2WVUA

Crystal structure of a michaelis complex of alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-l-fucose
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
437
structure length
437
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 159
structure length 437
sequence length 437
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvuA01
1HX0A 1C7SA 1E9LA 2WZHA 3HU7A 5GNXA 1HIZA 1V02E 1KXQA 1BG4A 2CBUA 4CVWA 3WMSA 4GINA 1GORA 4QLJA 5A6AA 1VEOA 1QI4A 2WVSA 4AW7A 1XSKA 4HOWA 4HZ8A 1R8LA 2ZE0A 2UY2A 4W5UA 4J3VA 2J77A 2XIBA 5CPSA 3VTRA 1VFUA 4U5IA 1Q6GA 3CUFA 1I1WA 4GO9A 2WHMA 2BXZA 1BYDA 3VDAA 4N42A 1B3XA 1FOBA 2YBTA 1XD1A 1GQKA 3VIGA 1D2KA 1BHGA 3UR8A 3MUZ1 1BQCA 4JKMA 3JUGA 4UOQA 1W9DM 2WLZA 1JDCA 4PMDA 2BS9A 4AIOA 4MNMA 4PMZA 4AYGA 7TAAA 4UNIA 2Y8KA 3S2CA 1V0MA 2X05A 4EK7A 4ZEPA 1G5AA 4Z2JA 4GQQA 5D9NA 1CZ1A 2XIIA 3AHZA 1GNXA 3QOKA 1E6QM 1PAMA 4GZEA 5HPCA 5I77A 1V0NA 1EDTA 1W91A 2ZUNA 3CZNA 4MTVA 2J7GA 2VUYA 5AC4A 2QLYA 2XYLA 3CUHA 3BVUA 1M04A 5TD4A 4NZFA 4W7UA 3VVGA 5A2AA 4W8AA 4QAWA 2WK2A 1HWWA 1SR0A 3A4XA 3HN3A 2OWCA 3WDQA 1W3KA 2J74A 2NT0A 1QPKA 2VZUA 1E40A 2Y5EA 3VX0A 1V02A 4AD2A 2WC7A 3W26A 3PZOA 3SUTA 1E4IA 2VO5A 3WEMA 1GHSA 1OIMA 3MUY1 2GJXB 1B3WA 3CLWA 3ZT7A 4R5EA 2PC8A 3VDBA 1E55A 4FMVA 2WANA 5A6BD 3EJSA 1LG2A 3I3EA 3BUIA 2D73A 4AZIA 2ZOXA 4F66A 1J11A 2BY1A 1JD9A 4QCEA 3WBEA 4AD1A 3A6OA 1KQYA 2J79A 2XVNA 2YL6A 5FCZA 1HKJA 4Z2KA 3WH5A 1OT2A 3PZIA 3AOFA 3ARVA 2D22A 5A6LA 3EYPA 1UASA 3AROA 3W6MA 2WMIA 4A3HA 4B3KA 5JIWA 3BLPX 4PCSA 3AIWA 1H2JA 4AD4A 4WKFA 4DO6A 2EEXA 1U2YA 3SUUA 1N82A 4JZ5A 1EDGA 2ZXAA 1C8YA 3B9EA 2O9PA 2DGAA 1DTUA 1NOFA 1HVQA 2DQXA 4R27A 3PZUA 1Y7VA 1DWJM 1J0KA 3WD3A 3M6DA 1V3KA 2DH3A 2YA1A 2XVKA 2WW5A 3OLEA 4ZENA 4Y7EA 5C70A 5HPOA 3MS8A 4UOJA 1H1NA 4JIEA 2X0HA 3VMPA 4FF5A 4UR9A 4MJ4A 2V3GA 3DX4A 1W9XA 1E0WA 3AMCA 3HG4A 4CCEA 2C7FA 4ZXLA 3SCOA 3OLGA 4V2XA 3AIUA 1GOMA 3DDGA 3RCNA 2XHYA 2Z1KA 2YL5A 3WD1A 2CESA 2WSKA 3IAQA 1HJVA 4LX4A 2F7QA 3B9AA 4UCFA 3SUSA 1MWOA 3RILA 3MMUA 2CBJA 1HP4A 2GJPA 1JYVA 2IXUA 4LPCA 1JD7A 3EBVA 4PBGA 3SEPA 5HBFA 3AXHA 3BAIA 3TTYA 1E6ZA 1EIBA 2JEQA 3WDPP 3F5LA 3CHCA 1E15A 2WMGA 1MXDA 1E72M 4JFUA 2EPNA 5ABHA 3WY2A 3H54A 1G1YA 1RD6A 3POHA 4C7DA 2WAGA 2O9TA 4MJ2A 4FK9A 3CZSA 4PTXA 4S3KA 3MV11 2MANA 3N17A 3B9DA 2UY3A 2CITA 3PZMA 1DWHM 4OGZA 1WB0A 3LPFA 3WL0A 3I3DA 1MVYA 4W87A 3AXIA 1CXIA 4XV0A 3IJ9A 1UD3A 3L2LA 2F1BA 1CBGA 5BYWA 5M5DA 1CIUA 1QBBA 2VR5A 3M07A 5BRQA 1W9PA 2G4FA 1R47A 1GJUA 5DT7A 2WXDM 3MANA 3MKKA 1CGYA 1WZKA 4EAMA 4W88A 3WD0A 3OGRA 1E4NA 2V3FA 3AMKA 8CGTA 1CEOA 4HMCA 3EMCA 1PIGA 1KTBA 1PEZA 3CPUA 1QI2A 2DDXA 3HG2A 4K68A 2EPLX 4F79A 1QBAA 3D5HA 5IHSA 4JCLA 3BUDA 1Q6DA 1ISVA 1W2VA 4OBRA 3SIMA 5A6KA 3BVTA 4MNKA 2O9OA 2A3CA 2Q8XA 2JALA 5ABFA 4GO8A 2CHOA 1G0CA 1C93A 3ARRA 3NSMA 3ZQ9A 3ARTA 2ZX7A 1HJSA 3GH4A 1UOKA 2X2HA 2EADA 2JF7A 5CXPA 4CVUA 2WNWA 2J25A 1EDQA 4IM4A 3VO0A 3AFBA 2ZUSA 3WQ6A 1R85A 1UR4A 1JL8A 1BFNA 4AD3A 5A8OA 1TE1A 4OBSA 3WD4A 5E0FA 3VGHA 1Q6CA 4AMXA 1E6SM 1BVNP 1H3GA 3WELA 4E2OA 5A8NA 4KRTA 1HF6A 3LPPA 1H09A 3T2PA 2WCGA 1LL6A 2JFEX 2VZTA 1PX8A 3WKZA 1E0VA 2WSPA 3CZLA 3A21A 1KGXA 4W89A 4P8UA 1CGTA 1XCWA 1J0IA 3CZKA 4S3JA 3L4UA 4P7OA 4Z2IA 3W38A 4HZ7A 1QNSA 2ZUUA 1CYGA 5I3DA 3PZ9A 3L4VA 3TTSA 4UFJA 4D6CA 3IJ8A 2V3DA 2WZEA 3L4ZA 2OW7A 1VJZA 2J7EA 1BTCA 2AMGA 3OBAA 3VMNA 1HNYA 3FXYA 1E3ZA 3BAYA 3FN9A 2E9BA 3F5JA 2EJ1A 1UZ4A 1LQ0A 1DWFM 1PBGA 1RH9A 4D6EA 1MQQA 2EAEA 1W9UA 1B2YA 4C7FA 2FHFA 4CN6A 1EQCA 2VI0A 3IK2A 3WH8A 4Z2GA 4DWSD 4PTVA 4JFVA 3VINA 1JNEA 3N1AA 2Z1SA 5A6BA 2WKLA 3AISA 4M81A 3LXCA 4PSPA 1JYXA 3OB8A 1XH1A 3HG3A 3ZR5A 2QF8A 2BY2A 1OSEA 3VILA 1OGGA 4JL1A 1E6RA 3VDCA 2VRQA 3LRKA 1GQLA 1MXGA 1QNPA 4H8UA 4CCDA 3AQUA 3TONA 2DSUA 4BQ5A 2RGLA 4JKLA 1EO5A 4MB3A 2WHLA 2OYMA 3ARYA 4J3XA 2O9RA 3K1DA 4MPKA 5E6ZA 1SYTA 5E9AA 4F9DA 1JYWA 1GCYA 1R86A 7CGTA 5LA0A 2OWXA 5A8PA 4GIAA 2W62A 3WH6A 4LYQA 1TFVA 4FNTA 4MB4A 1OINA 3CZ8A 3T09A 1CLXA 5EBAA 5GNZA 3PTQA 3O2LA 3WQ4A 4CN1A 3DHPA 4ATLA 3BVVA 1JF5A 3BAXA 1XC6A 3AIEA 6A3HA 2GUYA 4GPNA 1W9VA 4U3CA 1KR1A 3QOMA 2PBOA 4ZE5A 3ALGA 3W53A 5DF0A 1NWUA 1FHLA 1KFWA 4N0RA 3RMEA 4P8XA 3I3BA 1DWAM 4MNLA 1R46A 2JE8A 1E70M 1LF1A 5CGTA 1EOKA 5HOSA 2DH2A 2WVTA 2G3JA 2VX6A 2FE0A 4P7NA 4TX6A 4RL3A 4CU8A 5KZ6A 4D6IA 1CENA 1JNDA 1ISXA 1TQSA 3VUPA 3WY3A 4QFUA 1FFRA 3VIMA 1MW2A 3W28A 3FHQA 3DX0A 2WM0A 3RM9A 1W3HA 4IISA 2WMHA 1K9EA 1TUXA 1VIWA 2YLAA 3LMYA 1SMAA 1BPLB 4JFSA 3GXDA 1Z32X 4GKLA 4CGTA 2J78A 2J47A 2J8FA 1H5VA 1AQHA 4QDMA 3WQVA 2TAAA 3U7VA 2J7CA 2DT3A 3WF4A 5AYBA 1B31A 3IJ7A 2VR4A 4UQ9A 5D8WA 1LWHA 1NWSA 2CEQA 3LPGA 3SUVA 2XN2A 2A3EA 4E4PA 3AYSA 1LL7A 1AMYA 1IV8A 3AHYA 3CUIA 1PZ3A 4DUVA 1J0JA 1CXLA 4W85A 4TX8A 2WMIB 5JBFA 3VIOA 1WDQA 1QW9A 3RO8A 2ZUMA 5CJ5A 1O7AA 1E5JA 2PWHA 3HMCA 1WZAA 3F4VA 1B0IA 3QGVA 3A4WA 4HU8A 7A3HA 3CV5A 1TA3A 4U2ZA 3OIHA 4J28A 4IUGA 2GDUA 3SCQA 1KGWA 2IGTA 1IT0A 2W67A 1UR2A 1UR9A 1NQ6A 1MW3A 5BWFA 1OGSA 3VKKA 1C91A 2J7HA 3VM5A 2OSXA 1B3YA 1QVBA 4RE3A 1YHTA 3KL0A 5EB8A 3U57A 4ACZA 3WY1A 2J75A 5KEZA 2D2OA 5JUVA 1WDPA 4DUWA 3CHFA 3PZNA 3DYOA 5LYRA 1JI1A 1PPIA 4FNPA 4D6HA 4WK9A 1NM9A 1J01A 3A24A 3AIVA 3VD5A 2VVSA 1XRVA 1ZBVA 2ZXQA 5GQBA 2D20A 1BSIA 1HXKA 2XGIA 3NSNA 1JDAA 1UR8A 2OW6A 3WBAA 1H0IA 1JZ3A 1V6YA 3H53A 3ZIZA 2E8YA 1C3FA 4QLKA 2EPOA 1BYBA 3W82A 1MW0A 5I79A 4AYSA 3OGSA 1R7OA 5I2UA 1JG9A 2B31A 1UKTA 3DYPA 2QV4A 2F7PA 2PI6A 3SCTA 1KB3A 2VQUA 4H8HA 4KMQA 2FHBA 3RM4A 3WY4A 2F1AA 1GOWA 1NOUA 1EA9C 4UZUA 4D1JA 1CGWA 1EXPA 4PCTA 4M29A 2BY3A 5EFFA 4UQEA 1WO2A 3WF1A 3BC9A 1QHPA 4FNQA 3WSUA 1WZMA 3BGAA 5ECUA 2VURA 1QNQA 2NW0A 3WH7A 2EQDA 4E8DA 2PBGA 1KR0A 4XX6A 3VIPA 6CGTA 2WC3A 2ZWZA 3O6AA 1OT1A 3D4YA 3W27A 3W25A 1JI2A 2V38A 2VX7A 2CKSA 4GI9A 1VB9A 1ZJBA 2BFGA 2XM2A 3PZQA 4ZFMA 1DP0A 4DWSA 1V08A 2Y2WA 4D6FA 1UD6A 1QI0A 4D71A 1E6NA 3AYRA 2ZX5A 3WH9A 5CLWA 4DM1A 5ABFB 1V6UA 2DT0A 1L0PA 3LRMA 1JXKA 1OGBA 3AIQA 2X09A 1E5NA 3CMJA 3TV8A 3T0DA 5DMYA 4ML4A 4JL2A 3AMDA 4H41A 3BAKA 1VEPA 2WLYA 1CXEA 5CPQA 1C8QA 1GVYA 1K9FA 5GNYA 4DUXA 1QI3A 4U2YA 4UFHA 3VSTA 2ZUVA 3VDHA 1J0YA 1OM0A 1V3IA 2OLHA 2WCAA 1HXJA 3UG4A 2G3IA 1AVAA 1KTCA 3VD7A 2XFFA 4JAWA 3WQ5A 4AMCA 1QOXA 4UQAA 1W1TA 3GXNA 2A3AA 2VX5A 3MUIA 1J0ZA 3ARWA 2E9MA 2WMKA 3AHTA 2ZX8A 1EQPA 4M56A 3W24A 3D50A 3L4YA 5I24A 2QHAA 5A8QA 3EJQA 4TOQA 4XZWA 1KBKA 1Q6FA 5EFDA 2J4GA 3BUPA 3CUGA 1CDGA 1TVNA 2NT1A 4U5KA 2DSZA 1V03A 1FHDA 2XTKA 2EXOA 3ALFA 5BXRA 4PMXA 4NXKA 2PB1A 2XFRA 3WUFA 1U33A 2DSVA 5D9MA 1UA3A 1H11A 1OD8A 1E43A 2VZVA 2X8RA 3PHAA 1OBAA 2FDMA 3EJTA 2JIEA 1UKPA 2FYVA 5M3WA 1NARA 3BXWA 4HPHA 3SCVA 1X1NA 4V28A 4H04A 3VNYA 3DECA 4DO4A 5IHRA 5E1QA 1G9HA 2D0HA 1E56A 4HOXA 4KGJA 4FLQA 2W66A 3S6TA 2G8ZA 2CERA 3CTTA 4BQ3A 3TOPA 1XH2A 4AZHA 4MNJA 1KGUA 4IPNB 3K4AA 5CQ1A 2E8ZA 1CPUA 1JAEA 1SFSA 2E4TA 5A6MA 2BVYA 4HOZA 1MQRA 1GQIA 2XG9A 5LA1A 1E6XM 3KLKA 4UQDA 4W7WA 5A95A 1TR1A 2ZICA 2W5FA 4AMWA 5D4YA 3S5YA 1VBRA 3GZAA 3WDHA 4J3SA 1EO7A 1GHRA 2VVNA 5M03A 4UZSA 4F9JA 3AS3A 1HN1A 3N11A 2FH8A 1JGIA 3SCRA 4PMRA 4NF7A 2DT1A 3THCA 2ZX6A 1WDSA 4B15A 3WN6A 4GZIA 5DEZA 1MQPA 1FP8A 3FAWA 1UR1A 4FNUA 2OSYA 1XV8A 2WBGA 3GBDA 2GJXA 3VIHA 1GOQA 2WVVA 1M01A 4ZXOA 2V5DA 3GXTA 3BVWA 2ZX9A 3IANA 4NXSA 4XUYA 5I78A 3OGVA 1KWKA 2VX4A 3GH5A 5AC5A 3WMCA 1GUVA 4LXFA 1V0LA 1W9BM 2FGLA 1QNRA 3UR7A 5C8BB 3PTMA 1HVXA 1WNOA 4QLLA 2J7DA 2GJRA 4HU0A 2ZWYA 2J62A 3RJXA 1LL4A 1U30A 1ISYA 5CPTA 5CLTA 3KWXA 2ZXDA 4HMEA 4HTYA 2W4XA 1GOOA 4CKQA 4PMOA 3MI6A 2F61A 4D6JA 5A94A 2EABA 3GTNA 1NH6A 5A8MA 4URIA 6TAAA 1UA7A 3L2MA 1OWQA 4L4OA 2QPUA 3N12A 2W91A 1PIFA 1M53A 3AHVA 3CO4A 3H55A 1GPFA 2VTFA 3UESA 3UETA 1R33A 2WWCA 1OD0A 3QHNA 5CSYA 4H2CA 2YDQA 2X2IA 4QCFA 2YA0A 1W3JA 4UQBA 3VPLA 4QP0A 1UQYA 4M1RA 1JF6A 4RE4A 3PZTA 1CLVA 3GYCA 2DPEA 3LXAA 1E4MM 2YDSA 4MAZA 1AQ0A 1V6WA 3AI0A 1X6NA 1XYZA 3UEQA 4W8LA 2CXGA 2OWWA 3LRLA 2CBVA 1KCLA 3AZTA 1BAGA 1XH0A 1H41A 1ODUA 1CNVA 1PS3A 1V3HA 1VENA 1UD4A 3FAXA 4X0NA 4CD5A 3GXMA 1R7AA 1IZJA 5D9PA 1J10A 3D4ZA 1VFOA 2WVUA 1E73M 1ESWA 1TA3B 1UD2A 8A3HA 2UWFA 1IZKA 3VIJA 3VM7A 3AMLA 2ZUWA 4TXEA 3G6LA 3M46A 3TP4A 4CU6A 1H4PA 4YN5A 1JZ2A 1WKYA 1S46A 3WDIA 4MADA 1UKSA 3RIKA 4ACZB 2XWEA 4AEEA 1GOKA 2CCRA 2YOCA 1XD0A 1ZB5A 3RM8A 2CYGA 1ZBCA 4ATDA 1P6WA 3OZPA 2QMKA 2RGMA 4OUEA 1VF8A 1ISZA 3AS2A 2ZUTA 3TTOA 2W92A 3F5KA 1V6VA 3WUBA 3N04A 2WPGA 5CG0A 1DWIM 1EGZA 3ARUA 3FY1A 3OZOA 2WCSA 3SUWA 4D6GA 3VGGA 3A23A 4C7GA 2BHYA 3II1A 5BXPA 3FNDA 4GXPA 3TA9A 3DX1A 3U5YA 3WQWA 5BROA 3BMVA 3DX3A 5BXSA 3BCDA 4GQRA 1NP0A 4PMQA 4UFIA 3WNMA 5JIPA 4AZ5A 5I0DA 3U5UA 4MB5A 1UYQA 1XHGA 3WNOA 2YL9A 3D3AA 4JHOA 1JZ6A 4J3TA 2JF6A 2YJQA 2BVTA 1FFQA 2OYKA 1PX4A 3OG2A 3VD3A 2X0YA 2VMFA 4Z2HA 5IFPA 1W1YA 3DDFA 4M82A 3L4XA 2WB5A 1ECEA 4AZCA 1V6XA 2DEPA 1B30A 1TQTA 2VZOA 2CNCA 3A4AA 2DSKA 4WSJA 4P7RA 4KH2A 1ITXA 3HZ3A 2E9LA 4CCCA 2D3NA 4NRRA 5BXTA 1HJWA 2DT2A 5AY7A 4OOZA 1MYRA 3SCWA 2ALWA 4WLCA 4BS0A 1LJYA 2UY4A 4WF7A 1J18A 1Q6EA 1US2A 4CD8A 1EHAA 3BSGA 3VU2A 1LLOA 4TUFA 4B16A 1FH7A 2VC9A 3CMGA 1WP6A 4MB1A 4XZBA 1X6LA 5I23A 4PUEA 3GH7A 1GW1A 1R75A 3VSVA 2NSXA 1OIFA 2XJ7A 3NYDA 5AYIA 3CZGA 4AIUA 4MDOA 2Y4SA 2FGZA 2CBIA 4OZOA 4HA3A 4AD0A 2D3LA 4DWSB 4KGLA 4WIWA 4UFMA 3NCOA 2XM1A 4AEFA 4OIFA 4EANA 1AQMA 1A47A 4JFTA 1TZ7A 2XGBA 3EDFA 4P8VA 3WD2A 2V3EA 4AZ7A 4PMUA 1WAWA 3J7HA 3CZEA 2YL8A 3VMOA 4GZJA 2FHCA 3W0KA 1YQ2A 1E1EA 1UWIA 3CUJA 5A6SA 1CXHA 2GK1A 3AIRA 3WNNA 1E0XA 3W37A 4B9ZA 2YDRA 3WDRA 3N13A 1VFMA 4AD5A 3HJEA 2YIHA 1E71M 4NZCA 3NUKA 3AMGA 4LQ1A 4MDPA 4FNRA 1CECA 3WEOA 3T08A 3VOCA 1PX3A 1M03A 3ZJ7A 4AISA 2PWDA 1TQUA 2C8NA 2CHNA 5CSUA 5ABEA 2W61A 1F4AA 5CGMA 1JZ5A 3N15A 4PTMA 3SURA 1JZ4A 1CXKA 4J27A 2PF0A 2WHKA 1C90A 2GVYA 1WZLA 3DHUA 1NWRA 2WMFA 4FLSA 2GDVA 3WUEA 3ARSA 3GNOA 3AIBA 1KXVA 1G01A 1RP8A 1HL9A 3LXBA 1L8NA 4DM2A 2XSAA 4JHZA 3WF2A 1JZ7A 1C7TA 1XSIA 5D8ZA 1W1PA 1BYCA 1QHZA 4W8BA 4W84A 5A3HA 1J0HA 1LG1A 4ACYA 4M8UA 1WCGA 2IXVA 4WKHA 1UR0A 4U31A 5EMYA 5FOOA 3NJ3A 3QHMA 5IFTA 2CIPA 2OSWA 5FD0A 1UKOA 2A3HA 1B9ZA 3UERA 4OJYA 5M17A 2E3ZA 2D0FA 2G41A 1HKMA 3MSGA 3AJ7A 3DC0A 1FA2A 1MFVA 3L4WA 4TVCA 3D52A 5FKYA 3EDEA 2EO7A 3CHEA 1WE5A 2XPKA 2EPMX 1PZ2A 4X0VA 2CETA 4P8WA 3ARXA 3A5VA 3A3HA 5I6SA 1OCQA 3MO4A 4OOUA 4JKKA 4HMDA 3QR3A 1R87A 1VAHA 1MFUA 2D1ZA 4WJXA 3W81A 3AS1A 1CWYA 3APGA 1JFXA 2BNJA 1W3LA 5FL0A 3T2QA 1GJWA 1HT6A 5DO8A 4KRUA 3CBWA 1E4LA 3VIKA 3BUBA 3MU7A 4HPGA 1HJQA 1MW1A 3VIIA 1HTYA 1UQZA 3VGDA 3BLKA 3ZR6A 4BA0A 3WFZA 4PRWA 4EKJA 2WVVB 3U7BA 1TQVA 1XCXA 1OB0A 2XN0A 2W63A 1GVIA 4LYPA 5A6JA 2WHJA 4D72A 4EE9A 1CGVA 2DSWA 3SCUA 3SCSA 1QX1A 2E40A 3CC1A 4P7LA 1SZNA 4GI6A 3L4TA 3GDBA 3KE0A 3ARQA 5E70A 3BUQA 2PWGA 4YHEA 3RJYA 4AZGA 3K8MA 1VBUA 1FH9A 5LA2A 1UWQA 4D6DA 2BVDA 3A22A 2EACA 2F2HA 2O92A 5A69A 3WMBA 4BCEA 4B9YA 3IAPA 3PBGA 2Y8VA 3AICA 2DIJA 1W1VA 1UD8A 2YA2A 2X1IA 1V3LA 1BGAA 3N18A 4HA1A 4CD7A 4CU7A 4L4PA 4CUCA 2X2YA 3KEHA 1SMDA 3AZRA 3ZJKA 3EJPA 3B8SA 4PTWA 2VT0A 2J7BA 5JBEA 1PJ9A 1G94A 3K4DA 4DWSC 3BAJA 3ECQA 2F7RA 3AXXA 3T0AA 1F4HA 5C71A 1R34A 1HL8A 1D7FA 1UH3A 2AOSA 3W4RA 3PN8A 2VJXA 1WDRA 1JZ8A 4LYRA 4A3YA 4BZYA 1ZJAA 2VCAA 3NIYA 3WDJA 1GQJA 1LWJA 2UY5A 4M24A 1XSJA 3ZMRA 4AY1A 3KL3A 3ZSTA 2V5CA 4NRSA 1V3MA 3MMWA 2WBKA 3VGFA 3NSXA 4HP5A 5D9OA 2F18A 5ABGA 1QWNA 4DO5A 3OLIA 2XSBA 2E0PA 3LX9A 1CXFA 5FIPA 2G3MA 4YPJA 4U33A 1TMQA 2X2JA 4LGXA 1CGUA 2D23A 1DHKA 4PMVA 3EDDA 3PTKA 4PYSA 3EDJA 4PN2A 5F7UA 4A4AA 4JFWA 1XYFA 3K46A 1TQWA 1UUQA 4Q7NA 3WUGA 1QHOA 4TTUA 3SCNA 4V27A 4AZ6A 2CKRA 3N9KA 4NSBA 2XUCA 1E1FA 3BVXA 1NWTA 2XVGA 4W93A 4TVUA 3RDKA 1JIBA 2EPKX 5DFAA 4BQ4A 4X9YA 4UOZA 3T2OA 1TVPA 3GBEA 1XGZA 3RPMA 5BRPA 3VSUA 3ZM8A 4J7RA 2IUZA 3KLLA 5IXEA 3OA5A 1A3HA 1QI5A 1I1XA 1E3XA 4NX0A 2YFOA 1ZU8A 2WZIA 3HG5A 1HP5A 4E8CA 2XWDA 3MSDA 1V3JA 3AS0A 3FW6A 4PUDA 3ZOAA 3QHOA 4M80A 3ZO9A 1B3VA 1B1YA 1DWGM 3O9NA 3CZJA 3AHXA 1TCMA 2Y24A 3WIJA 2QPSA 1WPCA 5HDRA 1UHVA 2J7FA 3CGTA 4W7VA 3CH9A 2BHZA 4H8VA 5FL1A 3D51A 4AZBA 1UG6A 1KBBA 4AC1X 4AZCB 1VFFA 3EJRA 4CD6A 2D0GA 2AAAA 2WC4A 4CD4A 3ZJ8A 1CGXA 3EDKA 2ESCA 4AIEA 4UTFA 1ISWA 1JAKA 2BHUA 1E6PA 4PMNA 1BG9A 3E1F1 4J3WA 1M7XA 2BV9A 1EOMA 1ITCA 2F8QA 3GNRA 2WYSA 4AXNA 1NOWA 3K8LA 1BVZA 2DIEA 3M7SA 3BAWA 3WEZA 3WL1A 1Q4NX 1UH2A 3TTQA 5HNNA 3WF0A 4Z2LA 3WNPA 2YBUA 2EBNA 4U3AA 5HXMA 1T0OA 1J9YA 2C0HA 3KZSA 3VD4A 1BYAA 1KXHA 4W5ZA 2G3NA 4UFKA 2FH6A 3GXFA 4J3UA 1C8XA 5E09A 1JYNA 1UWRA 5BCAA 1QW8A 9CGTA 1GOIA 2BY0A 5CZKA 3PZVA 4B3LA 3VNZA 1ZL1A 5E0CA 4UQCA 4OKDA 1UKQA 2GK1B 3G6MA 3CIVA 4H7VA 2HVMA 2VL4A 1KWGA 2ZXBA 4HA4A 1CTNA 1K9TA 4NZJA 3UG5A 2ZIDA 1W2PA 1JXJA 1HKKA 1I75A 2VCBA 3EMZA 2XVPA 4TVDA 4TTGA 3BLBA 2CPUA 3AZSA 5A2CA 4AWEA 2JEPA 1KXTA 3ZT6A 4RE2A 1RP9A 3WFLA 2VRKA 3WENA 3EJUA 3ZSSA 5JBDA 2YKKA 1KQZA 2JIWA 3VX1A 2OYLA 1QWUA 4D1IA 4JCMA 1BF2A 1UZ1A 1UD5A 3W6LA 3DX2A 1JDDA 1UH4A 2GSJA 2VCCA 1EHNA 2VQTA 3NDYA 3SCPA 3ARZA 3CHDA 4Q22A 4W86A 4BQ2A 2VOTA 3PZGA 3OLDA 2WMJA 4ZE4A 4BF7A 4FNSA 1ODZA 3MV01 4WKAA 3UG3A 4P7QA 1J12A 2PWEA 1GZJA 1O7DC 3LPOA 3MUAA 2PWFA 2WKGA 4PSRA 4XB3A 1K6AA 5A2BA 3W29A 4FLRA 3WNKA 1K9DA 1KCKA 3VGBA 3UCQA 1FH8A 3DYMA 4UFLA 1HJXA 3WNLA 1US3A 4YHGA 2BXYA 3ARPA 5DT5A 1W32A 1VEMA 3IGUA 4PMYA 3VD9A 2XN1A 2J8GA 4KWUA 1DEDA 4MAVA 2YFNA 2A3BA 3MMDA 2VNCA 1O6IA 4F8XA 3BSHA 1JFHA 2XVLA 1UWTA 5I5RA 1UWSA 3BCFA 1H0GA 1V0KA 2D24A 1B90A 2VZSA 3POCA 3A47A 3BH4A 3GM8A 1BLIA 3FHAA 4IPLA 1B3ZA 2QMJA 5A1AA 3WQ8A 1FP9A 4HZ6A 3NDZA 4PEEA 3WF3A 1HJUA 3GXPA 1NP2A 3THDA 1H49A 1BGGA 4FLOA 1GONA 2XFYA 1EH9A 1TG7A 4WSKA 2YLLA 1ZBWA 2HISA 1HKIA 3GNPA 3ZT5A 3T0BA 1ZBKA 1RPKA 3ZJ6A 4CN4A 2GFTA 2VRJA 3EMQA 1ZS2A 3GXIA 4ATWA 4NI3A 3BMWA 5GPRA 5IDIA 4GI8A 1UWUA 1D3CA 3VGEA 1QNOA 3K8KA 2F7OA 1C92A 3S5ZA 2WWDA 5E6YA 3KL5A 1VRXA 3VIFA 1VJSA
chains in the Genus database with same CATH superfamily
3NCMA 2WZHA 5DRNB 5EU6A 1XRFA 4FP1A 1LO2H 3RWFB 1IBZA 5KSBF 1GORA 3REVB 4JOMA 3ULVC 3FYYA 3MRJB 1O5KA 4QIRA 5E4IA 5T3XH 2UY2A 4UTMA 2EECA 2FZBA 5EO9A 5K33A 4X61A 1Q6GA 1BOYA 2VENA 2PR4H 1KA9F 2E7BA 4OZ4B 4QRUA 3HHRB 3EG9B 1FOBA 2YEZB 3FCTB 1LQSR 4KW2A 2WSQA 4JO2H 3JUGA 3V18A 1F41A 4NQCB 2BS9A 3JZYA 3DO7B 1T66C 3C5ZD 3PWLA 3REWB 2X05A 5D7JD 1DFXA 4EK7A 4ZEPA 2J8UF 4ODUA 1QBMH 1QFOA 2JQZA 2R1YB 4LLVA 3OJ2C 1W0MA 3QE5A 2NSMA 3VXMB 1UA6H 3W7IA 1BFTA 1ZALA 2VUYA 4WGKA 5TD4A 4NQDD 3IIVA 5ID1B 1SLXA 1B57A 2WK2A 3WDQA 3GTIA 2BSED 2XPGB 3U48A 4HJIA 5D4IA 5CZSA 4BXVA 4WO4B 4ZFCA 3MUY1 3N34A 4TO8A 4R5EA 4JVUA 4I0KA 3I02B 3LH8A 1J5OH 3BJLA 5A6BD 3C5SB 2CRZA 3EFFB 2K9UA 3TJLA 3O45A 1EP2A 2HKHL 4NM8H 3MRHA 4KJPD 1I3RB 3ATBA 1TVBA 2X4UB 2BDQA 1DL7H 1SSGA 3IFNH 4MDIB 4HWBA 3B0XA 1XGEA 5JIWA 3VKCA 2NNFA 3RI5K 3B56A 2D7QA 3GB7A 4KCTA 4FXGC 4DO6A 3IDIB 3ZQWA 2DGAA 1GVEA 3I2CH 4OLXL 1NFPA 4B5ZA 1EBHA 5JO5B 2ZAGA 5EFIA 5FA3A 5HPOA 1H1NA 4JIEA 1ZT7B 3AMCA 1SJXA 2J27A 1YZZA 2PDCA 4EQ3A 2XHYA 4JBRA 1AMKA 1A9BA 4LX4A 3RL1B 4H6QA 1BAFL 1VQTA 5GRJL 1JYVA 3WD5H 3GNML 3UYIA 2I7GA 2J5LB 1IFHL 1O9ZA 1E15A 4DEPC 3H70A 2MANA 3HW7A 5GRVL 1UWEL 4JPVH 3FF7A 5IB5A 5D1QC 4ANKA 1XGQB 3NAAH 3IJ9A 3W39B 4GK8A 1HQ4B 1I7ZB 4UTUA 1Z42A 1CGYA 2D31A 3BQUA 3OYXA 4DZBB 2PDJA 1A0DA 1XMEB 1A5CA 3L3IA 3IFLL 3PWNA 3ISIX 3FQUA 4QRQA 2GT9B 5TDPB 4GLRI 4QHKJ 4JCLA 1YJDC 1NCAL 3VE0A 4AENA 4P04A 5DZVA 3E9UA 1O7DE 3OXRB 1RZ8B 3S35L 4KZCA 2VW7A 4QHNA 3SGJA 1CW2A 3ZKND 4DK5A 3TFXA 2FYYA 2I60H 3MLUL 3EX3A 5I15H 1A3RL 1TE1A 4XKYA 4G7EA 1Q6CA 4HUWA 5SWZE 1OK6A 4NRYB 2WCGA 2IVFC 3KDPB 3VWJB 4DEWA 4JM4H 4Y9GA 3A21A 5TGBA 3EYVA 3L7RA 1IGSA 5CPMA 1RIVH 3N73A 1XEDA 3P8IA 4WI0A 4PAZA 1IT9H 1OCWH 1EAPB 3NPVA 4X2UA 4XP1L 2GGJA 1QVOA 4PJGA 1NIDA 1BMZA 1ADQL 3SO3C 1OF2A 3LCHA 1H8SA 4RZ5A 2PR9A 3TNNA 3LTPA 2ICEC 4MD4B 4JFVA 3VINA 1RZKC 1GAFL 4YXHH 1CB4A 2IJ0C 2QF8A 5DJ2B 1P5VA 2A77L 2HFTA 4JYEA 3H2CA 3ETBJ 4QRRD 5CNHA 2OAAA 1KLFB 4BQ5A 2VGBA 3ECWA 1M6OB 4D7PA 4J2QA 4LCUB 1QEXA 4KJWC 4Y1AE 4IU3B 2BSTB 5GISH 2CCLA 3WV0A 5A8PA 3AVEA 2WNQA 5EIQA 1FYTA 4YXLL 1F6FB 1E5YA 3D25B 3EO9L 3PFMA 5GRZA 3ZU8A 1JPEA 3NABL 2BASA 1S9YB 4XOBA 2VB5A 3C2AL 4LSQL 4XMKH 4DFIA 1XLKA 1DUYB 4N2KA 4DKFH 2ORBL 3CT7A 4UTBL 2DQFB 1T20A 3HN5A 4Y2WA 3DO4A 3LNIA 4H13C 4ZQTA 3C09C 3VIMA 4P23B 3CM4A 4IISA 5CGYC 3M5XA 4K7VA 1RQBA 3OV6A 5BO0D 4J5VA 4XZLX 2CM5A 3MV7D 5FA5A 1LLWA 1CF1A 1MZZA 1XYBA 1NWSA 2HJKA 4AT6B 3US0A 4PS7A 1SM3L 4TX8A 4MA1C 4TVPD 3O2DH 3COOA 3M0ZA 3N2BA 2IPFA 4L4JA 5I1DA 4IHOA 2ENQA 5CJ5A 4I7VA 4GLEA 1HJCA 4EP8C 2EUWA 1JCVA 4I5BB 3HMWL 3A4WA 2QQKH 2E9GA 1R3LA 3QQ1A 3CHXA 4DJMA 1UR9A 1Y65A 4KO7A 3VKKA 2FUQA 1KYDA 5TPWL 3H3KA 3C4UA 4PRPB 4QYAA 2J1YA 2ZC8A 5T8GA 3DYOA 5I8EB 1F3XA 3P2TA 4TNWF 3G6AB 4FC3E 1PLAA 1ZBVA 2N1TE 3QRBA 1KELL 3RPKA 5GRYA 3TM6A 2HRPL 3RO6A 2XGIA 3N0PB 4IRJA 1NMAL 1AGEB 1ZS8B 3H7VA 4GNVA 4XI5D 3ASNB 2GTZA 3H0TB 4Y9PA 3SADA 3QPYA 3DYPA 4AHQA 4K4KA 4EQ2A 3DSNA 2JKNA 2Y89A 1WT5A 2ZQ0A 2VR2A 1CGWA 2A9NH 3WJZA 4YHZH 3WO3B 4UQEA 4FNLL 5F0PB 1FC1A 2HFEA 1TO3A 5T1KB 2ITDB 3MYOA 3HZKB 3KXFE 4RA0C 1MI3A 3TIDA 4EF9A 3QT2A 1CLYH 1VD6A 4R83A 4RPPA 4PV9B 3IJYA 3SDCC 1UXSB 3MODH 1ZJBA 2FECL 3UTSE 4UCGA 2R15A 1VFHA 1FH5H 1I7UA 3IETB 4R85A 1JGUH 2E7HA 1WKEA 3CQ0A 1RUAL 4EN3A 3IFPA 1BFOA 3QWNA 4ONFH 1PWLA 1Y6MR 5GGSA 2COQA 1GVYA 4HJJH 1D6EB 2GFBB 5EBWA 3LH2L 2AL1A 5EORH 1J0YA 3U46B 3V7MA 1AVAA 2E76C 5E24E 1W1TA 2VDGA 5ABDE 3BLIA 2OK0L 1DTNA 4RETB 3PGFH 1YAZA 3TYUA 5C0BE 5M94B 3BUPA 1JRHH 3RTLA 4LLDB 1T99A 1Q72H 4DW2L 2IFGA 5IVXA 4L8CB 4N2OA 2XTKA 4LCWB 4FPSA 1U1JA 1VLWA 5KOMC 1UA3A 1OD8A 5H6HA 2VZVA 4FQQB 2JIEA 3VXRB 4FEIA 5C0CD 5G2HA 4QXGL 4H04A 4KUCD 3BG3A 4X8JA 2D0HA 4UILL 2HS6A 3KWWB 2YD6A 5FGBA 1N64L 4IRSD 1IGJB 4QRTB 4PWHA 3SPVA 1EMTH 3RVWD 3ESNA 1HTIA 5AAMA 2ZG1A 2WWNA 2NV9A 2I26N 3KLSA 1G5GA 1LRQA 1TPC1 3N11A 2F08A 1G7JB 2RAMA 4NC0B 1P48A 4PMRA 2WZTA 3V5CA 3B34A 2Z8RA 4PS8A 4AQEA 1NKOA 3CT2A 2WVVA 4OV5A 3FO9A 4ODBD 2WIIA 4EVZA 1TV5A 1N6VA 3O2WH 2XHNA 1IC7L 3AG4B 4Y9AA 1QYGH 2JCCE 3Q58A 2X6AA 2VN4A 4GY7A 2VDPL 1GOOA 3GC2A 4IJRA 3P30L 4DK6A 3NCYP 2R56L 4UNVA 4PCFA 3T0EB 1BJ8A 2WP3T 4XCFL 1AKJA 4Q32A 2B1AH 4A2HA 5TIMA 5F9DC 3KS0H 1NMBL 5C1MB 5I73C 1HI6B 3QNXB 3DARA 1ZV2A 3ZLHA 4UQBA 4QP0A 5KBLA 4M1GL 3FUFA 3U30B 2PTXA 1Y0LA 5IP4A 1OAZH 5E6IB 2J73A 3LHPL 1CR9L 4TULL 2K3HA 1KBIA 2Y7MA 3DBPA 1SU5A 3WN5A 3SE9L 1BDYA 4LCQA 1TJGH 4HUCA 1ESWA 1DJSA 1TA3B 4ADJA 3BGGA 2NLJB 1XPGA 1FHGA 4NUGL 3JVGC 4NIKB 1UKSA 4ACZB 2XWEA 2Z7ZA 1AJ2A 3D2UB 2CYGA 5DURD 4XBEL 3W0WA 4HJ1A 1JWMA 2WO4A 1PU0A 1HEZA 4O2CB 4H0LC 4XAKE 1FZJB 1SYVB 3S3BB 1HINL 4DBSA 3NGJA 4KXZI 3LHYA 3EWXA 1P2CB 4PUMA 2Y7QA 3TN0C 3WNOA 5E08H 4J3TA 4YK4B 3LG3A 2ZWLT 2VEFA 3MRFA 2R24A 3MFFA 1ZEAH 4MZ8A 3VD3A 1GEHA 4RW3A 3KM2A 2X2GA 4D9QD 4B50A 5LN4A 5LGJA 1V05A 1P53A 5E9DE 1OAYH 4WLCA 3ILEA 3BSGA 4UMGA 3C0LA 1BM7A 5AEAA 3KPQA 2ADAA 2W81C 4RWYL 1MVUA 4M6OH 2GQAA 1WEJH 1OXYA 3SYAA 5D9SB 1N5YH 4N0YH 5AZEH 5E5CA 4NNPH 2RJMA 2Y4SA 1RUQH 2J88A 5D7SL 2O7QA 5CR8A 3EOUA 2ATAA 1CFVH 3LB0A 2R91A 2NR6D 2HXTA 1U4FA 4JPKL 2YRLA 1R9YA 3G1AA 3O4OB 3IFOA 5I1IH 3PGDA 1I7TA 3GFZA 4ZD3H 5CEYB 3KNBB 4N8PA 5CD5D 2IPJA 3WDRA 1IEBA 4DZAA 3F00A 1U8IB 4C6IA 1NJ9A 4NZCA 3NUKA 3IUDA 3VOCA 1D5MA 4Z3IA 3DSFH 1TQUA 3KS5A 1IEAA 3RVXC 3B4UA 4UTAH 3UP6A 5MKGB 4DESA 3I9GL 3U79A 1XBVA 4P5KB 5F7DB 1N8ZA 4YSEA 2IC2A 3QEGL 1JNNL 3PQYE 1KXVA 4IMDA 2QPEB 3Q5OA 4H1LB 4ZUVA 3U4FA 4KJYA 2EDKA 3HLKA 1BYCA 1IKFL 3UP8A 1Y1UA 1J2WA 2PW1B 3TAKA 2CIPA 4DNLA 2JNZA 3QEHB 2G41A 3FOLB 4CBPA 2YS4A 5LNUA 2NXGA 3D52A 5D8JH 1SXSA 1S9WB 4FRWA 5IR1A 4QXIA 4WW2B 3BPOB 4DGIL 1PZ2A 2FL5A 1DQIA 4F37F 4PGCA 1CWYA 4GRLB 2BNJA 5JLZA 3BIKA 2XTJB 1R3YA 1ND0B 3FU8A 4ONGL 3GE7A 3BUBA 1RK5A 4WDWA 1ZD6A 4WGHA 4PY8J 5C0GA 1XZ0B 1A6WH 1CGVA 1H3WM 1AODA 5C6TH 4XBMA 3EJZC 3KE0A 4AX3A 5GS0C 3GU1A 4A6YA 1YPXA 5LA2A 4PJ9B 2CKBL 2GPZA 4NZ4A 3O6FA 4UMSA 3QUMH 3IAPA 2PF8A 3VXSA 2AV1B 3ONCA 2B7QA 2X9YA 2Q3RA 4I9MA 3GSXB 5J11C 3LSOA 3GSWA 4JY4B 3CUPA 1GIGH 3P2VA 3N2CA 1N59B 1VFBA 2X2YA 4LU5L 3OBEA 1FUYA 2QUVA 1P5UC 1MNUH 2VT0A 4R7DA 4JTUA 1L6GA 4TL5A 4G5DA 4NENA 4AFYA 4ZVJA 3MC5A 5C0AD 3LS5L 1QMLA 1BJMA 1UUOA 3EOSA 2A5UA 2VFHA 4LE8A 3WYZA 5B7YA 5AKSA 1II4E 3DTUB 2VCAA 1GQJA 4PJFE 5H2BB 3KL3A 4GYPC 2D03H 3FQRB 3UAJA 2A6LA 2O5XH 3IDGB 3ZL1A 2F18A 2XG4A 4PW9A 4C91A 5E8NA 2MJWA 3U0WH 1XB6A 2K45A 1YPIA 1XYMA 3HBLA 4PN2A 1KPRA 4U1HB 2QKFA 4YLQT 3N9KA 3UC0L 2JKWA 3BVXA 1FE8L 3CK5A 4X9YA 3RFZB 2D2CC 4GGHA 2VC2L 1ZWIB 3HRZA 5IHHA 4IBTA 5DANA 4PJIF 4XBKA 2NQCA 1L9TA 3C6LC 2CJTA 5FJPA 3WCZA 3PHOB 2J2ZB 3ZO9A 3PJSA 4LKCA 2RUSA 4FQCH 1N8WA 1EEZB 1A49A 2K8QA 2VWTA 4XNUH 3PPHA 1HWGB 4GFIA 1PZDA 4I9TA 3T8XA 1OGAD 3OMAB 2R4SH 2TSAA 2WC4A 5DVLA 4GJTB 4UTFA 1ISWA 2R4RL 4PWGA 3BRGC 1BG9A 1RZFL 1IBGL 4F27A 2Z92A 2JMRA 2WBJC 2DIEA 1LUCB 4MA7H 5FYLL 3WL1A 1YYCA 1CI1A 3RWCB 5E8DH 3VI3B 1RPQA 1HH9B 1MJ7H 3JV6A 3FCGA 2CRYA 3KGTA 2PPFA 5AW7B 3C2SA 1ZLSL 3MDJA 1CS6A 3MCKB 3GMPB 1QAPA 5KZEA 2ZTJA 4WQ6A 1A6ZA 1NAL1 3CSYB 2AZAA 1B4RA 1U2CA 5CZKA 3TL5A 1B4EA 3QIUB 4OKDA 5LIUX 2GK1B 5EIVA 5AL8A 1G6RH 4H7VA 1YEIL 1PY0A 2G9HB 4YHIB 4HUXA 3QQ3B 1JZJA 4Y16D 4GAFB 3DGBA 3UG5A 1ECQA 1F4WH 1R3VA 1HKKA 3QFJB 1NM4A 4XX5A 1FWHC 1SUJA 2Q8LA 4MSWB 1RAKA 5DVPA 2VRKA 4K73A 1PDYA 4G8FA 4FOJA 4HEME 3D39D 3VX1A 3EHBD 4JEQA 3F64A 4JCMA 4QITA 1FORH 4MZ3A 2PTYA 4CNIB 5FGCB 1NGZB 1MDLA 5FC9A 3KYOA 3HBQA 3JZEA 3VZYA 1TYEB 1J5HA 4E42A 2K6YA 4FG4A 2Z6IA 4PH6A 1K6QH 3M5YA 2EEBA 1NPNA 4AMAA 3VYNA 4PGZA 3ZKXC 4S1RL 2BIQA 1KXQE 4FQXC 3MUAA 4R4FH 1P7KA 2C3VA 5FACA 2WQUA 5CLYA 4C59B 4TLSA 4FLRA 1Y18B 4D3CH 1QPRA 3VGBA 3FN0H 2H3NB 1F42A 4PJFF 1VEMA 3IGUA 1IIKA 2MFNA 3F12B 2IWKA 3LHAA 5CGBA 5F6IB 2YFNA 4MWAB 5HBBA 3ANVA 3O41B 1NGXA 5I5RA 3FS9A 5I02A 4JHWH 1B90A 1ZLWH 3JWOL 3BH4A 1BLIA 4WUUD 1P0EA 1G7IB 3DG7A 1YECH 3NDZA 3C6EA 1D9KD 3QI9C 3PUOA 4HLZG 3WLBB 4Q6IC 1CD1A 5DQJA 3EFOA 4UM8A 5F3BA 3RK8A 2ZJSH 2FX8L 1OQXA 3M17B 2ZZUT 2EINB 1MCHA 3BD5A 5HHPB 5E6YA 1FGVH 2LVEA 1E4HA 3QULB 4Y9BA 4Y9FA 3ZHNA 3BWSA 4UR8A 3S8WA 2RB8A 4CQDA 5ALBH 1YEEL 3V6FB 1ZV9A 5CN2A 1RVGA 2VFEA 5AWNL 1CE1L 3U6WA 4FQ2L 2PXYB 1A6VL 3LZRA 5ESQB 4J4PA 3MRLB 3RLHA 5FYKE 2NDFA 3BO8B 2XIBA 1G7MA 4HS6B 3P4OA 4G8TA 2D3JA 3NQKA 4U1GB 1I1WA 1SZEA 3RY4A 4BH8A 3K2GA 3DK0A 1U8OB 4FQ1L 3IS4A 4PMZA 1PNDA 5FV2A 4XVSH 1E1CB 3S2CA 1GKOA 1MY7A 2CO7A 3SD2A 5C0RL 3MRDA 4BCXA 2WBXA 5J1TC 1HH6B 5HPCA 2HVNA 1P43A 5E93A 4FZ8L 4ACTA 4MTVA 3FDKA 2VDIA 3LNMA 3TYCA 4OSUL 5ETUA 1ZAJA 3SO7A 4J3ZA 1YSOA 2Y06L 1EFXB 1XC4A 4PP1C 3LI1A 2BCKB 2JSFA 5ACMA 2Y5TA 3C8KA 3W26A 3PZOA 3TW6A 2AFNA 3OC5A 4L5ZA 2ITEA 4LDCA 1OIMA 4XP9L 4UV4H 1LEGB 5ISZB 4N6FA 4TQEH 1LCOA 1NEUA 1NGPH 1NBYA 4HHAB 5LLIC 3U4AA 5D6CB 2QSCL 2BY1A 1B9BA 4FFYH 3BUYB 3GTXA 2CNYA 4K7YA 2FLIA 4XVTH 2TSYA 4DJDC 4RQQB 2QEJA 1BEXA 4I0PB 4APQC 4YMZA 3M8OL 5A6LA 3DURB 1JGEA 3QIBC 2FTPA 3ZDYE 4GRSA 1EX5A 1THFD 4FXSA 5HGHA 1J9TA 3TIMA 1IO4C 3BN9D 4YHPA 1PZBA 1RK0B 2BIOA 3KD4A 2VEPA 5AC8A 1J0KA 2I16A 2WJ7A 5LWYH 4Y7EA 2XWZA 4M9PA 2V3GA 4IFKA 5I6XC 1JMZA 2OJZH 1UOVA 1ONEA 4ERIA 1E9QB 2Z65C 4IPJA 4ODHH 1ZXKA 4O10A 2BMBA 2GAZB 1SO3A 1Y8BA 3KOXA 4LUSA 4H8PA 2VL5A 4Z76B 3TEYA 4GFTB 4NQVA 2F8VA 4RGNE 4JM2C 1ZLVH 2RH9A 1KXTB 2DDQH 1CGSH 3MV11 1RIUH 3B9DA 3PZMA 2MQ3A 3UVIA 3FB7B 1W5PA 1QBBA 3J27A 1A7NL 1W9PA 5C86A 4OZFG 4RSVA 4KRPB 3T6CA 3ERXA 4F0KA 1Z3NA 3SFKA 2Y85A 4I1NB 2IOIA 3THUA 1PIGA 1WA2X 2DDXA 1RK7A 4KKCC 4HBQA 3MGOA 4Y4KD 2UY6A 4K71C 3W11D 3BVTA 4LIQE 1MG2C 2BW4A 5I19H 2ZX7A 1T1YA 4OZHE 1KLGA 1U58A 5DQ9B 5G4HC 3ZHLA 3QY6A 1R85A 3PV6B 2N7SA 3AZUA 3EKCA 1BFNA 3TBWB 4JFDB 5BW6A 4YHNA 1URZA 1E6SM 2DQEH 4BFIB 3DFHA 4BXSV 2VZTA 4QTHA 3G5ZB 1RZMA 3QQDA 1KGXA 2Q7YA 4DN3L 1RBAA 3W7DA 3E2VA 2G5BA 1J0IA 1JV5B 4Z7IA 2HMIC 3BUVA 1JF1A 2GLKA 3L4CA 1NICA 3DUSB 3LHWA 1QNSA 5GGRB 3L4VA 3TTSA 1ONRA 2GQ3A 3UPCA 1H5BA 4QY8A 1J4EA 3W00A 3FN9A 5B38B 1UJTA 3RWHB 4YNYB 1PD0A 1OFBA 3VXPB 4O1DA 3E80A 4KPHL 1O5RA 5TK4A 4Y2DB 4DWSD 3KPSB 4REQA 2ZG2A 2AKZA 4JZNA 1KCZA 2XVBA 1IT7A 4LYKA 1XH1A 5EU7C 5IM7B 1R0MA 2ZDSA 3QO1A 3U4BL 3FN3A 1GQLA 1UEYA 4CCDA 4H8UA 5JIMA 5D7HA 3ASWA 3SQSA 2FR4A 4Z7WE 2RTTA 4K5MA 3DXAD 3I6KB 3ZDYF 1FFOB 3RU8H 4PFHA 1RBOB 1R86A 3LZFL 5TE7H 2W62A 3NO3A 1BD2D 2F19H 4O02L 3MJ7A 1MHPL 3AIEA 2QT3A 6A3HA 2GOKA 2RHGA 4DI9A 4KC3B 3GSQA 4ZQNA 1KR1A 1GKRA 2H1PH 3QJHB 2QJGA 3RTQB 4N6EA 5T5NG 5I8OH 4ZS7H 1U91A 1E70M 4O0KA 1A1OB 5HOSA 2YLKA 4TX6A 4CJ1A 2VLLA 4EZJA 1SEQH 1V7YA 4XZHA 4OCYH 1CENA 3G2GA 2W60B 3VUPA 1I0DA 2KH2B 3H8NA 3GDMA 4NQSB 5DD3H 3V0JA 5ESAA 1VIWA 3LMYA 1I9CB 1A5FH 5GVJA 4GKLA 4JO5A 2J78A 4DQOL 2CLLA 3WQVA 4HXBL 1PD1A 2ZCLL 2V9RA 5BVJB 1YDYA 5CMAA 3MV9E 4QEEA 3RX2A 5DK2B 3AYSA 2F5BH 1YEJL 4FP8H 3W2DH 2Z29A 4CRPA 4ZX3A 3N2MA 4WOZA 4KX7A 4JY5H 5AOJA 6ENLA 3O63A 3Q65A 3S1XA 2ZBTA 1BVLB 3LCXA 2LU5A 2AXFA 5GZNA 1MHEB 1MW3A 1AXSB 1RY7B 1C91A 1DBML 2AK4D 1BYOA 1YEDA 2D2OA 3QR1A 5IFAH 3MYZA 3DIFB 1E4WL 4OZHF 1YEHL 4XPBH 3C61A 4LNCA 1OX4B 3AIVA 1ZP3A 1ACXA 3R58A 3MMTA 4OIIL 1S7SB 4ZDHA 5IFHH 2D20A 15C8H 4HGWA 2O6FA 4DNHA 5C9UA 1V6YA 2EKSB 2VC6A 3R0NA 3FSTA 3W3OA 4J23A 4GKNA 4K9EC 1Q1PA 1MUMA 1L0XA 2BZ7A 1INDH 1O7VA 2IPWA 4MD5A 3KBSA 4D1JA 2IXQB 1HCYA 5ANME 2W95A 4AZUA 5IUCA 4MZ2A 5FHBH 4US6A 1T22B 2BM3A 4JG1H 4OLUL 1T0MA 4AWTA 4W4OA 3KYMA 4M4RA 2UWEE 5ECUA 1DQKA 1G9MC 4A63A 3JV4A 4MXQD 4XX6A 1KB9J 1TSHA 4TS6A 3Q0HA 1RJYA 4U3HA 2A74B 3QPQD 1N5AA 5MHBA 2VX7A 1TO4A 2R0KL 5BU6A 2Y36L 1OT4A 4HUUA 3FL7A 2X4NB 4KXBA 3LRMA 1BQGA 4DYJA 5DUPL 4YHLL 1U8PA 1KJ3H 1I9JL 1BM3L 1F00I 4H41A 4Z7WF 1VEPA 3V9CA 5BNXD 4N8VB 4LUYA 2AGKA 5BQ7A 5LBSL 2GJNA 4CQ9A 1QAWA 4DGWC 1WAUA 3KPPA 2NY6D 1L6SA 3GXNA 1MPAL 1J0ZA 4KERA 5J8LA 4RFOH 3CQIA 3EJQA 7ODCA 3EYFB 3SB3A 1EWDA 3UAFA 4RDVA 5SX5K 2B59A 1XGTA 1PXGA 3EB4A 3W86A 2EXOA 1LM8V 3NCCB 2NYKA 5T1LB 3SPCA 2NY4B 3IE9A 5D9MA 3CD4A 5A16A 3FJNA 1INQB 1NCDH 2VDRB 5C07B 2YBGA 3V0WL 5T9CE 5K9CA 2RJHA 1MHCB 4FLQA 3TEWA 4L4VE 1S7UA 4KQ0A 3KPRA 3TYGL 2HT3D 4Y0GA 2EDTA 1VC4A 1JPTL 1SFSA 3O3AA 4AK2A 2FO1A 5FEPA 1HHKA 2W5FA 4YBHA 5C7VA 4H2AA 3IU3B 5FYLE 4B90A 4JDVB 5AECA 4A2RA 1A4CA 3K80A 4NHUB 2JIXA 4UAOC 5HNUA 1QFPA 4K1GA 1S1RA 1GOQA 4QOKD 1B5TA 4MZIA 4WHYH 5B7ZA 4HV8A 3VFTB 4LXFA 4C5ZA 1OX5A 4HHPA 1IEXA 2VXSL 1EGMA 3TO4C 4AZ8A 4HIEB 3G8EA 1U30A 4Z0BL 2NWSA 1CYXA 2CD0A 3TXAA 1QPOA 2G2PA 4UBDC 4XPHL 4L4OA 3DBXB 2W27A 4HJWA 2CO2A 1OD9A 1ICPA 4KX9A 5IKCB 5J6HB 4ABUA 4PREB 1D7BA 5L2KB 2F38A 3UTTA 3STCA 5K4ZA 5HHOE 4LWWA 4ZFOA 3GVRA 1W3JA 3VOHA 4RE4A 4A2GA 3IWUA 2XZAH 3BSZA 3CJPA 4AQ8C 1SOKA 4BSWA 3KS6A 1AO7B 2UWEF 4D8PB 4LOUD 2YCEA 4N2NA 3LYEA 3B7UX 3HPJA 5EEWA 2VDLH 5DD5L 4P2RE 3O0LA 5CP3H 3E0WA 3P9LA 1IZJA 1RK6A 4GG8B 4O0QA 1IZKA 1UGKA 2YCKX 3EJCA 2ADJB 4L9LC 4L6OA 1H3PH 4ATDA 3OZPA 4P48A 2NQLA 3F5KA 4Y4FA 5HYSB 3N04A 4EUPB 3F7LA 1BVKA 5L6YL 1IE5A 1NCCL 4C6JA 3DX1A 1GZQA 3DX3A 5CINH 1JCKA 5GSVB 2X87A 5ICXA 3WNMA 4X5XA 3NSCA 3U5UA 4UIKL 1M3IA 5G4EA 5K59E 5B1CA 2OMTB 3QY7A 1AJ7L 3EYSH 2P1FA 4R34A 1J8HB 5DU7A 5LNSA 3OG2A 4DP0X 1JOIA 1DUZB 2FZNA 4PUKA 4RIRB 1XLHA 3SR7A 4PJCB 4OUUA 3CLMA 1IC5H 2I07A 1EGVA 2UXGA 5DJ0B 5AY7A 4PRID 1VP5A 2WMPB 4LKXB 3FOMA 4MPQA 5D2NC 2G97A 2VC5A 5JOEA 4ZBCA 2PP7A 3LKRB 1OIFA 4HF5L 3TQVA 3ROLA 1BQUA 1NSNH 3FTYA 1BX2A 5CC5A 1FWAC 2ZSWB 4OM1L 2ZADA 5BZDA 3FGCA 2R69L 4X6BB 1TPUA 3K30A 1KM1A 2V3EA 4C6EA 5T1MA 2XN9B 3CZEA 1S8DA 4KTDL 3W0KA 1YQ2A 3BW9A 1UWIA 4FXLA 5HGBB 3FKRA 4UT7L 5FSEC 3HUJB 2JI3A 2WPBA 3FV9A 4LOCA 4M62H 4JJ5B 3ZJAA 4MDPA 3FQNB 2X4PA 2NQHA 3HJZA 3JTBA 5CSUA 1XLIA 4UTWC 2R29L 4IEFA 1XGPB 2VZ1A 5EU3A 2PF0A 1GOHA 2GUOB 3DHUA 1YDVA 3VCRA 4ELDA 3OKMA 4BFFA 1GJPA 3NO1A 4AL8L 3BFOA 5IUSA 2DYPD 4JHZA 2CA4A 3UZXA 4F8TA 2OJPA 4W6XB 1JMXA 4C4KO 3VG0L 4UTCA 3UGVA 2DM3A 5BJTA 4WKHA 1R5IA 1U0QA 4MJIE 1YBQB 1JTTA 1GW9A 1UM6L 2Z91B 4WKZB 4O8AA 1HL5A 2Q86B 1YN7B 3B43A 3T6XA 2PWUA 5T3XD 2DBLH 4BF9A 1UXMA 2YWYA 1KFCA 3QPKA 5KSVA 1MSSA 2CETA 4HBCH 2DEYX 1JXFA 4OOUA 3H8AA 2GBUA 5F9AC 1F1DA 2D1ZA 3RVUC 3K71A 1GJWA 4GUPA 3KMDA 4LSPH 5L9FA 4HETA 4IKLA 3VAEA 2CNZA 4KMTL 3TA3A 1L9NA 4EXKA 3ETTA 3ET9F 3IK4A 4AYFB 4ZOEA 5EMKA 2CO3A 1RR2A 5LJYH 5A6JA 4D72A 4AEIL 4DJED 4YL9A 3PWUB 1Z9PA 2NXIA 1LD9B 4A6GA 4YTUA 4FI8A 5EB9A 1U8QB 2VIRA 5I82A 4D6DA 4M6MH 2ZYFA 1FLRH 4R5VA 3QQ9C 1ROWA 4HS8H 3GSVA 3PBGA 1KT2A 1JK8B 2I56A 4G1EB 3UJTH 5DO2D 1XRSA 1K3IA 4H2HA 1A3WA 4L4PA 3M41A 5IIEA 1TZGH 3VVWA 2FX7L 5K59F 2BH0A 2XXFA 2XV0A 4RMWA 1V7NL 4MCYB 4FCAA 5JPNB 2W65B 2ZOKA 5FAGA 4NPKA 5MP6L 1YEFH 4F57H 1CC3A 3S0CA 5TE4H 2EVIA 1VADB 2QTVA 3QYMA 1CFTA 3NSXA 4Y5YA 2PU1A 1HXMA 1XLAA 2Q02A 2G3MA 3P5YA 3GR4A 2D23A 3RGVD 2IBGA 4I8DA 1UACH 5IGXL 1TQWA 1BYNA 3U2OA 5B7FA 3I75B 4XAWH 3QUZB 2XVGA 5LHDA 2DZBA 2DICA 4RV8A 2JLPA 2OP4L 4WCYH 4CMHC 5JHDB 5BRPA 3VSUA 4ZBJA 1D5ZB 1F97A 1B88A 1YMMB 3HE7B 3HG5A 1OO2A 4QX4A 5J9PA 2OJEA 5I3KA 1B3VA 1B1YA 5BZZA 3B9KC 4I85A 4S1FA 1QJWA 2G50A 1IM9D 2OEJA 3OPUA 4PUJA 3P9MA 3D51A 5GJSL 4KQ3H 1W5NA 2GWGA 2CIKB 5AOZA 4NKMA 2J6EL 4QE5A 3BXNA 3FSUA 3Q8FA 1PS9A 2G2RB 3GIPA 4OCRL 4PJ8C 4F8PA 4X63A 3P82A 4GW4B 1DL3A 5IB2A 2NLYA 4UM9D 2O6DA 1OAXL 5LAXA 3WL9A 1EZUA 2L3BA 1UZHA 2E5BA 3AITA 4OGAD 2BIHA 2DZTA 2GSIA 2PP0A 5EBMB 3S2AA 2NNCA 3V4PA 1GS6X 3MLZH 2BSSA 2QDWA 3VNZA 5E0CA 4UDUB 4NY2A 4X4MA 3MFGB 4C6MA 5E5MB 3CQQA 3UDWC 3Q1SL 2ZIDA 2L7JA 3ORWA 4TVDA 2C19A 2BMKA 5A2CA 4O19A 3N1PC 2YGNA 4O9HH 2NY2C 3ZT6A 4NKOA 3RY5A 4IG2A 3L2IA 3T0CA 5KZDA 3DGGA 3WFDL 1VGEH 2XWTB 3GRWH 1WBYA 5D2LB 3BZEB 1XIMA 2E5CA 3B3DA 5FYKU 5FGRA 1FP5A 2XIJA 2Z25A 3FU3A 2VCCA 3VC5A 3H3PL 2E7DA 4MIMA 4O58H 4MKMA 3NDYA 3FK4A 2Y1AA 1CU4H 1EDHA 3CFKA 1O7DC 3GSNB 3HO8A 3GKZA 4HNCA 3TYAA 1HOCA 3BH8B 4KKAC 3RE0A 3VNIA 3UF9A 3BWAB 3NRFA 1ROCA 1BOGA 1W32A 3OG6B 2NY1D 2J8GA 1WZ1L 3LS4H 4HDIB 3FRPA 5BUPA 3UBXG 2GJJA 1XGYL 1E65A 2UX7A 4CDHA 2VZSA 1U3HB 1UGNA 43CAA 2QVMA 2OMVB 2UY7A 3PNWA 4HUVB 1KLUB 3R79A 5HULA 1R3IL 5G1MA 1KTLA 4MVBD 1RAMA 2ARWA 4E3TA 1FL6B 2D7NA 5IB1A 5F88A 4WSKA 3KFTA 2QCFA 2ICWB 4M5ZH 3LRGA 1KBJA 3S2MA 3BX7C 4YWSA 3IXTA 4JTHA 5JQ6H 3WG6A 4G6FD 3HU7A 5JUEH 3B8YA 4GY1A 1HGWA 5BUGA 3V0AC 4NP9A 3UC2A 2IMNA 1RV6X 2V8LA 5C3TA 2VMDA 1LE5A 2WVSA 4FZEH 3GO2A 3F7YA 3D33A 5H91A 4HZAA 5B7EA 1TFHA 1A6AA 3D12B 1R3SA 4HSOA 3P3TA 5D1QB 3QDMA 5ENWB 3PWPB 4N8CH 3VDAA 3P2DA 2ERJC 5DHVA 2K0RA 4GBXA 2OLDA 2ARJB 2X7LA 1BXNA 3SW6A 3NQ8A 3UXKA 5IJKA 3M43A 5FS5A 2VGFA 3TMLA 4MMZA 5J1AB 3DRTA 4JGJA 2XH2A 1A6UH 1JTPA 2DF3A 3X11A 4S3AA 4NKIL 4GRWH 3WIIH 5C0DA 2ZXGA 1G7QB 4NNXB 4JM0A 4TQIA 2DD8H 4W7UA 3GBML 4UTIA 2JJSC 2WYTA 4I5XA 4YS1A 3STZB 1QWKA 3JT2A 3VI4E 1HWWA 2J74A 2NT0A 4GHRA 2KLSA 1YCSA 3FCPA 2DM4A 4PJ5D 3EYUL 2C79A 4K3GA 1OHZA 2FSDA 5CU5A 3L7EA 3EOOA 3I3EA 2FIKB 4AIZB 1EJ6A 4W9JC 2J79A 3W1TA 4IK7A 1YIXA 1R9ZA 5HPMB 4NC1E 4LO9A 1PLBA 3SYPA 4E5XG 2YW3A 3IDYB 1YPZE 3IE4A 3AIWA 2PO6D 1H2JA 4GUGA 1U2YA 1ESOA 3SO3B 2O9PA 3A9IA 5AHEA 4JQ4A 3STBA 1Y7VA 3VFGH 5BS0B 4QXUH 1V3KA 5FJRA 1X5IA 2VLRE 4AMKL 3CVHL 5DUML 1EZVX 3PBWA 3VMPA 2EUZA 3LEXA 4MJ4A 5IESL 2QQLL 4O14A 1EAJA 1JPDX 3A3WA 2R2EB 2EG6A 2RH0A 2B2XH 4H88H 3WIHA 4WRHA 4QI3A 4N5ED 1IQWH 3G9VA 1PCKA 2J24A 4H8WL 4XP4L 1EZ2A 3H54A 5IHLB 3CZSA 3NOIA 3P0YL 1T41A 5LBVA 1CXIA 3D07A 3G1SA 4DAIA 1YEKL 1RULL 5BRQA 1L3WA 3B03A 1IM3D 4BI6A 2DWDB 1XR9A 5IW3A 3C09B 3EMCA 3IDNA 3T44A 1FPTL 1F9CA 1UC5A 3VFSA 1QBAA 4AEHH 3UWVA 1E4XL 2VLJE 5A3ID 5BRZD 2NUPB 2JALA 4KMLB 4ETQB 3UBFA 1UOKA 4PG9A 1FWIC 3E6FB 5GSRB 2I17A 5I5JA 3VO0A 1I4FB 4K23L 2ONEA 4POYA 2QCDA 2K4WA 2VO8A 4JFFB 2AC0A 4BEIA 5CJQL 4IDJH 1UEMA 3VXUD 4OZIB 5DJ8A 1HF6A 3WE6B 1VKXA 1KBLA 3MKVA 4DP4X 2OR2A 5FK9A 1TU2A 1XLCA 2P5WD 4OV6F 3FRUA 3BZ4B 1MUJB 1XIWA 4Q7BA 3W7HA 3VOJA 5EU5A 1QSZA 3CZKA 3KVMA 3DOSB 3OAWA 3KWSA 1XG3A 3VI4F 3NQFA 1O4UA 3QJVB 1VJZA 3VMNA 3GZQA 1JR1A 3IGXA 4GBUA 2B4CH 2AGJL 4Q58C 3TR2A 1U3YA 3F58L 1PYMA 3Q8EA 5U7SA 4KVCH 2WQSA 3RLVA 2XETA 5HGAA 4H9YA 4QRAA 3JSSA 4XWGL 2PLJA 4JD4A 1SXNA 3C08H 3G04A 5G2NA 4TQ8A 3N6QA 3LRKA 3B04A 1T5WA 2WHLA 3K1DA 2ZZ1A 2YD8A 3BK0A 4PUBH 1RLWA 4TSBL 1YPZF 2HYMA 4KZEL 1K2DB 4Y89A 3SDCB 4I3RH 2C1PB 1DBJL 2ACSA 2Q9OA 3M1BA 2IAMB 3DJRA 2R1PA 2RFXA 2DQJH 4HSAC 1BAWA 4Z7UA 4X98A 4FR6A 1JPMA 3MU3A 3I3BA 1R46A 1FZKA 2G4GA 2OMXA 5B3SB 1DVFA 3V0SA 5I8KL 1T0PB 1TQSA 3QAZC 2P1YA 5CJNA 4QFUA 3OKEB 1MW2A 3WUZA 3PL6C 2P8MA 3EH2A 1P4BL 4QXTB 5GGTL 1KJMA 3EYQC 1ZPTA 3G5YB 5DEFA 5DJZA 2A7NA 3BARA 2TAAA 4JO1L 2V7HA 1S2CA 1XP3A 1W17A 5EU4B 4TOYL 4WK0B 3OTRA 3WJMB 3UW6A 4TNEA 1IAOB 1EJWC 4LSVL 4GX8A 1I85C 1F74A 4S1DD 3SDXB 3DV6A 3PFQA 4WGVB 3JUZA 4Q14A 3U3HA 1IGCH 2W80C 3REQB 5JQ9A 1NCBL 1DJIA 1I8JA 4XPAH 5B3NA 1QR7A 3WFBH 4DF1A 4WJ5B 5KEZA 2X4QA 5C09D 1EGJL 1DE4A 1QSFE 2MHAB 5AB9A 4WK9A 1J01A 4M6NL 1WTLA 5D1XD 2A7RA 1HESA 3G08A 3MCLL 1XEUA 2JCCF 1HXKA 1JDAA 3KCJA 2CDEB 3HZVB 4C8XA 5ILTH 3MZNA 1Z5LA 4L3FA 3H9SD 1UKTA 2DVXA 1NAMB 4GSDL 1QR4A 1GHFH 1RZIA 3WY4A 1EA9C 1FWWA 4JTIA 3PJLA 4PJAB 1ZSHA 2HZGA 1R19A 2DIBA 4LVAA 2HQAA 2MH4A 5C9ZA 3MLVH 3O9WA 1GZHC 3PV7A 2BP1A 2IO5A 4DKTA 2PPDA 2XH0A 2IAND 2ZWZA 4JO4H 4D94A 3KLAA 3IU4H 2E25A 5I1KL 2GC7C 2ZA1A 5CEXA 3BH9B 2FJUB 1DP0A 2EDMA 5I73B 2XWXA 2EUXA 4D71A 2K4AA 3KZPA 4U7MA 5HVFB 1SLWA 5TNVA 1MIML 2F53B 3T8VA 3VSQA 2PW2B 4HT3A 2HPMA 3T77A 5CPQA 4ICMA 5JHLH 4GXVH 1QI3A 4LHUB 3VSTA 2VXVL 1YUHB 4AX7A 3NGBC 3GPEA 5GGQL 3NXFA 2BNQD 3GBNL 4FTVE 3Q01A 1YNPA 1EVTC 2CLFA 3HG1D 2E9MA 3NJJA 3CV6A 2ZX8A 3RZCA 5A8QA 3EJYC 1MHHA 1SJCA 1U8CB 4LJ3A 1Q6FA 2XFXA 3FQ4A 2V33A 5F70A 3O81A 4JZJA 2UX6A 3CWNA 4E2VA 1KGJA 4G8EB 4FQIL 5IFJB 2R1XA 4MY9A 2JQAA 2PB1A 4G42A 1W72H 3PHAA 4JDTH 4LPYA 3WUWG 1I9EA 1TCDA 3DRQA 3BG9A 4D0CB 4X9BA 4R7LA 1XLGA 3B6SA 4HOXA 5HMDA 2G8ZA 4YEFA 3FUMA 2EVFA 1XH2A 1VPOH 2YGPA 3MO7A 5A6MA 2Q0ZX 3SDAD 3WLWC 4HCRL 4G9FA 1MQRA 3SYCA 1YNKH 1X9LA 3RU8X 1MFCL 3DX6A 1BXCA 3RLSA 6XIMA 2CLIA 4Z3HA 3MBDA 4E0RB 1U5HA 3AUJA 4N0CD 1R0AL 5D1ZB 4BDVA 5GGVL 3CXFA 1P0SE 1N0LB 3W1NA 2OTUA 1T21B 3BIBX 2CJUL 5D7IA 5DJXB 3B37A 4JQXC 5EUOB 5I7GA 1Z9SB 1F18A 4ZX4A 3ZVHA 2VM8A 2OQLA 4ZL1A 3OGVA 1TWSA 1K4CA 3WMCA 3OVUB 4N9OB 4OV4A 2K78A 1PJWA 2G3XA 3P0WA 5LKYA 1SZFA 1CURA 3QZEA 2XH7A 5GJTH 1LL4A 2ROXA 3HC0A 5DSCB 3ITTA 2ZXDA 1Q4WA 3FCSB 2MNRA 4WJ8A 1WGOA 3QTPA 5KN5B 2VTFA 1QXLA 4M3KB 4G1MB 3IWPA 4PY7A 3CLFL 4OR1A 1QBML 1S5VA 2YW4A 1TETH 1HYRC 3THQA 2I5GA 2CBVA 4G43A 3S4SG 1XH0A 2Z4GA 1SBSL 4TYUA 3TT1L 1H60A 1VENA 2R2CA 1C8PA 1V3HA 1XZWA 4AF0B 3ROOB 2PP1A 4JN2B 2GG1A 1JHKH 1MLBA 4PUNA 1XBRA 5C5YA 4YN5A 4IP5A 4G80B 5KYXB 2VDMB 1MAMH 4LEOA 1J5OL 4DYEA 4XP6H 3QDGD 3BZFA 1ISZA 2ZUTA 2GC4C 1V6VA 5F7FA 2WCSA 3A23A 4C7GA 2BHYA 4GXFA 3B2MA 5CZXD 3BCDA 3TLLA 3HE6D 3V5DA 4PB4A 5B4MD 1T6VN 1XHGA 4P2VA 2OX5A 5JW4M 1L6ZA 4XE0A 2PRMA 3GFUA 3D8MA 3HAEA 5HP5A 5T1JA 5BZAA 1RCYA 2NZ9C 2DZVA 2VZOA 4ZXBB 5GZOD 4Q3MA 1OZMA 1PMYA 1IWAA 1Q6QA 1EHAA 3MRKA 4DTGH 4AM0B 4IM8A 4NCC1 3TF7C 3AT8A 1OKEA 2H9GA 3G5VA 2G95A 4F58L 3IJSA 2JKTM 4XWOD 4AIUA 4MAYD 1QLFB 5IF0A 4S10A 5JQHC 4R96B 4IMLA 2OR8A 2X1RA 3SODB 4JR9H 3LN9A 3B2VH 1TJXA 3GIVB 3MHFA 2NTFB 1FBIH 5IROD 1U3NA 1G1CA 2Y70A 4JFEE 4PJBE 3QQ0A 2XZCL 5ERWA 2E68A 5A6SA 1H0DA 1T5XB 5FF4A 1PCXA 1V8HA 2YIHA 4KWSA 5IW6A 3O6KH 2PWDA 1NC4B 4JFQB 3WLRA 1FNEB 4Q52A 5T1DL 4U3SB 4IX2A 4M51A 2DWTA 2IPTH 4ALAH 3TNMA 4QRSB 1WTGT 3UPMA 5LCVL 1P7QB 4K8GA 4LS1A 1O95A 1HL9A 3LXBA 3F7VB 3TU9A 3QEQE 1C7TA 3ARGA 2DW7A 2K6ZA 1GQNA 3C6LB 1W1PA 3B9OA 5I1GL 3HLAA 3TASA 2HX9A 5C0EA 3QHMA 4RRPG 5I15L 3LKPA 2OSWA 1X4ZA 3DTXA 3GC3A 4LFHD 4EDWH 4EOWL 1GG0A 2AZUA 3W73A 5BU9A 2H9AA 5C8JA 3EEZA 4CW1B 2Z24A 4FHAA 3FB5A 1JJKA 4B5EA 3VFNB 3FH7A 3A5VA 1V27A 5F7BA 4FI4A 3VH8B 4FFTA 1RIVL 2WZMA 4RKAA 1QA9A 5AKTA 3KOZA 1W3LA 1XYLA 5G2IA 2DZEA 3MBWA 4M5TA 3SQBA 1P7TA 2FZDA 3TR9A 4JX6A 4XKMA 2PDHA 1MW1A 3HS0A 1UQZA 1T1WA 3PDOA 4EKJA 2AEPH 4PGBB 2YCLB 2XN0A 5CBEB 3DG6A 5LQBL 4JQAA 3O3BB 4UINH 4PJDE 3Q05A 3Q06A 3SQOH 2WO3B 2XSXA 4N2GA 2P52A 1A22B 4Z7VB 1VRSA 1A0CA 3U7WH 1XLDA 1HHGB 3RPDA 3N18A 5DRNA 4MNQB 1XXXA 3LIZH 2F8OA 3RWFA 2J7BA 1BVNT 3REVA 3CAVA 5SV3A 2FJSA 3MRJA 2UXVA 4ZO7A 1TKWA 5GRUH 1HL8A 2EXWC 1FDZA 3HGRA 3V4VA 1JQXA 4OZ4A 3EG9A 1W2KT 5HYJD 1LK3H 2YEZA 4ZG1A 3FCTA 3JWNH 2COVD 3NJGA 4DO5A 3D3VB 1OJXA 2NXHA 1EEYB 3DO7A 5L8KB 3REWA 4L56A 1RPXA 1SJHB 5A2LH 3EDDA 2Y3NA 1NCWL 1ZA6B 4DKFL 3ALPA 2R1YA 4FQXB 4TVPL 1Q8JA 3VXMA 3WNJA 4M48L 4MCMA 1M05B 1K8CA 1TWDA 3GBEA 5J04A 2VITA 4PJBF 5A8GA 1Z8AA 2IUZA 3KS0J 2XPGA 5IJBC 2WZIA 4TQTA 4EEEA 3L1OL 4PYGA 8RUCA 3BPCB 4U1LB 4WO4A 1TNMA 3A6BL 5D72L 3AHXA 2B1HL 3I02A 3D6NA 1ZANL 3PK7A 3C5SA 5HDRA 4LVDA 5AHIA 3FQWB 3ZIYA 3MXVH 3QI9B 4H8VA 3EFFA 1F6PA 1C5BL 4Q6IB 4R88A 1WITA 3M86A 5TDNB 3KG5A 1ZT4B 3EJRA 1I3RA 1IQDA 2YPLD 2D0GA 2X4UA 4NQEB 1SM9A 3EDKA 5KJ4A 4ZMWA 3HOJA 2BHUA 1D6VH 3MT1A 4PMNA 3TYZA 3E1F1 3F04A 4R4BB 1UP2A 2CO4A 2C3XA 1NIBA 4FG6C 2C3WA 1EP1A 1GC1L 1AGFB 4YGVB 4A3UA 4NBXB 3IDIA 4FHBD 2CZ5A 2VH5H 3PSWA 1I3GH 4D7BA 5JO5A 4KNSA 2VM4A 3OHXC 2HRLA 3N40F 3ERPA 2FH6A 4YDIH 1ZT7A 1UWRA 3A0OA 2ZOOA 4ODXB 4YCPA 3NQDA 1QW8A 2W9EL 4HN4A 3RL1A 4XN1A 4RGNC 1YLVA 4IYKA 1LK2B 2CLRB 2IQ0A 1KPUB 1GTFA 3DV4B 1UROA 2I5IA 2VMJA 1DSYA 1QRNB 1AK5A 4HYVA 4M6QA 4PBDA 4KFPA 3P2BA 4U49A 4ZS6C 4MYPA 2E7LC 3EJUA 4HHHA 2GOUA 4MUZA 2CWXA 3BT2L 1CMOA 1XGQA 4PJDF 3W39A 4EPEC 1R9FA 2ZOWA 1XR8B 3DX2A 1HQ4A 1I7ZA 2GSJA 3US1A 3ZDZE 1R2RA 3NBNA 4DZBA 5D6DC 4BQ2A 4WKXA 2WMJA 3QEUB 2FSEB 2GT9A 5TDPA 4P7QA 2O6CA 4YVNA 1MCPL 2HT2C 4N0UB 2EE3A 2ODOA 3SGKA 4XB3A 3N6HA 2OV0A 3BANA 1X5FA 4CC1A 2MUCA 1RI8A 4ZQKB 3QJXA 3OXRA 1RZ8A 3PP7A 3WNLA 3PGFL 5AHMA 3UNTA 4NO2B 3DFOA 1JRHL 1A5LC 4MAVA 4F8XA 4P9MH 5ECVA 2R2HB 3FBQA 1YNLH 4BUGA 4NRYA 1B4KA 2OL3B 1G7VA 3ARDD 3ZTDC 1T2XA 2OXHB 2CSPA 3P84A 4U4MA 5C7HA 1J6PA 1H61A 4HH8A 5CG7A 1HL4A 2HISA 4P9HH 1L0QA 1EAPA 4NRZB 3KRBA 1XB8A 4JFOA 4GI8A 5F1KC 5DFVD 3ELQA 3K8KA 2N7BA 1D5IL 1HX0A 1C7SA 3OX8B 2CBUA 1ZKAA 3TX9A 1F76A 3IJQA 4KROC 3OZ9L 3BHBB 2A21A 3FO2A 2QDEA 4MD4A 1K77A 3CU7A 1XSKA 4JM2B 4LS0A 1YQVH 1RHHB 2XOTA 1WFOA 5DJ2A 2KL6A 4QDPA 3SHSA 4DB7A 2YCIX 2FWSA 4QHUB 1KBWA 3HMXA 3G3LA 1KLFA 2Y3AA 1ICSA 4H1ZA 1ZNNA 1M6OA 4LCUA 4HWNA 3O2WL 5DD6B 4O0ZA 2FZ8A 4UT9A 4IU3A 1UMLA 1RY8A 1RBLA 2YZ1A 2YMXH 4EBQH 4ZTOH 4G7QB 2MRYA 3H6AA 3D25A 4Y4HC 4JTKA 4KOCA 4ONOA 1GGYA 4Z1YA 3KCLA 1QT1A 3T71A 3G5XB 3WEAA 1S9YA 3VCLB 3PXJA 4W8AA 3KLHC 1YDPB 2Y7OA 2OWCA 1DUYA 4G59C 3VX0A 2DQFA 2XWRA 4LUJA 1B3WA 1E5ZA 4P23A 3IDMB 4OBTA 4NZDA 4IP7A 4QDWA 1AY1L 2EDJA 2MKLC 1QFUH 3W7JA 3L08A 2ADYA 3WBEA 3WFEH 1I9IH 3O8AA 5I5IA 1P6BA 5FCZA 4OLZH 1M65A 4AT6A 2E5EA 2D22A 3ARBC 3MXWH 2C1HA 3EYPA 3T9WA 3ZDZF 1IE7C 2BFVH 4DP6X 4ZOBA 1QFEA 2EEXA 1U8NB 4I5BA 1N82A 4B5XA 2ROYA 3OAUL 3H9YA 3PZUA 2IF7A 3U2IA 3WD3A 3QCTH 2CLKA 1X7TA 3HPZA 4F33B 4PRPA 4L3ED 5C70A 4PL1A 4CEXC 2X0HA 2VXTL 5I8EA 4NSKB 4GUOA 1E0WA 1MFAL 3G6AA 1GS7A 4OM0H 1FDLH 1QSVA 1G9NC 3DVNB 4KEVA 1HJVA 2EIDA 2WBWB 1ZS8A 4LY8A 4R8WL 4K9JA 1HP4A 2V4LA 3ZTCC 3QDJB 4F8QA 4Q8MA 3QHFL 1EJVC 2QADC 2O9TA 2QQQA 1NUFA 2G60L 2EDFA 3ML9A 4XVJL 2QJIA 2L0DA 2G9KA 1K8DB 4JG0H 5AVSB 2NQ9A 2DLGA 5T1KA 4J8RB 3NQ2A 5DT7A 2ITDA 4NQDE 3HZKA 3R2GA 4GXUM 2NZIA 5FAAA 3KR3H 1QO5A 3TVMB 4PV9A 2WQAA 4H0GA 4HIQA 4IGBD 3CN0A 1Q6DA 3CTLA 1FCBA 1IEQA 3S5LG 3OR6B 4YSRA 2O9OA 4G8GD 2A3CA 3IRPX 3IETA 2IGLA 3VK5A 4QMEA 4XTRD 5CXPA 4AW4A 1M9HA 4FI6A 2EH8H 2NXYB 1D6EA 1HSAB 2GFBA 3D85B 3G6JB 3U46A 1H3GA 5DY2A 1AE6H 1PB0A 2O1AA 4U28A 3WKZA 3EOTL 2CHXA 4LLDA 1DIDA 1CGTA 3RZWA 3L4UA 4GA8A 4Z2IA 1DSFL 3NG3A 4L8CA 3LQGA 2V5SA 4HWBH 4AQOA 4LCWA 1SVZA 4ZPTB 4HYRA 5K9DA 4R2GD 5HHMD 4XTDA 1T7ZA 3LA4A 2AMGA 1ILSA 1D9EA 4XC1H 1L9MA 2E9BA 5AW8B 1LQ0A 1FHVA 3SY6A 1J8RA 3KWWA 2E6QA 3W9ZA 3P3YA 1OPGH 3WJXA 3AISA 1JYXA 3EJJX 2C3GA 1PKQB 3OB8A 2H3DA 1IGJA 1OSEA 2B08A 4QRTA 2Z1VA 3H2AA 1AKPA 2GPTA 2BVUA 3WBYA 4FKEA 3FS2A 1OCRB 1LYQA 1QASA 2VE6B 3SBQA 4X4KA 1I3VA 4DXVA 4YUEL 2FD6L 1IGTA 3V1HA 1B4JL 1FWCC 1UCTA 5E6ZA 3AYTA 4JS7A 3FO0L 2ZKHH 1NLDL 5DI8B 4FNTA 1OINA 3IDJB 2Q7AA 5EZIH 4GJIA 5EMJA 4S2CA 4ATLA 2TRSA 1BF6A 2BNRE 1DVYA 1ID2A 3HFYA 3UWQA 3W53A 1MNUL 3U25A 3QNFA 4HFUL 3APDA 3ZO0A 5DHYB 1OC7A 4AUYA 3GC5A 1W16A 4KUZH 4CU8A 2OO0A 1R9XA 5FHAH 2X5PA 2FNBA 1MI5B 1GYNA 3FHQA 2CUHA 5AOMA 4NWUH 3BPNC 1EC8A 3L81A 3VXTB 4AY7A 1DVXA 3KVKA 4DJFA 1AQHA 5GJMA 4JRLA 3U7VA 1HI6A 5D2WA 3QNXA 1F07A 1O66A 2AMUA 5I1JH 4C4BA 4MNGB 4OU3A 4H9ZA 2AMXA 4FFVC 4L1HA 4K55A 1LL7A 1VGAA 3RKDC 1HHHB 1PZ3A 3TBCA 4ZRGA 5E6IA 1CXLA 2WMIB 4ICCX 1WDQA 1IXPA 4MCNA 1M7OA 4PRHB 3CUXA 1E5JA 5E7FA 2JB5L 1B0RB 2R2BA 2PPGA 1TA3A 4GNJA 5GS3A 3CBKB 2NLJA 4X0KB 2YXFA 2Z27A 4ZSOB 4LEXH 1IGMH 4ACZA 2OZ3A 4PMFA 4QE1A 3D2UA 3T40A 1VZHA 3SM0A 5LYRA 4B97A 4OHQA 3FT2B 3A6CL 3BEVA 4D9RE 4FKKA 2H5UA 2HT4D 3LTSA 4QRRE 1FZJA 1SYVA 2OW6A 5JW5B 2ESVD 1P7HL 4PTUB 1P2CA 4UAOB 1BYBA 3NIGB <