4GE8A

Oye1-w116i complexed with (s)-carvone
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase 1
total genus 155
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ge8A00
4N6EA 1V7YA 2A21A 3S5NA 4JDYA 4GUIA 2PURA 1IXOA 3B05A 5AC6A 4UTTA 5I3HA 4A29A 3OVQA 3TE9A 4OQVA 1UUOA 1SO6A 3TAKA 1I4NA 4O54A 4UFHA 2V9DA 1XM3A 3CC1A 5BRBA 3U2OA 1IIHA 5D2TA 4KKXA 4FHAA 4N2YA 4NT0A 3GX9A 4UFLA 1TRDA 1KM5A 3E0IA 3DAQA 3HGOA 2E77A 4POCA 1WDWA 2DZTA 4I7WA 4Q4KA 2NX1A 2HS6A 1XC4A 1Z42A 4DBEA 1JCXA 3V1PA 3SGUA 1K3UA 1DJNA 2Z1BA 1KFKA 3NNTA 5CPNA 1ME8A 1NF7A 1OYCA 3KVLA 3LHWA 1FXPA 3PULA 1OYAA 1FCBA 2Q3OA 5LKYA 4C1KA 3MHFA 4MOZA 3TC6A 5IBXA 4DXVA 2NX3A 3UWZA 2YW3A 2DORA 3T4CA 4ML9A 3N2XA 3NZRA 3W7DA 4N9BA 3LGEA 1ME9A 3O6CA 3NM1A 1Q6OA 4UMAA 3TC7A 3ABRA 3MYPA 5TBOA 4MLRA 1UASA 4Z1DA 4U28A 2A0NA 5F4SA 3H53A 1HG3A 3DKJA 4JGDA 4E2BA 3KXQA 4Y90A 3PB2A 4WY0F 3GVGA 4IMDA 2CLOA 3HO8A 4O16A 4UFKA 1OFEA 3BLEA 2FJKA 1WBJA 3UNDA 4DF2A 4O1DA 1L6YA 3LTSA 5U7SA 1KW1A 4OT7A 4UNLA 3NQDA 3HBLA 3SI9A 1RZMA 1LORA 3C8FA 3GXTA 4O4WA 1LLZA 3O6DA 4IPJA 3G24A 5HWMA 4O15A 1UB3A 1VYPX 1Y0EA 1FCQA 5H2ZA 1YDNA 2J24A 3W1TA 3K30A 3NPUA 3DHFA 1H7NA 3BLIA 3CWOX 2HS8A 5D02A 1G4EA 2XFWA 3DH7A 3GDRA 2QUVA 2WSQA 2E6YA 4UUIA 3M9YA 3E9AA 1VH7A 3KX6A 3UWUA 3S1WA 3M16A 3FEMA 3LDVA 2EAWA 3GIYA 2QUTA 1A5SA 2ZTKA 5CZ0A 3P5YA 4JN6A 1S5VA 2NWSA 4NU7A 5DCDA 3CB8A 4M6QA 3EWWA 1TV5A 1BKSA 1OYBA 3BGJA 1TPVA 3PWAA 3PR2A 1EUAA 1AW2A 2VEIA 3O8AA 4JEQA 2AQWA 3LTYA 3MBDA 4P61A 5F2LA 3TQKA 3W1NA 1XCFA 3B0UX 4MY9A 3NEVA 4GWEA 1GJPA 1KM4A 3SIZA 4NJJA 5HUOA 2B0MA 1FY6A 2V82A 3IVTA 1P4CA 3P61A 5AOUA 3TA6A 4FNUA 4IMFA 4O18A 4LW7A 2ZZ3A 1BEUA 5AYXA 1OVDA 4GJ1A 3UQNA 1A50A 1P5BA 5A5WA 1QPQA 1SSGA 1W8SA 1S3HA 4XWUA 4ZZ9A 2A5HA 4PC8A 2Z0IA 1W5PA 4UTKA 4FIQA 2C13A 3DHDA 4TIMA 1K7FA 3NQGA 1JUKA 3VE7A 3H54A 4CNPA 5K4ZA 1PHQA 4NXKA 1P0NA 1XBXA 1WOBA 3CLMA 1K03A 1HL2A 3CT7A 3KHJA 2PC4A 5FF2A 1I8JA 3HIJA 5DN1A 2ZA1A 4JR5A 4X2RA 5F4XA 4RLIA 2ALDA 3M44A 2CLEA 3LLFA 3W2UA 5BW6A 1EEPA 3PF3A 1QPNA 3A22A 3P8JA 3RFAA 3FOKA 3C2VA 1IIGA 3L68A 5AHMA 3NO5A 5AHFA 4LS2A 5C6MA 1WQ5A 4LVBA 1ZNNA 4MY1A 2ATMA 4Q33A 1KM1A 1NEYA 5DY2A 1OFAA 1LOQA 4UR7A 1VZWA 5K9CA 1JCYA 1FCVA 3C0JA 2EPHA 4KWWA 1KTBA 4N9CA 4RR4A 1GZGA 1M6JA 1ZFJA 3DENA 3G1DA 5D2YA 1B57A 2ZZ6A 3VFLA 5EA9A 4A3UA 3HG2A 2X1SA 3S5OA 5AC7A 3MP3A 3I7SA 1VCGA 3NQ7A 1NFBA 3L65A 2NUYA 3H55A 5J5DA 1LLWA 4UTWA 3ELFA 4OU1A 1B4KA 5KZMA 4LNYA 2FB2A 3GKAA 3M47A 4TX9A 3P67A 3FLUA 1QO5A 3TROA 3O63A 3P62A 1SZEA 2G97A 4DEFA 3L5LA 2QUUA 1VYRA 3W1QA 3WJSA 2V0TA 4AH7A 1F2JA 1G7VA 4NZFA 3F1QA 2FDSA 1P1XA 3GR7A 2YFNA 3FYPA 1Q45A 2CZEA 3P81A 3T7VA 1SO3A 1X8FA 3L0GA 1W54A 5BNKA 3A5FA 3UD6A 3UPWA 4MZYA 4NNAA 4X9SA 1KTCA 4AB4A 5HR7A 3GNDA 3L66A 1MEIA 3R8RA 3G0SA 3N2MA 6ALDA 4FX7A 1TV7A 1N8FA 1U83A 3TR2A 4ADUA 1AL8A 1EIXA 3C61A 2I9EA 3W1LA 1JR1A 2GUUA 2JKAA 1GVOA 2WO5A 3E49A 3L21A 4AF0A 4O1AA 1KV5A 1L6WA 4WXYA 1RD5A 3ATYA 1R2TA 3CHVA 3W1RA 3QF0A 5G4WA 1CX9A 2CLKA 2ZRXA 3TW7A 2RHGA 1T99A 3TJXA 2NXHA 3UZJA 4LS0A 4AWUA 1YTKA 5LNWA 2C18A 3NQ8A 3NA8A 3LX9A 5LHFA 4QITA 5DXXA 3QC3A 3TAOA 3M5YA 4Y8FA 1AK5A 2I1OA 4U4MA 3PC0A 1W31A 3PUOA 3STCA 1VR6A 3G1AA 1EPXA 1M5WA 5G4EA 3NZ1A 2GQ9A 5I3GA 3A24A 2H3BA 1XFBA 3OA3A 4JTLA 1XBZA 2DZPA 3LXAA 5FEWA 3HPXA 3MBFA 3W1UA 1YXCA 1K7XA 1MSSA 2R8WA 3LCXA 1NVMA 1E51A 1YDOA 4AAJA 1AL7A 2C14A 3O1NA 2QEZA 2ZZ4A 3GDMA 3KVKA 4UFJA 3W7PA 2Y6ZA 4FNPA 3BV4A 3ATZA 5E0KA 4FIRA 3MMTA 5KZDA 2DP3A 5AYYA 3TKFA 2W79A 4NJKA 3TX9A 3TDFA 1TMHA 3W22A 5D05A 4MLJA 1DORA 3G1SA 5LSMA 1TJRA 1QNVA 1CW2A 3DZ1A 4LV9A 1I2NA 1KM6A 4JIQA 4IX0A 4HNTA 1ZAIA 2BTMA 4DO5A 3R2GA 3LOTA 5G2WA 3G1HA 3STGA 4IUOA 3GB6A 3FFSA 3OHIA 4RJEA 5J5RA 4RV8A 1SO5A 3NGJA 3FKRA 4HN4A 4QNWA 5G1YA 4EOUA 1TPB1 1TV8A 4TU1A 1F74A 1XUZA 4MJZA 3G8RA 5D37A 2QAPA 1JQVA 3QFEA 1F7BA 3IIPA 3I6RA 5EMUA 2JKPA 3C2EA 1W5QA 1SZGA 2CLLA 3UXDA 3HPZA 4PODA 1FDYA 1NSJA 1IF2A 1TTJA 3TFCA 4TR9A 4PL1A 2PRMA 3Q94A 4AWSA 2FQIA 2WSRA 4IX2A 1M7PA 5AN7A 1KM3A 1OFRA 1H7WA 1EX5A 3JR2A 5HWJA 2DJXA 2RDTA 3QYQA 1R2RA 3W7KA 2GJNA 3TQVA 1BWKA 3G1FA 2B7NA 1FQ0A 2D73A 1VC4A 5ABTA 3EEGA 3KRUA 3N3MA 2J27A 4NNBA 1J4EA 5L9FA 4IXXA 1LRQA 1MXSA 3CU2A 3EXTA 2F84A 3M43A 4O17A 4X22A 5LNVA 4HSOA 3LB0A 3TW6A 1NAL1 1K02A 4DQWA 1OK4A 2J9XA 2BLEA 1KM2A 4XKYA 3MP4A 5E1QA 2J88A 3M6YA 3FS2A 1MEHA 1JQXA 3C52A 2NV1A 1VJIA 3O07A 3U8GA 5KZEA 3Q58A 2YPIA 4CCCA 2FFCA 4M5PA 4OHQA 4EF9A 5F1VA 1GPWA 2QCLA 3NPXA 3FJ6A 3NQFA 2Q8ZA 1J5TA 1VQTA 1H1YA 1HFBA 3E02A 1HUVA 1GVSA 1TQXA 2C6QA 4GUJA 4D2JA 4MFDA 3BW2A 3W1PA 3AO0A 4HPJA 1U5JA 1H51A 2A7NA 3ZFHA 1B3OA 3DBPA 4P2VA 3DXIA 1X1OA 2YYTA 5L6UA 2VELA 1HTIA 4CNNA 2DJLA 4JTJA 3LHUA 1OK6A 3B0VC 2WNNA 4O10A 1FX6A 2QCEA 2ZZ2A 3E12A 5A8GA 4JY8A 2VFIA 5D33A 4KWVA 3STFA 4LRTA 3W7JA 1LM1A 4YMZA 2VEPA 4NJIA 1ZCOA 3WK2A 4NZJA 5KITA 4JYDA 5FI8A 1FWRA 1RVGA 3W71A 2R94A 1Z44A 5C54A 2O7QA 1XXXA 2NUWA 3W75A 5HQEA 5AHEA 5CPLA 3S6DA 4UTWC 3N19B 4ZQMA 3NR0A 4YLWA 1YXYA 3IIZA 3T40A 4XBSA 1YYAA 2YDAA 4HKPA 1F5ZA 2E6DA 2E6AA 2E5DA 2JBMA 3NYZA 1Q6LA 4O0ZA 3FIGA 1XDLA 3JRKA 1GEQA 1HO1A 3NL3A 4MY8A 1FWNA 1F6KA 1UCWA 3A9IA 1PL9A 3TXVA 5FF0A 3P5ZA 2GQAA 1K7EA 4N9EA 2ZQ0A 2NUXA 5MHBA 4JDBA 3EX6A 2QCDA 2WNZA 1UJPA 2RKXA 3KFTA 3PSWA 3DFNA 5AHNA 3E96A 4HHPA 3SW6A 1GVQA 4K8HA 4NX0A 4ADSA 3R89A 5G2IA 3HGJA 5KSWA 2CZDA 3NQMA 1DQXA 5CPOA 4TO8A 5H91A 5BMWA 1WXJA 3L2IA 2X16A 1RQBA 3W2KA 3FYOA 3JS3A 2XN1A 3W73A 3HG5A 3MJYA 2QJIA 4O50A 1SU5A 3ANYA 4ZVJA 3UXAA 2ZZ7A 2GQ8A 4HSNA 2ZRVA 2OZ0A 4IPIA 4JX5A 3ABSA 2ZYFA 2E6FA 1EUNA 3CEPA 4WX2A 1K8XA 4K6AA 1F05A 2ISVA 3C4UA 4LT9A 4PFMA 4BI7A 1O5KA 3GAKA 4NJGA 4ICNA 2V5LA 3LHVA 2A1YA 1TO3A 3LRKA 3RNDA 4XTDA 1AW1A 4A22A 3PUDA 1ALDA 2ISSA 5EBUA 1H60A 3S1UA 4IMGA 1H7OA 4AHOA 2J9YA 4R34A 4UCGA 1QDSA 1X6UA 2Y7FA 3LBCA 3PY2A 4GBUA 3GZ3A 3DGRA 4ONVA 3UY7A 1GT8A 1WA3A 3SJ3A 2YW4A 3W7RA 3W84A 4E0CA 4JTEA 1SPQA 5FEZA 4EVZA 2A7PA 1KFLA 4OGZA 2PE4A 1ZJIA 2EKCA 1QO2A 3GAYA 4GUFA 3S42A 4WD0A 2E5BA 1OFDA 1OFQA 1X7FA 4ALDA 4B5NA 3BG9A 3M5XA 4CCEA 3QEZA 1WX0A 1GQNA 3CPRA 1G4PA 4O53A 1WYIA 1VRDA 2F7FA 4AHPA 1H7XA 2C19A 1TQJA 2YFOA 3PS7A 2BSLA 1KFCA 5TQLA 2Y62A 2FLIA 1TTPA 2JGQA 1HO4A 4CQAA 4Y6GA 3HMJG 4PL2A 3GYEA 4ZL1A 1GTEA 3QMSA 4DPQA 4FO4A 1GG1A 3QPZA 4A2RA 3NL6A 4QJ1A 4RCXA 1SZNA 3GK0A 5FEXA 4UR8A 4HNVA 1OG0A 2OT1A 3MYOA 4CNOA 3W07A 1TCDA 2AAMA 4YCPA 4ZQRA 2V2HA 4LWWA 4IMCA 4KFPA 4LOCA 3P74A 5BOOA 4J9JA 3DFSA 5D04C 4TMBA 1QMLA 1JCMP 1M7OA 5K9XA 2NX9A 5LNRA 1ICPA 3P8IA 1P0KA 1TPWA 1ZAHA 4LC8A 1EWDA 1YDVA 2GVLA 1Q6QA 4C1LA 5CSRA 1JJKA 4EIVA 4NX5A 4M19A 4PTNA 3MP5A 1TTIA 4N6FA 5G1TA 4QNEA 3PBWA 1KLZA 4HPXA 3NXFA 4O4VA 3Q2DA 1D3HA 3B03A 5K2ZA 3TMLA 3O16A 4GUHA 5AYZA 1TTQA 2JGYA 4H3DA 5EY5A 2Y88A 1ADOA 4GC4A 1KBJA 3IIXA 2GOUA 1GVRA 2HSAA 4O13A 3PSVA 1LCOA 2G96A 1IXPA 4GE8A 3LCGA 5DELA 1KM0A 2FPTA 3I7RA 3W74A 4MPQA 2DZXA 1SO4A 2P0OA 4XKYB 4XBKA 4FX8A 3W7QA 1EB3A 1VCFA 1LBFA 4AHQA 1AG1O 3PG8A 1SW0A 4JS3A 2ATSA 3G0UA 3WK0A 3UWVA 3SZ8A 3M1ZA 1YPFA 1I2OA 2ZTJA 1W5NA 3LV5A 5HULA 1TPUA 5LGXA 3UY8A 2P10A 3DFTA 2QDHA 4NXSA 4O19A 2X1TA 2ZRZA 3SR7A 5D2XA 1R47A 1ZY9A 3W87A 5K4XA 1TPEA 3NDOA 6TIMA 1IXNA 5C55A 3M0ZA 1DV7A 5FF7A 1JRCA 3DFOA 3DFPA 4QM1A 3UYCA 1A5CA 1SR9A 2ZZ5A 3RF9A 3G18A 4OWGA 3EWBX 4UNKA 4W9TA 4DBDA 3VCRA 2JK2A 2YYUA 3INPA 4I7UA 2C1HA 5IBXC 4LY8A 4O14A 1QPOA 4DO4A 4GXMA 3THAA 3C2RA 2BXVA 1C8VA 4M6VA 3W1XA 4IGHA 5D38A 3G22A 1LRNA 2C16A 1H61A 2V2DA 3LHZA 1K8YA 1H1ZA 2Y61A 1UBSA 1I2QA 3IGXA 3ZWSA 5K3VA 1G6CA 5HR6A 2A6NA 5LGZA 8TIMA 2ZRUA 5HWNA 1JRBA 5LNUA 3NQEA 4MVAA 1OF8A 3W6YA 4WOZA 1WV2A 3G3DA 1QPRA 2H3DA 3U6WA 3W7NA 5F4WA 3NM3A 2QR6A 5DBTA 2DZWA 1W5OA 4YXGA 1ZALA 3LV6A 3LHTA 3M7WA 3HG3A 4JD4A 3GXPA 3EWZA 1IXQA 5HMSA 3GXNA 3HGSA 3CIXA 4NNCA 2NXGA 3QQ1A 4JTHA 3LI0A 2WPBA 2YXGA 2E09A 2C0AA 2X2GA 5KMYA 3BK0A 4O0KA 4HIBA 5F1UA 3RLVA 1YLVA 3N73A 3IVSA 2OMAA 4OBTA 5DCBA 1FXQA 1PIIA 3LCLA 4UTIA 3QW4B 4WY0A 1B9BA 4JTIA 1KV8A 1S5TA 1UUMA 1GVFA 4MYAA 1QOQA 3I65A 3DFQA 4LVDA 4O12A 1I2RA 2X30A 3SY5A 1DQWA 5LZLA 1MEWA 2VFFA 4FNTA 3S1VA 4WJEA 2ZBTA 1EP3A 4LC6A 5LHEA 1QR7A 3VKJA 2DU2A 4UTHA 5KTLA 1OX6A 3NQ6A 5EPDA 4Y96A 3RLUA 3P7YA 3QZEA 2ZFAA 1THFD 3WJXA 3B4UA 1LTDA 4K7YA 5AHIA 3PBVA 3O05A 4OV4A 4PA8A 3DKLA 4ZQOA 3GDKA 4RZ6A 1O94A 4BF9A 2GPTA 2VKZG 3I7QA 5IM51 1CI1A 3EX4A 4WZHA 2ISWA 3LLDA 4RXFA 1Z41A 2J6XA 2P1FA 4ORMA 1D9EA 3O06A 3WJYA 4DELA 4LTSA 3O6YX 3QRHA 3N9RA 3TCEA 5AFDA 2QCHA 4M7TA 2QJHA 3KAOA 1SQ7A 3TMQA 4YCOA 4UTJA 4UTMA 3THQA 3G3MA 4DF0A 3UWWA 1YTDA 4YL2A 1JCJA 1XI3A 3IEBA 3L5MA 4JTGA 5CPMA 4XZ9A 2QCNA 4MKNA 3HOJA 2CWNA 3W7MA 3GLCA 4QIUA 2O7SA 2GVGA 5HNRA 2VFEA 3BGGA 1RQEA 1JUEA 1EP2A 3R13A 3T44A 2V30A 1KBIA 1SFJA 2RDUA 3MWAA 1TJPA 4N02A 3LCFA 1ML1A 3QJAA 4WOQA 3W7EA 3CIWA 3CQ0A 2TYSA 4M6PA 2XN2A 3LTPA 1Q3NA 5D03A 4MZ8A 1N7KA 2B7PA 4O52A 2CZFA 3NQVA 2IQTA 3EXRA 3PB0A 1G67A 3FJLA 1QFEA 2WQPA 2RFGA 4AWTA 1WAUA 4X3ZA 5K9DA 4Z0JA 1DVJA 4RK8A 5F2GA 1PCWA 3NVTA 3PAJA 4MJMA 3HJZA 3LXCA 1ZAJA 3PBYA 2NZLA 2QCFA 4JTSA 1SSDA 1V5XA 3ZR4A 3PG9A 4PCFA 2XN0A 1A5BA 3EWUA 4XUGA 4O57A 1G7UA 3C2OA 3S0CA 1BTMA 2EGZA 1H7PA 1L6SA 2A7RA 4UTLA 4JYFA 1XBYA 4AF0B 1SFLA 2Z2UA 3T78A 1XUUA 4XTIA 4CQ9A 1QCWA 3UWYA 5EYWA 2PRLA 1VGAA 4L4MA 1ZHAA 4JXCA 4MFEA 2Y70A 3MW7A 3M41A 1VCVA 2V81A 3BG3A 5CKSA 2H90A 3B0PA 5F2IA 3KRZA 2PRHA 2CU0A 4UMBA 3BVJA 4FXRA 3TSDA 2ZDRA 3TNOA 3S8HA 2QJGA 2W0UA 3MI6A 3TJLA 3LXBA 4BK9A 3IIOA 1F73A 3EXSA 3BW4A 3GKFA 4O28A 1RR2A 2QKFA 1VLWA 3GR8A 2VOMA 3LCHA 5D09A 3TH6A 3TFXA 4LUJA 3L5AA 2AGKA 4JTKA 4O8RA 3LRMA 2FPYA 1YPIA 3TXZA 4OV9A 2Y85A 2CLHA 3P82A 3LCIA 2ABAA 3W2JA 2C15A 3W2NA 1QWGA 2VC6A 3VE9A 1GOXA 1TREA 4E38A 4UTTC 3BG5A 4G1KA 3A21A 5I3FA 1T0OA 4IQLA 2ZRWA 3T55A 4Z08A 3L67A 4EWND 2A6LA 1G4TA 4RZ4A 4UFMA 5EL1A 3EKLA 4S1FA 1GYLA 2V5BA 2DZVA 5D2WA 4L4LA 1TPH1 3VI2A 1K8ZA 4CCDA 2YCEA 3NQAA 2FB3A 2HMCA 4KFNA 3RK8A 1OJXA 2CLFA 1OFPA 3TIMA 5AB3A 4N4PA 3LI1A 5I3KA 4K36A 2VEMA 1JVNA 3R5EA 3L9CA 4RXGA 3FA5A 2JKEA 1DL3A 4N9DA 1T96A 2QAFA 4LVFA 5AHLA 4KFOA 1YXDA 4IXHA 3SFKA 4JX4A 3OG3A 1PV8A 2NWRA 3PM6A 1PS9A 2ZZ1A 3NQCA 2E68A 1W56A 5GVJA 1RV8A 5CSSA 4Z1AA 1VPXA 2ZA2A 2DZUA 3B8DA 3G8EA 3W7GA 2Y63A 2Y89A 4XQ6A 5D2VA 1LROA 5I3IA 1FWWA 4Z1CA 2TRSA 1WBHA 1OX5A 1ICSA 1JCLA 3OEXA 4DPPA 3M5VA 1PCKA 2QCCA 3LM7A 3N34A 2OJPA 3FKKA 3NOEA 2PCQA 2R91A 2ZRYA 2H8ZA 3BPWA 1H62A 1O4UA 1GG0A 5DCEA 4A21A 4EF8A 1LOSA 3GDLA 1FWTA 3WK3A 3QMTA 3TU9A 1O60A 3EX1A 4ZQPA 1O5XA 3SECA 3IGSA 2WJZA 2RDWA 2YSWA 4AVFA 3C3NA 3P60A 3W85A 1H7RA 5CG7A 3TK7A 1W1ZA 5HJLA 3LCWA 5TIMA 4WY0B 2YZRA 1DOSA 4DO6A 4NJHA 1ZENA 2GVJA 4HNUA 4K7VA 3L0KA 4BWLA 3WJWA 1JCNA 3MI2A 4Q32A 1N55A 3IGUA 2YX0A 1DKWA 1VS1A 4FNQA 1OABA 4R33A 3UZ5A 3EB2A 3W7CA 1TSIA 3HF3A 1VLIA 3KOFA 3RU6A 4O1CA 2Z6JA 2V2CA 1KFBA 4K8EA 4AXKA 1D3GA 2QCMA 3PUEA 3EX3A 4WQ6A 1YADA 1YTEA 4Z1BA 1XL9A 1F6PA 3USBA 4GNJA 1QOPA 3MUXA 5CZJA 3KVMA 1B4EA 1PVNA 3D0CA 3GDTA 1KFJA 4N4QA 3AJXA 3QMRA 1A53A 4K37A 1W3TA 2B7OA 3W7OA 4JIPA 5DXYA 3NL2A 3IIVA 3DU0A 1QAPA 3G0XA 1RQHA 3CTLA 4CQ8A 2WNQA 4MZ1A 2UV8G 4ZQCA 1OFBA 3C2FA 4LUIA 3W83A 1LP6A 4I7VA 4S2BA 4BR1A 2WKJA 1AMKA 3PVFA 2VFGA 4QQ3A 1TPFA 3W72A 3B06A 4E2DA 3QW3A 3OBKA 1EA0A 7TIMA 1KTNA 4JY9A 4IOTA 3SGZA 5EKYA 1J2WA 3WJZA 1KA9F 4RKAA 2RH9A 5D32A 2A2IA 3EX2A 1R46A 1VYSX 2C3ZA 4TMCA 1TPDA 3TQ0A 1C29A 1NF0A 5HUPA 3NPVA 1TB3A 5AC8A 1W5MA 3EWXA 5G2HA 1H50A 4M7SA 5FF4A 3F4NA 3G1YA 3PBUA 5HINA 5K7JA 2B4GA 3I68A 2X1RA 2Z6IA 3YPIA 1TIMA 4JX6A 2Y7GA 1H5YA 1LBMA 2G95A 2TPSA 2E5CA 2TSYA 5D30A 3TV8A 5C5YA 1FDJA 2CLMA 3HB9A 3UWQA 2VFDA 1TPC1 3ABOA 1Q6RA 4NVTA 3HQ1A 3R12A 2A85A 1JULA 3Q37A 4MIMA 4A2SA 3L0NA 3IVUA 1SZFA 2BWGA 1Z48A 2WOQA 2CFFA 3MHGA 4JYEA 3QPYA 4QAIA 1EWEA 2VXNA 3CM4A 4CLMA 4K39A 4MUZA 1OX4A 3DI0A 3ABQA 3LBMA 1LOLA 2KZHA 3F4WA 3W1MA 3G1VA 4UXDA 2BX7A 1XDMA 3NAVA 4FNSA 4YWIA 4GUGA 1T8XA 2R14A 4MYXA 1PE1A 2OCZA 2NLIA 2FIQA 3NL5A 1VHNA 1GYNA 3W76A 1MZHA 4JTTA 1H63A 3QQ0A 3OIXA 2CZ5A 3W7HA 1BWLA 3ZWTA 4GRSA 3M5ZA 2B7QA 4RX0A 2ZCGA 1VHCA 1G4SA 2OX1A 3N14A 2Q3RA 2TMDA 4RZ5A 1A5AA 1X1ZA 4FXSA 1F76A 1MO0A 1SW3A 5C2XA 1I45A 3B04A 3NPWA 4ZMGA 4WXZA 2W6RA 4DF1A 3LERA 3NG3A 1LZOA 2FTPA 3GNNA 3QH2A 1IGSA 3W23A 3BARA 3P84A 5FF3A 1OX4B 3BW3A 3EWYA 4IMEA 4R7JA 1DBTA 2DZSA 1SW7A 3VNDA 3HG4A 4WUIA 2J9ZA 3LRLA 1ICQA 3ZS4A 2Y7EA 3KVJA 4HNNA 2ZA3A 1ONRA 3S5ZA 2WSYA 1W3IA 1OF6A 2E1DA 3G1XA 3HPSA 2GJLA 3W9ZA 2QF7A 1S5WA 1PHWA 2YR1A 5DY3A 1LRTA 3S1XA 3EKZA 3QSTA 4FB7A 4IJBA 2H6RA 3NQ2A 1DJQA 3UPBA 3MI3A 1SUXA 4BI6A 4ZQNA 1FDZA 1ME7A 5BMXA 2G5WA 3W70A 3W2LA 4ADTA 1R30A 3OVPA 4FEZA 5FESA 4O1BA 5CGQA 5I3JA 1JUBA 3QM3A 1G69A 4JTFA 1OFOA 4LVGA 2A4AA 1I2PA 1L9WA 4K38A 5FEPA 3CWNA 1RPXA 4Z0SA 1OHLA 4UTUA 2QDGA 1EP1A 2QCGA 3BO9A 5SWUA 3C6CA 3W3OA 2VEKA 2CLIA 3A23A 5U4NA 1O95A 1XKYA 3WK1A 1TYGA 4LVAA 1R2SA 3QSRA 3W7LA 3V75A 3CEUA 3W1AA 2EHHA 4FF7A 4O11A 1GWJA 4FX6M 4ORIA 3W2MA 4NUWA 5LNSA 4AEOA 2YGYA 2NXIA 1FBAA 1FUYA 3O15A 1GTHA 1W3NA 3DI1A 2VENA 4QISA 3S5YA 3BLFA 5DBUA 3W86A 2Q8LA 4UIOA 2I14A 3MHUA 4JICA 4BI5A 4JNMA 4UFIA 4I9AA 4R53A 5E93A 1LDCA 4HT3A 3SSJA 4Y9AA 4PEKA 1C9DA 4OE7A 4UMCA 4AMAA 5T26A 5CZTA 3W7IA 5DLCA 3STEA 3F03K 1L2UA 4H4IA 2X1UA 3HGRA 2WV8A 4LU0A 1LYXA 4H6KA 4BWLC 1LBLA 2HTMA 3P80A 4LRSA 4IWWA 1FCUA 4UC5A 4JTUA 2QCDB 1KLYA 3W88A 5F2MA 5G5IA 3OVRA 3WFAA 3IV3A 4QSHA 1WOAA 4LS1A 3TUUA 1TRIA 2OT0A 1XBVA 2EF9A 2Y7DA 2CW6A 2LLEA 3N9SA 4NQ1A 1DHPA 1AW5A 4PH6A 2NV2A 2BZNA 3S9YA 3MO7A 1W37A 3RMJA 1FWSA 3KRSA 4LV4A 4GFSA 3TSBA 4FNRA 1W0MA 2VFHA 2H8XA 2ABBA 3LHYA 3A5VA 5KINA 3TSMA 2FPVA 1KFEA 3IRDA 4BFAA 2V8ZA 4S2CA 3C56A 5CZSA
chains in the Genus database with same CATH superfamily
1V3KA 2VQTA 4V15A 1V6TA 3KBSA 1IXOA 1Q13A 4K1WA 5I3HA 4A29A 1SO6A 2YZ5A 1XSIA 3TWBA 1QNRA 1QWKA 3B0YA 1XM3A 5BRBA 2D24A 1M03A 2F6UA 4AZ5A 2CXEA 4KKXA 3B9NA 4N2YA 3H7VA 3GX9A 1MRAA 3BV7A 2QNEA 1TRDA 4DZ5A 3DAQA 4OOUA 5DFAA 1XC4A 1YKWA 2Z1BA 2JF7A 3N4EA 5I78A 1F3WA 1VEMA 1CLVA 3KL3A 3F7JA 2VDHA 3LHWA 1FXPA 1JXKA 4DNHA 1J0HA 2VOTA 4GI8A 4DBWA 3R79A 4QXIA 3UESA 2Z2BA 4ZCWA 4Q3MA 2YW3A 2QMKA 3B97A 3V0TA 4JFSA 4ZSTA 2WHJA 1POJA 3CZ8A 3NVDA 2VVSA 1C7SA 2FMOA 2IQDA 3HFYA 2WZTA 1NU5A 3KM8A 1Z7AA 1K9FA 5F4SA 2ZVIA 4AD3A 3RJYA 4M51A 4E2BA 4YVPA 1EC8A 4Y90A 4LPCA 4X60A 2PGFA 1OFEA 4IP4A 2FJKA 3C5QA 1WDQA 3BMXA 4JHZA 4M56A 4OT7A 4QE4A 4UNLA 3HBLA 5DRCA 3SI9A 1RZMA 4PSRA 4M3PA 3AHZA 3H2MA 1KBBA 2XM2A 4H9UA 5DRIA 4F8XA 3TN6A 4O15A 4C6LA 3N4FA 1E6XM 4P7LA 4ZFMA 1Y0EA 5H2ZA 5D9PA 1YDNA 2J24A 4C5ZA 3DHFA 3FN9A 3A9BA 1WZAA 8XIAA 4NY2A 3BLIA 2HK1A 1W17A 2QJNA 2PDIA 3GDRA 3ZSTA 4B9ZA 1S38A 1VH7A 4GZEA 3UWUA 3S1WA 4D6FA 3FEMA 3LDVA 5EMMA 5FAJA 2CYGA 1PB0A 2YLAA 3MS8A 2ZTKA 4R85A 3ZMRA 4IJRA 5CZ0A 1MNZA 4WDXA 3A12A 2NWSA 2DEPA 5DCDA 9XIMA 1TV5A 3FHAA 2PDNA 4W93A 3BAIA 3BGJA 5AZ0A 5GQBA 3TQKA 2AQWA 3LTYA 5E6YA 1VIZA 2BVTA 1EDTA 4QDWA 4GWEA 4MDPA 4XB3A 3AS3A 4GZJA 3SIZA 3VM5A 2QQ6A 1UA3A 2ZUNA 1FY6A 2V5CA 5AOUA 4FNUA 3GG7A 3ORWA 3ARWA 1Q4NX 5AYXA 3CAKA 1OVDA 1MUWA 5A5WA 1QPQA 4IIEA 3PTDA 5I06A 4ZZ9A 2A5HA 3R1ZA 2Z0IA 1NQKA 4RW5A 4CEUC 3CPUA 2Q02A 5H6HA 1E73M 5HNNA 2O0TA 3E1F1 2PCEA 3M46A 4NYYA 1MYRA 3BAJA 3N2OA 4I5UA 2J4GA 3CLMA 3CT7A 2ICSA 1JCTA 4LJ3A 3HIJA 2ZA1A 4JR5A 4LANA 5F4XA 3W38A 1A5NC 3K4DA 3LLFA 4F9JA 2UY4A 3M0XA 5BW6A 3H8AA 1QPNA 3A22A 3ALFA 2VGBA 3L68A 3LLXA 3BCDA 4IP7A 5AHFA 4LS2A 5FSDC 3HV8A 1UWRA 4LVBA 2ATMA 1NEYA 4RE2A 1LOQA 3P2VA 1JCYA 4U10A 1KTBA 4N9CA 2DH3A 1GZGA 1W3KA 2VCBA 3U4FA 3G1DA 3VFLA 3CTTA 4GI9A 4XZLX 1NFBA 2QMJA 3TLQA 5J5DA 3PFMA 3ELFA 1C92A 1B4KA 4KCVA 2YL6A 1UKSA 1TR1A 4CEXC 3WQGA 4QG8A 1X6LA 3FLUA 2VM8A 3TROA 4FAMA 4R9OA 1SZEA 3DG6A 2XSAA 2F8QA 3W1QA 4AH7A 2V0TA 4LFYA 4WGHA 3O0KA 1XP3A 1P1XA 3GR7A 4LSBA 4XD3A 3T7VA 4GGBA 4O8AA 4XO6A 4IISA 1EGVA 1UP0A 2G8ZA 4Q4PA 1Y5VA 5BNKA 3A5FA 1XIMA 4NNAA 4X9SA 1K4HA 2ZX8A 1N8FA 1GW1A 2D3NA 1AL8A 3COTA 1GNXA 4D6DA 2JKAA 1Q8JA 3KHDA 3L21A 5A8OA 1KV5A 4WXYA 1R2TA 4JNYA 1BXCA 3W1RA 1KBLA 3RX4A 2CLKA 3VNYA 1T99A 2NXHA 3WLOA 3SGGA 1YTKA 2C18A 1REQA 3LX9A 1BF2A 3FVDA 4PUUA 2OSYA 4LF1A 3QC3A 3UU0A 1Q63A 3SJNA 4Y8FA 3WLKX 3PC0A 1W31A 3PUOA 1Z8AA 2XFRA 1I1XA 2IUZA 3WBXA 1XFBA 3OA3A 1XBZA 1DWIM 3WL0A 2X0SA 1YXCA 4J3UA 2R8WA 3TYEA 4X2PA 4CN6A 3GTFA 4BQ4A 4G56A 4FNPA 3BV4A 3FW6A 1TCMA 4FIRA 1KXTA 3MVIA 4NZ5A 3ZYZA 2DP3A 3U2ZA 1R5YA 3HPFA 3TX9A 1CXFA 1J0YA 3WUEA 2XVKA 1FRBA 2E8ZA 3MO4A 3VGFA 1KM6A 3ARYA 1TG7A 1EJSC 3R2GA 3LOTA 1P6WA 5A8QA 5J5RA 1SO5A 3NGJA 1ITQA 3FKRA 3AXMA 5LYRA 1EC9A 4D8LA 1J0IA 5T9BG 4MJZA 4V28A 4LAMA 1F7BA 1XPYA 3I6RA 5EMUA 3T0BA 2JEQA 2XVLA 1W5QA 4B5WA 1LWJA 4MWAA 3OZMA 1IF2A 3TFCA 4J5NA 5BRPA 6PTDA 3Q94A 3WQ6A 3G6MA 1E9YB 1C7TA 2VZVA 1KM3A 3LGDA 2BXYA 3GVVA 3JR2A 4LCRA 1R2RA 3ABXA 2GJNA 4BHYA 3TQVA 2ACUA 1TMLA 2JIWA 3N3MA 4PUWA 2X0YA 2J75A 3WEOA 3EXTA 4RW3A 2F84A 5LNVA 4HSOA 4IL2A 3GR4A 1CCWB 3NGFA 1NAL1 2WMFA 2OKOA 1VFOA 1NTHA 2ZE3A 2J9XA 3CL7A 3MP4A 3NZGA 5E1QA 2J88A 1ISVA 2YJQA 2Y5JA 1MEHA 2ZUUA 1UYQA 1VF8A 3C52A 2NV1A 4ZEPA 4CCCA 3AC0A 4CVUA 2BOFX 1TZ7A 2GUBA 1C93A 3E38A 4OHQA 5BWAA 1UP3A 5F1VA 2Q8ZA 3FX4A 3SCUA 4HGXA 3M0YA 1JDCA 3UZYA 4QS5A 1IHIA 1IYXA 1OCQA 1XG4A 2WJEA 4HPJA 4YTRA 5M1TA 1U5JA 1DJYA 3LNPA 4XAFA 3OQEA 4AYGA 1V8EA 2DVUA 3OHMB 3GBEA 5FCZA 1HKVA 2Z27A 2VGIA 2Z4GA 4PB4A 4KWSA 4IM4A 1EOMA 4MUPA 1FWIC 4FMVA 3PN8A 2FKPA 5CSUA 2ZZ2A 1CGUA 4HQVA 4JY8A 4KGJA 1DJXA 1TR9A 5M17A 4YMZA 4AD5A 2VEPA 4NJIA 4IZGA 1E9IA 3U9IA 2W91A 4NZJA 2CKSA 1LT7A 3MJMA 4JYDA 5KITA 3OP2A 4PSPA 2WSKA 3FNDA 5DF0A 5C54A 5JU6A 3MDWA 1R9XA 4CKQA 5HQEA 2HRWA 4ZQMA 3NR0A 3IIZA 3SQLA 4PMZA 5K9CA 1F5ZA 2E6AA 1Q6LA 4I9MA 1IT7A 2VVNA 3JRKA 1BYAA 2PTWA 1GEQA 1EGMA 1CXLA 1FWNA 2PP0A 3SUSA 3TXVA 1O12A 1TELA 5LIYX 4E8DA 2HWGA 3KCLA 5MHBA 4JDBA 1AD1A 3T09A 2QCDA 3BLPX 3SCRA 3EOOA 4J2PA 1HVQA 3WMLA 4RZBA 3K5XA 2R24A 1FKXA 4HHPA 1GVQA 3BCJA 3T2OA 5KSWA 5I77A 2UBPC 5BMWA 1WXJA 5CLTA 1RQBA 3FYOA 2I56A 2P5NA 1UPPA 4GBDA 2OZ0A 4JX5A 4TVDA 3PWIA 3A4JA 4RE4A 2E6FA 3KE0A 4L56A 2WANA 3D46A 3CEPA 1OC6A 2ISVA 3CH0A 3EMCA 3C4UA 3HM7A 1O5KA 1U22A 1BVZA 2A1YA 4RPPA 1W9BM 4A22A 1UWQA 1ALDA 4PTVA 5BXSA 3S1UA 1H7OA 2XPKA 3SADA 1PZ1A 1QDSA 4PUNA 2WQDA 3LBCA 3GZ3A 3UY7A 4DXXA 4IGNA 3SJ3A 3W7RA 3W84A 5FEZA 2A7PA 1KFLA 4OGZA 2PE4A 2PDMA 2E5BA 3VOGA 1EYWA 4XIMA 4FPSA 3CQIA 2F9RA 4B5NA 3BG9A 3M5XA 3GHUA 3QV6A 3RYSA 2HQAA 1GQNA 2V63A 1B54A 3MQTA 3QY8A 3IK4A 5IFTA 1P48A 1UJQA 5TQLA 1GYMA 2REQA 4QLJA 1HO4A 7A3HA 5BXTA 3PZIA 4A6GA 4JTQA 3RCNA 4DPQA 4N42A 4XKMA 4QDMA 3QPZA 2WCAA 3M0HA 3FSUA 3GK0A 1PWLA 3GW3A 5FEXA 4HNVA 2YL9A 3R0UA 4L4OA 1JIBA 2QYGA 3MYOA 4QEEA 1TCDA 1X38A 4PTWA 4E3VA 2RJHA 4ZQRA 4AD4A 4LOCA 3P74A 1GOQA 2GLKA 4J9JA 4OZOA 3KUMA 3WQDA 1A4MA 4HBKA 1JCMP 2FGZA 2BP1A 3WELA 2NX9A 5LNRA 1ZAHA 2J8FA 1OSEA 3WQWA 3QR0A 3CASA 2DW6A 3RR1A 1JJKA 3KP0A 4GVFA 1VFLA 5HPCA 2Y1HA 4M19A 5BU9A 4PTNA 3WQVA 3WUGA 4MWAC 3QPEA 3R43A 3Q2DA 4GYFA 1D3HA 3B03A 2RAGA 2QF8A 5K2ZA 2PB1A 5EY5A 1S2VA 2Y88A 4R7WA 1ODUA 3LCGA 4LXFA 1KCXA 4AIBA 1DIKA 3I7RA 4NAFA 3W74A 1M7JA 4QG9A 4HK5A 2EQDA 4FX8A 3GFZA 3PZ9A 1NWTA 3DYPA 1DHKA 3N29A 3WK0A 2BY1A 1FFQA 1NFPA 2R1MA 5EBAA 4I8DA 3DERA 3SZ8A 2QVHA 3M1ZA 1I2OA 1U5VA 5LGXA 3V18A 3GIQA 3OYXA 3VIKA 1QI0A 1EBHA 4ZOBA 2YBUA 2X1TA 4I6VA 3W87A 6TIMA 4DUXA 2IMRA 3AMCA 1JRCA 3DFOA 3DFPA 4QM1A 3GNOA 1A5CA 3OGRA 3RUBL 3RF9A 3G18A 1RBLA 4UNKA 1XDJA 2HE8A 3MUIA 3UF9A 2AOSA 2C1HA 5IBXC 4LY8A 4O14A 4DUWA 2YIHA 2GJXA 4JN7A 2BXVA 1UR0A 4IFOA 3IUHA 2J78A 1ZBKA 1GJUA 3FJNA 2FH8A 2ZXDA 3VDAA 3QOMA 3RAOA 4K1GA 4HD5A 2A6NA 3RLGA 4LAOA 8TIMA 1JRBA 5LNUA 3NQEA 4MVAA 1WV2A 3B9AA 4PUKA 3U6WA 3W7NA 2AKMA 3NM3A 2GWGA 2QR6A 5DBTA 2ZXQA 5HAOA 3WDPP 3W01A 2NQZA 1VKFA 4JD4A 2A3CA 3RO6A 1K6AA 2PDJA 2EJ1A 5HMSA 2WPBA 1Z69A 5A6BA 2E09A 1R86A 3BK0A 3K1DA 5F1UA 4GY1A 1GOMA 4FLQA 1PDZA 4AXNA 5BXPA 2FHBA 1EQPA 1JPHA 4HYWA 1Q85A 1WZMA 4UTIA 4HMEA 1GORA 1B9BA 1WNOA 2CITA 2VCAA 1QOQA 1U1UA 1ADDA 2XIOA 2X30A 3PZQA 1EPVA 4G2DA 4LC6A 3VIMA 3ZT5A 3BLLA 5EPDA 4HZMA 4ILSA 1LTDA 4PR4A 5I07A 1V0KA 5JBFA 4XZHA 3WD3A 4KEUA 3WH5A 4RZ6A 5A3HA 2WMIB 4BF9A 2BB0A 4JTCA 1MFVA 1CI1A 5IM51 4FI4A 2J6XA 2PGWA 4ORMA 1D9EA 3WJYA 3O6YX 5MKGA 1TJ0A 3N9RA 2QCHA 3K1GA 3QY6A 3TMQA 4YCOA 3DCPA 3CT2A 1IZKA 4H01A 3THQA 3SCPA 2BOEX 2PDUA 4A05A 2BY3A 2W67A 2QCNA 4AIOA 1RUSA 1T5AA 4GISA 4KMQA 2X09A 2PP3A 2QT3A 4QIUA 2GVGA 4P7QA 2DGAA 3BGGA 2NQLA 3R13A 5E5CA 4MADA 1SFJA 3U3HA 1IEIA 4ASTA 2ZUWA 3W7EA 3LPFA 3GYCA 1W8GA 3P0XA 4JCLA 3B8UA 3CIWA 5I02A 3LTPA 1N7KA 4O52A 1S2WA 4S3DA 3RU8X 2V38A 2HPIA 2IQTA 1XGZA 2BG5A 4HPGA 4G7EA 1PPIA 2RFGA 4ACZA 5GJNA 3QKZA 3GVWA 1IGWA 4MF4A 3RPDA 1O1HA 4IUGA 1CTNA 1JF6A 5A6TC 3WH7A 4EXBA 2CHNA 4AZGA 3PAJA 7ENLA 3DHUA 1ZAJA 3PBYA 3DYMA 1HKJA 1V5XA 1XF0A 4YS1A 4CQBA 4BJHA 2X42A 1G7UA 3QV7A 2E3ZA 3FA3A 1UD3A 2A7RA 4UTLA 5I09A 4AF0B 2Q09A 1JYNA 2D2GA 3H12A 3T78A 4IQJA 5DEZA 1VGAA 4L4MA 4JXCA 3OIHA 1OCNA 3AXIA 1RP9A 2H90A 3MY9A 3V16A 2EPMX 4O1EA 4HZ7A 3J7HA 1U5HA 1V3HA 4YTTA 4UMBA 3TSDA 3HU7A 3T9PA 1E70M 3SN4A 1QI5A 4LGXA 3MI6A 3UPMA 1EDGA 1DPMA 5AYBA 3LMZA 3WLRA 3QVQA 2A3HA 3EDEA 3IIOA 4ZO9A 3EXSA 5JVLA 2YA1A 3LCHA 3TWAA 2BY2A 2AGKA 5C70A 3OBAA 3M0KA 1XLMA 1DWHM 2FPYA 3TXZA 2D0HA 3P82A 3BAWA 4C91A 5I24A 1QWGA 4HU3A 3VE9A 4Q8QA 4LAKA 2ZDSA 1T0OA 4IQLA 5HQLA 1FOBA 4EWND 4PB5A 4L4LA 1TPH1 3PAOA 2YCEA 3NQAA 2ESCA 2Y5EA 4HOWA 1OFPA 3TIMA 5AB3A 5A6KA 4G8TA 4ICMA 3L9CA 4RXGA 2OB3A 3FA5A 3DHPA 3DBNA 3TTEA 3EPMA 3KW3A 5AHLA 3WDHA 3LSCA 4P8VA 1R3QA 2QV5A 4CNTA 3OG3A 4DWDA 2D2HA 1SJAA 3CUGA 1C9WA 3P6LA 5C9ZA 2YDRA 4XK2A 3NQCA 1SM9A 6XIAA 5CSSA 1UWSA 3SFWA 3SRFA 4Z1AA 1XQKA 5C9WA 3CBWA 2Y63A 2Y89A 5I3IA 1J96A 5GNYA 1JEZA 3PFRA 1C8QA 1KCZA 5EB8A 2AQVA 1XLLA 1KRMA 4KBXA 1QHPA 3N34A 4YYCA 3AROA 4JQAA 4NRSA 2R91A 4XSMA 1FHVA 2ZRYA 3ABZA 1O4UA 3UA4A 4MB3A 4OTKA 6XIMA 3VKCA 3TU9A 1O60A 4ZQPA 3IGSA 2J8TA 2RDWA 4NHVA 3C3NA 4E4PA 2PTXA 3LCWA 4Z2LA 5TIMA 2YZRA 4B9YA 1DOSA 4WKAA 3MMWA 1ZENA 4HNUA 3L0KA 4B4FA 3HTWA 5TNVA 4DRSA 4MB4A 4AC7C 4BWLA 3WJWA 4XUYA 2XINA 1JCNA 4Q32A 1N55A 9RUBA 1OABA 4R33A 3W7CA 4PRTA 4TV5A 1YNPA 3KOFA 2P53A 3MSRA 1TZZA 2Z6JA 3R10A 2V2CA 5A6SA 4K8EA 4AXKA 3T8QA 2VX6A 1PO9A 2Z7GA 3PUGA 2OZ8A 2X2YA 2PUZA 5CZJA 3APGA 3OODA 5JIPA 5IDIA 1PVNA 4H9YA 5M3WA 3AJXA 1Z9AA 4PBEA 3NL2A 4DO7A 1XIHA 3G0XA 2IXUA 3MZNA 5LIXX 2DT0A 2WNQA 4DJFC 7CGTA 1AFSA 4ZQCA 3C2FA 1HKWA 3PP7A 1A4LA 1QK0A 4S2BA 4MPKA 1AQFA 1JG9A 1TPFA 3SCNA 4C60A 3OBKA 3T07A 1U1HA 4D6EA 7TIMA 4L61A 4REQA 2P3ZA 3D47A 2VWSA 4IOTA 5EKYA 3LGGA 4GQ0A 3N15A 4RKAA 2RH9A 4RL3A 3L2LA 5D32A 2A2IA 2Z00A 3UCCA 3EX2A 2VT0A 2VTFA 3TQ0A 1C29A 3GTHA 3BURA 3NPVA 1W5MA 4CNSA 3SO7A 3T1GA 4DJED 5FF4A 3G1YA 5HINA 4LF2A 5ABEA 3I68A 1TJ1A 4DYJA 2D3LA 1TIMA 1AJ2A 1H5YA 1HN1A 1YE4A 3B8TA 2TPSA 9CGTA 1RD6A 4XV0A 2XZ9A 5C5YA 4Y2WA 4UZSA 4E5TA 4UCFA 3HQ1A 3BOFA 3Q37A 2QDDA 1SZFA 1Z48A 2CFFA 3MHGA 3WF4A 3V1HA 2QJMA 3NUKA 3CM4A 1W2VA 4K39A 3N2BA 3ABQA 3LBMA 3FSTA 1XDMA 3CO8A 4JFTA 3IUDA 1LG2A 1T8XA 1PE1A 1JL8A 2FIQA 3L4VA 3AJ7A 5EMJA 4JTTA 1H63A 1W32A 1UWAA 3SQSA 2B7QA 3LPGA 1IZCA 3AYRA 4QEHA 3T81A 5TF0A 1FWGC 2TMDA 4RZ5A 5BROA 1CNVA 3ZJ7A 1SW3A 5C2XA 4IICA 4HK6A 4GACA 2W6RA 4KCUA 3LERA 1VRXA 4PRRA 5C7VA 2YCJA 4HCHA 1W1IE 3QHNA 3W23A 4ACYA 1I6NA 4AVNA 4Z42C 3CZLA 1ONEA 3GM8A 1DBTA 4AZBA 1SW7A 3VNDA 4WUIA 3VOFA 1PZ3A 4ATLA 4HNNA 3S5ZA 1OF6A 3QTGA 4GXWA 2V5JA 3S9IA 3S46A 2PMQA 3VGEA 3VFCA 3SY1A 4EXAA 2GYIA 5C71A 1J9YA 3A3WA 3SCQA 2H6RA 4IJBA 3C3UA 3UPBA 3T0AA 2G5WA 1XLGA 1HL9A 5FESA 3WNNA 5I3JA 3WLNA 4I3GA 3TQPA 3IGHX 2E9LA 3BH4A 3CWNA 1Y5XA 2E9MA 3MDUA 4UTUA 2QDGA 2X8RA 3K2GA 5SWUA 3GXIA 3W3OA 3JW7A 2VEKA 1EC7A 3EZ4A 2X40A 5CBJA 4BF7A 1XYFA 5EGRA 1QHOA 1GQIA 3QSRA 3W7LA 3E2QA 1YE6A 5BOEA 2EHHA 4FF7A 4OFCA 3XINA 4O11A 4FX6M 2J8GA 5LNSA 1AZ2A 2XIMA 1E3ZA 1FUYA 4LQ1A 1US2A 1R3VA 3HQPA 2VENA 3LS9A 4LEFA 5XIMA 3S5YA 2PLKA 5DBUA 5CJMA 3CV6A 2I14A 3WCZA 4D9PA 4JICA 5F7UA 1UH2A 2C79A 5FJPA 4QCEA 2WC3A 4NSBA 3RITA 4PEEA 4OE7A 1X97A 4UMCA 4AMAA 1W3JA 3W7IA 4L64A 3STEA 1EJUC 3HGRA 1RP8A 1JAKA 3CQKA 4P7OA 4MHBA 5A69A 6TAAA 4AWEA 3ZM8A 3DX5A 2QCDB 1VD6A 5F2MA 3IV3A 1TKKA 2INFA 3E3HA 1TRIA 2OT0A 2Y7DA 2CW6A 3N9SA 1JFHA 4K2SA 2D0FA 4MB5A 2XH4A 2NV2A 1R8LA 4A35A 1QW9A 1W3LA 4D6IA 5BCAA 4GFSA 1W0MA 2ABBA 3LHYA 3AMDA 3S2CA 2OEMA 3H6OA 3AYTA 1LQ0A 1BAGA 4S2CA 4AZCB 3C56A 2XIJA 1V7YA 4N6EA 2A21A 4GUIA 4TUFA 4J2MA 2I17A 3K8KA 1P0EA 4OQVA 3W29A 2G3MA 3Q45A 3TAKA 4LYQA 1I4NA 2V9DA 2HNEA 3I3BA 2O9RA 1IIHA 4A4AA 1DYSA 4GJJA 4H19A 2DQXA 4Q4MA 2ZICA 2E77A 4POCA 2DZTA 1XLEA 2E0PA 4Q4KA 4WJ8A 2NX1A 4S3AA 3MCOA 1V6VA 3VD5A 3UJSA 3V1PA 3AHTA 1WKYA 1DJNA 2BXZA 1YBQB 4XZIA 4NYUA 1A0EA 1NF7A 3KVLA 4XISA 2OGYA 4D6CA 4IFKB 4W7WA 3RPTA 2Q3OA 4DZHA 1PDYA 4HOXA 4AVOA 3UWZA 3T4CA 4ML9A 3N2XA 3NZRA 4IG2A 3K8MA 4NIRA 3W7DA 4GVGA 3ABRA 5BZAA 4C1NB 2ACSA 5TBOA 2A0NA 1W9UA 4GD0A 4JGDA 4A8IA 1K6WA 3UBPC 3GVGA 5FL0A 3HO8A 4O16A 4UFKA 3VD4A 3IWPA 3UNDA 2OO0A 1HXJA 1V08A 4JFUA 3ICJA 3NQDA 2W63A 1G1YA 3C8FA 1TJ2A 1LL6A 4O4WA 3E0WA 2PEVA 2J7EA 2FFIA 3O6DA 3IARA 1XYLA 1AQHA 4LY4A 5HWMA 4XZWA 3BAXA 5CC5A 1QATA 4GPNA 2AMGA 3TYDA 2X7VA 2Y2WA 1H7NA 1R85A 4IPNB 1EXPA 2HS8A 1ISZA 4UB9A 3UGRA 3DH7A 1JYXA 3ME3A 3M64A 2ZXBA 4UUIA 2CWXA 4HA3A 1R9YA 2OVLA 2CBJA 4CQCA 3M16A 4W87A 3GIYA 3CUFA 2QUTA 1TMQA 1A5OC 3P5YA 4JN6A 4W5ZA 2CESA 5A8NA 3F5JA 1H1NA 3NTYA 3BMVA 1UMYA 1ECEA 1XICA 1OYBA 4IIBA 3PWAA 4RDVA 5GNXA 5C2CA 2VEIA 2PDPA 3DGBA 1GGOA 3W1NA 1XCFA 2X7WA 2V3FA 4LCQA 4E4UA 3NEVA 1GJPA 1KM4A 1QJWA 3TP4A 3VNIA 3ARZA 2B0MA 4OUEA 4AUBA 5I7GA 3IVTA 2V82A 3ALGA 1V0NA 4O18A 2VRJA 3GQYA 1YQ2A 4K68A 1WO2A 4GJ1A 4UTFA 1A50A 4G6CA 3VX0A 1W8SA 2PFHA 1S3HA 3CHCA 4YTQA 3DHDA 4TIMA 2XVNA 2F2HA 3E2SA 4AY8A 3M0JA 5K4ZA 3WYZA 1PHQA 3SCTA 4AYSA 4ROPA 4EX4A 1P0NA 3UR5A 4GZIA 3UERA 2ZIDA 3CZKA 1HL2A 3KHJA 2PDLA 4JTAA 3ZSSA 5DN1A 3NOYA 4X2RA 4RLIA 3M44A 1OC5A 3B8SA 3HURA 3GTIA 1KCLA 3C2VA 5AHMA 2VZUA 1WQ5A 3A13A 4J3XA 1CENA 4GNKB 4PB3A 1KM1A 5DY2A 1MRQA 4ACZB 4UR7A 5CEWA 4GX9A 2PDGA 4KWWA 1HVXA 3OZOA 1Y5WA 3EA2A 1XLKA 4CQDA 4IIDA 1DXIA 4KRUA 1HX0A 1B57A 2ZZ6A 5FJOA 1HGWA 5LA0A 5EA9A 3KLKA 1K9EA 3S5OA 5AC7A 2FJUB 1D8CA 3NEHA 4PBGA 1LLWA 4UTWA 2W61A 5KZMA 3E0LA 4KF1A 2FB2A 2W9MA 3P67A 1QO5A 2VUYA 1QK2A 3O63A 3P62A 2G97A 2VZSA 3UR7A 3L5LA 4KW2A 1MZRA 8A3HA 3WQFA 4HB7A 1SO3A 2ZX5A 1X8FA 3EAUA 2GDVA 5D8ZA 4FXJA 1AH3A 1RK5A 4GCXA 5CAHA 2DIKA 5CC3A 1JDFA 3BJTA 3SB0A 2RDXA 2DW7A 3G0SA 6ALDA 2NQJA 4B16A 1M9HA 4C7GA 1W2PA 3W1LA 2I9EA 3JVAA 1GVOA 2WO5A 3AI0A 4GH1A 3E49A 1MW2A 1BSIA 4XZMX 5FKYA 4GQQA 4D6JA 3ATYA 3AMLA 5D9MA 2GGIA 4B5TA 1QBAA 3TW7A 5M03A 2RHGA 4C7DA 3VNKA 3THUA 2G3JA 5LNWA 1GCYA 1UIPA 4KEMA 4QITA 5H8UA 1CLKA 3UNTA 4ZODA 1RPKA 4A3QA 4K3ZA 1M53A 3STCA 1RY0A 1VR6A 3VDCA 3DIPA 3FA4A 2NVCA 1ZSXA 1ZB5A 3A24A 2H3BA 4JTLA 4HP5A 4F0SA 4H41A 3VOCA 4PTDA 1MSSA 1YDOA 3T6CA 1AL7A 3GDMA 4AAJA 5A8PA 3W7PA 1H41A 2Y6ZA 5E0KA 3ATZA 1B3VA 3HN3A 3MMTA 4C6NA 2XUCA 3MB9A 3TKFA 2PODA 2W79A 2HPMA 4NJKA 3G1SA 4BEQA 3E2VA 4B5VA 1MVYA 3IJDA 1RCQA 1X39A 4HNTA 1BTCA 3CAWA 4DO5A 3SCOA 1UHVA 3G1HA 3GB6A 3PJUA 3OHIA 1RBAA 3AHVA 4B5UA 1MQRA 4PMDA 4RV8A 7ODCA 2C1GA 3V0SA 1OGGA 4EOUA 2R1NA 3F2DA 1JPDX 1TV8A 4YN5A 2W27A 4MNJA 1PKYA 2QAPA 4ZE4A 1TWDA 5HXMA 3IJQA 3U48A 3BXWA 1A47A 3GVRA 1AQ0A 1TTJA 2GJRA 4C6FA 1WAWA 4TR9A 4W86A 3U57A 4PL1A 2PRMA 1A3XA 4CU7A 4AWSA 2YA0A 1M7PA 3E6EA 5IHSA 3L4YA 3SM0A 4WKHA 1EX5A 5HWJA 4G9PA 2WJFA 4YVXA 4G1NA 1CGVA 3W7KA 4PBFA 3LYEA 3KBMA 3SEPA 4F3HA 3AYVA 1A0DA 5ABTA 3O7UA 4NNBA 1J4EA 4DLMA 1NARA 5L9FA 4LBUA 4IXXA 1MXSA 2PC8A 4GY7A 4O17A 1EJWC 3TW6A 4DQWA 1K02A 1DTUA 1N8WA 4PUMA 3POHA 2PTYA 2B81A 2BLEA 1KM2A 3AIVA 1IR1A 2RUSA 3UT0A 4AZIA 4UQDA 1JQXA 4KESA 1PX3A 3U8GA 3Q58A 1G9HA 1IQ8A 2YPIA 4BCEA 3F4DA 3S6OA 1XSKA 1OZQA 4M0XA 2QCLA 1NIUA 2DIEA 1XYZA 1F4HA 1H1YA 1HFBA 1OZMA 4H1ZA 1HUVA 4UBPC 3R8HA 1GVSA 1GPFA 4MFDA 3MSGA 2VD8A 4IH3A 2V5DA 4R88A 1FVPA 1H51A 2A7NA 4P2VA 4KPLA 3KOXA 4KEZA 2D23A 5L6UA 2IW0A 2VELA 3VZXA 4WJXA 4CNNA 4B2DA 2VR2A 1R9ZA 1BQGA 1F8MA 1G5AA 5CGMA 3DOPA 5A8GA 2EG8A 4ZSUA 1PX4A 4KWVA 1U2YA 2VUNA 4JQ1A 5G4HC 1NWRA 4V2XA 3KP1A 1CXIA 3WK2A 1Q6GA 5FI8A 2VD9A 3W71A 4P8XA 1XSJA 2D20A 1CWYA 1YNQA 3WG6A 1I60A 5CPLA 4GYKA 4H8UA 3GW0A 5EMLA 1YXYA 1E6PA 2IPWA 1YYAA 2YDAA 4HKPA 1EJTC 1XDLA 5H8PA 2PDCA 4H9ZA 1ONXA 3NL3A 4C6CA 4MY8A 3S5SA 1RJQA 1KRBC 5FF0A 5CPTA 3WEZA 3P5ZA 1P0DA 4L65A 4FS9A 2ZQ0A 3ONCA 5BOFA 5XINA 1VBJA 2ZWYA 4IIGA 4M82A 4E3TA 4HPHA 2RKXA 3PSWA 1LL4A 1PKLA 2VHLA 2G37A 4K8HA 4NX0A 1FA2A 5G2IA 3NQMA 5IOBA 2XH7A 5CPOA 3OW1A 3FAXA 4AD2A 4F0LA 4V27A 3HG5A 1SU5A 3UXAA 5FJRA 3URAA 3OJGA 5EMKA 3II1A 5CSYA 3ABSA 4UQBA 1ZL1A 4LALA 4RNFA 1VEOA 1M04A 1KXVA 1F05A 3TN4A 3VKBA 4LT9A 4BI7A 4NJGA 1TA3A 4DYKA 5IRPA 4HZ8A 1GQKA 3BDKA 1W6TA 2ACRA 1E4NA 2UY5A 3S1GA 1QHZA 2G3IA 3MPGA 2ISSA 2VURA 3GVQA 5CQ1A 2YL8A 4IMGA 5I79A 4AHOA 1GVYA 3RR4A 4AX7A 4TV6A 3GWQA 3L4XA 2DFAA 1IWBA 3MV11 4E0CA 2D1ZA 2WLZA 4FLSA 3GAYA 1T8QA 4GUFA 3S42A 2C91A 5IFPA 3VILA 4ZTYA 3S4TA 1HP5A 1E1EA 3PJXA 4DJDD 2DZBA 1NDVA 4J3SA 1V0MA 1OIFA 3E0VA 1VRDA 2F7FA 2BSLA 5CJ5A 3C8NA 4CQAA 2ZUSA 4Y6GA 2GZXA 3HMJG 2HROA 4PL2A 4ZL1A 4PFHA 1XX1A 4GX8A 4A2RA 1UKOA 4HA1A 4UR8A 2Z1KA 1OG0A 3TZFA 2XSXA 5E9AA 1JZ7A 3IUIA 3WLPA 4LWWA 4MJ4A 1W1TA 3EDFA 3DESA 4TMBA 1EYEA 2IPGA 4LUTB 3W26A 4C1NA 1ICPA 2O55A 3CGTA 4LC8A 1YDVA 4NP7A 2GVLA 5CSRA 4EIVA 4GQRA 2A79A 1WCGA 4Y9PA 1H0IA 4GLEA 3MP5A 4JNZA 3VZYA 1Q6CA 1Q8AA 5G1TA 5A6BD 3AXXA 3NXFA 4JIRA 4MM1A 3SUVA 3TMLA 3GU1A 4GUHA 1KRCC 2JGYA 4J3VA 1BVWA 4GC4A 2WMIA 2GOUA 1GVRA 1KGWA 4Z17A 3PSVA 2G96A 5C0QA 1IXPA 3PZMA 2WPGA 3IK2A 2NQ5A 1HGYA 3TC3A 3CMJA 1XLIA 1CT5A 2ZC8A 1EB3A 1XIDA 5HJXA 4HSHA 1KWKA 1AG1O 1SW0A 3OU8A 3G0UA 1TX2A 4XAPA 3H26A 4S39A 2EJAA 2DSUA 1W5NA 1TPUA 3LPOA 3UY8A 4FALA 1T41A 3DFTA 4XD6A 2QDHA 4O19A 2ZRZA 5K4XA 4C65A 2WMGA 2WB5A 3BJSA 3H24A 5C55A 3QBUA 3M0ZA 5FF7A 4JHOA 3QZAA 5REQB 2OOFA 4W9TA 3VCRA 4HU4A 4XD4A 4DX3A 3WD4A 1QPOA 1JNDA 2CETA 3RRAA 3QXBA 2J6VA 4M6VA 3W1XA 3EMZA 4XAGA 1WXYA 4GCAA 1GOOA 4IGHA 2XHYA 1IV8A 1K8YA 1YBQA 4GMEA 2ZE0A 1V3LA 2Y8KA 3IGXA 3A4WA 3ZWSA 3I6TA 1G6CA 4B5XA 1KGXA 3MKKA 5LGZA 2YCIX 4Q7BA 3I4KA 3P93A 3ITXA 3G3DA 3HPAA 1OINA 3MCMA 3OLGA 1Z3NA 2WHMA 3RM9A 3WH8A 3BAYA 4Y7EA 3O2LA 2W5FA 3KBWA 1P0BA 2XIBA 1RH9A 3E5BA 2G0WA 3GXPA 3EWZA 4LAUA 1IXQA 1PZ2A 1RK6A 4NNCA 3MKCA 3OVGA 2NXGA 1W3HA 3QQ1A 3LI0A 1CXHA 5HOSA 5BU6A 3QC0A 4HIBA 4Q8NA 1UWTA 3CV2A 3RLVA 4GYJA 3WQCA 4AQLA 1L0PA 4OBTA 1BRLA 1J79A 1PIIA 2G4FA 1UZ4A 4TXEA 3TLLA 1OCBA 4JTIA 2BBFA 3SRHA 3NSXA 3I65A 3DFQA 1ELSA 3NCOA 4O12A 2PZNA 1DQWA 2DSWA 2QPUA 2VFFA 4FNTA 3S1VA 2ZBTA 1CPUA 3EA3A 2DU2A 3V0UA 1OX6A 3NQ6A 3H4WA 1I1WA 1Z32X 3C0SA 3KTSA 3VXGA 4JCMA 1KD0A 1AMYA 1BVNP 3PBVA 4OV4A 4PA8A 5FOOA 4E4FA 3RHGA 2GPTA 1W9DM 1MUMA 3I7QA 1D3CA 3ZO9A 1EJVC 4LTSA 3WNLA 1P1MA 2TAAA 1FH9A 1AH4A 2QGYA 4YL2A 4JTGA 5CPMA 3MA8A 3W0KA 4ES4A 4XZ9A 2VYOA 1Z89A 2CWNA 4S23A 5C9RA 4AZHA 5E9XA 2CHOA 3GLCA 2O7SA 3MCNA 4RE0A 5HNRA 1M3UA 2DSZA 1JUEA 2GSEA 5A8MA 2VC9A 4HNCA 4H8HA 3MWAA 1JZ8A 2OG9A 3QJAA 1YPXA 2QIIA 4WOQA 1PSCA 3QLDA 3CQ0A 2Z1WA 1UQYA 1Q3NA 1UWIA 3UFYA 2B7PA 2PAJA 1EJRC 1M65A 2Y4SA 3PB0A 1G67A 5B7YA 3QHOA 1QFEA 5J8LA 3R6IA 3H22A 3UVIA 2X0HA 3CV7A 5K9DA 4IG2B 1E6SM 1PCWA 1VBGA 4MJMA 4GIAA 3GY1A 4RDWA 3GHTA 2G3NA 2FVMA 2QCFA 2WXDM 2R82A 1GKRA 5I3DA 5JQ9A 3GHRA 3EWUA 4XUGA 4O57A 1IEWA 3S0CA 5ABFA 1H7PA 4MTVA 1LL7A 3VPLA 3V5CA 1SFLA 3GHSA 4XTIA 1QCWA 1MQPA 1UR9A 4YNGA 2PWGA 4J7RA 2J74A 1FFRA 2WSPA 1VCVA 2V81A 4G5DA 3VIIA 2QXWA 4GG9A 3OG2A 5F2IA 3LPPA 5AVNA 1B1YA 3GG8A 4AG0A 2CU0A 1LUCA 3CQJA 3BVJA 4FXRA 3S8HA 3TNBA 2ZOXA 1RCOB 2QJGA 2W0UA 1S46A 3WLTA 1TIWA 4I9JA 4EKJA 3GG0A 1F73A 2NT0A 5MKGB 3BW4A 2GVEA 2CERA 1BYDA 4F0KA 1W9PA 3U4AA 4O28A 1RR2A 2QKFA 3GR8A 5D09A 3TH6A 3CV1A 3TFXA 3L5AA 1KB3A 5HMEA 2YKKA 1OD8A 4GGHA 1YPIA 3LZ5A 2XTKA 4OV9A 1H49A 2ABAA 5EFFA 3W2NA 2WC4A 3B4YA 3CHEA 3CS2A 4BS0A 1E3XA 1J6OA 4HTYA 2CBUA 2QVNA 4Q22A 2AGTA 4YHGA 4Z08A 4IMAA 2A6LA 1G4TA 4RZ4A 3B8VA 2J7FA 1HJWA 1GYLA 4U3CA 2V5BA 1TWWA 4QX4A 1K8ZA 4KCTA 4DZAA 1NM9A 4HNLA 4KFNA 2CLFA 3GC5A 3LI1A 2DT1A 4K36A 3GE7A 4W7VA 4KETA 4NG3A 2BFGA 3PPGA 4INFA 1DL3A 1K4GA 3D3AA 3QHMA 1YDYA 4G7FA 3WBWA 2IQ0A 2HEJA 4KFOA 3O9NA 4TX8A 1RY8A 3ITOA 1UQZA 4G7EB 3UGVA 4V1XA 4HOZA 1V03A 5GVJA 1TFVA 3VA8A 4EANA 3KTCA 2ZA2A 2DZUA 3B8DA 3G8EA 3W7GA 5D2VA 1V6WA 4X0VA 4WDWA 3KCOA 4OOZA 1QNPA 2YDSA 4PGLA 1OX5A 4PCTA 5D8WA 3TYUA 1ICSA 4WRHA 1I9CB 5D4YA 3BANA 4DPPA 4JIEA 2QCCA 3LM7A 3MC5A 4ZO7A 3KLLA 4FR1A 2ISDA 2H8ZA 5LXEA 5DCEA 2REQB 3KZPA 1LOSA 1HP4A 3WLLA 3ZVHB 2QUMA 3IJLA 4Q4RA 3M4HA 3SECA 4ROQA 2X1IA 2JIEA 1SJCA 4YTUA 3W85A 5A6JA 1HQTA 1W1ZA 5HJLA 3I4EA 4WY0B 1Q6DA 1EIBA 1XLHA 4NJHA 2AL1A 5HATA 4K7VA 7TAAA 1OT2A 4QLLA 4ZB0A 4KWOA 2HXUA 3MI2A 3W02A 3IGUA 1VS1A 4MMWA 4H83A 4IGSA 1TSIA 4S3FA 3QFWA 4AD0A 1VLIA 1E43A 3AYSA 3EA1A 4O1CA 2G41A 1KWGA 4F0MA 2QCMA 1F07A 1WKEA 4WQ6A 3NSMA 3BQ6A 4Z1BA 4CN1A 2HVMA 3BC9A 1XL9A 4DJFA 3EOSA 3SAZA 4GNJA 1QOPA 3MUXA 1HKIA 1B4EA 5ABHA 4LUYA 1KFJA 3L23A 3QMRA 4GJIA 4K37A 3WO8A 5HBFA 3DU0A 2XVGA 1RQHA 1P6BA 3CYVA 4EWJA 1W1B1 4TTGA 4HMCA 1M7XA 1F6YA 2UV8G 3RN6A 1QI3A 4LUIA 4C6JA 3PZVA 4I7VA 3NJ3A 2WKJA 1UR3M 1AMKA 2VFGA 3B06A 4RUBA 1EA0A 1ZZMA 3TTSA 1ISYA 1NWUA 4PRWA 3SGZA 1FHDA 2CKRA 3FGCA 3JU2A 3C2YA 3WJZA 1KA9F 5M5DA 4MNLA 2UWFA 1L6GA 3WN6A 3UG5A 2QS8A 1WZKA 3WLSA 3LZ3A 1DJZA 2WAGA 3MUAA 4DBUA 1TB3A 1V3MA 1KO0A 5G2HA 1H50A 1OBAA 1JF5A 4L6OA 3SSZA 3V5FA 1QOXA 1CGTA 4XIAA 1KKOA 4RDZA 1E15A 2YCKX 3OLIA 1JNEA 2J7HA 4J35A 2PWVA 3VCNA 1FDJA 3HB9A 3WNKA 1TPC1 1XINA 4NVTA 1HZYA 4FOKA 1JULA 2DT2A 3L0NA 3DG3A 2VNCA 3QPYA 4QAIA 1EWEA 1O1ZA 4LH8A 4CLMA 3F4VA 1AJ0A 4H6RA 2OWCA 1ZJHA 2RGLA 1ZBCA 4UXDA 3W1MA 4CGTA 4FNSA 4GUGA 2OCZA 4DJEC 4AD1A 4IL0A 2NV9A 3W53A 2OQLA 3OIXA 2CZ5A 2BGNE 4DWSA 3M5ZA 2XSBA 4HYVA 4RX0A 3G5EA 3MUCA 1BHGA 2Q3RA 2P88A 1US3A 3QR1A 1X1ZA 4FXSA 1F76A 1MO0A 3N11A 1QPKA 2WZHA 3B04A 3NPWA 4ZMGA 1NOUA 1R38A 4DF1A 4JKLA 2PDXA 1XC6A 4Y9OA 2VC5A 3APYA 2IKJA 1IGSA 2HK0A 1VFFA 2ASHA 4A8RA 1XISA 3EWYA 2BHUA 4IPPA 1JZ4A 3DYOA 2BOGX 4WSKA 2J9ZA 1ICQA 1PYFA 2Y7EA 1VP5A 2WVTA 2E1DA 3HPSA 2ODOA 4UOQA 2Z29A 2OYKA 3GO2A 3WDJA 2GJLA 1QXLA 4MSSA 2QF7A 4GABA 1PHWA 1W91A 5DY3A 3BL3A 4R5EA 3GZAA 2PTZA 2H9AB 2J7BA 2I57A 3MI3A 1SUXA 2VMFA 4ZQNA 4BI6A 1B30A 1PTDA 4JEJA 1C3FA 4LUSA 3ECQA 2GFTA 3W2LA 4ADTA 1GK8A 1GW9A 4QFUA 4F2UA 1YW1A 3QM3A 3DC8A 4R7OA 4JTFA 4LVGA 2NW0A 1I2PA 5FEPA 1B3XA 3N13A 2ISFA 3CUXA 2AL2B 2FH6A 1M41A 1H09A 3C6CA 1EKOA 1EO7A 1I0DA 3CXOA 2DUXA 1O95A 1XKYA 2QIWA 3CZGA 5CGTA 1R2SA 3S47A 1KXHA 3EDDA 3CEUA 4UQCA 4AC1X 1JD7A 4ZOAA 1GWJA 1B2YA 1LLOA 3W2MA 4E8CA 4AEOA 4QRNA 3O15A 1XLFA 1XR2A 2Q01A 4DXKA 1W3NA 3NDYA 4GH3A 3BLFA 5DT5A 2Q8LA 3SBFA 4UIOA 4X63A 4W5UA 4YTSA 4MB1A 1VBHA 3LU2A 4JNMA 4YJ5A 4I9AA 3AXKA 1C9DA 4UOJA 4GXPA 4LCSA 5CZTA 2WZMA 3F03K 3OOQA 2WV8A 1QI4A 4LU0A 3ITGA 1LYXA 3HMCA 4AW7A 3QV9A 1DWFM 4XZBA 2ZX6A 4LRSA 3T08A 4UC5A 4JTUA 2W3ZA 1KLYA 3W88A 5G5IA 1ITUA 1XYBA 3G6LA 1W1PA 3OVRA 3A4XA 1GHRA 3ARUA 4QSHA 3WZ0E 4LS1A 3TUUA 1XBVA 2EF9A 4H9XA 4NQ1A 1AW5A 2XFFA 3ZVHA 1NY1A 3WF3A 1O7AA 1FWSA 3PNUA 1UZ1A 2QUNA 2VFHA 4OUIA 4GO9A 1ITXA 3GFYA 3TSMA 3ANUA 3IRDA 4BFAA 4QJ3B 5CZSA 3QY7A 3S5NA 4JDYA 2PURA 4UTTA 4AISA 4Y9MA 3TE9A 1PTAA 1V79A 4O54A 4UFHA 2R1PA 2OGJA 3CC1A 1QUMA 3U2OA 5D2TA 1UBPC 1OQFA 1E5JA 4FA3A 3MTWA 1H5VA 2JALA 4NT0A 4FHAA 3BE7A 1HF6A 1UKTA 4UFLA 3USZA 1KM5A 3HGOA 3N12A 4DHGA 2WHKA 1XYCA 2HS6A 2XJ7A 1Z42A 1JCXA 3SGUA 1JDEA 3RXZA 5D9NA 4MKSA 5REQA 4F2TA 3ARXA 3T8LA 3R0KA 1B31A 4MNKA 4DJDC 3PULA 3FV9A 3FJ4A 4C1KA 1O68A 1PWMA 3MHFA 4QLKA 5JUVA 5IBXA 4DXVA 1E9ZB 4J3WA 3ZIZA 3EEZA 4AZ6A 1OC7A 4N9BA 4PTXA 3UG8A 2WMKA 3W4RA 3CL6A 3TC7A 3MYPA 4DVOA 2D2JA 3AWOA 3H53A 1HG3A 1BKHA 2O9OA 1CBGA 4NF7A 3KXQA 3IV8A 4IMDA 4Q6JA 3BLEA 4EK7A 4DF2A 5HNTA 1L6YA 3LTSA 2O92A 3P14A 4JFVA 4QSFA 1WXZA 4KS0A 4C6PA 3ANVA 3GXTA 1LLZA 4XSLA 4IPJA 1YEYA 1QU4A 3G24A 3R4IA 4E2VA 2ONEA 1UB3A 2P76A 4LUTA 2WKLA 4ZO8A 1VYPX 3CYJA 3W1TA 3NPUA 5KZ6A 3DECA 2YL5A 4S3CA 4Q8VA 4Z2KA 1EZWA 5D02A 1H11A 1V3JA 1E4MM 1EHAA 3NWRA 1POKA 1CLXA 2WSQA 2E6YA 2JQXA 2VJXA 1GKQA 4GKLA 4EAYA 4HN8A 1A5SA 3K4AA 2GWNA 1VFMA 1KNWA 4JQ2A 1S5VA 1XIIA 2BNJA 3CB8A 3EWWA 5XIAA 1BKSA 2G50A 3NYDA 1XIEA 4DWSB 3H2CA 4AFYA 1FKWA 3PR2A 3B3DA 3CHFA 3AWNA 3O8AA 5F2LA 4LB3A 3MBDA 3KDOA 1UOZA 3AIQA 3SCWA 1ZP3A 5FJUA 4NJJA 4Q8WA 2D22A 4H9VA 1PTGA 4QE1A 1P4CA 3ITLA 4IFKA 4IMFA 5DX7A 3GU2A 3KTXA 3VOJA 1IT0A 1MUCA 3WBEA 3V5OA 1MW0A 1W5PA 2GK1B 4UTKA 1E0XA 2C13A 1XIJA 1K7FA 1JUKA 3W24A 3VE7A 1C90A 1U33A 4CNPA 2VX7A 4DNMA 4H9MA 2BGQA 2HDJA 1OT1A 1WOBA 4GIRA 1F8IA 3BSHA 2QV4A 3CQHA 2PC4A 1F3TA 2I5IA 3NSNA 2ALDA 3AXHA 1EEPA 3RFAA 3U7VA 3TOYA 3CUZA 3VCCA 3S9ZA 1R3YA 4MY1A 4J28A 4Q33A 1OFAA 2VR4A 4BKNA 3AUOA 3C0JA 3VNLA 1WP6A 3T2QA 5B80A 2CNCA 4RR4A 1NDZA 5LA1A 1M6JA 2YB4A 3M7SA 4E6MA 1ZFJA 2OEJA 5LIWX 4KIEA 1MQQA 1E9LA 1XRSA 4A3UA 1K9TA 2X1SA 4US5A 3I7SA 1VCGA 2PWFA 7REQA 2NUYA 1JGMA 1A5LC 1ONWA 4OU1A 5ABFB 1S5MA 3VM7A 1F9CA 3GKAA 3M47A 3NO1A 3VVGA 2VX4A 4DEFA 1HT6A 1VYRA 2QUUA 4L80A 4PMVA 3WJSA 1F2JA 4B3ZA 3VNZA 3F1QA 1JI2A 2FDSA 1JYWA 3M0IA 3FYPA 2EPLX 1Q45A 3P81A 1S39A 1W54A 2OOGA 1UA7A 2C7FA 5HPOA 1TE1A 1GZJA 4PMQA 2BVDA 2VI0A 4MZYA 1EHNA 1KTCA 5HR7A 4J3TA 3GNDA 3L66A 1MEIA 2OELA 3R8RA 2ZUVA 3T4WA 4FX7A 1TV7A 1OM0A 1TWZA 1U83A 3TR2A 1EIXA 2GUUA 4H7VA 4PUJA 1X6NA 4UR9A 3WFZA 3FYYA 1XIGA 2FZNA 3W27A 1E56A 5G4WA 4HA0A 1CX9A 1AH0A 2ZRXA 4W84A 1FHUA 3LSBA 5FA5A 4W8AA 5E6ZA 3GUWA 4XD5A 4LS0A 1N2VA 4AWUA 4FP1A 1F4AA 3BZJA 3NQ8A 4NAFB 1VENA 4C6EA 4P8WA 5HK4A 1J0JA 2PWHA 2PWDA 4RPQA 2I1OA 4CD4A 3G1AA 2OYLA 1EPXA 5G4EA 1M5WA 1KKRA 3NZ1A 2GQ9A 5I3GA 3TN3A 2QJJA 3LXAA 5FEWA 3HPXA 1Y7VA 4V1YA 3ZXWA 3W1UA 1K7XA 4ZA0A 3LCXA 1T40A 1NVMA 1WKFA 1E51A 3O3RA 2C14A 2QEZA 2ZZ4A 3KVKA 3O1NA 4CNUA 5JBDA 3GH5A 1KGUA 1WUEA 3KWSA 3TDFA 4B2DD 1TMHA 2WZIA 1DORA 3LNMA 5LSMA 5A6MA 1TJRA 1EH9A 1QNVA 3DZ1A 4LV9A 1I2NA 1D7KA 4JIQA 5A1AA 2BTMA 4I8YA 5KETA 4U31A 2XH0A 2OLSA 5AYIA 1ZTVA 2J66A 3K4WA 5G2WA 3VIJA 3UG3A 3FFSA 4RJEA 3AMGA 3K13A 1DTNA 3WY1A 3VIHA 3ENLA 5G1YA 1XUZA 3MUY1 5D37A 3VABA 3ZLGA 3OZPA 1JQVA 3KBVA 3QFEA 3IIPA 2TODA 3VIPA 4PCNA 2VDIA 2CLLA 3HZ3A 4M81A 5IXEA 4GVIA 3UXDA 3HPZA 4PODA 2HCVA 2QGHA 4XVDA 1FWJC 1CB2A 1TWIA 2FZ9A 1ITCA 2WSRA 5AN7A 4HNOA 3NZPA 1OFRA 1XIFA 1JFXA 4ZE5A 1EFZA 4S3JA 2RDTA 4AY7A 1G94A 2V5KA 4BY3A 5FD0A 3TTOA 2D73A 3EEGA 3VD9A 3A47A 1EL3A 2J27A 1LRQA 3TZNA 5I03A 2DY3A 3M43A 4ZOEA 4WGXA 3VDBA 1ESWA 1OK4A 1KR1A 4EE9A 3OQ8A 2ANUA 3NQBA 3WD0A 3XISA 5FJJA 1MI3A 2FTWA 3RCMA 2OLHA 1PAMA 2VWTA 4D72A 2VRKA 3KEHA 1WKDA 1LWHA 2DT3A 4D8AA 4R3UA 2Z24A 3NPXA 3FJ6A 3URNA 3NQFA 1VQTA 2WVVB 1MNSA 2A3LA 4BF5A 1TQXA 4J27A 8CGTA 2QDEA 1BLIA 4F9DA 3BW2A 1H2JA 3W1PA 3PZUA 5FSEC 1B5TA 1B3OA 2SFPA 1K9DA 4C5YA 1L6FA 5JMUA 2HBXA 1X1OA 1MXGA 2YYTA 4GQBA 1Q5MA 2OX4A 3LHUA 3H7UA 2PWEA 1OK6A 3QGVA 1UP2A 4O10A 3BICA 3WLQA 1FX6A 5M2FX 1NOFA 3E12A 1ZJAA 3ID7A 3EWCA 1EO5A 4RV3A 3STFA 1YRRA 4MWAE 3CO4A 4GZ7A 4AEFA 4ZTXA 3T0DA 2Y8VA 1J18A 1ZCOA 4CUCA 2RJGA 1OG6A 1XRTA 2R94A 3OLEA 3GFXA 4URIA 2O7QA 2WNWA 1XXXA 5E0CA 4XAZA 3A4AA 2NUWA 3W75A 4TTUA 1SFSA 5AHEA 3S6DA 4UTWC 3N19B 4XBJA 4YLWA 3TYAA 3ARPA 3W25A 1PUDA 3BGAA 4HPNA 1DWJM 3TA9A 2FGBA 2XGBA 3L4ZA 4F4RA 4GVHA 1UCWA 3A9IA 1DJWA 1PL9A 1E40A 5AZ1A 1JI1A 3O0FA 1FWDC 1K7EA 2J7CA 2NUXA 3V3WA 4ATDA 4L5ZA 5HQMA 3Q4DA 1UJPA 2J79A 4Z1YA 3MMDA 3Q65A 5AHNA 3E96A 3MZ2A 3FY1A 2OWXA 2VDGA 4ADSA 3R89A 4KRZA 2CZDA 1O6IA 4TO8A 5H91A 3TJ4A 3S2NA 5T91A 5KEZA 2HXTA 2X16A 5JH1A 2E40A 5I2UA 3JS3A 2XN1A 1DIEA 3MJYA 4DJEA 4ZVJA 3ANYA 2GQ8A 1EX1A 1CDGA 4HSNA 2PF8A 4KT2A 1IEQA 5LA2A 3NURA 1TV3A 2ZYFA 1EUNA 1C8XA 4EXQA 1VJZA 5BWFA 2ZUMA 4JBRA 1TZ9A 4A3YA 3IJIA 3VKAA 4F66A 2V5LA 2V67A 1TO3A 3RNDA 1AW1A 3VAVA 3PUDA 4FZIA 5EBUA 2Y24A 1H60A 2FVLA 5DMNA 1E0WA 4R34A 3VUSA 3EB4A 1X6UA 2Y7FA 3PY2A 3DGRA 2P0IA 4ONVA 3RILA 2AAAA 1ZBVA 3NIYA 3THCA 1SPQA 5T9CE 3RJXA 4EVZA 4GKTA 1QO2A 3RO8A 4OECA 1OFDA 3IPWA 5C9UA 1LQ2A 4ALDA 1T6MA 3VC6A 4CCEA 1L8PA 3TYCA 3QEZA 3PPFA 1WX0A 3CPRA 4O53A 3AICA 1WYIA 1PKMA 4DUOA 2GQ3A 3OO2A 1TQJA 1TX0A 3PS7A 3P0WA 3QR3A 4M6UA 2FLIA 3WH9A 5GJMA 2P50A 2JGQA 5DMLA 2PDHA 4DZIA 3UJFA 3GYEA 1GTEA 3QMSA 4WLCA 5TAOA 4BQ5A 2FZBA 1G01A 3RPMA 1VFTA 1O5QA 1PJ9A 2O9PA 1I0BA 2V2HA 4IMCA 4KFPA 5CBIA 4LYRA 5BOOA 5D04C 3UWEA 4BQ2A 2OFJA 1M7OA 3VX1A 5K9XA 1UD5A 3OBEA 3P8IA 1EWDA