3WDQA

Crystal structure of beta-mannanase from a symbiotic protist of the termite reticulitermes speratus
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
330
structure length
329
Chain Sequence
b'QDWNISSSPVTPSPSAGAQKLYSFLVQNFQKKIISGAMTLQGGDESAQTKEPDWLQQNAGHRPALVGLDFFQTGKGEEWYYNDSRFSKQVVNGAKSYWQKGGIPALCWHWRDPSKDTDAFYSPSSGNSATQFDADQAVKSGTAENKAILQDLAVIADQLQDLRDAGVAVLWRPLHEASGKWFWWGYKGADALKKLWKIEFDYFVKERNLNNLIWVFTAGTPIEGIADWYPGDDMVDVIGMDIYATQGDHATQQDYFNQCKSIFKGRKIVAMSECGSVPEPDLAAPWSFFMPWYNNYCIPEGSNPYNSLEFWKKTMSSSLVITLDNMPGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-mannanase
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Family 26 beta-Mannanase from a Symbiotic Protist of the Termite Reticulitermes speratus
pubmed doi rcsb
source organism Symbiotic protist of reticulitermes speratus
molecule tags Hydrolase
total genus 118
structure length 329
sequence length 330
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wdqA00
4B9YA 2YLLA 3WNNA 3NIYA 3G6LA 2DT2A 3OLDA 4LYQA 4KH2A 4PSRA 3L4YA 1NOUA 5AYIA 4R27A 4H41A 2YDQA 1M7XA 3N18A 3ZR5A 2DSKA 3AZTA 2VT0A 4DM2A 3W37A 7A3HA 1C91A 1RP9A 2BS9A 3SUUA 4B15A 2OSYA 1KR1A 4TXEA 1EDGA 4AYSA 1EHAA 3MUAA 4OBSA 1N82A 1OSEA 2ZUVA 1CXIA 1V0MA 1JZ3A 1OINA 4Z2LA 2DT0A 4BQ2A 1NP2A 4WSKA 4DUWA 4DWSA 4WIWA 4LQ1A 4E8CA 4EKJA 1E1FA 1V03A 1JZ8A 4BQ4A 1JYXA 2W5FA 4A3YA 2BVYA 3PTQA 4JFVA 3WL0A 4CVWA 2CBUA 4K68A 3MU7A 4P8XA 1W9DM 3WQWA 1E0XA 3MV01 1JD9A 5FIPA 4IISA 1HP4A 4PCTA 5A8PA 1J0ZA 4J3TA 1C90A 1JAEA 1V0LA 4U3CA 5LYRA 1SR0A 3WFZA 4PN2A 3W53A 5I2UA 4CD8A 4ZE4A 2WMHA 2ZX9A 4M1RA 4YN5A 1UR0A 4MNKA 1OGBA 2VZUA 1FFQA 1R87A 2E9MA 4CN4A 1ECEA 4MB4A 2PI6A 2Y8VA 1BYBA 3HJEA 3ZSTA 1LLOA 3UR7A 3VDAA 4J28A 4KGJA 1KCLA 3L4ZA 1HF6A 2XIBA 4UQ9A 2W67A 3VOCA 1WP6A 4KWUA 2J79A 2CEQA 1R8LA 2XVGA 5IHRA 1V3JA 1UD2A 3SCWA 2GUYA 4E2OA 1HJVA 4U2ZA 3UERA 5I23A 3EMZA 1BVZA 1TCMA 1UR4A 5I79A 1QNOA 1RPKA 3F5KA 5CZKA 4JL2A 3WBAA 1QNQA 2XVLA 3GXDA 1VRXA 3LPOA 4JKKA 1ZU8A 2F61A 2BNJA 1HJWA 4UNIA 1ZJBA 1NP0A 2XPKA 4J7RA 3VIJA 1DWFM 1TR1A 2J7CA 3PTMA 5ABFA 1J9YA 1ZBVA 2JIEA 1QPKA 4PYSA 1HL8A 1J10A 1XRVA 3WDJA 3VNZA 1HXJA 2XFYA 1BF2A 4HOZA 5CLWA 2D0FA 2CERA 1O6IA 1JGIA 2V5CA 5E09A 1PX4A 1MYRA 4UZUA 1W1PA 2PBOA 2VURA 3ALGA 5GNZA 1VF8A 1WCGA 2C0HA 1B9ZA 3FY1A 2WLYA 4PTXA 4C7DA 3NSMA 1HIZA 2QPUA 4TOQA 1YHTA 2E40A 3VM5A 4LYRA 1QBAA 3WEZA 1EIBA 1LL6A 4C7FA 2XJ7A 2BHYA 3U7BA 1WZKA 1JDAA 3PZTA 2O92A 4YPJA 5JIWA 5EFFA 1M03A 1TG7A 3MKKA 2WKGA 3N13A 5I24A 1UA3A 3K8LA 2CBVA 1PAMA 1OIFA 3VIMA 1FFRA 3EBVA 2X05A 3AJ7A 5FCZA 4PUEA 1K9DA 2Y2WA 2B31A 2CCRA 1HNYA 2JF7A 1NWRA 4FF5A 4B3KA 3IANA 5CJ5A 1CNVA 1F4HA 3N11A 4M81A 3AIUA 5KEZA 1GCYA 4NRSA 1PBGA 2D0HA 2FGZA 5CPQA 4CU7A 4GI6A 2A3EA 1OBAA 3WQ6A 1OT2A 2PWGA 2FHFA 5A6BD 1ZS2A 3FHAA 4P8VA 4F66A 3MV11 3SURA 4TVUA 3GBEA 1KBBA 1KGWA 5M3WA 1EDQA 3J7HA 2Z1SA 1E6XM 3WL1A 4WKFA 1V0KA 1US2A 1AQMA 1CGXA 1GOQA 4D6EA 1E4NA 1W32A 3SCSA 1QW9A 2XVKA 4PMOA 2J8FA 3QOKA 1C8XA 1GORA 3M7SA 4UQCA 3M46A 3BAIA 2DT3A 3CGTA 4Q7NA 1H49A 5A69A 4EE9A 1V3IA 3FXYA 2YA1A 1G94A 3KEHA 3AIWA 1JF5A 2IXVA 1ISYA 1UKPA 6TAAA 1TVNA 4QLJA 4D71A 3BSHA 3DHUA 4N42A 5IFTA 3SCRA 1E71M 3VILA 2CHOA 5D9NA 3CMJA 4V28A 5A8QA 5A6SA 1CZ1A 1EH9A 2J25A 2VX4A 2D20A 3IJ8A 2HISA 4MNMA 1UKSA 4W7WA 4XZWA 3W82A 1E3XA 1GVIA 1M04A 4AD0A 2WBKA 2QMJA 1VFFA 4DWSB 2WB5A 5E0FA 2W61A 4KMQA 3RJXA 1E5NA 1D3CA 1W9XA 3VMOA 5D9OA 1BLIA 4JCMA 1W3JA 2GSJA 3THDA 1E0WA 1V6UA 1Z32X 5A2CA 4P7RA 4H2CA 1NWSA 1HKKA 3KWXA 4M80A 3CHFA 4MAVA 1DP0A 1LJYA 1GZJA 4GO9A 1QHZA 1R85A 4B16A 1GQJA 4UQAA 2WVTA 1CXEA 1UWTA 3WD4A 1ZBKA 4U5IA 3AHVA 1NWUA 3OZPA 3M07A 1MW0A 5IDIA 3CUGA 1UQYA 5DEZA 5BXRA 3L2MA 1GOWA 1ZBCA 1JXJA 3WIJA 3BH4A 3AIRA 3WMCA 9CGTA 1EOMA 1K9TA 3NDZA 2OWWA 1E4MM 3WDRA 3BAWA 3AI0A 2ZWYA 4LPCA 4TTUA 3OLIA 1V02E 4HU8A 3E1F1 5A2BA 4CD5A 4AEEA 3OIHA 5FL1A 2J7DA 5DFAA 2J74A 3CZ8A 1UR8A 1C7TA 1EOKA 4NF7A 1D7FA 2WCAA 4CN1A 3VTRA 4Q22A 1UWIA 1OD8A 3WF4A 2YL6A 1FOBA 2XWEA 1GQKA 4TUFA 3OB8A 1JFHA 2NW0A 1GNXA 2JE8A 3ARRA 2CITA 4PUDA 1DEDA 1ISXA 4AZ7A 7TAAA 2ZX8A 3BSGA 3MMUA 1QOXA 4H7VA 2VRKA 5AC4A 2YKKA 3T2QA 3POCA 2VMFA 3N04A 1E0VA 4UQBA 3GXIA 2D2OA 1E6ZA 3L4XA 5ABFB 3OGVA 3VD3A 1W3LA 4AD4A 4JFTA 4F9DA 2FHBA 1E4LA 1HKJA 1NOFA 2UY4A 4JL1A 4PTWA 3RJYA 4PMUA 4HMDA 3OGRA 3TP4A 1CECA 2XVNA 2XHYA 1PIFA 2BXYA 4NSBA 4UOZA 1CLVA 2BHUA 4EAMA 2E3ZA 1KBKA 1KWGA 2WAGA 3SUVA 4L4OA 5EB8A 5LA0A 3POHA 1B0IA 3VMNA 2V3EA 1GQIA 1QVBA 3IJ7A 5AYBA 1JXKA 3VKKA 1UKOA 1J18A 1EO7A 3MSDA 1U2YA 1B1YA 3VDCA 1V3KA 1OM0A 4OOUA 1TZ7A 5ABEA 1HT6A 3ZJ6A 4J3WA 5C71A 4AD2A 3UCQA 3CZKA 5JBEA 4XUYA 4P8WA 2W66A 2Y8KA 2VJXA 1W9BM 2EPNA 2NT0A 1FH9A 3K1DA 1RD6A 2VZOA 5DT7A 4DWSC 2ZXBA 3K8KA 2O9OA 3KL3A 4EANA 2VQTA 2Y4SA 3PZOA 1NM9A 2WKLA 1J0IA 2WC3A 2J4GA 4HPHA 2J7GA 3PZQA 4PMYA 3QOMA 1BAGA 4U33A 2AOSA 2GK1A 4M8UA 2CXGA 3ARZA 3ZO9A 1B90A 1I1XA 4PTMA 2BXZA 2X0YA 1V3MA 3L4WA 1W9UA 4Z2GA 3ZT6A 2FH8A 4M29A 2UWFA 4P7QA 1E6SM 4DUXA 4FLQA 3TTSA 3DYPA 3T0DA 1Y7VA 4BA0A 3VVGA 2E0PA 2J7EA 1WKYA 5ABGA 1CGWA 4TTGA 4AWEA 1DWHM 3ZQ9A 1GOMA 4X9YA 3EDDA 1G9HA 1PPIA 1DWJM 2WWDA 1J0JA 4RL3A 4CVUA 4OIFA 2YL8A 1G01A 4C7GA 3WD2A 3CMGA 2BVDA 1MFUA 4CCCA 2PC8A 2WCSA 2PF0A 5JBFA 1GJUA 2VQUA 2DIEA 3G6MA 1ODZA 5ABHA 2VTFA 3ZT7A 1CGTA 3I3DA 1EDTA 1DWIM 4AIEA 3WDHA 3WQVA 1EGZA 2OSWA 3LPGA 1QNPA 2VNCA 1LG1A 3VPLA 2WLZA 4HZ8A 1H5VA 1LQ0A 5CGTA 2YBTA 4UCFA 3IAPA 4OZOA 1CYGA 3UR8A 5CPTA 4AD5A 4B9ZA 4D1IA 2ZXQA 2O9PA 4XZBA 5HXMA 1NH6A 4AZBA 3AHZA 3PZNA 1WE5A 1VIWA 2EBNA 3BAKA 4ATWA 3CUFA 3BAYA 1MQPA 3T2PA 1GOIA 5BXPA 2C7FA 3EDEA 3IAQA 2OSXA 2DGAA 1E9LA 3N12A 4KRUA 4AD1A 2G41A 2GJPA 3K8MA 3RIKA 1XCWA 3VIHA 3PBGA 1DHKA 5BXTA 3WQ5A 1W1YA 2G4FA 2X8RA 4UOQA 5E0CA 3A47A 4IPLA 4JIEA 4V27A 1UD3A 4PCSA 4U2YA 4H8HA 2DH2A 1PJ9A 5M17A 3AHTA 3T0AA 8CGTA 3D5HA 3AIVA 1L8NA 1O7AA 5EBAA 1EHNA 2W4XA 1JNDA 5GPRA 1WDQA 3WH8A 1OGSA 2CETA 2QLYA 4A4AA 3RMEA 5BRQA 3VIKA 1V3LA 3IJ9A 1JZ4A 3MUZ1 1V6YA 1VAHA 1VFMA 3WD0A 3FNDA 3EDJA 1L0PA 2QPSA 5M5DA 1LL4A 4PMRA 1MWOA 3W81A 2VRQA 2FH6A 3GH5A 3T2OA 1UH4A 4J27A 1FH8A 2DSWA 2E8YA 2ZIDA 1KQYA 3BMVA 4N0RA 2DPEA 3VGEA 2WW5A 3KL5A 1TFVA 4M24A 5IHSA 1E72M 3WNMA 4D1JA 1K9EA 1V6VA 3GYCA 4CCEA 2VX7A 2WBGA 2X09A 4W87A 4J3VA 3VGHA 3RM4A 5FOOA 1I75A 1XH1A 3AXIA 3NSXA 1KCKA 2ZE0A 4PMZA 1KXVA 2WC7A 4NZCA 3UEQA 1JZ7A 1VFOA 1XYZA 5BCAA 5I0DA 3ARSA 4PMXA 1UKQA 4RE3A 2YBUA 4PRWA 3W4RA 3VO0A 1B3YA 2TAAA 1SMDA 2DH3A 1UYQA 4W7VA 3LPFA 2VO5A 3B9DA 3QR3A 1VEPA 3APGA 1CIUA 1X1NA 3OA5A 4CU8A 4X0NA 3DYOA 3BMWA 3T09A 1PZ2A 2WMKA 4GI9A 2J78A 2UY5A 4UFHA 4D6IA 4GQRA 4J3UA 1K6AA 5E70A 4UFJA 3PHAA 1A47A 4GKLA 2GVYA 3NDYA 1IZKA 3AMGA 3WH9A 1HVXA 4X0VA 4RE4A 1G0CA 4AISA 1GVYA 1E6RA 3AZRA 2J7BA 1VEOA 3MSGA 4W7UA 2ZUWA 5JBDA 2CYGA 1BSIA 3VMPA 1WZMA 1UD6A 3FAWA 5FD0A 3MUY1 2VCAA 2WCGA 3AZSA 2XYLA 3TTOA 3O9NA 1UD4A 3AIQA 3TOPA 1W1TA 4HA3A 3TA9A 2ZX7A 4XB3A 1CGUA 3GZAA 2WANA 2BVTA 4PTVA 1PZ3A 4P8UA 3A3HA 3MO4A 1HP5A 1HJSA 3LPPA 4OBRA 1JFXA 2XUCA 3CH9A 4J3SA 4S3JA 2OWXA 2GK1B 1BYCA 2VL4A 5D8WA 1V6WA 2J62A 3VX0A 3VU2A 3AMCA 4F8XA 1M53A 4HTYA 4MB3A 1WO2A 4R5EA 1CXLA 2O9TA 3VIOA 1BG9A 3AHYA 2ZUSA 5D9MA 2OLHA 2BHZA 1JNEA 5C70A 2WZHA 4TX8A 3SCNA 3QHMA 3GH4A 4IPNB 1UH2A 1DWGM 3ARUA 2WHJA 3ARXA 3VD5A 2QF8A 4AC1X 2IUZA 2V3DA 3NCOA 1GOOA 3EYPA 2CPUA 4OOZA 1UZ1A 2V3GA 2XWDA 2Y5EA 5DMYA 3M6DA 1UA7A 2WMGA 3NSNA 1S46A 4GI8A 1OD0A 5DF0A 2XFFA 3AYRA 4EK7A 3ARYA 5A6LA 2EJ1A 1V3HA 1JI1A 3BXWA 1QI3A 1KFWA 3ZJKA 3JUGA 1W9PA 1WDSA 2WPGA 2FHCA 5CGMA 4QLLA 3AMLA 3GH7A 1MFVA 5TD4A 4MNLA 1QNSA 2J7FA 1ZL1A 2VUYA 5C8BB 4AZ6A 2G3NA 4W93A 4AY1A 2XTKA 4YHGA 1OGGA 1H3GA 5GNYA 2W62A 2VR4A 4WJXA 2CBIA 1ITXA 1E15A 4CD4A 1JZ2A 1H4PA 3WDQA 1J11A 1KXQA 5D8ZA 1E6QM 3UESA 1E3ZA 5FKYA 2X2YA 1RH9A 3K4DA 4GO8A 3AMKA 3CUIA 1NARA 2V3FA 4PMDA 3RCNA 3VIPA 1WPCA 3ZOAA 1U33A 4P7OA 1E6PA 3AS1A 4IUGA 1VJSA 2ZXAA 2EPMX 3SCQA 1XCXA 1KQZA 2A3HA 1ODUA 3SCPA 1C8YA 1XGZA 2DSUA 3F5LA 4CN6A 4KGLA 1VFUA 2XSAA 1C93A 2D1ZA 1CWYA 3SCVA 2Q8XA 5CSUA 1HX0A 3THCA 1MW2A 1W3HA 2CESA 1QW8A 3WEOA 5A6JA 4E4PA 1E40A 1MW3A 3BLPX 1VB9A 2WVVA 4Y7EA 5HNNA 1KXHA 1WDPA 2GDVA 1BPLB 4GQQA 8A3HA 3AIEA 2YDRA 3RM8A 3T08A 1XYFA 3WH6A 5I3DA 1J12A 2A3CA 1KR0A 1SFSA 4UFLA 4W8LA 3WD3A 4PMNA 5E9AA 4MB5A 4D6GA 1LL7A 5LA2A 3WNPA 1UKTA 2XSBA 5IFPA 2DIJA 4BQ3A 3L4TA 5A8NA 4W86A 1XD0A 4TX6A 3CHEA 2BY3A 1HN1A 4TVDA 3BCFA 2X1IA 3CLWA 5AC5A 2OYMA 3PTKA 3U5UA 4AD3A 3W6LA 4AEFA 3WMBA 4CGTA 1UHVA 2WMIA 1TMQA 1H0GA 3CZJA 4AZHA 4QLKA 4ZEPA 1UH3A 2WC4A 1ESWA 5CG0A 3ARWA 3BAJA 4W5UA 5GNXA 2WHLA 1LWHA 2WMJA 3WH7A 2CKSA 2YJQA 5BYWA 1OT1A 1E56A 1B31A 5DO8A 2WVUA 1GQLA 4CU6A 4HOXA 3SUSA 1GJWA 3L4UA 4BCEA 2CNCA 1B3XA 2NT1A 2EXOA 1BGAA 4AZIA 2JALA 4HA1A 3CO4A 3PZVA 1WAWA 1UOKA 4GZEA 4U3AA 4W5ZA 3BLKA 2BV9A 3WUFA 6A3HA 2OWCA 3WBEA 2VZSA 3ZT5A 4CKQA 5A6MA 2WHKA 1H1NA 3II1A 3MMDA 1MXGA 5ECUA 3WUEA 1QI0A 2FDMA 2ZUMA 4WF7A 2D24A 2D23A 1ISWA 5CSYA 1VEMA 1B30A 4W89A 4U5KA 3VINA 3VIGA 3WN6A 4QDMA 1GONA 2W63A 4DM1A 1RP8A 1DWAM 1GHRA 2EEXA 5HDRA 1IT0A 1TVPA 4QP0A 4L4PA 1CXHA 2YL9A 1D2KA 1NQ6A 4JCLA 4OJYA 2DSZA 1C7SA 5D4YA 4M56A 1CBGA 2AAAA 1MQRA 2W92A 3W29A 3WF2A 4AZ5A 3ALFA 3SIMA 1Q6GA 2D3LA 3BGAA 2G3MA 4Z2IA 4UR9A 4W8BA 3W26A 5A3HA 1R86A 4H8UA 4FK9A 2UY2A 1BYAA 2VVNA 2ZWZA 2XGIA 4UFIA 7CGTA 1XC6A 4GINA 3AICA 3CUJA 1E4IA 3WD1A 3DC0A 3PZMA 3VGGA 1UUQA 4CD7A 2J7HA 4HZ6A 1TE1A 4H8VA 1HJXA 3GNRA 3WSUA 4MPKA 3SCOA 1DTUA 4UOJA 1W91A 4MDOA 2PBGA 5A8OA 3CUHA 4PMQA 3AOFA 3HN3A 3OBAA 5FL0A 3WQ4A 3N17A 1LWJA 2ZUTA 2BY1A 2YLAA 5A94A 1GUVA 1IZJA 5AY7A 3ZJ7A 4LX4A 4WKAA 3VGFA 1NWTA 1XH2A 5CXPA 4D6HA 1WB0A 1KXTA 3T0BA 4ACYA 1V0NA 1FH7A 2JEPA 2CIPA 3BAXA 1E70M 2VVSA 1UG6A 2VI0A 2RGLA 2ZUUA 2WYSA 1C3FA 2MANA 2GJXA 2NSXA 3O2LA 5E6ZA 2VX6A 3A4WA 1WZLA 4MNJA 3EMQA 3ECQA 1R7OA 4GZIA 3OGSA 1AVAA 4HMCA 3DYMA 1JIBA 5HPCA 2OYKA 3S6TA 4JKMA 4MJ2A 1XH0A 3VDBA 3FAXA 3WNLA 2XM2A 2GFTA 3WQ8A 4RE2A 3RO8A 2JFEX 1SMAA 2J77A 3MMWA 4UQDA 3SUWA 1G1YA 3KZSA 3O6AA 2ZICA 1W1VA 5CPSA 2WVSA 1OCQA 3W27A 1Q6FA 2UY3A 4URIA 3CPUA 2WK2A 1VBRA 4HZ7A 1JG9A 2PWEA 1CGVA 5F7UA 1LF1A 2HVMA 2XVPA 5D9PA 3WF1A 4BZYA 1WNOA 1H41A 1MVYA 3I3BA 3SEPA 2D0GA 3AISA 1R7AA 1JYVA 1TA3A 1LG2A 4W88A 1FP9A 3GXFA 1CEOA 5I77A 3GNPA 1E1EA 1EQPA 1QBBA 2C8NA 3GDBA 1US3A 1ZB5A 1CTNA 4P7NA 1ZBWA 1H2JA 1P6WA 1V08A 3NJ3A 5HBFA 2XM1A 4ML4A 2AMGA 4LGXA 1PX3A 3NYDA 4ZE5A 2VOTA 2YIHA 1ISVA 4HMEA 1HJUA 1PEZA 3UG4A 1J0KA 2RGMA 1X6LA 4JHOA 1FA2A 2EO7A 2WVVB 3WDIA 3W38A 1F4AA 1XHGA 3AMDA 1YQ2A 2QMKA 3F5JA 5GQBA 4UQEA 3ARTA 2VCCA 4ZXLA 3UG3A 4JAWA 2VX5A 4GPNA 3VGDA 5BROA 3W6MA 3I3EA 2VZTA 1BYDA 4JFWA 1M01A 3B8SA 3RILA 5I78A 2FGLA 4PEEA 3GM8A 2GJRA 3L2LA 1WDRA 1JF6A 1HVQA 2XIIA 3AYSA 4GIAA 4FMVA 4ATLA 3CBWA 3U57A 1E73M 1EA9C 1BTCA 2WNWA 1UWQA 2ZX5A 2YOCA 4AIOA 3CHCA 4MADA 2BFGA 3U5YA 4FLRA 4F9JA 2A3AA 4ACZA 3K46A 2PWDA 1BQCA 2WMIB 2GDUA 4QCFA 2WZEA 5CLTA 1CGYA 3WUBA 5DT5A 1QI5A 3N9KA 1IV8A 2ZXDA 2XFRA 1E43A 2DDXA 2VRJA 2EPOA 3K4AA 1MXDA 3BCDA 4D72A 2DEPA 3HMCA 1JDDA 4QCEA 5I6SA 2WM0A 1B3VA 1XSJA 3VNYA 4WKHA 4AZCA 1UD5A 5A95A 4ZFMA 4OUEA 2VCBA 4CUCA 3VGBA 5JIPA 3ZM8A 1A3HA 3WKZA 3VDHA 3MUIA 3WDPP 1JYNA 1XV8A 1JZ6A 2D22A 3BC9A 1HL9A 1H11A 3GBDA 1H09A 1UQZA 3OG2A 1CPUA 1J0HA 3EDFA 4FLSA 4MB1A 4AW7A 2EPKX 2YA0A 3W28A 3FW6A 1ISZA 1X6NA 3FN9A 3RPMA 1QI2A 3MANA 5I5RA 3EDKA 2YDSA 3AS0A 3RDKA 1QI4A 5A8MA 2CBJA 1E6NA 4UFMA 3TTYA 3WENA 4YHEA 2F2HA 1EXPA 3KE0A 4H04A 1XD1A 3ARVA 3AS2A 2WSPA 2G3IA 1NOWA 1VJZA 2WSKA 2DSVA 4JFSA 1CXFA 5BXSA 1G5AA 2IXUA 4UFKA 1ITCA 1TUXA 2J8GA 1EQCA 3GNOA 1B3WA 2PWHA 1U30A 2E8ZA 4D6CA 4J3XA 4HPGA 3FHQA 3AXXA 4MAZA 3TONA 1BG4A 3IK2A 1JD7A 3QHOA 3OLGA 1UWRA 5LA1A 1E55A 2EPLX 3WF0A 1UWUA 3L4VA 4UZSA 3VD9A 1C92A 4LYPA 3QGVA 1CXKA 5A1AA 1AQ0A 3PZIA 3PZGA 4XV0A 4NRRA 4ZENA 1B2YA 4HOWA 3SCTA 4CD6A 3CZEA 4AZGA 1HKMA 2D3NA 2G3JA 1HJQA 2E9BA 2JF6A 4KRTA 4NI3A 4AIUA 4AMCA 3EMCA 2Y24A 2VC9A 2PWFA 4GZJA 3ZMRA 3OLEA 3KL0A 4TVCA 3CZLA 4D6DA 3WNOA 3WFLA 3SCUA 3ZR6A 4XX6A 1QNRA 2QV4A 1ZJAA 4W85A 3ARPA 4QAWA 2VR5A 4HU0A 2VZVA 1JYWA 3QHNA 3CZGA 3WEMA 2WXDM 3WMSA 4F79A 1GHSA 3ZIZA 2V38A 2PB1A 4JKLA 3VX1A 4BF7A 4ATDA 1FP8A 1BHGA 2CKRA 3CTTA 4PSPA 3DHPA 4Z2HA 1VENA 4IM4A 4MDPA 3UETA 1BVNP 3AS3A 3AXHA 2YA2A 1JAKA 2QHAA 2GJXB 3A4AA 3WNKA 2J47A 4BQ5A 4DWSD 5EFDA 2F8QA 1UZ4A 2V5DA 4PBGA 4W84A 1CENA 1HKIA 3WF3A 4S3KA 2E9LA 3NUKA 2XGBA 1PIGA 4D6FA 2BY2A 1UR2A 5A2AA 1UWSA 1JZ5A 4D6JA 1QHOA 2ZOXA 3HU7A 2W91A 3GXMA 2J75A 4WK9A 3WELA 1GOKA 2E4TA 3PN8A 1B3ZA 3DECA 3U7VA 3B9AA 2XG9A 1Q6DA 3AROA 1W9VA 5A6AA 1E5JA 3VD4A 2DQXA 1XSKA 3AQUA 4A3HA 5E6YA 4JHZA 1OIMA 5A6BA 2JEQA 3A4XA 4CCDA 3VIIA 1XSIA 4V2XA 5BRPA 3RM9A 4QFUA 1CDGA 1FHDA 5CQ1A 4ZXOA 2WMFA 3A6OA 1UR1A 3F4VA 3SUTA 3VD7A 3S2CA 4MJ4A 3AIBA 3GTNA 4E8DA 1TA3B 4JZ5A 3PZUA 3ZSSA 2X0HA 1VBUA 1W3KA 3AFBA 4LXFA 3D3AA 5BWFA 4P7LA 1FHLA 3WUGA 4B3LA 2BY0A 5M03A 1UD8A 2ZX6A 4JFUA 4W8AA 6CGTA 1QHPA 4U31A 3ZJ8A 4PMVA 1J0YA 2A3BA 1CLXA 2YL5A 3VUPA 3W25A 1MW1A 4HA4A 2CHNA 3B9EA 4WLCA 2OYLA 5HOSA 2DT1A 3N1AA 3UG5A 2ZUNA 1MQQA 3W0KA 3W24A 3WH5A 4DUVA 3VM7A 3OZOA 3CIVA 1OB0A 1AMYA 4FLOA 1BFNA 1UR9A 2WWCA 1KGXA 4Z2JA 1H0IA 4MTVA 1W2VA 3WY1A 1EO5A 1K9FA 1Q6EA 3CHDA 4BS0A 1AQHA 2JIWA 3PZ9A 5A6KA 1I1WA 1C8QA 1GW1A 1W2PA 2WZIA 1JL8A 4ACZB 3N15A 5IXEA 3TTQA 1Q4NX 1JI2A 4WSJA 4OKDA 1GPFA 1PX8A 2O9RA 2WHMA 1Q6CA 4HP5A 1OWQA 4Z2KA 1JDCA 1BGGA 4GXPA 5EMYA 3VIFA 3MS8A 2G8ZA 5HPOA 4AXNA 3LMYA 1WZAA 1V6XA 2EQDA 2ESCA 1KB3A 1V02A 2Z1KA 5JUVA 1KGUA 3AHXA 4AZCB 4M82A 3ARQA 4UTFA 5KZ6A 1KWKA 1J01A 1SYTA
chains in the Genus database with same CATH superfamily
4B9YA 3DGRA 4LRSA 3ABSA 3WK3A 4F0SA 2LLEA 1VIZA 3V36A 3ZR5A 4DRSA 5FI8A 4DM2A 3RGTA 1PDYA 7A3HA 4K39A 1RP9A 2BS9A 3TW6A 3HFYA 3DKLA 2UBPC 3NFUA 1EDGA 4F2UA 3MUAA 3G22A 2PTYA 4BQ2A 1OABA 4WSKA 4LQ1A 4E8CA 1IEQA 1L8PA 1RCXB 1JYXA 3FDGA 2YPIA 3F2CA 2W5FA 4RDYA 4M6QA 3R8RA 4GIRA 3PTQA 3WL0A 2EKGA 4FOJA 3N9SA 1PKMA 3TR2A 1HUVA 2PDGA 5G4WA 5KETA 1K8YA 2G37A 4DI8A 3R11A 1KM1A 1KM2A 3MV01 2CZFA 3R1ZA 2PURA 3E0VA 1EGMA 3T1GA 4ERIA 5FIPA 2CWNA 1HP4A 2FJKA 3CYJA 3PUDA 3N6QA 5K4XA 5LNUA 4U3CA 3TN4A 1POJA 3ZVHA 4B91A 4WOQA 4CD8A 4KIRA 2Y62A 2GGHA 3O07A 2VZUA 1FFQA 3VC6A 2AAMA 2E9MA 4CN4A 1DYSA 2PGEA 3TQKA 2NXGA 3P93A 3HJEA 3TJIA 2VFGA 3HMJG 1NSJA 2W67A 3VOCA 4KWUA 2J79A 2CEQA 1MUMA 3KTSA 1V3JA 2GUYA 1AJ0A 3RO6A 3W7HA 3EMZA 4H9VA 4YMZA 1UR4A 1XLKA 3EEZA 5CZKA 4BY3A 4O19A 5FACA 3WBAA 1QNQA 2XVLA 4O28A 3GNDA 2F61A 3IJQA 1EKOA 4DPQA 4DBDA 4UNIA 1OCNA 4R7OA 3QC0A 4ZSTA 1J9YA 4RDWA 4DAIA 5D03A 1HL8A 2YCEA 4JYDA 3MP3A 3TN5A 1O6IA 5CBJA 4K8GA 3ABZA 2QDHA 2R1KA 4JX5A 3VNLA 4NQ1A 3FY1A 3B9OA 2WLYA 3KVMA 1V93A 4PTXA 4C7DA 3RAOA 2QPUA 3NAVA 4AIBA 2E40A 5LIWX 3QFEA 2J6VA 4GJ1A 2FVMA 3G3DA 3U4AA 3K5XA 1W3TA 2BHYA 3U7BA 3EPMA 3LA4A 3PZTA 3SJNA 1YADA 4HMNA 3G77A 3W00A 2O92A 5F2MA 1U5JA 4AVOA 8XIMA 2VEIA 3EB2A 1IE7C 3MYOA 3WG6A 2ZRYA 4FXRA 1TG7A 3AU2A 4Z1YA 1J2WA 3K8LA 2CBVA 4N02A 5K7JA 3EBVA 3AJ7A 2J8TA 3SI9A 2J6XA 1EUAA 3DC8A 1OHLA 1F4HA 3P61A 3CPGA 4DO4A 2RHGA 4ZO7A 3AIUA 5KEZA 3N4EA 4NRSA 3IWPA 1LORA 4CU7A 1LZOA 2A3EA 1OBAA 3WQ6A 2PWGA 3TSBA 1L9WA 2FHFA 2XFWA 4RPPA 3MV11 1KGWA 5M3WA 1W8GA 4LAMA 4I6VA 4S3BA 5LIUX 4WKFA 1US2A 2QUVA 4XD5A 1JCMP 4GUGA 2RJHA 4E4FA 4Q4RA 1AW2A 4PMOA 4G1NA 1FWGC 1US0A 1G4SA 2QUMA 4NYYA 1C8XA 1GORA 3M7SA 4DO6A 3W7QA 4ZB5A 3W7OA 2CFFA 3BAIA 2DT3A 3CGTA 5M2FX 1H49A 2HVOA 4JTTA 4A3UA 1V3IA 4GUHA 2ICSA 2YA1A 4LF1A 2PLKA 3AIWA 3OIXA 3A23A 4LUYA 1JF5A 1D8CA 1FWRA 3S42A 1ISYA 3WK0A 4MZ8A 4QLJA 3RRXA 5I06A 5LNVA 1H61A 3TQ0A 5DBTA 4O8RA 3SCRA 3ES7A 4I90A 4DI9A 3XISA 4A8NA 2WKJA 1P48A 2J25A 3IJ8A 4HYVA 4W7WA 3VNMA 3YPIA 4N9CA 5HULA 1J8VA 2IKJA 1RCOB 4MOZA 4AD0A 4WXZA 2QMJA 1VFFA 4DWSB 2XN0A 5HWMA 2PU0A 2XH2A 3TV8A 1R2TA 1BRLB 5BWAA 1W3JA 4PL1A 3PNZA 3N25A 3THDA 3F2DA 4JDYA 3QR0A 2V81A 3QGAC 1K7XA 1HKKA 3VE9A 5I09A 4ZSUA 2Q09A 3KWXA 3RFAA 4M80A 3NQ2A 4MAVA 3LS9A 1EWEA 2Z6IA 1EJ7L 2WVTA 1KTCA 1SZFA 3AHVA 4MKSA 4Y90A 2R1NA 5ABTA 1NWUA 3I6TA 5J8LA 1F6KA 5IDIA 3S1UA 1XL9A 1UQYA 3CUGA 4RJEA 1DJHA 3EZ4A 1PHWA 1HG3A 3R25A 3NZ1A 1XBYA 3FV9A 3WMCA 1XISA 5D2YA 1OF8A 1YE6A 2R1PA 5EMUA 3OLIA 2R94A 4AEEA 1DQXA 4JEJA 2R8WA 4NF7A 4JQ1A 3VYLA 3KRSA 3VTRA 4DX3A 1UWIA 1RJPA 4EPBC 1QWGA 4YCOA 1QK2A 5C2CA 3ARRA 4PUDA 1DEDA 1FWBC 4AZ7A 7TAAA 5ENLA 2ZX8A 3MP4A 3I4KA 4IOTA 4GD0A 4XSMA 1LT8A 1QOXA 2VRKA 4H7VA 3T2QA 3ATYA 3N04A 3KM8A 2Z26A 3W1AA 1E6ZA 5AYZA 2XH0A 1I6NA 3CV7A 4AD4A 1ICPA 3E96A 4ZL1A 4DBSA 4PTWA 1F73A 1FKWA 2A7NA 4IGHA 4FSAA 5EA9A 2AQOA 3T0CA 1CLVA 4EAMA 1KBKA 1JCTA 2AKZA 3SUVA 4L4OA 3POHA 5EU9A 4CQBA 1JXKA 4DBUA 2YDAA 3MSDA 3EXTA 1RAKA 3M43A 4CEUC 4TO8A 1TZ7A 4IT1A 2V5KA 3W7PA 3EX3A 5C71A 4AD2A 6ALDA 3D3FA 3CZKA 1YRRA 5LGXA 4XUYA 1GTEA 5AECA 1TWIA 3R7MA 4GUJA 4P8WA 2W66A 4BI5A 5HATA 1V5XA 1RD6A 2VZOA 4DWSC 2O9OA 4EANA 4CQCA 2CLOA 1E1CB 1NM9A 1PUDA 1DIDA 1I0BA 2J4GA 4HPHA 3B0PA 1MRAA 3TJ4A 4PMYA 4G56A 4U33A 2AOSA 3GC5A 4M8UA 4OVXA 2CXGA 4F48A 1XLBA 5E0KA 4NT0A 2C18A 2CLMA 2BXZA 2FH8A 3OHIA 2DZXA 3M1ZA 1K3UA 5AKQA 5AVNA 4DUXA 3P2VA 3S2JA 3IV3A 3UNDA 3VVGA 2R91A 2ISVA 1YYAA 5AHMA 5LHFA 2MUCA 4GYJA 3VOJA 2NX1A 4WUIA 5AHNA 2GOKA 3ZQ9A 5B80A 1GOMA 4X9YA 1PPIA 1DWJM 3I6RA 3S6DA 1QATA 1J0JA 3ERPA 1G01A 3N2OA 4C7GA 4E3TA 3GHUA 3H4WA 3OEXA 2BVDA 4HU4A 1MFUA 3DIPA 2PC8A 5JBFA 4FPSA 4IG2B 3QKZA 1G4TA 2QJNA 3WX7A 1ODZA 3I3DA 4AIEA 4PC8A 3TQVA 3HPSA 3A5VA 3TA6A 5C55A 3FIGA 2YBTA 4GKTA 1Y5VA 3TXZA 3IAPA 2BOEX 3GTXA 5C5YA 4OZOA 3OYXA 5I3GA 3QY8A 3STCA 3UR8A 4AHOA 3GHSA 4B9ZA 2ZXQA 2O9PA 4XZBA 5HXMA 3KWSA 1YDVA 4UNKA 7TIMA 3B0XA 4O17A 1WE5A 2C79A 2DVUA 2EBNA 3BAKA 2PDIA 1P43A 2B7NA 2E68A 1MQPA 1XYBA 1GOIA 3M0LA 4LWWA 2C7FA 1KBLA 4C6OA 3EWZA 1XIGA 4DBEA 4KKXA 1E9LA 3W1NA 1N8IA 1SO5A 1A5NC 2GJPA 4WDXA 3VIHA 4OECA 4NXKA 5C7HA 4NL1A 3PBGA 3ISIX 4HHMA 3WQ5A 2I5IA 1NFPA 3CT2A 3DAQA 3GU9A 2G4FA 2X8RA 5E0CA 4JIEA 4PCSA 4FF7A 3W87A 2CLFA 2ACRA 4NY2A 1PJ9A 1K4HA 2GWGA 1RR2A 1Z41A 3AHTA 2E5BA 4X60A 2Z7GA 3M0HA 2NUXA 5EBAA 1EHNA 1JNDA 4DYJA 2E6FA 3WQEA 3SRDA 3P60A 3L67A 4MHBA 1T0OA 3WJSA 3GYEA 1XUZA 1IGWA 3MUZ1 1OFBA 4TV5A 3EDJA 1L0PA 2QPSA 4KESA 2HROA 3C0SA 2G4JA 3P8IA 3KVJA 2HPIA 2FH6A 3GH5A 3T2OA 2V69A 1RK5A 1FH8A 3EX1A 1FWNA 1KQYA 3RPDA 3BMVA 2GVLA 3VKBA 1TFVA 4M24A 2ZZ5A 3E6EA 3E49A 4D1JA 4L6DA 1K9EA 1V6VA 1M7JA 4CCEA 3KP0A 5AHEA 1MUCA 3AC0A 3VGHA 5FOOA 1I75A 1UP2A 2ZBTA 1N8FA 4WOZA 1B4KA 3AXIA 1KCKA 2ZE0A 2GGGA 3LTYA 5GVJA 1JZ7A 4LBSA 3LQGA 2OOFA 3O3RA 5I0DA 4ZQRA 3O7UA 1UKQA 3C5QA 3M5YA 2YBUA 4PRWA 3BLFA 3NZPA 5JH1A 3PBYA 4D8AA 1SMDA 1UYQA 3OTRA 1Q66A 2VO5A 3QR3A 4QHRA 3BV7A 1OFEA 3APGA 4EF8A 1P4CA 1TJRA 4E2DA 3DYOA 3MDUA 2PDWA 3FJ6A 3T09A 1PZ2A 1UIPA 1DBTA 4ZOAA 3EOEA 5MKGA 1NEYA 4HU3A 4GQRA 2Z1VA 1K6AA 5HMEA 4UFJA 3PHAA 1LRTA 1NDWA 2GVYA 1IZKA 3WH9A 1HVXA 4GZ7A 3UZWA 1GVYA 1E6RA 3AZRA 1FQ0A 1VEOA 5JBDA 2TPSA 4JTGA 1MEIA 3KBWA 3VMPA 2RDWA 3CL6A 3FAWA 2VCAA 3AZSA 3F4DA 1UD4A 4Q8QA 3TOPA 3U0HA 3IIZA 3TA9A 1CGUA 4IIBA 1XXXA 3NQVA 4L7ZA 2QCDB 1VLIA 3U3HA 3MO4A 1UZDA 4HNTA 2VD8A 1OZQA 3KUMA 4OBRA 4POCA 3SN1A 1JDEA 3QXBA 3QYQA 4W9TA 2OWXA 3W72A 1BYCA 1HTIA 2VL4A 5D8WA 1V6WA 2J62A 3CL8A 1KRMA 3AMCA 3KW3A 3QVQA 2PE4A 1M53A 1R2SA 1WO2A 2O9TA 1UB3A 4M6PA 3UWVA 4ZTXA 2ZC1A 3VIOA 2POZA 2PD9A 4LAZA 5D9MA 2OLHA 5CZTA 2V0TA 1FBAA 1O5KA 3GH4A 4IPNB 1ZCOA 3ARUA 3ARXA 3VD5A 1KFBA 1NJJA 4ZGYA 2V3DA 3CC1A 1GOOA 1ICSA 2QPXA 3EYPA 1PB0A 2ZTJA 2Y5EA 1UA7A 6REQB 1ZJIA 2HE8A 4ZB2A 4QGCA 2G0WA 4GI8A 1Q45A 1WUFA 5DF0A 1O5RA 3KXQA 2NQLA 5A6LA 1M3UA 4HCLA 1RBLA 5C2XA 2FTWA 1JI1A 4LUJA 1ONXA 4UTMA 1QI3A 1DXFA 1KFWA 4ROQA 3JUGA 3PWGA 1A5BA 2JKEA 1ZLPA 3EB4A 4FXFA 4XZ9A 5F4SA 3LZ3A 1CX9A 4MNLA 4G7EB 3LBMA 1EJWC 1ZL1A 3QFWA 1YW1A 3L5AA 2G3NA 1EIXA 4H6QA 5AZ1A 3OQ8A 4JQ4A 4FP1A 5HJXA 4WJXA 4QAIA 1JZ2A 4C60A 1J11A 5D8ZA 1AFSA 2ZZ3A 3C6CA 2X2YA 4BHYA 1R9XA 2Z1BA 2QKFA 5EYWA 1R9ZA 3CUIA 3RCNA 4JNYA 4P7OA 1E6PA 2Y63A 4WR3A 3UWZA 1GVFA 1KQZA 5TBOA 3TAKA 5T9CE 5KZDA 5JVLA 2X42A 3UGRA 2VFIA 3LYEA 2DQWA 1OG6A 2V2CA 3T78A 1XGZA 3WQCA 1MEWA 1TMHA 1VFUA 1C93A 1VFHA 1REQB 5CGQA 3P82A 3THCA 4JX6A 2TYSA 1OFPA 5IM51 2NXHA 4E4PA 1D9EA 1E40A 3TSDA 3CWNA 2YCLA 4JTAA 4Y7EA 5HNNA 1WDPA 2POTA 5LNRA 2G3FA 3RM8A 3T08A 3KRUA 4QNWA 1J12A 1TSIA 2J9ZA 1KR0A 1SFSA 4AUBA 2V8ZA 1BWKA 4I9MA 4CNNA 4HCHA 4PMNA 5E9AA 4RW5A 2OXNA 3WBXA 3ZWTA 3KHJA 3EPNA 3NVTA 1LL7A 3ITGA 2XSBA 4GWEA 2DIJA 3RLUA 4BQ3A 5A8NA 4UC5A 4HPXA 3GC2A 3ZLGA 1L2QA 3TXVA 5AC5A 3PBVA 1UPPA 4D2JA 1Z6KA 4NZ3A 3W6LA 3E0LA 2XIJA 4CGTA 3FJ4A 4AZHA 1QXLA 5I3FA 1JCNA 3IS4A 1FY6A 3COTA 4GXMA 1I8JA 3LUTA 4N9BA 1FWFC 1VKFA 2REQA 1A4LA 4DJFD 2HXUA 1KCZA 1DIEA 3WLOA 1LWHA 3KVKA 2NZLA 2QJMA 4DJDC 3SQSA 2DJXA 1GVQA 4A8RA 2TODA 4OUIA 4DXXA 2WO5A 2E1WA 5DO8A 2IPGA 1K77A 1GJWA 2NT1A 1W5PA 2D2GA 3CLMA 1T5AA 3PZVA 4I5XA 5GJNA 2CLPA 6A3HA 4C6MA 3SFKA 1HW6A 3WBEA 4WVXA 2VZSA 3ZT5A 1E9YB 4CKQA 1I4NA 3GU1A 1XC4A 4LFYA 2R82A 1Q8JA 3AYVA 1QI0A 2E5CA 2KX9A 2R14A 1ISWA 1B30A 3VINA 1PE1A 4QDMA 1PWLA 3AUOA 1GONA 1RP8A 1DWAM 1KFJA 5B7YA 3C4UA 1CXHA 2OVLA 1NQ6A 3TLQA 3VKCA 3UXAA 1G7UA 4YIWA 4OWGA 1CBGA 2AAAA 1MQRA 1YPFA 3W2UA 3BJSA 2NVCA 4S2CA 1MDLA 4JQAA 3NQCA 1HO1A 2TSYA 3IPWA 3LCHA 3MWAA 2Y89A 4Z17A 4PCPA 2DUAA 2UY2A 1BYAA 2VVNA 1FWCC 2XGIA 2PP0A 3PPFA 3W9ZA 1H62A 7CGTA 1E4IA 1TJ2A 3IIVA 4XG1A 3WD1A 2BMBA 3PZMA 3V1HA 1XLMA 1S5NA 2J9XA 1S5MA 4H8VA 3GNRA 4UTIA 3A21A 3QR1A 4MPKA 4JTKA 1W91A 5DELA 4MDOA 4FNQA 4PMQA 4LUSB 3OBAA 3GSMA 1GEHA 2ZUTA 2Y0FA 3CMFA 1GGOA 4LX4A 4RLIA 4IMFA 5C9UA 5HQMA 2DUXA 3W2MA 3IGSA 1WB0A 3N2XA 1KXTA 4ACYA 1RVGA 2JEPA 2NQHA 2BGSA 2CIPA 1QPQA 1XPYA 3IJ6A 3IVUA 5G1TA 1JCXA 2RGLA 4ENLA 2FMOA 2MANA 4A2RA 1M6JA 1TR9A 4XBKA 4MNJA 1GYMA 2ZRZA 3W23A 1R7OA 4F0MA 2PGFA 3DYMA 1A5UA 3RITA 1JRCA 4XVEA 3S6TA 3U9IA 3KP1A 2XM2A 1A0CA 4FX7A 3LOTA 3RO8A 1SMAA 3TN6A 5E93A 4M5PA 4RZBA 2QEZA 3LRLA 2WK2A 4HZ7A 2PWEA 1CGVA 3BUVA 4RDVA 1LF1A 2ATMA 4WY0A 5D9PA 1LRQA 3PUEA 1DHPA 2FJUB 3I3BA 3AISA 1JYVA 5HMSA 1ZB5A 3QV6A 2X7WA 4P7NA 4PE8A 4M6VA 3BLDA 5F4XA 3NJ3A 3FDKA 4ML4A 4L1GA 3RN6A 4DB7A 2AMGA 2XISA 3B06A 3NYDA 4U10A 4IHCA 3NPVA 2YIHA 5I3JA 3SRKA 3V5OA 1ZQ5A 4JHOA 3FGCA 2WVVB 3WDIA 3W38A 1E0TA 1F4AA 1XHGA 4JQ2A 1HKVA 3AMDA 3F5JA 4UQEA 4HKPA 3MI2A 4L64A 4JTJA 3MVTA 3V18A 1POKA 4QBXA 3PPCA 3I3EA 1WKDA 4JFWA 4ZQPA 4XKMA 5CZ0A 1NF7A 4B5VA 1JF6A 1HVQA 2XIIA 5AYYA 3S8HA 3CBWA 3H2AA 5I00A 1T7LA 2INEA 3P81A 2C91A 1ZJHA 4HSNA 4MADA 3U5YA 4FLRA 4ACZA 5D05A 3K46A 1DOSA 3DUGA 2GDUA 3TNOA 3RX3A 3WUBA 4X22A 1KTNA 2ZXDA 2B7OA 3UVIA 2YCIX 3SY1A 2EPOA 2OGYA 5BW6A 2QNEA 1JDDA 5I6SA 4Y9AA 3NG3A 5TF0A 2F6XA 4LY4A 4ZOBA 1SW0A 2WNZA 4CUCA 1A3HA 2V2HA 3OHMB 1TMLA 3AO0A 3BC9A 3IK4A 3PSWA 4ZB0A 1H09A 1FUYA 1EBGA 1CPUA 3RX4A 1JJKA 4MB1A 2BGNE 2EPKX 1YMYA 1Z69A 3W28A 3FW6A 1X6NA 3RPMA 3WLQA 3MANA 3OVRA 3EDKA 4MZYA 4KCUA 3H53A 3AS0A 3LNMA 3RDKA 1QI4A 1JUEA 3W70A 3GLCA 1BSLA 3KE0A 1LOSA 1KBIA 1TPB1 5FF0A 1IWPA 1XD1A 3DG7A 1YTKA 3L5LA 2PMQA 4FNRA 3GNNA 2WSKA 1EEPA 4UFKA 1TUXA 3GXPA 5AHIA 1IT7A 3PVFA 4OTKA 1FHUA 3FHQA 3A22A 3AXXA 3C0LA 1LBMA 1JD7A 3QHOA 3OLGA 1SZRA 5LA1A 2JK2A 1E55A 3WF0A 4ADSA 1EF3A 1Y5XA 1KA9F 4UR7A 4A21A 1FWJC 3PZGA 3H4GA 4NRRA 1LUCB 3PANA 2Q8ZA 5D37A 1XGDA 3AYTA 4CD6A 3NQFA 4LS2A 4KFNA 2XU2A 2JF6A 1HJQA 2E9BA 3NXFA 4GZJA 1IZCA 3ZMRA 2PDMA 3OLEA 5BOOA 3KL0A 2DV0A 3G8RA 1U83A 4H9YA 5DRIA 3SCUA 1RALA 3U2OA 2QV4A 2VP8A 4K7VA 4YCPA 1KFLA 5TIMA 2HPMA 2Y85A 4O18A 1YDYA 4F79A 5KINA 4MWAE 3ZIZA 2V38A 3H7RA 2PB1A 3I7QA 3H55A 4O12A 2FQIA 4ATDA 1FP8A 1DL3A 1LRNA 4MY1A 1Y0EA 4IM4A 4S3FA 3UETA 3KBNA 4GABA 3GK0A 3DU0A 4RCXA 5A6TC 1PTGA 2QHAA 3A4AA 4DWSD 1B54A 3VFLA 4XZHA 1S5VA 1JCJA 4OGZA 1HKIA 3WF3A 5LXXA 3B0UX 3H54A 3NUKA 3WFAA 1Q7QA 1JZ5A 2ZOXA 3HU7A 3LCLA 4PH6A 2P3EA 3I65A 1E51A 3DECA 4I3GA 1MZRA 1SO4A 4Y96A 4HK7A 3VD4A 3ZFHA 3BLIA 4H6KA 2ZKMX 4JHZA 1OIMA 2OO6A 4YJ5A 4JTCA 3VIIA 3LLDA 1CDGA 4QFUA 4YVXA 4ZXOA 4ALDA 4MPQA 3VD7A 1CT5A 3NQAA 1QDSA 2IQTA 1QFEA 1AQFA 4E8DA 1TA3B 2E09A 3W76A 1AUSL 4HTBA 4AX7A 4IGNA 5G5IA 4GBUA 4P7LA 1FHLA 4CNPA 2OTDA 2VOMA 1XLIA 4W8AA 2P8CA 5FJIA 2DZTA 2VDHA 3WK1A 4DY1A 1ENUA 3UYIA 2DZVA 3RR1A 4AG0A 2PD5A 1HL2A 2VR2A 2CHNA 5HOSA 3UA4A 1F3EA 2DT1A 2ALRA 4S3AA 2H3BA 4FIRA 3W7LA 4Q8NA 3WH5A 1LQAA 4HJWA 1GG0A 4DLMA 3VOIA 2F38A 5G2HA 2I17A 3UZ5A 1AMYA 2W0UA 4PBEA 3LXCA 1C9WA 1KGXA 2E6DA 1UUOA 1H0IA 1P0BA 3VKAA 1IEIA 4B90A 4EPEC 3PZ9A 3O0KA 1GVEA 4AWUA 3TFXA 1OX4B 2V63A 3IJLA 4QE1A 3REQB 4Q8TA 3BOLA 5CEWA 2GYIA 2X16A 3TTQA 4LAOA 5F2IA 5I03A 3URNA 2D73A 3H22A 4HP5A 1JDCA 3RXZA 3C8FA 4Z0JA 2G8ZA 1NFGA 4AXNA 3KLKA 2EQDA 3PFMA 5JUVA 3WLLA 3ARQA 2DZWA 2PDBA 2YLLA 4GQ0A 4JDBA 1JCLA 3WNNA 1SFLA 4AY8A 3V3WA 3W7IA 2V30A 3L4YA 4R27A 4H41A 3B8TA 3Q58A 3LQLA 4C65A 2RDXA 2XN1A 2VWTA 3W37A 3GVVA 4FAMA 1R9YA 5BU9A 2GL5A 4Q4OA 3RR4A 1O12A 1OADA 4NNCA 4UWMA 2HQAA 2ZUVA 1CXIA 4LAUA 2IQDA 1P0EA 4DUWA 4DWSA 1KLZA 4WIWA 1E1FA 4Z1DA 1BRLA 2CXEA 1QPNA 2OB3A 4H9UA 1A3WA 4JFVA 4ZFCA 1R0MA 3WLHA 4DEFA 2O4MA 1R38A 3GR4A 3MU7A 2QGHA 1W9DM 1E0XA 1TZ9A 5HMDA 1NTHA 5CKSA 3GW3A 3CIWA 4H7ZA 2EG7A 1JRBA 3VC5A 3E9AA 4PCTA 3QGKC 5A8PA 3C2OA 1RHCA 1EP3A 2BLEA 3BG3A 1H7RA 4RKAA 4J3TA 3MSYA 1V0LA 1EPVA 3V75A 4XAFA 1SR0A 3SGUA 4K2SA 4PN2A 4IQDA 2WMHA 2ZX9A 2WZTA 4M1RA 1P7TB 1UR0A 2RH9A 2WNNA 3PULA 4ZTYA 5HQLA 1R87A 1ECEA 4YNGA 1RJRA 4Q6JA 4PCFA 1BYBA 3LGEA 2XIBA 3LM3A 1X98A 3DENA 5U4NA 3WLNA 1R8LA 1UD2A 3SCWA 1HJVA 3UERA 3BCJA 5I23A 2B4GA 2GSEA 3F5KA 4EWND 3HGRA 4MF4A 1DORA 3NURA 2EKCA 4PFHA 1QRQA 1ZU8A 3PPGA 3W84A 4O1FA 3NVDA 3RLGA 2RAGA 1IF2A 4J7RA 4WDTA 1K8CA 1TR1A 2J7CA 3Q65A 3PTMA 3EWXA 1QPKA 2AQWA 4J40A 3RLVA 3WDJA 4JNZA 5HWJA 4OFCA 4C90A 3MBDA 4H83A 3D6NA 1BF2A 1PHQA 3G1AA 1XIEA 5CLWA 3W2KA 2D0FA 2Q3OA 3TE9A 1IR1A 1JGIA 4LY8A 1PX4A 3ID7A 3LU2A 5GNZA 4IMGA 1VF8A 2C0HA 4ICMA 1HIZA 4TOQA 1K4GA 2PDQA 3R58A 3T4CA 2RUSA 3WEZA 4DO5A 1EIBA 1GQNA 4E8GA 4C7FA 3ITYA 2AKMA 2GQ3A 3LBCA 3KOXA 4YPJA 5H8UA 1E1CA 3LRKA 1M03A 4L9ZA 3MKKA 4NI8A 1R3YA 2WKGA 5FSEC 3UZXA 5I24A 1BKHA 3VCCA 3E2SA 3L21A 4PUEA 3CQHA 4B5XA 1HNYA 3NQ7A 2JF7A 3VCRA 4B3KA 4L6HA 1YKWA 1CNVA 3N11A 4UB9A 1PBGA 4GI6A 2FZNA 3CAKA 1X7FA 1OT2A 3SN0A 1PL9A 1OF6A 1ZS2A 3CXOA 1KBJA 3L68A 1PS9A 4F66A 1TWZA 3SURA 4PEKA 3GBEA 1KBBA 3LY0A 1O66A 2BOGX 1SSDA 1H7PA 3J7HA 1KKOA 1E6XM 3WL1A 5LIYX 2IQ0A 3NO1A 4HPJA 2PDUA 1AQMA 5CC3A 3PWAA 1LBLA 2GQ9A 4D6EA 4I9TA 1E4NA 4QJ5B 1HFBA 4C5YA 1XLFA 4IG2A 2J8FA 3GW0A 3HPXA 3BDKA 1MUWA 3S0CA 3MKVA 3GTIA 1SW3A 2R1LA 4NG3A 4LS1A 1M7PA 1EC9A 1Q3NA 5A69A 3FXYA 2ZDRA 2H8XA 4PUMA 1XI3A 1W3NA 1G94A 1GEQA 3KEHA 1B3OA 4IFKB 3ZLHA 2V67A 2C6QA 3NQDA 6TAAA 4K3ZA 4D71A 2YGYA 4IXXA 2PTWA 4EPDC 4UTLA 1TJ0A 3VILA 2PWUA 5A6SA 3K1GA 2D20A 2JBMA 3UYCA 3G0UA 4MNMA 4DWDA 1UKSA 4ERGA 4XZWA 4AH7A 3UJEA 3NNTA 1M04A 4J1OA 4DELA 4GK8A 1T6MA 2FLIA 6ENLA 3RJXA 1H7XA 4PTDA 2D69A 2V82A 5D9OA 2HNHA 1BLIA 4JCMA 2ONEA 3EWUA 4JIQA 3NQ6A 4HNUA 1E0WA 4H2CA 1NWSA 1L6WA 2YFOA 3CHFA 3IGUA 1P6BA 3R10A 3O0FA 4GO9A 1QHZA 4UCGA 3QMRA 4Z42C 3G18A 4B16A 1GQJA 5F1UA 4QXIA 4UQAA 1UWTA 4U5IA 3WK2A 4HB7A 4GRSA 1F8IA 4I9JA 5DEZA 5BXRA 3DBNA 1ZBCA 2VDGA 3WIJA 3BL3A 5F2LA 1EOMA 3GR7A 1XLJA 2OWWA 3WDRA 4I8DA 1EJSC 3AI0A 4TTUA 1N8WA 4GQGA 1V02E 3OIHA 5FL1A 2J7DA 3CZ8A 1EOKA 1D7FA 5SWUA 5C9XA 3M7WA 1FWDC 4CN1A 4DJDD 4RXFA 2RFGA 4DF1A 1FOBA 3B97A 4GYPC 2XWEA 3HF3A 1GQKA 4TUFA 3OB8A 3UWQA 3WLSA 3ABRA 2CITA 2V9DA 1D3GA 5CBBA 3ANYA 4R7JA 1ISXA 1D8WA 3BSGA 5AC4A 2YKKA 2VMFA 4O1AA 5BZAA 4Q32A 4O16A 1X8FA 3L4XA 4AF0B 3VD3A 4F9DA 1EJVC 1E4LA 4GBDA 1X8CA 2YW4A 4HMDA 4MKVA 5I3KA 3HGJA 1KRCC 2Y61A 4UOZA 1O5XA 3LERA 2OMAA 2RJGA 2WAGA 5LA0A 2Y70A 3VMNA 1EJTC 2E7FA 3TH6A 2V3EA 4ZA0A 1GQIA 3G1SA 1QVBA 3IJ7A 5D04C 3QQ1A 4BF5A 4ECLA 1VHCA 1WUEA 2L5HA 3VKKA 5IBXC 1J18A 3QJAA 4RE0A 1B1YA 3VDCA 3TC3A 1TJPA 2QZRA 4OOUA 5ABEA 1J5TA 4J3WA 3CWHA 2HZGA 1BWLA 3CEUA 4GIYA 4L4LA 4IF2A 4FX6M 1G4PA 4K1GA 2VJXA 4C6NA 2EPNA 3PY2A 5DT7A 2ZXBA 3K8KA 2QAPA 3KL3A 2PDJA 2QCDA 2Y4SA 3PZOA 4NZ1A 4PUWA 1ME9A 3BPWA 2OZ8A 3PZQA 1L6FA 5MKGB 1BAGA 3PP7A 4C6IA 4JHMA 4MIMA 1B5TA 3VI2A 1B90A 2A5HA 5AOUA 2X0YA 1V3MA 3GG1A 4NJJA 2VFFA 1UMLA 4HCDA 4P7QA 3TR9A 3IGHX 3TTSA 4HHLA 3T0DA 4ZOCA 3TCSA 2OPJA 2QCCA 2QCLA 1CGWA 2Z1XA 2GQAA 3W83A 2WWDA 5EBUA 4OIFA 5LNWA 2HS8A 3CMGA 3NQ8A 4WCJA 1IGSA 6REQA 2VQUA 3CU2A 3HJZA 3B05A 2PZ0A 3PJUA 5K9CA 3LNPA 4DF0A 4QG8A 3ZT7A 1CGTA 4YTRA 3E74A 1KO0A 5G1MA 3DBPA 5C0QA 2I5QA 1BD0A 4AQLA 3GFXA 3C0QA 2OSWA 3GZ3A 1QNPA 3TU9A 3VPLA 2WLZA 1H5VA 3DOPA 5CGTA 3RG6A 1LLWA 1CYGA 4DJDA 4LBUA 5CPTA 4ZVJA 1J4EA 3KS6A 4CQDA 3QKEA 4D1IA 4H00A 4H9TA 3LV6A 4G7EA 3AAMA 3PZNA 1VIWA 1SU5A 3Q67A 3CUFA 2HJPA 5T91A 3BAYA 1XFBA 2AQVA 3UA3A 1VFSA 3IAQA 3AALA 3UGVA 5L6UA 1E0UA 1BQGA 1XCWA 2EHHA 4FI4A 2OLSA 1VP5A 1W1YA 5FAGA 1OC6A 4IPLA 4V27A 1ZGDA 3INPA 3CNYA 1GKPA 4H8HA 4ORIA 2DH2A 3HQPA 2Z25A 4L6OA 5DMLA 4OV9A 3BE7A 1RCQA 3UFYA 1UP3A 3MCMA 3THAA 4WD0A 2W4XA 3HG5A 3TFCA 2XINA 1S2TA 4ONVA 3URAA 3M16A 2DZBA 4H01A 2CETA 1VRDA 3S2LA 1REQA 1W1A1 3C86A 2ZVRA 3VNIA 3RMEA 4F40A 1V3LA 3IJ9A 1JZ4A 1VFMA 4OU1A 3MWCA 4K1WA 3W81A 3NEVA 2HXTA 4DZAA 1XLAA 4E6MA 3THUA 1SJAA 2PDCA 2DSWA 2E8YA 1F3XA 4M7SA 2DPEA 2WW5A 3KL5A 1UC4A 4XIAA 3RK8A 2OODA 2ISDA 1DJQA 1UZHA 3L5MA 3USZA 4Q8PA 2VX7A 4MUPA 4W87A 1JPIA 4J3VA 3GUWA 3MCNA 3RM4A 3TROA 4RW3A 4IP5A 1XH1A 1WA3A 4AWTA 1VFOA 1XYZA 5BCAA 1TKKA 3V5FA 3ARSA 3LSBA 2PC4A 1F9CA 4MG4A 3VO0A 4KFPA 4RZ5A 3T8QA 1W37A 4MVAA 3BW2A 5CG7A 3PPHA 2DH3A 1K8XA 1KTBA 1CIUA 3IUDA 5REQB 3H2OA 2PF8A 1R3SA 2Z7KA 2D2JA 5CAHA 2WMKA 1IHIA 3M9YA 2Y88A 2UY5A 4PCNA 4XZMX 1DJGA 3CV6A 1R5YA 3R13A 4AX6A 3AMGA 4X0VA 4RE4A 3M0JA 1G0CA 3S4TA 4AISA 4K8HA 2J7BA 3TLLA 3NL3A 3MSGA 4W7UA 2CYGA 3C2YA 1IXQA 2IW0A 2B81A 4X2PA 1Q63A 4NJHA 2WZMA 1L6YA 1RLDA 3DDMA 1NU5A 3O9NA 5E1QA 4HA3A 2ZX7A 2WANA 1FCBA 4K38A 1PZ3A 4P8UA 4JOMA 2RDTA 4KT2A 3VKDA 2XUCA 3MY9A 4F2TA 2Z2UA 3CH9A 4ZQCA 4J3SA 3UQNA 4S3JA 4GY0A 1Q7MA 1SM9A 1PSCA 4Q6XA 1Y65A 1P6CA 2GVJA 1MO0A 4F8XA 5FEPA 4YYCA 4A8LA 4R5EA 3KOWA 2VEFA 3WYZA 3HB9A 1H1ZA 3WMLA 2HBXA 3PJTA 2ZUSA 3GG8A 4KERA 4FZIA 4TX8A 3SCNA 3QHMA 4GA8A 1UH2A 1DWGM 2WHJA 1J6PA 1OY0A 2DZAA 1UIOA 9XIAA 4JTHA 1R6WA 3M6DA 3KTCA 2WMGA 1S46A 1GOXA 2GGJA 4S3EA 2HE5A 1OD0A 1K7FA 1VCGA 5FEWA 4LUSA 3URBA 9RUBA 3HGOA 3GTHA 1HGYA 1VFLA 3B8IA 3N29A 2CU0A 3ARYA 4LT9A 2EJ1A 2NUYA 4YVPA 3KCJA 1GKRA 1WBHA 3HG4A 2JKAA 2FHCA 4DJED 3P3BA 5CGMA 1X1OA 2OKTA 3DH7A 4Y8FA 2P50A 1QNSA 4GXWA 3R5EA 2HSAA 3V5CA 3P84A 2GLKA 4B5NA 2XTKA 1W54A 5GNYA 4FOKA 1WDWA 1A50A 1VLWA 2CBIA 3EB3A 2NX9A 4QROA 1XLDA 4YTQA 2J27A 5DY2A 3GVWA 3NR0A 4HNNA 4KRZA 4Q8WA 3TMQA 1TREA 5G2IA 1RH9A 3BSMA 3K4DA 4ADTA 2A3LA 1BKSA 1NARA 3PF3A 2ZFAA 4HYWA 1U33A 3CPRA 1VJSA 2ZXAA 1PDZA 1A5CA 3A9IA 4XD6A 1JQXA 4EPKA 3HA1A 3BG5A 3SCPA 4ROPA 1K70A 3H4XA 3R0KA 3TEVA 4ES4A 1DXIA 3WLRA 3EGJA 2D1ZA 3WJXA 1HX0A 1SO6A 1GZGA 1MW2A 3LGDA 1OJXA 4X9SA 4LVDA 3WEOA 1Q8AA 2IPFA 3NZGA 2WVVA 2GDVA 3GE7A 1BPLB 8A3HA 4TMBA 4L80A 1XYFA 4GJJA 4S39A 3WH6A 4R53A 4UFLA 3WD3A 1QOQA 2BX7A 3TYZA 3H24A 4D6GA 5LA2A 5JH2A 3HFTA 1UKTA 4PB3A 4IH3A 2BY3A 4TVDA 5C9WA 2F84A 2X1IA 1T40A 1S3HA 4Y9PA 3U5UA 4AD3A 3WMBA 1TMQA 4NX0A 4QLKA 4ZEPA 1KD0A 3HQ1A 1EYEA 1OCBA 3F2BA 2QW5A 2EGZA 1TYGA 2WC4A 3MB9A 4XISA 2OX4A 4O4VA 3DFYA 3VNKA 3JR2A 3W07A 5BYWA 3FCPA 3WQOA 3QYSA 4JY9A 1BTMA 3R89A 3SUSA 1XIMA 2R9RA 2Y6ZA 2CNCA 2EXOA 3BV4A 4AZIA 4OT7A 4HA1A 2YXGA 4GZEA 2BV9A 4PA8A 1H51A 2ALDA 1TZZA 3PFRA 5A6MA 2WHKA 4FIQA 1FCQA 4BF9A 1MXGA 3ELFA 5DMMA 4IL0A 3WUEA 3WLKX 3W7JA 4AB4A 2FDMA 4M3PA 3W2JA 3NQGA 4LANA 5CSYA 2QS8A 3VIGA 1RV8A 1GYNA 2EEXA 1IT0A 3GY1A 1T41A 4FXSA 1XRTA 2DSZA 4JTIA 4OE7A 1GG1A 4I7WA 1TO3A 3QQ0A 3BGAA 4M6UA 4Z2IA 4UR9A 1LUCA 4V15A 1TRIA 1R86A 4H8UA 3W6YA 5A3HA 2NQJA 4LV9A 2ZWZA 4KEVA 4LH8A 1XC6A 1MDRA 3CUJA 3PG9A 4DJFC 3UY8A 3DC0A 4IPIA 3VGGA 1UUQA 5AC6A 4XWUA 2ZZ7A 3MA8A 3PUOA 2PDKA 3SCOA 3W7DA 1DV7A 2PRHA 4XAGA 4IMDA 1OK4A 4B2DA 1SFTA 4KF1A 4Q8UA 3HN3A 3WQ4A 3CYVA 5A94A 1TVLA 2V5BA 2YLAA 1GUVA 2C1GA 4JIHA 5AY7A 1YE4A 3VGFA 2PUZA 2F7FA 2FIQA 6PTDA 4D6HA 3C3NA 3T0BA 4IJRA 3C61A 1LQ2A 4L4MA 3QN3A 1SJCA 1E70M 2VVSA 4K7YA 3HV9A 1SPQA 3M6YA 3CO8A 1R3WA 3O2LA 2VX6A 3A4WA 3D47A 3H21A 1V7YA 3TOYA 1AH4A 4IXHA 4GZIA 3OGSA 1ECQA 5HPCA 2OYKA 4MJZA 4RNHA 5TNVA 3FAXA 4I5UA 3EXSA 2GFTA 1U22A 1K6WA 3EWCA 3M0KA 2P88A 3MMWA 4D8LA 5D02A 3DFTA 7XIMA 3N3TA 2IKGA 3O6AA 4KEZA 5CPSA 1O4UA 4KEUA 1ZCCA 4URIA 3I4EA 2HCVA 2NXIA 5F7UA 3RHGA 3CASA 3H2NA 1MNSA 2D0GA 1R7AA 3H12A 4XO6A 1TA3A 2HMCA 3SQLA 1E1EA 2C8NA 3GDBA 2ZRWA 1A5SA 1XRFA 1H2JA 5DX7A 3OPSA 3FYPA 2PTDA 1V08A 5EMJA 4LGXA 2PCEA 1GVSA 1ISVA 4HMEA 2EF9A 4GACA 3UG4A 1J0KA 1OC7A 1RPXA 3QTGA 3ARTA 4I7VA 4RZ4A 4ZXLA 2CZVA 4QJ1A 4JAWA 3TMLA 1QAPA 4LW7A 2VELA 4Q4KA 1ZTVA 4EF9A 3RILA 2PLJA 2FGLA 5I78A 3O63A 2GGIA 3UT0A 3R94A 3TN3A 2PWVA 1RD5A 4ATLA 3TIMA 3W73A 1E73M 1M68A 3DI1A 1QO2A 2WNWA 3EWYA 2ZX5A 4AIOA 3CHCA 4F9JA 1OX4A 2A3AA 4BR1A 1OFRA 2PWDA 2BWGA 2CZEA 2WMIB 3REQA 3DESA 5LZLA 5DT5A 3N9KA 2BBFA 2XFRA 4A3RA 1E43A 2VHLA 4H4IA 2VRJA 3K4AA 2O4QA 2MNRA 2DEPA 4M51A 2WM0A 2GJNA 5DN1A 1B3VA 1KM0A 4GOAA 4FNUA 2VFHA 1GYLA 1AMKA 1UD5A 4ZFMA 4KWOA 4NAEB 4IGSA 3MHUA 3ZM8A 3VDHA 3WDPP 4O1DA 2FGBA 1JYNA 3LD5A 2QDGA 1IQ8A 1HL9A 4LF2A 4K36A 1H11A 3B3DA 4GJIA 1ZHAA 3EDFA 1XLHA 4MWAB 4RUBA 4FLSA 2QCMA 4GFSA 3PSVA 2YA0A 3FN9A 1TQJA 5I5RA 1S2AA 3E3HA 2FVKA 3FA4A 3NGFA 1DPMA 2OFJA 1YXCA 1E6NA 1AA1B 4UFMA 3TTYA 3WENA 2EG8A 3S6OA 1TRDA 3W7KA 1C9DA 3QMTA 4LCRA 5BU6A 1TWSA 3AS2A 2WSPA 4Z1BA 1NOWA 1VJZA 2C0AA 4LVGA 2DSVA 4JFSA 1CXFA 4WGHA 3UZYA 1FWTA 3FYOA 3G0SA 3GNOA 4QG6A 2P0OA 2ABAA 1ZRQA 2I9UA 4NZFA 3UP8A 1ALDA 1ZUAX 5HR7A 1N55A 4MAZA 4ZMGA 1JPHA 1PKLA 2EPLX 4O0ZA 2A21A 3HIJA 3QGVA 1CXKA 4XBJA 5A1AA 1AQ0A 1TCDA 4RZ6A 1P7TA 2AL2B 4ZBCA 4Q4QA 5G1YA 2IS7A 4B92A 4AZGA 2D3NA 1XICA 5K4ZA 5DRCA 3GC4A 4EVZA 5IDZA 4GH1A 2PWFA 3CZLA 1DVJA 4O11A 4QTGA 2DVTA 3IUHA 1QNRA 4IPPA 4W85A 3ARPA 2YXOA 1TPH1 4MYXA 4C6QA 4HU0A 3N2BA 3L65A 1F2JA 2ACSA 3T55A 4RX0A 1X96A 3F7JA 4MLRA 1ITQA 2V6AA 4LUTB 4BF7A 1SZGA 3CTTA 4PSPA 1WV2A 2F2KA 4HPNA 3MCOA 2ZZ2A 1MSSA 3ES8A 3AXHA 1JAKA 1NAL1 1AL8A 1K03A 2GJXB 4BQ5A 3WNKA 4FALA 5EFDA 1QK0A 1R3QA 3DI0A 2OEMA 5XIMA 2E9LA 1BVWA 1KLYA 4IFOA 5DCBA 4D6FA 1GT8A 2QGYA 3KVLA 1KV5A 4Y2WA 3SY8A 3H2FA 3GXMA 3DFPA 4WK9A 3WELA 3GDKA 4O1EA 4R9XA 4UR8A 4MWAC 5MF5A 3B9AA 1Q6DA 1XSKA 4A3HA 4GUFA 3OBEA 2Z2AA 1FWEC 1O95A 3A4XA 1X7IA 4CCDA 5BRPA 5CQ1A 3BQ5A 3A6OA 1UR1A 3F4VA 4MJ4A 3P5YA 3GTNA 1TX2A 3ZSSA 1VBUA 1XDMA 2ISFA 4GVHA 3N6HA 5BWFA 4F2BA 5CSRA 5PTDA 2ZX6A 4JFUA 3L12A 1W1ZA 3SB0A 1TWWA 4U31A 1M5WA 3H70A 1CLXA 3B9EA 1NDZA 2P76A 3N1AA 1N7KA 3UG5A 1MQQA 3E5BA 2QIIA 3MMTA 2FPTA 4DUVA 1EEXA 3GR8A 4FLOA 4YTTA 4GYPA 3E0FA 1UR9A 2WWCA 1E9ZB 4JN6A 4O14A 4J5NA 4MTVA 1AQHA 1Q6EA 4B5SA 1C8QA 1XX1A 2WM1A 3GFZA 1AD4A 5I3HA 1UR3M 2VGBA 4NNAA 2I14A 3GFYA 5FF4A 4NKCA 1BGGA 4GXPA 3O8AA 3QV7A 4S23A 1WZAA 5TQLA 1PYFA 2FDSA 1KWKA 5KZ6A 4IFKA 7ODCA 4J2PA 3ZWSA 3NIYA 3G6LA 3OLDA 4US5D 1NY1A 5HJLA 4BJHA 3BWWA 3QM3A 5LGZA 4MMWA 2VM8A 4PUJA 2YDQA 3H2MA 5IBXA 3N18A 3VKJA 3AZTA 1XG3A 2HV5A 1XIDA 1H7OA 4B15A 4N6EA 2CLIA 3HZ3A 1KFCA 1KR1A 3CTLA 4TXEA 4D9PA 1EHAA 4NAFB 1WXZA 1XP3A 4OBSA 3SAZA 1EZ2A 1N82A 2YCJA 4UTWC 4NYUA 4Z2LA 2DT0A 3V7PA 4BI7A 1EBHA 1PZ1A 5MHBA 5CC5A 1V03A 1JZ8A 1MI3A 4BQ4A 3UJ2A 1RLCL 2WSRA 4MFEA 3W3OA 3R8GA 2Z00A 2FZBA 4A29A 1RA5A 1TE6A 3DG3A 2ZRXA 2CBUA 2DZSA 1OG0A 1WXJA 1Q4WA 1JD9A 4L9XA 4JTFA 2GQ8A 3B0VC 3MVIA 5CJNA 3RCYA 1C90A 1JAEA 5LYRA 2NV2A 2QJGA 3BZGA 5I2UA 4ZE4A 4X3ZA 2HWGA 1GPWA 3QEZA 1TPUA 1VYRA 1XDJA 1ITUA 3FOKA 4MB4A 2Q6ZA 3LHYA 1YNPA 2PI6A 2Y8VA 1PYMA 3ZSTA 1LLOA 3UR7A 3VDAA 3GHRA 4J28A 3RX2A 3V0SA 1KCLA 4TQTA 3L4ZA 4CQ9A 1W8SA 2A2IA 2OR2A 2ISSA 5K3VA 3IIPA 4REQA 4ZQOA 4CQ8A 5IHRA 4K8EA 3ENLA 3IJDA 1VH7A 3MJYA 1JCYA 3KDOA 3PJXA 4RNIA 3OG3A 4U2ZA 4HNOA 4HZMA 4NILA 1BVZA 1JUKA 1L2UA 4L5ZA 1RPKA 4JL2A 3LLFA 4NZ4A 3VOGA 5G2WA 1VRXA 1FDJA 2WOQA 4QQ3A 4V1YA 2BNJA 3GVQA 1HJWA 4YL2A 1ZJBA 2XPKA 2PDYA 3G1XA 2VD9A 3AU6A 5AFDA 4GNKB 1XYCA 4AF0A 4GC4A 3VOHA 1ZBVA 1UASA 2PEVA 5CCZA 1J10A 1XRVA 4CLMA 1HXJA 2XFYA 5CPLA 3SGGA 4LNCA 1NVMA 1S2UA 2CERA 1K7EA 4Q7IA 3I68A 1G67A 4QE4A 4M7TA 4ZCWA 3NGJA 4UZUA 2PBOA 2VURA 2J88A 4KWSA 1ADSA 1TELA 2Y7FA 3CT7A 4YU1A 3I6EA 4PB5A 2IKHA 3VM5A 1JPKA 3SDOA 1W5NA 5CZSA 1QW7A 2XJ7A 3LK6A 1WZKA 4JTSA 3OQEA 4US5A 3NQEA 5EFFA 3MBFA 4UTTC 5FF3A 4N9DA 4KCTA 3GNXA 3A64A 5AC8A 1PAMA 2CWXA 1OIFA 3VIMA 2X05A 3NEHA 4C6BA 1RUSA 1XIIA 4GMEA 2B31A 3EPOA 4JIIX 2VEMA 4GVFA 1DTNA 2PLMA 2QULA 4FF5A 4NHVA 2I57A 1FDZA 2GPTA 1GCYA 5AC7A 2DORA 3F4NA 2D0HA 2F6KA 2FGZA 1RY0A 5XIAA 5A6BD 3GXTA 3FHAA 4P8VA 4TVUA 3N2TA 5J04A 3K13A 3W7GA 3BANA 2Z1SA 4FO4A 4G2DA 3ONCA 4S3CA 3P5ZA 1TIMA 3T40A 2QF7A 4O8AA 1V0KA 4EOUA 3M5XA 4TIMA 1CGXA 3GHTA 4JYFA 1GOQA 1QW9A 1SZEA 3L0NA 3PB0A 2UV8G 2INFA 2XVKA 4U4MA 3HQOA 3CUZA 4P2VA 5EMKA 2TRSA 1W56A 1TPVA 1NDVA 1KFKA 4NZ5A 1MEHA 4B5TA 1VPQA 2CZDA 1ZAJA 1XJBA 2IXVA 2Z6JA 4S38A 4C6JA 1F5ZA 3U48A 5RUBA 4JTLA 1UKPA 2ZDSA 1TVNA 4HK5A 4GVGA 3DHUA 5IFTA 1TUFA 3T81A 1VCFA 3B03A 2CHOA 2CLLA 3ITCA 3CS2A 2QUNA 1CZ1A 2OT1A 1EH9A 4B5WA 4EACA 2FPYA 2HISA 1BWVA 3HQNA 1Z7AA 1RBOB 3W82A 1E3XA 4IMAA 2BZNA 3M5ZA 2WBKA 5FEXA 3EAUA 4LAKA 4KMQA 3MP5A 3LRMA 4C91A 1E5NA 1D3CA 3VMOA 1XDLA 5ECVA 3TX9A 4MY9A 2PGWA 2P0IA 1KNWA 4I8YA 1V6UA 1YLVA 1Z32X 3UU0A 4P7RA 5HUOA 8RUCA 3ABOA 3NQBA 1S1RA 1Z42A 3TJLA 2F6UA 1WX0A 1GZ1A 1GZJA 3W7CA 3E38A 3T6CA 3KLLA 4V1XA 3MTWA 3BTNA 3H2EA 3U6WA 4R9OA 3M41A 3MQTA 4AU0A 3TCEA 4P5UA 4B4HA 1MW0A 3M07A 3OZPA 4XO7A 2CLHA 3L2MA 1GOWA 2BXVA 3L0KA 4QS6A 2NWRA 3VXGA 3WQGA 3BGGA 3AIRA 3T44A 3HPZA 9CGTA 1K9TA 3NDZA 1E4MM 1PV8A 2ZWYA 3BJFA 4JTRA 3E1F1 4CD5A 3CWOX 2CC0A 5DFAA 2WJDA 2J74A 4FHAA 4GFIA 4O10A 1UR8A 1C7TA 2WCAA 2VENA 1JR1A 2QJJA 1OD8A 1YNYA 4N7QA 5TAOA 4A3QA 1QTWA 5D32A 1GNXA 2JE8A 4BI6A 2X1RA 3FA3A 1O68A 1S39A 1YXYA 4JN7A 1Z89A 1NIUA 3MMUA 2PTZA 4UTHA 3POCA 3LGGA 1E0VA 2CLEA 3GXIA 2D2OA 1QR7A 5ABFB 4Q7BA 1YTEA 2PDFA 3OGVA 1W3LA 2QJHA 3PUGA 4JFTA 2FHBA 4Q4MA 1HKJA 1NOFA 2UY4A 4JL1A 3RJYA 2O56A 3OGRA 4AHPA 5REQA 1CECA 1YXDA 2AL1A 2XVNA 2XHYA 1DQUA 1XGEA 2BXYA 3LMZA 1WAUA 2OQLA 2BHUA 2E3ZA 4FXJA 1KWGA 2OQHA 1J2BA 1A80A 5EB8A 2YSWA 1MZHA 3CAQA 5FJTA 1N2VA 4L9YA 1UKOA 1U2YA 3RYSA 1V3KA 1OM0A 4CNUA 4JR5A 1XBVA 1G4EA 2Z24A 2A85A 1HO4A 1OX6A 2OZTA 2FFIA 3UCQA 5JBEA 1KM6A 2HEJA 1W9BM 3PBMA 3S5ZA 1P0DA 1FH9A 3K1DA 4DUOA 1JPDX 4O0KA 2WKLA 2OZ3A 1J0IA 3LENA 3CV1A 4OBTA 2JGYA 3OVQA 1LWIA 2J7GA 1K02A 2C3ZA 3UPBA 3ZO9A 4I6KA 4PTMA 1KM5A 1W9UA 2OQYA 4Z2GA 4M29A 3TK7A 3DYPA 1RA0A 1OX5A 1Y7VA 3TQPA 4BA0A 3QY6A 2E0PA 2J7EA 1DQWA 3ANUA 3KRBA 1UCWA 3ZZ1A 1A3XA 3CJPA 2PAJA 2DZPA 2W9MA 3EDDA 4WHBA 4X2RA 4U28A 2CZ5A 1Z48A 3DCPA 4J35A 2OG9A 3WD2A 2OX1A 4O1BA 1W5OA 2WCSA 2C1IA 1GJUA 1FDYA 1MNZA 2DIEA 3G6MA 4ZOEA 5ABHA 3CQKA 2VTFA 1EDTA 3CUXA 1DWIM 1LROA 1VYSX 3BLOA 3WDHA 1EL3A 4AYGA 4ZR8A 1EGZA 4L61A 1UP0A 2Y1HA 2FTYA 3LPGA 1PTDA 2P5NA 3RU6A 3O05A 2E67A 1ML1A 1EWDA 4ADUA 2YZRA 5D09A 2NQZA 2NQ9A 4I9AA 4PUUA 3UW6A 1XLGA 4Q3MA 1RK6A 1LOQA 1EA0A 4AZBA 1DJXA 2HBVA 2W79A 3T2PA 5DQPA 3W85A 5BXPA 4JIPA 5EPDA 2DGAA 2B0MA 4KRUA 5U7SA 4AD1A 3K8MA 3G24A 4G6CA 3CB8A 3BVJA 1DHKA 4XUGA 3KCOA 3MHFA 2PTXA 4PUKA 4UOQA 2NLYA 4GUIA 3A47A 4HN8A 2WV8A 4U2YA 3OODA 3OO2A 3QLLA 3NYZA 3LN3A 1IIHA 1W0MA 5M17A 3KX6A 2ZE3A 3T0AA 8CGTA 3C52A 3D5HA 1L8NA 1O7AA 2C19A 4IIEA 4LNYA 5JU6A 4S3DA 1VC4A 3SBFA 2QLYA 4A4AA 3PAJA 3TVAA 3VIKA 1I2OA 1TPC1 2EAWA 4TX9A 1V6YA 5M5DA 1EX1A 4PMRA 1MWOA 5CH9A 3MI3A 1EXBA 5DXXA 2ZIDA 4DJFA 3VNDA 1DIKA 2OZ0A 3VGEA 1E72M 3FA5A 4C6LA 1G69A 3ZR4A 1XBXA 3GYCA 5C2GA 4H7CA 3O16A 1Z44A 3W1QA 2PP1A 3KBMA 3N34A 2X1UA 1J96A 3BICA 3Q4DA 1TV8A 4PMZA 3ZXWA 2PDNA 1QJWA 3G1HA 2VC7A 4L56A 2ADAA 4PMXA 4RE3A 4HVXA 2CLKA 4Z08A 4JIRA 2WSYA 2TAAA 1IIGA 2PA6A 4ICNA 4W7VA 3RRAA 3LPFA 3B9DA 1X1NA 4CU8A 2OCZA 2HRWA 3TJXA 2FZDA 4XZIA 4PGLA 5BOFA 3BMWA 4FNTA 1SJBA 1EJRC 2VGFA 3EWWA 2Z2BA 3S1WA 4N4QA 2J78A 4GI9A 1R3RA 4UFHA 4D6IA 1J79A 3DFNA 1UBPC 5E70A 1JQVA 1A47A 1OC5A 1AL7A 1NF0A 2I9EA 1ONWA 2W6RA 4IFRA 3ITTA 2J24A 2ASHA 1H1YA 2WPBA 4FEZA 3HV8A 3R12A 1UD6A 1I2PA 2FTPA 1RQBA 2XYLA 2EJAA 2XIOA 2ZA1A 4JQ3A 3TTOA 3MI6A 1W1TA 4HNCA 1AJZA 3F03K 2A7PA 5D2VA 3L66A 2BVTA 4PTVA 3A3HA 3DFHA 2TMDA 1HJSA 2VFEA 2UZ9A 3TWBA 3LPPA 1JFXA 3QBUA 3MT1A 3LB0A 2GK1B 4WJ8A 4HBKA 4O54A 1JDFA 1HKWA 3VU2A 4HTYA 3LCGA 1DJNA 4MB3A 1EP1A 1CXLA 4C5ZA 5A8GA 2ZC8A 3PAOA 3BOXA 3AHYA 3NQMA 4LVAA 3KAOA 4WZHA 2Y8UA 4DZIA 3RLHA 4XTDA 2QF8A 3CAWA 3NCOA 3HG2A 1QO5A 1GVOA 2CPUA 5BOEA 3PJWA 1UZ1A 2V3GA 2XWDA 1AH0A 2BOFX 3NSNA 1XM3A 1F3WA 3BZJA 3QQWA 2C16A 2PP3A 4LJ3A 3S46A 2QAFA 3TZNA 2YX0A 3TYCA 4UBPC 3ICJA 4MWAD 3A4JA 1V3HA 3ZYZA 3LX9A 5HANA 1I45A 1M41A 1BF6A 3ZJKA 5H8MA 3BURA 4DYEA 1W9PA 3S3GA 4AWSA 2P3ZA 1P5BA 2PFHA 1OFDA 4C6EA 4DXKA 3L9CA 3H6OA 3GH7A 5TD4A 2J7FA 2NV9A 2I16A 3W7MA 4AZ6A 3BLLA 4W93A 2DW6A 4YHGA 1OGGA 1FWIC 2VR4A 4CNTA 4O53A 4CD4A 1H4PA 2YW3A 1D3HA 1KXQA 3UESA 3BGJA 2FPVA 3B8DA 4O4WA 2W3ZA 3S5YA 3IACA 2OT0A 4GO8A 3AMKA 3F1QA 2V2DA 1A5AA 3G1YA 2I7GA 4KQNA 2V3FA 3VIPA 4RXGA 3EOOA 5C54A 2ACUA 4IUGA 4LRTA 2A3HA 3FVMA 1TV4A 1QASA 3UXIA 4E2BA 1ODUA 4NUWA 5HNRA 1C8YA 3B9NA 2XDFA 2DP3A 3GQYA 1CWYA 3MO7A 2DUZA 4GC3A