1DYSA

Endoglucanase cel6b from humicola insolens
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
345
structure length
345
Chain Sequence
GNPFSGRTLLVNSDYSSKLDQTRQAFLSRGDQTNAAKVKYVQEKVGTFYWISNIFLLRDIDVAIQNARAAKARGENPIVGLVLYNLPDRDCSAGESSGELKLSQNGLNRYKNEYVNPFAQKLKAASDVQFAVILEPDAIGNMVTGTSAFCRNARGPQQEAIGYAISQLQASHIHLYLDVANGGWLGWADKLEPTAQEVATILQKAGNNAKIRGFSSNVSNYNPYSTSNPPPYTSGSPSPDESRYATNIANAMRQRGLPTQFIIDQSRVALSGARSEWGQWCNVNPAGFGQPFTTNTNNPNVDAIVWVKPGGESDGQCGMGGAPAAGMWFDAYAQMLTQNAHDEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Humicola Insolens Family 6 Cellulases: Structure of the Endoglucanase, Cel6B, at 1.6 A Resolution
pubmed doi rcsb
source organism Humicola insolens
molecule tags Cellulase
molecule keywords ENDOGLUCANASE
total genus 143
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1dysA00
4AVOA 1HGWA 1QJWA 1UP3A 2BOFX 2BOGX 4B4FA 1DYSA 4AX7A 3VOJA 4I5RA 2BODX 4AU0A 4AX6A 3VOIA 3ABXA 3RPTA 4AVNA 1QK2A 1OCJA 1UP0A 1UP2A 2BOEX 3A64A 3RU8X 4A05A 3A9BA 1OC5A 4B4HA 1CB2A 1OCNA 1OC6A 1OCBA 1BVWA 3VOFA 1UOZA 1OC7A 2BVWA 3VOHA 4I5UA 1HGYA 1GZ1A 1TMLA 1QK0A 3VOGA
chains in the Genus database with same CATH superfamily
1PZ1A 1IIGA 2Z7GA 1QFEA 4G56A 5CJNA 2QCLA 1LUCA 3FNDA 5CC7A 1JXJA 4ZXLA 4LUJA 4QE5A 1ADDA 2YYTA 4IFKA 4L6OA 3VIHA 4U2ZA 3L2LA 2WPGA 2PAJA 2YOCA 4DWSA 4LANA 5I03A 4JTEA 2Z2BA 3ARZA 5A6SA 1GW9A 4CQAA 3RMEA 4TMBA 4WR3A 4HCLA 1WDPA 2ZE0A 1GVYA 1JZ6A 2XIIA 4C1LA 1V0MA 1R9YA 3E96A 2OCZA 1K8ZA 4AH7A 8RUCA 1A5LC 2DU2A 1M03A 2YA2A 4JNZA 3CASA 1R85A 3T44A 3AALA 4GA8A 1M7JA 2PZ0A 5DFAA 3H2NA 1FXPA 3HFYA 1Z69A 1W3JA 4D6JA 1XLGA 4P8XA 1VIWA 2TODA 4ZOAA 3VD7A 5BNKA 4JTCA 1TREA 1F8IA 4OV9A 1H7OA 5DELA 5AB3A 4W4QA 3TN6A 3IGHX 4EXQA 1TV4A 4I7WA 4Q8QA 1MVYA 1DJYA 1KFLA 2AQOA 4EPBC 3PBGA 2YL9A 4PCSA 4RNJA 3LA4A 2PLCA 2ZA2A 1H62A 2WQDA 4JCMA 4AVOA 2VC7A 1XYAA 3N73A 4DHGA 3T81A 9XIMA 1EC8A 3CUJA 5FAJA 3LM3A 5BXRA 1HZYA 2ABBA 3OW1A 3W7EA 3GXPA 5A8QA 1L9WA 4A4AA 4RZ5A 2OWXA 3NG3A 4J5NA 4Z0SA 9RUBA 2VHLA 1BHGA 1ISWA 2WKJA 4LJ3A 2AMXA 3QM3A 3ANVA 3LV6A 4GZ7A 3N2CA 2MUCA 1ISYA 5FESA 4QEEA 2CWNA 1Q6CA 1RVKA 1OGBA 3QY8A 1OM0A 3NNTA 5HMSA 4PMQA 2DUZA 3QTGA 4JFSA 5BROA 2VEPA 1SFLA 1JGMA 1YX1A 1H11A 1BXNA 4DJFC 2V3DA 2GGHA 1J2BA 1T41A 1ZAJA 4Z1YA 1DWFM 2XIBA 3N4FA 4GYFA 2QYGA 4OBSA 6ENLA 1UUOA 4JTHA 4JTQA 4GD0A 3FJ4A 4FR1A 4LC6A 2NQLA 3UT0A 2EQDA 2OMAA 4CVWA 3PBWA 4MUPA 3SURA 2QCMA 3CO8A 1L6GA 1U5HA 4K8EA 2OYMA 1E4NA 1S2VA 2E67A 3EX1A 1KRCC 4B5XA 2QF7A 1HL2A 3JW7A 1UYQA 5BU6A 2P3ZA 1JD9A 4J28A 2FTPA 4RL3A 3T05A 1XLBA 1V7YA 1DJZA 1CB7B 4GNJA 4Q8TA 4GY0A 3EB3A 1DXEA 2UZ9A 1XQLA 3SBFA 3L66A 3MYPA 1BGGA 2E8YA 3IUDA 3AIWA 2PTDA 5C9UA 3K13A 1W2VA 4AF0B 1PKLA 4IISA 1UUQA 5LGZA 4WDXA 4TX6A 3PZTA 2ZX7A 2WVTA 5H1WA 1OEPA 2G4FA 2PRHA 3B40A 2YW4A 3E12A 1H49A 2Y7FA 1E3ZA 1LUCB 3VA8A 1QCWA 3LXAA 1X7FA 1XIFA 3L65A 2YIHA 5BYWA 4HPHA 3EB2A 3NQMA 5E0KA 4GKTA 3W7KA 2DZPA 3P0XA 4GQBA 3W7OA 3KTCA 2WZTA 4QR6A 2R24A 1UH4A 4Z2KA 1CGVA 3OPSA 4I8DA 3NVTA 4JYFA 1WE5A 3P74A 1V6YA 3QW4B 1BTCA 1KCZA 1W1B1 3KRZA 3BW3A 1MQQA 1A0EA 2BY2A 5HNUA 1UR0A 1EDGA 4AD0A 3BLIA 3O1NA 4PUJA 4WGHA 4WIWA 2QUVA 3R79A 4XUGA 4DJFD 1GNXA 2FPVA 1XUZA 2P3EA 3C8NA 2QCHA 1WBJA 5KZDA 5IOBA 1R3WA 3W7QA 1KQYA 2PTWA 5MF5A 4MNLA 2H8ZA 1PKNA 1PIFA 5E09A 1I9CB 1Y0EA 3MYOA 3VCRA 4W8LA 4C6MA 2LLEA 5HINA 2CETA 1TPC1 3H12A 4QJ3B 3REQA 2HE5A 4QXIA 4RK8A 3SQSA 2UY4A 5FKYA 1JCMP 1GOMA 3PZOA 1FH9A 2Y89A 2XUCA 1JPIA 3W29A 3VM7A 1AH3A 4EPKA 3B9DA 1M04A 4ZZ9A 3V0UA 3GXFA 1JQVA 1W9XA 2CWXA 4B4FA 1ECEA 2VI0A 3EKGA 2B7OA 4M7SA 1LWHA 2VELA 5GQBA 5HR6A 1HKIA 1ZBVA 2WSQA 2V6AA 2BHYA 3I4KA 2XGIA 1XX1A 4JFVA 1UC4A 4J3SA 1RQBA 2XN1A 4LCQA 4QQ3A 4CQBA 3AYTA 4OT7A 1LWIA 1M41A 3MMUA 3SUVA 1QNPA 4P7LA 3RYSA 2I14A 5F4XA 4ZENA 1BGAA 4PSPA 4LUSB 3B8SA 3LMZA 5A5WA 4B15A 2F6UA 2DUAA 4FLSA 3S2JA 3HZ3A 2D0HA 4GISA 4S3EA 4TVDA 1TQXA 1Z44A 4FZIA 4JTTA 3WQ8A 3W7RA 3SM0A 3MS8A 5GJMA 1ITCA 3C2OA 1K70A 5D09A 2JGQA 3G2GA 4M5PA 3RIKA 3W72A 1DKWA 3R2GA 3I65A 2FPYA 1XDMA 4PH6A 4FNRA 2DZAA 2GQ9A 4N6FA 1K03A 4DM1A 2YCLB 3A4WA 2DZTA 3UY8A 1K8CA 2FZ9A 3SCSA 1CYGA 4DYKA 3NGJA 1JZ8A 3POHA 2XG9A 3VIJA 1ODUA 2FIQA 4A21A 1Q2SA 3KUMA 1QPRA 2H3DA 2FLIA 1X38A 3GTHA 2REQA 4JN7A 4H8VA 1D8CA 3AROA 3V75A 1GHRA 2BHZA 4ZA0A 1L6YA 2GQ8A 1PSCA 1XLHA 1YNQA 4CN1A 2D23A 4LV4A 4AZIA 2ZX8A 4L6HA 3ITTA 5LKYA 4F2TA 4GH1A 1SZEA 3GE7A 3PG8A 4P7RA 4O12A 1CXKA 3KL3A 2FZMA 3S6TA 1DWHM 3DFNA 5A8OA 1X6NA 5G4WA 2QUNA 4DI8A 1BAGA 3MSYA 1H2JA 3BTNA 3WJSA 2WCSA 4F0SA 2PDKA 1Q8AA 3E9AA 4F2BA 1YE6A 2CBVA 3SRHA 1YTEA 5A6TC 3S42A 4DWSC 4YPJA 4O10A 2WXDM 3VU2A 3RFAA 3OG2A 4I9JA 2F61A 2PCEA 4HU8A 4Z1BA 2Q6ZA 3WMLA 2QVNA 5CSYA 4FOUA 3ITVA 3TE9A 2ZUNA 2Y62A 5HMFA 3LHYA 3IJ8A 2QKFA 4FS9A 3CT2A 4IMEA 4HQVA 4GI4A 3WL1A 3SCTA 1Q5MA 3E6EA 1WPCA 2ZVIA 3AUJA 4G8TA 2E5DA 2AL2A 3NDYA 1RSCA 1N55A 3C2YA 3CK5A 3BAYA 2BGSA 2VT0A 4FF5A 4JN8A 3GHTA 3QLDA 3MUY1 3IRSA 2PRMA 3E49A 3GWQA 3MVIA 4H6QA 3DDMA 3T0DA 3D46A 5AC7A 2QGHA 4P61A 4KT2A 3WDHA 2WHLA 2X09A 3SIZA 2QV5A 5LHEA 1AQHA 2P0OA 2Y6ZA 3VNJA 1C9WA 2C1HA 2WJZA 3DGBA 3WK1A 1PX3A 3HBLA 2EJAA 2XSAA 2HK0A 3WBXA 3W1AA 4CKQA 3THAA 1K9TA 3EWWA 5JXQA 4RV8A 1LT8A 4A22A 1WAWA 1FWNA 2JK2A 1QK2A 5KETA 4QG8A 1ZLPA 4O8AA 1RK6A 2VFDA 4LC8A 2NUWA 4RW3A 2G3MA 1NWTA 3NCOA 4Z1CA 1UKTA 5A6JA 4H9UA 3E38A 5REQA 1AJ2A 1A5BA 1AD1A 2DW6A 4JFUA 3GYEA 1JF6A 2E3ZA 4L9YA 2DQWA 2JE8A 1C8QA 2F84A 3VD3A 1YBQA 1J10A 1GQIA 1VH7A 1VBRA 1GVSA 2CZEA 3ZIZA 2WNQA 4B5VA 4ZQCA 2VC6A 1MZRA 3WMCA 5LNRA 3G22A 4Q4MA 4PB3A 4UTWA 4C6NA 4E2BA 3VKBA 2BNJA 4OZOA 1FOBA 2YFOA 3W2JA 4X9YA 1TWIA 1TZ9A 1HKVA 2BHUA 1JCLA 3HA1A 3W26A 3LCFA 4DELA 2XZ9A 5JQ9A 2PBOA 3CL6A 3C52A 1SO3A 2QUMA 2DQXA 1T8QA 2HV5A 2AQWA 3PB2A 4IP4A 1E0TA 1PCKA 3W7HA 3RUBL 3S5SA 3WLLA 4K8HA 4DYJA 2J7DA 2DY3A 3UQNA 4DZAA 1V77A 4QJ5B 1FUYA 2XIQA 3E2SA 1V0NA 2FB3A 1G6CA 2FB2A 3B4YA 1J12A 1TPEA 4AWEA 1UWRA 1AUSL 3QRHA 3GVGA 1E56A 5AKQA 1CX9A 3NZ1A 1PCWA 1R46A 3UNTA 4UQBA 3SY8A 4XQ6A 4LVBA 1K4GA 2XVLA 1PZ0A 3VDGA 5BWAA 2E6DA 3ARPA 4H9MA 2HBVA 3P5YA 2A7NA 1RXOB 5HMEA 1JCNA 1OX4A 1U30A 3AAMA 3GG8A 2D20A 3S9IA 2WHJA 1J18A 2OOFA 1ITQA 4K7VA 4LY4A 4A29A 3WBYA 3CMFA 4MWAB 4PL1A 3HPZA 5AHNA 1SU5A 3ZT6A 1XRSA 3BSHA 5T9CE 4XBKA 1BXCA 3GO2A 1GKPA 2L5HA 3FKRA 5LNWA 3HOJA 1IEIA 3IJ9A 3J7HA 3MANA 2I56A 1EL3A 3ONBA 2W91A 2A3CA 3WK2A 1SM9A 4M6QA 5I23A 2VGFA 2Z1SA 4MNJA 1I2OA 2OGJA 4K1WA 2EPLX 2NT1A 5H8UA 4BJHA 3UPBA 3M5XA 2ZXQA 1GGOA 4TTGA 1PYMA 2WNNA 3LSCA 4HNVA 3CS2A 4C5ZA 2YKKA 3OIHA 4GFIA 5CPSA 4CD4A 1EKOA 1KRAC 1QR7A 1TB3A 4GNKB 3W1LA 2X1SA 4MY9A 2W9MA 1T6MA 1JZ3A 2WC3A 3VOIA 3A4JA 2C8NA 1UBSA 3A23A 4UTIA 4BK9A 3N9RA 3GS6A 1SVDA 4YIWA 2BVYA 2DFAA 3CC1A 1XSIA 4GABA 2V5CA 3QV6A 3QJAA 5DCBA 1TTPA 3UGRA 1IXOA 5A6BD 2WMHA 4QX4A 1KD0A 4KWOA 2WM0A 1GOWA 4GXMA 4XAPA 3GNNA 1H7RA 4V27A 5A8GA 2WNZA 1EB3A 4IMDA 2HK1A 2D0FA 1Z7AA 4EXAA 1WDDA 5BOOA 4CU8A 1HGYA 3MY9A 3QN3A 2V5BA 1P0EA 1BPLB 2YLLA 5C6MA 5I3JA 1FWAC 1H51A 3G24A 5CLTA 3B0XA 3NGFA 5CAHA 1N8IA 3WLTA 4I9AA 4UNLA 3QC0A 1KV8A 3CIXA 3CQIA 3MSRA 2CLEA 2CLIA 3M43A 3VIFA 1ZRQA 3SJNA 3MO4A 6CGTA 2PP1A 4WDUA 4FNPA 1KA9F 1KRMA 4D1JA 1E1CA 1QW8A 4HNUA 4OJYA 1O4UA 1ZBWA 3AHVA 1B3YA 1TIMA 3NQFA 2FKPA 3WN6A 1XBVA 2X8RA 2V2HA 3AS2A 1S3TC 3GK0A 2VX6A 3RNDA 3GW0A 1Y8BA 2VVNA 3FJ6A 4L4OA 4J2MA 5CZJA 2VFHA 1VRXA 3Q4DA 2PDLA 5AC5A 4UR7A 1DE5A 1ZTVA 1S5MA 3BURA 3S1VA 2IXVA 2BDQA 4LWWA 3M6DA 4NXKA 4CEXC 4B2DA 4PZVA 3CV7A 1FCBA 3ATZA 3B9OA 4CNSA 1Z42A 4AB4A 4JX6A 5IDIA 3GZAA 3TYUA 3WFZA 3RHGA 3VK5A 8TIMA 2WANA 3LTYA 1P0NA 1GJWA 1MUCA 2XVKA 3N2BA 4UZSA 3K46A 4I90A 4RZ4A 1LG2A 1Z8AA 3H23A 3B0PA 3C6CA 3CBWA 4PB5A 4QISA 4JIRA 4QFUA 3VVGA 5AC4A 2I9UA 3HM7A 4WLCA 4FIRA 5DMYA 3T42A 2CZ5A 2HJPA 2PB1A 3PUDA 3VOGA 4LAMA 5AHFA 3RR4A 1K9EA 3LM7A 4R53A 1YPXA 3AI0A 3BLEA 3NXFA 5BRQA 3A9IA 4JTSA 3W87A 4M6VA 1AMYA 4RCXA 3BGGA 3HG3A 4XAYA 3UJEA 5F2IA 1DJHA 2BWGA 4PMXA 2J88A 2ANUA 5EMJA 4JEQA 4D8ZA 3EB4A 1JI2A 1XIEA 4AFYA 2UV8G 3R10A 5GNYA 2Z1VA 2E5CA 2HDJA 1LDCA 3WDJA 1B54A 3WEOA 4MWAA 2ZWZA 2YBVA 3UA4A 4A3UA 1BQGA 2BSLA 4Q8WA 3G3DA 2Z27A 2PS2A 4UQCA 2TMDA 2DT1A 3OLDA 4RNIA 3G5EA 4RV3A 2PLJA 4ORIA 4HVXA 2E28A 1UD6A 3PZUA 1PUDA 4GBUA 3CZKA 4B90A 4X3ZA 4KWSA 4K39A 5HPCA 2V82A 3KBVA 2DZWA 4IIFA 4J4KA 3CPUA 4O1BA 5AZ0A 1O7AA 3GDBA 3CTLA 3CXOA 4U5KA 1EYEA 4GQRA 2BY3A 3S4TA 3LRKA 2H9AB 3VFCA 4XD4A 5C5YA 5J04A 4MOZA 1DIDA 4JYDA 1RZMA 3NSNA 3KL5A 4GIYA 1XLIA 3PN8A 3KZSA 3DFQA 3EMCA 4IG2A 3VIGA 4CQ8A 1C93A 3KZPA 2C91A 3CZGA 4OUIA 6ALDA 1YIXA 3RK8A 4AWSA 3CHVA 2WCGA 2A1YA 4H8NA 2OX1A 4H19A 1OWQA 2V69A 2YL8A 3UW6A 1Q7QA 4GLEA 2HROA 4NY2A 4TUFA 3G1YA 1ICQA 3C0QA 4QBXA 2FZBA 3QXBA 4IMAA 4M1RA 3A4AA 4IXHA 1GWJA 4U3CA 1BXBA 2Y5EA 5HJLA 4DXKA 1JCXA 3ITLA 1RQHA 3ITYA 4K36A 1NP0A 3JS3A 2NUXA 4E4PA 1XD1A 4TX9A 4OHQA 3XIMA 5I77A 1P43A 2O7SA 1A5KC 3WELA 2H8XA 1U5VA 3RO8A 2HXTA 1HX0A 4PUDA 1A47A 3LHWA 2ZUMA 1DXIA 4OBTA 1YEYA 3WLMA 1I75A 4XWUA 3TEVA 4H9VA 3OGSA 2GK1A 4JY9A 3TTSA 4NYUA 3BDKA 1V6UA 6REQB 4W88A 3N4AA 4Y9MA 1QI0A 5D04C 4EK7A 3B8UA 2F6KA 2BS9A 3MHGA 5EMYA 1HW6A 1WZMA 1JI1A 3C5QA 1GZJA 4CNUA 1UD5A 2XFRA 3W2MA 4N7QA 4RJEA 1PX8A 1AG1O 1CGWA 5D4YA 1FFQA 3UCDA 1R30A 3T9PA 1KCXA 3OQ8A 1JFHA 1JXKA 4NZFA 2VXNA 4PMRA 3C0SA 3VI2A 1MFVA 1XM3A 1X6LA 3MP5A 5AOUA 5LIWX 4PUEA 3PULA 3TMQA 3FAXA 3K4DA 4Z2GA 1G9HA 3M7WA 2PDHA 2WAGA 4Z0JA 5LHFA 2PDYA 3W7LA 3FYPA 4PMNA 2Y5JA 1G01A 4NL1A 2X0SA 4JIPA 3UESA 3NZQA 4G5DA 1X6UA 5K9XA 3T7VA 3DCPA 2JF7A 3P80A 3EOLA 1OG0A 2VQUA 1E0UA 1VFTA 3KOWA 2B7NA 3MU7A 5DBTA 4RZBA 4RKAA 2J7BA 1QI4A 4C6LA 4RNFA 1N8WA 1VP5A 1UKOA 1SUXA 3LLFA 2Q09A 3C4UA 3CH0A 4V15A 3A4XA 4XZ9A 3RPMA 2NQJA 1ZJHA 3FVMA 3T0AA 4G6CA 2CKRA 4H01A 1J79A 1OINA 5AVNA 3UG3A 2PUZA 1EOKA 5KZMA 4D6FA 1EBGA 3QTPA 1RP8A 3EX4A 3CQ0A 3TCSA 3ZOAA 4QM1A 3VKAA 5MKGA 2NV2A 1GTEA 1NU5A 5KTLA 3HMJG 5I3KA 4FOKA 2PDBA 3FN9A 3APGA 5C7VA 2CNCA 3G1DA 3O7UA 4E2OA 5G2WA 1DP0A 4UTJA 2V63A 3KTSA 3DX5A 3KDNA 3N34A 4AXNA 4FO4A 1TZZA 4GK8A 2A85A 3TYZA 3WH5A 1GOIA 1XL9A 1XG3A 3C0JA 3LPPA 3BE7A 3HN3A 3WK3A 3FGCB 3CWOX 1J5SA 4MB4A 5CGQA 3VNIA 2QJIA 3MUXA 4O4VA 3RR1A 1UKQA 1G67A 2IQDA 2DJXA 2J6VA 4ICNA 1IZCA 4PB4A 1SO5A 1NFPA 2F38A 1DHPA 4C6EA 1ML1A 1HKJA 3U57A 3OGVA 1IEWA 1TVPA 1OCNA 1W3LA 2D73A 3GNXA 4PTMA 2E6AA 4K2SA 1KBLA 3AJXA 4LVFA 3RDKA 2BTMA 4R9XA 2FDMA 5DQPA 2GQAA 4BEUA 1OX4B 4V33A 3EXTA 2XH0A 4MZ8A 3T40A 2CHNA 5EBAA 1TE6A 4HOWA 3CLWA 1EX5A 4XTDA 3HG5A 2R9RA 3H24A 3RLUA 3MJYA 3I6EA 4UIOA 4N6EA 5IRPA 4IJCA 4KCWA 2GL5A 4GQ0A 1V51A 2OYLA 4B91A 4WD0A 2XH2A 3EX6A 3T2PA 5BW6A 4IICA 1EX1A 4S23A 1YLVA 4YHEA 3ZZ1A 2R94A 3W7MA 2DZUA 4PTVA 1BEUA 3LX9A 4HHHA 3ES8A 1SW7A 4LF2A 4QDWA 5CXPA 1XQKA 5EKYA 2C1IA 1VBUA 3ECQA 3GUWA 5D2WA 1G7UA 2AQVA 2HZGA 1FDYA 3HV8A 1VCVA 1XYBA 2GLKA 4YXGA 1NFGA 4Z2HA 3BXWA 1DJGA 4E38A 1G69A 4E8CA 1S1PA 3A13A 1JG9A 1XJBA 3KXQA 3ARSA 3TJ4A 2DPEA 1OZQA 3PJTA 4Y7EA 5CPTA 1WO2A 2GJLA 3DOPA 2Z6JA 3KAOA 1H1ZA 3DFHA 4EPDC 4F2UA 4C6IA 1AODA 3W27A 3MDUA 4O57A 3JUGA 4LV9A 2G5WA 4LS2A 4HTBA 1UWUA 1CGXA 4DJDC 1ISXA 4UXDA 2PGWA 5BZAA 3QGVA 2FJKA 4UQ9A 3CPGA 3ARYA 1UUMA 3NM3A 4K38A 2QJHA 4R7JA 4GGBA 5K4XA 2QEZA 3LHVA 2VX5A 3UA3A 2XJ7A 3KOZA 1VYSX 4EF9A 2J9ZA 2WZEA 3NVDA 1TFVA 1DTNA 1ZSXA 1J0ZA 3PTKA 3RU6A 2Y88A 3ZLHA 1VGAA 4BA0A 5M5DA 3H55A 2B81A 2E9MA 4NG3A 4A2RA 1JRBA 1UIPA 4LUYA 1PTGA 1FWEC 1J0JA 3ME3A 1S2CA 2ZX9A 1NJJA 2XH7A 4GBDA 2P10A 3GG1A 3ZWSA 2I57A 3UGVA 2VZSA 3QGKC 4E8DA 3R1ZA 3M47A 3BC9A 1P7TB 3CUHA 2QT3A 3GY1A 3IIZA 2FVKA 4IJBA 1HNYA 3R11A 2YLAA 1AVAA 1NWRA 1SPQA 1EEXA 3IGUA 4WVXA 4CNOA 3NL3A 4JCLA 4N02A 1PB0A 3LB0A 3NIYA 3N12A 3WDQA 1Q66A 2I17A 4XSLA 4KIRA 4ENLA 1OQFA 3GU9A 3H7RA 5DMMA 3ARXA 4KGJA 1DEDA 4DUOA 2ZRXA 2EBNA 4OOZA 3KWSA 1THFD 3TA6A 3A9BA 1ODZA 3HURA 3QMSA 1ISZA 1IT8A 3MKCA 3H21A 4B9ZA 3BZJA 1E73M 1GJPA 1D9EA 1ONXA 1C90A 3TZFA 1BYCA 4DI9A 3LD5A 1SYTA 1FCUA 1AH0A 4JDYA 4C60A 2O9TA 3BG9A 2VWTA 4PUMA 4WUIA 1A80A 5FSDC 2NQ5A 5A8PA 1S3HA 3MMWA 2BOEX 1F8MA 1SMDA 3HQNA 3GXNA 4YTUA 1V3IA 1ZU8A 2ZXBA 2D24A 3BJFA 3B0YA 3VIMA 3TV8A 1MQRA 2IPJA 1TR1A 1LWJA 4AAJA 4DQWA 4JIIX 3PJUA 3WDIA 2YSWA 3GFYA 1LQAA 4S1FA 4YHGA 4JL2A 4B4HA 3OZYA 1XBYA 3UD6A 1XUUA 1IWAA 1WYIA 3W2KA 2F2KA 3N11A 2VO5A 4M80A 5D03A 1NOFA 4XUYA 1K4HA 3EDFA 4AU0A 1NARA 3LG3A 1SMAA 1QVBA 3RLGA 5ECVA 1XLKA 3W00A 1SSDA 3CNYA 2C13A 1YNPA 5ENLA 3IVTA 4ATLA 4GJJA 3PWAA 3IIPA 1HFBA 4HT3A 1W9PA 1E9IA 2XSBA 1FQ0A 1LL6A 1KXQA 2HMCA 2WSKA 3OVPA 1QU4A 3EWDA 3MKVA 1CGUA 1DWIM 3VOHA 2WW5A 3R89A 2YGYA 3AHXA 2QGYA 4B5NA 1EBHA 1PVNA 3GZ3A 2CC0A 2VENA 4HSNA 3M16A 3EYPA 3G1HA 6REQA 3TKFA 4HTYA 2ISFA 1QHZA 4W5UA 1GQLA 3RX4A 1XLJA 4NF7A 5ABFA 3NO3A 3U7BA 3HPAA 5AYZA 1E72M 4WY0F 4NAEA 3II1A 1VEOA 1XCWA 5T26A 2W3ZA 3PZ9A 2ZQ0A 1OZMA 2AAMA 4HU4A 3UWEA 3HPXA 1JF5A 3IGXA 1P5BA 4KPLA 3GHRA 1EIBA 2RDXA 3FYOA 2V3FA 3GVRA 4GFSA 3W7CA 3OYZA 5CPMA 2CITA 4KBXA 3DFYA 3RILA 4OWGA 1V6WA 3QHMA 4O1FA 1XLMA 2VZTA 1IR2A 3D6NA 2H9AA 1LQ0A 1TSIA 3OA3A 5LIUX 2WKGA 2NQ9A 4KEMA 1PBGA 6XIMA 3VIIA 5HR7A 5A6AA 4IL0A 3WCZA 4W7VA 3MKKA 2ZADA 3OU8A 1OD8A 3BSGA 1MNZA 3QQ1A 3WEMA 3BICA 3CPRA 3NQ7A 1WBHA 4IOTA 2J25A 4QJ1A 1TJ1A 3FEMA 5DY2A 4CCZA 1W5MA 1QW7A 1AFSA 3LPGA 1EXBA 4XV0A 3WKZA 2JKEA 4IUGA 2XVNA 1OBAA 3MWCA 2NVAA 2Y5SA 4H3DA 4N9BA 2WJFA 1TCDA 4AG0A 4D6IA 2CLLA 2WZIA 3OA5A 5I09A 4EPEC 4NNBA 4ACZB 2NZLA 1UG6A 3GNRA 2PURA 3I7SA 3IK4A 3GTNA 3R0KA 3S2MA 4MM1A 1D3GA 3T0CA 3P0WA 2F9RA 1MUMA 3Q2DA 3W6MA 4HNCA 1KR1A 1XIGA 1I8JA 1TVNA 1P1XA 1UHVA 4HK7A 1UH2A 3ABOA 4BHYA 5IFTA 1YTKA 1OC6A 3BAWA 1GQJA 5KITA 1HGWA 3BCDA 4JFTA 4QDPA 3MCMA 1JEZA 2E40A 4DF1A 1W31A 1JQXA 4XD5A 4HYVA 3LXCA 4RUBA 1EF2A 1HJWA 3WL0A 4J40A 2YXOA 3K8LA 3PFRA 4MLRA 3OYXA 4NKCA 4OU1A 4JTDA 2GOKA 1TPDA 3FA4A 4OECA 2J8TA 4HA3A 1GOQA 2ZRWA 3C2VA 1W3TA 4JX4A 3DHPA 4X2RA 3TCEA 3GH4A 2QJMA 2OB3A 3Q58A 3DHFA 4C5YA 2XISA 2OX4A 4XAFA 4IG2B 4ZO9A 4UTFA 4WKHA 2E0PA 2CPUA 3BAIA 3QVQA 5BXPA 1ALDA 1KXVA 4XKYB 4ZO8A 3S1UA 4LY8A 4ROQA 4LPCA 3FA5A 3QQ0A 3S83A 2YDQA 4LAOA 6PTDA 3NOYA 3U9IA 4ZQRA 3TQVA 1BWVA 1SZNA 4JHMA 3DAQA 1W54A 1OCBA 2J9XA 3UXKA 1F3EA 1W9VA 3WQVA 4KMQA 3TC3A 2XM1A 3IGSA 2A3HA 4I5RA 1Z3NA 5BMWA 4PBGA 4HMEA 1CXIA 1RY0A 3H8AA 2V81A 4FF7A 5FL0A 3W0KA 4MHBA 2OJPA 2VDGA 3ZJKA 1XRTA 1TMQA 3WUGA 4K7YA 1XIIA 3CB3A 1E70M 4TV6A 4IT1A 5CLWA 2BMBA 3LRMA 3AQUA 2CLMA 3PBYA 1WKFA 2B4GA 3WD0A 4GHRA 2VRQA 5H8PA 3PPCA 5DO8A 3W2NA 3D3FA 4MAZA 1LOLA 3DG3A 4CLMA 3R7MA 1FDJA 5E5CA 4ATDA 4O0ZA 3S5OA 1YHTA 4LFYA 3IJQA 3WBWA 2HNEA 3SIMA 1FBAA 3GG0A 3NURA 3L12A 3ITGA 1TPWA 3SCRA 1US3A 2C7FA 1TJ2A 4UQEA 4NNCA 1NEYA 3BK0A 3ZVHA 4WSJA 1JVNA 2VCAA 1W8GA 4ZB2A 1H7PA 1SFTA 3MV01 4KW2A 1OHLA 3ABQA 2I16A 1VIZA 4IX0A 4ERIA 3R25A 5A8NA 3SECA 1XLFA 1ZNNA 4DPPA 3EPOA 4Z17A 3QZEA 2Z1XA 5MKGB 1F5ZA 3FHQA 3DECA 3S1WA 1JJKA 1MEWA 1XGDA 3FXYA 4CCCA 3WH8A 3ABSA 1GOKA 5AECA 4CD7A 2ZZ6A 3VZZA 4AZ6A 1WCGA 4HOZA 3PHAA 2OYKA 3VE7A 3WJYA 3TJIA 3P8JA 5LIKX 3P82A 5LXXA 2X0YA 5A2BA 4AYGA 4D71A 1CI1A 4JTLA 3BLPX 4R5EA 1OIFA 4GUHA 1VFHA 4HZ6A 5AZ1A 2VD8A 3P3BA 2O55A 3MZ2A 4MAVA 1UR2A 4QRNA 3I3EA 5BCAA 4DNHA 3WUFA 3G0UA 3TXVA 3M0HA 4XSMA 5EPDA 3LYEA 4AZ5A 5IFPA 3WBAA 4XB3A 2A79A 3L4WA 1Q65A 2BOGX 3GR7A 4LVAA 1GVQA 5ABHA 4DO6A 3CAQA 1GVOA 1JCTA 3GDMA 1OX5A 1S5TA 1RPKA 1J0HA 4DUWA 2J79A 2BY1A 3GUGA 4DJFA 3PZGA 3GNOA 3TW9A 4KFOA 1BFNA 3WH7A 2GVEA 4UBPC 4WY0B 1T40A 3BQ6A 1YXDA 4JQ4A 1C8VA 1RD6A 1PX4A 1FWHC 4QCEA 3CU2A 4LUSA 4QJ4B 1BF2A 1B3OA 4NZ1A 4LYRA 2PE4A 1K7FA 2WSPA 2G3IA 4U5IA 5CZSA 4HHMA 3HMCA 4LS0A 5JBFA 4O13A 1VCFA 3A3HA 3L68A 3H2EA 4NU7A 4DNMA 1UROA 2NSOA 3VKKA 1E0VA 2QR6A 1F73A 3UXIA 2XIOA 4DRSA 1ZS2A 3QGAC 5HWMA 2ZCGA 4PFMA 1FDZA 3WQOA 1ZB5A 1K02A 5ABEA 2FVMA 2QV4A 4GVGA 4WDTA 2OO6A 3OODA 4Z42C 2NXHA 3E2RA 2CESA 3ITXA 4UQDA 2PGEA 4OOUA 1NTHA 1LQ2A 1VR6A 3B8IA 2I5GA 7ENLA 4AMAA 1C8XA 2PRLA 1SO6A 1H1NA 3REQB 3FFSA 1XSJA 1QPNA 4CNNA 2QHAA 4UCFA 2R1LA 3ALFA 1DYSA 5GVJA 1V8EA 1W37A 4ZSUA 4S39A 1R38A 1ZBCA 3L4UA 1XXXA 4WJ8A 3E2QA 3FJNA 1E1FA 2R82A 3JZUA 2ZXAA 4OFCA 2QDEA 1QBBA 4H04A 4MADA 1A5CA 1X1OA 2P5NA 3AMDA 1JZ7A 1US2A 4GVIA 2PPGA 3QLLA 3UCQA 3BGAA 3OLGA 1EGMA 3DU0A 1IIHA 3B8DA 4DAFA 3WUEA 1EPXA 2GGJA 2ON3A 4L7ZA 4O17A 3QFWA 4MJZA 3PTMA 2V0TA 1X96A 2H3BA 1T5AA 4FXSA 4KEUA 5DX7A 4LXFA 2PDPA 2A3AA 1B31A 2UY3A 2GWGA 3KE0A 3ZT5A 1MUWA 2DT3A 3DG6A 3IJ7A 2O92A 3S5ZA 4AZCA 3GHUA 3ZXWA 4GJ1A 4DZ5A 3LHZA 1BG9A 3NL6A 2ZDSA 1XPYA 1VHNA 1VF8A 2H90A 1T7LA 2P76A 4ZOCA 1S5NA 4MB5A 4WXZA 3UCCA 4LCRA 3STCA 3RRXA 4I7UA 2QJGA 1W5OA 3FS2A 4LAZA 3PWIA 1SFJA 1FFRA 3CAVA 2X1IA 2DVUA 4JS3A 1FHLA 3GAKA 5EGRA 2PGRA 3VDHA 1MXSA 4US5D 4YS1A 3VGGA 1QUMA 3DYPA 4LNYA 1Y65A 4KETA 5HJXA 2OQHA 2Q8XA 1YPFA 5E9AA 3N18A 1Q7ZA 1FCVA 3RMJA 4X0NA 3KCLA 3NQCA 3TYBA 1SGJA 1I0DA 3H4WA 3MUCA 4RDWA 2DIEA 1AW5A 4UMCA 3DKLA 3VNMA 1ECQA 1M5WA 4LYPA 2C15A 4NSBA 2D2OA 4D72A 1U1JA 1QT1A 2OR2A 1M3UA 1E15A 4C6FA 4GUFA 4MFEA 1XYMA 3WK0A 3O07A 3FJLA 4L80A 3WQEA 2ASHA 1N2VA 3UERA 4HNLA 4NASA 3WLRA 1EEPA 1F76A 4L1XA 4H7ZA 3RLVA 3GU1A 1OX6A 4R27A 1J93A 4C6JA 1EP1A 5I3GA 3BMWA 1QATA 3NUKA 5A2CA 2PU1A 2NV9A 1XV8A 2CLPA 1VZWA 3QQWA 4MYAA 2XVGA 3WBEA 1LLWA 1MO0A 4M29A 3QY7A 3N4EA 2Q71A 2JALA 4ILSA 4O8RA 2VEKA 3TX9A 3WNLA 1OADA 3GVQA 1FRBA 3A24A 3OZMA 5E9XA 3TXZA 3SN4A 1KBKA 2XU2A 3PB0A 4HSOA 1FHUA 2YCEA 3ARRA 2GUYA 2GUUA 3A12A 3UXDA 1W5NA 1W1IE 1XC4A 3WNPA 5HUOA 4GIRA 5LNVA 1O94A 1DJQA 4W85A 5I6SA 5G4EA 1KBBA 3E5BA 3NPWA 1K8YA 4IIEA 4QLLA 2CHOA 3FKKA 5D30A 3EPMA 1R2RA 3V35A 3GNPA 7ODCA 1TPUA 3LCHA 2V5JA 1PTDA 3KP0A 2V67A 4XVEA 2O9OA 2DGAA 1F61A 3GDTA 3OEXA 3KCOA 6TAAA 3SSZA 2UWFA 2VFGA 1OD0A 3SN1A 1HKMA 1VBJA 1E6XM 1Q3NA 1AZ1A 1L6FA 5C9ZA 3W84A 1MXDA 5BMXA 1RK5A 5C2CA 2QCNA 1YADA 3WEZA 4MPKA 5TBOA 3AICA 3HTWA 1RV8A 2VEFA 1W17A 3Q94A 3VGFA 1MXGA 4Y9AA 3NQGA 4LRSA 2G0WA 1L8PA 5LIYX 2PCQA 3HQOA 2QJNA 2QDGA 1W91A 3NPXA 2POZA 2RH9A 2XH4A 4FP1A 2JBMA 4AWUA 2QUTA 4O11A 4M7TA 3EX2A 1Q13A 3WQ4A 3S3GA 1OF8A 3FY1A 2YA0A 1EFZA 4ONVA 1UQYA 1DWAM 2NWSA 2JQXA 1ZJIA 2FMNA 2OG9A 4BQ4A 4XIMA 3MSDA 1ZP4A 1OK4A 2OEJA 2A6NA 1SFSA 4O18A 1RLDA 3LTSA 3W28A 3QC3A 3VPLA 3EOEA 1UA7A 4JICA 5H91A 4ES4A 1K9DA 3WQDA 5K2ZA 1VYRA 1EO5A 4F8XA 4A35A 1UJPA 1TRIA 3EWUA 3ARVA 1UD4A 4LS1A 2D0GA 4ML9A 4IQEA 4PSRA 2NLYA 3VIOA 1GKQA 4QCFA 1UWIA 1CB2A 1X1ZA 2WNWA 3DKJA 4JTIA 4FNUA 8XIMA 4CEUC 3WQPA 4OKDA 1V4YA 3W81A 2QULA 2GVLA 4FSAA 4PC8A 4LTSA 1LL7A 4QP0A 1M7OA 2HCVA 3W2LA 1PJ9A 4MVAA 4ZTXA 3L4ZA 4GY1A 5HNNA 4S3BA 1GTHA 4O0KA 1OC7A 4AIBA 1WUFA 2G50A 2QVHA 4M6PA 3TQ0A 2HVMA 1W56A 3VX0A 1K9FA 1BVZA 3T0TA 2BGQA 3GFXA 5C7HA 3P62A 4E2DA 3SCWA 3SN0A 2G37A 4M19A 2AGKA 1XLDA 1NF0A 3NTYA 3W37A 3LDVA 4FX6M 2D3NA 1MYRA 1YRRA 4ZL1A 4R34A 1WXYA 2JFEX 3F7JA 3VYLA 4ZGYA 4ALDA 1UMLA 4Q32A 3H6OA 2QAPA 4Y9OA 4ERGA 4YN5A 5CZTA 2G3NA 2INFA 2OLHA 3NAVA 3BW4A 4BKNA 4HJWA 2CFFA 4DM2A 2D2JA 3CTTA 4BI6A 1OF6A 3CWNA 4LEFA 4EX4A 1NY1A 1HTIA 5CZ0A 5LGXA 1DOSA 2R1NA 1JPKA 4TX8A 4KCTA 4UTLA 3U2CA 5XIAA 4A8IA 1FVPA 1F6KA 1W5QA 2VC9A 3EGJA 2PP0A 2OVLA 1JIBA 3GHSA 1O68A 4QIUA 2BX7A 1F3TA 1DWGM 3TU9A 2F2HA 4QLJA 4WGXA 3PAJA 4JR5A 1V6TA 4YCPA 4HN4A 3CZLA 3MI2A 3S47A 1BVNP 2QPSA 4LALA 3N9KA 1YXYA 1SO4A 1NELA 1TWZA 3OTRA 4HKPA 3H2OA 1J6PA 4BZYA 3PZIA 3U4FA 1FWDC 1CZ1A 4KRZA 3OZOA 2E1DA 1GQNA 4GX9A 3GR4A 1AQMA 1VB9A 4JHZA 1AW1A 4C65A 3QOKA 2Z29A 4ADSA 5C0QA 3VDAA 4XZIA 3TW7A 1M68A 4GKLA 4HK6A 4IQJA 4IXXA 1DJXA 2JIEA 2OSYA 3MO7A 4H7VA 4YVXA 3KHDA 3T8QA 3CT7A 1X97A 2WVSA 1CGYA 4LYKA 2ZRZA 1UZHA 2ZKMX 4HOXA 3NR0A 4GY7A 3RRAA 3KOYA 5CCZA 1J2WA 1IR1A 4MG4A 1RA5A 3VGHA 2QW5A 3L4VA 2NQHA 3M64A 3OBAA 3JR2A 3DFTA 3TNOA 3TN4A 3SADA 5AYBA 1DWJM 1TZ7A 1GZ1A 5I3HA 3PZQA 3F2DA 1W1YA 3W4RA 3D3AA 3BOFA 3VM5A 4IMGA 4GPNA 1DHKA 4TO8A 5HWJA 4L65A 3KRBA 3T78A 1ME7A 1XF0A 3ENLA 4KIEA 1IEVA 1QJWA 4A3QA 4MDPA 5LA0A 5A95A 3W38A 3ITOA 3CGTA 3ZVIA 1C92A 1TTQA 3K5XA 4G2DA 1TX0A 3OJGA 3N25A 3W7DA 2PLMA 4IZGA 3VNKA 1X8CA 4PBEA 3KS5A 4X22A 1ME8A 4Y9NA 1XG4A 4HYWA 3GB6A 4BI5A 4PN2A 2ZZ4A 4GCAA 1A5NC 2R14A 1JR1A 1H3GA 1IWBA 2AOSA 2FDSA 5DY3A 3GIQA 3CIVA 4H00A 3E5PA 1EIXA 3WYZA 2VJXA 1VEMA 2XIJA 1ITXA 2JIWA 5G5IA 4DJED 2ACQA 4HYRA 1CW2A 1WZAA 4OUEA 1PYFA 2YBTA 5CH9A 1FKXA 2X1UA 2VTFA 3G1FA 4UR9A 2DDXA 1VS1A 2YZRA 1JRCA 2WV8A 4ZQPA 1U83A 1JYWA 3N2TA 4AZ7A 4MY8A 3WZ0E 3M1ZA 2E9LA 4P5UA 4GYPA 1NFBA 3BLLA 2TAAA 3MDWA 4KWVA 4RPQA 1G4TA 3P93A 3AMLA 3LZ5A 3VZXA 5BRBA 4US6A 3UJFA 3HIJA 3TTQA 4JQ3A 1IXPA 3IAPA 3TYAA 3UZJA 1E1EA 4J3VA 3M0JA 1U5JA 5HNTA 2RJHA 2BG5A 2ZIDA 2W61A 3KBWA 4W7WA 1YBQB 3AMCA 3DC8A 1H4PA 1HF6A 2DZXA 4MWAD 1BYBA 3ZM8A 2CLOA 1L2UA 5EMUA 3WX7A 1HKKA 3NQ8A 1KM2A 3A5FA 1G0CA 3EDKA 2E25A 2OODA 5JH2A 3BV7A 1JPMA 5KEZA 3AXHA 3S1XA 1YW1A 2ZUWA 5M1TA 3ABZA 2ZICA 1LF1A 4IPIA 1UASA 1E51A 4ICCX 2B31A 3MJMA 2VVSA 2QNEA 1J01A 3C86A 4GRSA 2IPGA 4ERAA 1S5WA 1W32A 2J4GA 1NAL1 3WF2A 4DF0A 3IJDA 5D2TA 3MI3A 5LNSA 3SW6A 1UP0A 1W5PA 3W74A 2OWWA 2DSZA 3KX6A 2ZZ1A 1PZ2A 1Z9AA 4E5TA 4XZBA 3W7JA 6XIAA 3P5ZA 1KKOA 3EDJA 4HMNA 4J9JA 2GJNA 3K30A 2Q8ZA 2GJXB 2ALRA 3Q67A 3OP2A 4UR8A 4C1KA 3SY1A 3NPUA 4DBDA 1C3FA 1O95A 2WOQA 3RPTA 4DJEA 4PMOA 5I3DA 2HVOA 3W1TA 3WQCA 1HO4A 1C9DA 2J7GA 4KESA 1QASA 2YL6A 1B0IA 1ELSA 1OVDA 3XINA 1O6IA 3S2CA 1F74A 1PIIA 1LJYA 2V30A 1V5XA 1QBAA 3SY5A 1GORA 2VNCA 1MZHA 1VENA 1DBTA 4BR1A 1UCWA 4NJJA 4MSSA 4E0CA 4M24A 3PG9A 3M0IA 3POCA 4LRTA 1CXLA 4Y90A 4PUNA 4O0QA 2Z7KA 4PGLA 2WBGA 3B8VA 5C9XA 4NJKA 5B80A 4WX2A 3PK7A 1TYGA 1J6OA 2PMQA 3AS3A 3LN3A 1KKRA 3WDRA 3FGCA 1IEQA 5ECUA 2QPXA 4CD8A 4A3RA 1GG1A 1YDOA 4UOJA 5I7GA 2X40A 3FAWA 2KAUC 3U2EA 3IUIA 1DJWA 5FIPA 4ZQNA 2J7HA 4B5WA 5LA1A 4BI7A 2BVTA 4NAFA 3O6YX 1Q2RA 3KBMA 4NT0A 1PDYA 2QIIA 3CZ8A 1RCQA 4DB7A 2ZTKA 4LAKA 4F0RA 3G1AA 1DL3A 1VFFA 1MEHA 2O9RA 2VFFA 4L4PA 1QI3A 4PTNA 3C56A 5C55A 3A64A 1HL8A 3S6OA 2OPJA 1K6AA 1XYLA 1XBZA 1TR9A 1US0A 3U48A 1S2AA 2CBIA 1V6XA 1G4SA 3S5YA 1B3WA 4Q7BA 1QO2A 4PCPA 4FXRA 4I6KA 3MT1A 2BBFA 3N13A 2R8WA 1NDWA 4TTUA 3TOPA 3VD5A 1Q6GA 2XWEA 4V2XA 3N1AA 2Y70A 3QF0A 5CKSA 2QS8A 3V16A 4DBWA 1E4LA 4FOJA 2C79A 3LCLA 1BRLB 4O15A 2NW0A 4K8GA 4LBRA 1J0IA 1DXFA 1OYBA 5FF0A 2DSWA 4PA8A 4GXPA 1TPVA 2EGZA 3IAQA 2TYSA 1DQXA 3H2AA 4J3XA 4F9DA 3WMBA 2P1FA 1W1ZA 4HU3A 5D2YA 1LM1A 2WLYA 2ZDRA 1XHGA 4NXSA 1FP9A 4AC1X 1XDLA 1LRQA 3W01A 4AF0A 2V2CA 2F6XA 3GLCA 4LAUA 5PTDA 2HQAA 1DQUA 3QYSA 4WDWA 1EWDA 1P6CA 5AC8A 4Q4PA 4YLWA 4M1BA 1IZKA 3ARQA 4NNAA 3E02A 1PKYA 3A5VA 1O1HA 3PPFA 5K3VA 2WMKA 1IT0A 5U7SA 5E1QA 2ZUUA 3U7VA 4LYQA 4UTHA 1C7SA 4J1OA 1UKPA 3O06A 3EKLA 3FDKA 4JTGA 4GQGA 1KTBA 2RDTA 1C91A 2HEJA 3L4YA 4HNNA 3EX3A 3BLOA 3FK4A 4O53A 3STGA 2Z1WA 4UFIA 3U2OA 3QPEA 3V0SA 3VCNA 3MI6A 2IS7A 4GINA 5FCZA 1YDNA 3LERA 3INPA 2XFWA 3UZXA 3OLIA 4A05A 2QMKA 1MWOA 2MANA 5A6BA 1WOBA 3KVKA 4LBSA 3BQ5A 2W6RA 4WF7A 5T9BG 2FZ8A 3S5NA 4JNYA 1RR2A 2GQ3A 5FJPA 3S8HA 2IPWA 4UTMA 1FWRA 3F4WA 3PP7A 3AU2A 4ATWA 2ACSA 2X41A 4ZODA 1TG7A 1KGWA 4S3CA 1V79A 3F4CA 2ZRUA 3DH7A 4FLOA 3GKFA 4PMZA 1B3XA 4MB3A 4HZMA 1LTDA 2YYUA 3LQGA 4O28A 3VAVA 4WJXA 1NQ6A 2FYMA 3TMLA 1B9BA 5GNXA 3W70A 1DPMA 2QQ6A 4FXFA 4IX2A 5JMUA 2HE8A 2YB1A 1POKA 4JD4A 1D3HA 3QYQA 4EOUA 2VZVA 1L6SA 3UVIA 3AIVA 3SUSA 1KRBC 2WK2A 3R58A 3GSMA 1W1PA 3KRUA 2NLIA 1VFMA 3KFTA 5F7UA 4MNMA 1HJQA 3VKCA 3BO9A 1CBGA 4RW5A 3GIYA 4AEEA 3QR0A 1E6NA 3EEGA 3LI1A 3MPGA 1RD5A 4WCJA 1FCQA 4QTGA 3V36A 1F4HA 2VP8A 3N9SA 3VTRA 3DG7A 1NH6A 2HS6A 3G1VA 5AY7A 2OU4A 3AUOA 3ABRA 3KVLA 3AISA 3F5LA 3IVSA 1JNEA 3AIUA 3GTIA 3B04A 5DLCA 5G1MA 2YDRA 2XGBA 2Y8VA 3F1QA 3TR9A 1OY0A 3GYCA 2F8QA 3W2UA 1O5RA 1GOXA 5HOSA 3A3WA 5DCDA 4GO9A 2XDFA 3IANA 1F9CA 3MP3A 3QBUA 3PFMA 2FH8A 1JUEA 4KWUA 3N2XA 2NXIA 2Z2AA 2B7PA 3PAOA 2QCDA 1QI2A 3PNUA 4W93A 3MUIA 5ABGA 2OEMA 2CYGA 3W71A 4S3KA 3VNZA 3HGRA 4ECLA 1U1HA 1ZCOA 4IP7A 3VOFA 3BCJA 4E8GA 2DP3A 1AL8A 2W5FA 2C71A 4UTUA 3RCYA 3K1DA 2ZZ5A 1NWUA 3APYA 4YWIA 3D5HA 3ANUA 3LXBA 4YVVA 2G97A 4IFRA 1OK6A 4PRRA 4H1ZA 4Q33A 5JBEA 4AYSA 4Z2JA 1R5YA 4M81A 1FWWA 2HBXA 3FVDA 4A2SA 3ZLFA 1GOOA 4S2BA 1O12A 4C6DA 2I5QA 5DRIA 2A0NA 1S38A 3LHUA 3L2MA 1R6WA 1VPXA 2X7WA 4JYEA 2EG8A 5GJPA 4B92A 4M6UA 2UY2A 4RLIA 4JTUA 5FF4A 3EWXA 4K6AA 1TUFA 3IWPA 3SEPA 3E0WA 4B3KA 2I9EA 3CV6A 1HL9A 3T8LA 1PDZA 4DX3A 1H7WA 4DJDD 1P1MA 1ADSA 4NI8A 2CLKA 5REQB 3EMZA 2C1GA 1NVMA 1JNDA 2VOMA 2NX1A 1LROA 1W0MA 4ADTA 2EAWA 3I68A 4R7WA 5IHRA 3W6YA 4TXEA 2OXNA 4GI6A 1A4LA 5I0DA 3MMDA 1QWKA 1AJZA 1NOWA 3L23A 1BYDA 1CXEA 1XKYA 4Q7NA 3AHTA 5RUBA 1WQ5A 1QMLA 1REQB 4O52A 4UQAA 1H50A 5CGMA 1FP8A 4EAMA 2G41A 1GYLA 2ACUA 4KCUA 1XKJA 3DC0A 3PJXA 2XWDA 3VILA 4JXCA 1H7XA 4O1CA 4EAYA 1ZY9A 3TAOA 4H6EA 2Q01A 3OQEA 3KS6A 1H63A 2V8ZA 5DRCA 2E9BA 4JIQA 2VGBA 5I3FA 3CYJA 3H26A 4R3UA 3W07A 1BKSA 3O63A 1O5XA 4ZOEA 4HN8A 3G0SA 1K3UA 3AZRA 1E6QM 3QV8A 1E0XA 3VUPA 1UB3A 1H61A 5K9CA 2JKAA 3ATYA 1OFOA 3IJLA 4Y2WA 1KFCA 1E9LA 1F7BA 4YTSA 5CPOA 3OLEA 3TK7A 1FX6A 2PDFA 2OWCA 2FQIA 1GT8A 1NWSA 1WKEA 4NAFB 2VZUA 1XC6A 3N6JA 1KR0A 4CUCA 1JYNA 1TO3A 3R12A 4DBEA 4PE8A 2WJEA 1R7OA 2TRSA 2RUSA 2IMRA 1JUBA 5MHBA 3TSMA 3AZTA 1AA1B 2PEVA 1OSEA 2HXUA 2OO0A 4UOZA 1XRFA 3I7RA 3LBOA 1HIZA 1FWBC 3E0IA 3M5VA 3PC0A 3WDPP 2Z25A 5D8WA 3N29A 1XGEA 5E0FA 2XZ7A 1U1UA 1T96A 3N3MA 4MWAE 1LLZA 3M9YA 3QW3A 3R94A 2I5IA 1TWSA 1F6PA 3T0BA 1JULA 2AMGA 4WSKA 4XKYA 4JKLA 1H5YA 1EQCA 4JX5A 4IIHA 4K37A 1UMYA 1B9ZA 2X1TA 5XIMA 2TSYA 3B9EA 2YCIX 3LPFA 3R4IA 1EH9A 5F2LA 1QPKA 5G1TA 3CUZA 4H9YA 3TN3A 2OLAA 3NEVA 3OBEA 2GFTA 2WMIB 2QAFA 2DH3A 2PDNA 3LQLA 3IRDA 2PDCA 1AZ2A 2NSXA 2WKLA 5LZLA 2X0HA 2R1PA 4FX8A 5B7YA 1TE1A 4L4LA 2HTMA 1CDGA 1UW9A 1BSLA 5G2HA 3VGDA 1P48A 3CZEA 4NZJA 3HF3A 1QAPA 4KRUA 4H7CA 1ZQ5A 3OBKA 5L6UA 3UP8A 1TPFA 1B30A 1CPUA 2HISA 4HPNA 3R8RA 3U4AA 2WZHA 2WB5A 4YL2A 1EGVA 1M7PA 4ACYA 4B16A 4UTTA 4YTRA 2P8CA 5JBDA 4KCVA 2A21A 4BWLA 3BW2A 4K3ZA 2VM8A 1HG3A 4D2JA 1K77A 2QDDA 2XINA 3O15A 2CHRA 2ZZ3A 3SRFA 3UJRA 2Q8LA 3RPDA 3TTEA 3BG3A 4PEKA 1XINA 2OSWA 2W62A 3BSMA 5B7ZA 3ZJ7A 4N9EA 4HCHA 2C18A 4O14A 1XISA 2X16A 4HP5A 3TLQA 3TTOA 3WJXA 7A3HA 4DEFA 4US5A 4QS6A 3NYDA 1TJ0A 3MBDA 3PUOA 3WD1A 5DXXA 1LRNA 4H8UA 1EJTC 4YMZA 2ISDA 4Z2LA 1RJRA 3TIMA 3E74A 5IM51 1P7TA 1XGZA 4IF2A 4I6VA 3V5CA 2EF9A 3WMSA 5CPQA 3SAZA 4DWSB 4NYYA 5E6YA 3M46A 5FAGA 4O1DA 1Z89A 1KCKA 4GC4A 4GX8A 1ICPA 4UFHA 3LEPA 1VFLA 2VR5A 2VFIA 4ACZA 4C6BA 3FDGA 2VL4A 4EXBA 3G1SA 1TWDA 2OLSA 1TKKA 3AOFA 2ISWA 3GG7A 1FY6A 5GNZA 3B4UA 3GBDA 1LRTA 3JVAA 3A22A 3WD2A 4WSHA 2DSUA 3M0VA 2BOFX 2WZMA 2RHGA 2AKZA 2VX7A 5BRPA 1RCOB 3DZ1A 4M82A 4JTAA 4NIRA 5A1AA 3SUUA 2CZFA 2VX4A 4D8LA 2BVWA 1KFKA 4BCEA 3R0DA 4AIUA 4UZUA 4BQ3A 4UMAA 4AVFA 4C6OA 2J8FA 1K7XA 1J5TA 2V3GA 3H7UA 2BGNE 3WLNA 1GONA 4XO6A 2Z1BA 1UOZA 3ISIX 4PODA 2XHYA 4QGCA 1KLZA 3GDKA 1TTJA 1ZPTA 1VRDA 4NJGA 5AHIA 2XN2A 2D2HA 4N4PA 2Y8KA 3PSWA 4GO8A 3DERA 3MHUA 5HQMA 5FF7A 5XINA 3IK2A 3ES7A 3O6CA 3BJSA 4H9XA 2A5HA 3PBMA 1JAKA 3GM8A 3IIXA 4Q6XA 4MFDA 2J78A 4HB7A 1I60A 1F2JA 3G3MA 3KOXA 1BWKA 1XWYA 3T2OA 4OBRA 3OZPA 2Y7DA 1S46A 1CXHA 1OG6A 1E43A 4LVGA 3RO6A 2DVXA 4JPGA 3W73A 3ZJ6A 2W79A 1K1DA 5AHEA 3TYDA 5I07A 4H9ZA 3M07A 3DENA 4I8YA 1HJSA 1OFPA 1B1YA 4A8NA 3OVGA 2O9PA 4ZEPA 3R8HA 1V3LA 3K4AA 1ZCCA 3OB8A 3MQTA 3I3BA 1EXPA 3CHFA 4AISA 4ZFMA 2XIMA 3TVAA 4O50A 3UETA 1DTUA 3WIJA 2GZXA 1I1XA 3PZMA 2BODX 2R6OA 4Z08A 1ENUA 5JU6A 2RDWA 1V02A 1Q7MA 4RDYA 2INZA 1CENA 2WHMA 1W6TA 2ODOA 3L7RA 4QAWA 1ZJBA 3L4XA 2Z28A 3KBNA 3G77A 4BFAA 4AX6A 4NILA 1ZAHA 2W66A 4Q22A 4AY8A 1ZENA 3RU8X 3A47A 4C7FA 3HQ1A 4AZBA 3THDA 4ZO7A 5CPNA 4K1GA 1XPGA 2QF8A 1B3VA 4FK9A 1KV5A 3GDRA 3W86A 4R85A 3TYEA 4RE0A 4GC3A 2CZDA 5HAOA 3WH6A 2Z24A 4M51A 2E6FA 2OKTA 1EHAA 3W1PA 2VGGA 5E70A 4GCXA 1RBLA 3S9ZA 1ME9A 3BL3A 3H2MA 2R1MA 1SSGA 1R47A 5BU9A 3F4NA 3WFLA 1N7KA 1LBLA 2DIJA 3G1XA 4N0RA 2AAAA 1TCMA 2ZUVA 1N8FA 1Q85A 4PRWA 2NX3A 4KS0A 4NVTA 3UR5A 3V1HA 1LZOA 1E71M 1IXQA 3DBPA 3H4XA 4KEZA 3ZJ8A 2PODA 5AC6A 4JTJA 3M0MA 4LCSA 2CZVA 4E4FA 3NA8A 1KM3A 1QNQA 2VEIA 2OKOA 4S3DA 5CBJA 2YCKX 1PXGA 3WG6A 3N6QA 3E2VA 4Q4OA 3W24A 3WNMA 4C6CA 4IQDA 2QCFA 1G1YA 3CYVA 3BARA 2GGGA 1BTMA 3HPFA 2V5KA 1P6WA 3OHMB 5E6ZA 4RPPA 1NDZA 4Y8FA 5HANA 3N6HA 4CNPA 3SSJA 1XBXA 1TELA 1MW0A 3L0KA 4RE2A 1VKFA 3EXSA 3AHYA 4MWAC 4JL1A 3UXAA 3QV7A 2ZRVA 3CB8A 2RFGA 3USBA 1PAMA 1KGXA 2BY0A 1D7FA 4LGXA 1YMYA 4MUZA 2Q02A 4UMBA 4AHPA 2ALDA 4FX7A 3DI1A 4L1WA 2DW7A 2ZVRA 2OZ3A 4EACA 2CBJA 4I9MA 1DE6A 4ZOBA 4B5UA 1Y7VA 3SR7A 4TVUA 4IGMA 3DXIA 3LU2A 4XZLX 1VBGA 3SDOA 1EHNA 1XLAA 2X30A 1UBPC 1Q6FA 2E77A 5BOEA 1XSKA 2P88A 3VFLA 1A49A 1WXJA 4DZIA 4KFNA 1JDFA 1VHCA 3RLHA 3STPA 1ZALA 3XISA 1G5AA 2OTDA 1I0BA 4MJ4A 1QI5A 5HK4A 3ARWA 1CCWB 2ZA3A 2RAGA 3QR3A 3BV4A 3W1UA 4DJEC 2G3JA 2WSYA 4AY7A 4WKAA 5KMYA 1QNRA 3K8KA 4ADUA 2Q3OA 4ZE5A 4BQ5A 1LBFA 4XX6A 2FZNA 4DLMA 3LHTA 3N3TA 4NRRA 4A8LA 3ZR6A 1XH0A 1O1ZA 1V3MA 2GK1B 4IGSA 3CQHA 5CC3A 3JZEA 1A5MC 1EP2A 3WUBA 4NHVA 1MRQA 4L5ZA 2FHFA 1ZGDA 3BOXA 4OGZA 1Q63A 3V5FA 1NP2A 3VDCA 4U2YA 3QKEA 4OTKA 2CLHA 1J11A 3G6MA 3K2GA 4U3AA 1PKMA 2BZNA 1EJXC 3W25A 3B06A 3TQPA 1KFWA 2O4MA 1JGIA 3T4WA 5C54A 1Q6LA 2PDGA 1VC4A 3NQAA 3P14A 1E6PA 2VRKA 3ZLGA 2X2GA 3VCCA 3CV1A 1A53A 1WUEA 1UPMB 1B3ZA 4JQ1A 2TPSA 5TQLA 3KTXA 3NQ6A 3VO0A 4DYEA 4H41A 3A3XA 1W1A1 2VEMA 1I45A 3L21A 2MNRA 1C7TA 3VNYA 4XBSA 2VZOA 1Y5WA 2OGYA 2Z2UA 1PL9A 3IEBA 3FA3A 2VKZG 3NZRA 3ANYA 3FYYA 1PV8A 2WMIA 1WV2A 3W22A 4I5UA 4INFA 4DXVA 3TJXA 1F4AA 1S1RA 1FWJC 5I06A 4JGDA 4Y8EA 1VD6A 4DBSA 4DIAA 3EWZA 5I02A 1FA2A 3GW3A 4AD5A 1ZUAX 5DF0A 3W53A 3BGJA 1SR9A 1MW3A 1OYCA 1XRVA 1E6ZA 4XVDA 4PRTA 2HS8A 1ICSA 4F0MA 2DZVA 3CWHA 3BPWA 1YDYA 2GJRA 5KSWA 3EBVA 2OZTA 3W76A 1WX0A 3BANA 3G8EA 3LV5A 1UZDA 9CGTA 5C2GA 1OB0A 1GVIA 3AYRA 1BYAA 1FKWA 5CZKA 4U10A 1MRAA 3FHAA 2PDWA 3G0XA 3WQFA 3CMJA 4MKSA 4WK9A 4QITA 1RLCL 1B57A 1MFUA 4DAIA 1TJRA 1R2SA 3C2FA 2JEPA 2GVGA 5E0CA 1KGUA 3CEPA 4HD5A 4X9SA 3W1XA 4YYFA 2IUZA 2PGFA 1PTAA 1V3KA 4QNWA 3N2MA 3TJLA 4H9TA 4F48A 1UWTA 4YVPA 5T91A 4RE3A 1X7IA 3W6LA 1HJVA 3GXMA 2J6XA 5LIXX 4MZ1A 2NWRA 4X63A 3VABA 1V0KA 4FNQA 4HK5A 4JTRA 4LF1A 3RF9A 3PPHA 4QG9A 4ZXOA 1OT1A 2IW0A 5D2XA 3VKJA 3I6TA 2W63A 3UZYA 4DY1A 3KWXA 5A2AA 1RH9A 4UWMA 3HG2A 2PDIA 1UD2A 3C61A 3WF4A 1A5SA 4L56A 4W9TA 7REQA 2GVJA 1XS2A 4XAGA 1M53A 3ABXA 5CSSA 2FZDA 5T8GA 4N42A 3UG4A 4EANA 1W9BM 2RDUA 3MUAA 2ZOXA 4LU0A 1WNOA 2WMFA 3B05A 2BASA 4TR9A 3R8GA 3UPWA 5HXMA 4AY1A 1E6RA 2WQPA 2A3EA 3V0TA 4ZO6A 5A6KA 5HDRA 1UR8A 3PUEA 4O54A 2X05A 2PDXA 1B90A 1EA0A 2ZUSA 4IPJA 1VQTA 4JTFA 4JN6A 4PTXA 2C6QA 3IIOA 3NSMA 3RJXA 3RITA 1KM5A 4GZJA 2V9DA 4HJFA 2C0AA 3VDBA 3B8TA 3V5OA 2XGZA 1PWMA 4IJRA 3RG6A 4CU7A 3CHEA 1JFXA 1CWYA 4JIEA 2QDHA 5FJJA 4AEOA 4KWWA 1JUKA 2KX9A 2OEKA 3VMPA 3QSRA 4MPQA 2GDUA 3VE9A 3QR1A 1RALA 5G4HC 4AIEA 4CCDA 2EO7A 3O3RA 1GJUA 1B2YA 2Y63A 2GVYA 1A5AA 4B9YA 4M0XA 1Q6EA 1ZBKA 3G1RA 1IWPA 3O2LA 4UUIA 1OFDA 1HKWA 1HO1A 2RGMA 5A6LA 3BUVA 3IV8A 2D1ZA 3AZSA 1WA3A 1CNVA 2GGIA 3WQGA 3LK6A 4OQVA 3CLMA 4DWSD 3ZFHA 3PBVA 1UC5A 1GCYA 3USZA 2IKHA 5LYRA 4AMCA 1O60A 1X39A 1KWGA 4HGXA 2C14A 2PDQA 5DT7A 3EAUA 2I1OA 3BLFA 1NIUA 3U0HA 1F3XA 4W87A 3C3UA 5AFDA 1EYWA 3RX3A 1H09A 2JEQA 2AL2B 2J9YA 2DSKA 5CGTA 1M01A 3RCMA 1P0DA 1UZ4A 5TIMA 2EG7A 2ZWYA 2Y61A 2YA1A 4TMCA 4FAMA 2QIWA 1KLYA 4UFLA 1Q4NX 3W7NA 4LBUA 1OABA 3UWUA 2PTZA 4PEEA 2DZSA 3GDLA 4HA4A 3COTA 5FF3A 3AYVA 1Y5XA 1TRDA 5FJUA 1KO0A 3AS0A 3KVJA 3MA8A 3O8AA 7TIMA 2CBUA 4C7GA 1O5KA 4DUXA 1LG1A 1R9XA 2X1RA 3MWAA 2GSHA 2XVPA 4WZHA 1GQKA 3N17A 3VNDA 1GEHA 1LORA 4D8AA 1UR3M 5I78A 2J7CA 1WDRA 1XH1A 8XIAA 3GC2A 4NAEB 2WVUA 5DMLA 1EO7A 4Q8MA 3GU2A 1RY8A 3WENA 5TF0A 1GZGA 3AIBA 4BS0A 3SCPA 1TMHA 4W8AA 1NDYA 4DLFA 4FNTA 3QEZA 1OIMA 4QE1A 1J0KA 4YYCA 1RBOB 4RE4A 3GH5A 2XFFA 2VRJA 3AWOA 1E4IA 3NOEA 2DORA 4B3LA 3MTWA 3K8MA 4PL2A 2J62A 5KZ6A 3P8IA 2ZUTA 3RM4A 4IWWA 2WSRA 4M56A 5A69A 1O5QA 2ISVA 1UWSA 2IXUA 5A8MA 1L8NA 1FH7A 3AYSA 1REQA 4M3PA 3RJYA 3W1QA 1KXTA 3URBA 5HJYA 3NQEA 4WRHA 4AD3A 1KM1A 4WY0A 2WHKA 3PJWA 3RX2A 3N19B 2NX9A 3M0LA 4KH2A 4L1GA 3UR8A 1IQ8A 1KQZA 1GPFA 2PTYA 1ZZMA 3PTDA 4UNIA 1YTDA 3WLPA 3H22A 1XYCA 1NSJA 1S39A 3LPOA 3MCOA 3EOSA 3AMKA 3BAKA 5FEXA 3SRKA 3IUHA 5F2MA 3CO4A 4C6QA 5HWNA 4OV4A 2IPFA 4H6RA 3SCQA 1UWAA 1ADOA 3CUFA 2V2DA 3DFPA 1TV7A 3P81A 4XAZA 5K9DA 3O0FA 3FV9A 2OQYA 3SQLA 5FJIA 3VMNA 2VC5A 2XTKA 2CIPA 4ZSTA 2FTYA 1XCXA 4N9DA 3U2ZA 4Z1AA 2PLKA 3BOLA 5A3HA 3ZQ9A 3EMQA 3TP4A 2WCAA 1WXZA 2RKXA 1GUVA 3NFUA 3LCIA 2CXEA 5DANA 4PUKA 4D1IA 1IXNA 2J7EA 2YB4A 3QH2A 2E4TA 5EMLA 1EGZA 4FA3A 2WPBA 3GXTA 1EOMA 1BRLA 4IPPA 4EIVA 4LUTA 5L9FA 1EWEA 3F03K 2YDAA 4N2YA 1EDQA 1CLVA 1SZRA 3W75A 2PDUA 1Q6DA 5JIPA 1UWQA 4IGNA 1QPOA 3L5AA 1T99A 5HNRA 1VJIA 2EPNA 3BMVA 1KBJA 4JKKA 3M0KA 3W83A 3B97A 1H41A 4ZQMA 1W3KA 5EMKA 4XG1A 5D02A 3MC5A 3UEQA 2V5LA 3KOFA 5HQEA 4AQLA 1A50A 4UFMA 3BVJA 3AJ7A 1QHOA 4RXFA 4WQ6A 4YNGA 3HG4A 3NWRA 1G4EA 1VFOA 2WVVA 3SGZA 4AW7A 1MDRA 1XI3A 3KVMA 4D9PA 1QRQA 3PUGA 3UWWA 4XBJA 5G2IA 1JDAA 4FPSA 1IHIA 4GH3A 4EP8C 5FJOA 2Y7GA 3H7VA 3P84A 1W9DM 2ABAA 4OE7A 4A6GA 1QO5A 2BLEA 5C70A 2DSVA 2OELA 2XYLA 3DN5A 2VEGA 2WMGA 1I2PA 4PUWA 4HNOA 5D9MA 4IL2A 1V0LA 4AZGA 1Z48A 4HMDA 4JKMA 3BH4A 4ROPA 3EA2A 1UIOA 2YR1A 3OOQA 2EG6A 1TA3A 3CHCA 4NX5A 1XD0A 1S5VA 5EA9A 1R2TA 4QHRA 1R3SA 1XIHA 4PYSA 5SWUA 3TW6A 4J3UA 4QAIA 3NDOA 2Z0IA 5F2GA 2WVVB 4L64A 3FX4A 3V1PA 3TZNA 4V28A 4GIAA 4ZVJA 3T1GA 4IGHA 3URQA 4IIDA 1FWIC 1KFJA 2PC8A 3FSUA 3IARA 1DQWA 2G96A 1OGSA 3EWCA 2OZ0A 2DT0A 5F1VA 5CG0A 1QDSA 1TVLA 4B5TA 5FL1A 4XKMA 2J74A 1ZFJA 4PULA 2YX0A 4HA1A 3WO8A 1QOPA 1JZ2A 2OQLA 4J3ZA 2YXXA 1EC7A 2PF8A 1R0MA 2VQTA 4GUGA 5IXEA 3ZSSA 4ZE4A 5GPRA 1PS9A 3UBPC 2PDMA 2H6RA 4AD1A 4C90A 4BF7A 5FJRA 2BVDA 4D6DA 2HPMA 3ZS4A 4AEFA 5TD4A 4Q4SA 3C2RA 1D8WA 4F9JA 2Q3RA 3TFCA 3VX1A 2GUBA 3TFXA 2VMFA 2O0TA 2OZ8A 1KM6A 2REQB 2NUYA 3STEA 1OFAA 4CNTA 4YTQA 5JUVA 3D0CA 1CIUA 1LOQA 4S38A 1MI3A 3JU2A 3VD4A 3DFSA 1JZ4A 5C9WA 1E6SM 1LP6A 4P8WA 3FOKA 3M0XA 3LGGA 5M03A 3E0FA 4XK2A 2E7FA 3PSVA 4UNKA 3ZT7A 2VDHA 1KCLA 3HFTA 3P60A 2WM1A 1KBIA 3U3HA 3AXMA 3TONA 5EMMA 4MY1A 4A3YA 3UFYA 4LUTB 2PZNA 4IM4A 1B4EA 2DH2A 4IFOA 4GNVA 1EP3A 2NVCA 3B0UX 1XIJA 3HV9A 4GUIA 2G8ZA 5DBUA 1WB0A 4XD6A 4QDMA 3I7QA 1KTNA 5F4SA 4HMCA 1IF2A 4NJIA 3RM9A 5LSMA 4W84A 4B3ZA 1V6VA 2C16A 3W1NA 5EL1A 1NOUA 2GSJA 3C2EA 1UA3A 4X61A 3UZZA 4CQ9A 3UYCA 1OCQA 3VXGA 3ZO9A 1GYNA 5JH1A 2NQZA 3AIEA 3H4GA 4GQQA 4DVOA 1QNOA 1OCJA 4HZ7A 5IHSA 2ZC8A 2PD9A 5CEWA 4TV5A 2V68A 4HIBA 5D8ZA 4UTKA 1V3JA 4ZTYA 1ESWA 1XIMA 2VCBA 3CAKA 3ELFA 4CU6A 4PTDA 5A6MA 1W8SA 1A0DA 4H8HA 1UR4A 1HT6A 2FGLA 1KNWA 3ZVHB 1E3XA 3E1F1 1KC7A 3M44A 2DEPA 2F7FA 1XH2A 4ZQOA 5AVHA 3IJ6A 2HNHA 3ZR4A 3DEQA 1Q45A 3YPIA 2ZTJA 5DEZA 3VOJA 5FSEC 2NVDA 2Y85A 3LENA 3UF9A 3GD6A 3TYCA 1K6WA 3KP1A 1C29A 4P8VA 3B03A 4IPNB 4Y6GA 5A94A 3DI0A 4FR6A 1QOQA 5LNUA 3O0KA 3LCXA 2G3FA 2IQTA 1XYFA 2GGEA 5KINA 3GR8A 1TX2A 1JAEA 1E55A 4C7DA 2G95A 5D9NA 4UOQA 4RZ6A 4Q4QA 1B5TA 1ZHAA 1E9ZB 2A3LA 4HPJA 1AQ0A 1P6BA 2HSAA 3DHDA 4CQCA 5CJMA 2ICSA 4Q8NA 3T4CA 4QLKA 3KLLA 1H5VA 1EDTA 3PZNA 3WQWA 2B7QA 4LSBA 2GJXA 4XZHA 2ACRA 2YZ5A 1Q6RA 2JGYA 2ATMA 4AZHA 1XFCA 3UXLA 3NPVA 4KFPA 4MZYA 3ORWA 2I7GA 4JTKA 1SJAA 3Q65A 1SZFA 4ZB5A 4B5SA 2CCRA 1TJPA 4DO5A 1CLKA 3CL7A 1F05A 4WJEA 4QQUA 3AXKA 2FPTA 4LVDA 3B9AA 4V1XA 3ITCA 4O1AA 2ZX6A 1W1TA 4NQ1A 1QPQA 4W7UA 4BY3A 2BXZA 4ORMA 2A6LA 2XFYA 1E9YB 3O6AA 4W8BA 4GMEA 4AC7C 4AIOA 3LOTA 4QSFA 5U4NA 1VCGA 3NJ3A 4MKNA 3T2QA 3CUIA 5HPOA 4EF8A 2OT0A 3ZMRA 2PWGA 4GOAA 3BG5A 1E0WA 1SJDA 3BAJA 4U28A 2IQ0A 4QEHA 4Q4KA 3PPGA 1AJ0A 4NRSA 4LEQA 4O1EA 3FCPA 3ARTA 3TH6A 3P2VA 1U2YA 1MSSA 3W3OA 2J24A 1XICA 2E6YA 1C8YA 4HCDA 4O16A 2A7PA 7PTDA 3WNNA 4AHOA 4GVHA 3WH9A 1JCJA 3RN6A 1V08A 4L4MA 5D9PA 2C19A 1IGWA 4MJ2A 1I2NA 1W3HA 4I3GA 2FGZA 4I7VA 1K7EA 4HBKA 5DT5A 3LZ3A 4MMWA 4KERA 4URIA 3N15A 1X1NA 3E0LA 6TIMA 1A5OC 3GAYA 1Q8JA 3WJZA 3RCNA 1PE1A 3GTXA 5I24A 5D38A 2PU0A 1BG4A 5K4ZA 3GBEA 1QOXA 3B0VC 3M6YA 3R0UA 5EB8A 3UWYA 4FIQA 1FH8A 1RP9A 2A2IA 4GWEA 3BZGA 2GOUA 2GYIA 2ZX5A 1GEQA 3WQ6A 3BMXA 1BSIA 3GIPA 4P7OA 2POTA 3T07A 1SQ7A 3EDEA 4ZMGA 3N2OA 5D32A 1JPDX 4PR4A 1W3NA 4P7NA 3GXIA 3UWZA 1LOSA 3R6IA 3W9ZA 1VJSA 1FXQA 4HHPA 1UP2A 1LL4A 4MIMA 1L6WA 3C0LA 1TPB1 3DBNA 1QW9A 5AN7A 3UWVA 4AHQA 3F5JA 5FEWA 3QZAA 4H83A 3UJSA 5DN1A 4QS5A 2KZHA 3VOCA 4GG9A 3GH7A 3O9NA 4S3AA 3WJWA 3TROA 4ZBCA 4QROA 4UB9A 3TSBA 2GDQA 3DYOA 3MVTA 1JDEA 3THCA 3UR7A 1M6JA 2YCLA 4HU0A 1EUNA 4LT9A 1LYXA 5CPLA 4LB4A 4XZNX 1CXFA 3OHIA 3RM8A 2EPOA 4PCNA 3VIPA 1H0IA 1Y5VA 1WZLA 5EY5A 4RXGA 4JDBA 3NZGA 3QY6A 3AS1A 4J3WA 3U5YA 5H6HA 4JZ5A 3U5UA 3EWBX 1MDLA 3OGRA 1TV8A 2EKCA 2G4JA 1P0BA 5I00A 1XLEA 1KFEA 4H4IA 1VLIA 1OYAA 4YWSA 4IIBA 3QOMA 3LRLA 1ZJAA 2ZZ7A 5IBXA 5K7JA 5FEPA 1EC9A 2EEXA 3M0YA 3AIQA 1YPIA 4PCFA 4LW7A 4EVZA 4F66A 1EJWC 4DJDA 5HATA 2JF6A 3HGSA 4J3TA 2GDVA 3WLQA 2PWFA 5JIWA 3LCGA 3NQ2A 4IMFA 3Q37A 3QSTA 1H7NA 1HUVA 3S46A 2WLZA 4JIHA 3UZWA 3S9YA 4KEVA 2OOGA 8A3HA 4Y96A 3H2CA 5EFDA 3MBFA 2W27A 3WD3A 3WNKA 7XIMA 4K68A 4R7OA 3MCNA 5HULA 1I6NA 5FOOA 3DGRA 3K1GA 3HO8A 3NQBA 4L9XA 4DWDA 1EA9C 3F4VA 5M17A 1BF6A 5EFFA 2D22A 1B4KA 4GXWA 3LNPA 4FALA 3CQJA 2A3BA 4BF9A 1G7VA 4FEZA 2PWUA 3NEHA 3PANA 1PO9A 4PMYA 4XZWA 1VLWA 1R86A 3KLKA 3FSTA 3QFEA 3HJEA 4FXJA 1R3RA 3PS7A 4OIFA 1HQTA 4C6PA 3W7IA 3SQMA 2Y8UA 1V03A 1EQPA 3WLIA 3NO1A 3L0GA 4U33A 3VINA 2PF0A 5CQ1A 3KHJA 5D37A 4HSHA 1OGGA 2DZBA 3H70A 2EXOA 4R33A 5CAKA 4NJHA 3W7GA 2IKIA 4DUVA 4GYPC 3BCFA 4AD2A 2VURA 3UNDA 3W23A 3V3WA 3EZ4A 4EWJA 2J8GA 2Y2WA 3MMTA 3SCOA 1H1YA 1CGTA 5CJ5A 4BF5A 2HPIA 4Q8OA 3STFA 2PWEA 4D6HA 4WEVX 1YDVA 4LNCA 1U33A 2FJUB 2WC7A 4AZCB 2OSXA 3NZPA 2PTXA 2GJPA 1FWGC 3EWYA 2ZYFA 1J96A 4G9PA 3SGUA 4TIMA 1M7XA 4J7RA 2NV1A 3WLOA 1WOAA 1RBAA 5AYYA 1CTNA 4ASTA 4LOCA 4KRTA 4XISA 3UYIA 3EA3A 3FW6A 4L9ZA 3NYZA 5I5RA 3RGTA 2UBPC 2V3EA 3GRIA 1LT7A 1WDWA 3U8GA 4A8RA 4HPXA 2R1KA 7REQB 1M1BA 2D3LA 1UP3A 3PF3A 3IJIA 3EXRA 1RVGA 1FHDA 2FFIA 3KCJA 3TDFA 3CHDA 3DFOA 3M41A 3M4HA 3PZVA 1GVFA 2WBKA 4MTVA 1N82A 1CEOA 3A6OA 1TQJA 3MB9A 2ZXDA 2P53A 1S2UA 1LLOA 5H2ZA 2WC4A 4MYXA 5D2VA 4POCA 2PWHA 1YYAA 4GE8A 2FMOA 4S2CA 4WXYA 5BOFA 1RA0A 4DZHA 7TAAA 3ZSTA 2QLYA 4Q4RA 5FI8A 3SZ8A 1HVQA 3AFBA 1DORA 3WLHA 3GXDA 2PI6A 3ICJA 1AQFA 2A7RA 1ONRA 1XP3A 3SB0A 3W1RA 1R87A 1FHVA 3APTA 4Q8UA 4FLRA 4XIAA 1XIDA 2IKGA 1GVEA 4NUWA 3P67A 5TAOA 1SW3A 3MHFA 5C9RA 2VFEA 4MB1A 4C91A 2X2YA 4REQB 1XLLA 3WQ5A 3V4BA 3ZWTA 1UOKA 4ZCWA 4F4RA 2EKGA 3Q45A 1OFRA 3SGGA 2E09A 1YE4A 4ZB0A 1VYPX 3QV9A 3WSUA 2Z00A 1I1WA 2IKJA 2GSEA 2BP1A 5E93A 4XD3A 4AWTA 3MW7A 3TNBA 1XLCA 3WF0A 1ZP3A 2BB0A 4BWLC 1MW2A 2XM2A 3IPWA 3QMRA 3AC0A 1Z41A 1EZWA 2HWGA 3THQA 4QSHA 2BXVA 4JOMA 1V3HA 3OVRA 3UPMA 2DT2A 4RNHA 3M5YA 3G8RA 4C1NA 2QMJA 3SO7A 3I3DA 4M8UA 5J5DA 3MUZ1 1S2TA 4GACA 3QKZA 1QWGA 1MEIA 3LI0A 3EDDA 3CQKA 4JNMA 4UFJA 1GYMA 1LBMA 4H2HA 3URNA 4E2VA 3MV11 3VMOA 3GC4A 4AD4A 1DJIA 1EPVA 3EEZA 1UH3A 3AMGA 4UTWC 2V5DA 5FD0A 4CN6A 1YKWA 2QCEA 1HXJA 5CC5A 2Y7EA 3HQPA 2QZRA 3WY1A 1KM4A 2X7VA 4RDVA 1PHWA 3W7PA 1ZAIA 3PWGA 4GYJA 1Q4WA 4KGLA 3W02A 1Q6OA 3NO5A 4CCEA 3GKAA 3M0ZA 1E5NA 3WLKX 3CMGA 4FHAA 4OVXA 2D2GA 4MDOA 1IZJA 1IGSA 2FFCA 1ONWA 2AL1A 2PD5A 1VJZA 4W89A 3TC7A 3F2CA 3LGDA 4HNTA 4REQA 3KM8A 4S3JA 2VCCA 4PUUA 5F1UA 3WLSA 1CLXA 3W82A 4ML4A 1S2WA 1TTIA 1FWFC 4JHOA 3VKDA 3ERPA 3R13A 4J35A 4C6KA 4Q8PA 3VC6A 5I3IA 4LX4A 3ONCA 3DUGA 4JFWA 4YJ5A 2J47A 3OIXA 1YNYA 3TQKA 1R9ZA 1BWLA 1PWLA 2J66A 4UCGA 3B3DA 1E5JA 4Q7IA 2YL5A 1LCOA 4PMUA 5GJNA 4EKJA 3UZ5A 4XZMX 3HU7A 1NDVA 1O66A 1PEZA 4H6KA 3LMYA 5D9OA 3GVVA 2FTWA 2VR4A 3NXLA 1TWWA 1XCFA 4F0HA 3MP4A 3M5ZA 1QK0A 3S2NA 2CU0A 4YTTA 3CEUA 1MMFA 1FTXA 1EJUC 1HP4A 2Z6IA 4NI3A 1MQPA 4NZCA 2PC4A 3BLDA 4X60A 3WF1A 5F4WA 2HVNA 3NM1A 1HVXA 3H53A 2DIKA 1P4CA 3ARUA 3F4DA 1KWKA 1KW1A 3HPSA 4R88A 2VR2A 5J5RA 2FHCA 1KM0A 3SCVA 2RJGA 1V02E 3SFWA 4O19A 2YPIA 1L0PA 1FWTA 4N9CA 4E4UA 2D69A 4GI8A 3SCNA 2DV0A 1A3WA 1QHPA 3PY2A 4UFKA 3SJ3A 2PSNA 2NXGA 1WP6A 3L5MA 5C71A 2CEQA 1GKRA 2PWDA 2QCCA 1UD3A 4MLJA 4F79A 5G1YA 1JCYA 1UR9A 3WD4A 4IMCA 4DXXA 5D05A 2WYSA 3FEQA 4IP5A 4RR4A 3QHNA 3KDOA 3H2FA 1JPHA 1QNSA 3R5EA 3N04A 1BQCA 3PTQA 1ISVA 4CGTA 2P0IA 4O4WA 1OFQA 2EJ1A 3L67A 2WMJA 3D47A 4CN4A 3T09A 2W92A 1D7KA 5CC6A 1GK8A 5I2UA 4GZIA 1UR1A 2PDJA 2AKMA 1AW2A 1OC5A 3BJTA 5HQLA 1Z6KA 3LGEA 4FMVA 4NZ3A 3W85A 2QUUA 4G1NA 2VUYA 1WKYA 3NDZA 4Q8VA 1VAHA 4IQLA 3DESA 3GNDA 1EJ7L 2QXWA 4IH3A 3JRKA 4G7FA 4P2VA 2FVLA 3PNZA 4Q6JA 1JDDA 4PBFA 3WF3A 3T6CA 4GZEA 1OJXA 3AIRA 2O7QA 4PMDA 4QG6A 1NF7A 1WDSA 3FLUA 4IHCA 1UPPA 3KW3A 4AVNA 4JQAA 3EPNA 5FEZA 1I2RA 3LSBA 1M9HA 1MNSA 2JKPA 1RPXA 4QNEA 1HJUA 5LA2A 4Y9PA 5CBIA 3FIGA 3LY0A 4WOQA 4GJIA 4D6GA 3QPZA 3P7YA 2YCJA 3TWAA 1KXHA 3VIKA 4D6EA 3ALGA 1VPQA 5TNVA 4ZR8A 1EUAA 3W1MA 1OT2A 3LBMA 3SUTA 3GX9A 2BFGA 3G18A 1XW8A 3VZYA 4JQ2A 1R3TA 4Q3MA 2Z26A 1JD7A 3I4EA 1SW0A 2QCGA 1D2KA 1QXLA 3LS9A 4IUOA 3H54A 3C8FA 1I2QA 1F6YA 5H8MA 1ITUA 2ZBTA 1H0GA 4F40A 3VC5A 4UC5A 1SJBA 3T08A 4S3FA 1GHSA 1ONEA 4J2PA 5AYIA 2WO5A 3CM4A 2ZFAA 4E3VA 1T8XA 3ID7A 1XYZA 2R91A 2J27A 3ZYZA 5CSUA 3AXXA 4DPQA 4I9TA 3LCWA 1V7AA 3GVWA 1AD4A 3A21A 5KZEA 1T0OA 1A3XA 4Z1DA 1JZ5A 3QMTA</