2WVUA

Crystal structure of a michaelis complex of alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-l-fucose
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
437
structure length
437
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-L-FUCOSIDASE
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
total genus 159
structure length 437
sequence length 437
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvuA01
3IJ9A 2VZTA 4DUXA 3LXCA 2J47A 4QLKA 3E1F1 2WVTA 2EO7A 4F9DA 2XN0A 2W91A 2OSXA 1MVYA 4AEEA 8A3HA 2CYGA 1JZ7A 1MW0A 3VD4A 1H5VA 4U33A 1OGGA 3MSDA 3L4WA 4JHOA 1CZ1A 1UKOA 3AZTA 1FP8A 4GO9A 4MNKA 4MNJA 3VNZA 1NOFA 4J3UA 3ZO9A 1ZJAA 5GPRA 1TE1A 1QBAA 2YA2A 5F7UA 1OD8A 4MAVA 4HMCA 1MW3A 1VEOA 1BVNP 3PZOA 2VVNA 2WWDA 1IZJA 1J0IA 4GZJA 2JF7A 3CUJA 1LL6A 4URIA 1XYFA 2X8RA 1KR0A 4D71A 1PZ2A 3CBWA 1EQPA 5A94A 2YA1A 2VVSA 2WVSA 5CSYA 1R33A 1O7DC 1HKJA 2DT1A 2MANA 3VIOA 4AD3A 4OBRA 5E70A 2J7CA 4JFVA 3VGDA 3AYSA 1HIZA 1OINA 4H04A 4H7VA 5A1AA 4DWSB 2OYKA 2FHBA 2PBOA 2JFEX 3BAXA 2EJ1A 8CGTA 1OD0A 3TTQA 3MV01 3K8LA 4KGJA 1QWUA 4PRWA 4V28A 3WDQA 4Y7EA 2D20A 4CU6A 4FLRA 1W9VA 3S6TA 2BVTA 5IXEA 1WZLA 2CIPA 2A3AA 3N11A 1BGGA 5E0FA 4FK9A 1H1NA 3J7HA 1K9DA 2YLLA 3QOMA 5AY7A 1TG7A 5D9OA 1XH2A 1JXKA 3FAXA 2W63A 2D3LA 3AHZA 4AZHA 2XN2A 1J18A 5A6SA 5A8NA 3VMNA 1UH2A 2C0HA 5FOOA 1GUVA 1JGIA 3N17A 1W3LA 4ZXOA 3VIJA 3WNOA 5I24A 2PBGA 5BXRA 1OBAA 1E4LA 3VTRA 3VD9A 3VSUA 4ACZA 1TQUA 2XJ7A 5A95A 1E6XM 5A6JA 4W7VA 1W2VA 1MW2A 2OWCA 3L4UA 1V3HA 1UD3A 5A6BA 2VX7A 1CBGA 1TQTA 1K9TA 3QHNA 1GOQA 4PCTA 4MDPA 3AHYA 2UWFA 3A4AA 6TAAA 1BHGA 2XIBA 1BGAA 1B3YA 1ODZA 1TQSA 1UR4A 1SMAA 1TUXA 2DSUA 1R47A 5D9PA 4HOXA 3MS8A 3CTTA 3SUSA 4D6EA 3BXWA 3T09A 3IK2A 3EYPA 2ZXDA 3UESA 3VX1A 3WY3A 4J7RA 1KR1A 4X0VA 3F5JA 1KBKA 4BA0A 2WMKA 3WBAA 2BVDA 4PMRA 1C7TA 2V5CA 2E9BA 2VRJA 4ML4A 3A6OA 4HTYA 2VZVA 4B9ZA 5BRQA 1C92A 1IV8A 4A3YA 4Z2KA 3I3DA 1JI2A 4ZENA 4AZ5A 3VOCA 4W89A 2XWDA 3VGGA 2WM0A 3POHA 1CGVA 2W67A 3ZR5A 3S2CA 3BUBA 3BUQA 4MAZA 3B8SA 3CUHA 2VZUA 3A24A 1TA3B 1KXVA 4CVWA 4JAWA 2WCSA 3AIBA 3PZGA 3F4VA 2VR4A 2YL9A 3WUEA 2BHZA 2XM2A 3CZNA 2ZXBA 2DT0A 1JZ6A 3VSTA 5CG0A 3CMJA 1R87A 3AISA 3VM7A 3AMDA 4WK9A 4D6DA 2VL4A 3CZSA 3RO8A 5I2UA 2IGTA 3W26A 4AXNA 1V08A 5M5DA 1AMYA 3FHAA 1M53A 2G8ZA 4AZIA 1C8QA 3VD7A 2BY2A 5DFAA 3TTSA 3N12A 3AICA 2D2OA 2FGLA 1GORA 1CXIA 1JNEA 3LMYA 3WBEA 3THCA 4EANA 2DSVA 4UFMA 3VD3A 1V02E 4JFWA 4TTGA 1UD2A 5LA2A 3QR3A 4W7UA 2VR5A 4WLCA 3ZOAA 4V2XA 3UG3A 3OG2A 1QI5A 5CJ5A 5EMYA 3TV8A 3SCSA 2W62A 2G3MA 2GSJA 3WENA 3M7SA 3EDDA 2DSZA 2BHYA 3GDBA 1BYAA 4ATWA 5BWFA 3TOPA 1B3VA 4PMZA 1QI0A 3ARPA 3PZUA 2NT1A 1LG1A 3WQWA 1CXEA 1Q6FA 1D3CA 3WUFA 2PWHA 2CBUA 3AIVA 2V3EA 1E1EA 1GOOA 3WNNA 3W28A 1J12A 1MFVA 1UD4A 3DX1A 3OGVA 1K6AA 3N9KA 1JZ2A 2VTFA 1DWIM 2X2JA 2F61A 4X9YA 2BNJA 1C8XA 1O7AA 2XGIA 3A47A 1BYDA 3SCQA 2VCBA 4D6JA 5GNZA 1OM0A 5BXSA 3PZMA 5CLWA 2DH3A 3CHFA 2XVLA 3WDPP 5BXPA 4J3VA 2JIWA 2GDVA 5FKYA 3WQ4A 1VFFA 2WBGA 2ZOXA 1W3HA 1JL8A 1VFUA 1JXJA 5IFTA 5LYRA 4HPHA 3T0DA 1F4AA 4BQ4A 1UKSA 3GH4A 2ZE0A 1VFMA 1SR0A 4J3TA 2ZWZA 2FE0A 4GKLA 3BVUA 3CZ8A 1B9ZA 1DP0A 5CGTA 2A3EA 3T08A 5AC5A 3H55A 3GXIA 2XPKA 3W29A 3CV5A 3U7BA 2XVPA 1KGXA 4CD5A 3EMZA 4W8LA 4TVUA 4NXSA 4LQ1A 4HA3A 1H0IA 3RPMA 4PMDA 1ECEA 3M46A 1UOKA 5AYBA 3VUPA 1E6NA 2ZICA 1G1YA 1JF5A 1B31A 3QGVA 2F7OA 2XG9A 4ZEPA 4TVCA 2DSKA 4AD0A 1LL7A 3KWXA 1UWSA 1SZNA 1XH1A 6CGTA 3ARVA 2WNWA 3BUIA 3T2OA 3NSNA 1EO5A 1KCKA 4NSBA 4AYGA 2PWDA 3ZMRA 4CD6A 4LXFA 2X2HA 2Z1KA 3SCUA 1CECA 1HKKA 2WMGA 1WDQA 3BAKA 1EDGA 4QLLA 2BY1A 1C93A 1W2PA 3GYCA 4W8AA 4OGZA 3TP4A 2O9RA 3W37A 2EPKX 2OSYA 4ZE5A 1VB9A 1ISWA 3AYRA 3CIVA 1I1WA 3EJUA 3BGAA 4ATDA 2GK1A 1PX8A 1US2A 4XZWA 4R27A 2EPOA 3SUWA 1ZBCA 4UQEA 3OB8A 1E40A 4C7GA 1E4NA 5HNNA 4HOZA 1DWGM 1EIBA 4PTWA 3OA5A 4FNPA 1HP5A 1G94A 2FH6A 1HJWA 3WFZA 1M03A 1V0NA 3VU2A 1U30A 2CKRA 3U57A 1MXGA 5DF0A 3VGHA 5I77A 3CUGA 4WSJA 2G3JA 3APGA 1ZS2A 4AZCA 4BS0A 2YA0A 3O6AA 4UZSA 1W1YA 1V6UA 3ARXA 5D4YA 4UOJA 1U2YA 2ZX6A 5CPSA 4AZGA 2YBUA 1CXFA 3GBEA 3RJXA 3VIIA 6A3HA 3KL5A 1R7AA 1QVBA 3OGRA 5IDIA 4M1RA 2VC9A 2D0HA 1CYGA 1JAEA 3SCPA 3BLKA 2ZUVA 4UNIA 5EB8A 3VIGA 1JYWA 4MPKA 1EOMA 1TA3A 2E3ZA 2WANA 3N15A 3OZPA 7CGTA 1W3KA 1UWTA 3K8KA 4FMVA 4RE2A 1E5NA 1F4HA 1OT1A 4UCFA 4OKDA 3VGBA 2UY4A 2J79A 3ZQ9A 2Q8XA 1JDAA 2XHYA 4AD4A 3NUKA 1OGSA 3SUUA 3SEPA 1W32A 2CHOA 3GNOA 5TD4A 1AVAA 1JYXA 3WL0A 1NWTA 1V3LA 2XYLA 2DSWA 1ZBKA 4WF7A 2O92A 5D8WA 4LYQA 4W84A 3AIWA 2A3BA 1UYQA 3BMWA 3CUIA 1SFSA 2VMFA 5A6MA 1QHZA 1V0KA 3AROA 3W24A 1LWHA 3T2QA 2J8FA 1V6XA 4AZ7A 3BH4A 1E0VA 2NW0A 4AD1A 3A5VA 4B3LA 1XD0A 1VBRA 4HU8A 1NQ6A 3CO4A 4FLQA 5E09A 3NDZA 2V3GA 2OW6A 3LRLA 3ZT7A 1V02A 2PF0A 1ISYA 3B9AA 1V3MA 2YFNA 2ZX5A 2VCCA 3BUPA 4NZCA 3MSGA 4JFUA 3ARQA 4P7LA 5GNYA 4IPNB 1JZ8A 1ZBWA 5ECUA 1FH7A 1XSJA 3PN8A 1D7FA 1W1VA 3PTKA 4Z2IA 1PIGA 2YKKA 1G9HA 3WNLA 5I6SA 4CU8A 4W86A 1HP4A 4P7RA 1PJ9A 3BSGA 3PZVA 2XFYA 3L4YA 1OT2A 2VUYA 2OYLA 2F8QA 2WK2A 3GH7A 3W27A 3MV11 4JHZA 3D50A 1W9PA 5FD0A 4U3AA 5HXMA 3WF2A 3AXHA 3K8MA 1M7XA 4D72A 1FP9A 1GONA 3CH9A 1TVNA 2ZUUA 5A6LA 1V3IA 5I3DA 4GZIA 1BSIA 1WZMA 3EJRA 2AMGA 2GUYA 2YOCA 1LL4A 3N13A 1E72M 3UR7A 1QI2A 4JFTA 2J75A 2RGLA 3QHMA 4AMCA 4HZ8A 3WUBA 3MUZ1 1JF6A 1J0ZA 1CGXA 1KWGA 4U2ZA 5CXPA 3ARTA 3VINA 3LXAA 3KLLA 1E3ZA 2VJXA 1E9LA 3EJQA 4U2YA 3DECA 3MANA 4GI8A 1NH6A 3ECQA 1JFHA 3TTOA 1CLVA 4AWEA 2YIHA 3UG4A 4ZFMA 3A23A 1TQWA 1V3JA 4D1JA 1AQMA 4ACZB 2VNCA 1CLXA 1CPUA 5CLTA 3LPPA 1KTBA 3IJ7A 1W9DM 4GIAA 1PBGA 2OSWA 5CGMA 1EXPA 4MB5A 2AAAA 1KQYA 1KQZA 3CZJA 4GI6A 5D9NA 4KGLA 2FGZA 2X2IA 5A2BA 1YHTA 1KWKA 2XIIA 3CUFA 3OZOA 1DHKA 4FF5A 5LA1A 4MJ4A 3AMCA 3W6MA 4UQBA 3VIHA 2DGAA 3WNPA 3GZAA 2FYVA 1NWRA 4GI9A 4IM4A 1CGWA 4NRRA 1GQJA 5DT5A 4AYSA 3AOFA 1HT6A 2G41A 4UZUA 3RM9A 4DWSA 3FHQA 2NSXA 1FHLA 3CZLA 3PTQA 4HA4A 5A8QA 1HX0A 1QBBA 2WMIB 2CBVA 3CHDA 3WQ5A 3LXBA 4PTMA 3BVXA 3TONA 5ABFB 1GJUA 2WSKA 5CQ1A 4CCCA 2YJQA 1RP9A 4GXPA 1GNXA 1ZL1A 1GOIA 3PZQA 2F2HA 2J8GA 4Z2GA 1TR1A 3ARZA 1JD7A 3WNKA 3ZSSA 1UKTA 5C70A 4PMNA 1FOBA 5I0DA 4MB3A 3D52A 1NOWA 4UQCA 1V6WA 1I1XA 3QHOA 3SCWA 4DO6A 4TOQA 1WB0A 4EAMA 4CU7A 2J7GA 2WPGA 2J4GA 1JD9A 3WDRA 4QDMA 2PI6A 1JZ3A 1CGUA 5A2AA 3A4XA 3GTNA 5BXTA 2VURA 2YFOA 4WKFA 3VNYA 4C7FA 4F8XA 1J0YA 2D0FA 4TTUA 4ZXLA 1KBBA 4QCFA 1J11A 3SCRA 4P8UA 4AC1X 5A8PA 4JCMA 4U31A 4HMDA 2VZSA 1QW8A 4AD2A 4E8CA 1NOUA 1ESWA 3DHUA 3AS0A 2CBJA 4MTVA 5JIWA 4J3XA 4HP5A 2WC3A 3W81A 1CTNA 2HVMA 1EGZA 3BLPX 5HPCA 2JEPA 1J9YA 1R86A 2E9LA 1UWQA 1FA2A 1HNYA 2GJPA 2VI0A 2WZEA 3WMBA 5I78A 3BLBA 1JAKA 1UUQA 4J3SA 1NARA 1NWSA 1EOKA 3NCOA 1UKQA 2XFRA 1M01A 1MQQA 1CIUA 3EDFA 2DQXA 1I75A 4OOZA 4CVUA 1UWIA 4E8DA 4WIWA 3CHCA 5JBFA 4B16A 3N18A 1V03A 2G3IA 3BMVA 1XCXA 3WF1A 4UR9A 3PHAA 3KL0A 1GOMA 1XRVA 3PZNA 1PAMA 1Z32X 4CCEA 2QPSA 5BCAA 4UFLA 2QF8A 1Q4NX 4MADA 4QLJA 4AMXA 3DX3A 4M81A 1TZ7A 2EEXA 5FL1A 3G6MA 4W85A 2W61A 2WWCA 1W9UA 3AHTA 1QI4A 2BY3A 2ZXAA 2FDMA 3K4DA 3ALFA 1JYNA 3VSVA 4ACYA 1HJXA 4KRUA 1E6PA 2CBIA 3AHVA 2WCGA 3ZT6A 3LPFA 2W92A 5DO8A 1L0PA 3MMUA 4A3HA 3RIKA 1XD1A 4DM1A 1FHDA 3UETA 1GOWA 1OIFA 1NP2A 2O9OA 3RM4A 2E4TA 4AEFA 1GJWA 4OJYA 1XCWA 2V5DA 2W4XA 5I23A 5CPTA 4TUFA 1LF1A 2BV9A 3WKZA 1UD6A 4KWUA 3PZIA 3D51A 1G5AA 1C91A 1SMDA 2WHKA 4KRTA 4H41A 3WELA 1UKPA 1DWFM 3WDHA 4RE3A 4JZ5A 2WAGA 4QCEA 1BG9A 3L2MA 4V27A 1V0LA 2GVYA 3OLEA 1NWUA 4F9JA 3BUDA 3WY1A 5IHSA 3WQVA 1W9XA 1H09A 3GNRA 2BS9A 4DUVA 1FH9A 3EJSA 2E40A 4KH2A 4P8VA 1VFOA 2WHMA 2ZWYA 5A6BD 3AI0A 4IUGA 1QW9A 1E6QM 1VJSA 3DHPA 1UA3A 1QWNA 3VM5A 5KEZA 1XSKA 4BF7A 1ZBVA 2E0PA 1EH9A 4D6FA 1M04A 2CXGA 3WL1A 4OOUA 4AMWA 2ZX7A 5KZ6A 3VIMA 1KGUA 4QP0A 2EAEA 1P6WA 2OWXA 1RPKA 3CGTA 5HBFA 4DUWA 3PZ9A 1E55A 9CGTA 4M29A 1MQRA 1JDCA 1QNSA 3WH9A 2VZOA 1O6IA 3OGSA 4DO5A 4Z2LA 3ZSTA 3OLIA 4BCEA 3WQ6A 2J77A 1BTCA 1W3JA 2ZIDA 3ZJ7A 3HU7A 1GZJA 3A21A 5D9MA 3FAWA 2XSAA 5A6KA 2VRKA 4XZBA 4UQAA 4QFUA 4B9YA 4H2CA 2WHJA 1EO7A 2YL5A 3DYOA 1EHNA 1E0WA 1JYVA 1HF6A 3WD2A 2E8ZA 3WDIA 1GHRA 4P7NA 3WD0A 3FXYA 4FNRA 2TAAA 2Y5EA 3BC9A 3BCDA 3HG4A 3UEQA 1E5JA 1EDQA 1IZKA 1DTUA 3ARSA 4HZ7A 4PMOA 3WD4A 2BVYA 4GINA 1G01A 4AY1A 3MMWA 2YDSA 3U7VA 5ABHA 3VDAA 3MKKA 3ZM8A 3AIEA 2PWEA 3SIMA 2QPUA 3EBVA 4PUDA 4YPJA 3EDJA 1WZAA 2V38A 1A47A 2WXDM 1ISZA 2D73A 1GVYA 2GJRA 3AIQA 3NIYA 1H2JA 3DX0A 5M17A 3EJPA 3SCVA 4M8UA 1XGZA 2WMFA 1W9BM 4M24A 4NZJA 5AC4A 3SURA 4BQ3A 1QHOA 4D6CA 4MJ2A 3VPLA 3UERA 5E6YA 3BCFA 1E71M 1LLOA 1TCMA 4P7OA 1E1FA 1WPCA 5M03A 2DH2A 4GO8A 4D6HA 3AMGA 3WMSA 4PTVA 1B30A 3VD5A 2VRQA 4CN4A 1QI3A 2DIEA 3NYDA 1EDTA 2X05A 1PS3A 2XWEA 1RD6A 3CMGA 2WSPA 4AIUA 1EHAA 1CXHA 1GPFA 1HKIA 5E9AA 2OW7A 4ATLA 4J28A 3IAPA 4WSKA 4MNMA 1J10A 2X09A 3BAYA 3HMCA 4EE9A 3LPOA 1HWWA 4TXEA 2W66A 3IAQA 4UQDA 5CPQA 3H54A 2O9PA 4GQRA 3EJTA 1ZB5A 4P8WA 4JKKA 2QMKA 1VEPA 4MNLA 1CENA 4WJXA 3WEZA 2Y8VA 2CEQA 2X1IA 1UD8A 2ALWA 1ISVA 2FH8A 1WZKA 2X0HA 3GXTA 2CKSA 4UOQA 1W91A 4XB3A 3DDGA 1E6ZA 4QAWA 1R85A 2WVVB 2ESCA 2UY2A 3U5YA 1MQPA 5A3HA 2YL6A 2EXOA 1OIMA 4WKAA 4AIEA 1B3WA 1HJUA 1BVZA 2F1BA 1E73M 4JCLA 1WCGA 3BVTA 3T2PA 1FFQA 1WE5A 4EKJA 2CCRA 2E8YA 1CGTA 1V6VA 3AXIA 3WQ8A 5BYWA 2CERA 4NI3A 3CLWA 1C7SA 4P7QA 1ODUA 1KXQA 2WVVA 2DIJA 3A22A 1E56A 3WF3A 3VIFA 1R46A 4W93A 1Q6EA 5A69A 1Q6GA 3VGEA 3F5LA 3GBDA 4L4PA 3CZKA 5JBDA 3AJ7A 1XH0A 4HU0A 3VVGA 2WVUA 1JIBA 4W87A 1J0HA 4AZCB 3KLKA 3LRMA 4CD4A 2B31A 4NXKA 2EPMX 1ZJBA 2OYMA 2QLYA 3S5YA 3VMOA 2PB1A 2EACA 3LPGA 2OWWA 3JUGA 3NDYA 2WC7A 7A3HA 3GM8A 2ZUMA 1N82A 3H53A 3ZT5A 3DC0A 1RH9A 1IT0A 1BYBA 1Q6DA 4H8UA 3LRKA 1HKMA 1JZ5A 3HJEA 2ZUNA 4OZOA 1HVQA 4CD8A 2OLHA 2VX6A 3OLGA 1UZ4A 3B9DA 1GW1A 2J7HA 3THDA 3VILA 1UWUA 1B0IA 1E43A 2EQDA 1KXTA 3GH5A 3O2LA 1H4PA 2V3DA 5FIPA 2WMHA 2BXZA 1DWAM 1X6LA 4S3KA 4PCSA 5HOSA 3POCA 1HL9A 4ZE4A 1US3A 2WHLA 4W8BA 3CC1A 5A8MA 3NSMA 3L4TA 3UG5A 2WLZA 4M56A 2F7QA 1E6RA 1WO2A 3HG2A 3M07A 1OGBA 1MXDA 1UR8A 1XV8A 2ZX9A 4MDOA 3MU7A 4F66A 1OSEA 3AS1A 2F18A 3FN9A 1PX3A 4FNTA 1VBUA 4DM2A 1VJZA 1B2YA 3VMPA 1WNOA 4W5ZA 3B9EA 2XN1A 3CPUA 3WF0A 5BRPA 5FL0A 5CSUA 3MMDA 2FHFA 1GVIA 4UOZA 5JIPA 1TVPA 2GJXB 2ZXQA 1WAWA 1BF2A 5D8ZA 3AIRA 2CHNA 1QNRA 3L4XA 3CZGA 4D6GA 3DYPA 1C3FA 4FNUA 1DWHM 3ZJKA 3KEHA 3WMCA 2GDUA 2GJXA 2JEQA 4E2OA 4UQ9A 3HN3A 4PN2A 2XGBA 2WB5A 4OBSA 2DEPA 3AS2A 5ABFA 2A3HA 3II1A 3FNDA 4NF7A 4RE4A 1D2KA 3SCOA 4Z2HA 2ZX8A 4XX6A 4M82A 1UR9A 1R7OA 4YHEA 3N04A 1PPIA 2QV4A 2WBKA 3AS3A 3DYMA 3RM8A 3BAIA 3PZTA 3U5UA 5IHRA 3VIPA 3D4ZA 3AZSA 4IPLA 3M6DA 1WP6A 4B3KA 1VEMA 1K9FA 1AQ0A 3BVWA 4GQQA 4PEEA 5A8OA 3AMKA 2W5FA 2YDRA 3NJ3A 4Q7NA 4K68A 3RMEA 1Y7VA 2J78A 4AW7A 3WNMA 4CUCA 1V3KA 1J01A 4R5EA 2VCAA 4AISA 1LWJA 3VDCA 1GCYA 1J0KA 2F1AA 4A4AA 4PMXA 4LX4A 3WY4A 4TX8A 4JKLA 3OIHA 1GHSA 1E3XA 1NP0A 3ARWA 4HOWA 5HPOA 2J62A 2VX4A 1G0CA 3AQUA 2JE8A 3VDBA 1NM9A 3G6LA 1VRXA 1CXKA 3CHEA 3ARYA 2EPLX 4TX6A 4AD5A 1C90A 2Z1SA 3DDFA 3ARRA 1J0JA 1HJSA 1LG2A 2DT2A 2O9TA 4PMVA 4OUEA 5IFPA 4DWSD 2IXUA 2YL8A 2PC8A 3S5ZA 2F7PA 3WIJA 3VO0A 1UR1A 1W1TA 4J3WA 4HPGA 4DWSC 1R75A 5LA0A 1E15A 3GNPA 1BLIA 1BG4A 3BSHA 1HJVA 3MUY1 1JI1A 5EFDA 5EBAA 3CZEA 2J7DA 3WF4A 4BZYA 3LX9A 4EK7A 1GQLA 3SCNA 5I5RA 3F5KA 2WC4A 1H41A 3MO4A 3WDJA 2G4FA 3BAJA 3BAWA 3AIUA 1ISXA 3BVVA 5CZKA 1UG6A 2CETA 1QPKA 2J7BA 4KMQA 5A2CA 3RCNA 4MB4A 1KCLA 1QNPA 4FNSA 2UY5A 3RDKA 2HISA 1EQCA 1TMQA 3HG5A 4D6IA 2F7RA 1K9EA 3AFBA 4C7DA 3KZSA 1VF8A 1B1YA 4J27A 1TQVA 3WFLA 3K4AA 2BXYA 3WUGA 2D24A 4W7WA 1HXJA 2V3FA 3VIKA 4FLOA 4N0RA 3W25A 5E0CA 1KTCA 3N1AA 4UFKA 2ZUSA 2VQTA 4LPCA 2C8NA 4PMUA 1CXLA 1E6SM 4GZEA 3UCQA 1B3ZA 1X6NA 1CNVA 1UA7A 4OIFA 4H8VA 3GXMA 1UASA 3IGUA 1CWYA 1UWRA 4CKQA 4JL1A 3DX2A 3D4YA 1A3HA 2GK1B 4GPNA 2AOSA 3PTMA 1E70M 2J25A 2D22A 2WZHA 1BYCA 2PWGA 1V0MA 4PMQA 2YBTA 1KFWA 3TTYA 1U33A 2PWFA 1BPLB 5HDRA 2CESA 5DT7A 2QHAA 5I79A 4L4OA 3RILA 1UH3A 1QNOA 3NSXA 1BAGA 3W4RA 1GQKA 1UR2A 1PZ3A 4PUEA 1DEDA 4W5UA 3VKKA 2WW5A 1FFRA 2VO5A 1E4IA 1UQZA 2CITA 3ALGA 3MUIA 2JALA 5E1QA 1R8LA 2WZIA 4E4PA 1ITXA 2JF6A 2EBNA 1TFVA 5ABGA 2X0YA 2XUCA 1HL8A 1UR0A 1QOXA 4PSPA 4NX0A 1JDDA 3VX0A 3W6LA 4CN6A 2Y8KA 1E4MM 3W0KA 2EABA 5GQBA 4XV0A 3OBAA 2Y4SA 1JNDA 5JBEA 2XSBA 3ZJ8A 1W1PA 3IANA 3T0AA 3VDHA 4P8XA 5A6AA 1BQCA 3AXXA 4TVDA 1XYZA 2YDQA 4UFHA 3SUVA 1HVXA 4F79A 3GXNA 2VX5A 4S3JA 1KGWA 1VAHA 2WKLA 1T0OA 1LQ0A 1WDPA 1X1NA 3TA9A 2DDXA 3HZ3A 4W88A 2CPUA 2XVKA 4X0NA 1HJQA 3WH7A 2D3NA 1C8YA 1KXHA 3FW6A 2UY3A 1Q6CA 1HTYA 1OB0A 4BQ5A 2GFTA 3D5HA 3DX4A 2XVGA 3AHXA 3ZJ6A 1JG9A 3L4ZA 2A3CA 3EMQA 3SCTA 3K1DA 1MFUA 1AQHA 3EDEA 4JL2A 3O9NA 1MWOA 2XTKA 1QNQA 4LYPA 4UFJA 1HN1A 3WD3A 2CNCA 2FHCA 1R34A 3GXPA 1V6YA 3FY1A 5C8BB 1WKYA 4CD7A 3AMLA 4CGTA 2WKGA 1MW1A 3PBGA 1GOKA 3WEOA 4CN1A 3VGFA 1JFXA 2WMIA 2Y24A 3ZR6A 3SUTA 1B3XA 3OLDA 4JFSA 3GXFA 1OCQA 4Z2JA 3A4WA 3WD1A 1MYRA 4PBGA 2J7EA 4PTXA 2X2YA 1S46A 1WDSA 1YQ2A 1PEZA 1EA9C 3HG3A 3EMCA 4PSRA 2J7FA 2WCAA 4IISA 2Y2WA 2E9MA 3MI6A 2IUZA 1ITCA 2D0GA 3K46A 3I3BA 4UFIA 3KE0A 2BFGA 3A3HA 1H3GA 4D1IA 4FNQA 3W82A 4U3CA 3WH5A 3I3EA 3QOKA 5FCZA 2IXVA 1RP8A 1L8NA 3T0BA 2VT0A 4BQ2A 4U5KA 3GXDA 4M80A 5BROA 2D23A 2DPEA 5DEZA 1XSIA 2XFFA 1LJYA 5EFFA 2WMJA 3WEMA 4NZFA 4AIOA 1QHPA 1SYTA 5JUVA 3W38A 2VOTA 5AYIA 3L2LA 2JIEA 4JKMA 1UQYA 4FLSA 1B90A 5GNXA 7TAAA 1UZ1A 1XHGA 4AZBA 1PIFA 1VENA 3WSUA 4WKHA 3WY2A 3WN6A 3UR8A 4PMYA 4LGXA 3W53A 2VQUA 1DWJM 3WH8A 2XM1A 4DO4A 2BHUA 1E0XA 1ZU8A 5C71A 2EADA 1GQIA 2D1ZA 5ABEA 4B15A 3KL3A 2WYSA 1CDGA 4MB1A 1WDRA 1H0GA 4RL3A 3ARUA 3WH6A 1H49A 1QX1A 3ZIZA 2RGMA 3MUAA 4XUYA 2C7FA 4PYSA 4NRSA 4YHGA 5M3WA 1PX4A 2J74A 2WLYA 4CCDA 3RJYA 4UTFA 3IJ8A 1BFNA 1XC6A 4JIEA 3D3AA 4HZ6A 3L4VA 1FH8A 5E6ZA 4HMEA 2ZUTA 1KB3A 2BY0A 1VIWA 1JZ4A 2G3NA 2QMJA 5DMYA 3EDKA 4HA1A 1UH4A 1UHVA 2NT0A 4H8HA 1CGYA 3AZRA 4AZ6A 2YLAA 4N42A 1UD5A 4YN5A 2ZUWA 4U5IA 4LYRA 1OWQA 1HXKA 1H11A 2XVNA 1CEOA 2EPNA 2DT3A 4Q22A
chains in the Genus database with same CATH superfamily
4D9QD 2FB4L 2HUEA 3PWGA 2Z7WA 3LXCA 3E02A 4QLKA 4NNPL 2WVTA 4YXKH 2ICES 4ZR8A 1WA3A 5IQ7H 2P5WA 4P9ML 3T3PE 1U95B 4HJFA 3AUOA 3TJEH 4EPDC 3VXSA 3BG9A 2UXGA 1MQ8A 1BGXL 4Y1AA 5LCVH 4AEEA 4EPBC 2CYGA 5EU6D 5EU5B 1F3XA 1BD2D 3WJJA 1I3UA 3HMWL 5EULV 2DZXA 1MW0A 3KYNA 3K30A 1ZRUA 3VD4A 4IBUA 1H5VA 4LESA 3L4WA 3N41F 4JHOA 4K2UH 5D93C 1CZ1A 1LOSA 3EGXB 9RUBA 1S5WA 4Z08A 3N34A 2CNZA 3ZKNC 2AI0L 1WAEA 3LM3A 4HTBA 4CNPA 1FP8A 4XWOC 1ZKAA 1VBHA 1DDTA 4EQ2A 4MNKA 4MGXA 3WE6B 3O3DA 4J3UA 3EFOA 4K1WA 1SOXA 2BNUB 3DMMA 4G1KA 1ZJAA 1HKWA 2DBLH 2WBJC 5T9CE 3DO7A 1TE1A 1XP3A 1DQIA 4MAVA 1IAOA 1GSMA 1I1RA 4LEXL 1OSPH 2W65A 4IBWA 1TKKA 2XFGB 3WFHA 2ENYA 2G0WA 4ZYKA 2CLPA 1J8HB 2JF7A 4FZ8H 3H8AA 1S7XA 1X5IA 3M0HA 3UJRA 1HH9A 4NM8H 2W5PA 4BFEA 5I6MA 3AGVA 1PZ2A 4PLJD 1KR0A 1T20B 1VZHA 1XYFA 1OCBA 1IQWL 4JHUA 3EB3A 4ODXB 2OQHA 1NLDH 4CNOA 1VS1A 1YY9D 2BERA 5IRPA 1FG2B 3SPVB 2ZKXA 3F64A 1K2DA 4WEMB 5T5FA 2DVUA 5AECA 3SKOB 4JPKH 1HKJA 4Z95L 1VZWA 2C1OB 1Y0EA 2BP5M 3VFTB 4NP4L 3BV7A 1JK9A 2O30A 4L4TB 2B4CH 3HIZA 5DSCA 5L4FA 4AD3A 4S1QH 4J1UA 1NCOA 2EYRB 2QQKH 5E70A 2HTMA 3E1ZA 1T7WA 5B21A 2ZXWB 3TH3T 1AGDB 2QXWA 5HJLA 2FYYA 2IKGA 4ODSH 4NQXB 1S7RB 5ICZB 3EXTA 1EJVC 2E7BA 5A1AA 4G6FD 1JVKA 25C8L 3N42B 3ZE1F 2I9TB 1FWCC 2GIYA 3TA3C 5ECVA 3V10A 3OGCB 2OYKA 1W1B1 2FHBA 4PB4A 4L3EE 3A4EA 3PP4H 4RCXA 1YMME 3V5DA 4PI2A 4M5TA 2A83B 2EJ1A 3GPEA 8CGTA 1E9QB 1GKPA 3B03A 5A6IA 1L3NA 3KBVA 2XIMA 5EBMB 3MV01 1BP3B 2DQCH 2EIKB 3NQMA 1CFTA 3R4IA 1KJMA 4KGJA 1KRMA 3BGGA 1ZSDB 5IEKA 1FYTB 2Z4QA 4G6KH 3BTNA 5A8GA 2O5ZL 1UM4L 3WDQA 4MAYD 2D20A 4Y7EA 2AXGB 3NQIA 4K36A 3JSSA 1W9VA 3QMRA 4EX4A 3MHZA 1A4AA 2BVTA 2WQRA 4XC1L 3Q6GH 4O5LH 4BDVA 1BEUA 3ZHLA 2PDJA 4UNLA 5IXEA 1HFUA 1KZQA 2A3AA 4I6VA 1NGPH 1SDDA 2JXMA 4PRBB 3NQGA 3TU9A 2AVGA 1FNEA 3FFDB 1H1NA 1NQBA 1DBBH 4PRHE 3QIUA 3QNYB 1K9DA 3O3EB 3F7YA 2V5RA 3GBMH 3QOMA 4ZCWA 5C0AD 3U4BL 2XYCA 4GH3A 1WUNT 5AUMB 1ZVSA 4JFZL 3RTQC 1J86A 1K8XA 2Y88A 1MFAH 1OF8A 2CLMA 5MENA 5DTFB 3T8XA 2CUMA 4IRJA 3T6QC 2XDFA 1J18A 2XN2A 2I56A 5A8NA 1J9RA 2VDLL 4IIZA 4XXCC 3VB8A 4NT6B 4O2CB 3VMNA 5FYKD 5C3IA 2C0HA 3CBJB 5FOOA 5AZEH 1B4RA 5DJAA 2NR6A 1WAPA 3D2UB 4KC3B 4ZXOA 3VIJA 3GHBH 4JGDA 1GG1A 3VCRA 2LFEA 3MLVL 3KBNA 4M1GH 1NCUA 3VTRA 1BW8A 3H3KA 4M6OL 4GRSA 4KKCD 3U0TB 2VWEE 2GYSA 4AUJA 1E6XM 5CZSA 5LG6A 3LH8A 3S9ZA 4OGXL 2NUTB 4PE8A 4QRPD 5KANI 1AXSB 5EZJB 3VFMA 2Z8WC 1TTPA 3IGFA 3OBKA 4OR1A 2WTRB 1F3RB 1TYRA 5I9QB 1V3HA 2OWCA 3WBWA 4OVVA 4ZX6A 3LB6C 2ISWA 3QISA 3L5XH 4WEVX 4QTHA 1U58A 4XVUC 1E0UA 4Y96A 1Q90A 1QTWA 1DSFH 1ASQA 4UMGA 3OF6A 3NQCA 4E8DA 4H9TA 1WFIA 4TNFA 3SZKC 4AGOA 2Z8SA 1HFBA 3DA0A 4PJ9C 3CUIA 4JFXB 3LKPA 1MI5A 5KS9E 2ZYSA 2XIBA 1NBZA 1BZ8A 3O3BB 2AEWA 3H4GA 3KCWA 4HWEL 4JTKA 3P0YL 1JEZA 1GSKA 5LIKX 5IREA 1SMAA 3CFNA 1MN4A 3GSNB 4FFYL 5IIEA 2WOQA 1R47A 4JIHA 4HOXA 3FTVA 1XL9A 3WQCA 1CDJA 2VHLA 4DH2A 4R4FL 2EDXA 5CR8A 3CTTA 1PZ5B 2W80C 4OCMC 4XP4L 4XTRD 1HK6A 2CBPA 5LG1A 4D6EA 1CD1A 2BWDA 3LKRA 3OVUB 4HS8H 5IB3B 4GOAA 1GY1A 3BZ4A 1ZT4B 5K33A 3IK2A 4NERA 4F9LA 3ELAT 1R9XA 4I6KA 5SWZD 3UESA 3ZWSA 3H4FA 4J7RA 3LZFL 2FZBA 5EEUA 1ZPLA 4ELMA 5I1DA 3UAJD 3S2JA 1D9EA 4HFUH 5CCGE 4KXBA 3FB8B 3HGRA 4BQCA 2JBMA 2NZ9D 3T9WA 4NNCA 3WBAA 1MCEA 1OQFA 3E49A 2YPLE 1C7TA 2E9BA 2PSNA 3RITA 2QDGA 7REQA 4S1SL 5ADOH 2JKTM 1KCRL 3I6EA 3QSRA 3F6IA 1MCLA 4O9HH 2OMUA 1TV2A 1QFHA 4L64A 2PP0A 3G6JF 5E93A 4Y5VA 3ET9F 3AM8A 3NCYP 1NDZA 2ATPA 2FTWA 5EUOE 1R3LB 2RUSA 4GVHA 4KQ3L 3I3DA 4ZENA 2XWDA 3ZJAA 5AG8A 4M5ZL 3PWVA 2WM0A 5CGYD 1XW8A 2W67A 1MAKA 4IHCA 2FL5A 2UWEA 4YSAA 5C7HA 4JHBA 3UZJA 1KPRA 3JT0A 3CX5K 4M3HA 1YQVL 1UENA 3B8SA 2QSTA 5BQDA 3FV9A 1AD1A 3GHTA 1F02I 4FG6C 2V5YA 3T4YB 3LV3A 5F1IA 3UTQB 2CWRA 1UXSB 2BIOA 4C56E 5F96L 4DW2H 1HWGB 3CNYA 1I85A 4GAYA 4Z7UF 4Z7IA 1SVDA 4I90A 1LRNA 3E96A 3NJXA 3KH4A 3VNMA 4C47A 5HMEA 3WUEA 5LXGH 4XNZC 2W88A 3EYOA 2DT0A 3Q3GB 5CG0A 5CBAA 3PY9A 1H8SA 3G9AB 4QRRA 3TVMA 3AISA 3VM7A 4WK9A 4D6DA 1VZIA 4G43A 1X5YA 4JRXD 5DVLA 5AVWB 2VW4A 4OFCA 3LV5A 4S3AA 2NVDA 3RO8A 4MLSA 5I2UA 1NEZA 2QCDB 5AVRB 4NGHL 1Z9AA 2JKXA 2PCQA 3ZE0B 1V08A 3W26A 2NQ3A 2PXYB 3QPXH 4KROB 4Z7OE 1M53A 4D0DA 3U83A 4DEUA 2CDGB 3RBSA 5HDQL 5C55A 3QDAA 4MZ2A 4LBSA 3K4ZA 4RIRA 1J2BA 1SJEB 1QYGL 2EYSB 5E99H 3ABQA 4IJBA 3VCCA 2PF8A 3PIQB 3JWNE 4S1FA 4M7LH 1Z44A 2B20A 1INDL 2JCCB 1N6UA 3D85A 1CCWB 1Q9WA 2Y0FA 1FL5B 4OECA 1CXIA 1IEAB 2YGOA 3F05A 3P0YH 4HU3A 5DR5L 1QUNA 2CE6A 2H2SC 3TM6A 4F7PB 3B34A 5I6XC 1BRLA 1FDZA 3I9AA 1ONXA 1P7KB 2C1IA 2V9DA 2AKMA 5HUPA 3UBHA 3EKZA 2OCCB 3ASNB 3UBXA 3VD3A 4AYBA 1XF0A 3RWEB 3LB0A 2PWUA 3GBNL 4P5TA 4YXKL 4JFWA 2HP4A 1TZZA 3QY6A 3QUML 1MQKH 2WLNA 3QIWD 3SDDD 2VR5A 3AQZA 4FQLH 2HROA 3K2IA 1OOAA 4YL4A 5D96B 1JN6A 2Q0ZX 4Y5YA 5IESH 2R1KA 3QNFA 1DIOA 4KK9C 4G8GB 2CLIA 2NY6B 2F2KA 3MJWA 1QI5A 3NEOA 2CNYA 5EMYA 5AOJA 5CJ5A 5FFLA 3QR0A 1SN0A 4TF4A 5I5JA 4AJYV 3ILQD 2EUVA 2GSJA 3W7QA 2W9MA 2FO4A 3ZZLA 3T6XA 3SRHA 4PB0L 5D2NA 4BXVA 2V37A 3A0OA 3EDDA 1C12A 1PV8A 4Q8TA 2UVFA 3KPPB 4RWYH 5IHUL 5I8CB 1VCGA 4BKLB 1BYAA 4WJG3 2G5UA 1KLGA 3OVGA 4ZBJA 5BWFA 4H9MA 3ZKXC 5MEPA 3MLTB 4OJEH 3TOPA 3LZNA 1JZFA 4AAJA 2GJ6B 3T8LA 4X6DB 1Z9SB 2NT1A 3LZRA 3NR0A 1XG3A 4PJEE 1Q6FA 1NJ9B 5CF3A 1R5VA 1JPGA 5I1GL 4JANB 4ESKA 1W5NA 1D3CA 3WUFA 4ODVL 5F3FA 3AITA 4LH8A 3AT9A 3FQUA 2X3CA 3PTDA 1GOOA 4A2EA 5HANA 3WNNA 2ZAGA 4WO4C 3ETTA 4GVFA 5LBGA 5J0BA 2V4LA 4MJ5A 5KYUA 1DQUA 4L1WA 1KYUA 5HQMA 1LP9A 2ZD0A 1UD4A 1DVXA 3QORD 4C54A 5DMGD 1K6AA 1R3TA 4XPHL 2VSDA 5C0JB 5KWYC 1JZ2A 5HDBB 3WL9B 3P2VA 1Q72H 2IWKA 1UVQA 1XINA 1Q9KA 3DIPA 1JNHB 2H90A 3VXGA 5LKYA 3WEXB 3CFTA 3CDZB 3KXFD 1U8KB 4X9YA 2BNJA 2HK0A 3R43A 5JOPE 5C09D 3LI1A 4DVRH 5DRZA 2HJPA 5IQNA 4WV1C 3A47A 2VDRB 4GKNA 2OZ4L 1U8CA 2M1KA 5PCYA 1OOWA 3QPQD 1KB5H 3MRGA 3LDVA 4I8YA 4XCEA 3MJ9L 2DH3A 3MNWB 1RQBA 3IVTA 3MRBA 4K37A 3CASA 1ZLEA 2C4FU 4NS0A 4F2MB 5I0YA 2EH7H 2P8LB 1P7TA 1REQB 2JIWA 3EWBX 4IRJD 1VFFA 1SXZA 2AP2A 2PP9A 4TXVB 5B1BB 4B9CA 5H4ZA 5IBLD 4ABUA 2VC5A 5DZ9A 3P3BA 3O6DA 3E0FA 4IK7A 3TSBA 2ZZ3A 2R0ZL 3MUGB 1A6WL 4G9FA 1SW7A 1ME7A 4HPHA 2AERT 3BEWA 2B15A 1OQOA 4AL8H 1RV8A 3NTCL 4XXDA 5L8KB 1F4AA 2E09A 3RU8X 4AKOA 4K71C 4XH2A 3M17B 1XFBA 4I9JA 2J4WL 4PRDB 4PGDB 5KBLA 1OAXL 1K7EA 4J3TA 4IMAA 3ABLB 1UWXH 1P5VA 4HX1B 4EPSA 1W17A 5IVXE 3HGJA 4QX4A 2JJUA 3ZQWA 1XCTA 3S9DB 1HQTA 2NY1C 3BVUA 1TV4A 4WSGA 2O6CA 4U6HB 1XH3A 2H9GA 4LCWA 5E8OB 1YXCA 5AC5A 2PAJA 2I5YL 2VISA 4XO3A 5B8CC 1JNJA 1CW2A 4AKPA 1YPIA 3MWCA 4ELKB 1U91B 4CD5A 4OT7A 8PAZA 3H26A 3E0WA 1RHFA 1AGDA 2VABA 4N2KA 4EUPG 4HV8B 4W8LA 4N02A 2G97A 1BBDL 5E1AA 5FUOH 1R5IB 1GVSA 4HA3A 3MQTA 4LCYA 3RPMA 1OZUA 1XCFA 5F9WC 1ECEA 3E8UH 3PDGA 2ZOUA 3VUPA 4O2FA 1J8VA 3H23A 1JF5A 3WIIH 3QGVA 2F7OA 3SBPA 4NWTL 2H1XA 4I77H 3PDOB 3WJMB 4FOKA 1CLYH 3QS2A 2DSKA 3CNKA 3FZUC 5FECB 1UWGH 2R56H 5I6KA 1UWSA 1XH1A 3ARVA 6CGTA 1RZJC 5HD8D 3E3HA 3WK0A 3ZYIA 1S2CA 3EOTL 4ES4A 3DX7B 1FO0L 2H9AB 3L16A 2X44D 3QORB 4PJDA 1Q13A 3W2LA 4JPWL 5J3HC 1MIEH 5CC7A 3MC5A 4NSBA 4Z7AA 3NCFB 1YEFL 5DD1L 3SO3B 3PHQA 5BNXD 3JYCA 5AD0B 1RJCA 4EAYA 3B6SB 3EXSA 4ZMWA 4JTFA 5CEXA 2PCXA 1QDSA 2X2HA 1A6ZA 5GRZA 1DUZB 2Z1KA 4RX4A 1PKNA 5FF3A 4Z3IA 1HKKA 4H19A 4UR7A 3P9LB 3WMPA 4AM0A 1UEMA 4JFOB 4QLLA 3GJFH 4RAVA 4MS6A 2HX8A 3QCTL 5G2HA 4Y4HB 3FJTA 2FLBT 4LSSH 4W8AA 3N4FA 5CHNB 4PB9H 2YDAA 5AYXA 5HATA 1U8LA 2EPKX 5HHNA 5IBUB 2OSYA 5E8DH 1VB9A 4N68A 3UTSD 3QYQA 1DZ0A 2HT2D 1ED3A 3FCTB 3IIVA 4UUIA 3U9PH 3NDOA 1KFEA 4O11A 4UDTB 1IQDA 2SEBB 4KX7A 5MI0C 3RL1A 3VTTA 1YEEL 2P44B 5K9QI 2CBTA 1U42A 4OD3L 3L13A 4ORMA 1WSST 3EKCA 5FYJD 3EZ4A 1BM7A 4X8GA 1US2A 2PNDA 1A6AB 5LLIC 1OT4A 1OCZB 5ICYA 1X7FA 2VLRE 4HF5H 3I6KB 2YYTA 3SUWA 4A05A 4DYKA 4LRIA 1XIWB 2FR4B 5AHEA 3S3JA 2JCWA 1EHLH 1R6WA 4ODBD 5GJSH 5IHWA 1DVFA 1LZOA 3EOSA 2CO7A 4PY7A 4HOZA 4OFPA 4JPSA 5E2VL 3CHVA 4C4BA 1KPUA 3DX9A 1IR1A 2DY2A 2Z0UA 4PGJA 1UACH 2GBTA 4QAMB 3VXOB 1BQGA 3FJ4A 3ULUL 1FL5A 4B50A 2COVD 4YDLC 1ZWIA 3D18B 1S9KC 1UP3A 2B7QA 1NBZB 3DIFA 4B91A 3ES6A 5LIUX 2TRYA 3WFDL 1VPXA 2FH6A 1K8CA 3JV4B 3WFZA 2BVUA 4G6ML 5T33L 1FL3B 1XL6A 3QUYD 5IFAH 2BS8A 3GJFK 3LZQA 3MX0B 2IQDA 2V2DA 4O18A 1NEUA 2WXJA 3DG6A 1LORA 2G37A 4FHKA 3KJ6H 3VG0H 3UTTB 1W72L 4EI5D 2RBLA 1F6PA 4OLVH 1G7LA 4ANXA 4OFDA 3SQLA 3V7AE 2ORBL 2DQEL 2A6DA 2LGNA 2X12A 3RKDC 3UTZB 5JA9A 2G3JA 2PYFA 6REQB 5HR6A 3ARGC 4WHTB 1R0MA 4U6VH 4CNTA 2PTTA 3KPRA 5I2IB 4NRYA 4MYAA 3C09C 4QF1A 3N06B 4AZCA 4TS6A 2ISSA 2YA0A 4UZSA 2WBWB 4UNUA 2R23A 2Q1EA 4XBMA 1V6UA 4AVOA 3TMLA 4HUVB 4UOJA 4KWVA 1U2YA 2BIPA 4A67A 1N9PA 2R1YB 5D9SB 2DM3A 2ZX6A 4FEIA 2PTXA 3IDGB 3UJJL 1FO0B 1YEFH 5D70L 4B4FA 2CLOA 1G5GA 4E9TA 1EXUB 1DHPA 1YYAA 5E95B 3UWQA 4ZO7A 1TPUA 1SZGA 5DC4B 3IDXH 3H3PH 4FP8H 2VC9A 2D0HA 3IE4A 4HZAA 4KESA 1ADQA 4GBDA 4XMKH 4DK5A 5HQEA 2NR6D 5KTLA 3ULAB 1VCBC 2RQEA 1LRQA 3DHMA 5EB8A 5F88A 4YTQA 3UGVA 4UXDA 2JJSC 3TBBA 1JYWA 4O4YH 1IE5A 4G8FB 3OGOE 1PZCA 1DFBH 5BZXA 4AITA 3ULUF 2PMZA 1TA3A 1GHFL 2E3ZA 3F5WA 1RJLA 3BH9A 2VLRB 1AC6A 4GFTB 5FM5M 3UJIL 1F1AA 3S46A 1UWTA 3K8KA 3CT7A 4HALA 2NUPB 2DV6A 3CQHA 2BNRB 1I45A 3FA4A 1LO5A 4FNLH 3EPNA 4DJEC 1CG9B 4K23L 4UI2A 2Z26A 1VESA 1JSYA 3MFFA 4J35A 3PF3A 3EYVA 5T1LD 3CH1A 3AALA 2HRWA 2R1WA 3W11D 3ZLQC 3BKJH 3KPLA 2JJVA 4ZTPL 5BUGA 1E1CB 3UACA 2W60A 2KAUC 5C0FA 2VN4A 2IAMA 2XN9D 1V27A 2Q8XA 1OTUC 1ULVA 1JDAA 4HWUA 4JFZH 4C58B 2XHYA 3B2VL 3UBGA 4ENLA 1PHQA 2W3ZA 5DDHB 4MLIA 4TVDA 5E8EA 5I0WA 5CC6A 4ZZKA 5F4WA 1YMHB 4CNIB 2R0LL 5EY5A 2VDNL 2YN3A 2WGNB 2H4EA 4PJIE 1JYXA 3D33A 2JKNA 2OAAA 2RDXA 2IAMC 1BAWA 3C08L 5EU4A 2AQOA 3KBJA 2O92A 4Q9QH 4GUGA 3QUYB 3G0XA 1NIAA 1BRLB 1UM5H 4YDVB 2H6PB 4KAQL 4ZNEE 3SQSA 2FQDA 3D2UD 2YUZA 1M1XB 4DI8A 1L7TL 3EYUH 4J1OA 2AABL 4OJFH 3BP4A 2E7CA 1RY8A 4QY8B 1UA6L 4L9XA 3W24A 2N01B 3T2QA 2WLMA 2ORBH 2H41A 1R3HA 3FN0L 4AZ7A 1KGCD 1TYJA 4UOW0 4LKCB 1WD8A 5BMFL 3CVBA 4ILDA 3KCOA 4XP9H 1SHXA 2IADB 2ZG2A 1SGKA 3EGDB 1XD0A 4BQ8A 5EG6C 5BS0A 1FFOA 1NQ6A 3VE7A 3T4YA 1Y8BA 4FLQA 1VLXA 5LXVA 5E09A 5KZEA 3IKCA 3NDZA 4JFEE 1ONQB 2CZNA 4LAQL 4YAQB 3D3VA 2BOLA 5BS0D 3ZBMA 4XOEA 4YZFE 4Q52A 2N7AA 3ZT7A 1J5SA 2E68A 1R3RA 2HE5A 1ISYA 4P61A 3VGAC 1X7SA 2WO5A 4GYPA 5DUPH 5I82A 1W72B 4ODTH 4ABWA 2K4AA 4LNRB 3HZMB 1IIKA 3ZZSA 4G1MA 2GIMA 3HHMA 5KVGL 5IFJB 3QIBA 4FTVE 3G9VA 2OMVA 5I1IL 1IEVA 2AV7A 5H8UA 4GEIA 5F9DC 4ZMPA 2R24A 1UURA 3QS3A 3ZU8A 5FB8A 1K6WA 1QRQA 1NAKL 3F04A 4MVBD 2D03H 1JZ8A 1JQXA 5GNYA 1A1MB 4OD1L 2UXVA 5HYJE 1ZBWA 1J5OH 1FH7A 5T3ZE 4U1IB 2PR4H 1YIXA 1M7PA 1D7FA 3CEPA 3PN8A 1VFBA 4KWWA 2CWXA 2RTTA 1W1VA 4LLVB 3C86A 3WMLA 3O07A 3HE6C 3PTKA 1JRBA 3QZAA 3JTTB 1PIGA 4FXTA 1CFBA 3ARGA 3ECUA 2YKKA 1G9HA 4NQQA 2Q76B 4QE1A 1F11B 3TJ4A 2YSSA 5AC8A 1A14L 3BN9C 4XO4A 1OFAA 1XYCA 1BCIA 1E67A 3UZVB 5HHXH 1A5MC 3W9EB 5L0QB 3BSGA 5KJ7E 3PZVA 1Q0YH 3BSZH 5B3SB 4FPSA 2XFYA 3LRGA 3L4YA 3V9EA 2QUUA 2VUYA 2OYLA 1LO4H 2VZ3A 2P1YA 3RWFB 4ZMTA 4P2RA 3OM3B 2B1HH 4OLWL 4ZNEA 2GL5A 3W27A 1FZOB 5AKQA 1XGTB 2HFFB 1Q9LA 4CVXA 5GS1A 5J6SA 5ID1B 4N85A 4CBZA 2B5IC 2E7FA 1JF1B 4LCIL 4Z6AT 3ZKMD 2WUBH 4NCDA 1AW2A 5I1CH 3F7VB 4R7NA 1OZQA 4FJZA 5DO2C 4D0BB 3NQVA 4HK6A 4S3FA 2HK1A 3WKNA 5FD0A 4TQTA 1NVMA 2CFFA 3WF2A 3AXHA 2AKZA 3K8MA 1K3IA 1QEWB 3W87A 1M7XA 4TV3A 4JN2B 1XR2A 1J88A 3MV7E 2ASHA 4HIEB 4KVNL 3UAJC 4LRIC 5KZDA 3CH9A 5I3DA 1H51A 1L7IL 3Q7JA 1H5BB 2ALAA 4LPYA 4W4OC 3C6CA 4KPHH 3MRKB 2Q8AL 2X1UA 2Q7YB 1G0YR 2ERJC 4GUJA 5LGKA 1NBVH 1WZMA 5JDJA 1FKWA 2X6BA 1A1OB 1DXIA 5KN5A 4JICA 3EJRA 2Y5JA 3S5LG 1OLLA 1XF4B 1LL4A 2PGWA 2WZAA 3ITTA 1FWIC 3CVHB 3C09B 3KRSA 2RGLA 3QHMA 3ME0A 4UM9A 5AQ0A 2NSMA 3WUBA 4AMCA 5HDQH 5HGGS 3K71A 4Y5XC 1WICA 3V6BR 1D5BB 4U2ZA 3ESOA 3M0JA 4XWOD 2VXUH 5CXPA 2FYMA 2WZMA 3LTPA 2A6LA 4O13A 3VINA 4FXRA 5DJ6A 3T0ED 4GAGL 2IDCA 1JE6A 3VI4A 5FKAB 4I9WD 3ZR4A 3KLLA 1OAQH 1E3ZA 3NFPB 4DCQB 1I8JA 2VJXA 1V7NH 1T04B 3UA4A 4XNZB 2V63A 3V0IA 2NY2C 2CLEA 3DECA 3MANA 2Q6WA 5BW6A 1NGPL 5KG9B 3BD5A 1NH6A 2C3GA 2HVJB 2BFVH 2NXZD 5TBOA 1NINA 3QK0A 4V33A 1ET5A 3ECQA 4F4RA 2CLRA 3MOQA 3BWSA 3CV2A 3NO3A 2Y5TB 1RMFH 3MROB 3FNKA 3TURA 2A7RA 2EKSA 3IMWA 2UVEA 4LLYB 3V4VA 5IHLB 3IDJB 3L23A 1I31A 1MJ7H 3RHWK 2GEQA 1JR1A 1HE8A 1XLLA 4GY7A 3W1RA 4WI3A 1CLXA 4OLXL 4HZMA 3QQ4B 3I50L 3OZMA 1NELA 1KTBA 1NDTA 1NIFA 5ESVB 2FATL 3IJ7A 3N6QA 4NENB 3F7PC 4YXGA 2F54A 5L88L 4MB5A 2H6PA 3TK7A 1UT1A 1JVOA 2JKJA 1LDPL 3MJGX 2DQFA 4IS6B 3VYNA 4B3VA 1TPVA 1I8MA 5C2CA 3LLDA 1IFRA 3CZJA 1KCZA 3QYSA 4KKLC 4DWDA 4QRQA 1A0EA 5CJ8A 5A2BA 4BI7A 1YHTA 2XIIA 4A6YB 2VFGA 1GAFH 2OTWB 3MZGB 3PFUA 3RI5F 4UT9A 4YHPA 1KG0A 4NQSB 2P0OA 1JS4A 3QGKC 5LA1A 4FA8A 3KDOA 1PG7X 3ERXA 4LARH 4WI7A 3DC8A 3UTOA 2WLJA 3VIHA 3GSWA 3WNPA 3PS7A 2XH4A 2Z31D 5T1KA 1G84A 1O6SA 1ZHKA 3LEYL 4BE5A 4KVNH 3UAFA 3C2OA 2B1OA 1XIIA 4QXUH 5EMJA 1CGWA 4NRRA 3W1AA 4BE6A 2VLRA 2DJLA 1D9KC 1TZHB 2CKNA 3SE6A 1P7HL 2XZQL 4ZZFA 1UJPA 4HIHA 1E30A 2JF1A 1T2QL 2BZ7A 4OZGF 3VXQA 5JW5B 2RHGA 4MWAA 3TCSA 3S1UA 1Z89A 3RJOA 2YYUA 2XWJA 5EOQH 3ARFA 3IDMB 5IFJA 2ACUA 4GC4A 4DQWA 2DI8A 3DSNB 3UYRL 3STEA 3CZLA 4PJGF 2F53A 1QBBA 2QVMA 4KJYA 4F8LA 1OF0A 2WMIB 3V0VB 3B06A 4NYLB 1W15A 3PAZA 4UTMA 4I0KA 1B6UA 3CHDA 3KCLA 5ABZA 3KXFB 3O41B 1MPAL 4UANA 1JTOA 2OQYA 4IGSA 3C8HA 4LOFA 2OQLA 3VAEA 2PP3A 5KYYA 4B5ZA 1SFTA 5J1TC 1G9MC 2WSYA 3GMNA 2WAQA 3H9SA 4HT1H 2J6WA 5IJDC 1ZGLM 1GGYA 1GNXA 4GXPA 2FNWA 4HZ1A 2B0SL 4M7JL 1LRTA 2F2HA 3PZQA 1Z9OA 1S8DB 4H20L 4KKCC 2J8GA 3T71A 1BJMA 3CCHA 3WJLC 2ZBTA 3S34L 4N0YL 4DLMA 1KELH 4O2EB 4M9PA 3TIMA 4MJIA 3WNKA 1SW0A 4M51A 5AWNH 3PNRB 4HJWA 4Y9AA 3FQRA 2R2BB 2GG1A 1Q1JL 3QWRA 5C70A 1XLJA 4IU2B 2Z1BA 2FBJH 3HCVA 4ZPTB 2XIDA 4F9PA 3RX3A 1SXCA 2N7SA 4MB3A 3BLEA 5U7SA 4XO9A 2WV3A 3MRFB 4HKBA 1F07A 3ZE2B 4WHTA 5GRJL 5DANA 3KYMA 5CZXD 1AANA 3GSRA 4ICXA 5I71C 1WB0A 3QHOA 1Y07A 1SEBA 4FC3E 3APYA 4TOQA 4KRLB 5BXFA 3IBEA 3O0RH 4CU7A 5HYFA 3VD1A 1KM6A 1JD9A 3FU3A 3NACH 4WGXA 4IKLA 3L67A 1KO0A 3V4PA 1K72A 4PP1C 4V1DD 5IOKA 4LSVH 4TSBL 5TDNB 5JXAL 2A4AA 4K8HA 2DQIL 3A4XA 1MUJB 3KM2A 3NGBC 4EF3A 1WKDA 4PUUA 3WLQA 3NABL 1VGEL 4P2CG 2WXGA 2QR0B 3FO0H 2C9XA 3DFNA 4N6FA 1C8VA 1A6VH 3FTZA 3LNEA 5EU6E 4NKDB 1RIHL 1RQEA 3MP3A 4TTUA 5REQB 4KY1L 4ZXLA 3MO1B 4IQDA 5JXEC 1J11A 1CDBA 1P4LA 4P8UA 1J8SA 2X4UB 2PWVA 4AL8C 5LWYL 3FUDA 1FPTL 5I76B 4NPYB 4AQZA 2XTJC 1FFNB 2WXFA 4HBCH 4E8CA 3D87B 4OZHA 4P05A 3DHUA 2YBRB 5KVDL 5ILTH 1I0DA 3AU6A 4R33A 3OJ2C 2X6VA 4HP5A 5KSUB 1T1WB 3NA8A 1X4YA 1PSKL 2B7DT 5I09A 1CTNA 3L3HA 1RUKL 4Y16D 2B81A 5LNRA 2FWSA 4OV5A 5HPCA 2D2GA 2FT6A 4X7TA 2BRRL 5MERB 1T2QH 2CO3A 4DJDA 2DWTA 1M5WA 5CCZA 1RSCA 2XH2A 1J9YA 2E9LA 4YSSA 4A66A 4S0TD 5KBPA 1UWQA 2AQRA 4KKAD 2CDFA 2RGSA 1FA2A 2VI0A 2WZEA 3BZGA 3R0KA 1A7QL 5KINA 1LQ2A 5I1AA 2Y7FA 1UUQA 4GJ1A 1XGYL 1OTTC 1QLRB 2O0TA 3EFDL 4P06A 3RMJA 3LZPA 3VKDA 1MEXH 1TVBA 4XCYA 3D0VA 3SKMB 2HS6A 2VGLM 3RU8H 4HFWB 2ABBA 4TX9A 3KXQA 3V18A 1W56A 3W73A 3PNWA 6TIMA 5IBXC 2NY4C 1F6FB 1CIUA 5FDWA 3K6IA 3WN5B 5E8DL 4QF1B 3UZZA 4JY6A 1XQ4A 4FFWC 3SDCD 4O50A 4PJ5E 4A8IA 1AQ8A 3MY9A 2NY7H 1A7RL 2DWSA 1KGIA 4XPFH 3TCEA 3OAYK 3RVTD 3J07A 1EEYA 3TDFA 4GYFA 2YUWA 4N8UA 1ZRQA 2I5GA 4E5XG 5AAPA 4U1GB 1J5CA 1AZUA 1G9EA 1G4TA 4O52A 3TBCA 1TXKA 3SRDA 3MODL 1PL9A 3JVGA 2WUBL 4AFYA 4E4FA 4H13C 3BXNB 2G75A 3F7QA 3NVDA 2FK9A 3P4MB 1PAMA 3FXIC 1FL6B 1UXSA 4F2ME 5MEOB 4ZUWB 5F6IB 2ZYIA 3QPEA 5DLLA 4PJ8D 2XHNA 3T81A 1BSLA 3QE5A 4FFZL 2OS7A 4PCNA 1S2EA 4LCWE 5LUMA 1GS8A 1LLWA 4ACPA 3LHAA 4Z1BA 2X40A 4PJBB 4RETB 4XNUH 5HQLA 3DX3A 4I89A 3JQOB 4RLDA 4M5PA 4MKMA 5LNSA 1D5MA 2EEXA 2XTJE 5I15H 1TZ7A 3H4XA 2YBVA 3NPVA 1GA2A 4TMBA 4ZUTB 1ZAIA 1A0QH 3M8OH 3HNSH 2W61A 4YVUA 3BANA 1JZEA 3WLLA 3CVHH 1QNIA 2FDMA 2Z93B 1TPEA 2ITDB 3SDDC 3SE9L 3ZDYB 1M7JA 1PAZA 1MUCA 5E0KA 2YLKA 1EZVY 3A6BH 1VYRA 4V1YA 2P5WB 1HJXA 3TWBA 1U8IB 2EXYC 4O02A 4RRPM 5EA0H 4JN7A 2P48B 4GD0A 1JZGA 3IDJA 4KK9D 3LPFA 4G7EB 1IM3D 1GMEA 4A3RA 1PXGA 3BVNB 1PSKH 4DM1A 3GVRA 1FHDA 3LTSA 4PGBA 4ERSL 1NP2A 4YVNA 4HCHA 2HX9A 3A3YB 3CLFL 1BZOA 4K8RC 4K9JA 2E4TA 1ES0B 4R97B 5IV2A 1IFGA 3U3HA 1XLMA 1YXYA 4R3SA 4LMQI 5IW1B 1NFGA 3LY0A 4NJ9L 3PQYA 1I9EA 2OR8A 3X13B 2A7PA 4RRPG 3DRQA 1TFPA 4LSQL 4OSUH 1JZJA 4EXAA 3OC5A 4GT7A 5F7WC 1QD0A 1MCDA 2FJFB 1G5AA 2Y25A 4YSQA 1NQKA 1NTDA 3BRGC 3G6DL 2AJXL 4PM1A 1A1NB 1QMLA 3FQXA 4E2BA 2NLJB 3TL5A 3MA8A 2CMRL 3JWDH 3TEUA 4BIKA 4NYYA 4EXQA 1X5AA 1OAXH 1SO3A 3SFWA 3N5AA 3RKDD 1DWFM 2CIKA 3RDTD 4XPAH 4JTGA 5IW3A 4WV1B 3GHPA 4GSDH 4Z76B 5KYXB 4WO4D 3V0HA 4F7MA 4KHTH 4HJEA 3OG3A 4V27A 5FJJA 3EOEA 3OAZK 5EO9A 5JNYB 1NPNA 3QH3A 1IT9H 4PVLA 4F9JA 2JQMA 4NVTA 2OZ4A 4WWOA 3WQVA 1H09A 1S3TC 2QGCA 4JO1L 5FYKH 4RESB 1YSOA 3G3LA 1HGWA 3C0QA 4HBKA 3TYZA 5JVLA 1ZFJA 5H35A 1S7XB 5KSWA 3P2TA 2BC4A 4LKXB 3CWHA 4TVPE 4P8VA 5HWNA 1FY6A 3TYBA 5IR1A 3C2SA 3TBSB 3ES7A 4FO4A 4K8EA 1ICSA 4NRZA 2GJJA 3PAOA 1UB6A 4IUGA 3W2NA 4F8TA 1QW9A 4TNVK 2AFNA 1J1OL 2NTFA 3DHPA 4TM9A 1VYSX 1HILB 1VF5C 3THML 1XDMA 3IUIA 3BN3B 2SODB 3RLGA 2C9VA 4L1DA 1JPSL 4K8RH 4EI5A 3KS6A 4PJBF 4XCNB 4YK4C 2IPKA 2A3TA 2E0PA 3WFEL 1IXNA 2XH7A 3RTQA 5BZZA 1NCHA 3PL6B 3V8OA 3EB2A 3Q5TA 3MZNA 3E6FA 4AEOA 1Q1PA 2B4CL 2EAEA 3C8KA 4FOUA 4PODA 4QP0A 3K91A 2AK4D 1CFQA 4HFUL 3RWHB 3PZ9A 4LEBA 3E6HA 3TYFB 3V55A 1XGQB 5IOBA 9CGTA 3GYRA 4UILL 2VDNB 4UB0L 5DEFB 4A2DA 2ICSA 4FDWA 4BK4A 4MXQC 4KXDA 4F7TB 1ZT4A 4K3JH 1BXXA 5AYZA 5IMOB 3NXFA 4W6YB 1R9ZA 4HG4J 2GAZB 1IM9A 1R3IL 4PMFA 2CZDA 5LHFA 3W11C 4Z2LA 1CZ8H 2OODA 4Q7DA 4GJJA 1HEZA 1THCA 1TTJA 2OBGA 1JMXA 1TB3A 4ZQCA 2E28A 3NPUA 4IMFA 1ZCRA 3WQ6A 3E2RA 2CRZA 4FSAA 4M6PA 1Y1UA 3GSMA 3C87A 1JCJA 1OC7A 4GRWB 5T1DH 1C5DA 3AFLA 4U28A 4M3JA 4YE4L 5DFVD 3WJSA 2FWUA 1KY6A 2A9ML 2HFEA 1F86A 3FU6A 3NJNA 2ZIDA 5FOBA 4N87A 3NPSC 4O5LL 3FB5A 5AOMA 1HO4A 1RCQA 3GIQA 1VHPA 2R9HD 3FAWA 4DGIH 2YOAA 2NW2A 3MRHA 4IQHA 4U05A 2ESVA 5G2NA 1U1HA 3QORC 2VRKA 5CAKA 4X0KB 1DIDA 3FCUB 1S2UA 5EC2A 1U41A 4B9YA 3SB3A 3NL6A 1ZDQA 3KPOA 1BQLH 5D1QB 3BGMA 1TE6A 3WD2A 2E8ZA 4HCRA 4X9GA 4M8VA 3WDIA 3OKNB 5IDZA 1OIOA 1WK0A 1Z0MA 5GRJH 1BEYL 2EEDA 1HQ4A 3BP7A 4XD3A 1I1AB 3VDGA 4J6IA 1WOAA 3I7RA 2E47A 4HKXB 5TGBB 1XR9B 1EVTC 3QEUA 1T6MA 2Y5EA 3BC9A 2GSMB 2Y5SA 1E5JA 3CAKA 4C56A 4IH3A 4HZ7A 3OZ9L 1NJ9A 4E0RB 4K3HA 1ID2A 2XX0A 2O93L 1MDLA 3FT2B 1ZPTA 1GOGA 1YMMD 2CKBB 3CPLB 5D6DC 3EYOB 5F7AA 1T5KA 3BDXA 4ZFGL 3SIMA 3WD5L 5JHBA 1NBQA 2XC8A 4NZRL 3UCDA 5F97E 2BW5A 2G4GA 2OPJA 2VN3A 5FF4A 3UBPC 4MNHA 3OOQA 4NJAL 5LGYA 1BKSA 4DN3L 4PP1D 2GK0B 5MKGB 4YPJA 3EDJA 4BJLA 3MT1A 1WZAA 5LWYH 5I1LA 3FQNB 2C16A 1HCVA 5G4OA 3CMOL 1B2WH 3G5ZA 3ML9A 2CLLA 4Y4KC 3L2IA 4HUWB 4Z5RA 4R88A 3GG8A 1GGCH 3DETD 2PF6A 5MENE 3UR2A 2YD8A 1DQJB 1W0YT 4AJ0A 2X5PA 3HJ0A 2WXNA 3ZRSA 1I9RH 3RFZB 3GMPA 4ABQA 4PBFA 1KOAA 3X3GL 5M17A 3SCVA 2D7MA 2W79A 4S10A 4M8UA 2Q71A 4K94L 4NUQA 3ZE2F 2VQ1B 5J8OA 2WMFA 1W9BM 3WGVB 1FCVA 3UWUA 3VXUB 1PKLA 1NEZG 3DIVA 3OKKB 4NZJA 3ZTDC 4HHLA 3W6YA 1QHOA 4OI8A 1K4DB 3NGBB 1VFTA 2VW7A 4GKOA 1IU1A 1PZDA 4DZ8B 4J5VA 1E71M 1OX6A 1TCMA 5F4SA 1DQVA 3GDMA 2FO8A 3GUTB 3TJHC 4Z7VB 3UXKA 4ZTXA 1TYGA 3BW9B 3C60A 3QJUB 2IO5A 4KZ0A 3ZTNH 2AEOA 3U4EB 1EEXA 1AR1B 2DH2A 1R2RA 3PWJB 2FSEA 3GU2A 3LCWA 2NLIA 2HMCA 4FMKA 3KTXA 2ICEB 4O1EA 3EEZA 3ZDXF 4LDCA 4G7YH 2AMXA 2P5PA 4M7LT 3MRNA 4LBUA 1B30A 4MXVE 5JYMA 4H01A 3TC3A 2WTPA 4OUUA 1HUVA 2I5QA 3LV6A 1QFWH 4H26A 5JQ9A 1XX9C 4PJBA 3U82B 4DFIA 1Z42A 4R5XA 3VQLA 1KLUA 1EEZA 3GI9H 4YUEH 3NYDA 5DS8B 3XINA 1YEJH 1DE5A 1WKFA 4IBVA 2PD9A 4DGYH 3CMGA 5CD3A 1Y6NR 2WMPB 1PDZA 1EYWA 5F2GA 5FO7B 3GR8A 4AIUA 1NOLA 4FFWD 3B2XA 2UZIL 1SEQL 3N3EA 4NNYB 4NO0A 5E9AA 3SDCC 3T1FB 3MBFA 3IAPA 4ATLA 1PCXA 4WSKA 1U8NB 1P0DA 1QBML 4Z7UA 5JOFA 3EGSB 4MNQE 1RULH 2FGBA 2X0UA 4GAYB 3RUGA 3EJTA 4O28A 1ZB5A 5FM5O 4P8WA 2GBAA 5CP7B 1KB9K 3BQ5A 4GIEA 4WJXA 1DQQA 5T26A 4A7GA 3C5XA 4AVIA 1XMWA 3U4FA 3F01A 3NZHH 3ZE2E 5KZCD 3EOUA 2ALWA 3DJZA 4JRFA 4N9GB 4H25B 4P3CL 2Z0BA 1SRDA 2FH8A 4BZ2L 5I6LA 4J2XA 4HIJA 4YBQD 3FFSA 4AC4A 4NBXB 3K7UA 2Q01A 3EF4A 4UOQA 2F6XA 4X2PA 1W91A 4KKQA 3O2VH 3TNNA 3DDGA 3UTZA 4DEPB 1E6ZA 4OCRL 4M00A 2A7NA 2X1OA 2B08A 3SDAA 5IF0A 1M05B 2CUAA 2WIIA 3HAEH 3FUNA 4A63A 3UJTH 2C91A 5K1NA 1T7VA 1B2WL 1PLAA 5D1QD 3H56A 3D39B 2CHXA 2O72A 2Y7LA 3MGAA 4U1GC 5ALBH 4DGVH 3JV5A 1U21A 1H3VA 1UXLA 3KS0J 3QYMA 3Q5OA 3VXRA 4TQEH 1EF3A 1JN6B 2IQAB 3JWNH 1UWEH 5AKTA 3KOZA 3WHE1 4MXWH 3W57A 2ZKYA 1HJUA 5JOPD 3O6LH 2F1BA 3LSBA 1D8CA 1WCGA 3OXRA 4YSRA 4HCRL 1S6NA 4K9EL 2QQKL 3L5WA 4GRLB 4EKJA 3DI3B 2V82A 3DX8A 3FSTA 1MDRA 2SEBA 1I1FB 2GSGA 1F2XK 1MHHA 1AXTL 1NUFA 1C08A 1OGAD 3ORJA 4P5TB 5E2WL 2XXGA 3UZQA 4IOFC 2AJUL 2DLEA 4IG2A 1S3KH 4CQBA 4XCCL 1UOWA 4YN3A 3T8VA 3KYKH 4UT6A 5FO2A 2FECI 5K9KA 4B41A 3QUYC 4XC3L 2AXJA 4G5DA 4P7QA 4AHQA 2WVVA 4UTIA 1FF5A 5HHQA 2BP0A 3HMXH 4LASL 3I6KA 2PMQA 4KKLD 4KS0A 2C3VA 2QVFB 5K1VA 1W0MA 4S2BA 3WF3A 3USZA 3H21A 3QEHA 1TX0A 3VIFA 5MP6H 3C6SA 1A6AA 4XP5H 4S11A 2H3XC 2NTFB 1FCGA 1EK3A 2NSQA 4M61A 1P48A 4LSSL 4JZJB 4N6RB 1OSPL 4EXBA 2C9AA 2JKEA 4WFGE 1KT2B 4X2UA 2UY6B 1UM4H 5AYUH 5E56A 3MI2A 3VGEA 4H4NA 3GBDA 5IK3A 4L4PA 5CCHE 2AJZB 3W00A 1KJ2H 1MH5A 1X5XA 4NCC1 3HPXA 2P8MA 3TW6A 1J0HA 1UC6A 4MX7A 5BRZB 4DWHA 1CQYA 1TEYA 2FZMA 3H22A 1E5BA 1ASPA 1JFQH 1MCPH 3NTYA 2RB8A 4H88H 2G9HB 3N91A 3WSQL 3S3DB 4B9IA 5FR3A 1LCOA 1TIUA 1ZSHA 2QLYA 3CHSA 4BYHA 8FABA 1VHCA 2BSRB 4OZIB 3B9NA 1A0CA 3VMOA 3DVNB 4JDEB 4MIMA 3SBFA 5IB2B 3LPGA 1JRHI 2OK0H 3BYYA 1IEIA 1X5FA 5D7IE 2EG7A 3IEBA 3N3TA 5E2TL 2H1PH 3BH8B 1FWNA 1DE4B 4KJPC 3NDYA 2WC7A 3GIVA 3D0VB 4X83A 3V95A 2XDHA 2H6UA 5HI4C 4FKEA 3LNMA 3K72B 2D3VA 32C2A 3FTSA 1TU2B 2Z65C 4UU9A 4XT1C 3BVNA 3ZT5A 5KBKA 5LVEA 1BYBA 4H8UA 1F8IA 3FCPA 2CDEA 5AZEL 1JZ5A 1A50A 1UUSA 4CJ1A 2ZUNA 1HVQA 2GUUA 4CD8A 5I1EL 4CAGA 1QSZA 4QI3A 4AQEA 2W1NA 3LIZA 3OLGA 4TQIA 1PEWA 1RK1B 1LM1A 2FLMA 2OXHB 3U2OA 3VILA 4NQTA 3NZ8A 2GUBA 5F1OB 2BP8B 5JMOC 5CNHA 4FXGA 4OFKA 2KX9A 3VFSA 1H4PA 3GUTA 5AW7B 1PB0A 2EDYA 2V3DA 4QHKJ 1AZ2A 4XK2A 4ZOBA 4IFRA 4R26L 3M45A 2WMHA 2BXZA 3XIMA 2XA8L 2WZ6A 1NFKA 1X6LA 4DGVL 1DWAM 4RGNE 3LZOA 1S78D 2OEJA 2O1AA 5EWIH 4OZ4A 5HVHC 2HRLA 1AMKA 1JPTL 1YYML 3EH2A 2WHLA 3OPZH 7TIMA 3NEXA 4K55A 1QABA 2PPDA 3C2VA 2E77A 2AL2A 4ORGB 2Q86A 4XNMB 4ZTOL 3NSMA 3RAOA 5KVFH 4MNQD 4KI5F 1MFCH 3ESUF 4X9HA 2IH1B 1AK5A 4MD5A 1FNSH 3EHBB 2F7QA 2W0FA 3CFEB 2H2PC 3HG2A 3M07A 1UWXK 1THFD 1VP5A 3UF9A 3NIDB 4K3EL 4AUYA 4DF0A 1A6WH 4CVZB 1OGBA 4R96A 4G8IB 1UR8A 3CIWA 1E4XI 3BIKB 4OIIH 3SY0A 2H6RA 1P1ZB 1IJNA 2TSYA 1RZ8A 5D7SL 3MU7A 3L9YA 4KRPD 3SKNA 4P9HH 2VXSL 4ALAL 1OSEA 3QQ0A 3OR6A 4L4VA 4Q0XH 3DROA 4MTMA 5EBWB 3UH8A 3UO8B 4Z3EA 5GISL 1DVFB 3FN9A 1LOQA 4FNTA 3W3BA 3TZVB 1VJZA 1RUAL 3IPEA 1FYTD 4C5YA 2ATKA 2HWZH 5TDOA 3NPXA 2Z91B 3VG0L 4R0LA 4X4XA 3VMPA 5BV7H 1SFLA 1S4IA 1VPQA 7PTDA 3CPUA 4WWPA 4J3OH 3BPOB 1A7RH 5EV7A 5F9JB 5KS9F 3PBWA 4JYDA 1ZTMA 1I9JH 2YXWA 3SDCB 1MFBL 2P8PA 2DDQH 3K80A 3MCLH 5DD0L 1MI5D 2ZXQA 5JIPA 3C3UA 3QBUA 4P5TD 4ECLA 3TH4T 3WFHB 2YGNA 3LHPL 5DK0B 3PBYA 1LGVA 4LP5A 3BVDB 3HKZA 5C7ZA 1UB3A 4HSAC 1CTOA 3AVEA 4GKSB 1KTRL 4N9EA 3ONBA 5B39A 3VFNB 2XJLA 1OY0A 1OANA 3ZJ7A 1YUHA 5FJRA 1RAMA 4Y4FD 2Z1PA 4Y4HA 4FNUA 2K7PA 4XBGA 1YEDB 1YXDA 2J6EA 1MJ8L 2IF7A 4XTDA 3WMCA 2Y06L 3QRHA 1XPGA 4AX6A 1C5CL 5TE4L 1GKOA 1GS6X 4JQIH 4ONHB 3SQOL 4OBSA 5GS0L 1ML1A 2DEPA 1ZT1B 4XBJA 1W3NA 5ABFA 2PYED 3HE6D 4YYCA 1NCTA 2A0NA 3II1A 3B6SA 4RFEB 5KVEH 1WXYA 4RE4A 1D2KA 3HI5L 2B4GA 2ZX8A 4IJRA 2EIJB 2JELH 1ZP4A 4DEPC 2EDBA 2XN9E 1VJIA 2Y7QB 3GJEB 4JMXA 4WTWA 3LKQB 5C08E 2J9YA 4JN1L 5EMKA 3LQZB 5CD3B 12E8L 4WWKD 3UBXG 3GIZH 1NWPA 3D0AA 3O3AA 1V7ML 2K0RA 4GIYA 3RWJA 1DQKA 5HI5D 3VI3B 4JFPA 1P9MC 1DUYB 3KRBA 3PZTA 4GUFA 2KLRA 5DD3L 3SR7A 1F1GA 1PKQB 3MCKA 3HN5A 4LVGA 3VXOA 2UZYA 4B3KA 1BGXH 5LCVL 3RQ3A 3LENA 1CFTB 4HC1A 3FHEA 5JMRA 4F20A 4O1DA 3EA3A 3CLFH 3EIFA 4LGRB 5D7JD 3WU1A 1BTMA 3DUUB 2ED9A 1H7PA 3PGFH 1FL3A 5AZ2H 5SWSE 2YDRA 3M41A 3PFRA 3STFA 3JV4A 3AWOA 2V0AA 5C07D 4Q7NA 4RZCA 4N2LA 5E4IA 3PJXA 4K68A 4BFFA 4FXKB 3PXHA 4Q97A 1Y7VA 2J78A 4H8NA 1DFXA 5H8DA 2W0LA 3ZTEA 5AWNL 2Y22A 3IU4H 2YZRA 1CR9L 1V3KA 4PY8I 4Z7WF 4U4IA 4ZPVB 1KY7A 1ZLUH 3CC5A 3X1BA 4DFHA 5JYLA 3WTVA 3HAEB 3NJJA 5J9PA 1TJHH 2R14A 5I6OA 5C0BE 4DIAA 3UZXA 4PUNA 3EH4B 4HXBL 4LEXH 2CLKA 2NY1B 3QZWG 2IV9A 2MJWA 4OZFH 4HHPA 4HNLA 4F1SA 5GSRB 5C0ND 4AY7A 1DQWA 3RVVC 1BVLA 3G18A 3L08A 4YH6A 3HGOA 3E3QC 5TFSH 3N4AA 3W1MA 3G08A 4EOWH 1A8ZA 4F9PC 1WYIA 1E3XA 3CQPA 2V5SA 4OTXL 1N0XH 1NP0A 1II4E 3GMLB 3TN0B 5HPOA 4G80A 2X9ZA 2NVAA 3QUZA 3JBG7 5AVYB 2JE8A 2OXHA 1PFCA 4ABVA 3X1GA 1JWUA 1VRXA 2V7HB 3BW2A 3U2SB 6FABH 3CHEA 2YXVA 4RX4D 5J6HA 1SUJA 1DJXA 3ARYA 4WU7A 2EPLX 3FMGL 4QXGH 1LWRA 2AXHA 2IWEA 4X99A 4YE0A 3E0VA 2AEQH 3A67L 4GW4A 1S9XB 2R69A 3DTUB 4IHBA 3ARRA 1LTXA 4OCRH 1IEHA 1HJSA 1LG2A 2W38A 2BGSA 1OM9A 3Q8EA 5D2LA 3S8WA 5BUAA 3VA2C 1FPTH 4A7GF 3LEPA 3ZO0A 3R11A 1OTSC 1SSGA 2IXUA 3VNJA 1IEBA 1LNUA 2WLIB 3PP4L 2N56A 5DXXA 2UX6A 4FKKA 3CVHA 4WR3A 2MNJB 1G0DA 3NVQA 3PFMA 1CVRA 2BVPA 1QO5A 2PYEB 3WIJA 2FD6L 2PCFA 3VO0A 1UR1A 3FS9A 1UW9A 3H2MA 4J3WA 3V0FA 2Z7ZA 1ZA3B 3QDME 3U1SH 2D9CA 4ENED 3JZUA 3CK5A 1KJVA 1NANH 1R75A 3JUYA 2CWNA 2HWGA 1NUGA 3SCMA 1BLIA 1P1ZA 1T22A 1EZUA 1VGKA 4UILH 2EVJA 4D0CB 1BG4A 1K8DB 2YPLD 3S3CB 3BSHA 3OWEA 1FVPA 3MUY1 1V7YA 2W95A 1JI1A 2C0AA 3RX7A 4M6ML 5EBWA 1Z8AA 2M26A 3OQRA 1KJ2A 4PJGB 4R8WL 2XIOA 2X10A 2TPSA 3VU1A 5EBAA 5FESA 5AW8B 4XMKL 3D12B 5CAYB 2J7DA 5CJOL 4YVXA 3KBPA 1WZ1L 2X38A 3PUCA 3O81A 5EO0B 3VXUE 4YS4A 2JB6B 4H5SA 5B4MC 2YXXA 3SB0A 4PGCB 4R2GB 1AJ7H 4YBLC 1PYWB 4XN8A 5GRXG 1NCWH 4CNIA 1O1HA 3GKAA 1IAIL 3PUDA 5AW1B 4EK7A 3KLSA 4RPQA 2GJ6E 1ZHLA 2AITA 2ZNWA 3U2JA 4E42B 3BQ6A 2YK1H 2IPFA 1MJUL 2YX0A 4B60A 2WC4A 1AIFB 2GFBA 2BK8A 3MMEA 2G9KA 5CJXC 1H41A 3MO4A 3TO4B 3KP0A 1SSDA 2VQ1A 2F38A 2K3TA 2Y3AA 5C0AA 3DRTA 1AZCA 5JXED 1S2VA 3KR3H 3M1OA 4CKVX 4OZFA 4GMSH 4FXGB 1W3TA 5DD5L 4JTIA 2P28B 3Q1EA 4BZ1A 3IVUA 3GZKA 2FWOA 2J2ZA 3QRGH 3Q13A 2J21A 3MODH 3SPHA 1J7VR 2N4IA 2R29H 1QPKA 4LNVA 1FZJB 3R7RA 2GVGA 3LQGA 4NZ3A 1O7SA 2CGYA 1EERB 2J8TA 3SM0A 1QKZH 5AVQB 2L0DA 4OFYA 1ZZMA 4FNSA 3AU0A 2IWFA 1LE9B 2UY5A 3MMTA 1QNZL 2F15A 3U9UB 1EQCA 3HG5A 3L17A 3U0PB 3QC3A 1K9EA 4C7DA 5FYLH 5BO1L 1W72A 2C14A 2ZUYA 5FGRA 2HZHA 4A7UA 4J27A 4YMPA 2YW4A 4WUUB 2ZC1A 3OVRA 3SSJA 1ETJA 1YMMB 2ZKWA 3LN5A 4HWBL 4HWEH 2O61A 3EWXA 3GKFA 2A73A 4UWMA 2GQ9A 4ANVA 5ABDE 4MZ1A 2J24A 4MFEA 3WCZA 4MJ6A 1BZ9A 3BZ5A 5E6UB 2D24A 5E5MB 1HXJA 3EKLA 3FQWB 1YLVA 4O51B 4P46B 2X4RA 5JOFB 3IRCA 4PG9B 4D9QE 3PL6C 3F2DA 4IGNA 1E5UI 3BO8A 4LVEA 2FZ3A 3STPA 5BOEA 4FQXA 4HUXA 3DBSA 5K9OA 4JLRB 1YN7A 4HZLA 3FUFA 2ZQ0A 3U8GA 3UADA 2VQTA 5GZOA 2VJ0A 3Q8FA 5J13C 3KNBB 1ICTA 3O8XB 4PRPA 1C5BH 3P62A 5DJYA 4M93B 3RF9A 1E6SM 1KEML 1B3ZA 3DN5A 4ZXBB 2A7BA 1QTYT 1AO7D 3P4NA 3W85A 1OYCA 4OIBA 4X5WA 4AENA 1RH8A 1KIRA 1IM9D 1T0MB 1UP2A 2YB4A 3JV6B