4GE8A

Oye1-w116i complexed with (s)-carvone
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 155
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ge8A00
3Q2DA 3N73A 1QDSA 1ZAHA 1LYXA 1C8VA 2CZDA 3NQEA 3MHFA 4IX2A 4GC4A 3S1VA 5F4SA 2AGKA 4JTJA 4FNQA 4UFIA 3W2MA 3F4WA 1GPWA 2J24A 3TQKA 2Q8LA 3PAJA 3PWAA 5DN1A 3W70A 2P10A 4EVZA 4WOZA 1NEYA 2C13A 3ZFHA 1D3HA 3E02A 5DCDA 1UUMA 3BLEA 2ZRXA 3HG3A 5HJLA 2YCEA 3M43A 2Y85A 2C1HA 4Q4KA 2YW3A 1VRDA 3MI2A 1H50A 5DELA 4CLMA 3IVTA 1A53A 3EWYA 3UWUA 4MFEA 1IGSA 1U83A 4HN4A 3VI2A 5GVJA 1YTEA 1MZHA 1GVFA 8TIMA 3W7JA 4JY8A 1JULA 4CQ8A 1VGAA 3ATYA 3QPZA 3FFSA 1YDVA 2A5HA 3DBPA 4GJ1A 5L6UA 2ZZ1A 4M7TA 4QIUA 3S5ZA 4KFNA 2V2DA 1YTDA 3HOJA 3PM6A 3T7VA 2ISSA 3PUOA 3FYOA 1QOQA 3VNDA 1KFEA 2W6RA 2QDHA 4UFKA 3NR0A 1MEIA 3UXDA 4Y6GA 3S8HA 3W1QA 3E49A 5AB3A 3O15A 4LU0A 4JTGA 1CX9A 5AOUA 3TK7A 2B7NA 4DEFA 5KTLA 1C9DA 4NX0A 4TO8A 1KFJA 4E2BA 1R2TA 1GT8A 5AC7A 3GXNA 1KV5A 5FF2A 3W88A 4XUGA 2YPIA 2GUUA 3LXCA 3WK1A 3LHUA 5T26A 3KHJA 1PCWA 2DJXA 4R33A 2NWRA 3DI1A 1W5QA 2VFDA 3IVSA 3NPUA 3W7LA 4GXMA 2YYUA 3L0GA 1ICPA 4UTTC 2FIQA 1PVNA 5BW6A 5F2MA 3O63A 1IIHA 4NQ1A 4MZYA 5LSMA 4N4PA 1W1ZA 3MP5A 4UTUA 1F6KA 1T8XA 2B7PA 3BK0A 3I65A 1OABA 1AG1O 1SO5A 1B4KA 4UR8A 3STEA 2GVGA 1C29A 1ME8A 2PRLA 2DORA 2V30A 2VEPA 4N9CA 2JK2A 2JKEA 3IVUA 3TMLA 3M7WA 3O05A 4A2RA 5LGZA 3MO7A 2RFGA 1SO6A 3FJ6A 1LOLA 5A5WA 1RQBA 5E1QA 3JRKA 3GDTA 1NSJA 4I7UA 1K8YA 3E96A 2QAPA 3B0PA 3BG5A 1I2OA 1SSDA 3R2GA 3P67A 3E0IA 3QMTA 4KWVA 4UTJA 5KINA 5J5DA 2D73A 1L6YA 1GYLA 3TW7A 3PC0A 2Y63A 4XZ9A 5D05A 1I2RA 1B9BA 1EWDA 3CEUA 1YLVA 1DKWA 3CPRA 4JGDA 2ZZ2A 3OG3A 2DJLA 1Q6RA 5D02A 2ZBTA 4UTTA 2ZQ0A 5E0KA 5SWUA 2A0NA 3WFAA 1HUVA 3W83A 4IGHA 1KW1A 1LOQA 1LROA 4JTTA 3BG9A 1JCMP 4N2YA 5CZTA 1VLWA 4UFJA 3UD6A 3KRZA 4E38A 3EWXA 3GDLA 4LNYA 1DQXA 3NL6A 2RDTA 2DP3A 3HG4A 4K36A 5G4EA 4PA8A 2AQWA 1TB3A 3I7SA 1QO2A 4MOZA 4O16A 4AB4A 1G7UA 4Z1AA 1SW7A 2DZWA 2QCDB 2VFGA 1TYGA 2RH9A 4FHAA 4GFSA 1I2PA 3LHYA 5G4WA 3VE7A 1FWSA 3TV8A 4RLIA 1GQNA 1RV8A 1FCVA 4AWUA 4M7SA 1I4NA 1WQ5A 4Z0SA 2GJNA 1OYAA 5F2GA 5DBTA 3PSVA 3QRHA 4IX0A 2CLOA 4UNKA 3G3DA 3TUUA 2XN0A 2G96A 4ZQPA 2X1TA 3M5ZA 2Y89A 2BXVA 4PTNA 1G4SA 1YADA 3C2RA 1SFJA 3QEZA 1MXSA 4Y96A 1LLZA 3W7IA 4J9JA 1KA9F 4N6FA 2QAFA 3MHGA 2X1SA 1GZGA 3EX3A 4AF0A 3F4NA 3S6DA 4MY1A 3OVPA 5HINA 1VH7A 3LX9A 1WDWA 3UZJA 3NL5A 2BZNA 1G4TA 3OEXA 3W7GA 1LZOA 2J88A 3G8EA 4KFOA 1LP6A 4JX6A 1SU5A 4RZ6A 4LV9A 4RV8A 2CZ5A 1OFAA 5TIMA 3PB2A 1FCBA 3MWAA 4HNUA 3EKLA 3BVJA 1B4EA 4LOCA 5IBXC 3B05A 4BK9A 2C18A 3CEPA 3W7QA 3EX6A 2C14A 4UTMA 5CZ0A 1TV5A 2QCHA 3Q58A 2Y7FA 2NXGA 1D9EA 3MP3A 1KFKA 2JKAA 4DELA 2NX3A 2Z1BA 4K8EA 1VCGA 1W5NA 3W74A 4MVAA 2HS8A 1PV8A 4FF7A 1RQHA 1VLIA 1KM3A 3GR7A 3W22A 1X1ZA 2ZA1A 3LI1A 3B0UX 1CI1A 3CT7A 3N2MA 1JQXA 1AL7A 1DJQA 2CLMA 4WXYA 5AC8A 1XI3A 4PODA 4X2RA 3U2OA 1TIMA 3AO0A 2FB3A 3OA3A 2G95A 1IXPA 3C2EA 4QSHA 1X8FA 3VFLA 3IRDA 4I7WA 3M9YA 2QUVA 4O4WA 4WQ6A 4A2SA 2PURA 1GVRA 2ZZ6A 3LM7A 3N9SA 3ZR4A 1J4EA 1FWTA 3EX2A 1VZWA 3N2XA 3P61A 3LDVA 1MEHA 3W23A 1LLWA 3NQ2A 1UUOA 1AW5A 3BW4A 3LGEA 4FNUA 1LTDA 4NNAA 4FX6M 4CNPA 2IQTA 2F7FA 2V8ZA 4OHQA 3L65A 5KZDA 5CSSA 3RLVA 3TAOA 5AFDA 1AW1A 3ZS4A 1KM5A 3HGSA 3W1MA 1ZENA 5D2WA 1W3IA 2ATMA 5EMUA 3UY8A 3QC3A 3BLFA 2HS6A 3GDRA 2YFOA 2PRMA 1SUXA 2QCFA 6TIMA 2E5CA 4BR1A 3LTYA 4ZL1A 1TRIA 3NM1A 2CLKA 1EP3A 1QAPA 3S1XA 1XDMA 3SJ3A 1FUYA 1QNVA 1IXOA 5CSRA 4GRSA 4WOQA 4IXHA 1R2RA 4RZ4A 2OCZA 1O60A 3PBVA 4QISA 4XTDA 3ABOA 3DKLA 3QFEA 5H91A 2RDWA 1JRCA 3LOTA 3IIZA 4O54A 2PRHA 4YXGA 1DOSA 3MP4A 3W1UA 1ONRA 1ZALA 2NLIA 2BSLA 4Z08A 4FNRA 3TFCA 3SZ8A 4I9AA 2DZVA 3W7OA 5L9FA 2VC6A 5FF3A 5EBUA 1MO0A 4NJHA 3DFOA 4DF0A 4LC8A 2EAWA 3LCGA 3IGUA 4JX5A 3HGRA 4C1LA 1NF7A 3BV4A 1H60A 3RFAA 1WV2A 3BLIA 3CU2A 2J9ZA 4UTIA 5CPOA 5F2LA 1ZNNA 1KFCA 4DQWA 2CLHA 3L5LA 3GDMA 4HNNA 5D2YA 2VFEA 2WPBA 3LRKA 5D38A 3NZ1A 3HIJA 4O50A 2VEIA 3E9AA 2B7QA 1XKYA 1SR9A 4ZQRA 5TQLA 3N19B 1OX6A 4YCPA 3GR8A 1THFD 1EWEA 4OE7A 3G0SA 2J9YA 1L6SA 2NV1A 3WK0A 4WD0A 2Y88A 2VFIA 1KBJA 3UQNA 3HBLA 4CCCA 4O28A 1K3UA 3HPSA 3M5VA 1TPUA 4O1DA 1KM2A 4ORIA 4BWLC 2J27A 1XM3A 1F5ZA 3NQGA 1W5MA 1TPEA 1G67A 1UB3A 1SQ7A 3TR2A 1I8JA 4LRSA 2Z2UA 5D03A 3H53A 3L5MA 3TE9A 2GQ9A 2EKCA 3P7YA 4QAIA 1L9WA 4Q32A 3LRMA 4WX2A 1NF0A 3SGUA 1OX5A 1OF6A 2GVLA 1O5KA 4UXDA 1TCDA 4DPQA 1V5XA 3BPWA 4DBDA 4R34A 3GXPA 3A5VA 4FXSA 5HNRA 3C2VA 4G1KA 3EXTA 2A21A 4X3ZA 4IUOA 1KV8A 4M6PA 3NVTA 4UMAA 3HG5A 3M0ZA 2NX9A 5EA9A 4HSNA 1TSIA 4JTUA 3TAKA 4UTWA 3NG3A 1AW2A 2VFFA 1EA0A 2E09A 1I2QA 4MZ8A 4M5PA 5CZJA 1K8ZA 3TXVA 4DO5A 4RXGA 1GVSA 4UFHA 5LHEA 5F4XA 4N9DA 3A5FA 4JNMA 1TPDA 4X9SA 1F6PA 1G4EA 5FEZA 1XDLA 3PBYA 4JYDA 1GOXA 1ICSA 4JY9A 1WXJA 3GKAA 3UXAA 3STGA 1LRTA 3MBFA 4TIMA 2E68A 1RD5A 4Z0JA 1OYBA 3RU6A 5I3FA 3C3NA 3SGZA 5K4ZA 5LNVA 3EWZA 1SFLA 1TTIA 2V81A 1XC4A 3T55A 3IIXA 3DFSA 4LTSA 5C55A 3DFTA 5AHEA 3EKZA 2WSYA 1JCNA 1P0NA 1VYSX 1BWLA 4O18A 1LBMA 1SZGA 2RHGA 2V0TA 4PEKA 1PIIA 1OFBA 5AHLA 3U6WA 4EF9A 4AF0B 3S5NA 1I2NA 1YYAA 3G8RA 3P5ZA 3SFKA 4AHOA 3KX6A 3PB0A 1YPIA 3TC7A 2DZXA 1KM1A 3PVFA 4O14A 2QCGA 3WJWA 4ZZ9A 3EB2A 2CWNA 4Y90A 1DHPA 4IJBA 1E51A 3L0KA 3VCRA 2E6DA 3KAOA 4MJZA 3QQ0A 4S2CA 1XL9A 4PL1A 3NO5A 3NAVA 4K38A 1QR7A 1VYPX 1A5AA 2Z6JA 3DU0A 3GDKA 1QO5A 4P61A 5EKYA 4UR7A 4RR4A 3FA5A 3W7CA 4JDBA 3T4CA 5DCBA 4UMCA 4O10A 1G7VA 3CB8A 2ZRVA 3LHWA 4N9BA 3JR2A 2NUXA 2Y7EA 3VKJA 1OVDA 3DFPA 4NX5A 3NXFA 2VENA 2PE4A 3TQ0A 3PG9A 1W31A 4WZHA 5AHMA 4O8RA 1S5VA 1H7XA 2VKZG 2CLFA 2WJZA 3O6CA 4JXCA 5AN7A 1GYNA 4EOUA 4TU1A 1A5SA 3Q37A 2YR1A 4NJJA 5HUOA 4IMCA 5KITA 5G1YA 2H90A 2VEKA 2TYSA 4CNNA 3P82A 1EPXA 4JDYA 4YWIA 3LB0A 1DBTA 4L4LA 5DXYA 5I3HA 5HWMA 4O1BA 4FX7A 4OQVA 3HPXA 1LM1A 5FEXA 3HMJG 3C0JA 4JTEA 1T96A 1KBIA 1EUNA 5KZEA 4DBEA 2Y61A 2NZLA 4ZQOA 2X30A 4GUHA 4PH6A 3V1PA 3E12A 4IQLA 1VHNA 3NQMA 1UJPA 4GBUA 3W71A 4AWTA 3PUEA 4U4MA 3P80A 3TW6A 3W7NA 3LHTA 4NT0A 1TPC1 4AWSA 1TPFA 3GVGA 1ZFJA 1ME9A 2ZZ4A 5A8GA 1TPWA 3M16A 4DO6A 3IIOA 4OV9A 3MW7A 4P2VA 4NZFA 4UFLA 3OIXA 3UWQA 5AYXA 1TJRA 1L6WA 1H7PA 2WOQA 1R2SA 3O6DA 3GZ3A 3PS7A 4RX0A 3O1NA 2ZYFA 1WOBA 5C54A 3ANYA 3WJZA 3TROA 4O1AA 5BRBA 1G4PA 1FDYA 4AMAA 2VEMA 1Q6QA 3W1RA 4HIBA 3SY5A 3W6YA 1GVOA 4PCFA 1JRBA 3HB9A 5MHBA 2WQPA 1YPFA 2O7SA 3NL3A 4XBSA 3LLFA 3M41A 3T40A 1QWGA 3QF0A 1W3NA 2EPHA 3G0UA 3WJXA 5BMXA 2E6YA 4OU1A 3QM3A 2OX1A 2Z6IA 5FI8A 1JCYA 4NNCA 3S0CA 4RKAA 1FWWA 1GVQA 4MZ1A 4ZMGA 4GUFA 1QOPA 1W5OA 1Y0EA 1NAL1 4IOTA 3KVKA 1RZMA 1OJXA 5DLCA 3G1FA 4GUJA 1OX4A 2WNNA 4LS1A 4AH7A 1ZCOA 2VELA 4AXKA 3P5YA 1IXQA 1TTPA 4OGZA 3TQVA 4OBTA 1Q45A 3CIXA 3LI0A 5K4XA 2BX7A 3I7QA 1TREA 1BTMA 3OBKA 5J5RA 3P60A 3S42A 3HJZA 1H1ZA 2FPYA 2I1OA 3N14A 5LKYA 3N3MA 3W84A 2AAMA 5F2IA 2NUYA 2H6RA 1Z41A 1Z42A 1VQTA 3LCFA 1EIXA 1RR2A 3D0CA 1NVMA 3M5XA 5FEPA 5LZLA 4IMGA 4ADUA 3W7EA 3DAQA 2TSYA 3C4UA 3RMJA 2E6AA 2F84A 3LCHA 1B3OA 4DPPA 1K7XA 2A85A 3TXZA 2H3DA 2HMCA 3O07A 3QMSA 5K9XA 5KZMA 2QF7A 2X16A 3W87A 1ME7A 3ATZA 1G6CA 2W79A 4CQ9A 1GG1A 2RKXA 2CZEA 1WAUA 4O4VA 3A9IA 2CLIA 4KKXA 1HG3A 2Y6ZA 3NQDA 1OFRA 2YXGA 2PCQA 2DZPA 1ICQA 4MYXA 3M1ZA 1VCVA 4D2JA 1HL2A 2ISWA 1OFDA 2YYTA 3G22A 1NFBA 4UTLA 4JD4A 2R91A 7TIMA 3GAYA 1SZFA 2WV8A 1HTIA 4WUIA 3GNNA 3W73A 3ELFA 2W0UA 3GK0A 3O16A 3UZ5A 1A50A 4MIMA 5D09A 2ABAA 3LBCA 1R46A 1WX0A 2WSQA 2TMDA 3WJYA 3C52A 4HPJA 1H7RA 1DQWA 2BTMA 4IWWA 3JS3A 4ML9A 1W54A 1M7PA 2NXIA 3W2UA 4A21A 3HQ1A 1K7FA 3I68A 3MMTA 3B04A 1DV7A 5D04C 3EEGA 3P8IA 4XWUA 4S2BA 3M47A 1QPNA 2ZZ7A 3DZ1A 1VJIA 1H63A 2ZFAA 3O8AA 3QJAA 3W7HA 2R14A 4LRTA 3G0XA 3QZEA 2QR6A 4N02A 4NJIA 3BARA 3R89A 1OK4A 4A29A 5IBXA 3GX9A 1H5YA 3FLUA 5CPNA 1KM4A 3LCXA 3PBWA 3UWYA 1ZAIA 3EWBX 4FIRA 4X22A 2PC4A 3LERA 1R47A 3G3MA 1H1YA 3O6YX 3FIGA 4MY8A 5HMSA 4E0CA 1DORA 1OK6A 3RK8A 3P74A 4K7YA 2JKPA 4GNJA 5BMWA 1X6UA 2NUWA 3W3OA 4O13A 1N7KA 4ONVA 2QEZA 2FDSA 2ZRZA 3QW3A 4LWWA 4YL2A 5K7JA 4FEZA 5D32A 1W56A 4N6EA 4UIOA 1Q6LA 3TA6A 1ADOA 2P1FA 3NNTA 4A3UA 1FWNA 1Z48A 4HSOA 1TO3A 3TIMA 2C3ZA 1O4UA 4ZVJA 4DF2A 3EWUA 5D30A 1S5WA 5I3KA 3ZWSA 3LTSA 1DL3A 3NQCA 1IIGA 2QKFA 5LNSA 3G1VA 5H2ZA 1FQ0A 4JTSA 4FNTA 3GNDA 4O11A 4CCDA 4Z1CA 5HR6A 1LBFA 3LXBA 5FF4A 2Y7GA 5F1VA 5CPLA 1XBYA 4Z1DA 1Q6OA 1LBLA 4BI7A 2V5LA 3V75A 3HGJA 3W2NA 1LORA 2XN2A 2V9DA 1K02A 3UYCA 1M6JA 4L4MA 3LV6A 3C6CA 4LVGA 5DCEA 4YLWA 4M19A 3HG2A 3LHVA 4WY0A 2QCCA 3EXRA 4ADTA 4AAJA 1YXDA 4LVDA 2ZRWA 3I6RA 5D33A 1VHCA 1XUZA 4QNEA 3KVLA 5CZSA 1JCJA 4ADSA 3DENA 1KFBA 3L0NA 1DJNA 2FLIA 1ZY9A 1JR1A 2XFWA 3DI0A 4XTIA 2C0AA 1KTBA 2V5BA 1TMHA 3M44A 3UPWA 3NA8A 5CKSA 1WOAA 1FBAA 3YPIA 1U5JA 2FTPA 3LV5A 3G1XA 3QSRA 3QYQA 2GJLA 1TPVA 3W7MA 3W1NA 5F4WA 5AC6A 1XBVA 3W07A 1H61A 4UNLA 1TTJA 2FPTA 1V7YA 2BLEA 2FJKA 3PY2A 4IMEA 1PHWA 3TX9A 4IXXA 3LTPA 1VCFA 1P5BA 3W1LA 4HNVA 1SZNA 1HO1A 1A5BA 3NEVA 4RZ5A 2C15A 2FFCA 2ZZ5A 4TR9A 4B5NA 4LVFA 4LW7A 4XKYA 5AYYA 1RVGA 4BWLA 1H62A 4JTHA 5D2VA 2V82A 1I45A 1ZHAA 3FEMA 1OX4B 3I7RA 1TPH1 4JYEA 3DFNA 3BW2A 1TQXA 3TJLA 5DY3A 5AYZA 3QQ1A 4MJMA 4MKNA 3FYPA 4LV4A 2A4AA 2DU2A 4JX4A 4O19A 4JS3A 3KVMA 3B03A 3AJXA 1JUKA 3NGJA 3R5EA 1LRNA 4Y8FA 1SW0A 3FS2A 2WSRA 2ISVA 2DZSA 3QW4B 2EHHA 3CLMA 1TPB1 3L2IA 4H4IA 1FWRA 3PG8A 1WA3A 1TQJA 4FX8A 3THQA 1ALDA 3NDOA 3HGOA 3NL2A 1W3TA 4MFDA 1Z44A 3C2OA 2JGQA 4LS2A 4NXSA 4EWND 3G1DA 4PFMA 1HFBA 4GUGA 3GIYA 1VPXA 3USBA 2CLLA 4O0KA 1T99A 3NQ8A 3C2FA 3FKKA 2YW4A 3GYEA 2CW6A 1OYCA 1VS1A 2FB2A 2EF9A 2O7QA 1SW3A 3G1YA 3LHZA 5G5IA 1IF2A 3IIPA 4O1CA 4JICA 3A21A 4Z1BA 2I14A 2OZ0A 4BF9A 3DKJA 1JCXA 5AHNA 3TDFA 3W2LA 3S1UA 1WYIA 4ZQMA 5EYWA 2LLEA 4ZQCA 2HSAA 1R30A 1XBXA 3R8RA 2OMAA 4OT7A 3G18A 4UTHA 1G69A 3CM4A 3NQFA 4K7VA 3DH7A 4JTIA 1SSGA 4WY0F 1HO4A 4ICNA 2J9XA 2NXHA 2QCMA 3S9YA 3IGSA 2ZZ3A 2DZUA 1MEWA 5K2ZA 2QUTA 4CCEA 1PS9A 1SZEA 3UPBA 4YMZA 3EX1A 5C5YA 4M6VA 3TH6A 3LXAA 3GB6A 3NPXA 4FO4A 1J2WA 1W5PA 3PBUA 1J5TA 3W86A 5DBUA 2YDAA 5EPDA 3G1AA 2ZDRA 1K03A 3W7DA 3MYOA 3KVJA 3W1AA 5K3VA 3CHVA 5HQEA 4R7JA 3KRSA 4YCOA 3IEBA 3VE9A 1P1XA 3NQ7A 5D2TA 2A6LA 2EGZA 2VXNA 5CPMA 4QM1A 4UUIA 3TFXA 3O06A 4N4QA 1AL8A 1H7WA 3A23A 3IGXA 2FPVA 3KOFA 1XFBA 4H3DA 2J6XA 3M5YA 1H51A 4MY9A 3W1TA 3L5AA 2WNQA 3QPYA 3W2KA 2OT0A 1UBSA 1QFEA 2QJGA 2QJIA 3LLDA 3WK2A 1F76A 3L9CA 2ZTKA 4C1KA 2ATSA 5LHFA 2C19A 3QMRA 2QJHA 1PHQA 3W7PA 3HF3A 1VYRA 3TU9A 1L2UA 5I3JA 4O52A 3W1XA 5LNRA 1QPQA 6ALDA 3W2JA 1H7NA 2G97A 4W9TA 4UCGA 4UC5A 4AVFA 3L21A 2CZFA 3QH2A 3KFTA 4O53A 3PULA 2ZA2A 2JBMA 1CW2A 1FXPA 5EY5A 3L66A 2E5BA 4JIQA 3CTLA 3TKFA 4HPXA 3ABSA 1OHLA 5LGXA 3FJLA 1YDNA 4FNSA 4H6KA 4OWGA 1DVJA 4MUZA 3FOKA 4POCA 3SR7A 3RLUA 3S5OA 2CFFA 2Y7DA 3W76A 1PCKA 2KZHA 2R94A 5CGQA 3A22A 1EX5A 5KSWA 2ZA3A 2NV2A 2QCEA 1IXNA 4K39A 4BFAA 1TV8A 1GEQA 2A1YA 4GE8A 3NOEA 4FIQA 3SW6A 1TJPA 1FCQA 1WBHA 4MYAA 1F73A 2QDGA 3R12A 4QJ1A 2A2IA 2JGYA 3ABRA 1YXYA 2I9EA 3K30A 3EX4A 3M6YA 2WNZA 4ALDA 2Y62A 1T0OA 1VR6A 2WKJA 3UNDA 2Q3RA 5AHIA 1H7OA 1XBZA 3P84A 3GLCA 5BNKA 3GKFA 4NUWA 5U7SA 1SPQA 2ZTJA 4EF8A 5DXXA 4WY0B 2E77A 2ABBA 2NWSA 4LVAA 1KTCA 4JTLA 1FY6A 2GOUA 3W85A 1SO4A 2QCLA 2QUUA 4HNTA 2YX0A 3H55A 1D3GA 1W0MA 2E5DA 5LNUA 1JQVA 4UTKA 1GWJA 2YSWA 3P8JA 1LRQA 3W1PA 3T44A 4K37A 3SIZA 2E6FA 3NPWA 4QITA 1GTHA 4QQ3A 3N34A 5F1UA 4AEOA 3NQ6A 5G2WA 1X7FA 2ZRYA 3MI3A 3Q94A 2Q3OA 3G1HA 3TSDA 1PL9A 2VFHA 5FF0A 4R53A 4BI5A 4LY8A 4NZJA 4E2DA 3S1WA 4HT3A 3N9RA 4LUIA 1WBJA 1F7BA 3S5YA 5KMYA 2XN1A 5G2IA 1JUEA 4JTKA 3RF9A 3BG3A 4MLJA 4K8HA 4FXRA 3QSTA 5FEWA 4NXKA 1S3HA 4LUJA 4O57A 3OHIA 3PF3A 2A7PA 4IPJA 4UMBA 3B8DA 3HPZA 4JIPA 1P4CA 4TMCA 3MUXA 2A7NA 5G1TA 3OVQA 4XKYB 3F03K 1LDCA 1A5CA 2C6QA 3LCWA 3RNDA 3DFQA 3GXTA 1F2JA 5ABTA 4OV4A 2GVJA 4MPQA 1QPRA 3R13A 3KXQA 4I7VA 1TRDA 4PL2A 1GJPA 2GQ8A 2H8ZA 5E93A 3LRLA 4LVBA 1W8SA 3LCIA 1FDJA 1N55A 2Z0IA 4KFPA 3W72A 1ZAJA 3SSJA 3C56A 5CG7A 4IMDA 1FX6A 1JVNA 3CIWA 3NQAA 1BEUA 3IV3A 4NJKA 4K6AA 1QPOA 3B4UA 2V2CA 4DXVA 1RPXA 4AHQA 3PUDA 1AMKA 5HULA 1XXXA 3TNOA 2GPTA 3CWOX 4RXFA 1QCWA 2RDUA 2E1DA 3UWZA 3INPA 3SECA 3LBMA 3IIVA 1LCOA 1M5WA 3KRUA 3OVRA 1KTNA 4S1FA 3P62A 1OF8A 2FQIA 4A22A 4LS0A 1S5TA 2ZRUA 4XBKA 1F74A 4RK8A 4CQAA 4ORMA 4XQ6A 3NYZA 3EWWA 3BGGA 2B4GA 4M6QA 1TV7A 1YTKA 3MJYA 5EL1A 3NM3A 4WJEA 1SO3A 3C61A 1OFEA 2DZTA 3TJXA 3DHDA 5FF7A 2HTMA 3UY7A 4BI6A 1ZJIA 4MLRA 2H8XA 3DHFA 5U4NA 3ZWTA 3TSMA 3F1QA 1Q3NA 1UCWA 5BOOA 2R8WA 4Q33A 3BO9A 4JYFA 3TMQA 2Q8ZA 2B0MA 2QCNA 4PC8A 4O12A 4LC6A 4UFMA 4RCXA 3A24A 4FB7A 2ZCGA 3MYPA 1YDOA 2TRSA 4IMFA 2A6NA 4DF1A 3CWNA 1FXQA 4TMBA 3G24A 2OJPA 4JTFA 5C2XA 4HKPA 1M7OA 2X1UA 1F05A 2GQAA 2A7RA 1K8XA 1ML1A 5HUPA 2C16A 4GWEA 2VOMA 1N8FA 4Y9AA 4GUIA 1OG0A 4QNWA 3WJSA 1O5XA 5I3IA 3TCEA 4RJEA 3HO8A 3H54A 5HWJA 5HWNA 1OFQA 3PR2A 1FDZA 4O15A 3DXIA 3ABQA 3EXSA 3PSWA 4NU7A 4AHPA 3G1SA 1MSSA 4DO4A 4HHPA 3BW3A 3W75A 4NVTA 3W7RA 2QCDA 1P0KA 1W37A 1EUAA 1O95A 3STCA 1KM0A 4LT9A 1B57A 5IM51 2G5WA 2Y70A 3L68A 1BKSA 5K9CA 4UTWC 2H3BA 3W9ZA 5C6MA 4O0ZA 1FCUA 2X1RA 4O17A 2YGYA 3THAA 3B06A 4N9EA 4EIVA 3C8FA 1K7EA 4JR5A 3TSBA 4FNPA 2X2GA 3NPVA 1OFOA 1TTQA 1JCLA 2CLEA 1OFPA 3UWVA 4IPIA 1RQEA 1PE1A 4U28A 1GTEA 2BWGA 2UV8G 4JN6A 4NNBA 1X1OA 4ZQNA 5LNWA 3NZRA 1YXCA 1VC4A 5AHFA 3W7KA 2YZRA 1EEPA 4KWWA 1O94A 5HR7A 3WK3A 3B0VC 2ALDA 4JEQA 1QMLA 1EB3A 1XCFA 3CC1A 5G2HA 1KFLA 3BGJA 3L67A 3STFA 3SI9A 2WO5A 3GAKA 5D2XA 1AK5A 5FESA 3LCLA 2YFNA 5DY2A 1JJKA 5I3GA 4WXZA 5D37A 1GG0A 3CQ0A 1LOSA 1XUUA 1UASA 1KLYA 1KLZA 1EP1A 2V2HA 3MBDA 3MI6A 1KM6A 3DGRA 3FKRA 5TBOA 3T78A 2NX1A 1EP2A 4NJGA 3MHUA 2CU0A 3NQVA 3U8GA 1JUBA 5K9DA 2P0OA 4CNOA 2B7OA 2OT1A 1BWKA 4TX9A 3P81A 3UWWA 2TPSA 3TC6A
chains in the Genus database with same CATH superfamily
3Q2DA 1QDSA 1ZAHA 2O9OA 1NWRA 4IX2A 4AVNA 1CWYA 2DFAA 3TN6A 1Z6KA 4FNQA 4IH3A 4UFIA 5LIWX 1RJPA 5A8MA 3WQDA 4OTKA 5G1MA 3TQKA 3ARWA 3KCJA 1JEZA 4B3ZA 1L8PA 4C65A 3PWAA 4F79A 5DN1A 3KBJA 4EVZA 1D3HA 3ARXA 2YCEA 3CB3A 4IJCA 2C1HA 4DJDA 4UQ9A 1G9HA 3MI2A 3PNZA 2ICSA 3EWYA 3UWUA 4U2ZA 5GVJA 1DIEA 1UR4A 1Y8BA 1AH4A 8TIMA 3W7JA 2IXUA 3GY1A 2BV9A 3GXFA 1KKOA 3PM6A 3K2GA 1R7OA 2OSXA 3T7VA 4ES4A 2OZTA 2IMRA 2HCVA 3FA3A 3HMCA 3DBNA 4GO8A 1KFEA 1CB2A 4UFKA 5HMFA 3KBMA 4K68A 2CXGA 2YXXA 1AA1B 3TCSA 1ONXA 3QY7A 3COTA 3V5FA 5AB3A 1D3CA 2J13A 1U22A 1UPPA 4JIRA 4DWSB 3ID7A 2ZUVA 3N04A 1OM0A 4Y9OA 5KTLA 2CBIA 2P76A 5KEZA 1GT8A 3ZIZA 1EFZA 1Z7AA 2BY1A 3QV6A 3W88A 1LT8A 2IPWA 2YPIA 1UKOA 3V0TA 3CMFA 3KHJA 3N25A 4L56A 2DJXA 1V3KA 2ZUUA 1CBGA 1GKPA 1ICPA 4HVXA 5BW6A 1IIHA 4NQ1A 4CEUC 2X09A 4MZYA 5C7HA 2J8GA 3A4XA 4GI9A 3D6NA 5ABGA 1V3IA 1R3SA 4UR8A 3C86A 2J7CA 1ME8A 3RX3A 1TJ2A 3OA5A 4WSJA 3M7WA 2F6KA 1SO6A 4PFHA 3BURA 3JRKA 3S2CA 3LGDA 1NSJA 4I7UA 4ZFCA 2ZX7A 3E96A 1HGYA 1UWUA 3JW7A 1UP2A 3R2GA 1K9EA 1MUMA 4DJFA 1B3ZA 1F07A 1AVAA 3BAYA 1Q85A 2Y63A 1I2RA 1EWDA 2JQXA 2E7FA 3P6LA 1EDGA 1VENA 2ZZ2A 2E9BA 4IIGA 5B7YA 3H2OA 1Q6RA 4HTBA 2I5QA 5SWUA 4WJXA 2A0NA 2HBXA 3W83A 2IPJA 3GU9A 1LROA 1EGVA 3BG9A 4G9PA 2WC7A 1F3EA 3O7UA 4LNYA 4DXXA 4K36A 4PA8A 1GOWA 2P88A 4MOZA 1G7UA 2OQLA 4RV3A 3MZNA 4YTUA 2Z1XA 4FHAA 4GFSA 4GXWA 3TV8A 5AYIA 2XZ9A 4NY2A 4UBPC 4HNLA 5E70A 1D7FA 4Z0SA 1AQFA 3G3DA 5AVNA 1WKEA 2XN0A 5IDZA 2Y89A 2YA1A 3IACA 1SFJA 2DSVA 5LA1A 1XR2A 1LLZA 1NQ6A 4ERAA 5BROA 4N6FA 2H9AA 2QAFA 4LCQA 1VF8A 5A2AA 2YCLB 1VH7A 1WDWA 1DJZA 3OEXA 2EG8A 1LZOA 5G4HC 3G8EA 5FJTA 1UOZA 2YZ5A 5FACA 3QC0A 3R8GA 2E4TA 1OFAA 5TIMA 5MKGB 3PB2A 3EKLA 3BVJA 4PMZA 4D6IA 3REQA 2BHZA 4BK9A 4Q8NA 1KGXA 2NXGA 2UY5A 3A9BA 1D9EA 3MP3A 4DELA 1ODZA 2NX3A 1KBKA 2DH2A 4K8EA 4MVAA 4HA3A 1TMLA 3LG3A 4D6DA 3W01A 1DWIM 1RQHA 3GR7A 4GA8A 2HK0A 3B0UX 5AYBA 4WRHA 7A3HA 4A3RA 4I9JA 1F61A 1JQXA 1QVBA 3PUGA 3E0VA 3ZYZA 4X61A 5AC8A 3IJDA 4PODA 3U2OA 3AO0A 2FB3A 3VIOA 2G50A 3VFLA 3WLTA 3IRDA 3SCTA 5HNUA 4J3WA 1W9DM 1JDDA 4WQ6A 1Q5MA 4WKHA 2QULA 3N9SA 3ZR4A 1FWTA 1MEHA 3P0XA 3W23A 5C8BB 3PBMA 1YX1A 4AD3A 4CNPA 3BZGA 3S2MA 4LYKA 5KZDA 5CSSA 2VGFA 1AW1A 3VD4A 3HGSA 5PTDA 2X05A 4UWMA 3QC3A 5A8PA 1JYVA 1HL9A 4W87A 4B9YA 2PU0A 3SY8A 2QCFA 6TIMA 4E4UA 2WMKA 2E5CA 4ZL1A 4MSSA 4ZOAA 1AJ0A 1IXOA 5CSRA 5HPCA 4RZ4A 1GW1A 1EGMA 3CAWA 2RDWA 3IIZA 1Z9AA 4BCEA 1DOSA 2PWFA 3W1UA 4ZO7A 2F9RA 2PB1A 3W6LA 2DGAA 3T0TA 2JEPA 5C2GA 1M53A 2V5KA 4KBXA 3RDKA 2EAWA 2E1WA 4C1LA 1JL8A 1H60A 2PCEA 1WV2A 3FJNA 4V1YA 3PP7A 5CPOA 5F2LA 1KFCA 3QKZA 1P6CA 4H7VA 1VJSA 4HNNA 4PBFA 4PTWA 3DN5A 2QYGA 4H6QA 3HIJA 4JOMA 1DQUA 1PKNA 2B7QA 4C1NA 3AWNA 4AZCA 1OX6A 4YCPA 1EWEA 2PDYA 1ISVA 3B4YA 2J9YA 3G0SA 1L6SA 1M9HA 1NDWA 3PJXA 2FGZA 4AUBA 2DH3A 3HBLA 4PTMA 1IEIA 3L4UA 2QPXA 1I6NA 4BWLC 1S38A 3WQWA 4HU0A 4ZODA 5IOBA 3N6HA 1UB3A 3WF1A 1SQ7A 5D03A 3H53A 5CGTA 3SM0A 2FGLA 4KGLA 3FAXA 2J74A 3GBEA 3VD9A 5HAOA 1NF0A 4D1IA 2P50A 4ILSA 3IUIA 3C2VA 5E9XA 2OG9A 3QZAA 3EXTA 2A21A 4IUOA 3AZRA 4M6PA 3NVTA 1AH0A 4L1WA 3SCOA 4CN1A 3HG5A 3GH4A 1UR3M 1UZ4A 1M65A 4AD1A 1C7SA 3AXIA 2NX9A 4RE3A 1TSIA 1XRVA 1B5TA 3NG3A 2GJPA 2XVKA 3F7JA 1UR9A 1S2TA 1WDPA 1MWOA 1V6VA 2E09A 1VFSA 4KEZA 4M5PA 2E0PA 1X7IA 1K8ZA 3TXVA 4RXGA 4GCAA 5J04A 4U31A 1RSCA 1JGMA 4JNMA 3GZAA 4FAMA 1TPDA 2I17A 3M0KA 3T8QA 1F6PA 3VKBA 5FEZA 2WC3A 3VKAA 1GOXA 4MNMA 1RLCL 4PUUA 3GTNA 2YL9A 1Q7MA 1LRTA 2XM1A 1V77A 4LH8A 4AY1A 4KEMA 1TZ7A 1RD5A 1TZ9A 1ZBWA 3CZEA 3C3NA 3TW9A 3AXXA 3EWZA 4HN8A 1TTIA 4AW7A 2DQWA 3KTXA 1P7TA 3GBDA 3DFTA 4MKSA 4TX8A 2UY2A 1R3WA 1YEYA 1PYFA 2RHGA 1PIIA 1GQKA 4LQ1A 5IFPA 4AF0B 3S5NA 1YYAA 1UWIA 2J25A 4QAWA 4W88A 5REQB 3GFZA 1KM1A 2CWNA 3FSTA 1E51A 1PAMA 3L0KA 1GZJA 1QOXA 2F6XA 3RMEA 3QQ0A 1JF6A 1XL9A 2G3MA 5HDRA 1J11A 1A5AA 4H9YA 3BLPX 4H9UA 3DU0A 3GDKA 1QO5A 2D23A 2PWHA 3VKCA 3H21A 3W7CA 3KS5A 5DCBA 1G7VA 3VK5A 1KD0A 3AC0A 3VKJA 1OVDA 3WH6A 2YL6A 1XGEA 4UTFA 5DQPA 3LYEA 3HPAA 2I16A 4W93A 4NX5A 1ITXA 1UUQA 1B3VA 2PE4A 3TQ0A 1PX3A 5I06A 3WSUA 5AHMA 4H01A 5GNXA 1Q6DA 2ADAA 4JXCA 5AN7A 4TU1A 1A5SA 5DX7A 3W4RA 2WXDM 2PBGA 4WF7A 2H90A 4P7OA 4TV6A 4CNNA 3P82A 3PANA 2QZRA 2ZX6A 1GQLA 4B5TA 4J2PA 4FX7A 3HPXA 2WLZA 3TWAA 1K9FA 3C0JA 4CQBA 1PO9A 1T96A 5TD4A 3IJLA 1XLFA 4RUBA 1XYBA 1P48A 1UC4A 5CLWA 4ZQOA 1EZ2A 1E0WA 2EXOA 3LPFA 5CBBA 4PH6A 3GVRA 3T05A 1C90A 1MDRA 3W71A 4AWTA 1W91A 1A5NC 3P80A 3AIQA 5DRIA 1E4NA 2PP0A 2ZXDA 4AWSA 4G2DA 2UWFA 2I5GA 4PBEA 5FJUA 3VIHA 1XSJA 1EH9A 2GDUA 3IIOA 3NCOA 4Q4QA 4P2VA 3OIXA 1VBJA 3UWQA 4CU8A 2CITA 2G3IA 4HGXA 3GS6A 1X39A 2OZ8A 3VIJA 1A5KC 5C54A 2REQA 4OJYA 4O1AA 5XINA 4BQ3A 5H1WA 1V4YA 4FOKA 3GC2A 1Q6QA 1EIBA 2O55A 1NQKA 4HOXA 1V51A 4FP1A 3L7RA 4JTAA 4IPPA 3NL3A 2QJJA 3WMBA 1EYWA 3T40A 1QWGA 3WQOA 4B9ZA 1WDRA 1RK6A 4W84A 1W3NA 1XLGA 4G6CA 2QLYA 3R58A 3I3BA 3VDGA 4QCEA 5BMXA 2A79A 3QM3A 2OX1A 4AD4A 3QTPA 2PFHA 1DTUA 4US6A 3LPPA 4ZMGA 1R3TA 1QOPA 3GVQA 4KERA 3KVKA 4KIRA 3BSGA 1JD7A 4WR3A 1OX4A 2VUNA 2WNNA 3KTCA 4PCSA 2VELA 1WDDA 2V3EA 1IXQA 1QU4A 1TTPA 3NDYA 3TQVA 2FHFA 4MWAC 2EPLX 1GOIA 3T2QA 4PE8A 3LI0A 2BX7A 1CXIA 7REQB 3SCUA 1KXTA 2NUYA 1TVPA 4FLSA 3U57A 4E4FA 5LZLA 5CPQA 3QHOA 1YE4A 3W7EA 2WBGA 2WQDA 1E9ZB 4DPPA 2J62A 3VDAA 1XP3A 2HMCA 2PDKA 3L2LA 1ZUAX 1QT1A 1T40A 3F2CA 3APYA 5BXPA 3QMSA 4YTTA 2QF7A 1SZRA 4PB4A 1ME7A 3B9OA 1AD4A 4EAMA 1G6CA 3D47A 4GI8A 2CNCA 5HMEA 4ZXLA 3BLKA 3FK4A 1UMYA 1GG1A 4O4VA 3A9IA 4KCTA 4NZ3A 3EPMA 2Y6ZA 3WD0A 2XYLA 1P0BA 2WM0A 4LUTB 3EOSA 4MYXA 2D0HA 2FZNA 1W3JA 4ICMA 4PUDA 1XPYA 1HTIA 4OBSA 3GK0A 3GFXA 4ACZA 3SY1A 1V0MA 4S3KA 4A4AA 2WSQA 3WJYA 1DQWA 4IWWA 1LG1A 2VHLA 3URBA 3W2UA 1VEOA 3SCSA 3B04A 1SFSA 1I60A 3QR0A 2ZZ7A 4NRSA 3VNKA 1NIUA 1KB3A 1QBBA 4F40A 3QZEA 5CJ5A 1E6PA 4N02A 4NJIA 3VUSA 4G1NA 1KFWA 4A29A 5IBXA 2P8CA 1H5YA 4H00A 3HURA 3PZ9A 3LCXA 5I2UA 3KL0A 4FIRA 3WX7A 3VNMA 2PC4A 1EXBA 4LBSA 3MSRA 1R47A 5HOSA 2X0SA 3B9DA 4K7YA 3EA1A 2JKPA 4D8ZA 3AHVA 2NUWA 4C6CA 1EJWC 2G37A 4GOAA 5D32A 1ITUA 3CIVA 3LD5A 1EJSC 2J7DA 3TA6A 1IEQA 4HSOA 1KCLA 4HYRA 4W5UA 1V6YA 3ICJA 2VR2A 1I0DA 4J2MA 4ROQA 1IIGA 4MF4A 1FQ0A 5E6ZA 4D6EA 4FNTA 3GNDA 3BCJA 4O11A 2IPFA 1AJ2A 3LXBA 5EGRA 4H41A 4CD4A 4BY3A 3WD1A 4Z1DA 1Q6OA 4BI7A 3HFYA 1BHGA 2PTDA 2R1PA 4C6MA 2Z7KA 2XN2A 4F0SA 2V9DA 1K02A 1POKA 3UYCA 1M6JA 4L4MA 1F8MA 3LV6A 3QV9A 3C6CA 2Z00A 4LVGA 5DCEA 4U3AA 4M19A 1E1CA 3LHVA 4AAJA 5D33A 1R38A 3SAZA 2NQJA 4P7NA 3DENA 4J5NA 2J7HA 2XIJA 4PUWA 2XINA 1XW8A 1EBHA 1KQYA 4AZ5A 2V5BA 3POHA 1EEXA 3UPWA 1U5JA 2FTPA 3QSRA 3QYQA 2YB1A 1TPVA 3W7MA 3W07A 1H61A 4LY4A 1TTJA 1W9UA 3IGHX 5ECVA 3GW3A 1FRBA 2ZVRA 3EDKA 1TVLA 4IMEA 1PHWA 1P43A 3EMCA 4XZBA 1U1JA 2Y2WA 3WDQA 2DV0A 3BAIA 3VNLA 3QN3A 3S46A 4DJDC 4LAKA 3UEQA 4BQ5A 5HNTA 5BU6A 4HK5A 4TR9A 4Y7EA 3UJEA 3OBEA 1I45A 3I3EA 2OQHA 4WIWA 2HNEA 4I3GA 4JYEA 1TQXA 1VEMA 3QQ1A 1JCTA 1E73M 4MJMA 1J9YA 2TAAA 3H2EA 2DU2A 3N12A 4JS3A 1JUKA 2WVVB 3NGJA 2X0YA 1LRNA 2FYMA 2VI0A 2FFIA 3FS2A 1X38A 2DZSA 5HMDA 1TPB1 3CO4A 1BD0A 3VINA 1WA3A 4FX8A 3THQA 2BXYA 5JBEA 1CLXA 4MFDA 1Z44A 1NH6A 1A0CA 2R82A 4PFMA 4N0RA 2INEA 3R0UA 1VPXA 4HCHA 4PMVA 3VDCA 2CLLA 1Q63A 1T99A 1S2VA 3EPOA 2YW4A 4Q4PA 3ZSSA 1OYCA 2O7QA 1SW3A 1V0LA 1FWHC 4JIHA 3IV8A 3KRBA 3IIPA 5G5IA 3ZT6A 4BF9A 1XG4A 3VVGA 3DKJA 1JCXA 3S1UA 2DSKA 4E2OA 1OIFA 2HSAA 4ZXOA 5A6AA 1R30A 1VFLA 2XJ7A 4OT7A 3G18A 1G69A 3RU8X 5DMLA 1XX1A 3NQFA 1F6YA 1UROA 2FDMA 1ZU8A 3DH7A 4JTIA 1SSGA 4F8XA 1A0EA 3APTA 3IGSA 2QUTA 4B15A 4CCEA 1KRBC 2F8QA 3GO2A 4QE5A 2XH7A 3EX1A 1TKKA 3TH6A 2BFGA 3NPXA 9RUBA 1J2WA 1PZ3A 3PBUA 3F4DA 4M51A 1J5TA 3F4VA 5EPDA 3MQTA 1K03A 1YRRA 2PDGA 5D9OA 4XAGA 3WIJA 4HTYA 5EMMA 4XZHA 1QWKA 2OLSA 1ZCCA 1V3HA 4KRUA 5LIXX 1TV4A 2YA2A 3O06A 4HYWA 2BODX 1E4IA 2V3DA 4YVVA 1XFBA 2J6XA 2Y4SA 3RM9A 3E2VA 4DN1A 2FKPA 5BCAA 2X8RA 3WNLA 3L5AA 3QPYA 3WMLA 3W2KA 4DI8A 1QFEA 3WK2A 4PCTA 2ZTKA 2ATSA 1HQTA 2C19A 2QJHA 8XIAA 1W2VA 1R9XA 4ASTA 3TU9A 5A6KA 4O52A 3W1XA 4Q7NA 3W2JA 3M4HA 4GGBA 3CS2A 3B40A 3L21A 4PUMA 2ZA2A 2JBMA 2A3BA 1Z32X 1FXPA 3GUWA 1E40A 2YKKA 3TKFA 4HPXA 4P7LA 2AKMA 4QE4A 1H0GA 4MUZA 1LUCB 3KLKA 4YNGA 2KZHA 3IJ9A 2EKGA 5KSWA 5CC7A 4GABA 2QPSA 1TV8A 3GNXA 4FIQA 3SW6A 4W7WA 2YDRA 2QDGA 1YXYA 1UWRA 3NZQA 3K30A 3L4TA 3EX4A 1XLBA 2QMKA 3M6YA 5A6LA 2ZOXA 3UNDA 3EKGA 3MUAA 2OX4A 3VABA 1XBZA 3CPUA 3P84A 3GLCA 2I7GA 4W5ZA 1A49A 4DM1A 1ADSA 4PTDA 3M0IA 2GJXA 1JYNA 2NWSA 3OODA 3UG4A 4C6KA 3ARZA 2EPKX 3H55A 1OD8A 5AC4A 3AS1A 1XS2A 3RX4A 2YSWA 3T44A 4KGJA 3NPWA 3SSZA 1XIFA 3N34A 1HNYA 3VNZA 4AEOA 3O0KA 3NQ6A 1X7FA 3MI3A 2Q3OA 5B80A 4M0XA 5JIPA 2VFHA 4AMCA 5FF0A 3TTEA 1EQCA 4HT3A 2QS8A 5KMYA 2WCGA 1BXCA 1VRXA 1REQA 2VCBA 3KLLA 1EX1A 4B3LA 1EHAA 4NXKA 1S3HA 1I75A 5A8OA 3OHIA 2ZIDA 3DX5A 4IPJA 4JIPA 2ZWZA 4Q4SA 2BS9A 2OEMA 4C6BA 3MUXA 3OVQA 4A35A 4XKYB 2C6QA 2VQTA 3DFQA 3GXTA 3CJPA 3T2OA 2GVJA 3MU7A 4F0MA 2WKGA 1HN1A 4PL2A 1VKFA 3BC9A 2R1NA 3V18A 2H8ZA 2HROA 3WMCA 3LRLA 4LVBA 1BAGA 3DHUA 4NL1A 3N13A 4KFPA 3O6AA 3C56A 2VL4A 4TVCA 1JPDX 1JVNA 3NQAA 5M17A 1QTWA 4JHZA 1XIBA 4LBRA 4DXVA 4EPKA 1RPXA 4AHQA 3PUDA 3AZSA 3R43A 4RL3A 2GPTA 4ERGA 3CWOX 3VGEA 2RDUA 2E1DA 2A3CA 1U30A 4WJ8A 3INPA 3WELA 3UFYA 1JYWA 1M5WA 1DXIA 1H41A 1HKIA 4S1FA 4H2HA 3P62A 4QTGA 1XIJA 4RK8A 4CQAA 1YBQB 4XQ6A 1PJ9A 2B31A 3K8LA 4ZB5A 3QY6A 4I8YA 1TELA 2B4GA 4LPCA 1FWCC 3EEZA 1YTKA 5CQ1A 2F61A 2YB4A 4HJFA 5EL1A 4QE1A 3B8IA 5FSEC 4WJEA 3RM8A 2G8ZA 2HWGA 5LIUX 2HTMA 1SGJA 4UCFA 3R25A 1VPYA 3II1A 3N4EA 4LXFA 3KBSA 1Q4WA 1TX0A 4IFKA 3TZFA 4V1XA 1B31A 4LUSB 3MSDA 4JYFA 3ZO9A 4C6LA 4GVIA 4GVHA 4O12A 2A3HA 1VPQA 4JHOA 4U5IA 3A24A 2ZCGA 1TA3B 3SURA 3ZLGA 1TWWA 3MYPA 3BLLA 5A2BA 3H2NA 3W00A 1GVYA 4IMFA 4QG6A 3CWNA 4QG9A 3A6OA 1NWTA 3KBVA 3U2ZA 4TMBA 1QNOA 3WLPA 2OJPA 1GW9A 1NOUA 1DWFM 1AQ0A 1JNDA 5C2XA 4UQDA 1K4GA 3S5SA 4XZNX 3SUUA 3W29A 4PBGA 3QY8A 5HUPA 4GWEA 4IIHA 1N8FA 4OZOA 3CTTA 1SMAA 2DT3A 4QNWA 2PUZA 4R9OA 5I3IA 3TCEA 3H54A 1C8QA 4NAEA 2YL5A 2AOSA 5FJOA 1CCWB 3K46A 3ARSA 4AHPA 3G1SA 3BW3A 1IZJA 1W37A 1EUAA 3TP4A 1U1HA 1KM0A 1A3HA 2NLYA 2W62A 4LT9A 1B57A 3L68A 3OYXA 2AMGA 2XH0A 1OGBA 2WJFA 3A64A 2C79A 3PPGA 2H3BA 5BXSA 3H2FA 3H2CA 1FCUA 4O17A 3THAA 4AXNA 2VO5A 3PPHA 4EIVA 4ZO9A 1E6RA 1K7EA 3URAA 1XISA 2X2GA 2AKZA 4GVGA 4RPPA 1RQEA 1KRAC 3GNOA 2WZEA 3GXIA 3NZRA 1YXCA 2JIEA 3RR1A 4Q8PA 2VMFA 3M0MA 1HKVA 4O0QA 2YZRA 4KWWA 3FXYA 3B0VC 3N1AA 4QDMA 2ALDA 2PDQA 3WDIA 1XCFA 2GK1B 4IGSA 4QBXA 2DZBA 2EJ1A 5G2HA 3ZMRA 3FEQA 4CGTA 2WO5A 4K8GA 4ZTXA 4IIFA 4E3VA 3VGDA 1HP5A 2R1MA 4WXZA 1LOSA 4LX4A 3ZXWA 2VX6A 1KLYA 1KLZA 1EP1A 3SRHA 3MBDA 2FVLA 3MI6A 3DGRA 2NX1A 4QCFA 1WKFA 4HOWA 2CWXA 4HZ7A 1XYCA 3L4WA 3NQVA 1OEPA 1QW7A 4BZYA 1QK2A 4E2VA 3QOMA 3R11A 3FW6A 4ATLA 4CNOA 3WDJA 2B7OA 1ZJAA 3N29A 2G4JA 5GJNA 2A3LA 2WJEA 3HA1A 5D9MA 3OZPA 3TC6A 1HZYA 1E0VA 3ITYA 3WD2A 3MHFA 4GC4A 1EPVA 1NWSA 1KXHA 3VDHA 3PWGA 1DXEA 1OGSA 2J24A 5JXQA 2Q8LA 4L4OA 2P10A 4PCNA 4WOZA 1W9BM 5DCDA 3BLEA 5HJLA 2ZADA 3M43A 4XAPA 1ZQ5A 3AI0A 2CHRA 5FCZA 1EOMA 4MFEA 1IGSA 1U83A 3VI2A 1YTEA 1E6SM 1JULA 3AHTA 3N2TA 4CQ8A 1PKMA 3QPZA 3MUZ1 3DDMA 5L6UA 3S5ZA 3FJ4A 4KFNA 3I4EA 3M7SA 3S4TA 3BXWA 1LWIA 5C9WA 4S3CA 1TWIA 2XIBA 4H6EA 3PFMA 1QOQA 4GINA 3UF9A 1RBLA 1QXLA 2XM2A 2QDHA 2EPOA 3KOWA 4IP7A 3DG6A 4J27A 2BB0A 3FVMA 4OIFA 3UWEA 2FHCA 2HPMA 3P2VA 3WG6A 4CNUA 5AOUA 2A3AA 2IS7A 1JAEA 2Q8XA 1GUVA 4TO8A 4C7DA 1OBAA 1KFJA 3AUJA 5AC7A 4HD5A 1EF3A 1KV5A 4H9TA 3F5JA 1DXFA 2GUUA 3B0YA 1PIGA 5CLTA 4R33A 4HHHA 1W5QA 1MRAA 2VFDA 3HV9A 4GXMA 2YYUA 2ZX9A 2V63A 4UTTC 3TYUA 2FIQA 3FGCA 3TN5A 2OR2A 2C1IA 3SIMA 1F6KA 3BK0A 3I65A 2EBNA 4N7QA 1B4KA 3OZOA 2GVGA 1SFTA 4EP8C 2PRLA 2VEPA 4N9CA 2JKEA 4A2RA 3TMLA 3MO7A 3FJ6A 1LOLA 2POTA 5A5WA 1XGDA 3H8AA 1UPMB 2QAPA 3OLEA 1OG6A 1AH3A 3QMTA 4KWVA 5J5DA 4AC1X 3Q65A 1KNWA 4JCLA 2X1IA 4JTDA 1LWJA 1GYLA 3TW7A 3MKKA 3PC0A 1US0A 3TA9A 3NSXA 1PIFA 5D05A 4GGHA 2WZMA 5D4YA 1QI0A 3CEUA 3C3UA 1YLVA 3CPRA 3VILA 2WSPA 2OPJA 2GYIA 2ZQ0A 4KS0A 5E0KA 3U5UA 2WSKA 1XLAA 3WFAA 1HUVA 5E0FA 1FKWA 4JTTA 3UXLA 3QGKC 4N2YA 3UD6A 2VZSA 1BGAA 3FSUA 3KRZA 4E38A 3GDLA 1XYMA 2DP3A 5G4EA 1JDEA 2AQWA 4R7WA 3IK2A 3FYYA 1OT1A 3I7SA 4O16A 1SW7A 2DZWA 2QCDB 4HNOA 2WPGA 4GYJA 3D3FA 3VE7A 1GQNA 4Z17A 4AWUA 1ZP3A 2D24A 1I4NA 4M7SA 1WQ5A 3VOCA 2GJNA 1T6MA 5F2GA 3PSVA 4IX0A 2CLOA 1MQQA 3RPDA 2XSXA 2G96A 3M5ZA 2PZNA 1E4MM 2BXVA 2UY4A 1TCMA 2Z1SA 5I3DA 4XSLA 1E0XA 1HGWA 1RALA 1ZS2A 1Q6GA 3OJGA 2BVDA 3S3GA 2W66A 1JGIA 1GNXA 1GZGA 3F4NA 1BVZA 3S6DA 5DMMA 3CWHA 3AXMA 3A4AA 3LX9A 3UZJA 3EMZA 4Z2JA 1G4TA 2WHMA 4AYGA 1A4MA 2J88A 1TUXA 1AMYA 1O12A 5M1TA 5T9BG 1J6OA 2CZ5A 3RPTA 2O92A 1I0BA 4JNYA 1IQ8A 3MWAA 4E8GA 2FZBA 1B4EA 5IBXC 3B05A 5GQBA 3CEPA 3W7QA 1W8GA 3EX6A 5CZ0A 2Y7FA 3WBYA 2HPIA 1A3XA 2NQ9A 3QV8A 4E8DA 4RDZA 2HS8A 3L12A 4XZWA 4AWEA 2WB5A 3NIYA 1U2YA 1VLIA 1KM3A 3GU2A 4KETA 3W22A 3DERA 4M3PA 3V1HA 3CT7A 4TUFA 3N2MA 2OZ3A 4US5D 1AL7A 3R0DA 1J93A 3AYSA 4S3BA 4WXYA 3OP2A 1XI3A 5H8UA 5DMYA 1XCXA 2ZWYA 4X2RA 1TIMA 1IXPA 4QSHA 3EA2A 2PDIA 4CQCA 5A95A 1UKTA 2IUZA 3GQYA 2XPKA 1GVRA 4LB3A 4ENLA 1UD5A 1VZWA 3P61A 3NQ2A 6CGTA 3LGEA 1VJZA 1LTDA 3PZUA 4CN4A 4OHQA 2HZGA 3RLVA 3RXZA 5AFDA 1KM5A 1S3TC 4KWSA 4H04A 5KZ6A 3W1MA 3CH9A 3WL0A 1GZ1A 3HV8A 1W3IA 1ISYA 5EMUA 1UHVA 2D2HA 2HS6A 2YFOA 2BOFX 1FWBC 1SUXA 3FCPA 3WENA 3LTYA 3QZ6A 3NM1A 2CLKA 2WLYA 1CYGA 2VC5A 4GK8A 2J7GA 4WDWA 2VR4A 2ZUWA 4AU0A 4WOQA 4IXHA 1O60A 4U33A 3DKLA 4RDWA 3ENLA 1JRCA 1KGUA 3CLWA 2BMBA 3MP4A 4YTRA 3GG0A 2GOKA 1R7AA 4JIIX 2BSLA 5E0CA 2PDBA 1XYZA 3U9IA 4FNRA 3TFCA 3SZ8A 3IAPA 4I9AA 2DZVA 1SJDA 3GNRA 2FH6A 3RGTA 5L9FA 2VC6A 4NJHA 4LC8A 4JX5A 3AJ7A 3BV4A 4WKFA 1P0DA 1PBGA 2J9ZA 4Y9MA 2GVEA 3DHPA 3L5LA 3LRKA 5J8LA 1GCYA 4O50A 1UP3A 1WXYA 2VEIA 3Q4DA 4GD0A 3E9AA 4TV5A 4JPGA 1SR9A 2W9MA 5TQLA 3N19B 3NFUA 3GR8A 1PTGA 2J4GA 3LNMA 1JDCA 2NV1A 1U5VA 4XISA 1CLKA 2Y88A 1TG7A 4J4KA 3H2MA 4CCCA 2OB3A 3CH0A 2HXUA 3HPSA 1TPUA 3T4WA 1KM2A 3DUGA 1XLMA 1W5MA 1TPEA 3QTGA 3T0BA 1K6WA 9CGTA 1R3RA 3TR2A 2POZA 5F7UA 2EKCA 2Z29A 1EJRC 1R85A 4WX2A 3ZM8A 1DIDA 4H8NA 1OF6A 2GVLA 4DPQA 1V5XA 2EEXA 4R34A 3KCLA 3GXPA 3A5VA 4NF7A 5HNRA 4G1KA 5BYWA 2WNWA 3AISA 5I6SA 2BGSA 3M0ZA 4FOJA 3TJIA 3CYJA 4EXBA 3OLGA 4PTVA 3TAKA 1AW2A 1UZ1A 2XUCA 4I5UA 4I9MA 3VOFA 1EA0A 3K4DA 2QVNA 1B3XA 2Q6ZA 4IFOA 5CZJA 2P3EA 4HHMA 4QGCA 5CJMA 1GVSA 4UFHA 5A1AA 5LHEA 5F4XA 4IMAA 4X9SA 3EDDA 3VOHA 1G4EA 1OGGA 4JYDA 4RDVA 4JY9A 4WSKA 2NW0A 5EB8A 2P8BA 4FZIA 3STGA 3MBFA 2E68A 3WLRA 3WUFA 4WLCA 3RU6A 4UZUA 3UCCA 4N42A 5JMUA 5I3FA 1RPKA 1SFLA 2V81A 3T55A 3DFSA 1W9VA 4RNIA 3MV01 2WSYA 1VYSX 1BWLA 4O18A 3ZJ6A 1J12A 1SZGA 2V0TA 4PEKA 4DI9A 1UG6A 5AHLA 4EF9A 3PZMA 4EE9A 3G8RA 4WDUA 3SFKA 3KX6A 2WCAA 4V28A 4CU7A 4PB5A 4OECA 3PVFA 3ISIX 3WJWA 4ZZ9A 1IT7A 3S1GA 4IJBA 1AODA 3VCRA 1EO7A 2E6DA 3KAOA 2PDNA 4QSFA 3S2NA 3WEOA 5LYRA 2O9RA 4ROPA 5DANA 4K38A 3UZYA 1BXBA 1XD0A 2CYGA 3WUBA 4QS5A 3PAOA 1RCXB 3T4CA 3ZJ7A 3SCNA 3WQ6A 3ZLFA 4N9BA 3JR2A 2NUXA 2HNHA 1XYAA 2Z1VA 3UBPC 4X0NA 4GI4A 1W31A 4DJEA 2J77A 4WZHA 3OO2A 4C6QA 4O8RA 1H7XA 4MGGA 4GC3A 3O6CA 4EOUA 1DE5A 4GQ0A 3Q37A 2YR1A 3OB8A 4IMCA 5KITA 3OBAA 1S5NA 1LT7A 1UR2A 4ACYA 3PTMA 4GQBA 1DJYA 4YWIA 2OVLA 3K4AA 2Y8KA 4L4LA 1W1YA 4QJ3B 4O1BA 2V3GA 1CT5A 1LM1A 4LEQA 1QJWA 1YMYA 3HMJG 1LQAA 1YHTA 3AU2A 1HF6A 3AIWA 2Y0FA 1ELSA 3PUEA 3ZQ9A 2NSOA 6XIMA 3TW6A 2Q09A 4NT0A 1GONA 3BE7A 4AIEA 1B0IA 1TPFA 2BGNE 3GVGA 3DG7A 3M16A 4DO6A 1HJQA 2PTXA 1FVPA 1IZKA 2BG5A 4I6VA 1TJRA 2G3FA 1S2UA 2WOQA 5C70A 1R2SA 3O6DA 1FP9A 4ZTYA 1QPKA 3N3TA 5T8GA 3VIIA 4LBUA 3OHMB 4KWOA 5BRBA 4AVOA 3ARRA 1P6WA 3BV7A 3SY5A 3W6YA 1GVOA 3HB9A 4JTQA 2WQPA 1YPFA 3WCZA 3ARUA 3WLJA 3LLFA 3E0FA 3TN4A 3NOYA 3K1GA 2O0TA 2E28A 2RUSA 2EPHA 1WNOA 2ONEA 4HK7A 1NWUA 1CZ1A 1M04A 1MXDA 3DC8A 5FI8A 1JCYA 3WQEA 3QXBA 4NNCA 1RHCA 3B8WA 5C9UA 2PDFA 1FWWA 1GVQA 4L9ZA 3ONBA 3A4JA 1W5OA 1Y0EA 1EF2A 4REQA 1RZMA 1OJXA 1RP9A 4JL1A 2E3ZA 3M64A 3QGVA 1WUFA 2E8ZA 4J3VA 5A69A 3BTNA 5ABFA 1V93A 4F9JA 5AY7A 3GG7A 4OOZA 3I7QA 3P60A 2GQ3A 3HJZA 3N14A 2FJUB 3N3MA 4E3TA 4LCRA 4PMXA 1FFRA 1Z41A 3D0CA 2JE8A 3M5XA 5FEPA 3UERA 1BGGA 4KF1A 3GSMA 4IG2A 2TSYA 3C4UA 3RMJA 4NKCA 3G5EA 2F84A 1B3OA 3CUGA 3W53A 4AFYA 4HPGA 3NSMA 1V08A 1ZRQA 2FZMA 1TJ0A 3O07A 4CUCA 3VD5A 4UB9A 3ORWA 5K9XA 5T9CE 1XIEA 3CZLA 4R27A 3C2YA 2E25A 2W79A 2WWCA 3NVDA 7ENLA 1JDAA 3SN0A 4QRNA 4BHYA 3MPGA 3PZQA 3V16A 2GGJA 4KKXA 3NQDA 2PCQA 1QW9A 3S9ZA 3M1ZA 4D2JA 1HL2A 1TIWA 1TWDA 2L5HA 4UTLA 3SFWA 5I00A 7TIMA 2WV8A 2GUBA 4OKDA 1DJGA 3GNNA 3W73A 3NO3A 3W82A 4AD0A 2W0UA 2G41A 2XG9A 3LEPA 3W6MA 4J7RA 2PDWA 2TMDA 4KIEA 1H7RA 3POCA 5CCZA 1N2VA 3MMTA 3MDWA 2W3ZA 1FFQA 5D04C 3VTRA 3P8IA 2X42A 1QPNA 1F4AA 3DZ1A 3QHMA 1VJIA 1I1WA 3QVQA 2ZFAA 1HX0A 1MRQA 4G7EA 2QR6A 5GJPA 5DT7A 4X2PA 1ODUA 1GOKA 1OK4A 3GM8A 4RW3A 3TTYA 3V5CA 3UWYA 3HFTA 1TV3A 4NZ5A 2HK1A 1ZAIA 3EWBX 1PUDA 3LERA 1SVDA 3NZPA 3G3MA 3FIGA 4MY8A 4E0CA 1DORA 3KE0A 3RK8A 1C91A 4YIWA 2WKLA 2QJNA 5BMWA 3LMYA 2Y5SA 2QV4A 2OWWA 5A8QA 4QDWA 4ONVA 3AU6A 2FDSA 2ZRZA 1OD0A 2PWUA 3KW3A 2ZXAA 2YIHA 4ZE5A 2VDHA 1CXLA 2QNEA 4ATDA 4UIOA 4MB1A 1QI2A 2P1FA 2WMGA 5BZAA 4MM1A 1FWNA 3WFLA 3O9NA 2WWDA 1O4UA 1WZLA 2AL2B 3SUSA 3MVIA 4S3FA 3W28A 1DL3A 4GZJA 3NQCA 4HBKA 4B5XA 3WQPA 2O4QA 1IWPA 2QKFA 3G1VA 4GNKB 1S2WA 5HR6A 3CUHA 4HCLA 5FF4A 1V3LA 3KL5A 2C8NA 4CCZA 5F1VA 1ZJBA 1XBYA 3WEMA 5I24A 1ECEA 8RUCA 2VRJA 4C6FA 3WH9A 3W2NA 3TYCA 5HPOA 4IJRA 2QDDA 3SUWA 8CGTA 5ABEA 1SJBA 2WHLA 3WLHA 4B5SA 2QF8A 3AYVA 3K8KA 3PJTA 2EG6A 3HG2A 4X60A 4D6GA 5IDIA 2ZXBA 4WY0A 3MKVA 3EXRA 4H2CA 4LVDA 3I6RA 1HJSA 1XLIA 4Z2HA 3A47A 3AMCA 2ACUA 3KVLA 5CZSA 6REQB 4ZOEA 2VGBA 3VNIA 3VX0A 1E70M 1CXEA 2JEQA 4FLQA 3UJRA 3DI0A 4XTIA 2C0AA 3ZVHB 3NA8A 4XUYA 1V02A 4NRRA 3G1XA 3CZGA 5CAHA 3W1NA 5AC6A 1XBVA 2FPTA 1VIWA 4A3QA 3ERPA 2FJKA 3BAWA 1S5MA 4OUEA 2VUYA 4IXXA 1GGOA 5FJJA 1P5BA 1RUSA 3W1LA 1LL7A 2Y8UA 5AVHA 2FFCA 2O56A 2ZZ5A 4HA4A 3VCNA 3WYZA 4LVFA 4XG1A 4EXAA 3MVTA 1RVGA 3XINA 3P14A 1J0YA 1UD6A 4LAUA 3I7RA 2NT0A 1TPH1 3TJLA 3FYPA 3MY9A 4QR6A 1Y5WA 1YPXA 3PZTA 4O19A 3WF2A 3VZXA 3AJXA 1WZKA 2RDXA 3DEQA 4ZO6A 2BOEX 3ITLA 3F2DA 4H1ZA 3RJXA 2EHHA 3CLMA 4KRZA 1OCJA 1EC9A 3L2IA 4H4IA 1FWRA 4W7VA 4CKQA 1MW0A 3HGOA 1W3TA 4EANA 1WCGA 3C2OA 4FLOA 4G5DA 4EWND 4NXSA 4W8BA 1OZMA 1E9IA 3GIYA 3WQCA 3P93A 3E3HA 1ZPTA 4O0KA 3NQ8A 3WNOA 1C9WA 3G77A 4Q4OA 4ZSUA 1XYFA 2CEQA 2GWGA 3RILA 3G1YA 3LHZA 3VKDA 4F0LA 4QS6A 3LLXA 4JICA 3A21A 4Z1BA 2I14A 5AECA 1X98A 3TDFA 4C6NA 4GJIA 2PPGA 1WYIA 2LLEA 4ZQCA 4XV0A 2F2KA 4S3DA 1JG9A 4IQEA 1Q2SA 1QUMA 4H9VA 1Y5VA 4MNKA 2QCMA 3U4AA 5IFTA 2DZUA 1MEWA 4H8UA 5K2ZA 1JPKA 7XIMA 1KXQA 4XZIA 1JI2A 3MC5A 1OCQA 5C5YA 5DMNA 2PC8A 4GH3A 4H83A 5DBUA 4CD6A 2YDAA 3VUPA 4GY1A 3W7DA 3MYOA 4M8UA 3KVJA 3V0SA 5K3VA 2XVLA 3CHVA 5HQEA 3RIKA 3KRSA 4S39A 3FV9A 1RCOB 3NQ7A 3C0SA 4PUKA 4XSMA 3KL3A 4DUOA 2VXNA 4QM1A 3UVAA 4LAOA 3DYMA 1AL8A 4MWAD 1KR0A 3KOFA 4H3DA 4JEJA 5A6BD 4WVXA 4MY9A 3W1TA 2OT0A 1UBSA 2QJGA 1E3ZA 2VRQA 4YTSA 4J1OA 4C1KA 5LHFA 1O66A 3VOGA 1PHQA 3W7PA 3HF3A 1XCWA 1VYRA 3A13A 2HEJA 3ARVA 2IQDA 2HDJA 2G97A 1UWSA 3M46A 1HJWA 4UC5A 4AVFA 3DC0A 3PULA 1CW2A 4Q8WA 1EXPA 3L66A 5BOEA 2E5BA 4IP5A 4JIQA 4B92A 3ABSA 1TR1A 3EGJA 3FJLA 1YDNA 4PRWA 3SR7A 2WMIA 3PK7A 5IXEA 3S5OA 1DIOA 3IARA 1PCKA 3CV7A 4XAZA 4LF2A 1EX5A 2RGMA 2NV2A 1IXNA 4BFAA 1NTHA 3QFWA 3NOEA 2OSWA 3MUY1 1TJPA 1FCQA 5HBFA 3T09A 4EWJA 3ABRA 1C7TA 1B3YA 3L4YA 3L23A 1LL6A 4ALDA 5HJXA 1T0OA 3THUA 1DPMA 5AZ0A 3BLOA 5AHIA 3BMXA 5T91A 5LA2A 3RYSA 3T0AA 4GY0A 3KHDA 4IFRA 1SPQA 4PRRA 4ZCWA 4RNHA 1DWGM 2E77A 1OT2A 1JYXA 4GYPC 4JTLA 2QUUA 2YX0A 3CHEA 1W0MA 4K37A 1SYTA 4QITA 5CJNA 3N2OA 2I56A 5F1UA 1JZ6A 3G1HA 2NQ5A 2PF0A 4QLLA 3TSDA 4I8DA 2D0FA 1PL9A 2WM1A 3F5LA 4PULA 2ZKMX 1FHUA 4NZJA 4HA1A 4CNTA 4F2TA 2UY3A 3S5YA 3HQNA 4NILA 5G2IA 4CVWA 1KCKA 3RF9A 2XDFA 2DIEA 4HYVA 4O57A 4LUJA 4QP0A 3E0WA 4B2DA 1W1TA 3B8DA 1P4CA 5I23A 2W92A 3CQKA 2E9MA 1LDCA 1A5CA 4ZB0A 1Q7QA 4PUEA 4UQEA 4GYFA 3T81A 3MSYA 1PXGA 2VD8A 4I7VA 2QHAA 1GJPA 3LNPA 3ONCA 4KRTA 1B54A 1W8SA 4U3CA 3LCIA 4XB3A 1N55A 3DOPA 3W72A 1DJIA 1ZAJA 3UGRA 1Q66A 3ZLHA 1QK0A 1BEUA 3WF3A 4RE4A 3TYAA 5CBJA 4DWSA 5BU9A 3NZGA 3E2SA 4HB7A 1GORA 2XHYA 1AMKA 2PU1A 1JXKA 3WZ0E 1G94A 4WGHA 3P0WA 1QCWA 3UWZA 4LYRA 5FAJA 2OSYA 3IIVA 3KRUA 3ZZ1A 1KTNA 3MB9A 1J79A 3AHXA 2FQIA 4A22A 4IGMA 2ZRUA 4XBKA 3KM8A 4BEUA 4Z2IA 3CMJA 3NYZA 4XD3A 1TJ1A 3EWWA 3BGGA 4M6QA 1FTXA 1EL3A 3N17A 3PPFA 2CKSA 1PWLA 2DPEA 3NM3A 1WUEA 3C61A 4OVXA 3TJXA 1H09A 5HQLA 4Q4MA 4WDXA 4XAYA 5I09A 2H8XA 3DHFA 1W1PA 5BWFA 1MW2A 3ABXA 3F1QA 2CCRA 4MDPA 2MNRA 3BO9A 2VWSA 2Q8ZA 2QCNA 2CETA 1Y7VA 4P8VA 1LG2A 5KETA 4LC6A 4UFMA 3UA3A 2OKOA 4V2XA 3WN6A 4DJDD 2TRSA 3SUTA 2YL8A 3VXGA 1M7JA 3QKEA 2VGIA 1FXQA 3G24A 1ZTVA 1QHOA 2XH4A 1M7OA 2X1UA 3SBFA 5EMKA 1ZBKA 2GQAA 3CGTA 3VC6A 2C16A 3DYOA 5CG0A 2VOMA 3LM3A 5LA0A 5HWJA 5HWNA 1JZ4A 3PR2A 4F9DA 1FDZA 3DXIA 3RM4A 1FWEC 3ABQA 1W9XA 3E6EA 3PSWA 3TN3A 3W81A 3W7RA 3GTIA 2YCJA 1O95A 5H6HA 4Q22A 2JF7A 5K9CA 5JQ9A 5FJPA 1UZDA 3VM7A 2OTDA 3W9ZA 5C6MA 2CHOA 4O0ZA 4F3HA 5CPSA 3PJWA 2X1RA 1UR1A 4JFVA 1ZL1A 4N9EA 4BEQA 4INFA 3C8FA 3LGGA 4LALA 2AQVA 1KCXA 3WH7A 1OFOA 1TTQA 3ZJKA 3UWVA 2PGFA 1GTEA 4LJ3A 2BWGA 4JN6A 1ZBVA 4NNBA 4ZQNA 7ODCA 2Y5JA 5AHFA 3W7KA 4MWAE 4FR1A 3QLDA 3WK3A 2HVNA 4JEQA 1A0DA 2WZTA 1VBRA 2YCLA 5B7ZA 1QNSA 2X41A 4GIYA 5D2XA 3JUGA 3VIMA 3LCLA 5I3GA 2OOFA 1GG0A 3CQ0A 3H26A 5GPRA 3WBXA 5EFFA 1KM6A 3FKRA 4NJGA 3PFRA 3VGGA 3U8GA 5MKGA 1FHVA 4PR4A 1JUBA 3CT2A 1A5LC 3B0XA 1D2KA 2XGBA 2R24A 4DJFD 4W86A 3H7VA 1FWAC 1K6AA 2OT1A 2VVSA 3P81A 2TPSA 3AHZA 5JU6A 1C8VA 2G3JA 1N8IA 3GR4A 2Z1WA 4ZFMA 2CBJA 1GPWA 4CVUA 3F2BA 4B5VA 2CBVA 4LUYA 4NAFB 3BJFA 3GG1A 4GQQA 1RY8A 4DJEC 2C13A 3H22A 3ZFHA 3E02A 4LAZA 1UUMA 4DNHA 3GH7A 4JCMA 4XD6A 4KH2A 3UXIA 4XBJA 1E6ZA 4Q4KA 1E1FA 2YW3A 4IICA 3H23A 3MMUA 3UG3A 4CLMA 1H50A 3IVTA 1A53A 1HIZA 4HN4A 1BRLB 3G6LA 3MWCA 3OGSA 3SQSA 1GVFA 1YW1A 4JY8A 4YYCA 3N2BA 1UR8A 3ATYA 3KDOA 4MWAB 1TE6A 1PX4A 2A5HA 3HOJA 4KCVA 4AY8A 2ISSA 3R7MA 3D46A 5HXMA 3FYOA 3VNDA 4FXJA 2W6RA 1A4LA 2WVTA 3GTFA 3NR0A 1BTCA 1MEIA 4DWDA 3S8HA 3M0XA 3W1QA 3B8VA 1Q4NX 3O15A 2OYLA 2WW5A 1D7KA 4JKMA 5HANA 5CAKA 2C91A 1ZP4A 2VD9A 2B7NA 2DIKA 2CC0A 1C9DA 1T5AA 1XLEA 4KWUA 2IQ0A 1POJA 4E2BA 3AIBA 1MW3A 3GXNA 4CQDA 5FF2A 2V67A 3VMNA 3WK1A 4OFCA 3LHUA 1BYAA 3EDJA 1LL4A 3DI1A 3TVAA 1NFGA 3IVSA 3NPUA 4J3TA 3W7LA 3CZJA 3L0GA 5IHSA 3O63A 2D22A 3W0KA 3KP0A 3BH4A 3IWPA 3N2CA 1W9PA 2FZDA 3MP5A 4UTUA 3J7HA 4IISA 1SO5A 4MDOA 2IKHA 3STEA 3LUTA 1C29A 3T1GA 7CGTA 2DORA 2JK2A 1GOOA 3AXKA 4J3XA 3ME3A 2WK2A 1RQBA 5E1QA 3GDTA 1K8YA 4NI3A 3BMVA 1VFUA 3PN8A 2B81A 1SSDA 1UZHA 4P7RA 3P67A 3E0IA 1XRFA 2D73A 5C0QA 3CL7A 2XFFA 1QNPA 1DHKA 2DVXA 1B9BA 4F4RA 1BF2A 2Y24A 2O9TA 3OLDA 4GYKA 2OXNA 1X96A 1B90A 3WDHA 4UTTA 4H19A 5AZ1A 1KW1A 3U7BA 1PDYA 4GX8A 5CZTA 3VKKA 4UFJA 2VVNA 3EWXA 4M6UA 1CDGA 5HQMA 3FXGA 1IWAA 3BZJA 1TB3A 1XIMA 1QO2A 2OOGA 1F3TA 3W37A 2VFGA 1TYGA 4LEFA 2BVTA 2DSZA 3LHYA 1GQJA 1BG9A 1XYLA 5G4WA 1RV8A 3H70A 2QPUA 1OYAA 5DBTA 4ZA0A 4C91A 4XD4A 4MB3A 3QRHA 4UNKA 2FH8A 3TUUA 5I78A 2CHNA 3LQGA 2X1TA 4Q6JA 1VFHA 3ZOAA 4LCSA 5BWAA 3PPCA 1G4SA 3C2RA 3GW0A 2C1GA 3ARTA 2F2HA 1WPCA 3W7IA 3KWSA 2VJXA 1KA9F 4J40A 2GL5A 2PP3A 1CNVA 2PDHA 1VFTA 4K1GA 3Q67A 4UZSA 2F6UA 4AF0A 2G4FA 4IM4A 5REQA 4MY1A 1T8QA 2BZNA 2GGHA 2V5CA 3IJ6A 2INZA 1LP6A 1NELA 2X2YA 4FR6A 2V5JA 3UJSA 3RG6A 4D9PA 4DYKA 4JX6A 2ASHA 4LV9A 3ES8A 5A6BA 4GJJA 1FCBA 1DYSA 3I10A 1CTNA 1ZBCA 2C18A 2C14A 4JTCA 4UTMA 1TV5A 2PAJA 2QCHA 3Q58A 3HTWA 1KFKA 2JKAA 3TYZA 2Z1BA 1VCGA 1W5NA 3PWIA 4DO7A 3BJTA 4FF7A 5FD0A 1GVEA 2BVYA 2RAGA 1X1ZA 4HU4A 2ZA1A 1QHZA 4CN6A 1DJQA 1ZGDA 2CLMA 1B2YA 2W4XA 3VIPA 2DT2A 3OA3A 2G95A 3RPMA 3C2EA 1X8FA 1J5SA 4I7WA 4AY7A 4NSBA 3OZYA 2Z7GA 4O4WA 5EFDA 4A2SA 5A8NA 1GJWA 2ZZ6A 3LM7A 1UIPA 3WUGA 3N2XA 1VAHA 4GHRA 4FNUA 4S23A 2QGHA 2IQTA 2V8ZA 5CPTA 1UQZA 5HK4A 3E2RA 3BWWA 3SO7A 3TAOA 2VYOA 2WZHA 3HQPA 1VD6A 1E1EA 2C0HA 2ATMA 4R85A 4PSRA 3GDRA 1BXNA 5CEWA 3MS8A 2PRMA 4AD5A 3TNBA 2O4MA 4BR1A 1XH2A 2V5DA 2J7EA 1EP3A 1QAPA 4BS0A 3ZVIA 1FUYA 4GRSA 1R2RA 2OCZA 4BKNA 3PBVA 1GHSA 4QISA 4DAFA 3L4VA 4XTDA 3ABOA 3OQ8A 5I07A 3QFEA 5CSUA 4O54A 2ZX5A 1JZ8A 1ADDA 3THDA 2NLIA 4B4HA 3UR7A 4ZB2A 4L64A 4GBDA 4M82A 1R5YA 3DIPA 4ZOCA 1T7LA 3W7OA 2WMJA 2INFA 2VRKA 3SRDA 1N82A 5FF3A 5EBUA 5D8ZA 3DFOA 4DF0A 3LCGA 4RNFA 3IGUA 3HGRA 1NF7A 3HQOA 3WH5A 3CU2A 3GDBA 5HATA 2CLHA 1IEXA 3GIQA 3GDMA 3H7UA 2VFEA 2WPBA 2P0IA 1BYBA 3NZ1A 3GE7A 3AXHA 4ZQRA 2D2GA 2I5IA 3C8NA 4OE7A 1Q65A 3WK0A 3GHRA 3BSHA 1BPLB 2VFIA 1NDVA 3H4WA 2ZUMA 3S6OA 1OY0A 3CHDA 4O28A 1RA0A 3UNTA 3M5VA 2AGTA 1XG3A 1HKJA 3B9EA 3WLOA 1XM3A 7REQA 4PGLA 3JZEA 1S39A 5CSYA 1D8CA 4JBRA 5BXTA 1I8JA 4LRSA 3TE9A 4QAIA 4R9XA 1BG4A 2PLKA 3SGUA 1OX5A 4URIA 1TCDA 4HNCA 1HJXA 3WBWA 1JNEA 2Y1HA 3R8HA 2X40A 1KV8A 1JFHA 4CEXC 1JZ5A 4DX3A 3CK5A 3RUBL 4IUGA 2V3FA 3WLLA 3MSGA 3QOKA 4HSNA 2PMQA 4JTUA 3CXOA 3RCMA 4KPLA 3CQJA 2VFFA 2OO0A 1XF0A 4MZ8A 4W89A 3EYPA 4LUTA 4HPNA 2D2JA 3H7RA 1PTDA 3SUVA 5CZKA 3A5FA 3SQMA 4I5RA 1MW1A 1XDLA 3N6QA 3PBYA 3AS3A 1CXKA 1EDQA 1WXJA 3GKAA 2ANUA 4Z0JA 3TQPA 1US2A 1RA5A 1WB0A 2DDXA 4PMYA 3H12A 3SGZA 5K4ZA 4LTSA 5C55A 2PS2A 4QHRA 5AHEA 3CL6A 1Z69A 1UH2A 1P0NA 4ATWA 3UJFA 3VO0A 1LBMA 1L8NA 2H9AB 1OFBA 3U6WA 5DEZA 4AHOA 1JD9A 3PB0A 3AALA 1YPIA 3PZGA 4M56A 3GG8A 3TC7A 2X0HA 3UR5A 3EDEA 4MJZA 1V0NA 1PTAA 3NAVA 1QR7A 1VYPX 2DSWA 1PB0A 3M07A 4UR7A 4RR4A 4G7FA 1H0IA 1XIIA 3S83A 4JDBA 4HU3A 3CV6A 4WEVX 2VZTA 4NASA 4UMCA 4O10A 2OWCA 3CB8A 3REQB 4BF7A 2Y7EA 1VEPA 4Q8UA 4P5UA 2UBPC 1GYMA 3K8MA 2J75A 2XVGA 4AIBA 3NXFA 4RDYA 2E9LA 4O1FA 3PG9A 1S5VA 1ZSXA 2CLFA 3T0CA 1IWBA 4KMQA 1QI3A 4NJJA 3UZXA 5TNVA 1KBBA 2VT0A 2VEKA 3MCOA 2TYSA 1EPXA 4JDYA 4HMNA 5DXYA 5HWMA 2QT3A 4OQVA 2PI6A 1O5QA 3TOPA 5IHRA 4JTEA 3BQ6A 2NSXA 1E43A 1EUNA 4DBEA 4F0RA 2Y61A 1IT8A 5XIAA 3NEHA 1JI1A 2X30A 4GUHA 1G5AA 4IQLA 2J7BA 4GBUA 1UJPA 3HN3A 4JFWA 4U4MA 5FSDC 4QQUA 5I5RA 3LHTA 4S3AA 2WMHA 5E09A 4LANA 4P8WA 2XU2A 1ZFJA 5A8GA 3FAWA 4EPDC 4OV9A 2XTKA 2VZUA 3WQ8A 4V27A 4Z42C 3BCFA 1UKQA 3WEZA 4XX6A 4NI8A 3GZ3A 1Q6EA 3O1NA 2ZYFA 3ANYA 3KWXA 4KQNA 4M29A 3WJZA 4IIBA 4A05A 3TROA 2VC7A 2XIMA 5DT5A 3GHTA 4AMAA 1QI5A 4KEUA 3H6OA 4HIBA 2VDIA 4PCFA 1HXJA 3UCQA 1JRBA 5MHBA 5JBDA 2WAGA 4C6EA 1NOFA 1OADA 2W63A 2GGGA 1IR1A 3R94A 4HMCA 3GYCA 3ANUA 2Z25A 2E6YA 4OU1A 1R86A 3WLMA 1KO0A 1QHPA 1UIOA 3S0CA 2QMJA 4RKAA 3GC4A 1DJHA 3TOYA 4R7OA 4DYEA 4GUFA 1TE1A 4KCUA 4IOTA 4U10A 4Q4RA 3WO8A 4C1NB 4AZCB 3BUVA 3WFZA 3G1FA 4J3UA 2W91A 1PZ0A 3HM7A 4DZ5A 4OOUA 2XZ7A 4AXKA 3P5YA 1OB0A 4PUNA 4W85A 3QBUA 5D9NA 5K4XA 2WVVA 4GZEA 4AYSA 3S42A 2FPYA 2I1OA 5LKYA 3CUIA 3TYEA 3W84A 1F3WA 1QATA 2H6RA 3LCFA