1DYSA

Endoglucanase cel6b from humicola insolens
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
345
structure length
345
Chain Sequence
b'GNPFSGRTLLVNSDYSSKLDQTRQAFLSRGDQTNAAKVKYVQEKVGTFYWISNIFLLRDIDVAIQNARAAKARGENPIVGLVLYNLPDRDCSAGESSGELKLSQNGLNRYKNEYVNPFAQKLKAASDVQFAVILEPDAIGNMVTGTSAFCRNARGPQQEAIGYAISQLQASHIHLYLDVANGGWLGWADKLEPTAQEVATILQKAGNNAKIRGFSSNVSNYNPYSTSNPPPYTSGSPSPDESRYATNIANAMRQRGLPTQFIIDQSRVALSGARSEWGQWCNVNPAGFGQPFTTNTNNPNVDAIVWVKPGGESDGQCGMGGAPAAGMWFDAYAQMLTQNAHDEIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
publication title Structure and Function of Humicola Insolens Family 6 Cellulases: Structure of the Endoglucanase, Cel6B, at 1.6 A Resolution
pubmed doi rcsb
source organism Humicola insolens
molecule tags Cellulase
total genus 143
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1dysA00
4AX7A 1QJWA 1OC5A 1OCNA 1GZ1A 1QK2A 4I5UA 3VOJA 4AVNA 1OC6A 1CB2A 1TMLA 2BOFX 3RPTA 2BOEX 1BVWA 3A64A 1QK0A 2BOGX 1UP2A 3VOFA 1OCBA 3A9BA 3ABXA 4B4HA 3VOHA 1UP3A 1OC7A 1HGYA 4AVOA 1DYSA 1UP0A 1OCJA 4AX6A 3VOGA 4B4FA 1UOZA 4AU0A 2BVWA 1HGWA 3RU8X 2BODX 4A05A 4I5RA 3VOIA
chains in the Genus database with same CATH superfamily
1XLJA 4CU7A 1QVBA 2F2KA 4GH3A 3M64A 1WAUA 1HP4A 1ISWA 3A5VA 4GINA 3AHTA 4O4WA 3CQIA 5E9XA 1XLMA 3I3DA 2J27A 3K4DA 1L2QA 1XUZA 3ECQA 1OFOA 2V3EA 3LGGA 1N82A 1GVFA 3G1FA 2XIBA 1UZ1A 1JVNA 4K3ZA 2VMFA 1QT1A 3SI9A 1RJRA 1XW8A 3H6OA 3T40A 3CHVA 5BXSA 2FVKA 1SQ7A 4IMAA 3TN6A 4LVFA 5HMDA 3SCSA 3G1VA 3MY9A 2WVVB 3R0KA 3B9NA 3MVIA 3WMBA 4DZAA 3V75A 5AYXA 4AF0B 4LALA 1G67A 4Q3MA 4EANA 5EYWA 4AHQA 4PSRA 4AYSA 1FUYA 3HQPA 2P1FA 5CEWA 3G8EA 2QUMA 4NASA 3T6CA 1IXOA 3HBLA 1CENA 3B8DA 4HHPA 2WM0A 1S3TC 2QDHA 2BGSA 3VD9A 1IR1A 1XIGA 1VYPX 3ZR4A 2QVNA 4DJFC 2PWDA 3JRKA 4Q8PA 2VZTA 5CSRA 3EMZA 3VOFA 4H9TA 4C6JA 3S2LA 3ZLHA 3RITA 4NYUA 1XIJA 4Q32A 2V5BA 3SQSA 2VGGA 3BK0A 3NGJA 1VYSX 3CXOA 3H21A 1TVPA 5D2WA 1K7XA 4P8VA 5E6ZA 2NT0A 4CVWA 5J8LA 1TJ0A 1FWWA 5LIKX 1UMYA 4AWSA 4A3RA 3MV01 1W9VA 4I7VA 4H8NA 5FF7A 1KXTA 3VUPA 3LBMA 2NUWA 2ACRA 4TTGA 3HGJA 7REQA 3UT0A 2GQAA 3LGEA 2D23A 3F7JA 1XHGA 5HNTA 2Z26A 1UQZA 1FWTA 2EEXA 4HTYA 1LUCB 3MC5A 3TAKA 1Q6EA 3TYZA 2ZXQA 2Z2AA 1TV8A 3TTEA 2QF7A 3WF0A 4A2RA 3EB2A 3TR9A 5KTLA 2G4FA 4HKPA 3REQB 4QDPA 1EP2A 4H9VA 3VDGA 3KTCA 4LVBA 3W1TA 2EHHA 2PDWA 4OOUA 2X05A 1OB0A 2BFGA 2CZ5A 2YW4A 4WEVX 2CZEA 5A2AA 5C70A 3E0LA 3CMFA 1X1ZA 4C6NA 2DIEA 1UPPA 3W29A 2A85A 2GVYA 4JTQA 3HGRA 3BLEA 4ERIA 1BKSA 3IAQA 4M7SA 2QJNA 3M41A 4U5IA 3WFAA 3QF0A 2I56A 1MFUA 3MYOA 3P7YA 1WDQA 3OTRA 3C2VA 3AYVA 3GIYA 4M6UA 4AIEA 3H24A 5AC7A 1ZZMA 2PGRA 3GXNA 3MKCA 4CQAA 5LHEA 2WQDA 4HOZA 2RHGA 3HURA 1KXHA 2QUVA 4C1NA 4X9YA 4LTSA 2AGTA 1WKEA 2O4MA 1JZ2A 3WH8A 1PTDA 1JDCA 5JH1A 4OU1A 1JCTA 2BTMA 3EXRA 3EB4A 1QO5A 1HJWA 2ATMA 3U3HA 3KBVA 2BXYA 3QJAA 3FK4A 4GUFA 3QHOA 1K03A 1LT7A 1TPB1 1H3GA 3WLIA 2YX0A 1QATA 2DH2A 2J4GA 3S5ZA 2H3DA 3SBFA 5HK4A 4KIRA 2J7CA 5PTDA 2F61A 4LAMA 3SUSA 3WL0A 2FDMA 1MQRA 3F5KA 2QLYA 2WW5A 4MB3A 4F0LA 1M41A 1XG3A 4NZJA 2YDRA 1GOOA 5A6MA 5E70A 2VX6A 2JKEA 4IPNB 1JPMA 1G0CA 4FNPA 2Z2UA 1IZJA 1EC8A 1ESWA 1TE1A 4NZ3A 1EIXA 2VC9A 2X09A 1OFBA 1V6WA 1WP6A 3F2CA 3QGAC 5AB3A 4XSLA 1ISVA 4MKNA 3W87A 1H11A 3DX5A 5DY3A 2V38A 4PB3A 1JFXA 3VKAA 4OECA 1JQXA 1KLZA 1OWQA 3KBWA 3SRHA 4M8UA 1OX5A 3MI6A 2HPMA 2G3JA 3EOOA 1IV8A 1JUBA 3H23A 3N4AA 3IUIA 5FAGA 4IUOA 2P8CA 4YNGA 3UNTA 3VKCA 4I9TA 1GKRA 4L65A 3VIHA 4X2PA 1TV5A 4EXBA 3D5HA 3S0CA 1XWYA 5D9MA 3L5MA 3CTLA 2VFGA 4JHMA 4YLWA 2NQ5A 2Z1KA 1MUCA 1EKOA 1RR2A 3BW4A 3LG3A 4O52A 4GYPC 2CWXA 4NAEB 1X1OA 3SY5A 4DVOA 3VM5A 4AEEA 3VGFA 1S46A 3LTPA 3UZZA 5AYBA 1AQFA 1O12A 3A12A 3DKJA 4J9JA 1M5WA 1BF2A 5BOEA 4A8LA 4I5UA 2XFYA 1KBJA 1YKWA 2VP8A 4GJIA 4GZIA 4ADUA 2ACUA 1OK4A 4K1GA 4XG1A 2Z1VA 1EX1A 3W7CA 3GDMA 4LUYA 1LRQA 1A5BA 5AVHA 3IWPA 1LOSA 2XDFA 2Y0FA 2BMBA 5HJLA 3CT2A 4X61A 4UXDA 1HF6A 1UH4A 1XICA 4Z0JA 4P7QA 2QGYA 1P0KA 1A80A 1IGWA 1TZ7A 3PNZA 4L4OA 1ZP4A 4UQEA 2P53A 4Q8TA 4JTUA 4QDWA 4AG0A 4S3FA 2VD9A 1U1UA 2V2CA 2YBUA 1XIDA 4EWND 2OVLA 1A3WA 4DUOA 3U4AA 1BYCA 3C3UA 1IEIA 4GGHA 1EPVA 4D6IA 2ZA1A 4QSHA 4JTJA 3UJ2A 3UBPC 3TW6A 4KH2A 3LXAA 3HB9A 3GE7A 1TWWA 1GHSA 3MTWA 3PBGA 3G1RA 4D6FA 5G4HC 3NG3A 4XIMA 1GQNA 2YXOA 1AQ0A 5A6JA 4Z1DA 2VEPA 5HQEA 1R9XA 1WQ5A 4E8GA 2VR4A 5TQLA 2GDQA 2Z2BA 4FOJA 4P7LA 3N6HA 1H0GA 1RBLA 4OVXA 4RE0A 2GSJA 1RV8A 2E5CA 4WCJA 1DXEA 4AX6A 5CC5A 1VPXA 2R8WA 2WSYA 1DPMA 3FLUA 2VT0A 1LLOA 2D73A 1A0DA 4GOAA 3S5OA 4O15A 2R6OA 1FWCC 1KB3A 1HKJA 2DZXA 2XVKA 1FTXA 2ZBTA 4RE2A 4MNJA 3TQVA 4PRTA 2X0HA 4C6LA 2ZE3A 3W38A 3W26A 2O55A 5BRBA 1PDZA 2ASHA 1LWHA 1E5NA 4JTCA 2PWVA 5G1MA 1LZOA 2PTDA 4H83A 3CB8A 3G3DA 1JZ7A 2ZUVA 3SN4A 2YL5A 2G37A 1HJSA 1XLLA 4HA1A 1XPGA 3LERA 1Q7QA 1TIMA 5CZ0A 5FL1A 2P3ZA 1VHCA 5D09A 4GCAA 4HNOA 2C3ZA 5LHFA 2V82A 2VL4A 1YDYA 3BJTA 4RE3A 1L6WA 3P84A 2BVTA 1HX0A 1UWRA 4YWSA 1HKWA 3UJRA 4NRSA 1UR4A 2PLCA 4H2HA 4TVUA 4JD4A 5ABEA 2ADAA 5EMLA 5TBOA 1HW6A 1Q6QA 1OCNA 2J7EA 4XD4A 3N04A 2CZFA 3I6RA 2VCBA 3WH9A 5A8GA 2I7GA 1E6PA 3QZAA 8TIMA 3UWWA 1XRFA 1Z41A 2PWFA 3T0TA 3EZ4A 1Y0EA 3LLFA 4ZO9A 4B5SA 2FFIA 4GJJA 2Z6IA 4JCLA 3RK8A 4J2PA 1V08A 2INEA 4PEKA 4R5EA 2X40A 5SWUA 2L5HA 2JGQA 4KRTA 4W9TA 3SFWA 3SRFA 1V6UA 3S6TA 4FEZA 4XKYB 4NNAA 3S47A 3Q4DA 3D3AA 4OHQA 3APGA 1NY1A 1SO4A 2P0OA 3TCEA 4X0NA 1JNDA 4TUFA 4AZBA 4JYDA 3SCUA 3QV6A 5AHMA 2C7FA 2WVSA 4AZCB 5HA7A 3G0SA 4PEEA 2G3NA 1BXCA 4KERA 3BLOA 3IJ6A 4DXXA 3MZ2A 2DW7A 1AODA 4GQRA 1F76A 4RXFA 4IZGA 1UD4A 1CNVA 2JIWA 3TTOA 2FJKA 5T8GA 3FHAA 2XGZA 4NJJA 4LUTA 1EXPA 2J8FA 3OP2A 5MKGA 4W89A 5L6UA 2HK1A 1DJIA 4MVAA 2D3NA 2WZIA 4XD5A 3ARWA 1AA1B 3WQDA 1F2JA 3HV9A 1JRBA 2QJGA 1R46A 2PF8A 1SZNA 1TPC1 3MUCA 2IS7A 1FBAA 1R5YA 1Y5VA 2Y7DA 4POCA 4UZSA 4XAZA 4D1JA 4HZ7A 2LLEA 4NU7A 4PCNA 4ZQCA 2JF6A 3VIJA 4W87A 1PPIA 4CNNA 1OVDA 3SSZA 3GYCA 5M2FX 3I7RA 3H7RA 4IL0A 4ZB2A 2ZUUA 1KFWA 1E70M 1TCMA 1EP3A 1H7OA 4F2TA 3U0HA 4S3BA 4RPPA 1EDTA 2HRWA 1HKIA 3WY1A 2AMXA 1FVPA 4FLSA 3KS5A 1LBMA 4IXXA 3MP3A 2NXHA 3KP0A 3DKLA 1TR9A 1ZENA 4LC8A 1E6SM 1VR6A 5A5WA 1NWRA 2CC0A 2CLKA 4Q33A 4UTIA 4LF2A 3W7OA 1Q4WA 5HANA 1E71M 3B8TA 4ZENA 2GJXA 1YPFA 3PY2A 1QTWA 3G1AA 3TTYA 2Y2WA 4MLJA 1WNOA 1TG7A 3W3OA 3FKRA 4JYFA 2QDDA 4BF5A 3DZ1A 4LGXA 1KRCC 2A7NA 1DWIM 3FAXA 5M1TA 3WQVA 1QNRA 4ZFCA 2PDXA 1XLBA 3GM8A 4HK7A 1J18A 1DE6A 4P7RA 3W7NA 1GJUA 2JIEA 4L6OA 3F4DA 3RX2A 1VCFA 4NYYA 2HWGA 2PCEA 3VKBA 2Q01A 3QGVA 4O1DA 1UWTA 5EMUA 3FVMA 4PMJA 2A1YA 2W79A 5JIWA 1V3JA 1TA3A 3H7UA 4GI6A 1P6WA 3PTKA 3M0IA 3K4WA 2Z00A 4AX7A 3VD7A 3N19B 1UR3M 3EOUA 4MZ1A 4Z1AA 1S2VA 2F38A 1VFOA 1J93A 1X7IA 1T6MA 1BTMA 3NQAA 3GU2A 3QV9A 2V6AA 1THFD 4CNUA 5LA1A 7TIMA 4LY4A 1TPFA 4H9XA 3L4ZA 2WMIA 4R9XA 3FFSA 1IEWA 4JN8A 3B0UX 2YGYA 4XZNX 2NVCA 3VFCA 3GR7A 1J5SA 3PAJA 1R30A 6ENLA 3AC0A 2DIKA 3KOYA 1HNYA 3VKDA 2NVDA 3B9DA 2R1PA 2FGZA 4ZMGA 4QQ3A 3W88A 5ECVA 6ALDA 1DL3A 3FAWA 3RR1A 2D2OA 5JBFA 1XV8A 3DENA 3WL1A 3WNPA 3IK4A 2X1TA 1KO0A 1UBPC 3DFPA 3GG8A 3QYQA 2JF7A 4EWJA 2C91A 2TSYA 1Z6KA 2RUSA 1OY0A 3DI1A 2BSLA 3RDKA 1KFCA 5GJMA 1W3HA 1ZALA 3GG0A 2J62A 2BY2A 3BCJA 1P0EA 3WK0A 2CHOA 1X38A 5CSSA 4TX6A 3NQ2A 2WC3A 3TIMA 2VDHA 1L6GA 2VXNA 2YCEA 4L6DA 2DVTA 2OCZA 2PRHA 3TWAA 2ZZ4A 3PB2A 1XYFA 3GTHA 2QUUA 4MWAA 1YPIA 4RZ5A 2ZA3A 2BHZA 1EGZA 4XUGA 5F1VA 4B5XA 2Q8ZA 3H22A 1LCOA 4IM4A 4IISA 4HNTA 3SFKA 2WM1A 4A3HA 3STEA 3OA3A 1PKNA 2CBVA 3LHTA 3BW3A 1S5WA 3UVAA 1OC7A 3AIVA 4F0HA 3P60A 1W8SA 2GQ9A 2W0UA 1KCXA 1NH6A 3ID7A 1H62A 4W86A 3GWQA 5HMSA 3W7PA 2FZDA 3GG1A 4GHRA 1Y65A 5FA5A 3WKZA 4LCRA 3KCJA 5G4WA 3NM3A 2ZVRA 1FRBA 3RCNA 3UY7A 3VGBA 3BO9A 2PDIA 2CBJA 3EWYA 3OIHA 1CLXA 3ZWSA 1E40A 4M82A 4UC5A 3WMLA 2WNQA 1FH7A 3RNDA 2QUTA 1QXLA 1TSIA 4HNVA 1LL4A 3LA4A 2VUYA 2HXTA 3EMCA 4PTNA 1RXOB 3AZSA 2KAUC 4YIWA 3T55A 1REQB 4H9UA 4S23A 1US3A 2NWRA 2I16A 2MNRA 2XINA 5BW6A 1WE5A 4HSOA 1OFEA 4NG3A 3AALA 3LK6A 1YRRA 2YW3A 4YTQA 2Q02A 3L5AA 3M0MA 3C2OA 2E40A 3UETA 2JEPA 3B40A 1XLFA 4PCSA 1DKWA 4MZ8A 5BMWA 5T9BG 1I0DA 3BOXA 2X8RA 4OFCA 4LNCA 1BEUA 3ARYA 1W5MA 5F2MA 1F8MA 4M1BA 1V03A 5C9WA 1EX5A 3PHAA 4JIRA 3GKFA 3DAQA 1WDSA 4R3UA 1QO2A 3W6YA 2WZMA 4JZ5A 3PG9A 3JU2A 1XC6A 3QC3A 3WLKX 4QNEA 1NOUA 1QWKA 5BNKA 1H7WA 1FP8A 3DOPA 3HQNA 3UVIA 3SECA 1E43A 1XIIA 1Z48A 4H2CA 4UTTC 5AECA 1XLIA 1C7SA 3KVKA 3FJ6A 1MZRA 2HVOA 2Y70A 3KM8A 3Q45A 1WKDA 4QROA 1RBAA 1RCXB 5I24A 2G3MA 5AC5A 1ZSXA 4KW2A 1R3WA 1FWJC 3ARQA 2NQLA 3OYXA 4IH3A 5AHNA 1ITQA 3CJPA 1V3LA 1KFLA 3N15A 3LV6A 4X3ZA 1W5QA 3A24A 4UNLA 5LIUX 4JR5A 4PMQA 2NVAA 3W1RA 3FEQA 2QR6A 1IWPA 3U9IA 3CL8A 3EDDA 1SUXA 3EA1A 2VRJA 3WDPP 1XGEA 2QEZA 5CAHA 1BF6A 3EEGA 4Q6JA 3QHNA 1ZRQA 1B3ZA 4AB4A 1R7AA 2QT3A 2G0WA 4HA3A 3P82A 2ZFAA 3OZYA 4XO6A 2E6AA 4LVAA 4DN1A 4ZTYA 3ANYA 1UPMB 1KC7A 1QI0A 3QZ6A 1PHWA 3VC5A 4PB4A 1KRAC 5TF0A 2O4QA 3WDHA 3KRUA 2A5HA 5I7GA 2YCKX 1GPFA 1A3HA 4JYEA 4MKSA 4QLJA 4O28A 2QPXA 1DJWA 1CTNA 2FZBA 4Q4SA 3NWRA 1W56A 2CITA 3T2QA 3RPDA 4AH7A 2OO6A 4KEZA 3VNJA 2Z4GA 1A5NC 3C2FA 4KKXA 3PP7A 2OMAA 3QOKA 3U2EA 1ZP3A 3NR0A 1BWLA 1PCWA 1YHTA 3C2EA 1I2NA 1GQJA 2EPLX 4M5PA 3VI2A 4DJEA 1A4MA 2UZ9A 3GVRA 4UFKA 5I77A 1X6UA 3Q94A 2Y1HA 4CLMA 3DFTA 4WGHA 3G24A 3HZ3A 2WVUA 4JGDA 3GHSA 1MNZA 4FIQA 1DV7A 2OLSA 2R9RA 3L4TA 4HMEA 4RNFA 1GNXA 1J12A 4ZOAA 2XIMA 2GL5A 1JDEA 2Y7EA 4IJCA 5C8BB 4DUXA 2YCJA 3UXAA 4IFRA 5HWJA 2IKIA 3QR3A 3RM9A 3IGUA 3T44A 1IZCA 3A9IA 1CT5A 4E4FA 1JPIA 3KOZA 4A6GA 3OGRA 1RCOB 4MDPA 3B0XA 4KGJA 4JOMA 4V33A 2F6XA 4PCPA 3V4BA 2OZ3A 2Z28A 4ZCWA 4C5YA 2GLKA 4JTSA 2AL1A 2PE4A 1YYAA 3ABOA 2XPKA 3SO7A 4UFMA 4GVFA 2I57A 4L1XA 4RV3A 3PBVA 1C3FA 5EU9A 1JZ3A 5FJPA 1S1RA 5JQ9A 2NXGA 1B31A 3MYPA 1GKQA 4DWSA 2AAAA 2YCIX 4TOQA 3UG5A 3P62A 1HO1A 1ONWA 1GG0A 4GVIA 2CBIA 4V28A 3LTSA 1KGUA 1SJAA 3DGBA 3ZS4A 1YNPA 3UCQA 2EAWA 1UIOA 1M01A 3E1F1 3OQEA 1Q66A 3ITCA 3BWWA 5EMYA 3TQKA 2WBKA 3IIPA 1E15A 1S5MA 3CTTA 3EWBX 4Z2HA 2DVUA 1D3GA 2V9DA 4DJFD 3I4EA 4XVEA 2OGJA 3UPBA 4XISA 4JNZA 2X7VA 4F0MA 2PD9A 4FF5A 2CIPA 1A49A 1AZ1A 3H2NA 4ZXLA 4AZCA 4GUGA 4BQ3A 1W5OA 3M5YA 5AVNA 1EBHA 3S6DA 1EXBA 3DFHA 3E5PA 1RALA 5K4XA 1N8IA 3N4EA 3G0XA 1EF3A 1MEIA 4F66A 3TSMA 5DXYA 1VGAA 3NQGA 3A5FA 3S5YA 1GOWA 2GOKA 1OG6A 3OA5A 4P8XA 1A5AA 4GISA 5G2WA 4LANA 3HGSA 3MZNA 1V0NA 3CV2A 2WKGA 3KX6A 2JK2A 4BFAA 2VEFA 3BCDA 1KWKA 1A0EA 1LWIA 4GIYA 4GXPA 2QUNA 1JR1A 1YW1A 4HK6A 4LX4A 1AL7A 4AXNA 4B16A 5AYYA 2E1WA 4DM2A 3LPOA 1M6JA 2X1RA 3UYCA 3MHUA 1GCYA 2VC6A 5FCZA 3EBVA 4GUHA 1AUSL 4AZ7A 3BGJA 2W62A 3BLDA 3TR2A 1F5ZA 4M80A 1L6SA 2ANUA 2F7FA 5DELA 3TCSA 2GVEA 3WLTA 2PF0A 4QM1A 4F0SA 4Z42C 1JPDX 4YTSA 2KX9A 4GY1A 1JXKA 3MWCA 4GZEA 3N2MA 4L4LA 1MSSA 8XIMA 2C14A 4J3XA 4HZ8A 1TMLA 2ZUNA 4ZOCA 1XDMA 4OBTA 3QFEA 3T9PA 1F9CA 1O95A 1E0VA 4ZVJA 4GBDA 3NL5A 4W8LA 1RQEA 2F84A 4AVOA 1ONEA 1AQMA 1ME8A 3T81A 1WOAA 4Y9PA 1ZLPA 2QCCA 1TVNA 4CD4A 4PGLA 3WELA 1FWAC 4PTDA 2OT1A 3BTNA 3ATYA 1E9ZB 2BHYA 3K30A 3URAA 1H2JA 2WKJA 3E02A 1Q65A 2WMGA 3PR2A 1QUMA 3GO2A 4DI8A 2HVNA 2NLYA 2WJFA 5AYZA 4EAYA 1G7VA 5LNWA 3MUIA 3NQDA 1OBAA 3NYDA 3ITTA 4UR8A 3B0YA 2ON3A 2ZDRA 3RO8A 3C0QA 3MCNA 4O17A 1I9CB 3DN5A 2ZA2A 1FOBA 1E0TA 1T99A 3IACA 3TN4A 4C6FA 1OC6A 4XQ6A 3C8NA 1P7TA 2XH4A 3USZA 3WSUA 4YCPA 2PTWA 3THAA 4DQWA 3CWNA 2CLEA 3WLJA 3G1HA 4GO9A 3GH4A 3FEMA 3H4XA 1EC9A 3T42A 2YDAA 3U7VA 5HPCA 2O9TA 3PUEA 4REQB 1LRNA 1FKXA 1C9WA 3WJXA 5I00A 4YS1A 1HKKA 4R85A 3VXGA 3UFYA 3DECA 3V18A 1KV8A 3SR7A 3ES7A 2C6QA 5GJNA 3UWZA 3KRSA 3ENLA 1RLDA 5H6HA 2E68A 3GTFA 3SURA 3T0CA 2RGMA 3TUUA 1JGIA 1O1HA 1H60A 1BTCA 3R0DA 1XYCA 2VDGA 1YPXA 3SCTA 4IX2A 3SRDA 2G41A 2GPTA 3H2EA 2J9XA 1PE1A 3NPVA 2Y6ZA 1UKTA 4DO7A 2QJJA 3W84A 4WXZA 1XS2A 2O7SA 3HPFA 3CNYA 3W2UA 1WZKA 1CWYA 1UD8A 3FYOA 3EWCA 4U3AA 1QHPA 3OU8A 3DYPA 2NWSA 4JFUA 1VPQA 1K77A 4LYQA 4PMRA 3URNA 1A5UA 4EP8C 1RD6A 1F8IA 1PYMA 3KZPA 1HTIA 2E4TA 2QCMA 4IG2A 4IGSA 2CLHA 4HA0A 2POZA 3EPMA 4PUDA 3A6OA 2BBFA 1W3JA 3C0LA 3S1UA 1J0IA 3GTIA 4LPCA 4CN6A 1HP5A 3NL2A 5A8PA 3W7DA 3M5VA 4X2RA 4RJEA 2EKCA 3OG3A 3C3NA 3GBEA 4JFWA 3OLIA 4A3QA 2HTMA 1A50A 3AAMA 1GZJA 2I14A 1JCNA 1W9DM 3RPMA 5CC3A 1GZGA 4KWOA 1W91A 1LOQA 5IOBA 5DCDA 4JIHA 4K1WA 4JKLA 2OWXA 2F2HA 3LEPA 3M46A 4DEFA 1ECQA 3MMUA 2RDXA 1OFPA 4W5UA 3UPMA 3SRKA 5I0DA 4UR9A 1V7AA 1XJBA 3WF1A 2E9MA 4UTHA 4GPNA 3VOJA 4BWLA 1YNYA 2J79A 1KQYA 1UZHA 3C61A 3LHVA 3OZMA 5I09A 2XZ7A 4A21A 3KL5A 4NSBA 1E6ZA 3PUOA 2XISA 1PYFA 2ZC8A 3AJXA 4W93A 1W1A1 5LNRA 2Q3OA 2XHYA 2YKKA 4PSPA 1OZQA 3WJYA 1OCQA 1REQA 3B8WA 4LAZA 4HSHA 4O13A 4UOQA 1DJHA 3WLSA 1QOXA 1NDYA 4H8UA 2BOGX 3M16A 1R3RA 5IM51 2GWNA 4CCCA 1KR0A 3G1XA 1RVKA 2OT0A 1ONXA 4A3YA 3S8HA 1RHCA 5CJMA 3DU0A 1EFZA 2V2HA 1OGSA 1GHRA 4IMFA 2C0AA 4U33A 5HNUA 4CCDA 1IZKA 4NUWA 2J7FA 2QXWA 3GZ3A 3W1NA 2H3BA 3N3MA 1X6LA 5FEWA 3FJLA 1FWGC 3W7QA 4ICCX 5J04A 1GEQA 1M53A 1J4EA 4V1XA 3DYMA 3VNMA 2FH6A 3WNNA 4WGXA 1JYXA 3UU0A 1J8VA 3AIRA 4PMDA 1BRLA 3HMJG 1Z89A 4RX0A 5CGMA 4O14A 5CG0A 4LBSA 3AZTA 1UH3A 3WH5A 3VPLA 3ZJ7A 2D0FA 5D03A 2DP3A 2PDCA 3AICA 2WSQA 3GXFA 3L0KA 4AZIA 5A95A 5DFAA 4L64A 1U83A 4IIHA 5IDIA 4OE7A 2BVYA 3RN6A 1JFHA 3GU1A 2D22A 5CC7A 3P5YA 3KXQA 1QWGA 1XLEA 4AEOA 2VX7A 1W9XA 1QOPA 3BUVA 1V51A 2C71A 4HMNA 4ZQMA 2C8NA 2IPWA 2YB4A 4DO5A 4TU1A 1NWTA 1SJDA 3AXHA 2QF8A 1GYMA 1GVIA 3MI3A 3S2CA 2X42A 3PWGA 4E2DA 4HHMA 2PZNA 5K9DA 1OYBA 3M5XA 4LEQA 3IIVA 4MF4A 3KVJA 2QJMA 1W9BM 1L8NA 3UW6A 2WZHA 3T0BA 3H53A 1X97A 3W37A 1UWSA 3G6MA 3OG2A 4B5UA 2A79A 2PA6A 1P0DA 4G2DA 2Z29A 5K4ZA 2XG9A 1TJRA 3WK3A 3IRSA 2QKFA 3LZ5A 1FA2A 3GG7A 1XRSA 3TP4A 4WX2A 2BY1A 4XK2A 3UXDA 4DF1A 1YMYA 3EMQA 4K2SA 1JJKA 3HTWA 3OVPA 3BL3A 1NSJA 4BI5A 1ELSA 1ZTVA 5EA9A 1U1HA 3SIZA 3W0KA 3SGZA 3RXZA 2DUXA 2HBXA 4IT1A 3O07A 1JEZA 1LBLA 2RDTA 1V6TA 4HNLA 2OSWA 1DJGA 2O56A 1XQKA 1HGWA 2WNWA 4H04A 3CHEA 1WOBA 1QNPA 4R7JA 3AU6A 1PSCA 1V7YA 4MLRA 3LBOA 3VGDA 3WUEA 3ZR6A 2Y5SA 4BCEA 2Z24A 1WXZA 3QGKC 3KS6A 1HXJA 3CIWA 4LBRA 3L67A 1KRMA 1W1PA 1J0ZA 3SEPA 3W1XA 2QYGA 3TDFA 3ZJKA 3BCFA 2YLLA 1NOWA 1QI4A 4O1FA 3MDWA 3VILA 4AC7C 3WDQA 3BC9A 4XX6A 3CK5A 4RUBA 2QMJA 1AVAA 4JDYA 4I9AA 4W84A 3CZJA 3HJEA 4KWUA 3THDA 3CZKA 1YX1A 2WMFA 3LPGA 2WZTA 4W5ZA 4H41A 2R1LA 1GORA 3NOYA 3I6EA 3GTNA 2DSZA 2EXOA 3QQ0A 4ZGYA 3KTXA 4MOZA 3EA3A 3W7LA 3WQWA 3SJ3A 3C0JA 2BVWA 2IKHA 4WVXA 1OT2A 3M5ZA 4CD7A 4YTTA 1DWAM 4CEXC 1NFBA 2REQB 6PTDA 4IQDA 1GOMA 5I78A 3PJXA 3NSMA 1Z9AA 3EEZA 1IXQA 3WJSA 2CCRA 3DHUA 1R2SA 2Z0IA 3BAXA 2HCVA 3I3BA 1ME7A 1WX0A 3AQUA 3UERA 4MSSA 3QQ1A 3IJ9A 4JTIA 5CXPA 3DCPA 1JDDA 3LENA 4Z2KA 3CAWA 1DJQA 2E3ZA 4K68A 3UJEA 1V3HA 3OBEA 1NP0A 1U5VA 5E9AA 4B2DA 3EDEA 1G4EA 1V6YA 4XTDA 3ANUA 1XLAA 2P8BA 3ICJA 3GAKA 3M44A 1XINA 4PTXA 3LQLA 3TJXA 1HQTA 3LRKA 1VJZA 3POCA 1KKOA 3AHZA 2V68A 1I1WA 1EGMA 3N1AA 4I90A 3BAJA 3GSMA 3RIKA 4N9EA 4NNBA 2ZRUA 1IT7A 1OCJA 3F1QA 2VFFA 4JTFA 3AS0A 4F9DA 3RF9A 2W9MA 3QOMA 1U22A 3RILA 5AHEA 3OIXA 1XBXA 3STGA 1X8CA 4LJ3A 1FP9A 4GYKA 4GVGA 1GYLA 3A4AA 2X1IA 1ME9A 4ZO6A 4TMCA 1ZBWA 3PZNA 1Z3NA 3CQ0A 4ZQOA 4WDTA 2YOCA 1VFLA 1RZMA 5HMEA 4EPEC 2PWGA 2DZSA 3CAKA 1YNQA 1TUXA 3TJ4A 2YCLA 3BPWA 1UD2A 3PAOA 1XLHA 2YL6A 1PKMA 5I07A 5I06A 3JZEA 3LRLA 1XDLA 2OKTA 3HM7A 3QKEA 1SSDA 4L9YA 4O1BA 1KM4A 4LUSA 3VNIA 2P3EA 3WX7A 1H7NA 1VKFA 5DMYA 1RK5A 3U6WA 3CZGA 3VM7A 1TX2A 1K8CA 1WKFA 3WEMA 3HN3A 3KDOA 3B9OA 3GNNA 1ZBCA 1WDPA 5C9UA 3KTSA 7REQB 4GMEA 4EACA 3BG3A 3MSYA 1IIHA 1POJA 1KR1A 2CHNA 3N2CA 2VWSA 3EOLA 3EWZA 1UR2A 5DMMA 5DF0A 3SB0A 5LNUA 4X63A 1NF7A 4FZIA 1HG3A 1IF2A 2XU2A 4C6BA 3WZ0E 1FH8A 3RRAA 1XIMA 3CBWA 4KCTA 3GHTA 6CGTA 1OCBA 3GRIA 1EYWA 3OHMB 5A3HA 1D2KA 2GJRA 1TPUA 4NZCA 4U2YA 4UIOA 4P2VA 2WVTA 4W7VA 1V3IA 4N9DA 3TC7A 3QM3A 3MV11 3W4RA 3KCOA 1OEPA 4WDUA 1DJZA 4F2BA 4RDZA 1Q4NX 1ZQ5A 1S5NA 2UWFA 1EDQA 2GGGA 3VZYA 1F61A 1J79A 2HJPA 5HOSA 3UZ5A 3W81A 1KXQA 4AD1A 1KCZA 2FH8A 3ZWTA 2WCSA 2X0YA 3PTMA 1R8LA 1RK6A 1KGWA 1QCWA 5FF2A 1PX8A 1XSJA 2W63A 2J7HA 4D6HA 3VCRA 3PBWA 4QX4A 5LXEA 1B9ZA 1F6YA 4IL2A 1ADSA 2XJ7A 3PJWA 1E4MM 3WYZA 4C1NB 2YJQA 1NU5A 1J5TA 3A47A 4UMAA 1G1YA 2QCLA 3NDZA 1PL9A 1S2TA 3GDBA 4JTKA 1DYSA 4TX8A 1Q8JA 1YBQA 4F2UA 4QITA 3TMLA 3EWWA 4KCUA 5T26A 3HMCA 2EJAA 3B3DA 2MUCA 2VKZG 1ZS2A 1HIZA 1F07A 1QDSA 3VX0A 4I5XA 3UA4A 3L4YA 5GPRA 1G4TA 4OV9A 1WA3A 2CKSA 4XZLX 3R7MA 3VU2A 1WAWA 2MANA 1VJSA 2OO0A 4PMYA 4MYAA 1KCLA 4FO4A 1XSIA 2ZYFA 3N25A 1TR1A 4J3SA 4F40A 3CH0A 3WCZA 4JBRA 4HNNA 1KM3A 1KFEA 1KBKA 3AIBA 5DN1A 4Y96A 4KQNA 4LQ1A 4CNTA 2GUYA 4YYFA 4GX8A 3FVDA 1SW7A 4FX8A 4R27A 3STFA 3V0UA 4Q8QA 2DZAA 1LT8A 3ZO9A 4MNMA 1QI5A 4ZBCA 2PRLA 4K38A 3PPHA 2ABBA 3AHYA 2Y8VA 4NJIA 5LXXA 1BXBA 9RUBA 4P7OA 2VUNA 5DX7A 4HMCA 1XH1A 3L66A 4QAIA 4HVXA 5C5YA 1PZ2A 1TQJA 1P4CA 4DYKA 2V5CA 4YVPA 2GGIA 4U5KA 5FEZA 4YYCA 3OZPA 1LRTA 4BF9A 2C19A 2E5BA 2VI0A 4GQBA 1RLCL 4IHCA 1KBBA 1K4GA 4YJ5A 5AHIA 3MO7A 1H1YA 5RUBA 5BWAA 3M6DA 1I2QA 1UP2A 2OGYA 4NZ5A 3LDVA 3BV4A 4K8GA 3ZVIA 4GVHA 3ZT7A 3B06A 1XKYA 4WZHA 5CPQA 2VM8A 5D02A 4GD0A 3DC0A 3E2SA 2I5QA 4LNYA 1FH9A 5FJUA 5ABFB 3PSWA 3L5LA 1TWSA 3EX4A 1HN1A 1KV5A 2V30A 1V8EA 2OJPA 2PP3A 4CCEA 3G1DA 4D8AA 3QHMA 4XD3A 2E7FA 3MW7A 1H49A 4NXKA 4B9ZA 2VZVA 1L9WA 3W00A 1OJXA 4HZMA 1J0HA 2WC7A 3IJIA 1JYNA 3PZ9A 2QGHA 1PAMA 3CT7A 1VBGA 3GXTA 3STCA 1IXNA 2B7QA 2Y62A 4BQ5A 2CLIA 3BSHA 3W9ZA 3K8KA 1LF1A 4QLKA 3N13A 5C0QA 3W2LA 4PMVA 3PWAA 1BAGA 3MP5A 4CU6A 1EF2A 4HNUA 4CQ9A 1EA9C 2ZZ3A 3K1DA 5HAOA 2JFEX 1B0IA 1R9YA 1K8XA 2FPVA 4NAFB 1BVWA 3GDLA 4NXSA 5DY2A 1Q7MA 2PDYA 3WBWA 5CJ5A 1JI2A 3L7RA 4S3CA 4FA3A 8A3HA 3E0IA 5FF3A 4K39A 3LD5A 5CPMA 5HUOA 3EKGA 3VO0A 3BV7A 1UUMA 2BASA 3PZQA 3WQEA 2PDMA 5BWFA 3GYEA 2F8QA 3C0SA 2VO5A 3S5SA 2X2YA 1I2PA 8XIAA 1ZJHA 3S1VA 4NILA 4YL2A 2WZEA 4P5UA 3U48A 3H7VA 1B3VA 2IQTA 4FX7A 4R34A 1GJWA 2ZWZA 3WMCA 4G1NA 5BROA 3CPUA 3M1ZA 3P0XA 5CSUA 4N9CA 3B8IA 3PWIA 3B0VC 1GOIA 1SW0A 3P80A 5ENLA 1EGVA 3K8LA 4HJWA 4EPDC 1M3UA 1QJWA 2YZRA 1KM2A 4Y8EA 5JMUA 3SW6A 2GVLA 3J7HA 2FMOA 3O3RA 4XAPA 4H01A 1EQPA 4PC8A 4IGMA 1XX1A 4J7RA 4S1FA 4GFSA 1XLGA 2PEVA 2OKOA 2P10A 1UD6A 1E51A 5E5CA 3VIKA 4HBKA 1XRVA 2NUYA 4RPQA 3UWYA 1J0YA 4GNJA 4JQ2A 3UWVA 4UOZA 4PCFA 1GOXA 3FA5A 1OABA 2HE5A 4F9JA 3VNZA 3ORWA 3F5LA 3WLNA 1EZ2A 1F73A 3LMZA 1P48A 3VOIA 2AAMA 3DXIA 3M0HA 4FR1A 2VZUA 4X60A 5HATA 3NEVA 1AL8A 3TZFA 2OPJA 2ZRYA 2D2HA 3N11A 1SR9A 3HG2A 1VFMA 2OG9A 1E1CA 1K9FA 2XVPA 5EY5A 1MW2A 1IEVA 4JEJA 1XIBA 3TFCA 5A6SA 1UC5A 4U31A 3QY8A 3GHRA 4QQUA 2DZPA 1BG4A 3SSJA 3E6EA 3GC2A 4DXVA 1M65A 5CZSA 2A7RA 4HPXA 1EJXC 1J0KA 3FY1A 3GB6A 1C8VA 3WD3A 1ZAHA 1MW0A 2OQHA 1PZ1A 3NUKA 2V3FA 3W07A 3E5BA 4JIIX 1PCKA 4ONVA 4M6VA 5CGQA 1AMKA 4WRHA 3M6YA 2UBPC 5C2CA 3W25A 1LLWA 3W01A 1PO9A 4JIEA 4AY7A 3U2CA 4PUKA 4H7VA 3FHQA 2Y88A 3RU6A 3GFZA 4IGNA 5LNSA 3AYSA 1R3SA 5LIWX 3AUJA 5K9CA 4GCXA 2QCEA 3BAYA 3O6YX 3N34A 4XB3A 4AUBA 4CD6A 1DQXA 1SGJA 1YTDA 4QJ1A 2WB5A 3BLLA 1W1TA 1BLIA 4GZJA 2J9ZA 3CPGA 3SY8A 1EO7A 3Q65A 1V4YA 3TYDA 1EEXA 3UCCA 3QKZA 2WSRA 3TNOA 4R53A 1QFEA 3QSRA 3NFUA 3RCMA 3W73A 1BWVA 3VOGA 3MHGA 2EG6A 4J3TA 4Y7EA 2CPUA 4MZYA 4URIA 2YA1A 4LUTB 5I3GA 5MKGB 3S42A 4KWSA 1UZ4A 5H8MA 3NQ6A 2EF9A 1FWHC 4B90A 2PDGA 3H4WA 1XP3A 1OFQA 1UR0A 1D9EA 1PWMA 4P7NA 4H8HA 4IWWA 3RX4A 3B4UA 5FJJA 3WLPA 4NI8A 4J27A 3PC0A 1BSIA 3UJSA 1OT1A 1YXCA 4R7OA 4ILSA 4R9OA 2BOFX 3FXYA 3SGGA 1TRIA 3E9AA 1H51A 2Z1XA 3AMLA 4UR7A 3R13A 2YB1A 1QHZA 2Q8LA 3T0AA 5GNZA 1S39A 3RUBL 1E72M 1KFKA 2FZ9A 4CN4A 4HPJA 4WHBA 1U33A 4AWUA 3W70A 1JXJA 5I3DA 2WQPA 4Z2LA 1MXDA 5B80A 3KCLA 3T78A 1BSLA 1OIMA 3CC1A 2ALDA 1TFVA 3CQHA 4PFHA 3T8LA 2PC4A 3RG6A 1UH2A 5FOOA 1W37A 4N7QA 2EJ1A 3WF4A 3N9RA 2GJXB 3OVRA 3BAKA 1GVQA 3LXCA 4ICNA 1P6BA 2WSKA 1JDFA 3EX3A 1XIEA 2EG8A 2ZC1A 2I1OA 3BMVA 2AL2A 3KRZA 1UQYA 4I6VA 2QPSA 3NPUA 4UTWA 1JD9A 4OQVA 2CLLA 1ZBKA 4JTLA 3VE9A 3GUGA 3PZTA 4RZ6A 3VMPA 3JR2A 4PUUA 4HK5A 4XZHA 4HOWA 3FOKA 3KL3A 4ZL1A 1JF6A 3W1PA 3NVDA 3GVGA 1TA3B 4PTVA 1TVLA 3UD6A 5A6BD 3LRMA 3E96A 4W7UA 4PMZA 1DTNA 3QV8A 3E0WA 3WNKA 1UCWA 4ICMA 4OUEA 4KWWA 1AFSA 1T96A 4MIMA 4QJ3B 2ZZ1A 1UWIA 3W53A 2A4AA 4GIEA 4GI9A 1E56A 1TWIA 3R11A 4KPLA 3W1AA 2YBTA 1HZYA 3T08A 2WMIB 5EFFA 3MBDA 4QAWA 3NPWA 3R1ZA 1M7PA 4BI6A 5BMXA 3CAQA 3WDIA 2WWCA 3GFXA 4QTGA 1UD5A 4ZO7A 1N8FA 4RNIA 5AFDA 4GIAA 1L8PA 7TAAA 3LCLA 1RSCA 3S1XA 5BYWA 4GI8A 3NSXA 1EZWA 4R7WA 4GZ7A 4IIDA 3ZXWA 2E77A 4RZBA 1OFDA 3I68A 4H9ZA 3POHA 2FJUB 3W82A 1TPVA 3O6AA 4CD8A 4XBSA 4ZTXA 1OZMA 3VIMA 3ITYA 4EXQA 1BVNP 2G50A 5DBUA 2FB3A 2NQJA 3OLGA 4UCGA 1VB9A 5EMKA 4H3DA 4DIAA 3G3MA 5DEZA 5IDZA 1MI3A 2V3DA 5CCZA 4ACZA 1JYWA 1E9LA 4GXWA 1RQHA 4HTBA 5E1QA 3UP8A 1WXJA 3FCPA 3PFMA 3HGOA 1HT6A 3LI0A 5HNRA 1EEPA 3VD3A 3KWXA 4FLRA 2I9EA 1TE6A 4L9XA 3T07A 1UR8A 4JTHA 3TW7A 4MWAB 1GYNA 4RLIA 4CNSA 4JTGA 1WUFA 2FPYA 4FIRA 4UQAA 3AI0A 2ZX9A 1AW5A 4XZBA 3FW6A 1AJ2A 1KWGA 4N6EA 1BHGA 1S38A 3IIXA 2B0MA 4PBGA 1T0OA 4FALA 1TIWA 3LCFA 4PFMA 1Q13A 4DXKA 2OZ0A 2WHJA 1B4EA 3LHUA 4PCTA 3IVTA 2W67A 1FFQA 3E0FA 3H8AA 4NHVA 3VFLA 4N6FA 3C6CA 3F5JA 3DG7A 5GNYA 1LG2A 2VQUA 4TX9A 2WO5A 4GYJA 3LNMA 4TVDA 2XIJA 3KOFA 5GNXA 2ODOA 3CV7A 3CEPA 1KFBA 1TMHA 1WKYA 2BB0A 3KRBA 1OSEA 2ZUWA 1MW1A 4DX3A 1YDOA 3AS2A 1DE5A 3KWSA 1PEZA 3CMGA 4XVDA 3UZWA 3VD5A 4US5D 2YDSA 3DHDA 4H7CA 1OD0A 2ZUMA 6XIMA 1M68A 3JVAA 3TC3A 5CPSA 5HXMA 4HPHA 3WK1A 2PI6A 1KCKA 3NVTA 4CQCA 4K7YA 1QNVA 1CLVA 1EJ7L 4FLOA 3MSDA 4XV0A 3LU2A 5I5RA 1EJVC 4XZ9A 3SUWA 1IR2A 4Q8OA 2J74A 4IMGA 1UW9A 4LVDA 1RAKA 1FQ0A 5ABFA 1IEQA 4XBJA 2ISWA 4LYKA 4WSKA 3W22A 1CGYA 4U2ZA 2DFAA 3B9EA 3OLDA 1RVGA 1A5OC 4ROQA 4I3GA 4G7FA 1E9IA 1NDZA 2BGQA 2XWDA 1A5CA 5M5DA 4O1AA 1ITXA 4MNLA 4IMDA 3O06A 2OTDA 4ZE4A 1CCWB 3PBMA 1KQZA 3VIIA 4D8ZA 2X2GA 2PU1A 5C7VA 2BWGA 4ML4A 1W5NA 1S2UA 4YN5A 2YFOA 4YHGA 4Y9NA 1UJPA 1NQKA 3QXBA 4GQ0A 1Q6OA 1I2RA 4XSMA 3O6DA 4ZB0A 2HDJA 1KM1A 3WFZA 4BKNA 4RK8A 4MB1A 2OQLA 4NAFA 4JY9A 1UR9A 4GA8A 2FPTA 3CHDA 2QCDA 1P6CA 1WPCA 4HCHA 1UOKA 4QE1A 5M17A 1XXXA 4E3VA 5CJNA 1E1FA 1H7RA 1ALDA 2D69A 1PIFA 1UA3A 4FNQA 3TOPA 4WQ6A 5IXEA 1F74A 3VDHA 4RCXA 2C0HA 2Z7KA 4PMXA 3N2OA 1KM5A 3AS1A 3MUAA 2GGJA 4QCEA 2ICSA 2WPBA 4TR9A 3GC5A 4GH1A 3TTSA 5KETA 3DIPA 4DBSA 4DBWA 3HG3A 4LS1A 3N3TA 1AJ0A 3NOEA 3HA1A 3RJYA 2GDVA 3SUUA 4WJ8A 1XYLA 1NWSA 1SFLA 2NXIA 4NJKA 4WY0A 4D2JA 4HJFA 5BXPA 2CLOA 3CAVA 4EE9A 2JBMA 3D47A 1OX4A 1VLWA 1M1BA 4G7EA 1W6TA 3PN8A 4AD5A 1NVMA 3PJTA 2WHMA 2WBGA 4GNVA 2J75A 2W91A 1E3ZA 2EG7A 1EDGA 2HV5A 3EKLA 2CXGA 1PZ3A 1GT8A 3K2GA 4C60A 1AZ2A 2Y85A 4WKAA 4TV6A 3N17A 4V15A 1KTBA 3AMCA 1ADOA 2GUUA 4M6QA 1CGWA 1ZHAA 5REQA 3L0GA 4D6EA 1Y5WA 3BSMA 4GJ1A 5I3IA 1KBLA 4MB4A 1B9BA 4DJDD 5AZ1A 3Q2DA 3OOQA 4Z1BA 3P6LA 3TAOA 4M29A 4ZB5A 1ISXA 4G1KA 5ABTA 1NARA 4LS0A 5E09A 1R0MA 5LGZA 4HHHA 4E4PA 2WLZA 3BGGA 4YWIA 2XN2A 3TMQA 4PUEA 3M47A 3UPWA 4DM1A 5DT7A 4ZQPA 4FP1A 4B4HA 3CASA 3WQOA 3CWOX 1MMFA 2BP1A 1RP9A 4FOUA 2WJEA 1F6PA 1RJPA 4EIVA 3O7UA 4DRSA 3W7MA 3DHPA 1VIWA 2VEIA 4C7DA 4HA4A 3LS9A 1YTKA 4D1IA 1CXLA 3T0DA 2AOSA 4LRSA 4O57A 5E93A 5ABHA 2IKGA 4AYGA 1W9PA 4DWSB 1H1ZA 4EVZA 2WLYA 4KBXA 5C7HA 4UTKA 4KCWA 2JKPA 3I7QA 2DQWA 1WV2A 5HUPA 1E6RA 3TJLA 5C55A 4JNYA 6REQB 3DC8A 1HJVA 3A4WA 4JXCA 2XGIA 5D2YA 3QPYA 2PDJA 5KMYA 3DHFA 2QJHA 3IUDA 5B7YA 1ZJAA 1EH9A 1VD6A 4AISA 3DFYA 2D0HA 5FJIA 5DRCA 1CLKA 2IQDA 4JN7A 2FYMA 3TYCA 4XZMX 3PBYA 3DERA 2CW6A 2DZVA 2IPGA 3WQ4A 1SW3A 2GWGA 3OGVA 4D6JA 2FTWA 4KWVA 4YTRA 5K7JA 7CGTA 2CBUA 3R25A 3WQFA 1W3NA 1AH3A 1QW7A 1WDDA 3UG3A 4LW7A 4FXSA 3OLEA 4NP7A 3HO8A 4QDMA 3A9BA 4O8AA 5CZTA 4J35A 2BVDA 3EOSA 3S46A 3LBCA 1R3QA 4J4KA 5E0CA 3FXGA 3L4WA 4K6AA 5CZKA 1U1JA 3MHFA 1Q6LA 1CPUA 2FHCA 1FDZA 2EPHA 1Q7ZA 3ITXA 3NQCA 1F4HA 2B7OA 1UROA 3VYLA 4IPIA 3SCVA 1H63A 1W0MA 3IANA 5DRIA 4IFKA 3ZFHA 2ATSA 1Y7VA 3W2JA 3IVUA 3V5CA 1XYMA 3RMJA 5JBEA 1SVDA 3GDRA 4OBSA 2XGBA 2ONEA 1NP2A 2BY3A 3L4UA 3A22A 2YBVA 3KEHA 2NV1A 5GQBA 1LL7A 4M56A 2FQIA 4KETA 1EBGA 5AC4A 2R94A 3GH7A 4UNKA 4HHLA 2OU4A 3AWNA 3AFBA 1VQTA 1XBZA 2HZGA 3N9KA 1Y8BA 2J7BA 5C2XA 2BV9A 1GK8A 4LB4A 1CGTA 3PUGA 3ZIZA 2A3EA 1MUWA 3MUXA 3T8QA 3A3HA 4UCFA 4RW3A 4PRWA 1PB0A 3CZEA 1W3KA 2BY0A 2DSKA 3MBFA 4Z17A 4D71A 1B4KA 5FJTA 2FDSA 1P43A 4W8BA 3HFTA 2PODA 4LY8A 1VP5A 1BGAA 5AY7A 4IOTA 1DORA 3L2LA 2IKJA 1XUUA 3AYTA 2TAAA 3G18A 1DJNA 4DY1A 2O9RA 4GGBA 4MWAC 4HZ6A 3WBAA 4AVNA 1GVSA 1FHUA 4AMCA 4Q7BA 1B90A 4IP4A 1NJJA 3MI2A 2FVMA 2FHFA 1UP3A 2NX3A 4KGLA 4S3JA 4ZSUA 3GUWA 1NWUA 3G77A 3BJSA 2WV8A 3NM1A 4FX6M 3UCDA 3AXXA 1K6AA 2I17A 4NF7A 2EGZA 3F4CA 1P7TB 2DW6A 2Y8UA 2XVGA 1MW3A 2BOEX 2VFHA 1QPRA 2VELA 1MWOA 2ZCGA 5E0FA 1QR7A 1V0MA 2C79A 2G95A 5FD0A 1EJUC 3UQNA 1JPHA 2VEMA 1JUEA 2OLHA 4H4IA 3AJ7A 4PUWA 4S2BA 3R8HA 1SO6A 1HUVA 1VENA 3R0UA 1ZJBA 4YMZA 4I7UA 2GSEA 1M9HA 5AC6A 1PVNA 3SJNA 3C52A 4O8RA 4OZOA 5EMJA 3QMRA 2NV2A 4IIFA 4D6DA 1K3UA 2VC7A 2B31A 2X41A 3PB0A 1AD4A 3KVLA 9CGTA 3WQ8A 3W7GA 4IQLA 1EUAA 4HB7A 4DZ5A 2BS9A 3AYRA 3MCOA 2C1GA 1JNEA 1R47A 3M0ZA 3WQ6A 3ERPA 4FNSA 2OSXA 4LF1A 4D6GA 2EPNA 2B7NA 3P74A 2VRKA 2J25A 5K3VA 2PLJA 2XM2A 4JFVA 1GG1A 1K9EA 3SN0A 2Z1BA 5HWNA 3QW4B 1GPWA 4AIUA 3KHJA 1K9TA 5C2GA 2ZZ6A 5D05A 5BCAA 2CLPA 1TJ1A 5LSMA 3TLLA 2HK0A 1PIIA 4HPNA 3W02A 1GQIA 2ZX7A 5IFPA 1CGVA 2INZA 4NT0A 2CXEA 3VABA 2AQVA 2QAFA 3KLKA 2G4JA 4WDWA 4CVUA 2YA2A 4IG2B 3NZGA 4ADTA 1BYAA 2ISFA 4X22A 1K4HA 3L4VA 2WHKA 2VX5A 4CNOA 4IIEA 1PXGA 3W27A 5A69A 1ADDA 3NA8A 1RCQA 5CZJA 4IMEA 2H8ZA 4CEUC 4FXFA 2R1KA 1F6KA 4M24A 1Q6GA 3GHUA 4KEVA 2QVHA 3GNDA 4IP5A 3WLLA 1CXFA 1Z7AA 3WBYA 1RA5A 5MF5A 2JE8A 2Y7GA 1OM0A 4Y9OA 4DNHA 1D3CA 3HPZA 2QS8A 4ZODA 4AZHA 5HWMA 3W72A 2YXXA 2DSWA 1JAEA 1GEHA 1TTPA 3AS3A 2OEJA 2PP1A 3VC6A 1YXDA 4A8IA 2PC8A 1ZAIA 3CV6A 3S1WA 3G8RA 1FHLA 4KMQA 3CM4A 4F8XA 1PKLA 3MKKA 4K7VA 4KIEA 1UMLA 3P67A 1XF0A 3PPGA 1C9DA 1SZEA 3W7KA 5C54A 4FS9A 4RW5A 2PDKA 4O53A 2DVXA 3LX9A 4PTMA 3W76A 2FFCA 1HKMA 3CMJA 4K37A 1JCLA 2OWCA 4MJMA 3UZJA 2H9AA 3PZGA 1FXQA 3ARRA 2VYOA 4HOXA 2QIIA 4GABA 4ERAA 4G6CA 2GGHA 1J2BA 3ZZ1A 4HCDA 2ZIDA 3TWBA 3RM8A 2DY3A 1TMQA 1HJUA 1SR0A 4XWUA 2W61A 2HSAA 3IARA 3LV5A 1AD1A 2PTXA 1KRBC 1VFSA 4Q22A 3U5UA 4DAIA 4AY8A 4F0RA 1FWBC 4IP7A 3SCQA 4AXKA 1TTJA 3QRHA 3MSRA 1AQHA 1UHVA 2OR2A 2ZZ7A 3BLFA 2NSOA 1E5JA 4J2MA 3M9YA 2GOUA 1UC4A 1R85A 1L2UA 4WKFA 3VCCA 2E28A 3A21A 1PX3A 2VGIA 3KLLA 4LAOA 3IS4A 3THCA 4EPBC 4MJZA 2XFFA 3RRXA 4Q4KA 5IBXC 3UNDA 1S5VA 2GUBA 5CBIA 2QDGA 2J9YA 2XH7A 1EJWC 4PUNA 3S83A 4DJEC 3ZVHB 4AD0A 5F4WA 3BLPX 2VOMA 1VBUA 1CEOA 2XN0A 4E8DA 1BRLB 3FSTA 1LL6A 4Z2JA 2QMKA 3M43A 1DWHM 3MKVA 2Z1WA 1W1B1 3E38A 1H09A 3ABQA 1XISA 4JPGA 4G8TA 2QIWA 2V81A 3NNTA 1B3XA 1NIUA 1YXYA 3ABXA 5D9PA 2PDQA 3UEQA 3ZSSA 1I4NA 2ZRXA 3CUIA 3YPIA 1GVEA 3TSBA 4MAZA 3W1LA 1YADA 3ZR5A 3RU8X 1VBJA 1Q6FA 3WDRA 1B1YA 4O0ZA 2EKGA 1FWRA 5LIXX 5FAJA 3AXKA 1OIFA 1ZUAX 4GI4A 3NQFA 4QSFA 5CPTA 1QPKA 1E6XM 1ONRA 1FFRA 1GQKA 3C4UA 3V1HA 4WF7A 2Y89A 3TC6A 3QVQA 4DBEA 2DZBA 3CUJA 5M3WA 2A6LA 4DWSC 1LORA 5KZDA 1EYEA 2PBGA 3H70A 1YTEA 4QE5A 4CNPA 2Z25A 4B5VA 3KP1A 1C8YA 1N8WA 3QTPA 4JHOA 1DJYA 3ELFA 1YEYA 4AZGA 4YXGA 1PWLA 4FXRA 4D9PA 1OADA 3VUSA 1W1IE 4RZ4A 4PR4A 3E49A 5I6SA 2YLAA 3O8AA 3WD2A 4JL2A 4QIUA 3P8JA 5I3HA 2BODX 3LLXA 2PTYA 4GO8A 4BHYA 1MDLA 3FIGA 1B3OA 3WIJA 3IAPA 1DTUA 3TYAA 4PMOA 3LUTA 5HMFA 3W1QA 1FKWA 2OOFA 5IBXA 3WBXA 1S2CA 2PZ0A 1AG1O 3KUMA 4HPGA 4QLLA 3NL3A 4J40A 4D72A 3LMYA 3QV7A 2CHRA 3TLQA 4TV5A 1EJSC 1XI3A 5A6LA 5C71A 1M7XA 3QY7A 3O6CA 3GXIA 3NPXA 4ML9A 1JF5A 3BSGA 3CQJA 1MNSA 2UY4A 3HPAA 1NDVA 1Q6DA 3W74A 5JIPA 3R2GA 1ZPTA 1DWJM 1EWDA 4NQ1A 3P61A 2A7PA 3NYZA 4Q4RA 4S38A 3WD0A 4JIPA 4WXYA 2WCGA 2D1ZA 4J3UA 1UB3A 5TIMA 3QYSA 2ZTKA 4C6OA 2DSUA 3SQLA 3LB0A 1NOFA 2EPKX 2BLEA 3TFXA 4DJFA 1CXKA 1JULA 2CEQA 3VIOA 5I03A 5IHSA 3RYSA 3PM6A 1VFHA 3CUGA 3UGVA 1CX9A 1V93A 3UZXA 4ADSA 4L1GA 2C18A 3WQPA 3QW3A 3V0TA 2GDUA 1QRQA 5FEXA 3IJDA 1J01A 2O9OA 1H41A 1EHAA 1ZAJA 3NL6A 4IPPA 4EX4A 2C1IA 3NGFA 3DFNA 6REQA 5U4NA 5CBJA 5LGXA 2OFJA 2CERA 4BEQA 2YYTA 2Q3RA 2NQ9A 3VNLA 3QSTA 3WUBA 3PPFA 2V8ZA 4GUJA 4PL1A 4MJ2A 3NIYA 2XVLA 1OF6A 4O19A 4BJHA 1MXGA 1CXHA 4JQ3A 5T9CE 4FNTA 2ZKMX 3IJ7A 3O0FA 1EP1A 2NX9A 3SCWA 1IIGA 1VRXA 2QDEA 5HQLA 2DJLA 3SZ8A 2WCAA 4GBUA 3JZUA 1AW2A 3GNOA 5CPNA 4A4AA 1Z8AA 2ZICA 1OG0A 4Y9AA 1W3IA 4LAUA 1EB3A 1SYTA 4V27A 4RR4A 1V5XA 3GDTA 1JGMA 1C93A 2FMNA 3NEHA 3MPGA 1OYAA 3CHCA 5KZEA 1UBSA 2A3BA 3QR1A 1ZJIA 4HU4A 2ZRZA 1XPYA 1F7BA 2ZUSA 4DI9A 1OFAA 3V5OA 1D8WA 5D2TA 4GG9A 2IMRA 3EPOA 1TO3A 2BX7A 2HROA 4DYEA 1X98A 3BQ5A 2WNNA 1H50A 3BOFA 3M0XA 3GLCA 5D2VA 3TN5A 2YCLB 4FSAA 3G1YA 4O16A 1WB0A 4MAVA 4PUMA 1UWUA 3OVQA 3W71A 4WDXA 3SCNA 2J6VA 3CEUA 1M7JA 4QRNA 5FACA 2OX4A 4LUSB 3BAIA 1W8GA 2J8TA 4QS6A 3UXIA 3L9CA 3V0SA 3IJLA 2AKZA 3QR0A 1XCWA 5HNNA 1QK0A 4FLQA 4EF9A 2WPGA 8RUCA 4Y6GA 5EFDA 4RDWA 3R8RA 3SAZA 3ZT6A 3NZPA 1X1NA 2WJZA 2DDXA 1EC7A 1D8CA 1R2RA 4O54A 2E1DA 5DMLA 5LIYX 1CBGA 1B3YA 1IGSA 4KRZA 3NQ8A 1UASA 5AYIA 2O92A 3XISA 4OJYA 4Q4QA 1O5KA 4ALDA 1F4AA 7XIMA 3IIZA 2BHUA 5HINA 4QG8A 4XKMA 1EA0A 2CYGA 3B4YA 5DBTA 4FI4A 4L61A 1U5JA 1NEYA 1SZFA 2ZZ2A 1UYQA 1FWFC 2Y5JA 1DP0A 4N9BA 2VDIA 3CH9A 1HL8A 5L9FA 3W23A 3WFLA 1KBIA 4WSHA 2VGBA 2NSXA 3VDAA 5A1AA 1I2OA 1RPKA 5HBFA 1Q2RA 4AIBA 3C2YA 3CHFA 3F4WA 3U8GA 4BZYA 4PODA 2F6KA 3B04A 2OYMA 4LBUA 1JCMP 2OSYA 1GKPA 3QQWA 3R4IA 4JTRA 1TZ9A 1N7KA 3PANA 2Q71A 3KFTA 3PZVA 2XIQA 2VZSA 1BD0A 3WLQA 4FR6A 3WF2A 3DYOA 1VJIA 3HOJA 2HEJA 4DBUA 2E8YA 2IW0A 5FF4A 1WCGA 5IRPA 1P1XA 5CH9A 4B3LA 1TX0A 2PRMA 4WLCA 1KLYA 5FSEC 4AU0A 3AWOA 2QJIA 4FF7A 4IJRA 3CB3A 4MFEA 1XBVA 3K4AA 1QAPA 4JX4A 1P0NA 3IPWA 1NAL1 3K1GA 1DXFA 3S6OA 1K02A 4NNCA 4TVCA 3EA2A 3LCWA 1IT0A 4PA8A 1SU5A 3CV1A 3WG6A 1MO0A 4BWLC 2TPSA 5H91A 3L23A 4GYPA 3DG6A 2VENA 4IICA 4Q4PA 3IK2A 3SCPA 1JD7A 1FCUA 3ABRA 4R33A 2OEMA 1B57A 1M04A 3NZRA 2HPIA 1ECEA 4N4PA 1I1XA 3RPTA 4KCVA 2IPFA 4P8UA 4TTUA 4LFYA 3B0PA 4JTEA 5D30A 1DQWA 9XIAA 1YBQB 5CBBA 2E6DA 1HO4A 1KTNA 2PP0A 5G1TA 2YR1A 5HQMA 4JY8A 2GJPA 3W2KA 5D04C 3BJFA 2CLFA 3V16A 1WYIA 1GW9A 1IT8A 4OIFA 3CZLA 1EJTC 2DT0A 3MVTA 4ZXOA 1TRDA 1AW1A 3LM3A 3O05A 4XO7A 1XQLA 5DCBA 3EKZA 2VD8A 4LSBA 2VVSA 3ARUA 4FXJA 2ALRA 5I79A 3N2TA 4F0KA 2E0PA 4C6CA 5KITA 2PGEA 2X1SA 2V5KA 3QLDA 4DHGA 3RCYA 3BG9A 1VEPA 3NSNA 1XLDA 4Z2IA 1VAHA 3DFQA 4G9PA 3BE7A 4ZOBA 2VC5A 3LY0A 4L1WA 1JAKA 3SY1A 3L2MA 3OW1A 3URBA 3GKAA 3WH6A 1D7FA 4GC3A 1FWNA 4A05A 3BDKA 4IPJA 4CD5A 4OBRA 2TRSA 1Z42A 4QHRA 4HD5A 3FGCA 4BEUA 3VIPA 4BQ2A 1CXIA 4G56A 1UA7A 3VE7A 4OWGA 1XLCA 1I8JA 5I3KA 3LSBA 1H61A 4PB5A 2ZE0A 3M4HA 1GTHA 4PE8A 4DB7A 2D20A 1RPXA 2RJGA 4H6KA 2VURA 3WMSA 2FZMA 1C90A 4O18A 4UWMA 4PZVA 1UKQA 4AIOA 4GLEA 4UQ9A 2QW5A 1FHDA 1JUKA 4PBEA 4B9YA 4U3CA 1J2WA 1JZ5A 3HF3A 1VF8A 1FWEC 4O1CA 3LOTA 1VFTA 1K7FA 1GQLA 1L0PA 4QEEA 2B81A 1SJBA 3SN1A 4JQ4A 1T8QA 4HYVA 5F4SA 1WXYA 4QFUA 4PRRA 2ABAA 1K70A 3ABSA 4OV4A 3GQYA 4DNMA 3VK5A 1SSGA 3GFYA 1NELA 4KRUA 4DBDA 1NFPA 1JL8A 4H8VA 2Z7GA 3CIXA 5JU6A 3RHGA 4AAJA 3GNRA 5KEZA 3F2DA 4HMDA 2Q09A 2PDBA 3ARZA 4GQGA 4WJEA 4W85A 3LZ3A 5I2UA 2G3FA 1ICPA 2VX4A 3T4CA 4UQDA 3AMDA 7ENLA 5GJPA 2J13A 3KBSA 3MQTA 3TE9A 1TTQA 1ITUA 4LH8A 3STPA 1S2WA 3HJZA 4MADA 3HV8A 3GIPA 4U4MA 1PDYA 3NZQA 3CUZA 4NZ1A 2E9BA 1T41A 3NXLA 2AQWA 3U57A 3O16A 4ENLA 1Q8AA 4LXFA 3ZVHA 3UR2A 2PGWA 2EPOA 3LCIA 5FJRA 3V35A 2V5LA 3VIFA 1IQ8A 2XFWA 3KE0A 4L7ZA 4QG9A 2I5GA 4JFSA 4JIQA 4E2VA 1G6CA 2WVVA 2QHAA 3SDOA 2D2JA 3GNPA 3K13A 4CCZA 3L4XA 1AH0A 4IMCA 1BG9A 4AF0A 3LHWA 3H4GA 4QE4A 4Y90A 3H55A 2HBVA 3E74A 3W7JA 3ZT5A 4HU8A 3A4JA 1BYDA 3ME3A 3MP4A 3NZ1A 3NQ7A 4K8HA 3HU7A 2VEGA 3H54A 5AKQA 4QS5A 1IEXA 3LTYA 4A3UA 2ACQA 5D32A 3Q58A 3CL7A 4N0RA 3OBKA 1XM3A 1OHLA 1ZBVA 1VZWA 3L2IA 3AIWA 1US0A 5MHBA 4EOUA 1DVJA 5LZLA 4UBPC 5G1YA 4KEMA 3V3WA 1XIFA 4E0CA 3E0VA 1K8YA 4GXMA 4P8WA 4IJBA 2W66A 2V0TA 5D4YA 3NDYA 3FYPA 3ONCA 4DUVA 1KFJA 4GNKB 2VFDA 1UUQA 1PV8A 3GY1A 3QBUA 3APYA 1CYGA 2A3AA 1U5HA 1O4UA 2KZHA 1R2TA 2ZRWA 5AN7A 1J0JA 2RFGA 3LGDA 2Q6ZA 1DXIA 4GFIA 3LCHA 4H9YA 2WMHA 3LHYA 2RDUA 4ZR8A 4FNUA 4UFLA 4JQAA 3CIVA 4FAMA 3T2PA 1MDRA 4X9SA 4QEHA 2HNHA 2VVNA 3EDKA 1JZ6A 1FCVA 1EQCA 4RDVA 4LRTA 4V1YA 3G22A 4AY1A 1LWJA 5FL0A 3BZJA 1V6XA 2Z27A 1LUCA 3SCOA 3U2OA 5FSDC 2W5FA 4TQTA 4J1OA 1E1CB 5A2CA 1TWDA 1UWAA 3N6JA 4UQBA 1LOLA 3MUZ1 3GW3A 3TXVA 4B5NA 1DHKA 3REQA 2PWEA 3CGTA 3M7SA 3G5EA 2TYSA 3QZEA 1CDGA 1I45A 4RDYA 5AHFA 2PFHA 4A22A 5IFTA 1SMAA 3E12A 4C91A 4IFOA 1N2VA 4GY0A 1RY0A 3RJXA 2DUAA 3DI0A 4C1LA 4JEQA 1XDJA 4PBFA 1T40A 5H8UA 4I5RA 3CS2A 4HYWA 5GVJA 2ZQ0A 5D9OA 4DLMA 1DBTA 5G4EA 2OZ8A 3GIQA 3P93A 4UFIA 1GWJA 2PTZA 3DESA 4U28A 4HU3A 1HJXA 4O11A 1IYXA 4XBKA 3MT1A 4M51A 2PCQA 3U7BA 3HQ1A 4PMUA 1QHOA 2OELA 1XGZA 3W85A 1O68A 1ODUA 2GFTA 5JVLA 2PPGA 3PG8A 3TEVA 1BGGA 1O66A 5D37A 1XSKA 3UF9A 1X7FA 1QW8A 3TH6A 3LCXA 1E0WA 2JALA 5D38A 1R3TA 2PSNA 1WBJA 4YVVA 4TXEA 1VEMA 5JH2A 3P14A 5IHRA 4HYRA 3KW3A 3TW9A 4LCSA 3BGAA 2IUZA 3WD4A 3KOXA 2G3IA 5A6KA 2JGYA 1BFNA 1FY6A 4NZ4A 5DO8A 5D8WA 5XIAA 2YXGA 4N02A 1XBYA 4HGXA 3WD1A 1YQ2A 1IE7C 5TNVA 4UMBA 1TQXA 1JIBA 3IGSA 1I6NA 2WXDM 3WNMA 4NIRA 1X6NA 5BXTA 1O60A 3W2MA 1HL9A 3WF3A 1SZGA 4EF8A 5C9RA 2POTA 4EKJA 4YHEA 3UXKA 7A3HA 2CU0A 3HQOA 4IUGA 1X39A 4DZIA 3P3BA 4WJXA 4O12A 4JNMA 3O2LA 2VFIA 4N42A 3EX6A 3NQBA 3N29A 2Y4SA 3BVJA 5CSYA 1JPKA 1E73M 2PDUA 3U5YA 3GXDA 2OWWA 3W86A 2H8XA 4MWAD 2ISDA 2HS6A 4C6QA 1O5XA 1R3VA 2YFNA 3OQ8A 1RP8A 4KESA 3VKJA 4A35A 1ZCCA 4LYRA 1KM6A 3ZSTA 2J78A 4P61A 3ANVA 3PZOA 1OF8A 4UMCA 5BU6A 4Q8NA 2PWHA 1VCGA 1G7UA 4LWWA 2PB1A 1H4PA 1US2A 3PZUA 2XSAA 3G2GA 2QCFA 1UKPA 3DBPA 4NAEA 3W7IA 2OLAA 1XFCA 5A2BA 2AL2B 1K9DA 4XIAA 3C86A 4FPSA 1GVYA 1LTDA 1CGUA 5EL1A 1EOMA 4LUIA 3TJIA 4AMAA 5AZ0A 1ISYA 3G6LA 3EX1A 2FVLA 3VX1A 4HIBA 4AZ6A 4LU0A 4MJ4A 4NX0A 5BZAA 1B30A 1O1ZA 2DSVA 5LYRA 1A53A 1HVXA 1J10A 5AC8A 5ECUA 2BGNE 3QEZA 4DO6A 1MXSA 4H00A 3E2VA 4CKQA 4DZHA 1QBBA 4H6QA 4O0KA 3BW2A 3N2BA 3M0JA 1V3KA 1VYRA 4YTUA 3GD6A 4AHPA 3C5QA 4QJ5B 4C6IA 4MWAE 3SCRA 2OZTA 2CKRA 5CC6A 5BOFA 3OPSA 1UG6A 1O94A 4FNRA 3C56A 3RLUA 3MSGA 2IXVA 5HR6A 1JDAA 4AC1X 3V36A 3WUGA 1SM9A 1J9YA 3O1NA 4B5WA 4UUIA 5FI8A 4UOJA 3UESA 1VPYA 1CECA 2PAJA 5A8OA 3URQA 3QY6A 1UKSA 1VEOA 3ZLGA 2FIQA 4WK9A 5EBUA 4GWEA 2R1MA 3IVSA 2QCGA 4C6PA 2DQXA 1MRQA 3D3FA 3BMWA 4Y8FA 1SFSA 3RFAA 4NVTA 2X7WA 4OTKA 4O1EA 3VDBA 1BQGA 2A0NA 2OQYA 3L0NA 1XRTA 4QG6A 1OFRA 4MY1A 4MNKA 1SO3A 2PDHA 5CKSA 2WWDA 3GVWA 2WYSA 3FA3A 4JX6A 4QBXA 2VCAA 2VJXA 3K8MA 2J7DA 4JTAA 4MY9A 1R87A 3MS8A 3ZQ9A 3VAVA 1W32A 2QULA 3RLGA 1XCFA 2J47A 3L68A 4XZWA 1G69A 4ACZB 1B3WA 3RAOA 2EQDA 4G5DA 1UWQA 4HSNA 4LAKA 4WD0A 5EGRA 7PTDA 1OD8A 3QH2A 3UYIA 3MU7A 3PTQA 1C29A 2YDQA 4OGZA 2XSBA 4K8EA 3CYJA 1DIKA 1ISZA 3VNYA 3VCNA 4BA0A 3B8UA 1BQCA 4W7WA 1FDJA 3IRDA 2XIIA 3MANA 1F05A 3COTA 2J88A 3VNKA 4MGGA 3WDJA 1E6NA 1Q45A 3N73A 5A6AA 1XH2A 4S3EA 3KDNA 4UTTA 4PUJA 2PURA 3GK0A 3V1PA 1ITCA 1KM0A 3BH4A 4BQ4A 1DIEA 3BQ6A 3FNDA 1F3WA 4CU8A 4AFYA 5DCEA 4DF0A 2C16A 3P81A 4J5NA 1TREA 2Y5EA 3S9ZA 4LEFA 2YPIA 4NZFA 2PDFA 2GK1B 4DO4A 4RV8A 4DJED 2D3LA 3KL0A 4Z0SA 5LA2A 4OKDA 1XR2A 3AHXA 3TTQA 1SJCA 3CWHA 4ZO8A 1V77A 2B4GA 4CUCA 2XZ9A 1P0BA 3SM0A 4Q6XA 3VA8A 3EXTA 3CPRA 4FHAA 4ZA0A 2ISVA 1DJXA 2HISA 5H2ZA 1FWSA 3ONBA 3CO8A 5AHLA 2I5IA 1CB2A 1QW9A 5CLTA 5FF0A 2QV5A 4AWEA 3DUGA 4TMBA 3OGSA 3T05A 5CQ1A 1R38A 1FCBA 3KHDA 2ESCA 4DWDA 4OT7A 4UB9A 1UP0A 4UNIA 4B91A 4US6A 2OEKA 4OOZA 5E0KA 4XKYA 3VGGA 2A6NA 2A3CA 4EK7A 4UZUA 3THUA 3WLHA 3MCMA 2EO7A 4GRSA 3WLMA 4LUJA 1TZZA 3R94A 4D6CA 3TX9A 2XH2A 3WN6A 3PF3A 2Q8XA 3PNUA 3SADA 3CUXA 4E8CA 1OGBA 4C6DA 4DWSD 1XD0A 3JUGA 3I7SA 1XKJA 1MQPA 3IJ8A 3W7EA 1EUNA 4GQQA 1AK5A 3KZSA 2NLIA 1E0UA 3ZM8A 2QQ6A 3NDOA 4MMWA 5DLCA 3PFRA 3PZMA 2V2DA 1WO2A 3P0WA 3BOLA 2Y61A 4JKMA 5FIPA 1V0LA 4EXAA 5KINA 1QMLA 2UY3A 3RO6A 5HULA 2GVGA 3GXPA 3WJZA 3EXSA 1VCVA 4AZ5A 3SUTA 2QCDB 5CG7A 5I02A 3TQ0A 3OEXA 4HCLA 3EWUA 1C7TA 2YL9A 3ZYZA 2WAGA 3N14A 3VVGA 4C5ZA 1JCJA 5BRQA 2ZOXA 2P5NA 3LPFA 2AKMA 4AQLA 4I6KA 2G97A 4O50A 4QJ4B 1J6OA 3BARA 3ARVA 3H2CA 3MJMA 3PK7A 3TROA 1W3TA 1UD3A 1XL9A 1ZFJA 3L21A 4MDOA 5G2IA 4B3KA 2JQXA 1OC5A 5AOUA 4EAMA 2AMGA 4KF1A 1HVQA 3KBNA 3FX4A 4FOKA 3VTRA 2GSHA 5CAKA 3TKFA 1C91A 1WUEA 1G9HA 3AMKA 1ZGDA 4JX5A 4PYSA 3UR5A 4AHOA 5JUVA 1S5TA 1F3XA 4Y2WA 1POKA 4FB7A 2DU2A 2E6FA 4ERGA 3LSCA 4WY0B 4GUIA 1GZ1A 3GAYA 2R14A 1OX4B 1ZL1A 3BMXA 4G7EB 4BS0A 4NJHA 3SQMA 1RUSA 3VZZA 2ZX6A 1HGYA 4Q8WA 1E9YB 1PUDA 1ZY9A 1G5AA 4Q7NA 3G0UA 1SPQA 3BICA 1QOQA 1QBAA 4MPQA 2IPJA 1UIPA 4EPKA 1JCYA 4RE4A 3R6IA 5REQB 4LV9A 3XIMA 2FKPA 2DORA 1VHNA 2QV4A 4ATDA 3Q37A 3W75A 1UJQA 5A8NA 3EX2A 2PMQA 3TONA 3ARPA 5F2GA 3PS7A 3WEZA 2GZXA 4W8AA 1DEDA 4F48A 3VGEA 1RJQA 4L56A 2VCCA 3F03K 3RMEA 3R10A 2VR5A 4I8YA 2GQ3A 1AMYA 2ZWYA 1TJPA 4GACA 4ZQNA 5I3JA 2W6RA 3N9SA 3HPXA 4B3ZA 4LC6A 1MRAA 4D8LA 2YSWA 3EDFA 1CW2A 1PHQA 5G2HA 2AQOA 1V79A 3PJUA 5LA0A 3UWUA 4J28A 1DHPA 1L6FA 1TB3A 3VMOA 2D24A 3KBMA 3NAVA 1C92A 3LM7A 1ZCOA 4NRRA 4M19A 2P76A 1GONA 2HXUA 3AISA 2DIJA 4XTIA 1TPWA 3D46A 3W7RA 3GTXA 1KD0A 4PMNA 3SGUA 1Q85A 5C6MA 3DH7A 4ZEPA 6TAAA 3FA4A 3R12A 4C7GA 2DUZA 5H1WA 4LCQA 3OVGA 2H90A 1LROA 3EYPA 3PSVA 1DQUA 5TD4A 1ENUA 2DV0A 3DBNA 3F4VA 2PDPA 4J3ZA 2Y63A 3EOEA 3OODA 2YYUA 3K46A 1FWDC 4JS3A 4O4VA 2Y24A 3I6TA 4F4RA 1Q6RA 4UTWC 3AXIA 1RA0A 5J5RA 3CYVA 4HP5A 4S2CA 5DQPA 3LCGA 3MWAA 4MY8A 4Q8VA 4C65A 1O6IA 3AHVA 3LLDA 5JXQA 2XSXA 4MHBA 2UV8G 3WQ5A 3TOYA 1AH4A 3R58A 3FJ4A 1J11A 4E5TA 4IXHA 1VFFA 4LVGA 3OZOA 1BWKA 3C2RA 2V3GA 4A8NA 2E5DA 1K1DA 4QR6A 3H2AA 3IJQA 3WBEA 2OX1A 3AROA 3AMGA 1S2AA 4CGTA 1NF0A 5J5DA 3NO3A 3E2RA 1W17A 1PKYA 1NFGA 3B8VA 3BZGA 3VMNA 2ZTJA 2ISSA 1U30A 1GOQA 3CLMA 2HNEA 4Z1CA 1JQVA 5HJYA 1JRCA 1RD5A 1G4PA 1XFBA 2BG5A 7ODCA 2ZUTA 1W54A 2R1NA 3MDUA 3HPSA 2X30A 4K36A 1VLIA 4IFKB 1E4NA 4B92A 1JCXA 4ROPA 3LQGA 5K2ZA 4QGCA 1SFTA 3EWDA 1IXPA 1VIZA 4MM1A 2E8ZA 1CI1A 2A3HA 3LHZA 3A13A 1MFVA 6TIMA 3O15A 3FJNA 3UY8A 5BU9A 3AUOA 3CLWA 4JCMA 2Y7FA 3BLIA 3U2ZA 4NI3A 3T7VA 4NKCA 5EMMA 1LQAA 2V69A 1QPQA 2NZLA 3CL6A 3WENA 3NQVA 4OUIA 2G8ZA 2C15A 3GH5A 1TV4A 2FZNA 1TJ2A 4CQDA 2CLMA 5E6YA 2BZNA 1T5AA 2W4XA 5A6BA 3TV8A 2C1HA 3CUHA 2DT3A 1K7EA 3LPPA 1WZLA 3OYZA 4BF7A 1W2PA 2JKAA 3MMTA 3THQA 2OXNA 3VZXA 4DPQA 3V7PA 5DXXA 1EPXA 1LM1A 1U2YA 2W92A 3U4FA 3GDKA 3NO5A 3FKKA 2XN1A 1XD1A 1W1ZA 1KA9F 1YE4A 1RQBA 4XD6A 1KXVA 4FMVA 1HKVA 3TN3A 2J7GA 5EB8A 5A6TC 2NUXA 1OINA 3TVAA 5KZ6A 5DT5A 2OODA 2WKLA 1CGXA 1R7OA 3NTYA 2A2IA 1WDRA 3P8IA 3C8FA 1PX4A 1VRDA 3S2NA 1CXEA 4S3GA 2DZWA 3B05A 1V3MA 1R6WA 3NO1A 3MJYA 3ATZA 2P50A 1O5RA 3WQGA 2EBNA 3I65A 3APTA 1W9UA 2QCNA 4JN6A 4MUPA 5FKYA 4ASTA 3AIEA 2OYLA 4XUYA 4WOQA 3F4NA 3I10A 5D8ZA 2J24A 5I23A 2TODA 3TYUA 2CETA 1V02A 3I4KA 2VQTA 3QFWA 3FYYA 3TYBA 1W31A 1X96A 4E4UA 4E6MA 1R9ZA 2VZOA 1FXPA 3F2BA 4GE8A 1UOZA 2XVNA 1PIGA 2RGLA 4NX5A 1SMDA 1VC4A 3JW7A 2FTPA 2AGKA 1VBHA 1B2YA 5CGTA 3NCOA 4DYJA 3NJ3A 3MO4A 5F2IA 3W7HA 3AIUA 4JHZA 4RKAA 4MFDA 4PULA 4JDBA 4Z08A 1TV7A 3AO0A 4ORIA 1MQQA 1A5SA 5EPDA 4J3VA 2E25A 5I3FA 1TV3A 3DFOA 2EPMX 4ZSTA 1A0CA 1B54A 1XYZA 4LYPA 2XYLA 2XIOA 1JZ4A 4KEUA 3UG4A 1M7OA 4GC4A 4UTUA 2Z6JA 4E3TA 4ACYA 1W2VA 1VFUA 1LG1A 1XYBA 2VOTA 1Y5XA 3R89A 1E0XA 3UG8A 1L6YA 3WLRA 1W1VA 3CUFA 2XFRA 4ZE5A 3WNOA 4UTLA 1M03A 3A4XA 3UGRA 3WNLA 1CIUA 3N2XA 1W3LA 1DWGM 1UKOA 2XUCA 1H5VA 2PD5A 1EHNA 2P0IA 5K9XA 1D7KA 5F2LA 1OYCA 2DH3A 2ZVIA 1X8FA 3S4TA 4YVXA 3UR7A 4JL1A 1RBOB 4TIMA 3UJFA 5EBAA 4W4QA 5M03A 4L6HA 2ZRVA 5U7SA 4M0XA 2BDQA 4N4QA 4IQJA 3MMWA 1LJYA 3FS2A 2WC4A 3TSDA 3MMDA 3OO2A 1T8XA 4ZQRA 4C90A 4AWTA 4MTVA 4C6MA 3HIJA 5C9XA 1ODZA 3BAWA 3I3EA 1TYGA 3TK7A 3ZOAA 4US5A 2VWTA 4IIBA 3NXFA 5A8QA 4XZIA 2IXUA 4S3AA 4M6PA 1XH0A 4RNHA 1VH7A 4JKKA 3UXLA 1XLKA 3DG3A 4B5TA 3IGXA 4UTJA 1TTIA 1Q3NA 1YDVA 4WKHA 1QNOA 5F4XA 4M81A 1V02E 3ZMRA 3OBAA 1UZDA 3HG5A 3GU9A 2D0GA 5H8PA 2RH9A 1KKRA 2GK1A 4F3HA 2GJNA 4INFA 2HE8A 3B03A 2DPEA 4NL1A 2GVJA 2H9AB 2J6XA 5F1UA 4E2OA 4ES4A 2UY2A 2GQ8A 3ARXA 2V5JA 2ZADA 1TKKA 2X16A 4Z2GA 4DF2A 4QISA 1YIXA 1H7PA 2VFEA 3S2MA 2QZRA 5EKYA 1A5KC 1A47A 4YU1A 2J8GA 3GR8A 2DZUA 3II1A 1FX6A 3EGJA 1SFJA 3NURA 4H6EA 1D3HA 3GBDA 4DLFA 2GGEA 5DANA 3S5NA 3T2OA 4DJDC 3IEBA 4QXIA 4Y9MA 1PJ9A 1CB7B 2XM1A 2YA0A 5B7ZA 1XG4A 2XH0A 3H2OA 3M0YA 2Y8KA 1YLVA 2WMKA 3A3WA 4HN8A 4CN1A 3K5XA 1O5QA 4U10A 3QC0A 4GYFA 5BOOA 4MYXA 2G96A 4A2SA 3S2JA 4WR3A 3W1MA 1QPNA 1J6PA 3DGRA 2PDLA 3IV8A 4UFHA 3R5EA 3KVMA 1Z44A 4Q7IA 3EWXA 2H6RA 3H26A 3PBUA 4ATWA 1GTEA 1Q63A 4W88A 1K6WA 5F7UA 4M3PA 2VNCA 2ZXBA 4XAYA 3R43A 1TELA 4XAFA 3M07A 3ITLA 3IUHA 5HPOA 2B7PA 2WHLA 2R24A 4LT9A 3UR8A 3CO4A 2G5WA 3GVVA 4GIRA 5KSWA 4B2DD 3QTGA 3QLLA 1LBFA 4Q4OA 4A8RA 3A23A 4H1ZA 5C9ZA 1R3YA 2YIHA 1E4LA 1VBRA 1TUFA 2DT1A 3S3GA 3VIGA 4KFOA 1A5MC 2PS2A 3P5ZA 3S9YA 4AW7A 1ZB5A 2JEQA 2WMJA 2ZX8A 4JFTA 1WDWA 4UTMA 3KOWA 4GK8A 1C8QA 4IX0A 4UFJA 1JYVA 2YL8A 1T7LA 4PTWA 2BXZA 1A5LC 3USBA 4DAFA 1RY8A 4IPLA 1FWIC 2OB3A 3OB8A 2O9PA 2ZZ5A 1IWAA 3TA9A 3GW0A 1E55A 4B4FA 3H12A 4RXGA 1GUVA 2DT2A 2DZTA 4YCOA 4HN4A 3FDKA 4DJDA 4HU0A 2C13A 2PBOA 4BY3A 5JBDA 2WSPA 4XAGA 4AD2A 5ABGA 2GJLA 2X0SA 4HNCA 1MVYA 4LB3A 4IF2A 4MUZA 5CLWA 1LDCA 1V0KA 3M0VA 3VD4A 2ZXDA 3O63A 3ITVA 1TPDA 2R82A 3DEQA 2NQZA 2PLKA