1DYSA

Endoglucanase cel6b from humicola insolens
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
345
structure length
345
Chain Sequence
GNPFSGRTLLVNSDYSSKLDQTRQAFLSRGDQTNAAKVKYVQEKVGTFYWISNIFLLRDIDVAIQNARAAKARGENPIVGLVLYNLPDRDCSAGESSGELKLSQNGLNRYKNEYVNPFAQKLKAASDVQFAVILEPDAIGNMVTGTSAFCRNARGPQQEAIGYAISQLQASHIHLYLDVANGGWLGWADKLEPTAQEVATILQKAGNNAKIRGFSSNVSNYNPYSTSNPPPYTSGSPSPDESRYATNIANAMRQRGLPTQFIIDQSRVALSGARSEWGQWCNVNPAGFGQPFTTNTNNPNVDAIVWVKPGGESDGQCGMGGAPAAGMWFDAYAQMLTQNAHDEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Humicola Insolens Family 6 Cellulases: Structure of the Endoglucanase, Cel6B, at 1.6 A Resolution
pubmed doi rcsb
source organism Humicola insolens
molecule tags Cellulase
molecule keywords ENDOGLUCANASE
total genus 143
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1dysA00
3VOFA 1UOZA 2BVWA 3VOJA 1UP0A 3A64A 1QJWA 2BODX 3RPTA 1TMLA 1OCNA 1OC5A 4AU0A 1DYSA 1GZ1A 2BOGX 4I5RA 1CB2A 1UP2A 3VOIA 4B4FA 1OCBA 3A9BA 1OC7A 3RU8X 3VOGA 1BVWA 4AVNA 3ABXA 4B4HA 1QK0A 1OC6A 2BOFX 3VOHA 4I5UA 4A05A 4AX6A 1QK2A 1HGYA 1OCJA 1UP3A 4AVOA 2BOEX 4AX7A 1HGWA
chains in the Genus database with same CATH superfamily
4HHLA 3S1GA 2JE8A 2Y5JA 1E1CA 1NWSA 5D04C 4MUPA 2GK1A 3BOLA 3OZMA 2YA0A 3MUY1 4XAFA 4NZ5A 1CIUA 4MKNA 1S3TC 1R5YA 2OFJA 5HPOA 1DWAM 3NA8A 4AB4A 4G1KA 1VBRA 4L6HA 1AQFA 5HNUA 1A80A 5CH9A 3B8UA 5A5WA 5FESA 3ZIZA 2CBJA 3GO2A 4F0KA 1K8ZA 4B5UA 3MBDA 4N9CA 5DQPA 1UMLA 5A6MA 3NXFA 1V3LA 3SEPA 5AHFA 4U5KA 1DHPA 3CU2A 1IXNA 2ZTJA 4A4AA 4ZBCA 4MZ8A 3UU0A 1QOPA 2E9LA 3M0KA 3M44A 5AHIA 2EGZA 4H9TA 3PY2A 3QKZA 5K9DA 5DT5A 2O55A 1TIMA 3LCGA 4M6VA 4NAEA 3GB6A 1FHVA 4G8TA 1A5OC 3EWXA 3WJXA 1OZMA 3LLXA 5C9XA 1R2TA 4UTWA 4A3RA 1ZENA 3FW6A 1D8CA 4B5VA 3W76A 3WLKX 4AZ6A 1RJRA 3N2MA 1T41A 4NNBA 4P7LA 4JOMA 2P0OA 3T4CA 4A3YA 2PDYA 3T9PA 2V5CA 4MLRA 1TPEA 2Q09A 3HQNA 3SIZA 3AMGA 2QT3A 4DZIA 3AYRA 3BAJA 3WUGA 5FSEC 3LY0A 4YIWA 3FIGA 3N04A 1B2YA 1R30A 5FJPA 1VQTA 3GHTA 1YDVA 3AXXA 2Z29A 3PK7A 3PZTA 4XAYA 4Q7IA 4IMEA 3DHDA 4ERAA 2VCCA 4PBEA 4OV9A 3FFSA 4EP8C 4JFSA 1BSLA 2NVDA 1UP2A 2DU2A 2PGEA 2YA2A 3L2LA 4MJ2A 1V7AA 3UD6A 1IYXA 5DELA 1WKYA 4AIUA 2X05A 3VD4A 1J6OA 1ZSXA 4RZ6A 4US6A 3PPHA 3STFA 3NWRA 3S5SA 3DC0A 5FJTA 1K6WA 1EB3A 2HXUA 3GRIA 2YLLA 2J25A 3KL0A 2XISA 4XUYA 5M3WA 4IQEA 1ONXA 2DSWA 5AC5A 2J7HA 4MFDA 2V81A 3IJ8A 4MDOA 2VC7A 4Q6JA 2MNRA 3AIWA 1NARA 2EPHA 3MHFA 3ARUA 3DZ1A 3GC2A 1ICPA 2VR5A 4LUIA 4GFSA 1QI3A 1M41A 1JRBA 3PULA 1OCQA 2OO6A 2QJHA 3F5JA 4IF2A 2BLEA 4GKLA 1QMLA 4Z1CA 2GVGA 2DUXA 1LWIA 4M0XA 4H6KA 1UH2A 4HTBA 4B15A 1QW9A 2LLEA 4FOJA 1F7BA 3B8IA 1E6XM 2OO0A 1EQPA 3P5ZA 2CHOA 4R7JA 2OQYA 3EWDA 5FF2A 4QCEA 4WSJA 1PYMA 2X8RA 3GNDA 1XRVA 2XHYA 3MMDA 1VFFA 3GHUA 1YTEA 4PBGA 2DZBA 3VM5A 2BODX 2NT0A 3M7WA 1O94A 1KGUA 1GW9A 5F4XA 3W82A 3WLPA 1F9CA 1OX5A 3M5ZA 4ZFCA 1J0KA 3CUZA 4W9TA 1TIWA 4NJHA 3S47A 5CQ1A 4EXQA 3H24A 3U0HA 5CC7A 4E0CA 1EA0A 3PBWA 5C8BB 4DI8A 4MUZA 2GPTA 2FH8A 4IFOA 3AHTA 2GGIA 3GBEA 4LX4A 4CNSA 4EVZA 3DYOA 3RN6A 1ISYA 1T99A 4O0KA 4Q33A 1DOSA 1GKRA 3RCYA 3PP7A 4L9XA 4UMBA 3WUEA 3TXVA 4YU1A 3QH2A 1C7TA 4X2RA 4DUXA 2OYLA 3CTLA 1NOFA 2R1PA 4HGXA 2NZLA 3K1GA 3L2IA 1UD4A 5I09A 2G3NA 4W87A 4XSMA 4GI4A 4U31A 2BOFX 4AD1A 3FAXA 2ZTKA 1HJQA 5KSWA 3T42A 4Y2WA 3VA8A 2V30A 1Z48A 3LLFA 1YNQA 4RE2A 1XLBA 3FLUA 4I7UA 5D03A 1WUEA 4DVOA 4WKHA 3LCWA 4E8CA 3BARA 2VI0A 3A4JA 3PJXA 4GINA 1FHLA 1B9ZA 1FWRA 4WDXA 2JIEA 1HFBA 3VX0A 1ZJHA 3KBVA 5AYYA 2E8YA 3MMUA 3AI0A 2ZZ7A 1EA9C 1PHQA 3GX9A 4NJGA 1XBZA 2HK1A 3CEUA 1WKEA 3IPWA 1IEWA 4N2YA 3T0TA 4IP7A 1ZHAA 4ADTA 7A3HA 3LDVA 1NQKA 4UTUA 1DIEA 2ZIDA 2GDVA 2YB1A 3LRMA 3OG3A 4E2OA 4JTEA 4AFYA 2V5BA 4S3KA 5FACA 1Q6RA 2KAUC 4J3TA 3ID7A 5H6HA 3MYOA 2H3DA 3GXDA 1TV8A 1VYSX 1DE6A 1T8QA 1NFPA 4IMGA 3TC3A 5C9ZA 4MJMA 1GVRA 1VJZA 3NJ3A 1UC4A 4R53A 5D2TA 2Y5EA 3PF3A 1CGWA 2VFIA 4Q32A 1XF0A 3W7HA 1U5VA 3BW4A 1YTKA 2YDAA 2BY1A 4BQ5A 2DH2A 2VOTA 4J3ZA 5AHEA 1V79A 3UZJA 5FA5A 2QMKA 1LLOA 4DBSA 3WZ0E 1XYCA 1K9DA 3EDJA 4ZO9A 2ZX9A 4XD6A 4FF7A 3K8LA 2HDJA 2YR1A 4HMCA 3NFUA 1JDDA 2I9EA 1V51A 3E2SA 3TX9A 4GUJA 3WL0A 1V3HA 4J27A 4L9YA 5D05A 5E6YA 5F2LA 4UZUA 2ZA1A 4IGSA 5T91A 2FIQA 3NM1A 2VZOA 1A49A 4E8DA 3FAWA 2DZAA 3KOFA 4Z0SA 1ECQA 2ATMA 5C5YA 1B4EA 2O9OA 3JUGA 3NR0A 1O1ZA 4LUJA 2VC5A 1ZZMA 2I7GA 2G4FA 3TOPA 4HU8A 1F61A 1JPHA 3VINA 1VLWA 1KC7A 2WWCA 4KS0A 1FQ0A 4P8VA 1XLIA 3DFTA 1KQZA 2XIIA 1KM0A 3EPMA 3TW6A 1JCMP 3K8MA 1SM9A 1VFHA 3Q4DA 3JU2A 4JEQA 2ADAA 3BLKA 2ACSA 3AMCA 3IAPA 3TSDA 7CGTA 2VL4A 2YCKX 4DHGA 2YOCA 4KEUA 4W89A 3ITVA 5IOBA 4GOAA 4IPJA 4DXVA 4CD4A 3WEZA 5HMDA 1KCZA 1XXXA 2HSAA 5AC8A 1IWBA 4UOJA 4PTNA 4IZGA 5M2FX 2IKJA 4IG2A 3KX6A 4ZQPA 1EDTA 1FVPA 5FI8A 4UR8A 1M7JA 3PBUA 3TWAA 4RDVA 2A7NA 3H7UA 3B97A 4A22A 1JPIA 4LEFA 2C1IA 1P6CA 4CCZA 2DQXA 1EH9A 2YXGA 2A3BA 4HSHA 3KEHA 1F3XA 4L80A 1EGZA 4XZLX 2DUAA 1CXEA 4N6FA 4ZB5A 4JBRA 4IJBA 3VX1A 2YBVA 5J8LA 3M0HA 3E2RA 2ZOXA 4H41A 3UPBA 2WHJA 2PURA 2AMGA 2P53A 2WB5A 3GH7A 1LLZA 3LENA 3QRHA 4H8UA 3FYYA 2PDKA 1OK4A 2D3LA 5IM51 1RALA 3PNUA 4W7WA 3C4UA 1UKPA 5CGQA 3RRAA 3T2PA 4U28A 1JD7A 1OD8A 2XM2A 4F66A 1NWRA 4BZYA 1JQXA 1QFEA 4AYGA 3EEGA 4FI4A 4UUIA 1A5UA 1H1NA 3MQTA 4GZEA 2PDCA 3GXTA 1ODZA 1UZ1A 1O5KA 2ZE0A 3MUXA 4FPSA 4OU1A 5BMWA 3ECQA 1PWMA 2GL5A 4JX4A 3STPA 1BGAA 4J40A 4AD3A 3JZEA 1GOKA 3OLEA 1OSEA 1P7TA 4ZTXA 1JZ4A 4RXGA 2O7QA 4LRTA 3WQDA 2C16A 2V69A 3BPWA 2A3AA 4YHEA 3ZT7A 4O17A 4LW7A 1XDLA 1H63A 1G1YA 4JFTA 4PRWA 1ISXA 2RFGA 3S5YA 3BICA 4WDTA 1Y5WA 3BMVA 5LNUA 4AEOA 2WMHA 1BD0A 3W9ZA 4I8DA 3ABXA 1GOOA 1K02A 4I5UA 3E9AA 1XKYA 1RA0A 3IARA 1QRQA 2D20A 2HEJA 5CSYA 2R8WA 3EKZA 1V03A 3LPFA 5JIWA 3BJSA 4JIEA 3TSMA 3F4NA 4F48A 4HMNA 1B9BA 2HMCA 4DBUA 3A5FA 3UJRA 3KWSA 5E5CA 3VKJA 2FZDA 3GH5A 2PTYA 5A3HA 2PODA 5MKGA 3IRSA 1RBOB 3F2DA 5A6LA 4Q4SA 1OT1A 1TYGA 2A2IA 1DWJM 1WUFA 1AJ2A 1XGEA 3MY9A 1NTHA 1DWIM 3WF4A 3TQKA 3TLLA 5LNWA 4IPLA 2HNEA 3SAZA 1W3LA 3GKAA 1ZAIA 2EG6A 3OPSA 3ERPA 3PFRA 4JGDA 1UUMA 2PBGA 4UQ9A 3BJFA 4KQNA 3IJ9A 1WA3A 4ZOCA 4D6GA 3E5BA 3OW1A 4V1XA 2OPJA 3VZZA 1HF6A 2WHMA 3SCTA 1DEDA 1FCQA 1D7KA 4R33A 1QO2A 2W4XA 3DG6A 4HP5A 3PZGA 1J10A 1GQKA 5FAJA 3W26A 5JH2A 3TMLA 4RPPA 3IIPA 1OG0A 2E6YA 3KVLA 3C2YA 1T7LA 4R27A 1FXPA 2ZX5A 4JYEA 2BXYA 3RUBL 1DVJA 1DP0A 3L67A 3MPGA 3SURA 3A4WA 3U57A 2GLKA 2PDGA 4Y9MA 4F8XA 3LX9A 3CHFA 3KRBA 2XFFA 3MI3A 5BNKA 3VNDA 4INFA 1GVYA 5G2IA 1W1B1 2WOQA 3W6MA 3NYZA 1GPWA 1Q6CA 5ABTA 2ZRWA 3NDYA 4BF5A 5KETA 4IUOA 3LGDA 1FWEC 4V27A 4TMBA 3R0KA 1SW7A 2V0TA 1RV8A 3M43A 1HG3A 1M53A 2XFRA 2XVGA 3ZR5A 4NQ1A 2DQWA 3EEZA 5M1TA 3LXCA 4KWSA 2PMQA 2GUUA 3UZXA 3IVSA 2BNJA 3G24A 4DWSB 1EIXA 1F3EA 1KW1A 1I2OA 1ALDA 4Z17A 1XICA 1MQPA 1LUCB 1JI1A 3F2CA 5D30A 1VR6A 1KM1A 1W1VA 3PR2A 3CGTA 3VC5A 3NQGA 2QLYA 4PMUA 3ES8A 4HA4A 2ZZ3A 4N9DA 4XISA 2WHKA 1QPKA 1DWHM 3K2GA 3VILA 1KFCA 3W02A 3N2CA 3QFWA 3POHA 5BXPA 1JR1A 2X16A 1EXBA 4PRRA 3TVAA 3G22A 5CLTA 1M65A 2QV4A 4PODA 1BSIA 3IGHX 5A8MA 3K13A 4DUVA 3AALA 5LXEA 1YBQA 3C0QA 1YNYA 3W7OA 4LXFA 2XIBA 1WE5A 3I7SA 1A47A 2VCAA 2WVVB 4GIEA 3INPA 1CWYA 2YCLA 3M0VA 3ARXA 3B0VC 4W88A 3P93A 2CWNA 3UETA 4QR6A 1P0BA 2RGLA 3V18A 4DXKA 2DP3A 5E0KA 2NUXA 1ZB5A 3A3XA 3FKKA 1S1RA 1I2QA 2PRMA 3MKCA 4EPKA 3S2LA 1T6MA 1M04A 4P5UA 5I79A 1JYNA 3AMLA 3N17A 4AY1A 1ADDA 3P84A 1XH2A 4H2HA 1IEIA 2GJXA 1AZ1A 2VFFA 1DE5A 2WNWA 5KZ6A 3QY8A 4KEZA 3SCRA 4UBPC 3AO0A 2O9RA 4FXJA 5CPQA 1IR2A 4RDWA 2J27A 5CG7A 4C7GA 3FSTA 1H49A 2PZ0A 3WDRA 4CN4A 3W2LA 4GISA 5D32A 3IACA 3S2CA 2R1NA 5AN7A 2Z7KA 1J5SA 4JCLA 4BF7A 3W1LA 3I7QA 3PWGA 3IV3A 1F3TA 4XVEA 4IL0A 3RU6A 4L61A 2J66A 3UWWA 3KOYA 3PPFA 5AVNA 3UR7A 1O60A 1A0EA 1B3XA 4PC8A 3S0CA 2PB1A 3SY8A 1ITQA 5G1TA 3WF1A 1XIBA 1I2PA 3WLIA 1ZP4A 2P88A 4AD2A 3CUIA 3O07A 5D33A 4A8RA 2V3EA 3UZYA 3OGVA 2OR2A 4R85A 3QPYA 2R1LA 2XZ9A 2EKCA 2R1KA 1U30A 1ME8A 3KZSA 1QOQA 3EXRA 4HZMA 2ZYFA 3CUFA 2PCEA 3H54A 4NUWA 4IXXA 4CNPA 3NAVA 4K1GA 1LG2A 1S3HA 4HPNA 2PWDA 3IIXA 5D4YA 5EMKA 4O4VA 2Z2UA 1A50A 4M6UA 2BSLA 1RXOB 1FWDC 3GK0A 2QDGA 4DWSC 2BVDA 2V5DA 1M6JA 4ZOEA 3SUTA 1VLIA 4GJJA 3L23A 3QGAC 3IJDA 2PF0A 1GTEA 2WSYA 1QK2A 5IBXA 4XO7A 1A5SA 3VCRA 1M9HA 3MV11 3PWIA 4IJCA 3GDMA 5FJOA 4KF1A 4MPKA 1S5TA 3W1MA 1UZDA 1DJQA 3N12A 3WJYA 4DJED 1YIXA 3CH9A 4F0LA 4L4LA 4YYFA 3DU0A 3BANA 1D7FA 5FOOA 3SUUA 1LORA 4D1JA 4TVUA 1C8YA 2NXHA 2NX1A 1HQTA 1PVNA 5JVLA 1P6BA 1OFBA 4H9YA 4AIOA 5IHSA 1PKNA 4M1RA 3WH9A 1MYRA 2BOEX 2QIIA 2DZSA 4J2MA 5F2GA 3TZFA 4ZSUA 4ZXLA 1Y7VA 4XKYA 1ZFJA 1ZS2A 1TV5A 1XIDA 4JX5A 1OIMA 2W5FA 2DSVA 3I3DA 2W6RA 1I2RA 1UWTA 1W5QA 1SZRA 5CSSA 4H04A 3KP0A 1K7XA 1UKOA 1I4NA 1Q5MA 3IRDA 3A21A 1A5LC 1D3GA 5GQBA 5HATA 3BUVA 5DY2A 2A7PA 2QCFA 1E6NA 3QR0A 4CU7A 4JN7A 1EBGA 4LC8A 4ZGYA 4P8WA 2OT0A 3QW3A 1DJGA 2ZBTA 3IGXA 3H8AA 4NF7A 3V16A 3HPZA 1E55A 3EOOA 1H7NA 1EYWA 4U3AA 4LUYA 5HMSA 4PMJA 3URQA 4AD4A 1V3IA 1UUOA 2WANA 2DGAA 3LCHA 1O6IA 1JDEA 3PANA 4JCMA 1PO9A 1XCFA 4FS9A 2IKIA 3LBCA 3FVMA 7PTDA 1LROA 2Y4SA 3TFCA 5CBIA 3UR2A 4DWSA 4C1KA 5G4EA 1TSIA 2ABBA 4C6JA 5AFDA 2RDUA 2D0FA 5A2BA 3PZUA 1PPIA 2WW5A 4GY1A 4PUEA 4PH6A 5EMMA 1K1DA 4IFRA 3OYXA 2J9ZA 3SUSA 4FXSA 1GJUA 2BY2A 2PRLA 3G0SA 3JR2A 3UYCA 1LRNA 2J9YA 1ZP3A 4PL1A 2CU0A 3VIMA 2PU1A 3V5FA 4GUHA 3OG2A 3HIJA 1O1HA 1W3JA 4CUCA 3HPSA 3WKZA 2YDRA 5I3DA 3TA6A 3UXIA 3G1SA 3B8SA 5BOFA 2A1YA 2OZ0A 5CZSA 1F2JA 2GVLA 1M7PA 3F4DA 3EWCA 4LVAA 1XRTA 3VMOA 1JDCA 1BLIA 1DIDA 3WBYA 2ATSA 3BGAA 1TRIA 4LBRA 1JUKA 2VEGA 2TMDA 3QZ6A 1BTCA 4UXDA 1GONA 3R1ZA 3L4YA 3I68A 4CD6A 1OZQA 3V0UA 5EMYA 1NQ6A 1E6ZA 3MHGA 2HVOA 4CQAA 3QOMA 4TUFA 4PEEA 2WMGA 1IGSA 1CNVA 4YVPA 2UWFA 3CB3A 1L6GA 3CNYA 2NLYA 3W71A 4DUWA 3KBJA 1ZJAA 3CH0A 2Y6ZA 3MANA 5AYZA 1IHIA 1PIGA 1QR7A 3T4WA 2DIJA 5JXQA 1VC4A 1HN1A 4PTWA 3CPUA 3Q58A 1JFXA 1P4CA 2Q8ZA 4Z2LA 1WX0A 1K8CA 1Q4WA 4MWAA 2PDNA 1WXJA 4FOUA 4REQB 3RPMA 3VZXA 4QSHA 3ZFHA 4JTHA 1G7UA 4YVXA 1TA3B 2PEVA 3RLGA 4H6EA 4WGHA 1Q3NA 4AHPA 3P14A 1JIBA 3E6EA 1RUSA 1C9DA 1GZ1A 3IJIA 1HXJA 4UFKA 1EZWA 7REQB 3CV2A 3T8LA 2O7SA 3V0SA 3OA5A 1CENA 3CTTA 4DJEA 1TZZA 1MW0A 2VZSA 5K9XA 3TJ4A 2G97A 1F05A 1W1TA 2PTDA 4UMCA 4K8GA 3BLFA 5TF0A 4MWAE 4H9UA 1BF2A 1NDZA 1WAUA 4S3AA 3B05A 3TCSA 1OINA 1KRAC 1J96A 1G4PA 1TWWA 5C54A 2E6FA 1TTJA 1J18A 1FP8A 3EDDA 1TKKA 2FGZA 4E3VA 5C70A 4HJWA 3W81A 2RJHA 4D8AA 3GTFA 3UVIA 5LA2A 1A0DA 4JTKA 1GHSA 3EAUA 3ICJA 4B5WA 3KLKA 1R9YA 1A0CA 5BXSA 2OQLA 3C0JA 2F6UA 1XIEA 1MFVA 4AWUA 4QJ5B 2D2JA 2DIKA 5GNYA 1UR2A 2D1ZA 2NUYA 3N3MA 3QYSA 3EB2A 5I00A 5EBAA 4AC1X 1B3VA 4NSBA 3M0YA 5FD0A 1ZNNA 4NG3A 3I10A 4Q4OA 3CWOX 2C15A 1LL4A 1KR1A 3CV1A 3SZ8A 2J8TA 2E5DA 3TK7A 4A05A 1JAEA 4Z0JA 5IBXC 3VDCA 3LPPA 3D3AA 2FGBA 4DM1A 3W07A 1KBLA 2A7RA 3P67A 2CZ5A 1K7FA 3CC1A 3QC3A 4QEHA 1KFEA 2DIEA 4M51A 3AXHA 3CZ8A 1RR2A 4YTSA 3B3DA 3DECA 2QJMA 3SIMA 4JTSA 1F4HA 2ZA2A 3S1UA 3RAOA 1GOWA 3T78A 3QMSA 4LUSA 2VENA 1BGGA 1P1MA 1XBYA 2DT0A 1VEOA 3BGJA 3CZLA 1XPGA 4GH3A 1QNPA 2DSZA 1JGIA 2JKPA 3UZWA 1V3KA 1MW1A 8XIMA 5CBBA 3NVDA 1CZ1A 3WO8A 4WX2A 4I90A 4ML4A 2P8CA 4EE9A 1EJ7L 1S2UA 4G5DA 4EPBC 4RCXA 3DH7A 3WDQA 3NQMA 5D2YA 4GD0A 1W3HA 1PTGA 5D2XA 2R6OA 3ZO9A 3CJPA 1ODUA 3NPUA 4XD4A 1KBJA 3N15A 3AHZA 4S1FA 1VFSA 2PPGA 3VYLA 2OOFA 3QJAA 2AL1A 5HDRA 4X9SA 5ECUA 1AL7A 3AIBA 5A8OA 3W01A 3BG3A 1P6WA 1CBGA 1SW3A 4LS2A 2HQAA 4OV4A 4DZAA 4TXEA 1JCTA 4ZCWA 3LBMA 4AHOA 5EYWA 1G5AA 4NP7A 3A12A 3N4FA 3C6CA 4Z1YA 1VFTA 3VOGA 4XTIA 2NSXA 3DFYA 3OVQA 3QOKA 3PUEA 3M0LA 3GU2A 1X8CA 4UIOA 3WNKA 2GDUA 3U48A 1TQJA 3W7EA 1Q7QA 4DEFA 2OEJA 3K5XA 4CQCA 1XISA 1MEIA 5AECA 1ZL1A 2EF9A 2WV8A 4NZCA 3LBOA 1XYLA 3OVGA 4JIHA 2PC8A 4DQWA 2PFHA 3WLQA 1RSCA 1SW0A 2D3NA 1Q6FA 1S5NA 3LZ3A 1AW1A 3SRFA 1TJRA 4H8VA 1PSCA 3H2MA 3GFXA 3FCPA 4ZO7A 1E6RA 2QHAA 2PLMA 1JPKA 4UNIA 3PB0A 1BAGA 3I6RA 3W00A 1O5QA 1Z7AA 1HUVA 4AU0A 3O3RA 2YL5A 3KBWA 2X42A 4H8HA 4JKKA 3S2MA 4PTDA 3W7GA 1PWLA 1Q85A 5FJUA 5CZKA 3GC5A 2NLIA 2AGTA 4O8RA 1X8FA 4GJIA 4H9XA 3AICA 4MG4A 1THFD 4O18A 1Q6GA 1QO5A 3W7PA 3MUCA 4LF1A 3HQPA 3DI1A 3TNBA 2UY3A 4H01A 3PG8A 5A6KA 4O52A 2HNHA 2OMAA 3U5YA 2GQ9A 3FDGA 1UH3A 4E3TA 2Z1KA 2DPEA 1R9XA 2E8ZA 4FLSA 4KWUA 4PTMA 2F8QA 3TJIA 4KT2A 1IIHA 4M6PA 4LSBA 3T08A 1UASA 3WNOA 3GNPA 1E4MM 1AMKA 5G2WA 4OVXA 1A4LA 4KPLA 4JS3A 4WDUA 4LY8A 3S46A 1KM5A 5I77A 5CZTA 1B3WA 3PBYA 3ONCA 3TONA 1W3NA 4HSNA 3SY5A 2FB2A 4QBXA 1OWQA 1A5BA 3B03A 4GY0A 2A79A 5HR7A 4M24A 5A6TC 3W74A 4GZJA 5TD4A 1OGBA 1G9HA 3WMCA 3RFAA 3HG4A 3G1DA 4LV9A 3VE7A 3BAYA 2JALA 1G94A 3M1ZA 6PTDA 1EQCA 3XISA 2YW4A 4L9ZA 1J5TA 1HGYA 2V5JA 4S3CA 3H4WA 5DRCA 4DB7A 3KP1A 3TWBA 1KWGA 1NVMA 4XZIA 1E9YB 1GYLA 6TIMA 3ZSTA 4MLJA 4DNHA 3B06A 5CPMA 1T8XA 4E4UA 2OGJA 5I03A 1QOXA 2PLJA 1I75A 4MMWA 4A3UA 3TN6A 4IMCA 3S5ZA 4K8HA 1AW2A 1CGTA 3AS2A 2ZUTA 2WPGA 3ANVA 5EMLA 4MPQA 3W7MA 1XYZA 5ECVA 1W6TA 1M68A 2CCRA 3LV6A 4C6EA 3TQPA 2R9RA 3EMQA 4L65A 3QR3A 3GD6A 3VDBA 3LCIA 4WSHA 4AZ7A 1GGOA 3G6LA 1X38A 2DEPA 4QROA 3RM9A 3TTYA 1Z8AA 4ATDA 4C91A 2ISSA 3ME3A 8A3HA 1BYAA 1KA9F 2XVNA 3ARPA 4IIBA 3WH7A 4XZNX 5G5IA 3B8WA 4F40A 5D2VA 2ZZ1A 4C6PA 3H7RA 4GMEA 1YNPA 3IIVA 3MS8A 3PPGA 2ZRYA 3MVIA 3O15A 4PRTA 5I3GA 2UV8G 3O63A 2NT1A 4LBSA 3TCEA 2DZWA 2YSWA 3BW3A 1C93A 1WDSA 4NNCA 3W7RA 1JEZA 3ABRA 4UTTC 1XD0A 4JIRA 3RPTA 4PR4A 4DF1A 4B90A 4O13A 1EGVA 2QXWA 1WAWA 1JPDX 4U5IA 4WOQA 2OKTA 3K1DA 4WKAA 2GGHA 3ZQ9A 3P81A 3R2GA 3ZYZA 4NRSA 1ZCCA 1H7RA 3TR2A 4AW7A 4F2BA 2IS7A 1KFBA 1W5PA 1HKJA 3M4HA 4JDYA 2D24A 5I5RA 4BCEA 1TCMA 1BQGA 2QAFA 3TC6A 2E6AA 1W5NA 3O0FA 2ZVRA 3QLLA 1OF8A 1P0KA 1ADOA 4GXPA 3E0LA 1QU4A 2QUVA 2YYTA 2KX9A 2O9PA 2B7QA 3GE7A 3VCNA 3M64A 2ISDA 1JDFA 5BROA 2PDUA 1I0DA 1XM3A 4GVGA 3W6YA 4GZ7A 1TPH1 4PUUA 1GYNA 3HQ1A 3SM0A 3NSMA 2QCMA 4B3LA 4AYSA 3HTWA 3TXZA 2VC6A 2WMKA 4GXMA 3FSUA 3WQWA 1ZALA 1NP2A 4DJFD 2OZ3A 3MWAA 3KXQA 3BTNA 1ZGDA 1H2JA 2XYLA 2GGGA 4GQQA 1VEMA 2ZC1A 3WELA 3F4CA 2XTKA 1OC6A 3HN3A 4NZJA 3TYUA 1MEWA 1DTUA 4IIGA 2QCLA 3TN4A 1BPLB 1UWRA 1L0PA 4UZSA 3ZR4A 2Q3OA 6XIAA 2Z6JA 1JZ7A 4Q8QA 3DCPA 4CNOA 4HPGA 2E9BA 5HQEA 1TJ0A 3W88A 4AD5A 1F73A 1VP5A 1YPFA 2XSAA 1B31A 3V7PA 3WFAA 3D6NA 4MB5A 2C8NA 2XJ7A 1VRXA 4EX4A 2RDXA 1TTQA 1D9EA 5A1AA 2OSWA 3TMQA 4Y96A 3RIKA 1W3IA 2P3EA 1G01A 3KL3A 2JEPA 2J13A 4S39A 4DNMA 3QVQA 3IGUA 5REQA 4H7ZA 3ZLGA 3MA8A 5BWAA 4MAVA 5TNVA 2FQIA 2BVYA 3AOFA 1C92A 3NZPA 4UFLA 4C90A 1DQWA 4PMNA 1LOQA 3SB0A 1Q7ZA 1PB0A 1LWJA 1LL7A 4QE1A 4LANA 5G1YA 4AZGA 4IGHA 2JGQA 4WJXA 1WB0A 2QDHA 4HZ8A 1XP3A 3M5VA 4AZHA 2Z1BA 3M07A 1O12A 3HFTA 3KRZA 2XH7A 4F2UA 3DG3A 2UY4A 3CMGA 2B7PA 5JU6A 2IUZA 3DFOA 2I17A 2PRHA 2VGFA 4UC5A 1BHGA 3IVTA 1GKPA 1O66A 2XDFA 5F1UA 1GTHA 5CPSA 3AYTA 4Z1BA 3L0KA 1R85A 3E2VA 3APTA 1J11A 1RQBA 3LRKA 3U2OA 1E43A 1RPXA 4HU4A 4IISA 1WNOA 1OFDA 2VGBA 1XSJA 4GUIA 5DX7A 3ABOA 1TWZA 5I3KA 5AHMA 4ASTA 3WQVA 4H3DA 3WYZA 5BXRA 4CCDA 2ACQA 3NIYA 4ZB2A 4XD5A 4KCUA 4AISA 4PUNA 3R13A 4KETA 2DJLA 3OO2A 2X0YA 4W7VA 4HZ6A 3VIJA 2PWUA 2HJPA 3RCNA 2OLAA 2VR2A 4JY8A 5HWNA 5I3FA 3KTXA 2G37A 3WQ4A 4C60A 5HA7A 4Q8TA 1M01A 3RM4A 2VVNA 3PJUA 4M19A 2PZNA 1DORA 2A0NA 2EKGA 3D47A 3WD4A 4TO8A 1VYRA 1SJAA 2VRKA 5H8MA 4AAJA 4O28A 3G1XA 2EBNA 3LZ5A 3GVQA 3OBEA 1SGJA 1W54A 1PZ0A 2ZE3A 1V3MA 1C29A 3OZOA 4AHQA 5AVHA 3BCJA 4MIMA 1M03A 1ELSA 3PN8A 2J7GA 1V7YA 2OCZA 5GJPA 3GTXA 1W31A 2WVUA 3C56A 4S3EA 4H00A 3VIFA 2GJNA 2J4GA 2WSRA 2V2CA 2H3BA 2DVXA 2FZMA 2D69A 2DJXA 5EMUA 3HQOA 3TC7A 4MTVA 3IAQA 3CS2A 2E5BA 4C6MA 2X1IA 3SCPA 3UNDA 1K77A 3A9BA 1IQ8A 4LU0A 3MC5A 3UPWA 4NL1A 1RD6A 3I7RA 3MSGA 2P5NA 4PCTA 4L7ZA 2VFGA 3XINA 3IUDA 2NXGA 3VD3A 3H22A 2PGWA 1KQYA 4ERGA 1E1EA 8XIAA 2ISWA 1L6FA 3QV6A 3RMJA 3W27A 1DBTA 1X1ZA 3LNMA 1JULA 3Q65A 1EGMA 1U33A 4L4OA 1PL9A 1HL2A 1W9UA 2VFEA 4BJHA 4ECLA 1PX4A 3SN4A 3F03K 2WMFA 2WJFA 4IPIA 4BWLA 1R3YA 4BR1A 3B9NA 3OQ8A 3GC4A 2WCSA 3BAWA 5HNRA 1PDYA 3VGHA 2JK2A 1EJSC 4JTLA 1YPIA 4RZBA 1H5YA 2FVMA 2H9AA 3C3NA 4A6GA 4WOZA 2GJRA 4IX2A 3N29A 2XU2A 1EC7A 2JF7A 4CNTA 3FJNA 1WQ5A 2QJJA 3ZVHB 4ATLA 2VT0A 5I3IA 1VPYA 2Q8LA 3THQA 1T5AA 2E1WA 3HV9A 5LIYX 1MVYA 4KMQA 1XUZA 4DJDD 1PX8A 3PB2A 3WQOA 3O06A 4ZOAA 2WCGA 4LWWA 1B54A 1XLEA 4CQBA 1B4KA 2A6NA 4LGXA 5A8QA 3A5VA 3VUPA 4GVFA 1GOMA 4S3GA 4JNMA 3VNYA 5A6SA 3CEPA 2F6XA 2GOUA 2WVTA 1A5CA 2OWXA 4HOZA 3GUWA 9XIAA 1L9WA 3DESA 3DC8A 3NTYA 4YS1A 4LVGA 1WZKA 4CKQA 2GFTA 3LPOA 4RJEA 5F2MA 3M0IA 3U3HA 4LT9A 4JTJA 1UA3A 4FIQA 2OT1A 2WWDA 4GHRA 1A4MA 3W2NA 3W7LA 3TTEA 1W2PA 1MSSA 4QDPA 2Y1HA 3OP2A 4F3HA 7ODCA 3WQFA 2OEMA 1PS9A 3CL8A 3WBWA 4OIFA 3KHDA 3SW6A 4Z08A 1U5HA 1K7EA 2VP8A 2F84A 4W85A 3W2JA 1ICQA 3UXLA 1E4IA 5I06A 4U2ZA 2CHRA 5GNXA 4NT0A 1E4LA 1QUMA 1UD5A 1JJKA 3GUGA 3N9SA 2E25A 3IUIA 4O0QA 1T96A 1QPOA 4Q8VA 3SUWA 2GK1B 3C61A 4GQBA 3WNPA 3VD9A 3CK5A 4FMVA 4AY8A 2QULA 1GT8A 3TYBA 3DYMA 1S2TA 3IIOA 3QSTA 3G1YA 1L6WA 3OHMB 3I65A 2CETA 2X1RA 1TPVA 1KV8A 2VYOA 1MXGA 4X60A 1XX1A 3QHOA 4RE3A 1TZ9A 1P7TB 4DO4A 3HZ3A 1OFOA 1RD5A 4UTHA 3ARRA 4FLOA 4KWWA 1PZ2A 3PBGA 1K4HA 4RX0A 4KCWA 5I0DA 5C0QA 3MSYA 4ORIA 2E9MA 3W24A 2ZRXA 4IIEA 3R79A 2QZRA 3KBSA 3U7VA 4M8UA 1Z41A 2ABAA 3BW2A 4AC7C 5B7ZA 1XIJA 2WO5A 3LTYA 5BW6A 1SO4A 1W5MA 4PULA 1IWPA 4DIAA 1ECEA 2BS9A 2UZ9A 3SSJA 4O10A 1EWEA 3BK0A 5J04A 1NOWA 3JZUA 4P8UA 4O4WA 3VNKA 1W5OA 3STEA 4LNYA 4WIWA 4GIAA 1QBBA 2UY5A 3TTQA 2ZWYA 5A8GA 4PEKA 1HKKA 2Z00A 1KBBA 3M6YA 4NY2A 5CCZA 2RDWA 2YBTA 3IWPA 4XAGA 2EHHA 4MZ1A 2INFA 4WQ6A 1YRRA 2EG8A 4UR9A 6REQA 2VC9A 3FJ4A 5H2ZA 1TJ1A 5LZLA 1X1OA 3DENA 3B4UA 2NWRA 4PB3A 1K4GA 3QGKC 3CV6A 1TX0A 5I3JA 4D6DA 1TV7A 3HGJA 5EY5A 2XSBA 2GWNA 1M3UA 2CHNA 1XGZA 2FHBA 1Q2RA 1JF6A 4AXKA 1YHTA 1CX9A 2PDFA 3CASA 4W5ZA 2AKMA 3QTPA 3TR9A 1V8EA 2BXVA 4G7EA 1I2NA 2V38A 3T09A 4HA1A 4AEEA 2PP0A 3P0XA 3AWOA 5C9UA 1AW5A 1S5VA 4FO4A 1EF3A 4TV6A 4WDWA 3T1GA 3K30A 4WVXA 2QIWA 3W25A 1S2VA 1E5JA 4GPNA 2VWTA 1V0NA 3SR7A 1HIZA 1R9ZA 1R46A 2X09A 3OBKA 2G41A 5C9RA 3MSRA 4XTDA 2I9UA 1JYWA 1XIIA 3LM3A 5H8UA 4JKMA 2WXDM 4JYDA 1X1NA 3CQIA 2ALRA 4PCNA 2VR4A 2WM0A 3MU7A 2EO7A 4CEXC 4JHMA 4QS6A 3ARSA 1NDWA 5EFDA 1X98A 2PDWA 2ZUSA 3F5KA 2CLPA 4N02A 3S9YA 3LM7A 3S2NA 2ZKMX 1TRDA 3MWCA 4W8AA 4C6DA 2OWWA 4QE5A 4H19A 3SCQA 5I3HA 4DJDC 5A2CA 3UJ2A 3P61A 2H6RA 1ZBVA 3VNIA 3N14A 1KKRA 3ITCA 2DT2A 4ACZA 3AAMA 3WH6A 4WCJA 5HWJA 1TPWA 3LA4A 4NIRA 4AIEA 3TYAA 5CJNA 1W1YA 4QLKA 2VQUA 4LB4A 1W9PA 3AISA 1SSDA 3R6IA 4FX7A 4BWLC 3QY7A 4GVHA 1Z89A 2F9RA 1KFLA 1US2A 3Q67A 4Q6XA 1HKIA 2A6LA 4KGJA 3R12A 3XIMA 4TTGA 1G67A 2WCAA 3NVTA 3DKJA 4HIBA 1TTPA 4DN1A 1SR9A 3MP3A 2POTA 5FAGA 2E0PA 3ABZA 4RNFA 2XN1A 3MJMA 3IK2A 2VURA 3OBAA 1IZJA 4UWMA 5JQ9A 1PE1A 1FWGC 1Y0EA 1XBXA 4GG9A 3SQMA 3UG8A 3W7IA 1LG1A 3M0XA 4QLJA 2YIHA 3A6OA 4Y8EA 4LAUA 2CIPA 3HFYA 3VM7A 1TV2A 5DCDA 4IG2B 4C6FA 1J8VA 2AQOA 3MKKA 3E0IA 3TZNA 4I9JA 1FWFC 2WC7A 1E9ZB 3DXIA 3WLLA 3EMZA 1TUFA 3RO6A 3TLQA 4DUOA 4F0SA 1PKLA 2D23A 1SPQA 3PTKA 2DZUA 8TIMA 2XSXA 2A3HA 4URIA 1UP0A 4IM4A 5GJNA 4NZ3A 1YKWA 9RUBA 1EC8A 2O56A 1JAKA 3TROA 2Q02A 2Z28A 4BY3A 2Z24A 3TYDA 4IIDA 1X96A 3DEQA 4J3WA 1XLAA 4L1XA 1C8QA 1JCYA 2P0IA 5D8WA 1X7IA 1TUXA 2CPUA 3KM8A 2QCDA 3VGDA 1AMYA 4OBTA 5EB8A 3NNTA 1FRBA 3W38A 1ZY9A 1NH6A 4BI5A 1N82A 4AMAA 1VAHA 1AZ2A 4B91A 2YXOA 4RR4A 3MZNA 5AC7A 1AH4A 4QFUA 4GH1A 4H9VA 1UD6A 2C71A 2ZRZA 1XH0A 3THCA 1FOBA 3IV8A 3SSZA 1ZUAX 5XINA 2JBMA 3OLGA 2CBUA 3TAOA 4CD5A 1I60A 2GVJA 1RCOB 1Z44A 3CQ0A 1KM4A 3P82A 3PJWA 3S5NA 1NWTA 4CN6A 4WD0A 1IIGA 1ENUA 3IJ6A 4NAFA 4W84A 3MP4A 4JTUA 4UQDA 2Q71A 1VHNA 3OVPA 3G18A 2F61A 3QSRA 1NEYA 3AU6A 3OLDA 2G96A 1AK5A 1W8GA 4Q8MA 2BG5A 1LL6A 4DBWA 1WOAA 4CU8A 3G6MA 4E38A 2X0HA 4RE4A 2D0HA 5CJ5A 1Q6LA 4LCQA 2HRWA 4B2DD 4FHAA 4GO9A 5H8PA 2OSXA 3KRSA 3RJXA 1L2UA 2Q01A 3FKRA 5E0FA 4MKSA 3MTWA 4OUIA 4YCPA 1QT1A 2Z1VA 3FEQA 1RZMA 2BMBA 3BZGA 4QG8A 1LQAA 4KWOA 5J5DA 1GZJA 5HR6A 1XRSA 4X22A 4XKMA 1ISZA 3GDTA 5I6SA 2QMJA 1N2VA 3C86A 1KFJA 4ATWA 1JNDA 1OJXA 3IJQA 1NF0A 1M5WA 5JIPA 2J62A 3KS5A 4AVOA 6REQB 3NOYA 3WLOA 3M6DA 4Q7BA 4J4KA 1E71M 2QDEA 3QQ0A 3VNLA 3KVJA 2J77A 2NQHA 3B8TA 1C8VA 1TVLA 2WJZA 1DPMA 1F6KA 4UCFA 4ICMA 4U4MA 3FHQA 3VD7A 2TODA 4B5SA 1NDVA 3W85A 3WY1A 2QYGA 4CQ9A 3UXDA 1B57A 2AAMA 3TQ0A 2JEQA 2TSYA 1XLDA 1KGWA 2V8ZA 2Y7EA 1PV8A 5D37A 3USBA 1QPNA 3L7RA 3BSGA 1EDGA 2G3FA 4IHCA 1R2RA 1C8XA 4PCFA 4LUTA 4KESA 2ZZ2A 1TFVA 3L2MA 3PBMA 4QJ4B 5EBUA 3LI1A 4EOUA 4JICA 4CNUA 3LUTA 3UJSA 3V35A 1F07A 4XAPA 2GVYA 3KL5A 3HMJG 1HJSA 4WUIA 4R7WA 6CGTA 3BGGA 5EU9A 5BRBA 1CCWB 4ONVA 4RKAA 5DEZA 1O4UA 2ZUWA 2INEA 1OX6A 1E9IA 2OOGA 2OKOA 3N2TA 3N6HA 1BYBA 2XH4A 1VD6A 1IT8A 2G8ZA 4NKCA 3NQVA 1PCWA 4ZEPA 3WEOA 4HK6A 4PUKA 3A23A 4Q8UA 2E7FA 2PDBA 3L4XA 3QHMA 4HT3A 5K4ZA 4DYJA 4O54A 1AH3A 1H7WA 4GJ1A 1J0IA 2X2YA 4YTRA 4FX6M 1NP0A 3RU8X 5A69A 4DAIA 2PD9A 4W4QA 1XQKA 2WKGA 3DI0A 5DMLA 4S2BA 2AQVA 5K7JA 2WMIA 5LGZA 1BVZA 5KEZA 3NQ8A 4KIRA 3EXSA 1KXQA 4NAEB 3LMZA 4A8LA 3H53A 1V77A 2WPBA 3OVRA 3RHGA 1IR1A 4NU7A 1SVDA 1MRAA 3WQEA 5FJRA 5G4HC 3V1HA 2FJKA 4CVWA 4AZCB 1KTCA 1TG7A 1KO0A 1H50A 1RVKA 5BZAA 4AZ5A 4HB7A 2F6KA 3SY1A 2D73A 2NQ5A 2I5GA 4ZMGA 3NGFA 4JIIX 2WVVA 4UB9A 2Y7FA 4EPDC 4AD0A 3AJXA 1E51A 1K9TA 3SGUA 1OC5A 1I1XA 4G2DA 2Y62A 1QAPA 3T55A 3BC9A 2Y8KA 4ZQMA 3WLHA 1MFUA 3PZQA 1G69A 1GORA 3VIPA 2CBVA 1OIFA 4GUFA 1UW9A 2XWEA 1HO1A 3R10A 4Q4RA 2I5IA 2V82A 1V02A 3ZLFA 3U4AA 1PIIA 4FR6A 4B16A 3EOSA 5CSUA 3N2OA 5ABHA 1JD9A 3AIEA 2WKJA 1ZAHA 5D09A 3RGTA 3E96A 2NQJA 4KFPA 5H91A 4I7WA 3OB8A 4H8NA 3ARQA 4HOXA 4YYCA 3W86A 2WK2A 3WSUA 3CPGA 1GPFA 1TB3A 4UTKA 2OG9A 3W7CA 4JXCA 4Y9OA 3F1QA 4WKFA 1MUMA 2EXOA 2X41A 2IPWA 5HUOA 4C1NB 2VX5A 2Z25A 1GKQA 1HKWA 5EA9A 2R14A 1E4NA 4AWTA 1R38A 4K39A 5GVJA 2QUNA 2CLEA 4JYFA 4L6DA 1CGVA 1S39A 1TR9A 2FFCA 2XM1A 4R9OA 2YZRA 3NM3A 5DCEA 3C8NA 4YMZA 1PKMA 4DYKA 1TPFA 4OUEA 3O7UA 1ZPTA 4NZFA 2WZEA 4OOZA 1FWNA 4C7DA 4X9YA 3W23A 4UQEA 3KTCA 2YL8A 1U1JA 3U7BA 3CIWA 3EWZA 3SRHA 2HPMA 2NQ9A 4S23A 4R9XA 4QRNA 3N25A 4ZSTA 3VDAA 3IIZA 1EHNA 2NVCA 3FA4A 2CC0A 2PDIA 3ZXWA 4ZQCA 1GVIA 4A8NA 3OIHA 7REQA 1V0LA 1A3HA 1F4AA 4FEZA 4NILA 1QHPA 3HGSA 3OZYA 2DW7A 4MY8A 5A94A 4GVIA 4ZQOA 2DZTA 3WX7A 2GQ3A 4LYQA 5B7YA 2ISFA 5A2AA 3DFPA 4PMQA 3QF0A 1JZ5A 1A53A 4HYVA 1GG1A 2D22A 4DXXA 2TAAA 3LCFA 1XC6A 3PUGA 1UKQA 1R3RA 3V4BA 1GVQA 3QC0A 4XZWA 3PS7A 4IL2A 4XO6A 4EAMA 3EWUA 4WHBA 4G7FA 1GHRA 1Y65A 4XX6A 2J24A 4Q4KA 2PP3A 1Q7MA 3L4TA 1XD1A 3CXOA 4JKLA 3VGGA 3KWXA 3VGBA 1UWIA 3EKGA 3OYZA 3U5UA 2CLIA 1UR3M 1XSKA 1QATA 3A13A 5AYIA 3N18A 5T26A 2Y89A 3V1PA 3EPOA 3R8GA 4DY1A 3B0XA 1ZBKA 1JI2A 1OCNA 1QNRA 3TU9A 4UCGA 4GABA 2HE5A 4YTQA 1XCWA 3LCXA 3SCSA 1HL9A 1SSGA 3S6TA 1PTAA 3N9KA 4JTIA 3HGOA 1JCXA 3I6EA 3BJTA 1V0KA 3MW7A 1PCKA 4XZHA 4P7QA 5CBJA 3LHWA 1EF2A 5LGXA 4QG9A 3VIGA 4XB3A 5LNVA 4CN1A 3DERA 2ZRUA 1YTDA 1QBAA 3QLDA 1FWJC 1OFEA 3RR1A 3APYA 3EDKA 2ZUVA 2AQWA 1CECA 4GYKA 3T8QA 5IDZA 3TOYA 4Z2KA 4IWWA 1UR9A 1D3CA 4IQJA 1TMHA 3WLNA 3M9YA 4NVTA 1I8JA 5AC4A 3SQLA 3H23A 1TELA 3A4AA 3V0TA 7XIMA 3EWBX 3N6QA 4HK5A 1DXIA 1ZQ5A 3YPIA 1EP2A 5FCZA 4C6NA 1AQ0A 2OX4A 3U9IA 3ITGA 4JIQA 4Z2HA 3DHFA 1L2QA 1Q65A 3WLTA 4L1WA 4QAWA 4WEVX 1GEQA 1L6YA 1OYBA 1W1A1 4Q8NA 2WNNA 2QJIA 5FF0A 3NQCA 4LCSA 4J7RA 3BQ5A 3MP5A 2QPSA 4GUGA 3POCA 4PL2A 1EIBA 3J7HA 1NAL1 1UZHA 1V08A 2CLLA 3QHNA 4Z2GA 2PC4A 5TAOA 1R7AA 5T8GA 4A3HA 4RPQA 1SJCA 1QWKA 4RW5A 1UROA 4ZTYA 3PSVA 3V36A 3EX1A 2VX6A 5ENLA 3LHTA 1KM6A 4V2XA 4UOQA 3JS3A 4KRUA 2W0UA 2AOSA 1J6PA 1YEYA 4B4HA 1YQ2A 5KTLA 3AJ7A 2V2DA 3MBFA 4R88A 1EX1A 2VRQA 3AFBA 3AYSA 1KXTA 4JEJA 4WY0F 2GUYA 4YPJA 3B9AA 4NI8A 4QTGA 3B40A 4A8IA 3NO3A 4CU6A 1H5VA 3F2BA 2YCIX 4DWDA 3A47A 3E12A 1O5RA 3ZMRA 1ISWA 3DGRA 4BQ4A 1TWDA 4KWVA 3W37A 3NSXA 1CGXA 5A95A 3E0VA 3UG4A 2RGMA 1DQXA 4V1YA 4REQA 2PDQA 1FH9A 3FY1A 5CZ0A 3HG2A 3O6YX 3W1XA 1IZKA 4KEMA 2ICSA 1VBJA 4J3VA 2ONEA 2NX9A 4HPXA 2PI6A 4A29A 2VRJA 4LS1A 4I7VA 4X63A 3WLRA 3WENA 4HPHA 3VMNA 3R8RA 4F0MA 3RCMA 1GZGA 4C6BA 3FGCA 3IVUA 3EDFA 4Z2JA 1D3HA 3QEZA 3WLMA 1SYTA 3EPNA 1K70A 4PTXA 1FWCC 1Z3NA 3P0WA 4UTJA 4KERA 3THUA 2OYKA 2ACUA 3R0DA 2E4TA 3KHJA 4QGCA 1V3JA 4LYPA 5FF7A 1K6AA 2OB3A 3P2VA 1LLWA 3DX5A 5HQMA 3BQ6A 1GQLA 3SGZA 3ARWA 2P8BA 4JDBA 1BWLA 2NW0A 1H61A 1P1XA 4HD5A 2YKKA 4U33A 1IGWA 1V6TA 1JYVA 1SZGA 4LNCA 1NDYA 3HJZA 3WNMA 1H7OA 2I56A 3BE7A 4RL3A 1GVOA 4PB5A 1TR1A 1YMYA 4FNSA 4IUGA 1FDYA 1BVNP 2HV5A 4F0HA 3LMYA 2X7VA 3UWVA 5E09A 1JCLA 3UESA 3F5LA 1OC7A 5KZDA 4PUMA 4H1ZA 1VF8A 1WXYA 3H70A 5ABFB 3GR4A 4ZQNA 1XLJA 4B3ZA 1Q6EA 2W92A 1IV8A 5JH1A 2Y5SA 5M17A 4KRZA 4D8LA 3W2UA 1BG9A 1W2VA 1VPXA 4QISA 2HZGA 4X2PA 1LBLA 3GG8A 3DDMA 3KRUA 2PE4A 5DY3A 5C9WA 1OY0A 1WYIA 4QSFA 2H8ZA 4HMEA 5E70A 4RDZA 5SWUA 3GNXA 1VCGA 1XLKA 3I4KA 5E6ZA 3MUIA 5DT7A 1C9WA 4MNMA 4JHZA 3WD0A 3TA9A 4DJFC 1JYXA 5DF0A 4LB3A 3NZQA 2VVSA 3GW0A 3B4YA 4RLIA 4QHRA 1JXJA 2QF8A 3NDZA 3KZPA 5DMMA 3G1FA 2WJDA 1K8XA 5CPTA 3T2QA 1MNZA 1SU5A 4QP0A 4J3SA 4H6QA 1TV3A 4M6QA 4TR9A 2JFEX 3NO1A 3W2KA 2GSEA 3IANA 3P60A 2IQ0A 5DO8A 3LU2A 3VKDA 1J0ZA 4N4PA 2RHGA 3QMRA 1J4EA 1XIGA 4G9PA 2BX7A 3I3BA 3CUHA 1ITXA 3UXAA 3CM4A 1KCKA 5LYRA 1HX0A 4HN4A 4CGTA 4NI3A 5DMNA 4FNUA 3QQ1A 4HSOA 4MSSA 4JN6A 3DBNA 3S1WA 1XLCA 4GC3A 5AZ1A 3SECA 2R91A 2WZHA 1SFJA 1SZEA 3C2EA 4WGXA 4G7EB 1BG4A 3W7JA 3W53A 2Z26A 2RUSA 3U4FA 1FKWA 3ARZA 1VRDA 4FX8A 3WDHA 4OBSA 4BQ2A 1GOIA 2J7BA 1UP3A 2X0SA 4LUTB 3IEBA 1YBQB 3ZS4A 1R8LA 1VFMA 1T40A 4RDYA 1F8IA 4JTDA 2OSYA 3MV01 4LCRA 1VKFA 3CQHA 4JTAA 5LNSA 4GXWA 3SJ3A 4JZ5A 3NQBA 1Q13A 1VGAA 2J47A 2AAAA 3O6DA 3G8EA 3RILA 4W7UA 3AIQA 1YXYA 5F4WA 3WN6A 2YJQA 1AFSA 3Q2DA 1WDWA 3EZ4A 4C5ZA 4C7FA 1OG6A 2OQHA 4L64A 3T6CA 2PDPA 2C14A 5CLWA 2WSQA 3URNA 2VZVA 4B5TA 2ZDSA 2QAPA 2CZEA 1OX4A 4K37A 4O8AA 3VZYA 5LNRA 1XV8A 3HMCA 4UTTA 2D2HA 1M1BA 3CAQA 2ASHA 3PZIA 3AHXA 3LERA 4GKTA 2Y8VA 2PA6A 2ZVIA 2J9XA 2PWFA 3VIHA 3N2BA 5MF5A 4XK2A 4GLEA 1D2KA 3LHVA 3U2CA 5HNTA 1YLVA 4TVDA 3SDOA 3TDFA 3BG5A 2JQXA 1J2BA 2EPMX 1DJNA 1QNOA 2CXEA 2PWGA 2J8FA 3H55A 3AIRA 3TYEA 1E3ZA 5T9BG 3WQ6A 4GK8A 1VZWA 3LSBA 3DHPA 1QNSA 3CWHA 1M7OA 3C2FA 4M80A 3T7VA 3T0CA 3U2ZA 5CSRA 3LV5A 4NNAA 2DV0A 4H2CA 1OABA 3C52A 2YDSA 4W93A 3W73A 3NL6A 4N42A 1ITCA 3DAQA 5HJYA 4RNHA 3HJEA 4ZE4A 1RH9A 4A2RA 2OWCA 1C91A 4FXFA 2FMNA 1SO3A 1W17A 2O0TA 4XBSA 3CO8A 3WDJA 3QGVA 3AMKA 5EKYA 4ICNA 3SI9A 3N2XA 2EJAA 3MI2A 1SJBA 2VCBA 1M7XA 3PZVA 2QVHA 2YGYA 4ZFMA 1QNQA 1UJPA 4W86A 4LUSB 1HGWA 1GJPA 1TPDA 1DV7A 3C2RA 1JG9A 3VFLA 2XIJA 4JY9A 3GG7A 1F74A 4FNRA 6TAAA 4QDMA 2PGFA 1EC9A 2FFIA 3LTSA 1V6WA 4QXIA 5FEXA 1EKOA 3E49A 2GSHA 3QBUA 2PWHA 4GO8A 3DHUA 2ZDRA 3PG9A 1ADSA 1XINA 4LEQA 4DPQA 2F7FA 4P7NA 1FUYA 2WBKA 2ALDA 4MVAA 3RLVA 5LA0A 4ML9A 4BEUA 1DWFM 2PTZA 1XIMA 2ZX7A 3UXKA 2XGBA 4AX7A 1OGGA 4O1EA 3BV7A 2TPSA 5BYWA 1RK5A 4FK9A 4D1IA 4ES4A 2E67A 3LHZA 2ZZ5A 1UUQA 3IJLA 1Q6DA 1S46A 1QW7A 4LAMA 3UR8A 3W1UA 1F6YA 2MANA 1OYAA 2PDJA 5GNZA 1WZMA 2ZZ4A 3R5EA 1OF6A 4U2YA 5CAHA 1RY8A 5IRPA 4W8BA 4AIBA 1AL8A 3WEMA 1A5NC 4O1BA 3GR8A 1OVDA 1P0NA 4MWAD 4HCHA 2VO5A 1OADA 4MY1A 3G1HA 3P8IA 4NHVA 4HU0A 3S83A 3PSWA 3WF2A 3EYPA 2A5HA 3WJWA 5FJIA 1EWDA 2WSPA 1R0MA 2YW3A 2GGJA 5LA1A 1EUAA 5CPOA 2WKLA 3KCOA 3GS6A 1LQ0A 4D8ZA 3R8HA 1SQ7A 1VIWA 3N4AA 1S2CA 2QPUA 3MUZ1 5AYXA 4C6QA 2P76A 1K8YA 1OEPA 4NJKA 3FVDA 1V02E 2QCDB 3RM8A 1Y5VA 3ANUA 3L68A 3O8AA 4E2BA 3QZEA 2OGYA 5KINA 5IDIA 1GK8A 2PP1A 2E68A 2VEKA 5L6UA 3W1PA 3BCDA 4MM1A 1E0XA 4JFUA 1Q8JA 5H1WA 3OJGA 1OD0A 3FDKA 3WD1A 3LXBA 4ACYA 1VJSA 5LIWX 3E02A 4CD8A 3T0DA 3R43A 4LYKA 5JMUA 3GQYA 3VO0A 1XHGA 1SFTA 4RUBA 1JUBA 1FCVA 3AHYA 2V6AA 1J2WA 1OK6A 3VPLA 4AH7A 4O0ZA 2Q3RA 1AJZA 4LF2A 2BV9A 3P7YA 3I6TA 2QJNA 1KM3A 1E9LA 4KCVA 2FHCA 2DY3A 1W32A 2C1GA 2VGIA 1S5MA 4QJ1A 5HBFA 1UJQA 3KDNA 2ZUUA 1IWAA 1OM0A 3M0ZA 3BLOA 3THDA 2FYMA 3UY8A 1QPQA 3V5OA 3W7QA 3DFQA 1PIFA 2Y7DA 1Y8BA 2WZMA 1EUNA 3WK0A 4B9ZA 1FBAA 4L5ZA 5BU6A 2C18A 3B9OA 1CXFA 1KBKA 4AG0A 3GFZA 4GGBA 1E40A 4GYJA 3MJYA 1UBSA 4JTRA 2NSOA 4RW3A 3CMJA 4UQAA 2Y8UA 2IXUA 3ZJKA 2CERA 4AWEA 3BDKA 3KFTA 4KCTA 4BS0A 4L4PA 1BKSA 5FIPA 3RLUA 1TE1A 3O6AA 3UR5A 3H2NA 1OFAA 5FEPA 3GDKA 4DX3A 2VEPA 4ZB0A 1SUXA 2CLKA 1Z32X 4HNNA 3RX2A 3WDIA 1TCDA 1GVFA 1WDRA 1KRBC 3CT2A 4Q22A 1XG4A 3C5QA 1KCLA 5KMYA 2BP1A 3CUGA 5ABEA 2HVNA 3NPWA 1W0MA 1EJWC 2YXXA 2XH2A 1CW2A 4HJFA 4HNOA 3SCNA 3LLDA 3SCUA 5BWFA 1W56A 3GNNA 4MNKA 2QNEA 4GQRA 4ZO6A 4IP5A 5HXMA 2CESA 4D6FA 3PTDA 3S1XA 4LVFA 3RMEA 3L4UA 4GX9A 5C6MA 1O5XA 1RJQA 2JKAA 3L5MA 4F2TA 3SRKA 2BY3A 4QM1A 5E0CA 1FKXA 4X61A 1OFQA 1KXHA 1R3TA 3TP4A 3VU2A 4PZVA 1D8WA 3FOKA 1LF1A 4BA0A 4IPPA 4D6CA 1DIKA 2Y61A 2OZ8A 1W3TA 2W91A 1P0EA 4K3ZA 1EJXC 5C71A 3CHDA 1YDYA 3MI6A 1FDZA 4Q4PA 4DPPA 1R47A 2DDXA 4H9MA 1UPMB 4KFOA 4H9ZA 3HA1A 3FNDA 4GGHA 2V3GA 3UG5A 2VHLA 4PFHA 5DCBA 2J7CA 1E1FA 4Y7EA 3VDHA 3A3HA 4S2CA 1KM2A 2DSUA 3W28A 5CC5A 1R86A 5AKQA 1BRLB 2Z1XA 4MGGA 1QXLA 4D2JA 3T07A 4ILSA 3EXTA 3N19B 1KTNA 1EJVC 4QIUA 3S3GA 2ZADA 1VBGA 5AY7A 2PTWA 5REQB 5FKYA 4DJFA 1E70M 3W72A 2RJGA 2X30A 4AZCA 1JXKA 1VFUA 1CLVA 3AUJA 2Z0IA 4PYSA 1UQYA 2GQ8A 1A5AA 4U3CA 4OOUA 3HM7A 1YE4A 4GWEA 3FJLA 2WMIB 1HT6A 2WJEA 3WK1A 3HF3A 3KBNA 4PUDA 3BAKA 1NU5A 4XWUA 4D6IA 1FWIC 4FAMA 5C2GA 4JTTA 1GQJA 3LRLA 5CGTA 2GWGA 3TN3A 1JDAA 1E56A 2VZTA 5G4WA 2EQDA 3OGRA 4N4QA 5D9PA 1LYXA 2VFDA 3VOFA 3EOEA 1CEOA 3RRXA 4EWND 6ALDA 4Y9PA 3BLLA 4O53A 1WP6A 4MYXA 4GC4A 4A21A 3LGGA 2FZ9A 4ACZB 3N4EA 1LT7A 3RPDA 1YPXA 4CLMA 1W8SA 5HULA 5I2UA 3FN9A 2DT1A 2YFNA 2ZUNA 2ZXAA 1F76A 1MDRA 1FWHC 1H41A 1WXZA 2XVKA 3GVVA 3KOWA 3MMWA 3QTGA 1HJVA 9XIMA 4IFKB 4OBRA 4H4IA 2R94A 1KKOA 3AROA 1K9EA 1UWQA 1RK6A 3W84A 1CB2A 4ALDA 4BQ3A 3WF0A 1H62A 2J74A 4MDPA 4HU3A 3URBA 4E4FA 4YJ5A 4KFNA 1VBHA 3UZZA 3O2LA 3CWNA 2QV5A 2J7EA 3WQ8A 4YCOA 2Y63A 1W3KA 4C6LA 4XKYB 1QI5A 1PUDA 2WYSA 1V5XA 3CYJA 4WRHA 5K3VA 1CPUA 2V2HA 1KV5A 1BXNA 3ZM8A 4FNPA 1MZHA 4IIFA 1R87A 1FTXA 2VFHA 1E0VA 4HA3A 2DW6A 3EOLA 4OQVA 2VM8A 1GNXA 3VIIA 1DJIA 1GJWA 5TQLA 3QY6A 4XZ9A 5K2ZA 1W9BM 4UTLA 2C0AA 3L65A 4DZHA 5M03A 3Q94A 1Q8AA 2BVWA 4PA8A 1XDMA 1LBFA 3V5CA 4ZOBA 2O9TA 3UW6A 3PPCA 1UZ4A 4WY0B 2OTDA 1YDNA 3G5EA 4WZHA 4DO5A 1GOQA 2CLFA 3FYPA 3M5XA 3T0AA 5CGMA 3ITYA 1OCJA 3BOFA 2ZCGA 5BXTA 3UT0A 4ADSA 3TW9A 1RLDA 5GJMA 4OT7A 2E09A 3GXPA 1JRCA 4HQVA 3GDRA 4HCLA 2I57A 1Z42A 2RAGA 5HWMA 3WK2A 4X0NA 3ARYA 3W83A 5K4XA 4WR3A 4S3DA 2CEQA 2CXGA 4DAFA 5HOSA 1BYCA 1DJZA 5BRQA 1S2WA 3R4IA 4OWGA 2FH6A 3ZJ7A 4TOQA 3OEXA 1Q6QA 2UY2A 3C0LA 2DSKA 1E72M 3ARVA 4M81A 1U1UA 3R58A 1NIUA 4S38A 4Q3MA 1KGXA 2ZZ6A 6A3HA 3QXBA 4HOWA 5DXXA 3K4WA 3GIQA 4O16A 2G4JA 3OZPA 1HKVA 4MZYA 3WQ5A 3W1TA 3BMWA 2BVTA 6ENLA 2X40A 1X6LA 3W1AA 5I23A 3E3HA 1H1YA 2NV9A 4DF0A 1W9VA 4YWIA 3AU2A 3GVWA 4JQAA 3RK8A 1X39A 3TE9A 1H11A 3MCOA 4GCAA 3ATZA 1PX3A 3G3MA 5HANA 4HCDA 2QJGA 3GNOA 4KW2A 1JZ3A 4JTCA 4LRSA 4EK7A 1HVQA 3FXYA 4R34A 4N9EA 4FP1A 3SBFA 2FTYA 1SO6A 4AUBA 3TN5A 1W1ZA 3C2OA 2AKZA 3WH5A 4CCCA 4BI7A 3E74A 2WMJA 2IPFA 3L5AA 2GVEA 4IIHA 4FIRA 4HKPA 3A9IA 1CXHA 3LXAA 4QE4A 4AQLA 1LWHA 1OBAA 5A8PA 2J7FA 1J0JA 3BLPX 1FWAC 2NV1A 2Y88A 1QASA 1QJWA 1TWSA 4HNUA 2BB0A 4H7CA 1XSIA 3G2GA 2VDGA 1UWAA 3MDUA 2EPNA 1LCOA 1IF2A 3CMFA 4M3PA 2FPVA 3L66A 2XN2A 3M5YA 2XG9A 3QZAA 4US5A 3CAWA 3CUJA 3GW3A 4DRSA 1W9XA 1PHWA 1O7AA 3NG3A 4IQLA 2W9MA 4Q4MA 4AF0B 4ZZ9A 1O95A 4OKDA 2Y24A 1KLZA 5AZ0A 4EKJA 2BGQA 3R11A 4RV8A 1QI2A 2CZVA 1DJYA 2TYSA 1XFCA 3OA3A 1JF5A 3WLSA 2BHZA 3UPMA 4ZO8A 1XGDA 2BXZA 2QCEA 5LHEA 3GFYA 3H2CA 3RNDA 5CG0A 1QNVA 1BFNA 4UTFA 4RNJA 4NXKA 4DBEA 2PDMA 1RQHA 1MDLA 3TUUA 1IEVA 3CZEA 4QX4A 3WJSA 4IMDA 2BASA 2C1HA 4OE7A 2FJUB 3A3WA 2J78A 2W66A 4EPEC 5D38A 2EEXA 1AJ0A 3EB3A 2WC3A 1DXFA 3NEHA 4GACA 2FDSA 4IXHA 4O12A 3AXKA 4C5YA 1OGSA 4ORMA 4GNKB 1W9DM 4PMXA 4I9TA 5JBFA 1BF6A 4QQUA 1MXDA 1WDPA 4P7RA 2YL9A 1IEXA 1QTWA 4EAYA 3P62A 3ABQA 1DTNA 1FWBC 3DFNA 3WMBA 4J1OA 3AZRA 2NUWA 5JBDA 4IMAA 1H0IA 3PBVA 5A6JA 3VABA 1B1YA 1W1IE 3KTSA 5C2XA 4DLMA 2VTFA 3ITOA 2VX4A 2ZRVA 1ESWA 1WDQA 1UR8A 4HNLA 1E0UA 2P1FA 1C90A 1OB0A 2CBIA 3MB9A 3K46A 3EX3A 3OTRA 1VCFA 3CT7A 3GU1A 2GQAA 2FTWA 1F3WA 4XSLA 5A6AA 3NGJA 2QCNA 3M0JA 3N73A 4PMRA 3P8JA 3UBPC 4B2DA 1EZ2A 3WDPP 5IHRA 1SO5A 1XLLA 4IGNA 3ALGA 5LIXX 4JTFA 1CB7B 4GI8A 4MAZA 1BYDA 4WK9A 4H6RA 1VS1A 1ZAJA 3GH4A 1ZU8A 4HYWA 3LEPA 2DZPA 4UNLA 1B5TA 4M7SA 1PXGA 4XUGA 1JGMA 1POKA 3UCDA 3PAOA 2VDHA 2XFYA 2B31A 2WAGA 1G0CA 2I14A 2V3FA 3WK3A 1LDCA 1XKJA 1C3FA 5I02A 5J5RA 3COTA 2BGNE 1US3A 3UERA 2QGYA 2PDXA 1R3SA 2G5WA 3VOCA 5HMFA 3II1A 3TKFA 3H21A 2R82A 4O14A 4AMCA 3WLJA 3VGFA 4GIRA 2YZ5A 2GDQA 1KBIA 2WHLA 3AQUA 4MYAA 2Z6IA 3UEQA 4NJIA 2GGEA 3S8HA 1IT0A 3RDKA 4PFMA 2DVUA 3MO7A 3AS3A 4DJEC 4YVVA 3ANYA 2J8GA 1K3UA 3FK4A 2YCJA 4TTUA 4ZA0A 4R3UA 4Z1AA 4JNYA 3QQWA 4V28A 1TVNA 2POZA 1H60A 1EJRC 4M1BA 3CLWA 3KE0A 5CJMA 2XGIA 2W79A 4R7OA 4OJYA 2OELA 3W22A 2FB3A 4JQ2A 5BOOA 2HISA 4N7QA 3CL7A 3NXLA 2YX0A 8RUCA 3TJLA 3CAKA 3UVAA 2E40A 4NXSA 4HTYA 1Y5XA 3LB0A 1IT7A 2Y70A 1E6QM 4LVDA 3W29A 9CGTA 1KRCC 2ZICA 3TAKA 4F9DA 1I6NA 1YX1A 1BEUA 4RZ5A 3WUFA 5CC3A 3ONBA 4F0RA 2D2GA 5A6BA 1XIFA 3VCCA 1N8WA 3RLHA 3F4WA 1SJDA 5E93A 4L4MA 3GXNA 2HS8A 3VC6A 3M16A 3NPXA 5HPCA 4D6EA 1HJWA 1QDSA 3B9DA 5DRIA 2WNQA 3VIKA 2QCCA 2HS6A 4MB3A 4K7VA 1VFLA 2Y2WA 2R1MA 1XS2A 2V68A 1Z9AA 2XUCA 3SRDA 1F6PA 3FV9A 3KOXA 2Z4GA 4PUJA 2V3DA 1QK0A 1MQQA 3K4DA 3FEMA 4C1LA 1TO3A 4NYUA 1WKDA 4QAIA 1RPKA 2O4MA 3W1QA 3MCMA 2CKSA 3LN3A 3RXZA 3O05A 3KDOA 3AIUA 2WC4A 2J6VA 4GQ0A 3S4TA 2ISVA 4X0VA 1H3GA 2INZA 4DYEA 3AYVA 3L0GA 4J3UA 4S3FA 4K38A 1GCYA 4GA8A 4FR1A 1E6SM 5I7GA 3WG6A 5D8ZA 3NQDA 2B81A 3L21A 4ROPA 1XIHA 3F7JA 4I9AA 3NPVA 3HG5A 1XCXA 4YWSA 4FSAA 2OJPA 3MDWA 3N1AA 3QN3A 1KB3A 2XGZA 2AGKA 4UMAA 3L4VA 3O9NA 3BO9A 3E5PA 3SO7A 2G3JA 3FHAA 3UGVA 2NXIA 2W27A 3MT1A 3PUOA 3LHYA 4JPGA 1H51A 4A3QA 2E6DA 3H2AA 4F9JA 1VBUA 1N7KA 5L9FA 3ALFA 1GEHA 3RG6A 3APGA 3MZ2A 1AODA 2BHYA 7TIMA 2FVLA 1X97A 3TSBA 2W62A 2J7DA 4NASA 4Z42C 4J35A 4IFKA 1V6YA 5MKGB 1FWTA 1VB9A 2UBPC 3CV7A 3FJ6A 4U10A 4JFVA 2YL6A 4Q4QA 1SMAA 1EJUC 1LRQA 2WM1A 4FLQA 2D0GA 4L56A 3JW7A 3CHEA 3RITA 3NSNA 1NELA 3UWEA 5D02A 4PTVA 1MQRA 1E15A 4XAZA 3SFWA 5K9CA 4HN8A 1AA1B 3NURA 3TH6A 5BRPA 1E0WA 2CNCA 3M41A 4TIMA 1PTDA 3U2EA 1FA2A 1UD2A 2ACRA 2P10A 3V3WA 1ZBCA 3GKFA 2VMFA 3UCCA 2V67A 1GQIA 1TV4A 2WQPA 1BXBA 1TPB1 1NY1A 4G6CA 4LV4A 2WZTA 1V6XA 1Q6OA 1EPXA 1T0OA 3GXFA 2G3IA 2NX3A 4JL1A 3QPZA 1ME7A 4OHQA 4ZODA 4IH3A 4W8LA 3UFYA 4WY0A 3G0UA 2WZIA 2ZA3A 4MJ4A 2PWVA 4HK7A 1YYAA 3KCLA 3ZWTA 4ZQRA 3CIVA 4QCFA 2H8XA 1NSJA 1J0HA 4CNNA 5CPLA 4O1CA 4LS0A 3RF9A 3B8VA 4K7YA 4J5NA 3C8FA 5LKYA 5G1MA 4WLCA 3EX6A 1KD0A 2G95A 5CPNA 2GJPA 3DBPA 3UNTA 3CBWA 2E28A 4PSRA 2JGYA 3PM6A 2P3ZA 1VYPX 4HHMA 4K8EA 2CYGA 5FJJA 3GXIA 2WNZA 4KGLA 1UCWA 5E9XA 4PGLA 4CEUC 2Z2AA 1XC4A 2BBFA 5F1VA 6XIMA 4XBJA 1FY6A 1S38A 1R3WA 3QKEA 2C91A 3QV8A 4FF5A 4TQTA 3EOUA 1DL3A 3AMDA 1Q66A 5XIMA 3GDBA 4MOZA 2XFWA 4LQ1A 3W2MA 4LY4A 3TW7A 2X1UA 4IPNB 5C7VA 4UQBA 3WFZA 4HNTA 3UQNA 1IXOA 2BFGA 1GYMA 4FA3A 3LS9A 5D9NA 3CPRA 2CKRA 3UCQA 4WJEA 3VNZA 3LTPA 2PSNA 4HMDA 3F4VA 4MWAC 1HL8A 4GZIA 2E77A 1TPC1 4O11A 3MO4A 4I9MA 1X7FA 1DJHA 3WL1A 4UQCA 3V75A 7TAAA 3C2VA 1WCGA 4LJ3A 4AZBA 1V6VA 1EYEA 2HBXA 1GW1A 1R3QA 2YCEA 3MKVA 3P74A 3AUOA 3S9ZA 4ZL1A 4YN5A 4M82A 2YCLB 3CL6A 2ZQ0A 3GZAA 3O6CA 4PSPA 1XYMA 3UWUA 3AZSA 4JHOA 2FPTA 1JQVA 4GNVA 3GR7A 4MF4A 1W1PA 4P7OA 4NJJA 2IPJA 1JVNA 4RE0A 1EHAA 1P48A 5DANA 1TQXA 3VI2A 5T9CE 5FSDC 1VPQA 4POCA 4JQ1A 2QQ6A 3DUGA 3L5LA 4OGZA 4Y90A 4CCEA 3ATYA 1PZ1A 4Q8OA 1IXQA 3EWYA 3URAA 3REQA 1HJXA 1B90A 4UTWC 3BAXA 1C7SA 4E2VA 1G7VA 2W67A 1UC5A 1EX5A 3EB4A 5DMYA 2VUNA 2F38A 1NWUA 2VJXA 1I1WA 1S1PA 3LGEA 5D9OA 1A3WA 4OTKA 2XN0A 4PMZA 1U22A 2VEMA 1YXCA 4GFIA 2C79A 3QPEA 3B0YA 1ZJBA 4PMYA 4HNVA 3GIYA 1VHCA 1GUVA 3QM3A 1B3ZA 3A22A 1CXKA 4GX8A 3ITXA 4M7TA 3VXGA 3HGRA 4P8XA 3KUMA 2EPOA 1BXCA 3CB8A 5ABFA 3I3EA 1ZTVA 4LBUA 5EMJA 1MUCA 3OQEA 5E9AA 4DZ5A 4EXAA 2DFAA 2PCQA 1UA7A 1V4YA 4RK8A 1MZRA 2XIQA 3UJFA 3KVKA 3MCNA 1N8IA 4NX5A 3H2OA 3KVMA 2WLYA 3A4XA 3WNLA 3MUAA 2PF8A 1UYQA 1HW6A 3VAVA 1IEQA 3B0PA 3R94A 2XPKA 2I5QA 3LSCA 2OLSA 2GZXA 3DIPA 2BHUA 1AQHA 4K36A 4ICCX 3K8KA 3NCOA 3N6JA 2VQTA 1LZOA 3QR1A 1FWSA 1U2YA 4Z1DA 2XWDA 1LP6A 1VCVA 1UH4A 3BLDA 3WQGA 3S9IA 4ENLA 4D6HA 3EDEA 4QNWA 3GY1A 1MW3A 3ZOAA 1EP1A 3GDLA 3H2EA 2W63A 2YB4A 4D71A 4GYFA 3ZR6A 4JQ3A 3OLIA 3SUVA 1QCWA 4GIYA 3USZA 4R5EA 4J28A 4PCSA 2Z27A 1FWWA 1YE6A 3GXMA 4O1AA 2DT3A 1PAMA 1TE6A 2NQZA 4M5PA 4XIAA 2QPXA 2TRSA 4E5TA 1K9FA 1HP4A 4IOTA 3ZSSA 1E1CB 1Z6KA 1KLYA 3BH4A 1RJPA 3PC0A 2CWXA 3G3DA 1ZRQA 3KS6A 4XZMX 4JTGA 1FDJA 4UOZA 4AY7A 4X3ZA 1EOKA 4I6KA 4H7VA 4MJZA 4TV5A 3IUHA 2CZDA 5IFPA 2X1TA 3AWNA 1UMYA 3CAVA 2FKPA 3GTHA 2E1DA 1L8PA 2FLIA 3VD5A 3H4GA 4O1FA 4GQGA 5HK4A 3MVTA 1HZYA 1RHCA 5RUBA 4HVXA 1MXSA 1XG3A 4GBUA 1WZAA 4KIEA 3WQPA 4XIMA 5DBUA 2G0WA 3L4WA 4DWSD 3EA2A 5CC6A 2REQB 3PUDA 1XYBA 3UYIA 1EBHA 2QVNA 3HOJA 1JCJA 2PGRA 4KH2A 1UIOA 1ICSA 8CGTA 1U1HA 1DJWA 1UIPA 1XW8A 2PUZA 3QYQA 5E1QA 1CLKA 3UF9A 4AF0A 1OX4B 5TBOA 1ML1A 4MFEA 2QS8A 1KR0A 3RO8A 1EOMA 3EA1A 4UFMA 3UP8A 2VXNA 1WV2A 2ODOA 1OT2A 4UTIA 2XVPA 3T40A 4I5RA 3TTSA 2QUTA 4YXGA 1SMDA 4LTSA 1UB3A 4EIVA 1CYGA 3VOHA 1XLGA 1XUUA 3W70A 1Q4NX 3HU7A 4LOCA 3BWWA 4Y6GA 2VZUA 1AD4A 5XIAA 4UFIA 1MEHA 1UR4A 2J79A 3NL3A 4RV3A 1WKFA 4TVCA 3RX4A 1KCXA 3IS4A 4IGMA 2BZNA 4DM2A 3TTOA 5JBEA 4PE8A 2VD8A 3HURA 1HJUA 1AH0A 1BKHA 2PLCA 1VIZA 3GG1A 4K1WA 1MI3A 4F79A 4N9BA 1CGUA 2ANUA 5C55A 3B8DA 2YDQA 3S2JA 3ES7A 1KWKA 4Y8FA 5C2CA 2YPIA 5AHNA 4DO7A 3SCWA 3G1RA 1B30A 1UKTA 1WZLA 4JR5A 1UPPA 3GHSA 2ZX8A 3GSMA 1LUCA 3KBMA 5D9MA 1EO7A 2HBVA 3NQAA 4FLRA 3G1AA 4XBKA 1H7PA 2ZXBA 1SFLA 3OGSA 2A3LA 3AHVA 4JFWA 4V33A 3S42A 3OIXA 1ZLPA 3LK6A 4NAFB 3VKKA 3RYSA 3T44A 4I5XA 2JF6A 1CT5A 4QJ3B 1FX6A 1U5JA 4O1DA 4EWJA 1TA3A 3P3BA 2CFFA 1KXVA 1FXQA 4MNLA 3MYPA 3ARTA 2V5KA 1L6SA 3CLMA 1N8FA 5JUVA 2YLAA 4KBXA 3M7SA 3UGRA 1FHDA 1KNWA 3KLLA 3CYVA 4NYYA 1NOUA 3BSHA 3HPAA 3UWYA 1ME9A 3R25A 1PJ9A 1B3OA 4C6CA 3AXIA 1BTMA 1VH7A 2QF7A 3PZMA 4YNGA 3CUXA 3WD2A 2C19A 2O4QA 1XYAA 3CQJA 3PTMA 4WXYA 3BV4A 3LCLA 1XL9A 1AQMA 1ZCOA 3EWWA 3CZKA 1TTIA 2BWGA 3GZ3A 4N0RA 1F8MA 1LRTA 1TJ2A 2Q8XA 4EF8A 3TFXA 2BY0A 1XWYA 2RH9A 3PZNA 2FVKA 3W1RA 5AYBA 1YXDA 7ENLA 3GLCA 4JIPA 4ZXOA 1J01A 1R2SA 3SCVA 1XDJA 1ONRA 1BWKA 4IX0A 3GWQA 4M56A 2NV2A 3PVFA 5LIUX 1UBPC 2E3ZA 1KTBA 3TNOA 2OYMA 1HO4A 1LM1A 1TVPA 3EGJA 1DIOA 4AX6A 2L5HA 4YL2A 4UR7A 5MHBA 1RVGA 2OVLA 2WBGA 5BCAA 1UOZA 3A64A 3PZOA 1QHOA 5A8NA 2FDMA 1XPYA 4FZIA 4GI9A 1UWUA 4CD7A 3ZWSA 1TMQA 1VJIA 3L0NA 4A35A 4CQ8A 1HVXA 1UQZA 1JFHA 2XZ7A 4D6JA 1DQUA 1ONEA 4PN2A 3WD3A 3ZJ6A 2QGHA 1Q63A 4AWSA 3GM8A 3HG3A 1IXPA 3IK4A 2FMOA 1N55A 3NQ6A 1QWGA 3C0SA 4L1GA 4TX9A 2OU4A 4QLLA 4CQDA 1A5MC 2ZX6A 5EL1A 1LBMA 4FXRA 5IXEA 2PDLA 3LHUA 4ADUA 5KZEA 4I8YA 1F5ZA 2PDHA 3PAJA 1MRQA 3DG7A 3EBVA 3BZJA 4I3GA 1AVAA 3S6DA 2BDQA 5IFTA 1CXLA 2HTMA 3E0WA 1BQCA 1EO5A 2IMRA 4C65A 3G8RA 4E8GA 4AZIA 1CXIA 1ONWA 1Z69A 5HUPA 3NUKA 4P61A 2PTXA 2SFPA 4BEQA 3VDGA 1X6NA 4QQ3A 1TPUA 4I6VA 5HINA 1REQA 4DI9A 4YHGA 4JQ4A 4PMDA 1S2AA 2DH3A 1GVEA 1JUEA 4Y9NA 4QDWA 3BLEA 2IXVA 4KKXA 3AS0A 3DGBA 5AC6A 1EP3A 1US0A 3CHCA 5PTDA 2WSKA 1RBLA 3BOXA 1MMFA 4LVBA 4LAZA 3VKBA 1H4PA 1NM9A 2IPGA 3PFMA 3HPFA 3BG9A 3BSMA 3ZVIA 1OYCA 4TX8A 2VD9A 3ELFA 3W1NA 2PLKA 5BMXA 1BVWA 4WSKA 3ITLA 5ABGA 5C7HA 1KRMA 4GYPA 3TIMA 3STGA 3FYOA 2DUZA 4BFAA 1JCNA 3KAOA 4Q7NA 1B3YA 3PWAA 4G56A 5FF3A 4TMCA 3GIPA 3MSDA 2PS2A 4XG1A 2VEFA 2QEZA 4C1NA 3WBXA 2REQA 4LAKA 1H0GA 2J6XA 1NJJA 3TQVA 4LYRA 1CGYA 3NO5A 3GAKA 3EKLA 4PBFA 4K68A 3ORWA 1G4TA 3HB9A 1NFBA 4XV0A 3Q37A 5HAOA 2CITA 4N6EA 1J9YA 1I9CB 1JL8A 4EANA 3L4ZA 3REQB 2IKGA 2AMXA 4TU1A 3LD5A 3GTIA 3UZ5A 4C6OA 3OHIA 1XJBA 3ZT6A 2FHFA 2EPLX 3AS1A 1Q2SA 4UFJA 3H6OA 4RZ4A 4FB7A 4GY7A 3RJYA 3NQFA 1A5KC 2BGSA 1E73M 1HTIA 1CDGA 2QR6A 3LOTA 3GYCA 4D9PA 3WBAA 1EJTC 1JZ8A 1EEPA 3FX4A 5BOEA 3ITTA 2EJ1A 4HHPA 1FH7A 3PNZA 4MHBA 2W3ZA 2GSJA 4JL2A 1LJYA 1UD3A 3QFEA 3ZT5A 2VGGA 5KZMA 3PHAA 1PZ3A 3R0UA 2Y0FA 1E3XA 3O1NA 1G6CA 5CKSA 4NRRA 3BCFA 2B4GA 2CLMA 2X2GA 1KFWA 1PDZA 4BK9A 1XI3A 3MMTA 1ITUA 3LQLA 1EL3A 4UTMA 3WFLA 5I07A 4Z2IA 1RA5A 2EG7A 2AL2B 4G1NA 3E38A 2Y85A 2KZHA 4AVFA 2VELA 1DJXA 3L12A 3NL2A 4CVUA 1QI0A 4LALA 2QKFA 2FGLA 3ZVHA 4PUWA 2VUYA 3QV9A 4JN8A 2VEIA 4GCXA 3SCOA 1WDDA 4DLFA 1JZ6A 4YTTA 3D5HA 3KOZA 5EGRA 2NVAA 2I1OA 2VOMA 1EFZA 3P6LA 1IZCA 1QPRA 5FEWA 1S5WA 1NFGA 3SN0A 3GYEA 1UR0A 3GVGA 2A21A 3FS2A 2H90A 3GBDA 3SQSA 3H2FA 1J79A 4MB4A 1SZNA 4GE8A 2ON3A 3TYZA 2B0MA 3RR4A 2ZFAA 1P5BA 3H26A 3IJ7A 2F2HA 1EEXA 3NQ2A 4O19A 3WQCA 4HPJA 3BL3A 3SFKA 1LOLA 3VK5A 3S5OA 1ZJIA 1XRFA 1LT8A 1L8NA 1R7OA 1TZ7A 1TJPA 2PBOA 3E1F1 4B92A 1RAKA 2FPYA 2XVLA 4QEEA 3STCA 3WMLA 3A24A 3WBEA 4B9YA 3GG0A 3GVRA 1VFOA 3DFHA 1WBHA 3UWZA 1VEPA 1H1ZA 1JZ2A 3VUSA 1XLFA 5D2WA 2ESCA 4JX6A 3E0FA 4HZ7A 4W5UA 1TWIA 4EF9A 2CLHA 2QUUA 2J88A 2HE8A 3W3OA 2MUCA 4MADA 3UG3A 5AHLA 4F4RA 4HYRA 1RBAA 1XH1A 2VX7A 4HBKA 1CTNA 4H83A 1AUSL 3D3FA 2RKXA 1FFQA 5EFFA 3UWQA 2C7FA 1OHLA 2VNCA 3B9EA 4O50A 1XR2A 4EXBA 1EDQA 2PAJA 3GTNA 2A85A 1OFPA 1UOKA 2OZTA 3VMPA 1RCQA 4E2DA 3EX4A 5B80A 2C3ZA 1YW1A 3E2QA 3ZJ8A 2O92A 1RP8A 3D0CA 3B04A 2G3MA 4QNEA 2XIMA 2OX1A 2QCHA</