2WVUA

Crystal structure of a michaelis complex of alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron with the synthetic substrate 4- nitrophenyl-alpha-l-fucose
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
437
structure length
437
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 159
structure length 437
sequence length 437
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvuA01
3I3DA 1CGWA 1UD4A 2XVNA 4UNIA 1C8QA 3BVTA 3MV11 2OWWA 1JZ6A 1E4IA 1HKKA 4DUXA 4AEFA 2YOCA 2XFYA 3A23A 1ZL1A 5AYIA 5A6BA 2WW5A 1ESWA 1QHZA 2IXVA 3ZT5A 1J0JA 5AC5A 2VO5A 3DECA 2YLAA 4B3KA 1X6LA 3MSGA 4PTXA 1V6UA 4CD4A 1HX0A 1GZJA 3VIJA 1TQWA 2DH2A 2A3CA 2WMJA 3MMDA 2EPLX 2ZX8A 3VD7A 4JKLA 1OGGA 3ZO9A 1TA3A 3W4RA 3DDGA 1Q6FA 1W2PA 2X05A 4S3JA 4CD8A 4ZE4A 1XSIA 3GM8A 3NCOA 4RE2A 1MVYA 4BQ3A 1BGGA 4P7OA 1KGUA 2V3EA 1KFWA 4D6IA 3NSMA 2WNWA 1GOWA 2WM0A 1V3KA 3QOKA 3RILA 4GZIA 3WUFA 3A5VA 3GXMA 4X0VA 4NSBA 3FN9A 1NWSA 3ARRA 2YKKA 5A3HA 4Z2LA 2J7FA 4V28A 3T09A 3AICA 1JG9A 1ISWA 3OBAA 2WCGA 4M29A 1PZ3A 1R47A 3CHFA 4P7RA 4H2CA 1EXPA 1X1NA 1CIUA 3IAQA 1ZS2A 3UCQA 4WKFA 1M53A 2VURA 1AVAA 1B3YA 5CPQA 1OM0A 2NT1A 1PPIA 3UR8A 1JZ2A 1JZ8A 1GCYA 1O7DC 4WSKA 2WMKA 1XV8A 3RMEA 1J0KA 2J4GA 3BMVA 2VT0A 4F9JA 5I78A 4KRTA 2ZIDA 4XZWA 5E70A 4OOZA 1CEOA 3LPOA 3BUIA 1MQRA 1CWYA 2VVSA 3VGHA 2E9MA 3WQVA 4CCEA 1W3KA 4AIUA 4U31A 3VIIA 1HWWA 2XPKA 3AHXA 4TX6A 2E4TA 3WL1A 1CENA 3EYPA 1HKJA 1BTCA 1HJQA 4HMDA 1C93A 1TG7A 2J79A 1NOWA 2D1ZA 1R7OA 1UR2A 4AYGA 1GORA 5BXRA 3W81A 2EEXA 1JDAA 1LLOA 1EQPA 1BF2A 1MW0A 5E9AA 2F7QA 1KXVA 1TFVA 3LMYA 2GK1A 5BRPA 5AC4A 3VGEA 3VINA 3WMCA 2X0HA 2XWEA 4RE3A 4H7VA 4FLRA 1E0XA 3FAXA 1VEOA 3F5JA 1XCXA 3NDYA 2FGZA 3L2LA 1KQZA 4YN5A 1WDPA 5A8MA 2IGTA 2B31A 4M81A 4M80A 2XVKA 3MO4A 1DEDA 5FD0A 1H49A 3AIEA 1ZB5A 3AQUA 5IHRA 1UWIA 3QHOA 2FGLA 5KZ6A 5A6MA 2EPOA 1FOBA 1KTBA 4J3XA 2J7GA 2VX5A 2XM1A 2FE0A 2DT1A 3LPFA 1HF6A 3ZM8A 1HNYA 1UOKA 4J7RA 1JZ4A 3SUSA 4OGZA 1E6XM 2OYMA 4B15A 1H41A 3VPLA 1UZ4A 4WSJA 2ZX9A 3VMOA 1KXHA 3DC0A 4PCSA 2ZXQA 1UD5A 4MNMA 3PN8A 1D3CA 3FHAA 1H0IA 3N18A 4P7NA 3RM8A 3EJPA 2WBKA 4NI3A 4MADA 1WZKA 1QI0A 1UKPA 1WB0A 2VQUA 4UQEA 3WQ4A 1W9BM 4W86A 2XWDA 2DDXA 1H1NA 5DMYA 3WENA 3WMBA 2YDQA 1VFFA 4CN4A 4L4PA 1W1PA 3VMPA 1R86A 4AZCB 1MXGA 1XD0A 3BCFA 3VGFA 1V6WA 1MXDA 5BCAA 1TMQA 4W7VA 2BY1A 2BS9A 3VUPA 1E72M 2OW6A 5BROA 3AMCA 3GH7A 3THDA 2VUYA 4EE9A 4KGJA 4KMQA 3W28A 3VDAA 3CLWA 1HJVA 2FHFA 3L4YA 4LYRA 5M5DA 4NZCA 1BQCA 1UWQA 1UWSA 4UFIA 3L4ZA 1FH7A 3VTRA 4WF7A 3WBEA 3LPGA 3PBGA 3HG3A 3ZT7A 1W32A 3WSUA 1KB3A 5CG0A 5BWFA 4BQ4A 1QWNA 3ARWA 1TCMA 4CVWA 2ZWZA 6A3HA 1UD3A 4NZJA 3MUIA 5GNZA 3B9EA 3TTSA 1C8XA 1K9EA 3SUUA 2PWHA 1BFNA 4ML4A 3UG5A 1JNEA 1X6NA 3F4VA 4PMYA 2AMGA 4WIWA 3VX1A 4MNJA 4WKAA 1E1EA 2DPEA 4JCLA 3NYDA 4QFUA 5E0FA 1WKYA 3WFLA 4D6EA 1E4MM 4JL2A 5JBDA 3WD3A 2EAEA 2XSBA 1E56A 1LWJA 1E6NA 3WNOA 3WDHA 5I2UA 1V6VA 5D9OA 3GTNA 2ZX7A 4PBGA 4PN2A 2ZXBA 1W9XA 1TVNA 3W82A 3EJQA 2VRJA 3ZJ7A 4H41A 2Y2WA 2OSXA 1NM9A 2YJQA 1K9FA 1QNSA 2W61A 3BAIA 4NRRA 4KWUA 4AIEA 1O7AA 2CNCA 3K46A 2YA1A 3NJ3A 1E43A 3BVUA 3UERA 3MS8A 3UR7A 1E9LA 1QI3A 1C3FA 3AIQA 4YHEA 5GQBA 1JZ7A 1DWJM 1ZJBA 4MNLA 3AI0A 4NZFA 1CXHA 1G94A 2F1BA 1R33A 2WVVA 1YQ2A 4LX4A 1P6WA 3WDQA 4A4AA 5JIWA 3OLGA 5I0DA 1JAKA 1WAWA 1ISZA 3BUQA 2OYKA 2WC4A 3MUZ1 1ISXA 4CU7A 4PTVA 4CU6A 4AMCA 5EMYA 3CPUA 2WHLA 3WF1A 1GJWA 1WDQA 4IPNB 1U33A 3BSHA 2Z1SA 4D1IA 1CBGA 2UY2A 4QCFA 2HVMA 2OSWA 1R8LA 1K6AA 4Q7NA 3DYPA 2CBJA 5A2CA 2GDUA 3VIMA 4W89A 4AXNA 1WO2A 3IJ8A 3SCPA 3WUBA 2ZE0A 1ISYA 1MW1A 1ZU8A 1E15A 2JFEX 5HDRA 2DSVA 3BXWA 4D6CA 2O9OA 3WELA 1QPKA 3LRKA 3QHMA 2BHUA 1V0NA 1CDGA 2WANA 3K4DA 4MB5A 1B3WA 2VNCA 3KLLA 3WY1A 4BQ2A 2TAAA 4LPCA 4AY1A 2GJRA 1C8YA 3A4XA 4M56A 1TE1A 2OW7A 1U30A 1G0CA 3VD5A 2WB5A 1XH2A 1GVIA 1L8NA 5A1AA 3T08A 1JNDA 3ECQA 4N0RA 2WVUA 2F7OA 2W66A 5FL1A 3POHA 1QBAA 1FHDA 3ZMRA 3ARXA 1BG9A 3VILA 1PBGA 2A3EA 3MV01 3OA5A 3AZRA 4OKDA 4UCFA 5E6YA 3WUEA 4GI6A 4EANA 2WVTA 3JUGA 1UWTA 2J7DA 3UEQA 1V03A 4UFJA 1JFHA 9CGTA 4URIA 5FKYA 3WBAA 1UR0A 4KH2A 3HMCA 1V6XA 1BGAA 1E3XA 4ZEPA 4AEEA 5EB8A 1CTNA 4FLOA 3VIFA 3WH9A 4ZENA 2D2OA 3A24A 2F18A 4W8LA 4GZEA 2E8YA 3CC1A 5CSYA 1JL8A 4JFSA 3TTOA 4DO4A 1E5NA 2WMIB 1G1YA 1GOMA 2O9RA 3K8MA 3M7SA 4HA1A 2XN1A 1KBKA 3WNNA 1HP4A 1UYQA 5C70A 3O6AA 3D50A 4EKJA 3WH6A 5JBEA 4D6HA 3CGTA 5E09A 5BRQA 1VB9A 3PHAA 3VU2A 3WDRA 1B30A 1CPUA 1UQYA 3D4ZA 8CGTA 1G5AA 2YL8A 2GDVA 3AS0A 4PRWA 2W63A 4F66A 1OWQA 2DSZA 1ODZA 5JUVA 4PCTA 1CNVA 5LA1A 3GZAA 2AAAA 1NOFA 1JDDA 2PWFA 2IXUA 3RDKA 1PZ2A 2O92A 1N82A 4HP5A 3SIMA 1XD1A 5D9PA 2YDRA 2GSJA 4AW7A 1Q6DA 1Q6EA 1TR1A 2XVGA 4H8HA 3CIVA 4ACZB 1OB0A 3D3AA 2FH6A 1WZMA 2F1AA 3DX2A 5GNXA 1TQTA 3BC9A 5ECUA 4TOQA 2J62A 1LL7A 1E0WA 2BVYA 4IM4A 1GQKA 3WH7A 4AD2A 4PMNA 1E55A 2WHMA 3BVVA 1HXKA 3WQ8A 1GVYA 3OGVA 3OLDA 1PX3A 4AD4A 2YA0A 1GOKA 1UA3A 1R7AA 4PMRA 2JIEA 3EBVA 5LYRA 1QNOA 4M1RA 2DSWA 4E8CA 5IDIA 4MPKA 3QHNA 3IAPA 3HN3A 4FMVA 3U7VA 4OBRA 4CVUA 2UY4A 3SCTA 4QAWA 4GIAA 4Z2HA 2D23A 3LXBA 4RL3A 1NWRA 2EJ1A 1W9DM 1BHGA 1GUVA 4B9ZA 1VF8A 2C0HA 1I75A 1XRVA 4HOWA 2X8RA 2BXZA 3UG3A 4HA4A 4KRUA 5A8OA 4HPGA 2VCBA 2JE8A 3ARPA 4UZSA 1KGWA 3VX0A 3OG2A 3WY4A 5ABFB 2D3LA 1HT6A 5C8BB 5CGMA 3J7HA 2BY2A 1M7XA 1IZKA 3WNMA 4D1JA 2XN2A 1H0GA 4U3AA 3ZSSA 1MW2A 3RCNA 2ZUMA 1C7SA 3VM5A 2J77A 2CYGA 4HA3A 2BVTA 2DIJA 3WNPA 1R87A 3AIUA 4J27A 3MUY1 3RJXA 3RJYA 2VTFA 4HMEA 3DX1A 4WJXA 3IJ7A 1LF1A 5KEZA 3VGDA 5GNYA 4QLJA 1GOOA 5A6AA 3BAXA 2BXYA 3SEPA 2EABA 1UR9A 1UR1A 5FIPA 3OGRA 1BYBA 4EK7A 3BAKA 1QHOA 2VR5A 1BVNP 3W27A 1J18A 5DT5A 3GXIA 3U7BA 2WZEA 1JI1A 1UKSA 3VIPA 2EO7A 3CZ8A 1PJ9A 1GHSA 3HU7A 2PWGA 4ACYA 4DUVA 1QNRA 3N04A 4MJ2A 1JF6A 2X2JA 2CBVA 2ZOXA 5I79A 1M03A 4W8AA 4AZ6A 3KEHA 2XG9A 1D2KA 4DWSD 1FFRA 1UWRA 3DX4A 4HOZA 3N17A 2ZXDA 4PMDA 3N13A 1UKTA 2NT0A 1K9TA 2J47A 3EDEA 2W5FA 3FHQA 4QCEA 3TP4A 5AYBA 3T0BA 1DP0A 1UD2A 4GI8A 1QW9A 2G3JA 1ZBVA 4MAVA 3M07A 5BXPA 1XGZA 3VD3A 3EMQA 4TVUA 1AQ0A 1TQSA 4FK9A 2XTKA 1FH9A 1RD6A 1DWIM 1OGBA 1J10A 4GPNA 4AZCA 3OZOA 4MAZA 5CQ1A 4CD6A 2EXOA 3DHUA 1BYCA 1BAGA 3LRLA 3AZSA 1BPLB 2F7RA 3SCWA 4NF7A 4UOQA 2EPMX 4QP0A 4U2YA 2G41A 3IANA 2D20A 4HTYA 1MQPA 5IXEA 3RM4A 4UFLA 4UQDA 4LGXA 1W3JA 1LG2A 2PBOA 3W25A 2WLYA 1QBBA 1QWUA 3AXHA 4H8UA 3SCUA 3VSUA 1Q4NX 1GPFA 1MFUA 3ALFA 3CHEA 1ZBWA 2PWDA 2VZOA 3GNRA 2VR4A 4PTMA 3WIJA 2YL5A 1Q6GA 1VBUA 1H3GA 1NQ6A 1E6QM 4GQQA 3AS3A 4W7UA 1OCQA 1MWOA 3LX9A 4L4OA 3PZOA 1SR0A 1QNPA 3T0DA 1NARA 1WDRA 3TA9A 2OSYA 2WMGA 4FLSA 4GKLA 1DWFM 2E3ZA 3CZSA 4A3HA 4B16A 5EBAA 3W6MA 5CJ5A 5CPTA 3SCQA 1EH9A 4ATWA 1LWHA 3DDFA 1CXKA 4UFHA 5DEZA 1XYFA 2O9TA 2Y4SA 4C7FA 1LG1A 2V5CA 2Y5EA 4M8UA 4U2ZA 2D3NA 3ZIZA 1IT0A 5A2BA 1FHLA 1QX1A 4LQ1A 1TQVA 1OD8A 3SURA 3KE0A 2JALA 4M82A 5A95A 1JXKA 2C7FA 3F5KA 2X09A 5A8PA 2FHBA 1E70M 1OINA 3MU7A 3SCNA 4BQ5A 3CV5A 1TZ7A 2G3MA 1UD6A 3HZ3A 1AQHA 3AFBA 3BLBA 4XV0A 4CCDA 3A47A 3GXNA 4MB4A 1UA7A 2J75A 3OZPA 4LXFA 1QNQA 1ISVA 1E6RA 3AYSA 3GBDA 1T0OA 3O2LA 4P7LA 1R85A 3L4UA 4X0NA 2BV9A 2ZWYA 3BAJA 1LQ0A 1CGYA 3OLIA 3EDDA 2JF6A 3NIYA 3EDKA 1HN1A 2EACA 1E4LA 1PIGA 4BS0A 3CHDA 3LXCA 1O6IA 3TTYA 2YLLA 2J78A 3E1F1 4U33A 4AD5A 3L4XA 1CZ1A 3G6MA 4Z2JA 1M04A 1ZJAA 2D0FA 2PB1A 3AROA 4DWSB 3B9DA 1J0IA 1E71M 3U5YA 5FOOA 3KL0A 3W38A 2WSPA 1LL4A 5A69A 3B8SA 3PZGA 1HTYA 4GXPA 2W92A 3PZIA 3VSVA 4QDMA 5ABEA 2J7BA 3SUWA 2PBGA 1Q6CA 3SUTA 4J3UA 3VVGA 3MKKA 1LJYA 1HL8A 4GINA 3CUHA 3OB8A 3PZTA 4HPHA 3KZSA 4JZ5A 4H8VA 2BHZA 2VCCA 4J3WA 1EIBA 2ZUVA 3KWXA 3AMDA 1GNXA 1H09A 4XX6A 2DH3A 4OOUA 1HIZA 2VC9A 1ITCA 2DIEA 5HOSA 5IFTA 2AOSA 1J12A 4B9YA 5D8ZA 2G4FA 5A8QA 1VJZA 4GI9A 1CECA 3THCA 4XUYA 1YHTA 2FHCA 1XSKA 2VZTA 2GJXB 3FAWA 2GUYA 2XN0A 2CIPA 6CGTA 5GPRA 3PZQA 2FH8A 1B0IA 4GZJA 4S3KA 1KCKA 2VOTA 4P8XA 5TD4A 2WPGA 1WE5A 3DHPA 1B31A 2RGMA 2J8GA 3GH5A 3FXYA 2WMIA 3PTKA 1UD8A 1US2A 4TVCA 4UOZA 1B9ZA 1VFMA 2E9BA 4AD3A 3GXFA 3SUVA 3A4WA 5A6KA 1IZJA 1MFVA 4UQ9A 1HJUA 4AYSA 1PS3A 2G3IA 1KR0A 2BY3A 2XM2A 1CXLA 3LPPA 4UQCA 3WF4A 4WKHA 1S46A 1KBBA 4P8WA 1OIMA 3WEOA 3ZOAA 3BUBA 4AMXA 2G8ZA 3AOFA 3VIOA 1J11A 3MSDA 4MDOA 3BGAA 2ZUWA 2ZUTA 4BA0A 1R34A 1FP9A 1FP8A 5LA0A 1B90A 4J3SA 2XUCA 2VZVA 1C7TA 1PX8A 3VOCA 4OZOA 4JKKA 4D6FA 2ZUNA 2WVSA 3FY1A 3WN6A 4MJ4A 1DTUA 3BSGA 3BVWA 3L4VA 4QLKA 3A3HA 3WY3A 1BSIA 2XJ7A 3VKKA 1H2JA 1UH2A 3A4AA 1ECEA 1EDQA 1AMYA 4PMUA 4FNTA 4ACZA 3CUIA 2O9PA 3MMUA 1MYRA 4F79A 2CEQA 3ARSA 1E3ZA 2D22A 2JEPA 3L4TA 4JKMA 4AZBA 2WMFA 2EPNA 2DT2A 3ARZA 2X2HA 1JZ5A 4CD7A 1GOIA 2D73A 1UR8A 5A6BD 4CD5A 1EOKA 2W62A 4AISA 3NDZA 3NSXA 3SCVA 5CLTA 4PUDA 4GO8A 4FNRA 4JHZA 2VI0A 5JBFA 4CCCA 1JDCA 1E1FA 1HKMA 4UR9A 1QI5A 1XH1A 1Y7VA 3VSTA 5LA2A 3H53A 1JYWA 3CZLA 2CPUA 2W91A 1CGTA 4FNPA 3T2PA 2FYVA 5I6SA 2XIBA 3GXTA 5F7UA 2A3BA 3TTQA 3CBWA 1VRXA 4W93A 4JAWA 1W1YA 1OD0A 1WPCA 4FNSA 1J0HA 3N15A 1W3LA 3VD4A 1OGSA 4U5KA 5ABFA 1U2YA 4BZYA 3QGVA 1UZ1A 3ARVA 2PF0A 1KCLA 3ZT6A 1GHRA 3T2OA 2Y8KA 3S5YA 4AMWA 1NOUA 3VNZA 4MTVA 2NW0A 3WF2A 1PX4A 1MQQA 3II1A 3NUKA 2D24A 2MANA 3WNLA 4AZIA 3UETA 1C90A 3VGBA 5DF0A 2BVDA 3HG2A 1DWAM 5BXSA 3WMSA 5A6LA 4AZ5A 3FW6A 1BVZA 4OUEA 4AC1X 1ODUA 2F2HA 3N1AA 4RE4A 2QV4A 2CBUA 1VIWA 1JI2A 1BYDA 4P8VA 3CZGA 2VCAA 4ATDA 4W88A 4GO9A 2ZUUA 3AMLA 3DYOA 5DO8A 3SCRA 1HP5A 4BCEA 1E5JA 5D4YA 4Z2IA 4UQBA 1E6ZA 2A3AA 1UKOA 3AXXA 3WEZA 1EO7A 4XZBA 2V3DA 4ZXOA 4JL1A 1E40A 3D52A 1V0MA 2VX4A 3CZEA 3QOMA 4TUFA 2ZXAA 4W7WA 2ZUSA 4UOJA 1CGUA 3I3BA 3WQ6A 3PTQA 1VFOA 1EDTA 3PZVA 1I1XA 4TXEA 5AY7A 4PSPA 1RP8A 4W85A 5EFDA 2CBIA 3SCSA 1V0KA 4HZ6A 1XSJA 4JIEA 2Q8XA 3PZUA 2XYLA 1UH4A 4CKQA 2QLYA 1XYZA 5A8NA 5FL0A 4FNUA 4D6JA 2PI6A 4K68A 2GVYA 3WF0A 4W8BA 1SMAA 3ZQ9A 2ALWA 2EPKX 3EMCA 3POCA 1UASA 5CPSA 1CLXA 4UZUA 3EJSA 2CCRA 2HISA 1R75A 1JF5A 3CUFA 4HOXA 1EHAA 2DGAA 1TVPA 5D8WA 2XFRA 2DQXA 4NXKA 3AHTA 1GJUA 1HJXA 4KGLA 2XGBA 4MB3A 1RPKA 3IJ9A 2E9LA 2XVPA 2CHOA 4TTUA 3RO8A 5I5RA 3PZMA 2Y24A 1EDGA 1IV8A 4ZXLA 2WCSA 3EJTA 4LYPA 2WMHA 2XHYA 2QPSA 1E0VA 3AZTA 3MANA 4X9YA 1B1YA 1XHGA 1W91A 2X2YA 1UKQA 3L4WA 2WK2A 2WSKA 1W9PA 1SZNA 3DX0A 2CESA 2DT0A 2J8FA 2YL6A 4PTWA 3W24A 4JFVA 3PTMA 2WBGA 1UQZA 1TA3B 3N11A 3WKZA 5M3WA 2EQDA 4AWEA 3T0AA 2BFGA 2ZICA 1W2VA 3FNDA 5EFFA 1JFXA 4C7DA 2WZHA 3OIHA 3BCDA 3HG4A 4ZE5A 4HU0A 1W1VA 2JEQA 4CN1A 3VM7A 1W9VA 2JIWA 4Z2GA 5HBFA 5I77A 3EDFA 2E8ZA 1V02A 4IISA 4E4PA 1NP0A 1GOQA 3KLKA 3D5HA 1EQCA 1XH0A 4R5EA 3VD9A 1RP9A 1WNOA 5C71A 3CMGA 3ARUA 1US3A 3N9KA 2YBUA 4HZ8A 1HJSA 2VZUA 4U5IA 3GYCA 3GH4A 1BYAA 1KXTA 3AS2A 2VVNA 3AIVA 1JIBA 5HPOA 3UESA 2RGLA 3K8LA 3VIKA 4PSRA 5HXMA 4UFKA 1CXEA 5I24A 1F4HA 3WH5A 3K1DA 2CHNA 4FLQA 3W37A 1GQLA 2J74A 1CGVA 1C91A 1GQIA 3QR3A 1OT2A 4IUGA 3GNPA 5A94A 3AHZA 3VIGA 4LYQA 2DEPA 2UWFA 2BY0A 4MDPA 1HXJA 1JYVA 3WD2A 2G3NA 3IGUA 5DT7A 5DFAA 4J3VA 3KL5A 3W29A 4MB1A 1L0PA 4TX8A 3WH8A 2X2IA 2ZX6A 2Z1KA 1JD9A 1F4AA 4OJYA 2ESCA 3TV8A 4P7QA 3L2MA 1QOXA 1H11A 1UHVA 4NX0A 1E73M 2GK1B 3DX3A 4DUWA 4NXSA 1G9HA 5ABHA 2UY5A 4JFTA 1E6PA 1V3JA 3A21A 4B3LA 3BUPA 2E40A 4DWSA 1J01A 3CZKA 1HVXA 4V2XA 3WY2A 3NSNA 4V27A 1XCWA 2YFNA 2W67A 3LRMA 3WUGA 8A3HA 4W87A 3N12A 2WZIA 1KGXA 3A22A 1QW8A 2Y8VA 6TAAA 2VMFA 1SFSA 4UQAA 4J28A 2OWCA 1W3HA 1FFQA 4BF7A 1EA9C 3BH4A 1D7FA 1K9DA 1RH9A 2CKSA 1ITXA 1KR1A 5E0CA 4W84A 5JIPA 4WLCA 1FA2A 3AMKA 1CXIA 2WKLA 1HJWA 1NWTA 2YA2A 1UUQA 1NH6A 2DSUA 2VQTA 3GNOA 4YHGA 1SMDA 1E6SM 2UY3A 1V3HA 4IPLA 3ZJKA 2V38A 2V3FA 3WF3A 1VFUA 3W26A 4FNQA 2CERA 1WZAA 2F7PA 3VDCA 1V3LA 1KTCA 5A6SA 1OBAA 2D0HA 3PZ9A 3ZSTA 3BAWA 3AIBA 3A6OA 4CU8A 1FH8A 1HL9A 3K8KA 4GQRA 2VX7A 1B3VA 3GXPA 2JF7A 4D72A 5BYWA 2GJXA 1WCGA 4WK9A 5CSUA 3AJ7A 4TTGA 2WWDA 4YPJA 2OYLA 1GONA 3CO4A 2WCAA 1VEMA 2WYSA 1BLIA 2WHKA 2ZX5A 5D9MA 2PWEA 2C8NA 3D51A 1I1WA 4HZ7A 3KL3A 4CGTA 3B9AA 2WAGA 4F9DA 4JFWA 1W9UA 2WC7A 1QHPA 1E4NA 2F8QA 2FDMA 2VJXA 3WQ5A 1EO5A 5I23A 3S6TA 1H4PA 4FF5A 3WDJA 1V3IA 4QLLA 4Y7EA 4Z2KA 1VENA 1R46A 3MI6A 4PYSA 2J7CA 2YFOA 4J3TA 2VRKA 5ABGA 2OWXA 2QMKA 1B2YA 3VDHA 3U57A 2XVLA 4PMXA 1GW1A 1JXJA 1DWGM 3BAYA 2A3HA 3IK2A 3AIWA 3WEMA 5FCZA 2XGIA 3CMJA 3VMNA 3CZJA 5CLWA 1V3MA 3AMGA 3H54A 1AQMA 1J0ZA 3M46A 1JYXA 2CETA 1QI4A 5IFPA 4ZFMA 4OBSA 4NRSA 3DYMA 5CXPA 3WFZA 4E2OA 5BXTA 5I3DA 4D6GA 3RM9A 1OSEA 1SYTA 1LL6A 3SCOA 2YIHA 3S2CA 3VDBA 4DO6A 4OIFA 3MUAA 1QVBA 1EHNA 2WC3A 1B3ZA 1W1TA 1VJSA 2IUZA 3MMWA 4W5ZA 1JAEA 1M01A 3VO0A 3ARYA 4N42A 3GDBA 4PEEA 4MNKA 1KWGA 2V5DA 3BVXA 2OLHA 3T2QA 1V0LA 3CTTA 3VGGA 4C7GA 1UH3A 2VL4A 5D9NA 2XSAA 4AZHA 5E1QA 4AIOA 1TQUA 3TOPA 3AYRA 3WD4A 3CUJA 4UTFA 3BLKA 4DO5A 3GBEA 4XB3A 4DM2A 2E0PA 4JCMA 3O9NA 3G6LA 3EMZA 3W6LA 3H55A 3WDPP 2X1IA 1PIFA 3VNYA 2WVVB 3CHCA 2QHAA 3W53A 5IHSA 4PMVA 2BNJA 4PMZA 3WNKA 2W4XA 2QMJA 5A2AA 2GFTA 4PMOA 2CKRA 1JGIA 1A3HA 1A47A 1ZBKA 2J25A 3ZR6A 5M17A 1CXFA 1NWUA 4Q22A 4JHOA 3CH9A 1VEPA 5HPCA 4HU8A 5M03A 4ATLA 4P8UA 1DHKA 3WL0A 1UG6A 4TVDA 3AIRA 3ARTA 4D71A 5HNNA 3WD1A 1XC6A 1KXQA 4E8DA 3K4AA 4M24A 1EGZA 4HMCA 1OIFA 2VRQA 2WHJA 5CGTA 2J7EA 1H5VA 2XIIA 5CZKA 2DT3A 2NSXA 1BG4A 3CZNA 2GJPA 2VZSA 1Z32X 7TAAA 4W5UA 1WZLA 3LXAA 1PEZA 1JZ3A 5A6JA 2QPUA 1UR4A 4AD0A 3WQWA 3TONA 4PUEA 1HVQA 2V3GA 3UG4A 3VIHA 4A3YA 1MW3A 3EJUA 3U5UA 1CLVA 1NP2A 3AHVA 3D4YA 3OLEA 1QI2A 7CGTA 4CUCA 2YDSA 3WD0A 2QF8A 3I3EA 1VBRA 3WDIA 1UWUA 2WXDM 3ZR5A 3BUDA 3RIKA 1C92A 2WKGA 1CGXA 4AZ7A 2F61A 3BLPX 4DM1A 2WLZA 3PZNA 3ZJ6A 3BMWA 4PMQA 3ARQA 1JYNA 4EAMA 1DWHM 1OT1A 1ZBCA 3M6DA 2XFFA 1TUXA 1GQJA 1VAHA 1V08A 4JFUA 3AISA 1G01A 7A3HA 3HG5A 1CYGA 2WWCA 4CN6A 1PAMA 3ZJ8A 2D0GA 3F5LA 3S5ZA 4F8XA 3EJRA 4R27A 2YL9A 1HKIA 4DWSC 1WDSA 4UFMA 3W0KA 4D6DA 2PC8A 5E6ZA 3ALGA 1WP6A 2EBNA 3CUGA 2CXGA 1J9YA 3AHYA 2CITA 1B3XA 1KQYA 4U3CA 2DSKA 1V6YA 4H04A 1EOMA 3APGA 3HJEA 1V02E 1KWKA 2EADA 1J0YA 3AXIA 3GXDA 3EDJA 4AD1A 1JD7A 3AS1A 2YBTA 2X0YA 2BHYA 3OGSA 2VX6A 3RPMA 4AZGA 2J7HA
chains in the Genus database with same CATH superfamily
3NDYE 1SN0A 3BZFB 5DX7A 4HD5A 2E4FA 1AJ7H 2BOCB 4P57A 3H9HB 5CBJA 1UP2A 4WI2A 2AJUL 1ESWA 1LBFA 4P9HC 2ZVRA 3HQNA 2IPUK 4D9PA 5D5MF 2WXRA 3EFOB 1GZJA 1ILSA 2CM5A 2ZX8A 4JKLA 5F7NC 5D8JH 2X05A 4G7SB 4IRJB 4WI0A 1BGGA 1FYTD 4JYFA 1KFWA 1ZLSL 1VS1A 1V3KA 1CFNA 3N1MC 1NAKH 4XNUH 2Q7YA 4X6EB 3ZYJA 3N9RA 4LF1A 3IAQA 3EYQC 4EF3A 4HJ0D 4KMLB 4E8GA 3EOEA 2CLOA 4L1DA 4KWWA 1O7DC 5DK0B 4N02A 2WMKA 5JYMA 1AGBA 2B7PA 3U7YL 4KRTA 4XCEB 4QSFA 2VVSA 5M2FX 4IJRA 1ADDA 2WWKT 4WIQA 3AHXA 3W2NA 4K9EC 1PQZB 1HJQA 2X4OA 4JQXA 4OAWA 1XFCA 4MWFA 4PJBB 1YCSA 1EQPA 4JX4A 4RMVA 4S1DC 4AT6B 4JO3H 3VGEA 3UJJL 3QMRA 2EJAA 4FPSA 5LQBH 2FGZA 1Q72H 3MO4A 4AE0A 4QD2E 4QRAA 5D1QE 2G9HB 5DY2A 1V55B 5HMDA 3DFPA 3KGSA 2OYMA 3OU8A 4PUMA 2JLLA 4MCMA 3BW2A 2XYBA 4HIJA 1DBBL 5DRNB 1I8MA 4A35A 4XO5A 1TU2B 2ZOWA 1JCMP 1NM4A 2HVOA 2OR9H 5HGHB 2VQUA 3FO0H 3DWTA 2X70A 4PJFB 3WENA 1G6CA 1BZDA 1NTDA 3QRLA 1N59B 4V1DA 5EU6A 3ESPA 5F21B 4AZCB 1D3HA 2NQHA 4JX0A 4Q4RA 4S3AA 2VDPL 1II4E 2I7OA 2FRGP 1AS6A 5JZ7C 3W28A 4L3AA 1W5MA 4IBQA 4UFIA 1E9PA 2C71A 2CLPA 1FYTB 2ZUXA 2H3BA 1QUNA 4YBLC 5KYXA 4CNNA 5IW6B 2QADD 1TENA 3MUIA 2JKNA 1MRAA 4LVOB 5LNUA 4E5XB 4APQC 1YEIH 1M57B 5AOUA 3ABOA 1QRKA 3NYDA 5KVDL 3LYEA 2ANUA 2HP4A 3PF2A 2HG5A 1RJYA 1E6NA 2EHHA 4Z42C 1XIHA 4NQCA 2P1FA 1EBPA 1P1ZA 3FTSA 4EPBC 3ZJ7A 3LAFA 3S1GA 2R1YB 3FKUS 1P0EA 3PJSA 4Z7NF 2CXKA 3ULVC 4IPPA 5K59E 3D7PA 2HVNA 1LE5B 4HZMA 3P54A 3Q6GL 4FEIA 3A64A 1C3FA 3IVUA 2GHZA 3AIQA 3W01A 3LDBC 1FGVL 4EIGB 1S7RA 4KW2A 4HHGA 4X9IA 1SPQA 5D2NB 5JXED 1X4YA 4EVZA 2P28B 1HSAA 3UMNA 5KYUA 3REQA 3SB0A 3Q9PA 3VI3B 3DOPA 4WY7H 1JEZA 1T2JA 4P2QD 2HMID 3BSHA 4WWID 1ERNA 4MYAA 5MEOA 3CDGA 4YHNB 4HYTB 2DF3A 4W89A 5IOPA 3SCPA 2ATSA 2QQLL 5LXVA 3IJEB 5E2UL 2J20A 4B27A 3VOFA 3ENEA 1QPKA 1V77A 1ZS8A 5B39B 1V0NA 3ZMEA 4J3OG 1KEGL 1D7DA 4JCWA 2A6DB 4J6RH 1YAIA 2WVUA 3QZWG 2OMZB 3G9AB 3TA3C 2H7WA 2ZA2A 3DI2B 1DUYA 2CLKA 4BD4A 3GHEL 4UFJA 2CIKA 4I2XE 2NY3D 3DJSA 3W7PA 2XZQH 3EO1A 3R0NA 3OVPA 2QADB 4WR3A 3VIFA 3FSUA 4W8LA 5LBVA 3L7EA 1JL8A 5AALA 4DK6A 3TS8A 2WMIB 4HK3N 2DZBA 1QHQA 1KW1A 4IJTA 3HIJA 4UT6A 2FJKA 2CLVA 1BQLH 3UZZA 5GS2D 2XLLA 5E8EA 1R3QA 4DN1A 4JTTA 1RZFH 2MNRA 1XGUB 2DORA 1TJPA 4PS7A 3MXWH 2NY6D 4DAFA 3QRGH 2GJLA 4PTTA 1ODZA 1EEXA 2XZZA 4N2KA 3RZCD 1WCBA 2CBPA 4NKDA 1U6AL 4YYFA 4ZFZA 1T22A 3B43A 4HUUA 4ACZB 2FT7A 2Z0BA 1GRWA 3NQIA 4RFNC 5SV4A 4BFKA 3LQZB 2F0CA 2OSLA 1GQKA 5AKTA 5I17A 1M6UA 1IGCH 3ILQC 3GKZA 3QZMA 2NNFA 4OI8A 4P2QB 1T83C 4HKBA 1I7ZB 1FO0A 3F6IA 5I73C 4NZTL 5K33A 3MBED 3E80A 4Z1PA 2ED6A 3PFMA 4NP4H 1EC7A 3FN0H 4LLUB 2MKLC 5LAXA 1GC1H 1N2RA 4MJMA 4HOWA 4PYGA 3BSZH 2NUXA 3MJYA 4KAQL 1WZ1H 4G5AA 2XFWA 1B0GA 5BMFL 4XN5A 1VACA 5GJPA 2D3LA 4I3SH 1TZ9A 2WUCL 4N8VA 3LD8B 3JVGA 4U3AA 2W5PA 3H22A 2ZUMA 3T04D 4PD4J 5CGYC 4HA3A 4I9AA 3EGSB 1M9WA 1BX2A 2Z31A 1X5LA 5IQNA 1JPSL 4HAKA 1K8DA 2NY3B 3WCYA 4P99A 1BQ5A 3TN0C 4XPTH 5JW4M 5CWSA 3H7VA 4ZVJA 3BDXA 5FIPA 4N2LA 2J5LC 3UABA 4JTGA 4RRPA 5G2IA 1LEKB 2ZTJA 2LVCA 4HU4A 2F74B 3MLWH 3L81A 1NBYB 4YDVA 5FB8B 2VH5H 2CBVA 4U7SA 5HYJE 2R7EB 1KRCC 1XGQB 4HIXH 4AQEB 3IFNL 4BH7B 3Q8BA 1KGIA 3GSRA 2NY6B 5IY5B 2NSOA 2AGJL 1QW9A 4RGMC 3RZCB 3UYPB 1NL0H 4OT1H 5F2IA 1R3JA 1OFPA 2EH8H 2OFQA 4TUJB 4MQXC 4G42B 1B6DA 1F8TH 3MZGB 4XC1H 3I6KA 4PY8J 1PDKA 4EPSA 2BFVL 2D20A 3II2A 4HTYA 1YY9C 4UM8A 4HCLA 5IV2A 1H7RA 1A3LH 3U9UB 2EUXA 2WLYA 3M0JA 3AXHA 4EPKA 4OGAC 4XCFL 3DHFA 4Y8FA 1EQWA 2X7LA 1GGOA 1DVTA 4DPRA 5HD8C 3MBEB 4XBEH 2VSDA 4GQQA 3TWYA 1FY6A 3RWJA 2DLFL 3LX9A 2KLTA 3ABRA 3OAUL 2XXMB 4TSCL 5CAKA 1HIML 2BASA 4WW1B 2R24A 3LZFH 3EYQD 3CC5B 3S9IA 2P5ED 4MMYB 1LG1A 2ZNWA 4JE4B 4DP0X 5DEJA 2RUSA 1IAOA 1EJFA 3L2NA 3HZ3A 1VHNA 4XV0A 1O12A 3NFNA 3N06B 3AYSA 3DLQR 3NM3A 3L4UA 1OHLA 1CGSH 2X53A 1EJRC 1AZRA 3HI5L 2QSCL 4R4NC 1L8PA 3JU2A 1CI5A 4S1DD 3HMWL 2H8ZA 5IGXL 5A40E 4RPQA 3KAOA 1XIMA 1CC3A 4GXFA 4WZ9A 5JO5B 3BRFA 2PB1A 3HBZA 3QDMD 1PEWA 3OKKB 2WSPA 2WZTA 1W56A 3KBPA 3VH8A 1OVDA 1GYWA 1F5ZA 4FLHA 4PL2A 1A5FL 5FX3A 4QTIL 1GT8A 3ARGC 4O52A 4HNNA 5I02A 2WQVA 3D39E 3WQOA 2UWEA 3QEQD 2GGJA 4Z0JA 1NMCC 5E1HB 1H5BA 2VCCA 1FL6A 5CJMA 1HIZA 2G75A 3EGDA 4WFGE 4PWHA 2JQXA 2ZA1A 4BZ1A 5A8QA 3THCA 2EO1A 4N86A 4I7WA 2Z7GA 1V51A 4Y5XA 5JZ7D 4NSKA 1ES0A 5C5YA 4Y9CA 3DHPA 3TWCL 2WUBL 1R24A 3K4ZA 1F90L 1FVDB 4P2AA 3TIDB 4LBAA 4JFPB 2I9TB 5I5JA 1TWDA 2AXJA 2G3IA 1ZSXA 4PJXF 4APQD 3DGGB 2W60B 3O7UA 2Z8WC 3A4JA 1J8HB 3WEBA 1JPDX 2WLMA 3KYOB 3LLDA 1THFD 3W2LA 2P5EB 1UB6A 1IF2A 2VAAB 1U5HA 3VXME 4JKKA 1P84K 2ZUNA 4PRRA 1LUCA 3M0XA 1JK8A 5F1IB 2EDBA 3C4UA 4AEHH 4Y2WA 1JGLH 3RUGB 1BSIA 4LEBA 2XJ7A 3FQUB 5AVQB 4YX2L 4I5BB 3S2MA 4FNTA 2WZMA 2C79A 3ULVD 2O9PA 3CSTA 4IKIA 3HGSA 2NXGA 3MUGB 1U1HA 4R8WL 4XAYA 3EH1A 5AVYB 1FIGL 1CIDA 5H35B 2DVUA 3BZEB 2X1PA 1A5LC 4ZUVB 1WD8A 2AXGB 3LKPB 1YMME 2OB3A 3CU7A 3IMWA 5FYKU 4IGSA 3EOUA 1XR8A 4OTXH 1EIXA 2EVHA 5CBAB 4OQTA 2VN3A 2GY7B 3EZJB 3ITTA 3LENA 2X0SA 2R2BA 3GHUA 3PIQA 4AXWB 3QEQB 4LVFA 5C7XL 4DYJA 3ZT6A 6ENLA 4L4JA 1C5CL 3VXUA 2E68A 2VEGA 3UPCA 3DTXA 4KJYA 5KJRH 5ENWA 3TA3D 1N64H 3HZKA 4KITB 4HS3B 4JN1H 8RUCA 1VIWA 3EXJA 1Q3NA 1B3IA 4PJ7F 4X42A 4YBLB 4XD5A 4WFFD 1ICPA 1QW7A 3PNUA 2CJUH 3RGBA 1JPFB 3EO0B 4NC0B 5CO1A 4ERIA 3WEZA 5FF2A 2AJVL 3HGOA 3LNMA 1QOKA 4APQB 3BWAA 3HF3A 1CGUA 5AY7A 3RPIA 5EFDA 2CBIA 1KCRL 4FXGA 2OO6A 1F97A 4C56D 4XB7A 5L2KA 3BOXA 4WDIB 3QNZA 3EMCA 2Q6WB 2RJGA 1N67A 3KVQA 3DIPA 3NQEA 2EE0A 1VDGA 1EB3A 3MLTA 4WOQA 2FSEB 3EBAA 4WWOA 2AK4A 1I82A 4KFPA 1H6EA 4YDMA 3FOMA 3PZMA 4GYPA 4YTUA 3LDBB 1RBAA 3DURA 4Y5VB 4N85A 3MANA 4IXHA 2APFA 3ANYA 4XXCC 3BV7A 2ADFH 5K9QG 2WK2A 5EO1B 2W88A 2VDIA 5HHQB 3ILQD 3AREA 3QS3A 2AGKA 2LTQC 1W2VA 1AOHA 1QQDA 4HDIA 1M41A 3QJTB 4NWTH 1T0MB 2MRYA 1YYAA 2UYLA 4F2BA 1V02A 3PJWA 1QYGH 2JGYA 5BV7H 2G60H 1S7WB 2IANE 3ARUA 1E5AA 3NCXA 2WXMA 3QG6B 1H0DA 2NLIA 3P80A 2VVNA 4XN1A 5GZNC 1W3IA 2DZEA 4KJQC 4PM1A 5IB4B 4UFKA 3KZPA 5AYUL 3OO2A 4Y2NA 1F5WA 6XIAA 1EYWA 4ROPA 5I03A 3TA3B 1BZ7B 5CGYD 2BIHA 1UA6H 3L2IA 2DM7A 4O4YL 4IQLA 4BGDA 3MZTA 1HXJA 2XIMA 5C08D 1ZE3C 1KLGA 3NJIA 4MB1A 2X2IA 1S9XB 4OJYA 3TN0D 1JGMA 4QE4A 2XYCA 2ZP0T 5HJGA 5ABHA 5DLMH 4WXZA 1NKOA 1HDMA 2BVUA 3S1WA 2PD9A 5KVEL 3MLZH 4MA8L 4WHCA 1DJSA 1FC2D 3TBSA 1KG0B 4F3FA 2OWCA 2FTAA 3X13B 3V4VL 2QQKH 3K91A 2OTUB 3TNBA 1ITXA 4YH6A 2GLKA 3GDTA 4BSWB 5ILTH 1X9UA 4MDIA 1RI8A 4FALA 4PRID 3PNWA 2P8BA 4LSSH 3SGEH 1NBCA 2BRRL 2D0HA 1ZSHA 3W23A 2DQJH 1T03H 3ZSTA 1H1ZA 4MQXD 4XNQB 1NCGA 2YSSB 1Q45A 1BXXA 1FH8A 1GEHA 4NT6A 5E8NB 2JF7A 1Z5HA 2P4AB 5BYWA 4RFNB 5LNSA 4QWWC 4XWGL 3MRQA 3OL2A 1GONA 43CAB 2ZX5A 1YY9D 4AVHA 3D51A 1BMWA 4HZ7A 1VLWA 1ZPUA 4W6YB 1Q9LB 3GSNA 5E95B 3FONB 1RURL 3IV3A 4U1SB 4WAFA 2F8QA 3PAOA 4OGAD 2R39A 5FLUA 2WAHA 3H3BC 5I73B 1EZVX 1A6UL 4MA1C 4R7VA 1QPRA 5HD8D 2J7CA 2JKPA 2FIQA 5EC1A 4PJEB 3FFCA 3EXSA 3GHSA 5JHDD 2A3HA 5T1LD 2J44A 3AIWA 3GSOA 5FHBL 3NEVA 3CZJA 2Y36L 4NRSA 5CXPA 3A4FA 4YSAA 2K45A 1LL6A 4B5ZA 2R59A 5FSDC 2YIHA 5HP5A 4HHHA 5E94B 1W1TA 5ES4B 5B21A 3UPAA 3JBG7 4ZUSB 5B8CA 2I16A 1INEH 5DZNA 4XUGA 5E5LA 3E8UL 1TT6A 2H2SC 2ABAA 3RJQB 5C08B 1FBIH 1NDYA 3BWWA 3PHSA 1EC8A 4YDZA 3TN0B 4N0UB 3BP5A 4XBGB 4BM7A 2MJWA 4DKFL 2H8PB 2J5LB 4HZLA 4HXBH 1AO7E 4R4ND 1PBYA 1UGNA 3D69B 4L4MA 5AWNL 4GY1A 5IHSA 2BNJA 1CBJA 1BP3B 3DSFH 3GO2A 1JWUA 1U4FA 2UX6A 4PMOA 1KJ3L 3GUFA 5IB1A 1U95B 4AB4A 3KPMB 4X83A 1EF2A 1XXFC 3URQA 2NZ1A 3E2RA 1IMHC 1DHKA 3WL0A 2Z64C 3QHZL 4RGMB 3ARGD 5KAQG 4PRIB 4YDJB 2NUTA 1AZ1A 4NKQB 4EOUA 5L9DL 5INCA 4I4WA 3QCTH 1QEXA 1SZFA 3KPSD 3Q2DA 2GJPA 1IGMH 2DB8A 3SN1A 1MCWW 4A6YH 5LBSA 1JZ3A 2ADIA 4G72B 4GJ1A 1YNKH 3PABA 3UTPD 3T9WA 2QJNA 1NF0A 5G2HA 3CSBA 1MVUB 2PLJA 1DBKL 1XC4A 5IB2B 3K6OA 2WKGA 5CIPB 4GJJA 2OMNA 4F33B 2XPYA 4HK6A 1H7NA 5E2WL 3DGDA 1NGQL 4IS6B 3KBVA 1M71A 4GP8B 1G01A 3HG5A 5JHDB 2Q10A 5T1LB 4FHBD 2IWGA 4M19A 4F9PC 2K9UA 3GR7A 3INUL 3QUYC 1B3XA 4OFCA 4NO2B 4QT5B 1S5IH 1B0RA 3S0PA 3QZBA 1KFCA 1EJSC 3C61A 1YLVA 2W0FB 2BVQA 5AZEL 1S7VA 2XVNA 5KVMC 2JB6A 4FQJL 1PY9A 3F05A 3G1DA 2YOCA 5A6BA 4EZJA 2AJSL 4HN4A 4JRFA 1IEAB 1NCIA 2IJ0C 4XP6L 1X6LA 3HC3L 1XLIA 1MZYA 2EPLX 3LHYA 5C2GA 3VD7A 4HS8H 4ETQA 1UWFA 3DIFA 4GXVL 2Z7KA 3EH3B 3UCRA 1AK5A 5I6XC 2AL1A 1ZD6A 4S2CA 4FQQA 3NCEB 1A0QH 4GZIA 1BRLB 2IXQA 3CDFA 3FN9A 5CFAA 1NWSA 4CRPA 4ZTPL 3NAAL 3V95A 1R47A 3ARGB 4H2CA 3B8WA 1EXPA 1CIUA 5BQ7A 1NMCB 4UNTA 2CLRB 2QHLA 3KPSB 3TEVA 4X7TA 1YSOA 1FF5A 1SHWA 2B1OA 1BAFL 1MJ7L 2A3TA 3K6SA 4XAGA 4D9RE 1CFSB 3P30L 5FCUH 2DZVA 3PANA 3W9DA 3C52A 1T20B 1RLCL 2J79A 3JZYA 4YHML 3S9ZA 3LRHA 4WW2A 2W95A 4JN8A 1KXVA 5I3JA 4RGND 2FATH 2O5ZL 4N2NA 1QSFD 3BYYA 3MYJB 3FA4A 3H2NA 4H7VA 3AC0A 3FB8B 3AWEA 4KZCA 3MSPA 5IROC 5IHRA 5KZ6A 1OAUH 2GTZA 1XXXA 1HNFA 3I84A 1REIA 1HHKA 1F3DJ 4FQIH 3BI9X 1RUPL 2RMNA 4PBWD 1IAII 4PCSA 5E1AA 5BVJA 3PN8A 1NUFA 3SSJA 4BFJA 3BD3A 3HNTH 4MX7B 1L0QA 5DMYA 1H1NA 3U1SH 5I1GH 4DZHA 3I65A 3VJ6B 4O1BA 1J9RA 4M3PA 2PR4H 1A6TA 3WJYA 3GGWA 1Y5XA 3G3LA 2YD9A 4G8EB 1NIUA 4GKNA 2Q09A 3FU0A 4OCMC 2Q8BH 2VSCA 2FB4L 5G4EA 2FHFA 3KWUA 5M5DA 3H0TB 3ZE1F 1UUSA 1OO2A 5GS0C 5K1JA 4YSUA 3H1ZA 3LPGA 5FA5A 4F3HA 2DQUH 3WFDL 3TNMB 3TTSA 1YEEL 2DWEB 3G6DL 3QDME 4LBEA 1TCRA 3P0GB 4JHUA 2Y7GA 2GSIA 1HCFX 4NNAA 1RA0A 3IPEA 3T78A 2JXMA 1TJ2A 1GIGH 3KPQA 2YPLE 5FOBB 4Y9GA 2EAEA 3ASOB 4XCCH 1UATA 3RX7A 2PF8A 1FCBA 5AL0A 3HLAA 4GQ9H 3U0PB 5GZND 3W82A 1OAQL 3BOFA 1JF1B 2YJQA 3T3PB 3S3JA 4Q9QH 4ORGA 1PCSA 3WQDA 4MMXA 2CNCA 4OV5B 4OF5A 4BH8B 4BZ2L 5IW1A 2CR0A 4N7QA 3GIZL 3O6KH 4NRYB 3O41B 4YHEA 4N0YH 4LSUH 2OZ3A 5AHMA 1QSFB 1E27A 1YMYA 5D72L 2YXWA 3B0UX 4XVSH 2WVVA 4JPVL 1AE6L 1MCKA 1T8XA 3X17A 3K2GA 3ARBA 1ISXA 7XIMA 1GZPA 2R4SH 3FMGL 4G3YL 4YHLH 5KYNA 4IPNB 5I6LA 4AYFB 1HKLH 4K73A 3CK5A 4D1IA 1UWEL 1I4NA 4IIHA 2J1XA 2M2DA 3ZY7A 5A2CA 5IEKA 3VIMA 1OC6A 1UXMA 1RJPA 4DELA 1QSED 2V2XA 1NGZB 3OKNA 3W7QA 1DN0A 2VNCA 3RPKA 1C8YA 2R29A 1V27A 4JPIB 3Q4DA 3GRGA 3QXUA 1GYNA 5EC2B 1U30A 2JWYA 2OM5A 3H9YA 4UT9A 4A55A 3GU9A 3FEMA 3B7YA 5C9XA 3K72A 3POHA 4DBEA 5BRBA 4HH9B 2OCZA 3PUGA 1XQLA 4L6HA 4NAFA 1PBGA 2NVCA 3MA9L 2HX7A 4UWQB 4QWWD 2E3VA 1YEDA 5E6YA 3RGVA 2QGCA 4PRHD 3CVHH 1TEYA 2ZKWA 4ZJ9A 4I9XA 4PJIA 4JQAA 1XQKA 3J27A 1NQKA 2LTQB 3D9AH 3MRHB 3PG2A 1JGUH 4JDVA 2PETA 2BMKA 1IQDB 4PJCA 3O8XC 1PCXA 3TYGL 1G1YA 3UZYA 3ATFA 3AXMA 4LLMA 2GPZA 1BM3L 5FF6B 2V37A 1LO0L 3WX7A 4FOJA 3EWUA 4X4ME 2HPMA 4O54A 5KYWA 2YDAA 4KIRA 4N3TA 1SLWA 4NO5A 3DFSA 2Y07H 1J5HA 2WWMC 4H7CA 1RIHL 1W5QA 3O6YX 2H2SD 4JGNA 1VYSX 3D3AA 4YN3A 4AQ1C 3W2DH 3PWJB 4K7PH 4WFFE 1ZUAX 2FZ9A 1M1XB 4JS3A 1M7IA 4NBXB 2QVKA 4LSVL 3P2DA 1IAIH 6FABH 3EBVA 3VYNA 3ZE2B 3CFCL 4GG6F 3TK7A 3KPPB 1QSEB 3LKRA 2D23A 4LQFH 4FCAA 4C56E 3U4EB 2C0HA 3SQOH 5F9OL 1JCLA 1D5IL 3P9MA 2X1UA 2YRLA 4PIRF 5AC8A 2VKXA 3LMJH 1WUNT 3NPVA 1DQIA 3L3OC 4AK2A 3GSMA 2IKHA 3T8QA 1BZOA 5HK4A 4JTJA 2NY5L 2VTFA 3F65A 4HMEA 4NRZA 1TKWB 3FQRA 2H9AB 5IHBA 2E7LC 4PRHB 3GR8A 1LF1A 5KEZA 5EMKA 5EBLB 1AW5A 3SBWC 3DFNA 5L7XL 3OGRA 4H9XA 4DVRH 3KLHC 2ROYA 1QHOA 2BO0A 4R3SB 2KMWA 1JI1A 4MA1B 3PU7A 4ACYA 4QAIA 3ETSA 5LN4A 3BKYH 4ZX3A 4H1LB 3L54A 4PGBA 2YYTA 3RLGA 3T8XA 2OK0L 3TU9A 2XTJC 3WEXA 4M6ML 4GI4A 3QUYD 4TSBH 3CZFB 5B7EA 4KVCH 1J1PH 1QFOA 4C59B 2X1QA 4O51B 2HXUA 1CFVH 1F11A 1ID2A 2IBBA 3UAJA 3U9PH 3D3VE 3V0VB 1YEKH 3AITA 2P1YA 3FSWA 3IBOA 1K85A 4QP0A 1MCWM 3NPZB 3BVDB 2B08A 2XRAH 3RM4A 2OU4A 3JXAA 1NFGA 1UBPC 1XWYA 1OC7A 1RUMH 4FG2A 2PPGA 1ZBWA 3Q8AA 4OLWH 1EJXC 1T1WB 4X7FC 2QT6A 3DBSA 4YL9A 4UTWC 4L4OA 3DXAA 2Y1AA 3GDCA 5C0EB 2WMGA 4S1QL 2E3ZA 4IIGA 4B16A 4PE8A 2H5UA 1PL9A 3O4LE 1EFQA 3JV5A 4ZB2A 2Y6ZA 4Y9NA 3HIZA 2LFGA 2Y5EA 2NQLA 4DJFC 4KQNA 1RFDL 1K4DA 3O6FA 3FHEA 1JXDA 1XEDA 5JHMA 4P5TC 4NNPL 3NCYP 3QPEA 3LMZA 1I7UA 4Y19E 4HF5H 2WSDA 4H1ZA 1GAFH 3GXNA 1FORL 1QNQA 1N9PA 3HCVA 5BZXA 3N5AA 4IFKB 4H40A 3WD5L 3KR3L 2IWFA 3VTTA 4DGYH 5SWSA 1H19A 1JN6B 3KWWA 1AHKA 5DEGB 4TM9A 4M61B 4MFDA 4BF9A 3CHDA 4U33A 3G5YA 1ZFJA 3K0WA 2H90A 3SDXA 2D3JA 1XBDA 4L29B 5EL1A 4CC4C 3LH8A 2VN7A 3T71A 5IROD 3DMMA 1QK0A 2WAQA 2VDML 4AUYA 4HKPA 1A21A 5FOOA 3W38A 1TV2A 5JHDE 1IL1A 2NRDA 3PZIA 3QUYB 3W7LA 2QF7A 5H8UA 4F1SA 2MQGA 3QQ0A 3GO1L 3GSUA 4OV4A 1TRIA 3OB8A 1YVLA 3RITA 3BTNA 2ZZ3A 1GGIH 4WWKA 3VNLA 4WGWB 1FKWA 2WBJA 3L6FB 4P5MA 4BE5A 2XU2A 4OOUA 5I30H 1SUJA 1YEJH 4NUMA 4GEIA 4N5UA 3EOAA 1LT7A 5F2GA 1CECA 3FAWA 1I8UA 2G5BA 4HWUA 1UJPA 4IL2A 1F73A 5I6XB 1ZDQA 3N4FA 3UBXA 5GS0D 1QFEA 2J8GA 2XPZA 1WFNA 2X1RA 3WFEL 1HH6B 4QDWA 5A6KA 1CB2A 4LCWA 3H2MA 4Y2OA 1PS3A 3OKEA 2Y72A 1MFAH 3IJQA 1WA0X 1CU4L 3L7FA 3VFGH 1CN4A 2B5IC 2E25A 4IQJA 1U91B 2OEKA 4ICMA 2FGBA 2DTSA 4NJKA 4KPHL 4BCZA 5IVXF 5I6NA 1I3VA 1UH2A 3RNKB 1FCQA 3PFQA 1R1CA 1MYRA 4BFEA 2RD0A 4JKMA 2WMFA 4BWWA 3OEXA 2CRIA 4E4FA 3B0VC 2HFEA 2WINB 2DMKA 1OSPH 3LN5B 4LYKA 1QLFA 3QNXB 1FNFA 4X5WA 3MRBA 3PWUA 2P8LB 5I1IH 3O9WA 5E6RB 3QXVA 2J6WA 4MBOA 3RNQA 2AQRA 4UR9A 3MLPA 1HHJB 4POZC 3W1ZA 1JULA 5LA2A 1ZCRA 2W91A 3CZLA 1AY1H 1A7NL 4M5ZL 5F7UA 1TTGA 4UU9A 1B4LA 3OGCA 4PRBA 4I85A 5GGSA 2V7NA 3VXRD 2ERJC 2XFXB 2NW0A 3II1A 3L0KA 3M5XA 2XIDA 2PAJA 3WMSA 1G7MB 3WHE0 2V82A 1AHWC 1IAIM 3SOTA 2CBUA 4K55A 2BNRD 2JCCF 2I56A 2BPBA 4IWWA 3M44A 2E7CA 3CWOX 2FECL 4X6CF 1RZIB 4OJAA 4HV8B 3FQTB 3NZUA 5J5RA 5E7FA 3O8XD 4OCWL 1QJWA 4PFEA 2PCFA 2FPVA 3IDUA 1WHOA 4I9WE 2JV6A 2EO9A 4YBHA 1IQWL 3UTZB 4O1DA 1NPJA 4Q7DA 1QPQA 3NRPA 3WF0A 4ZUWB 3QR2A 3EOBA 1R75A 1DLFL 3I2CL 1W6TA 1GJUA 2FT6A 4A22A 1XIIA 4Q6XA 2WWMD 2CHOA 1T21B 5HYSB 4RNRA 3H7LA 3U6RB 3AWNA 1IV8A 3S2JA 2LQRA 2XHYA 3OHMB 4YE4H 3FYPA 1FFNA 4RGNE 4RWYL 2DT0A 4OLVL 2G96A 4LP4A 4E9RA 4G43B 4HYVA 5EFFA 4C7DA 3HS8A 4F27A 1GGTA 4Y0GA 2PCEA 3CEUA 5U4NA 3LDVA 4N9EA 4CN1A 5F9DC 4O2FB 3QO1B 1W9VA 4Z7AA 2BWQA 4K7FA 3B0YA 2QHRH 3FKKA 2KPNA 5EF1A 1T04B 5EO0B 3VXRB 1H60A 1G7JB 3AS2A 4KEZA 4GUJA 3IE4A 1P1VA 3W9EA 4CADB 4XZIA 3OKDB 1R3IL 4LHUG 4GUQA 5EF0A 5DQ9B 1YUHA 1K4GA 4CJ0A 4ELKA 5AHNA 3C2AL 3T1GA 1CGVA 5CMAA 4JUSA 4IUGA 3VCRA 3UIZA 3AHZA 4YDIL 4JZNA 3SDYL 1NSNH 1IGJA 3C3UA 2BNRB 2GBVA 1PW3A 2ZBTA 1EFXD 3L2MA 2Y9RT 4ZO9A 2XI9A 1SUHA 4QY8A 2X16A 3O8XB 2MPVA 1BVNT 1P43A 4Y4HA 5DI8B 5DJ0B 4UTAH 3DENA 2MEJB 3WY2A 3NSNA 4AGNA 3G08A 4KHTL 1DQMH 5IJBC 5B7YA 1U58B 4PQXA 4KTGA 5EU5A 2Y8VA 3TJEH 1FFQA 4XCNB 9XIMA 5E0CA 4TV3A 2XTJD 5EZIL 1HJWA 4K3EL 3H2EA 2YA2A 2ZWKA 3IJSB 4G5DA 3WXWH 5C0DA 5FEPA 2CERA 3VDCA 2F19L 1BFVH 1K70A 3OHXA 5FJUA 1U3NA 1T4KB 3R06A 4LNRB 1VIZA 2AITA 4HU2A 4FQHA 3VFTA 2XQBH 4AQ1B 4OW6A 2I14A 2OR8A 2ENJA 3L7RA 4P59H 1BZ9B 4LHJB 3ZL2A 1HSBA 1AKJA 1I1AC 3WLMA 3W56A 1FNSL 5ADPH 3TMQA 4AVKA 2Z35B 3OG4B 5AW3B 1CMOA 1T1ZA 4PYSA 2EC8A 2C9AA 2OZ4L 3MJMA 2J6VA 3ELAT 4AYEC 1ACYL 1OIOA 3C2SA 2FJUB 2XGIA 4XKYB 1KLYA 1UVQA 5E4IA 1QI4A 5IFPA 2XIOA 2Z4TA 4RZ6A 3ABLB 4IIDA 4P4RB 3KW3A 5HHMD 3STZB 4B5XA 5D2LA 1UZGA 3DG7A 1DYZA 3MLSH 3D85A 5IVZA 4DO6A 4JPKH 3L3OB 4DJFD 3WQGA 2JKXA 1WAAE 3MMWA 2IUZA 4HJJL 3PREA 3IGLA 1DUZA 3ARYA 4P5SA 4P5TD 2OX4A 1KKOA 1BEYL 2VWSA 4K8RH 2HFFB 2QFRA 1EFXB 4PREB 3TOPA 4U6HB 1IIKA 4WKZB 3DIVA 5E0KA 1TPVA 3QHFH 5C92A 5SX5K 4MNGE 5AZ2L 5F1NA 3U7AA 1HOCB 2LLNA 3WTSA 3WNKA 2MMXA 3K81A 4Z1YA 3W84A 4IU2A 5KSUA 3CHRA 2J2ZB 3UZXA 3PGDB 4QTHA 4YBQD 2XTJB 2J73A 4EF8A 4KDTC 4HC1L 1G1OA 4MGXA 1TSIA 4HU8A 3RG6A 1G7PA 4KROC 4H26A 3Q2VA 2NDFA 4OIAA 2L4OA 3F83A 1KNOA 2VRQA 2Z4GA 5DJAA 3L3IA 4RIRB 2VXQL 2WNZA 3TU6A 2ISVA 3ARDA 3SQSA 3C5JA 1SO5A 3WQWA 2GITB 2BP1A 4K71C 3C8KB 1MWAL 2V3GA 3STLA 4H1LH 5AVNA 1JZDC 1KGCD 1CLVA 1XGRB 3D4YA 3OLEA 2KT6A 5IM7A 3H2CA 3Q44A 1UWUA 3V79C 2OKMA 3QDJE 4NQQA 4Y9OA 2HROA 6XIMA 1KCZA 3IJLA 3WMPA 4HJEA 4TNWK 1TJRA 4RR4A 3V16A 3H6JA 2FSDA 5L4FA 1Y0LB 3UC2A 1MCRA 1OAZH 3KPRA 3FQXA 1X9QA 4XVTL 4DWSC 3UDWA 3S3CB 5I1JL 1ZPTA 3E0IA 3ALWA 5IKCB 2NTFB 1FL5B 1ZVSB 5IFAL 4U3CA 2V4LA 3KDNA 5HHMB 1K3IA 3N41B 4PWIA 3OVGA 4NPYA 3AS1A 1JUFA 3D6GA 4AQ8A 3EFFA 4P5TB 1T3FA 4Z78B 3UBHA 1YYLH 1SOKA 3K2UH 5HI3C 5AKVA 4WFHE 1T6VN 4P2OC 3UADA 5A2LH 3Q8CA 3F84A 1BFOB 2IG2L 4IU3B 1TTQA 3V7MA 4UIMA 4CD4A 3VIJA 1OYBA 3MI2A 3QDHA 4F9LC 3BL3A 2F58L 1N6QH 1ZKAA 3IGKA 3FVDA 1FWFC 5CUSH 4DESA 3TCEA 3VW3H 4D6IA 5DYOA 4O9HH 1GOWA 1U8HB 5CJXA 2OEMA 4POZD 2HX8A 3ULUE 4U6VH 1EL3A 2XKNB 4JD4A 2V9UA 3CHFA 1JNJA 4P7RA 1NDMB 3A4DA 3GMQA 1FJ1B 3FQWB 1M53A 5D2XA 4PJGB 4QRPE 1H9DA 4NIKB 2V5MA 1MUCA 1GCYA 3G1XA 5K69A 1JVKA 1FCGA 3OXRA 1NAML 5E70A 4OOZA 1QLEB 4GS7C 3NFPB 3ULUH 1W3KA 3I6EA 2P48B 4DI9A 3NA4A 3WYRA 1JWSA 1A1NB 4FQXC 5I3HA 4A7VA 4OFQA 1TVHA 1KT2B 3BGFC 1OGTA 1MW0A 1VZGA 2RACA 3I6RA 4NUPA 5AC4A 2ENSA 1TUFA 4U10A 4JVPA 5DWUH 3G5VB 4LWWA 4JR9H 1MRCL 2WO4A 3GC4A 4WSHA 2EDXA 3PL6C 5C0AD 4OZFA 4X8CA 4O8RA 3OAYK 2WYIA 1EZLA 3LRGA 1XYCA 3JTSB 2X3BA 3NCFB 1RZJL 4J7RA 4ACTA 3WJWA 2B5IB 2G4GA 1UZ4A 4UQIM 4EUPA 4Z1BA 4RCAA 2B1AH 3AQXA 2HJFB 4C1LA 1CTOA 3AWOA 4MADA 4LJ3A 2QUNA 4DK3A 2E75C 3W73A 2B4GA 1RVFL 4GO6B 1S2UA 4RDVA 2FVKA 2YDQA 1OCWH 5CG7A 4L4PA 2UUDH 3GSXA 1DBJL 1A2YA 3H7UA 4Q52A 2EYTA 1J8HD 3WYZA 3T65B 5BROA 1U8IA 5DSCB 4FFVC 1QZ1A 4KMQA 2B3RA 4JM2C 2B7QA 3CIAA 4M1DL 1ZA3B 2E76C 3F58L 3WSUA 1F05A 4B3ZA 1A3QA 3BP7A 1TCMA 4HVBA 3OR6A 3N19B 4DFIA 2FUQA 2RTTA 2QNEA 4WHYH 1W5OA 2D7NA 3GMRA 4Z7VF 1UGKA 1TXKA 4Q8BA 1JPGA 5AQ0A 3ME0A 1A5BA 5LGJA 1AD4A 3WD3A 1W6LA 5B3NA 5B22A 1HW6A 4L5FL 3NEOA 5BOFA 3N1GC 3L5MA 3RIFF 2ERJB 2OZ0A 3MLUH 3FVMA 4CLMA 1CZ8L 2PNDA 1XF0A 2QSQA 1TETH 4UV4H 3L48A 4GGHA 4KWUA 3TC3A 3IIXA 2PPEA 5I1DA 3K46A 4GJTB 3KPOB 5LHDA 3QXDA 1AHWB 3QR0A 5FDWB 2ZSWB 3VGAC 3GZ3A 4N2MA 4K3JL 1CXHA 5C0BA 4NGHH 3OLGA 4YNYB 3B9OA 3ITVA 3KDMA 5C0AB 4A7GF 1CK0H 3MI3A 3CFBA 4AMCA 3EHBC 1G43A 4YL4A 3WE1A 4I1PA 3B40A 3IDNA 3M64A 4ZQKB 1W8NA 1FP5A 4OSUL 3DYPA 3NIDB 3BD4A 1GVEA 2OMTA 4XMTA 2ZE0A 5IFHL 2CBOA 2DSVA 4XNXL 4PWGA 5KVGE 1PO9A 3WELA 4PB9H 2XSKA 1ZLVK 5CSZB 3AYVA 3IU3A 2HA1A 2GJRA 3ATBA 1PY4A 2WB5A 4K2UL 2JB5H 1D5XA 3E3QC 3D46A 2W66A 3ECWA 3U2EA 3VB9A 3BFWA 1IEIA 1TB3A 4KXBA 1H15B 4JRYD 2RAGA 1XGYH 4F8OA 5KVGH 4XR8C 2YXVA 2ZOOA 4JY5L 1GVRA 1IXPA 1I1AD 5EBGA 5HHVL 3NJKA 1VC4A 2D2OA 2V30A 4JFSA 1IEVA 4H8QA 3RRAA 5AN7A 2OT1A 1ZXKA 4X80H 2XNAB 4GH1A 2G4JA 4EKJA 5JBEA 3QP3A 4TXVB 2WZPA 3UJ2A 4PJBE 4JNMA 2QUVA 1B30A 2BOLA 1Q65A 4DF2A 2WZ0A 4WEUD 5LA1A 5C9JA 5JXAH 3G5XB 2AAAA 2VN4A 3MRFB 2ARJB 2VLJA 3UPRA 1XD1A 4K0OA 1D7CA 3QPQC 3S1VA 2F1AA 3MTWA 2J62A 3A3WA 2XG5A 3W1XA 1M7DA 2OJPA 5EGRA 3G5EA 4Z18A 3R8QA 5CPOA 3TYBA 3OLDA 3RI5K 2ZRYA 2PO6A 5I66B 1KEML 3NPWA 2R0ZH 4O16A 4PJFE 3PWLB 5CU5A 4OWGA 2R1XA 2B4CH 1BG1A 2AQOA 4G9DB 2GJJA 5FKPA 3L3JB 1YNPA 1KRBC 4ZFOL 2PYFB 5AHIA 4D0DB 4KROD 2VCBA 4OJEH 3P77B 2I9UA 3JTBA 1FYTE 3B2PA 3ULAB 4ODXB 1VADA 1YY8A 4B3EA 5CGMA 4QITA 3TT1L 3RQ3A 2AAVA 1MW2A 1U4EA 2IO5A 4GG8A 2ZE3A 4JRYB 4G80A 4RMSA 4AM0Q 2FO4A 5GGRB 4QLJA 2BXYA 4G1EA 2ZOLB 1I1AB 5ERWB 4KY1H 3GI9L 3BAKA 2K7PA 4WCYH 2QJIA 4ZDHB 4XBSA 3STGA 3CVIH 2SEBA 1UM6L 1PJ9A 1U21A 1VCBC 5I15H 5JHLL 5L6UA 3N04A 4Y7MA 4U6YA 1W0VB 4IK7A 4DWSD 5ICYA 3W39A 1OC5A 5I2IA 3EDEA 4OCRL 3V0SA 5D2NE 5HJBA 2CCWA 4OCYH 4J40A 3UTTD 4ELMA 2CNYA 5C0RL 3NO3A 5LUMA 4XPBH 3VI3E 5MP6L 4RFOL 1EEZA 2PLMA 5FW6A 3GG7A 5I1KL 4C6FA 4MDRA 3ZTJH 5HI3D 2Q20A 1OYCA 1IB5A 4IH3A 3KYMA 5ITFB 1TTJA 4P2OD 4IHOB 4U2YA 5IXEA 4QHMB 1GKOA 4F48A 4FS9A 2FJFB 2VXUL 1I9IL 3S5LA 4PTDA 1T89C 1JHTB 3Q05A 3ZWSA 3QQWA 4L1SA 1BZQK 5DK2A 1VBUA 1JS4A 2OMWA 1MFDH 4N2OA 1NFDF 4A3HA 4M5TA 4KROB 5CJ5A 3KGUA 3BKCH 1Q6OA 3QZOA 4N6RA 4C7FA 1KDJA 2R56L 5FAAA 2HLAA 2FGWH 2VRAA 2P8MA 5TJWK 1DE5A 3GIVB 2ZZUT 5C0CA 4IJCA 2R23A 1E70M 4K71B 4UBDC 5DZLA 1D5MA 1EX1A 1I1YA 3QI9A 3KLAA 3BLBA 1OOAA 3SY0B 1SDYA 4TVPL 2OMUA 3I9GH 4FQXD 4OGXL 2GK0A 3QJFB 3S88H 1ACXA 1YBQB 5AW8B 5T1DL 1RK0A 3ZS4A 2RR3A 1CW2A 4XVJH 1ADQL 4BS0A 2L7JA 2ESVD 1YJDL 2J78A 3T6QC 3TH3T 1CZ1A 5KBPA 3UQNA 3VFNB 5LN8A 3FUFA 3PL6D 4DWSB 2APBA 3WLJA 3VRJB 1G7HB 2R2EA 1LL4A 4GXPA 3M5VA 5ICZA 4GE8A 2V5RA 5JPNC 2V2TB 1K8ZA 4QXTA 3UTTB 5HMFA 3VDGA 3APDA 1GMIA 5C6TL 5HHME 1L6FA 5HYQB 2DZXA 3IMVA 4HPHA 5AD0A 3EIFA 4QJ5B 4P2QE 3P2VA 1EIBA 3LM3A 2DQFB 1GZGA 1H09A 3TZVA 4AJYV 4JVWA 2MQCA 4P2OB 5IFTA 3FU8A 4AX3A 5CD5C 4OM1L 1OD7A 4JYDA 4LK4A 4FFVD 2CIPA 5IBTH 4JM2D 1ZT1B 3QCVL 1W72B 4S3KA 3D5OF 4YHZH 5IBUG 3GH5A 2VDRB 3FXYA 1Z3GH 1J1OH 1QDSA 1F6YA 3RX3A 1VFMA 4HXAL 2ED7A 1HO1A 1HE7A 3JYBA 3SCMC 3U4BH 5FJTA 3BLDA 1Z2KA 4WKHA 3V5HA 3WEOA 3ZOAA 3WLOA 3AOFA 3MRCA 2APVA 4BA0A 2WNNA 1UCBL 5GRWA 1FP9A 1FP8A 4TYUA 4O12A 2FLRT 5C0GB 4DI8A 3PUDA 2NYKA 3TBCA 5IHHA 1WV2A 5D7LD 2BNQD 1XINA 4GS7B 2XCMC 1H2JA 2Q8AL 4WWNA 2Y2TA 4JJ5B 4FQXB 3MQTA 4PGDB 3BGFB 2VL5A 4ALAL 3OM3B 1OGPA 3HRPA 4O4WA 5F7FA 2ESVB 2W9LA 5I16B 5GGVL 4LF3A 3MRDB 1MH5B 5GS2H 3PL6B 1YYCA 3TYDA 2ZRVA 3G3MA 4FFZH 3DA0A 3EHBD 4W9LC 2I1OA 1DV7A 4QDPA 2EDWA 1N7MH 1YZZA 2X4UB 2RH0A 4X6FA 2D03L 3ZDXF 5K1NA 4U1HA 1JNNL 3HA0A 1KFEA 3HLKA 1L6XA 2A9ML 4UB9A 1T7ZA 3HC4L 4EXPX 4HH8A 5B38B 1H3PL 1TWSA 1DVZA 3NSYA 3EPMA 3EO9L 1HI6A 3BEVB 3SSZA 5EOTB 4F8TA 4XMPH 2CRMA 3UEZA 4EOWL 4K2SA 1W37A 4H8NA 3IXAA 4IQDA 2DEYX 2FX8H 1ETZA 3ANVA 3HG2A 3X11B 5IK3A 4ES4A 1Q0XL 3IMTA 3WKPA 4GRLC 4JM2B 4EF9A 2F54D 1YEFL 4WI3A 4ATDA 4HBCL 5D09A 5IUCA 3TE9A 1EEPA 5DO8A 2LW3A 1E5JA 1G9NC 2LLEA 5FYJD 5GRJL 4HNCA 3QFDA 2F6UA 4X9BA 3W3OA 3TQKA 2OXHB 3QOMA 2ZUSA 3WQ6A 3PHQB 1SDDB 5B7MA 3IWUA 4GFXA 1A6VH 1UH4A 4G9FD 5DBUA 5A8NA 5FL0A 3Q06A 4U1LB 1ZLUK 1DVJA 5H2ZA 2WQDA 1VESA 2B59A 5D7LB 2HISA 2BNQB 2V2DA 1TVPA 1JTPA 1IGTB 3SB3A 2YSWA 5JQIB 4HJIA 5D04C 1EZSA 5EEZA 1RPKA 1KDIA 1Q85A 1OVZA 4WO0A 1EDGA 3VGAB 5IMKA 1IHIA 4LYPA 1XLJA 3V4PL 1NJJA 4X9YA 5I1HL 2E6JA 2ZCKL 2KS0A 3ZYZA 1G4TA 5FM8A 3F7VB 4JFVA 1A1OA 1KO0A 5CSBA 3V4VA 5EBWB 3EHBB 4YLQT 1Y18A 1ZXQA 4JRXD 1NCHA 1Q9KB 1K4CA 2O72A 1DJWA 3B7RL 3ZE0F 3INOA 1SRDA 5ACZA 4EQ3A 5B4MC 3SQBB 3P82A 3G2GA 3NIDE 5SWQB 3R79A 2FR4A 3UGRA 3AIVA 1JGVL 1JIBA 1PB0A 3UESA 1N8ZB 5E2TL 1O5KA 3BWUC 4GUFA 5FEBA 5DS2A 4AQAA 3B1TA 1CWVA 1AQKH 4P9HH 4BGLA 5A94A 3FRUB 3P7YA 1J8HE 2F54B 1FDYA 2DEPA 4HGWB 1TZAA 1JYVA 3SGJC 2P5EE 1JCYA 3R25A 1R0AL 3MLRL 3V0GA 1O7DE 4Q33A 1L6WA 5HJ3A 1UHVA 3LBCA 4K8EA 5DCDA 5C55A 2ZKYA 3K1GA 4WFED 3RUGE 3BP6A 1BQSA 1A5KC 4XMLL 4LEXL 3GZPA 1NDWA 1XDLA 2F08A 3CZKA 4ICNA 3NN8A 4XP1H 4UC5A 3V6ZB 2CKBL 8A3HA 4B91A 4LPWA 4HSNA 4G9FB 1WF5A 4IMGA 3C75A 1ZV9A 3ZFHA 4Q97A 4ZX6A 4BF7A 1HYSC 4W84A 2IOMA 4WLCA 2Z7YA 5J9PB 3QUMB 1Q6RA 2VQTA 2UY3A 4YDLC 1S9YA 2BVOA 4HWBH 3ZLQC 4E2BA 1K6QH 4R7XA 4ZOCA 4HWEH 4XO4A 3MW7A 5DT1L 1YW1A 1MRQA 4K9EH 3O0FA 3G24A 2A4EA 4F2EA 3ES6B 3IGAA 4IG2B 1XTMA 4CU8A 4PY7B 5EZLB 4N2DA 3AUVA 1P0SE 3QEQE 3KXFA 4ODTH 3ZRSA 1ZEAH 3QJXA 2MTPA 2WAGA 4JFWA 4KJQD 3C6LC 3OQ8A 3VWKC 5IREA 4JRXB 3MJ8B 1WXZA 3RVWC 1ACCA 1GVOA 1U8OA 1FH5L 4FKKA 1J2BA 4PV8A 3U46A 5JNYB 1X4ZA 4MLIA 4QRNA 3FRPA 1AQMA 2ZF9A 3GZKA 3IRPX 5JOFB 3BV4A 2BNUB 3SE8L 1FGNH 3EYOA 4PJ9C 3VRIB 3AFLA 1P53A 4YYCA 4MLJA 1E9OA 3C60C 4NZDA 4PEEA 4TQEL 4UBDD 4JPWH 3MBWA 4OZHB 1OY3B 4DBSA 4G5ZH 3MFFA 3AYRA 1LEIA 1MAJA 2E9IA 3ONBA 3WIFA 3O9NA 2BSEA 4Q6YA 2AQQA 3WJLC 3LVTA 5GRZA 3ULVE 4JTUA 3S47A 3W0WD 1A14H 3M17A 3HTLX 5IG7B 1TV4A 1JGIA 3EJCA 3MYOA 4GCXA 3EOTH 4H5SA 2F7FA 2ZWLT 4P8UA 3TPUB 1HEZB 3AIRA 3OBKA 5GJTH 3CXDH 3UBGA 5CGTA 3ULVH 3UD6A 3U0TA 3Q8FA 4JZOA 3EXTA 2J1WA 2OG9A 1L6YA 3HBGA 2ICEA 4IOFC 4UYQA 4FG6C 1HVQA 1IBDA 2EDKA 2GJ6A 1UZ6F 4OB5L 1NLDH 1FRGH 1SU5A 2VR6A 2AJYH 3U5UA 5CD5D 4Y16A 4BV1A 2VDHA 5F7DA 1LTXA 2YGOA 1L5GA 2WXDM 2AQTA 2F61A 3CL8A 2GIYA 1KJ2L 3ARQA 2I07A 5JH2A 2I9EA 3UXAA 1EJVC 1XZWA 1GQJA 5AVXB 5F97E 2OJEA 5DHXB 4TTDC 3SCMD 2CJSA 3GUTA 1LNUA 2YL9A 2LE9A 5F3FA 1IEHA 1FZOA 2DSKA 2D2GA 3APGA 4C57C 1I9CB 5T33H 3L95B 2QCLA 5LHFA 2EUVA 4O02B 1MDAA 2DDQH 2A2QT 3C2FA 2NCMA 2DU2A 4X9FA 2CHWA 1YQVL 4AEFA 3VQLA 1EAQA 1GKRA 3MA7B 4QIRA 3MSGA 3KLDA 4IMAA 1OPGH 3QWRD 1I8LC 4P3CL 3M0IA 4A67A 4DZBB 4RMQA 5LDSA 2LLLA 3C5SB 4S3CA 2FL5A 4HUWB 4JQVC 3W0WB 2G2RA 4MJIA 1AXTH 3B5TA 4YSCA 3HVNA 4R0LC 3BIBX 2WLKA 1QFWL 2POZA 2XX1A 2CRYA 1YYML 4NSBA 1MFEH 4HISA 4IIQA 5JPNB 2A38A 5A3HA 3W2JA 4LNVA 1ISWA 5CJQH 5I1EL 3REWB 3EH2A 2DVXA 3T8MA 4L7ZA 4GK8A 1HCVA 4JRLA 3O6LH 4H6EA 3K74B 2OX1A 5DS8A 2ATAA 4QHUB 4ADJA 1JZ2A 1YDVA 3HJ0A 1QNVA 3WJZA 3M0LA 1E7UA 5TDOA 3GAKA 2ICWA 3QIWC 2CZ5A 3CJPA 1MPAL 2J27A 4PJEE 2XPKA 2H6PB 3WL1A 2E4TA 4BK4A 3P2BA 4JB9H 1N2VA 1GVQA 2PEVA 3S3PA 3NESA 4GRLD 1P4CA 1KTNA 3NOEA 3W81A 4Y9MA 4HCRL 2P5PA 1J6OA 1UZHA 1N0LB 4Z76A 3LMYA 3SOBL 4XZLX 2CO2A 4ACPA 5KN5A 3TKFA 3DGRA 1U8MB 6PAZA 2YEZB 4WEMB 4GUHA 4FC3E 1WDPA 3NK4A 3SCMB 5J57B 1F00I 4OZGA 1GZHC 5C08E 3RVXC 4LFHG 1A6AB 2EPOA 3VCNA 3ZKMC 4RAUA 4K8GA 4N0UE 2AC0A 1IFRA 4X6DA 4MUZA 4WNQA 2QL1A 1OF2A 3B2VH 1HWHB 3QQDB 1XH3B 3DO7A 5FSEC 2FAUA 5EH1A 4BZ2A 5DDHA 4LVHC 1BA9A 1DO6A 1TQXA 2VENA 4OR1A 4EP8C 5C97A 2CO6B 4FULA 1EJ7L 8FABA 4M4PA 1DZ0A 4J3OC 2XTSA 2BP8B 4LSBA 1A5SA 5LHEA 4C4BA 2Y06H 5HHPA 3BW9B 5JW5B 4PRIE 4JDTH 4MDJB 4OLUL 3RFZC 1QWKA 4OCSH 1AJ7L 4LCIH 4FTVB 1XL9A 4F0HA 3WBEA 2YEVB 3BKJH 4XP4H 3WG6A 3ARWA 4QRQB 4CVXB 4CVWA 4S1SH 3SUUA 1BFNA 3UG5A 2LAGB 1A7OH 1SR9A 5D8JL 2PCXA 2I5YL 1CFQA 3KPLB 1J5SA 5B4MD 4GRSA 1NFKA 3VFVA 3O45B 1UXSB 3X12B 1NCCH 5F7EH 2VUKA 2ZX7A 3WLRA 4YPGA 3ZDZB 1NAKL 4XNUL 1VLXA 2Y2WA 1LO2H 5IF0B 5DYFA 3VZXA 2BW4A 4DXVA 3T3MB 3HQOA 1MOEA 4GRLB 1GWJA 1QI3A 3HUJA 3BAEH 1I8JA 4LRIA 3B3IB 2A83B 5HQLA 2ZFAA 5CIPH 2C1IA 4GFTB 4E0RA 2AKRA 1G94A 2F1BA 1HU8A 4LEOA 2OYKA 4QYOB 3I9PA 3DX6B 1PWLA 4PCPA 4PTVA 1WDQA 3W1UA 4TN9A 2H9GA 4UDTA 3HI1A 3QEUA 4N2GA 4N9BA 2YCLA 5MHBA 4JO3L 5AAWC 5DN1A 2X4PB 5C6PB 1L7TH 1XF4A 3MUHL 3GC3A 1Q72L 3ZGHA 1HYSD 4CQ8A 1Z0NA 1P9MC 1ZSDA 2Y7MA 2BHUA 1F8IA 2H0FA 1M7UA 3WXVH 1O5QA 2BNQE 1O7VA 1HCZA 2LV4A 4EI6B 3KUMA 4N0RA 2F7OA 5FL1A 5DO2C 3ZMRA 4GUPA 3NJNA 4MAYA 3TJLA 4NQSB 3Q2WA 1JGDB 1EZVY 4OKDA 1JZFA 5EBMB 2C9PA 2WVTA 3USBA 4FHAA 4Z6AT 2OR9L 4S38A 3P0WA 4URIA 3FO0L 3G8RA 1M42A 1FVCA 4XN7A 3KPSE 1U8JB 2DUAA 1UB5A 4OQ1A 1VFSA 3BIKB 3C6LD 3VWKD 1N5YL 2BTMA 3FB7B 1FQ9C 3QQ1A 1E5NA 3RVWD 3UTPE 3O6MH 2XPGA 1OCCB 2LHAA 5EIQA 5C70A 2I9LB 3WH6A 4XBPA 3IIVA 3CGTA 5H37H 3DEQA 3WS6A 1A02N 4PJCF 2K70A 1HYRC 3QN3A 5FM5O 2FBJL 4OHQA 4WDTA 4KZDL 5CC7A 1NCBH 4G7VH 1JOIA 2KDYA 1YEIL 1O1HA 4PJ9D 4IMLA 4QHKI 1LORA 4QGYA 2XUWA 4X4XB 3MOQA 4U6TA 3O2WH 5DXYA 1Z69A 2RIKA 3SIMA 2XFGB 3C60D 3QA3A 5FFLA 1Q6EA 1XF1A 4FA3A 4F7TA 1UXWB 1XG3A 3WTTA 1I9EA 5FXCH 2HJLB 2BINA 4YHIB 1TQTA 1Z42A 4ONGH 1HZYA 3V6FA 1PFOA 3TW7A 3W1LA 5JPMC 1L9RA 4GYBA 3IETB 4A2HA 3VACA 1KY6A 2P0OA 1PX3A 3VI4A 4TNFA 3ZUNC 2GB2A 1GOKA 5CD3B 3ARFC 2APTA 1M1SA 3UZEC 4M1RA 4E8CA 2X4RA 3HN3A 4MJ5B 3F4NA 4F40A 2UY4A 2EDJA 5DEFB 4P46C 1RULH 1I8IB 5AUMA 2WOYA 3WUZA 1K4HA 4GC3A 3I4KA 1KBPA 4RQQB 4WY7L 4KRUA 1E51A 4TKWA 3N43B 2AQWA 4DLFA 4YDLB 2FX9H 3L3DB 3P93A 3TAOA 1HT6A 3MP5A 5KSBF 1H0GA 1Z3RA 1XIBA 2K7QA 2R15A 2WWKO 3N6JA 2UZXA 3FZUC 4IOFD 1FZKB 1F6FB 2NY0C 4FG6D 3RJYA 3MJ9H 7FABH 5G4WA 5F7LB 3S3SA 4HPOH <