1DYSA

Endoglucanase cel6b from humicola insolens
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
345
structure length
345
Chain Sequence
GNPFSGRTLLVNSDYSSKLDQTRQAFLSRGDQTNAAKVKYVQEKVGTFYWISNIFLLRDIDVAIQNARAAKARGENPIVGLVLYNLPDRDCSAGESSGELKLSQNGLNRYKNEYVNPFAQKLKAASDVQFAVILEPDAIGNMVTGTSAFCRNARGPQQEAIGYAISQLQASHIHLYLDVANGGWLGWADKLEPTAQEVATILQKAGNNAKIRGFSSNVSNYNPYSTSNPPPYTSGSPSPDESRYATNIANAMRQRGLPTQFIIDQSRVALSGARSEWGQWCNVNPAGFGQPFTTNTNNPNVDAIVWVKPGGESDGQCGMGGAPAAGMWFDAYAQMLTQNAHDEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cellulase
molecule keywords ENDOGLUCANASE
publication title Structure and Function of Humicola Insolens Family 6 Cellulases: Structure of the Endoglucanase, Cel6B, at 1.6 A Resolution
pubmed doi rcsb
source organism Humicola insolens
total genus 143
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1dysA00
1OC7A 3VOGA 1OCNA 3ABXA 4B4FA 1UP3A 4I5RA 1OC5A 1OCBA 3A64A 4AVNA 4AU0A 1GZ1A 1QK2A 1TMLA 1HGYA 1DYSA 3VOJA 3VOHA 1UOZA 1QJWA 2BVWA 2BOEX 2BOGX 3RU8X 1OC6A 3VOFA 4B4HA 3RPTA 1UP2A 1CB2A 4AX6A 2BOFX 4AVOA 3A9BA 1OCJA 2BODX 4I5UA 1QK0A 4AX7A 1BVWA 4A05A 1HGWA 1UP0A 3VOIA
chains in the Genus database with same CATH superfamily
1TR1A 3WDRA 4GQBA 3H4XA 4LALA 1XIEA 4O1FA 1GVEA 4O11A 3PZGA 1TJPA 1E1FA 3OYZA 2WHKA 3A21A 3BLLA 4N9CA 2VZUA 1FWFC 1J9YA 3C2OA 5GPRA 2BFGA 3BV4A 4UFJA 2ZRVA 1PCKA 4PL2A 1VPXA 2J7FA 1DYSA 2ACSA 3WQ5A 1N55A 3H4GA 4MLJA 1BSIA 5LIXX 3BSMA 1JCMP 5HWNA 4J7RA 1U30A 1CYGA 2HZGA 4NNAA 1K70A 4GIYA 1IWAA 5C9UA 1KV5A 2OO6A 3NVTA 2A7NA 1DV7A 1NDVA 1K8CA 1TMLA 3TTOA 1EZWA 1TWWA 5FI8A 4HVXA 2F2HA 3IPWA 1W5NA 2OVLA 1W9DM 1ZBKA 4G9PA 5LA2A 3H8AA 4QROA 1W3HA 4H83A 3D3FA 3OVPA 4Z1AA 2I7GA 2XSAA 1XSIA 4CQDA 4N6EA 1D8WA 1NOFA 5DANA 1OT1A 3ANYA 3M0KA 2E4TA 4LW7A 4OUIA 2WZMA 3HGRA 3UWUA 3ORWA 1OK4A 1OSEA 4MNMA 2JEQA 3HBLA 4LJ3A 3LXAA 5E70A 2J8TA 4W87A 3T55A 3MS8A 4GH1A 4KESA 3H2EA 4U33A 1GVSA 2JKPA 2FVLA 4J40A 2IQ0A 2WBGA 3IUIA 1A50A 4A05A 1CIUA 1UR1A 4D6DA 2X2GA 3NZGA 1R3YA 3W75A 1PZ0A 4B5TA 1VLWA 3WDIA 2VC7A 1UD5A 2ZA1A 1IR1A 4CU7A 4KRUA 2B0MA 3CZ8A 3WF0A 4N42A 4PCNA 2QCGA 4K39A 1YPFA 3MCOA 4GUGA 5I00A 3K13A 5A6AA 1Q3NA 2PDMA 5FF2A 1TWDA 2PDPA 1QWGA 4AD1A 5A2CA 1FCBA 2PEVA 1JCTA 1FKWA 2NT0A 1PYFA 1IF2A 3TJXA 3G3MA 4I5UA 3WBWA 1PPIA 3CO8A 4WSKA 3W2JA 3HV8A 1OFQA 2DZWA 3N2TA 3VZYA 3WLMA 4C1LA 2G3FA 4ICMA 3R25A 3LRMA 2I5IA 3A9IA 4IPIA 4RXFA 1IZJA 3S4TA 3SCQA 3N04A 5E09A 4UQ9A 1RCXB 2ZUUA 3G8EA 4ML9A 3ARYA 3HG4A 1EJ7L 4DQWA 3KVLA 3NPVA 1M7XA 1H61A 3MUZ1 4ORMA 2OSXA 3GXNA 1TB3A 1CECA 4U4MA 2WM1A 4HOZA 1QBAA 5HNRA 1H0IA 2XVPA 5CGQA 1HJXA 5C54A 3BG9A 1FX6A 5IFPA 1Y8BA 3KCJA 4OQVA 3MUIA 3BLKA 2YCKX 4O14A 1FWIC 1WZLA 1CGTA 3APTA 5AHNA 3TA9A 2VFFA 1K7XA 5HBFA 5JIWA 3E2VA 5HQEA 2YA0A 3LCXA 3TW7A 4JICA 3PPGA 3N2MA 1JNDA 1JULA 4J2PA 4EXQA 3RNDA 3EWYA 1PVNA 3ABZA 1O5KA 6ALDA 2X40A 5E5CA 4A3RA 3TXVA 1BPLB 4NUWA 1TJ2A 4HHPA 3UZYA 1V6VA 2OT0A 5HMFA 4WJEA 2O9PA 1E9ZB 1XCFA 5AZ0A 3XIMA 3MMTA 4CD5A 1LZOA 2VJXA 1KFLA 3EWWA 3G1VA 1KM1A 2E1DA 3GG1A 4GVHA 4AYSA 1J0KA 3IJ9A 3SCWA 2JK2A 1VHCA 1TTPA 4UMCA 1E56A 1CB2A 1KD0A 1HKJA 3LB0A 3SUTA 3Q37A 1BWKA 3MB9A 5A6BD 3GXTA 3PSVA 3AJXA 4GXMA 1M6JA 3AMKA 1JCJA 3CH9A 2CPUA 3GXMA 4H3DA 3P60A 4H6RA 2ZKMX 4X61A 3UWEA 1F07A 1P0NA 5CC7A 2WLYA 3OJGA 3L0KA 2HPMA 3OBAA 2ZCGA 2ZX5A 3GX9A 1TQJA 3VOIA 1DOSA 3CAKA 2EPLX 4XBKA 1HZYA 1CT5A 4DZIA 3T4CA 3IS4A 2DSKA 2O7QA 2VL4A 3ABSA 3OGSA 4WJ8A 1LUCB 3WUFA 5CPOA 4FF7A 4W9TA 3PB0A 2J75A 1W17A 3C3NA 2X7WA 2TMDA 4ZQPA 4E2OA 3RMEA 1AQMA 3IJLA 4HIBA 5C7HA 3P8JA 4CNSA 4U31A 3RYSA 3XINA 3T44A 5JQ9A 3MO4A 3U48A 1JGIA 1NAL1 1O66A 3U5UA 3AIBA 3T09A 2DFAA 4L9ZA 3VD9A 1HGWA 1X8CA 3N6JA 3G8RA 1I1WA 2G50A 1W56A 1DP0A 3OU8A 2WC7A 4RZBA 2ZDSA 3HPFA 4AD4A 4NZ1A 3IV8A 3WBYA 1XH1A 2ACUA 3C61A 4DNHA 4JHOA 3W2LA 2J79A 3SIZA 1P6WA 5LIKX 4JTLA 1ITUA 4FEZA 2VUYA 3L21A 1QFEA 2ZVRA 3NYDA 3UCQA 3AYSA 4GJJA 3HPZA 4DJFA 2VURA 1PUDA 4YMZA 1UPPA 3WLSA 4QXIA 3NQCA 3Q65A 3T0AA 4IMDA 2XG9A 4W8BA 2EJAA 3HF3A 1ZP3A 3IAQA 1E9LA 2A3HA 6CGTA 1QHOA 2JIWA 3STEA 1EA9C 1XJBA 3WFLA 4JFTA 4F8XA 3K4DA 4FMVA 4FX7A 4GYPC 4TU1A 3UF9A 4WY0A 4ATDA 2P8BA 1J0YA 4F3HA 2VO5A 4QM1A 1ONWA 4GYKA 3I6RA 1VJSA 2UY5A 1IEIA 3W7CA 2WSPA 4U2YA 4MB5A 3ARQA 3PNZA 3HA1A 1XYZA 3BGAA 2PLJA 1LLWA 1UH2A 3L4TA 1OHLA 2NWRA 5FF3A 4QS6A 3DEQA 4ROQA 4C6NA 1EQPA 2DQXA 5I2UA 4NXKA 1U5JA 1SPQA 3WLPA 1VENA 2UZ9A 4DXXA 1H41A 3EPMA 3LEPA 3OHMB 4EANA 4RV3A 3TU9A 3LG3A 1HKKA 3V16A 4B5VA 1UA7A 2WB5A 2EG8A 4FOJA 3CQJA 5H1WA 3CWHA 4YL2A 4HZ8A 1UB3A 1R8LA 2VEMA 4KH2A 1R38A 2VFEA 4GUJA 3UVIA 1B3ZA 1SFJA 2PRMA 1X1NA 4GO8A 1EEXA 4QLLA 2E8ZA 2OQLA 1J0IA 5M1TA 1YDOA 3DU0A 1H51A 1ZENA 3UJFA 4J3VA 1O68A 4D72A 1YPXA 4LYQA 4J27A 4P7OA 4A8NA 2DEPA 2RKXA 1FTXA 4IG2B 3UWVA 1YDVA 5CQ1A 4RDWA 3A4WA 1WKYA 3WQDA 4LUSB 1Q8JA 2NQZA 4GI9A 4LU0A 5B80A 5JIPA 3WLIA 4AUBA 4GVFA 1TSIA 5DBTA 2UY2A 3IRSA 4H9ZA 4HCDA 3MU7A 1C8YA 3RR4A 5HUOA 4XTDA 1FHLA 2BWGA 4X60A 1JDCA 5FF7A 2PDWA 2C1GA 5HQLA 4PUDA 5FAJA 4YU1A 3ALFA 3G1FA 4GMEA 4X9SA 4H6EA 3M46A 3KLKA 3II1A 1GORA 4K37A 3VPLA 2DGAA 1W3KA 1PKLA 3JZEA 1V4YA 1WQ5A 1CTNA 5H2ZA 3GR8A 4S3FA 1NF7A 4XG1A 3TYCA 5CG0A 3LCWA 1VFHA 1QI4A 1V3KA 1V79A 3TFXA 5T8GA 4XX6A 5TIMA 4WIWA 4DWSC 3V4BA 4XB3A 4QJ4B 4UTKA 2CLHA 2CXGA 3GK0A 3GIYA 4QE5A 1BRLA 2GVYA 3A12A 4AVFA 4NU7A 1SMAA 2L5HA 1A5NC 2QCNA 2YCLA 1DEDA 3E38A 3N19B 1E9IA 1DJGA 4PFHA 5AVHA 4AEFA 3SCOA 1TUFA 3UT0A 1BF6A 1TPH1 1XBYA 2PF8A 1KV8A 4JTUA 2DORA 4R33A 3DH7A 2C18A 3OZPA 1OX4A 3SJ3A 3E1F1 1MEIA 2OOGA 3WQCA 5CGMA 4AF0B 1HT6A 4G2DA 5AC6A 4AZHA 1UWRA 2VZOA 5CLWA 3NTYA 4PULA 3W38A 4GFSA 1GGOA 4F4RA 3NA8A 2WJEA 2YYUA 1XRVA 1CGVA 3C2YA 2QUNA 3SCRA 1GYLA 3L9CA 1OC5A 4DZ5A 5G1YA 4DHGA 1PKNA 3EDEA 2ASHA 1QJWA 2IPFA 2I9UA 2WVSA 2FVKA 1W91A 3T40A 1K9EA 2NUXA 3AIVA 4KCVA 2ZVIA 3GWQA 1ZSXA 4S3CA 2QCEA 4IGHA 5DY2A 5BRBA 1PV8A 4JS3A 2X41A 3PJUA 3GTHA 1DWFM 2PDJA 3NSXA 1S5WA 3NSMA 3THDA 4C6FA 4MMWA 4LNCA 4NVTA 4H9UA 3CUHA 3VNZA 2BNJA 2BBFA 2HXTA 4CNPA 1UKOA 2ZZ5A 3W86A 2PPGA 1EX1A 3WUBA 2EG6A 5K7JA 2E6DA 1IT0A 3BGGA 3B9AA 3PZTA 1GVIA 2YBTA 1OWQA 4RDZA 1MXSA 2XVKA 3W7IA 4KERA 5EY5A 4S2CA 2D73A 3U2ZA 5EMJA 1VYPX 3ZVHA 4PMNA 4TXEA 1BLIA 4OOUA 3CV7A 4YTUA 3P5YA 3P0WA 1G7UA 4FXRA 3KBJA 4MNLA 3CPUA 1IGSA 2D69A 1CGYA 4XIAA 1ZJHA 4CCCA 1J6PA 5M17A 1ONRA 5I79A 5HQMA 4ZR8A 2XTKA 2R1LA 4U10A 1Z9AA 2O0TA 3PUOA 1BG9A 1R30A 4AU0A 1B57A 3GQYA 3LHYA 4RNFA 3UA4A 5D2XA 4UTUA 3DIPA 2E77A 4QAIA 3SQLA 1GJPA 3UWWA 2J74A 3NZQA 4AWTA 2DZXA 5F1UA 4H6QA 1F05A 3QJAA 4L1GA 4WVXA 3B8TA 3NURA 1F3WA 3RCYA 4FLSA 5E1QA 4IX2A 2VR5A 2VFIA 3PVFA 2PE4A 1KGUA 2UBPC 3SR7A 2DJXA 4C1KA 2Z28A 1G01A 4JL1A 2HDJA 5LZLA 4W88A 5CAKA 2ZDRA 2QQ6A 1AMYA 4IXXA 5D02A 3OIHA 4YTTA 3SI9A 3RG6A 3W2MA 3TDFA 4Y9PA 1B90A 3BLPX 1R3VA 5HPCA 3OGVA 2R94A 3M41A 1DJIA 4Z2HA 2QV4A 1XLFA 1RA0A 2GQ3A 4E8GA 1WDPA 1CI1A 3ZJ8A 5E9AA 1KCZA 4LAMA 4NAEB 3VNIA 2DVXA 2J66A 1JZ7A 3VOFA 4UNIA 4RE0A 2YOCA 2FZ9A 5C8BB 1E6RA 4IP5A 4MDOA 3I6TA 1WXJA 4W8AA 3UZWA 2D23A 2WKJA 1MNSA 2H3DA 3QMRA 1F3EA 3AWOA 3W37A 1SJCA 3TWAA 1OZMA 2NV9A 2G8ZA 4UTTC 1GEQA 1CGWA 1UZDA 4J9JA 1R86A 4XTIA 2ANUA 3LNMA 5CC3A 1VYSX 3LBCA 4XAYA 3QTGA 4UTFA 1GPFA 2CLFA 3F4WA 3JUGA 1TREA 1W1ZA 2ZYFA 3AZRA 3I65A 1WV2A 3PAOA 2YYTA 3DN5A 3UPBA 4NZFA 3DBNA 5LGXA 5J8LA 1NWRA 4UQBA 4PC8A 3R79A 2ZRUA 1WB0A 4IQLA 4MWAB 5G4EA 1H7NA 1RVKA 2V3FA 2VNCA 1H2JA 5IM51 3TE9A 4GNJA 2PWVA 5DELA 4DB7A 1UIPA 4ZOBA 1RK6A 4L4PA 2IMRA 4GX9A 1KRCC 5CJMA 4E2BA 1WBJA 2R14A 1A5KC 3VCCA 3UJEA 4WD0A 4JIEA 4WGXA 1TE6A 3RF9A 1EGVA 4KMQA 2GJNA 4JQ2A 1J5SA 1O5QA 4MPQA 2PUZA 4GH3A 4JTQA 2BV9A 5JVLA 3QW4B 4GKLA 2PMQA 1RVGA 4DLFA 2GK1B 3UR5A 3W0KA 2YIHA 1K03A 2C13A 4K38A 2NT1A 1DE6A 3OOQA 3ZMRA 1BWVA 3W27A 5BU6A 4B2DD 4QE4A 4GG9A 5G2HA 3IJQA 3H2NA 2PWFA 4FA3A 1QK0A 2FIQA 4AH7A 1S2WA 3REQA 3KW3A 1AFSA 2G3IA 4UR8A 3WMBA 4CNOA 4PUKA 4LUTA 5ECVA 4RDYA 4HSHA 3VZZA 1GZ1A 4KW2A 4HOXA 3FVMA 4JTEA 5FEWA 1KKRA 3THAA 3IJDA 4O1DA 3VGGA 4WKFA 4FS9A 3GS6A 2VDIA 4R7WA 1XHGA 3LCIA 3DAQA 1FY6A 5JMUA 1M7JA 3UXAA 4OBRA 3FFSA 4JHZA 3N11A 3KL5A 2A4AA 3LCGA 3PZOA 4EE9A 1LDCA 4XKYB 3W84A 1S2UA 3Q4DA 3SN4A 2VX5A 3TH6A 1I60A 2PTWA 1VFMA 2FZ8A 3V0UA 4XVEA 4FB7A 1P1MA 2WKGA 3TLQA 1ISYA 3T1GA 2NXIA 4OWGA 4B4HA 1QASA 2PRLA 1NVMA 1BD0A 2CBUA 4ZTYA 2CYGA 2GL5A 3ZIZA 3IIXA 1EJTC 2QUMA 4IIBA 2ZE3A 2QDEA 3R0UA 2DIKA 5U4NA 1GHRA 4LAZA 2YL9A 2WJZA 1U5HA 1IV8A 5DCDA 3FEMA 3KRUA 1P48A 2A7PA 2VRJA 3RK8A 4DWSD 3T2OA 3RFAA 1MEHA 2E5DA 3G1RA 5C6MA 2NUYA 3VGHA 1OY0A 4A3YA 1KM4A 1LROA 5BOFA 1C9WA 1EGMA 2GUBA 3G1XA 1Y0EA 4V28A 4W7VA 1TX2A 1ZCOA 1AJZA 2Q8ZA 1BQGA 4X63A 2ICSA 5CC6A 1VF8A 5E9XA 4GGBA 1BEUA 4K1GA 3TEVA 3C52A 1ICQA 2IXUA 1K3UA 4HN8A 4DWSA 1F76A 1R85A 1UBPC 5KSWA 1KO0A 3EWBX 3XISA 2W91A 3BCDA 2ZE0A 2IKGA 3CUGA 1L0PA 3LENA 4LBSA 2J47A 4RDVA 2NQLA 3IIVA 2BOGX 2EF9A 1QI2A 4O13A 2BY1A 2Y8UA 3PJTA 4IPNB 3ZLFA 1YTDA 1BVZA 4NILA 1UBSA 4Y9MA 2AL2A 4C6QA 2YBUA 9XIAA 1OIFA 3LHZA 3M7WA 3CQKA 3FYPA 1LBFA 3BW4A 3UY7A 4YXGA 3PWAA 4REQB 3RU8X 4E8CA 2Z2BA 4KWVA 4ZA0A 3N4AA 5AHEA 4UTIA 3SCPA 4FNPA 1Y7VA 3WH9A 3AYTA 1FWJC 3JW7A 1TELA 3W1PA 5HNNA 2J8FA 3TKFA 5C9RA 1RV8A 1IXOA 1YDYA 3IAPA 1EJSC 3ZOAA 3P67A 4XO7A 5LXXA 4ZQNA 2WQDA 3BLEA 4DUOA 2OLHA 4GXWA 3U3HA 3GB6A 4RW3A 4C65A 2G95A 5F4SA 1DJQA 4QCFA 1DQUA 2DT3A 3BO9A 4M29A 4QG9A 2J7HA 2VCBA 1QRQA 4LF2A 2OYMA 3TTSA 2XM2A 3RPMA 2ZX9A 1W9BM 2IXVA 2CZ5A 4TVDA 2Y2WA 2YA2A 4JTGA 3F03K 1H1ZA 2HVMA 3SUVA 3W4RA 4L61A 3CLWA 1V0KA 4O0QA 1AQ0A 4MYXA 4YHEA 1KXQA 1Q6CA 4A2RA 4DUWA 4BF5A 5HR6A 4DBUA 4F2TA 1JJKA 3P81A 5EMUA 4W5ZA 2C16A 3A13A 3ID7A 1UWAA 5D09A 4IMCA 1UPMB 3GLCA 4HCHA 1XGEA 4C6IA 2Y7GA 4E5TA 4IUOA 5FJTA 4XAGA 1JZ5A 1GKRA 1E0TA 3BCJA 4KFOA 4V1XA 3GD6A 4BF7A 1US0A 3POCA 1XFCA 1TA3A 2EG7A 4YNGA 4NJIA 1KR1A 1J5TA 1E70M 3LPGA 3MSGA 2W6RA 1W37A 1L8NA 4DO5A 2NX1A 4H9YA 1I75A 4UQAA 2YW3A 3W7OA 1WPCA 5A6KA 1A0DA 1RY8A 1W3IA 1TVNA 4EF8A 5DEZA 2AMGA 1UMLA 2V3GA 3SURA 4BEQA 4GKTA 4CEUC 1OCBA 1BSLA 5D9NA 2QJJA 1RY0A 5CCZA 3TYUA 5DCEA 1AUSL 3ARZA 3TYDA 5PTDA 1C91A 1WO2A 4IFRA 1W3JA 4ZTXA 1S39A 3CAWA 2YPIA 1YNPA 4JAWA 4JTDA 3DGRA 3L67A 3BGJA 5G1TA 1HJUA 1I2RA 5FKYA 4M1RA 3AZTA 4AVNA 1UUMA 4Q32A 1MW3A 3KRZA 4EWJA 1ZU8A 1X8FA 3C56A 3FJ4A 2FVMA 2Y8VA 5D33A 1UR2A 3U2CA 1GPWA 3GXPA 2VQTA 4NG3A 3ABRA 4UQDA 4L56A 4Y8EA 2ZWZA 5DMNA 1OYBA 2RGMA 3ISIX 3VIPA 2V82A 4ENLA 3C0JA 3OTRA 1XD1A 3W1MA 2TODA 2ZIDA 1FA2A 1A0CA 5F2LA 1E6PA 4FLRA 2CU0A 1MQRA 1O5RA 1H7WA 4HPNA 2YZ5A 3ZZ1A 1QW7A 3W24A 1EB3A 4CN6A 1ODUA 3ZO9A 4NJGA 3O05A 3KBNA 3CHEA 1EYEA 1L6SA 3A5FA 4OBSA 3H70A 1QOXA 1ZS2A 5FA5A 4DELA 1SFSA 2WCGA 3LV5A 2J9ZA 3MP4A 3HPXA 1ODZA 3DHUA 3FSTA 4Q4KA 1EF2A 3KWSA 1VBJA 2BASA 4XQ6A 2WVVA 3WBEA 4OJYA 4HA0A 2PGFA 3SN1A 5XIAA 1H11A 3M16A 1CCWB 1VBRA 1BTMA 2ZUMA 4F0RA 5KETA 1DTUA 2Z6IA 1K6WA 1K77A 1NWTA 3QC3A 5ENLA 4LVFA 3MSRA 3SRFA 3MC5A 3U5YA 1JUKA 2VFHA 3L12A 4C6PA 4IQEA 2FJKA 2TYSA 3ARXA 2DT1A 4NRRA 2POZA 4RE2A 2D0GA 2MANA 2VX4A 1K9FA 1TPVA 4B5SA 3S2NA 3WG6A 1Y5VA 2VGFA 4LVBA 3H2FA 3U6WA 3TJ4A 3TTYA 2GJPA 3TW9A 4NAFB 1JNEA 2VD8A 5HMDA 4DWDA 4O17A 4GZ7A 2D3LA 3NDOA 3IJ6A 1KA9F 3MV11 3DUGA 1OC7A 3W87A 3CMGA 4PRWA 4O18A 1O60A 1A3XA 1VFOA 5JXQA 3UWZA 1GQLA 2PGWA 1A53A 1T96A 4EXAA 1I2OA 1X96A 3RM9A 5I06A 1S5VA 3GFYA 3G0SA 4C6MA 4O1AA 2VRQA 3PPFA 4H41A 3ZFHA 4C6BA 5CC5A 3E0WA 4TX6A 4L1XA 4KQNA 3IGSA 4AZCA 1MW2A 3SY1A 1TJ0A 4QG8A 2DH2A 3D47A 4GO9A 1S3TC 1Z3NA 5I3DA 2XU2A 1EF3A 4NJJA 4CNNA 1YIXA 2Z1BA 4O53A 1W9XA 3IJ8A 1GYNA 2DZBA 3TONA 1E3ZA 2NUWA 4G8TA 3CWOX 3S5ZA 4O1BA 1FP9A 3EXRA 4Q4OA 2HQAA 4JIIX 3L65A 1R9ZA 1BXCA 1KC7A 2QJGA 3AIRA 2Y61A 1SJDA 1EHNA 3CS2A 2YDQA 3IGHX 1XSKA 5BU9A 3L2IA 3VK5A 1EDGA 1XLDA 3ABXA 3GTXA 3NFUA 2J7GA 1DIDA 3CJPA 1FFQA 1R3WA 2DU2A 1AW2A 1UOZA 2C8NA 2FTYA 3CTTA 2H9AB 4Z2LA 1XP3A 1EH9A 1M7OA 4HK5A 2XFRA 1W5OA 1TV7A 5LHFA 4IGNA 4ZXOA 3S3GA 2DSUA 3A47A 3FGCA 4HZ7A 3B0XA 4HSNA 3SSZA 1UKTA 2ZX8A 3H7VA 1KWKA 3KX6A 2A6NA 1BXBA 2FGZA 4H7VA 5C2GA 3DESA 2O92A 3GU9A 1O4UA 2O4MA 2WMIB 3QN3A 4QJ3B 2OKTA 4HYVA 4X2PA 4D9PA 4DBEA 2FH8A 3ES8A 3C6CA 3O8AA 3I6EA 3NXFA 5D05A 4Z0SA 3W00A 2E9LA 5REQB 3WZ0E 4QIUA 4LS2A 4Z1BA 3W2NA 4S3DA 2OX4A 4NYUA 2NQ5A 3TMLA 4Q4SA 4WR3A 1THFD 5GVJA 4L4MA 1W3NA 3SEPA 3GW3A 1Z8AA 3EDDA 3TN4A 4JY9A 2VD9A 4GJIA 3QOKA 5TD4A 3OVGA 4EXBA 5GQBA 1HO4A 2DPEA 4DBSA 1BVNP 4QP0A 1EXPA 3VNDA 1SO4A 2D2HA 3UPMA 3S1XA 3TJIA 3HGOA 1FUYA 3O16A 4TQTA 3EOSA 3EOUA 1F7BA 1JAKA 1MRQA 3HFTA 1CXEA 1LORA 3RM8A 4X0VA 2ZUSA 3CPRA 1KCKA 1EUNA 3BG5A 3GNDA 4PUMA 8TIMA 2XWDA 3NEVA 3WQGA 5DMYA 4YHGA 1V0LA 1KLZA 1Z44A 5A6TC 5A6MA 3T7VA 4JFWA 3UYCA 2VT0A 1ZUAX 1W2PA 2IQDA 3CWNA 5HWJA 3W2KA 3KL3A 5GJPA 3G0UA 1IZKA 1SW0A 1PDZA 4K8GA 1FXQA 1MDRA 4O15A 3TR9A 3WD0A 3I68A 4JYEA 5G4WA 3PAJA 4O28A 4ADUA 2HWGA 2C1HA 1XLEA 1R6WA 4AY1A 4EKJA 2VC9A 3P2VA 4FHAA 2BX7A 1I1XA 1QWKA 1RJRA 5D2YA 4HU3A 3LPFA 2V6AA 2OB3A 2ZC8A 2BVWA 1TWSA 4MB3A 3T4WA 2OTDA 3B03A 2WK2A 1XIBA 3QYSA 4MAZA 3WF1A 3U7VA 1HN1A 5BMWA 2DT0A 3NO3A 3H7RA 9XIMA 3STGA 4LSBA 4XK2A 5AZ1A 1H09A 1EKOA 1FH7A 4GXPA 4MF4A 4NZ3A 4PBFA 3PZMA 4ZODA 2VFGA 3ZXWA 2R82A 4MNKA 3V5OA 2E5CA 2Y5JA 3ZSSA 1BWLA 3AYRA 4D6IA 1P4CA 3QY7A 3MMUA 3L7RA 2BVDA 2GGGA 4JGDA 1GJUA 2FMNA 1V3HA 1QNRA 5G2IA 1WYIA 1PX4A 3W1RA 1GQNA 1QNOA 3F4NA 3OODA 1WDSA 2PZNA 3BAWA 1QHZA 1EYWA 3UZ5A 3ZR4A 3TZNA 2VC6A 1XLAA 2FPYA 3JU2A 2XFFA 4I7WA 1X38A 1VFLA 5BRPA 3WQWA 4ERAA 1QO2A 4PUEA 1TVPA 4F79A 1LBLA 5DQPA 3CK5A 1L2UA 1W8GA 2Z24A 4CD6A 5T9CE 4ZQCA 4LWWA 2V5LA 1B3WA 2QPUA 1W2VA 3WJWA 3TOYA 1WOAA 3UCDA 3L4XA 4RX0A 2REQA 3H24A 3LQLA 4NIRA 4IIEA 3RCMA 1KNWA 1JQVA 2FGBA 4KS0A 4JIRA 3PUGA 1W32A 2B7OA 2G97A 1GG0A 4O8RA 3EZ4A 1JI2A 3BOXA 2NSOA 1GEHA 1XYLA 1NDWA 1JYXA 4TUFA 2ZUTA 4Q7NA 1H50A 1ESWA 2KZHA 3LNPA 3G6MA 3NOEA 3CMFA 2WKLA 4LAOA 1FHVA 3SDOA 4YN5A 4NX5A 3PZUA 4UTMA 2D24A 5HR7A 2Q3RA 3DFTA 4WUIA 1SZRA 4JTTA 1AL7A 1UKQA 5EL1A 3AHVA 2WW5A 3RDKA 1DPMA 1H5VA 2OT1A 3VZXA 4JBRA 4AZ6A 3PF3A 4ZB2A 3PBYA 1KTNA 2KAUC 5CSYA 1V6WA 4R5EA 4CU8A 3SY5A 2WNZA 4YPJA 3AJ7A 2P10A 1VFFA 3T2PA 5HATA 2YL5A 1QW9A 2ZX7A 1A5SA 3AUJA 3BTNA 5K9CA 4IQJA 3RRAA 1U1HA 4XD6A 1OX5A 1P0DA 1W9UA 3TN5A 3E2QA 3L4ZA 3IK2A 4D8ZA 3FJNA 1GOOA 3TC6A 1HXJA 3OO2A 2YLAA 2VGIA 1NOWA 1PXGA 1YNQA 3UG5A 4MFDA 2W62A 2RJGA 3ITCA 1ZB5A 4JQ4A 3UZXA 3ZJKA 1KFJA 3N2XA 5FSDC 3CZKA 2PWHA 3UXDA 3S6TA 2Z7KA 1XSJA 1LLZA 3K8KA 4OVXA 4U2ZA 4Q8QA 2VR2A 1G94A 4H2CA 4LGXA 3VKBA 4X0NA 1SZEA 2HEJA 2DZSA 5MKGA 5FCZA 3ITOA 3ITVA 4CCDA 2DW6A 2UY3A 4KCWA 4HJWA 4U5KA 1SR0A 5CZSA 1R3SA 1UHVA 1JCXA 1BQCA 3VIGA 2GGIA 4Q7BA 1UMYA 3KRSA 3F5KA 1Q63A 4YVPA 1G4SA 1RD5A 3BURA 4JL2A 1FDJA 4AZGA 1FWHC 4FIRA 4QNWA 1HIZA 1NH6A 3URNA 1C7TA 4HZ6A 2QJIA 4HU4A 5JBDA 1MQPA 1TIWA 3NM3A 1CLXA 3B4YA 4W89A 4OE7A 3PNUA 4EPDC 3VO0A 3F4VA 4X9YA 4BWLA 1W0MA 2A7RA 1X39A 1LJYA 1EQCA 2QT3A 1GOIA 5DO8A 1S38A 2OGYA 4LBRA 4EP8C 1EZ2A 4ACZB 3R13A 5IFTA 1SZNA 1O12A 4RZ4A 1V6YA 3TYAA 3UETA 4CNTA 1W5PA 5DXYA 1OX4B 4KPLA 3KBVA 5M03A 3KVMA 3B9DA 1EWDA 2E0PA 3IIOA 1A5LC 1A3HA 5EFDA 4TX9A 4ZE4A 3UG3A 3EB4A 5CPLA 2ZUWA 3F2CA 3PTDA 2EKCA 1MUCA 3WMCA 3FKRA 2FHCA 5HUPA 1YYAA 1CGXA 3WNNA 4RE4A 3F4CA 4CCZA 1Z69A 2VGBA 4US5A 3G1SA 5HAOA 1DXEA 4C1NA 5F2MA 3W6YA 2V5JA 1TTIA 4Q8VA 3GC2A 2WMJA 5D32A 1AMKA 2AGKA 1I2NA 1QNPA 5I77A 2PDCA 3AXIA 3AU2A 4OBTA 2Q3OA 2WLZA 3CHFA 3C3UA 3NQ6A 4XZWA 1US3A 2QCMA 4ERGA 3V1HA 1SGJA 2A5HA 4DNMA 4DI9A 3G1HA 2Z00A 2V2HA 1MMFA 4V15A 3H2CA 2GDVA 2A3LA 5A6LA 3AU6A 3O0KA 4H6KA 2PBGA 3KAOA 4CN1A 3BLFA 3PZQA 2IKIA 4OU1A 3BPWA 4B4FA 2GQ9A 2P88A 1KFEA 1KCLA 3A23A 2XZ9A 4NSBA 4MOZA 3WJZA 3MKCA 1A4MA 2PP1A 4MY9A 5FF0A 3LPPA 2P53A 1MSSA 3WLOA 1LYXA 4GCAA 1B31A 3T6CA 2QNEA 2W66A 5G2WA 1LWJA 3D5HA 3W7HA 5JH1A 4XUYA 1A5UA 1YNYA 4AEOA 1RCOB 2R91A 3ZR6A 1HQTA 1W1PA 2J27A 2HRWA 1QOPA 4NF7A 4DJDC 2R1MA 1J96A 2BOFX 4LB4A 3TWBA 1PIFA 5DX7A 1Z48A 3MY9A 3NQAA 7XIMA 5HULA 2JEPA 3WLTA 4H01A 1J2WA 4BFAA 4QDMA 1NARA 2W67A 3A5VA 1RQEA 3LDVA 3C0QA 4F0MA 3AISA 3AS1A 4QLKA 2VZTA 4WHBA 3P7YA 2XGIA 2JGYA 3FW6A 1R3QA 4UR9A 4H00A 4I7VA 3K1DA 4AQLA 1JZ2A 1UD8A 3ANVA 4IL0A 1LQAA 4M51A 2QUVA 4WSJA 4JNMA 3AHTA 3M5XA 3CV1A 4MLRA 1KRBC 1FFRA 3VU2A 5ECUA 4ZOCA 2WNWA 5D38A 3B8IA 3USZA 1SO3A 1I0DA 1S2CA 2J4GA 3WLJA 4KIEA 5M2FX 3M0JA 1EL3A 4MSSA 4MHBA 4C6OA 5AB3A 4G7EA 5CBJA 2F7FA 4GI6A 1RH9A 2ZA3A 2J8GA 2RAGA 2DSVA 4HTYA 5IBXC 3LX9A 4LYKA 4E0CA 3VCRA 1TPWA 4JQ1A 4GZIA 2QUUA 1GT8A 4GOAA 5A8OA 1IWBA 3AHYA 6XIMA 1R7AA 5LIUX 3W74A 2RJHA 2VX7A 1J93A 2W92A 4FR6A 3HG2A 3GH5A 4ICNA 1PKYA 1VH7A 3HU7A 2QDDA 3FEQA 1B9BA 5LKYA 4J5NA 1WAUA 1E6ZA 3QY8A 4RZ5A 3W1TA 8XIMA 4Q4RA 3DG6A 1GKQA 3HJZA 3CV2A 3EX6A 1S1RA 3LYEA 1RK5A 1PYMA 4ML4A 1LWHA 3PZNA 4IQDA 5I78A 4N9DA 1XIJA 3GHUA 3RILA 1JDFA 4FXSA 4XIMA 5T91A 3VKKA 2VKZG 3R1ZA 2F8QA 3BAKA 3M0ZA 1PZ2A 3MYPA 3WCZA 3W7GA 1WAWA 3W07A 5LNWA 4MJ4A 5KTLA 1SW3A 4I7UA 3MP5A 5D37A 4BQ2A 1H3GA 4DAIA 3BLIA 1E1CB 5I07A 3QLLA 4JNZA 5LGZA 4NI8A 2DZAA 4CNUA 4YWIA 3PZ9A 5A6JA 5AC5A 1NOUA 4JTRA 3OPSA 2OFJA 1PJ9A 4HN4A 2YA1A 1J79A 1CXKA 2YXOA 4FK9A 1E4MM 4OZOA 3R58A 1EX5A 2F84A 3OB8A 1NU5A 4PMDA 4F9DA 1C9DA 1KRAC 4XZHA 1TX0A 3QHOA 3U9IA 1A47A 3N73A 3LXCA 1F3TA 4Y96A 3O6DA 4JTIA 3NG3A 2PD5A 1ZBCA 3SCVA 1P6BA 4LS1A 4HMCA 3VMPA 2OXNA 4L6DA 3VD5A 4G7FA 4TMBA 5M5DA 3WEZA 4P8WA 4FAMA 3IIPA 2RFGA 3K1GA 5BXSA 5LNRA 2YB4A 2PC4A 2X0SA 1MDLA 2DDXA 1V0NA 2V3EA 1XCXA 4E6MA 2WSYA 1RCQA 4CQAA 5F4XA 4LBUA 1ZFJA 1P7TA 1OX6A 1E4IA 4LNYA 5FJRA 3H6OA 3W7PA 2F61A 1L6GA 4LB3A 2CLOA 4JFVA 2XVLA 1P5BA 2PA6A 2Y24A 3DFOA 1HVXA 1T0OA 1XLCA 4P8UA 5HOSA 3QXBA 4P8VA 2E5BA 1XLJA 1UC5A 1N82A 1JF5A 4PTXA 2HBVA 5ABGA 1KFKA 5A2BA 4EK7A 2VWTA 3NCOA 3O9NA 4DI8A 2QEZA 3B05A 5C9ZA 1QPNA 3UD6A 2Y62A 2GJRA 3R94A 3MMDA 2J7BA 1KWGA 1XFBA 4UR7A 5F2IA 3NUKA 9CGTA 3BMWA 1FVPA 3PR2A 1EJRC 2FFCA 2Y6ZA 5JUVA 1D3HA 5DT5A 2E6FA 4GCXA 4RNIA 1UZ4A 2QZRA 4ALDA 1V6TA 1JGMA 3QV6A 4KCTA 2QXWA 1G4PA 2XHYA 2QYGA 1V6UA 3MUAA 3T78A 2B4GA 1JDEA 1YHTA 4H4IA 3VDCA 4JKLA 3UQNA 1XKJA 1XQKA 1FWCC 2E28A 1VBHA 3VX1A 1K8XA 3WNLA 1ONXA 1XG4A 5D2VA 2MUCA 2GWNA 3OLDA 1D7FA 1R0MA 1C93A 3HO8A 1IT7A 2P8CA 5J5RA 3VKAA 5FJPA 3QF0A 1Q8AA 1X7FA 1DJYA 4C7DA 2GSJA 5D2WA 4YYFA 1SO5A 1VLIA 4MYAA 4UNKA 1QDSA 1TUXA 4KETA 3BAJA 4X22A 1RQBA 3MUY1 3E0FA 3VINA 3PB2A 1JFXA 3CYJA 4IFOA 2W4XA 1XL9A 4MG4A 4R34A 1GZJA 4EPEC 1E6SM 3S47A 3LCFA 1QBBA 1ICPA 1R5YA 3MPGA 5EMMA 3EBVA 1RSCA 4QDWA 4V2XA 2ACRA 3HIJA 2D2JA 3LM7A 3IUHA 3MUCA 4POCA 1RBLA 3ARTA 4AWEA 3LBOA 2Y5EA 3LCHA 3UZJA 3MSYA 1M3UA 3VNLA 4HHLA 1QI5A 1ZAIA 4LV9A 4N0RA 3S9YA 4D6HA 3QH2A 2A2IA 5DY3A 2WQPA 5HPOA 1NWUA 1CNVA 4MUPA 3IACA 5T9BG 3R7MA 3TYZA 3GYCA 1IEWA 4L4LA 1J11A 4E8DA 4Q3MA 5HWMA 5CSRA 2A3BA 3Q45A 3A9BA 5TF0A 3KZPA 4HU0A 3ITYA 3HQNA 3P8IA 4QSFA 2ALRA 4ZOEA 3N13A 4NX0A 4M7SA 4J3WA 1XDLA 1E1EA 1WDDA 2CBVA 1TO3A 1UD4A 2FJUB 4DY1A 4DJDD 2Z26A 3W22A 1FHDA 3MJYA 1DORA 3WNPA 5EBAA 1PIGA 3SSJA 1HP5A 1LF1A 3WF2A 3UNTA 3T8LA 4D6GA 4UQCA 1TCDA 1O1ZA 4OT7A 4TX8A 3E6EA 3GXFA 3VGBA 1FWBC 2CZDA 1IYXA 4UTWA 4BJHA 4GC4A 3SBFA 2XWEA 4I9AA 3FAWA 4AIUA 4DJEC 4XISA 2A1YA 4QE1A 1EXBA 1YXYA 4ZO6A 3OLIA 3S2MA 1DJWA 1TWIA 3WDPP 1DWJM 3GDBA 4NY2A 2BZNA 4D6EA 3GHSA 5CPQA 3LHVA 4M6VA 4DXVA 1C92A 3E2RA 4O1CA 1UCWA 4BQ5A 4P7NA 1EO5A 3APYA 3U2EA 4GVIA 4WCJA 4W93A 4A8LA 1V0MA 5A69A 3QR0A 1JVNA 5EMYA 3CZEA 4AD5A 1T8XA 1JDDA 1NQKA 3S5OA 4AHOA 3WQ6A 2PDFA 4INFA 2DQWA 4UMAA 2YDRA 1JXJA 3CEPA 1DE5A 4XZNX 4DYKA 2H8ZA 5JU6A 5CAHA 1ME8A 3WD1A 4M0XA 4PZVA 1QPKA 1E0UA 2Y85A 3TQVA 3WLKX 3HV9A 2R1KA 3ABQA 3KEHA 2RHGA 4US6A 1OYCA 5AN7A 3KVJA 3TJLA 2HK1A 3T8QA 5A8NA 1FWAC 1LUCA 2FZBA 3MT1A 3FHQA 3AMGA 4XD5A 4D6FA 2D20A 1JYNA 1GTHA 1X6NA 4GNVA 1F6PA 1QR7A 2VDHA 3GIQA 4N4PA 2Y7FA 1K6AA 4KEMA 1LP6A 4F9JA 2BXYA 1FDYA 4GUFA 3DECA 4O0KA 1X1ZA 2CNCA 1TMQA 4WGHA 2F38A 1PTGA 4AD2A 4YTSA 2XZ7A 1GVOA 1TPFA 3MHFA 3FAXA 4MKVA 3EDKA 2W9MA 5D04C 4BEUA 2FGLA 1DJNA 2YR1A 1PTDA 1JPKA 4BI5A 3FN9A 3E96A 4C90A 2XPKA 2YDAA 3DENA 1JPMA 1XIHA 3W2UA 3SRDA 3PHAA 1RPKA 3N18A 4PUNA 3JZUA 3SFWA 5BNKA 3AIEA 4I5RA 1NP0A 5FIPA 1VEPA 5EMLA 4W84A 3RPTA 3GNRA 5HJYA 3HPSA 3MO7A 1KBBA 4PTWA 1V02E 2CHNA 5I09A 2Y89A 3T0DA 3BZGA 1J10A 2DSZA 3GAYA 4MWAC 1WDRA 3S1UA 2G41A 3GE7A 3IVTA 1ISVA 1MNZA 3ZT5A 6TAAA 4R9XA 4URIA 2WWDA 4E3VA 4R27A 2J7CA 5LNUA 1LOSA 1VBGA 1O7AA 1QNVA 4BF9A 4P2VA 1D9EA 2PDKA 4LAUA 5GNZA 1XLKA 1K02A 2HE8A 4L5ZA 1V3JA 2RDWA 1GWJA 2C3ZA 4P5UA 4IGMA 3GTIA 3VIFA 1MYRA 2IPWA 3NSNA 1G7VA 3DHDA 1M04A 4Q4MA 4IWWA 3KCLA 5A8PA 1MUMA 2EO7A 3V7PA 1PHQA 1SMDA 3CB8A 1UWUA 4GE8A 1XGZA 4HNLA 1B2YA 3NR0A 3QQ1A 2WXDM 4KWSA 2BXZA 1RBOB 3GHRA 3LK6A 1NWSA 2P0IA 3AXKA 5HA7A 4ATLA 1JCYA 4L6HA 3YPIA 1ZJBA 3VXGA 3OQEA 1LCOA 3LXBA 3RR1A 3WQPA 3VUPA 2JE8A 1WZMA 3GG7A 3W1XA 2YSWA 4QX4A 1CPUA 5D8ZA 4FNUA 1S5TA 3K8LA 4FX8A 2XIIA 1SUXA 3OZMA 4LRSA 4S3AA 3ITXA 4PCPA 1L8PA 2X1IA 5BXRA 4LFYA 3SGUA 3WELA 3KBMA 4IG2A 4HU8A 1XC6A 5FSEC 1RD6A 1AH4A 4LUSA 3A4JA 4G6CA 4GVGA 1XUZA 3W1NA 1KXVA 3FY1A 4TV6A 3O6AA 2NXGA 4O4VA 1E5JA 3T2QA 2X0HA 4FALA 2GSHA 2VWSA 1JG9A 3EXTA 5CJ5A 4I9TA 5C2XA 1Q5MA 2ZRXA 1ME7A 3LZ5A 1XICA 2QDGA 3FDKA 4RXGA 1IHIA 4OGZA 4IMGA 3GW0A 3VI2A 2JGQA 4GINA 1VBUA 4K7YA 2DH3A 4ZO7A 1DIOA 3E0IA 2FLIA 4S1FA 3GBEA 5EU9A 3VGEA 3WH8A 1UD3A 1E6XM 4BZYA 3NAVA 5I3HA 4CVUA 2VVNA 5XINA 3W7MA 3CQIA 1QHPA 2BODX 3ARVA 4ZVJA 3AHXA 4CCEA 3R43A 2FTWA 1NJJA 4WDUA 3H2AA 3RX3A 3PWIA 1RHCA 1F2JA 1ZTVA 3BW2A 4HBKA 1TR9A 1R2RA 3RX4A 3P84A 1S5NA 3S46A 1EA0A 3BAYA 3QQ0A 3HGJA 4RK8A 1RA5A 5IHSA 2VRKA 3BE7A 2YJQA 1YXCA 1XI3A 3GNXA 3B8VA 2XH7A 3W28A 1GNXA 4IJCA 2OZ3A 4ZFCA 4CVWA 1M65A 4KRZA 2A6LA 5A6BA 1EEPA 1G67A 3U4AA 4I6KA 4KT2A 1OT2A 1EJWC 2H90A 2BY0A 3UNDA 4MNJA 1QNSA 3KP1A 3GUWA 2BHZA 1VPQA 1C8QA 4PTNA 2ALDA 4Y9OA 2AQWA 4LVGA 3URAA 5AC7A 1ZAHA 4IL2A 4ADTA 5K9XA 4Z2KA 5J04A 1DWAM 3SAZA 2FB3A 4IIGA 2DVTA 1TMHA 4L64A 3FK4A 3NPWA 1GCYA 2C0AA 1RPXA 1W5QA 3GNOA 4AF0A 3FX4A 1LOLA 2VVSA 1LBMA 1H7XA 5MHBA 3L66A 2PU1A 2AAAA 2NLIA 1CB7B 2C0HA 2OQYA 4JIQA 3JVAA 1KLYA 4AMAA 1J4EA 2DSWA 1NSJA 4KWOA 3BVJA 1SZGA 3TZFA 4NKCA 2RDUA 5FEXA 3P6LA 4CU6A 1QW8A 2DVUA 3TW6A 1YBQB 1OG0A 3PWGA 3IEBA 1WKFA 3H21A 1HGYA 4KEUA 4IT1A 4K8EA 5AYBA 5EBUA 2PCQA 1UR9A 1XPYA 2ZX6A 1OF8A 4RPQA 4AIOA 4NNCA 1I2QA 1S5MA 1UKPA 4KEZA 5F2GA 4KRTA 3ZLGA 3ITTA 5HMEA 3PBVA 2XVNA 3BLDA 2VEIA 1B3YA 4DJED 2VP8A 1B30A 2GVLA 1V3LA 3UXKA 3LI1A 1U2YA 4W86A 1XLGA 3RX2A 2J24A 2ZZ4A 3TA6A 4UTJA 4WOQA 1TPC1 2O7SA 4DF1A 2PRHA 3TAOA 5CSSA 3FA5A 3EA1A 4HZMA 1QNQA 1QMLA 4A3QA 3VNKA 5AYIA 2VI0A 3ITGA 4UFKA 3SCTA 4DN1A 5EKYA 4Y9AA 3LUTA 1OCJA 1TE1A 1LTDA 1RR2A 2B7NA 5DF0A 3CZGA 1JZ4A 4S3EA 4ZEPA 4B3ZA 4MFEA 1Q85A 1GQKA 4JEJA 3L5AA 3DG3A 4KEVA 4LC6A 1K9TA 1F73A 4ZSUA 2BGNE 4NHVA 3QGAC 3NZRA 1J8VA 3QVQA 2EGZA 3EKLA 4Z1YA 2QIIA 2VEFA 5E6YA 5BRQA 3M4HA 3BH4A 2AOSA 3ZM8A 4XAFA 5FAGA 1UZ1A 2ODOA 2BP1A 3CTLA 3W53A 4D6CA 3S1VA 1VIWA 4QHRA 4GFIA 3KOZA 3A6OA 3A64A 1XIIA 1TPDA 1EIBA 1SJAA 2QMKA 3DFSA 3TN3A 2JBMA 3IGXA 3LTYA 1W54A 2OPJA 3R10A 1QI3A 2ZFAA 3B0YA 4IF2A 3B8UA 3VUSA 4A3HA 3RGTA 1DWIM 3UCCA 1YTKA 1V93A 4MKNA 4H7ZA 5HJLA 3I7SA 3NQFA 1GG1A 4XAZA 4R7OA 4CLMA 2TPSA 4UFHA 2GQ8A 2NQ9A 1DHPA 1YQ2A 4NAEA 4XZIA 3RJYA 4K36A 3KDOA 1SVDA 3LTPA 3MI6A 3W76A 2R6OA 3NQ7A 2Z1VA 1U83A 4GQRA 2VDGA 3TX9A 2R24A 5TQLA 4BI6A 4XAPA 1GW9A 4ICCX 4WRHA 4XKMA 3TK7A 3WQ8A 2VFDA 3VAVA 3T42A 3N2OA 3OLGA 2XISA 4L9XA 4MWAD 4DBDA 4UCGA 3P0XA 3B0UX 3EMCA 4HGXA 3NOYA 3VOJA 4M8UA 3KLLA 1VCVA 2BHYA 2Z29A 3J7HA 3L4WA 5M3WA 3GXIA 3I10A 3GG0A 3N25A 2PD9A 4GIAA 3RLHA 3ZSTA 3WX7A 1OD8A 2GUYA 1HFBA 2BTMA 3TQKA 3DYPA 4PGLA 3FXGA 1IEVA 1N8FA 2CWNA 4PMZA 3WD4A 3WLHA 4QQ3A 4HHMA 3CASA 3MVTA 1YRRA 4OOZA 1SU5A 1REQB 4GLEA 5CPTA 3IV3A 1RLCL 2ZOXA 2PTYA 2XIMA 2VYOA 5IRPA 1UIOA 3MW7A 1UROA 3F5LA 4HNUA 5G5IA 1PHWA 1UQZA 3JRKA 5CBIA 2D0HA 4H19A 1FKXA 4YTQA 3W88A 5H8MA 4FX6M 1V3MA 5U7SA 2WZIA 4DRSA 1VRDA 2GK1A 3CGTA 3KTSA 2AL1A 3W25A 3INPA 2BMBA 4JX4A 3HGSA 1O95A 1A5AA 1IXPA 3L2MA 3M0HA 3N17A 1H63A 2JALA 1OGSA 4Z08A 2WMHA 4UXDA 1FRBA 1J01A 4HCLA 4PRTA 2OGJA 2QGYA 3TTEA 2XH2A 4B90A 4JKMA 4PUUA 3SW6A 1WBHA 3G1YA 2E40A 2XM1A 1BKSA 3TQ0A 2XN2A 3QV8A 3GTNA 4JOMA 1D3CA 2J62A 3TC3A 4WDXA 1Q6RA 3GHTA 3W9ZA 3MUXA 2XINA 1A0EA 2C1IA 4WSHA 2XJ7A 3UU0A 5A95A 2ZADA 3B06A 1B4EA 3L4YA 4LUIA 4NI3A 2ZBTA 2J7EA 3M6YA 4TMCA 4BHYA 2PLCA 3O3RA 4Q8OA 2V68A 4GQ0A 3WFZA 4ES4A 5CH9A 1OFBA 3NDYA 3OZYA 3UW6A 4XKYA 4PL1A 1FOBA 2G3NA 4HTBA 2V2DA 3FSUA 2VM8A 3C0SA 2ZXAA 1Q65A 2CKSA 4I6VA 2GJXB 4C6CA 1AH3A 4FR1A 4AZ5A 3TN6A 2EQDA 4ZBCA 1RUSA 1G4EA 5EMKA 3M0MA 3C8FA 1FBAA 1N7KA 1IXNA 1MZRA 1VD6A 4N2YA 4HP5A 1LOQA 3CT2A 1WDQA 1XYAA 1BHGA 3R8GA 1KXHA 3CQ0A 5BZAA 5C9XA 2ATSA 1YW1A 3LGDA 1Z89A 1UJPA 4N9EA 4B15A 3GR4A 3KWXA 2IS7A 1NTHA 2FH6A 1AODA 4GIEA 1OEPA 2GOKA 4IUGA 4GUHA 3KZSA 4YCPA 1PZ1A 4UB9A 1GOXA 3V3WA 5GJNA 1OC6A 4HB7A 1GUVA 1WOBA 4ADSA 3CUFA 4ZE5A 3UGRA 3VTRA 4FXJA 1F5ZA 1LRNA 2FZMA 3DHPA 3QHNA 3VC5A 3K4AA 5HDRA 3GR7A 2E8YA 4K7VA 3RITA 1HP4A 3NPXA 3WENA 3PM6A 1XV8A 1NFPA 2WZHA 1XCWA 4Z2JA 4MIMA 1S1PA 4XD4A 4REQA 3GU2A 2IKJA 4JX6A 2VQUA 1N8WA 1YMYA 4AXNA 4QJ1A 3QSTA 3BMXA 1XIFA 3E0LA 4MWAE 4YYCA 2RGLA 3A3XA 4O10A 3RO6A 3WBXA 1H7PA 4C5ZA 1UQYA 1H62A 3CV6A 2RUSA 3R12A 3LZ3A 4PB3A 3VMNA 3W7LA 3HMJG 2CHRA 1I0BA 5AOUA 1PO9A 4MZ8A 3WD2A 5HANA 1IQ8A 2PDIA 4IMEA 3PULA 1JUEA 1L6WA 1W31A 2BVTA 3BOFA 1P43A 2C7FA 4Q22A 1VPYA 2V38A 4ZXLA 3DFHA 4B3KA 1OYAA 3AOFA 4RNJA 3SCNA 4RUBA 5KZDA 3UXLA 3BQ5A 2PBOA 4WXZA 2Y88A 3KM8A 4CEXC 1UR0A 1YEYA 4Z2IA 4G1NA 4PR4A 3MHUA 2POTA 3V5FA 2CERA 4AD0A 3GUGA 5DT7A 1EWEA 1MQQA 1E0XA 3E49A 1MWOA 5H8UA 4DM1A 3FS2A 4E4FA 3ZR5A 1R9YA 4LQ1A 3CHDA 3MKVA 4QFUA 3SGGA 4GYPA 4J1OA 1W1TA 4JYFA 5GNYA 4LF1A 4PBEA 1E73M 5DLCA 1X1OA 2WSKA 4HA4A 3PK7A 1TCMA 4A3UA 2Y0FA 2G3MA 3VFLA 1XRTA 4IIHA 1GVFA 3VC6A 1TJRA 2CIPA 1O5XA 4XD3A 4EPBC 3DKLA 9RUBA 2PSNA 4AYGA 4Y2WA 3FNDA 4EF9A 3EYPA 1E71M 2HTMA 8A3HA 4DJFC 3EX1A 2V5BA 3LM3A 3C5QA 2WJFA 3G5EA 1BGAA 2WVTA 1P6CA 1ME9A 3JS3A 2BDQA 2PDXA 5FD0A 3TV8A 2AQOA 1PWMA 4Q8PA 4QQUA 4WF7A 4C6KA 4MM1A 2HBXA 2QDHA 3DOPA 5AFDA 2F2KA 1H49A 4P7QA 5AC8A 3CL7A 2YCIX 3UA3A 3DBPA 4GK8A 1TPB1 1JRCA 1EHAA 4P7LA 1VCGA 4DPPA 4GZJA 4L7ZA 1CBGA 3PUDA 3KHJA 3R8RA 1WDWA 3QV7A 5CSUA 1G6CA 1Q7QA 1UOKA 2PZ0A 4B2DA 1BYCA 3LY0A 2D2GA 1UP2A 2WJDA 2GYIA 4NRSA 1XBVA 4LVAA 4MUZA 3S6OA 2PU0A 4EX4A 4NXSA 3E5BA 5LIYX 1KBIA 1JRBA 3SCSA 4M81A 1LT7A 3CBWA 4AW7A 1K8ZA 2HPIA 2ESCA 4NL1A 3QFEA 3OG2A 3DERA 4R53A 1KQYA 3GBDA 4NZ4A 1HKMA 5C55A 2Y7EA 3SECA 5E0CA 1IIHA 3T0BA 4LY8A 4ERIA 4PMYA 2WNQA 4Y8FA 2VENA 4C5YA 1SJBA 3ICJA 2OKOA 1UWTA 4HD5A 5JH2A 3N15A 2DZVA 5TBOA 3L0GA 1G0CA 1XDMA 5BMXA 3M0YA 3EMZA 1CXIA 2QJHA 1EC7A 5ABFB 4PMVA 3DFPA 2W5FA 4M56A 2J77A 1F74A 3OIXA 1FHUA 1FWSA 5I3GA 3NYZA 2Q6ZA 3AS2A 1AJ0A 1FCQA 1POJA 1QTWA 3I3BA 3RLVA 5CGTA 2WPGA 3DX5A 1GONA 3GY1A 2QF7A 1WX0A 1L9WA 1ENUA 4WY0F 3W7RA 2GOUA 6REQB 1JPHA 3VMOA 1TV5A 4KWWA 4MTVA 2WO5A 1GW1A 4LOCA 3HM7A 3UXIA 4HPGA 4QEEA 3W85A 1OFEA 1RP8A 4GUIA 2ZUNA 3WUGA 1UC4A 3G22A 4M24A 3LI0A 4GC3A 3BSGA 2GSEA 3F1QA 4X2RA 3TIMA 1MZHA 2E1WA 1KXTA 1XUUA 2Y63A 3MSDA 1OFRA 1F61A 4NAFA 4IFKB 1UWSA 2DV0A 1XLLA 3K30A 4ZL1A 4H1ZA 4XSLA 3C8NA 1PIIA 3QPYA 2QCDB 3VDGA 3O63A 3WDHA 2AAMA 2AGTA 3TUUA 3URQA 1XW8A 3S6DA 2DP3A 3BWWA 2GGEA 3ELFA 4LXFA 2WMFA 1CX9A 2ZC1A 4B5NA 1W1YA 1XYBA 3WDQA 1R2TA 3F7JA 2PTDA 3LMYA 2WV8A 2MNRA 3WLNA 3B4UA 4UFIA 3RLGA 3GXDA 3MV01 4S3BA 4Y6GA 3H4WA 1TFVA 1C7SA 3UWYA 2CLMA 5CZTA 2DUXA 3NGFA 4PTMA 4OKDA 1HG3A 2WPBA 3VD4A 3MHGA 3ARPA 8RUCA 5AVNA 2R1NA 4DAFA 1BYAA 3F5JA 4D6JA 1E6NA 1XS2A 3NZPA 2V69A 2G5WA 3W7KA 2WHJA 1CW2A 3GH7A 2OSWA 3CAVA 3KOFA 3T05A 1HUVA 1Q2SA 1JI1A 3LSCA 5DN1A 1KKOA 4RV8A 4TOQA 3SUUA 3M43A 4HPXA 1SQ7A 3LGGA 3Q67A 5I3JA 3MWAA 3MCNA 3S1GA 2XDFA 3WF4A 1KGWA 3IK4A 2BS9A 3AHZA 4A29A 1H1YA 4AAJA 5CZKA 4GNKB 4QLJA 5RUBA 5D9PA 1UYQA 3PBWA 1D7KA 4GY0A 2H9AA 2CW6A 3WF3A 2B7QA 1KTCA 4AC7C 3QR1A 4F0KA 1LRQA 4HT3A 4JFUA 3QV9A 3P14A 3FJ6A 3P62A 2HNEA 1OGGA 1T5AA 4QS5A 1KM2A 1ADDA 2Y70A 2WMIA 4Q7IA 3EB3A 3CC1A 4UTHA 2DIJA 4Z1CA 4AFYA 1OINA 2P3ZA 4AWUA 3G77A 1FP8A 4JTAA 4GBUA 4CQBA 1VEMA 5REQA 4HQVA 2BSLA 1TPEA 1U22A 4MY8A 2PTZA 2CWXA 3MA8A 5BWAA 4FF5A 1QVBA 5C70A 7REQA 1V51A 3KUMA 1OG6A 3U0HA 4A35A 1OFPA 3TCEA 3URBA 3W7EA 1DXIA 4F0LA 1C8VA 3O6YX 1XLBA 3UFYA 2VTFA 2J6VA 1NF0A 2I16A 5BW6A 2B81A 1C90A 2J25A 5DFAA 2FDMA 3IUDA 4O54A 1X7IA 3MDWA 1L6YA 5FJUA 5TAOA 3N29A 1XGDA 4ZO9A 4B5UA 1AZ1A 4U3CA 1S3HA 3ME3A 3QMSA 1KQZA 4LYPA 2Z25A 1XYCA 3O0FA 3RXZA 3LU2A 3N6QA 4I9JA 4BI7A 5CZ0A 2DT2A 3C86A 5KZEA 3PN8A 3CYVA 4DPQA 4UTTA 4PCFA 3MP3A 4MZYA 2BVYA 5IDZA 3OLEA 3QC0A 2DUZA 1GZGA 2EPMX 2XGBA 2V2CA 2QHAA 5LA1A 3BMVA 1J2BA 3NIYA 4PEEA 2YKKA 3CUJA 2FTPA 2CFFA 3WNMA 3CIXA 2PDHA 3L4UA 4A2SA 2VCAA 4JNYA 1UH3A 3HOJA 3KS5A 4C6LA 4KKXA 4S2BA 3CHCA 1OCNA 3M47A 4O19A 3H54A 1YXDA 1YLVA 4RE3A 4R88A 3WKZA 4AZIA 2E6AA 2DY3A 1HJSA 3L0NA 1XR2A 1ITQA 1F6KA 4W7UA 3GH4A 3MZ2A 2Z7GA 4DJFD 3VIHA 3RN6A 4G5DA 1UZHA 5LYRA 3AAMA 3FHAA 4O16A 2W61A 3GAKA 4E3TA 4F0SA 4AB4A 3CM4A 1KB3A 1QOQA 1GVRA 4U3AA 4HKPA 2R9RA 1F8IA 3DKJA 3CZJA 5E0KA 5CPMA 1NFBA 1HTIA 1BXNA 1ZCCA 3TTQA 3TSMA 3LBMA 1MO0A 1A5MC 1AH0A 3LLFA 1L6FA 1H7OA 4F2UA 2QKFA 4AEEA 3MTWA 5CLTA 2ZZ7A 2V5DA 2ZQ0A 2RDXA 2X05A 3OBEA 3NEHA 2CZEA 3WLQA 2ZZ1A 3NQBA 1M53A 2OX1A 5IDIA 3EOEA 1NELA 4K3ZA 1ML1A 1TV8A 1SSDA 2GGJA 2IUZA 2V30A 4Q8TA 3IJIA 3AS0A 2YW4A 3HJEA 5IXEA 5BXTA 1SZFA 2CBIA 3G6LA 3H2OA 4CGTA 2VZVA 3H12A 1PDYA 4MAVA 4FXFA 2ZXQA 2PWUA 2ZTKA 2XH4A 4CQ9A 4QR6A 3M6DA 1M03A 3AMCA 4CN4A 1BF2A 3NPUA 2O9OA 2DIEA 3ARRA 3I4KA 2R8WA 3AUOA 2DZPA 3ENLA 4CQ8A 5H8PA 2I17A 2I5QA 3DFYA 4C7FA 2PCEA 3EDJA 1VB9A 5F7UA 3GDMA 4AY8A 3GVRA 3VIKA 4O52A 2WC3A 3M5YA 3EX3A 4BK9A 2Z1KA 3KTXA 3FDGA 4A8IA 1QATA 2QPSA 4Z1DA 1M1BA 3V75A 3FKKA 4H8HA 4MJZA 2YCEA 5JBFA 4DVOA 1ALDA 3QPZA 3EWCA 1CXFA 4BR1A 1CGUA 4HNTA 1UWIA 4JCMA 1ISWA 1XISA 1DWHM 1E43A 4RCXA 3N14A 3ONCA 3M07A 3RHGA 5FACA 3WD3A 1NEYA 3E02A 3N9SA 2YGYA 3GC5A 4WKHA 5KEZA 2GVEA 3KOXA 1HKWA 4IJRA 4ZFMA 1HL2A 3VIOA 3UYIA 2CXEA 5XIMA 3NO1A 2ZXBA 4ONVA 1M5WA 2JKAA 2IPGA 3ARWA 3B97A 2X09A 2Z4GA 3CIVA 1J12A 3V35A 2PFHA 1PL9A 1YKWA 3P80A 4Q4PA 4NYYA 4UWMA 3G2GA 3MQTA 4U28A 5KINA 4GY1A 3Q58A 2Q09A 2X30A 4RPPA 1HW6A 3MYOA 3PTQA 2JIEA 2X1RA 1Q2RA 3HFYA 4K1WA 1K8YA 4M6QA 4LANA 3OVRA 5HMSA 3GRIA 1HKIA 4UFLA 1HNYA 3DC8A 2V5KA 4FNSA 3LERA 1LQ0A 1JYWA 5A8GA 3GNNA 1IWPA 1ZGDA 1P0KA 3GKAA 2E6YA 3C4UA 1VFUA 4XBSA 2EXOA 2W3ZA 4TV5A 1CXHA 7TAAA 1JXKA 2PTXA 1A3WA 2J13A 1BTCA 4AD3A 1MEWA 3OGRA 4C7GA 1J18A 2CKRA 3W71A 2D3NA 3W82A 1JCNA 1FWEC 1IEXA 1CDGA 2TRSA 4GA8A 4WXYA 1JZ8A 3BZJA 3PBGA 3UR7A 1FH9A 4JIHA 3ZWTA 4XSMA 2OQHA 2DUAA 3B04A 2XFYA 1B3VA 4FI4A 3DHFA 4ACZA 2UWFA 3LRKA 2NVCA 3GTFA 3W3OA 3AXMA 1VRXA 2QW5A 4RZ6A 4DX3A 3E74A 1AQHA 3QW3A 4HNOA 4EWND 1ZALA 1PB0A 1QPOA 2V81A 4DF0A 1LL6A 4W4QA 1OJXA 2BGSA 1R7OA 1MFUA 3WO8A 3L23A 3KS6A 1MFVA 4A21A 4PMQA 2ISVA 5I24A 2C71A 4HA3A 4Y7EA 3UVAA 2DZTA 1U33A 4RKAA 2RDTA 1LL4A 1RXOB 3NM1A 4PB5A 3AZSA 3ZJ6A 1WE5A 1Z7AA 5FJIA 2X1SA 3GFXA 1QXLA 3UERA 5LSMA 3W02A 3RCNA 3STFA 1ISXA 3NQGA 4RR4A 1W1VA 4W85A 3WLLA 1ZQ5A 3O07A 5CBBA 5DRIA 1F8MA 1B9ZA 2FZNA 2VEKA 4ECLA 4OIFA 3EB2A 1BFNA 3B9OA 1J0JA 1V08A 4S3JA 1Q6OA 4GACA 3MI3A 5K2ZA 2FKPA 3CT7A 1FCVA 1Q45A 1JEZA 3BICA 2XN0A 2Z6JA 4NASA 2EPNA 2HXUA 4V33A 4O57A 4D8LA 4WY0B 3LCLA 1TIMA 3EKGA 1A4LA 2FQIA 1W6TA 4AX7A 4IICA 4OV9A 4GD0A 1T40A 3BOLA 1PEZA 1PAMA 2B31A 3G1DA 2WSQA 2C14A 1ONEA 4YVVA 2VEGA 1KBKA 3ZT6A 4J4KA 1SYTA 3LTSA 5A6SA 3RIKA 2VCCA 3S5NA 1UD2A 4HPHA 4L1WA 1AA1B 4CD7A 1OADA 1VJIA 3HZ3A 4C6DA 4BQ3A 4P8XA 3NL5A 4PN2A 3VE9A 2YDSA 3VNJA 2WVUA 3HURA 3MJMA 3RUBL 1PCWA 3E0VA 4XZLX 2Q8XA 3CU2A 3NQEA 4DYEA 1HL9A 5BWFA 3PTMA 1UKSA 2XFWA 1DJZA 1A5OC 1F4HA 5I7GA 4ZB0A 4AIEA 2VHLA 1CLKA 1LQ2A 3N2BA 3AXXA 3GDLA 1KM6A 5HJXA 3B40A 4QNEA 1HX0A 4ZB5A 3RMJA 3H2MA 1RLDA 2VGGA 3ZLHA 1OCQA 2CLLA 2PLKA 3NO5A 4M19A 4PYSA 5EGRA 3S1WA 1DJXA 1UH4A 2OODA 1FDZA 2GWGA 1NIUA 3R89A 4IMAA 2PP3A 3M5VA 2GPTA 3IRDA 2QAFA 1R2SA 3CUIA 4QITA 4JN8A 1SFLA 4IPJA 2Y8KA 2INEA 1K1DA 3GO2A 4PMXA 1ADOA 4GRSA 3V36A 4MB1A 1EJXC 2JKEA 3S2CA 5EB8A 4UQEA 3THUA 3UEQA 1L2QA 4AISA 5SWUA 3FXYA 3WYZA 4LS0A 5AECA 4JX5A 3BG3A 3LV6A 3BXWA 4RNHA 4HK7A 4LCSA 1Q6LA 4JCLA 3DYOA 3BSHA 1F9CA 2X0YA 1HJQA 1MXGA 1XYMA 1TKKA 2FDSA 3DFNA 5LXEA 3W70A 3NQDA 4B9ZA 1WKEA 3N6HA 5IOBA 2WMGA 1BRLB 1X6UA 4H9VA 4GQQA 4F40A 1QPQA 1QK2A 5F4WA 4EPKA 2ZICA 2CLIA 3W7DA 2YCLB 3VX0A 4K2SA 2PWEA 2HS8A 4J2MA 2P3EA 3NL2A 3R6IA 3S9IA 2E09A 2VMFA 4J3SA 3N3TA 4JXCA 3BL3A 1QUMA 7ENLA 3MWCA 3WL1A 4C91A 6PTDA 3OQ8A 1E0VA 3NZ1A 3PS7A 2C19A 1DBTA 4J3XA 1VP5A 3BCFA 2OJPA 1MW1A 2I56A 3SRKA 3GZ3A 4HMNA 4WKAA 4R3UA 2QVNA 2GLKA 3LS9A 5EA9A 1VAHA 3VM7A 3W1UA 4D2JA 4W7WA 5HK4A 3QZEA 4FNQA 3SQMA 4A22A 3B0VC 3EWDA 1EO7A 1XLHA 2E68A 5LNSA 3KXQA 4QCEA 1LWIA 4BKNA 8CGTA 3GDRA 1VCFA 3G3DA 1E1CA 3WMSA 1J6OA 1AW1A 3WNKA 4YWSA 2OZ8A 4ILSA 2HSAA 5D9MA 1E6QM 1US2A 3R5EA 4HPJA 4IX0A 3PANA 4LTSA 2V0TA 4TTGA 2GVGA 3LHWA 1X98A 1SSGA 2ABBA 4M6PA 1JD9A 3HMCA 4GYJA 1J0ZA 2BB0A 1OK6A 3DGBA 4AIBA 2CLKA 1N2VA 1XRFA 3WMLA 1EBHA 2W79A 1S2TA 1DVJA 1GOQA 2D22A 1DL3A 3WL0A 4N02A 4HMEA 4M5PA 2W0UA 3RO8A 2QAPA 1CZ1A 2VELA 1BAGA 2Z2UA 4XZMX 1DTNA 4YJ5A 3VIMA 3AS3A 1NP2A 1ECQA 5D8WA 2PDYA 1XBXA 2CBJA 2NLYA 2HISA 2HVOA 4M3PA 4A8RA 2WBKA 2JF6A 1XRSA 2XGZA 4GQGA 1T99A 4I3GA 4ZQRA 1EP1A 4ORIA 3ZVHB 4M7TA 1VEOA 4LY4A 4S23A 2CZFA 5I0DA 3AIQA 5E0FA 2G96A 2CZVA 1W9VA 4DZAA 2XSBA 4ZQOA 4DYJA 4HA1A 5FOOA 2ADAA 2NWSA 2IKHA 2V5CA 3TOPA 3C2EA 3AMDA 3W29A 1ZY9A 3D6NA 3O1NA 3N1AA 3AIWA 4DBWA 5AY7A 1GVQA 3I3EA 1Q66A 2INFA 4GY7A 3EA3A 3VE7A 3H26A 1G1YA 2OYKA 3BANA 3LN3A 2C6QA 1EJUC 4XV0A 2OWCA 4AMCA 4BS0A 2ZRWA 3BW3A 3IJ7A 2EPOA 4LH8A 1K7FA 3BV7A 4GWEA 4UMBA 4IPLA 3LQGA 2NX9A 1KBLA 3N4EA 5CKSA 4B16A 1V5XA 3KRBA 1UR8A 4MGGA 3VILA 3ZWSA 4P7RA 2VR4A 4IGSA 2D1ZA 3AI0A 4FNRA 2OLSA 1E72M 4M6UA 3ECQA 3WQOA 4H9TA 2VXNA 1S46A 2GGHA 2DJLA 1IE7C 3TFCA 1WUEA 2G3JA 4WDWA 1E9YB 1NY1A 2YFOA 3O6CA 2JFEX 2WWCA 4HSOA 3O2LA 1HF6A 3QBUA 4H7CA 3G1AA 3SUWA 3SADA 1F4AA 2W63A 4F48A 3TNBA 1E4NA 3CEUA 3M7SA 4I8DA 3USBA 3M9YA 3BQ6A 1VIZA 3A3WA 3VFCA 2QS8A 1K4HA 3W72A 2F9RA 3PC0A 4N6FA 3HN3A 2XSXA 3QYQA 1WUFA 2Z2AA 2A0NA 5ABEA 3ATZA 1OFDA 4HMDA 1TVLA 2A21A 3A22A 4M80A 4B5WA 3GC4A 3BJSA 1KR0A 4NZ5A 5L9FA 5FESA 1ITXA 4DEFA 3PJXA 2PURA 2YBVA 2ZWYA 5LA0A 2J78A 1JZ6A 2ZA2A 3CO4A 4AWSA 1XC4A 2OMAA 1OD0A 3EMQA 3MMWA 2HNHA 2O4QA 1LM1A 5L6UA 5CJNA 1W3TA 1GOKA 3AROA 4MADA 3E3HA 4DXKA 2FHBA 3M64A 3D0CA 2QV5A 4K6AA 2C15A 4V1YA 3W1AA 3S5YA 4LC8A 1WXZA 3MANA 1GQJA 3GU1A 1MUWA 4DZHA 4J35A 1ZL1A 3M0IA 4RLIA 4MJ2A 3DC0A 1JZ3A 6TIMA 4TVCA 5K3VA 1TRIA 3NQVA 4YCOA 4K8HA 4AHQA 2IQTA 3S2LA 2IPJA 5A8MA 1IT8A 4PEKA 1CLVA 2X42A 3C2VA 2FHFA 2ATMA 2PWGA 1E40A 1S2VA 3PUEA 4AHPA 2EJ1A 2WOQA 3WQVA 4Q8MA 3TMQA 1HL8A 1RQHA 2H8XA 3STCA 3QY6A 4N7QA 3WK3A 2XIQA 4EAYA 1R3RA 4HOWA 1Z42A 1UR4A 1LT8A 4KFNA 1OGBA 5CPNA 3THQA 2CEQA 3FA3A 4JTKA 3REQB 3EPOA 4JHMA 4HYWA 3SRHA 2D2OA 2DZUA 4LUTB 1TRDA 2QLYA 5I03A 4F0HA 3AWNA 2WMKA 1TWZA 6ENLA 2A3EA 3TVAA 1NQ6A 3CL8A 3TCSA 1XIGA 1ZLPA 3AFBA 4Q8NA 3GDKA 3GDTA 5HINA 4UC5A 2VC5A 3I3DA 1DIKA 3AYVA 5CEWA 2P1FA 1T7LA 1EUAA 2ISWA 1GJWA 4J28A 4MB4A 4IIDA 4PE8A 1TZ7A 3FCPA 2UV8G 3N4FA 1OFAA 3IWPA 1EC8A 3KFTA 3OP2A 3QHMA 3SZ8A 5A94A 4O1EA 1IEQA 4WLCA 2OO0A 4JIPA 1MXDA 3QZAA 1Q4WA 2VEPA 3IARA 3BLOA 1JIBA 3S8HA 4Q8UA 4L6OA 3R8HA 4FIQA 1FXPA 2BHUA 1AK5A 5A2AA 4V27A 2EPKX 1EOKA 4S3GA 4LT9A 1ADSA 1G69A 4H8VA 3W1LA 3IANA 1F3XA 4A4AA 3HTWA 3G0XA 1EOMA 3ANUA 3D46A 1JPIA 4UTLA 3HQOA 2PODA 1UASA 3WY1A 1HJWA 4XO6A 5I3IA 5DMMA 4U5IA 3TSDA 1XLMA 1JAEA 1KW1A 4DWSB 3WH5A 4CUCA 2BXVA 2CHOA 5A5WA 4QISA 4WQ6A 2XH0A 4MPKA 1FWTA 3W7QA 1ZBVA 1R87A 3EEZA 4NJKA 3SJNA 4OV4A 4QJ5B 1D8CA 2AL2B 4I5XA 1IR2A 3KHDA 2WANA 4TO8A 1H60A 1BYBA 2ZXDA 2BGQA 1KGXA 4D1JA 3VIJA 3WJSA 1ELSA 2V67A 1VKFA 1QCWA 2CCRA 5G4HC 3UPWA 3S5SA 4MZ1A 3DCPA 4FP1A 3WNOA 4NQ1A 3TP4A 1B0IA 4QG6A 4BA0A 3PTKA 2QPXA 2PGEA 3WSUA 2AMXA 1IIGA 4AC1X 1AG1O 4JQAA 2PI6A 2OELA 4IOTA 3QMTA 5B7YA 2O9TA 1UR3M 2FPVA 3LMZA 3RM4A 4TR9A 4ATWA 1OF6A 3PSWA 3A3HA 3F4DA 3C0LA 3H53A 3QKZA 4XZ9A 3AC0A 1B3OA 2YFNA 1RP9A 2AQVA 5KZMA 1NDYA 2FPTA 4YTRA 3CL6A 2EKGA 4BWLC 1QAPA 4XBJA 3EKZA 1TTQA 3E9AA 1TV2A 3QM3A 1XF0A 1OIMA 2B7PA 4KIRA 1KM0A 3V1PA 3PG8A 2PP0A 2YXGA 4AG0A 2O56A 4UZSA 3QPEA 3WH7A 3UP8A 5BOEA 5LHEA 2UY4A 3TSBA 1WNOA 3WJYA 2Q02A 3P93A 1FWRA 2WZEA 1I8JA 4FO4A 3VD7A 1D2KA 1V02A 2VOTA 1VHNA 4UBPC 4I9MA 5EPDA 3OA5A 3SFKA 1IGWA 2J7DA 3V5CA 4JFSA 4MKSA 4OECA 4O12A 2NVAA 2BG5A 3N9RA 3QGVA 5FJJA 1E55A 1ZP4A 1TA3B 1LLOA 2EAWA 1GOMA 5HNTA 5ABTA 3DXIA 1VGAA 3BC9A 3NVDA 4PA8A 1ITCA 1YADA 4B3LA 4IP7A 2XIJA 1OFOA 4X3ZA 4ROPA 5EFFA 3GVQA 3FIGA 3EPNA 2YLLA 3BAXA 5DCBA 3UG4A 4DJDA 4ASTA 3GG8A 3QEZA 3GZAA 1JL8A 2YL8A 2OLAA 5DXXA 1W8SA 2G4JA 1VS1A 4JZ5A 2V9DA 3MBFA 7CGTA 1NDZA 1YE4A 3O7UA 5AHMA 3FLUA 3K4WA 4DF2A 3PPCA 3RJXA 1Q13A 1V6XA 3G24A 3U7BA 2QJNA 3OW1A 3W81A 1UUQA 3WFAA 3EXSA 4B92A 3ERPA 1PBGA 1V03A 3QKEA 2ON3A 3E12A 4IIFA 1SW7A 3TXZA 1LRTA 4XWUA 1JYVA 3K46A 4NJHA 1YPIA 1W3LA 8XIAA 1UG6A 1VJZA 7REQB 3M0LA 4G56A 3T0CA 2OEKA 5D9OA 3UG8A 3VABA 1AZ2A 1VR6A 3WK0A 1M68A 3W1QA 2X2YA 3CUXA 3TQPA 3NNTA 2VX6A 1KCXA 1VFTA 4Y90A 3N2CA 3B9NA 5KZ6A 3N3MA 1TTJA 3CHVA 1PE1A 1UJQA 4MVAA 3SM0A 2PB1A 3CUZA 1PX3A 5AC4A 2QCFA 5E93A 5AYYA 1I9CB 1XD0A 4PSPA 1W5MA 4XVDA 1HKVA 2NV1A 2WYSA 2PDGA 5IBXA 3VIIA 3KTCA 3VDAA 2HVNA 4KGJA 2WVVB 3QTPA 3JR2A 4IXHA 1B1YA 3VD3A 1H4PA 3CNYA 3WEMA 3VVGA 1XBZA 3K2GA 3WK1A 4GZEA 3MKKA 3UWQA 2PDNA 3APGA 3HG5A 4OUEA 1WCGA 3H23A 2X8RA 3NQ2A 2QVHA 3EOOA 5C2CA 3S0CA 4LCRA 4WEVX 1UA3A 1Q6QA 4L80A 1OB0A 2CESA 2QULA 1XLIA 4PMUA 3E5PA 3L5LA 3MI2A 4I90A 2ISFA 3OHIA 1M01A 1M9HA 1CWYA 1E5NA 3K8MA 3A24A 1FWDC 1CXLA 1KM3A 4Q33A 2C79A 1O1HA 1PKMA 1TV3A 3ABOA 1Q6FA 4DM2A 1W9PA 3SUSA 4HYRA 2I14A 3T9PA 5HNUA 3LGEA 1YBQA 4IPPA 3UJ2A 4GPNA 4E2DA 4ZSTA 2XUCA 3MDUA 1AW5A 1EP2A 2WCSA 3GM8A 2GDUA 4NZJA 2OZTA 1EDQA 1AD4A 5K9DA 1Y5WA 2WC4A 1R9XA 3OA3A 3PBUA 4E4PA 4KCUA 2FZDA 4AZCB 5C7VA 4GI4A 4GYFA 3WQFA 4D71A 5GJMA 3F2BA 4KGLA 1QO5A 4OTKA 3SGZA 1S2AA 3FYOA 4ZOAA 2OU4A 1V7AA 1N8IA 1R46A 3H55A 3NQMA 3PG9A 4IP4A 3SO7A 1FWWA 2CITA 3FOKA 4HK6A 3UGVA 3BARA 2HS6A 2Q8LA 2G0WA 2WM0A 5BYWA 3VCNA 5CG7A 4LX4A 1DQXA 1Q7ZA 3DG7A 3EOLA 5ABHA 2TSYA 3H22A 3ZYZA 1DIEA 2HK0A 3UY8A 1Y65A 4EACA 2PF0A 4ZZ9A 3WUEA 4JYDA 3ZQ9A 4FLQA 4O4WA 3VKCA 1BVWA 1YX1A 5JBEA 1ZJAA 3B8SA 2QCHA 3Q94A 2ONEA 2Z1SA 3OG3A 1V77A 1B4KA 3R4IA 4M82A 4UFMA 5BXPA 4JY8A 3SIMA 4G1KA 4KWUA 2VUNA 1TYGA 2YCJA 1XDJA 3WDJA 1YE6A 1KBJA 4PMJA 4F2BA 1ZHAA 3S83A 3UR8A 4M1BA 3FGCB 3BJTA 4JDBA 2QIWA 1C29A 1Q6EA 3LPOA 4O0ZA 2ZZ2A 1JUBA 4CD8A 2H6RA 1ZRQA 5AYZA 2OYLA 2FB2A 1XYFA 2NW0A 4B9YA 4MJMA 5EYWA 2E9BA 3VOGA 4MDPA 3EWUA 3B9EA 4LEQA 3ZVIA 3WK2A 3V0TA 2OWXA 2I1OA 4GX8A 3CXOA 1A49A 4DUVA 3GYEA 1AL8A 2E67A 5F1VA 1T41A 4UOJA 3POHA 2ZUVA 3M0XA 1JR1A 1TZZA 1PSCA 3RRXA 2ZRYA 3R11A 3EWZA 6XIAA 3I7RA 2QF8A 1GQIA 3CLMA 1O6IA 4Z0JA 5H6HA 3KCOA 3N12A 4JD4A 1KM5A 2Y5SA 1TJ1A 5T26A 3SN0A 1D3GA 1A80A 2I9EA 4RW5A 4ZENA 3VOCA 3GNPA 2PDBA 4ZCWA 2Q01A 5AKQA 3IVSA 1VZWA 2FFIA 3PFMA 3TAKA 5I6SA 4H04A 3KOYA 5AHLA 5I02A 3L5MA 4JR5A 5FJOA 3R0DA 1XH0A 5I3KA 1LG2A 3SB0A 3UJSA 1B5TA 3FJLA 3FYYA 1PWLA 5BROA 1X6LA 5DRCA 1ZBWA 4JDYA 4RL3A 2WAGA 3WH6A 2O55A 1M41A 2ACQA 1PTAA 3K5XA 3HQ1A 1BYDA 1K9DA 1REQA 5FL1A 4GHRA 2KX9A 3T81A 1JDAA 1DHKA 2BOEX 1DWGM 2J9YA 4UCFA 1FCUA 3TC7A 1XG3A 2Z0IA 1FWGC 2NVDA 4O50A 4US5D 2E25A 1YTEA 1I4NA 2PLMA 4C60A 3FA4A 2XIBA 2GQAA 3QGKC 3CAQA 1OBAA 2OEMA 4XUGA 3A4AA 2EPHA 4PODA 2GVJA 2I57A 3MZNA 2HMCA 1KFWA 3P82A 1R3TA 3C2FA 4XZBA 5KITA 1TG7A 3M5ZA 2QMJA 4QAWA 2CC0A 4AZBA 3P3BA 4DO6A 5E6ZA 1Z41A 3CPGA 2TAAA 3LLXA 4AXKA 4LRTA 4YS1A 4IH3A 1I45A 3RU6A 5H91A 3EGJA 2Z1XA 1Q6GA 1LL7A 1G5AA 4DLMA 5C71A 2GZXA 4UIOA 3RAOA 1EPVA 4K68A 4LV4A 4BCEA 3E2SA 2YB1A 4JEQA 3IIZA 3IGUA 4JTFA 2WNNA 3ZT7A 4PTVA 1F6YA 1CEOA 1HO1A 3ITLA 3VGFA 1G9HA 4S38A 2YX0A 1B3XA 4PRRA 5AHFA 2OCZA 3CIWA 2JQXA 1MRAA 4ZMGA 2INZA 1HVQA 1H0GA 4YVXA 2OG9A 3MVIA 3F2DA 1EP3A 4QRNA 1UP3A 5FL0A 2HJPA 1EGZA 4YLWA 2GDQA 2ZRZA 2OWWA 4DJEA 1TV4A 1ZJIA 2E9MA 1WZAA 5K4XA 3ARSA 4E4UA 2V3DA 2GJXA 3WLRA 2REQB 3QLDA 3ES7A 1XH2A 2CETA 3DYMA 2QJMA 4DO4A 1E0WA 4C6JA 4Q6JA 3ALGA 4CKQA 2OSYA 3N34A 4WOZA 2PDLA 3LA4A 4DUXA 2WHLA 5A8QA 3S42A 3T07A 1E51A 5D30A 2ABAA 4FNTA 3SCUA 4NZCA 4R7JA 1VC4A 2O9RA 3AICA 3T08A 4DO7A 1V3IA 3T0TA 4L65A 2CLEA 4UTWC 2I5GA 2EHHA 3PFRA 1WA3A 2HE5A 1YDNA 3TYEA 4UNLA 3U8GA 5I5RA 3CMJA 3NL3A 2FMOA 3HB9A 1UWQA 3DZ1A 2R1PA 2G37A 3U4FA 1Z32X 3ARUA 1PS9A 4QSHA 5KMYA 1GVYA 4FLOA 3W23A 4Z2GA 4DIAA 2YZRA 5DMLA 2V8ZA 3TROA 3S9ZA 3EWXA 5I23A 1H7RA 1RALA 2OZ0A 3Q2DA 3ONBA 1KRMA 1TPUA 3LHTA 3GVGA 4TIMA 3QR3A 1X97A 5I3FA 2WHMA 1WP6A 1U5VA 3WIJA 3LLDA 4HJFA 4JTCA 3B0PA 1SM9A 7A3HA 4EOUA 3S2JA 3D3AA 2GUUA 4QEHA 4D1IA 1B54A 1EFZA 3G18A 5A1AA 3A4XA 4ACYA 1TQXA 2X16A 4GJ1A 1AJ2A 4GABA 4WDTA 4NP7A 4EIVA 4JN7A 2XN1A 5CXPA 3B3DA 1FWNA 3EDFA 4Z42C 3COTA 3WBAA 4GI8A 2E3ZA 3AO0A 4H8NA 5IHRA 2A79A 4N4QA 4R9OA 4B91A 4AVOA 1EPXA