2WVUA

Crystal structure of a michaelis complex of alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-l-fucose
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
437
structure length
437
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 159
structure length 437
sequence length 437
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvuA01
3OGRA 1GNXA 3GNOA 4UQAA 4H2CA 1B30A 3VDAA 5I3DA 1QI2A 5A6BA 4KGLA 3EYPA 1JYXA 5D9MA 2VRKA 4OBSA 1UHVA 4OZOA 4J3WA 3DYPA 4PMQA 4XUYA 3SCUA 4ACZB 4QFUA 4HA4A 1I75A 1K9TA 3N12A 4DUWA 1LQ0A 3VMOA 4TUFA 3WNOA 1B9ZA 1JXJA 3MI6A 2CERA 4QAWA 4IISA 3RM9A 5ABEA 3RDKA 1TQWA 4QCEA 1LWJA 2J8FA 2Y2WA 1HL9A 2J74A 3UCQA 3LRKA 4AD1A 1KGWA 4D6CA 3HN3A 4LYQA 4IPNB 3WEOA 4P7RA 3GH4A 3VPLA 5I77A 4D6HA 1W1YA 3BUDA 3AMDA 3CBWA 3WQ4A 4W7UA 2YL9A 2GJXA 3TV8A 4AZBA 4IUGA 4FLRA 3CUHA 2RGMA 3TTOA 1JXKA 4GQQA 5A3HA 3BVWA 1E6PA 2WAGA 2XFRA 3ZR6A 5D9OA 1E0XA 5HPCA 2VVSA 3VD5A 1DWHM 5A2CA 1H1NA 5FD0A 3W38A 3EDDA 2VRJA 4JKMA 1IT0A 2QMJA 1V6UA 3BGAA 5CPTA 2PBOA 3ARWA 5FKYA 4MDPA 4DO4A 3QOKA 4MB1A 2PB1A 3EJPA 1W9PA 3LPGA 4XZWA 2ZWZA 4PMVA 1JZ4A 1ITCA 2OW7A 2D73A 1QVBA 2XGBA 3L4TA 1HTYA 2DIEA 1JFXA 1JD9A 3DYOA 1J01A 4OBRA 2ZXAA 2WM0A 1O7AA 1VEPA 1X6LA 5D8WA 1KWGA 3A47A 2XIBA 1C90A 3OGVA 3MKKA 4OOZA 1UR0A 4U3CA 1OINA 3AHVA 3RO8A 3ZQ9A 3M7SA 5IHSA 4FF5A 2BXZA 2Y24A 3D50A 2WK2A 1R86A 1HP4A 3KWXA 3BAYA 1WZMA 5ECUA 5D9NA 3QOMA 5M03A 1J0YA 3WF2A 2C0HA 1G5AA 3S6TA 2WHLA 1PIGA 4X0NA 3VMNA 2G3MA 3VTRA 1J10A 4V2XA 5E1QA 3WNNA 4NF7A 4LX4A 3BCDA 4NZFA 4PCSA 2VTFA 5BXSA 3VSVA 1EOMA 1HXJA 4TVUA 1SFSA 1ISZA 4GINA 2WLZA 3GXNA 1R33A 4R27A 4EAMA 3RCNA 2A3AA 3K4DA 4H8VA 5KZ6A 1U2YA 1UD8A 1QOXA 5FL0A 1GOQA 4R5EA 5FCZA 2B31A 5JUVA 1NOWA 4DUXA 4MADA 3CMGA 1PPIA 3WDPP 3A5VA 1FFRA 2BVTA 1HL8A 3PZNA 4P8WA 3VIFA 2W67A 1OD8A 5LA2A 1MQPA 3CH9A 2XM1A 4MAZA 1WZLA 3EJQA 4D6GA 2XPKA 2W91A 4ZEPA 4AIOA 2WVUA 2BXYA 3WY1A 3W6LA 4HPGA 5D4YA 3AS0A 3WMSA 4AZIA 1KQYA 1UZ1A 1KWKA 4U2YA 4H8UA 2OWXA 2XM2A 2GUYA 2O92A 2VX7A 3L4UA 2WMJA 2IGTA 3BUBA 2J25A 3DX4A 3RPMA 1NH6A 3BLKA 1LL6A 1E9LA 3HG2A 5A6MA 3VIPA 3WQ6A 1E4MM 1SMDA 3GXMA 1HKIA 1E56A 1CWYA 5M17A 3W24A 6TAAA 1IZJA 1C7SA 1E6ZA 2XFFA 1KGXA 4UQEA 2GVYA 2Y8KA 3GM8A 4HU8A 2WHJA 2OSYA 1ISXA 3THCA 3SEPA 3BVVA 5DEZA 3MS8A 4GQRA 1DWJM 1V08A 1BAGA 2GJXB 3WEMA 3AMGA 3AS3A 5DF0A 1ZB5A 3VX1A 4P8XA 3U5UA 1W2VA 1WZAA 1CGUA 2CYGA 3TOPA 2X2JA 2ZX9A 1WCGA 3BUIA 2D23A 2CITA 5A2BA 2DH3A 1E3XA 4GZIA 2FHCA 5A8PA 1QI4A 3J7HA 1V3KA 4WSKA 2WKGA 2DEPA 1FHDA 4AZ5A 1VBUA 3EJTA 5CG0A 5A6LA 4RE2A 3ALFA 3EDFA 3VOCA 1QNOA 3FNDA 4HA3A 2YIHA 4WKAA 1HJUA 1PZ3A 3ARSA 2BVYA 2X1IA 4F66A 1L8NA 4JHZA 2DT3A 3ARPA 4TXEA 3K1DA 1FP9A 5DO8A 2JEQA 1BPLB 1M7XA 4MNMA 1SMAA 3T0BA 7CGTA 2ZOXA 3DC0A 1EHNA 1RD6A 4CD4A 1PAMA 1B0IA 3UERA 3SCPA 3GXDA 2BFGA 1GVYA 1A3HA 2FH6A 2W4XA 3DHUA 2JF7A 3WY2A 4CCCA 3VGHA 3BC9A 4F9JA 4C7FA 2VZSA 2C7FA 2QPUA 5ABGA 1IV8A 2VUYA 2X2IA 4CCEA 2O9TA 4CN4A 2CBVA 2YDSA 4CD8A 4UQBA 3T2PA 2QLYA 2G4FA 3WNKA 1GZJA 4JAWA 1BYCA 1NWUA 1JI1A 3WFLA 2WHKA 3NDYA 2WPGA 5BCAA 1C91A 3THDA 3WUEA 3HU7A 4AD5A 2IXUA 3BAWA 4JL2A 1OGGA 1W9BM 3VO0A 4D6DA 3SCRA 4MDOA 1C3FA 1QPKA 1F4AA 4M56A 4KMQA 3GZAA 3KLLA 4D6IA 2CIPA 3BAKA 5A8MA 1C93A 3U5YA 3SCTA 2BVDA 2DSZA 5DFAA 5CXPA 4GKLA 2E40A 2NT0A 3AMLA 4CKQA 4PN2A 2BV9A 2ZE0A 1E1EA 3PN8A 1V0NA 5CQ1A 4PTMA 3T2QA 2YOCA 4MB3A 3MMDA 1UWUA 3BH4A 2YFNA 3EDEA 4NX0A 4W5ZA 1QW8A 1BYAA 3WH6A 2CNCA 4UFMA 1JD7A 3L4XA 5I78A 2J7CA 1UD4A 2DH2A 2CXGA 2VZTA 1R85A 3WEZA 4CGTA 1V6XA 3WUGA 4B16A 3N15A 2WVVB 4J3TA 4AZCB 4PRWA 1DWFM 4K68A 5IDIA 2XN1A 1NQ6A 1KB3A 1OD0A 3VSUA 3CIVA 4GI9A 5A2AA 3CZJA 1UD6A 4U3AA 4HZ7A 2WBGA 2EEXA 1EOKA 2CESA 2JIWA 2D2OA 4YHGA 3WF3A 3LPPA 1H3GA 2AAAA 4PMRA 1MW0A 2F1AA 6CGTA 1HWWA 4M80A 3MSGA 2BY1A 2HVMA 4W86A 2VZUA 1R8LA 5CLTA 1JZ7A 4XZBA 3UETA 3OIHA 1R87A 4Z2JA 4W84A 1CGVA 1VJSA 2YA2A 1J18A 4IPLA 4CVUA 1G9HA 2F7QA 5M5DA 4GZEA 4AZHA 1OCQA 3A4XA 1US2A 2PWEA 3AROA 1BYBA 2DSWA 3FAXA 1J0IA 3ARVA 1XYZA 3ZJ8A 2AOSA 3OG2A 2YFOA 1XH1A 3WNMA 5IFTA 3S5ZA 8CGTA 5C71A 3VNYA 4PTXA 1S46A 3B9EA 4W8BA 1KXHA 1UWIA 1HT6A 4DM1A 1CENA 4B15A 4AD3A 3CC1A 4DWSB 1TMQA 4TTGA 1EXPA 4JFTA 8A3HA 4JFVA 4U33A 4AXNA 2J7FA 2EPKX 1E73M 1QHPA 3ZR5A 2E8YA 2A3HA 3O2LA 3BLPX 4V28A 1KCKA 1GPFA 3IAQA 2FH8A 2AMGA 4MJ2A 4JFSA 2WBKA 4A3HA 4CD6A 1JYNA 1W9DM 5ABFB 4NSBA 3MANA 3UG3A 2GJPA 3BCFA 1MWOA 3KEHA 2JEPA 3AMKA 2C8NA 1GQIA 2J75A 1CXHA 3CLWA 1OGBA 4MB4A 3AXHA 3NUKA 1FHLA 2E3ZA 4W89A 3POCA 1HNYA 1UR4A 3ECQA 2X8RA 1BLIA 3I3DA 3DECA 2J47A 3W4RA 2D0GA 2WSPA 2V3DA 1WZKA 4CU8A 4LYRA 2ZUNA 3PTKA 1H41A 1SZNA 1VEMA 1EO5A 4B3LA 2CCRA 3FHQA 4DWSC 1LJYA 1HF6A 3N04A 1H0GA 5E6YA 2VR4A 3BVXA 5HXMA 3VGBA 3N11A 4FLQA 1BSIA 1UA7A 2ZUSA 1OBAA 2Y8VA 4D6FA 3WQVA 2V3FA 5CLWA 3BAXA 3AIUA 1TVNA 4FNTA 1EDGA 1GCYA 4JZ5A 4OKDA 4ACYA 3F5JA 2TAAA 1HJSA 2QPSA 3EJUA 4S3JA 1XD1A 4H04A 1TA3B 4HPHA 2EO7A 1VEOA 1WB0A 2F7RA 1KQZA 4CU6A 1TQUA 1GQJA 1HJWA 1HN1A 4N42A 3LXBA 1Q6FA 1XSKA 4V27A 5A94A 3DHPA 1HX0A 2V38A 2ZUMA 1Z32X 2BY2A 1W32A 2CBIA 5E70A 2ALWA 3IJ9A 1JZ3A 2Y4SA 3WD3A 2D24A 2GK1A 3EMZA 4PMXA 1KGUA 4F79A 1D3CA 4D1IA 2DSKA 3VGGA 3ARQA 2FHBA 1E43A 4UFKA 5CJ5A 1TG7A 2WMIB 1TZ7A 1HJXA 4LGXA 1XCWA 3L2LA 1B1YA 1H09A 2WNWA 3VILA 2PI6A 2G3NA 1ZU8A 2CHOA 3SUVA 3AICA 3PZMA 1QHOA 1W3KA 3FW6A 4AZGA 5GQBA 4OIFA 3LRMA 4DUVA 2XVPA 3FN9A 3I3EA 3AIEA 5BWFA 4GZJA 3ARUA 4J3XA 3CMJA 3VIMA 3W29A 3M46A 5A6SA 3S2CA 4YHEA 4QLLA 1XCXA 4CCDA 3GXTA 3L2MA 5E0FA 1H4PA 1C92A 2WCGA 3K8KA 3PZUA 5DT5A 4A3YA 1KCLA 3ZJ7A 3LPOA 4BA0A 4WKHA 2O9RA 1W3LA 1B3WA 5A69A 4KWUA 1BGGA 3WN6A 5TD4A 1NARA 4OJYA 4LYPA 2WW5A 3RMEA 1R47A 4AEFA 5HOSA 1UASA 3RM4A 3CHEA 1UH4A 1CEOA 3VM7A 5LA1A 2YLAA 1M04A 1W1PA 1MW1A 3LPFA 1JGIA 1C8YA 2OW6A 1ZBWA 2YL6A 3GXIA 4GIAA 1ZBCA 1MFUA 3SCWA 4URIA 1HVQA 1ZBKA 1Q6GA 3M07A 3MUZ1 4UZUA 4AYSA 3W25A 3SCOA 2EPLX 1B2YA 4EK7A 4QCFA 5BXTA 1UD3A 5IFPA 4FNPA 1UKTA 3L4WA 1SYTA 2D0HA 3NCOA 4BQ3A 1W9VA 2CETA 1BTCA 3W0KA 2D3LA 1QWUA 1V3IA 1UD2A 3WD1A 2WCSA 3VDCA 3KL0A 5GNYA 2FHFA 5JBFA 1H5VA 3VD9A 1MFVA 5EBAA 3D51A 5E09A 1P6WA 4M8UA 4ATDA 2ZIDA 3WL1A 1TVPA 3UR7A 3UR8A 3PHAA 1H0IA 3ZOAA 5I5RA 1VENA 4HMCA 5M3WA 2VVNA 1V6YA 4AWEA 3WL0A 1CXEA 1XV8A 4NXSA 2J79A 1R7OA 2F18A 3EJSA 1HP5A 4EKJA 5A6BD 4PMOA 4AMCA 1KXQA 2EAEA 3FAWA 2VL4A 4AZ6A 1KBBA 1Q6DA 4C7DA 1J0HA 4Z2LA 2BNJA 2ZXDA 3SUTA 4LPCA 3L4VA 1R75A 1TQVA 1JZ6A 2QMKA 1GQKA 4GXPA 2JE8A 3AXXA 2YBTA 3BSGA 1J0JA 1E3ZA 4NRSA 2ZUUA 4KRUA 4B9YA 5BRQA 4J7RA 4QLKA 3EJRA 1ZJAA 2PWHA 1VBRA 3WELA 1ISWA 2ESCA 3VMPA 1UWSA 1FH8A 3VU2A 3GDBA 4OGZA 3AHZA 1RP8A 2E9LA 1Q6CA 1W1TA 1B3VA 3AIBA 1E6QM 1PZ2A 1CECA 2VOTA 4BZYA 1ZJBA 3BAJA 2WWDA 1V6VA 3EBVA 1H49A 3LXAA 1MW3A 2XVGA 3AZTA 3PZGA 3WUBA 3VD4A 3AIRA 3VM5A 3WH9A 1GOIA 1E4NA 4FNUA 1XRVA 2XTKA 3H53A 4U31A 1MQQA 3MV01 3B9AA 2JALA 1FA2A 3MSDA 4P7LA 5AC5A 2GDUA 3SIMA 5I0DA 2WVTA 3VIHA 4Z2HA 4UQ9A 1VF8A 3VIGA 1CZ1A 1VAHA 4UFLA 3T0AA 5FOOA 1J12A 1JL8A 4GO9A 2YKKA 1B3YA 5AYIA 4GI6A 4FNRA 4AY1A 1XHGA 3T0DA 3ZSTA 1E1FA 3B9DA 1JZ5A 1PJ9A 4CD7A 4AC1X 2G41A 1FH9A 3PZOA 1NWSA 3ARRA 3ARXA 2W61A 1J9YA 3AIWA 1XSIA 3CZSA 1N82A 1XH2A 2DT1A 2FGLA 3WNLA 1E70M 3L4ZA 4AMXA 1V02A 2VQUA 3CGTA 4AD0A 3ALGA 4WSJA 2D22A 1H2JA 1UWTA 2WXDM 4UR9A 1CXIA 1U33A 1ODUA 4MB5A 4A4AA 3GTNA 3WENA 7TAAA 3H54A 4U2ZA 4NZCA 5HBFA 4PMYA 1AQ0A 3RM8A 1GW1A 3A4WA 2O9OA 4NZJA 1X6NA 1HKKA 1EDQA 2J7GA 4AD2A 2XGIA 5EFDA 1CGTA 3MU7A 1V0LA 1CPUA 3AS2A 4AIUA 2VCCA 1WPCA 1I1XA 4E8CA 4PMZA 2DIJA 1NWTA 3VVGA 4UZSA 1K9FA 1QW9A 3MUIA 3II1A 3WF1A 1OWQA 3BMVA 3AIQA 3DX0A 4J3VA 1UH3A 3U7BA 3RJYA 3S5YA 3MMWA 1DWAM 5JIWA 5JIPA 3LMYA 2YBUA 5CPQA 1HJQA 1OIMA 4M82A 1CGXA 3VGFA 1VRXA 4HOXA 1EA9C 4U5IA 2ZWYA 2WMKA 3UESA 5CGMA 3IAPA 4U5KA 4MTVA 3CHCA 5A8NA 4WF7A 3VGDA 1FOBA 3AFBA 3MV11 3CHDA 1Y7VA 4W8LA 9CGTA 1GOOA 4KGJA 3CUGA 1BFNA 3MO4A 2VRQA 3N17A 4P8UA 4XV0A 2XIIA 5LYRA 4JKLA 3WMBA 2J62A 2YA0A 4GPNA 4AISA 3BLBA 3D4YA 4KRTA 4HZ8A 1BG4A 2QV4A 1OT2A 4W8AA 3W37A 3CV5A 4W88A 3PZ9A 1EQCA 4CN6A 1DEDA 2XHYA 5A1AA 2CKRA 4PUEA 4YPJA 4LXFA 3VIKA 1EO7A 4HU0A 5BXPA 1AQMA 4B3KA 4P7QA 4ZFMA 4QLJA 3ZSSA 2VI0A 1UR1A 3CZ8A 3ZO9A 1M03A 2NW0A 1V02E 1JG9A 1JZ2A 3QHOA 4FLSA 4DO5A 3TA9A 1J0ZA 4X0VA 1EH9A 1LG2A 1FP8A 3GH7A 4OOUA 2XVNA 2DSVA 2FYVA 3AHTA 3OLDA 5JBDA 1PIFA 3QR3A 5BRPA 2J7HA 4W5UA 3VGEA 2J4GA 3WY4A 1UOKA 2W66A 2O9PA 1AQHA 1LG1A 3NYDA 4QP0A 3WDQA 4L4OA 1UR8A 2WLYA 1VFUA 1XGZA 1KTCA 4UCFA 4CU7A 2W63A 3BMWA 2WKLA 1MQRA 1O7DC 4EANA 2HISA 4TOQA 3T09A 1CGWA 1XYFA 1E55A 4JHOA 3VD7A 5GNZA 3WBAA 1W3JA 2VJXA 3CZKA 4PUDA 2F7OA 1BF2A 4W7VA 5CSYA 3IK2A 3TTQA 5DT7A 5CGTA 3W28A 1E4LA 3W81A 4CUCA 3T2OA 2BHZA 2W92A 3PBGA 1V3HA 1OGSA 1PEZA 2OWWA 2ZX7A 2WMHA 5GNXA 3IJ7A 3LXCA 1E6RA 3WUFA 4DM2A 1QI3A 2MANA 1KXTA 5C8BB 4M24A 2ZUTA 4FMVA 2IXVA 4AZ7A 1PX3A 5AC4A 3CPUA 1UG6A 3SCVA 1WDQA 2VX5A 2X2YA 1JFHA 1KXVA 1QI5A 4PTWA 5IHRA 2WC3A 2PC8A 3IGUA 3OBAA 3PTQA 4AIEA 5C70A 4UOQA 4MJ4A 2VR5A 1V0KA 2X0HA 3W27A 5A8QA 2E4TA 3VX0A 3NDZA 3TTYA 3WIJA 2YJQA 3WF4A 2GJRA 3U57A 2CKSA 3N9KA 3O6AA 3BUQA 3WMCA 1VB9A 4J27A 5I24A 1I1WA 2Z1KA 3VDHA 3WNPA 3WY3A 2VT0A 4TTUA 1NOFA 3HJEA 4J3UA 3W82A 3DX1A 2UY2A 3HZ3A 2BHYA 2X2HA 3WDIA 1MYRA 2JF6A 2XFYA 1K9EA 1T0OA 1KR1A 4ZXOA 3MUY1 3ZJKA 2XWEA 2VCBA 1B90A 1WE5A 4UFHA 3A6OA 4H7VA 1TQSA 2OLHA 1ZS2A 1VFMA 2A3EA 5KEZA 1VFFA 3K4AA 1JYVA 4JFWA 2X0YA 4WKFA 3AYRA 1E6XM 4HP5A 1C8QA 3IJ8A 3QHMA 1SR0A 4DO6A 3GNRA 1R46A 2X09A 1E6SM 5CZKA 1WP6A 5D8ZA 2J78A 3WDHA 1QHZA 3K8MA 3VNZA 1CIUA 4PYSA 2VC9A 3G6MA 2XWDA 4FK9A 3LRLA 1CGYA 1UKQA 1DHKA 3KL5A 5I23A 1HIZA 3OA5A 5EFFA 3DX3A 3WQ5A 2VO5A 1UR9A 1L0PA 3SUUA 4XX6A 4C7GA 3F5KA 1KR0A 3W6MA 3G6LA 2WVSA 3BAIA 3WD0A 2JIEA 1RP9A 5F7UA 3K8LA 2EQDA 4WK9A 2CEQA 5A6AA 1DTUA 3NJ3A 4PSPA 2A3CA 4UQCA 1JIBA 2WZHA 3AZRA 1JYWA 1B31A 4PSRA 4H8HA 1J11A 5A8OA 3U7VA 3HMCA 3WH8A 2F1BA 4HA1A 4AD4A 3B8SA 1UWRA 1GJUA 2EBNA 2UY3A 2FE0A 1W9XA 4HOZA 1UD5A 2WCAA 3BVUA 1CDGA 3POHA 2XUCA 1B3ZA 2CPUA 4CD5A 3BVTA 1CLXA 4ZE4A 2BS9A 2OYMA 1G94A 4M81A 1DWGM 3FY1A 2OWCA 3WDRA 1IZKA 4D1JA 1KFWA 1E0VA 3ZIZA 3AIVA 3JUGA 2FGZA 4M29A 3BSHA 1ZL1A 2VX4A 1CXLA 1E72M 5I79A 4P7OA 3SUWA 1H11A 3SUSA 3CTTA 3D5HA 3PTMA 1PX8A 4MNLA 3CUJA 4F9DA 3T08A 3AQUA 1Q6EA 4EE9A 1EDTA 3TTSA 2XJ7A 2G3IA 2ZX5A 2UY4A 1UYQA 2UY5A 4N0RA 1UKSA 2Q8XA 1UQYA 4JKKA 2D3NA 3N13A 3CZEA 2W5FA 2BY3A 4WLCA 2XN2A 3ZJ6A 5IXEA 2QF8A 1QBBA 4HTYA 3GXFA 1V3LA 2YL8A 2DSUA 2ZX8A 2PBGA 1KBKA 3AS1A 5JBEA 2XVLA 3N18A 3A4AA 2IUZA 1MXGA 1V0MA 2CHNA 4JIEA 3EMQA 1OT1A 1US3A 1ISVA 4UOZA 1JNDA 1O6IA 3VKKA 1R7AA 1XSJA 4Z2GA 4RL3A 1E5NA 3WD2A 1JDDA 2E8ZA 2WZEA 2EXOA 2Y5EA 6A3HA 3D52A 1D2KA 4YN5A 2VZVA 3PZIA 4AZCA 2VURA 1NP2A 1GOMA 3KLKA 2VQTA 2J7BA 3AHYA 1C7TA 1QNSA 2BY0A 2XYLA 1ESWA 2X05A 3OLGA 1TCMA 3BUPA 3DDGA 2V3EA 4J3SA 2GDVA 5FIPA 5BXRA 4UTFA 1QNRA 5LA0A 3AOFA 3L4YA 1Q4NX 2J7EA 1RH9A 3EMCA 4PMUA 4TVDA 2J7DA 3F5LA 7A3HA 5E6ZA 4D72A 2DDXA 2Z1SA 2DT2A 4UNIA 4E2OA 3AMCA 4Y7EA 1ISYA 5FL1A 4H41A 2CBUA 4DWSD 3WD4A 1LLOA 4Q7NA 3EDKA 1E4IA 2OYLA 3BXWA 1MVYA 1QNQA 3UEQA 1BGAA 1ODZA 3IANA 5DMYA 3WFZA 1E40A 4B9ZA 2GSJA 1W3HA 1MXDA 3ZM8A 1BHGA 4E4PA 2WMIA 2E0PA 1YQ2A 3WH7A 5A6KA 1JF6A 3GH5A 4MNJA 2ZXBA 2GK1B 4PCTA 2WC7A 1OB0A 3A22A 3KE0A 4X9YA 5AY7A 4HOWA 1UH2A 1C8XA 3OLEA 1E5JA 1NM9A 2YA1A 3PZQA 3GBDA 2F8QA 1G01A 1NWRA 1HVXA 2G3JA 2QHAA 4NI3A 1JF5A 2VNCA 3CZNA 4L4PA 3APGA 4NXKA 3ZT7A 3NSXA 4BQ5A 1WKYA 2XN0A 4D6EA 2WZIA 1FH7A 4HZ6A 2NSXA 4AEEA 4JCLA 4UFIA 1WAWA 3WH5A 1EIBA 4PMNA 3NSNA 1UQZA 3GBEA 3K46A 1CLVA 1HKMA 3WDJA 2WHMA 1R34A 3VIIA 1LL4A 1GHSA 1TQTA 3CHFA 1UR2A 3D3AA 4CN1A 3UG4A 1TFVA 2FDMA 1WDSA 3CZLA 4TVCA 4JL1A 3HG5A 1PX4A 1OIFA 5HNNA 3KL3A 1OM0A 4UOJA 2EABA 3H55A 2DPEA 4ZE5A 1UUQA 2ZUVA 4WIWA 4E8DA 3SCSA 3VIOA 1BVZA 1A47A 2BHUA 4XB3A 1UKPA 4OUEA 1HXKA 1HKJA 1CNVA 5I6SA 3AZSA 2XSBA 1ECEA 4F8XA 1ITXA 4FLOA 4DWSA 4BCEA 2UWFA 1QX1A 3QHNA 2RGLA 3AJ7A 1GJWA 1BVNP 2NT1A 2DGAA 4ZXLA 1V6WA 4W87A 3CUIA 4MNKA 1CXKA 3ZMRA 2ZUWA 1W9UA 1XC6A 1JAKA 1E71M 2D20A 2WYSA 2OYKA 5A6JA 1GHRA 5E0CA 3ARZA 2G8ZA 5CPSA 1EHAA 4MAVA 3A24A 4ATLA 4UFJA 3N1AA 5ABFA 2XVKA 1BQCA 3RJXA 2VMFA 1V3JA 4Z2KA 3OB8A 3WF0A 2VCAA 4FNQA 1OSEA 1K9DA 1NOUA 4HMDA 1UWQA 2YDQA 2EADA 2WC4A 5AYBA 2E9MA 5BYWA 3PZVA 1AMYA 5EMYA 3W53A 3VDBA 4P7NA 1JAEA 2PF0A 4PBGA 2YDRA 2F7PA 2PWFA 1QI0A 3VD3A 2VX6A 1XD0A 2WB5A 1JZ8A 1EGZA 4TX6A 4M1RA 2V5DA 4JFUA 2OSWA 1MW2A 1CTNA 1GOKA 1JDAA 2DQXA 3QGVA 4GI8A 1AVAA 4W85A 3SCNA 4BQ2A 5CSUA 1BG9A 3AYSA 3ARYA 1J0KA 3EDJA 3AHXA 3HG3A 1G0CA 3E1F1 4NRRA 1M01A 1GUVA 2D0FA 3GYCA 4BF7A 3FHAA 4GO8A 1G1YA 4AYGA 2ZXQA 2EPMX 3DX2A 2E9BA 1VIWA 4AMWA 4W7WA 1QNPA 1DP0A 3I3BA 4PEEA 5BROA 1K6AA 4S3KA 1YHTA 1W91A 2DT0A 3TP4A 3GXPA 3AXIA 2JFEX 3UG5A 5A95A 1B3XA 3KZSA 2YL5A 1D7FA 2XG9A 3RILA 4RE3A 1LWHA 1RPKA 2WSKA 2V3GA 2WMFA 5HDRA 4LQ1A 1UZ4A 2GFTA 1X1NA 1WDPA 1TE1A 1W2PA 3VINA 2EPOA 3WKZA 4CVWA 1GVIA 3TONA 1JI2A 1BYDA 3ZT6A 2EACA 1GQLA 3VUPA 4HMEA 4Q22A 2WVVA 4W93A 3WSUA 1W1VA 3SURA 1GOWA 3SCQA 2VZOA 3FXYA 3DDFA 4FNSA 4UQDA 1F4HA 2J8GA 2W62A 1FFQA 3VSTA 5ABHA 2ZX6A 4D6JA 3F4VA 3W26A 3ZT5A 1LF1A 2A3BA 1E0WA 3OLIA 4PMDA 3O9NA 1VFOA 4IM4A 5D9PA 3A23A 1JNEA 1TUXA 5GPRA 4BS0A 2WWCA 3NIYA 1TR1A 3AI0A 3CZGA 3D4ZA 2F2HA 4ATWA 3WQWA 3VIJA 1QBAA 1WDRA 3WBEA 4QDMA 5I2UA 4KH2A 3HG4A 1GONA 4WJXA 4D71A 5E9AA 2EJ1A 1WO2A 1E15A 4TX8A 1KTBA 3MUAA 3NSMA 3CO4A 2PWDA 2WMGA 4RE4A 3CUFA 1EQPA 3A3HA 1V03A 1GORA 3WQ8A 2PWGA 1JDCA 2XSAA 3AISA 3GNPA 4Z2IA 2CBJA 1PS3A 1V3MA 2V5CA 4MPKA 2OSXA 1CBGA 5EB8A 4ZENA 2F61A 4BQ4A 1NP0A 1UKOA 3A21A 2D1ZA 2J77A 4AW7A 4JCMA 1M53A 2WANA 3M6DA 1CXFA 4ACZA 3OZOA 1QWNA 2ZICA 3OZPA 3OGSA 5HPOA 1PBGA 1LL7A 3LX9A 1HJVA 3PZTA 1VJZA 1E6NA 1ZBVA 3MMUA 2YLLA 1XH0A 1TA3A 1WNOA 4P8VA 4J28A 3DYMA 4PTVA 1U30A 2EPNA 3ARTA 4ML4A 1CYGA 1DWIM 3RIKA 1UA3A
chains in the Genus database with same CATH superfamily
3GNMH 1IL1A 4FQJL 1GNXA 5DHVH 2BMKB 1KRAC 3GNOA 3OGRA 5J04A 1DQJA 4PJGF 5HHPA 3GFYA 1B30A 4KIEA 3N1GC 3UZ5A 5XIAA 1BQRA 3UZXA 3EO9L 5DK0B 3TZNA 3UPWA 5I3DA 4ZW7A 5A6BA 4K3JL 4TNEA 3S4TA 3OR7A 1JYXA 4BFAA 4G2DA 2P5WA 2VRKA 4O0KA 1UHVA 5K7JA 4K9EH 4KRLB 2C9PA 4PMQA 2W9DL 4UT6L 2HDJA 4DFHA 3FQ1A 1FH2A 1FNAA 2P5EE 4KJWD 1IZCA 3U9IA 4XCNB 2QTEA 2VISB 3ZY7A 4HA4A 2ZKMX 3GZQA 4GUQA 5J4MA 3M1BB 4HFWA 2DV0A 1HCYA 2HG5B 2EJAA 1LQ0A 3ESUF 2Y62A 5FCUL 1AYOA 2XICA 1NFDF 2PGFA 2ZRXA 1IAKA 1M2VA 5CAKA 1IO4C 4UB0L 1LO2L 5T3XD 2X7VA 3G7TA 3QEQD 2GTZB 1JXJA 3UPBA 3MI6A 3E6FA 3H8NA 2GK0B 2ZPKH 4LKXB 3TNMB 3MRHA 2CERA 1I4FB 2FZBA 5AALA 3RM9A 3NCJH 2W0FB 2FUQA 6ALDA 5TE7L 5AB0A 5C0AD 1IIKA 1U9KA 2GTWB 3S34L 4QCEA 1LWJA 4XAPA 1JHLL 2EDOA 2ZZ3A 4R9XA 1OAKH 1HKLH 2Z35B 2Y2YA 4HZMA 1HXMB 3M0KA 3EXJA 1KFJA 1UIOA 2V69A 1OIOA 2O6DA 3N1QC 5D7EA 3ALXA 1KGCE 5EU6D 4K9EC 4IPNB 4FULA 2HH0H 3T05A 4F0HA 3P4NB 1FGVL 4GO6B 3ZUCA 2ZA2A 4PAZA 5DJZB 5AB1A 3SKJL 3FCTB 3VAEA 1XF5A 2FJHB 1FNGA 1JNHB 3IN2A 3CBWA 3T4AC 4A3RA 1FC2D 2YC1A 2AERT 3W1NA 3WQ4A 1RIHL 4N3UA 1ECYA 3TBSA 3T0EE 2YL9A 4S1QH 3B4UA 3QXDB 1DE6A 4O1CA 4NRZB 1YMMA 3W00A 3JV4B 3TA6A 3DHMA 5CBAB 3NO3A 5GRJH 1TJ2A 2X3BA 2Y1VA 4PJCA 3CUHA 2GBVA 2QEJA 4X4ME 4ZNEA 3ANYA 5AVXB 3VFSB 2RGMA 4WDTA 2QVHA 4U1GB 2X9YA 2CXKA 1R0MA 1KJ3L 3TTOA 4GQQA 5A3HA 1UZDA 3MZ2A 2NQ5A 2BRQA 3L9BA 1A6WH 2C9XA 5CPMA 4KK8C 4LEQA 1ROWA 4W9GC 4C56A 3GIZH 2KLTA 4M19A 4DJEA 1E0XA 1PDZA 2PXYC 3FO1B 4NERA 3A9BA 1DWHM 3AXKA 3NQGA 4I8DA 3D1MC 5A2CA 4XNZB 4D0CB 1C5DA 3GFXA 3HE6C 1SVBA 2CZ5A 1WBHA 2B9BA 2AEQH 2E56A 1VCBC 2YR3A 4Y4KD 1F6LL 3VFMB 4OV5B 1BAFL 2ZRZA 2QKSA 2QMJA 4ROQA 3ZRCC 1VZWA 4M1CC 5BOZG 1J6OA 2G50A 4DO4A 4WEMB 1OZQA 2Z34A 3OXRB 4HGWA 3Q06A 1OO2A 3CFQA 1OWRM 3UIZA 1Q13A 2PDMA 2WXGA 3PSWA 1ZAGA 2ZWZA 4NO5B 1SFHA 4MFEA 1MLCA 2WJFA 3CLEL 4LVHC 3PWLB 2IXQA 1ITCA 4AQAA 4LCWA 1JMXA 3NO5A 2OW7A 4LF3B 4AOFA 2F6UA 2RDXA 2V8MA 1YE6A 1NCAH 1XF3B 3EYQD 4I2XE 4YBLB 4YDLC 3LBCA 2DIEA 4MCNA 4KQ0A 2NY4C 2H6PA 4NZUL 4PS8A 3OB0H 4H1LB 4UDTA 4G9FE 5HVWA 3AO0A 3VNJA 3LRSB 4G5ZH 1OCZB 3JZUA 1DVQA 4KRPD 2ZXAA 2QUNA 4MZIA 3NOEA 1X96A 1ZKAA 1O7AA 3C2AL 3MCLH 2R8WA 2BPBA 2HA1A 4AJ0A 3A47A 3Q6FB 3ME0B 5FLVA 3T7VA 4X22A 3KLAB 2ACSA 2OBGA 1TUFA 3MJ7B 4O02B 1E4WL 3WHXB 4AXKA 1A2YA 1RLBA 3KS0J 1I82A 4R96A 4U3CA 1QO3B 1Z1WA 4O1DA 3JTTA 2JXMA 1XIWB 4F15B 3N44B 4FQIH 3H2MA 3M7SA 3BH9A 2AV7B 2AV7A 2BXZA 3P11H 1TJ0A 2Y24A 3GRGA 4XPTL 3C2OA 2JXMB 3LI0A 3GG0A 4AH7A 4R96B 4Z3HA 5JOFB 3PSVA 3QAZB 3ZVVA 4C6DA 5C2XA 4LSPL 3H0TB 1HP4A 3MP3A 2QDEA 1ADQA 5B8CC 2Z25A 1S5TA 4JX0A 3ZTJH 2YK1H 4C6EA 3MC5A 3C9NB 3MLSL 1T5WA 4LVDA 1TJHL 1XIDA 1GGCL 1YG9A 1UPMB 3HJZA 2YD5A 4E9LA 1I2NA 4OZHE 2C0HA 2WHLA 3WO8A 1PIGA 3NXFA 4GSDL 4P5MB 5FF6A 4X7EC 4FG6D 4BKLB 4FR6A 4HIIB 3VMNA 5JMRA 4UBDC 2G3MA 3CG8A 5E1QA 2CIIB 4F8QA 1WKEA 5T8IA 2VDML 2FEJA 1GTFA 4GK8A 4WI0A 2VXQL 1BZ8A 3U7YL 4NF7A 3ARGC 4S1DD 8XIMA 3MLVH 4FI4A 1WG3A 4YZFE 3FZUD 1A80A 4GH7B 3BCDA 4NZFA 2XXGA 2G75A 3T8XA 1GZPB 2DQGH 3W72A 5BXSA 4QMEA 1PG7W 1TETL 3VSVA 4CVZB 5ISZE 4QRTA 5A2JH 4Q8TA 4OGXL 1AGCB 1CLOH 4J2XA 5F9OL 1SJDA 1BJ1J 4PJGE 4HAGA 2VDHA 4JRXE 1YEGH 4B5WA 3NFSL 4GINA 1A5OC 4HEMA 1UMLA 3NACH 5FA3A 3IGFA 5G55A 3UO1H 1R33A 4R27A 5DCDA 3MZGB 4IEFA 3GD6A 4EAMA 3TFKD 4H8VA 1JUBA 2Z27A 1QOXA 4WFHE 2AGTA 3HNVH 4WK0B 2RJGA 1ME8A 2RFXB 1CDBA 3VH8G 5HJYA 2QVKA 2XC8A 5C0JA 3LNHA 5IK3A 3C8FA 4DT2A 3T4YA 4DUXA 4OUUB 2G2PA 5DY3A 4AGOA 4GYKA 1XZ0B 4JN1H 1CD1B 5TE4H 2BVTA 1FVEB 3A5VA 3TVMA 3WUZA 3KAOA 4P8WA 4RJEA 4N5ED 5C8BB 3M17A 1NOAA 2VN6A 4NRZA 2E7LC 3FX4A 3QXDA 1OD9A 3PHQB 5EZIH 5FK9A 1MQPA 1WZLA 2P3ZA 2CLOA 3O2WL 2R1MA 8XIAA 4M7KL 5JA9A 2W91A 3MFFB 1V6TA 4CMHB 3HRZC 4K1WA 4G7SB 3K6OA 4N0UB 4K6AA 4MPQA 4Y8FA 5DFWH 1DBMH 2OR9L 2FJHA 4GY4A 3KPRE 2WZAA 4IMLA 2NY6B 3QQ3A 4XAKE 4F4RA 5I3IA 4LNRA 1Q6RA 3VA2C 3MA7B 3P4LA 3CYVA 3IMBA 3BG5A 1V5JA 4X9HA 3HVNA 1I53A 4QKXB 4JTQA 5B22A 2VENA 5DCCA 4PJ6A 5LB1A 3B7UX 1TSHA 1EZVY 2VX7A 2Z35A 3I6LD 4OM0H 3V16A 4CVXA 5GJTL 3TN0A 1MY7A 4IJTA 4PJEE 2BW4A 4NJIA 4ZMGA 5FEBA 2J25A 3S1VA 1HQRA 3MRPB 3TNMA 4Q58C 2BZ7A 1HHJB 3QV7A 4DQWA 1L6PA 3LERA 2VDNL 5DHYB 3JUZA 5CCKH 1LL6A 2WYIA 1E9LA 4F0KA 1IAKB 4RFOL 1EFXB 3AWNA 4TSAL 3E8UH 2O72A 4MA3A 3W11D 5A6MA 1UB3A 1RU9H 4OLWH 3UTTE 1S78D 3KBJA 1KZQA 3I2CL 3UYIA 4FOMA 4NO2B 1REQB 1M05A 4K15A 1CWYA 2VLKB 2F5AH 1TJHH 4JS7A 4B9IA 5AG8A 1MHEB 2VXSH 4Q7IA 2YGNA 4YVNA 4JGJA 2F68X 1KGXA 1FL5A 4H8QA 3MLWL 1K2DB 4ICCX 3MYJA 4IRSD 2BGSA 2ODIA 5IKCB 2ORBL 4OWGA 1O7DE 2ATKA 1K5NB 2G9HB 2JQAA 5AW2B 3UABA 2EKGA 1R2TA 1IILE 2NQHA 2ITEA 2Y6SC 4HBQA 4PR4A 3UP6A 5HHPB 1ZTXH 3QUYC 2N0KA 4UC5A 2F74A 1M71A 3QA3B 1JV5A 1DSFH 1RZIA 4JANA 5HDBB 4KCVA 3U5UA 3F2DA 3LH2L 4O2EB 3I9AA 5DUBA 1ZVSB 2CYGA 4MVBD 1D5IH 3ARFC 5H2BB 2Z28A 3SO3C 4R34A 2B1OA 5IFAL 4TXVB 3T0EB 1NFGA 1OFQA 3RVWD 1W0YT 2PR9A 2CLVA 1JEZA 4TULL 1WFIA 2GDVA 2IPWA 1E3XA 1ITUA 4S1SL 1O95A 3K2IA 2LGNA 4P2AA 2OEJA 5C6TH 2BC4B 5EUOF 1VQTA 4XN1A 1YDYA 4WSKA 4A7GF 1XBRA 3P67A 4JVUA 2Z7ZA 3H2WA 3FGCA 3EJTA 3JW7A 4Q33A 2HVOA 3WE6B 4HXBL 5A6LA 3VFVA 1AH4A 4IRJC 1NBVH 4C4KT 3EDFA 3WIIH 3WSQL 2A83A 2A83B 1QNOA 4NQ1A 1TMCB 2YIHA 3N40F 4L18A 3L12A 4ZOCA 1ZE3C 3IRZA 2YARA 4OLXL 5IROA 3SGDI 3H23A 3QZAA 3TNOA 1XG4A 3MMEA 1X3DA 3MQIA 1WFUA 4CC1A 1FWAC 4J8RB 1PKNA 2DTSA 2DYSB 4YDIH 4Z7VA 4OCYH 5E6ID 2HTKC 1XGRA 5C08D 3CUZA 3HC2A 4BSWB 3EOUA 3OPZL 1JPSH 3W1UA 5H8MA 1UB6B 5ACZB 4MJHA 2PF6A 3OZYA 3CXFA 4R97B 4EE2A 1G7JA 1A0DA 3VI3A 3ARPA 4M1CD 4EZKA 4TXEA 1YMME 1OEZW 3PXLA 4LLMA 3VFGL 4MKVA 2CLVB 3LMJH 3VFOA 1D6VL 2R0WH 4NQSA 3T0EA 1A65A 3GKWL 5ALBL 3NA8A 1XEUA 3SOBH 2AJYL 1FV1A 1O7SA 4XNMB 4YDLB 2EDNA 2DQMA 3DETC 4I7VA 7CGTA 3AU0A 2VDPL 4XP4H 1RZIB 3RWIA 4XKYB 3HI1B 1A4KB 1EDHA 2B1HL 1YVLA 4OQ1A 1AQ8A 4A2RA 1PAMA 5C07D 1T2QL 1B0IA 3KYKH 3UERA 2IDSA 3EHBD 4YHYC 1X5XA 1O5RA 3CAKA 3WLLA 1KGIA 1DLHB 4PJXA 4Z8FL 1S7UA 4E6MA 3V4PH 4LS2A 3U3HA 2H3NB 4L23A 4MHHG 1CQYA 1FFPB 5EO0B 3C2YA 3DHUA 1QRKA 4XVJL 4LPTA 4JYEA 4AVIA 4YL2A 2Q2LA 4MXVE 4LUTA 3RR4A 4F15C 4KKPA 4S39A 3ZZ1A 2C7FA 2PZNA 1LO4L 4ZSUA 1IV8A 2VUYA 1CLOL 5I73C 2NTFA 2X2IA 5DZOA 1LTDA 4G8GB 3BIAX 1N7ML 3EOAA 5GRYA 3MKVA 1XDMA 3MBDA 4WVXA 4LSDA 1I2PA 4JTDA 2E5EA 1QPRA 1OHLA 2OZ4A 3U1SH 3QI9D 3QR2A 1LLAA 1N9PA 2PPAA 3FBQA 4PGBB 4PY8I 5DR5H 4UQBA 1Y1UA 3T2PA 2QLYA 3MRPA 5E51A 3K2MC 5AW7B 3DEQA 3HAEA 1POJA 2JKWA 3EA1A 1IBYA 3CMOL 4RX4A 3DVIA 1WA2X 4QT5A 4QY8B 5DVPA 4ZTPL 3EO0A 4F7CA 2C3HA 5BCAA 1HFBA 2WHKA 1C91A 4OTKA 2HPMA 1QEWB 2NY1C 1TPFA 4RGNB 3TBVB 1BJ1H 2ALAA 5F7EH 4E8GA 3ECBA 3F7VB 5JOPD 4B95C 5L4MA 1OGGA 4JYFA 3EIFA 3BKCH 3HAEH 4L8DB 5GSRA 2NYKA 5E8PB 5DJ2A 1ZENA 4GP5B 2FECI 1D2OA 5D2NB 3DROB 4FP8L 4XZUA 4NLAA 3SKMA 4BJHA 1QPKA 1YNLL 2DZPA 1F4AA 4RFNC 4WU5A 1VF5C 1Z9OA 3WQGA 5DEGB 3LEVH 4FEMA 4PS3A 4WNQB 1JCMP 2I27N 3W9DA 4F2EA 5E4EB 4A6YB 1C93A 3M17B 3L4CA 3SO3B 1VPXA 4FXFA 2BVDA 3TVMB 4LF1A 3SCTA 4GKLA 1CD1A 3TU6A 5DVOA 1AD1A 4GRLD 4IKNA 3P0XA 5JR1L 4BRJA 1T83C 4G42B 4OUUA 3PB0A 3BN9D 3IFPB 3N2JA 4DJEC 1TZHA 4CW1A 1V0NA 4PTMA 1HDMA 2SODB 4JB9L 3I75A 5LKYA 2WY3B 4MB3A 4LHUG 1OCJA 4C5YA 1O5KA 3ULUL 1ECQA 5LXXA 3PGFL 4NNAA 4U10A 3BH4A 1BXNA 1ME7A 1HESA 2EIJB 4W5ZA 2W65A 1KOAA 5DXYA 1VJIA 5AKVA 4O54A 1I9RL 1R5WA 3KPSD 4LVEA 5K39B 3BW4A 5I78A 2HRHA 4ONGH 4KVNL 2J7CA 3SRHA 1AGCA 1UD4A 2OCCB 2YQ2A 3W2DH 1RZGB 1UC5A 4J1UB 3EYVB 5DJ0A 4MZ3A 4LUYA 4FI6A 1U36A 3UWWA 5G4WA 3UWZA 4GW4A 3QEQB 3MSPA 1ICTA 3CT7A 4BUGA 3IPEA 4G1EB 5I2IA 3APFA 3L9CA 3LCIA 2J6EL 4IRZL 2DQCH 3RFZC 1D5XA 2EC8A 4WI0B 1QBML 4R97C 1FORH 3WEBA 1THAA 3V0VA 3X1GA 3WTXA 5FDYA 3QUMA 4I9MA 1KBPA 3BISA 3R4DA 2GSIB 4GI9A 4XWGH 4BKLA 4HWBL 4EZLA 1C8VA 4DN1A 2YD2A 3F6LA 5IUCA 5IOKA 1OPOA 1V55B 2JIXB 2WBJC 1MI5B 3V4LA 4Z7QE 1RPUA 3GSNB 1QDSA 3KCOA 1TQCC 2B15A 3EOYG 3IMWA 3RDTC 1WK0A 1W6TA 1T66D 5DVNA 5HHNB 4HZ7A 4W9CC 2EH8L 4PRBA 1DCLA 2GGJA 4EVNB 2YD9A 3FO0H 2MNWA 1W5NA 4HA0A 1X7TA 1XC4A 4ERSH 3ABKB 4DJFA 1D2PA 2WMPB 4PMRA 1X7QA 4FZEL 5DO2C 1MF2H 4IMGA 5BQ7A 6CGTA 5D72L 2ZC1A 1G87A 3CN1A 3TYFB 3WLHA 3HNSL 4NKOB 2PP9A 4M80A 5C9WA 5B1JA 5DJYA 3OHXB 5I71B 2Q8ZA 3WJXA 5FX3A 4Q4IA 2BY1A 2HVMA 1HJCA 1BMWA 3FQWB 3KGUA 3NGJA 3ME0A 2WUCL 1JZFA 2A9BA 1UOWA 2C26A 4XZBA 5JH2A 3UA4A 3OAYH 3ZL4H 3GF8A 2EDHA 4IKJA 2DWDB 4YMZA 1FLTX 4P9HH 3OIHA 3MUGA 5C0FA 3UETA 1E6OL 5JMOC 4IMDA 4W84A 4JO3L 4HN4A 2FPTA 3REQB 1J18A 1YRRA 1KM1A 1X44A 2CG9X 2E7BA 1RSCA 2F53B 1G9HA 2OJZL 4RPQA 5FAAA 2F7QA 1Q0YL 3DGCR 1YNKH 3NSCA 3PGDB 4YUEL 3E3HA 3Q65A 4ZGYA 1J1OH 2A7RA 3FUJA 1OCQA 1PLGL 1HQ4A 5KSAA 1PBYA 1SLUA 2IXQB 2R69A 3PV6A 4Q9CA 4GSXA 1JXGA 1US2A 3AROA 2V5JA 4HW6A 4NO5A 2P7TB 4BF5A 5A8GA 1W3TA 3ZJ8A 1DEEA 3GB7B 2VWSA 3V6FA 1VZHA 4BXSV 1WWCA 4KFNA 1A22B 4UTAA 3OG2A 1RFDL 5C0RL 3SR7A 1PZSA 3ZQXA 1GWJA 2Z4QB 5D2NC 3WS3B 4UQ3B 4U1JA 4OV5A 5IFTA 3S5ZA 1Z9MA 1C1EH 5CCHE 2ONEA 3TNNB 1NCIA 3G6DH 1MIEH 2DJ4A 3FL7A 2W3ZA 1UXSA 3A6CH 4BEQA 3MNMA 4OV6F 1CZ8L 3B6SA 1HT6A 1UWIA 1ZHKB 4ES4A 2DJLA 3SZ6A 5DRZA 5JPNA 4N9DA 1RVFL 2G0WA 5AG9A 2H0EA 1ZAHA 3HV8A 1NCAL 3UYPA 4ZZ9A 1VRSA 2BX5A 5CINH 4JFVA 4U33A 3H24A 4PJCB 3TROA 2EPKX 2X3CA 2O55A 3QZWG 2A9NL 1HHGA 2ZSVB 1QHPA 2C1HA 1YMMB 3LH9A 4PW3A 4MDRA 3UWYA 2MCPH 1LEGA 4M5ZH 3TJHD 1VR6A 4HIQA 3L1EA 2B1AL 4PJ8C 4IU3B 1E4HA 4ZO8A 4ADIA 3DI2B 2UX7A 5U7SA 2GYIA 2FH8A 1I1FB 5FS5A 1SN0A 3TAOA 1JNHA 3R2GA 2XU2A 2CNZA 3PWAA 4WO4A 3GSUA 3P2BA 4HJGA 3JWDL 3FB8B 5EU9A 3CQ0A 1RUPH 5T9BG 1M7DA 4WGKA 3SSJA 4F66A 3MAWA 3NCCB 4MJID 5E6RB 4JN7A 3KEHA 3QJTB 4FQIL 5HHME 4LCVA 3I68A 2C8NA 1VERA 3G1SA 3QIUB 3OG3A 3STFA 2V0AA 1DVXA 4FXLA 5TF1L 3FU6A 5EDXA 1BLNA 2VLJB 1SJEA 2ZUQB 3NUKA 1FHLA 4GYPA 4RDYA 1CL7I 1EZLA 3NJNA 4ENEC 4MQSB 3POCA 4FYTA 1HNYA 4KHXL 4M7LH 3MRHB 1UR4A 3C5JB 2WQPA 3BWSA 2GK0A 3CBJB 3E6FB 3FT3B 1XINA 3S9YA 2YO3A 2GTZA 3DECA 3I3DA 3MV9D 3QXAA 1P0EA 1BWVA 2E4FA 1AHWB 4JY4A 2J47A 3L5IA 3CEUA 4RXGA 1IGFH 2WSPA 4ORGA 5ICZA 1A4AA 1TTCA 3HLAA 3OJGA 3PTKA 3KHQA 4OAWA 3ZRSA 5IJVB 3QW3A 5T1JA 2XN9D 4KNTA 2FNWA 1M7UA 2ZP8A 3FHQA 1LJYA 3O6FC 5F2GA 3NFNA 4IJ3C 1H0GA 4PUKA 3P2VA 5MHBA 5HXMA 2Y1HA 3VGBA 4LUIA 3UZZA 1ML1A 1FG2A 5HDBE 2PABA 5J6GA 1UA7A 3KDPB 3HR5B 4D6FA 5EU4B 4X4ZA 3GRWH 2WPBA 5TK2A 4PE8A 2JLPA 2OSLA 3ZKNC 1PSKL 3BAXA 3AIUA 1TVNA 4JQVC 3UBXA 4Q4RA 4GSQA 3RJOA 2DL9A 1YC8A 3PAYA 3KXFD 1B4RA 3CCHB 3V4BA 4B3ZA 1OL0A 5EU3B 3PP3H 1F7BA 1FPTH 3HZMA 1QW7A 4R83A 2W94A 3CTLA 3UBPC 4ACYA 4DI9A 4RV8A 2BP0B 2JF1A 2QPSA 1EX0A 3H9SB 4H04A 3IDXL 4HPHA 4PVMA 4Y7OC 4C6NA 2EEFA 1SOSA 2ZYIA 3BPNC 3VTTA 1LO3H 1SVCP 3M47A 3V35A 1A9BA 5LO7A 2F7RA 3ZUNC 1X97A 4P61A 1TQUA 3FFDB 4MA7L 3QHFL 3TC9A 1SVDA 4CQBA 35C8L 2NZ9D 1Q6FA 3QWRA 3RGHA 1PCWA 4K9JA 2ZUMA 3ZLGA 4MD4B 1LMIA 2MJWA 4NJAH 1G84A 3G6DL 1OC6A 3QQDA 1CICC 3BT0A 4QYOA 4FLHA 3PPHA 3D09A 2BSDA 2ZOOA 3E38A 4N6RB 5F7FA 2I9LB 3HQ1A 1AGDB 2WV3A 1MG2C 4UM8B 5EBMA 5C9ZA 2DSKA 4JLRB 4DHLA 3FUHA 1KM2A 4ZX3A 5IBLD 3EWUA 3AWGA 4H6RA 2GIXA 3P61A 4UFKA 1RMFH 1E27B 3WE1A 5I66A 1TG7A 5E5MB 4O14A 3ZHNA 3MLZH 4P5TA 4K07A 1TZ7A 1D6EB 2ODHA 4UIKL 2BP1A 4IKIA 1C5CL 2KUTA 1CT5A 1L9WA 4V2CB 1AKJD 4WZ9A 4JHAH 1QFHA 1WAUA 3ETBJ 4LBEB 1P9MC 2W59A 3K72A 1U8IB 4F27A 2VM8A 4F20A 3CLFL 4JIIX 1OAZL 5TDPA 3MCOA 4XHQA 2WIIA 1N8IA 1FRGH 1YMMD 3FW6A 1XLKA 4PJ7A 3JWDH 3PWNA 3DFPA 2J13A 5I1GL 1CTMA 3CAVA 2XVPA 4YQXH 3I3EA 1JXDA 1LO2H 1GJIA 1MNUH 2J57A 1KTLB 2PTVA 4OF5A 4MS8D 3HNVL 2C9QA 3FJ4A 5DMKB 4HIJA 1T41A 3ARUA 1U58A 3ILPB 4FHBD 3AWOA 3GSXA 1KYDA 3S2CA 1H15B 4HK6A 3QJHB 4A8NA 5AVNA 1CQKA 3TO4B 1XX1A 3N2CA 2VDKL 3CFNA 4UINH 1X5MA 5DS2A 2GJLA 5MEOA 2A7NA 1B3OA 1Q0XH 2EXSA 3K2UL 3CEPA 5TK4A 1A1OB 3FUIA 5HHOB 3BW9A 3SQRA 4DQAA 1NAMB 4ZFQA 3LSOB 1UM4L 4DPAX 3JRKA 1KCLA 4JZOB 4NQDE 4QRPB 3V0IA 3VFNA 4X6BB 5FO8B 3UVAA 3QIUC 2WGXA 4PRTA 3WLJA 2O9RA 5F1NA 4IQLA 1BQLH 4K9EL 4PY8J 5T1DH 3Q8EA 1K6WA 2W27A 1VRDA 3T1FB 3WN6A 3C5ZA 4JM4L 2REQB 3H56A 1HC1A 3MRLB 4I0KA 2HE5A 3U36B 4O2FB 1CLYH 4QJ5B 3EB3A 1EMTH 1B0GB 3CYJA 2WUBL 1UATA 3CFIC 1WXJA 4XIMA 3E3QC 2CAKA 3OHXC 5I71C 5HJGA 1M5WA 1KO0A 5EMMA 1UH4A 5LA1A 1P9MA 3ZTCC 2D3JA 2JK5B 5IG7A 2YXOA 3SADA 4FOKA 4LESA 1NLBH 4XVTH 1HQTA 4OQTL 1IBZA 2P5WD 2V2DA 2VDIA 3RB5A 4JAMB 1T1YA 1G9ML 3D9AH 3K2GA 2ZF8A 4FKHA 1B6UA 5JXED 3B1UA 1H5BB 2JJVA 3Q8AA 4TQHA 2CE6A 1ZBWA 3W7HA 3GXIA 2KX9A 4LKCA 5TPWH 1SXNA 1BG1A 3U8GA 3FLUA 1MFUA 1Q8MA 3L8QA 1BDYA 4HAFA 5DC2A 5E0QA 3JWOC 3DC8A 1ZBKA 4XZHA 4F40A 5KZMA 3QWOA 4OD2B 3AREA 3SN6N 1VLIA 4N8VG 2CWNA 2H3BA 3R0KA 3LS4H 3V1PA 4UZUA 5K9DA 1GKPA 4TUJB 2K6WA 4Y4HD 1CL7L 3SKJH 1JHKH 4X61A 2PLCA 1U4EA 5EUKA 4TS6A 1LD9B 1A9VA 1XDJA 4IQEA 3RMJA 4F0SA 1NOLA 2OTDA 2R1LA 2YZ5A 5IFPA 1ULVA 3VXPA 3NCOA 1G7MB 1BQHG 3EUDA 3ULVF 1EUNA 3DSNB 1F6AB 3IIVA 3W0KA 1ZT1A 3I6KB 4LIQE 1HFUA 4ODWA 3HUJF 4F2FA 1A5BA 4M6VA 2VXTL 4UTCA 7FABH 3UU0A 1THCA 4U1NA 3BEWA 4ODXA 2JKPA 4U4MA 1CICB 1V5XA 3QHTC 5HD8D 4PYHA 4BWWA 5B38G 4YXKL 1N18A 4PBWD 3KR3L 5CJOL 3SE3C 4APQA 1H5VA 3QY6A 1MFVA 4N9EA 1QLEH 1TTBA 2GGHA 3D51A 2HVJA 2HWZH 3TYGH 3VCLB 3H4GA 3LVTA 4M8UA 2O6FA 4WWKC 5F7AA 4F8NA 1I7TB 3F85A 2WBXA 3CFDB 4NOFA 3TWCL 2W07A 3DTXB 2H1PH 1DQXA 2HE8A 1A1NB 4A38A 1AODA 4C6OA 4EXBA 1ZLWH 5HNTA 2L7QA 3UAJD 4AX7A 1EO8H 4E41A 1QA9B 4HUNB 3M5VA 3DMMB 2OLDA 1VENA 3RIAK 3V0HA 4ONFL 5I5RA 2VVNA 4LSTH 1S5WA 2FEDD 4X4XA 3RWHA 2J79A 43C9B 4PV1C 2DQEL 1TWWA 2GVLA 5L4FA 2HTKD 4IBVA 4UXDA 3T6CA 3V0SA 3ULVL 2AQNA 4Q8QA 2F18A 2ZOTA 4EKJA 4OFQA 1RULH 5A6BD 4AMCA 3NT0A 3QHZL 2KI6A 4GAFB 2VUNA 4KRMB 1F6KA 4HF5H 1JQVA 5CPOA 4GA8A 1HO1A 1YUKB 4ZFOL 4C7DA 2Q76B 3OPUA 3BIKA 1H7NA 5HVHB 5AYQA 4NZUH 4WFHD 1MFEH 1UMYA 1JZ6A 3IDNA 1QSED 4HLZH 4TNVK 3PF3A 1GQKA 4E42A 1XF4A 2EYSA 4ZMOA 4Q9RH 3GMPA 4NKIH 5GGTH 4GXPA 3FB7B 1JZIA 4PUNA 1AGFB 4QYAA 1RIVL 1DFBH 2JE8A 2NR6C 1KYUA 1LRQA 3VXSA 1ZRQA 3AXXA 4JTKA 3DG3A 5KZDA 2OELA 3O63A 2P8PB 1S7WB 1J0JA 1FNSL 4R7DA 1M3JA 5GGQH 1YTKA 4X60A 4JFED 3VDGA 3PWUA 3VFPA 4J6RL 1LXMA 1XGQA 1TENA 2BIOA 2DS4A 3EJRA 1ZLWK 4Z78A 1A3LH 1ASPA 1E0TA 5BOEA 3N2XA 2HS8A 4I0PB 2TSAA 4ZPVA 3LEPA 4LBSA 1JZEA 3MDJA 1UUOA 2XPGB 2ESCA 4DW2L 4FD0A 3RGVA 2PMQA 3TAKA 1TVHB 2NNAB 2OXHB 3CFKB 3GDBA 4PUBH 1X8CA 4QQ3A 4NM8L 4IOIB 5KUMA 4FPSA 2EIZA 5GZNC 2I07A 2E9LA 2OXGB 4YZWA 1U41A 1ZA3A 3ZKXB 1Q6CA 3ZL1A 1RH8A 4JTSA 3U6WA 1XLJA 4YHNA 1EZVX 1PZ2A 2ICCA 5AKSA 3K71A 1CURA 4HJ0C 1VBGA 3DVNA 3INPA 1INEL 3BAJA 2IFFH 5TH2B 2R29L 3QC6X 4DGVL 2XSXA 3L0NA 2YD3A 4IWWA 4QXUL 4KCTA 1J05B 4RFEB 2VLME 1XTMA 1TEYA 1HNGA 1FQ9C 2WIMA 1HSAA 3L5HA 4H25A 4MD0A 4PJHB 4QKTA 4U3HA 3GS0A 3KDMB 4Y4KB 3D05A 3ZLQC 2VXQH 1T89C 2HLAB 3VD4A 1A3XA 3WH9A 3AADB 3ES8A 1E4NA 1XRVA 3KEDA 2VXUL 5ITFA 3VXUB 2JCCE 1Q94A 1WHOA 3H53A 4IG2A 4NGHH 1NBYB 4U31A 4JFZL 3B9AA 4AGLA 2CK2A 2I9UA 2VFHA 5F6IB 2I5QA 3P54A 1R5YA 4YDKH 1G4RA 1GL4B 4QNWA 4G7RB 3VI4A 4LSPH 4TMBA 4U6YA 4A2MA 3SIMA 3DV4B 2OZ4L 2WVTA 3GRWA 3BURA 3RHWK 4Z2HA 3VE0B 2EE2A 3L6FB 4Q0XH 3ATAA 4D9LL 3ARFD 4FIQA 4O00A 1I1AD 3T0AA 2X7LA 3NIDB 3VCNA 5EO1B 4ICXA 4IPIA 3KGTA 5D7HA 1T04A 3MXWH 5B3JF 5BZDA 1L6YA 2PR4H 3BI9X 4GX8A 2VQ1B 3ZSTA 1JZ5A 2PP3A 3GTTA 1WLHA 3MJ6A 1UCTA 4Y0GA 1TKWB 1EJOL 2PFHA 1HAUA 1I0DA 5DLMH 2B0MA 3KVJA 3OD3A 3U2IA 2W8CA 2G41A 4DFIA 2Y7LA 1R3KB 4LEXH 3VXRB 3OHMB 4P2QA 3WYRA 3NZQA 5IROD 1EERB 4PBDA 4XO4A 3ARXA 3WS6A 3N85L 3NPSB 5ANMB 1G6RB 4OH2A 2A74C 3EX1A 4ZAKC 3UC0H 1M1XB 3CNYA 1FCVA 1N82A 3H9HA 3CVDA 2DT1A 3G5VB 3LNFA 1KB5L 1SBSH 3GMNB 1E70M 4NHVA 4AMXA 5HQEA 4FZEH 4JM2D 4H2HA 4Y2LA 4QNPF 2OMWB 1MF2L 4Y4FA 1BFOA 2X4SB 5IBLC 1V02A 5FF4A 3W76A 3HI6H 4NKDA 2EUVA 1ZFJA 5LQBL 3BRDA 5I8KL 1N10A 1NC2B 4OD1L 1UZ6F 4F0LA 3EJZD 1MHCA 1HXYB 4B2DA 3G3DA 2D3VA 2JKRM 1MQ8A 4Y16A 3PWPE 1T03L 2WKJA 3T9WA 3QPZA 4RZ5A 5JU6A 5FGCB 1RY0A 1VCAA 3OX8B 3QCTL 4OCRL 3AYTA 1M1SA 2K45A 4KY1L 4HPJA 1HE7A 4MB5A 5L8LB 1T80A 3A6CL 2IANA 1XGPA 3SY1A 3TQPA 1TKWA 3T0ED 3WENA 4LS0A 1KYOK 4PYGA 3KRZA 4FQJH 4M03A 4U2ZA 2QKFA 4NZCA 4Z18A 3LDVA 2VQ1A 3EOTL 4RFOH 5DD3H 5IJKC 4PMYA 3WK1A 1AQ0A 4X6CE 4NLHA 2Z24A 3UNTA 3X3GH 4XZ9A 1T04B 5JW3H 4DGIH 3T78A 2WLIB 2DVXA 2W0LA 3A64A 2LHAA 1J1OL 3ZGIA 1X4YA 5CD5C 2JBMA 1OZUA 2UXVA 1B4KA 4B2DD 5KYXB 1HKKA 1BZEA 5FFLA 2J7GA 1MFBL 3L6FA 1MUCA 3NIGF 1O1HA 12E8H 5DA4A 4N9GA 4CC4A 3DURB 3HMXA 2B8OT 1WXZA 4QTHA 3IGXA 4KFZC 2G5UA 2GGEA 2TRSA 4TUOA 3B2VL 5LCVA 3D69A 1KSRA 1C1EL 2O5XH 1IFRA 3QEQE 3X14B 4M0XA 4Q8BA 4UTHA 1NWTA 4O18A 1OLZA 3IYLW 1OAQL 3UMNA 1K9FA 3B43A 4XB8A 1DSFL 1NBZA 3CHQA 3QC5X 5I19H 4QG9A 4XQ6A 5IB4B 3A4FA 3OBKA 2E6DA 1M4KA 4B97A 1ZZMA 4Q8WA 3QZBA 4J3VA 3CDGA 3U0WL 2JELH 1D9KC 1WWWX 2R9HC 4JKPH 3RJYA 7PTDA 1N4XH 2I60H 1HKLL 1TO5A 2P24A 4ZMXA 1AC0A 5JIPA 4Y19E 3LMYA 5D2LF 1OY3B 3IXAA 4HJJH 4AKQA 5FO9B 3ATZA 1C08A 1FZKA 3D2UA 2FZ9A 2ZDRA 1HJQA 3M16A 3WBYA 4I90A 3IARA 1OIMA 1CGXA 3FUNA 5T3ZH 3V8OA 2IS7A 2I07B 1EA9C 2R14A 1E8YA 2F54D 3AZUA 3GRBA 3KBEA 4UTWC 3ITLA 3U4KA 3BO9A 3CHCA 9RUBA 2XPGA 4WF7A 4YTTA 4CNNA 5A8NA 2NY2C 4U1SB 3V4UL 1TE6A 1FH5H 4HEPG 1S3HA 3E6EA 2AJ3B 2DWXA 4NFBA 3RGVC 4ECLA 4DI8A 2XDHA 1A7NH 3UPAA 3CHDA 3FT9A 5IBTL 1TV4A 1BVKB 2BOLA 3T81A 3U4EB 1BVOA 4N90E 1HYRC 5MENB 1BIIA 2N56A 3VXSB 5EMJA 1A7QL 2VXVH 3MPCA 1ZGDA 4QGCA 1BD2A 1KLUA 2OVLA 1A5LC 5LYRA 3VXTA 3WXWL 3UWUA 3N34A 1XF4B 2PCFB 1NELA 3HE7B 4X5RA 1U5JA 2KBGA 3D4YA 4KFMA 1Q7ZA 5ELIA 5B1AB 1KLYA 1TQBB 3IJQA 2GSHA 4N8CL 2PS2A 1T1WB 1JWSB 2XG4B 3OMAB 4N5UA 3CV5A 4JG9A 3VACA 4L8BA 4B53A 5KYUB 2QGCA 4CN6A 3W37A 1S38A 4NYLB 3PZ9A 2GFBB 4NM4L 2DYPB 3ZKMC 1GS8A 5JVLA 2HJLA 3NGBB 1OB1B 1IUZA 1JPST 1EO7A 4IJCA 5BXPA 1AQMA 4MMYA 2R23B 3F83A 3FVDA 3U2ZA 4B0MB 4B3KA 1FIGL 2APTA 5I3FA 3BSZL 4HKZB 1RK0B 3QORB 4KVCL 3JZEA 2FPVA 1P4CA 4C56E 4XN7A 1HWHB 3LD8B 1V02E 3X1FA 3BD4A 4I2XA 3TVMC 4L4TA 4TN9A 4G8AC 4GAYA 4OFIA 3T0WA 4NQDD 3V4PL 2R2EA 1JG9A 3VRJB 1CFQA 3T2LA 2BASA 3QHOA 2JWYA 1U8QA 4DO5A 3LEVL 4PLOB 4PBXA 3WL9B 1A1NA 1WZ1L 3TA9A 1RJZB 4PTTB 3GMOB 5AEAA 4AM0Q 1B0RA 2TSYA 4CJ0A 1EH9A 4KEMA 3ZZLA 3LB0A 4ODSL 2FRGP 4H00A 4QHUB 4C60A 3GH7A 2VC5A 4PGEB 2HPOA 3G1HA 3QDGB 3O9WB 5AWNL 2PDUA 1RUAH 3IJEB 5TQLA 3SPCA 1U3ZA 5I07A 3AHTA 1CICA 3OLDA 1LE5B 1P53A 1PIFA 2M1KA 1S9WA 2YKLL 1KM4A 4ODWB 1ZLEA 4NJAL 5IIEB 1ZT1B 3I6KA 2HXUA 1J87A 2X5PA 3DSNA 5F1IB 3KOWA 3MT1A 5FYJU 2AXGB 1G7MA 2Z7YA 5I1IH 1XISA 4N2FA 5D7JA 5FA4A 5D8JH 3WY4A 3EX2A 3KHDA 1XGDA 4K55A 4MNQB 3HG1A 4X99A 3S35H 1QFWM 4QP0A 5HVFB 1KN2H 5DQ9B 2D31A 4L4OA 2H26B 2X4PB 4ANXA 1VFUA 3B2DC 3ULAB 2VDKH 3HUJE 5LNDA 5CZTA 5D03A 4CU7A 3IE4A 5E6IB 1P1ZA 5C08B 1RHCA 4XNYL 4K71C 4OIBA 1MQRA 3N4AA 2DM4A 4EANA 3AT0A 3FUFA 5LXVA 3Q2DA 5GHWH 1CVSC 3T09A 1TWDA 4OFCA 1AS6A 4OE7A 1TCRA 3HG1B 1UUMA 1PLAA 4NC2B 2FIKB 4FFVC 1VCGA 1W3JA 2VJXA 4J8QA 4NWUH 4FQCH 1BF2A 4NNPH 4W7VA 4JHVA 2Y7QA 3R12A 1W8EA 5I1GH 3THAA 4BYHA 3SPVB 2UY7B 4K3DH 1DJNA 5IHBA 2M83A 3U9UA 1A66A 1E4LA 4XC1L 2NMSA 3FFSA 2GI0A 3E5BA 2BHZA 4WW2C 1SQ2N 3RVWC 3RBGA 1V3HA 3N40P 3P4MA 1OGSA 1PEZA 1LZOA 4LRIC 4IHOA 3NBNA 4XAYA 4U6HA 1X5FA 4QHUA 4X7SL 3U36A 3US1A 2HNEA 2WMHA 4G6KH 4DM2A 3LXCA 4EDWL 3EWBX 1AKPA 5I1HH 3VFUB 5KSBE 1KXTA 5FSDC 4C6BA 4X6DE 5D72H 3U46A 5CC7A 2DEWX 3BMXA 1D8CA 1G9MH 4O1AA 2PETA 4OI9A 4WGWB 4G1MB 1UROA 1UM4H 1UG6A 4WEVX 3NIGE 3PG2A 3SCVA 5D93B 2WQAA 5CP3A 4DGIL 5FEWA 1W8GA 2ADGB 2AITA 4IS6B 3S9DB 2J2ZB 1AR2A 2Q20A 3OVPA 5TFSL 3RL1B 2NX9A 2P50A 4LVHB 4S2SB 3KP1A 2N01B 4A55A 5F3BA 4EUPH 1ICQA 4TR9A 1SRDA 1SM3H 2DOCA 3BL3A 4QE4A 2NOYA 3G8EA 1SXBA 5GGUB 4HNNA 4MJ4A 2JTDA 3L5XL 4W1TA 1KC5H 2WZ6A 4Q4SA 1V0KA 4XBEH 3FJNA 3FT4A 2BCMA 3FYIB 4F1SA 3RN6A 1YEJL 4XBKA 3B34A 3CQJA 1R3YA 4O8RA 3PDOA 4QEEA 3U57A 2FT6A 1LDPH 4XCFL 4GBXC 4BFGA 5F2IA 3S47A 4FXGA 3QUXD 3BUQA 2FLIA 2QCFA 3B8TA 2PCEA 3R1ZA 1QABA 3K6FA 5FGBA 1V4YA 2FYMA 2BOBB 1A3RH 1YCSA 2ZCLL 1BFVL 3ABZA 4FXRA 4J1OA 3WQOA 1R9FA 5I75B 4HPOH 1I1WA 2Z1KA 3VDHA 2YPIA 3EKZA 1H8LA 4YL9A 5LN8A 2VT0A 2JELL 1F4XL 3AWEA 4HHGA 1HUVA 3MA8A 2ZT9C 5KYYB 3HJEA 4J3UA 2MUCA 3W82A 2E1DA 3G1XA 2VLRB 4IIHA 3TQVA 3DIFB 4GKZA 3S5OA 5M94B 3NCBB 4P5TB 4NRYB 1QMLA 1A5KC 1MYRA 3TN0D 5H37H 1CZ8H 2XFYA 3KRSA 4QI3A 1K9EA 3BOXA 3MLUH 2QIWA 1IAOB 1WICA 2OPJA 2Y22A 2QDHA 2XWEA 2OYPA 4FA3A 2VCBA 2BERA 3BOFA 2A1WL 1XF2B 4LCRA 3E7JA 1Q6OA 3W74A 3G1RA 1WWBX 3A6OA 4C6JA 2G60L 3PUUA 3V0JA 4EN3B 3D2UB 1C08B 4JQIH 1VFMA 3VYPA 2H2SD 2OL3A 3IXAB 2CRMA 3TM6A 4G7QB 2DM7A 3C8KA 4I85A 3VXOB 4D2NA 4E9XA 5C0EB 5KEZA 1B4EA 1UM6L 2ICWA 4LU0A 1D8WA 2CR0A 3CDGB 3K4AA 1KB5B 4L4VB 4ZVJA 3NPXA 3S4SA 3LLXA 1BF8A 2P52A 2AHIA 2DLIA 2J8UF 4DZHA 1WBZB 1A9BB 1TREA 5IB4A 1HL2A 1A21A 1T3FB 3F58L 4BK8A 3IJ8A 1CK0H 1SR0A 1JS4A 3H9SA 4DO6A 4JZNA 5SX4H 1R46A 2X09A 1BGXL 2DEYX 3W7CA 4F3FA 4WY0A 2VM4A 1W15A 4K71B 4Q14A 1QHZA 4HX1B 4FFTA 3TYBA 32C2A 3KHOA 4LASL 4ZDHB 5LGHL 4J4KA 3JSSA 4Z7WA 1A6VL 5C1MB 3UZJA 1SJBA 2B7DT 2JKXA 3E0WA 5E4AA 4QXTA 4P2YA 5KVGL 3KPMA 1BW8A 2OK0L 2WLIA 2AKRB 1SN5A 1NDGA 4YSPA 3WN5B 4C6FA 1DHKA 2ICEA 3CU1A 5E1GA 1N67A 4PJIA 1T7ZA 4GYPC 5EFFA 3URBA 4OGAC 2V5LA 4MX7A 3FSZA 2GLKA 4OZ4B 1Z41A 3F5KA 3EWXA 3TTEA 2IANB 3W6MA 4JY4B 2ED9A 2ZVIA 3WD0A 1PYFA 2JIEA 1PVHA 1RP9A 3WIIL 5F7UA 5CBEA 5SWSB 3SSZA 3IUIA 5KVFL 2J88L 2VE6A 4WK9A 3QG6B 2WN2A 3GNDA 2WXHA 1F3JB 1XQKA 2A3CA 1YEHH 4YBHA 1JIBA 1SYVB 5HNUA 3O6FD 1FNSH 4NRXA 4PJ8A 1QHQA 4IDLA 1DSWA 4DZ8A 4J6RH 4H8HA 5IQOA 1J11A 3P2TA 3LDBC 4MDJB 3GMQA 3QUKB 3U7VA 4KQ4L 1JN6B 1FWXA 4HJGB 5DHXB 5I02A 5C0IA 4JTAA 4HPXA 3QIWC 1ONEA 3X12B 1GY2A 5F1KC 3GSWB 1A5FL 4YSUA 2LLEA 4HA1A 3QZWA 2C9VA 5E4OA 1EZUA 3VXRA 3W7LA 4IU3A 5ERWB 3Q3GA 4IBQA 2WNNA 4FS9A 2YCKX 5I6KA 3RX3A 4DAFA 1F90L 2EBNA 3ONCA 2K3TA 2UY3A 3IV3A 4HOZA 1UD5A 1HHGB 4XMZA 3SN4A 1J86A 2WZTA 3WHE1 1CDGA 5JHLL 1XQLA 3OQ8A 4CD5A 5IW6A 3BVTA 4KZ0A 4ZOEA 3MUHL 4JTLA 3QPQC 3SDCC 1PO9A 2LTQC 2OYMA 5I3JA 4S0HA 4X9GA 1DWGM 4APQC 5JPNB 3KPOB 1E8WA 3W9EB 4JX6A 2OWCA 5F8RC 3VQLA 5KANG 3EGSA 3HZKB 4I1RA 2QDVA 2YWYA 3V0WL 2XKSA 3WD5L 1D3HA 1IBBA 2P5PA 5F6HI 4EXKA 4PD4K 4A6GA 5D2LB 2J5WA 3BG3A 3LKPB 1J8HA 4MNHA 1OTTC 5T5FL 2XKNA 3BSHA 4GLRH 1ZL1A 2HMCA 2VX4A 4NN7C 3T77B 3UH8A 5I79A 3N9GH 1G7PA 4P7OA 5DYOA 4Y5YB 3SUWA 1TLMA 3MNZB 4ELKB 3SYOA 1TR7A 4C1NB 4R26H 3BYTA 1FRGL 2E7DA 2GQ8A 1D7BA 3ZLHA 2VLLA 2VERN 1YJDL 1X5AA 3CXDH 3MRGA 3RZCA 1UPPA 3ZE1B 2HLAA 1HQ4B 2DMBA 4X6DB 1P6BA 3SJVB 4IGBA 3T08A 1HSAB 2ZG2A 1OALA 3AT9A 3SDCD 4B50A 4MD0B 4DZBB 4M6UA 2HVNA 3GK8H 4KK5C 4LCIL 1WAPA 2F53A 3EO9H 2V30A 5B1JC 1N64L 3IJDA 3G6JF 1MDLA 4PUJA 5DMNA 4C56D 3B97A 5D38A 5FKPA 4N0RA 1EJOH 1OADA 3D4GA 2VABB 5CZ0A 3NP3A 3STEA 3CC5A 1L7IL 4NAFB 2AQWA 2W5FA 2BY3A 5CZVL 3T65A 4A21A 5B7FA 3FO9B 4XG1A 3ZJ6A 4JM2F 4NP9A 3G04B 3NCFB 1ONQB 4US5D 2AXFA 2DQDL 2Y1AA 2QF8A 4HTYA 4XNUL 5I5JA 1QFOA 3LRHA 1FBAA 4F7PB 5ADPH 1V3LA 5EN2B 1RCOB 2J44A 3NQIA 4IM8A 4Y4HB 4ZW6A 5CD3B 5B80A 2IALB 1WBYA 2P8LA 4O5LL 5EV7A 1XGQB 2YYUA 1E4XH 3LKOB 1JBJA 1KBKA 2QT3A 1OE1A 1L9PA 2CWRA 2A6NA 2ENYA 2P8PA 3L1FA 4WQOA 1U8HA 5E56A 2AVGA 1G9EA 1FWDC 1MVUA 4P57A 5J3HC 4YEFA 1V51A 4EVNA 3J27A 4HJUA 4L1HA 4MA7H 5SWSE 2NQDA 3WQPA 4N5EC 1EVUA 2YPLE 1IEXA 1OT1A 3CQPA 3SDXA 2B7NA 5C9XA 1FWHC 3FF8A 3CFJA 3TS8A 1DBJH 4D9LH 1OAXH 1E0OB 2DLEA 4FCAA 1O6IA 1P1XA 2XA8H 4KTDH 4P4KC 4Z0SA 3ZTDC 2JIXA 1EV2E 1I8MB 2O7QA 2A9ML 3CHSA 4BELD 1E5NA 1F9CA 1BF5A 3ES7A 3BIKB 5SX4I 3F7QA 5KBDA 1HYSD 2Z8WC 4HU4A 3DRQA 5IBXA 3TX9A 4XO5A 2JCCF 3H2PA 1XCQB 4IRJD 4NPYB 5IHUH 3V0VB 6A3HA 2F54E 5CNHA 2NXYC 4P05A 4JO1L 3C4UA 4N22A 3CAQA 4NZTH 4PIBA 1RJLA 3ZJAA 1R5IA 1JZDC 1OFPA 4NY2A 5IESL 5I2IB 4FAMA 5FOJA 4H9YA 3QCUH 2KZWA 2MH4A 5BV7C 1AW1A 2QULA 2W81C 4OB5L 2FJSA 4Y19D 4ROPA 2VQTA 3DUSA 5DGQA 5D70H 4ZYKA 1BRLB 3TXZA 1C7TA 4QXGH 2CRIA 5FACA 4NJJA 1RJPA 2FLMA 2UZXB 3T2NH 2OO0A 1XAKA 3SIKA 5E23A 1BVLA 4LSVL 2DIAA 3SE3A 4NKMA 1AH1A 5GJPA 3VXGA 2B81A 1I7TA 3MHUA 2AJVH 3BUPA 4LLUA 4YGVA 4E3VA 4JGNA 3KBFA 3NCMA 4J3SA 1AD4A 2VGBA 2X4TA 2YRZA 5K9JL 3AOFA 1HDMB 3SBPA 3U2JA 1DYZA 2BDNL 4PJ9C 4LMQE 4Q6JA 4GUPA 3EMCA 1F18A 5H35B 3RWJB 5F9AC 1ZPUA 1Q66A 2C0AA 2J7DA 5AHNA 3URNA 3TJPA 2YBVA 3QAQA 3KS5A 3IS1X 3PP3K 4HHWA 4YPGA 4L9DA 3VXPB 4A6YA 1IGJB 2DDXA 3W1RA 1NCJA 2Z1SA 1BM7A 3BWUC 1MFNA 2NZ1A 3D25A 2CLMA 4ZJ9A 1KJ2B 4Z7IA 2XH7A 3ASNB 3R7RA 5GGVH 2NY7L 3DXAA 4FFWD 2WD0A 2DM3A 3PJLA 2H8PB 1KBGL 1GZQA 3QWOB 4OD2A 1DO5A 4Z0XB 3H2NA 1NCWH 2CJTA 2RJMA 3PP4H 4O58H 5D7LA 2WNXA 2X1RA 1KENH 2QSCL 3ECBB 3FTSA 3HAEG 3CSBA 3KYMB 4PJ5A 3ULVH 1CBVH 4OJCA 1L7IH 5C0BD 5FKAA 3ZK0A 1KZYA 4OW6A 4Y1TA 4PZVA 2FX8L 2ZCZA 4OFYA 3EYOB 3S35X 3QRLA 1QNQA 4MLRA 1BGAA 4HV8B 4O1FA 3UJSA 2ICWJ 1DJZA 1T1YB 1YNTA 2GSJA 2NV9A 4MYAA 4JQVA 3LAFA 4Y9EA 4GUIA 2ZG1A 4P49A 4U1KA 1PSCA 3KUMA 1A7PL 1KCUL 1LT7A 4Q9BA 4DRSA 5BVPH 1QJWA 1IIGA 2P1YA 2X53A 4O02H 25C8H 4BI6A 4E4PA 2ZKYA 2NWSA 1M68A 2CO7B 1ZP4A 4K8RL 2JKJA 4B96A 1YQ2A 4GXUN 4X6CB 4C4KO 3SFWA 1BJMA 3L81A 4NAEA 1NFIB 4HULB 3EYUL 2REQA 3G1DA 1E9PA 3MLSH 2QJIA 3SQBA 4CMMA 5K5YA 2P76A 3HPLB 1VFLA 4PCTA 2R4RH 2VDNH 4WWPA 1T8QA 3JWOH 5H6HA 1CT8A 2PWUA 2FL5B 3FK3A 4JRXA 5J8OA 2I9TA 1DLHA 1JHKL 4PJXB 4BK5C 1EFQA 1FKWA 4IIGA 4MXWL 1UH2A 2VC2B 3AAZB 4L9LB 3UADA 4CJ1A 2QR6A 4ADUA 4ZOBA 1ONRA 3MLRL 3OLEA 4PTDA 2WXFA 5MEOB 4WHYH 2NX5E 3LV3B 3MLYL 4H19A 4KJPC 3HS0B 4LSUH 1PD0A 4PLJC 5SWZE 3JT0A 1SO3A 2DZSA 3PZQA 2NWRA 3C09C 1F8TL 1I8AA 4B91A 4N8VA 2YPVL 4AYFB 3XINA 3ILPA 3QIWB 2F8QA 1XCTB 1NWRA 1O60A 3QV9A 1AE6L 5F89B 5FV2A 2QHAA 2Y7MA 3FQXB 4LLMB 4NI3A 5F7HA 1A4LA 3F1QA 4EX4A 4XPFL 8PAZA 3N6QA 4Q56A 5FW7A 1G7JB 5TAOA 4NP4H 4IBSA 4FXJA 1JOIA 5FEXA 4K3DL 3L5MA 1JGDB 3QQNA 4NXKA 4BSWA 3KPPA 5KTLA 3DBNA 4FX7A 2V2CA 1MZRA 4HPYH 3ZDZB 1B0WA 3F4DA 1OSYA 2XN0A 1PS9A 3MQTA 2DYRB 2WZIA 1V8EA 3ATDA 5I8OL 5E2VH 4P23A 1L7TL 3QUZC 5JW4M 3IIZA 4JTCA 4W4NA 3U0HA 1OGPA 2UZIH 3PWVB 4NQED 4MKMA 3ZYOA 1NCDL 1NCCH 3F6IA 4XMUA 3K6SA 4P9HL 2W60A 1TPB1 4UFIA 4Q8OA 3IMRA 4AYID 4UT6A 2Z7WA 2EZ0D 4F7MB 4X5PA 3M8OH 4NN7B 3WDJA 2OI9B 1EAOA 2N1TE 5BO1L 2ID5A 2GSMB 2CZEA 1MHHA 1Y65A 2ANUA 4PRIA 1GHSA 2W0UA 4AY7A 4CQ8A 2Z2BA 3BW2A 3SDAB 4CN1A 2XQBL 3ABRA 5AL8A 3UZEC 2FDMA 3ZKSD 3VXUE 4PJXE 4WHBA 4TVCA 3L95B 4JL1A 3BVNA 3FCPA 2QQNH 4QLRA 5F7WC 3H4WA 4AAJA 2OP4H 3FFDA 5AWNH 1OGAD 2HAZA 3N1FC 3O3DB 1W0VA 2I17A 5T3XL 1NY1A 4WSHA 3EOBA 5HNNA 1YSOA 4GBUA 1N5AA 2BCKB 3JT2A 3UC0L 4REQA 2JB5H 3F5WB 4NUQA 1CD0A 3H55A 4HALA 4U05A 3RUGB 1WV7T 1DBJL 1EJ8A 1JV5B 1P6FA 4I5XA 4PS4H 4JR5A 1VFSA 2X4OA 1R3WA 3MBWB 4LLWB 4MLSA 2IKJA 4AE1A 4LLVA 1VP5A 2B4GA 4WIWA 3ERXA 4FO4A 4ICNA 4DW2H 1TWIA 3QIWD 1C9SA 4GUFA 3MRCB 3L17A 3VB8A 1HKJA 5D7LD 5SX5H 3UJ2A 5I1CH 4ICWA 2A3TA 4YFDB 1AD0A 5C0ND 5I30H 4H0LC 1ECEA 1DVSA 1ITXA 4FLOA 2CLRB 5HDOA 2OMXB 5H8DA 3THUA 3TH2T 3OJDB 1PYMA 1HZYA 1MHEA 1MRCH 1TZOA 3RWEB 4NENB 2RGLA 3AJ7A 2R4RL 3NFNB 2WLJA 1E4XI 1CYXA 2V2XB 1M05B 2NT1A 1GJWA 3PE9A 1XRTA 4NO2A 1RQHA 5E08H 3EBHA 5L7XL 3D8MA 3KYKL 5BXFA 4OAWB 3N43B 5IJVA 2VW7A 5L0QB 3B9VA 4QG8A 4YWSA