1DYSA

Endoglucanase cel6b from humicola insolens
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
345
structure length
345
Chain Sequence
GNPFSGRTLLVNSDYSSKLDQTRQAFLSRGDQTNAAKVKYVQEKVGTFYWISNIFLLRDIDVAIQNARAAKARGENPIVGLVLYNLPDRDCSAGESSGELKLSQNGLNRYKNEYVNPFAQKLKAASDVQFAVILEPDAIGNMVTGTSAFCRNARGPQQEAIGYAISQLQASHIHLYLDVANGGWLGWADKLEPTAQEVATILQKAGNNAKIRGFSSNVSNYNPYSTSNPPPYTSGSPSPDESRYATNIANAMRQRGLPTQFIIDQSRVALSGARSEWGQWCNVNPAGFGQPFTTNTNNPNVDAIVWVKPGGESDGQCGMGGAPAAGMWFDAYAQMLTQNAHDEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
publication title Structure and Function of Humicola Insolens Family 6 Cellulases: Structure of the Endoglucanase, Cel6B, at 1.6 A Resolution
pubmed doi rcsb
source organism Humicola insolens
molecule tags Cellulase
total genus 143
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1dysA00
4AVNA 4AVOA 2BVWA 1UP0A 3RPTA 4B4HA 1CB2A 1UOZA 1UP2A 1TMLA 1UP3A 2BOFX 3ABXA 1GZ1A 1OCNA 2BODX 1HGWA 1QJWA 2BOEX 3A64A 1HGYA 4AU0A 4AX7A 4I5RA 4A05A 3VOGA 1BVWA 1OC6A 4I5UA 4B4FA 4AX6A 2BOGX 3VOIA 3VOFA 1DYSA 3RU8X 1QK0A 3A9BA 1QK2A 3VOHA 1OC5A 1OCBA 3VOJA 1OC7A 1OCJA
chains in the Genus database with same CATH superfamily
4JIRA 3EDDA 4UR7A 1XPGA 1RJQA 3VNMA 4FNQA 3N6HA 1JRCA 1XYCA 2A7RA 3GW3A 4LW7A 1IF2A 1QNPA 1P6BA 1WZLA 1OT1A 2X30A 1E56A 3D47A 3QOMA 3LSBA 1WXZA 3K8MA 3UNDA 3AWOA 3T81A 3PTMA 1FWEC 3RF9A 1KQYA 4Q22A 3PZVA 2YFNA 4RZ5A 1CGVA 3LX9A 1V6YA 1EJSC 3EYPA 2DSWA 4GFIA 3AYVA 3AZSA 4ZEPA 3BURA 3EXTA 4GO9A 2QDDA 5L6UA 3SUTA 4MWAD 3HGJA 3G1SA 4B5VA 3D3AA 2GK1B 4JGDA 5BROA 4QJ4B 4E2BA 5XIAA 1A3WA 1UUQA 3O6AA 1XQLA 3ANUA 3LCLA 3R1ZA 2CBJA 2ZDRA 4OBRA 2V3DA 2QJIA 3W6LA 2ZTJA 2W5FA 2YCKX 3W1QA 3O15A 1XICA 1W9DM 3UZJA 1D7KA 3EGJA 5BZAA 2YPIA 1ZAIA 3Q94A 3BUVA 1CEOA 1KFEA 3BW3A 2Y5EA 3TU9A 2WVSA 1CW2A 1H5YA 3HGOA 2ZRZA 3TXVA 3ECQA 1KCLA 3TWBA 3M0YA 4I5XA 4PUWA 3N9RA 4O28A 2W3ZA 3BOFA 4ORMA 4Z17A 2QMKA 3OVQA 3BVJA 6REQB 1FDJA 1PHWA 1S1PA 1MO0A 2PRMA 3W7RA 1AJ2A 1DIDA 2WPGA 1WP6A 5HMEA 4NASA 4EXQA 5HQEA 5LXEA 1NOFA 4JN8A 3VIJA 4W4QA 2ZX7A 1PO9A 3L5LA 1GQIA 3UXIA 4GZJA 4C6LA 1B31A 4DUWA 3BL3A 2HPMA 2VEKA 3IJ6A 4DBUA 1X97A 3DH7A 2YR1A 8TIMA 2Y61A 1DIKA 2R91A 1E9YB 1TVNA 2PWVA 1X96A 4HB7A 3HQNA 1RD6A 4EF8A 3VIMA 4MKSA 4QISA 3NM1A 4H01A 1NFPA 2G3FA 1JF5A 1LOLA 2ZRWA 3FYYA 3K8LA 3W85A 2Y1HA 1UJPA 4AD2A 4MJ2A 3VA8A 4I7UA 2HWGA 4EE9A 1UC4A 1A5KC 4AIOA 4DHGA 3JW7A 3W7IA 3RAOA 4R7JA 5CC7A 4HHPA 2YL9A 1G4SA 5AY7A 1VFUA 2G4FA 5MF5A 4FNTA 3SCQA 1NAL1 1T5AA 1AMYA 4J35A 4HTYA 4ZOBA 1TV8A 1B3OA 3R89A 1FWGC 4FNSA 4JTTA 4B5UA 4BJHA 3MC5A 2DZWA 1FWFC 5HWNA 3W73A 3BZJA 3G1AA 4FLRA 4HCLA 2PSNA 2ALRA 2Z6JA 3BE7A 4ZB0A 2V30A 3C61A 3GLCA 3WQOA 2VO5A 4JQ2A 2REQA 3RX3A 1D8CA 4MB4A 1NWTA 3GSMA 3M4HA 4CNSA 3EDFA 5F2LA 3UZ5A 3WX7A 5A8OA 2PZ0A 3FK4A 1WAWA 3GIYA 3UW6A 3EOLA 1GQNA 2R9RA 4BI7A 5I7GA 2BOGX 3OEXA 2PZNA 3IJQA 5A95A 1J6PA 1ONWA 3G22A 2HXUA 4AY8A 3U3HA 3ZJ6A 1UC5A 3LGEA 2ODOA 2V81A 2WZMA 4JQAA 4DO7A 3STPA 1K1DA 2DVUA 4GGHA 2EJAA 3W07A 2OO6A 5KZMA 3FN9A 1NDWA 1TWIA 1WZAA 4AY1A 3H2OA 3VIHA 4ONVA 3EBVA 3GU2A 4XZHA 4IFKA 4C1KA 1G4PA 1E55A 3WH9A 3IRDA 4RW5A 3GAKA 4RXGA 3MSGA 2D2OA 3WK3A 2G4JA 1XIHA 2CITA 5MKGA 3EXRA 1B3YA 3SR7A 3MYOA 4JKLA 2I17A 1YW1A 3SN4A 4L9YA 2VCAA 1MVYA 3OPSA 1B0IA 5HAOA 2R1PA 5REQB 1EJ7L 1KXVA 2RKXA 2ZOXA 1EA0A 2H90A 4GHRA 3UBPC 4N4PA 5FF7A 5C2GA 3UWEA 3TROA 2JIWA 3A12A 3A3HA 3PZIA 1VC4A 3TYCA 1TVLA 2WZIA 3PZTA 3NXFA 5EY5A 4YVVA 1BKSA 3BGAA 4GNJA 5ABFB 1K6WA 3B8IA 3FA4A 2BMBA 4Y9PA 4GC3A 3T2PA 1TJ1A 3VNKA 4NUWA 4NJGA 3PC0A 4ROQA 2WMIA 2WJEA 4M6VA 3HFTA 4GBDA 5CAHA 2O7QA 1ZJBA 3VD9A 2R94A 4Q4OA 1H0IA 3WNLA 4WHBA 4DJED 4JHMA 3WH5A 3S2NA 3WFAA 4HU0A 3DG7A 1XGEA 3PJWA 2QCNA 4C90A 1XBVA 2PE4A 1UR8A 3E0WA 4H83A 1CB2A 3H24A 2YW4A 3W7EA 1D3CA 5C9XA 1E6NA 1I2PA 4P7RA 4GVIA 3HN3A 2J8FA 4WY0B 4LALA 3WJYA 3QF0A 1TIMA 3N4FA 4LF1A 3SM0A 1MW3A 3OA5A 3EB2A 2O9OA 3DN5A 2AMGA 1DIEA 2WJZA 3NJ3A 2ZZ6A 3UR7A 3BAYA 4F79A 3MSRA 4XAFA 3GHUA 1OCNA 1PB0A 5A8MA 3W76A 2DY3A 1Q7MA 2CC0A 2UBPC 2ISFA 4EP8C 1DJGA 1OY0A 3KE0A 1JZ5A 3AIWA 3SBFA 5EYWA 2Q8XA 3DUGA 1TV2A 3MBDA 1VBGA 3VIGA 4HPGA 1UKOA 4PSPA 3FVDA 4OE7A 4CNNA 4GPNA 3CPGA 3R79A 2V9DA 4GG9A 1YX1A 3WYZA 1JJKA 3H26A 3BH4A 3EA2A 5D30A 3GW0A 1WBHA 4PUNA 1IT7A 3TZNA 4WKFA 5T9BG 5JUVA 3M0KA 2YFOA 2OTDA 5DELA 1G9HA 1W3IA 1SU5A 2DP3A 3T07A 3PB2A 4S3BA 4INFA 1EQPA 2X0SA 1A0DA 1DQXA 3ZMRA 4GCXA 2AL2B 1AQ0A 5JIPA 3MP3A 2VEMA 3WQCA 4P8XA 4LUSB 3W38A 2NXGA 3G1VA 1JR1A 2ZKMX 4HIBA 3C2OA 1Z44A 2R82A 3RDKA 1UHVA 4C1NB 2VELA 3NDYA 4ADUA 4R3UA 3NL2A 1MXDA 4AG0A 1XDMA 4ZR8A 4JHZA 4UTKA 1AJ0A 3ZVHB 2CXGA 1H51A 4JQ1A 5A6AA 4CD7A 3S46A 3AMCA 3KRBA 2QUUA 1KD0A 3QVQA 2ZX5A 4O12A 3TVAA 2DT0A 1K4GA 1HJUA 4KFNA 3WLTA 4Q7IA 4J5NA 3DFSA 2P1FA 4GQ0A 3VM7A 5I3KA 5HULA 5D9MA 2YKKA 2JGQA 4N9DA 2C18A 1NIUA 5DQPA 3WDHA 4KEMA 4LYKA 1AVAA 4HPNA 5J5DA 5M2FX 3PZUA 1F07A 1CGXA 4GZIA 4FSAA 1K8CA 4QGCA 2PWFA 3URAA 5K7JA 3GDTA 1IGSA 1W9UA 3NNTA 4K1GA 2FGLA 3BO9A 1S3HA 3BXWA 4Y9MA 4A3RA 2LLEA 3L4UA 4MNJA 1KM1A 2NQZA 3DU0A 4WSKA 1M53A 4JTCA 4AY7A 3DDMA 3QPEA 3E74A 2NX3A 5A69A 3W53A 4DBDA 1XD0A 3QPZA 3VZXA 3S42A 3AYRA 1RK5A 3C56A 4IIEA 5GPRA 5A3HA 3LMYA 4ASTA 3WJWA 1OBAA 4Q6JA 3COTA 4MADA 2RGMA 2PLKA 3WD2A 1YRRA 2C15A 1ECEA 3WLRA 4PEEA 4ZQCA 2RDUA 4MZYA 4CN6A 2IPJA 2GGJA 2XG9A 3EX1A 2HV5A 5M5DA 4MUPA 3AWNA 2BV9A 1QW7A 3VMOA 4A35A 2J8TA 3QLLA 2C13A 3IIXA 3GIQA 1ENUA 1IXOA 3N1AA 4KCTA 5D05A 3KVMA 2VOMA 1RQEA 5LNRA 1VYPX 3RK8A 2V6AA 3SUVA 2WHJA 2XPKA 4QBXA 1HO4A 3P74A 4RK8A 3VDAA 1NDZA 4Y8EA 3SB0A 5D09A 3NQMA 1G94A 2Y7DA 4F2TA 3AUOA 3M0VA 3C2RA 4UMCA 2CLLA 1DHKA 4H9TA 3CTTA 4JL2A 2PS2A 2EHHA 3VE9A 1E0UA 3E49A 3GY1A 3UYIA 3WD4A 4WOZA 1T8XA 3RLUA 1ZBCA 3QFWA 4M7TA 3LB0A 4YTTA 3E6EA 1VBUA 1FHVA 3PZGA 5EMMA 3R0KA 4FS9A 3IIVA 2P0OA 1TR1A 2E6AA 3CQJA 3NQGA 5F7UA 4V1XA 1THFD 3FSUA 5CZTA 1PEZA 3F7JA 1OGGA 2Z1KA 1P1MA 3ARUA 3TN3A 4B9YA 1E1CB 2WQDA 3CMFA 3LHYA 1XR2A 1E51A 3TH6A 1ISYA 2BOEX 2VJXA 3PHAA 2J24A 4LYQA 1SZNA 4MSSA 3MYPA 4X2RA 3BGGA 1AL8A 1PE1A 3PSWA 3LCGA 4OUEA 1DWFM 2W61A 4IQEA 3W22A 4WEVX 1JUBA 3WKZA 4Y90A 4CEXC 3PFRA 5I3JA 4RZ4A 2NV1A 3FOKA 3GTFA 1JULA 5U4NA 5FESA 4O1AA 3IUHA 1TB3A 3TYUA 3XINA 1ODZA 4AIBA 2ABAA 3W7DA 2OYMA 4ML9A 3WQWA 1HN1A 3TYAA 4DF1A 1Z48A 4JBRA 3QHNA 4HNCA 3VILA 1DKWA 3OLIA 1EJWC 3NQ2A 8A3HA 3OQ8A 1QFEA 4P8UA 5BXTA 4IOTA 3OLGA 1F3WA 5A94A 4YJ5A 2F6KA 1O1ZA 1Z9AA 3DC8A 4JX5A 5DCDA 1HO1A 1NF0A 1XRTA 1XYZA 2BGQA 4WSJA 3VCCA 4LS2A 1J8VA 4GMEA 2X1IA 3CASA 1HGYA 4QLLA 2OEJA 2FFCA 1KXQA 3KOYA 3B0UX 3S1XA 2J62A 4C5ZA 1OYBA 3WIJA 1R3RA 3VGGA 2OOFA 3BSMA 3MU7A 1DIOA 1DJYA 2H8XA 4DF0A 3C3UA 2VZUA 5GJNA 2DV0A 3VIIA 3HM7A 4UNIA 2V2CA 3IGHX 2GWNA 4CNPA 3G1RA 5C7HA 1IE7C 4JZ5A 2I5GA 1LRTA 3AS3A 4EPEC 3W7MA 3TLQA 2GFTA 1GG0A 1LL6A 4FOKA 2ESCA 4IG2B 1K03A 2YBUA 4I5RA 4UTIA 1A5SA 2CWXA 3MW7A 5LA0A 4P7NA 1TPFA 2ADAA 2GVLA 3P61A 1CGWA 3GHTA 5C7VA 1JZ2A 4ES4A 2QZRA 3S9YA 3T2QA 2I9UA 2BFGA 5CLTA 3IS4A 5K9CA 4UNLA 3WLIA 5KZ6A 1W3TA 1ZAHA 1JYXA 3KOXA 5TQLA 4L9XA 2Z1WA 1RBOB 1BGGA 4LC8A 1PDYA 3LCIA 4HMNA 3P67A 2YW3A 4K8EA 1XBZA 4ZB5A 4LBUA 3OHMB 1S5WA 1DQWA 4U31A 5BNKA 1A0EA 4FIRA 4GE8A 2YL6A 5DXXA 2Z6IA 3NPWA 2EPHA 3UVAA 4A05A 4QJ5B 4JTJA 2IS7A 1TWWA 3NZRA 1I9CB 5DT7A 4M6QA 3RCYA 3WLJA 5H6HA 4FR6A 5D9NA 1H49A 2Y8KA 4B91A 3SUSA 3N9KA 5I24A 3LPGA 3Q37A 1SZFA 3GG7A 1FH9A 4K36A 3BG5A 4DO4A 2WYSA 4DZ5A 1REQB 2PURA 4IMFA 5FI8A 2G97A 3PSVA 1ZENA 2HS8A 4FA3A 3U7BA 3UXAA 4KQNA 3SUWA 4NILA 4FF5A 2VFDA 2ZVIA 5FKYA 3ME3A 1XSJA 1R0MA 4WIWA 2VUNA 3KX6A 2PDIA 1MUMA 2BWGA 1UH3A 2YZRA 4H2CA 1BWVA 1VCFA 3E12A 1P0DA 4ZE4A 1Q6GA 1F3EA 3ABXA 2FDMA 2NX1A 1TZ9A 2XM1A 3PNZA 3KAOA 2YCJA 2R8WA 4W93A 5A6LA 1B4EA 3REQA 1QI4A 3PTDA 4OBSA 4W88A 2VENA 3CHDA 4QIUA 1XDJA 1JNEA 4TX9A 1UWAA 3B4YA 3B8WA 5H1WA 3TW6A 2AGKA 3CEPA 3Q2DA 3UR5A 3WK0A 3T08A 2YL5A 3QV8A 1L6FA 4PFMA 2I5IA 2Q8ZA 2XH7A 1E6ZA 3GS6A 3CH9A 5EPDA 4JTUA 3WNNA 1OD0A 4QSHA 3CZJA 1W9PA 4D6FA 1CWYA 3CAVA 2ZE3A 4JN7A 4XIMA 2YDSA 2VURA 1WDPA 4KESA 3UG8A 4XBKA 2RAGA 1TO3A 1LWJA 2NQJA 3LHZA 4LUYA 1IXPA 3DHPA 3NSXA 1HKWA 4AEOA 2QR6A 1Q6CA 3SFKA 1FKXA 4HHHA 1R9ZA 2PF0A 4BF5A 1CECA 1MEIA 3B9OA 2CW6A 1U1UA 4KRUA 3UWVA 1O5XA 2B7NA 1QO5A 2A21A 5AHIA 5LYRA 4BQ3A 4EAMA 2BHUA 1QUMA 1BRLA 5AC7A 2Z29A 1GVYA 3JU2A 1D3GA 2EKGA 3NSMA 1XD1A 2OZ8A 5FSDC 4KRTA 2C6QA 4M7SA 3R8GA 2OGYA 2X0YA 1XRFA 1EYEA 1UD6A 1Q6EA 2RDTA 2ALDA 3IJIA 1F5ZA 1Q13A 2FQIA 2CHOA 5FCZA 1H3GA 3C8NA 3AS2A 5CBBA 4MG4A 5IFTA 2YXXA 2OJPA 2ZWZA 2BOFX 1KR0A 1EBGA 8CGTA 4GQGA 1GNXA 1UW9A 5I3HA 2DPEA 1N55A 1SSGA 2CLHA 1MDLA 1VJSA 3WDQA 2Z28A 3F5KA 4PB5A 4AB4A 5I07A 4KCWA 2XFRA 1ZJIA 5D33A 3FJNA 3ITGA 3S4TA 1L2UA 3CXOA 2HZGA 3HG4A 4JCLA 4A6GA 3W00A 3CH0A 4XG1A 1I6NA 3RR1A 1TMHA 4OJYA 4N9CA 3GUWA 1TPUA 3OGRA 3N3MA 5FAJA 1KBKA 4GOAA 4XAYA 3WQGA 3AIUA 3AIVA 4DO6A 1D8WA 1LL4A 3CHVA 3RO8A 4JNZA 3BGJA 3ZYZA 3QR1A 2PLCA 3LMZA 1OFBA 1FCBA 1MZHA 3GTHA 3ARXA 5C9WA 4UMBA 1EUAA 1W1A1 4S3JA 1H50A 4HCHA 3CEUA 1CXLA 2H8ZA 3FGCB 4DUVA 4NG3A 3KRUA 1XSKA 2RUSA 3AIEA 3EXSA 3S1UA 3TQPA 4TMBA 1Q4WA 1LLOA 4JAWA 3M7SA 3ARTA 3E0IA 2VD9A 1L6GA 3GTIA 3GFZA 4AX7A 4RDVA 1M68A 1OFRA 4DYJA 2EPNA 1RLCL 1C8XA 2WVUA 5K9XA 4AC7C 2TMDA 4G7FA 5AECA 4QG6A 4R7WA 3BLOA 8XIMA 1PZ3A 2A3CA 2E28A 4LOCA 1H63A 3QN3A 3OLEA 4YWIA 3UZZA 4DM1A 1JQVA 3G1XA 1QHOA 4CCDA 3WQ5A 1OGBA 4IGMA 3T0DA 2XZ9A 3CZEA 4JKKA 4D72A 1XGZA 4W8AA 3QC3A 3TTSA 1D7FA 3BLIA 1W5QA 3W29A 5BW6A 1XIGA 3GKAA 2V5LA 1FWHC 3LTPA 3XISA 2ZXBA 2WZEA 2DSUA 1OIMA 4Q4PA 5EL1A 5FEZA 5CAKA 1XKYA 1UROA 3K4WA 2ZFAA 2ZC1A 1Y0EA 3AXMA 1P6CA 5HNNA 5A2AA 4LFYA 2HPIA 1OIFA 3AZTA 3QXBA 1VEOA 4XBSA 2O9RA 1A5BA 1EZ2A 4WDWA 2MANA 5B80A 4WJXA 4H9UA 4HA3A 3NR0A 4NZ1A 1A50A 3EWDA 4GLEA 1DHPA 5FJRA 3WMLA 4PTNA 3PF3A 5F4SA 3O8AA 4J3TA 4XD4A 2HTMA 4EOUA 2E67A 4R9OA 2OQYA 3MKKA 5BWAA 1EA9C 3JVAA 4UTJA 4HSHA 1PJ9A 1JXKA 2PCEA 3A9IA 1TJ2A 4WY0A 3PAOA 4N4QA 3N15A 1H7OA 1HJWA 4KS0A 2I7GA 5IHRA 2ZIDA 2DFAA 3FEQA 4LAMA 1BFNA 4JTKA 4A29A 2G96A 2UY3A 3RRAA 4GRSA 1I60A 4RXFA 3MO4A 5HR7A 4O4WA 4DBWA 1UB3A 6XIAA 3F4VA 2A5HA 2O56A 3QMRA 1UKSA 3DGBA 2VDGA 3RHGA 3QW3A 4IMGA 3VIFA 1EO7A 4HPXA 2ZRVA 4IL0A 2VEGA 1R3YA 3VZYA 4BEQA 2VR4A 4GH3A 3SCUA 3E0VA 3ZVIA 3TN4A 3O7UA 3OYZA 3LPPA 4A21A 2X05A 4K1WA 1W3KA 4L56A 1OX4B 1MQQA 3MUCA 3W7QA 3AMKA 2PGEA 3G6MA 3U4FA 3LM3A 3RPDA 3T05A 3QY6A 2FJUB 4U2ZA 5LSMA 2BB0A 3A4AA 4Q7NA 2AL2A 1LRNA 4LUSA 1B3VA 2J7GA 4J1OA 2IKJA 1XLIA 2BG5A 3EX2A 1XLKA 1X1OA 3D3FA 1RP8A 1XRVA 5D38A 2INFA 3NL5A 4AIUA 1EGZA 1AD4A 1Q6DA 4Q4RA 4UZSA 1XYAA 4P7LA 3LOTA 1TV3A 1UKTA 1A3HA 2CZFA 3T6CA 5CBJA 3DI0A 4O57A 4PTXA 4WDUA 2VEFA 2NQ5A 2GGGA 4B3ZA 2A3BA 1YQ2A 4HOZA 1FTXA 3C2VA 1VENA 3S2LA 2AQOA 4TTUA 4IT1A 3TMQA 3LEPA 3HURA 3W7GA 1T6MA 1ZP4A 1NARA 2O4MA 3KWSA 5I3IA 2VFEA 4M82A 1UWSA 3HBLA 3ABQA 4BA0A 2XYLA 3VOFA 1ONRA 4MB5A 3DHDA 2Y0FA 2XVNA 2D0GA 3VZZA 3P0WA 2VGIA 1A0CA 3DYOA 4GYPC 1JVNA 2OEMA 4YHEA 3LG3A 3VKBA 5A8QA 1RBAA 5T9CE 1Q6FA 1VH7A 4ACZA 2P53A 5TIMA 4C60A 5BU6A 1DE6A 1L8NA 4GUHA 3T55A 2QVHA 3QGAC 1XINA 3LTSA 3KEHA 2A2IA 4NL1A 2V5KA 1IXQA 2VT0A 1MFVA 4G9PA 1ZJAA 1EO5A 2PI6A 2V67A 5E0FA 3AIBA 5D03A 3BW2A 1XUUA 4JDBA 1AH3A 3B05A 4IUGA 1X98A 5LIYX 4FLSA 4WDXA 1NP2A 3ZM8A 5HJYA 2VQTA 2VZVA 1OQFA 3QZEA 3W1TA 3DKJA 1FH7A 2PP3A 1XJBA 3PUDA 2J7CA 1IEIA 3MVTA 4D6JA 2F84A 2C16A 3GNPA 2CLEA 5AC5A 1ADSA 3M0HA 3WH6A 2NXIA 2GPTA 1R2TA 3HO8A 3ZQ9A 4RNJA 1H2JA 1KW1A 3SJ3A 2P88A 3NZPA 1WCGA 1Q2RA 1OGSA 1YNPA 3HQ1A 3VX1A 3QJAA 4XUYA 4Z1DA 5CBIA 1H1NA 1KFCA 3ZJ7A 1TFVA 4YTSA 4JQ3A 1L0PA 3SRHA 2EEXA 2R6OA 2WSYA 3LPFA 4O4VA 3UCCA 4CQDA 1EJUC 4J3SA 1UH2A 2IPGA 1UD8A 2NWSA 1SJBA 4QHRA 3KVLA 4GYKA 2OOGA 1VHCA 3NWRA 4HZMA 3S5YA 1HKKA 4P7OA 2WZHA 2Y70A 2YCLB 4D71A 3OLDA 3KW3A 3TDFA 4PMVA 4JDYA 3E0LA 3ES7A 4LXFA 2BXZA 3U5UA 2E3ZA 1H1ZA 3GX9A 4UTTA 4HMDA 4I6KA 2Y85A 3HG2A 2DSVA 3U7VA 2BLEA 2VKZG 3VK5A 4K2SA 2YB1A 3DC0A 3GFXA 3NQ8A 1YDNA 3TTYA 1UASA 1KA9F 3N14A 4DJFD 4DYKA 4NAFA 4MM1A 4GJIA 3AU2A 1TCDA 3P8IA 1FH8A 4M1BA 2Z7GA 3AYSA 3USBA 4NSBA 3THQA 1R30A 1NFGA 5AYIA 3PUEA 4XQ6A 3W71A 7TAAA 3ITXA 1LT8A 2XN1A 1M9HA 4F3HA 2Q09A 5D2VA 1SO6A 1RLDA 1RSCA 2UV8G 2ZZ5A 3TOYA 2Z00A 2OXNA 3FJLA 3L68A 1XYMA 3R94A 3D46A 4AEFA 1ONXA 3V0SA 3G1DA 1B90A 1W6TA 5DLCA 3PN8A 2ATMA 4GH1A 4MNLA 4LAKA 3WNMA 4P8WA 2UY2A 4GXPA 2VUYA 4N42A 5DMYA 4FB7A 3TAOA 1PKYA 4MGGA 4LT9A 4EVZA 3MMDA 3SQMA 3VPLA 5EMUA 3H4WA 3IK2A 5I06A 3HQPA 3ABOA 3K2GA 3AS0A 3LUTA 4Q8PA 4I90A 4IG2A 4AD4A 1PXGA 3VMNA 1JCTA 3E9AA 4BFAA 4TR9A 4LUTB 1J12A 3RN6A 4HU3A 1RR2A 1O94A 1V6UA 2IKHA 5AYYA 1GOIA 5CPTA 5CSUA 1MEHA 4DWDA 1T96A 4ATDA 1BG4A 3P84A 3L4TA 3GNNA 4JXCA 1JAEA 4ICMA 4AHOA 5XIMA 1TQXA 5D8ZA 1TR9A 3G1FA 5LNVA 3G1HA 1VPYA 4NJIA 4ERIA 1CTNA 3AJXA 3GC5A 2CLPA 5AC4A 5D2XA 4AYGA 2QPUA 2J66A 3V0TA 3AXHA 1JI1A 3IVUA 2J7HA 5LIUX 1F8MA 3BAXA 3WLLA 2IUZA 5CJ5A 3N3TA 1AW2A 3LNPA 4IIFA 2J78A 1OCQA 5JU6A 2GLKA 1B9ZA 3M44A 3WBEA 2ISSA 1TVPA 4LCRA 3WDIA 5AYZA 4HK5A 1DVJA 1G1YA 5HWJA 5C8BB 4S3FA 4BZYA 1VIWA 1GTEA 1QVBA 3BTNA 2FGBA 3M07A 5A6BA 3KS6A 1X1NA 4UNKA 6CGTA 3P7YA 2CYGA 3T4WA 2Q02A 3EA3A 1XLCA 2OEKA 5A6TC 2YOCA 3ZJ8A 1QMLA 2ZBTA 2XFWA 5KTLA 1NVMA 1BWLA 4XD6A 3WJXA 1VLIA 3ELFA 1UD3A 3G1YA 3NQDA 5E9AA 2PLMA 3WQPA 4NI3A 5FA5A 2X2YA 3RRXA 3OVGA 4FHAA 3KFTA 3TCEA 1HGWA 3THUA 1VHNA 2WBGA 2DT1A 2P8CA 3EKLA 1P48A 1QOXA 3HV8A 3CQIA 4W5ZA 4WGXA 3N2MA 1J18A 4QM1A 4Z1BA 4MWAE 3AS1A 1TG7A 1ADOA 4IWWA 4X63A 4YCOA 3FX4A 1U2YA 4PB3A 2J47A 5K2ZA 3OGVA 5T91A 4XZMX 1S5TA 4ERAA 2D0HA 1I2NA 2OZTA 2OYLA 1KB3A 4IM4A 4H6EA 1R5YA 1XIMA 3AUJA 1XIFA 1RALA 1EC7A 1WB0A 2HNHA 3LDVA 2QCFA 3EX6A 4DF2A 2AKMA 3UJFA 5CSRA 3S9ZA 1KRBC 3EB3A 4JNYA 4CU6A 1VBRA 4UB9A 3UF9A 4ZENA 1FRBA 3C2YA 2VQUA 3AI0A 2J77A 2E1DA 1DV7A 2DH3A 7REQB 5FEXA 1S2AA 3WCZA 1E6XM 3ENLA 3SCRA 3RIKA 1LOSA 3GB6A 2VZTA 3JZEA 5AVNA 1K3UA 4V33A 4DX3A 3R7MA 1KFKA 5M17A 1XLAA 3N34A 3C0SA 3B03A 4IIHA 3I7SA 2DEPA 1CB7B 4AZCB 4R5EA 3M41A 3B06A 4RE3A 1LDCA 3VGFA 4O1FA 1P6WA 5IFPA 4L80A 2YZ5A 4H9ZA 1HFBA 5DBUA 3SO7A 3NO1A 3GYEA 1BLIA 3W82A 5GNZA 1SJAA 4MTVA 1ICQA 1KXTA 3MZNA 4EPBC 1HKMA 4IJRA 1JCLA 3LLFA 4U10A 4NX5A 1V51A 2WCGA 4S3DA 4AWEA 2VGBA 3R8HA 3TNBA 1HUVA 4QSFA 3W23A 3LQGA 5H91A 3TAKA 2H6RA 2VC6A 4JEQA 3GXIA 3SCTA 1CXFA 3H2AA 5JH1A 4US5A 3PZQA 1JFHA 2C1HA 4AZHA 3VKJA 4PMYA 3OBEA 3OA3A 3G18A 4ADSA 1ZBVA 1V6TA 2C3ZA 4YTRA 3N2XA 2WW5A 2PDNA 2ZX6A 2QDEA 3M6DA 4GVHA 1J2WA 1EPXA 3SIZA 2XN2A 5EBUA 2G3IA 3VOGA 1TPDA 2VWTA 3K1GA 4MB3A 2NVAA 3M9YA 3BSGA 2W63A 3SI9A 5BOOA 3FFSA 4J7RA 3SY5A 5FEPA 1UZDA 2XHYA 4RPPA 3PZNA 1GOMA 3H7VA 1RY0A 3F03K 5FF2A 2VRJA 4B5XA 4NYYA 4HT3A 2FB3A 2X09A 3LYEA 5HWMA 4H19A 4DJDA 5BYWA 1UIOA 1UWRA 2FB2A 3JZUA 4KEUA 1TIWA 1YLVA 1TWSA 3F2BA 1E9LA 1G01A 1Q45A 4GKLA 4D8AA 2PC8A 2E68A 3S1GA 3AJ7A 4EF9A 2HNEA 1EIBA 4UCGA 3ZT5A 1IV8A 4GVFA 3OZOA 1JZ4A 3PS7A 1N82A 3MKCA 1WDQA 3U6WA 4BS0A 4FP1A 3HJZA 1EF3A 2A7PA 4QFUA 4GA8A 1Q3NA 2E8YA 4QE4A 1S39A 1TV5A 1MW2A 2B31A 3ALFA 3LBOA 2NLIA 3PJTA 3ZLGA 3PBUA 3SJNA 2X8RA 1MWOA 5E6YA 5AHNA 4J3UA 3QTPA 4XKMA 1A47A 4XISA 3KHJA 3OTRA 4F0KA 1UWQA 1UUMA 1US2A 1JYNA 2HMCA 1R86A 3PFMA 4MY9A 3P60A 1E3XA 1XUZA 4PA8A 3B40A 3AXKA 3LCFA 3DX5A 2DGAA 4C6IA 1SJCA 1KM2A 4DVOA 1EP1A 1HP5A 5T26A 1F3TA 1B2YA 3ARSA 5AB3A 3HOJA 3KOFA 1UP0A 1GW1A 4WJ8A 2PDKA 1TMQA 1KKRA 5KINA 1LYXA 1UZHA 3Q67A 2ACSA 3U2ZA 1ESWA 4DYEA 3SGZA 3VKCA 4GNKB 1A5AA 1G5AA 4E8CA 1R47A 2PWHA 3PG8A 3EOSA 4IQJA 2I14A 1XLMA 4HNLA 4ZZ9A 1LT7A 2VX6A 4PYSA 4PE8A 4XO6A 3V1HA 1QI3A 4DWSA 2Y2WA 3LZ5A 1A5OC 4Z1YA 4AIEA 1DXEA 3L2LA 4DM2A 1U5JA 3NL3A 3EX4A 3KVJA 1YXCA 4Q4QA 4IMAA 2XM2A 4GXMA 1XLJA 4RDZA 2OQLA 3NEHA 1ZPTA 3O07A 2PP0A 3ARZA 4M19A 2V2DA 2VGGA 1BEUA 5GJMA 5TAOA 1XSIA 3TYEA 4NZFA 1QI2A 1JDCA 4C6PA 1J2BA 3WQ4A 1XLHA 3IK4A 4FNRA 2F7FA 4H8NA 3WBWA 2AL1A 4QXIA 3S5SA 1BXCA 1H7PA 5C2CA 2C71A 4US5D 4DAFA 3UJSA 4FAMA 3KHDA 4A2RA 1V3HA 4Z2GA 3T44A 1UKQA 1E72M 1RHCA 2Y7EA 2BHZA 3N2CA 3VINA 1HJSA 2PDQA 1W1VA 3LZ3A 2GSHA 3QZAA 3W83A 3BOXA 1EIXA 4GX8A 4HU4A 4JICA 1WXYA 3R2GA 3C0QA 3ITOA 1QNOA 1XYLA 2OFJA 3ATZA 3K4AA 2UZ9A 5TNVA 3M7WA 1W1TA 4PBEA 4OOUA 4IZGA 4CQ9A 2CKSA 3P3BA 3H53A 3OODA 6A3HA 3U0HA 3S3GA 3CZGA 1TYGA 3FEMA 5IOBA 4IIDA 1PCKA 1J0YA 4L1XA 1TELA 4Q4KA 1A5CA 1GEHA 4MMWA 1FWRA 3UPWA 1KFWA 2Y7GA 4NP7A 3QBUA 2JKPA 1JG9A 4E38A 4N9BA 4UFKA 3WNPA 4LEQA 1SW7A 4WQ6A 3MBFA 2PA6A 4QX4A 1JDAA 2MNRA 3BWWA 3AXXA 4CLMA 1W2VA 4E0CA 4WXYA 2ACUA 3SIMA 1L9WA 2PWDA 3FYPA 3C3NA 4MY1A 4LEFA 3CS2A 3M0LA 2X7VA 5CZJA 1SYTA 4Z2JA 3I6RA 1AJZA 1XKJA 3F4DA 1GHSA 2Z2AA 1V6VA 2V5CA 3BPWA 1VAHA 4S23A 2VTFA 1JCJA 4YN5A 4DZAA 5DEZA 2RH9A 3WLKX 1W3NA 2XGZA 3B04A 4Q8OA 1K77A 3VKKA 5AHFA 5C0QA 5JBEA 5G2IA 4ZQPA 1K70A 3G8EA 2WJFA 3DFPA 3GM8A 4H2HA 5JMUA 3J7HA 3W1RA 3BCJA 4HJWA 1UG6A 1UMLA 1IIHA 4M51A 3LQLA 3I65A 1XL9A 1ZAJA 4UOQA 4KWWA 3W7LA 2E40A 4XSLA 1OFPA 4FO4A 4MFEA 2MUCA 5FJIA 3O1NA 1AG1O 3O2LA 5GJPA 1A3XA 1TV4A 3UY8A 3L4YA 4NYUA 1C91A 3DERA 3M5VA 3DG6A 3MV11 4BKNA 4XWUA 1LROA 3U2CA 4X60A 3S5ZA 4LBRA 4XZWA 2WNQA 4JHOA 1E0TA 2YGYA 4S3KA 2YLAA 1TPEA 1XI3A 3UWUA 4CN4A 3LNMA 3SUUA 3BLKA 3GR8A 3S8HA 1YE6A 3IIOA 1NQ6A 3U8GA 1VB9A 4O15A 1QAPA 1XIJA 2B7QA 5LKYA 2CEQA 1EJVC 3TK7A 1OWQA 2NVCA 3B9NA 4E6MA 5F2GA 3BLLA 4LAZA 2FVKA 1RJRA 4N02A 4DWSD 3WF0A 1SO4A 3SRKA 1HL2A 3QV9A 4KCUA 3RU6A 1P0EA 3R5EA 3EWZA 2CLFA 3B8SA 3QYQA 5EMLA 3RYSA 1D2KA 4U4MA 4MFDA 2QUVA 1TZZA 5A1AA 2YCIX 3O0KA 3R10A 3G0XA 1KWGA 3CK5A 3GHRA 5I23A 1UPMB 4ACYA 3KOZA 4IPNB 1V5XA 2O9PA 3PWGA 3V5CA 1UPPA 3GNOA 3V5OA 5D4YA 1FHUA 2AAAA 1EKOA 1P0BA 1EOKA 4B2DA 2GVYA 1R8LA 2R24A 4RJEA 3L67A 1W8SA 4CNTA 1OG6A 1E0VA 4C6CA 4Y9AA 2VMFA 4IP7A 1RK6A 4J9JA 9RUBA 3VFLA 3FLUA 2RJGA 4IL2A 1N2VA 3EDJA 3GDMA 8RUCA 3IWPA 1BKHA 1JCNA 1FCVA 5CZSA 4Q32A 4UFIA 2QCMA 2NXHA 2ZUTA 4Q4MA 4MOZA 3STGA 1O5QA 1ZQ5A 3QR3A 3FJ4A 4DJDC 3D5HA 2WXDM 3W6MA 1ZCCA 2WNZA 4S39A 5D2TA 2QDGA 2H3BA 2NT1A 5DMLA 5FL1A 4BF9A 3L4WA 1V4YA 1PKNA 4HCDA 3LLXA 3LRMA 4UFHA 5BXRA 3E1F1 4U3AA 1P7TA 2J74A 1FWAC 1EYWA 4S3AA 2FZNA 3M16A 2DT2A 2WMFA 1QOQA 1RH9A 2FIQA 3FS2A 4HJFA 2GZXA 5E6ZA 5I2UA 2D3NA 4KFPA 3AMGA 4Q33A 2OT1A 5M3WA 1V93A 4ALDA 5GQBA 2JBMA 4KGLA 3LXAA 2QUMA 3LBMA 1EFZA 1YBQB 2QJJA 1QHPA 4TVCA 1YADA 3TA6A 1RQHA 2POZA 1IZJA 4EWND 1K6AA 2XIOA 1BTCA 3M0MA 1YDVA 4NI8A 2F2KA 3TTEA 1QK0A 1E4MM 5E93A 4ICNA 1QPOA 3NQFA 1VEMA 4LUTA 2OODA 2GUUA 1FA2A 2XIQA 2FTWA 3TLLA 1T99A 1W32A 5HK4A 1JUEA 1TWZA 2XVGA 1T0OA 1XH1A 2X16A 4JNMA 4HVXA 1QCWA 1NWUA 1W31A 4IQDA 4F9DA 4O13A 2EG6A 4O0KA 5CSSA 1IEWA 2CPUA 4HPHA 1GVFA 4GX9A 2PD9A 4X3ZA 1GOOA 1PKMA 4CVUA 5C2XA 1GGOA 4QNWA 4YXGA 1XIEA 3W74A 2D24A 2Z1VA 3IANA 4JTIA 4YMZA 1XH2A 4LF2A 1LWHA 1J5TA 1SPQA 1TJRA 3VC5A 4E4PA 2HBXA 5CZ0A 1N7KA 3QV7A 5DO8A 4LV4A 1QOPA 4D6IA 2XIMA 3TSMA 3CUZA 4POCA 4RCXA 1AUSL 4HNTA 4DXVA 2VR5A 1GJUA 4C7FA 4PBFA 3DEQA 4D6EA 4TMCA 3QEZA 1VJIA 4NZ5A 1SM9A 1ZNNA 4YL2A 2NVDA 2PCQA 4NJHA 1XX1A 3IAPA 4MWAB 2FPTA 3SQLA 3I7RA 2QV4A 1BQCA 3U2EA 1QPRA 2OKOA 3BOLA 3EWXA 5FJPA 4LCSA 3TN6A 1OFEA 5J5RA 2Y8VA 3W27A 2XIBA 2E4TA 2C79A 2A3AA 4DZIA 1BQGA 1AD1A 4JX4A 1WZKA 1MNSA 1S1RA 2CZDA 1NTHA 5EMYA 4WKHA 2BY0A 4PCSA 1MEWA 4AAJA 3H7UA 1SO5A 4O0QA 4FOJA 3L2IA 1OFAA 3S5NA 1HZYA 3WH8A 1DWGM 3R0UA 3IV8A 1SZEA 3VUSA 3TUUA 2Z2UA 3P93A 1EGMA 1VIZA 4W86A 4XVEA 4B2DD 3W1UA 4J27A 5HJLA 3N13A 1MZRA 4A3HA 4O52A 3QGVA 1ZFJA 1JD7A 3W0KA 3A4XA 1BGAA 3CL6A 4K39A 3G6LA 1JPIA 2QF7A 3VOHA 4M5PA 1QW8A 1BG9A 4FI4A 1EQCA 3W72A 3V7PA 3VGEA 4O50A 4EAYA 1GT8A 2OO0A 4YWSA 3FXGA 3PBWA 1QI5A 4BK9A 4F8XA 3CHFA 4RUBA 1MUWA 1EBHA 3W2JA 4KEZA 1S5VA 2DT3A 3WZ0E 3LSCA 3TC7A 5AHMA 4K8GA 4OQVA 3T42A 2HJPA 2KAUC 5HPOA 3WD3A 3ZIZA 4G1KA 5EA9A 1DJQA 3URQA 4JQ4A 4QE1A 1O5RA 1ALDA 3U4AA 4FPSA 3QHOA 4HZ6A 3A47A 3WNKA 2B0MA 3H2EA 2B7OA 2OSXA 3CTLA 5E1QA 2RFGA 3O6CA 1V3KA 3RX2A 1GONA 3QPYA 2O55A 2PDBA 2WOQA 3MMUA 5A6SA 2PEVA 3A3XA 3GVRA 5HR6A 5G4EA 1CNVA 3GU9A 3B4UA 5AC6A 3WDPP 1Q5MA 1EUNA 4E2OA 1MQPA 3V35A 3S9IA 4XKYB 1HW6A 2J4GA 3R11A 3LHVA 4IUOA 3LERA 4XD3A 1WPCA 3BLDA 1GVIA 4RNFA 2QS8A 1PWMA 3DCPA 4NNAA 3P81A 2ZE0A 2VX4A 1ZY9A 2CCRA 1S38A 1Q63A 4WD0A 1FWNA 4LJ3A 1K9DA 4DB7A 3ITLA 1QPNA 1D9EA 4UQ9A 1H4PA 3S6TA 1MNZA 4FLOA 2EG7A 1XPYA 3KL3A 1KFBA 2C14A 4CEUC 1I1WA 1RCXB 1ZZMA 2ZADA 3MCNA 1BPLB 4O1EA 3R43A 3ISIX 5HMFA 1XBXA 1LZOA 4Q6XA 1R2RA 2OZ3A 3PUOA 4X0VA 3W75A 3MWAA 4ZODA 4FOUA 1AW1A 2JKAA 1K4HA 5I79A 2VYOA 4HPJA 1OADA 2QCGA 1YKWA 3GRIA 4AWTA 4Q8VA 2BZNA 2X1TA 3T09A 2YXOA 4O8RA 4AWUA 1Q4NX 4RLIA 2EGZA 2GJRA 4EPKA 1KBIA 4FXFA 4E5TA 3H70A 1HTIA 2NT0A 5BRBA 1H7RA 4H6KA 2QGHA 1PBGA 5A5WA 1CDGA 1UR2A 1K8XA 4JN6A 3NYZA 3AYTA 4CCZA 1QR7A 3NUKA 2P3ZA 4GQQA 1W1IE 1W1YA 4HN4A 3TQVA 1GOWA 3C2FA 4PL2A 1DJHA 3C0LA 3CUJA 3ZOAA 4S1FA 4UQBA 1UA7A 4WLCA 3QY7A 1JGIA 2B4GA 4CQ8A 1E4LA 2PDPA 3SAZA 4L1GA 4L5ZA 1TJPA 4PR4A 9XIAA 3W01A 7PTDA 3CJPA 5F4WA 1SMAA 4PEKA 5DANA 3BG3A 3EDKA 4HZ7A 3KL5A 5EFDA 4UFJA 3BV4A 1H09A 1B3XA 3T0AA 4IMCA 4LCQA 2V8ZA 1EHAA 3B0PA 1M6JA 2YB4A 2Q3OA 3DGRA 4AFYA 1OFDA 3K5XA 4XAZA 4IPLA 3CL7A 4JL1A 4XBJA 1DXFA 1XGDA 4MUZA 4QP0A 4C1LA 1JAKA 1QU4A 2GQ8A 3AU6A 2YDAA 4LB4A 3W6YA 5A2BA 2GJXA 3CZKA 2OLAA 3T40A 5DRCA 3GC2A 4JY9A 3TC6A 1XDLA 4UFMA 4DN1A 2Z4GA 2EJ1A 1WOBA 4B3KA 3WK2A 4RX0A 2O4QA 3F5LA 4Y9OA 5D2WA 5BOEA 2A79A 3MI3A 3NOEA 4GY1A 4HGXA 1SFLA 3W87A 2FZ8A 3GE7A 3AHTA 4W8LA 3BSHA 1Z32X 3T8LA 4P7QA 4DRSA 3W7HA 4C6OA 2FZMA 4ATWA 1EB3A 3H23A 3K30A 3V0UA 4MDOA 1FWSA 3ITYA 4I9MA 4LPCA 3QLDA 4RV3A 2JF6A 2V3FA 3OO2A 2ZUSA 1KRCC 3VNYA 3IIPA 4A8RA 3KS5A 3FJ6A 5CC6A 1VFOA 4IXHA 2G0WA 2WSPA 5EFFA 1TUXA 4AVFA 1LG1A 2NZLA 3HGRA 3PZOA 3LK6A 4O10A 4JS3A 3EPMA 2POTA 4HYRA 1GK8A 3CAKA 1VYRA 3LA4A 2DZTA 2QCHA 5LNSA 2EPMX 2QCLA 5G2WA 1PX8A 1NOUA 1XS2A 3VD4A 3MUZ1 2HE5A 4GYFA 3SW6A 1M7OA 3SCPA 1NWSA 4GIYA 3OOQA 2J7EA 3NFUA 3AC0A 3INPA 2WVVA 2ZCGA 1W1ZA 2X2GA 3EMQA 2V63A 2H9AA 1CXKA 5D02A 1Y7VA 1ZUAX 4PTWA 2QMJA 1DTUA 3AROA 3CWNA 3JRKA 3TMLA 4Z1AA 4PTDA 1J6OA 3ABZA 3QH2A 4NHVA 2FVLA 3KZSA 2REQB 3M0IA 4GINA 2W62A 2XWEA 1ITCA 4K38A 2SFPA 4CD5A 1Q6QA 4JTSA 1BF6A 1OFOA 3VX0A 1CENA 2P50A 4GI8A 5H2ZA 2VM8A 3G24A 3KXQA 4FIQA 5U7SA 3KWXA 1Z41A 4O54A 5ECVA 3ZZ1A 5BRQA 1QT1A 3PPFA 5I5RA 4PULA 1O95A 4HK6A 1UCWA 3AIRA 4GNVA 1KRMA 3C4UA 3H55A 4C6KA 2FHBA 4PL1A 3IV3A 4UTWA 3W25A 2PU0A 1WDSA 1A53A 1R9YA 2ZX8A 1KM5A 3OG3A 4FX8A 3CO4A 4U33A 3HG5A 3DYMA 4PCTA 2E77A 3RPMA 4UQCA 2VVNA 2C1IA 3RILA 2W92A 1GJPA 1TE6A 2PTWA 1QPKA 5RUBA 4WRHA 4M3PA 1JPMA 4BF7A 3UA4A 2X42A 1WKYA 3A5VA 3MSDA 4V27A 1PX3A 3M6YA 2C8NA 3TQKA 2WNWA 5AYBA 1E5NA 4R85A 4YLWA 3H21A 1U22A 3GC4A 1W8GA 2UY4A 3THDA 4D6HA 5MKGB 3KLKA 4GABA 2X1SA 3QFEA 4UTHA 1GZJA 2FFIA 1EWEA 3SECA 4IX2A 2AQVA 3AAMA 1E5JA 3TFXA 4JFTA 3AICA 1UR9A 2X0HA 3A64A 4LNYA 5BCAA 4BHYA 5ABGA 3IUDA 3SCWA 3KTXA 5HINA 2XDFA 1Y5VA 1YEYA 4GO8A 4JIHA 4O53A 2W0UA 1SZGA 5C5YA 3NA8A 2WKLA 2AOSA 3I6EA 1V79A 3ZLFA 4AWSA 4HMCA 3WELA 4J28A 2QAFA 3HA1A 4KWUA 4WCJA 2JQXA 3FHQA 3GQYA 3CAQA 4IFRA 2VZOA 3ES8A 3Q4DA 5IDIA 3RLHA 1Q8AA 2OGJA 3GG1A 3UG3A 2D3LA 3MHFA 1V0NA 4BWLA 1M03A 3D0CA 2BX7A 4BEUA 2HCVA 3CV1A 3W7KA 2E6DA 1S2CA 2BXVA 3PM6A 1R6WA 1W56A 2YA2A 1J0JA 1IHIA 1F05A 4QAWA 4AQLA 4B9ZA 1GOXA 1N8IA 4K7YA 4UBPC 3RMEA 1LLZA 3KCLA 3CQHA 3UZYA 3S1VA 5AOUA 1KFLA 3F4NA 2VC9A 4L65A 3FIGA 5KZDA 1W5NA 4H9VA 1Q7ZA 3P5YA 1WBJA 4C6FA 3IGXA 4MPQA 4KWSA 1R3VA 6ALDA 2VCCA 1IR2A 4PRTA 4KKXA 2J7DA 3UT0A 3B8DA 4MB1A 3MKVA 3TSDA 3AO0A 3VE7A 2EXOA 1XH0A 2EO7A 1E6QM 4Q8WA 1JUKA 4QG9A 2ZZ3A 5LGZA 1ISZA 4G5DA 5CPSA 4UQEA 1KTBA 3G5EA 3Q65A 2JE8A 3WL0A 5CG7A 4QTGA 3AXIA 2GDVA 3W88A 2XFYA 3WFLA 3CV2A 1KTNA 1B3ZA 4X61A 1AZ1A 3LGDA 1GCYA 3URBA 2Z1SA 1JPHA 3O6DA 1U33A 5FF3A 3T9PA 3R6IA 3PWAA 1HL8A 5CPMA 1O5KA 2QCDA 3FA5A 5DX7A 1KBLA 3BAWA 5I00A 1OK4A 1IIGA 4TVDA 2X7WA 1HIZA 5IBXA 4J4KA 1V7YA 5FOOA 1RP9A 3WMSA 4ZSTA 3PPHA 2WAGA 4N2YA 1LCOA 3UXLA 3ZR4A 1J93A 2QGYA 3K4DA 2GSEA 1A5MC 1QHZA 4I9JA 1P0KA 1FDYA 1IWAA 3O16A 4DIAA 4XIAA 3R0DA 3DENA 4P5UA 2WSQA 1Z6KA 3MA8A 2YXGA 4E4UA 1V08A 1S5NA 4DPPA 4DNMA 6PTDA 1TTPA 3S83A 2QIWA 2VZSA 1L6YA 3KBNA 4MYXA 1OZMA 3APTA 4NY2A 3SFWA 2OVLA 3MANA 2QQ6A 1GJWA 4AZ5A 4EX4A 1E1FA 1EP3A 3RLGA 3PULA 1FWIC 1ZHAA 3BQ6A 2GQ3A 1ZSXA 2O9TA 4PMXA 1GZ1A 3CIVA 3CT2A 4JTQA 3L4VA 1QNQA 2PFHA 4AZ7A 4WZHA 3TW7A 1K7FA 3G0UA 5LIXX 4CU7A 3QR0A 1LQ2A 3W2LA 3WLMA 2D20A 4AHPA 2WM1A 5MHBA 5LIWX 2NUYA 2BGNE 5CGQA 5CC3A 3DG3A 4AF0A 1J96A 3DYPA 2QJGA 3DBNA 3UETA 4IJCA 4Q7BA 1WKEA 1L6SA 5D8WA 5DBTA 1TPWA 1OC7A 4W89A 2L5HA 2R1MA 4FXRA 4PMUA 1M7XA 3OBKA 1YBQA 5F4XA 1PIGA 4X2PA 3GVGA 3AHZA 1X38A 3A5FA 4M6UA 4WSHA 1TA3A 4QEEA 3W2UA 4KF1A 4IH3A 3LS9A 1V3MA 3KBMA 1JDEA 1EP2A 2OSYA 3M0JA 5EB8A 4M6PA 5E0KA 3I3EA 3SN1A 1UIPA 1BXBA 2VOTA 1ITXA 4HYWA 4UTLA 3CLWA 3KP0A 3NSNA 5A6JA 5CSYA 3EKGA 4PB4A 4LS0A 4HD5A 4IGNA 4QEHA 1K7XA 3M5ZA 3HIJA 2Y4SA 4OU1A 3VABA 4UC5A 1JZ6A 4DELA 3ARQA 3EZ4A 4HSOA 1LJYA 1VPQA 4O17A 3JUGA 3MUXA 1HKVA 3MV01 1N8FA 3FAWA 1M7PA 4Z2HA 4MDPA 4M81A 5AHEA 3B0YA 3VOJA 2A6NA 3UJEA 3R13A 1UZ1A 1DWHM 3TV8A 4FEZA 2RJHA 1KLYA 3FVMA 2GGHA 3L0NA 3AISA 3W7PA 2OQHA 1HNYA 4AD1A 2D0FA 1XF0A 1V7AA 5G5IA 2QW5A 3N9SA 2XJ7A 3QM3A 2GQ9A 2EKCA 4PGLA 4IJBA 1EHNA 4JIPA 1OINA 5G4HC 4MVAA 2PAJA 2DQXA 2IPWA 1VPXA 4MWAA 1P5BA 4NT0A 1Q6RA 4I7VA 1I2RA 3CMGA 1SO3A 1YPFA 1Z8AA 1J9YA 3HPXA 3K13A 4S2CA 3MJMA 3GKFA 3UZWA 4LVFA 1B57A 3T78A 1KKOA 5I3DA 2J79A 3VMPA 5CG0A 4L1WA 3N04A 3B0VC 1H1YA 3S1WA 3T0TA 1EEXA 1XP3A 4CD6A 4Z2LA 1WO2A 3B8UA 1VR6A 2YA0A 1VBHA 2QXWA 1J11A 3DXIA 4UTWC 4BY3A 2BP1A 3WQFA 4N6EA 1X7FA 2WMKA 4F0RA 3GG8A 1H60A 4M24A 3BAKA 4M0XA 1OK6A 3I68A 3GVWA 2JEPA 5CCZA 2JALA 1T41A 2J13A 4F4RA 2DW6A 5AN7A 1VFHA 1TPH1 3E2VA 2HQAA 3MI2A 4LX4A 3TONA 1M3UA 4H00A 2GVJA 1TKKA 4GIAA 2ZRYA 3WUBA 1C93A 2C0HA 1HJQA 2ACQA 2R1KA 1CT5A 3ZSSA 3H12A 2XSBA 2GK1A 3IVSA 5KETA 4H8UA 1E6PA 2Q8LA 2ZQ0A 1M1BA 4HSNA 4A8IA 2J6XA 2TAAA 4PC8A 1AA1B 1A5UA 1B4KA 2ZDSA 4CKQA 5F2IA 5FEWA 1EC9A 5DCBA 2J8GA 4F0HA 1IR1A 3O0FA 4WY0F 1PV8A 4GYPA 4PTMA 1UWUA 3N25A 5G4WA 3KVKA 3QTGA 2CU0A 3A23A 3UCQA 3RX4A 1FBAA 2V69A 3N18A 4YS1A 3SURA 3IARA 4S2BA 3BLPX 2VL4A 2BS9A 2PD5A 3NO3A 1EDQA 4OBTA 1GOKA 3LGGA 4N0RA 3DHUA 3PAJA 3QYSA 3L66A 1S3TC 3VNDA 5KITA 4GK8A 1AZ2A 1W17A 3CC1A 1WKDA 1NF7A 5C71A 3O05A 1E0WA 1H41A 2G3NA 3U9IA 2PDUA 3BANA 1KM6A 6REQA 3CAWA 1FWDC 3STFA 1NP0A 2GOUA 1F4AA 4YPJA 1J5SA 3B9DA 4BWLC 2QAPA 5DT5A 3WLNA 4RV8A 3WMBA 3GU1A 1QBBA 3NO5A 4JYDA 4NJJA 1RV8A 1TTQA 3G8RA 2B81A 4ZOEA 1V0MA 4K8HA 2ZXDA 5K4XA 3WEZA 1F74A 3G0SA 1EJTC 4XZBA 4AVOA 1WAUA 4YVXA 4D6DA 2NSXA 3CZ8A 3M1ZA 2I57A 1R9XA 2GSJA 1QJWA 3GXPA 4JTHA 3EWUA 4L4MA 1V02E 1XBYA 2P5NA 2CERA 4KRZA 4PCNA 1T40A 2W27A 1EDTA 3ZR6A 2UWFA 5I03A 4LRSA 4ZXLA 1G7VA 3GVQA 5HNRA 3NYDA 4U5KA 4MKVA 1AL7A 4IGHA 6XIMA 4DEFA 3IVTA 4PUKA 2DW7A 2JFEX 3GVVA 5LGXA 4N9EA 4GI6A 2VC7A 3BAJA 3LBCA 1YDOA 3PBYA 3NXLA 2ZUMA 5HATA 2ISVA 2BY2A 4AYSA 2YSWA 1MI3A 3OZPA 5DCEA 2TRSA 2F9RA 4A3YA 4Y2WA 2J9YA 3OP2A 2HVMA 4JYEA 4QRNA 4W85A 4F2BA 5I3GA 3C5QA 1JDFA 3F5JA 3AALA 1MDRA 4ZFMA 3SQSA 2P8BA 1OVDA 2FGZA 3NIYA 2OKTA 4XZLX 1KCZA 5DFAA 4CNUA 3REQB 5IBXC 4J3VA 1LOQA 4D1IA 3GR4A 2C7FA 3AMLA 3NTYA 4L4OA 2X41A 3RGTA 3NCOA 3RFAA 4RDWA 1FFQA 3CL8A 2FHFA 4PUUA 4HNNA 1PYMA 4D9PA 2CIPA 3T7VA 1W5OA 1I2OA 1JZ3A 4AD5A 1GKRA 2QKFA 3NQCA 5I0DA 1CX9A 1GQLA 3GXDA 1BYAA 1OJXA 3GXMA 4NXKA 2QNEA 2V82A 1TMLA 1WDDA 1KGUA 3U48A 1EF2A 1C9DA 4DJEA 2WHLA 1V6XA 3EOOA 4GD0A 5HXMA 2ZWYA 3FHAA 1KR1A 5AZ1A 4H9XA 2J88A 4J2MA 3VCRA 2GGIA 2ZUNA 4IXXA 4XK2A 4QDWA 4E3TA 3H7RA 3CMJA 1IEVA 3E96A 4YNGA 3F4CA 4I6VA 4B4FA 3N6QA 5AHLA 2YDRA 5REQA 1IYXA 3BMXA 2PRLA 3OZYA 1ZU8A 3WFZA 1C8YA 5FL0A 2GQAA 1RPKA 3QV6A 4MJMA 4ZVJA 4MLJA 3AHYA 4FXJA 3WQ6A 2ZZ2A 2E1WA 1KCXA 3L9CA 1MW0A 1BRLB 4CNOA 5ABFA 1TCMA 3MWCA 4JYFA 4P2VA 3VGHA 1IT8A 1PHQA 1O7AA 4ZFCA 1IZCA 3CPUA 3HG3A 5E5CA 1R38A 1GQJA 1M7JA 3VCNA 3W1XA 5DY2A 1RXOB 5IM51 2WMJA 2PLJA 1O60A 3DZ1A 4O14A 3V4BA 3IJLA 5LHEA 2PDFA 4S3EA 1JFXA 3V16A 1EC8A 3FNDA 1C9WA 1DWIM 3B9EA 4I7WA 4KH2A 3LI0A 4XV0A 4REQB 3P0XA 5TF0A 2HBVA 2A85A 1BVNP 3UWYA 2Q3RA 2EPLX 4RZ6A 5EU9A 2YCEA 3SZ8A 2J75A 3CB8A 3TOPA 4W5UA 2E5CA 3TQ0A 3P14A 3MY9A 3CBWA 3PBVA 4F9JA 1UP3A 1O4UA 1EXPA 3NURA 3TR9A 1HKJA 4ZL1A 4H7CA 1MSSA 3VVGA 4JR5A 1DP0A 2Y24A 1KC7A 1MFUA 2BVWA 5XINA 3IIZA 4QLKA 3TC3A 4CU8A 1LG2A 2PTXA 1XC6A 3BQ5A 1T8QA 1GUVA 5IXEA 4DO5A 1XC4A 3LM7A 3WF3A 4QNEA 4L64A 3VYLA 2GWGA 4G7EB 3DFTA 3GH5A 5M03A 4NKCA 4A22A 4H9YA 2PDLA 3S5OA 2BDQA 3WENA 3A3WA 2PU1A 4IPIA 4US6A 3RMJA 1ME8A 3NDOA 2ZA1A 4MWAC 1ZJHA 5I02A 4L9ZA 3G3MA 2HXTA 3TIMA 5H8UA 1X6LA 3OJGA 1JYVA 1FQ0A 2OX1A 1B54A 1KCKA 5HPCA 4IMDA 1ITQA 4B4HA 4UWMA 4NXSA 4WXZA 1G67A 3I10A 5CZKA 3VD3A 3W81A 3LV6A 2QYGA 2W79A 4C1NA 1KGWA 1X39A 1AH4A 3F4WA 4XZ9A 4M8UA 3TA9A 4MLRA 2GL5A 5H8MA 4CQAA 4KCVA 2E7FA 4HHLA 2VEIA 4LH8A 5JH2A 3SY8A 1I0BA 1JD9A 3ZVHA 3PR2A 1PYFA 3LI1A 3UPMA 1RAKA 1R3SA 5CPQA 1B3WA 1DJNA 1JF6A 3O06A 4C6MA 1TQJA 3CUGA 4HBKA 3V5FA 1HT6A 2I56A 1GHRA 4U2YA 3HV9A 3PJXA 1JYWA 2P0IA 3DFQA 3C52A 2YBTA 1Q7QA 2E09A 4O19A 1V77A 1XLFA 5FIPA 1GPWA 1VLWA 5LHFA 4JTEA 1FHLA 3MO7A 2R1NA 3SRFA 1Z69A 1VBJA 2OZ0A 3E2QA 5I6SA 1Z42A 4GUIA 2H3DA 3CQ0A 1J4EA 3CT7A 1NQKA 1CLXA 4W8BA 3W7CA 4PUMA 5LNWA 1WNOA 2WMGA 3QQ0A 2ICSA 3G77A 1RA0A 4ZA0A 2OX4A 4I8DA 1Y5XA 1DOSA 4FF7A 3AQUA 1A4LA 4TOQA 4YU1A 4V28A 4JTAA 4Z42C 1GG1A 1LBLA 1E43A 2PDYA 4M1RA 3WMCA 3BDKA 1FY6A 3GUGA 4E8DA 4ZO9A 4EXBA 4RW3A 1G7UA 1TPVA 2YA1A 1W91A 5CLWA 2ZRXA 3ITTA 3O63A 2ZUWA 2WWCA 1BF2A 4L4PA 1IT0A 4PRRA 3GNXA 1VFSA 4C6DA 3W86A 2G41A 2E9MA 1W9BM 4IP4A 3ID7A 2XSXA 2VHLA 5E09A 3LXBA 4QS6A 3VIOA 3LN3A 2CBVA 1GOQA 1KM4A 1IWBA 1UR3M 1WUEA 1ZBKA 3DI1A 4DZHA 1SQ7A 1DQUA 3E5PA 4K7VA 4N7QA 2CWNA 1SFTA 3OB8A 2JF7A 1H5VA 4PZVA 4W7UA 1V3LA 4QJ3B 3DIPA 1GEQA 3QRHA 4LANA 3ARVA 2DVTA 4R88A 3CNYA 2QF8A 1PZ2A 2BBFA 4XSMA 2V5DA 2QUNA 1WDRA 2XISA 1MYRA 4UOJA 1M01A 2XWDA 2GJLA 4ILSA 3W1MA 2AAMA 2OSWA 3BJFA 3QQWA 3LCHA 3G2GA 3UG4A 3BK0A 1NU5A 4MZ8A 1TSIA 2XU2A 1JL8A 1H7NA 1E1CA 2ZZ7A 3M47A 3RXZA 2QULA 1W37A 2D1ZA 3WEOA 1FVPA 1Q85A 2DORA 1NDYA 1JPKA 2P10A 1OYCA 4UR8A 3B97A 1TRIA 2YJQA 4QITA 2X40A 3MHGA 3HJEA 3ALGA 1EDGA 1XFBA 4QDPA 3WD1A 4IHCA 3NVTA 2VRKA 5DRIA 4NJKA 4DXXA 3NM3A 5KSWA 1SR0A 5SWUA 1LBFA 1YYAA 4L4LA 3SCVA 4FLQA 4RR4A 3KP1A 4HKPA 4LY4A 1OEPA 1S2VA 4ACZB 1XCFA 2XH0A 3M64A 4G1NA 4OFCA 2Z1BA 4TXEA 2RDWA 4IP5A 2DDXA 2OYKA 3WF1A 1FWTA 4UUIA 4YIWA 3W1AA 1VEPA 3WQ8A 3WBYA 1E0XA 1VZWA 3EMCA 4B16A 4DJEC 3M5XA 3THAA 3CO8A 5IRPA 3P8JA 3OG2A 2Z24A 1UYQA 3OVRA 3T0BA 4QJ1A 3NPXA 1Q6OA 1CGYA 3UXKA 3KLLA 3W2KA 4GUJA 3UWZA 1JDDA 3F2CA 1C7SA 3HPSA 1LUCB 3MDWA 3VDCA 4G8TA 1CIUA 1S2WA 2CXEA 3KCJA 1OD8A 3FY1A 4DLFA 4Q4SA 5LNUA 4HP5A 3SCOA 3LCXA 1TTIA 4C7GA 2V0TA 4HYVA 5EGRA 1VQTA 3AIQA 1OX6A 5BXPA 3W02A 1DTNA 3ZT7A 1UR4A 5G1YA 4GY7A 1P4CA 3CHEA 1GKQA 3RO6A 3MZ2A 4KERA 4HA0A 5C6MA 4Z2IA 4C91A 3TNOA 4JY8A 2ZA3A 1FCQA 3CWHA 5G2HA 4ZGYA 6TIMA 3L21A 3L2MA 4NVTA 2WJDA 4GBUA 4IFOA 1VJZA 2GJNA 3I4KA 2F6XA 3IPWA 4MAZA 2PDJA 3ARRA 4XO7A 1EZWA 3VFCA 7TIMA 3ZLHA 1F8IA 1VYSX 2WV8A 3GG0A 4O11A 3FDGA 2E9BA 3V1PA 4GUFA 3R25A 1JRBA 2GUYA 2UY5A 1U5VA 1ISXA 3UZXA 4LGXA 3ZFHA 1HF6A 4ZBCA 1J10A 4Z2KA 7XIMA 1POJA 1WOAA 3FYOA 1IEQA 2CBUA 3FCPA 1PIFA 2NUWA 4WKAA 3YPIA 3HU7A 3CIXA 4R27A 1K7EA 3VD7A 5LXXA 4EACA 2FVMA 2VVSA 3KBWA 4ZCWA 2PP1A 4PMQA 1VP5A 2QJMA 4URIA 2GVGA 2WANA 1LORA 1REQA 2RDXA 4NAFB 2PDWA 5DN1A 2XVLA 1JZ7A 3WQVA 2FZDA 3LD5A 1PUDA 3M43A 2IQTA 4NAEB 3EEZA 4HK7A 4C5YA 1JCXA 3ZWSA 3C6CA 1K02A 3OGSA 1J0IA 2PGWA 5HUOA 3CUFA 3NQEA 1LQ0A 2HEJA 2DH2A 3KCOA 1UR1A 3P80A 1WUFA 2D2HA 4MYAA 4ZTXA 4HNUA 2E9LA 4OGZA 4U5IA 1OG0A 1M65A 3POHA 4G56A 1KM3A 4H4IA 3FDKA 2PB1A 3WUGA 5BU9A 5EMKA 4IICA 4A3QA 4OT7A 3IGSA 3SADA 3AOFA 3SY1A 4TV5A 1EXBA 3TJLA 2OPJA 1K9TA 3GZAA 4ZQNA 3FW6A 4O0ZA 4PUDA 2DIJA 4P8VA 3N2OA 3BJTA 3OIXA 3ARWA 5CKSA 7A3HA 3N2TA 3NQAA 4O1DA 4YTQA 5HNTA 2NSOA 3A4WA 2BASA 3W28A 1YPIA 4QG8A 4B5TA 1X6NA 3S2MA 2HS6A 4F0MA 3TSBA 1C3FA 3HF3A 1RUSA 4BI5A 3UR2A 4PUEA 4LWWA 3DECA 2ZXAA 4CQCA 4HA4A 1IZKA 1H61A 1P0NA 1U5HA 1ICPA 3T4CA 1BTMA 2EPOA 1WZMA 4UIOA 1EGVA 4Z1CA 4AZ6A 1I0DA 2OB3A 4PRWA 5CJMA 4M56A 4PCPA 2PPGA 1YXYA 1KV5A 3HFYA 1W0MA 2I5QA 2WHMA 4JPGA 3UD6A 3KBJA 3PJUA 4WK9A 2DZBA 5PTDA 4MIMA 4FNUA 1R7AA 3L0GA 3H22A 1KGXA 3T8QA 1DE5A 3GDBA 5M1TA 4PH6A 1LWIA 3UJRA 2YBVA 5HQMA 1WKFA 4RL3A 3CPRA 3B8TA 4N6FA 1EX5A 4DBEA 2VFGA 4J3ZA 1CBGA 3VNZA 1TPB1 4TV6A 1QNRA 3VC6A 2FLIA 1JI2A 3TTQA 2XVPA 1ITUA 5D9OA 4I3GA 1OC5A 3PTQA 3NOYA 1LTDA 4B5WA 1PCWA 3VAVA 3ZWTA 3MUAA 2J27A 1UWTA 2GGEA 4IGSA 3VXGA 4XD5A 1H7WA 4GXWA 4X0NA 4LV9A 1O6IA 4XAGA 2OLSA 3O3RA 1KBJA 1E71M 3DKLA 1G4EA 1KO0A 1FDZA 1FHDA 4TX6A 4JIQA 3PVFA 1T7LA 4LQ1A 1UKPA 3P2VA 1ZL1A 3M5YA 4GI9A 3GFYA 4GWEA 2D2JA 3BLFA 1EJXC 1XLGA 1PWLA 2Y5SA 4ZO8A 2ISDA 1QW9A 3HGSA 2QUTA 1EX1A 2TPSA 1H7XA 2DUXA 1E6SM 1WDWA 3FGCA 4C6QA 3SGUA 3MVIA 3SEPA 2NUXA 1W5MA 5A6BD 1C8VA 3E38A 1AQHA 2PBOA 1YNQA 3WEMA 4DXKA 4XTIA 5D04C 3ZT6A 1VCVA 3EB4A 4MKNA 3WBAA 1ME9A 1GZGA 1RQBA 1IQ8A 2DVXA 5ECUA 1ML1A 4ZQRA 4TU1A 5KZEA 1UA3A 4ZOCA 4WVXA 1PX4A 4H41A 3PZMA 3TJIA 3W70A 2INZA 5CGMA 2XINA 3VDBA 3UFYA 2D69A 4BQ4A 4GUGA 3BCDA 3HPZA 1PL9A 4Q8MA 4JTDA 3VUPA 3MCOA 4X9YA 3PUGA 1BAGA 4RZBA 3WK1A 4Q8QA 2F6UA 2D22A 2FMOA 5I77A 1JPDX 5CXPA 3H4XA 4D2JA 3STEA 2HSAA 4OUIA 4A8LA 3RU8X 3DFOA 5B7YA 2G5WA 5F2MA 3RJXA 2Q6ZA 3CYJA 3V18A 4LB3A 1CGTA 2VEPA 3IGUA 2NV2A 5ENLA 1ME7A 4RE4A 3KUMA 2WZTA 1C7TA 3K1DA 4JOMA 3L5MA 3RR4A 1TTJA 3WQEA 1DYSA 2YYUA 4A2SA 3CV6A 2Q71A 4JCMA 2OELA 4UCFA 2JK2A 2BVTA 3FA3A 3QKEA 2GDQA 1HJXA 3E3HA 4TUFA 2W4XA 3IJ8A 1TREA 4LNCA 1Y65A 4REQA 1EPVA 1XHGA 3ONBA 3SN0A 1FWBC 4PMNA 4FNPA 4DUOA 3S47A 4O1CA 3LU2A 2WC4A 2OWCA 2W66A 1C29A 1FP9A 3PBMA 1E40A 1SMDA 2VFIA 2Y88A 3N4AA 4F40A 1RJPA 3H4GA 3W3OA 1UD5A 3LV5A 1Q8JA 4R33A 4IPJA 2HK1A 1VFLA 1PS9A 3HQOA 3VD5A 5D9PA 4BCEA 2CETA 3KDNA 1HQTA 1LM1A 2TSYA 5HJXA 4H7VA 1GORA 5EKYA 2NX9A 4FZIA 1U83A 4G7EA 4LS1A 2Q01A 2G50A 3SRDA 3LXCA 1WXJA 3P5ZA 3BCFA 4EIVA 4D8ZA 2VC5A 4JEJA 1NM9A 4AC1X 3CM4A 1TZ7A 1XIBA 3ABRA 1OX4A 2A4AA 4IIGA 1PZ1A 1FXQA 3EKZA 1QTWA 4KT2A 4Z0JA 3WQDA 1E9IA 3U2OA 3N17A 4KGJA 1PTDA 4D6GA 1KV8A 1VRDA 3VKAA 3R4IA 1JIBA 1OC6A 1RD5A 4AZBA 1J0KA 2QCCA 1MXSA 3WL1A 1L6WA 3EWBX 3W4RA 3T1GA 3TZFA 4BQ2A 4WJEA 3VNJA 3N11A 2F2HA 4QS5A 2KZHA 4ATLA 3WUEA 3BC9A 4DJDD 1GVSA 3GK0A 1N8WA 4MJ4A 4H04A 4OOZA 5A8GA 9CGTA 1QWKA 1O1HA 3CGTA 3L12A 3CV7A 2YLLA 3IUIA 3OQEA 4IISA 4FX7A 1UOZA 3WDJA 1XIIA 1J01A 3UJ2A 1E15A 2D2GA 3UYCA 3QMSA 2RGLA 2ANUA 3VO0A 1K9FA 1X8CA 4DLMA 3DOPA 3GXNA 5J8LA 2IMRA 4F2UA 4C6EA 1ZTVA 4UMAA 3WJZA 3TW9A 3MT1A 4YYFA 4OECA 4NNBA 4NRRA 3SGGA 2HK0A 5KEZA 3QOKA 4I9AA 3W9ZA 1PPIA 3N19B 1KRAC 1IGWA 4ADTA 1VKFA 4ZO7A 4Y96A 1OZQA 2Z2BA 1UD4A 2WVTA 1UH4A 3LENA 1OCJA 4XVDA 3EA1A 4Q8NA 3KL0A 4DWSB 5HBFA 2C91A 5LA1A 4GJ1A 5D32A 4K37A 2FYMA 1X7IA 4JTGA 4B15A 2ZYFA 1W2PA 5JQ9A 1KXHA 1JGMA 4RPQA 3EPNA 1NWRA 2PC4A 3APYA 1OF8A 1K8YA 1AW5A 3H54A 4AEEA 3VIPA 1XLBA 5CC5A 4DY1A 3II1A 3UEQA 3GBEA 1GW9A 3VNIA 3E0FA 3BARA 1ECQA 4F0SA 2FHCA 3L23A 4OV9A 4CD4A 4DQWA 2GVEA 1NELA 2ZX9A 3WSUA 1XIDA 1YHTA 3WLQA 1EOMA 3A21A 3UCDA 2A0NA 4XZNX 1V3JA 2TODA 4WF7A 1NJJA 2GOKA 3A13A 1OM0A 1HXJA 4UTFA 1F73A 4MHBA 3WLHA 3PWIA 5CQ1A 1TJ0A 3EEGA 1TWDA 3EDEA 3I3DA 4LY8A 1I4NA 1L2QA 1V8EA 3AHVA 4DJFA 2CZVA 3BLEA 5DF0A 3A22A 4R9XA 2WSRA 4HHMA 3VIKA 5E70A 3BAIA 3GIPA 4LVGA 1RZMA 7CGTA 5AYXA 2DIEA 3PPCA 4GCAA 5HMDA 3WF2A 4D6CA 1KTCA 4ZXOA 1UUOA 3TYBA 4GYJA 3CIWA 1AFSA 3TWAA 4PMOA 1XISA 2FDSA 3CUIA 4AH7A 6TAAA 1KWKA 4JFUA 5L9FA 1B1YA 2YX0A 2XH2A 3W2MA 2YCLA 1MUCA 1O12A 2VX5A 4AHQA 2DZSA 2FTYA 3S6DA 1BD0A 2E5DA 5BXSA 4GQRA 1A5LC 2ZZ1A 2EF9A 2VFHA 1TRDA 3VNLA 2PDXA 2PODA 4LUJA 5EMJA 1F3XA 4PBGA 1NY1A 5G1MA 1W9XA 4HOXA 2NV9A 1ONEA 2G3MA 2ZUVA 1F2JA 3H2NA 2INEA 5HOSA 1JEZA 3BMWA 3KBVA 4HOWA 5HMSA 3UR8A 4NU7A 3T0CA 3QHMA 5FF4A 7ENLA 3WNOA 1R7OA 4FX6M 1RVKA 1ISWA 1XG3A 1SFJA 2QLYA 4OV4A 2HE8A 1QASA 4O1BA 1Q65A 3LHTA 5A8PA 3AFBA 4AD3A 3SCNA 5BWFA 4CCCA 4PMDA 4B5SA 2EPKX 5KMYA 5FF0A 2Y7FA 1DWAM 2ATSA 4GACA 3TJ4A 1L8PA 3MP5A 1UR0A 1XCWA 1SR9A 2PGFA 3RUBL 4GKTA 3DFHA 3L4XA 2DQWA 2OLHA 1DL3A 4H6RA 3OYXA 4E2DA 1BYDA 1U1HA 3UNTA 1RVGA 4ZO6A 1AQMA 1W1PA 5AC8A 4HU8A 1F4HA 2C1GA 3V3WA 1LUCA 2B7PA 4EXAA 4LSBA 4OVXA 3CHCA 4JD4A 1V6WA 3BZGA 2CHRA 2NWRA 2G8ZA 4H8VA 4S3CA 1GYNA 4YYCA 1WX0A 3FKKA 1XLDA 1P1XA 3CZLA 4TQTA 4LVBA 2ZC8A 1UBSA 3KTCA 3GTNA 3AMDA 4R7OA 1B5TA 3A6OA 4GVGA 1PZ0A 3WN6A 2ONEA 3NDZA 3RLVA 4AXNA 2J6VA 4HMEA 3FKRA 5AVHA 5LA2A 2PRHA 3GDRA 3W1NA 1UZ4A 3E02A 4EWJA 4C65A 3PG9A 2JKEA 3ZO9A 3P6LA 3KRSA 3NQ7A 1YIXA 3LRLA 1F6YA 2WLZA 4KBXA 3NPUA 3MPGA 1AH0A 1DEDA 5TBOA 3WD0A 2CFFA 4F66A 2J7FA 1ZB5A 1W3LA 2WCSA 2OMAA 4GC4A 2WCAA 2FPVA 2DZXA 3FXYA 4L6DA 3W7OA 1LQAA 1CYGA 3EPOA 1ELSA 1ICSA 2V3GA 4WX2A 3KOWA 5FACA 4F0LA 1LF1A 1J79A 2O0TA 4BQ5A 4CD8A 1H11A 1DWJM 5D2YA 5JVLA 2J9XA 3QMTA 4P61A 1UD2A 4ZSUA 4YVPA 2W67A 1K8ZA 1QWGA 4ZB2A 1F76A 3MQTA 4OHQA 3UY7A 1VFFA 4RNHA 3WH7A 3IJ9A 3NZGA 1XCXA 1MW1A 1M41A 3VKDA 3ZJKA 1R87A 4GFSA 1W5PA 3VOCA 1XWYA 3JR2A 4MZ1A 4AMCA 1ZP3A 2VX7A 2DSZA 3HB9A 3W7NA 1TX2A 4E4FA 2PF8A 1NH6A 3HPFA 4PODA 4NAEA 4KMQA 2Y63A 3CU2A 1XYBA 4MNKA 2EAWA 5AZ0A 1RY8A 3UG5A 2NQLA 4LRTA 1P7TB 2Z1XA 1ODUA 3SCSA 2WPBA 4NQ1A 1US3A 5AKQA 3LLDA 2BVDA 4NRSA 5T8GA 2W91A 3N12A 5IDZA 3PP7A 5JBDA 1DJXA 3ZXWA 1WA3A 2XIJA 3GWQA 1YTDA 4ZOAA 2XTKA 2XIIA 3VU2A 3CUXA 2OG9A 4ZQMA 4IX0A 1O68A 1U30A 3R8RA 1YNYA 3A4JA 1YDYA 4A3UA 3LRKA 3FAXA 1NFBA 3TP4A 5CPLA 3GDLA 2CLOA 4ENLA 3O6YX 3ABSA 4WR3A 2GUBA 3RCMA 1IEXA 4V15A 2E6YA 7ODCA 3UXDA 1V02A 2DZUA 3VGDA 3OU8A 2PWEA 3TR2A 4AVNA 4ERGA 4LAOA 3L65A 4JTRA 2YDQA 3URNA 1SUXA 4XUGA 5A8NA 2WHKA 2TYSA 4L6OA 1TUFA 2P76A 2IKGA 3ANYA 7REQA 3M0ZA 2WC7A 5DY3A 1XM3A 3KRZA 4LC6A 3ERPA 3H8AA 5FAGA 5FJOA 3STCA 1UJQA 4KETA 1XV8A 1VGAA 1US0A 2E0PA 4WGHA 1PSCA 4ROPA 3DFYA 1A80A 1A49A 4U28A 3TJXA 2XN0A 1YMYA 4AZCA 4CCEA 2CZEA 1E70M 1WQ5A 1IXNA 2Z0IA 1P43A 2Y89A 4RE2A 1QPQA 3U5YA 1MRQA 3POCA 5FSEC 4I8YA 2XVKA 5B7ZA 3PZ9A 2DUAA 4NZCA 2BY3A 5DMNA 4ORIA 1QO2A 5GNYA 3WDRA 1OABA 1DPMA 4LVAA 4AU0A 4GIRA 1XFCA 3TEVA 2HVNA 4C6BA 1SW3A 5HNUA 2X1RA 3QY8A 4GZ7A 1X6UA 1WV2A 3UA3A 3L7RA 2ACRA 1C92A 2IPFA 2I16A 2AMXA 4ICCX 1KNWA 1E1EA 2WBKA 4JTLA 2NW0A 1Q66A 4B90A 1FCUA 4AX6A 4FR1A 4KIEA 3KM8A 3M46A 2FZBA 1AODA 3GH7A 1ZGDA 3PBGA 3AZRA 4W87A 2ZICA 1E73M 1GVQA 1K9EA 2QHAA 1D3HA 3VDHA 1SW0A 2CZ5A 3FV9A 4LUIA 3NGFA 1NEYA 2Y6ZA 3RM9A 3NQBA 1AQFA 5HA7A 1V0KA 2WB5A 3UP8A 4TVUA 3VOIA 2VFFA 5E0CA 2VR2A 4LU0A 4RNIA 3MUIA 2BY1A 2GJPA 2DSKA 3W7JA 1MQRA 3CB3A 2FH6A 2WKGA 1YE4A 1OSEA 4W7WA 3ZR5A 4DJFC 1CXEA 2G37A 4HN8A 5A2CA 4JKMA 2HRWA 2VNCA 1XLLA 2QVNA 2VRQA 2V38A 2PTYA 1AMKA 3RM8A 1Y8BA 4LYPA 2HVOA 4TX8A 2V5BA 3NQVA 4IF2A 3SSJA 2PTZA 2WNNA 2VWSA 1CXIA 3XIMA 4F48A 3W1PA 3EWWA 4ECLA 4B92A 2ON3A 1W3JA 3BMVA 4K3ZA 2WMHA 3GXTA 2OR2A 4XAPA 1CLVA 4L6HA 4V1YA 1FOBA 1R3QA 3H2CA 4Z0SA 5HQLA 2YL8A 2WC3A 2ZXQA 1FXPA 2O92A 1PKLA 1UQYA 2VP8A 4FXSA 5J04A 1LLWA 3W37A 4ZTYA 4KWOA 5FJTA 1R3WA 3TKFA 1GVRA 1TPC1 4GIEA 4J2PA 1HG3A 3CWOX 1VF8A 3DAQA 4CVWA 5F1VA 1JNDA 1E3ZA 2QV5A 3VDGA 2A1YA 2VGFA 3WJSA 2V5JA 1YXDA 3VTRA 5C70A 1FWCC 3OHIA 1GPFA 4C6JA 1GKPA 1XLEA 2VD8A 2D73A 3C2EA 3E5BA 5FJJA 1JCYA 1E4IA 3PPGA 4K6AA 1NOWA 5H8PA 1CXHA 1EEPA 4H7ZA 3C0JA 3K8KA 2F38A 3V75A 3VI2A 1CCWB 1VS1A 4UXDA 2JGYA 1HJVA 1BVWA 4Q3MA 2Z27A 2WSKA 3DBPA 5A6KA 3HMCA 1OX5A 3GAYA 4G2DA 1QXLA 3QSRA 1FUYA 1DJWA 1V03A 4MPKA 4HZ8A 2DZVA 3GR7A 4QQ3A 2E6FA 1R85A 3LTYA 4KIRA 5C9RA 3L5AA 1BWKA 3ZS4A 1XW8A 1HL9A 2PDCA 4FK9A 2PBGA 5DXYA 4LBSA 2QCEA 1RCQA 3TFCA 3ZSTA 3MI6A 2ZTKA 3QKZA 2BTMA 1DBTA 2I9EA 2IW0A 2ABBA 3MHUA 3UERA 1G0CA 2IQDA 1OB0A 3BJSA 4PCFA 5K9DA 1Z3NA 4UZUA 2AKZA 4HA1A 3APGA 1PVNA 3A9BA 4WOQA 5IHSA 3EWYA 5CPOA 5K3VA 2DJLA 1Y5WA 1OFQA 3CYVA 1YTKA 3C8FA 2Y62A 5GNXA 5CEWA 1OF6A 3NVDA 1HVXA 1V3IA 4E3VA 4D1JA 4NZ4A 2F8QA 4PMRA 2XZ7A 2DUZA 3B9AA 3AHXA 3LY0A 1F61A 3GXFA 3PY2A 2J9ZA 2O7SA 2FMNA 4EK7A 2ASHA 5CJNA 4OZOA 4DNHA 2CLMA 3QW4B 3RJYA 4L61A 1W3HA 1GYLA 4PN2A 3RM4A 1SFSA 1Z89A 3GZ3A 5BRPA 3EAUA 1S5MA 3V36A 3ITCA 3C86A 1I1XA 2VDHA 4UTTC 4ZQOA 3VGBA 1DJZA 3EMZA 2XSAA 2C19A 2ISWA 4RDYA 1S2UA 2PTDA 2BXYA 2FTPA 1RPXA 1J0ZA 4BI6A 2CKRA 4O16A 1H0GA 1I2QA 2GJXB 5F1UA 3B8VA 1ZS2A 3NEVA 4IFKB 2HDJA 2FJKA 4AXKA 2A3LA 2HISA 1Z7AA 3IJ7A 3NZ1A 4J40A 2HROA 3B3DA 2WKJA 1FFRA 4ZE5A 1O66A 1V0LA 1NSJA 4QDMA 4GJJA 3TYZA 1I8JA 5JXQA 3D6NA 1SJDA 3QQ1A 4DI9A 4CUCA 4YHGA 5HANA 1ZBWA 3I4EA 4CGTA 4J3WA 3FSTA 1YPXA 1FWJC 5CPNA 1VD6A 3RCNA 4PTVA 4Y6GA 2V2HA 4UQAA 4OIFA 4GQBA 1QDSA 1VFMA 4C7DA 2W9MA 2CNCA 1B30A 1XRSA 3THCA 4H8HA 4NZ3A 3MTWA 2WMIB 4XZIA 3IEBA 3IJDA 1YTEA 4E2VA 5JBFA 2IKIA 6ENLA 4V2XA 4C6NA 3USZA 4XTDA 2KX9A 4LVDA 1HP4A 1R2SA 2BHYA 3PTKA 4MF4A 4BR1A 4Q8UA 3SDOA 1AK5A 4ML4A 4G6CA 1S2TA 2VI0A 2PDHA 4MJZA 2FH8A 3N2BA 1F6PA 2J25A 5D37A 2WVVB 1W1B1 3OVPA 4PMZA 5GVJA 1CI1A 4IIBA 2H9AB 4DBSA 2CESA 1A5NC 1X8FA 4QROA 2XGIA 2PDGA 1DXIA 1RA5A 1S46A 4NF7A 3K46A 2FZ9A 4FMVA 3TX9A 1OT2A 3H2MA 4J3XA 4JFVA 3E2SA 1GWJA 3ITVA 3MSYA 3GHSA 2DU2A 2CLKA 2XFFA 3I6TA 1H62A