4GE8A

Oye1-w116i complexed with (s)-carvone
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
total genus 155
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ge8A00
2J9ZA 1JQVA 3TX9A 3HQ1A 1Z44A 1NF0A 4O18A 1YDNA 4AHOA 1HUVA 4ADUA 3U2OA 3A23A 3DHFA 4PCFA 1H63A 4GXMA 2FPYA 4Q32A 3W2LA 1XI3A 2VENA 4LUJA 2ATSA 1A5CA 1G4PA 3B8DA 3M47A 4JDBA 3NQ2A 4M7TA 2VEIA 4O4WA 1QOPA 2G5WA 2VOMA 2FB2A 4QIUA 3S6DA 1XBXA 2V82A 3VFLA 1VC4A 3CU2A 4IQLA 3FJLA 1OVDA 1XXXA 3PBYA 1EP2A 5J5RA 3NQ6A 4WOQA 3TQKA 1EA0A 4IXXA 3ZWTA 3TV8A 4UTUA 3UXAA 3PC0A 3GAKA 1PV8A 2J9YA 1DORA 3MUXA 1OF8A 1VR6A 3WJSA 2H3DA 3KX6A 3GB6A 4UFHA 1KV8A 4DXVA 3RLVA 5F4XA 3EB2A 1VRDA 4JTSA 3K30A 3DXIA 5I3JA 3W71A 3CM4A 1HO4A 4BI7A 4OE7A 3R5EA 5AFDA 1DKWA 1DL3A 4FX6M 1FXQA 4IMFA 1XFBA 4UIOA 2E09A 5G2IA 4UTTA 2BTMA 3PG8A 3BW4A 1H62A 1AW5A 3M41A 4OT7A 4MOZA 2ZQ0A 5AYXA 4IMCA 3ABOA 1A5BA 3FLUA 3W7PA 5F1UA 1VH7A 4R33A 2GUUA 2LLEA 2JBMA 1JCJA 1TMHA 1TREA 5A5WA 4AHPA 5AHLA 3W84A 1WV2A 1JULA 2QKFA 4AMAA 1LBMA 3NQAA 3I65A 3S9YA 2A6LA 2ISVA 1FWNA 1PS9A 5F2IA 1F6KA 1J4EA 5SWUA 2A2IA 1I4NA 2DU2A 3SIZA 2NX9A 2E5BA 4RXGA 5EBUA 3W88A 3C8FA 1K03A 2CLHA 4JD4A 4AB4A 2EGZA 1FY6A 2F84A 1XM3A 5TQLA 2RDUA 3P60A 2WQPA 3W1RA 5LNUA 1B9BA 3QF0A 4QJ1A 3LGEA 3TFCA 3IGUA 5DY2A 3NXFA 4X3ZA 1GTEA 4O52A 3FYPA 2ZZ2A 1GVRA 3LHZA 3YPIA 3W2UA 4PA8A 2P0OA 3C2OA 4TMBA 2WOQA 1XC4A 1PCKA 3LBMA 3TSBA 3FKRA 4FNTA 3JRKA 1I2RA 3A24A 3BG3A 1P4CA 3N9SA 2DZTA 4AXKA 1JUBA 2RH9A 2TMDA 1FCBA 2P10A 1WBJA 3NQEA 1KLYA 2VEMA 2WKJA 1C29A 2RHGA 4WY0F 1BWKA 3VE9A 3S5YA 1QWGA 4LTSA 1OX6A 2DZSA 3R2GA 4EIVA 2E68A 3DU0A 2CU0A 5AC6A 2HMCA 2JKPA 1S5VA 1N7KA 1AL8A 3EWXA 3TCEA 5EL1A 3GVGA 1GVQA 3QMSA 4NUWA 2CWNA 4E2DA 3F1QA 1W5OA 4PODA 4LW7A 1V7YA 1TRIA 1O5XA 1THFD 3GKAA 4CQ9A 3FEMA 4BI5A 3U6WA 2YZRA 1G4EA 1H7RA 1V5XA 4JDYA 5C2XA 2I14A 3HGSA 1TPB1 3QRHA 2PURA 1FQ0A 2QCLA 3EWBX 3UZ5A 3TIMA 4GC4A 5CZTA 1AG1O 1L2UA 2B7OA 4QSHA 1DOSA 5BMXA 3W2JA 1U5JA 5HUOA 3PSWA 2OMAA 4WX2A 3LHVA 5D2YA 2VFGA 1HG3A 1TTQA 4MY8A 3NPXA 3G0SA 2GQAA 3H53A 3C4UA 1A53A 3G1FA 4JTKA 5EYWA 1EWEA 4N02A 2I9EA 1LYXA 1FWSA 4IX2A 1UASA 3WK1A 1IXOA 5IBXA 4Z1CA 4Z08A 1ZCOA 3IEBA 1X1OA 5AC8A 4M6QA 2ABAA 4E0CA 2QCDA 1EX5A 2QCGA 4HPXA 2GVLA 2JKEA 3UZJA 5F1VA 2Y61A 2OT0A 2VFFA 3L0GA 2QAPA 3PY2A 5DN1A 1GVFA 1SFJA 3G22A 5FESA 3W86A 3NQDA 2B4GA 3HG3A 3WK3A 4NJIA 1WAUA 5AHNA 4I7WA 2EHHA 4Z1DA 3L2IA 2X1SA 3SJ3A 4JTLA 3CB8A 2W79A 4JTUA 4MY9A 3W7KA 5KZDA 3ZFHA 2YYUA 3DENA 5KMYA 3TJXA 3PB0A 4R7JA 5DXYA 4NXKA 1RQBA 3GX9A 3C2FA 3DFOA 1TPH1 3SECA 3TSDA 3LTPA 4GUIA 4MYXA 1RPXA 3QFEA 4DELA 1LP6A 2CFFA 2GJLA 3BV4A 1ZALA 3HF3A 1FWRA 2BWGA 4Y6GA 4FXSA 2GJNA 2TPSA 5CPMA 4O28A 3QQ1A 3W6YA 2GOUA 3UNDA 2V2DA 3EWUA 2NX1A 4LVDA 5D2WA 1GPWA 1JUEA 3TROA 1QAPA 5DCEA 4UNLA 1OYAA 5IM51 4HNTA 3DGRA 3NVTA 2QDGA 4GBUA 4Z1BA 4AHQA 3NYZA 2TRSA 2J88A 3STCA 4ZQRA 5KTLA 1TCDA 3C52A 3HGJA 5G2HA 4L4LA 2YCEA 3W23A 1I2NA 5DXXA 3R12A 4JTHA 4AH7A 4WOZA 1OF6A 1W5QA 1LLZA 1GG0A 3PF3A 1GVSA 1VGAA 1ZAJA 2QAFA 1FCUA 3GDMA 3P5YA 1XBZA 1NSJA 3DFPA 4JY8A 3W7EA 3N14A 1IIHA 4UTIA 2X1RA 3M44A 3S5NA 1K7FA 1KM0A 5KZEA 1S5TA 3MP5A 2CLOA 1QCWA 5FF3A 3TA6A 3NPUA 3LRLA 3GDTA 1W3TA 1KA9F 2ISSA 2FPVA 1KFJA 4O1AA 3PUOA 2ZZ7A 3LCIA 1G67A 3NDOA 5L6UA 3PSVA 2NXGA 3O16A 3TJLA 4UXDA 3CTLA 3G8EA 5D30A 1DVJA 4NQ1A 3MHFA 3NZ1A 2JGYA 1WYIA 3TU9A 2E1DA 1KFBA 4JYEA 5HWNA 1F05A 1R2TA 1IIGA 3TC7A 1TPWA 5LGZA 1KFLA 4ZQOA 2ZZ3A 3S1XA 4HPJA 1WXJA 4UTTC 1JRBA 2YW4A 5K7JA 5CSSA 3E12A 4IWWA 4MPQA 2R91A 1TTJA 1QMLA 3C2VA 1L6SA 1F5ZA 1XUUA 3UQNA 3O1NA 2H8ZA 3L5AA 1VLIA 2C6QA 1H1ZA 3V1PA 3W7QA 1KLZA 1MZHA 1TV8A 3N73A 2HS6A 3BVJA 1BTMA 2ZYFA 4RK8A 5CZJA 3UPWA 5K3VA 3W1QA 2OT1A 1F6PA 3C2EA 1UCWA 4JTGA 4ML9A 3NQCA 2R94A 4QNWA 5K4ZA 2CZEA 1B3OA 5K9CA 4JY9A 1X7FA 2PRLA 3IGSA 3TKFA 4JEQA 3IRDA 3M6YA 3NZRA 4LS0A 5EPDA 4FF7A 1SQ7A 1SO6A 4UNKA 3VCRA 2YFOA 3NO5A 1QDSA 2GQ8A 4UTJA 3RNDA 4AWTA 1G7VA 4RKAA 4QQ3A 4NNAA 3NAVA 2PRMA 3W7IA 4J9JA 3W1AA 4GWEA 3RMJA 3EKLA 5AN7A 4C1KA 3NL5A 1UB3A 3LHUA 5HNRA 3UY8A 2CZDA 2E5CA 4NJKA 3Q58A 4JTIA 3E0IA 1XDMA 3A9IA 1ZENA 2QCFA 3FJ6A 4G1KA 4K7YA 4LUIA 4JGDA 4IGHA 4NJGA 1LM1A 1ALDA 3NQ7A 5A8GA 4EOUA 3FKKA 4NJHA 3LCXA 4XKYA 5HJLA 3G1AA 2EF9A 1W56A 1GYLA 1H5YA 3UWQA 3H55A 4PL1A 3HGRA 5AHIA 4XWUA 2V8ZA 2Z1BA 1R46A 1I2QA 4HHPA 3PULA 3V75A 4DBEA 4Q33A 3QC3A 4UTMA 3B03A 3EXRA 3FFSA 1VPXA 3CHVA 4X2RA 2J6XA 1T8XA 2QDHA 3CQ0A 5CG7A 5FF7A 5CSRA 3B05A 3BW3A 4S1FA 1WOAA 1CW2A 4Y9AA 1A5SA 2RDTA 4WJEA 2YXGA 4POCA 1KFCA 2NWRA 3QZEA 1SPQA 3O07A 2ZRVA 1H7WA 3EX6A 2G96A 4LV4A 3S5ZA 2NUYA 3GLCA 4GUFA 3RK8A 1AL7A 4N6EA 3DBPA 1SO3A 3NA8A 3HIJA 3LOTA 4LY8A 2C16A 1HTIA 3GDKA 1YPFA 4GE8A 3TQ0A 5AYYA 3MYOA 4MYAA 1KFEA 3KVJA 5U7SA 1OG0A 4MVAA 4X9SA 1TV5A 3STFA 3FIGA 5FEPA 1IXNA 4RR4A 1O4UA 5HWJA 3T4CA 3O8AA 3W70A 3CWNA 1LBFA 3H54A 1P0NA 2NUXA 4PC8A 5LHFA 4NX0A 1AW2A 4OU1A 2Z6JA 3EXTA 1KM5A 4FNSA 2A21A 5FEXA 2ZZ4A 3C3NA 3B4UA 4O14A 2Y7FA 2ZRUA 1LOQA 3QEZA 1EPXA 1TRDA 1ME9A 1SU5A 3DFNA 5D02A 1XDLA 4U4MA 4DPQA 3N2MA 2CLFA 2GPTA 1ZAHA 4N9CA 5BRBA 4JTFA 3IIXA 5IBXC 3EWYA 5DBTA 5LNVA 3MO7A 3EEGA 4UMAA 2Q8LA 4K37A 1Q6QA 3LXCA 2Y70A 3N3MA 5K2ZA 1H60A 1TB3A 3S1VA 1SFLA 4NJJA 3W7CA 1H7XA 1NAL1 3DFTA 1MSSA 6ALDA 1OJXA 4AWSA 3MYPA 2ZRYA 3P80A 1PL9A 1LRQA 3W1PA 3S8HA 4ZVJA 2BXVA 1SZGA 2PC4A 2QCDB 3T7VA 1K3UA 2VXNA 5LNSA 3G18A 4JNMA 3B04A 1G4TA 4Z0JA 3TH6A 3TXVA 1SZNA 2EAWA 1WQ5A 3N19B 2D73A 2ABBA 4IOTA 5G4WA 3LRKA 1I2OA 4WUIA 2CZ5A 5DCBA 3QPYA 1R47A 1OFRA 4K38A 2QCHA 1SUXA 3MMTA 1LROA 1X1ZA 2E6YA 3I7RA 3NL2A 3MBFA 1LZOA 2WNZA 3QW4B 3TAKA 1B57A 3EX3A 3FYOA 4MJZA 1X8FA 3KRUA 1VYPX 4N9BA 2Q3RA 4RZ4A 1EEPA 1TSIA 6TIMA 4JXCA 5KSWA 3S1WA 1TV7A 3DH7A 4ADTA 2WJZA 4HNNA 4C1LA 1RZMA 3NQMA 5BMWA 4FX8A 4NNCA 4IX0A 5C6MA 1OHLA 1SZEA 3MJYA 1H61A 3P67A 1JCNA 2JGQA 1TPUA 3NEVA 4ZQNA 1TO3A 4P2VA 4UTHA 5GVJA 3MP4A 3OVPA 3L5MA 4ORIA 3DKJA 2VFDA 3W7DA 3ZWSA 4CCCA 2WNQA 4O19A 1K8XA 1LDCA 5CGQA 4ONVA 4FEZA 2Y85A 1KM3A 4CNNA 3NOEA 1RQHA 3OEXA 2NWSA 2VEPA 5D33A 1FUYA 1W54A 1Z41A 2P1FA 3LXBA 1LRTA 2CLMA 1F74A 3QSRA 3VE7A 3UWVA 2ZZ6A 4A2RA 3I7SA 3KHJA 2B7QA 3W2KA 3C6CA 4TIMA 1VCGA 1VQTA 1KM1A 3SSJA 3W2MA 1G7UA 2NZLA 1J5TA 4E38A 4UMCA 4IPIA 4ZQMA 3MP3A 5FF0A 3LDVA 1C9DA 5D2XA 4UFKA 5KITA 4KFOA 1FDJA 3FOKA 1J2WA 3VKJA 3F4WA 3GNNA 4JICA 1R30A 4ZL1A 3W1TA 1P0KA 3E02A 1DJNA 2FLIA 3G0UA 1G69A 2C1HA 3M5VA 4O8RA 1VJIA 1SZFA 1TIMA 3LV5A 3O15A 3PM6A 5D04C 1KW1A 3TQVA 3TSMA 4S2BA 1YXYA 4OGZA 3BGJA 4K6AA 1WA3A 5L9FA 1HFBA 1DQWA 4S2CA 3HPXA 1O5KA 3L66A 2O7QA 4MFDA 1VYRA 3W7HA 3PUDA 2Y63A 2EPHA 1F73A 4QAIA 1KTNA 5C55A 1AK5A 2DZWA 5LSMA 1ZFJA 4M6PA 4MZ1A 3HG4A 4MZ8A 2ZDRA 3B0PA 4N2YA 3D0CA 4Q4KA 3NPWA 4O0KA 3QH2A 4Z1AA 3IVTA 3N34A 3LHWA 4MY1A 3UYCA 3L5LA 2A7NA 3M16A 1OYCA 4ADSA 1PE1A 3P84A 4LNYA 3CIWA 4RX0A 3Q37A 1TJPA 3MW7A 3JS3A 5HQEA 1KFKA 1M7PA 1A5AA 1W3IA 1CI1A 1MO0A 3PVFA 4UMBA 4O4VA 4TU1A 2Y7DA 3P8IA 1M5WA 3CIXA 3QPZA 5KZMA 3HGOA 4O0ZA 1QPRA 2C0AA 2NUWA 3S42A 1FBAA 4NNBA 5E93A 2Q3OA 2V9DA 4UFMA 2B7NA 1RR2A 3R8RA 3DFQA 4NX5A 3W7JA 2RKXA 1UJPA 4I7UA 4XKYB 4HN4A 1OX5A 5BNKA 1EWDA 3UWUA 2ALDA 1KBJA 3W2NA 3ABSA 4RLIA 1W8SA 3LHTA 4O11A 3WJXA 1F7BA 2E5DA 1CX9A 2J24A 3P5ZA 4ICNA 3T78A 3W07A 5BW6A 2CZFA 4I9AA 3W87A 3EWWA 4XBKA 1LBLA 2C19A 2QEZA 4BK9A 1LOSA 1ML1A 5C5YA 3RFAA 4YCOA 3HPZA 3QYQA 4WXYA 3NNTA 5D2VA 4KFNA 3W3OA 1OFBA 4XTIA 1JVNA 1VYSX 3BK0A 4K39A 5F2GA 2PCQA 2DJLA 1TPEA 3TC6A 3W83A 3WJYA 4UFLA 3W7LA 2YPIA 2PE4A 1KTBA 1SW0A 4DF2A 2FTPA 2Y7GA 4AF0A 3DHDA 1G4SA 1LCOA 2A1YA 4JX4A 1XL9A 4RZ5A 4RV8A 4NZFA 3LRMA 2GVJA 3SZ8A 3O6YX 3RLUA 2NV2A 3LTSA 3UXDA 3M1ZA 1AW1A 2A5HA 2QCNA 1XCFA 3GXPA 2DZXA 3W9ZA 1ZJIA 3TXZA 3ELFA 4JS3A 2X1UA 4WXZA 2BSLA 2Z0IA 2C3ZA 4WD0A 3Q94A 4HNUA 1ICQA 1Z42A 2XN1A 5K9XA 3DFSA 2FJKA 1EIXA 2J27A 3CWOX 3LTYA 3OIXA 3SFKA 4JR5A 3WJZA 2B0MA 4MZYA 3W1NA 5AYZA 1U83A 2H8XA 4L4MA 1RQEA 3A5VA 2JK2A 1FWWA 1S3HA 2DP3A 3RU6A 1HO1A 3O6DA 2H90A 3W7MA 3WK0A 2VFHA 5LKYA 3L0KA 1O94A 4JN6A 1JRCA 3THQA 3QMRA 5CPOA 1H7PA 2AGKA 3PUEA 5AC7A 4OV4A 4NVTA 4LVFA 3NM3A 3GR7A 2J9XA 4MKNA 3CC1A 4UTWA 3S5OA 4O15A 1LTDA 5FEWA 1QPOA 3B0UX 4JTJA 3MHGA 1SSDA 1RVGA 4HNVA 5HINA 5LNRA 1MEIA 1W3NA 4BF9A 4GUHA 1P5BA 2C13A 2B7PA 1OX4A 1MEHA 3RF9A 4IMEA 4LS2A 1I45A 2ATMA 3KVMA 3TW7A 2NXIA 4O12A 5D38A 1TTPA 4CNPA 4IPJA 4GNJA 4NZJA 1W5MA 2A6NA 1KTCA 3W7NA 4GRSA 4D2JA 3IIPA 1LRNA 2G95A 3C2RA 3O6CA 5FF2A 3DI1A 1YDOA 4KWWA 5CZSA 1TQXA 2YYTA 3W74A 3BLFA 5HR7A 2V30A 1QOQA 5ABTA 3E9AA 4O1BA 3THAA 2W0UA 3G1YA 1SR9A 1JCLA 2H6RA 3CLMA 3ZR4A 4HIBA 1F2JA 4O16A 2X1TA 3ATYA 1JJKA 1GEQA 4IMDA 1GT8A 4UFIA 3U8GA 3L21A 3SY5A 2QUTA 4N6FA 4EF9A 1FX6A 2HS8A 4QNEA 3NQGA 4DO5A 3P7YA 4X22A 4WZHA 3W7RA 3IIOA 3EXSA 3CPRA 2Y6ZA 4DQWA 3UPBA 4LVBA 1PHQA 3NPVA 1KBIA 1EP3A 4GUGA 1OFQA 3TDFA 3W1XA 4UR8A 2FFCA 5D03A 4O10A 2TYSA 4TX9A 2RFGA 3IGXA 4CLMA 4ALDA 1K7XA 1PHWA 3HB9A 3KAOA 4H6KA 3BO9A 3WK2A 4A29A 2WNNA 2VKZG 4OHQA 3OBKA 1A50A 4UC5A 1NEYA 1TQJA 3NL6A 2ZA3A 1FXPA 3GIYA 4WQ6A 2GVGA 3M7WA 1XBVA 1TJRA 4XUGA 3USBA 4OV9A 2OX1A 1Q6OA 1T0OA 1H7OA 3CEUA 3UWZA 5I3IA 3W76A 1VZWA 3PG9A 4YLWA 4XQ6A 1ZY9A 2G97A 4OQVA 3LLDA 4UTLA 4Y8FA 4JIPA 5DCDA 1WX0A 5LZLA 1YYAA 3O05A 3LLFA 3T55A 5I3FA 5LHEA 2W6RA 3R13A 1IXQA 3IIVA 5EA9A 2V0TA 1R2SA 2CLLA 4EF8A 3GR8A 1MXSA 1TPDA 1Z48A 2XN2A 2Y88A 3UY7A 1N55A 4AWUA 3OVQA 3F4NA 3MI6A 4N9EA 1BEUA 1WDWA 5HUPA 4DEFA 3PWAA 5J5DA 4RXFA 3SW6A 4GJ1A 1RV8A 3W7OA 5G2WA 5H91A 4XBSA 4HSOA 1C8VA 5AOUA 4YXGA 1JCXA 5K4XA 5AB3A 4FIQA 5DBUA 3SGUA 5G1TA 4UFJA 2O7SA 3LCHA 4PFMA 3N9RA 3GYEA 1Q45A 4JYDA 3PR2A 1L6YA 2R8WA 2VFEA 2HTMA 1W1ZA 4LC8A 2QCCA 2XN0A 3UWYA 2X30A 1GZGA 1Q6RA 2DJXA 4O53A 3KRZA 4IJBA 2I1OA 3HMJG 3B06A 1K8YA 3AO0A 1ZHAA 3BG5A 4DF0A 2Z2UA 3S1UA 3HG2A 4WY0A 4O50A 3SR7A 1JUKA 1DHPA 4H3DA 1VHCA 4MIMA 2VEKA 1GQNA 4MLRA 3W75A 2ZZ5A 2FB3A 4FB7A 2DZUA 3NR0A 4JYFA 5CPLA 3TK7A 1Q3NA 4LU0A 2H3BA 3KVKA 3BGGA 2CW6A 3QMTA 4M19A 2ISWA 3TR2A 1JQXA 2ZRZA 3LCWA 1TPC1 2QCEA 1G6CA 3M5YA 1L6WA 2DORA 4FNQA 4A3UA 1VHNA 1YXCA 2ZCGA 3LCFA 4LC6A 3WFAA 5LNWA 1GWJA 4RCXA 3VNDA 4W9TA 2HSAA 1EB3A 1OFOA 4ZQPA 3GZ3A 4NU7A 3TW6A 3GKFA 1R2RA 1TYGA 4Z0SA 1K8ZA 2ZRXA 3OA3A 2A4AA 1GVOA 1MEWA 1GJPA 3M5ZA 3STEA 4CQAA 1W0MA 2JKAA 1LLWA 5MHBA 1XBYA 5CPNA 4LV9A 1NVMA 4KKXA 1FDYA 3L9CA 2WSRA 4N4PA 2ZA1A 4BWLA 1Q6LA 5D05A 1QPNA 4IMGA 3LERA 4LVAA 3FA5A 4K8HA 5DELA 5F2LA 4NXSA 3EX1A 4FNPA 2OCZA 2YGYA 3C56A 3MI2A 4QM1A 4MUZA 3G0XA 3C61A 3AJXA 3PBWA 3EKZA 1KM4A 3O06A 2DZVA 1O95A 4AF0B 3HO8A 2A85A 5I3KA 4UCGA 2C15A 3W85A 1GG1A 3NG3A 4CNOA 3C0JA 1KM6A 5DY3A 3HOJA 3SGZA 2YSWA 3BLIA 4FX7A 5D2TA 3P74A 1UUMA 1X6UA 4K7VA 2ZA2A 5EY5A 1N8FA 2VELA 5K9DA 2C18A 5E0KA 3ABRA 2YX0A 5D09A 4K8EA 1T99A 4DO4A 4JX6A 4YCPA 1H1YA 3P62A 1OFAA 2WO5A 3NQFA 2WSQA 3G3DA 1WOBA 1ZAIA 2WSYA 2PRHA 3EX2A 2DZPA 4I7VA 2QJGA 3HPSA 4FO4A 3M5XA 1W31A 1SO4A 1BWLA 3W1LA 1ADOA 2A0NA 3HG5A 4O1CA 5F2MA 1QFEA 4UTWC 3NL3A 2FPTA 4UR7A 4A22A 1ME7A 7TIMA 3IIZA 3PAJA 3I68A 1OFPA 4TO8A 4BI6A 2OJPA 3LI0A 1XUZA 3TE9A 1NF7A 1H7NA 3A5FA 3KFTA 3TUUA 3QQ0A 1WBHA 1GOXA 3ABQA 3UWWA 1LORA 3T44A 1FDZA 1EUAA 5HWMA 4JX5A 3VI2A 3KRSA 1OX4B 3LI1A 4KFPA 4R53A 2CLKA 3LM7A 1K02A 3P81A 3ZS4A 1ME8A 2EKCA 4LOCA 3TMQA 4O17A 4MLJA 4XZ9A 3G1DA 5FF4A 3N2XA 3W73A 3MBDA 2QR6A 3G1XA 2QF7A 4U28A 1K7EA 5I3HA 3E49A 3LV6A 2BZNA 5E1QA 2A7RA 2NV1A 4HKPA 3NQVA 3FS2A 1W37A 1FWTA 4RZ6A 3HJZA 4NT0A 1BKSA 3NQ8A 3WJWA 1YDVA 3BLEA 5CZ0A 3KVLA 4YMZA 2YW3A 3HBLA 1PVNA 3M0ZA 1QO5A 3LB0A 1JR1A 2WPBA 3LCLA 3W72A 5HULA 2ZRWA 1B4KA 2YR1A 2V2CA 1QPQA 1YADA 5H2ZA 1S5WA 3IV3A 3IVSA 4M6VA 3TFXA 2IQTA 4JIQA 3NM1A 3L0NA 3EX4A 3GAYA 1QR7A 8TIMA 4QISA 4O54A 4HT3A 4DO6A 3P8JA 1ICPA 2AQWA 3M43A 4H4IA 5BOOA 1OK4A 1W5PA 2Z6IA 3UD6A 4PTNA 1D3GA 1YTKA 5AHFA 1Y0EA 1VCFA 4LWWA 3TNOA 2E6DA 3KOFA 2FIQA 1SSGA 4FIRA 3GK0A 1YPIA 2OZ0A 5T26A 4LRSA 3B0VC 1H50A 3TAOA 3I7QA 2CLIA 2YFNA 3STGA 2ZBTA 3W1MA 1HL2A 1RD5A 3S0CA 3MWAA 1SW3A 2E6AA 5EMUA 5LGXA 4MFEA 2FQIA 3P82A 2ZFAA 1DQXA 3GDRA 1NFBA 4KWVA 2GQ9A 4YL2A 4E2BA 4EVZA 1T96A 5F4WA 3L68A 3DZ1A 4P61A 1M6JA 3L65A 1GTHA 5HR6A 3ATZA 4CCDA 1DJQA 4JTTA 4DBDA 4HSNA 2QCMA 2C14A 4PEKA 2R14A 4LVGA 4LS1A 2A7PA 4GUJA 1GYNA 4ZMGA 1XKYA 3LXAA 1YXDA 2ZTJA 2ZZ1A 2V2HA 2QUUA 4N4QA 1H51A 1YTDA 4RJEA 3G1VA 5FEZA 2ZTKA 2QJIA 4FHAA 3JR2A 1TPFA 3QJAA 2QJHA 5CKSA 3GXTA 2E6FA 1ICSA 5AHMA 2Y7EA 2NXHA 1DBTA 2V5BA 5FI8A 3PB2A 5U4NA 4A2SA 1JCYA 4GFSA 2VC6A 1PIIA 2V81A 4AAJA 1B4EA 4FNRA 3PBVA 2WV8A 2QUVA 4QITA 4O57A 1OK6A 1JCMP 3O63A 4IUOA 3I6RA 4LT9A 4M5PA 3G3MA 3G24A 3IVUA 1QO2A 2XFWA 4UUIA 4B5NA 1M7OA 4AVFA 2YDAA 3E96A 5KINA 4Y96A 3SI9A 3EWZA 1F76A 1ZNNA 2Q8ZA 3BW2A 1PCWA 4TR9A 4XTDA 4LRTA 4WY0B 1D3HA 2Y89A 3A21A 2TSYA 3CT7A 3L67A 2RDWA 4MJMA 3PBUA 4UTKA 3OG3A 1UUOA 3G1HA 2NX3A 1EP1A 3QSTA 1VCVA 3G8RA 3GDLA 3BARA 3QW3A 4BFAA 1AMKA 5DLCA 3DKLA 3BG9A 2UV8G 4IXHA 1QNVA 3F03K 4PL2A 4JTEA 4OWGA 3M9YA 3A22A 5C54A 3LHYA 4FXRA 1OFEA 1OYBA 1UBSA 4AEOA 1OFDA 2X2GA 4DF1A 1YLVA 5D32A 4CQ8A 3DI0A 4BWLC 4ZQCA 1FCQA 4PH6A 2BLEA 4EWND 5EKYA 1IXPA 4OBTA 4A21A 1LOLA 3P61A 1YTEA 3W1UA 1W5NA 3TMLA 4CCEA 3PS7A 4K36A 1EUNA 2NLIA 4O13A 2Y62A 1SW7A 3W7GA 1L9WA 2VFIA 1I2PA 3MI3A 4O1DA 2AAMA 3NGJA 1KV5A 3GXNA 3INPA 3LX9A 1D9EA 1I8JA 5G1YA 3OHIA 3R89A 2KZHA 1SO5A 1OABA 1ONRA 2CLEA 1KM2A 1TPVA 5D37A 1TTIA 5HMSA 4ZZ9A 3T40A 5G5IA 3W22A 1FCVA 3OVRA 4Y90A 4R34A 5AHEA 4YWIA 5I3GA 1IGSA 5F4SA 4BR1A 1VS1A 2F7FA 2FDSA 3G1SA 3Q2DA 3DAQA 2E77A 3GNDA 3ANYA 4TMCA 3LCGA 1O60A 4FNUA 1DV7A 4M7SA 3MHUA 3BPWA 3LBCA 4DPPA 3KXQA 4ORMA 5G4EA 1P1XA 5TBOA 2BX7A 2V5LA 1IF2A 5TIMA 1VLWA 2X16A 3QM3A 1E51A 3CEPA 4N9DA
chains in the Genus database with same CATH superfamily
1JQVA 4XZIA 3MDWA 1C9WA 1NF0A 1ZJAA 1US3A 2KAUC 2PP1A 2F38A 4HP5A 3DHFA 3APTA 3H7RA 2FPYA 2ATSA 1A5CA 3V5CA 2EQDA 3NQ2A 2X41A 4QAWA 1OCQA 2C91A 3EEZA 2V82A 1VC4A 3MUAA 6ENLA 1TWIA 1TFVA 3CU2A 3ARVA 4IQLA 3TNBA 1ONWA 3NURA 1XXXA 1EP2A 3LY0A 3NQ6A 3TQKA 1EA0A 3AICA 4UTUA 3PC0A 3PZIA 2CHRA 3WJSA 1W3JA 2VWSA 4I6VA 1GKRA 3AXHA 1JFXA 4XD4A 1REQA 4UQAA 4L6HA 1KV8A 3E0VA 3RLVA 4LBSA 4D8LA 3WLPA 3S83A 2WJEA 3RR1A 2I5GA 1VRDA 3RITA 1XFCA 3NDYA 1CCWB 3CYVA 1TWWA 3DXIA 4D6CA 4I9JA 4PTDA 3R5EA 2H9AB 2P3ZA 2VZSA 2VUNA 3UU0A 4W84A 5AECA 1XFBA 2VNCA 2MNRA 2UBPC 3ANUA 4UIOA 4UTTA 1PO9A 2O4QA 1XD1A 3M41A 3PZQA 1J6PA 2EPKX 2PDYA 2G37A 4ZSUA 1CB7B 2W63A 2WPGA 1R3VA 4I5UA 4CQDA 1AMYA 4YS1A 2LLEA 3CJPA 2ZX7A 4YWSA 5JU6A 1JULA 4BJHA 3ZR6A 4XK2A 4AMAA 3IJLA 3WUFA 1DIKA 3EOLA 5BXPA 5F2IA 3GVRA 3JZUA 3LNPA 2BXYA 4IM4A 3N2CA 1PZ0A 2NX9A 2E5BA 4RXGA 4U31A 2CKSA 1EQPA 2CXGA 8CGTA 3QV9A 3WH7A 1VIZA 4JD4A 3NZQA 3C86A 1FY6A 3UVIA 1SM9A 4B4HA 3WQ8A 3A4WA 5TQLA 1KR0A 1UQZA 5IHSA 3NO1A 3M07A 2WQPA 3W1RA 2DSWA 1NOWA 1R3TA 5CAHA 4HK6A 3NXFA 1S5MA 1LWJA 1QT1A 1GTEA 4EXQA 4S3GA 2ZZ2A 3LHZA 3WLNA 4PA8A 4Q6JA 2WOQA 1ZL1A 3ZOAA 4QEEA 2FJUB 3N9SA 2DZTA 9XIAA 2F9RA 2Y0FA 2TMDA 1XLEA 4JFUA 4ZODA 5DX7A 1K77A 4DLFA 4IZGA 1OX6A 2BV9A 3RMEA 2DZSA 4A8NA 4EIVA 1JG9A 3CHFA 4X61A 3OLIA 1LL7A 4L7ZA 4AZ7A 1GVQA 3Q45A 3OPSA 4NUWA 2VEGA 4E2DA 4PRTA 1V7YA 1JZ2A 3VA8A 4PUWA 2VRQA 3NXLA 4YTQA 5BU6A 1O5XA 1BG9A 3H6OA 3FEMA 2YZRA 1C93A 4GXWA 2XIOA 4JDYA 3WF0A 2ONEA 1TPB1 3QRHA 5E09A 2OYMA 2QCLA 3T0DA 1L2UA 2B7OA 2VQTA 2B31A 1XP3A 1BXNA 1YW1A 3OBAA 4I6KA 1XQLA 5D2YA 1HG3A 2PZ0A 3C4UA 4GMEA 2XIJA 4H7ZA 4PBEA 4L1WA 1LYXA 2IKGA 1AFSA 2PWEA 4H7CA 4CU6A 1EBHA 4D9PA 1P6CA 4NILA 2QCDA 3QGVA 3WCZA 3CUHA 3UZJA 1PXGA 5F1VA 2Y61A 1QVBA 3PY2A 2PWDA 1KCXA 1SFJA 8A3HA 1XLIA 1K8CA 4CQBA 2C71A 1WAUA 4YU1A 3CB8A 2VR5A 3W7KA 3N2BA 2WWCA 4EKJA 5C9ZA 3WBEA 3KOXA 2W27A 1CXHA 2ZOXA 3MS8A 1RQBA 1KXVA 1UKOA 1TPH1 3DFOA 3R43A 5CJNA 2HV5A 3TQPA 1LP6A 4I90A 5JIPA 2CFFA 2GJLA 3OZYA 3WLTA 3NJ3A 1ZALA 4J40A 5CPMA 3LA4A 3QQ1A 2GOUA 3HPAA 3EWUA 2FTWA 4EPKA 1JUEA 1OYAA 2J4GA 4HNTA 3DGRA 3NVTA 5A2CA 1SJDA 3WUBA 2TRSA 5HPCA 2Y5JA 3OGSA 1E3ZA 2VGIA 4KERA 2Y5EA 4MKVA 1E1CB 3W23A 4JTHA 4ZSTA 1OF6A 3PZTA 5CEWA 1LLZA 3T0TA 1BRLB 3PHAA 4UCFA 2GDVA 2DIEA 3VGBA 3DFHA 1BXBA 2QAFA 1FCUA 5C9XA 1UWAA 1NSJA 4XIAA 2YKKA 1GORA 2OOFA 3GW0A 1IIHA 3HFTA 3BXWA 4YVPA 4UTIA 2HXTA 4C6BA 1KM0A 4LYKA 3MP5A 2CLOA 5FF3A 2POTA 3LRLA 3VGFA 4OUIA 3GDTA 1W3TA 1KA9F 1PIFA 1WP6A 3QY8A 4GG9A 4Z2KA 1GQIA 3UCQA 3WFLA 2QIIA 2WHLA 1JI1A 1K9FA 2NXGA 4UXDA 4NQ1A 1PKYA 1AODA 3MVTA 2XFRA 4JYEA 1CLVA 1R2TA 1TPWA 1KB3A 3VMNA 5LGZA 5M17A 4ZQOA 2ZZ3A 3S1XA 1IZKA 1DWAM 4HPJA 5K7JA 3AXXA 4AD1A 5CSSA 1GVYA 3E12A 1QMLA 1QPKA 4AY8A 5A6MA 1Q7MA 1H1ZA 3W7QA 4JHZA 3N73A 4CNSA 3SRHA 5CPSA 3VOIA 5CZJA 1CPUA 3W1QA 1ECEA 1F6PA 4ML9A 3ES7A 4LAOA 1XV8A 5K9CA 3CQHA 4ATWA 4FF7A 3G1RA 1SQ7A 3OJGA 4K68A 2WVTA 4UNKA 3VCRA 1VF8A 1O7AA 1KR1A 4RKAA 2YBVA 4AYSA 4NNAA 2XGIA 2PRMA 4WJ8A 4FMVA 4Z2LA 2WMJA 4JFTA 4C1KA 2PB1A 3NL5A 1ELSA 3LHUA 1J12A 4GVHA 1R0MA 3KWSA 4JTIA 3E0IA 1A5UA 1UQYA 3E2QA 1ZENA 2GVYA 4G1KA 3VOGA 1FH7A 1LQAA 1PPIA 1PKNA 5A8GA 2WXDM 2XH7A 5HJLA 3BOFA 1WXYA 4GZIA 4DB7A 3OA5A 2ASHA 1H5YA 4PL1A 2BVTA 1WNOA 2V8ZA 3QTPA 4H8VA 1R46A 2WB5A 4JCMA 4GGBA 4P8WA 3QHOA 3FA4A 1T8XA 1XIMA 3CQ0A 5FF7A 3B05A 3H2MA 2YXGA 2EPLX 1JDCA 1KFCA 1RBOB 1K70A 2NWRA 3K46A 1SPQA 1H7WA 3EX6A 2PGFA 4HA0A 4LV4A 4LYRA 1HJUA 2NUYA 4GKTA 1KD0A 3UJEA 1KRAC 1U2YA 4N6EA 2PDFA 3VMPA 1H0GA 4LY8A 2XUCA 1ZBVA 4IP7A 3VDHA 1HTIA 3MV01 4HPGA 2V3GA 4QROA 4A3HA 1KFEA 2A3AA 4MVAA 2NQHA 2PU1A 3STFA 1IXNA 5HWJA 4JIIX 3O8AA 3KWXA 4GC3A 1J0ZA 4YTTA 2Z6JA 2QMKA 3EYPA 2A21A 5FEXA 4KETA 3R79A 3A6OA 3SRFA 1SGJA 1LOQA 3QEZA 1UZDA 3TYCA 5BROA 2GYIA 1HGWA 5D02A 4PMQA 4GNKB 2GPTA 3GWQA 3KZSA 4I9TA 3T0CA 1B9ZA 3TYBA 4BF7A 1KRMA 3VIKA 5IBXC 4CNUA 3EEGA 2Q8LA 1NQ6A 1Q6QA 4K37A 2WM0A 3LXCA 2Y70A 3N3MA 1W1VA 1H60A 4F9DA 3CWHA 1ISWA 1EBGA 2XWDA 4LBRA 1WZMA 4NJJA 3W7CA 3DFTA 1MQQA 1UKQA 1MRQA 3MYPA 3EBVA 1E4LA 3DYMA 4Q4PA 3MSYA 4ZR8A 1LRQA 3W1PA 1UC5A 3BAYA 1UWUA 2BXVA 2VXNA 1FFRA 4KS0A 4OOZA 4ZENA 1FWCC 4JNMA 4MB3A 2DVTA 4M1RA 3TXVA 1EL3A 3EDJA 1WQ5A 4QTGA 2D73A 1UH2A 2ABBA 3LRKA 1CEOA 2YL6A 3ZJKA 4WUIA 2Y8UA 2CZ5A 1A5NC 3UCCA 1R47A 1OFRA 4JNYA 1SUXA 3MMTA 2VURA 3NL2A 4I3GA 1LZOA 3EAUA 1O1ZA 1T6MA 1IHIA 1JD7A 2O92A 4N9BA 3MUIA 2PDGA 1HJQA 1YEYA 1YE4A 2UZ9A 1DYSA 3S1WA 3DG3A 4A4AA 2GGJA 2VCAA 1TV7A 4CGTA 3CQIA 1UW9A 3A3WA 5C6MA 2JEPA 4LAMA 2YBTA 3P67A 2GFTA 3UA4A 4HJFA 3NVDA 3NEVA 5C9WA 3ARRA 4KWSA 1JZ6A 5A69A 3L5MA 3HA1A 4YJ5A 4ORIA 3WYZA 1UYQA 1K8XA 4OOUA 5CGQA 4ONVA 2GUBA 4G9PA 3HU7A 4HK7A 1J11A 5I02A 5D33A 5FSDC 1VPQA 3WH6A 5DT7A 1F74A 1QXLA 2WC3A 3QSRA 3BANA 4GYPA 3UWVA 1P0DA 3I7SA 4Q4SA 1N82A 2WVVA 1UHVA 2IKHA 3V0TA 2PTYA 2V63A 4MB5A 3H2FA 1O6IA 1KM1A 3W2MA 2Z7GA 2FFIA 3MP3A 1OM0A 3MV11 3W37A 3LDVA 4UFKA 2W3ZA 1A49A 1W3KA 3T81A 4JICA 3ZVIA 1R30A 1DJNA 3SSZA 2FLIA 7REQA 2GDQA 3VIIA 1TJ1A 5JMUA 1SZFA 2BGQA 3O15A 1CECA 1GPFA 4TTGA 1AH3A 1YXYA 4JHMA 1WA3A 2VM8A 3HPXA 4DJEC 3ITYA 4GOAA 3L66A 4F0SA 1YNQA 3W7HA 3O3RA 3PUDA 2ZXDA 1E3XA 2PUZA 1A3HA 1F73A 3GRIA 1KTNA 1TR1A 4BCEA 2VOTA 1JIBA 3URQA 5G4HC 3EA2A 2FHCA 3LEPA 2GQ3A 4M8UA 5HA7A 1E9IA 3NPWA 3BMVA 3WNOA 4Z1AA 1CLKA 2A7NA 1YDYA 3UERA 4CVUA 4LNYA 3NGFA 4K3ZA 3Q37A 3U2ZA 1Z69A 3AYVA 1M7PA 2FDMA 3C0QA 4N7QA 3UR7A 1LG1A 4UMBA 4O4VA 3P8IA 5KZMA 1FA2A 2C0AA 2NUWA 2QV4A 1GW9A 5E93A 2Q3OA 4UFMA 4WDXA 4H9MA 2B7NA 1RR2A 3R8RA 1XWYA 2RKXA 4DUOA 2QULA 1OX5A 5CGMA 5BNKA 1V6VA 4ACZA 1EWDA 2ALDA 4H6RA 4J3SA 4GQGA 4GJIA 4O11A 4PUUA 4MF4A 2PMQA 1BSLA 3S2CA 1F7BA 3OYZA 3P5ZA 2J24A 3CL6A 3T78A 4QE4A 3H23A 1JZ8A 4XBKA 1LBLA 1D3CA 4TOQA 1RSCA 4R9OA 3LPFA 1MNZA 1LOSA 3L4WA 4IIGA 2FKPA 1ML1A 4Q7IA 3H26A 3NNTA 4WXYA 5BZAA 4XTIA 1CT5A 4V33A 2NSXA 1VYSX 4K39A 5F2GA 2PCQA 4X60A 2O9PA 1TPEA 7A3HA 4AZHA 3W83A 1OC7A 1DHKA 2YPIA 3LLXA 1KTBA 1SW0A 3HQPA 4FF5A 4RV3A 1K4GA 3DHDA 3PJXA 1LCOA 2A1YA 1V0KA 1J0JA 3N13A 2NV2A 2BGSA 3UXDA 3M1ZA 1AW1A 3THDA 2DZXA 4O8AA 3DGBA 3W53A 2CWXA 1TVLA 1PWLA 5H8UA 2C3ZA 1JDAA 1Z42A 2XN1A 1PAMA 2INFA 3DFSA 4ZTXA 2FJKA 1EIXA 4XAGA 2J27A 4NAFB 2DIKA 4QDPA 2PA6A 2B0MA 3A5VA 3RX4A 2H90A 2MUCA 3RJYA 2Z25A 4DBWA 5LKYA 4OTKA 4JN6A 3PTMA 4HA3A 1VFTA 4AZ5A 5CPOA 4W86A 3PUEA 1JF6A 4O1FA 5BWFA 3AZSA 3S5OA 3VILA 1LTDA 3EB3A 5LIXX 3H8AA 4JTJA 3ARZA 5LNRA 1ODZA 1ITCA 1CGUA 1W3NA 3W4RA 2DIJA 3RF9A 4LS2A 1ZQ5A 3W00A 1F07A 3AXMA 3IIPA 1EJVC 3ZJ6A 3WD0A 3UXKA 4DZ5A 3Q67A 1C8YA 2OELA 5CZSA 1TQXA 1UR0A 1XCWA 4OKDA 3PZNA 1RJQA 3NYDA 2F61A 4JQ4A 3KBSA 5FJUA 2W0UA 3VDCA 1SR9A 2ISFA 4QE1A 1XR2A 3B9AA 1B31A 2NQJA 4IMDA 1XPYA 3U8GA 3SY5A 3EMZA 1L8NA 4QNEA 3KTXA 4BF5A 2HPMA 1EHNA 1PHQA 3NPVA 1KBIA 4B5XA 1M41A 4GUGA 5DMLA 4UR8A 2FFCA 2TYSA 4NY2A 4S3JA 1X8CA 4DXKA 4OBSA 5CC3A 2R82A 3HB9A 3BO9A 2EG7A 2VKZG 5A6AA 4OHQA 1XDJA 2QPUA 4IFOA 1TQJA 4C6FA 1FXPA 3GIYA 2GVGA 1XLJA 3MUCA 4LEQA 5DMYA 1BAGA 3USBA 2OX1A 4GJJA 4PUJA 3CEUA 1H09A 3UWZA 2YLLA 4LXFA 4NZ4A 3L4TA 3S2NA 4LALA 3BQ5A 4OQVA 3M0XA 4Y8FA 2CLPA 3XIMA 1WX0A 1NQKA 3DBNA 3M0MA 5H6HA 5I3FA 2CHNA 2HJPA 3WMLA 4E4PA 3KW3A 2INZA 1R2SA 2XN2A 2FYMA 5D8WA 1ZBWA 3F4NA 4N9EA 4RZBA 3PZOA 1BEUA 1QUMA 3WLHA 4PCSA 2ZUVA 4XISA 4RXFA 1PSCA 1RV8A 3W7OA 5G2WA 3B8SA 4CQCA 2R1NA 3VNYA 4FIQA 4LAUA 2VX5A 3AMLA 3RILA 3SJNA 4UFJA 2PBGA 4GIYA 5HMFA 4D6IA 4PFMA 1H49A 1B3ZA 3N9RA 4JKKA 1Q45A 4CD7A 1TCMA 2CESA 2PCEA 1XLLA 4B3KA 1L6YA 3VU2A 4LCRA 5HANA 1V6YA 2ZIDA 3KRZA 3PJWA 1CB2A 4JIEA 4C6NA 4WJXA 4DF0A 2HBXA 3HG2A 3SR7A 5XINA 2VZTA 4H3DA 4MIMA 2QGHA 4MLRA 3W75A 4GKLA 4XZHA 2FB3A 1YE6A 2CXEA 1T7LA 4KCWA 2PTWA 3TK7A 1IT0A 3U7BA 4LU0A 4P7NA 3DUGA 2WQDA 1M3UA 4QR6A 2ZRZA 1QNOA 4GY1A 3CQKA 3RM4A 1MXDA 3LCFA 3QLLA 3QHNA 4LC6A 2PTZA 4KEMA 4QJ3B 4UZSA 4H41A 4WSHA 1OFOA 1V77A 3GZ3A 3UWEA 4AW7A 1RJPA 3TW6A 3L4YA 4Z0SA 2P88A 1V6WA 2A4AA 3M5ZA 3GG8A 1TX0A 1UPPA 3STEA 1KCZA 5TAOA 5CC7A 1XBYA 2C1IA 1G0CA 4I5RA 4WK9A 3CAVA 2EO7A 2VI0A 2ZA1A 4BWLA 1Q6LA 1QPNA 2DPEA 2DUZA 3EOSA 5F2LA 3EX1A 4FR1A 1Q2RA 2OCZA 2E3ZA 1ITQA 4MUZA 3PBWA 3AJXA 4KBXA 4F79A 4LUTA 4CN4A 2DZVA 1O95A 5MKGB 4AF0B 2A85A 5I3KA 2PLKA 3L12A 5PTDA 4F0RA 4G7EA 3GBEA 1KM6A 4HSHA 1KKOA 3LMZA 2QVNA 3P74A 3PJUA 4K7VA 4ZE5A 2ZA2A 4JQ3A 1EF2A 2VGFA 5K9DA 2C18A 4A3RA 1TVNA 3AIQA 4K8EA 1MW0A 3DX5A 3GFXA 1IQ8A 1E70M 1UD3A 3HFYA 4YCPA 3P62A 1OFAA 3NQFA 1QI3A 2WSQA 1XKJA 3RPDA 3TTEA 1SMDA 3QC0A 6XIAA 4H9UA 3EX2A 3VC6A 4KESA 3VGHA 4PMRA 3AFBA 2ALRA 4Q7NA 1BWLA 3ALGA 4IIDA 1ADOA 2A0NA 1QU4A 3HG5A 4O1CA 3PPCA 3BE7A 3ZJ8A 3WQOA 7TIMA 2EJAA 3IIZA 1B2YA 4J1OA 1OFPA 3FV9A 2OJPA 3GTFA 3LI0A 2G50A 4LUYA 1NF7A 3PUGA 2JF6A 1FRBA 2ZC8A 1WBHA 1U33A 4AD5A 3UWWA 3T44A 3AI0A 3KZPA 3VI2A 3KRSA 1TE6A 3R6IA 5HMEA 4C6KA 1M9HA 4R53A 1M65A 3S2JA 1F6YA 3LM7A 2VP8A 2EKCA 3TMQA 4WHBA 4O17A 4MLJA 2Z4GA 3G1DA 4V27A 4D1IA 2QR6A 4HA4A 2QF7A 4U28A 3MO4A 4ROPA 3WDJA 2BZNA 4HKPA 3NQVA 1NTHA 1ONEA 1UMLA 2H9AA 3HJZA 1BKSA 3NQ8A 2YW3A 3VNLA 3LB0A 4MM1A 2WPBA 3W72A 1Q8AA 4HK5A 3ITGA 5HULA 2ZUWA 4Q4OA 3NZGA 1B4KA 2YR1A 2QGYA 1BYBA 3WUEA 3G5EA 3IV3A 4M6VA 4ZBCA 3UA3A 3NM1A 3L0NA 5LIYX 4BZYA 1CGTA 1FWIC 2V5JA 1CENA 3PTDA 1QR7A 4QISA 4L9YA 2AOSA 4M3PA 5TNVA 1JNDA 1VEPA 2XIIA 1UH3A 3GY1A 2Z6IA 1LLOA 1YTKA 3EA3A 2XTKA 3E0WA 4RDWA 4LWWA 4E3VA 2R1PA 4GQRA 1L6FA 5FJTA 3WEMA 3WY1A 3BLKA 4XIMA 1W9PA 1IEWA 4TVDA 3VUPA 4BHYA 1W17A 1HN1A 1JDFA 1QJWA 2G3JA 3B0VC 2IUZA 4NZ5A 5CPTA 1XG3A 1H50A 4AD0A 3VGEA 3I7QA 2IPJA 4FS9A 3STGA 1HL2A 3CS2A 2JF7A 3GVWA 4EP8C 3KE0A 3KTCA 1FWAC 1V8EA 1GNXA 1GOKA 4KWVA 2GQ9A 4ZFMA 1LUCB 4Q8WA 1PZ2A 1T96A 3L68A 4G5DA 4HOWA 1M6JA 3L65A 2OOGA 4X2PA 1DJQA 3AHVA 4HSNA 2FH8A 1SZRA 4PEKA 2R14A 4LVGA 1SJAA 3M6DA 3FSTA 3K5XA 5J04A 1TUXA 3IUIA 2ZTJA 2V2HA 4N4QA 3AHYA 1FVPA 3SUVA 3USZA 2VR2A 2ZTKA 4UTFA 3R0KA 2QJHA 5CKSA 2E6FA 1ICSA 4PMJA 1DBTA 3OOQA 1UWSA 4IPPA 1OQFA 4H2HA 5D9OA 2SFPA 2ZXBA 4QG6A 4GFSA 2VC6A 1PIIA 4AAJA 3R4IA 2WJFA 1Y7VA 3O63A 4IUOA 4JIHA 3QV8A 4LT9A 3DC0A 2QVHA 2YDAA 4FP1A 2J7EA 2XFYA 4GCXA 3SCPA 2NT1A 3STPA 4XTDA 3BAWA 4WY0B 1DPMA 4LX4A 1D3HA 3UR2A 2Y89A 4PMNA 3SAZA 3PBUA 4UTKA 3VDAA 3W6LA 5BOEA 5DANA 3VZZA 2C8NA 2PI6A 1LL4A 1F3XA 4B9ZA 4DWSC 3BUVA 2AL2B 2OVLA 1OB0A 1BHGA 2UV8G 1W9DM 4IXHA 3F03K 1M1BA 1NWTA 1GW1A 2E8ZA 5C54A 1OFEA 2PF0A 1UBSA 1PZ1A 2X2GA 1CWYA 1UR8A 2WMKA 4F8XA 2QPSA 3AHXA 2DT2A 1FCQA 4EWND 3CZ8A 2OLHA 4OBTA 4A21A 3U9IA 4L65A 1W5NA 4FOJA 3IGHX 3TMLA 4CCEA 5ABFB 3WH5A 3WNKA 4I8YA 2VFIA 4URIA 4AD2A 1I2PA 2BNJA 7PTDA 1SR0A 2NVDA 2HNEA 5G1YA 4A3QA 4LY4A 2OLSA 3TP4A 4C6DA 1TPVA 1B30A 1A4MA 3BZJA 4W87A 3OVRA 2OZTA 4YWIA 1HJWA 1NFGA 5I3DA 7XIMA 4JCLA 3LSCA 3CL7A 3Q2DA 1J96A 5IFTA 3DAQA 2E77A 3ANYA 3N4EA 3W29A 1DV7A 3BPWA 1UG6A 4I9MA 2EPNA 3GO2A 1E1CA 4IQEA 5G4EA 5TBOA 2BX7A 1S2VA 4CEXC 1M01A 2X16A 3QM3A 1E51A 3CEPA 4N9DA 1BRLA 2J9ZA 3TX9A 3HQ1A 4O18A 4AHOA 1HUVA 5I07A 3U2OA 3A23A 3GE7A 4AX6A 1H63A 1G4PA 1BYCA 3ZM8A 2VD8A 3COTA 3FJLA 1WCGA 1OVDA 3PBYA 4REQB 3UG8A 3ZT5A 3FVMA 4IXXA 3TV8A 3RX2A 3UXAA 1PV8A 3MUXA 3T2PA 5HBFA 4DI9A 1VR6A 2H3DA 3GB6A 4OIFA 2EBNA 4GH1A 1BKHA 1W9VA 1QBAA 3KBMA 4JTSA 1IZCA 4AMCA 3SCNA 1NOUA 1J79A 5I79A 1G9HA 1KXHA 3W71A 5E0CA 4KIEA 1QNSA 2HISA 1LT7A 3SO7A 1MFUA 2E09A 4OECA 3ONCA 2XIQA 4BEQA 3PG8A 3ITCA 1AW5A 4C65A 4Z1YA 6XIMA 3RUBL 1XX1A 4X0VA 5AYXA 4CU8A 1GVEA 1A5BA 1KGXA 4XO6A 3FLUA 2OQYA 2GUUA 3S9IA 2JBMA 3KM8A 4AHPA 4G8TA 3W84A 5KETA 2QKFA 2FHFA 3SRKA 1LBMA 3NQAA 2INEA 2QJMA 3I65A 4Z2GA 5HXMA 1PS9A 4UNIA 1F9CA 2DT0A 3AWNA 4PULA 3PPHA 3P2VA 4S3FA 2XM2A 4AZIA 5D9NA 2W9MA 4QLJA 5EMMA 3NEHA 5EBUA 3C8FA 4AB4A 2VWTA 3B8UA 3PANA 2J7FA 1HKMA 3A3XA 1XM3A 3CO4A 4JQ2A 3VCNA 2F6XA 2RDUA 3KBWA 5CZKA 1Q7ZA 5BU9A 5GQBA 5FAGA 1UD8A 1M68A 3QF0A 1K6WA 4QJ1A 2EPMX 4X3ZA 1C7SA 4JL2A 4ECLA 4O52A 2YCLB 3FYPA 1E4IA 3YPIA 4CD5A 3W2UA 2P0OA 3C2OA 1WDRA 3BLPX 2OKOA 3WF2A 3LBMA 4FNTA 4H2CA 3MKVA 3AU6A 1GEHA 3DDMA 1CYGA 1SJBA 6REQB 1NWSA 1RCXB 1R3WA 4AX7A 1G1YA 1GYMA 2RHGA 1Q6CA 4WY0F 3S5YA 1LL6A 2DT3A 3AISA 2R24A 1EC8A 1W1IE 3R2GA 3NOYA 1EZ2A 2CU0A 3VNIA 3GM8A 1HXJA 1AL8A 3K8LA 3EWXA 3FCPA 1HF6A 3QMSA 2CWNA 3WELA 3F1QA 1TJ0A 2OLAA 4GI6A 1L6GA 2YCIX 4JPGA 1TRIA 2OB3A 4HCLA 3GKAA 4CQ9A 3S2MA 2PWUA 4AC1X 3VX0A 1Q6FA 3U6WA 1XW8A 1ECQA 3FDGA 4Y9PA 4BQ2A 1E6SM 3B8VA 4GABA 5C2XA 3HGSA 3ECQA 3VM5A 3WNLA 4QCFA 5EB8A 4HMCA 1H3GA 3GS6A 5E0FA 5A6KA 3EWBX 3TIMA 4GC4A 3N18A 2WZIA 2J47A 3CPUA 1NU5A 1ZUAX 2VO5A 4CU7A 3CAQA 2YB1A 1TTQA 5B7ZA 1ITUA 2GQAA 3IV8A 4UQ9A 5HNTA 1A53A 3CASA 3R10A 4N02A 2I9EA 2VMFA 1UASA 3V0UA 3WK1A 2P50A 3WNNA 1QASA 3LZ3A 2YL5A 1CXFA 4Z1CA 3IEBA 1X1OA 5AC8A 2YA2A 1EX5A 2GVLA 4AZGA 4DJDC 3L0GA 1S1PA 4CN1A 1GVFA 3RM9A 5A6SA 5CJ5A 2B4GA 3WK3A 1V79A 5IRPA 4GNVA 5HNNA 5T9BG 5AHNA 1TMQA 4I7WA 3SJ3A 1S2WA 2A3HA 2GJPA 4JTUA 4MY9A 1SJCA 5KZDA 4E5TA 3DENA 5KMYA 4YN5A 1O5QA 1MNSA 5DXYA 3AYTA 4NXKA 3V0SA 3SECA 1HP4A 1O5RA 4FSAA 8XIMA 3BV4A 1ESWA 1FWRA 2BWGA 5FAJA 2TPSA 5ABEA 2V2DA 3ME3A 4LVDA 5D2WA 4DY1A 3TROA 5IM51 2QDGA 1HIZA 3FAXA 1V02E 2VDIA 3NYZA 2J88A 3ARXA 4ZQRA 1E56A 3STCA 3T05A 3WD2A 4FA3A 2ZX6A 1I2NA 3CLWA 5DXXA 3QPEA 1HKIA 4WOZA 1W5QA 3CV1A 3SY1A 3PF3A 3GIPA 4ZOCA 1XBZA 4EACA 3W7EA 3RAOA 2BDQA 3QGKC 4KPLA 1TWSA 4UQDA 4YYCA 2YJQA 3EDFA 2X1RA 1K7FA 1S5TA 3G2GA 2OU4A 3TA6A 3NPUA 4CCZA 2FPVA 5ABHA 1LT8A 3VGDA 1KFJA 4Z17A 1D7FA 3R0DA 4NG3A 5L6UA 3PSVA 1XSIA 3TJLA 5EMLA 2VX7A 5D30A 1OCBA 2JGYA 5A8PA 1WYIA 3TU9A 3H12A 3DOPA 4H00A 2RGLA 1KFBA 2I5IA 1IIGA 3TC7A 3AOFA 4US5D 1KFLA 2Q8XA 2OPJA 2AMXA 2OZ3A 1YX1A 4FPSA 3D3FA 4NP7A 4EAYA 2YW4A 3B3DA 1ZLPA 4IWWA 4DJFC 3C2VA 4PUKA 5CGTA 4ICMA 2WVUA 1F5ZA 1XUUA 3O1NA 2H8ZA 1TV8A 2XINA 3BVJA 1HKJA 1EYEA 2ZYFA 4RK8A 2OXNA 3UPWA 5K3VA 3UR8A 1W3HA 1ZGDA 2OT1A 1Q7QA 2ZE0A 4JY9A 1X7FA 1LF1A 1MUCA 4PYSA 4LS0A 4JOMA 1XLBA 2YDQA 1OZQA 2YFOA 2GQ8A 1BF2A 1FFQA 4XV0A 1G7VA 1X1NA 2WZHA 1Q6EA 3NAVA 4LF2A 3W7IA 5T91A 4UOQA 3W1AA 1O1HA 3CZEA 2YA1A 3WG6A 4P8XA 3VIFA 4OZOA 5B80A 1X97A 3Q58A 3H4WA 1BGAA 2QCFA 2BP1A 4PR4A 4W88A 2QJNA 4V1XA 2W92A 4ZXLA 3GDBA 4JFWA 4DIAA 3NQ7A 2D2HA 1EOMA 5DMNA 1YIXA 3G1AA 3H70A 1W56A 2ZWZA 4AISA 5CG0A 2DQWA 5A6BD 5JQ9A 2X09A 2Z1BA 4HHPA 3V75A 3K8KA 3R8HA 4DBEA 3PFMA 4Q33A 3QC3A 3HJEA 3EXRA 3MB9A 1OADA 2CCRA 3GNRA 3I3EA 3WMBA 5CSRA 1QI0A 1DE5A 1A5SA 2RDTA 1N8WA 3DECA 2WLZA 3QZEA 3O0FA 2IKIA 2ZRVA 2BHYA 2QMJA 2NW0A 1NARA 3N9KA 3T0AA 4GY7A 3SADA 3GLCA 4GUFA 3RK8A 1QHZA 2C7FA 4ZGYA 1MWOA 3HIJA 3KBNA 4ML4A 3GDKA 1W1YA 1YPFA 2G3FA 4GE8A 3FX4A 3TQ0A 4D6DA 2W91A 1PX8A 3MSRA 1OG0A 2NVAA 4X9SA 1TV5A 3VK5A 1ZS2A 3MWCA 5FEPA 1Q65A 3AIBA 4S3DA 4DM1A 1GJWA 3H54A 3T8LA 4NX0A 3FJ4A 3EXTA 3CXOA 1VFMA 5GNXA 4NAFA 4C90A 3C3NA 2GK1B 4O14A 2Y7FA 4A35A 3EOOA 4W85A 5ECVA 1OY0A 2XFFA 4Q4QA 2ACRA 1XDLA 5C9RA 4DVOA 4U4MA 1BTCA 3UT0A 3N2MA 2CLFA 3UVAA 1ZAHA 2QUMA 3I3BA 1UZ1A 5EMKA 4FLOA 5I0DA 2X7VA 1ISZA 4BQ3A 3IJQA 5K2ZA 4GQBA 4C1NB 4S39A 1P1MA 4WGXA 1NAL1 6ALDA 5CC6A 1TWDA 3SBFA 1PL9A 3S8HA 5LIKX 3CL8A 2XU2A 1K3UA 1XLDA 2PDHA 4FOKA 5LNSA 3NWRA 2HDJA 3TH6A 1G4TA 5BWAA 3IJ8A 4DO7A 2E9MA 4DRSA 4FLQA 5G4WA 1QNPA 2C79A 2PDPA 3RGTA 3TJIA 4O0QA 3B8WA 4K38A 3BMWA 3SUSA 1BGGA 4S3AA 4MDOA 1LROA 3MVIA 5I77A 3U5UA 1QW9A 2WNZA 3MBFA 1MW2A 3QW4B 3TAKA 1B57A 4DJED 3RRXA 3KRUA 4RZ4A 1Q5MA 5REQB 1WKFA 4HZ8A 4Y9NA 1K6AA 4JXCA 3WF1A 3WFZA 4ADTA 2O9OA 4AY1A 2ZWYA 1B1YA 5BMWA 4ACYA 3MJYA 4IICA 2E9LA 4TTUA 2JGQA 1HW6A 1TPUA 2GZXA 4ZQNA 4C6EA 2G4FA 3MP4A 3OVPA 3SQMA 3ZWSA 4KCVA 4FEZA 3L4VA 3ENLA 3NOEA 3BJTA 3HURA 1FUYA 1VJSA 2P1FA 2VHLA 2HPIA 3LXBA 4J3TA 4PUEA 1XIDA 3Q4DA 3IJDA 1TV2A 2R1LA 4A2RA 1UP3A 4TIMA 1VCGA 1V3IA 2QHAA 3E5BA 4HTYA 4IF2A 3ZO9A 2IPFA 3S47A 3SSJA 1RBLA 4UMCA 4IPIA 4H8UA 2DZAA 4H9VA 4KFOA 2R9RA 1J2WA 3VKJA 1PKMA 4AG0A 4ZL1A 2XIMA 3E02A 3G0UA 1ZU8A 1G69A 2C1HA 2UY3A 1R3RA 3M5VA 4O8RA 3CMJA 3LV5A 3VGGA 1JYNA 3PM6A 3NUKA 1KW1A 5D04C 3TQVA 1SYTA 5XIAA 1XIIA 3EOEA 3GBDA 1XIGA 1HFBA 1DQWA 1OCNA 3QR0A 4S2CA 2CEQA 1WZKA 2O7QA 1Y5XA 2ZUUA 1ZBKA 2Y63A 4UR9A 4BY3A 3N6HA 5GJNA 1US2A 4FK9A 3OODA 3VIHA 2PAJA 2J7DA 4N2YA 3TWBA 4O0KA 2Z1XA 2BY3A 1AQHA 2EG6A 3L4UA 3LHWA 2CBVA 4MY1A 3L5LA 1CXLA 3M16A 1OYCA 3S5SA 1ZP3A 3V18A 3IS4A 1JPIA 4AQLA 3VUSA 2VR4A 3N25A 1Q66A 3GH4A 3HZ3A 1ZBCA 3ORWA 3MW7A 4WIWA 1BPLB 4CD8A 3UZXA 4E2OA 4GZJA 1PZ3A 4EPDC 1A4LA 1MO0A 1B3WA 2WSPA 2Y7DA 1GZJA 1POJA 2EEXA 3HGOA 2PD5A 4NNBA 1S2AA 2ZUMA 1ZTVA 3W7JA 4I7UA 2GL5A 2J62A 5CPQA 1AZ2A 2I57A 3BV7A 5LIUX 4C91A 1KBJA 1ZZMA 3W2NA 3WQPA 3ABSA 1EJTC 4NRSA 4RLIA 1W8SA 1HGYA 1UD4A 1CX9A 5BW6A 4ICNA 4LGXA 3W07A 2HE5A 3WDIA 2P53A 3W87A 4IIFA 4RPQA 2QEZA 2VZVA 4BK9A 3WDPP 3OW1A 3R7MA 2BVWA 3RFAA 2J7BA 2WNWA 4GIAA 2CERA 3W3OA 1JVNA 3BK0A 1I1WA 2DJLA 3W6MA 4UFLA 4I8DA 1E0VA 5MKGA 4AF0A 1KRBC 5C9UA 4YNGA 2J7HA 3GU2A 3GG0A 4RZ5A 3QY6A 1TE1A 3SZ8A 3O6YX 2HE8A 3LTSA 1TELA 2A5HA 2QCNA 4HMNA 1XCFA 3GXPA 3CAWA 3TXZA 3REQB 1V0LA 1XPGA 3ELFA 4XZWA 1I0BA 3SCSA 2BSLA 1UKPA 2Z0IA 4WD0A 5AZ0A 4DX3A 5E70A 1A80A 3Q94A 5H8PA 2P8CA 3OB8A 1FWEC 3CWOX 5GNYA 1OIMA 3CZKA 3WJZA 1M03A 1TR9A 4MZYA 1NIUA 3W1NA 2HRWA 4L4MA 1JYXA 1BLIA 2PGEA 2P0IA 4LBUA 4Q8VA 3VIJA 1G5AA 1U1UA 4NF7A 1NFPA 2FZDA 3H7VA 2OO0A 2FGZA 2EJ1A 3MQTA 3QMRA 1H7PA 1O68A 3C8NA 3CUZA 4WR3A 1GOIA 4NVTA 3B4YA 4MKNA 2J74A 1DIDA 4UTWA 2IKJA 4O15A 5FEWA 1QPOA 2PFHA 3MHGA 1WKDA 3GUWA 2BOEX 3RLHA 3ZYZA 1MEIA 3CZGA 1XHGA 1I45A 2ATMA 3KVMA 1JL8A 1TTPA 3QZAA 5HK4A 4IPJA 4RE3A 1D8CA 1KTCA 2WLYA 2VCCA 1P0EA 1W2PA 2OSYA 1LRNA 4FXFA 3I10A 4TV6A 5I06A 5JVLA 2OQLA 3DI1A 4KWWA 4PTXA 1FHLA 4J28A 2YL9A 3BAIA 4DZAA 1GOWA 3W74A 5HR7A 1XYCA 4M1BA 1QK0A 1QOQA 5ABTA 4WDWA 5BCAA 4O1BA 2IQ0A 3THAA 4E2VA 2QPXA 5C71A 5A2AA 1YMYA 3CLMA 4HIBA 1UBPC 4U3CA 4HNOA 3ATYA 4WKHA 4DXXA 1EA9C 3L21A 2QUTA 3AIUA 3K4WA 1RY8A 3IIOA 4OJYA 3CPRA 2Y6ZA 3VDGA 4RDVA 4C60A 1JZ4A 3WN6A 2YDRA 3IRSA 1EP3A 4TX9A 4MB4A 2RFGA 3IGXA 1G94A 4US6A 3PPFA 4A29A 2WNNA 5AVHA 1ODUA 1J5SA 4WQ6A 4D71A 5T9CE 5I09A 1TJRA 5LXXA 1PX4A 4OV9A 1T0OA 3TCSA 5JUVA 1IT7A 2AKMA 3W76A 4MB1A 3CUGA 3CMFA 3WQCA 3N6JA 1NDYA 4YLWA 4XQ6A 1AA1B 1ZY9A 3LLDA 4UTLA 4JIPA 4M51A 3UR5A 3VABA 3RO6A 1VAHA 1BF6A 3UGVA 4UQBA 3LLFA 1BG4A 1QI4A 5LHEA 2W6RA 3IIVA 5EA9A 3TZFA 5JH1A 1W1PA 2CLLA 1A0EA 3AAMA 2Y88A 1HQTA 3OVQA 3MI6A 1P7TB 3LGDA 4DEFA 3PWAA 5J5DA 4GZEA 3U2EA 1OGBA 1E4NA 1OC6A 4XBSA 4HSOA 1C8VA 1OC5A 5C70A 4DZIA 4B4FA 3RRAA 5K4XA 1E15A 5AB3A 4M29A 1I60A 3SGUA 3CPGA 4IIBA 5G1TA 1LG2A 3GYEA 1Q8JA 2WCAA 3BSGA 4MWAE 1EJ7L 3NFUA 3PR2A 4QLLA 4LH8A 1XC6A 2HTMA 3F7JA 2ZICA 2XHYA 2QCCA 3TYZA 2ZKMX 4JEJA 1FKXA 4O53A 3HMJG 2I1OA 2WAGA 4A8IA 3EWDA 4KF1A 4WY0A 4LFYA 3A4AA 3K4DA 1JUKA 3OU8A 5HATA 1GQNA 3M7SA 2ZZ5A 3OQ8A 3D6NA 2W67A 5IHRA 2AL2A 3KVKA 4EAMA 2BMBA 2CW6A 2DT1A 3QMTA 3DIPA 4M19A 1TPC1 2QCEA 1HJXA 1G6CA 4FNQA 2CYGA 1E6ZA 1AZ1A 2XDFA 3WFAA 2A3BA 5LNWA 2XSXA 4RCXA 3VNDA 4QEHA 1UKTA 4C7GA 2J7CA 1R2RA 2ZRXA 1AUSL 2HVMA 5ABFA 4CQAA 3VD7A 1KXQA 1NELA 4KH2A 5MHBA 1W9UA 3VOCA 3L9CA 3CAKA 1QNQA 1Z89A 2PTXA 4IFKB 4J3VA 4IMGA 1XSJA 3LERA 4L1XA 1LQ2A 1IV8A 1MYRA 3FA5A 4NXSA 4FNPA 3C56A 4QM1A 3VX1A 1OGSA 5JH2A 2V38A 5D9PA 5CC5A 1V0MA 1C8QA 4A6GA 5HQLA 3TN5A 3W85A 3TYUA 3ARTA 1GG1A 3VC5A 4JTDA 4CNOA 5DRCA 3UGRA 5DY3A 3SGZA 2YSWA 3ZLFA 3TW9A 5D2TA 1UUMA 1OWQA 1GOMA 5M2FX 2NQLA 1PBGA 3ABRA 4KQNA 2FTYA 7ENLA 4JX6A 1H1YA 2PODA 3G3DA 1WOBA 4PCPA 4H6QA 3MSDA 4P8UA 1XRVA 4C7FA 2DZPA 2QJGA 2ODOA 2PLJA 3HPSA 2DEPA 1W31A 4J5NA 3W1LA 3S3GA 5BXRA 3H24A 1FWBC 1KKRA 1ZSXA 1QFEA 4UR7A 4A22A 2E1WA 1ME7A 3E5PA 2VD9A 1SVDA 4PCNA 3IJ6A 4IGMA 2PDIA 4TVUA 1KCLA 2G3MA 3SN1A 3OLDA 3PAJA 1XGEA 4TO8A 1R3SA 7ODCA 3KFTA 2DQXA 3TUUA 3AYRA 2Q71A 1IEQA 4REQA 2WCGA 3B0YA 1V51A 4QDWA 1FDZA 2DSUA 3AHTA 2BGNE 1OGGA 4CVWA 3AMCA 3FK4A 1OX4B 3WQDA 2BY0A 3P81A 4HZMA 2ZX9A 4LOCA 2YIHA 3BLLA 2VDGA 3UG4A 3W73A 3MBDA 3G1XA 2J79A 3SEPA 5A1AA 2NV1A 4QSFA 1KFWA 3FS2A 1FWTA 1VEOA 2REQB 3WJWA 2XVGA 3BLEA 5CZ0A 3KVLA 1V4YA 4YMZA 1V02A 1PVNA 3M0ZA 3LCLA 3SN4A 3H7UA 1LQ0A 5CSUA 3QFWA 2V2CA 1CTNA 4PMUA 4IP5A 5H2ZA 1K4HA 1EFZA 1X96A 1J10A 1VBUA 3TFXA 1FP8A 5LA2A 4JIQA 3B9DA 4ATLA 4L6DA 3EX4A 4HU8A 3EDEA 4UWMA 2ANUA 3GAYA 4F0LA 3KRBA 3SQSA 5FIPA 4FAMA 5I00A 2MANA 2YCJA 4DZHA 6TAAA 1I0DA 3DN5A 4HT3A 3P8JA 6A3HA 3W82A 3DFYA 5BYWA 4E4UA 1ICPA 2AQWA 1LWHA 1EH9A 4H4IA 4CUCA 3ZZ1A 1TMLA 1FWHC 4XG1A 1TIWA 5AHFA 5IFPA 1XLKA 1VCFA 2E4TA 1GCYA 3WQVA 1QWKA 3R0UA 3TNOA 3TVAA 2E6DA 1SSGA 4WVXA 3SY8A 2OZ0A 2WMFA 3L2MA 4F66A 5EFFA 4FZIA 1B90A 3RM8A 3RPMA 4JTCA 1B0IA 2I56A 2YFNA 3ZLHA 3W1MA 1RD5A 3S0CA 1KGUA 2PWVA 2CBJA 1SW3A 2E6AA 5EMUA 5LGXA 4MFEA 1CZ1A 2FQIA 3AQUA 3F5KA 3OTRA 3N2OA 1NFBA 1JAKA 1US0A 4EVZA 4GCAA 3SURA 2YCLA 5LA0A 3T6CA 2PC8A 4P61A 2V5KA 5HR6A 3GHUA 4DBDA 1XLCA 2QCMA 5FL0A 1R9YA 2Z2BA 5C2GA 5EFDA 2Y8KA 4XAFA 1M04A 6REQA 2QUUA 1AH0A 3PK7A 1YTDA 1WDQA 2JQXA 4V28A 1Q63A 4NL1A 3QJAA 2Y7EA 3AMDA 3HM7A 3AMGA 3MDUA 1C3FA 3GUGA 4W93A 5U4NA 4Q8OA 2QS8A 3MMDA 1I75A 4FNRA 1EJRC 3PBVA 4Z2HA 1PX3A 1FKWA 2GWGA 2FGLA 1E6XM 3G24A 1QO2A 5DRIA 4UUIA 1DXFA 3ID7A 3E96A 2X42A 5KINA 4Y96A 4HA1A 3MSGA 1F76A 1ZNNA 2Q8ZA 4HU4A 2VUYA 4GH3A 1S2CA 1IEXA 4XUYA 1TV4A 4OBRA 5FOOA 4F2UA 1XYFA 3A21A 4U3AA 2RDWA 4MJMA 2OFJA 3OHMB 5A6LA 1RP9A 1UJQA 4H83A 4LUSA 1EP1A 4WKAA 3DHPA 1VKFA 2WHMA 3G8RA 1CGWA 1Y65A 4BFAA 1AMKA 1EO7A 3BG9A 4R3UA 3WQFA 1GHRA 2WZEA 3A22A 1RLCL 1E1FA 4DWSB 3M0LA 2GJRA 2NQ9A 4CQ8A 3LBOA 3RHGA 4ZQCA 1JAEA 3CNYA 3ISIX 2BLEA 4AUBA 2X2YA 3OYXA 3WDHA 1MZRA 1MXGA 3DG6A 4XB3A 3CYJA 4O13A 1TJ2A 2GWNA 5G1MA 3GTHA 1GZ1A 3V4BA 3NGJA 2D1ZA 2WSKA 2ZE3A 4LJ3A 3INPA 2GLKA 2VC9A 1RXOB 3ZR5A 1D9EA 1Q2SA 3GFZA 1OIFA 3OHIA 3O9NA 4KCUA 2KZHA 1SFTA 1SO5A 2XH0A 1ONRA 3EGJA 2YCKX 4HVXA 3CH9A 4TX6A 3QOKA 4IL2A 4QJ4B 1UIOA 1FCVA 4LAKA 5AHEA 4F2TA 2XVKA 1Q85A 1IGSA 3EDDA 3WZ0E 2G0WA 1JI2A 1JZ3A 4BR1A 2WVVB 3L23A 3G1SA 5A8QA 1W91A 2VGBA 3NZPA 4HCHA 3XISA 3ARSA 4AIUA 4ZO7A 3LCGA 1O60A 4M7SA 3N11A 3VINA 1PDZA 1IEIA 1MFVA 1XIBA 2V5LA 1IF2A 3QKEA 3ZSSA 4MDPA 2XISA 1JPDX 4Q4MA 3A12A 1Z44A 2VC5A 4P8VA 5MF5A 4IG2B 1DXEA 4RNIA 2EPOA 1H1NA 4PCFA 3C5QA 4Q32A 4MG4A 3W2LA 4GO8A 4LUJA 4L64A 3M47A 3KUMA 3EPNA 4KRTA 4O4WA 2QV5A 4P7LA 2FB2A 4QIUA 3S6DA 1XBXA 2KX9A 4MNLA 3WLSA 5J5RA 4EWJA 3ZWTA 3VTRA 1OF8A 3KX6A 3K8MA 4RNFA 3M0HA 3RCNA 1KRCC 1J2BA 3GTNA 3SIMA 4QDMA 2GUYA 3MCOA 2E28A 1GVIA 3K30A 4HHLA 4IHCA 1MI3A 5I3JA 1VFUA 4BKNA 1HO4A 5AY7A 4BI7A 1E0WA 3HPFA 1DTNA 4OE7A 5AFDA 2CC0A 1DKWA 1DL3A 4HOZA 3CUJA 4FX6M 4U33A 1PDYA 4YVVA 1FXQA 5AKQA 2UY4A 4PMYA 4J3UA 3FHAA 3BAKA 2BTMA 3BW4A 4WDTA 2ZQ0A 4IMCA 3WLQA 3MZNA 1EJSC 4EPBC 4R85A 4R33A 2I9UA 2UY2A 1JCJA 4B5TA 1TMHA 1TREA 3G6MA 1UP0A 1VFSA 1V6XA 5AHLA 3RXZA 3SCWA 1EQCA 4AIBA 4B5WA 1ISVA 4XD6A 4MKSA 1WZLA 2J8TA 2EG8A 3S9YA 4FOUA 2A6LA 2QJJA 1F6KA 2FZMA 2DZBA 2J77A 4Q8UA 1I4NA 1WKEA 2DU2A 3GNPA 3SDOA 3SIZA 1EJUC 1V7AA 3E1F1 2DW7A 3RLGA 2WZMA 5AC5A 3KCOA 2GSJA 3UEQA 3W88A 1K03A 2XWEA 1MQPA 1ZJHA 2F84A 1KWGA 1MVYA 4S23A 1HNYA 1E40A 3LYEA 3WO8A 3P60A 3QKZA 6CGTA 1H41A 3WLJA 5LNUA 1B9BA 1UOKA 1FH8A 4QQUA 3LGEA 3D3AA 3TFCA 3IGUA 1N8IA 1T41A 1PKLA 3GXIA 4ASTA 4E4FA 3TTQA 3FN9A 3GVVA 3OGVA 4DJDD 1RALA 3APYA 3WDQA 4AFYA 1Q4NX 3TSBA 3LENA 3JRKA 2ACUA 2HXUA 5I78A 1P4CA 1HVXA 4ZB0A 4AXKA 1JUBA 4Y9OA 2RH9A 3WEOA 3N29A 2P10A 2X05A 3RR4A 3U48A 4B92A 2VEMA 2A79A 2WKJA 4US5A 3URBA 2FVKA 1BWKA 1EEXA 1VFLA 4LTSA 4C6PA 4LAZA 3LD5A 2B81A 1S39A 2E68A 1E73M 3DU0A 4KW2A 4P5UA 1HJVA 1S5VA 4EE9A 2V68A 4NHVA 1UWIA 1GHSA 1W5OA 4PODA 4LW7A 3QTGA 4XVDA 3SCTA 1XLGA 1XS2A 3WBAA 4BI5A 2GK1A 5BRQA 1D8WA 3C3UA 3O0KA 1H7RA 1V5XA 2QW5A 2I14A 4ZO8A 1MUMA 2BHUA 2ADAA 2PURA 3ARQA 1FQ0A 3ZMRA 3UZ5A 5CLWA 1AG1O 4RPPA 4ERIA 1DOSA 3CO8A 3W2JA 1U5JA 1V3KA 4WX2A 2D3LA 1TV3A 3LHVA 1UD6A 3BJFA 2VFGA 4C1NA 4MY8A 3P3BA 2O0TA 3G0SA 2OWCA 3H53A 1FP9A 3BH4A 3M0IA 4JTKA 5EYWA 1VP5A 1GUVA 1QW7A 1R9XA 1IXOA 3GIQA 5IBXA 4Z08A 1ZCOA 4GINA 2AAAA 2XVNA 4M6QA 3LPPA 2TAAA 4B5SA 5I7GA 1A5MC 4HPXA 2JKEA 5HNUA 2VFFA 5A6BA 2QAPA 3I4KA 3FGCA 5DN1A 1E0TA 4IMAA 4HU0A 3W86A 3NQDA 1E9ZB 3HG3A 3BAJA 4NJIA 4GI8A 4WDUA 3CV2A 3GTXA 4LCQA 4PBGA 3L2IA 2X1SA 4NRRA 2V3FA 2OWXA 1KNWA 3GG7A 4ZB2A 2ZUNA 3WH8A 2PDMA 3PB0A 4R7JA 2Q6ZA 5REQA 2D20A 3C2FA 2NQ5A 1UR3M 2AGTA 4MWAC 3TSDA 3LTPA 4GUIA 4MYXA 1RPXA 4NASA 1SMAA 2V67A 4W8LA 3HF3A 4FXSA 2GJNA 4B5UA 3W6YA 1EX1A 3UNDA 1E43A 1HKWA 2NX1A 2IXUA 4H6EA 1NY1A 1GPWA 1QAPA 1PB0A 4UNLA 3F4DA 3ARPA 4Z1BA 1HZYA 4AHQA 3C52A 4AD4A 4M81A 1J0YA 5FKYA 2VL4A 4AH7A 4Z2IA 4MAZA 2CPUA 1GVSA 1VGAA 1M53A 4GI9A 3P5YA 1AQMA 1SFSA 5C8BB 3N14A 4D6EA 5FACA 2YDSA 3S46A 4NAEB 2OG9A 4BQ4A 3M44A 4HU3A 1QCWA 3KP0A 4ZOAA 2W66A 4PN2A 3PUOA 3LCIA 3NDOA 1G67A 3QLDA 4B91A 4QE5A 2V69A 1W9BM 1JGIA 3KL3A 5AZ1A 4V15A 1F05A 2HWGA 5HMDA 4JAWA 4MUPA 1XRFA 3TZNA 4PMVA 1WKYA 4UTTC 1R87A 3U4FA 3UQNA 3PZVA 3L5AA 1VLIA 2WK2A 2C6QA 3V1PA 1KLZA 1MZHA 3AYSA 1J93A 1E9YB 3VYLA 4CEUC 5I03A 4DJEA 1JZ5A 4PUNA 4J7RA 5K4ZA 2CZEA 3VD3A 1B3OA 5HDRA 1UA3A 4Q7BA 2ZUTA 3BSMA 3IRDA 3PWGA 2FGBA 3VPLA 4AEFA 2VRJA 3V5OA 4AWTA 1EF3A 4QQ3A 1KC7A 3N4AA 4F48A 4GWEA 3RMJA 5AN7A 5LIWX 4QG9A 4TX8A 3ZVHB 3UY8A 4AZCB 2CZDA 3AWOA 3RCMA 1F61A 1V3HA 3A9IA 3FJ6A 4JGDA 1KXTA 4IGHA 4NJGA 4ZB5A 1ALDA 2W4XA 3KP1A 4S3BA 2YB4A 1TKKA 1WUEA 3FKKA 2VT0A 3LCXA 2OO6A 3VOJA 3RO8A 2UY5A 2EF9A 1JZ7A 3W02A 2Y2WA 3UWQA 3PZ9A 1E6RA 2YBUA 4GBDA 1Y8BA 1I2QA 1EPVA 3GH5A 3PULA 3AIRA 1CIUA 2XGZA 3G77A 4UTMA 1UD2A 3B03A 3FFSA 2A3CA 3T9PA 2QDHA 4OUEA 3VOHA 4X0NA 5CG7A 4U2YA 4S1FA 4Y9AA 4POCA 1H4PA 3CB3A 3U2CA 3O07A 3S6TA 2G96A 3S5ZA 2DSKA 4U2ZA 1QK2A 1NWUA 3DBPA 1SO3A 4U10A 1Z7AA 3NA8A 4TUFA 2C16A 3TC3A 1I9CB 1AD1A 3PJTA 3MYOA 3REQA 2VC7A 3CMGA 2WKLA 2V5CA 4IJCA 3FIGA 4RR4A 3GXFA 1EHAA 3VD9A 3CWNA 4GLEA 2NUXA 5LHFA 1AW2A 4RL3A 4OU1A 3B9OA 4ZO6A 2Y4SA 1R7OA 1YNPA 2ZRUA 2VZUA 1ME9A 3B9EA 3DFNA 4C6CA 1QHOA 3FW6A 4GYFA 3U0HA 2QLYA 4DPQA 3N1AA 3EA1A 3R25A 1MDLA 4N9CA 4AXNA 1XLHA 2QZRA 3EWYA 5LNVA 4JNZA 4IQDA 4UMAA 4C5YA 1CGXA 1JPHA 2Z28A 3KBVA 1JF5A 3PNZA 3AS0A 3CV7A 1HKKA 1SFLA 2D2OA 3V5FA 4D72A 1H7XA 1MSSA 2OEJA 3AC0A 2ZRYA 1MUWA 1V3LA 1KQZA 3ABZA 2BXZA 1TA3A 3AROA 2PC4A 3V7PA 3G18A 1YNYA 4EANA 2Y1HA 3FYYA 3B04A 3WNPA 5M1TA 4NI3A 1N2VA 4Y2WA 2D2JA 1GQKA 3QPYA 3VIPA 2PDCA 2QCHA 1HJSA 5CBBA 3I7RA 4HYVA 3QQWA 4Z42C 1OINA 2XJ7A 4MJZA 1VYPX 3VKAA 2A3LA 2Q3RA 5BRPA 3BWWA 3BMXA 3DH7A 2VX6A 1FWDC 3JVAA 4GIEA 1RZMA 3GU1A 3NQMA 4FX8A 1OHLA 2WW5A 3DERA 1G01A 1OT2A 2RDXA 1JCNA 1TWZA 1QRQA 4L1GA 4BEUA 4UTHA 4P2VA 2CITA 2XH2A 5GVJA 3UZZA 4IGSA 1OZMA 2Y24A 4G7FA 3T8QA 3DKJA 3AJ7A 1QHPA 3UP8A 2WNQA 3F4VA 1AH4A 3D47A 1DE6A 1LDCA 2Y85A 1KM3A 4CNNA 1PJ9A 4UOZA 3TEVA 1RQHA 3OEXA 2NWSA 2VEPA 2ZVIA 5CAKA 1W54A 2RAGA 3NSMA 4RDZA 2CNCA 1LRTA 2CLMA 3UESA 4IPNB 4MADA 3KLKA 2ZZ6A 1GJUA 3KHJA 3GNXA 3C6CA 3ONBA