4GE8A

Oye1-w116i complexed with (s)-carvone
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 155
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ge8A00
1ZAIA 1ZJIA 5AC6A 3P61A 1KV5A 4HT3A 3GDKA 3W7NA 5LNVA 5F4SA 4K8EA 4NNBA 1H63A 1AW5A 3S6DA 3NYZA 4X9SA 1N55A 4S2CA 1TPVA 3CEUA 5D38A 1GOXA 4ADTA 2UV8G 1ZCOA 4D2JA 1R30A 4X2RA 1M7PA 2E1DA 3QQ0A 1SZEA 4WUIA 3EWXA 5D2TA 2A0NA 3AJXA 2VFGA 1GJPA 3QRHA 2CLMA 3G22A 4O13A 3W84A 1LLWA 1Z42A 4TO8A 4PCFA 1JUEA 2ZA2A 3TX9A 4AAJA 4N4QA 4UTJA 4AWTA 1XC4A 3V75A 4UNLA 3W2LA 1W5OA 4JTTA 4IMEA 5KINA 4UFMA 1KLZA 3TMLA 3HPZA 3W74A 1NF0A 1A53A 4Z0SA 5DN1A 2E5CA 4ML9A 1OG0A 1VQTA 4G1KA 2FQIA 2QCDA 3GKFA 3CHVA 3OA3A 3QJAA 1XBVA 3W6YA 3UNDA 4FB7A 4EIVA 1IXOA 3B05A 5DXYA 3ANYA 3Q58A 4PA8A 2G96A 3SZ8A 4BWLC 2WNZA 4QITA 4DXVA 5EYWA 3EWBX 1EEPA 3O6YX 3G3DA 4MVAA 4RJEA 5C6MA 5K9DA 1SFLA 4UTWC 5HMSA 2X1SA 2E5DA 1ZAJA 4JICA 1QMLA 4GUFA 4B5NA 4MLJA 3VNDA 2H90A 4TMBA 3M0ZA 1JR1A 1FBAA 1DQXA 3UWVA 1QOQA 2RDUA 2FFCA 1CX9A 5HINA 4DF0A 3PF3A 4TIMA 4MY8A 4IPIA 4I7WA 3TSMA 3ZS4A 1OFRA 3TW6A 3M7WA 1H50A 2IQTA 4JTUA 2WJZA 3DGRA 3F1QA 3W1MA 3OG3A 4RZ5A 1SW3A 5TIMA 1EUAA 3HO8A 1WXJA 2JBMA 1IF2A 1A5BA 4M6QA 3LCHA 1PIIA 3GDMA 1SZNA 2ZZ7A 4FNUA 4M19A 4WY0B 4UIOA 1ICSA 2GVJA 4WZHA 3FOKA 4Z1DA 2E09A 5IM51 4YL2A 2ZRYA 1W5PA 2YSWA 2CLFA 3TW7A 5G2WA 1OJXA 3LHVA 3VE7A 3WJXA 2H8XA 3F03K 3HGSA 4MFDA 1OHLA 4UTTC 5DBUA 1Z48A 3S5YA 1TRIA 3TCEA 3NQFA 1TO3A 5D2YA 2VFHA 2ZYFA 2A21A 4HNNA 3LBMA 1D3GA 1DJNA 1XBYA 3FKRA 1RQHA 4BI5A 3FLUA 3QW3A 3A24A 3WJZA 2CLEA 2A1YA 3U6WA 3NOEA 2A6NA 1G7VA 1YTEA 5MHBA 1WBHA 5LNWA 4O18A 5G1TA 1RZMA 2HS6A 1KFBA 5BMXA 4CNNA 3N9RA 5F2IA 3A9IA 3DKLA 3UY8A 1JQVA 5LGXA 1K7FA 2B4GA 3MBFA 5E93A 2CWNA 3L5AA 2RH9A 2Y85A 2HSAA 2QUTA 2GVGA 2XFWA 4WY0F 4HNVA 1BKSA 3VCRA 1HTIA 2YZRA 3IIZA 4FHAA 4DO6A 4KFOA 1L9WA 5KZEA 4L4MA 3G1VA 6ALDA 3G1AA 3W1NA 3BPWA 1P5BA 2BSLA 2FB3A 3MO7A 4O4WA 3SY5A 3NL3A 1KLYA 3W73A 2NLIA 3NGJA 3TA6A 1PV8A 2NXHA 3DENA 4M7SA 4O57A 3HOJA 4JXCA 3R2GA 1SPQA 2Z2UA 3ELFA 1U5JA 2VC6A 4Y6GA 1DL3A 4BWLA 4OWGA 1UCWA 1PCWA 5K7JA 3OBKA 3BGGA 1RR2A 1JVNA 4UTWA 2RDTA 2WSRA 2WKJA 3PBYA 3NAVA 4TR9A 2VEKA 4FX6M 5D04C 4UMCA 3IIOA 5I3IA 3QQ1A 3ZWSA 3HG2A 3GKAA 1GZGA 3NDOA 1TV5A 1DVJA 3BV4A 2DORA 2Q8ZA 4GNJA 3PBUA 1W56A 1M6JA 5LNUA 1W5MA 2ZZ2A 5LGZA 3QSTA 3W7DA 5AHNA 4AEOA 3L0KA 2VKZG 1N7KA 5D2VA 1GG0A 5AN7A 1JUBA 1NF7A 4K7YA 2B7PA 1VGAA 2E6YA 3S1WA 4LVDA 3KRZA 1WBJA 2DZXA 2JGYA 4JTFA 2ZTJA 3PUEA 4JYFA 5GVJA 3INPA 3P8IA 4N9EA 4YCPA 3LRKA 4CLMA 1H7WA 4YMZA 2Q3RA 3L65A 4NX5A 4O54A 2ZZ1A 1ZY9A 2YCEA 2QCGA 1VJIA 4HPXA 4RLIA 4UTTA 1LTDA 3LRLA 1WYIA 2C16A 1IXNA 1JCYA 1G4SA 4DO5A 2CLKA 4J9JA 3SECA 3ABQA 2A7RA 4MYXA 3LXBA 1FCVA 4O1BA 1H1ZA 2EPHA 1HL2A 4PC8A 3PUOA 3EWYA 1BWLA 3P7YA 4O19A 1KFKA 2ZTKA 5D2XA 2V0TA 3GDRA 3JRKA 3EX1A 3FFSA 2Y6ZA 3TSDA 1J4EA 3QMSA 4ZZ9A 5CPLA 5BW6A 2QR6A 3HMJG 2VFFA 1EIXA 2AGKA 2DZWA 1L2UA 3CPRA 3HIJA 1H1YA 1E51A 1OFEA 3LTPA 1WQ5A 1UUMA 3N2MA 1K7XA 5G2HA 5HULA 5D30A 2QCNA 2F7FA 4X22A 3JS3A 4WJEA 1FWRA 1LRTA 4PH6A 5CZJA 1ICQA 1KM0A 3MMTA 2DZPA 1KM1A 4RZ6A 3CM4A 2R8WA 3TIMA 1D3HA 1EWEA 1HG3A 3PWAA 4XUGA 3K30A 1KM4A 1B9BA 3M41A 2YXGA 2ZA1A 3DU0A 2EGZA 2ZCGA 3E02A 1V7YA 2ABAA 5KSWA 3R13A 1GTEA 2ZZ5A 4NJIA 4TX9A 3W7QA 2TRSA 3STFA 3W1XA 5G5IA 1MEWA 4PFMA 5HWMA 5FF2A 4K38A 2CLOA 1KBJA 4O17A 1OVDA 2CLHA 2CFFA 3M6YA 1A5SA 3GXTA 2PRMA 2GJLA 3GDLA 3W7KA 1AMKA 2JK2A 3ABOA 2WV8A 2DZVA 3I6RA 1EX5A 1ADOA 1Q6OA 4NNAA 3T44A 2LLEA 2B7NA 4RZ4A 5A8GA 3IVUA 3FKKA 1GVSA 5D37A 3NQDA 5FEZA 1XDMA 1KFCA 1YPFA 3G3MA 4UTKA 3I65A 1LZOA 1DKWA 3UZJA 2YYUA 7TIMA 4QIUA 5HUPA 2ZRZA 1K8XA 4UR7A 1RQBA 3QM3A 3H54A 3TMQA 3TUUA 1QAPA 2OT1A 3GNDA 1H7RA 3C4UA 2TPSA 1L6YA 3CIXA 5KZDA 3W83A 4RK8A 1W8SA 4DF2A 4OE7A 4Z1AA 5F2MA 1EPXA 5AHLA 4DQWA 4NJJA 1DQWA 3FS2A 4UFKA 3WFAA 1FWSA 4FO4A 5AOUA 4MFEA 1A50A 1ME9A 5FEWA 1JULA 2BTMA 3DFQA 1EP2A 3FA5A 3ZWTA 2GJNA 3KOFA 3RNDA 4QAIA 2XN1A 4S2BA 2A7NA 3NPXA 5D33A 4ZQNA 3RLVA 2B7OA 2F84A 3GR8A 3NQVA 4FX8A 3V1PA 3W7LA 4GWEA 1PL9A 2Z0IA 4MKNA 1Q45A 2C6QA 3KRSA 4GXMA 3BVJA 3G1XA 4ORIA 3WK0A 1I2RA 3NQ2A 1Z44A 1KM5A 2H3BA 3SFKA 4CQ8A 4R7JA 4HNUA 4MLRA 4UNKA 3Q94A 4XKYA 4WQ6A 2C18A 2ISVA 5HUOA 4QISA 2R91A 2OCZA 3F4NA 3ATZA 3W7OA 1H61A 4LWWA 3UQNA 1K02A 3MJYA 4WX2A 3TQKA 3NA8A 4NUWA 4UCGA 5HQEA 1LBMA 2G95A 4NQ1A 1F73A 1C29A 1G4EA 3BG9A 4O8RA 3UY7A 1KTNA 5FF7A 1A5AA 2DJLA 3BARA 1ALDA 1KBIA 5DY2A 4ZVJA 1XXXA 2Y88A 4AXKA 4Z1CA 3W2KA 3E12A 1I45A 2R14A 4XZ9A 5LNSA 3HPXA 1OFPA 3GYEA 1I2OA 3SGUA 3L2IA 2QEZA 5E0KA 4OV9A 2ISWA 4O14A 4Z08A 5F4WA 5EBUA 4JX5A 3GIYA 5I3GA 2VFEA 1ML1A 1ME7A 1S3HA 1GVOA 1SO5A 4O12A 3O07A 4JTSA 2TSYA 3N3MA 3LGEA 3JR2A 1F76A 1WOBA 1YPIA 4UUIA 3Q2DA 4WOQA 3NM3A 5AHFA 3PM6A 1Z41A 3N34A 1GG1A 4QQ3A 4RXFA 4BI6A 3NQMA 4XBSA 2RHGA 1VHCA 3R89A 3QPYA 4LS0A 1TPEA 4R53A 1OK4A 2QJIA 3IIPA 1LYXA 1X6UA 1TTQA 1EB3A 2ZRVA 2YGYA 1DV7A 4JX6A 3NPVA 1VCVA 2V8ZA 3G1FA 2V81A 4N4PA 3DFTA 2QDGA 2VELA 4QNEA 4FNRA 2V5BA 3I7SA 5I3KA 1G4PA 3MYOA 3NQCA 3DHDA 5AYYA 2QCEA 3QMRA 3UWYA 2Y63A 3QPZA 4KFNA 4O1DA 3OVQA 3EWZA 4UFJA 1MXSA 3KVJA 4IJBA 5HJLA 1HUVA 1ZENA 2ZBTA 2HTMA 2GPTA 5DELA 4IWWA 4R33A 3DBPA 4W9TA 3BLEA 5U7SA 3NO5A 1XBZA 1FCBA 2C15A 1SR9A 2QCDB 3S1XA 2H3DA 4DBEA 1TQXA 4O15A 1NVMA 1EA0A 5C54A 2NUYA 3L21A 1LORA 4OGZA 3THAA 1O94A 1Q6QA 1TTPA 3SJ3A 5FESA 2H8ZA 3THQA 4NXSA 3MYPA 3W3OA 4NZJA 4JYDA 2QCFA 3QH2A 2J9ZA 4EVZA 1PCKA 1VCGA 5BOOA 4N6EA 1FWTA 4X3ZA 1O5XA 3A22A 3P5YA 3N14A 3DKJA 4NJGA 4P2VA 2Y61A 4FNTA 3H53A 3L9CA 1YYAA 1VCFA 1QFEA 4UMBA 3G24A 1B4EA 2BLEA 4MY1A 2ZRWA 3O06A 1O95A 4OHQA 4AF0A 2NV1A 3VI2A 2ZRUA 3GZ3A 3DI0A 4O52A 4Q4KA 5HR6A 3W23A 2CU0A 3A5FA 4JN6A 1GVFA 4GUJA 3MI3A 3BW4A 3RU6A 1KW1A 3LM7A 3CC1A 1OF8A 4NNCA 1OFQA 4LTSA 3NZRA 5CPOA 3QEZA 2P10A 4YCOA 4HSNA 1DHPA 1GVRA 2V9DA 3W7JA 2CZ5A 4MYAA 1TCDA 3IGSA 2QJGA 3SI9A 1LCOA 1FY6A 1JCNA 2JGQA 4CNPA 4U4MA 2FPVA 1RVGA 5K9CA 3HB9A 2TYSA 3S1UA 5U4NA 2CW6A 2Y7DA 3MHUA 4IMGA 4RX0A 1JQXA 1T8XA 1TQJA 1IXPA 1XCFA 5KZMA 1X7FA 1NEYA 5K4ZA 3LOTA 5CZTA 4LOCA 3G0UA 1XUUA 1RD5A 3P60A 3C56A 3L67A 5IBXC 1HO1A 3AO0A 4Q33A 5DXXA 2B7QA 1AL8A 1PHQA 1JUKA 1RQEA 1XUZA 4GC4A 3FYOA 1LLZA 3W85A 4LW7A 4IUOA 4ZQRA 4LY8A 2PRLA 3W7RA 3EXSA 3LCFA 4MPQA 4CQAA 5AC7A 3O6DA 4N02A 1T99A 4FNQA 3P82A 2J88A 1KM2A 3EX6A 4BFAA 5CSSA 3A5VA 4Y8FA 3C2FA 3TC6A 2FTPA 3W72A 3LHUA 3EWUA 2BX7A 3CQ0A 4HN4A 3W76A 3C52A 3RK8A 5J5DA 4LNYA 3N2XA 1JRBA 1LM1A 3C2VA 1VYPX 3NM1A 2ZZ3A 3UPWA 4HKPA 1LP6A 3RFAA 1FWWA 4JY9A 2GUUA 2A2IA 2VEIA 3P81A 3FYPA 3YPIA 2ALDA 4JTJA 2CZDA 3OIXA 4UTIA 4UFLA 3FEMA 4K36A 4H4IA 4NX0A 3W9ZA 3PR2A 1TSIA 4XTDA 4ADUA 4GJ1A 4KKXA 3UWUA 3TC7A 3B4UA 2A6LA 3TROA 1I4NA 1S5TA 3IGXA 1QO2A 3QW4B 5CZ0A 2I1OA 5BMWA 2CZFA 4CCDA 2OJPA 3HG5A 3TJLA 4C1LA 2NXGA 4JDYA 3TJXA 4UTMA 1TJPA 4OBTA 2NWSA 5J5RA 2YW4A 1H60A 4WD0A 4A2RA 1SW0A 1OFOA 1KFLA 3S8HA 2YDAA 3UYCA 2E6DA 3OVRA 1OFAA 4AHOA 2W79A 1HFBA 1D9EA 1TV7A 3FIGA 1J2WA 1LOSA 2E68A 4QM1A 4FIQA 1Q3NA 3GVGA 1L6WA 3L5MA 1GVQA 1FX6A 1ZAHA 2PCQA 3GAKA 4FEZA 1IIGA 3CU2A 3R5EA 2V2HA 1SSDA 3OEXA 4MIMA 1L6SA 4MZ8A 3ZR4A 2OX1A 3P84A 3LV6A 3SW6A 3NG3A 4A29A 2RKXA 4UTLA 4AWUA 5D09A 5L9FA 5K2ZA 2NZLA 1SW7A 1W1ZA 1XBXA 4KWVA 1AW2A 1MO0A 1TIMA 2NUXA 4OU1A 1BTMA 4OV4A 3C2EA 4PODA 2Y7FA 1XM3A 4MY9A 4Z0JA 4AH7A 4ALDA 3LTYA 3KHJA 3UXAA 3NPUA 5CZSA 4K39A 4ORMA 3IIXA 3TNOA 2QCCA 3GNNA 1DJQA 3QMTA 5AHMA 3W1LA 5IBXA 3PG9A 4IGHA 5F1UA 3TDFA 2GQAA 4KWWA 3LCGA 1G67A 1J5TA 3GAYA 4UMAA 2PRHA 2WSYA 5F2LA 4PL2A 3GX9A 4N9DA 3USBA 3LDVA 3CWNA 2C13A 3B04A 4N6FA 2ZQ0A 4E0CA 1TRDA 2Y62A 3M5XA 4CCCA 4ZL1A 3M44A 1YXDA 3NZ1A 3NEVA 3W71A 4CCEA 4MJMA 1X8FA 3A23A 3IEBA 4I7VA 5F1VA 2QUVA 3B06A 3LTSA 3NL2A 3C6CA 4LUIA 2Y89A 1MSSA 3DZ1A 3W1RA 1YDVA 5DCEA 1GT8A 4MZ1A 2GQ9A 1XFBA 3T55A 3LBCA 1H7NA 3DH7A 3G0XA 1H7OA 4JTLA 2PURA 2FLIA 2H6RA 2DZTA 1I2PA 2GQ8A 3UD6A 5F4XA 4O1AA 4RXGA 1UBSA 2NX1A 4IX2A 4TU1A 2O7SA 4N2YA 4O16A 1G7UA 1I8JA 1VH7A 5EKYA 4BI7A 1ME8A 1OX4A 3EKLA 1SZFA 3LCXA 3B0VC 2X16A 3LB0A 3CWOX 2X30A 4QJ1A 4E38A 3GXPA 3PB2A 3BLFA 1BEUA 4MJZA 1YTDA 3G8EA 1OF6A 3TXVA 2HMCA 5BNKA 5D32A 4H3DA 3SR7A 1MZHA 3DFNA 4RKAA 3PBWA 1T0OA 3G18A 3PB0A 3SGZA 3KX6A 3TXZA 1SO6A 4KFPA 3FJLA 1TB3A 3W70A 4LC6A 4JYEA 2V30A 3M16A 6TIMA 1QR7A 2D73A 4JTKA 4I7UA 3NQGA 1JCLA 1K3UA 1Q6LA 2YX0A 4LS2A 4NU7A 1EWDA 1GPWA 2Y70A 2EKCA 5I3JA 2A4AA 2I9EA 3R12A 3M43A 2J27A 3IRDA 4RV8A 1W5QA 2YFOA 4LV4A 4EWND 2BWGA 3TFCA 5I3FA 3TU9A 3NQEA 3STGA 5EMUA 3U2OA 3BK0A 2ZRXA 1MEIA 2C14A 4E2BA 3O16A 4FNPA 2YFNA 5D02A 2O7QA 3VKJA 3W22A 4PTNA 5I3HA 3LI1A 3NL6A 3STCA 3UZ5A 4NJKA 3NL5A 3GXNA 4LVAA 2ZZ6A 5CPMA 3T40A 1VYRA 3MP3A 4ICNA 1TREA 1FWNA 3BG5A 4UXDA 4A3UA 1KV8A 1TYGA 1SFJA 2WOQA 4XKYB 4XBKA 5LKYA 3W1TA 1VLIA 2ZFAA 4HIBA 1JCJA 4MZYA 3S9YA 3MI2A 4O28A 3P67A 1H51A 4GBUA 3TAOA 4JX4A 3MP4A 5CKSA 2VENA 2C0AA 2AAMA 3BLIA 5HR7A 4NZFA 1WAUA 4QSHA 3EXTA 1RV8A 3W75A 3LLFA 1XL9A 1K7EA 2RDWA 4O10A 4C1KA 1YTKA 4IMFA 3S5ZA 1ZHAA 4UTHA 1TV8A 3F4WA 3W7HA 3L66A 2W6RA 4AWSA 1TTIA 3LCLA 4E2DA 3LCWA 5DY3A 3TAKA 4MOZA 2ZDRA 1W54A 4AHQA 1MEHA 1F7BA 3N19B 4UTUA 1R2TA 1KM6A 3QC3A 1YADA 1VHNA 3W88A 1W5NA 3HJZA 3W7CA 5AC8A 2NWRA 1UB3A 4ZQMA 4BR1A 1QNVA 1LBFA 3S5NA 4RCXA 1THFD 1XI3A 4UC5A 5LZLA 4OQVA 3S1VA 3KXQA 4M5PA 4GE8A 1R2RA 1NAL1 4IXHA 4JR5A 2VFDA 3KFTA 4IOTA 5A5WA 3G0SA 1GYNA 3O05A 1F05A 4BK9A 4JIQA 4ADSA 3B8DA 3W7EA 1SUXA 2E5BA 3KAOA 4MUZA 5G2IA 3E9AA 4EOUA 4IPJA 5CG7A 3W2NA 1O5KA 2YYTA 2FIQA 3WJSA 2FB2A 3KRUA 1TPB1 3QFEA 1YXCA 3S0CA 3GDTA 5H91A 3QZEA 3UWZA 4JTIA 2Q3OA 1LRQA 1QO5A 3W7IA 4DPPA 5FEPA 4HNTA 5HWJA 4LVBA 2OZ0A 3W1QA 3T78A 1LOQA 1SSGA 1TPUA 4K6AA 1GQNA 3EXRA 1IIHA 1FUYA 1KFJA 3PULA 4ZQOA 5LHEA 4CQ9A 4TMCA 2PE4A 3QF0A 3E49A 4LC8A 4Z1BA 3WK2A 1EP3A 1FDJA 3MW7A 4JTGA 4K8HA 4LV9A 4XQ6A 5F2GA 2ATMA 4NXKA 3NVTA 5EPDA 3M5VA 3LXAA 1P0NA 3HGJA 1CI1A 1K03A 3EX3A 3P74A 5D2WA 3CB8A 3PAJA 3KVMA 3EX2A 4AMAA 5TQLA 1K8YA 4A22A 3HF3A 1OK6A 1PE1A 1R2SA 1EP1A 1WA3A 3W7PA 3EWWA 2QCHA 1AG1O 1FXQA 3DXIA 1VLWA 1AK5A 3MWAA 1HO4A 1N8FA 4EF9A 3BG3A 1S5VA 5K4XA 4AF0B 1FXPA 2E6AA 5DCBA 1C9DA 2ABBA 1QPOA 4LVFA 2JKAA 1M5WA 2WQPA 4WY0A 2QAFA 4DPQA 2G97A 5AFDA 1PHWA 4AB4A 4O4VA 3ABSA 1ONRA 2DU2A 3W2MA 2QAPA 2J9YA 1U83A 3QYQA 5BRBA 3P8JA 4Y96A 2NXIA 5AYXA 2Y7GA 3LI0A 3ATYA 1ZFJA 5DCDA 3WK3A 1OX5A 3DHFA 2C1HA 1AL7A 4IXXA 1BWKA 3ABRA 3CIWA 4FNSA 5E1QA 5L6UA 4JS3A 3LERA 2YPIA 5DLCA 1TPDA 2QUUA 3RLUA 3P5ZA 4LRTA 1WX0A 5G1YA 5CSRA 2DZUA 5KTLA 2EHHA 3PS7A 2J24A 1DOSA 1P1XA 3TE9A 3MP5A 2NV2A 3S42A 4ZMGA 5FF0A 5TBOA 1LBLA 1H5YA 1DBTA 3SIZA 3SSJA 3G1DA 3EEGA 1OABA 4QNWA 4XTIA 1NSJA 1TJRA 1XKYA 2QKFA 5AHEA 3HG4A 2BXVA 4GUHA 4O53A 3IIVA 4WXYA 1TPC1 4O50A 1SO4A 3W1UA 3PC0A 1B3OA 3C2OA 1OYAA 3LHTA 2VOMA 4LU0A 2V5LA 2FPTA 1H62A 3O6CA 1AW1A 3BGJA 1KTBA 3NNTA 3DI1A 1OX6A 3IV3A 3W07A 3DFPA 1B57A 5CPNA 4OT7A 2R94A 3LV5A 4YWIA 3Q37A 5EA9A 2XN0A 5HNRA 1PVNA 3U8GA 5C55A 2CZEA 3VFLA 3TSBA 3L5LA 1H7PA 4LUJA 1R47A 5K9XA 3PG8A 4O1CA 3LHYA 3EKZA 4M7TA 5D05A 1VYSX 3CTLA 1QPRA 2ISSA 2WNQA 2WPBA 4WOZA 1TPWA 2VEPA 5H2ZA 2VXNA 5FEXA 1VR6A 1VRDA 3TV8A 3T4CA 1GTHA 3TQVA 2NUWA 1A5CA 1EUNA 5EY5A 3HBLA 1W37A 1YDNA 2RFGA 2YW3A 1WOAA 3UWQA 2FDSA 4FX7A 3NPWA 1LOLA 3GK0A 1LROA 3M47A 4IQLA 3E0IA 2WO5A 1P4CA 4UFIA 3I7QA 3NQ8A 2QF7A 2J6XA 3B03A 5SWUA 2GVLA 4JEQA 2B0MA 1QPNA 4CNOA 1QPQA 4GUIA 5LHFA 1TTJA 4WXZA 5KMYA 4JY8A 2VFIA 2I14A 2V82A 3W1AA 1NFBA 5EL1A 3MBDA 1I2NA 2CLIA 2X1RA 4PEKA 1JJKA 1QDSA 1WDWA 4POCA 4JD4A 2QDHA 4YLWA 4YXGA 2YR1A 2P0OA 3HQ1A 4FXRA 3UPBA 3CLMA 4LS1A 2J9XA 3HG3A 2OT0A 1QOPA 1YLVA 3O15A 4JIPA 3I68A 2ATSA 2V2CA 2ZA3A 1I2QA 1VPXA 3O8AA 1KM3A 1FCUA 4AVFA 4FIRA 4JTHA 4R34A 4H6KA 3P80A 4LRSA 3HGRA 3M1ZA 2C19A 1Y0EA 3EX4A 2BZNA 1G69A 4Y90A 3W2JA 3S5OA 1S5WA 3MI6A 1O60A 3IVSA 1RPXA 2CLLA 5LNRA 1F74A 3M5ZA 3STEA 1TPH1 4M6PA 1KFEA 2WNNA 1OFBA 3WK1A 1GEQA 1FQ0A 1VC4A 5AHIA 4IMDA 5G4WA 4AHPA 3PSVA 3LRMA 1V5XA 3E96A 3NR0A 1ICPA 1GWJA 2X1UA 1W3NA 3W86A 3B0UX 1TPFA 2AQWA 1W0MA 3UXDA 5CGQA 3BW2A 8TIMA 3A21A 2VEMA 4O11A 4Q32A 4U28A 1H7XA 1XDLA 3P62A 3NXFA 2NX9A 3NQAA 1VZWA 1W3IA 4NVTA 3GB6A 1GYLA 3B0PA 3LLDA 4O0ZA 3WJYA 1QWGA 1LRNA 5DBTA 1SU5A 2EAWA 3W7GA 3BW3A 4RR4A 1T96A 5T26A 2DZSA 1TMHA 1O4UA 4DBDA 1KTCA 3RF9A 3IGUA 1B4KA 1YXYA 2OMAA 1SQ7A 2GOUA 1ZALA 1CW2A 5C2XA 2JKEA 4BF9A 4O0KA 3H55A 4FXSA 2QCLA 3LX9A 1VS1A 1LDCA 4JDBA 1JRCA 4DO4A 4DELA 3W87A 1C8VA 2X2GA 4K37A 3GLCA 1OX4B 1UJPA 2JKPA 4L4LA 3D0CA 3W2UA 2W0UA 2X1TA 2NX3A 3C3NA 3OHIA 4UFHA 3TQ0A 2DP3A 3C8FA 3LXCA 1IXQA 4ZQPA 2QCMA 4FF7A 2P1FA 1W3TA 4NJHA 4LVGA 4GFSA 3TR2A 3N9SA 5HWNA 4NT0A 3TFXA 1OYCA 2Z6IA 2PC4A 3M5YA 3MUXA 5FF4A 4IX0A 3LHWA 1JCMP 4HHPA 4K7VA 1YDOA 3PBVA 2A85A 3FJ6A 4PL1A 3QSRA 1UASA 3KVLA 3NQ6A 3NQ7A 3RMJA 3DAQA 3G1SA 1Q6RA 4M6VA 4DEFA 2Z1BA 3LHZA 2Y7EA 5KITA 3PUDA 4IMCA 1K8ZA 3KVKA 3O63A 1W31A 3N73A 4N9BA 1SZGA 3G8RA 3LCIA 1SO3A 4ONVA 4HPJA 5AB3A 3W7MA 2FJKA 5C5YA 4JGDA 2DJXA 3MHFA 3EB2A 3G1YA 3OVPA 5G4EA 3HPSA 5AYZA 2QJHA 3L68A 1WV2A 1M7OA 2EF9A 3PVFA 2KZHA 5D03A 1P0KA 2E6FA 1G4TA 1PS9A 3C61A 3T7VA 3O1NA 3C0JA 4HSOA 1IGSA 3W1PA 1QCWA 3MHGA 1KA9F 2G5WA 1X1ZA 5FF3A 2C3ZA 3PSWA 2WSQA 1FDYA 3TK7A 5ABTA 3I7RA 1DORA 4ZQCA 3IVTA 1UUOA 3TKFA 3M9YA 1G6CA 1FCQA 2Q8LA 1FDZA 1ZNNA 4A21A 4GRSA 4P61A 2E77A 3CT7A 4UR8A 1F5ZA 4GUGA 4DF1A 4A2SA 3DFOA 1OFDA 3TH6A 3L0GA 3R8RA 1F2JA 4Y9AA 3G1HA 2FPYA 2Z6JA 4XWUA 5K3VA 3GR7A 3VE9A 2TMDA 2V2DA 4JNMA 1JCXA 4N9CA 2XN2A 3C2RA 4S1FA 4LT9A 1OYBA 3ZFHA 3L0NA 1F6PA 1F6KA 2ZZ4A 5LSMA 3HGOA 5FI8A 3DFSA 2A7PA 4EF8A 3WJWA 4I9AA 2HS8A 3UWWA 1X1OA 3CEPA 1R46A 3PY2A 2A5HA 4JTEA 3BO9A
chains in the Genus database with same CATH superfamily
3N9KA 1BF6A 3VNZA 4S3DA 5F4SA 4K8EA 4X9SA 5RUBA 4J1OA 3CEUA 5D38A 1XCXA 1R3TA 2E1DA 3K5XA 1SZEA 4WUIA 5D2TA 2A0NA 1GJPA 3KWSA 4O13A 3W84A 1LLWA 1Z42A 4PCFA 1JUEA 2ZA2A 1BRLB 4N4QA 4AAJA 5A6SA 2V68A 4AWTA 5AC5A 3W2LA 1KR1A 1W5OA 1XG4A 4IMEA 4UFMA 1KLZA 1W1VA 3TMLA 1OGGA 3W74A 1NF0A 2VDHA 4NRSA 4Z0SA 4LYQA 4ZOEA 2PTZA 4JQ4A 4ML9A 1SVDA 3GKFA 4RPQA 1XBVA 2OGYA 4FB7A 3FVDA 2CKRA 2AL2B 4HN8A 4X9YA 3B05A 1NOUA 3KLKA 4AX7A 2OXNA 4OBRA 5C6MA 3TTEA 3N3TA 4JICA 1S2UA 5IOBA 1Z7AA 1ZRQA 2IKJA 4TMBA 3RUBL 1UH4A 3UFYA 1WZMA 3ZSTA 3M7SA 4IH3A 2FFCA 5JU6A 4TIMA 3U3HA 3CQKA 1ZPTA 4I7WA 1RCOB 3ZS4A 2WKGA 3VC5A 4Z2GA 1ZCCA 2IQTA 2ACSA 3F1QA 3N13A 1KCZA 3LQLA 1JAKA 4RZ5A 4AX6A 5TIMA 3BTNA 3HO8A 5ECUA 1IF2A 3ZOAA 5A6AA 1AVAA 1A5BA 4FSAA 3LCHA 1PIIA 3IWPA 3KEHA 4LQ1A 4WY0B 1XH0A 4KIEA 3VKKA 1B54A 1WAWA 4YN5A 1HKMA 4RNFA 4KW2A 2ZRYA 1W5PA 3MA8A 4F2TA 3WNPA 4ERIA 4IG2B 3UF9A 5HDRA 3TW7A 3VE7A 3WJXA 1RVKA 2H8XA 1BVWA 3WDIA 1OHLA 5DBUA 2DIJA 1Q6FA 4GYJA 4AZBA 3NQFA 4GQRA 2VFHA 3ZT6A 2GGEA 1NJJA 1DJNA 4C6OA 3FKRA 2YL8A 1RSCA 1FKXA 2XHYA 3E0WA 3T2QA 2FJUB 1E5NA 5A8NA 3ARYA 4NSBA 2L5HA 1IWPA 3B3DA 2A6NA 1G7VA 1YTEA 4MJ2A 4BQ3A 5G1TA 4Q6XA 3TTQA 1J11A 2VMFA 1UR4A 5F2IA 3A9IA 4HVXA 3DKLA 1JQVA 1A5NC 3HFTA 1NDVA 2QHAA 3N2TA 1P0BA 3MBFA 3QOMA 2ZX6A 4QCEA 2FVMA 2QUTA 1KRBC 2GVGA 1K9TA 2XFWA 4WY0F 3VINA 4NI3A 3IIZA 3TN3A 3EAUA 4ZSTA 4L4MA 2VC5A 3G1AA 3CASA 5CPSA 3RDKA 5E6YA 4O4WA 3SY5A 2G3JA 3NL3A 1XSJA 1KLYA 3M07A 1RBLA 1HF6A 3HOJA 4JXCA 1TWDA 3R2GA 3UA4A 3BOFA 3GHRA 3ARTA 4IFKB 4XB3A 3M0JA 3SBFA 4GY1A 4GZ7A 4OWGA 4XKMA 1UCWA 1KGXA 4L6HA 3GC2A 4H2HA 1RR2A 1XLFA 3LG3A 3PBYA 4JNYA 4TR9A 1PIGA 2VEKA 1J18A 7REQA 3K2GA 5FKYA 3OU8A 4RZBA 3HG2A 5KZ6A 1GZGA 3BV4A 3NEHA 4E4PA 3WLHA 2ZZ2A 3W7DA 5AHNA 1AJ0A 4V1XA 3T0AA 3GHSA 4PMZA 7PTDA 2REQA 6XIAA 4GIYA 4L9YA 1WBJA 4PMDA 1UKSA 2WBGA 3PUEA 4JYFA 2F8QA 2JIEA 5BXRA 4YCPA 4N9EA 3CV2A 2P5NA 1O1HA 5BXTA 3LSCA 2Q3RA 2NQLA 4S3KA 4GKLA 2ZZ1A 2HV5A 4OOZA 4HPXA 4RLIA 1WKDA 4F8XA 2VUNA 1LTDA 1WP6A 3FYYA 1IXNA 2P53A 1L6FA 3ABQA 3U4FA 1UD4A 2A7RA 5DMMA 1FCVA 2PGFA 4O1BA 1CT5A 2XIQA 2EPHA 1BWVA 1EJSC 4TV6A 4NHVA 1PKNA 2V0TA 1QBBA 1HVQA 3FFSA 1V3KA 2OTDA 1NWRA 2BB0A 1TVNA 4QAWA 2VFFA 1H1YA 4GOAA 4NI8A 3N2MA 1LG2A 1K7XA 1M53A 5D30A 4ZB2A 2QCNA 2QUNA 2FMOA 3VZZA 1LRTA 2HXTA 4HJWA 2DZPA 1JZ6A 4NZ3A 1FWGC 3TIMA 3K30A 1KM4A 3H7UA 5EMKA 3M41A 2ZA1A 3DU0A 2ZCGA 1V8EA 1ZLPA 2ABAA 5KSWA 4NJIA 4TX9A 1CXEA 3IPWA 1D2KA 4URIA 5AY7A 2BG5A 1EO5A 1J01A 3N04A 2CLOA 5HJYA 2POZA 1Q2SA 2CLHA 5AKQA 5HANA 2PI6A 2IPWA 8XIMA 2J4GA 2JK2A 3ABOA 3BAJA 1OWQA 4A3RA 4K8GA 4JQAA 3T1GA 3KW3A 2B7NA 1R86A 2PDXA 3ITOA 4FLRA 5HNNA 3Q67A 1YBQA 3AZTA 4ZEPA 1GVSA 3TOYA 3NQDA 3L2MA 3B40A 3TYBA 4GYKA 2PODA 4LCRA 3UZJA 1FH9A 3MZNA 4G2DA 4QIUA 5HUPA 4ZFCA 1CXHA 3UG8A 2ZRZA 1K8XA 4UR7A 1RQBA 3H54A 3TUUA 1EBHA 4H6QA 2OT1A 3AHTA 1GZ1A 1XRVA 1E56A 5KZDA 1MNSA 2BVDA 2BFGA 5CJNA 3ICJA 4RK8A 3VGDA 6TAAA 1AQMA 4JTDA 4MAVA 1YHTA 4DQWA 1U30A 4NJJA 4PCNA 4Q8VA 1DQWA 2QVNA 3FS2A 2VRJA 4LB3A 5JH1A 2F6UA 4FO4A 4ATDA 1TZ7A 1A0DA 3R1ZA 1JULA 3DFQA 3ZWTA 4CCZA 3TC3A 1NWTA 3GIPA 3AS1A 4ZQNA 5HQLA 2B7OA 3NQVA 4IM4A 5I0DA 3V1PA 4GWEA 1Q85A 1Q45A 2AGTA 3G1XA 3WQPA 3WK0A 1I2RA 1Z44A 2WM1A 3NSXA 1SYTA 3TP4A 2P88A 1Q7QA 4MLRA 3CAWA 3DG7A 4UNKA 3Q94A 4MDPA 3RN6A 4XO6A 4WQ6A 4JTCA 2ISVA 5HUOA 3PAOA 2R91A 2OCZA 2J47A 3W7OA 4LAOA 4LWWA 3FXYA 3NA8A 2FTWA 3UJRA 1CIUA 3RRXA 2XVPA 1REQA 4GYFA 1C29A 1G4EA 3KLLA 3UG5A 2JIWA 4O8RA 2FZNA 3BARA 1ALDA 1KBIA 2GJXB 1XXXA 2WZMA 4L61A 1HT6A 2DT1A 1ZJHA 2GZXA 3HPXA 3SUSA 1EZ2A 2DPEA 3KRBA 5CPQA 3L2IA 1R87A 1K8CA 4KCVA 2ISWA 4JX5A 2GGIA 5A8OA 4KCTA 1FP8A 5I3GA 2VFEA 1ML1A 1ME7A 1SO5A 3O07A 1X1NA 4U10A 1WOBA 4A05A 4B16A 4UUIA 2Q09A 1XF0A 4QQ3A 3CNYA 2XDFA 3VKBA 3R89A 3QPYA 4LS0A 1TPEA 3F4VA 3IIPA 2QJIA 2WWDA 2VM8A 1TTQA 1CXIA 3MB9A 1UPMB 1S2CA 2EPNA 5I00A 2E0PA 4QNEA 3R25A 1V4YA 1KFWA 3DCPA 1WUFA 4UZUA 4GIAA 4MB4A 3MYOA 1LL7A 3QMRA 2EPLX 1K4HA 2Y63A 3QPZA 1R9XA 3C2YA 3OVQA 3GTXA 3WQ6A 3LENA 4UFJA 1MXSA 4FAMA 3KVJA 5HJLA 3KBSA 4LUTA 1HUVA 4F9DA 2PZ0A 2GPTA 3VMPA 2PCEA 1E0XA 3BLEA 2YCLB 1AQ0A 3NO5A 1XBZA 2PD5A 1BG9A 1E70M 2QCDB 3CJPA 2H3DA 4DBEA 4O15A 3CL6A 2JEQA 3L21A 2VVSA 3SJ3A 3PUGA 2H8ZA 3GH5A 1AH0A 3MYPA 4FOUA 3RX3A 3W3OA 4NZJA 4K1GA 2ZE0A 4JOMA 5BOOA 4L7ZA 2FGZA 4Q4QA 2FTYA 1P43A 2PFHA 2PTWA 2VRQA 3PTKA 8A3HA 1N8IA 3VDGA 3G24A 2OR2A 2OLSA 1ITQA 3P0WA 5A2AA 1YE6A 1O95A 2OWXA 1XD1A 1TVPA 4RW3A 3DUGA 3BW4A 3WQFA 4Q8TA 1BPLB 1DJWA 1OF8A 4CNUA 5HJXA 3BCJA 4L5ZA 4ENLA 3UBPC 1O1ZA 4MYAA 1TCDA 3IGSA 4BA0A 1VBHA 5B7ZA 1W1IE 3VDBA 1G01A 3AS0A 4L1WA 1C93A 4RX0A 1KBLA 4ZOAA 5T8GA 3E2SA 1XH1A 5KZMA 3BC9A 2HJPA 3RM9A 1F3TA 1X7FA 5K4ZA 3LOTA 4GI8A 2BP1A 3HPFA 5CZTA 1T5AA 2GWNA 4M81A 4L1GA 2Z7KA 5GJPA 3G0UA 4RL3A 4GABA 4DN1A 2JEPA 2P0IA 3UPMA 2VQTA 2B7QA 1AL8A 4QP0A 1R9ZA 2PDLA 1RQEA 4DJDD 3FYOA 2E1WA 4LY8A 3IJ7A 4A8RA 4ACYA 3W7RA 1H09A 5B7YA 3APYA 2IXUA 4FNQA 3P82A 4GJJA 2J88A 1KM2A 4BFAA 3A5VA 2XIOA 2JF7A 1E4LA 1IWBA 2GGHA 3EWUA 2BX7A 1V6WA 3WD4A 3OZMA 3C52A 2WLYA 3F7JA 3N2OA 3JVAA 4KERA 2A3BA 1JRBA 5A6LA 3IJLA 3NM1A 1W9DM 2HE8A 3GTNA 1FWWA 1TX2A 4JY9A 2GUUA 2VEIA 3P81A 1V3JA 3FYPA 2PWFA 3FJ4A 3FEMA 3SFWA 4K36A 4NX0A 4FALA 3W9ZA 4KMQA 4XTDA 3B4UA 3UVIA 3TROA 4B2DA 3IGXA 4ES4A 3QW4B 2Z1WA 3BSGA 3PNUA 5BMWA 4DYKA 2VZUA 4X61A 3HG5A 2G41A 4QX4A 3TJXA 2BY2A 3PZ9A 4CQBA 5I2UA 2NWSA 1JZ8A 4L9ZA 2NLYA 1ODUA 3CQJA 1OFOA 3KCOA 1RJPA 2INZA 5CXPA 4BCEA 4GQBA 4RDVA 1OFAA 1R9YA 1TV7A 3ZVHB 1OQFA 1EYEA 3FEQA 4OOUA 3GFYA 4FIQA 1QPKA 2ZIDA 1NDYA 3MV01 2PCQA 3GAKA 3KBWA 3T09A 3CU2A 4H7VA 4WGHA 4MZ8A 1OEPA 3IK2A 3P84A 4PEEA 3EMCA 4K3ZA 2RKXA 2GDUA 4J5NA 4ZTYA 3WLRA 1KNWA 2PDKA 5A6BA 4KWVA 1QW8A 3TEVA 3OG2A 1TIMA 3GFZA 5HQMA 1J6PA 1DJHA 1Z32X 1VFUA 1K6WA 4PODA 1VPQA 4ALDA 4AH7A 5CZSA 3B97A 4K39A 4ORMA 3GNNA 1DJQA 1Z3NA 4IGHA 5F1UA 3CHDA 2XG9A 1IEIA 1Y5VA 3UR7A 2NT1A 2PRHA 4YNGA 1PO9A 3CWNA 2C13A 2ISDA 3I3BA 2Y62A 3DECA 4ZL1A 3GBDA 5CJ5A 4CCEA 4Y9OA 3R6IA 5F1VA 4PBEA 3AI0A 3M0LA 4ZTXA 2NVDA 1MSSA 4CU8A 1YDVA 2GQ9A 2I5GA 2VZOA 4WR3A 1UMYA 4CNTA 3NZQA 4H19A 3DH7A 3WUBA 4LYRA 3SUTA 2DIKA 2DZTA 3UD6A 1VBRA 2J78A 3TLQA 5LIYX 4RXGA 1VIZA 2O7SA 4N2YA 4O16A 4AEFA 4LAKA 2PS2A 3WZ0E 1ME8A 3E2VA 3AIVA 2FH6A 3LCXA 3WQVA 3WLTA 2X16A 3WNKA 3CQHA 3RAOA 4QJ1A 2ESCA 4E38A 3PB2A 4G7EA 1PB0A 3BLFA 1BEUA 4YYFA 4ZOBA 3W53A 4I8DA 3TXVA 1BFNA 2HMCA 1RCQA 1RJQA 3B8VA 3CUZA 3S9ZA 4Y9NA 4TTUA 2P8CA 3DFNA 1T0OA 4PSPA 3PB0A 1UQZA 3TXZA 3SY1A 2RAGA 1TB3A 1K70A 5A8PA 4DB7A 1B2YA 1KGWA 3ARXA 3MMUA 1YNPA 2WSPA 1DIDA 4HHMA 4LS2A 1BHGA 1XG3A 1GPWA 2F61A 3E2RA 3O0KA 1E40A 4D1JA 3L23A 1GONA 1NOWA 2J27A 4YTSA 1W5QA 2YFOA 1H2JA 4L4OA 3TFCA 3STGA 3L4ZA 3L4YA 2IQDA 3U2OA 1GK8A 2ZRXA 1PYMA 1DWFM 3FCPA 1GORA 3PZTA 4W7WA 1Y7VA 3GZAA 4B4HA 4GK8A 3LI1A 3UZ5A 3GXNA 2ZZ6A 3T40A 3D46A 1B1YA 4PRRA 1DJZA 3CHFA 3QGVA 3TYUA 3HQOA 4YTUA 1TREA 1FWNA 3GXMA 1ESWA 1TYGA 3GW3A 4XKYB 2VX7A 1XIEA 4L65A 4V28A 2B31A 1W32A 3S9YA 3UWEA 1H51A 1HGYA 3NSNA 4JFTA 3GW0A 4NZFA 2V3DA 3R0DA 4K1WA 4H8NA 3WD2A 4QSHA 3W75A 2YL5A 1XL9A 5I77A 4O10A 3PP7A 1JPMA 1KGUA 1X96A 4EX4A 4UR9A 2GJPA 4XZNX 3W7HA 1SJAA 3L66A 2W6RA 3LCWA 3WKZA 3CGTA 1E1EA 3U7BA 3LPFA 1IGWA 3QC3A 1P48A 1I75A 3R58A 3QR0A 5AC8A 2C1IA 3RU8X 3AYVA 3SO7A 2DDXA 4ZQMA 4LCSA 1LBFA 2PB1A 1THFD 2XVKA 1XI3A 3H6OA 5LZLA 3KXQA 1UR8A 4HOWA 1W1YA 4JR5A 4IOTA 3ANVA 4D6EA 2X40A 4BK9A 4HZ6A 2YBTA 1SUXA 2CIPA 2RJHA 3VX1A 2ZADA 3HM7A 1H41A 1O5KA 1XGZA 1ZBWA 3WJSA 2FB2A 5JMUA 3QFEA 1W1PA 1FWIC 1E1CA 1TJ1A 1LRQA 3TN6A 1XD0A 4MWAD 3IAPA 4DPPA 5D9OA 1XLKA 2J7HA 4DI9A 3T78A 2DSKA 1CLXA 2UY2A 3OZYA 4IIDA 4K6AA 3EGJA 1F6YA 1GQNA 4TMCA 1TUFA 4HQVA 4TOQA 2PLKA 2WANA 1VEPA 1IWAA 3AHYA 3M6DA 4KCWA 4I5UA 3CV1A 3WDPP 3MW7A 4JTGA 4XQ6A 1CGVA 1X8CA 4DJFA 2HVMA 3I6EA 3NWRA 5GQBA 4H9XA 3H2FA 3KVMA 4GI9A 1QTWA 4GD0A 2VWSA 3URNA 5TQLA 1KRAC 1VKFA 3HF3A 3O9NA 3VM7A 1EHAA 4GACA 3A4JA 1P6BA 2HEJA 2Y8UA 3SGGA 1XQLA 3DXIA 1YRRA 4CN4A 1ZUAX 1FFQA 1SJCA 3WH8A 3B8IA 3MWAA 4ROPA 1HO4A 1D8CA 3UJSA 7ENLA 4YVPA 5PTDA 1QPOA 4B92A 5CCZA 1UC5A 5IDIA 2G97A 1PHWA 3H2NA 3H4WA 3W01A 4MB3A 2CC0A 1TJ2A 2Y7GA 3TWAA 5FCZA 2I56A 3WK3A 1GQJA 3DHFA 2QYGA 4J3VA 1AL7A 1GW1A 1BWKA 4JEJA 4ZB5A 4S3GA 4LUSA 3CIWA 5E1QA 5L6UA 3MS8A 4JS3A 1MRAA 1TPDA 4JIEA 3URAA 2PDBA 3BJSA 3GTFA 4JKKA 1V02A 4CD4A 2J24A 1HP5A 4ZMGA 4AXNA 1H5YA 1PYFA 1DBTA 3KCJA 1V3HA 3SSJA 4PMVA 3EEGA 4XTIA 3CUHA 3OP2A 3R10A 3WQ4A 4GUHA 4UQEA 3TR9A 2D20A 2MNRA 4WXYA 2NQZA 1SO4A 1OYAA 4B4FA 3MMWA 2AQVA 3BAIA 4GX8A 2DY3A 2AOSA 4ZO9A 4ZO7A 3O6CA 4U31A 1AW1A 1TR1A 3BLKA 4FF5A 5DRIA 3AZSA 3GHTA 3U5UA 4OT7A 1XV8A 1PZ0A 3GM8A 2ZWZA 4YWIA 2XN0A 1XLMA 2QF8A 3U8GA 5C55A 3VUSA 2XFRA 3M46A 3VFLA 2G8ZA 4ECLA 4QLJA 4PE8A 4LUJA 4GC3A 2YA0A 1MFUA 2FZDA 3PG8A 1JNDA 1M65A 1OADA 3AS2A 5D05A 5D8WA 5BROA 3S2NA 3CTLA 3IS4A 2CWXA 1QPRA 3K8LA 2WPBA 4HHLA 3VC6A 1XYZA 3EYPA 1FWEC 2IS7A 1LF1A 1V6TA 3E0FA 4GCXA 4BJHA 3T4CA 1GTHA 1F8MA 1EUNA 3SSZA 7REQB 5LIKX 2RFGA 3U5YA 2KX9A 2YW3A 1J6OA 1WOAA 1H11A 4FX7A 3TZNA 1LOLA 1LROA 4UFIA 1P1MA 1V79A 2J6XA 2OELA 4KGJA 3WO8A 1EDQA 3AWNA 5SWUA 4AYSA 2B0MA 1QPNA 4GUIA 5KMYA 4G6CA 2WHKA 1QI2A 5EL1A 4JQ2A 2CLIA 2W27A 4UBPC 4X60A 1JJKA 4LUYA 3WL0A 4W7UA 1WDWA 2QDHA 1FHUA 3BDKA 5ECVA 3UPBA 1O7AA 3CLMA 4QROA 3ABZA 1QOPA 4JIPA 2ATSA 2ZA3A 3HURA 3AQUA 1VPXA 4QLKA 2HRWA 4J3WA 2VX4A 2OFJA 3AU6A 3THDA 5AZ0A 4R34A 3QOKA 3P80A 4LRSA 1RH9A 4QG6A 1MDLA 3HGRA 4JHMA 4V27A 3ITTA 3EX4A 4Y90A 2ZUWA 1S39A 1S5WA 3W6MA 2YDQA 3GXIA 3VIOA 1F74A 2Y2WA 3M5ZA 3CMGA 4IMAA 4E3TA 3ECQA 4KS0A 1VC4A 2NQHA 3QTGA 1VENA 1NU5A 3S2JA 3MU7A 1GVIA 1ICPA 1XYLA 3UW6A 2GOKA 4MADA 1VEOA 1W3NA 2AQWA 4ICCX 1JPIA 5TF0A 1W0MA 1H0IA 3GG7A 5CGQA 8TIMA 1WUEA 4MG4A 3NQAA 3ITYA 3UESA 4KH2A 3KTCA 2R1KA 5A6KA 1LRNA 2TAAA 3W7GA 3BW3A 4DAIA 5T26A 3V1HA 2EXOA 1KTCA 3RF9A 2YBUA 3GWQA 4L6DA 1B4KA 4XAFA 2OMAA 4DZAA 4F79A 1CW2A 4BF9A 3NDYA 1EKOA 3VKDA 3LX9A 1JRCA 4DO4A 2V5CA 3GLCA 1ODZA 4L9XA 1Q8AA 3WUGA 3HV9A 3LY0A 3VOGA 1BYAA 4FXFA 1HJVA 1HKWA 4ZQPA 2PP3A 1OD8A 2WC3A 2P1FA 3NXLA 3TR2A 5C71A 1OCJA 4NT0A 2PC4A 3MUXA 1JCMP 1EBGA 4GG9A 4K7VA 1YDOA 3S83A 1BVNP 4HHHA 4ICMA 4AZCA 1BXBA 3FJ6A 4PL1A 3AOFA 2W9MA 3RMJA 1Z9AA 1OC7A 4M6VA 3HFYA 2Y7EA 3A3HA 1RA0A 5FJOA 1K8ZA 2ZWYA 4N9BA 2YL9A 1SO3A 5T9CE 1E6XM 4HPJA 1XW8A 1VFMA 1FHVA 5C5YA 3EB4A 1WB0A 4JGDA 2XZ9A 1KCXA 2DJXA 1OBAA 5BCAA 5G4EA 3HPSA 4CGTA 5AYZA 5C70A 5CGTA 3L68A 3PVFA 3WQ8A 5I06A 1P0KA 4GH1A 2PDUA 3T7VA 3SB0A 2BHUA 3F4CA 2PP0A 3KZSA 1IGSA 3W1PA 2VX6A 1C8QA 2C3ZA 1EL3A 1RJRA 2WSQA 3WLOA 3I7RA 4ZQCA 3IVTA 4NL1A 2UZ9A 3M9YA 4TX6A 1FCQA 4Q8UA 4XD4A 4DYEA 1JYWA 1RK6A 2GQ3A 3AICA 3ZVIA 3ABXA 1AUSL 4A21A 2E77A 3R8HA 2PDYA 4IJCA 3ZO9A 3KP0A 4WIWA 5EB8A 5AYIA 3L0GA 1W9XA 1BXCA 1CZ1A 2FPYA 4NZCA 4QG9A 4AIUA 3FVMA 3VE9A 2OLAA 1A49A 4U3AA 2V2DA 4JNMA 4HK7A 2E8YA 1KWKA 2WWCA 4S1FA 5A95A 5ABFB 1BD0A 1JZ4A 3GUWA 5LSMA 1ISVA 1K9EA 3WDHA 2V5KA 1XRFA 3RYSA 3EMZA 3CB3A 3D3FA 2XJ7A 1E73M 3M0XA 2HS8A 3UWWA 1X1OA 3UG3A 2A5HA 4JTEA 2OZ3A 4KCUA 2DSWA 3RR1A 5E0CA 2PLCA 1ZJIA 4K68A 1KV5A 3CYJA 4HT3A 1E1FA 2PU0A 4KPLA 5LNVA 2P50A 1H63A 3T9PA 1T41A 2VQUA 4B5XA 5ABEA 1GOXA 4ADTA 1HL9A 3WD3A 1UMLA 1HKJA 1W3HA 1V6VA 1VBJA 1XRSA 2ICSA 1KC7A 4TO8A 3M0VA 4RE3A 1DJYA 1XC4A 3BLLA 4RE0A 4JTTA 2ZE3A 3HPZA 3S4TA 4OUIA 1A3HA 4L6OA 4PUUA 3B8UA 1OG0A 4AZIA 3W6YA 4LF1A 3RJYA 3LNMA 1IXOA 5DXYA 3ANYA 3CT2A 4C6LA 4ML4A 4QITA 2OVLA 3WH9A 1ZBVA 4Y9MA 4MVAA 4RJEA 5K9DA 4QEEA 2E5DA 1UZ1A 2IPGA 4D6CA 1QMLA 4B5NA 3QBUA 1RPKA 4XAYA 2NVAA 3VNDA 3UWVA 1A3WA 4MY8A 3N2BA 4IPIA 5JUVA 2KAUC 1LT8A 1VFHA 4PULA 1I60A 3DGRA 1CGTA 3OG3A 4I5RA 3A12A 3OLGA 3PWGA 2D22A 1WXJA 3WLPA 3AXMA 3WLLA 2ZZ7A 4XAGA 4M19A 2OOGA 2X7WA 1ICSA 1QRQA 3PJUA 1OZQA 1MUCA 3DEQA 1UBPC 3NOYA 2E09A 2YSWA 4NAEA 2WMKA 3WL1A 1RAKA 3VZXA 3EBVA 3F03K 3HGSA 3S5YA 1TRIA 2YJQA 1TO3A 2Q01A 2ZYFA 1P7TA 3LBMA 1XYCA 1ZP4A 3BOLA 1RQHA 4BI5A 1ENUA 3QW3A 3A24A 5BOEA 4ZSUA 2CLEA 2A1YA 3U6WA 1EO7A 1VJSA 1POJA 1JDDA 1WBHA 1TV3A 3GU1A 1RZMA 1IR2A 2XINA 5I23A 3TTYA 2GK1A 4CNNA 4UOZA 4JAWA 4EPEC 1KKOA 4IIFA 2ODOA 1K7FA 1CENA 2B4GA 1WDPA 5E93A 4DUOA 2CWNA 1UKQA 1PSCA 4PMOA 4HNVA 2INEA 1HTIA 5H6HA 4EXAA 5JIWA 4KFOA 2IXVA 1WDDA 6ALDA 1DWIM 4JTAA 1Y5WA 3KM8A 4N0RA 2WW5A 3MKKA 3MO7A 3NZPA 2QGHA 1JZ7A 1YQ2A 5CG0A 2OOFA 1NP0A 5CAKA 2ACQA 3AROA 4O57A 3EZ4A 4LGXA 3KL5A 2XPKA 4LX4A 2VR2A 1TA3B 3V5OA 1OIMA 4JZ5A 1SPQA 3ELFA 1U5JA 4AZHA 4A6GA 3EMQA 4BEQA 1DL3A 3PTDA 1PKYA 3BGGA 4LYPA 2Y5JA 3BQ5A 1JVNA 4UTWA 2WSRA 2OKOA 2Z26A 4HNOA 4FX6M 1QI5A 3LEPA 5LA1A 2Y1HA 5C2CA 4M0XA 4DX3A 1GVEA 4AFYA 1W56A 3VGHA 3QFWA 5LNUA 4RUBA 4CKQA 4FS9A 5EBAA 4UOQA 4CVWA 3L0KA 3V5CA 2O9RA 4K7YA 5E09A 4UQBA 3IACA 1VGAA 4TQTA 4C1NA 2E6YA 3ZQ9A 3H2OA 2IKIA 2DZXA 3KRZA 4JTFA 2YCJA 3C0SA 3W27A 1UG6A 1G1YA 3INPA 2PZNA 3P8IA 1H7WA 4B5UA 3L65A 3D6NA 3RCYA 4Z2KA 4NX5A 4O54A 4PMNA 4D6GA 1SR0A 3Q45A 2X0SA 1VJIA 4IF2A 4UTTA 2D0FA 1AA1B 2C16A 1G4SA 1V3LA 3CUJA 1UH2A 3PBGA 4IIGA 3SECA 3AHXA 3IJDA 3LSBA 3EWYA 4AD2A 2ZTKA 5D2XA 3GDRA 1I1XA 2Y6ZA 1GOQA 3QMSA 2O4MA 4OKDA 4OBSA 2QR6A 3VD9A 3HMJG 2AGKA 1YX1A 1JPHA 1GW9A 2DZWA 3HIJA 1OFEA 2W63A 3SUUA 1WQ5A 3BAXA 1UUMA 4JHOA 1C91A 3O2LA 4IT1A 2VT0A 4ZB0A 4X22A 4GVHA 2HBVA 3N4EA 1RCXB 3QHMA 4PH6A 1M68A 5CZJA 1KM0A 1EEXA 2IKHA 2EBNA 2W92A 3CM4A 2GUBA 1PIFA 3E0VA 1D3HA 1EWEA 4TUFA 4DI8A 4H9MA 1PTGA 1B9BA 3BH4A 5JVLA 1NOFA 1VIWA 3OTRA 2YXGA 2EGZA 3E02A 2C1GA 4L56A 2ZZ5A 1OCBA 1U5HA 2PMQA 4CU6A 5FOOA 3W7QA 5A2BA 3H4XA 2TRSA 2WK2A 3W1XA 4MNLA 5CLWA 1QNOA 4O17A 4Q7IA 1OVDA 2CFFA 2IQ0A 3B9OA 1A5SA 2PRMA 4WVXA 1DWJM 3OBAA 3LD5A 1EX5A 2I57A 3ZMRA 2LLEA 3UT0A 3SCVA 2ZICA 5JBDA 3GD6A 5MKGA 3NVDA 2YA1A 4HYWA 3MVTA 5FEZA 3CL8A 1KFCA 1YPFA 3G3MA 4IL0A 2MUCA 5HNUA 1HX0A 4PUKA 1MW2A 3PFRA 3TJIA 3PJTA 2W91A 1MRQA 3MQTA 3QM3A 1ITXA 1VF8A 2YBVA 1V0NA 3IJ8A 5D9PA 2TPSA 1CEOA 4DF2A 4OE7A 1E43A 4Q8QA 4XVDA 3WBYA 1FWSA 1E0TA 3T6CA 5AOUA 1W1B1 2BTMA 1EP2A 2GJNA 3KOFA 1W2VA 1TWIA 4QAIA 1U22A 4LPCA 1JEZA 4B9YA 4JFVA 4EACA 2F84A 4FX8A 2Z0IA 1EJUC 4MKNA 3W29A 3EPMA 3N6QA 4DXKA 1YE4A 2DQXA 3TW9A 3S2MA 4NASA 3V4BA 3TJ4A 1KM5A 2H3BA 4CQ8A 4R7JA 2OYKA 3ARUA 3GG1A 5LIUX 4NZ4A 5FJRA 3F4NA 3ATZA 5LIXX 1PTDA 1NP2A 4U33A 1OB0A 1DJXA 3TQKA 4NUWA 3PN8A 1XYFA 1IV8A 2P3EA 5HQEA 1BGGA 2BMBA 2D3NA 3BG9A 1OIFA 2YXXA 1A5AA 1LL6A 5DY2A 4ZVJA 3GVWA 2UY3A 3QKEA 4Z1CA 2ZC8A 1EF2A 2Z00A 2H9AB 5LNSA 1EIBA 1OFPA 4XD3A 2HZGA 2A3AA 1I2OA 3SGUA 4B5VA 4O14A 2OQLA 3C8NA 2G4JA 2BGQA 1S3HA 2RUSA 4O12A 4JTSA 1I6NA 4MWAB 3N3MA 3B9NA 3JR2A 3VOCA 1LQ0A 3R94A 3ARPA 4WOQA 3AMLA 3NM3A 2ZKMX 1Z41A 4PRWA 4PSRA 3N34A 1GG1A 5GNYA 5JH2A 4RXFA 4FXJA 1OK4A 1LYXA 3W82A 1X6UA 1EB3A 4F40A 4AD3A 3SCQA 2ZRVA 2YGYA 3IJ6A 1VCVA 2V8ZA 1E4NA 2V81A 3G1FA 4KRZA 4N4PA 2A79A 2QDGA 2VELA 3LMYA 5I3KA 5M1TA 3WENA 3RX4A 1DIEA 1QHZA 5AYYA 2QCEA 3UWYA 1C8YA 4O1DA 2HNHA 3EWZA 4ATWA 3MPGA 1SJBA 1YMYA 4KT2A 3WBXA 1H4PA 1A5KC 3QKZA 5DELA 4IGMA 1EJVC 2ZUVA 5H8UA 4GY0A 4WDTA 1FCBA 1NVMA 4QDPA 2NUYA 1LORA 4OGZA 3THAA 1O94A 3VCNA 5FESA 3THQA 4ACZB 2QCFA 2J9ZA 4N6EA 1LWHA 4WJ8A 2C8NA 5A1AA 4X3ZA 4JIRA 1PZ1A 3N14A 1W9PA 3DKJA 3LK6A 4NJGA 4P2VA 4LCQA 4DIAA 4XIAA 1YYAA 1VCFA 4UMBA 3HJEA 1B4EA 2BLEA 4C6KA 2Q02A 1F3EA 2DSZA 3XIMA 4OHQA 3BL3A 4DWSA 3SRKA 2ZRUA 3VI2A 2E7FA 3DI0A 4O52A 3V0TA 5HR6A 3TTSA 4JN6A 1GVFA 3MI3A 1KW1A 1HXJA 2FYMA 3DESA 3TYZA 4GQGA 4G7FA 3N4AA 5M03A 3OBEA 3NZRA 1LUCA 3QEZA 3IRSA 1DHPA 3Q65A 4MPKA 3SI9A 2QJGA 3E38A 2Y4SA 2WMIB 1L8PA 1RVGA 2CW6A 1M03A 2BXZA 5AVNA 1JQXA 3PZNA 3ZR6A 4A35A 5C2GA 3POCA 3CWHA 1UIOA 4LOCA 3S9IA 1VB9A 3VDCA 3MSGA 3VIMA 2Q71A 1HO1A 3AO0A 4Q33A 2WVTA 1ZQ5A 1PHQA 1MXGA 3AMCA 4GC4A 1KRCC 1F8IA 4ZA0A 4RDYA 4UZSA 4PMRA 2PRLA 1MQPA 3AFBA 1FWBC 3EA1A 1DXFA 5AC7A 5HATA 4LANA 4Q22A 4B15A 1UYQA 1Q6CA 1J12A 1KCLA 4LF2A 4DWDA 5CSSA 4Y8FA 3R4IA 3UP8A 2CERA 3O7UA 2ALRA 1DJGA 1Q6EA 2FKPA 3O0FA 5J5DA 4WEVX 3K1GA 3N2XA 4WCJA 1VYPX 5G1MA 4J3SA 3B0XA 3UPWA 1LP6A 3RFAA 3AYRA 2A2IA 3QYSA 2ALDA 4IIEA 4UTIA 4UFLA 3AIUA 1E0VA 1M1BA 2AL1A 4ADUA 2VEFA 5EFFA 3UWUA 4EPDC 2A6LA 1S5TA 1T8QA 5CZ0A 1AQHA 2I1OA 4GLEA 1CGXA 4KIRA 3WYZA 2X2YA 1US0A 1RY0A 2NV9A 2OJPA 4JDYA 3LLXA 4HCLA 5J5RA 3C3UA 3B0YA 3PJXA 4A2RA 3S8HA 4WSKA 3LNPA 4A8IA 1IT0A 4B3ZA 2OEMA 1FP9A 1HFBA 1D9EA 3FIGA 1IEQA 3SCNA 1Q3NA 2CITA 1QU4A 2WMHA 2CLPA 4QR6A 4JKLA 1D7KA 1SSDA 4EAMA 3UJFA 1FWAC 2OX1A 4GXPA 3LV6A 4PMYA 8RUCA 1V77A 1A3XA 3F2CA 5REQA 2BVYA 5AZ1A 5K2ZA 2NZLA 1SW7A 1XBXA 3CO8A 3IK4A 1AW2A 3WQEA 5C9ZA 1BTMA 4PCTA 3B4YA 4PUMA 5FIPA 2Y5EA 4P7QA 4ATLA 2Y7FA 1DIOA 2VL4A 1ZTVA 3LGDA 3NPUA 3W81A 3TNOA 1J96A 3OHMB 1X98A 5AHMA 3W1LA 5IBXA 3GH7A 3TYAA 2VC9A 3TDFA 4KWWA 4EKJA 1J5TA 2WSYA 3SN0A 4DM2A 3GX9A 4N9DA 3LDVA 3P0XA 2HXUA 4N6FA 2F6KA 3AS3A 1XIFA 3ERPA 3M44A 3NEVA 3W71A 2RGLA 1CBGA 1RUSA 3A23A 3HQPA 3IEBA 3UJEA 5A6MA 4RNJA 3GVRA 4BS0A 4TV5A 3LTSA 3NL2A 2DW7A 3JU2A 3C6CA 4S39A 4LUIA 2Y89A 2PDMA 3I10A 3BOXA 3R8GA 5I3DA 1TE6A 4F0MA 3LBCA 5D9NA 3TWBA 1H7OA 3TYCA 2H6RA 5F4XA 4MWAC 4GKTA 3BV7A 4O1AA 2EO7A 1UBSA 2NX1A 1B0IA 1H3GA 4IX2A 4ZR8A 3RCMA 1I8JA 4PUNA 1VH7A 5EKYA 4AVOA 4BHYA 3AWOA 3EPNA 3RLHA 1GOWA 4KBXA 3EKLA 4X63A 4E3VA 3B0VC 5HBFA 4XAZA 9XIMA 2X30A 5IDZA 1AH3A 1YTDA 2X05A 1FH8A 3CMJA 1GVYA 1ITCA 3UR2A 1T6MA 5D32A 4DYJA 4H3DA 1NARA 4DLFA 1MZHA 3OVGA 4OZOA 4RKAA 3PBWA 4J27A 3SGZA 4BKNA 1OD0A 3GE7A 1H49A 3UEQA 4ZGYA 3FSUA 3EOLA 6TIMA 1QR7A 2D73A 3MUAA 4I7UA 1ZU8A 1Q6LA 3APGA 2Y70A 3VILA 3VD7A 5CEWA 5C9RA 1MXDA 1QHOA 3P3BA 4Y2WA 1RALA 4EWND 2WVVA 1QI3A 4WGXA 5I3FA 3LBOA 4DJFC 3TU9A 1CNVA 3BAWA 4IQEA 5EMUA 2HDJA 1QNQA 3O16A 3TYDA 2YFNA 5D02A 1CGWA 1BSLA 1BXNA 2F38A 4NJKA 4LVAA 2A3CA 3ORWA 3H2MA 1RA5A 4E2OA 4AD5A 2DVUA 3I4EA 3PPFA 1IZCA 3R43A 3T0DA 1KV8A 3L7RA 4AQLA 2XIMA 1VLIA 4HIBA 3NTYA 2O4QA 1FWCC 7XIMA 2B81A 4FOJA 4GBUA 3S47A 3MP4A 2AQOA 3HU7A 2C0AA 4Y8EA 3WMSA 3BCDA 3EWCA 1S1PA 1J0JA 4XZLX 2VP8A 4NAFA 2GSEA 4LB4A 2BNJA 5EMMA 4W87A 2OEKA 4AWSA 3LCLA 2PD9A 5DY3A 3IGHX 2ZDRA 1EXPA 1W54A 3DG6A 1FWFC 3N19B 4WDUA 4LSBA 2OB3A 5XIAA 1V6XA 5GPRA 3V0SA 3AYSA 4HNCA 9RUBA 4IGNA 3EDJA 1XCWA 3W88A 1W5NA 4DBSA 4LEQA 2NWRA 2CHOA 1B3ZA 1UB3A 4F0LA 4BR1A 1QNVA 1S2TA 1V6UA 4RCXA 4G8TA 3C0LA 3AIWA 1ELSA 3S1VA 4GE8A 4J40A 4IXHA 1PEZA 5A5WA 3G0SA 1F05A 4GMEA 2E5BA 4A3YA 2YYTA 3W24A 2FIQA 1HKIA 3U0HA 3KRUA 1TPB1 1BRLA 3S0CA 3GDTA 5H91A 3QZEA 5CH9A 1UR2A 1PX8A 1QO5A 3W7IA 4Z17A 3WN6A 2PPGA 1UWRA 5JBEA 3BANA 4V1YA 5JQ9A 1TPUA 1U1HA 1FUYA 1KFJA 3IJ9A 3PULA 4CQ9A 3SY8A 2PE4A 4FI4A 1BYDA 2QV4A 4ZE5A 2AL2A 3QTPA 4H6RA 2UY4A 4LC8A 1EP3A 1PUDA 4MNMA 3WQCA 3SUWA 1FDJA 4NXKA 3U7VA 2QPSA 4KGLA 3LXAA 1CI1A 1LL4A 5H1WA 3EX3A 2FVKA 3CXOA 5D2WA 3VIGA 3ES7A 3CB8A 3SRFA 1KQYA 4GX9A 3NIYA 1K8YA 1TMQA 1R2SA 1WA3A 2BASA 3W7PA 4BQ4A 2QCHA 1AG1O 4ZO6A 3S46A 1J0ZA 4EF9A 2V67A 1S5VA 5K4XA 4AF0B 2E6AA 4QDMA 4LVFA 3F5KA 4IPLA 1M5WA 4WY0A 1XRTA 3CQIA 3ABSA 4AZ6A 4QJ4B 4M1RA 3QYQA 4IG2A 3P8JA 3BLDA 1YNQA 3ATYA 2PSNA 1MI3A 3URBA 4QBXA 4CVUA 2CBIA 4LXFA 3QZ6A 1C7SA 1P7TB 3ZJ6A 5FSDC 2XVGA 3RR4A 1EYWA 5DF0A 4C6IA 5BU6A 5G1YA 2EHHA 1OCNA 1P1XA 3TE9A 3WG6A 2NV2A 1CCWB 5FF0A 2WC7A 5TBOA 2D69A 1LBLA 3CO4A 1ZBKA 1OABA 4QNWA 4Q8MA 5LA0A 3DX5A 5JIPA 1XKYA 2QKFA 5I02A 1MW0A 5M3WA 4O53A 3IIVA 4O50A 1TPC1 3W1UA 1NWSA 2BBFA 1B3OA 1ECQA 2BGNE 3LHTA 2VOMA 1AH4A 2FPTA 2NVCA 1QK2A 3BGJA 1CGUA 1XQKA 1OX6A 2ZXAA 4F48A 2R94A 5HNRA 1KKRA 1VFTA 3QQWA 1HVXA 3CV6A 2XVLA 3PPHA 1J0IA 3TSBA 1MW3A 3GSMA 5I78A 1H7PA 4D9PA 1R47A 3LHYA 4C60A 4CD7A 1LT7A 1EGMA 4OIFA 1PKMA 1IE7C 4IFKA 2ZC1A 4L4PA 1TPWA 1JGIA 1QXLA 2V69A 1GGOA 3VPLA 1VRDA 2CETA 2NUWA 1VFOA 3ZZ1A 4P8XA 4AZ5A 4EPBC 4E8CA 2YOCA 4S3AA 1UWAA 3WQWA 4IPPA 3HBLA 4D6JA 3KZPA 1YDNA 2VX5A 2QXWA 1UR9A 3UWQA 2FDSA 3NPWA 3CMFA 3GK0A 3M47A 1FHDA 2Z25A 4GGBA 3LU2A 3PBMA 3I7QA 1S2WA 2E9LA 2QF7A 2VD8A 1EH9A 2J7DA 3GUGA 1AJ2A 1D3CA 4CNOA 1QPQA 2DVTA 1TTJA 4JY8A 3T4WA 2VFIA 4QSFA 4IIBA 3TCSA 3MCNA 4C65A 2X1RA 5IXEA 3OGVA 3OGRA 1EOKA 4PEKA 2AMXA 1QDSA 4POCA 4JD4A 1S2AA 3N18A 1Q6DA 3TLLA 3VZYA 1KXHA 4A8LA 1HJQA 1I2QA 2OQHA 3O8AA 3WY1A 2DT3A 1RBOB 3EA2A 1Z6KA 3W28A 1JF6A 3PWIA 4H6KA 2E25A 3M1ZA 2C19A 4WKFA 1JD9A 1SZRA 1G69A 3W2JA 2I5IA 3I4KA 3OGSA 1E6NA 4MNJA 2F6XA 3ITGA 7ODCA 1AZ2A 3M0IA 3STEA 4H7CA 1OFBA 2VZVA 2WKLA 3E74A 3WK1A 1GEQA 1TUXA 1I0BA 4U2ZA 3ZLGA 1FQ0A 4I90A 2XGIA 5FA5A 3E96A 1EJ7L 3H4GA 5DFAA 1DPMA 1B3WA 3WIJA 1WO2A 5M17A 2PF8A 3W86A 4IFRA 3B0UX 2EG8A 2PLJA 4D6HA 4G9PA 3BMVA 4O11A 4U28A 1H7XA 3P62A 4A4AA 1JYVA 2NX9A 1ECEA 4WSHA 1VZWA 3GB6A 1GYLA 3BXWA 3SJNA 4WRHA 3B0PA 3WJYA 4O0ZA 1JNEA 2X0YA 3GO2A 3KCLA 4RR4A 2WCSA 2DZSA 4MJ4A 4DBDA 3TZFA 1K77A 1XLHA 2FHCA 1YXYA 4O1FA 4DBWA 2GOUA 1BF2A 3LPOA 5AECA 3KBVA 3MJMA 4TTGA 4HK5A 4W84A 4M51A 5A8QA 5XIMA 4K2SA 3W87A 1C8VA 4K37A 5E6ZA 1OX4B 1UJPA 1ZGDA 4L4LA 1SMDA 1MUMA 3W2UA 3LYEA 4W5ZA 4C5ZA 5FD0A 2NX3A 1OM0A 2Y8VA 4XUYA 4UFHA 3TQ0A 2DP3A 3C8FA 3LXCA 4F4RA 2WJEA 2XM2A 2GLKA 1WZKA 3N9SA 3THCA 3VNKA 5HWNA 3DFYA 3LS9A 1RXOB 4HHPA 3WLNA 3VNYA 3GIQA 2V5DA 1P6WA 3MV11 4EPKA 1SJDA 3OIHA 3G1SA 2Z1BA 4M80A 4XD6A 1UKOA 4IMCA 1UC4A 3SUVA 1QASA 2Z24A 4DO7A 3N73A 2OYLA 3G8RA 3N11A 1MQQA 2XFFA 5AB3A 1Q13A 3E2QA 5MF5A 4L64A 3MHFA 3EB2A 3OVPA 2Z1VA 4XZHA 2VR5A 5HPOA 3GR4A 1Z89A 4LNCA 1M7OA 2EF9A 1FWJC 2WZIA 2E6FA 4QCFA 4XIMA 4ROQA 1PS9A 3UGRA 1F9CA 3C0JA 4OTKA 1GQIA 3SRHA 3IUIA 1KA9F 3PSWA 3AXIA 4HPHA 3TK7A 5ABTA 1DORA 1BSIA 4P7LA 3TKFA 3G1RA 4P5UA 3F4DA 2Q8LA 1FDZA 4R9OA 2I16A 3KUMA 2QNEA 2VOTA 1S46A 1B90A 4DF1A 3DFOA 3R8RA 4Y9AA 3WCZA 4DNMA 4XWUA 4DJEA 3U2CA 1RP9A 3W4RA 1WZAA 3AIQA 3RMEA 3GR7A 1ONEA 1MWOA 3VIKA 1JCXA 4N9CA 4PTVA 4W4QA 3C2RA 5C9WA 1DXIA 1OYBA 1HZYA 4QE1A 2ZZ4A 4D72A 3HGOA 2QUMA 1PPIA 2WQDA 3DFSA 1MNZA 2A7PA 1NWUA 4WKHA 4JIIX 4W8AA 3CEPA 3NCOA 4H9TA 1ZZMA 4PTDA 3GXDA 3WQGA 3BO9A 1W3KA 2OLHA 5AC6A 3P61A 1K1DA 3AALA 3SIMA 1AW5A 3S6DA 4MB1A 1UD5A 2CESA 4B90A 2BOFX 2ONEA 6ENLA 1ZCOA 1R30A 5A3HA 3EWXA 1RP8A 3AJXA 2VFGA 3QRHA 2CLMA 1UD8A 4D8ZA 5I24A 3TYEA 3TX9A 1XR2A 1EOMA 1IEXA 2I9UA 2BXYA 4UTJA 4INFA 1ONWA 3V75A 1LJYA 4PTMA 1A53A 3AIBA 4E2VA 1R0MA 1FKWA 2YCLA 2YLAA 3D3AA 4QRNA 2PDCA 3RRAA 5CC6A 2E5CA 1DYSA 4GZJA 4DAFA 4C6DA 4G1KA 2QCDA 4JQ3A 1CDGA 1FVPA 2IPFA 3CHVA 3OA3A 1E71M 1SM9A 3WLKX 4WDXA 4X2PA 2BY3A 3Q58A 2G96A 3SZ8A 1JFHA 1ZP3A 2WNZA 4DXVA 3IUHA 3MSYA 1EEPA 5J04A 4HK6A 3G3DA 1GUVA 5HAOA 1YDYA 4U5KA 1SFLA 4UTWC 1CB7B 5HMSA 2NW0A 1ZAJA 4GUFA 3WFZA 2OSXA 1Q66A 3GDBA 1EC8A 2H90A 4GYPA 1QWKA 1IT7A 1UWUA 3M0ZA 1JR1A 3N4FA 1FBAA 2WSKA 1DQXA 3FGCB 4AY8A 4Q4OA 9CGTA 1CX9A 5HINA 4PCSA 4DBUA 3SDOA 1EJRC 4HB7A 1OFRA 3TW6A 3V5FA 4DWSB 4CD5A 4JTUA 1X6NA 3WF0A 3W1MA 4GVFA 1WKFA 1SW3A 2JBMA 3GDMA 3RPMA 2Z7GA 1DWAM 3HMCA 4H8UA 1OY0A 1DQUA 3ZLFA 3MY9A 3GS6A 5HNTA 2XUCA 4B5TA 1JPDX 5IM51 2HPIA 2CLFA 1OJXA 1KXVA 3LHVA 2W4XA 2NSXA 3G77A 4UTTC 1YIXA 2FVLA 4HNNA 1RLCL 1XBYA 2OGJA 4GIRA 3FLUA 4WKAA 3WJZA 1JDFA 3NOEA 3H2EA 1BVZA 2W62A 3S3GA 2HS6A 5BMXA 3N9RA 2OSWA 2HNEA 3MCMA 2DH2A 3VFCA 3UY8A 3PJWA 4FK9A 4P7RA 3H8AA 2OO6A 3O3RA 1QT1A 1WZLA 1V03A 4OUEA 2NT0A 3K8MA 4PMUA 2HSAA 4CN1A 3A4WA 3PZGA 1BKSA 5C9XA 3VCRA 1G94A 2PDHA 1L9WA 3HA1A 5KZEA 1TX0A 3L4WA 3OYXA 2WZTA 3R11A 1E9LA 2BSLA 2FB3A 2CHNA 3W73A 4HP5A 3AXHA 3RGTA 1IZJA 4PB3A 4M7SA 3ARVA 1XFCA 1NIUA 3KDNA 2Z2UA 3QV8A 3VKCA 2VDIA 4Y6GA 4CD6A 4BWLA 1PCWA 5K7JA 3OBKA 4XAPA 3URQA 2RDTA 2WKJA 3W00A 2QW5A 1PX3A 3LZ5A 2DT0A 1UA3A 4US5A 3ARSA 2X09A 4UMCA 3IIOA 4AD4A 3GKAA 2DORA 2Q8ZA 1E72M 1M6JA 1W5MA 5LGZA 4AEOA 4AU0A 2VKZG 3QGKC 1V3IA 3FDKA 3FN9A 3EOEA 2B7PA 3W25A 3W38A 4DLMA 4LVDA 2DSUA 2QT3A 1KRMA 4QJ5B 3LRKA 2OO0A 4X0VA 4CLMA 5E0FA 4YMZA 3L4TA 4QLLA 2O55A 1J93A 4PRTA 3VM5A 4B2DD 1Q6GA 4JFUA 2J13A 1ZY9A 3UERA 2YCEA 5FL1A 2QCGA 4Q6JA 3V16A 3LRLA 1WYIA 1JCYA 4DO5A 4J9JA 3LXBA 3WDQA 2F9RA 4GO9A 4RDZA 1HL2A 4PC8A 3PUOA 4AY1A 1BWLA 3P7YA 3U2EA 1KFKA 2GUYA 1TELA 4J7RA 3TSDA 1J4EA 4REQB 1XHGA 4C6EA 1MYRA 5BW6A 9XIAA 4AWEA 2V38A 1EIXA 4JTQA 1U1UA 3P93A 2QZRA 2A3HA 1UP2A 4PMXA 3WMLA 5J8LA 3USZA 5HULA 2AMGA 3JS3A 4DZHA 5FJUA 1FWRA 1FHLA 5A6BD 1ICQA 3I3EA 1H1NA 1UD6A 1KM1A 4RZ6A 2OZTA 4AW7A 4XUGA 3PTMA 2QPUA 3AIEA 1AFSA 1R5YA 3RM8A 1L6GA 3ZYZA 3RPDA 3R13A 1GTEA 4S38A 3EB3A 2XSAA 4IGSA 2V3EA 1JZ2A 3WX7A 1MEWA 3F2BA 4K38A 3FV9A 1W2PA 1E6ZA 1V93A 2C0HA 3M6YA 3AMGA 3GXTA 3BJTA 4H00A 2GJLA 3W7KA 2WV8A 2DZVA 6XIMA 4UQCA 4D6IA 3PK7A 4RZ4A 1CPUA 4E4UA 4H41A 3IANA 5GJNA 3IVUA 1C92A 3CHEA 3SQSA 3GU9A 3H70A 4WDWA 4UTKA 1W8GA 3I65A 1LZOA 2YYUA 7TIMA 3GU2A 4MKVA 3REQB 3ZJ8A 3TMQA 1QAPA 5EMLA 4GBDA 4IP7A 1L6YA 3CIXA 3CTTA 4B3LA 1W8SA 1O12A 4Z1AA 5F2MA 1EPXA 3OJGA 5AHLA 2ASHA 3WFAA 2QULA 2BODX 3OO2A 4QTGA 4I6VA 4MTVA 1A50A 1JYXA 5FEWA 3FA5A 1OSEA 2X0HA 2W3ZA 4S2BA 2A7NA 3NPXA 4D1IA 2VJXA 1O68A 4FP1A 5D33A 8CGTA 3OLEA 3RLVA 5A69A 3TQPA 4Z2IA 4S3CA 5H8PA 1PL9A 2WCGA 2C6QA 3PZVA 1DIKA 5BRQA 4IICA 3AJ7A 1XIJA 3NQ2A 2J66A 3EA3A 4Z2LA 1DWHM 3C86A 3UU0A 6CGTA 3SFKA 4R7OA 4XKYA 3LUTA 3EEZA 4AD1A 1DP0A 1QW7A 4DWSC 4RE2A 1ZJBA 3UQNA 2DUXA 3EDDA 3UXLA 3A9BA 3LPGA 2G50A 1LBMA 2G95A 4NQ1A 1EFZA 1F73A 3UY7A 5FF7A 2DJLA 2ZXDA 2RGMA 3W2KA 1UKTA 1I45A 3E12A 4XZ9A 2ZX7A 4GHRA 3K13A 1V51A 1OGSA 1EC9A 3W02A 2NQ5A 4D71A 3ITVA 2QEZA 5E0KA 1A5MC 3PZMA 4OV9A 4J28A 1PZ3A 2VWTA 3KOYA 4Z08A 3QR3A 3GIYA 1R85A 4ZXOA 4BY3A 4LAZA 3S2LA 1ZS2A 2G3NA 1F07A 1F4HA 2TSYA 3LM3A 1GHSA 1F76A 2PDJA 1YPIA 3N2CA 3UXKA 4LYKA 4OVXA 4F0HA 4C6CA 3G5EA 4PUWA 1M7XA 3NQMA 4XBSA 2PWGA 4C6MA 3SCWA 3MUY1 1VHCA 1MMFA 4R53A 3QV7A 3V3WA 3G6LA 2DEPA 2G0WA 1DV7A 2WXDM 5D4YA 1CECA 4JX6A 3NZGA 3VOIA 1XDJA 2XIBA 3DFTA 2MANA 3OW1A 2V5BA 3CZJA 3GG8A 3KS6A 4FOKA 3O6AA 3DHDA 4YHGA 4DUVA 4Q7BA 2J62A 4CD8A 2YL6A 3MC5A 1A5LC 4KFNA 3DIPA 1VEMA 4IJBA 3RX2A 1ONXA 3E0LA 4KESA 1DHKA 1ZENA 2HTMA 1BYBA 3UR8A 1NDWA 2VD9A 1YKWA 4OFCA 4ZENA 5U7SA 2VZTA 2XIIA 3OYZA 3S1XA 1E4IA 1XS2A 3CIVA 1O5RA 1EA0A 2PA6A 1HQTA 5C54A 3AC0A 3WLSA 1GCYA 3UA3A 1EX1A 5E9XA 1Q4NX 3WUFA 3VXGA 4EVZA 1PCKA 2J6VA 2GYIA 3DC8A 5E5CA 1FWTA 3H22A 4C6BA 3VD3A 1C8XA 5F7UA 2VGGA 1YEYA 3P5YA 4EE9A 2Y61A 4WLCA 4LH8A 3H53A 3L9CA 3GHUA 4BF7A 4MY1A 2WLZA 3U9IA 2ZRWA 2PGWA 4C7GA 1PZ2A 3GZ3A 3W23A 3A5FA 5GJMA 3FNDA 4GUJA 4XD5A 4YU1A 3LM7A 3CC1A 1OFQA 4WSJA 2ON3A 4YCOA 1XLBA 3ITLA 4HSNA 1GVRA 3W7JA 4IFOA 3AUJA 4HMEA 1PXGA 1UWIA 1FY6A 1JZ5A 4JQ1A 1JCNA 4DJFD 4CNPA 1QATA 1HJXA 5I79A 4U4MA 3LN3A 2TYSA 3MUCA 4EWJA 5U4NA 2Z1XA 4MWAE 3T81A 4IMGA 3CUXA 3WNLA 3N29A 1T8XA 3T8QA 1TQJA 1IT8A 4E4FA 2OYMA 2C7FA 1NEYA 2CEQA 1J10A 1GKPA 1J2BA 2J75A 4Z42C 4YYCA 2PLMA 3FAXA 3CLWA 3P60A 3L67A 5IBXC 5DXXA 1ITUA 5FSEC 4F3HA 1XJBA 2GFTA 2QV5A 4PTXA 2VUYA 3N17A 4J3ZA 3W85A 4LW7A 1HN1A 3T08A 2JFEX 5EFDA 3LCFA 4CQAA 2D0HA 1EPVA 2D2OA 4I5XA 4N02A 1J9YA 1T99A 1E3ZA 2XH0A 3EX6A 1E9ZB 1UWQA 3DYMA 1XIHA 3TC6A