UZDA 4LAKA 1NDYA 3PHAA 4AF0A 3GR7A 4RZ5A 4KGLA 3GHRA 2NUXA 4MZ8A 3H21A 3N2TA 3PVFA 3WQOA 1GVIA 4NY2A 4HPNA 3R58A 1Y7VA 3LRLA 1J0IA 2A3HA 1VCGA 2I7GA 3WFAA 5IM51 4UR7A 2PTWA 4FS9A 2OQYA 1GUVA 4EPDC 5IRPA 4IQJA 4FEZA 1JCMP 2X0SA 3U2EA 2Y6ZA 3G1HA 3E2QA 2OYLA 4FAMA 3MB9A 1TVPA 3GU1A 1L6GA 3H4WA 3SRDA 4AAJA 2Y62A 1S1RA 5A6KA 1PB0A 2UZ9A 4NXSA 3S1XA 1FRBA 2AQWA 3V5OA 2YDSA 3QKZA 2VI0A 3L5MA 1FWAC 4DBUA 4ZQRA 2VOTA 3H4GA 4LU0A 4WDXA 4H7VA 4HK6A 1W3LA 1NP2A 2CLOA 1V03A 4KESA 2ZUWA 2QCMA 5CC6A 3PNUA 4NP7A 2ZBTA 4K37A 1MW1A 1TSIA 1HJSA 3F4VA 4UFMA 1XFBA 3NPUA 3PN8A 5D9PA 5LNWA 4AVOA 1F3WA 1AVAA 2FTWA 4KRUA 2E67A 4OVXA 4Y9PA 1OC5A 1H7XA 2I17A 1E1CB 1RK5A 4Y2WA 2ZUTA 4JTJA 4R7OA 5HDRA 3TMLA 2GVGA 4PYSA 1OK6A 4DZ5A 1ZJHA 3VIIA 1F6PA 2BGNE 1KM6A 3QLDA 1S5NA 3QN3A 2OYKA 1UR4A 1V6UA 1OD0A 1PDZA 4Q22A 5DT7A 4UQDA 3TP4A 1ONEA 3VFCA 1KM4A 1UJQA 4B2DA 4A2RA 3FKRA 4WOZA 2VEKA 4D6JA 4LEFA 2WQDA 5I2UA 3BGJA 3S83A 3W6YA 3GNOA 3IIVA 1OZQA 1EIXA 5CPSA 4KCVA 3W7NA 2V2CA 3GTFA 1LL6A 1FBAA 1B3YA 3M0JA 3V35A 4G9PA 2ZRWA 3NQ7A 1TRDA 3QHOA 3SCTA 5DMMA 4D8AA 4C6QA 3A4WA 1EC7A 3G24A 1POKA 4POCA 3ID7A 1DTNA 1QWGA 2AMGA 2Z28A 1R3WA 1VC4A 2OPJA 1IGWA 1SW0A 4Q7NA 3MO4A 3TWAA 4B9YA 2ALRA 3UVAA 3KBJA 2VRQA 1SPQA 3MY9A 4LAZA 3Q37A 1V6YA 1BPLB 2AKMA 3TLQA 2QJIA 2PWDA 4KWVA 1KBIA 2FYMA 4F0LA 1PL9A 3A3HA 3URAA 3UU0A 2PWHA 1KV5A 1RP9A 1XL9A 3DBNA 3A24A 4AHQA 1K7XA 2B4GA 4GIYA 3BOLA 2HQAA 5FSDC 1MUCA 3GFXA 3F03K 2E6YA 4TTUA 1XYMA 4ZFCA 1E40A 4ADUA 3VILA 1UR1A 2J78A 1FWIC 3HPZA 4GIRA 1P0NA 1JJKA 2YOCA 4TO8A 1IIHA 4IIFA 3BSMA 1BWVA 4KRZA 1UA3A 2ZRYA 4TUFA 4BY3A 2VGBA 2B7NA 3UWWA 3WQ8A 4P7NA 1PTAA 5A69A 3IIOA 4CVWA 3SCPA 1PPIA 2J27A 4XUGA 1G5AA 2CBVA 2PE4A 4OU1A 3N29A 4W7WA 4XSMA 3P8IA 5AHNA 2BVWA 3WDJA 4GZEA 1N82A 3IV8A 5BXPA 1IQ8A 3GNXA 2QJMA 3LPGA 1QTWA 4DN1A 4WSJA 2G95A 2R9RA 3L5AA 3B0YA 1CB2A 5BRBA 4G7EA 1FH7A 3H2OA 3LX9A 5E0KA 4HA3A 3BO9A 3VZZA 2Y8UA 4I7UA 3CUJA 5CJMA 3TTEA 1KXHA 2OT1A 2WW5A 1VB9A 4CNSA 2EG7A 2DPEA 4UOJA 3UR8A 3PG8A 4C90A 1I1XA 3KLLA 1ICQA 3NIYA 1DJZA 4Q4OA 3EB2A 3EWYA 1F2JA 1F4HA 3SCQA 5GJPA 4QE1A 3EB4A 5AHIA 1TR1A 2WMFA 1JNEA 1WXYA 1TTIA 1XLMA 3WF2A 2FZBA 4FO4A 1W9XA 2BY1A 4Q6JA 1Z41A 2F9RA 4MZYA 4EIVA 3W1RA 2ZADA 1GWJA 1YIXA 4LXFA 1JZ8A 2I16A 4Z1YA 3B4YA 1AMYA 3A23A 4DJDA 1ECEA 4O16A 1VFMA 4P8UA 4MADA 5BOFA 4L4LA 2BXYA 4JTRA 3DFYA 4LV4A 3FFSA 3NPWA 1UR0A 5DCDA 3IAQA 3GHSA 1SSGA 3P5YA 2BX7A 1M6JA 2CEQA 2WSQA 2WHJA 4NL1A 2V5BA 4RNHA 4LC6A 4LRTA 3QBUA 5HWNA 5AYXA 2Z1SA 5H8PA 3WQ4A 3TN6A 1VEPA 2WSRA 2WYSA 2XTKA 1KXQA 3C8FA 4AD4A 3AUOA 1OEPA 4GY1A 3T0BA 3SUTA 3GAKA 3S6TA 3ES8A 3S1VA 4E6MA 5REQB 1LL7A 1UMLA 3N2BA 2JIEA 3T6CA 3EX4A 2E0PA 3VKJA 4PTNA 1YDOA 4JPGA 5H8MA 4HNOA 2D20A 3FX4A 3VIOA 2QJHA 3B8SA 2NZLA 4I8DA 5HWMA 2YDAA 2JIWA 2BVTA 1U2YA 3TVAA 3IJIA 4UQ9A 3E2SA 4Q7BA 4QG6A 1LUCB 4B90A 1O6IA 2X16A 1W9VA 2PLKA 2CFFA 3OVRA 5JXQA 1B4KA 5CSRA 4NNCA 3O6AA 1QW8A 2PDJA 5KZDA 3N25A 3QYQA 1PJ9A 1YTKA 2VEFA 1P7TB 1J5TA 3FVMA 3RNDA 3AIQA 3CLWA 3DYOA 4MJMA 1Q6QA 3W7EA 3NXFA 4KWUA 4R33A 2OOGA 1RBOB 3GU9A 4CN1A 3MSDA 1CBGA 4FZIA 3ZJ6A 2CLLA 3ES7A 1DP0A 4R5EA 1JUKA 1V0MA 1S39A 1PZ0A 5EB8A 5J5DA 3HGJA 1RQBA 3TC3A 3C2EA 1N8FA 4GBUA 3SR7A 3A4XA 2ISFA 1EIBA 3GD6A 1TPC1 4IMGA 2YDQA 1VH7A 1QI3A 2IPGA 1QWKA 3MT1A 2HEJA 2CHOA 4YTSA 2BBFA 2EBNA 2D23A 4J1OA 1EGVA 1QPRA 3E02A 3HGOA 3K30A 4IFKB 3L0NA 4GI8A 2YB4A 5MKGB 1EOMA 1FKXA 1J0KA 2D2JA 2DZBA 4AXNA 4QBXA 4AHOA 5IFTA 1HNYA 5T91A 4GG9A 1IEIA 3CZKA 4O28A 4B5NA 1C7TA 2VR5A 1P0BA 1VFFA 1W1ZA 2G50A 1W1B1 1BVNP 2OFJA 3SGGA 4ZQPA 2GGGA 1FHDA 2OEJA 1JCXA 4JDYA 4DJED 1TPFA 1ITUA 1DKWA 5DY2A 4QJ5B 5D30A 1IXOA 4LC8A 1P48A 3AHXA 1QNQA 4JTKA 4AXKA 4BCEA 1XF0A 3B06A 1FDJA 2Z24A 4Q4RA 1PKYA 1UKPA 6TAAA 4BEQA 1TV5A 2Q8XA 4IP7A 3ZXWA 3KOYA 2HZGA 1QT1A 1A3WA 4JX4A 3M0LA 4M51A 2OSWA 3VNLA 4PTMA 2IUZA 4J3SA 3V4BA 3SRFA 1KBBA 2V8ZA 3WLSA 1UC4A 3BL3A 1W5OA 5ABTA 2WVVB 4KETA 1KCZA 1L8PA 3PZTA 5B80A 3OEXA 4HZ7A 5XIMA 3FKKA 3L5LA 1L6FA 1SO6A 3N15A 4V1YA 2DT0A 4O0QA 4PFHA 1UG6A 3SADA 4Z2KA 2FVKA 1DJNA 2UBPC 3QGKC 1HP4A 4XV0A 4US5A 5G2IA 1T7LA 4AY7A 1FCQA 3LV5A 3WQGA 3AMKA 4H8HA 2E9LA 1VEMA 4QITA 3QMRA 4JFWA 4GC3A 3FDGA 2ACUA 3S1UA 3ISIX 3E0WA 4QQ3A 4HD5A 4OHQA 4K7YA 1X39A 3ZO9A 5CC5A 1FDYA 2X05A 5HQMA 2OELA 3IACA 4ENLA 3P84A 4J3ZA 3L68A 5C5YA 4IPPA 5EL1A 1JZ2A 1KRMA 2OU4A 4GVGA 1OYAA 2G4JA 1IZKA 3U6WA 2WHMA 5I3GA 1P1MA 4IJCA 4OUIA 4IL0A 3M7WA 5KINA 4UWMA 1XUUA 3ARZA 4Z17A 4M8UA 4PB4A 3OGVA 4PUMA 5GQBA 5E5CA 2J7DA 2CBUA 2DW7A 1W5MA 3REQA 4WKHA 2VELA 4GCXA 4IPIA 2PTYA 3WH7A 1YBQB 3RHGA 3AALA 4TVUA 4CNOA 3ZLGA 4TVDA 2PC8A 1EPVA 3OVPA 4MYXA 1BXBA 3QY6A 4JNMA 2WLYA 1V8EA 1E9IA 2VEGA 4G8TA 1EWDA 3A9BA 4WJ8A 5PTDA 1ZAHA 3GG1A 4HBKA 1NEYA 1VD6A 2VD9A 3UXLA 1OFOA 1R6WA 1OC7A 2O9OA 4LYKA 2EO7A 4HHPA 2NVCA 3OLDA 4CNTA 5DMYA 4NNBA 2QCDA 4Q4QA 1YE4A 2J9ZA 1G69A 3HPAA 3QQ1A 3LTPA 2NX9A 1QHZA 1E4NA 3QY8A 3K4AA 3ATYA 2QDHA 3W75A 1KM2A 2DZWA 2J79A 1E6SM 2F7FA 3BPWA 4Q4SA 3B04A 3VCCA 4C1KA 3M1ZA 4H8UA 2JK2A 4CN4A 3L4UA 4BA0A 2R1KA 3AIUA 4JEQA 4BR1A 1YPIA 4QG8A 3A21A 3SN1A 3OZPA 2AKZA 4QHRA 2VC9A 2EXOA 4RKAA 1HUVA 1OFAA 5E1QA 1Q5MA 2FZDA 1BTCA 1W3TA 2PTDA 1KTCA 4HMCA 1KBKA 2NWSA 3MQTA 4LAMA 3T0DA 1V0KA 4PA8A 3B9NA 1GQJA 2GGJA 1RY0A 3M5XA 1RBAA 4AZIA 1PAMA 1WKFA 4HPHA 2I1OA 4UZSA 1Y5WA 3HQOA 1VFUA 4UXDA 1LBFA 4PMXA 2ZUMA 4X22A 1FH9A 1HQTA 4C6BA 3CZJA 4HA4A 1YNYA 3COTA 2PDIA 2XVLA 2PGFA 3ARYA 4MNKA 5CLWA 4Q8MA 5F4WA 5J8LA 3B8WA 3B8UA 2PBGA 2OWXA 1WDWA 1KXVA 1CGYA 1SFSA 1R8LA 3JRKA 1MFUA 3NPVA 2C16A 3GIPA 1QMLA 1V6XA 2J25A 3EYPA 1CWYA 2WMGA 2WVSA 3RRXA 4RW3A 5CG0A 2VUYA 1NY1A 3C2YA 2QIWA 4N0RA 3U57A 1TB3A 2X1IA 4NZCA 5CC3A 2DT3A 4ZOEA 3ZR4A 4GZIA 4B5VA 3W7HA 1XIMA 1SQ7A 3NVDA 4RPPA 3RFAA 1AK5A 1BF2A 3FYYA 3NFUA 5BROA 2W61A 2EPLX 2YXGA 2BXVA 3R0UA 3S46A 1M3UA 4O18A 3W9ZA 2A3LA 4MWAB 2V63A 4C5YA 2DW6A 4Y9MA 3TN5A 1IXQA 3QKEA 2CLEA 4HMNA 4R34A 4IFRA 1TCMA 2Z6IA 2WWCA 4JTLA 2OZ3A 5HJYA 4MKVA 3ZJ8A 1TZZA 2HK1A 4B5SA 4C7GA 4KEVA 2Q6ZA 1MQRA 4W85A 2PDLA 4L9YA 1ELSA 5FSEC 4NUWA 4I6VA 4PMUA 5HNTA 4REQB 4UOQA 2E9BA 2W3ZA 4NJGA 4FHAA 3ENLA 4ATDA 3NZGA 1GQKA 1LQAA 4D6EA 3S9IA 1UKSA 4D8ZA 3NQ2A 1C8QA 4GYFA 1I9CB 2V82A 4W89A 3EXRA 2GVLA 1ODZA 4J3TA 3LLFA 3LQLA 1F7BA 2XSAA 1FWFC 1EUNA 3FCPA 4LWWA 1VJSA 1FWGC 4EE9A 2NLIA 2OLHA 2FHFA 3F4CA 3SY1A 1Q6RA 4XZWA 1TCDA 3ITTA 1MZHA 3IGHX 1X1OA 2YCJA 2VFEA 1V6VA 1NTHA 4Q33A 2CPUA 3G0XA 1XBXA 4XD6A 1K3UA 3BCFA 4IMEA 3RILA 4N4PA 1E4IA 4AW7A 5LGXA 3CWHA 4ICNA 3DEQA 3CNYA 5HPCA 1XYBA 2IPWA 4D6CA 1PCKA 3SDOA 2EKCA 2VQUA 1LTDA 4PCSA 2VQTA 4W93A 3MKCA 1VPYA 2I9EA 3DGRA 1EZ2A 3WENA 2QGHA 2PGEA 1EDGA 4ZO9A 4DBSA 4L4OA 1ZU8A 1TG7A 3WNMA 1HFBA 1FFQA 1E6QM 2RJGA 1XXXA 4Y9AA 3VD7A 1W5PA 1EJWC 1R3QA 4O11A 2YA0A 4UCFA 1SFLA 3GR8A 1XV8A 4HMDA 2NLYA 4O1CA 4DF0A 4HJWA 3BARA 5CH9A 3ZQ9A 1XUZA 4CEUC 4DEFA 3WN6A 2YCLA 3L67A 3ME3A 3CZ8A 2PDPA 3BZGA 1KFLA 3SRKA 3A12A 1X7IA 4P7QA 3Q58A 4XTDA 4I5RA 1KW1A 1JCLA 4EF9A 3MHFA 1T40A 2PP0A 3O63A 3SI9A 2CZEA 1GHRA 2DT2A 3EZ4A 4K1WA 1QPOA 1UWIA 4PMRA 4PH6A 1UD2A 4NZ1A 1XLKA 1EYWA 2C91A 2ZZ7A 5A8QA 3L12A 3PC0A 3VKAA 5KZ6A 4FA3A 2RDUA 3WD3A 4IM4A 4DVOA 3WD4A 3G0SA 2BZNA 2VDHA 3P3BA 3T08A 3GRIA 2YXOA 3KRBA 1EA9C 1ZAJA 4HKPA 3TTQA 1C3FA 3USZA 3IJLA 1G0CA 5HAOA 3DHDA 4B16A 1FHVA 2CHNA 3BJSA 3CASA 4M24A 3ICJA 2VVNA 2OWWA 1O66A 5FAJA 5I3DA 5AHLA 4NX5A 3CIVA 3C5QA 2E6DA 4JFTA 2PPGA 5AZ0A 4FF5A 3U2CA 2ISSA 2X09A 2OOFA 2J7EA 3CT7A 4QS6A 5MKGA 2BOFX 3FXYA 1Q13A 3WLMA 3WEMA 1W5QA 2ZIDA 3RM8A 1EO7A 4NT0A 4HPXA 2Y4SA 2WJDA 3EDEA 1Q3NA 4QROA 3PJTA 4B5TA 1WKDA 5LGZA 4LYPA 3OGRA 4JHZA 3TA9A 2D3LA 5BOEA 4TMCA 3O16A 3P61A 3PM6A 2F6XA 1XQKA 1DQWA 4IFOA 2VEPA 2NQJA 2C15A 4WDWA 1E0WA 4YJ5A 1JCNA 1WKEA 1UJPA 3KBNA 2ZKMX 1CLXA 2G0WA 2GUYA 3MWCA 3ZR5A 1XPGA 1R9YA 2GUUA 1DQXA 3R10A 3W00A 2RGLA 5G2HA 3IEBA 1MFVA 3WUGA 2P53A 4W9TA 2CWNA 2WPBA 2WNZA 2X30A 3GKAA 4B9ZA 1QI2A 4O52A 3I3EA 3IANA 2RFGA 4S39A 3TW7A 4PUDA 1ZALA 2ZDRA 4F2UA 2DDXA 2R6OA 3ITLA 3CV6A 4H8NA 1C7SA 3VDCA 3TW9A 3EX2A 1W3KA 1TWWA 2X42A 4WUIA 1O68A 5CPMA 3W82A 4D2JA 3GIYA 4NIRA 2PLJA 4HT3A 3WNLA 3NSXA 3LCHA 4JQ4A 2V0TA 1AODA 3C2OA 4ACZB 1R2RA 1H49A 3DHPA 3HU7A 1W8GA 1WXZA 4E2OA 4LUSA 1BXNA 4U2YA 3NQGA 5I24A 3PUEA 1A5LC 1F76A 1RV8A 2XN0A 3LTSA 3NDYA 3B8VA 4ZOBA 3P67A 1SZFA 1PX4A 3PJUA 1XLDA 1LDCA 4UNIA 1W6TA 5A6BD 4IX2A 2OT0A 3W87A 4AIOA 1IE7C 1NDWA 4HYWA 1K7FA 3TCEA 2DT1A 3QPZA 1IZJA 2C14A 3I6TA 4IPNB 1ZY9A 4I8YA 4DJEC 2GL5A 1OX5A 4XO6A 3UT0A 4MJ2A 5D33A 3WNKA 2G5WA 1UUOA 2HCVA 5AOUA 2V5LA 2WLZA 3W24A 2J9XA 3DFNA 1XD1A 2NVAA 1DV7A 3L21A 2GFTA 4AZ6A 2QUTA 2BG5A 2V6AA 1LOLA 1TO3A 3AMCA 4HSHA 1I2RA 2CKRA 3EXTA 1XG3A 3N4FA 2CBIA 4GO8A 2WQPA 1EH9A 1O5KA 2V69A 4YLWA 3H12A 3FA4A 1O4UA 1KCLA 3TR2A 1ME9A 1JF6A 3F4NA 4H9YA 4AX6A 3QF0A 3B0XA 4ADTA 2ZA3A 4KCWA 4FNSA 4RNFA 2WNWA 5C2CA 3MHGA 2A2IA 5TAOA 2HRWA 3NZQA 5ABEA 1YPXA 2QCLA 1HTIA 4UTUA 1CZ1A 4AD1A 3WBAA 2XYLA 3MVIA 4R9OA 1XPYA 1JEZA 1GQLA 1UWTA 5AY7A 1NDVA 2FFCA 4PZVA 2Z27A 3S2CA 2IQ0A 3ZIZA 2OJPA 4NAEB 4AHPA 4NVTA 2ZRVA 3ZWSA 3U2OA 4WSHA 2DV0A 3M44A 4PSPA 1CXEA 2CKSA 4GD0A 1TKKA 3CHFA 3IGSA 3PWAA 1M68A 5LA2A 3KX6A 3VKKA 5FCZA 2W27A 2D69A 3KTSA 2I5QA 3B9DA 4OV4A 3XIMA 2H90A 3HV9A 3STCA 3KOFA 2WMKA 3UCCA 1ZS2A 3NAVA 1F6YA 2V68A 3GUWA 2RKXA 4ICCX 1AQFA 1G01A 1AH0A 3UWQA 2J8GA 4O1DA 5C0QA 7REQA 5BMXA 5LIWX 3CUZA 2I5IA 1Y0EA 1YW1A 3YPIA 4W5ZA 1QK2A 3WJWA 1RY8A 5LXXA 2Y7FA 3ANYA 3CYJA 3WQWA 4OIFA 4ORMA 1O5QA 1UR2A 3WD2A 3DHFA 3F2BA 3XISA 1QHPA 3P0WA 4QDWA 4K7VA 4H3DA 2J6VA 1ADOA 5BZAA 3KRSA 3WNOA 4IX0A 1F8MA 1PZ1A 2KZHA 4J2MA 3KFTA 4QJ3B 4JFVA 1EGZA 4FF7A 3CZEA 4WRHA 3WZ0E 5JBDA 4ZA0A 5C7HA 3I7QA 1ZPTA 4F9DA 1CGXA 5HPOA 3WLLA 4U33A 1GW1A 3VAVA 2QT3A 2A3CA 3IUDA 3OZYA 3VOIA 4DM2A 1O1ZA 4FSAA 1Q6DA 1L2QA 5BXTA 3OBEA 4MHBA 1UR3M 3W71A 3ZJKA 5DRCA 1V3MA 4HSOA 3AMLA 1OCBA 4PUEA 3SCVA 3AXKA 3A13A 1V79A 1S2AA 1NWUA 1VGAA 1E5NA 4MWAA 1TTPA 1SJDA 3H70A 1RLDA 4EPBC 1IR2A 4JYDA 4D6FA 4D6DA 3DFQA 4V15A 1TIWA 3ZVHA 2IKGA 2MUCA 4YHEA 1UBSA 4PMZA 4N9EA 3OP2A 3W1AA 3S5OA 3H2FA 4INFA 3ARVA 4TIMA 4ZXLA 1L6YA 2Y2WA 3A4JA 3W7LA 3DAQA 3KRUA 4TTGA 1TWIA 4REQA 3HG3A 1A4LA 3RU8X 1HL9A 5LNSA 3T0TA 4MPKA 5LYRA 1GZ1A 2A6LA 3AZRA 5LHFA 3N1AA 1VYSX 3C3UA 1X6NA 2CIPA 2ZWYA 3K8KA 3E2VA 2GJXB 3RLVA 3ZT5A 3UYIA 3CZGA 1WV2A 4EVZA 2R1NA 2YZ5A 4U28A 3OPSA 4MDPA 3VIFA 4OBSA 2O4QA 5H2ZA 2QAPA 3VOJA 3QV9A 2QCHA 3WBXA 1X8FA 3VD9A 2HISA 4J35A 1BWLA 4S38A 3SURA 4Q4KA 5CGQA 2XINA 3ANVA 3C2RA 4UR8A 3SCSA 2XN1A 1ZCOA 1OT1A 4LUTB 1M03A 4KF1A 3OBKA 1ICSA 2G3NA 4QLJA 2W5FA 5LZLA 3AMDA 4F0KA 4KERA 3LCGA 5CG7A 2ZA2A 4S3DA 1BKHA 1AZ1A 3FJNA 1N2VA 3KS5A 1B0IA 1I2PA 2Z6JA 2BB0A 1H7OA 4B2DD 1IIGA 3T40A 4QLLA 2WWDA 2FZNA 1XS2A 3N73A 4LEQA 1XX1A 4IQLA 3M6YA 3PPFA 4NHVA 4GYKA 2TMDA 3PANA 4U4MA 3NG3A 3RLHA 5F4XA 4IGHA 1NF7A 1K9DA 1E43A 1AFSA 1TJ1A 3MYPA 5EY5A 4M3PA 7PTDA 2H9AA 1G6CA 2NUWA 1TX2A 1KR1A 2OEKA 3W25A 4UFHA 5JIPA 3G1YA 1QI0A 1AL7A 2PU1A 3LXAA 4QEHA 4BFAA 2C0HA 3AI0A 1RP8A 4NZ4A 3AHYA 2CLHA 4LF1A 4N7QA 4PR4A 3UJFA 4JNYA 1C90A 2F38A 2C6QA 1OGSA 1VRXA 1TJRA 1UD5A 2VP8A 1U1JA 4JTFA 2UY4A 4C6DA 1XLHA 1GOMA 2PWEA 3GR4A 3FS2A 3S5YA 3TYAA 5C8BB 4XAPA 1GJWA 3LRKA 1TR9A 3B4UA 2XFWA 1M7OA 3HOJA 3GDTA 1YTDA 4JX5A 2OEMA 1LYXA 1E71M 4KRTA 5E93A 5HA7A 2A5HA 2DZTA 1D3HA 4EOUA 4TMBA 1IEQA 1GJUA 1TV4A 1YDYA 2HS6A 4GH1A 3VIPA 2PDNA 5LIKX 3MHUA 4PEEA 2O9RA 4Q8OA 3MJYA 4DWSA 1GK8A 3PAJA 3WUEA 3F2DA 1J5SA 3GFZA 2NT0A 3KLKA 2J7CA 1A4MA 1R9XA 3QMSA 3OYZA 5BMWA 4H1ZA 3DECA 1B4EA 4L1WA 4FP1A 3VCNA 1KFWA 1XLBA 2XN2A 1E6NA 4TR9A 4DNMA 3MWAA 4OZOA 2HV5A 2ZZ5A 3EOSA 4QE5A 4ZOCA 1XBZA 2XVGA 1ME8A 4CQCA 2CITA 4XZLX 4DY1A 3EMZA 2NW0A 1B30A 3M5YA 3WF0A 4PCNA 4JXCA 3BOFA 4M1BA 2XFYA 5KSWA 1WB0A 4NI8A 5DXXA 3TYUA 2PLMA 1FWHC 5DANA 3BDKA 3ZSTA 3O8AA 3RYSA 3NM3A 1KFCA 4H6RA 4LBSA 3QSRA 3TTSA 1O60A 1GYNA 3I3BA 2IKJA 5CZJA 1SZRA 2VXNA 1OCJA 4JTSA 3PBVA 4N2YA 5C54A 3AIBA 3N18A 1W8SA 1OFBA 4DJDD 1YPFA 1I8JA 3TLLA 3VGEA 4PTWA 2OZ8A 3LPFA 4CU6A 2B7OA 1EKOA 4JQAA 4D6IA 4GI6A 2PS2A 3UG4A 2WBKA 2V5KA 1MVYA 2IMRA 2DSVA 4F0HA 3MYOA 5K4XA 2VCBA 3CU2A 3M47A 2EPNA 4R85A 3W7OA 2BSLA 1PS9A 4XTIA 1K77A 2YFOA 3LK6A 1VP5A 3V5FA 4CD5A 1TZ9A 3W7QA 4JKLA 3VIJA 1U22A 5HBFA 2JKPA 1H11A 1IT8A 4WJXA 4ZB0A 3TQPA 5ABHA 1XSKA 2ICSA 4EACA 3UWUA 3UW6A 1F9CA 2NT1A 1HKIA 1WDDA 5LNVA 4F66A 4GFIA 4BZYA 4AD3A 3AC0A 2G8ZA 1KNWA 2OVLA 4UTHA 2ZICA 2VVSA 4I6KA 4LGXA 1TELA 3S47A 2IXVA 1ISZA 3RR1A 3ZT6A 1L6WA 2VFGA 1J6OA 2WMIB 4DO6A 1JRCA 3NGFA 5FA5A 3ARUA 4XKMA 5ECVA 4A22A 2VDGA 3MKVA 3PZQA 1UH4A 3VOCA 5IHSA 1VBJA 4HNNA 3LHZA 1THFD 4QCEA 1B3XA 5HK4A 4JEJA 3LBCA 5CGTA 2J62A 1KFJA 4XKYA 1W1TA 2VL4A 1SJBA 2VEIA 1G67A 3POHA 4F4RA 1TTJA 4MYAA 4LX4A 2Q8LA 3S6DA 1H5VA 1WDQA 3KP0A 3G22A 1VR6A 2I57A 1VYPX 4PRTA 2QV5A 3DFPA 3K4WA 3NDZA 3PPCA 3ZYZA 3W29A 2V38A 3DU0A 3WEOA 3FYPA 3TKFA 2WZMA 3T78A 3D47A 3AXMA 4M29A 4RJEA 3GG0A 1ZENA 3V0UA 1W3JA 4F79A 4L80A 1SW3A 5T9CE 2OQHA 5E0CA 3M0HA 3AUJA 2QHAA 4C60A 1X7FA 2HS8A 2C8NA 1MSSA 3G1RA 1QNRA 4GVIA 3UWVA 1AZ2A 1UKTA 4A35A 2REQB 5LNUA 3PPHA 1P0DA 1KTNA 5FJOA 1F3EA 4NAEA 1EUAA 1FWEC 2X40A 5CZKA 4CCDA 1U1HA 1XLLA 2GDVA 3WF3A 3WYZA 4ML9A 4JTIA 1TA3B 3DESA 3USBA 1KQYA 4AD2A 4E3TA 2JBMA 2PF8A 1Q6FA 3T2OA 3LPPA 4JIPA 1GVSA 1UOZA 1JDEA 2HBVA 4ALDA 4GNVA 2ZUNA 5FF4A 2F2KA 1OG6A 3V1HA 2PZNA 2ADAA 1GQNA 3O6DA 2PURA 2H6RA 3C3NA 1EJSC 5HMFA 3QMTA 2DSZA 1LJYA 3GH7A 3W72A 3PUDA 4YPJA 5E09A 3LZ3A 4E8DA 1OFDA 1F61A 4EXAA 1HL8A 2YL8A 4C7DA 3SZ8A 1GZGA 4CNPA 3O7UA 3ITCA 3LLXA 3W7PA 3EOOA 4W8BA 3Q94A 5EGRA 1K70A 4N9BA 2ISWA 2NWRA 5D2VA 2QPXA 3EEGA 2YCEA 1MRAA 2FH8A 5AFDA 3E1F1 1FWCC 4W86A 4F0SA 1CENA 2XH0A 3UZ5A 2G3FA 4CD8A 2GPTA 4XVEA 2W91A 5JMUA 3BLEA 2JGYA 3FNDA 2QZRA 3M46A 4JR5A 2XU2A 4DAIA 1UPPA 3EKZA 1SR0A 1UD8A 1P5BA 3BZJA 3VOGA 3LHTA 2PD5A 4F40A 5I02A 1LWJA 5IDZA 4US5D 4AU0A 3MPGA 3QC0A 1MEIA 4TVCA 3CL8A 3E74A 4S3FA 1UMYA 3VKDA 2E6AA 5M3WA 1YDVA 4AISA 5HMSA 3IVTA 1OQFA 4KMQA 3I3DA 1AW5A 1GVQA 4ZL1A 1QO2A 3FSTA 3OGSA 2RAGA 3ARXA 3MMWA 3FLUA 1F6KA 3BK0A 3OLGA 5IOBA 2FVLA 3SCOA 3S5ZA 3P8JA 2GQ3A 4EAMA 4RDZA 4WZHA 3NEVA 1OF8A 3GBEA 2QXWA 3UPMA 5DEZA 3LB0A 4E2BA 3H26A 2PAJA 5CPNA 4PUJA 2D24A 3V1PA 1OFQA 1D8WA 3VIKA 5DBTA 3WF4A 4CUCA 1MW2A 4UIOA 2DJLA 1TPVA 5G1TA 4FNUA 3GDKA 4WQ6A 1M7JA 3UCQA 4XO7A 2E5DA 3PBUA 4YIWA 1PE1A 3H22A 5A95A 1TJ0A 5EA9A 3B03A 2OXNA 2VR4A 1H7RA 4AWSA 3C61A 2DSUA 3KEHA 2GJXA 2E1DA 1M53A 4LUYA 1DJHA 4OBTA 1H7PA 1XLFA 4IJBA 1GORA 3WEZA 1GYMA 2DVTA 1WDRA 2V3EA 5FF2A 2BVDA 1KB3A 1S5VA 1NAL1 4PUUA 2J8FA 4KWOA 2D22A 4UC5A 4CEXC 1DJWA 1VFSA 2GSJA 1Z32X 5GJMA 1MEHA 4FX7A 3MI2A 1D3GA 3SN4A 4JGDA 1BGAA 4UB9A 3EPMA 4XIAA 2VZTA 3OYXA 1XGEA 3Q2DA 1VFHA 1QI4A 3K4DA 4AZ5A 3HMJG 1DIEA 3TIMA 1CLVA 4L5ZA 3MUY1 3BW2A 3CIWA 1NF0A 3QGVA 4MKSA 2EKGA 2WAGA 3TYCA 2TYSA 2VC5A 3L9CA 1XIEA 4PTVA 3W26A 4A8RA 2QUMA 5I78A 3HG5A 2D1ZA 5A8MA 1CDGA 4GI9A 3W07A 1TUFA 7TAAA 3SUVA 1XG4A 1KWGA 1OBAA 3HTWA 3RG6A 2P5NA 2X1UA 1DQUA 2C19A 2DQXA 4WVXA 3RMEA 3P0XA 2HPMA 4ES4A 4CD6A 1LCOA 2BGSA 5EPDA 3L7RA 1TJ2A 3Q67A 1EFZA 3WFLA 4LFYA 3F4DA 2W9MA 3TDFA 1Q65A 5FJTA 3TYBA 2WB5A 5HNRA 3LCLA 4PMNA 3LHYA 3BJFA 4O14A 1ME7A 3TU9A 2VR2A 3B8TA 3G0UA 1VBHA 2R82A 4D1JA 2PGWA 4MLJA 1W1PA 2P88A 3GWQA 1DJQA 4LYQA 3LU2A 4EAYA 4HVXA 3P14A 2BY3A 3MU7A 3T7VA 1S3TC 4JTQA 4MY1A 4NQ1A 5GJNA 1H51A 3S42A 4JNZA 2HVMA 3G2GA 3HJZA 3APTA 2Q01A 3TXVA 3DBPA 4US6A 3LA4A 2OTDA 1S5TA 4DXVA 4IGSA 2DU2A 2ZQ0A 5CZ0A 3WQEA 2HXUA 1E1FA 5D2XA 1QU4A 2RGMA 4S1FA 2EF9A 2HJPA 2GQAA 2VMFA 2C1GA 5A3HA 4D6HA 1XLIA 1TV7A 5CZSA 3F5JA 3W7RA 3M0ZA 2PD9A 3DKJA 4TQTA 1BLIA 2BHYA 2D2HA 3LV6A 3ORWA 3AJXA 1F74A 1DTUA 4UQBA 4IMCA 2J9YA 4BI6A 3UPBA 1GJPA 4JICA 3TJXA 3FEMA 3UG8A 3HIJA 4FMVA 3UJ2A 1YLVA 3IK4A 2BFGA 3H53A 2JKAA 3WK1A 1E56A 3C0LA 4L56A 3W1TA 2EQDA 3NM1A 1BSIA 4UTWA 3NVTA 1CYGA 2F8QA 1VIZA 4TU1A 5C9ZA 1J79A 4O1EA 1F3TA 3H4XA 2H8XA 1XLEA 3ONCA 1GEQA 1H3GA 3VD3A 1KBJA 5GNZA 5I6SA 4J3WA 1UP0A 4H7ZA 4ZMGA 1NELA 5KZMA 2C79A 3R6IA 2EHHA 1A47A 3BCJA 3CV2A 3TCSA 1R87A 2NSXA 1XH1A 1ADDA 4PN2A 2GJRA 5JBEA 4AY8A 4GXMA 4DAFA 2TSYA 5A6BA 4RDWA 2PWFA 4YTUA 1Y5XA 3DG3A 3AS3A 5M17A 4S3KA 3W2LA 3APYA 4HP5A 1TRIA 4U5IA 4A29A 3IJDA 4WK9A 3UBPC 1WP6A 1X1ZA 3NL6A 3MCOA 4H00A 2QDGA 3C2FA 1EA0A 2P0OA 2ZXDA 3H55A 5AZ1A 1JIBA 3S8HA 3TJ4A 5I5RA 5H8UA 1G7UA 4UNLA 3LI0A 4HU3A 1C8VA 4GUFA 1A5CA 2CNCA 2Z1XA 2QPSA 3BG5A 2VKZG 5A8GA 3DERA 3CUXA 1KFBA 2X2GA 1WOAA 3ZFHA 1RD5A 1AQHA 3VD4A 3B8IA 4O54A 2D2GA 4FR6A 2VNCA 2GVEA 2OZ0A 1I75A 1QBAA 4GUIA 2Y8VA 5BYWA 3R79A 3ITYA 1YTEA 3NEHA 3H7RA 2QJNA 4GIAA 1AQMA 4O19A 1OFPA 3K5XA 1HL2A 1VQTA 5G4WA 1V6TA 4LVAA 1RA5A 3AZTA 3LSCA 3RMJA 1SU5A 3TNBA 2QS8A 3HURA 2ZE3A 1EP3A 1C9WA 1KXTA 4OGZA 3HB9A 3WF1A 3TYDA 1H1ZA 2XSXA 1R85A 3PJXA 2QEZA 4QAWA 2WKJA 4JCLA 3ZS4A 2GJNA 1OJXA 4PTDA 3I10A 4JYFA 2ACQA 3N9SA 3W2KA 2A79A 2G3MA 4S3GA 4MY9A 4N9CA 4EPEC 3HFTA 3V36A 3TE9A 1N55A 4QJ4B 4DJFA 4DJDC 4RE3A 3T4WA 2PU0A 1V08A 1PSCA 5GNYA 1XYAA 5I06A 3GUGA 2ON3A 3HPSA 3NWRA 4M1RA 1TTQA 3VABA 1C9DA 1W1YA 1KFKA 2E68A 1US0A 4QLKA 3LS9A 4AD5A 4LJ3A 3LLDA 3VA8A 3WQVA 1NQKA 4GYJA 1TFVA 3H7VA 3BQ5A 1XYCA 1TREA 2NQLA 2VTFA 3DI1A 1FCVA 2ZWZA 1LQ0A 4Y9OA 1X38A 1DXFA 2WJZA 3RPTA 1XH2A 2TAAA 4N9DA 2G41A 3KCLA 5I77A 1V51A 5EMMA 1KGUA 1WAWA 4MPQA 4IG2A 3KBWA 4Z1BA 3GFYA 1G94A 1J11A 4M81A 2NV1A 5EMKA 3RAOA 3CAWA 4JHOA 3PULA 3T07A 3PFMA 1CXFA 1ECQA 5KTLA 1TA3A 4Z0SA 2Z00A 2ZX5A 3SY8A 2INZA 1B2YA 4WY0B 1H09A 5TQLA 1W1A1 1V02A 5TNVA 1PV8A 3IGXA 4J3XA 4UTLA 1XYLA 3ONBA 3NO5A 4C6CA 4GVFA 3S5SA 3TTOA 1P1XA 4YYCA 3TA6A 1W1IE 4OECA 4UFLA 1Z89A 2OG9A 1JULA 5J5RA 4LV9A 2ACRA 4CLMA 3Q45A 1HVXA 2PZ0A 3OA3A 2VRJA 2YIHA 3BGAA 2DORA 1OGGA 4NASA 4XAZA 5CPTA 2FPTA 4PCPA 3VO0A 2ZXAA 1AQ0A 5CPOA 2XZ7A 1TQXA 5E9XA 4N02A 1WDSA 1CX9A 3VOHA 3IIXA 1NWTA 2E7FA 3LY0A 3POCA 3DIPA 2PB1A 4R9XA 3KZSA 3UCDA 4TX9A 4LY8A 1ESWA 4RZ4A 4RZBA 4KT2A 3UZYA 1PBGA 2I14A 4OKDA 2CBJA 2INEA 4IICA 2ATMA 1R3RA 3M4HA 3WBEA 3WNNA 2XZ9A 3AJ7A 2AL2B 3BMVA 5F2IA 3AQUA 3PTMA 4LRSA 4MY8A 1RLCL 4HK5A 1UW9A 4A8LA 3UQNA 4U5KA 1BVWA 1HIZA 1QVBA 1UOKA 2XVNA 4LBRA 4S3AA 1M65A 1VBGA 3L2MA 4MJZA 5FEXA 2J74A 1Q8JA 1E55A 4ROQA 3RLGA 4QP0A 2C71A 1JCJA 2Y89A 4UQAA 3O1NA 1J0ZA 4DYJA 2Q71A 4LYRA 1B5TA 3BSHA 3CWNA 2WJFA 4KEMA 4NAFB 3QPEA 2XGIA 2V5JA 4UBPC 4XD4A 2CXEA 3ANUA 2AAMA 4GHRA 1EB3A 1POJA 2XPKA 4PL2A 3O2LA 4PMYA 1G9HA 3KVLA 1MQQA 2CLIA 1UIPA 4A3YA 2ZXQA 1XYFA 3TFXA 2J6XA 1PXGA 4Z2JA 5F1VA 1W5NA 2G97A 1CGTA 3OW1A 1HKJA 1QATA 3CMFA 1YHTA 3N2OA 2OMAA 3LHVA 1T8QA 4HOZA 4D72A 3P7YA 4YWIA 3M07A 2ZRXA 4UMAA 1AL8A 4NJKA 3N14A 3CM4A 3UYCA 1NOUA 1G4TA 4H04A 4KEZA 5I03A 2DZUA 1GEHA 3WDPP 5K9DA 2F84A 2QULA 1SW7A 3MUCA 3CS2A 5E9AA 4JN8A 1BHGA 4WSKA 4LT9A 3P81A 1FWDC 2PUZA 2GOUA 2H3DA 4Y96A 3STGA 3BICA 1ZZMA 2A1YA 1G4SA 2E3ZA 1F07A 1I2NA 2VFFA 2PODA 3KS6A 3VZYA 1W17A 2OO6A 3L66A 3WLKX 4EXQA 3I4EA 1X98A 1EPXA 2W66A 2RDXA 3WFZA 3KW3A 3ARTA 1BRLA 4NXKA 3ECQA 2PDKA 4MF4A 3G3DA 3SN0A 1O5XA 1ONRA 3LM3A 4ZO6A 3OO2A 4DRSA 1ZJBA 1AJ0A 1P0KA 2O56A 3LBOA 4R27A 3GQYA 1US3A 3E5PA 1E15A 4XWUA 2MNRA 5AYZA 1Q4WA 4A8IA 3WK0A 1KBLA 3IV3A 5CAKA 4S3CA 4PBGA 3V0TA 1Z6KA 2ABAA 4WHBA 1W9BM 4BI7A 3VYLA 2VFDA 1OIFA 3HG4A 4R7JA 3L4YA 1MDLA 1QW7A 2ZC1A 3RO6A 1L8NA 1F8IA 4R53A 4IQDA 3G18A 2DIKA 5TD4A 3R89A 3T1GA 2HBXA 2Z1KA 2FTYA 1LRNA 2CZFA 4G5DA 4IJRA 3H2NA 3INPA 1ZB5A 3MCMA 3TNOA 2X7WA 4PE8A 2X0YA 3WSUA 9RUBA 4QCFA 2YBTA 5AVHA 1E0VA 4LNCA 2DJXA 7XIMA 3EX3A 4O8AA 2J7FA 2BODX 5G2WA 2O9TA 2ZE0A 2Y63A 4B5WA 4F0RA 1R3YA 2GDQA 3OG3A 4X9SA 2WCGA 1SJAA 4ZZ9A 4JYEA 1DJXA 3BE7A 3HM7A 1EXPA 1I4NA 1YXYA 2IPFA 1XCXA 1OYCA 3RLUA 1GOOA 8XIMA 1PZ2A 1O5RA 3SFWA 3W7DA 4LVFA 4MWAD 1GW9A 1XKJA 3VM7A 5G1MA 2FGLA 1TQJA 1H5YA 2W4XA 1TPDA 5D2TA 3H23A 4X60A 2VFIA 4XD5A 3W2JA 2AQOA 3WQPA 3R1ZA 4AG0A 5HNUA 1VPXA 4NYUA 5AC7A 3AXHA 4KBXA 1GOKA 1R47A 3LEPA 4MG4A 4OV9A 1XINA 1KGXA 4NI3A 1OADA 4S3JA 3DFSA 3TONA 1JPIA 1HKMA 3H2AA 3PK7A 4R7WA 3CEUA 4H6QA 3FSUA 2YBVA 2ATSA 3AWNA 2AGTA 4GVHA 1BKSA 5BXRA 2KX9A 3VGBA 3C56A 2DUXA 3N13A 3M41A 3C4UA 4NZ5A 1VFOA 3LGEA 4AZCA 3URBA 1RJPA 1GOXA 1CGUA 2DIJA 2TODA 1LROA 4PMVA 3RX2A 1CEOA 3R8RA 3C0SA 3E9AA 5BCAA 2XIJA 1D2KA 1TWDA 3KWSA 4WKFA 1K8XA 1JYVA 2IKIA 4LAUA 1MNSA 3IRSA 2PWGA 4LB3A 2FIQA 3DZ1A 1WDPA 5KETA 5K9XA 4MAVA 2IQDA 4NYYA 4MJ4A 4FIQA 4DBEA 3D6NA 2GQ8A 3MKKA 4QM1A 2ZUUA 3GO2A 4OQVA 1C91A 1UZ1A 3CTLA 1Z7AA 2ZRZA 1E51A 4N6EA 1Z69A 4E8GA 2XM1A 1UD4A 2INFA 3ERPA 5DY3A 1FQ0A 1PHQA 3II1A 1VS1A 1KQZA 3IJ9A 4ZENA 2IS7A 3IUIA 1AA1B 3UR5A 4C6NA 4GH3A 4RLIA 5I09A 3VC5A 3KM8A 3BGGA 4W7VA 1EJUC 5LA0A 3QV8A 2X0HA 5HNNA 1R2TA 2GSHA 2UV8G 1JR1A 4LS1A 3LXBA 3W38A 4MB4A 4PCFA 1FCUA 5BXSA 1H0IA 2V5CA 5XIAA 1XLJA 1QPNA 1LLWA 2YL6A 1SFJA 4HYRA 3SB0A 2VX6A 4QS5A 1K8ZA 1HG3A 3WMLA 4BQ4A 3EWWA 4NX0A 3DFOA 4WDTA 3NGJA 4QSFA 3BC9A 1ICPA 4WEVX 2HSAA 1I45A 2XGBA 1UD6A 3QXBA 3DXIA 3OJGA 4JCMA 4ZVJA 5MF5A 1AJ2A 1KKOA 2DH3A 5D8ZA 3R25A 4C6EA 1SO3A 3EWBX 4A3RA 3CMJA 1DWAM 2Z2UA 1ZAIA 3WH6A 3M0VA 3AHZA 4LVBA 1CGWA 3WH5A 4I5XA 2X7VA 3MV01 1UD3A 2NUYA 3OZMA 2CC0A 3WQ6A 3RN6A 1AH4A 2P1FA 4KEUA 3VMNA 4C5ZA 4CGTA 4WLCA 4FLQA 2ANUA 4E3VA 4M0XA 3AHVA 4QTGA 3Q4DA 3N4EA 4ZTYA 4A21A 3EDFA 3FOKA 3SGZA 4HU0A 4M80A 1V4YA 1DJGA 1ITCA 3VNJA 3NQ8A 3TFCA 4ZGYA 4JIHA 4CNNA 2Z2AA 2NQHA 3AFBA 4LVDA 4DWSD 3EOUA 2CCRA 1L2UA 5DQPA 3MA8A 2ODOA 3SCWA 4PRWA 1O7AA 3M0MA 1V0LA 4HU4A 4IGMA 3QR0A 4UTTC 4AUBA 3WLOA 3BG9A 1H60A 3FHQA 5CGMA 3SO7A 4DUXA 1V0NA 3UGVA 1IWBA 1A3HA 1B3VA 3LN3A 3BANA 5JQ9A 3K8LA 1RAKA 1KM0A 2RDWA 2HWGA 2XISA 4HU8A 2V30A 3IGUA 3GTNA 1BD0A 4C1NA 2QVHA 3M16A 2FDSA 1VLIA 1GVEA 5LKYA 4RNJA 1BFNA 4U10A 1Q2RA 3V0SA 2ZC8A 4W4QA 1QHOA 5HATA 3CH9A 7TIMA 3VNYA 4H19A 1IYXA 1JVNA 4RV3A 2ZTKA 3W28A 3AISA 1MXGA 4Y7EA 4PMOA 1RCXB 3CLMA 4GY7A 4U3CA 4EP8C 3S2NA 1KRAC 1E1EA 2Y85A 3VNIA 3P6LA 1Z48A 3VOFA 4KWSA 2QNEA 4CCZA 3G1DA 3CQIA 4MAZA 4FX6M 1MUWA 3W1QA 5KMYA 2QKFA 3L23A 1FTXA 2CLKA 1M1BA 3IJQA 3QSTA 4LPCA 3WH8A 1NIUA 4WY0F 4Q8TA 5BW6A 5D04C 3AZSA 2WCSA 1UB3A 3VVGA 1I2OA 3H8AA 1PTDA