2WVUA

Crystal structure of a michaelis complex of alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-l-fucose
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
437
structure length
437
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 159
structure length 437
sequence length 437
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvuA01
1PS3A 1KBKA 1JFXA 3A23A 3WEMA 1AQHA 2QF8A 2EPLX 3CLWA 3MMDA 1ISXA 3GXFA 4J28A 1XV8A 1ZBCA 1GONA 2GDUA 3DYOA 1ITCA 1OD8A 3UETA 2YBUA 1Q6FA 1HKJA 1OT1A 1J18A 1VB9A 3EMZA 3L4TA 1HJUA 3WNLA 4QDMA 1G94A 3WF3A 1CLXA 4NXSA 3WKZA 2IXVA 4CVUA 3KE0A 3F5LA 5A2BA 4DO6A 3MSDA 4DWSD 1VF8A 4JKLA 3GDBA 3SCRA 1GPFA 1QNOA 2UY2A 3RJXA 3M07A 3LXBA 4S3KA 1QHPA 2NT0A 2WHMA 1FHLA 1WE5A 2WCGA 2VX7A 5CSUA 3GXDA 3DDGA 2YLAA 1MW0A 4HMDA 2B31A 4BA0A 1E0XA 1HL8A 3DX2A 4CU7A 1E70M 4LYQA 3EJUA 4KGLA 1M01A 4B3KA 1TQUA 3BMWA 4TVUA 3MUIA 2A3HA 4WK9A 1V02E 1E6PA 2V3EA 2ESCA 2G3MA 1C92A 2J7FA 1SMDA 4AZIA 5EB8A 3AZRA 3WFLA 2BVDA 1UKQA 2IGTA 1QOXA 1GVIA 1EHNA 1QBBA 4J7RA 3WDQA 1FFRA 1W2VA 1WKYA 1HP4A 1K9TA 2XN2A 2DT1A 4GZJA 4AYSA 4WKHA 5C8BB 2J7CA 4PEEA 2PWDA 3AI0A 2YA2A 2OWCA 1CTNA 1PEZA 3BVWA 2AMGA 2TAAA 4LGXA 4PMQA 1J0JA 4CN1A 3ZM8A 4PMDA 4PCSA 1V08A 4A3HA 3LXAA 3S5YA 3W6LA 1W32A 3N9KA 1E56A 1NWUA 1LG1A 5CZKA 1VIWA 1ZS2A 1HXKA 3PZVA 4MDOA 4R5EA 4P7RA 4LXFA 3CHFA 1B3YA 3THDA 1ZL1A 5E9AA 1JI2A 1PJ9A 4AY1A 4URIA 1NWRA 1HKIA 3T0DA 4U31A 3GXMA 3BMVA 2VI0A 4OBSA 3AXHA 7A3HA 4MB3A 1UWRA 3GH7A 2ZXAA 1J10A 4AD0A 2YJQA 2ZUUA 4DUWA 3BUQA 2F7OA 4N42A 2UY5A 2WMGA 1LL4A 3PHAA 2BHUA 2ALWA 2JIWA 2WM0A 4NF7A 3CZGA 2YIHA 3VD9A 1JZ3A 3VX0A 2WMJA 4B9ZA 3WQ5A 4CCCA 4WSJA 3ZMRA 1S46A 3LRLA 4J3VA 3CZNA 3DX0A 1VJZA 5HNNA 4ACZA 2JFEX 1MQPA 2VRKA 4GI6A 4Q7NA 1JIBA 4GO8A 1GOMA 4C7DA 5BXSA 4ZE5A 4D71A 5BCAA 5CJ5A 3W28A 2WSPA 2VTFA 1UR8A 2WWDA 4CKQA 2G41A 2J74A 2ZUVA 3J7HA 4ACZB 2W63A 1HJSA 2W91A 2VO5A 1UWSA 4V2XA 3W53A 3MV01 4OJYA 1W1PA 2W66A 3A47A 2VVSA 2QV4A 1KQYA 3TTOA 3VGBA 3HN3A 3WQVA 3GYCA 2XN1A 1DWFM 3B9DA 4ZEPA 4W93A 2BV9A 2BXYA 2XJ7A 1HTYA 1KWGA 9CGTA 3S2CA 3D50A 4H8UA 3II1A 2C7FA 4HMCA 4M56A 2A3CA 3AZTA 1JXKA 1UA3A 1J01A 1TE1A 4GZEA 2PI6A 1JF5A 1UR1A 3NSMA 2WMKA 4U3CA 4AMXA 2CETA 1QBAA 1DHKA 5I0DA 4OGZA 1GHRA 1CPUA 5BRQA 3IANA 1G0CA 3AS2A 3O9NA 1CLVA 4DO5A 5IDIA 3UG5A 2W61A 1MXDA 1C93A 1UKOA 3L4XA 4RE4A 2V3DA 3D4ZA 2WW5A 2C8NA 3WD1A 3U5UA 3POCA 5HXMA 1LG2A 2E8YA 2WZEA 4EAMA 4PRWA 5DEZA 1DWGM 3TTQA 5EFDA 1VFOA 1O7AA 2ZICA 1TA3B 1BFNA 3PTKA 3ZQ9A 2GJXA 3CC1A 1DP0A 3VIFA 3ECQA 3CUHA 4J3TA 4JFUA 3MU7A 4UFIA 3CZKA 4W8AA 2XGBA 4D1IA 1LL6A 1UD6A 2W4XA 1KR0A 4FF5A 3VKKA 2ZOXA 1OIFA 3AHTA 4MNMA 2JEQA 1UA7A 3ZOAA 2W62A 1EH9A 1IT0A 4W8LA 3WY2A 3BUPA 3BUDA 3HU7A 2Y2WA 2J79A 1JDCA 2OWXA 2OLHA 2GDVA 5CQ1A 2D0GA 2VNCA 4HZ8A 4U2YA 3UR8A 5TD4A 2V5DA 1C7TA 1G01A 1UWQA 2RGMA 4AISA 1EXPA 3AOFA 4KRUA 2YKKA 1F4AA 4MAVA 2E9BA 5DT5A 2DIEA 3OLIA 3K4DA 2CESA 1Q6GA 1Q6CA 4HP5A 3N18A 3BVUA 1JL8A 2BY1A 1BG4A 4UR9A 3QR3A 3SUVA 5E6YA 3VINA 4QCEA 4A3YA 3VMPA 1E4NA 1V03A 3VGDA 3FW6A 1V6WA 1MWOA 1UR0A 4PCTA 3PZ9A 4JFVA 1V3LA 1A3HA 1EDQA 3RM8A 1H5VA 3CUJA 1G9HA 2FGZA 4GINA 1HIZA 1WDRA 4CUCA 5FL0A 2O9RA 3WMSA 2WVVA 2YA0A 4C7FA 4PSRA 2EPNA 4H8VA 5D9OA 2CERA 4IM4A 1MW3A 4TX6A 1WZKA 4NZCA 2JE8A 3HZ3A 4BCEA 1QNRA 1D7FA 3HMCA 4QLJA 2FGLA 1XCWA 3EMCA 4UFHA 3TTSA 3T09A 4U3AA 4D6DA 2OYMA 2J8FA 1KGXA 3K8LA 4PTXA 4NZFA 2ZX7A 1KXQA 2Y8VA 3ARZA 2CEQA 5IHSA 1R8LA 2GK1A 2OSYA 4YN5A 4CU8A 3BLBA 1CXHA 1BAGA 2VX6A 3VSTA 1ITXA 2DT0A 4TXEA 5A8MA 3CZSA 4W7UA 4TOQA 2V38A 3VIIA 1WO2A 1PX4A 1LF1A 3BUIA 4BQ3A 2DQXA 2V3FA 3UG3A 1QI2A 4JKMA 3LX9A 2WHKA 3ZSSA 4P7LA 1XH2A 3CZEA 3OIHA 4F9JA 1EO5A 4A4AA 1UYQA 3SCOA 3CIVA 4AWEA 5BXPA 1QI5A 5HBFA 8A3HA 1D2KA 1JZ5A 1NP2A 2D3LA 1E6RA 3A6OA 1E5JA 1V3JA 4BQ4A 2WZHA 2V5CA 2FH6A 3ARVA 3KZSA 4FLRA 3EDFA 3ARYA 2ZX9A 3SCPA 3AYRA 4J3XA 3W24A 1CIUA 3LPFA 1GQKA 2J7EA 4EANA 1JXJA 4W7WA 3LRKA 4OBRA 1PX8A 2PWHA 3VIOA 1OGSA 4XX6A 5LA2A 2DPEA 3GBDA 5E1QA 2PBGA 3WF2A 4W5ZA 1BLIA 3ARTA 1BF2A 1J12A 3RM9A 1MXGA 2XIBA 2DSUA 5I79A 3N15A 2XTKA 3AXIA 2ZUTA 1GUVA 2C0HA 3BXWA 1E1FA 1PPIA 1XSKA 2WCAA 4F9DA 2YA1A 4W88A 3VU2A 1J9YA 2VC9A 4UOQA 3FHQA 3WDIA 2DDXA 1E4LA 5IFPA 3VIJA 3AMGA 5GNYA 3T0BA 5D8ZA 1CENA 1MFVA 3LPPA 4UZUA 2F61A 2VZOA 3NCOA 1WZMA 1TA3A 4GZIA 3EDJA 1GOQA 2YFOA 1PZ2A 3TONA 1V3HA 4AD1A 3ARXA 3CHEA 1QI0A 4DO4A 1RP9A 2O9PA 1W1TA 1VFMA 4JHZA 4W84A 4JCLA 3AIRA 2OSXA 2XFYA 1DWHM 2GJPA 2J77A 4GI8A 3VDAA 1TZ7A 4RE3A 2YDRA 4W8BA 3FHAA 4LX4A 1C90A 1K9FA 2XM2A 1J0IA 1CZ1A 1FP8A 2A3AA 2YL6A 2XM1A 1XRVA 2WMHA 4PMXA 4CD6A 4F8XA 3WY1A 6CGTA 1JG9A 3L4VA 1JDDA 4WSKA 2XVKA 3BUBA 5IXEA 3EJQA 3WY4A 3VTRA 5D9MA 1ZBKA 2WHLA 4S3JA 3ARPA 1I1WA 4M8UA 3LXCA 2PC8A 3WQ6A 1BGAA 2QLYA 5BXTA 1SR0A 4QAWA 2E4TA 4PMOA 2BHZA 1JD9A 4KWUA 1H41A 3RIKA 5A6SA 1T0OA 3BVVA 1XD0A 3SIMA 4Y7EA 2VRJA 4X0VA 5EMYA 4F66A 1E55A 4MPKA 1MQQA 4UQEA 3HG4A 3BLPX 4PN2A 4U2ZA 4AEEA 1B3XA 3GXIA 3VILA 3VD4A 1K9DA 4AYGA 2CKSA 4E2OA 3K8MA 4OKDA 2F7PA 5E0CA 1A47A 1AMYA 4Z2LA 3OBAA 3N13A 4C7GA 3WMBA 5LA0A 4AC1X 2F7RA 2DH2A 4NI3A 4FNQA 1ISWA 1E4IA 1M04A 1HVQA 1V02A 4W5UA 2X1IA 3EDKA 1J0KA 4AXNA 4AZ5A 2VVNA 3L4YA 2XFFA 6TAAA 3CZJA 3AROA 4AZCA 1XSIA 2Q8XA 1Q6DA 3MV11 4PUDA 3KL3A 1HJVA 4KMQA 2YDSA 2XSAA 3OGRA 1R86A 1CYGA 1OIMA 2YLLA 1QHZA 4AZ7A 3OG2A 2QPSA 2J4GA 2PF0A 4CD7A 4CCEA 1OGGA 2JALA 3IAPA 3W25A 4X0NA 4H04A 1RH9A 3VIPA 4M81A 1M53A 1NOFA 4K68A 3PTQA 2DSZA 1UHVA 5CGTA 3QOKA 8CGTA 1ISYA 4L4OA 3WD3A 3WEZA 1E43A 3AYSA 1GQIA 2D3NA 4OZOA 1DWAM 2WBGA 1CDGA 2BVYA 5C70A 2IXUA 3HG5A 1W2PA 5AC4A 5A6AA 1ODUA 3O2LA 1D3CA 4HU0A 2A3EA 1B9ZA 4HOWA 1CXEA 1V3KA 5CXPA 3RM4A 1JYNA 4FNSA 3K1DA 1V0LA 1WZAA 1FA2A 4B9YA 4HOXA 1CXLA 3W38A 3TTYA 4M82A 2FHCA 1E15A 2VMFA 3RILA 3A4WA 1BYCA 1X1NA 3MUY1 3H53A 3A4XA 2G3JA 1V3MA 4H2CA 1VENA 2E9LA 5BROA 1MVYA 3LMYA 1Z32X 5I6SA 2XFRA 3A21A 2ZWYA 4OIFA 1U33A 2G3IA 1NOUA 3AHZA 3VOCA 4JL2A 1QNSA 2WANA 2G4FA 5ABFA 5BWFA 4CGTA 1HJXA 4E4PA 1QX1A 5A8QA 1UWUA 3S6TA 3AHXA 1KR1A 1UZ4A 3UG4A 1J11A 2EPMX 1G1YA 5FOOA 1CGUA 1OBAA 2X0HA 5JBDA 3BGAA 1FOBA 3KEHA 3ZJ7A 1NQ6A 3VO0A 2J8GA 4CVWA 1HNYA 3OB8A 5F7UA 4HTYA 3OLEA 1CGYA 3A5VA 2OYLA 1CGTA 2WYSA 1AQ0A 2O92A 5FL1A 5I2UA 5JBFA 2D0HA 3VPLA 3WMCA 1GOOA 1BTCA 4D6JA 3T2PA 4ATWA 2D1ZA 1GW1A 3WUGA 1UKSA 3BAKA 4FLSA 4XUYA 1PBGA 1HKKA 3L2LA 3B9EA 3TOPA 1E1EA 4HMEA 2WLYA 2G8ZA 3D3AA 4CU6A 3A24A 4HU8A 1C3FA 2WHJA 2X8RA 2CPUA 2WB5A 4KRTA 2BHYA 1VFUA 1H11A 1QWNA 2WVUA 5A2CA 1HP5A 5I3DA 4MTVA 3BVTA 3WDJA 2Y8KA 3GH4A 4OOZA 1TFVA 4M80A 4J27A 1GQLA 1E9LA 3WY3A 1V0KA 4ATLA 4FNRA 4YHGA 4Z2IA 3CMJA 1WDPA 2NW0A 1TQTA 2F18A 3LPOA 1CXKA 4P8XA 1NH6A 1FH9A 5HPOA 1XCXA 1JYXA 4FMVA 4Q22A 1VJSA 2ZUMA 3NYDA 2BS9A 2YFNA 1HF6A 1MW2A 4UQ9A 2MANA 2EPKX 2DH3A 1R7AA 1CECA 2WXDM 3GXTA 5D9NA 1RPKA 3VIMA 1ODZA 3EJRA 4RL3A 3WH5A 1CXIA 1QW8A 1VEOA 4PMVA 5GNXA 4GXPA 3QHOA 1UD5A 2QHAA 3W0KA 2VX4A 1CGWA 4DWSC 1E6SM 1HL9A 5EBAA 3VVGA 4U5IA 1EDGA 3N04A 4J3WA 3CZLA 1EIBA 2XIIA 2WBKA 4XZBA 1EO7A 1TQWA 1PX3A 2F8QA 2FE0A 2XWDA 3EMQA 3BSHA 3CHCA 3ARUA 1WPCA 1OGBA 3VDHA 3BC9A 2EADA 1RP8A 1JZ6A 2CKRA 3ZIZA 4HA3A 4MB5A 5I77A 4IPLA 1QI4A 1HJWA 4RE2A 2FYVA 4NX0A 3NSNA 1W3LA 3N1AA 1EGZA 3W81A 3GNOA 1PZ3A 3ARRA 4J3SA 2D22A 2UY3A 4J3UA 2XHYA 3UESA 4CD4A 3I3BA 1R7OA 4QCFA 5AYIA 1FHDA 1Q4NX 5ECUA 4D6CA 3F5JA 2PBOA 3VD3A 1TUXA 3F5KA 5GPRA 3OA5A 4TX8A 4FNUA 1GORA 5ABGA 1E40A 2ZUWA 2XWEA 1TVNA 5GQBA 1BYBA 1OT2A 3APGA 3WD0A 1OB0A 3RPMA 3SCWA 3DHPA 4JHOA 1TQSA 5CPQA 2VL4A 3SUTA 1BYDA 3T0AA 5AY7A 4L4PA 4OUEA 4BS0A 2QMKA 4YPJA 4IISA 2WMIA 2YBTA 3AIWA 4U5KA 3W29A 3MANA 3VIGA 2ZX5A 4JCMA 1EQCA 1Y7VA 4NSBA 3T08A 4BQ2A 3S5ZA 2J25A 1R75A 4AIUA 1XHGA 2DEPA 4PUEA 4ATDA 2DGAA 3G6MA 3W6MA 2WMIB 3KLLA 3MI6A 2E9MA 3RCNA 1W9XA 4MJ2A 1IZJA 3WNNA 2X2YA 2VT0A 3K46A 1UUQA 3QGVA 3PZOA 3BAYA 4LPCA 5A6JA 4P8UA 1L8NA 1JNDA 1QVBA 5A6KA 4PSPA 1WAWA 1MQRA 1EHAA 4TTUA 2VR4A 2EQDA 1C8QA 3VD7A 3RMEA 3B8SA 5HOSA 4ZENA 5M5DA 1V3IA 4WIWA 2VX5A 4DUVA 2V3GA 1U2YA 4QP0A 4PMYA 4QLKA 2VZSA 3PZGA 2W67A 5CLWA 5A8OA 3VDCA 2CHOA 4XV0A 5A6MA 3K8KA 4NZJA 3ARQA 3DDFA 2FHBA 2J75A 4UQBA 4GO9A 1FH7A 2X05A 4Z2JA 3POHA 1E0VA 2WKGA 3VUPA 1UD4A 3CO4A 1HVXA 3GM8A 1C91A 4PBGA 2DT3A 3ZR6A 5CSYA 2ZXBA 3IK2A 2J7DA 4ML4A 5DO8A 1B30A 4OOUA 1O7DC 1XH0A 3VGHA 2PB1A 5HDRA 3MUZ1 5E70A 1WB0A 3TP4A 4JKKA 5CPTA 3NUKA 4W89A 1GNXA 1I1XA 1JI1A 3KWXA 2D24A 5A2AA 1YHTA 3WDRA 1UR4A 1IV8A 2JEPA 1QPKA 4TUFA 3TA9A 4PTMA 1KCKA 3BAIA 3L4WA 1FP9A 4P7NA 2UY4A 3AS0A 1J0YA 5A6BD 2D23A 3MO4A 5CG0A 1LWHA 3WIJA 3OLGA 3CHDA 3UR7A 4FNTA 3WNOA 2FH8A 4H8HA 4YHEA 1R46A 3CUIA 5M03A 1JYWA 2VRQA 5LA1A 1UOKA 5BXRA 1KBBA 2CIPA 3EDEA 1E5NA 2XUCA 3BH4A 1JZ4A 5JIPA 4DWSA 1O6IA 3SUWA 2YDQA 1KTCA 1BG9A 1QWUA 1KB3A 1FFQA 1KTBA 4AZGA 2WAGA 3RO8A 3EDDA 3RJYA 3VGFA 5FKYA 4EKJA 1LJYA 2J7GA 1U30A 4UFLA 3ZSTA 3VD5A 2PWEA 2CCRA 2Y5EA 4MDPA 1UD3A 1HWWA 1H3GA 1XSJA 1XGZA 3WQWA 3UERA 2EJ1A 2GFTA 3U57A 1R87A 1NWTA 4W86A 3SCNA 2VCCA 1UH3A 4LQ1A 4W85A 2DIJA 3FN9A 3WL1A 2YOCA 1QHOA 2PWGA 2XSBA 3VSUA 3DX4A 3BAJA 2XVPA 2DSVA 3ZR5A 3GNRA 1VBRA 3RDKA 1TCMA 2AOSA 4AEFA 2ZUNA 2EABA 3UEQA 1R33A 3OGVA 4BQ5A 4CD5A 4AZHA 3WNMA 3SCQA 2CHNA 3SCSA 1KCLA 1M7XA 4MJ4A 1XC6A 3WF4A 3W4RA 2ZWZA 4MAZA 1HX0A 3WSUA 1E73M 2J7HA 2E8ZA 2XN0A 5I24A 1K9EA 2E3ZA 3ZJ8A 1JFHA 2Z1SA 3WD4A 4ZE4A 1JGIA 2J62A 2EACA 1J0HA 1JDAA 1ESWA 4IUGA 4UNIA 2OW6A 3VIHA 3ALFA 1GOKA 5D4YA 5I23A 3EJPA 2BNJA 3WBAA 4NRRA 1AVAA 5I78A 3K4AA 1JYVA 4KH2A 3IJ8A 3AFBA 1SFSA 3WUFA 2DSWA 4JL1A 1PAMA 1BPLB 3PZMA 3QOMA 5A95A 4DM1A 1XYZA 3BLKA 1W91A 4FNPA 1E0WA 2WPGA 2WWCA 2D20A 3G6LA 3U7BA 2ZXDA 3WNPA 3MKKA 3QHMA 2YL5A 4UFMA 4B15A 1GOWA 3D52A 3L2MA 3WF1A 1EOMA 2GSJA 1OCQA 3PBGA 3CZ8A 2AAAA 3ALGA 2NT1A 2F2HA 3GNPA 2Y4SA 3WUEA 4N0RA 2BY3A 1W9VA 4AD4A 3SCTA 5A8PA 1KWKA 1HKMA 3GTNA 2JF6A 4WJXA 4D1JA 1ISZA 1JAKA 1LWJA 2DSKA 1NWSA 4AIOA 2ZX6A 4UFKA 1R47A 3IGUA 4DWSB 3EBVA 3EJSA 2X2JA 1Q6EA 3WFZA 1W9UA 1W1YA 5CPSA 3SUSA 3VIKA 1W3HA 3WQ8A 3H55A 3BCDA 2UWFA 4PTWA 5KZ6A 3NSXA 2WC3A 1V0MA 1V0NA 2VJXA 3M46A 1KGUA 1OINA 1MYRA 3PZNA 1BQCA 1UWIA 3OGSA 5FD0A 3U5YA 1QNPA 2BFGA 4AD2A 2VURA 1H0GA 4F79A 1NM9A 3VSVA 1UG6A 3AS1A 2J78A 3OLDA 2WK2A 4WF7A 2W5FA 3HG3A 3N12A 1R34A 4MB4A 3WQ4A 1X6LA 3WBEA 4R27A 1W9PA 1E6ZA 1LQ0A 1C8XA 5D8WA 3WNKA 1HT6A 5E6ZA 4UQDA 2EPOA 3ARWA 1UKTA 3SURA 2CBUA 4AW7A 3AQUA 1R85A 1E3XA 2X09A 4CN6A 3QHNA 3KL0A 1E71M 4HPHA 2OWWA 5KEZA 4CN4A 3T2OA 1J0ZA 2CBJA 1KGWA 3W37A 2CNCA 3WH9A 3W27A 2EXOA 1I75A 1EDTA 4Z2KA 3DC0A 1QW9A 1E72M 3TV8A 3IJ7A 3CMGA 1SMAA 4MNKA 3SCVA 2VZUA 2WC7A 3NIYA 3AMDA 3AJ7A 1E6QM 3AMCA 1HJQA 5M3WA 3VDBA 5AC5A 1E4MM 3O6AA 1BVZA 3THCA 1N82A 4MNJA 5DF0A 3B9AA 3WL0A 4B16A 1TG7A 1V6VA 3EYPA 2ZUSA 3BVXA 1IZKA 2F7QA 1US2A 1KXVA 2CXGA 1BGGA 1KQZA 2GVYA 1M03A 3OZOA 1UQZA 3UCQA 3MUAA 3BAWA 4FLOA 3FY1A 1HN1A 1V6YA 4DM2A 3T2QA 3AIUA 2EO7A 4JIEA 1W9DM 3I3DA 5DFAA 1TVPA 2ZE0A 1ZU8A 3PZUA 1X6NA 2CBIA 4AMCA 3AIQA 2IUZA 3WDPP 4MADA 3D5HA 1VAHA 5M17A 1UKPA 5E09A 2BXZA 4UCFA 1EOKA 4JAWA 4BZYA 3DX1A 1BYAA 2WLZA 1ZBWA 3WH7A 1KFWA 2VQUA 5BRPA 1OD0A 1UR9A 2O9OA 1JD7A 3AISA 4PMNA 3WENA 4ZFMA 3FAXA 1QI3A 4UFJA 1PIGA 5ABHA 3VM5A 4NXKA 4JFWA 1UH2A 1RD6A 4W87A 4X9YA 3ZT6A 2XVNA 1W9BM 2YL8A 3AIVA 1B2YA 2HVMA 5AYBA 4UQAA 1VEMA 3A3HA 1TQVA 1E6XM 4AD5A 4Z2GA 1HXJA 1NP0A 4ZXLA 2WNWA 1QNQA 5BYWA 4CCDA 1SYTA 3H54A 5DMYA 4AIEA 3AHVA 2W92A 1JZ8A 1WNOA 2DT2A 3JUGA 3MMWA 5JIWA 4NRSA 1G5AA 3VX1A 3M6DA 1H49A 3GXNA 1BSIA 2BVTA 3FNDA 1JZ2A 4FK9A 1WCGA 4H7VA 1CXFA 5ABFB 3IAQA 2WC4A 2VQTA 1B3WA 1KXHA 2JIEA 4WLCA 3L4ZA 2WMFA 2ZIDA 1MFUA 4HOZA 4BF7A 2OSWA 2VZTA 4UZSA 1DEDA 3BSGA 1CWYA 4PTVA 1E3ZA 1UWTA 1V6UA 3PZQA 1CGVA 1B90A 1W1VA 1VRXA 3OZPA 3N11A 2XVGA 4HPGA 4M24A 1ECEA 1LLOA 4U33A 3HG2A 3AIBA 3VMOA 4PYSA 3BCFA 3VGGA 1AQMA 3WDHA 1JAEA 2VR5A 4V27A 1GOIA 1UQYA 2WVSA 2Y24A 4ACYA 1ZBVA 2ZXQA 3CUGA 4UTFA 3GBEA 2XG9A 3W82A 2O9TA 1H4PA 2WCSA 3WN6A 4TVDA 1BVNP 1NARA 2FDMA 2WVTA 2BY2A 4DUXA 1FH8A 4KGJA 2CITA 4MNLA 4JFSA 4WKAA 1GQJA 5FIPA 1GCYA 1SZNA 3M7SA 1ISVA 4B3LA 3AICA 1UZ1A 2WZIA 1H09A 5A3HA 3PZTA 5FCZA 4GQQA 4D72A 3BAXA 3GXPA 2J47A 2YL9A 6A3HA 3NDYA 2ZX8A 3VNZA 1UH4A 3AHYA 1YQ2A 2GJXB 1UD2A 3VGEA 4JZ5A 1K6AA 3ZT5A 2CBVA 2QMJA 5D9PA 5EFFA 3ZJKA 1MW1A 5E0FA 3VMNA 5IHRA 5JUVA 3HJEA 2E40A 2X0YA 4ZXOA 4GKLA 1XD1A 3ZT7A 4GPNA 3WH6A 2Z1KA 2OYKA 1XH1A 2XGIA 3FAWA 1H0IA 2WSKA 3D4YA 1WZLA 4XZWA 1C8YA 1B31A 4LYRA 2F1BA 1CNVA 2XYLA 1PIFA 1OSEA 2X2IA 5IFTA 4PMZA 4MB1A 1UASA 5A69A 5A1AA 2CYGA 4PMRA 3WH8A 4P7QA 4GI9A 5HPCA 3U7VA 4CD8A 3AMLA 1V6XA 4HZ6A 3CV5A 3MS8A 4TVCA 4GQRA 4FLQA 4UQCA 4JFTA 2WVVB 1B3ZA 1VBUA 4E8DA 2XPKA 1CEOA 1F4HA 2VCAA 4P8WA 3WD2A 4D6EA 3IJ9A 1W3JA 5A6BA 4P7OA 4EK7A 2EAEA 3I3EA 4M29A 3AXXA 4HZ7A 4AZBA 3CUFA 5A94A 3VNYA 4AZ6A 1ZB5A 1JNEA 2NSXA 5A8NA 2VCBA 1ZJAA 2PWFA 2EBNA 1OM0A 1B3VA 4V28A 1EA9C 1TMQA 1JZ7A 5LYRA 1UR2A 2D2OA 4EE9A 3FXYA 1P6WA 3PN8A 2OW7A 4AMWA 2GK1B 2A3BA 3N17A 3DX3A 3F4VA 3PTMA 3A4AA 2FHFA 4QFUA 4HA1A 3CTTA 3ARSA 2D73A 3DECA 4LYPA 4UOJA 4D6IA 2BY0A 3AS3A 1VFFA 3EJTA 7CGTA 3DYMA 5C71A 1CBGA 4HA4A 1DWIM 2VUYA 3CPUA 2QPUA 4H41A 1JF6A 3LPGA 3WEOA 3NDZA 3E1F1 1GJUA 3SEPA 4AD3A 1UD8A 3AIEA 3MSGA 5GNZA 4P8VA 3W26A 3NJ3A 1H1NA 3GH5A 4D6GA 5I5RA 3DYPA 4WKFA 4UOZA 2VOTA 2X2HA 3A22A 4XB3A 1B0IA 4W7VA 4QLLA 2GUYA 1OWQA 1EQPA 1XYFA 3L4UA 3WUBA 4D6FA 2WKLA 1GJWA 3VM7A 1NOWA 1GZJA 4D6HA 4GIAA 2EEXA 3AZSA 4E8CA 1LL7A 1CGXA 3GZAA 4M1RA 2J7BA 1WDQA 1L0PA 3DHUA 3CBWA 3KLKA 1B1YA 1W3KA 1BHGA 4PMUA 5JBEA 1KXTA 3D51A 1VEPA 2HISA 3AMKA 1ZJBA 5CLTA 3CH9A 1WP6A 2XVLA 3SCUA 3LRMA 3KL5A 2GJRA 3ZJ6A 4TTGA 1WDSA 2VZVA 1US3A 3WELA 5A6LA 1H2JA 3PZIA 3MMUA 3CGTA 2D0FA 1TR1A 4AZCB 5CGMA 2F1AA 4Z2HA 3WF0A 2E0PA 4IPNB 1C7SA 5DT7A 1E6NA 1GVYA 1DTUA 7TAAA 5ABEA 2RGLA 1GHSA 1DWJM 3ZO9A 3SUUA 2JF7A 2G3NA
chains in the Genus database with same CATH superfamily
2EYTB 4TNFA 4PE8A 3O6FB 1HC1A 4WOZA 3M0LA 1JFXA 4IK6A 4LEQA 4KPHH 4YWSA 4WSGA 3MJ8B 5GSVB 1AQHA 2QF8A 2ITCA 1WT5A 3MMDA 1DVSA 4DI8A 1CFBA 4Z7WB 4LP4A 1XV8A 5LGJA 1GONA 4OLWL 1LXMA 4WGKA 4ZJ9A 1T2JA 2ZNXA 3S6OA 3BUYB 1ITCA 1E28B 2YBUA 4LB3A 4ILSA 3RMJA 1RPUA 1VIZA 1XAKA 2K0RA 3CCHB 1BAFH 3L4TA 1HJUA 2X4SA 4GPVA 3WNLA 1ITBB 4TNWF 1S7WB 3GMPB 1CLXA 1WV7T 3O6FD 1G69A 4KKPA 3NCWA 5HJ3B 4I7ZC 4N2EA 4CVUA 1TKKA 3F5LA 3N2OA 3EFOB 2Z7KA 3BE1L 2CD0A 3KM2A 1O9VA 4AGLA 3R0UA 3I6GA 6REQB 4JPIA 1R6WA 2NNXA 5FYJL 1C8PA 3SCRA 4NAEB 3I9PA 4AKPA 1QNOA 1MCWW 1BOGB 2FZ3A 4MMXA 4ZK8A 3H9SB 1RHCA 3RJXA 2CDGA 5I02A 4S3KA 1SJMA 4JG1L 5CEXB 3LDVA 2A6DB 3DMMD 2PTUA 4PL2A 1S7VB 1RUQL 2J2ZA 4DW2L 3C3NA 2A7BA 4NVTA 1F2QA 3ASNB 4LKCB 1VFTA 1XF0A 5T1KD 3E0FA 3DPDA 2HT3D 5C86A 4RK8A 3B5TA 3KXFA 2WCGA 3MJ6A 1VGKA 5CSZB 3SDXE 1EUNA 4CEXC 3PFRA 3C3UA 4XP4H 1I0DA 4TQTA 2ISVA 2NVAA 3GRWH 1XISA 4ACZA 4Z77B 3GWQA 1CL7L 3N0AA 4BA0A 1NGYB 4XZ4A 1E0XA 1V77A 3VYNA 3TJXA 4GVGA 3EG9A 1GOFA 4IBWA 4CU7A 1MI3A 1E70M 1HKVA 3V0JA 3TIEB 1RCOB 1NMBH 4YC2C 5F1IA 3VFRA 1J1XL 4JYEA 3TV3H 4LUYA 2E7LA 2C34A 1M6JA 2PRMA 3N73A 4FJYA 3VE0A 1EAJA 3K5RA 4K3JH 5JUEL 4JPWH 4G6FD 4BKLA 3MQTA 2APTA 1IKNA 2YMOA 4EVZA 3D9AL 4OFDA 1YNTB 3CVCA 2PYFB 3AACA 4WCJA 5LBSL 3SZ8A 2GY7B 1CU4H 2V33A 4HPYH 1ORQA 3IT8D 5CWSB 4ACPA 4BJLA 4DZ8B 3GHBH 1QFWH 4A8RA 1C92A 4LRNH 3RZWA 4AZIA 2VDOB 2DW6A 2NY3C 5CN1A 4PJ7B 5FM8A 2G3FA 3G1VA 4TSBL 1OCNA 3WFLA 1CDIA 1KPUB 5F1NA 5INDA 3VXGA 3W7IA 2Y3AA 1FZKA 3OVRA 2F5BH 3AALA 2F74A 3ZHFA 2G60H 3BH9A 3HFTA 4OCLC 1AXIB 2AEPH 1FFRA 1HHKA 2VW4A 1WKYA 4LYKA 2ZOUA 3DX6B 3LQZB 2RH0A 1HP4A 3VE9A 1RH8A 2VQ1A 1XF3A 1A7RH 3ELQA 2XN2A 2N0MA 1BZDA 2V7HA 2YAEA 4OY9A 2WBWB 4AYSA 5CEZE 1B9KA 4HV8B 2YXMA 4NJKA 4WKHA 1XF1A 4LSPL 4HUVA 4ICXA 5HQLA 2W65B 3GS4A 3AI0A 5IFJB 4UNKA 3MX0A 4HK5A 4IX0A 4ALAH 3DC8A 4XO9A 3WYZA 2PW1B 1DQKA 2NSOA 3BVWA 3MOBL 4LGXA 1MFMA 5I1LA 1NCAH 4FADA 3KLHD 2HVOA 5HY9B 3W37A 1E4WH 5IWLC 4G11A 3D87B 3BZDA 4MZIA 3BDKA 2P5EB 1DL3A 2Z92B 4B91A 4N1EA 2VH5L 4ZOCA 2BNRD 4KO5A 1W32A 4IIDA 1PLAA 1E56A 3QIBD 1RUSA 1FCBA 3VOJA 4A3QA 4HV8A 3NMEA 4ABQA 5ALBL 1IWPA 1N18A 1LG1A 1YMMB 1XBVA 2XPGB 4JO2L 1BX2A 1HXKA 2AW2A 2BRRL 2DZEA 5EHFA 4HIJB 3C5SB 1XKYA 1VQTA 1OAZL 5IEKA 4OZIE 5FF4A 5AOLA 5IDZA 1IM3D 4LOUD 3E96A 5C9KA 2QSCL 3THDA 5E9AA 5J6HB 1TYJA 1JI2A 4ODTH 2YD6A 1L7TL 2KERA 2MUCA 4URIA 5DMJB 1HKIA 4H6RA 3V5KB 4GXFA 2WUBL 2DKSA 3IXTB 1TFHA 3RNQA 5IJKA 2VI0A 3OX8B 4PVBA 5JDSB 5DD1L 2GVJA 4WUIA 4DLFA 5TQ0L 4QRSB 4Q2ZB 3TJEL 1W17A 3LPWA 2PCYA 4WRLA 1VKXA 3WLQA 1YECH 4LCCB 1TEFA 3NSJA 5ALBH 2JTDA 2UXVA 4NNYB 5TDNB 3QW9A 5I1CL 1J10A 5K1JA 1F13A 4L8SB 3CHVA 3R11A 3MJYA 4CNOA 3BP7B 2NR6D 1E5ZA 3CFDB 1YC7A 1B0GB 4XXCC 1H8LA 3X2QB 4MLJA 4N42A 1CLKA 3P84A 1IL1B 4BHUI 1PEWA 1EXUA 1T66C 3UZJA 1RV8A 3UZWA 2Q9OA 3CQ0A 3CSYA 3VB8A 1F6PA 4XHJC 2J1ZA 3UWZA 1HDMB 2WM0A 3P80A 4UNTA 4XO5A 4X9BA 1S3RA 4LCCA 3WQ5A 2QSCH 1IBGL 3GSVA 1BVNT 1S46A 1KTLB 2ZRWA 4NRZB 4QTIH 4FQIH 3DX0A 1NELA 2QR6A 1MHCA 4JTUA 1MQPA 1TENA 4MHHI 4GI6A 2FD6H 1A6WL 1C08B 1QFPA 1TJGL 2EO9A 5DQDL 4DGIH 1GOMA 3T6WA 1JPKA 1KRAC 4PEKA 2IADA 4ZQPA 4LPYA 5D96B 3TL5A 1HEJC 3S2LA 3IS0X 4Z0XA 4A8IA 4ZT1A 1JGDB 4V1DD 4DZBB 5FJTA 2WSPA 2VTFA 3K6IA 1O5QA 1T7VA 4TN9A 2AJZB 3CXDL 4UM9B 2IANB 4PJEB 4YX2H 2Z6IA 3HE7D 3LN4A 3LIZA 4B9PA 3VABA 4V2BA 4FAMA 5GS2D 4HZLA 4JB9L 3RWGA 3WTVA 1ONXA 2J74A 2J9XA 3QMTA 3ZYJA 4LW7A 1SDYA 3D1MC 5F3FA 3S3BB 2I60H 5HHXH 3IVKA 4ACZB 1RZMA 4FG6D 4ZZFA 2EVJA 1AH3A 3PANA 3P4OB 1MHEB 3TZVD 1J8KA 1XCTB 1XC4A 1RZ8A 1WFNA 2VO5A 3C08L 2P8CA 1KXTB 3KPPA 3MV01 4ZFOB 3WHXA 3QEQB 5H6HA 4JO1H 5AWNH 1CIDA 4OJYA 1KNOA 2FEDC 4JQIH 4YHLH 1NKGA 3KPSD 5I5JA 1MRFL 3DJ9A 4YUEL 1VH7A 1W1PA 3MCOA 3A47A 2A6NA 2ITDA 1JNHB 5DZ9A 4BFIB 2BGSA 1RXOB 3XIMA 2CUIA 1TELA 2AQ2A 2R0LL 4ANWA 5HYEA 5JVLA 2H7WA 4MTMA 3GYCA 1MCJA 2CNYA 1QK0A 1A3RH 5J6GA 2OKOA 3RE0A 3LOTA 3D6GA 5ECGA 1UBSA 2J3SA 3B9DA 1DBBH 3A0OA 3V5DA 4HZMA 4C6CA 3SGZA 2BNRB 4WWKA 5CLYA 1HTYA 3D0LB 2J8HA 3BJSA 5BO0D 1KWGA 1KA9F 2P5ED 3EYQD 4HCLA 3CG8A 4XVSH 1XLJA 2QVTA 3SRDA 1A5KC 4JRWA 3II1A 4NQXB 2C7FA 3RG1C 4M56A 1R3WA 1ZP3A 4QNEA 3VI2A 3OEXA 1JXKA 3LRGA 4LGRB 2J27A 1ETJA 5EUOA 4GZEA 4E42A 3KJ4C 4X8JA 2WMKA 1AHWC 1UIPA 2I1OA 2CKBA 2WO4A 5J1AA 1HESA 2CETA 2JQAA 2NTFA 4O12A 3AXMA 2F8VA 3EOAA 4LHQB 5FOBA 2LVCA 3FOMA 3LCFA 1E6OL 4O2FB 4OGZA 4HCDA 4DVRL 1GHRA 3Q01A 3HMXH 3ITYA 2PXYB 1V7ML 2R91A 2VOMA 3BK0A 1MFCL 2VISB 2C9RA 1VKXB 2D9CA 5DX7A 1CLVA 1F8TH 2RHEA 2VN7A 1RHFA 2NUTB 3PRZA 4DO5A 4F0SA 4IOSD 2W61A 1V05A 1ZCRA 1KB9K 2YN5A 3TYFA 1EUTA 2YBRA 3FKRA 1UA6H 3KVLA 2PR4L 2IBGA 4XBSA 3RCMA 4DJFC 2KLTA 2FJFB 4IDJH 5F9OL 3W1ZA 1EHKB 3PFQA 2WW5A 4NBYB 1CT8A 2ZZ5A 1S7RA 3DKJA 3U5UA 5EIQA 1YBQA 2VSDA 4JQVC 5HXMA 2ITDB 4M43H 1YYLH 4BFIA 1QFWL 3LKNB 3BLFA 1N5AB 4NKOA 1FWEC 4TUJB 4H9TA 4N9GB 5CMAB 1PO9A 2DQUH 3AO0A 4GNJA 5DY3A 2BNQB 2FDSA 2V2DA 4WJ8A 2WLNA 3VTAA 4TQHA 4AE0A 2H2SD 2BO0A 2Q6WB 5GRJH 1OP5H 5CJNA 2GJXA 1UA6L 2B4CC 2A0NA 1IQ8A 2CDFB 1Z0MA 3VIFA 3ECQA 3AAZB 3H42L 5T5FH 3VKDA 4UFIA 1F8TL 5TBOA 4ZSOA 1YNYA 2EDXA 1U8IB 3LQGA 1H63A 2DEWX 2RDTA 2ZP8A 3TA3A 4N0UB 3ZGIA 4CC1A 4W8AA 4D1IA 4KK6D 3S9ZA 4I1PA 3ULUD 1CDHA 4POZC 5IJVA 5LNRA 1KR0A 2IDFA 3VKKA 3ITGA 4NZ4A 1PG7X 1RJYB 4JZJC 4KJYB 4XVTL 4QRPE 1GVFA 3ALWA 1UA7A 4WWID 3K6SB 3QRFM 3CAKA 3ZOAA 2LGNA 1EH9A 4WY7H 5DI8B 2IPKB 3ME3A 2IDSA 3BUDA 3B3DA 3TC3A 2HBVA 4PWIA 3H0TA 1TLMA 3D25A 4IRJD 4RSVA 4YDJB 3G3DA 1XX1A 3FQ4A 3V4PA 4PGBB 3W2DH 1JDCA 2OP4L 4RIRB 5K9KB 2OWXA 2V68A 1HXMB 4I7VA 3S0CA 3RIFF 5GHWL 4LARH 4AEHH 3PL6B 3NFSH 5BS0D 1T1WA 2BCMA 4F5CE 1DBML 2ID5A 2VXNA 3ISWA 4U2YA 5TD4A 4UC5A 5DXYA 1IGSA 4BWWA 4JM2C 2FQDA 2QAFA 2PMZA 4OJEH 4AGNA 4KU1A 4WGWB 4FG6C 1L8PA 3LHPL 4IP4A 5DVPA 4JN2B 1UWQA 4NNYA 1AS6A 2E09A 2JFCA 2D4FA 2R59A 1JCJA 3MZGB 2JIXB 3NQ2A 2Y7OA 4OCNC 4ACTA 2YYUA 3GIYA 5G4NA 3FUEA 2WLLA 3R43A 2ATKA 4DBUA 3AOFA 1U8MA 4KRUA 4QTGA 1F4AA 3V6FA 3HUJF 3VCLB 3SN1A 5DT5A 2Q76A 1UUSA 3MZTA 4Z7UF 2DIEA 3CZFA 4GXVH 4IXHA 3MACH 3PY2A 4TULL 3OLIA 4YHIB 5DEGA 1UWXK 3Q6FB 3C5SA 1Q6GA 1SRDA 3N18A 3BVUA 3UBFA 2JIXA 4B5NA 1IGIL 2WKOA 4FSAA 5IJCC 4AWJC 4RZ4A 4Q4IA 3US0A 4DP0X 4BD4A 1FIGL 4JHAH 2RAMA 1FNGA 2ZCZA 1G7PA 4C55A 1BG4A 4CQCA 4DNHA 4KJYA 2QULA 2JKNA 3SECA 1MJUH 5I1JL 3OODA 4B27A 4L18A 1XCQB 4IMDA 3TSDA 1JRHI 3NZ8A 3F7VA 5ERWA 3GK0A 4W70A 2DD8L 4AOFA 4BXSV 3VFVB 1QPQA 3STZA 3EX3A 5EZOL 2VERN 3QDJA 3VMPA 3E3HA 1IXQA 2GSMB 5AKVA 4RFNC 5FAAA 3KRUA 4GKZB 4UV4H 4UIOA 4Q6XA 3FW6A 2VL5A 4L8CA 4BUGA 3TVAA 3ZVIA 3LH9A 4FABH 1KBIA 1A3HA 5K9XA 4WV1C 3LH8A 3ARDC 4HS3B 1H5VA 5JW5B 4WI3A 5C0CE 5ID0A 4MCMA 1FZOB 3NZPA 5CMAA 1FCQA 3GZPA 2DWDB 3CFUA 2FGZA 4GINA 4TL4A 5IVZB 3PAYA 5C8JA 2GJJA 4MJIE 1F3JB 1BXNA 2DQTH 3D0VB 4C7FA 2WVVA 4YHML 1Y6NR 4PSRA 3T05A 3ULVE 4JQIL 1UJ3A 3U7YH 1L6YA 1Y18A 2LU4A 5ENWB 4H8VA 1M7OA 2LOEA 4E5XB 5D9OA 4D2NA 2CERA 1SMOA 1DBJH 1MW3A 3PWLB 1TPVA 4IM4A 4TX6A 1OZMA 4PRHA 3L3IB 1YDVA 1D5BB 4NZCA 4HIPA 5KBMA 1KFCA 3TWAA 2PDCA 3HZ3A 4LOFA 2YAPA 1NCDL 3TLLA 5D6CA 2P9RA 3V0SA 4R7JA 2VISA 3I02A 4MZYA 5AB0A 1N5YH 1HOEA 1XCWA 4KROB 1XF4B 4N1HB 5EOQH 3EMCA 4XTIA 3VKJA 3WL9A 1TTBA 4ZG1A 3M1BB 5CZRA 3SE8H 4G3YL 1ZHNB 2P8MB 4HUXA 1MH5A 3PUUA 4Z5RA 3MU3A 4RXGA 3MY9A 1F00I 3OXRA 2J8FA 2QV2A 2ZNWA 4GZ7A 4PTXA 3EOEA 2ZAGA 3SQMA 1KXQA 4ZUWB 4C6IA 5EU4A 3NL6A 1BWWA 4F20A 2FD6L 4Y8FA 1RUKH 1ILUA 1KT2B 3LIZL 1IU1A 4YVVA 4JFFE 1R8LA 1M7JA 5E56A 1N7ML 1E9PA 2VC2B 4G6MH 5D1ZB 1P1VA 4CU8A 2W9LA 2BZ7A 3UA3A 4GMTH 4KTEL 4ODHH 2J88H 4FYRA 4KKBD 1QCWA 5IB5B 5DK0B 4KW2A 4J35A 4ZW7A 2G5WA 4WY0B 5I1DB 4XVSL 2VX6A 4HPJA 3HHSB 3NPSB 3VSTA 4U28A 2VR3A 1QSFD 4MX7B 5DUPH 3ULSB 2GGJA 4UTUA 3KCWA 4X6CE 5EU6A 1RBLA 3X1FA 5E03A 1H15B 2CALA 2XX0A 3OMIB 1H9VA 5IKCB 3OHIA 4W7UA 1KPUA 5F1NB 4TOQA 4HEPG 4QX4A 1A4CA 3KJ6H 5C0ND 1JUFA 3B9OA 3CS2A 2HJFB 4X6FA 4BQ3A 4P59H 3MRIB 1I1AA 3R0NA 2I5YL 1QI2A 4JKMA 1VR6A 4IBSA 4MZ3A 4DGYL 2TRSA 2VQ1B 3C5QA 4ONVA 2PZNA 1RQBA 4YSEA 2KMWA 4FE9A 4TSBH 3ZSSA 3ZY7A 1DJWA 1TPUA 6PAZA 3HVNA 4EUPH 4FFZH 2DU2A 3GKWL 4NM4H 3ERXA 1XH2A 4CVXA 4GFSA 4G8EB 5BVPL 1EO5A 2HFEA 3VFRB 4XODA 3GZOA 3VWKD 2OX4A 3OQEA 3GXUB 3SCOA 3FTZA 5IG7B 1YE4A 3KHJA 4KFOA 1X5XA 4AWEA 3OHXA 5BXPA 4JFEB 3NSFA 1EYEA 1YHPA 3MC0A 5J11C 1N8ZA 4JFDB 1YPZE 4HT1L 3NWRA 2PYFA 4JRYD 3E2RA 4JFQB 5CEZL 4HKBA 4HIXH 1NFPA 4NNAA 5MENA 3PULA 4AMKL 1G0DA 3REQB 1V3JA 2VDNH 3L3DA 1AYRA 1XBRA 5SWSA 4L29B 3W1QA 2WZHA 2A73A 1DZ0A 1JCTA 5AKRA 1D6EB 1QOPA 4K94L 4L3ED 4PRPE 4XXDA 1XGYH 5TE6L 4JIIX 3S2MA 1A1OA 4L4TD 3ARYA 4IIQC 1KM2A 2F58H 1S5HB 3FRUB 4PJCF 5CSRA 5IVXF 3VDGA 3OKKA 1BQ5A 1MVUA 2X4QB 3EJZC 4GG6F 4J1OA 4LRSA 5J11B 3ABSA 2ADIA 3B2VH 1TDQA 3IJEA 3SIKA 2JH2A 1LD9A 3DSNB 3IDXH 1CURA 4MD4B 5DRZB 3PS7A 3HPJA 3HAEG 1YEHL 3GUFA 3UABA 2F58L 3E02A 3LRKA 1B9BA 3ZMNA 1OGSA 4X8JB 5AKQA 4LLVB 3MZNA 1CL7I 3WF2A 3KWWB 4JR9H 1Z89A 2PBGA 2X1SA 4CNNA 5A2IH 1DQVA 43CAB 1J12A 1NBZB 1XICA 5KSUA 3M6YA 4P2QB 1RZIA 4Y4HC 4HSAC 3MCNA 5C0DA 1BF8A 4ZD3L 4Q32A 3GLZA 4WKZA 1Q7QA 5HI4C 3AXIA 2GVEA 2X0UA 1GUVA 1QPRA 3BXWA 2G60L 3I6EA 1PPIA 3ZE2B 2MH4A 2YA1A 1J9YA 2VC9A 1I2RA 2H9AB 4M8RA 1ZANH 4TXVB 1I1CA 3UACA 3WDIA 4C4KO 3PWIA 5I1GH 1E4LA 4E6MA 3ABGA 4LVEA 4R7LA 3WN5A 1CTOA 3VIJA 5I1EL 2GUOA 2CLKA 3DFQA 2VELA 4QNPF 2AJUL 4FFYA 2X4NB 2EIMB 1FC2D 3F62A 3MROA 3T0BA 5C2BL 2IF7A 3D3VB 5I16A 1UZDA 5AW7B 3NIGB 1MFVA 3L6FA 3MLXL 4A2MA 1PB0A 1FE8H 2F54B 3PJNA 1JZFA 1GCFA 1NDMB 3SSGA 3BJTA 2KZHA 4G8FA 1DBKL 1XYAA 2P8PA 4JFDD 2VR2A 3LHUA 4CADA 1QSFE 1P4BH 1JQVA 1TA3A 3PE9A 2PFHA 3EDJA 3KGUA 5FA4A 4APQD 3NZ8B 5ERWB 2WPBA 2VGFA 1KGYE 3WBWA 3C5ZC 2H9GA 4IKKA 1GOQA 2ZSVA 5HINA 5CCJA 4AHOA 3C2EA 4JHMA 3PWPE 1PZ2A 4F15B 3TEWA 1JXDA 1AGFB 6XIAA 2X4QA 1AUSL 3ARXA 4Q0XL 2JCCB 2PDBA 1YTDA 3M0KA 3QBUA 2XXFA 4DO4A 2VDMB 3F5WB 4JRLA 3B8UA 3LCIA 3BGFC 3QRGL 2VAJA 3MYJA 3GRIA 4QHRA 4A3UA 4JHZA 4JAMA 4JCLA 2ZYFA 4KY1H 2OSXA 3EXLA 1JS4A 4MKMA 2GJPA 3I9GH 4N25A 3H9SE 3MOQA 4Y5YA 5A43C 2EUXA 1XX9C 1FGVH 4NQED 1C1EH 3KW7A 1FBIH 1TZ7A 1P9MA 2X6CA 3MCG1 3V6OE 3L3HB 4RE3A 3G0SA 4TX9A 4W8BA 3SZ6A 1IGYB 5HHQA 3E2HC 1J0IA 2ZSVB 4OT1L 1CZ1A 1FP8A 1P7QA 1IC4H 2XM2A 2YL6A 3JWNE 3APTA 3UJRA 4XGZA 1Q94A 5ADPL 2WNZA 4OZHF 3QIWD 3NIDB 2GLKA 5CD3B 3JZEA 5D7IE 1MHPH 1Z48A 3FT3B 5AYXA 5FA3B 4BWLA 1AG0A 1GZHA 2EXWD 4F8OA 2R9HD 1W1A1 3UXDA 3DFSA 2CKNA 2V5YA 4KK8C 1RAKA 4WV1B 3B2UD 3RX5A 2FB3A 2PLJA 4YTRA 3BIBX 4KIEA 4PJIB 4GYBA 5AEAA 3BW4A 4H9VA 1HHKB 2APBA 2ZWSA 2N3JA 5BU6A 4LGSB 5FPIA 2X7LB 4NB7A 1YKWA 4LS0A 1I1WA 2JF1A 4Z1CA 2YGQA 1A1NA 4X6BA 3IIVA 4PRIA 5LGXA 1OT4A 3ILPB 4KKNA 2YEQA 5LWYL 3IUIA 2ACRA 4BS0A 5C6TL 1GVRA 1U1JA 1SR0A 3O6LH 5B39B 3G6DH 4KTYA 5FGCE 3HMWH 4ZUVB 1JNHA 4DLMA 5D70L 2YPLD 1PTDA 4F7PB 4RQQA 4WHCA 1J8HA 4ZAKA 1LM1A 1IC5H 4UV7H 4JNXA 4M3JA 4Y7EA 5AFAA 3QORB 1WGVA 5I1DA 4GYJA 4DBEA 3KBHE 3UBXI 4UQEA 5EO9B 3P77A 1VPQA 2OMAA 5CBJA 3V0IA 4ISVA 3TNNB 3O06A 1GVEA 4V1XA 2WWMD 1HKFA 2NNRA 2OMNA 1PDKB 4HJUA 4IMKC 1R5VB 3TBWB 4M61B 3ZWTA 1L9SA 1P69B 1W8SA 2X1TA 1A4AA 3BO8A 4JRYB 1KYOJ 1W72B 2KLSA 4ELMB 1IE7C 2QPXA 4NZUL 4HK3J 4JDEA 5DRWB 1NICA 1XKJA 4G6ML 3P6LA 4E2OA 2NY2B 1ITQA 4OKDA 5EFIA 5HHQB 3VA8A 4PJ8D 1FVEA 1HQ4B 3C12A 3GIVB 1M5WA 1MWAL 4KK6C 2ADYA 3FUJA 2IXQA 2PDPA 4L29A 1I0BA 2AXFA 2NNCA 2AQNA 5C0AD 2YPKB 3EAKA 3TCLB 1DEEB 5LA0A 1QYGL 5E7BA 2DQWA 4AC1X 3MO7A 3EOBA 4FNQA 4U1HB 4U1IA 3B05A 1BECA 3MRKB 1HVQA 4LCVA 5HHMD 1Q6RA 1KIPB 1A3LH 4YDLB 1V02A 2C7UB 4UUJB 5EBUA 1EP1A 4DJDC 5IP4A 1LO3L 1AXSB 3MRPB 4LLYB 4WW1B 4XN1A 2JK2A 2EKJA 5ESQA 1F76A 4IQDA 4I77L 4H25A 3CZJA 4LEBA 4QRUA 1VC4A 4OFIA 4EOWH 2VFGA 1NJ9B 4H9YA 3AROA 3N25A 3W1TA 3H2FA 4H9ZA 4GQPH 5C0DB 4O11A 1P4IL 3N41F 5EU3A 3V18A 1Z7JA 4Y1SA 3K30A 1JWMA 3TO4C 3MV11 1Z5HA 4JFYB 1UMYA 2XIDA 1W5NA 2NZ9C 2QW5A 2L5HA 1P6AB 4OCRL 4YVPA 2HJFA 4X6FB 3QJFA 3KL3A 4NQQA 1Q1JH 5C08B 4ZFFA 3PY9A 3VXSE 4FQCL 4E2DA 4QQUA 3M5YA 3KS5A 4DF1A 4DZBA 1N6UA 1FCCA 4GOAA 3M1CA 1CYGA 3HC4L 3NIFF 4N8VG 1OIMA 4D8PA 5EF1A 2ZA3A 3MP4A 4RAHA 4UNVA 1X5AA 2JI1A 5E8EB 1OB1A 1S5IL 2QPSA 2DQGH 3MRHA 3VXSB 2FATL 3MV7A 3RWJA 1VFLA 3IAPA 3EYUH 2I57A 2J66A 1OAKL 2JTYA 3N43F 3P5ZA 1H0DB 1H8NA 4FTVE 1RH9A 3WJLA 5KVDE 1QT1A 2OMBA 3VIPA 4M81A 4KKCC 5AW2B 1NOFA 4KTDL 2D7NA 1WUNT 2GPZA 4YAQA 5EEWA 1LE9B 1A5NC 1ZRQA 3U9PH 5DK2A 3CV7A 3RGVD 3RIAF 1C9WA 1FPTH 3L7EA 3W75A 3HC0A 3FFDB 4PJ5E 3UX9B 3AYSA 1L0YA 1GQIA 1TPFA 4M4RA 5J0BA 1F61A 4PUMA 2WBGA 3CE1A 2XCMC 5K1VA 5EWIL 3E8VA 3E0VA 2BVYA 4JTDA 5H91A 1TTQA 3HG5A 2RMNA 5F96H 3PSWA 5EA9A 2NX5E 3L1GA 2AGKA 4XNZB 2ZA2A 3LMZA 4US6A 1IRAY 1ODUA 3PQYD 2CJUH 4NN5B 3B34A 5IOKA 5JMRA 4QIUA 4P57B 1JNLH 4MHBA 2CHDA 2LHAA 2QGEA 4NJ9H 4LCWD 3EBAA 1CXEA 1BG1A 5CXPA 2GQ8A 1WS8A 3W39B 5AYTA 1ALDA 4HJ0D 3TE9A 4FNSA 1MFEL 1SVZA 5IHLB 3FFOA 1NC2A 1VADB 3O4LB 3E6EA 2GJ6A 2P0OA 3A67H 3TZVC 2HVKA 2FHCA 4DVBA 4M7ZC 4EEEA 2VMFA 3Q5TA 1KRBC 3TW7A 3Q8FA 1MRQA 1RSYA 3VA6A 4XMLL 5B3SB 3H53A 4R7DB 3H21A 1GS8A 4BBWA 1C9SA 2G5UA 4N2MA 2G3JA 2GSGB 1FFTB 4LNVA 4Q14A 3W85A 4WU7A 1T03L 4P06A 3RLUA 4PYGA 3SKOA 5IV2A 3DMMA 2R6OA 4O1CA 4QXIA 1PZ5A 1GKRA 2XFRA 3CSTA 4AM0A 4I9TA 3LCGA 3KXFD 2Z7UA 4XGZB 3ENLA 3TN4A 2ZZ2A 1U33A 2YARA 1OLLA 4BKTC 2NPLX 3SE9H 1B54A 3IEBA 5J8LA 2WANA 3QDGB 3W23A 5A16A 4PJ6A 4QOKA 4DYEA 7PTDA 2A77H 2HLFD 1ADQH 4KAQH 1YJDC 3HPLB 1N6QH 3FIGA 1QX1A 2GGGA 1RJPA 3UZVA 3F03K 3QV6A 3CWGA 2VJ0A 5AD0A 3MRLB 3S6TA 3RGTA 2Z7YA 4QRUB 4QKXB 1DBBL 2ZC8A 3FFCE 4B92A 3G6JE 5AC8A 5ANMB 3PG2A 1VD6A 2J5WA 1G1YA 3F00A 4TOYL 2VEGA 2X0HA 5HYJB 1ZHKA 1ZV5A 5FF3A 5JHLH 4FOMA 4Z7VF 2Y89A 3RFZC 1FOBA 4HIEA 4AF0A 1UROA 1H7OA 1UB3A 4C4UA 3VGAC 1TJIL 4N87A 2VFDA 4DELA 3UGUA 4PQXA 4JHVA 2VFHA 3MNZA 1NFDB 4HEME 4K7YA 4GFXA 4V1YA 2O4EA 3SN4A 3OLEA 1JP5A 1OP4A 1TJIH 2HRPL 5DZVA 3A5VA 1T20B 4WWNA 3BKML 3CEPA 4GAGL 2XKSA 4LSTL 3F7YA 1M56B 3ZKXB 1UCWA 1XFPA 5EBGA 4OCSL 1PU0A 3NEHA 4FKKA 4PWHA 5BW6A 1VPOH 1RK0B 4LVHC 5D2NE 2M2DA 2YC1B 3DUUA 5AOKA 3V7MA 1GYCA 4Z3GA 5FA5A 1GZQA 1A9BB 4XVJH 1GPWA 4WNJA 3PUDA 2NQDA 3NP3A 2XUWA 4M9PA 2Y63A 1GOOA 2ADGA 5CZTA 3WE6A 3GVQA 4PGBA 1SDAB 3O4OC 3BQUD 3RVUD 2E6DA 5DUJA 3UJJL 1JWSA 2B59A 2O61B 1GW1A 4HYRA 4K94H 4BA8A 5H1WA 5FGSA 2P42B 4UB0L 4BSVB 3LERA 2C9UA 2OZ3A 3NGBC 2QCCA 1UKSA 1U5JA 4FQIL 4Y4FC 1YEKH 3B9EA 3L2LA 4X4XB 4XOEA 2G0WA 2VEMA 2FYYA 3U1PA 1AW5A 1NAL1 3OOQA 3MSPA 2BNRA 1S2AA 4DO7A 3QIBA 4GFIA 2UWEE 3NGFA 2NQ5A 3W7OA 2ESVE 2VEFA 4I18B 2WHJA 3DDMA 4HHHA 4CQ8A 3R13A 4JGMA 1DKWA 3QFGA 1QQDB 1IT8A 4L1BA 4JM2F 4QR6A 2O93L 3DTXA 4V1DB 1HL4A 3QRLA 2XVBA 1IM3A 1QWNA 3Q1SH 1JDFA 1EF3A 3LKPA 4HS8H 4FTVB 5J13B 3HO8A 5CJXA 4C65A 1ZWIA 4EI6A 4ZSTA 1FWNA 3BVTA 3WDJA 4CC0A 4FQHA 2EH7L 3APNA 3PJXA 3RLGA 4M80A 3S97C 4IGSA 2LV4A 3IDIA 4JVWA 1E9LA 1YECL 3WY3A 3HJZA 1ZHAA 5CD5D 3EG9B 3R0KA 4LEXL 1Q65A 5HNRA 1A66A 3UTPD 1HO1A 4RWYL 3HURA 4IM8A 1BVKB 3QZWB 4Z7OB 1SVCP 3O05A 1J1PL 2B3IA 3QDGD 2PA6A 5C08A 2NR6A 1ADSA 3FQUA 5L7XH 3EHBD 1MRAA 3SDYL 1QJWA 2X4RA 5HI5D 1XIJA 2IPJA 2WJFA 5L8JB 4JM2A 2FQGA 3FO2B 1MHHA 4X7SL 3HS0B 3QDHA 1CXKA 4I3RH 1NH6A 5DWUL 4K9EH 4F92B 1K5NA 1RZIB 4IGMA 1SJXA 3FFCB 3O15A 4PR4A 1BJMA 3SJVD 4MJIB 4HHWA 3ZE0B 1TJ1A 4I9JA 2KT6A 3P62A 4DJFD 3NYDA 3S6DA 1CI1A 4TSAL 1L6SA 1UWFA 4Z18A 4RETB 3SB3A 1SXZA 1HF6A 4HU2A 5IB2A 3FDGA 5C9WA 4WWOA 2B39A 2A83A 2BIHA 3IJYB 4GWEA 1JPEA 2MANA 5C9ZA 2OL3L 1FV1A 4ZQKA 3SE4A 4K7PH 3B40A 1OSZA 3R2GA 1RPKA 1DR9A 1JWUB 4O15A 4RL3A 4OCYL 2IFFH 4F7TA 3BE7A 5CBAB 1G6CA 4NQCB 1W8NA 3HPAA 4IIHA 1CZ8H 4FQ1L 4IKNA 5ELIA 1ITUA 1YPZB 4B2DD 3O45A 3W0KA 5T1DL 2VX4A 3HE7A 3PWVA 3QUYC 2A6JA 4Y4KD 4XVUD 4E5XA 4JQ1A 2VN5A 3CXOA 3HC4H 3R10A 4G1NA 3MWCA 4QG8A 5LAXA 1GGUA 1YJDH 3QPQD 3N04A 4GBXD 4J3WA 5HHNB 2GITB 4NSKB 4GACA 1VF5C 4IPIA 1B2WH 4US5D 3SRFA 4J6RH 3QW3A 4XZBA 1EO7A 2ZCLH 2P28B 4MJID 4Q7IA 4NQCA 4UTAL 1RY7B 4FZEH 3NQDA 3MLUH 3WIFB 4YSSA 3EMQA 3UJFA 2YRPA 4B95C 3JR2A 1OGBA 1TR7A 1SEBB 5A3ID 1ROWA 3BC9A 2EADA 2CJSA 2VLLB 2I9EA 1LBFA 2CKRA 3SSZA 4MB5A 1VLIA 4EACA 4W9EC 2ICEA 5I77A 1E27B 1WG3A 2I69A 1KB9J 3LD8B 1RVFL 1WGOA 3QUZD 1BVOA 4JD4A 4RE2A 3I10A 3N0PB 1Q0XH 4QTHA 2HROA 2WV8A 1MFBH 1GKOA 1NCDH 1T83A 1K5NB 1OAXL 2BP8A 2XN9D 5F96L 4YDKL 1IEQA 3E5PA 3SZKC 3N1AA 3C6LC 5C0FA 1DVTA 3D7PA 2IH1B 2QHLA 1MCPH 4J3SA 3S35X 3ZZSA 4C6NA 1U4FA 3BG3A 3NG3A 4QG9A 3U79A 3LI1A 1X5HA 3CVHL 4JO3L 5M7QA 2XH7A 4OLEA 2YUZA 2AV7B 1Q4NX 1KEGL 5ECUA 3GD6A 4O02H 4YJZL 1U8QB 1TUXA 2NY5L 5LXGH 1ECYA 3OA5A 4X8GA 5GZOD 2R51A 1MJ8L 1GORA 3ZXWA 4NZRL 1HZHH 1QDSA 1T99A 4WUUB 5GSRB 3KTXA 2ZDRA 5GQBA 4EIUA 5K9CA 3R8GA 5XIMA 2Z92A 3SY8A 4DPQA 4ENLA 2ANUA 2PGRA 3APGA 4XWOD 4UR7A 3UO8B 3ZVVA 4FQPA 3NABH 4HAFA 4NJIA 5IGXH 2C5DC 1RZGB 1L2QA 1BQHA 1KRMA 1OZQA 1FNHA 3RFAA 3WO3B 2BGQA 1KV3A 5HDBF 5CKAA 3BQUB 5JPMA 4YFEA 5IFHH 1R0MA 1ZAJA 3WFEH 1Z6KA 2F5BL 3KYNA 1NLBH 5D1QE 3US1A 4L4PA 3PDGA 4O8RA 1R5IA 4JPKH 4WO0A 5T3ZH 3REVB 1EERB 4X83A 3V6ZB 2Q3ZA 1LE5A 1WYIA 2R0WL 2YXFA 4XC1L 3P81A 2YBTA 5CGYD 4GUHA 4IISA 2R0KL 3GSQA 4HVBA 1SXCA 1BTMA 4QNWA 5DCBA 1QAWA 3W29A 4AU0A 4JREC 2HH0H 3GF8A 5TQ2H 4A2LA 1MHEA 2PCXA 2XH4A 4R9OA 4Y7MA 4BQ2A 3PM6A 1FDLH 1YNLH 1NCNA 1UGKA 1XZ0A 3FO9A 4FI6A 1N7KA 4KXZI 4KXDA 4H26B 1FKXA 4AIUA 1H60A 4QS6A 3RURA 1SUXA 4PUEA 3CO8A 4ATDA 1GZQB 4OB5H 5LN8A 3NIGF 4AL8L 4JTKA 1BJ8A 2H32H 2VUKA 1TTUA 4KUCD 2ZZUT 4MJ2A 5E0KA 2POTA 3P2TA 4YTUA 2JJSA 3GDMA 4QISA 4XVUC 2A2IA 4S1RL 2YPKA 3TCLA 2P1YA 5A5WA 1BZEA 4H6EA 2VT0A 1RZKC 4L8DA 3UYIA 2DWTA 3QXAB 3IDIB 5M94B 3ULUE 2R27A 4KQ4H 2QELA 1P1XA 1YN7A 3O45B 4LCIL 4MCYB 3UJTL 4BGDA 4XVTH 2YCLA 1ES0B 3BZ4B 4LLDA 3M0JA 4NRZA 5E51A 3ULUF 1TJPA 4AMAA 3NVQA 3ISYA 2KYIA 3R7RA 3VXPB 4S2BA 4CBPA 4TNEA 3OVUB 3EXRA 4U10A 5AC7A 5A6KA 3BPCA 2R2EA 4HUNB 4Y8AA 3VFSB 5M95B 1IXNA 1RR2A 1WAWA 2O4QA 4TTUA 4NIYE 2W0PA 1W3TA 2QVNA 1QQDA 3ATAA 5G4MA 4N9GA 4ZENA 3C4UA 2CCVA 1MCEA 2VDNB 1WFTA 2QDGA 3VZYA 2OP4H 4HUVB 4U3XA 5GRJL 1HINL 4U1SA 4RFOL 1V3IA 5TIMA 5C97A 3BVJA 4UAHA 4FG0A 2VXVL 1GTHA 1GVSA 3FT2A 1OCZB 4TPRL 2XY1A 3S3JA 1AKPA 1IKFH 5KSAB 3TU9A 2WNKA 1EQWA 2G4GA 4ZXBA 2EDDA 3GHPA 3W1LA 4CEUC 4UTAA 4M43L 3PTDA 4GGHA 5INDB 4QLKA 2VZSA 5DCEA 5KS9F 1LILA 4AY8A 2BIIA 1TKWB 4HLEA 3QH2A 3ZFHA 3MRDB 3ZS4A 5EMUA 4Z7IA 3QN3A 3ARQA 3F83A 4HQQL 5HWJA 4UQBA 4GO9A 4HHPA 1J2WA 2X05A 4MQ7A 3ABKB 4MYWB 1UMLA 3O0KA 3VXME 1LWRA 3QI9C 2NYYD 5I1GL 2BSEA 5FJIA 1JZDC 1HU8A 2A6KB 2VXQA 3EYQC 1S9YB 2WW8A 4QE4A 3VUPA 3FGCA 1T6MA 4O10A 1C91A 4DF0A 4PGDB 4AGOA 3QEQD 3ZR6A 4TUJA 5I30H 4N9BA 1N26A 4GGBA 3DTXB 5AVUB 5CSYA 3UXIA 2BVWA 5ABDE 2IQDA 3GDRA 2FX8L 2IFGA 4JO4H 5HP5A 2CLVA 4W81A 3ESVF 3N4EA 1IXPA 2EDYA 1U21A 1X9QA 5I3GA 3OC5A 1JNNH 3VGHA 3PXLA 4YHNA 1IGYA 2FNBA 5E70A 4HMNA 2D03L 1Y5WA 4X22A 4X8CA 4U1LB 4JKKA 3OAUH 1KBWA 3MFGB 4U0RC 1EZ2A 1ZSXA 3BV7A 3UQNA 1AQDA 3DZ1A 4P57A 4DIAA 1E5AA 1V55B 4W89A 1GNXA 3UIYA 4NN7B 2B4GA 3GY1A 1QTSA 1R5IB 3CFCH 2HTLD 2R23A 3LVTA 2AJYL 1YHTA 3WDRA 1I8JA 4M7TA 1IV8A 4NC2B 3T3ME 1ETA1 4U1JB 3U48A 5I76A 2G4JA 4G71B 1N55A 2JELL 4FNLH 2YAHA 3QPZA 4UXDA 5GRZA 5BW7A 2DM3A 1NAMB 3VE7A 5LGKA 1KJVA 2IQ0A 4ZRGA 3ZIYA 2PPCA 1J0YA 1JZJA 4KKLC 2H0PA 1LQ2A 3E9AA 3MO4A 3FTGB 5D96C 1FVCB 1MN4A 3QFJA 4XMVA 3BN9D 5CG0A 4WUUA 3WIJA 5BOOA 4KK9D 4D0CA 4LVGA 2P5PA 1QR1B 2TYSA 3CHDA 3PDOA 3S3DB 3FQWA 1E5CA 5FW7A 1IT7A 1TUFA 2IOMA 2KQMA 1SUJA 3WNOA 4YSAA 4LHUA 3U1SH 4EBQH 4LBSA 1Z9NA 1T1YB 5AVTB 3C6CA 4LNYA 4PMFA 2AP2A 4XZUA 5I71B 1OW0C 2OTWB 3QISA 5M03A 3F4NA 4FAAB 2EIKB 3T8XB 1S78D 1KBBA 3NRFA 1MHCB 4N86A 5EB9A 3WTYA 1E5NA 2XUCA 3TKFA 1T21B 4BWLC 1GMEA 4IGBD 5T8IA 2V7NB 5JIPA 3B06A 4LKXA 4XPGH 4XXWC 2Q2LA 1IC4L 3W39A 1O6IA 1OK6A 5CU5A 3U0TA 4Q8OA 5AD0B 3IMUA 1QWUA 2YHGA 1F97A 1SQ2N 3V1HA 1D2OA 1FFQA 2FX9H 5EBLB 4Y16C 4FA6A 3NTCH 4IQHA 2WAGA 4L3EB 3EDDA 2UY6A 5HHVH 4F8PA 2R56L 1TZZA 1UEYA 3W7JA 4IW4C 4JMXA 1FHUA 1KBGH 5KSAC 1FRGH 1LJYA 3IK4A 3IWPA 2FQEA 3EKGA 5AVQB 1JFQH 1Q0YL 5TE4H 6TIMA 4UTKA 2HXAA 1HI6B 5ANME 3W9EB 1ZAIA 2BBFA 4DHLA 1IR2A 4HFUH 3F12B 1GEHA 3FCGA 1WIOA 3WEBA 2PWEA 4NQXA 3GS0A 3JV4B 3QQDA 1GIGL 3GMPA 4KNQA 2I14A 3D85B 3B1UA 1LCOA 5TFSH 5HANA 1TWWA 3EA3A 3PFMA 4A7GA 4IGHA 2J55A 4AZ8A 4NRXA 2BDNH 1LO0H 1MI5E 2VWEE 4RGMB 4TS6A 4ELMF 2JI2A 1W0WB 5EBWB 4RFEA 3GZ3A 5CC5A 2EDMA 2NY3B 2WY3B 1SM9A 4PG9A 4DETA 2EJ1A 4ZX5A 4ZQCA 1MCLA 3U57A 2CDGB 1G9NC 4B5SA 4ZB2A 3KPOB 2IQAB 1S5NA 4W86A 1Z1WA 1D6VL 4MA7L 4DP8X 1BZOA 2BMKA 4QO1A 1JRHH 6PCYA 2H8XA 3WQCA 4DGUA 3FU6A 1M1BA 2NUPB 4NIRA 2OMYB 3UZEA 4O19A 4I7WA 2FVKA 1H7NA 4RRPG 1RA0A 2YOCA 2HMIC 3IDYC 1NCHA 5F7KC 1GY1A 3ZYIA 1M7IB 3BP4A 5FX3A 5JOFB 2DSVA 3JWDL 2EEAA 3ZR5A 5ACZB 2Q6ZA 4KX8A 5IFJA 3H3KA 1ZE3H 5F1SA 2XFXA 5BUPA 3NO3A 3ZDYF 4N6QA 4R7XA 2XJKA 4ZOBA 4IIFA 4LCYA 3UYOD 4L3EA 2P80A 4JN6A 4PJ9B 5I6XB 1O7VA 5GRUH 1E9QB 1FFPB 3ROLB 1KD0A 3SCQA 2CHNA 1KCLA 2HX9A 1ONWA 2WNXA 3SDAC 3IDYB 3JZ7A 4JUTA 1CZ8L 2EDJA 3EBIA 1OAZH 1TMCB 5AZEL 4I9XA 5GRUL 2OK0H 2VXUL 1DBMH 1E73M 4K7PL 4NQEB 2YW4A 2HJKB 3EPNA 4K3DH 4L8CB 3GAYA 4KO9A 1K9EA 4HSOA 3GLAA 1NFGA 1DCLA 4OZ4A 4BZ1L 3EO0B 2ZTJA 3KVJA 5IIEB 1JFHA 5AN7A 3HB3C 4PJ9A 1JGIA 2J62A 2EACA 2HT4C 4PJHB 4X2RA 4WNQB 5F9WC 3VJ6A 2MKLC 4JHAL 2NY7H 4LP8A 1LEGB 1SVBA 4UNIA 3E0GA 5HHOA 5I07A 1YXDA 1NAMH 1SZEA 3G04A 4OFPA 2FK9A 2VDPB 3VACA 4AW4A 4DQAA 3AITA 2H3BA 1F41A 4K9EL 5B1JA 2H5UA 3QDAA 5IB3B 5TK4A 3OA3A 4GRLA 4ZW3A 5JXEC 3RX3A 2VGIA 2LABA 3NJIA 1A3ZA 2JJWA 3K4AA 3DTUB 1NU5A 3FHEA 2XDFA 4OWGA 2NX5D 3AFBA 3OJGA 1J1OL 2A9AA 3L21A 3QCTL 4JN7A 3UXAA 1AMKA 2DSWA 3WQOA 1A4LA 2FIKA 3MO1B 4LF1A 3FU7A 1WRFA 3PL6C 3LKOA 3LXUX 4RCAA 3SDCB 4QYOA 4CNIB 4X7TA 4NJJA 1THFD 3HUJB 3IFNH 5I3JA 4PLNC 2E27L 4P5TD 3V36A 2KQNA 2Y06L 2Q10A 5D2LA 4ZMVA 1P48A 5AHNA 2PO6A 1XB3A 4B0MB 1YMYA 3IRDA 3H2WA 4PS7A 2YL5A 3CK0L 4UWMA 4QT5A 1AP2B 1Z9PA 2DQTL 2F53D 1D3GA 1GOWA 2AJXL 1JULA 4DZIA 1KW1A 1EEZA 1PHWA 4O54A 3C8FA 4Q8QA 5E2JA 3QUKA 3PBGA 2NXYD 1KNWA 4ODXA 1Z41A 3GNPA 2Y4SA 4LEOB 2HBXA 3D85A 5I73B 1PKLA 1DDHA 3E2HB 3RRAA 4N0RA 3P67A 3V4VB 3LKSB 1NMCB 1T1WB 4PJBB 1HKMA 1LQSR 5C1MB 3GTNA 2VSKB 2WNNA 3I6TA 5EZIH 2XZ7A 5DJ8A 4WJXA 1E9OB 4NQEA 4D1JA 2ICCA 1JAKA 3FJNA 1OCOB 1FLRL 3P0GB 1Z6JT 5D7LA 1XRSA 1F73A 1ZQ5A 1NWSA 2DSKA 3HQNA 1R47A 3IGUA 35C8H 2D2GA 2WSQA 3MI2A 4GQ9L 1AJ7H 4XP4L 3SCMB 3EBVA 5HAOA 5CCZA 3FQ1A 5G5IA 3TWBA 2R14A 2WXGA 3L2NA 2A2QT 3WFZA 4L5ZA 1W1YA 2HJLB 3NP4A 5H35A 4G8IB 3GQYA 1P5UC 5SWQB 2GY5A 4NCC1 1P4LB 3ATZA 2H6PA 5HQMA 2Z8SA 3M17A 5JHDD 2OG9A 4HWNA 3QLLA 2O0TA 1EJUC 4BKSC 3WQ8A 1MKFA 1RY0A 4DVOA 4L6OA 2ESVB 4XC3H 2UWFA 5D03A 4P2RE 4JPWL 3M64A 2Y69B 2N1KA 3DFTA 3QC3A 2V2WB 4RV8A 4P3WA 1Q9KB 3TPUA 3PB0A 4MSSA 1RUPH 5BV7H 4OD2A 2VJXA 1ZRUA 4OTXL 1BGXL 5DD0L 3DXAB 4GKNA 5IMMB 2JMRA 2ZRUA 3TJIA 5IVZA 1EA0A 1EWHA 3VFMB 3MNDA 1I9JL 1CD1A 4HUUB 4JJHA 5EEZA 1P5UB 1WTGT 2XKNA 5D2NC 1B57A 3PJTA 3UTSA 1BQCA 1S5VA 3MYZA 2I9TB 4B3VA 1G1OA 4ZFOL 3OGSA 4Y90A 4ZFMA 1AP2A 4AD2A 4CGUB 4F79A 4TOYH 1F3XA 2GUOB 3AS1A 2E47A 2NY1C 1SN2A 2KKQA 3LHAA 3ILQD 1W8EA 4YSOA 1G6VK 4C4BA 4NNXA 4OIBA 3UIZA 1T6VN 2J78A 5BXFA 2WK2A 1D6EA 1OADA 1QSED 4WFFE 4WF7A 1T89C 2WQUA 5FUCE 2PR9A 3G08A 1D7BA 1LUCB 4LSBA 4EMZA 2H45A 3N12A 3BXNB 3B0UX 4AKQA 1AKJB 4R27A 3N1PC 2RJGA 4ZR8A 4LS2A 1XS2A 1SHSA 4N5UA 2Z4GA 2NW2B 5HHMB 3ARWA 3I2CL 4JGDA 1W0MA 1OF2A 2FATH 3P9LB 4I13B 4XBGA 4U6YB 4GRLB 2CBUA 1AGFA 3AQUA 4MDPA 4NIKB 1AAJA 2KLRA 3BT2L 4XN5A 3QV8A 1S7XA 3UTSE 4XE0A 2X09A 1EHLH 4CN6A 2NLYA 2P76A 1D8WA 1RFDH 4UTBH 4RBPK 3BXNA 4PI2A 2VC2H 3HZMA 5JW3H 5KEZA 2FBJL 1F8MA 4CN4A 3T2OA 2MNWA 3EBHA 2QKSA 9PCYA 3UJ2A 3DOSB 1GA2A 3MRGA 1FDLL 1YNLL 4R97B 3EX6A 4E9XA 5EU6B 2J56A 4PTNA 3LCYA 3DC0A 2DQ6A 3W3BA 3PGCB 2ODHA 1E72M 4YYFA 3FUNA 1DL7H 1NFDF 2XG4B 3JRKA 1SMAA 2RD0A 4V15A 3QIBC 2BNQE 3VXUD 4ONGL 5CR1A 4MNKA 3NIYA 3AMDA 4KV5E 3ARBD 4MJ6B 3UTZA 5AOJA 1OC5A 3FO0L 4XI5C 1OIOA 3AMCA 2G75A 4HIHA 5M3WA 5AC5A 1FO0H 4OUIA 1WK0A 3TX4A 3ECUA 1E4MM 2XHNA 5DK0A 1OD7A 3IJHA 2PP8A 2Y5TB 1B6UA 1BW8A 1TG7A 2A3LA 3GT6A 3NABL 2XINA 4KWVA 2P45B 2IDTA 3IXAB 4MDJB 4YNYA 4GZIA 3BVXA 5CSGA 3UP8A 1IZKA 4WZHA 2ZCKH 2ZPKL 3DFOA 3LTVA 4U3HA 1BGGA 2HAZA 5SWZE 4LSQH 4OD3L 2GVYA 4A67A 4ZO6A 5DTFA 3MV7D 4NHUB 2YLKA 4GG6B 1BQGA 2HXTA 1Z69A 4YQXH 3QK0A 4W9DC 4G80A 2J6XA 3T0EA 4HNVA 1GG0A 1QRND 3FY1A 4WUKH 3BMXA 4XVEA 5FFOA 3AIUA 3FEQA 3HPZA 1KSRA 2BRRH 3SKMA 2MMXA 4G6JH 2ZE0A 1AHMA 3AAZA 2QVFB 1A6TA 1X6NA 1BX2B 4HBCL 5K9JL 2GUBA 2NY7L 3MDUA 3V6OC 1E51A 1I1FA 1XUUA 2PZ0A 3AIQA 2R1YB 3C2RA 5CIPH 2X4OA 3L3OA 3QBTB 4E41E 4EDXB 3WDPP 2CPCA 3LKRB 4HWEL 2BOEX 5A8GA 2VLJB 1UKPA 5M17A 1RIVL 2VZ3A 5CZXC 3KR3L 5ESAB 3T3PF 2Q3XA 4BSWB 1DHPA 4BZYA 1H62A 1X6UA 1P1ZB 4ONOA 1VP5A 1TZIA 1TRIA 4B0MM 4GSQA 4DZAA 3QWOA 2Z34A 3WH7A 1SY6L 3W7DA 1R9FA 4P4RB 2DVXA 3VI3A 5L4FA 3GTXA 4N4PA 3U3HA 1HKLL 1CC3A 1ME8A 3NFPB 2OQYA 5DRIA 2ZCLL 2X4OB 1SEQL 2ADJA 2QR0A 3VTMA 1HOCB 4KHTL 1YEJH 2EIZA 2PP1A 5IM7B 1OZTG 1QNVA 1M1XB 1F90L 1NC2D 1QI3A 2BS8A 1KNOB 3JQOB 4HZAA 4UFJA 4G42B 4HNUA 3VM5A 2GBTA 4ANKA 5DA4A 3FA3A 2KPNA 1NUFA 2B20A 2X1OA 2Z1WA 1XDTT 4KWSA 4K5OA 3N2CA 1MUJA 1KN2L 3MLTB 4F15C 5BRZE 1TVHB 2ZOLA 3D4GA 4KKXA 2E3VA 3U82B 4RE0A 3OKOB 2XQYG 3TBSA 2X4UA 2CBMA 2WN2A 4JRXD 5HYIA 1OAYH 1FWIC 4GSDL 2HVMA 3CFNA 2CH8A 4KQ3L 4X5LA 5ESVA 43CAA 3RAOA 1E6XM 4Z2GA 3F04A 2CGRH 1PMYA 2NSMA 4JPVL 4Z7VE 1HXJA 4ZXLA 3MYOA 4AT6B 2Q86B 1SYTA 5HI3D 4P2OB 1T40A 3NVTA 4M8VA 5HUPA 4Y19A 3AHVA 5J5DA 1CFVL 1QVOB 3FONB 1S78C 2O26U 2NYYC 4H8PA 5EN2A 5MP6L 1DIEA 1TVHA 1R30A 4H3DA 4YU1A 1P2CA 4Q9QH 5D7IF 4EIGB 1G5AA 2FWOB 1HZLA 2BP3A 1QWKA 2WXLA 3UAJA 1BSIA 2DLFL 3MR9B 4OLVL 3QXWA 4K23H 1VFSA 1GHFH 1KZYA 4H7VA 3I84A 3X14B 1IYXA 4XIAA 5A6TC 4R4BA 5F9AC 3SYPA 3IJSA 1TCDA 1XIMA 5L9DH 4KKCD 5GVJA 1CG9B 3IAQA 4DW2H 4TNVK 1U8HB 3TN5A 1KXHA 5H8DA 2JIEA 3C2YA 1GYMA 1XCQA 4PJ5D 3VFGL 3IFLL 4JLRB 5DMIL 2QADD 4ZO8A 1TF4A 1AY1H 3ES7A 1ESOA 2CUMA 1U8KA 4BFGA 4WO4C 3BKYH 4BF7A 2EH7H 4B97A 4UZSA 3BH8B 3H7VA 5CN3A 4RDBA 1KOAA 1QASA 2O7SA 1AL7A 4ZMAT 4PTVA 4AY7A 2QJGA 4U1NA 4HT3A 2V0TA 1CU4L 4HPYL 2DZPA 3SYAA 1V6UA 4KF1A 4OVVA 3NR0A 1CGVA 2EIBA 1B90A 2BWQA 2XRAL 2I60L 3LZQA 5AKSA 3LEVH 1UPPA 3ABQA 3ATYA 3L5LA 2HRHA 4K3JL 1KIUB 5DJZA 5JUEH 1IC1A 4MAYD 3WLWD 4X5QA 3N11A 3LS5L 4HPGA 4M24A 3ZDZE 1ECEA 4AIXA 2OCCB 4I0PD 1LLOA 2J7GA 3ECBB 3LDBC 3T4YA 1JCNA 4PYSA 3L3KA 4GAAA 3TC6A 5DCDA 3WSQH 3BCFA 5GJSH 2R1MA 3R7QA 5AHIA 4Z3HA 3AWEA 3OHXC 1SJEB 4HCGA 2V5SA 2W38A 3DOHA 3WN5B 5HYQA 5MHSE 4V27A 3TMQA 4UT7H 3NPXA 4UTFA 3NCBB 1UCBH 2HLAB 1MZYA 3CUGA 1FG9C 5IBTL 1I7UA 2EDNA 4NNPL 3ZTJG 2BB0A 2WCSA 3WN6A 1T5XB 2EDLA 5EMMA 4OD2B 2IKHA 4H88H 1PNDA 4TVDA 4LOEA 4HD9A 3B56A 4L5FL 1NARA 2FDMA 3GNNA 1S1PA 1OX5A 5ECVA 3PNZA 4F9PC 4BUHA 3MXVH 2XKNB 5J13C 1NGZB 4OZGB 5DELA 1PSKH 2PYEB 5TPWH 3WBYA 1W6WA 1NCBL 2ED9A 4RX4D 1EEUA 3W2NA 5C09D 3SQSA 1M7DA 3PWJB 4LSPH 4MNLA 1FFNB 1S7UA 4PBXA