3WDQA

Crystal structure of beta-mannanase from a symbiotic protist of the termite reticulitermes speratus
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
330
structure length
329
Chain Sequence
QDWNISSSPVTPSPSAGAQKLYSFLVQNFQKKIISGAMTLQGGDESAQTKEPDWLQQNAGHRPALVGLDFFQTGKGEEWYYNDSRFSKQVVNGAKSYWQKGGIPALCWHWRDPSKDTDAFYSPSSGNSATQFDADQAVKSGTAENKAILQDLAVIADQLQDLRDAGVAVLWRPLHEASGKWFWWGYKGADALKKLWKIEFDYFVKERNLNNLIWVFTAGTPIEGIADWYPGDDMVDVIGMDIYATQGDHATQQDYFNQCKSIFKGRKIVAMSECGSVPEPDLAAPWSFFMPWYNNYCIPEGSNPYNSLEFWKKTMSSSLVITLDNMPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-mannanase
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Family 26 beta-Mannanase from a Symbiotic Protist of the Termite Reticulitermes speratus
pubmed doi rcsb
source organism Symbiotic protist of reticulitermes speratus
molecule tags Hydrolase
total genus 118
structure length 329
sequence length 330
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wdqA00
1CLVA 2VMFA 1C90A 4UOQA 1WDRA 2WMIA 3PZOA 3N1AA 1NARA 3WBAA 3WF0A 1DWJM 3VGGA 4J3SA 3VDCA 1GVIA 1W9VA 2FGLA 2X1IA 4ZE5A 1GHRA 3OGSA 2BVDA 4UFLA 1CGVA 4AZ6A 3WQ8A 1HKJA 1W1TA 3WEMA 3HJEA 1VFUA 1KR1A 4AISA 4LPCA 1JDAA 1SYTA 1DWIM 3U7BA 5I78A 2MANA 1W9BM 1F4HA 3N9KA 1V6YA 2CEQA 3ZSTA 1GONA 1PX8A 1KXVA 2WLZA 3VM7A 2ZX6A 3VDBA 5BXSA 4UFJA 4W7WA 4J3UA 1GQLA 4PMUA 4N42A 1EOMA 2GK1B 3CZGA 2ZUMA 4V27A 4DUWA 1G5AA 4EKJA 1E56A 5A2AA 1M53A 3O6AA 1QNSA 1JYWA 4JFWA 2G3JA 2D3LA 1QHPA 2YL8A 1V08A 1Y7VA 4M1RA 4OBSA 1VBRA 3CUHA 3VIHA 1E43A 4HZ8A 3WMBA 3GBDA 1HT6A 4FLQA 2E8ZA 4H04A 2W63A 3N18A 4PMNA 3BGAA 4E8CA 1HX0A 2XFRA 2D0FA 2F61A 3BAJA 5I77A 1JD9A 1NOWA 1PJ9A 1UH2A 4W5UA 2E8YA 4AZCA 5CPQA 1W1PA 4JCLA 4E4PA 2CIPA 2NT1A 4ZENA 3VIJA 1K9DA 3VIFA 5A6KA 1JXKA 5C70A 3DYMA 3PZMA 3NJ3A 4PEEA 2WMJA 3L4UA 4AXNA 1ODZA 4BCEA 4CVUA 4KMQA 2OYKA 1KGWA 3BCFA 1GOMA 1N82A 2E4TA 5AY7A 1QI0A 2V5CA 4YPJA 4GZEA 1J0ZA 2CCRA 1Q4NX 2J7DA 1HP4A 3WIJA 1DWHM 1TG7A 3PTKA 3SUTA 5GNXA 3WD3A 5BROA 1G1YA 2NSXA 1OM0A 3SCPA 4AD3A 3AHVA 2J7GA 3O2LA 3DHPA 2VCBA 1V3LA 4NF7A 2VVNA 2WCAA 2A3HA 1OGGA 1SFSA 2X8RA 1W9PA 1C3FA 2D0HA 1VAHA 4DWSA 4CD4A 2HISA 1BQCA 2YA2A 4D1IA 4V2XA 5DT7A 1VJSA 1R7OA 1F4AA 1OIMA 3QHOA 4D6JA 1QBAA 3D3AA 2CPUA 4UZUA 2TAAA 2EEXA 1QI2A 2O9TA 4WJXA 1CTNA 4P7OA 3SCUA 5CJ5A 3K4DA 4HOWA 2D23A 1EDGA 4PSRA 5GNZA 1KXHA 1E6PA 1W1VA 3UESA 3OA5A 1QVBA 1ZBWA 2GFTA 3SEPA 3PZ9A 1JZ4A 3DHUA 5D4YA 1R87A 1GQKA 3VGFA 2PWEA 1WO2A 1UH3A 4HOZA 4BZYA 2V3DA 4M29A 2VCAA 2WHMA 5A8QA 4D6DA 1V03A 1W3KA 1NP0A 4D6EA 1MXDA 2WM0A 4WF7A 1VRXA 1HF6A 2D0GA 3AJ7A 5KZ6A 4Z2LA 3TTQA 4XZWA 5D9MA 1E3ZA 5BCAA 1OT2A 4HPGA 4BS0A 1LL7A 1MW2A 1Q6DA 4CU7A 4WSKA 3WH9A 5AC4A 3WEZA 2W91A 1HP5A 1W1YA 1ZJBA 3AMGA 3U7VA 1V6XA 3AZSA 3APGA 1D3CA 2XUCA 3CLWA 1J12A 5M17A 4BA0A 1BYCA 1JZ2A 4CCDA 2OSYA 3LPOA 3WQ5A 3AROA 1JAEA 4IPNB 1US3A 1MWOA 2DT0A 2DH2A 4U33A 3SUUA 3IJ8A 3ZT6A 1WAWA 3WFLA 1PZ3A 3M07A 4JFUA 3D5HA 4Q7NA 4NRSA 1E3XA 3AYSA 4M81A 3B8SA 2AOSA 1R86A 1XSJA 3EMQA 4OUEA 1BGAA 4TVDA 5I24A 3AOFA 4U3CA 1MFUA 1WZKA 3WQWA 4N0RA 2OSWA 6TAAA 1KXTA 2WBKA 4U2YA 4BQ2A 1UKQA 1FFQA 1XHGA 1HJXA 1EHNA 3GH5A 1JNEA 3F5LA 2YDQA 2GJXB 3M7SA 3WDIA 3WL1A 5A8NA 1UWIA 3BC9A 3KL0A 2FH6A 4UOJA 3RIKA 3W4RA 5FOOA 7CGTA 3KL3A 1XGZA 1CGYA 1PX3A 3F5JA 1RPKA 2ZUVA 4CVWA 3WL0A 1ISXA 5CQ1A 3BMWA 2PI6A 3MSDA 5DF0A 2Y4SA 5FKYA 4LYRA 4ML4A 5I2UA 3HN3A 5E70A 2ZX7A 3WD0A 2OYMA 1CDGA 1FH9A 2ZXAA 4MAVA 4PMVA 3VOCA 1E9LA 2ZUWA 1W3HA 1AQHA 3QGVA 3NIYA 4LYPA 3WENA 5C8BB 4OIFA 1BVNP 3ZJ6A 3PZNA 2VZSA 3VM5A 4NRRA 1XC6A 3VUPA 3AXXA 2ZXDA 3VVGA 2ZXQA 4UFMA 2XPKA 4GIAA 3S6TA 1CGUA 4QLKA 5TD4A 1JYXA 3J7HA 3OZOA 8A3HA 1KB3A 1DWGM 2VOTA 3W82A 1W2VA 3CIVA 1VIWA 5A6BD 2YBUA 2VRQA 3CZJA 4PMQA 3AZTA 5I79A 3WNNA 5D9PA 1PEZA 2CXGA 2JIEA 1QHOA 1KGXA 3ZM8A 2UY5A 3HU7A 2DSUA 3QHNA 2WMFA 1KGUA 4HU0A 1UWUA 2ZE0A 2ZWYA 1OB0A 3UETA 4D6HA 4MB4A 1VEPA 2UWFA 1VFOA 1RP8A 5FD0A 3CUGA 2JIWA 4BQ3A 1NWRA 2YKKA 1EO7A 1R8LA 3GDBA 3VD9A 1E4NA 3VD4A 1CLXA 3MMUA 1FHDA 4M56A 1FA2A 1CGXA 4IPLA 2Y8KA 3B9EA 3UR7A 1JD7A 1E6QM 6A3HA 4UQBA 1QNRA 2WPGA 3W38A 4PUEA 3M46A 3CHCA 4HMDA 2XSBA 1QI4A 1OIFA 3FY1A 3I3DA 3AYRA 1UWTA 4PMZA 3E1F1 1H1NA 1EHAA 5BRQA 5C71A 1KWGA 4BF7A 3MUZ1 1HJQA 2J7EA 2JFEX 1G0CA 1E6XM 1CXEA 3ZOAA 1OGBA 4GZIA 2VL4A 4EANA 1H5VA 4GO9A 3VO0A 1XD1A 1X1NA 2IXVA 2GJPA 2G4FA 3WNKA 1UR0A 4HMEA 2EPKX 2QMKA 4W84A 1WDQA 4MNJA 5BWFA 4Z2HA 1KQYA 2ZUNA 2VO5A 4XB3A 4P7RA 3T08A 1EDTA 4P8WA 4B16A 3WUFA 3ARPA 1MW1A 1UA3A 3DYOA 2XWEA 4U5KA 3VX1A 4DUVA 3FW6A 2ZICA 3WDPP 7TAAA 1Q6EA 3CUFA 2DQXA 1CXIA 5DFAA 4C7FA 4GQRA 5IFTA 4CKQA 1GQIA 3ZR5A 2UY4A 2F8QA 4CUCA 4W8AA 3ARQA 5EMYA 4PRWA 3BSHA 4URIA 5CSUA 5D8WA 2WYSA 4B9ZA 2E9BA 1OWQA 2RGLA 2CESA 2Y24A 1BGGA 1V02A 3SCSA 1JZ3A 1V02E 2F2HA 3PZTA 1V3MA 2QV4A 4GXPA 4ATLA 3CHEA 3OB8A 1PX4A 3SCOA 3VMOA 3ZJ7A 2G3MA 1M03A 1XD0A 3A47A 1ISYA 2WXDM 4FK9A 1EA9C 3BCDA 4Z2GA 1BG9A 3A4WA 1HJWA 1UR4A 3K46A 3WD1A 3GBEA 3U57A 3PTMA 4J3TA 4CCEA 4IM4A 3EBVA 3SIMA 1V3IA 4MB5A 5CGTA 2VC9A 2WHKA 1MQRA 4TX8A 3MUIA 1FP8A 1GOQA 1JGIA 4W88A 3CMJA 3T09A 4F79A 2VURA 1ECEA 4MB3A 3VX0A 1UZ1A 2XVGA 5ABFA 1FH8A 3DECA 1VEOA 3SCVA 1CGTA 3POCA 1JZ6A 3NDZA 4EK7A 2XM1A 3K8KA 4UR9A 2WBGA 2O9RA 1ISWA 3UCQA 3OBAA 3WF1A 3ZO9A 5A3HA 3N13A 5D8ZA 1BG4A 1E15A 1TVPA 3WDHA 4MTVA 2BY0A 3K4AA 2D2OA 4PMDA 1V0KA 4AW7A 1OT1A 2WLYA 3ZT5A 1J9YA 2VR4A 1S46A 2XFFA 1VFMA 2W61A 5EBAA 3LMYA 1JAKA 4MADA 1E1EA 2BHZA 3N15A 4AD2A 1JDDA 3PZIA 5HXMA 2PBOA 2GDUA 1WE5A 4PCSA 1JZ5A 1UQYA 5EFDA 2XM2A 1XCWA 1UR2A 3KEHA 5E09A 4CCCA 1PAMA 2EJ1A 2XHYA 3F5KA 4CD5A 4R27A 1V0LA 4M82A 4UOZA 1GORA 2AMGA 4L4OA 3THDA 3EMCA 4J7RA 3VIMA 2BNJA 4HMCA 3MUY1 3B9AA 4PBGA 5JBEA 4M24A 3WNMA 4LYQA 1W9UA 1E0XA 2WZIA 2X0HA 1JYVA 4FMVA 4AD5A 3TA9A 4H8UA 1GVYA 1US2A 3EDJA 3LPPA 4W86A 2PWGA 2XFYA 1E5NA 2WC3A 4YHEA 3WUEA 2ZUSA 4HA1A 3VIKA 1WNOA 5A69A 1JF5A 4M8UA 1M04A 3WQVA 2CKRA 3U5UA 1UD4A 4H8VA 2Z1KA 3MSGA 2NW0A 1XYFA 1CGWA 3WUBA 4A4AA 2J7CA 4D1JA 1CPUA 2G3NA 4F9DA 3GXDA 3W27A 4S3KA 1TA3B 1W9XA 3G6MA 4A3YA 4MJ2A 3BH4A 4CN4A 4KRTA 1J0YA 5AYBA 4OBRA 4W93A 3BXWA 4AD1A 2O92A 1ITCA 1K6AA 4PCTA 5I0DA 2CERA 3ZQ9A 3O9NA 2QPSA 1U33A 2J78A 4ZXLA 2EPNA 1XH0A 5EFFA 4EAMA 4GZJA 1E71M 3ZR6A 5AYIA 4ACZB 1FFRA 3OZPA 2GUYA 3IAPA 2Y5EA 1VENA 2BXZA 1C92A 1WZAA 2A3EA 2BXYA 4JCMA 2DGAA 3CZKA 1JXJA 2WK2A 2WSKA 3L4XA 2VRJA 3VNZA 2XGIA 1HJVA 2VZVA 4E8DA 2XVPA 4W8LA 1B30A 1GHSA 4PTVA 3OLDA 3WBEA 1MXGA 1HIZA 4JL2A 3II1A 3QR3A 1E73M 3AIQA 5JIPA 4HP5A 3WF2A 3ARYA 4UQCA 4M80A 3KE0A 5A6BA 3WKZA 2JEQA 4QCFA 3WMCA 1CWYA 1J11A 4LQ1A 4OOZA 3N17A 1CXHA 1ZBCA 3SCWA 5I3DA 1UZ4A 1QW9A 3OLIA 4HTYA 2CHOA 2W4XA 4V28A 4CU8A 4D72A 2XSAA 2OWXA 1AQMA 1C8XA 4H7VA 3WD4A 5M3WA 2YBTA 3VGDA 3QHMA 3PZUA 4HA3A 1VBUA 1OBAA 2JALA 2XGBA 2E9LA 1OD8A 2UY3A 3TTYA 2YL5A 3GYCA 1UYQA 1XSIA 2XWDA 1MW3A 1J0IA 2J25A 1LL6A 2WVVB 9CGTA 4KH2A 2DSVA 2VRKA 3AS1A 3WDRA 1WCGA 4OZOA 4P8UA 4CD7A 2JEPA 2D20A 1W2PA 2BVTA 2ZUUA 2HVMA 3WH8A 2ZWZA 3QOMA 3BSGA 1CYGA 4W7VA 3CHDA 4JHOA 3FNDA 1PBGA 5E0CA 4D6IA 1PPIA 1H0IA 2IXUA 4MNMA 3IJ9A 4HZ7A 4GPNA 5CG0A 4Z2KA 1B1YA 2EPOA 1CXKA 4DM2A 1UR1A 3F4VA 3AMCA 1E6NA 1C7SA 5DO8A 1QNOA 1KWKA 2ZIDA 3ZMRA 4KWUA 4JKMA 2VX6A 1JFHA 5FIPA 2WCGA 2DIEA 1E72M 1NP2A 3UG3A 2RGMA 2G3IA 3VMNA 3ALGA 1EXPA 1IT0A 1NWUA 5E0FA 1LG2A 5CZKA 1MFVA 3SCTA 4J27A 2GJRA 2WMKA 1RH9A 4D6GA 2PWDA 3IJ7A 1HKKA 1PIGA 2V3EA 3EDEA 1W9DM 4B15A 1J10A 1BFNA 1J0JA 4KRUA 1OD0A 3FAWA 3I3EA 1M01A 4PYSA 2DSKA 3WN6A 1XYZA 1VJZA 2V3GA 3W37A 2ZUTA 4U31A 4H41A 4QLLA 4R5EA 3W28A 4U3AA 3AS2A 2Y8VA 4UNIA 4D71A 1MYRA 4X0VA 3N04A 2J8FA 4JAWA 3WF3A 2XYLA 1BHGA 2GK1A 2W92A 3NYDA 5AC5A 1AMYA 3W26A 3EDFA 2WMIB 4HU8A 1H0GA 1JZ7A 5JBFA 3ZJKA 1SMAA 1IV8A 3SCRA 2FGZA 1BF2A 2JF6A 1TMQA 2VJXA 3U5YA 3PBGA 3K8LA 1WZMA 5BYWA 5DT5A 3AMLA 5DEZA 4KGJA 3MUAA 1KBBA 2E0PA 2JF7A 3AICA 3RJYA 1B2YA 1NM9A 3L2LA 2OYLA 2J75A 2XG9A 4WK9A 3RO8A 5ABEA 4YHGA 3EMZA 1ODUA 2J4GA 4JKKA 3AMKA 2YJQA 1X6LA 2CITA 1BYDA 2WC7A 1QHZA 2NT0A 2OSXA 2G8ZA 2VQUA 1ITXA 2WSPA 5HNNA 3WDJA 3N12A 1G9HA 5LA2A 3W53A 3AFBA 1K9FA 5KEZA 2A3BA 1UWSA 2PC8A 5EB8A 2WZEA 1LG1A 3POHA 3VGBA 3AISA 1ZS2A 3FAXA 1HJUA 3MO4A 1R85A 3T0BA 3CMGA 5HBFA 1DWAM 3AIBA 3AIWA 3SUWA 2J77A 1E4MM 1BAGA 2OLHA 2D24A 1UH4A 4PN2A 4BQ4A 3DYPA 3VIIA 2YLLA 1LWJA 4JFSA 4MNKA 1X6NA 4AZCB 3FHQA 2EO7A 5A8PA 1UD3A 1UWQA 4UCFA 3ARZA 5ABGA 3W6MA 5CPSA 2XIBA 1O6IA 1WB0A 2BVYA 2ZX5A 4UFHA 2DPEA 3CZLA 4P7LA 4ZFMA 1CZ1A 1MW0A 3FN9A 3WEOA 1UKOA 4XZBA 6CGTA 5D9OA 3VNYA 4XUYA 2WMHA 1NH6A 3GTNA 3GXIA 4UQ9A 3MANA 2DH3A 4UFIA 1BYAA 1ZBVA 4MAZA 5I5RA 3ZT7A 1W3JA 1MVYA 2J47A 3VMPA 1ISZA 1Q6GA 3WNOA 4ATWA 2WHLA 2QF8A 1NWTA 3PHAA 1WKYA 1XH1A 4UTFA 1LJYA 1L8NA 2DT1A 3RM9A 3W6LA 3W81A 3W29A 1JFXA 1E4LA 1E0VA 1P6WA 3VD5A 1UOKA 1E6SM 2PBGA 3RPMA 3AIVA 4DWSB 5ECUA 1UKTA 2FHFA 2JE8A 4WSJA 3RDKA 3TONA 1ISVA 1GJUA 3IAQA 5BRPA 3GXFA 1QBBA 1OGSA 1UA7A 1NQ6A 1KBKA 4JHZA 1HKIA 1JZ8A 4TUFA 4D6CA 2C7FA 2VT0A 3VIOA 4J3WA 3BLKA 3VPLA 2WKGA 2BV9A 4PMYA 4UZSA 2WKLA 2WWDA 1BTCA 3TTSA 1VF8A 5BXPA 2VI0A 1YHTA 4FF5A 1WP6A 1V6UA 1J0KA 3RCNA 3MMDA 2VZOA 3W24A 1WPCA 3AS0A 3L4WA 3PZGA 1NWSA 5JUVA 1V3KA 4CD6A 1H11A 1I1XA 4B3LA 4B9YA 4AZBA 1ZJAA 2QLYA 3RM4A 1B3YA 1J18A 3PTQA 3UG5A 1GW1A 1DTUA 1QI3A 1B3ZA 4PTMA 4GKLA 1AQ0A 2WMGA 2CKSA 3AIEA 2FH8A 5I6SA 3ALFA 2YLAA 2WHJA 1E40A 1JNDA 4PMXA 5A6SA 1ZBKA 2QMJA 1HL9A 1U2YA 2V3FA 5IHSA 4AIEA 5A6LA 5BXRA 1LL4A 3WH5A 3L4TA 4JKLA 2OWWA 1UD5A 4E2OA 2DEPA 2BHUA 4TTUA 4AZGA 4AWEA 4ZXOA 4AD0A 2CBIA 4QAWA 1WDSA 1B3WA 1CENA 1G01A 2BS9A 2DT2A 1V3HA 1PIFA 1XCXA 2ZX9A 4WKFA 2WVTA 2CBUA 1B90A 1ESWA 1B3VA 3K1DA 3GXMA 2GJXA 1UUQA 3VGHA 2UY2A 1HKMA 3L4ZA 5LYRA 2X05A 3G6LA 5HDRA 1BPLB 2WWCA 1CEOA 1FP9A 1C8YA 1TVNA 2W66A 4DM1A 2X09A 3FXYA 2YDRA 1LQ0A 1Z32X 2VX5A 1TFVA 3ARSA 4Z2JA 3A3HA 4GI9A 3NSXA 1GOIA 1CXLA 1E4IA 4MB1A 3AI0A 3WH7A 2BHYA 4Z2IA 1EGZA 2VCCA 1KQZA 2FHBA 3W0KA 1TCMA 4WKAA 4L4PA 1UQZA 1VB9A 3VU2A 1HVQA 4H8HA 7A3HA 1I75A 4D6FA 2B31A 2XJ7A 2W5FA 3GNPA 1MQPA 1GNXA 2ZXBA 1H41A 4F8XA 3NCOA 4UQAA 1KFWA 3OGVA 2X0YA 3OGRA 5HOSA 1QNPA 3VDHA 2XTKA 5A6MA 2WANA 1LWHA 1ZL1A 3N11A 4OJYA 2EBNA 3VD3A 4AYSA 3RMEA 1DP0A 1H4PA 1DWFM 3ZSSA 3JUGA 3SUSA 2DSZA 3QOKA 1E0WA 4CN1A 5A2BA 4JFTA 1HL8A 4XV0A 1GOWA 3VTRA 4GO8A 1EO5A 4Y7EA 1QW8A 1V6VA 4AIOA 5ABHA 5FL1A 5IFPA 3VKKA 4DUXA 1JI2A 1V0MA 1VEMA 4A3HA 4MNLA 3DC0A 3BAIA 3T0AA 3LPFA 5IHRA 4UFKA 1B9ZA 1CBGA 1OCQA 5A8MA 1O7AA 1XSKA 8CGTA 2QHAA 3ZJ8A 4ATDA 2V38A 4AD4A 4TVCA 4ZEPA 5LA0A 3M6DA 4AC1X 1M7XA 4TX6A 4YN5A 4JZ5A 3GZAA 2XVNA 4TVUA 1TUXA 4B3KA 3SCQA 3VILA 4PTXA 4NI3A 1ZU8A 4X9YA 5LA1A 4AIUA 4ZE4A 1UWRA 2O9PA 1V6WA 2D22A 2WNWA 1FOBA 3W25A 2DT3A 2VQTA 4U2ZA 2E9MA 1H09A 4JIEA 4P7NA 4HPHA 3OIHA 5A95A 3KL5A 1HN1A 3T2PA 2W62A 1R7AA 2WCSA 3EDKA 4TXEA 3AXIA 5D9NA 1UKSA 2YDSA 3T2OA 2BY3A 1L0PA 2VVSA 5CPTA 5CLWA 2A3AA 2G41A 1EDQA 5CGMA 2WC4A 2XVKA 3NSMA 4W5ZA 3MU7A 4U5IA 2WAGA 1GJWA 4BQ5A 2ESCA 3AHTA 1KXQA 1JG9A 1C91A 4C7DA 1DHKA 1HXJA 2DIJA 1G94A 3WNPA 1RD6A 3MV11 3NDYA 4W89A 3ARUA 5BXTA 1GUVA 1WZLA 2WVSA 4Q22A 1JIBA 3LPGA 1TE1A 4AEFA 4CGTA 4TOQA 3VDAA 5FCZA 2VTFA 3A4XA 4AZ5A 1E55A 2VZTA 1AVAA 3OLGA 2YA0A 4PTWA 4K68A 4OOUA 2Y2WA 3WUGA 4WIWA 1BVZA 3AHXA 3WMSA 3BLPX 4AEEA 1CIUA 1IZJA 4MDPA 4JFVA 2W67A 4RL3A 5GPRA 3VIGA 5A6AA 4CD8A 4QDMA 3VGEA 3VIPA 4EE9A 4LX4A 3AS3A 4P8XA 3THCA 4FLOA 2YOCA 1H2JA 1RP9A 1D2KA 1E6ZA 3WELA 2J79A 2CNCA 4W7UA 4LGXA 1UKPA 1CECA 1LLOA 2ZX8A 1C8QA 1UD8A 3L2MA 4GI6A 2Z1SA 4H2CA 4J3VA 3SUVA 4CU6A 5IXEA 3A4AA 3GH7A 5CLTA 4JL1A 1BLIA 2VX7A 3GM8A 1E6RA 1QPKA 2E40A 3T0DA 3UG4A 3TTOA 1KR0A 1EIBA 5DMYA 1NOUA 1FHLA 4PSPA 3CTTA 3BAXA 2XIIA 3NSNA 4RE3A 5FL0A 4X0NA 4HOXA 2QPUA 4QCEA 1A3HA 2WVUA 4KGLA 4UQDA 3AZRA 2CBJA 2FHCA 3BMVA 1OINA 5ABFB 1TZ7A 3CZEA 3WQ6A 2OWCA 2FDMA 1QNQA 1E1FA 4F9JA 2CBVA 1WDPA 5E6ZA 2V5DA 1W91A 1EQCA 2J7HA 3PZVA 1UR9A 2WZHA 1VFFA 1HVXA 3A6OA 3CPUA 3MMWA 1A47A 2E3ZA 4QFUA 5A8OA 3ECQA 3PN8A 1KCKA 1V3JA 2VUYA 5GQBA 4HA4A 3OG2A 1U30A 1GCYA 2VX4A 4LXFA 2EQDA 5A1AA 3L4VA 1C7TA 1E70M 1H49A 2PWHA 1QOXA 3ZIZA 2PF0A 1GOKA 1GPFA 3AXHA 1OSEA 2CETA 3CH9A 1JYNA 3BAYA 1CXFA 5E6YA 3AIRA 1DEDA 1Q6CA 4F66A 3CO4A 1EQPA 2DDXA 2YIHA 2BFGA 1D7FA 3NUKA 3WNLA 1CNVA 2J8GA 1TA3A 2D1ZA 2XVLA 1FH7A 3I3BA 2VZUA 4W85A 1B31A 3SURA 3VINA 2CYGA 3GNRA 4DWSD 5JBDA 4IISA 1UG6A 4UQEA 5E9AA 3ARVA 4QLJA 4ACZA 2YL6A 3MV01 1W3LA 2EXOA 1HNYA 5CSYA 1EH9A 1MQQA 3ARTA 3KZSA 4AY1A 3RJXA 2IUZA 3UERA 5M03A 3WF4A 1XH2A 4GINA 1SMDA 4RE2A 3BAWA 5I23A 4TTGA 1I1WA 3HMCA 1TR1A 3CHFA 1UR8A 2ZOXA 3WQ4A 3FHAA 3WD2A 1B0IA 1YQ2A 1E5JA 1UD6A 3KWXA 4QP0A 3SCNA 3T2QA 3WY1A 3AHYA 3AQUA 3EYPA 4P7QA 1LF1A 3OLEA 4J28A 2O9OA 3IANA 3AIUA 1KCLA 3MS8A 4C7GA 1H3GA 3WSUA 3CZ8A 4PMRA 2YA1A 2YL9A 4PUDA 1ZB5A 1GZJA 2J74A 1BYBA 4RE4A 2WVVA 1HJSA 4FLRA 1IZKA 4NSBA 5A94A 1B3XA 3B9DA 3GH4A 2PB1A 4NZCA 1J0HA 5CXPA 3WFZA 3GNOA 1W32A 3S2CA 1K9TA 3TOPA 1JL8A 1GOOA 3EDDA 2J7FA 1XV8A 2WW5A 2GDVA 5A6JA 4W87A 1Q6FA 2J7BA 3CBWA 3CGTA 2A3CA 1GQJA 4AZIA 2WB5A 3RILA 2CHNA 4W8BA 1JF6A 3AHZA 2C8NA 2VNCA 2BY2A 3RM8A 5GNYA 1UHVA 2EPMX 3MKKA 5JIWA 4PMOA 4P8VA 3UEQA 2GVYA 3TP4A 4HZ6A 4WLCA 2EPLX 3ARWA 4IUGA 1NOFA 4WKHA 2D3NA 1J01A 3AMDA 3CUIA 2C0HA 2DSWA 3VD7A 4DWSC 1K9EA 2X2YA 3BAKA 4MJ4A 2J62A 4AZHA 5IDIA 5F7UA 3PZQA 2AAAA 2Q8XA 3WDQA 1JDCA 4MPKA 1C93A 3ARXA 3L4YA 1JI1A 2VR5A 4OKDA 2PWFA 4AMCA 3CUJA 4CN6A 5A2CA 1SR0A 1QI5A 1V0NA 3IK2A 1BSIA 1XRVA 4ACYA 1EOKA 3ARRA 4XX6A 5HPOA 4GQQA 3K8MA 3WH6A 1PZ2A 4MDOA 1UD2A 5HPCA 4S3JA 4J3XA 5M5DA 4AZ7A 2BY1A 4FLSA 2GSJA 4GI8A 3UR8A
chains in the Genus database with same CATH superfamily
4RDYA 2VMFA 1DPMA 1U5JA 1WDRA 1YDOA 1LLZA 2WMIA 3N1AA 4YMZA 4POCA 3VGGA 1D3HA 4J3SA 3VDCA 1KRMA 1JULA 1W9VA 1VPXA 3UXKA 3OGSA 3HG5A 4EF9A 1CGVA 3LM3A 4AZ6A 3N4EA 3KHJA 2ZA3A 5AZ1A 1HKJA 1QJWA 4GISA 1LZOA 4LVDA 1UUOA 1FWGC 1XLDA 5I78A 1KO0A 1CW2A 2XFWA 1UOZA 1KXVA 3S5SA 3VM7A 3G1RA 4UFJA 4J3UA 4XBKA 2GK1B 2KX9A 3CZGA 4DUWA 1BWVA 3F2BA 1F9CA 3F4CA 4CQDA 1REQA 2GLKA 3PANA 1QHPA 2YL8A 4NG3A 3TJLA 1M9HA 1Y7VA 1M65A 1VBRA 3CUHA 3GVRA 1E43A 4FLQA 2E8ZA 3MHGA 5G4WA 3WLTA 4E8CA 2XFRA 3SJ3A 1SZNA 4PBFA 3FGCA 3JU2A 5CPQA 3P5YA 1W1PA 4JCLA 4E4PA 1BKSA 3C2FA 1K9DA 2PLMA 5A6KA 3C2OA 3FK4A 3PZMA 4IH3A 3V16A 3L4UA 4R7WA 1XLMA 3HB9A 4QG9A 1KFBA 1PDYA 3U4AA 1FBAA 3FXGA 4Q8WA 4UMAA 2CCRA 1Q4NX 2J7DA 4J4KA 3WIJA 4PCPA 3TTEA 2PDMA 3SUTA 2VWSA 3UY8A 5BROA 3M5XA 4M6UA 3EKGA 5FF2A 1K8XA 3OQ8A 3BARA 3N4FA 3O3RA 3EX3A 4KF1A 2WCAA 3UZ5A 2C18A 3TN3A 4V1YA 2C71A 3B8DA 4GYKA 1VAHA 2IQDA 4LJ3A 2HISA 2HSAA 2D2HA 1BQCA 5K4ZA 5JH1A 3S2JA 4D1IA 4V2XA 2WJZA 3V1HA 4D6JA 1QBAA 3UBPC 2IKJA 2Y7DA 3LQGA 4WJXA 2O9TA 3LLFA 1CTNA 4P7OA 5HMDA 2OMAA 2QCLA 4GUFA 1PKLA 4MF4A 3N2MA 4US5D 3S1XA 5GNZA 1VPQA 1PVNA 3BG9A 1ZBWA 2FJUB 1GVFA 2P88A 3QY7A 4ZTXA 1GQKA 4HOZA 5DY3A 3VZXA 2UV8G 2PE4A 3A24A 1R9YA 2Y63A 3HGSA 2WHMA 1SFLA 4GJ1A 3VUSA 3GSMA 1VCFA 2R1PA 3F4DA 3AJ7A 2XH4A 3LBOA 3TWBA 2NWRA 4HCHA 3W83A 3Q4DA 3CIXA 2CZ5A 4DNHA 4XZWA 1E3ZA 4HPGA 3NXFA 3E3HA 5D30A 4BS0A 1UC4A 1LL7A 1ZSXA 4WY0A 1MW2A 1WDWA 3L65A 2XGZA 2W91A 1LRTA 4H9XA 3U7VA 1W3IA 1VLWA 5M17A 1Q85A 3CQKA 4JIIX 4NI8A 4QSFA 4O17A 2ZKMX 2VEIA 3AROA 1N7KA 1XLCA 3H6OA 1US3A 2X41A 1K1DA 5AHMA 2DT0A 4LALA 3EPMA 4JFUA 4Q7NA 3R2GA 3AYSA 1GVRA 3TROA 3VFLA 1BGAA 4OE7A 3AOFA 3W2JA 1YNQA 1XBYA 3WQWA 1HGWA 1HTIA 4HNVA 1MEIA 1IIGA 3OP2A 5CCZA 3GH5A 3HIJA 4QR6A 2YDQA 5GJNA 1JCTA 2HTMA 2GJXB 4P5UA 4MWAA 3WL1A 3IGUA 3AWNA 3BC9A 3G1FA 3KL0A 3RIKA 7CGTA 3GIPA 3KL3A 2R94A 4C5YA 2P8BA 1RPKA 4IJCA 2C13A 1HL2A 3PF3A 1SO6A 4XZMX 5I2UA 5KZEA 4GK8A 3WD0A 1K3UA 4QX4A 2I17A 1CDGA 1JGMA 4PMVA 1XLKA 1ECQA 3NGFA 3MA8A 3GVGA 1BVNP 5LNUA 1Q7ZA 3DHDA 3VUPA 4M6QA 1I2OA 2ZXQA 4DHGA 4GIAA 1CGUA 4O1AA 3SAZA 2Q8ZA 4Q32A 1KB3A 1PZ0A 1HO4A 2VOTA 4FI4A 1J2WA 2PDNA 1TV2A 4HJFA 4Z1DA 2PTDA 2FMOA 4I7WA 3IRDA 1H63A 4B5NA 3KRZA 3CZJA 1IWPA 4PMQA 2NQ9A 2AL2B 2CXGA 1KGXA 2UY5A 3HU7A 4HU0A 2ZE0A 3WLJA 2ISDA 1EBHA 2PEVA 3LGGA 2UWFA 4JQ3A 1AW5A 4N2YA 1RP8A 3GR7A 4BQ3A 2YW4A 3R25A 1NWRA 2XH7A 3GHUA 3GDBA 3VD9A 3C0JA 1CLXA 4G2DA 1UMLA 2BVWA 4KFNA 1F3XA 4XAGA 2I5QA 3W7MA 3B9EA 6A3HA 3PG9A 4UQBA 5K7JA 2PDJA 3CL8A 1QNRA 5AHIA 3WQCA 3W38A 1XIGA 1A4LA 4HMDA 2XSBA 5LXXA 3LCGA 1QI4A 1OIFA 2VC6A 4MGGA 4EPKA 3I3DA 3KVKA 1AMKA 2HVNA 4PMZA 2XH0A 1MZRA 1EHAA 5BRQA 4GUIA 5C71A 4BF7A 3MUZ1 3S2MA 4GOAA 2XZ7A 3G77A 2JFEX 1G0CA 1TTQA 1E6XM 2ASHA 1TPC1 3ZOAA 5G2HA 3KWSA 4LUTA 4DB7A 3PTDA 1OGBA 4GZIA 2VL4A 3N73A 5CZTA 4GO9A 3VKDA 4RPPA 3A3XA 2IXVA 3KCOA 3MHUA 4QG8A 2D73A 1BRLB 3HMJG 2DIKA 1DIEA 5H1WA 4W84A 5K3VA 1KM1A 4B91A 1ZCCA 1T8XA 3UCDA 4IMEA 1GKQA 3BJFA 3T08A 1I45A 4C1NA 3WUFA 1FWBC 3DHFA 3MC5A 3QLDA 3F4WA 3IARA 3DYOA 1P0DA 5FJRA 4U5KA 3FW6A 1N8WA 1UZHA 1V5XA 2DQXA 2PDHA 3UA4A 5IFTA 4CKQA 3ZR5A 1XRSA 2F8QA 3LNMA 6TIMA 4S1FA 3ARQA 5HANA 4PRTA 5CSUA 1QMLA 1X8FA 1EUAA 4BI5A 3ZS4A 2ALRA 1AD4A 2FPVA 1V02A 3SCSA 1V02E 2F2HA 2VEPA 4XAZA 1Q5MA 4ATLA 3OB8A 2I57A 1XD0A 4HYWA 1YPXA 1YYAA 3QV6A 4FK9A 1DIDA 1B57A 3VOJA 1HJWA 3GE7A 3U57A 5CAKA 3LV5A 3PTMA 2AMXA 4EX4A 3MCNA 3EBVA 1RLDA 3G18A 2VR2A 2VC9A 4O1BA 2ZVRA 2WPBA 2NVCA 4TX8A 3MUIA 1FP8A 5HATA 4NNCA 1JGIA 3CMJA 7REQA 4F48A 3VX0A 1F74A 5ABFA 1SJDA 4AUBA 3I7RA 2GVJA 4LUSA 3LRKA 4Q4MA 1DTNA 1TV3A 4ZZ9A 1JZ6A 1E9ZB 4ZGYA 2XM1A 4Q4QA 1I2QA 2NVDA 2GGHA 2WBGA 2O9RA 3N13A 5D8ZA 1BG4A 3KOXA 5I3FA 4MTVA 2BY0A 4M7TA 4PMDA 5C2CA 1EJSC 4H9VA 1J9YA 3YPIA 4AX7A 2PGRA 2YCJA 5EBAA 2BHZA 3N15A 5I02A 2IQTA 4PGLA 3IPWA 5XINA 5EFDA 2XM2A 1UR2A 5E09A 4CD5A 3MTWA 3LHWA 4UOZA 2AMGA 3EMCA 3IJDA 2FVKA 1TPUA 4ONVA 4JYDA 2BNJA 3MUY1 2DVXA 5BOOA 3TA6A 4GY0A 4M24A 3WNMA 4LYQA 3SBFA 3R0DA 1H1YA 4ZQOA 3LPPA 3ITVA 3MYOA 2RJGA 1K77A 1XLAA 4UMBA 3E38A 4YXGA 3WUEA 4NY2A 3IUHA 1O12A 2ZUSA 3F03K 3ZLFA 3NFUA 1RQBA 4KCWA 5LNRA 1JF5A 1M04A 1R6WA 2QR6A 1F6PA 2A4AA 3WUBA 4A4AA 4Y2WA 1POKA 4E8GA 4ZA0A 4GUHA 1X97A 1RUSA 1ADDA 1I9CB 3BH4A 4KRTA 3PSVA 4QJ1A 1ITCA 1A0CA 2BG5A 3O6CA 2CERA 3CQHA 3SRFA 2QPSA 4LNYA 2J78A 3GTIA 3LTPA 4JTUA 3C6CA 2EPNA 4GIYA 4EAMA 4GZJA 3ZR6A 3DGBA 3QMSA 2WJFA 1XDLA 3IAPA 4ZOEA 4K2SA 2A3EA 4JCMA 3H23A 3GIQA 3BK0A 3G3DA 3QRHA 5FJJA 3TYBA 4C6EA 3NM1A 5KINA 2VRJA 4BK9A 1GVOA 4IIFA 2VZVA 4IIHA 1IZCA 1GHSA 4BWLC 4H8NA 1Z41A 3UXIA 4EPEC 2VDIA 3WBEA 4JL2A 3B0UX 4IGNA 2ICSA 3QR3A 3WQOA 4N9BA 2J27A 4HP5A 4UQCA 2JQXA 2HNHA 4S23A 4Q4SA 5DCDA 3T44A 1J11A 2V2HA 3SCWA 2O7QA 3GDRA 1QW9A 2EKGA 3TK7A 3QMTA 1I8JA 4M1BA 3BG3A 2J66A 3C2VA 4H7VA 3WJWA 4B5WA 2BXVA 3FEMA 3GFYA 4UUIA 3C4UA 3QTGA 1OBAA 1KKRA 2C1GA 2E9LA 3WK1A 1OD8A 2UY3A 2YL5A 1P6CA 3W9ZA 3GYCA 4GIEA 1EWEA 2J25A 2VD9A 9CGTA 2PP0A 3AS1A 5TQLA 4DJFC 4CD7A 4JNYA 3SIZA 3JS3A 3RLHA 1G6CA 3PVFA 5C7VA 2BVTA 2Y7FA 1Z8AA 4JXCA 2I5GA 1SO4A 4Q8QA 4PFMA 1YADA 1CYGA 3WQFA 1GGOA 4XVEA 4W7VA 2NXHA 3FNDA 4PCNA 1PPIA 4FXRA 4HZ7A 1B1YA 2EPOA 1CXKA 3TR9A 2DZBA 2AAMA 1UMYA 3KOZA 2F2KA 1QUMA 1O68A 2HDJA 2J9ZA 3EXTA 3BZGA 1JCXA 1OFOA 3ZMRA 2QVNA 4KEVA 5HMSA 2DIEA 1IIHA 1O1ZA 1TPB1 2JGYA 3G1XA 4S3CA 3TR2A 1UP0A 4OT7A 3E5BA 4YVPA 1TJRA 1YTEA 3SCTA 1TTPA 1E1CA 3NURA 3UZJA 2PWDA 1PIGA 3PUGA 1C9DA 1W9DM 3M16A 1J10A 1BFNA 6XIMA 2WNQA 3N2CA 2DSKA 1TVLA 5LNSA 2V3GA 3W73A 4CNUA 4QLLA 4JTKA 2NLIA 4R5EA 3W28A 4GVIA 4D71A 2ACRA 4X0VA 3N04A 4JAWA 2VWTA 3B4YA 2W27A 1OX4B 1TX2A 3UY7A 4OU1A 3NYDA 3W26A 1ITQA 1GK8A 4HK5A 4AG0A 2YB4A 1JZ7A 3AUOA 3CHVA 4IQDA 3SCRA 1SJAA 2FGZA 4HCDA 1BF2A 1I2NA 4RXGA 3UJ2A 3AMLA 5DEZA 5EL1A 3MUAA 1XM3A 1KBBA 1KBJA 5EYWA 2FPYA 5AYYA 2ZCGA 3G1YA 1L6GA 4XVDA 1TB3A 3MSRA 4YHGA 3EMZA 4N02A 1ODUA 3S9IA 2J4GA 3H12A 1X6LA 2CITA 3U2OA 2GQAA 2G96A 4GABA 1MEHA 4O50A 5PTDA 2WSPA 3BOFA 3RF9A 1G9HA 3AFBA 3KBWA 2WJDA 1UWSA 1ADSA 1Q6RA 4INFA 2FYMA 2EJAA 1UPMB 2ON3A 4Z1BA 3POHA 3VGBA 3AISA 1ZS2A 4JTFA 1R2SA 1R85A 3G8EA 1DWAM 4L61A 3LOTA 3TYCA 3E2RA 2C15A 1L6SA 4M6VA 4XZIA 4MNKA 3V5FA 1X6NA 4ZQRA 4L1WA 3ABZA 1UD3A 3DG7A 5CPSA 4A8IA 1O6IA 1WB0A 1FXPA 4YU1A 1DE6A 2HXTA 1MW0A 1JDFA 4A3QA 4LRTA 8XIAA 1XWYA 5D9OA 3USZA 2WMHA 3GTNA 3GQYA 3GXIA 4LY8A 3LLXA 4G6CA 3FSUA 4XD3A 4E4FA 1XYAA 2DH3A 2J9XA 4QGCA 3RO6A 5I5RA 5AZ0A 3ZT7A 2QPXA 4IICA 4ATWA 4JNMA 4MUPA 3IJLA 4DJEA 2VEMA 4O10A 5EMLA 2P76A 4UTFA 2HEJA 3W81A 1L8NA 3RLGA 3PFRA 1R3YA 1QFEA 4EWND 3VD5A 4HNNA 5F4XA 3DFTA 1I2RA 4PB4A 3L7RA 3EPOA 3MI6A 3AIVA 3QPYA 4H6QA 3CLMA 2EG8A 5K2ZA 5F4WA 4FOKA 3JZEA 2YBVA 1FCBA 1XBXA 2OT0A 4JHZA 2C7FA 2FGBA 2VT0A 3URQA 3QPEA 4RJEA 2WWDA 3UPBA 1SO3A 2FVMA 5EMMA 3TWAA 5BXPA 3I10A 4MKSA 2IPGA 2VHLA 5I09A 3TN5A 5C9RA 1ADOA 3MP5A 3SW6A 5D37A 3TC3A 1PKNA 3L4WA 1HUVA 3B03A 5JUVA 5FF0A 4X3ZA 4CD6A 3PJTA 1WXZA 4TO8A 4AZBA 1HFBA 3STFA 1B3YA 1XQLA 4R7OA 1VC4A 1B3ZA 4GKLA 5B7YA 1SM9A 2CKSA 1EP3A 3EKLA 3BLLA 5A6SA 1DXFA 3DG3A 2QMJA 2R8WA 1W5OA 5BXRA 2E7FA 1AQFA 4M5PA 3L4TA 2CU0A 4LCQA 4AMAA 2DEPA 1HKWA 1UB3A 4I5UA 4AWEA 2B81A 3QLLA 4ZXOA 4AD0A 4QAWA 1WDSA 4UTUA 1SVDA 1XCXA 5G2WA 4DBUA 4PB3A 4WKFA 2WVTA 4XTDA 3P61A 1F2JA 2E1WA 4CQAA 1SW7A 3QY8A 4FZIA 3VGHA 2UY2A 4QSHA 2CZEA 4XAFA 1DIKA 1LM1A 3R43A 4EXBA 2QGHA 4RE0A 1F3WA 1TVNA 1FWWA 2X1SA 1EGVA 1TFVA 4Z2JA 1QPQA 3IVTA 1DVJA 3W88A 1VPYA 3UPMA 3AI0A 3BLDA 2BHYA 4Z2IA 1EGZA 2TRSA 3IGHX 1KQZA 2PRHA 1X38A 2FHBA 3W0KA 1TCMA 1TPWA 1UQZA 1VB9A 2ZZ1A 4KS0A 3TMQA 4H8HA 4C6CA 4PL1A 1I75A 1U1UA 4YS1A 4EACA 3FKRA 2XJ7A 3GNPA 1MQPA 1GNXA 2VC7A 3UU0A 2WQDA 4RR4A 2PC4A 4O11A 2JKEA 2E6AA 4F8XA 3NCOA 4UQAA 5CPOA 1QNPA 3TSBA 5A6MA 3RMJA 1PTDA 3L5MA 3N11A 4OJYA 4AYSA 3RMEA 1DP0A 1E51A 3EA1A 4QQUA 3WQEA 3TOYA 4DBSA 1E0WA 4CN1A 5A2BA 1V6VA 5I3IA 1KTBA 3UNDA 4DUXA 3LB0A 1XW8A 1JI2A 1R9ZA 5LIWX 4PH6A 3UXLA 4F0LA 4UFKA 3P2VA 1VCGA 5LA0A 1FTXA 4JZ5A 3MJYA 3GZAA 4HHLA 3M0LA 3EB2A 3WLPA 3L66A 1YKWA 2CLOA 1ZU8A 3P3BA 2HROA 2GGGA 4ZE4A 2O9PA 2QGYA 3DX5A 4LUYA 3QYSA 4JDYA 1V6WA 3OYZA 4DI9A 4B3ZA 3W25A 4ZQCA 3CYJA 3SFKA 2D2JA 2DZXA 3EWXA 1RJPA 4U4MA 1SGJA 3KLLA 3KL5A 3T2PA 2DU2A 4YJ5A 4DBWA 2HE5A 1UKSA 2E6YA 3B9NA 4MPQA 5CPTA 3MT1A 3UWWA 4IZGA 2VD8A 4V15A 3STCA 4I7VA 2PDCA 4GXWA 1NJJA 2WAGA 3FYOA 1TCDA 4WDTA 3H2FA 3AHTA 1UASA 2DZTA 1TWSA 2FPTA 4LC6A 1YNYA 3GG7A 4F4RA 3PUDA 1MEWA 1OCNA 2I9UA 5BXTA 1GUVA 3CB8A 1YPFA 1TE1A 3FA4A 2VFEA 3NVTA 1E55A 3UG8A 1XP3A 1AVAA 4R85A 1T41A 3H7VA 3AHXA 3UGRA 3Q65A 7TIMA 3IS4A 1TRDA 1IZJA 4JFVA 4RL3A 3SB0A 1QK0A 4IGHA 4EE9A 4LX4A 3OVPA 4YCPA 3PG8A 1H2JA 1D2KA 3WELA 4W7UA 1UKPA 4KWWA 3E96A 1CCWB 3L2MA 2ACUA 2FTWA 3A64A 3HBLA 5IXEA 3CQ0A 3ZLGA 3GG8A 2GZXA 3I4EA 3M0XA 2PF8A 4C65A 3IIZA 3GH7A 5CLTA 2PGFA 3GM8A 4PB5A 4N7QA 1KR0A 3DH7A 3MWAA 1EIBA 1FHLA 3CTTA 1VYPX 3NSNA 1C8VA 3D47A 2QPUA 1KFCA 1ZJIA 3FDGA 1UR3M 3M0HA 4C6FA 4NNAA 4KGLA 3AZRA 3M0ZA 2CBJA 2HK1A 2FHCA 1OG0A 3OTRA 3BMVA 1OINA 4E6MA 2ABBA 2OWCA 1QNQA 1T7LA 1E1FA 3LCIA 4GI4A 2V5DA 5KZMA 1XRFA 4FIRA 1VFFA 1HVXA 3MMWA 2X30A 4NX5A 3GW0A 5A8OA 4XKYA 3T81A 1KM2A 1V3JA 4HD5A 3H22A 4LF1A 1F3TA 4UTTA 2FZ8A 1FHUA 3G0UA 2EQDA 3NQ6A 3E2SA 1U5HA 4H1ZA 1IEVA 1E70M 3RGTA 3Q94A 1H49A 3HJZA 1QAPA 2PWHA 3T7VA 3ZIZA 2OODA 1Q2RA 4ZO7A 1GOKA 3ZLHA 4NNBA 4IJRA 1OSEA 1P7TB 5DN1A 1WKFA 2GPTA 1DOSA 4GHRA 3RN6A 3N14A 2DDXA 1Q7QA 4YTTA 1D7FA 1CNVA 1XFBA 4P61A 1AH4A 2D1ZA 2Y7GA 4NASA 2HK0A 1DV7A 1MNZA 3GNRA 3F4NA 2H90A 3KDNA 1MXSA 4EIVA 3M47A 4XUGA 3RFAA 5E9AA 1K02A 3ARVA 3VE9A 4ACZA 1MQQA 4XAYA 4AY1A 1VKFA 2QYGA 5A5WA 1QR7A 3RJXA 2IUZA 5M03A 2OLSA 3A23A 5I07A 4AHQA 4GINA 3KP0A 1SMDA 2A3LA 3UWZA 3U48A 5I23A 3HQOA 1KM6A 2QCCA 1UR8A 2ZFAA 4O8AA 2QCGA 3KVMA 3WQ4A 1TMLA 1IWBA 3S4TA 4LYKA 1YQ2A 2OEMA 1QWGA 4NQ1A 1FWEC 3T2QA 3H2OA 3EYPA 1EB3A 2OJPA 3OLEA 4ZOAA 2G50A 4N4PA 1PKYA 2J8TA 2AQOA 2J6VA 5B80A 4Q4KA 1FWHC 4R7JA 2QULA 4PMRA 5K9DA 3THUA 4S3BA 3FVDA 1A3WA 3NO1A 2ADAA 2FFIA 3VNJA 1RY8A 3G1DA 3GH4A 1K4HA 1W32A 4A29A 1OC7A 2GGIA 3TOPA 1JL8A 5LKYA 1AL8A 3PBWA 4C91A 1S1PA 2J7BA 4LB3A 3OIXA 4C6NA 3CGTA 3I7QA 1BVWA 1IHIA 3RILA 2V5BA 3AHZA 1TV7A 4HNOA 3W7EA 3NVDA 1UHVA 2VDGA 4GYFA 2EPMX 1RZMA 5JIWA 3GG1A 3TQ0A 1AL7A 1KM4A 3TP4A 1EIXA 2EPLX 2Y88A 3CAVA 4WKHA 2D3NA 2CZDA 1Z42A 3CUIA 2R91A 2AQVA 1K9EA 2V2CA 2J62A 3IRSA 2AAAA 3WDQA 1OF8A 2AQWA 4YVXA 1JDCA 3RX2A 1DYSA 1AH0A 3TCEA 2NV1A 2PWFA 4RK8A 3VXGA 3I6TA 3REQA 3W1UA 4CN6A 5HAOA 3GDTA 4DX3A 4GYPC 4AQLA 1XRVA 4ACYA 4RLIA 3AYTA 3DZ1A 2Y89A 1XLLA 4PUNA 3K8MA 3P6LA 3AO0A 4K37A 1UD2A 3PPHA 3RLVA 2GUBA 4AZ7A 2PCQA 4FLSA 3T55A 2RH9A 3DG6A 4UOQA 1K6WA 3GKAA 2G3FA 3OOQA 5AHLA 3WBAA 1DWJM 4QJ4B 2X1IA 2ZYFA 1AZ1A 4E2DA 1FDYA 4PMJA 3R8RA 4NU7A 3HJEA 1VFUA 1KR1A 4AISA 4LPCA 1SYTA 3DN5A 2NQLA 2TSYA 3MWCA 1DWIM 3U7BA 4IF2A 4UMCA 1OYCA 1V6YA 3ZSTA 2WLZA 3B8IA 3G24A 4W7WA 1GQLA 4H6EA 4PMUA 4N42A 3FJ6A 3MDUA 2ZUMA 3CV7A 1RJRA 5IM51 4C6MA 1E56A 3O6AA 4NZ4A 1JYWA 3R8HA 3V0SA 1EJTC 3O7UA 4HSNA 4S3GA 3BTNA 1FWFC 2BZNA 2EG6A 5EKYA 4KERA 3VNLA 4H04A 2W63A 3N18A 4PMNA 3BGAA 3PBVA 2D0FA 1PHWA 1NOWA 1PJ9A 2A79A 2P53A 3W7PA 3PWIA 5JQ9A 2CIPA 4F0HA 4HVXA 4MWAC 1JXKA 1NF0A 5C70A 3HZ3A 3NJ3A 4PEEA 2WMJA 4KIEA 2CLPA 4QG6A 4AXNA 1ODZA 4GBUA 4BCEA 3UZYA 3BCFA 1N82A 4GG9A 1QRQA 1R0MA 2V5CA 4I8DA 4NL1A 5D2VA 3KBVA 4Z42C 1S2WA 3ZFHA 4CCZA 1HP4A 3SQMA 1TG7A 3PTKA 4EXAA 3PC0A 3NOYA 1G1YA 1PE1A 3TQVA 3I6RA 4YWIA 4GVHA 3AHVA 3H8AA 3GXPA 5FACA 2FZBA 3C56A 2PDXA 3DHPA 2VCBA 3VAVA 1V3LA 4NF7A 1TV4A 2E5DA 3CIWA 4IP7A 2A3HA 4PCFA 2YA2A 5C5YA 4ZOBA 3S9YA 4ASTA 2RDWA 5DT7A 1OF6A 3VNKA 3QHOA 1G7VA 2CPUA 3GC2A 4UZUA 3U2ZA 2EEXA 1QI2A 3FV9A 4NX0A 3ITYA 5CJ5A 3ATYA 1DJQA 2D23A 5HULA 4PSRA 2CZVA 4L6DA 1KXHA 1W1VA 3OA5A 2E5CA 3LERA 3O06A 4B5XA 5D4YA 2HV5A 1R87A 2PWEA 1WO2A 1UH3A 2OX1A 4HHHA 4BZYA 1E0UA 2V82A 4C6BA 3PUEA 4FEZA 1DJYA 3XINA 1V03A 1W3KA 1ONRA 1MXDA 3NA8A 4PR4A 2D0GA 4HU4A 3VNMA 2ZRWA 3EOUA 1F3EA 5CSRA 2PU0A 2DVUA 2V5LA 3K30A 3LENA 3ENLA 2I5IA 3PB0A 4EPDC 3W71A 1Q6DA 4CU7A 3IGSA 4K7YA 4ML9A 1KA9F 1W1YA 3CQIA 1KTNA 3AMGA 4LRSA 4PEKA 1V6XA 1MUMA 3APGA 2XUCA 3ZVIA 1BYCA 1JZ2A 1IXPA 3TEVA 3WQ5A 3AYVA 3UZZA 4IG2B 5MKGA 4I6KA 4LAUA 1XYBA 2W79A 3BZJA 2ZTKA 3MHFA 4IPNB 1XUZA 1MWOA 3MP4A 3GG0A 1P0BA 3E0WA 3SUUA 4PL2A 4QE4A 3M07A 1NDYA 4M81A 4LTSA 3EA3A 1R86A 1MMFA 3RU8X 5I24A 3ITCA 1WZKA 2HJPA 3OZYA 4WXZA 3QXBA 4JN6A 1E9YB 4FS9A 1KXTA 2ZADA 1UP2A 4UWMA 4DXXA 2IKIA 1XHGA 1JNEA 2QUNA 2BB0A 4GH3A 2NXGA 2MNRA 4H01A 3HPZA 3WDIA 3B05A 1YW1A 2HCVA 4DRSA 1XGZA 1PX3A 1FCUA 3EOLA 3CS2A 1A0EA 2ZUVA 4Q8MA 1ISXA 2H6RA 3BMWA 2PI6A 3MSDA 3G1HA 4LYRA 4NJGA 1N8FA 1X7FA 5E70A 3IJQA 2ACSA 4I3GA 2P8CA 3R0UA 1FH9A 2ZXAA 4GUGA 4MAVA 5FEXA 3VOCA 1E9LA 1R3QA 4DJDD 1W3HA 1EF3A 4ZVJA 5C8BB 4OIFA 3ZJ6A 3VM5A 1XC6A 3AXXA 4S3DA 4BKNA 1WQ5A 3QQ0A 4S39A 1W1IE 2V6AA 1F73A 4BWLA 1GJPA 4QLKA 3FJLA 1JYXA 5D09A 1DWGM 1G69A 3W82A 1W2VA 2INEA 4JY8A 3GU2A 3QTPA 3P84A 3U3HA 2OGJA 4LS0A 2YBUA 2GOKA 3GXTA 2NLYA 3S2LA 1VHCA 5I79A 5D9PA 1PEZA 4HTBA 1QHOA 1LDCA 2DSUA 3QHNA 1UWUA 3M6YA 2ZWYA 1P1XA 1OB0A 2PZ0A 4HA0A 2BODX 4D6HA 3O63A 1F07A 2JIWA 1V7YA 2PGWA 3BWWA 4FXSA 2YKKA 1R8LA 1R3RA 4A2SA 3RPDA 4M56A 2PTXA 3Q58A 3M4HA 5AHFA 1KFEA 3URNA 4IPLA 3HG2A 2PDBA 4IXHA 6REQB 1E6QM 5D02A 1YNPA 2Q3RA 3CV1A 1QO2A 3GAYA 3DI1A 3M46A 4PUEA 4IQJA 1R9XA 1OYBA 4AX6A 2VGFA 3AYRA 1UWTA 2BSLA 3L21A 3ONCA 3O0FA 3MJMA 1KWGA 1KV8A 2ATSA 4HQVA 3RX4A 4JQ2A 3CQJA 1OX6A 1YEYA 4EANA 1H5VA 3T1GA 3VOHA 3VO0A 3MI3A 3BV7A 3T07A 1P0KA 2GQ3A 3WNKA 2NV2A 4EOUA 1A49A 2HE8A 3LZ5A 1IT8A 4Z2HA 3EOEA 2ZUNA 4XB3A 2XSXA 1GZGA 1O60A 3M7WA 4JIHA 1FWAC 2FLIA 3DI0A 4P8WA 1TX0A 1MW1A 1TMHA 5DXYA 1V51A 4IIBA 4W4QA 1OX5A 4HGXA 2IKGA 2QUTA 2ZICA 3LUTA 3QZAA 4HYVA 2ZA2A 3M43A 3WLHA 3CUFA 3I4KA 3TW7A 3NQEA 3HGRA 4CUCA 4ADTA 4B5VA 3QZ6A 5EMYA 1RBLA 1G4EA 2WYSA 4G1NA 1UW9A 1OWQA 1GQNA 2CESA 2Y24A 4ZSTA 1BGGA 4RX0A 3W1AA 3R8GA 3SRKA 1A5OC 2JKAA 5U4NA 3VMOA 3ZJ7A 4IFKB 3KHDA 2G3MA 4PODA 1J5TA 4DPPA 1H62A 1H60A 3BCDA 4C6QA 4Z2GA 2EG7A 2WM1A 3GNNA 2IKHA 3VC6A 5CPLA 4US5A 2OT1A 3N6HA 1N2VA 3LBCA 3A4JA 3L9CA 1V3IA 1T96A 4MB5A 1D9EA 1K7XA 1SW0A 3TQKA 4HU3A 1GOQA 3R13A 4E0CA 2E25A 1UZ1A 2Y85A 1SZRA 4E2VA 5EMKA 1YE4A 1VEOA 4CQ8A 4GY7A 4IMFA 3AJXA 3G0SA 3GR8A 4LW7A 4MM1A 3EWWA 3K8KA 1ISWA 3QW3A 4AWTA 1O94A 3WF1A 5CSSA 3SY8A 3E5PA 5LZLA 1PZ1A 2D2OA 2E6DA 1V0KA 4AW7A 4XK2A 1OT1A 2NV9A 2WLYA 3IEBA 4GX8A 1S46A 1L6WA 4MADA 4AD2A 1VBHA 1BXBA 2DY3A 1G4TA 3OG3A 5HXMA 2PBOA 1B4KA 3N34A 1FRBA 1WE5A 5C7HA 1IGWA 1UQYA 4A8NA 1XCWA 4CCCA 3WLKX 1PAMA 2XHYA 3C86A 4JTRA 1WUFA 1DIOA 1V0LA 1TSIA 2POZA 3FOKA 2R1NA 1GORA 1P4CA 7ODCA 3THDA 1V79A 3UNTA 4J7RA 3VIMA 3P7YA 1FUYA 2DORA 1NU5A 3LEPA 3B9AA 2XIOA 3T4CA 3LSBA 2NX9A 4IMAA 4FMVA 4AD5A 1L2UA 1TO3A 4Q6JA 2WC3A 4MY8A 1JRBA 4AXKA 1POJA 2NQHA 2NQZA 3VA8A 3OHIA 5A69A 2PAJA 1OFQA 3KFTA 3WQVA 1UD4A 1WV2A 2Z1KA 3MSGA 2NW0A 5F1VA 4LAOA 1EJ7L 2J7CA 1CPUA 5DCEA 1RBAA 3GXDA 1XIMA 1TA3B 1RXOB 3G6MA 1DJNA 4GGBA 1O66A 4F0MA 1TZZA 4O12A 3KX6A 4M51A 1K6AA 4ZO6A 3H53A 3HGJA 4GCAA 3O9NA 1U33A 4REQB 2QJJA 4ZXLA 1XH0A 4JTGA 1DQWA 4IFRA 2KZHA 3W02A 4V1XA 1FFRA 1C92A 1J93A 2YXOA 1JXJA 5GJMA 3UWUA 4N6EA 1EEPA 3RG6A 3BW2A 3WQDA 3FFSA 4FP1A 2XVPA 4W8LA 5L9FA 3WLNA 4PTVA 3OLDA 4HCLA 5REQA 4GWEA 4RZ6A 4O13A 1AZ2A 1E73M 3AIQA 4AFYA 2YDAA 4I9MA 3WF2A 1VFHA 3WKZA 3GFZA 2JEQA 3BANA 1CWYA 4LQ1A 3V7PA 3KVJA 1ME9A 3N17A 2V8ZA 1LT7A 3W76A 2W4XA 2DUZA 3E0FA 2AGTA 2PUZA 4E3TA 2XSAA 2FVLA 5M3WA 3WD4A 4K1GA 4GNVA 3VGDA 3QHMA 3FEQA 3PZUA 4C60A 3UZWA 1FCQA 1Q3NA 3DDMA 2V5KA 1UYQA 1XSIA 1UJQA 3LHUA 1J0IA 1LP6A 2WVVB 3WJXA 7ENLA 3SO7A 1WCGA 4OZOA 1SW3A 4P8UA 1WYIA 4J2MA 4K38A 3C8NA 3BV4A 4WR3A 2ZUUA 1ONEA 3WH8A 2ZWZA 3QOMA 4JTLA 1ZY9A 6XIAA 3D0CA 5CZSA 5EMUA 1XBZA 1YBQA 4O0QA 4JHOA 1PBGA 4D6IA 1H0IA 2IXUA 3C61A 4GJJA 3WJSA 3NXLA 4IUOA 1XKYA 5CG0A 4Z2KA 3M0JA 1GYNA 1UR1A 1XS2A 1RK6A 3R4IA 1LORA 2HMCA 3AMCA 3VOFA 3URAA 1C7SA 5DO8A 4L9ZA 5F2MA 4XZNX 4KWUA 2VX6A 3NQ2A 5FIPA 2WCGA 1IQ8A 4GZ7A 1YXDA 1NP2A 5D03A 1FWCC 4C6IA 3BLOA 1EYWA 2RGMA 2G3IA 3TV8A 1A50A 1Q6QA 3ALGA 4C6JA 1VHNA 3QQWA 2F6KA 1NWUA 4A05A 1MFVA 3FIGA 2RDXA 3DOPA 1WX0A 1K8CA 3IJ7A 1HKKA 1H7OA 2ISFA 3EDEA 4QHRA 4EVZA 3QSTA 1RALA 1V6TA 3PNUA 4DAFA 1Z7AA 1J0JA 2FMNA 2O56A 4PYSA 1M01A 3FAWA 1VJZA 2VEGA 4H41A 2WV8A 3RLUA 3FX4A 3COTA 2Y62A 1FHVA 3BJSA 4GGHA 2J8FA 3SGGA 2X1UA 2GK1A 1JCNA 4G5DA 3DFHA 3SQLA 2WSYA 1P5BA 5DBUA 1H0GA 4JTEA 1IV8A 1PWLA 2VFIA 4CEUC 3UGVA 3G1VA 2VJXA 2HS6A 3M44A 3PBGA 4ZQMA 3U5YA 1WZMA 3H2MA 1W54A 5BYWA 3W70A 2E0PA 5LXEA 1DQXA 4OUIA 2QVHA 5CC6A 2XG9A 5ABEA 3LXAA 4PTNA 2OLAA 4JKKA 2YJQA 3QM3A 4RPQA 2WC7A 1M7PA 2OSXA 2G8ZA 3O1NA 3LHTA 5KEZA 2V2DA 2PC8A 2ZQ0A 3WLMA 3WZ0E 1RCQA 4LCSA 4QNEA 2QEZA 3MO4A 3B0PA 1UC5A 3T0BA 3CMGA 5HBFA 4MKVA 3AIWA 3SUWA 1BAGA 5DXXA 2D24A 2FTPA 1T5AA 4M3PA 4BQ4A 4AHPA 3DYPA 2I16A 1EJWC 2YLLA 3VOIA 4WDWA 4AZCB 3FHQA 5A8PA 1UWQA 1SU5A 5ABGA 5E93A 4UFHA 4ZFMA 1SJCA 1CZ1A 4RW3A 2A7PA 3KUMA 2C79A 4UQ9A 4X61A 3MANA 2C0AA 4UFIA 1ZBVA 4DO6A 4GIRA 1D8CA 1ZQ5A 1YPIA 1SQ7A 1MVYA 2J47A 4UTHA 2PD9A 1GEHA 4ICCX 3GC5A 3WNOA 1JDEA 5CBBA 1EC9A 2QF8A 4ZQNA 4AYGA 1VS1A 1WKYA 3IUDA 1O5XA 3W29A 5I3KA 1E4LA 4DBDA 1E0VA 5FSEC 1AW2A 3JVAA 1P6WA 2PBGA 4RKAA 5KETA 1F6KA 4DWSB 3W2UA 1UKTA 3ITXA 3RDKA 4HK6A 4CQ9A 1ISVA 1KC7A 5BRPA 1XG3A 4DJDC 4LWWA 1TWWA 3LQLA 2OPJA 1RBOB 3CUZA 2WZMA 1ZAJA 4S3EA 2YB1A 2WKGA 2BV9A 3M5YA 3WJYA 1BTCA 3TTSA 1VF8A 4IIDA 3L2IA 3QN3A 1J0KA 1ICSA 4YYFA 1WPCA 3PZGA 4O16A 4CNSA 3V5OA 2CLFA 3P67A 1H11A 4B9YA 2W6RA 1ZJAA 2QLYA 3ANUA 4O54A 1J18A 3PTQA 3V18A 2E68A 1GW1A 3GTFA 2PLKA 3KZPA 2VP8A 1OHLA 1K8YA 5I6SA 3ALFA 2YLAA 2OKOA 1JNDA 4PMXA 3P60A 1ZBKA 3D3FA 4AIEA 4PFHA 1LL4A 4XBSA 1YXYA 1T0OA 5CC5A 2CBIA 2V81A 3O05A 2BS9A 3ISIX 1S2TA 2OZ0A 2CBUA 3UA3A 3W7HA 3GXMA 2GJXA 4O53A 4NZFA 1UUQA 1HKMA 2HRWA 4RCXA 3CL7A 2AGKA 3B8VA 3R7MA 3UW6A 2XH2A 2WWCA 4GCXA 3NL5A 4ALDA 2REQB 2X09A 3PAOA 1LQ0A 2ZC1A 2OCZA 3MPGA 2V67A 3ABQA 3A3HA 4UR7A 3U0HA 1GOIA 3WH7A 2F9RA 4NAFB 5EBUA 3LX9A 2VCCA 5FF7A 3C2RA 1PTAA 3GHRA 4Y8FA 3VU2A 1W8GA 7A3HA 3GZ3A 4D6FA 1PIIA 4OWGA 3CMFA 2ODOA 3NO5A 4LBSA 2D69A 3OGVA 4TMCA 5DX7A 2XTKA 4X2RA 1JCMP 1KKOA 5G1YA 2ATMA 3DBNA 2A21A 3VD3A 2DZUA 4JTCA 5DCBA 1DWFM 4JHMA 2QDGA 3IJIA 3WCZA 3ZSSA 1WA3A 3JUGA 4O0ZA 3QOKA 2AL2A 1OY0A 5KITA 4J1OA 4JFTA 2X7VA 3L5LA 2Z1WA 4QJ3B 1GOWA 3P80A 1SZGA 1EO5A 1RSCA 1DJGA 1UWAA 3MB9A 5ABHA 3B3DA 5FL1A 3VKKA 2Z6JA 3IVSA 1V0MA 1VEMA 4RW5A 4DF0A 3NPVA 2PDQA 4RDZA 3LHVA 5FEPA 1TJ1A 3LGEA 3CWHA 5A8MA 1XSKA 1TV5A 4AB4A 1M7JA 5G2IA 4BHYA 4TVCA 3WBYA 4Z1YA 5HQLA 4AC1X 1OK6A 4MLJA 3IJ6A 3UJEA 3PUOA 3GVVA 4MZ1A 2XVNA 4IX2A 4UTTC 4NYUA 4TVUA 4KETA 4B3KA 4IX0A 1HW6A 3UP8A 1ZUAX 4LCRA 4AIUA 4H9UA 1UWRA 4H19A 2D22A 2WNWA 3ZVHB 3EOOA 2DT3A 4FX8A 2E9MA 3QPZA 5D2WA 1H09A 4JIEA 3O6DA 3OIHA 4NJHA 3KOYA 1L6YA 1EEXA 3HQPA 3CXOA 1S2CA 3MBFA 1BRLA 2WCSA 3EDKA 4TXEA 1A4MA 3OO2A 4KEMA 5D9NA 3UD6A 5A8GA 2IW0A 4LEFA 4ZTYA 4QEEA 1GKRA 3VZZA 1YIXA 2BY3A 3B0YA 2VVSA 2POTA 4JQ1A 5HINA 2A3AA 1EDQA 4MHBA 5CGMA 4Z0JA 2XVKA 3NSMA 2INFA 4EP8C 2ALDA 4L56A 4QRNA 4QXIA 1J2BA 4J2PA 3BOLA 3KRBA 4G56A 4XSMA 3H55A 1C91A 4GYPA 1G94A 3WNPA 3ABRA 3NDYA 4W89A 4HNLA 3W7QA 5HR6A 1WZLA 2WVSA 4AEFA 4TOQA 2W3ZA 2VTFA 4GMEA 2B4GA 4GQGA 3UZXA 3K1GA 3KBSA 4OOUA 4AIBA 1J96A 5FEWA 1CIUA 4MDPA 1LBMA 1TWZA 2W67A 5GPRA 1ZPTA 1PTGA 5A6AA 4XG1A 4QDMA 3TAKA 3FLUA 3TJIA 3AS3A 4H00A 4P8XA 3L67A 1RP9A 3PBUA 4O15A 2J79A 4MKNA 2PTYA 3GKFA 1PS9A 2JBMA 1CECA 1QPNA 4KIRA 1YMYA 1TTJA 2ZX8A 3LTSA 1IE7C 1C8QA 1UD8A 3EKZA 4H2CA 4J3VA 3QV8A 3A4AA 4UB9A 3BGJA 4RV3A 3N9RA 1B3OA 1BLIA 3AUJA 3UG4A 3TTOA 5DMYA 3S6DA 3T05A 2XIIA 3HV8A 4JIPA 1EJUC 1KRBC 4X0NA 4HOXA 4L9YA 4LUJA 1NSJA 2VFHA 4BY3A 3KTXA 3O07A 2CLIA 4UQDA 3NDOA 4WRHA 4E2BA 3GNXA 1G4PA 2ISWA 3QVQA 2CBVA 4IPJA 5E6ZA 1W91A 1IT7A 1LRNA 2WZHA 3A6OA 3CPUA 1A47A 3NZQA 4QFUA 4X22A 5DANA 1KCKA 4MWAE 3H26A 1MDRA 5HJYA 2VUYA 4NAEB 5GQBA 2TYSA 3OG2A 1S5TA 2YSWA 4LXFA 5A1AA 3KDOA 5H91A 1YDYA 1GVQA 3NZGA 4N9EA 2Z2BA 1W5MA 3ZWSA 3BW3A 4ZSUA 2PCEA 3M5VA 4QIUA 2OXNA 1EP1A 4WJEA 5DQPA 3U9IA 1GPFA 4GX9A 4AY7A 3AXHA 2CETA 1T6MA 1JYNA 4B2DD 1WKEA 5H2ZA 3AIRA 8RUCA 4JTJA 3N6QA 2DUXA 2P0IA 3M41A 2WQPA 2JK2A 2CLEA 3M0VA 3MBDA 3W22A 2CYGA 3L0KA 4DWSD 3LDVA 5JBDA 1YXCA 4UQEA 4L4LA 3U2CA 4I90A 4CNPA 3MV01 1HNYA 3JW7A 3MZNA 3KRSA 3ARTA 3E74A 4Q8NA 1EBGA 1Y5WA 1IGSA 1XGEA 4XIMA 3B8TA 4TX9A 2PDYA 3BAWA 4FNSA 5K4XA 4TTGA 3RK8A 3W1QA 5FEZA 3HGOA 4JIRA 3P82A 5FJOA 3W01A 5C54A 3WD2A 1B0IA 4XD5A 2TODA 3KWXA 1R30A 2INZA 2PP3A 1O5QA 4A3UA 4P7QA 1LF1A 4F0SA 3BG5A 3DIPA 1DJWA 3SR7A 4I8YA 4LH8A 4J28A 2OGYA 2RUSA 2ZZ6A 3AIUA 4OQVA 1FWIC 5HR7A 1S38A 4KFOA 4ROPA 1H3GA 2ZRZA 3PPCA 3A21A 3ID7A 2YL9A 3DFQA 2OQYA 3SN0A 3QC3A 1ALDA 2G4JA 1BYBA 3N2OA 2Q02A 4LANA 3TQPA 4ENLA 5A94A 1B3XA 3ES8A 4AAJA 1J0HA 5BRBA 1Q63A 3NPWA 3WFAA 5AB3A 2GVGA 3URBA 1Q8JA 1S2UA 5GJPA 5AC6A 1H7PA 1WXJA 3TX9A 1GOOA 3DFOA 4O4VA 4JEQA 2YCIX 2CLMA 3GAKA 3ANVA 3CBWA 4GJIA 2A3CA 5I3JA 4AZIA 1Q66A 2CHNA 4W8BA 2VNCA 3RM8A 3GW3A 1LCOA 3MKKA 1Q13A 1AH3A 4AU0A 3WLSA 3ARWA 3THAA 1JPHA 1NOFA 1J01A 3AMDA 2BGQA 3VKJA 2DSWA 1FXQA 4AWUA 2X2YA 1EUNA 5F2LA 1XLIA 4B90A 1WOAA 3SADA 4MPKA 4IL0A 5T91A 1AJ0A 4LFYA 2QCHA 3HF3A 3O8AA 3OPSA 4LV4A 4GACA 3VKCA 4LAMA 5CAHA 1RCXB 1SZFA 4QISA 4AMCA 3PJXA 3GR4A 3CUJA 3K13A 1SR0A 4JTQA 3IK2A 1SO5A 4L7ZA 5MHBA 1BSIA 3QV7A 3MUCA 1ZHAA 3ARRA 5HPOA 3B9OA 1JPKA 1OYAA 3WLRA 5FSDC 3PB2A 4J3XA 1OX4A 3NPUA 3B9DA 2GSJA 2CWXA 4J35A 3OVQA 4LAKA 3RNDA 3S9ZA 3PZOA 1XR2A 4GVGA 1GVIA 4TMBA 3H24A 4ZE5A 1ZAIA 2GSHA 1JPDX 3ICJA 5KTLA 2BVDA 3WQ8A 2RAGA 4NXKA 3LNPA 1TREA 1GW9A 3UWYA 3S1UA 2MANA 3OVRA 1W9BM 1F4HA 3N9KA 2CEQA 1FX6A 3VDBA 5BXSA 1VR6A 3W7RA 3CV6A 2PLJA 1EOMA 3GU1A 2HBVA 2E67A 3QEZA 2YGYA 4V27A 3P8JA 1G5AA 4EKJA 3M1ZA 2ZRYA 1LWIA 1M53A 1FWNA 4JFWA 2G3JA 1V08A 4AVFA 3W75A 4OBSA 3DUGA 2RHGA 2A1YA 2X0SA 3WMBA 1HT6A 1RK5A 4O1CA 1HX0A 4AF0B 4IIEA 3A5FA 2BMBA 3D46A 3F7JA 2HPMA 4ZENA 4GNJA 1PO9A 3DYMA 2QW5A 2GL5A 4KMQA 1BTMA 1KGWA 1GOMA 2E4TA 1ZCOA 3G5EA 4YPJA 4O18A 3CPRA 3GS6A 1XINA 1DWHM 3BL3A 1MDLA 2CLLA 5GNXA 5JMUA 2ZVIA 3I65A 2NSXA 1Z6KA 4AD3A 3GWQA 4O4WA 2XIMA 4DI8A 3M64A 1K03A 4ICNA 1A5NC 5E9XA 1OGGA 1SFSA 1W9PA 4Q3MA 2OEKA 2D0HA 2X7WA 1Q2SA 3DC8A 3W23A 3H21A 1TRIA 3VZYA 1TPDA 3BMXA 1S2VA 3QW4B 1R7OA 1F4AA 4QBXA 1XC4A 3D3AA 3ITGA 1UJPA 2DZPA 2TAAA 2FIQA 2X1TA 1ME8A 3TZNA 5IBXA 4HOWA 4Q6XA 1THFD 2R1LA 4ORIA 1OZMA 1E6PA 2GFTA 1NDVA 1A5LC 3PZ9A 2NQ5A 2Y70A 4WY0F 5AC8A 2I56A 4NVTA 1XL9A 2OELA 4FA3A 4JYEA 4M29A 2HZGA 2WOQA 4D6DA 5G1MA 1NP0A 4D6EA 2PRMA 1A5MC 3SN4A 4Q4RA 1VRXA 1HF6A 5KZ6A 4FHAA 4Q8TA 2NQJA 3TTQA 3LCWA 5D9MA 5BCAA 4J9JA 4C1KA 5BWAA 3V75A 1MRQA 3STGA 3W86A 3S47A 2KAUC 1W1A1 3WH9A 5AC4A 1HP5A 5K9CA 1ZJBA 2YCLB 4R88A 3G0XA 1EX1A 1W5NA 4G8TA 4WGHA 3AZSA 3E2QA 4O1DA 4Z1AA 1D3CA 2ZRVA 4C6DA 3CLWA 4BA0A 2OSYA 2WSRA 1LYXA 4JQAA 4PA8A 3QMRA 3NQ8A 5C9UA 3W7KA 4UC5A 4Z08A 5ECVA 1JAEA 1BWKA 3T8QA 1X98A 3GB6A 3NQBA 2EKCA 2ZZ5A 4U33A 2Q6ZA 3KW3A 1WAWA 5IOBA 3D5HA 4NRSA 2EHHA 1IR2A 1E3XA 4I9JA 9XIAA 4LAZA 2AOSA 3EMQA 2PODA 4U3CA 1MFUA 1J8VA 3S8HA 4N0RA 3CPGA 2OSWA 6TAAA 3SY5A 1ME7A 1MO0A 2WBKA 4QAIA 2FKPA 4U2YA 3U4FA 3F5LA 1Y5VA 5J8LA 3M7SA 5FJIA 4E38A 1UWIA 2R9RA 2FH6A 4UOJA 3W4RA 4TU1A 5FOOA 3L5AA 1PB0A 2YYTA 3UFYA 2W0UA 3WL0A 3W87A 5AC7A 4Y8EA 5CQ1A 5E5CA 2NVAA 2Y0FA 4ML4A 1RVGA 4E3VA 1EZ2A 4QS5A 1EPXA 2ZUWA 4ZB0A 1AQHA 4LYPA 1YDNA 3W2NA 3W1TA 5TNVA 2VZSA 5LNVA 1FDZA 4UFMA 4J3ZA 2XPKA 4Z1CA 4UTWC 3S6TA 2MUCA 2I1OA 5TD4A 3J7HA 1S1RA 4LSBA 3N2BA 1UPPA 3WQPA 3VABA 3EWDA 1IXNA 2R82A 3VCCA 3ABOA 3MVTA 3CIVA 1R3WA 4IMCA 5AOUA 1VIWA 3H2AA 1X39A 5A6BD 4FF7A 3B4UA 3AZTA 2WMFA 5JXQA 4AHOA 4I6VA 4N4QA 4UXDA 4MB4A 1VEPA 4MJMA 4JYFA 8TIMA 1VFOA 5FD0A 3CUGA 2QCDB 1E4NA 3VD4A 1XIEA 1CGXA 5TF0A 1XLHA 3WLOA 1JD7A 3KTCA 1Y5XA 2C14A 3OU8A 4GE8A 3EX6A 2VGGA 1EYEA 4Z17A 1KW1A 3CHCA 4X9SA 2ZDRA 4ZOCA 1TTIA 2Z0IA 4HJWA 4W9TA 4IWWA 1FCVA 4KW2A 5FA5A 2J7EA 1G67A 1R3SA 9XIMA 1L8PA 1CXEA 4S38A 1H50A 3HQNA 2YYUA 1XD1A 1X1NA 1US0A 5G4HC 2GJPA 2G4FA 4U10A 1QOQA 4DEFA 4HMEA 1WDQA 5BWFA 2NX3A 2RDTA 1A0DA 5TBOA 4P7RA 1EDTA 1A5CA 4B16A 3OQEA 3TJXA 3R6IA 1UA3A 3LU2A 4D8AA 1UUMA 2A7RA 3EOSA 4H7ZA 2XWEA 1MZHA 7TAAA 4DQWA 1B9BA 5DFAA 1JUBA 1G7UA 3O16A 1A5UA 2UY4A 3C3NA 4W8AA 3R0KA 1M5WA 1DBTA 4PRWA 4URIA 4PZVA 1UP3A 5D38A 5D8WA 4K39A 4KWOA 2E9BA 4OVXA 2RGLA 1S39A 3UWQA 3CM4A 3KBNA 5AYZA 3N4AA 1LOSA 5CEWA 4LY4A 1JZ3A 3LCFA 1RLCL 2FB2A 3W7DA 4F2BA 2PWVA 3NQFA 2PTZA 3MCMA 1D7KA 3HPFA 5FF4A 2QV4A 3NL3A 3HA1A 3CHEA 2H9AB 5HNTA 3P81A 3P74A 4LU0A 1KM5A 1EA9C 3D6NA 3A4WA 4US6A 1UR4A 3K46A 4KBXA 3GBEA 1OQFA 5T8GA 4CCEA 3CO8A 1F05A 2FDSA 3SIMA 2PDIA 1MQRA 3UR2A 3T09A 4F79A 1ECEA 1WDDA 5LSMA 3H7UA 3UQNA 4Q4OA 4FOUA 4JOMA 3DECA 3GYEA 5U7SA 1CGTA 3LHYA 1J79A 2DFAA 3POCA 4LOCA 3NDZA 3VFCA 4EK7A 1LQ2A 4CQCA 4UR9A 1EA0A 4WD0A 4WOQA 3ZO9A 3EB3A 1TVPA 1NFGA 1XRTA 2Z4GA 1VBJA 1IF2A 1K7EA 4GA8A 4HN8A 2PRLA 4C1LA 1TQXA 3TMLA 5D2TA 4JIQA 3LGDA 4B4HA 3W85A 2OFJA 2XFFA 2W61A 2Z27A 3LMYA 1JAKA 1E1EA 2OEJA 3GO2A 1XIDA 2GDUA 3W1MA 3W7CA 1JZ5A 2PMQA 4JN8A 4LNCA 1P7TA 2EJ1A 2Z1BA 3F5KA 4R27A 2DV0A 3P62A 3K5XA 1TWDA 4DJFD 4UTKA 4HMCA 4PBGA 5JBEA 3LN3A 1W9UA 1E0XA 4DUOA 3AAMA 3TA9A 1GVYA 4GBDA 3EDJA 4FALA 3NYZA 4W86A 2Y8UA 2XFYA 1VGAA 4IIGA 3B0VC 2VUNA 1VJIA 1W8SA 1LBLA 2VFDA 4HA1A 3VIKA 1WNOA 1ZJHA 4NZ1A 3A9BA 2CKRA 1XYFA 2P1FA 3KVLA 2QAFA 1CGWA 5C55A 3HTWA 2G3NA 2V69A 4L9XA 3W27A 4S3KA 3VNDA 1EFZA 4OFCA 4A3YA 4MJ2A 4CN4A 1J0YA 3C3UA 3QFWA 4W93A 2YCKX 5AVHA 2QCMA 2IPJA 5C2GA 5I0DA 2OKTA 2OO0A 3IGXA 4DJDA 2F6UA 1E71M 1TJ0A 4S3AA 1V93A 5AYIA 3OZPA 2GUYA 2Y5EA 1VENA 2BXYA 2I9EA 4YIWA 4UNLA 3FJ4A 3CZKA 3P5ZA 4NZJA 1W3NA 2WK2A 2OU4A 3K2GA 4FX6M 2QCFA 2WSKA 3L4XA 1TPH1 1O1HA 1LROA 4E8DA 2VYOA 1B30A 2A5HA 4WDXA 3NL2A 4NP7A 2YX0A 1HIZA 1M41A 4Q8PA 3II1A 1XLEA 3DAQA 3I7SA 5EU9A 3KOWA 3EWCA 1UZDA 3KE0A 5EMJA 4QCFA 4JTHA 3WMCA 2ZRUA 2Z29A 3N2XA 3CC1A 4OOZA 3EXSA 4IP4A 1UZ4A 3OLIA 4FO4A 4HTYA 2CHOA 3LTYA 3TFCA 4D72A 2OWXA 1C8XA 1KV5A 3ZR4A 2YBTA 1DHPA 3KBMA 4HA3A 1VBUA 2JALA 1LOQA 1ZALA 4B5TA 3WBWA 3UWVA 1W31A 2XWDA 2XU2A 1MW3A 3L0GA 1LL6A 3R11A 4Q8VA 1MUWA 2DSVA 2VM8A 3WDRA 1XISA 4X60A 4A8LA 4G7EB 2JEPA 3QGAC 1A5KC 1OFEA 2QDHA 2ZE3A 3PWAA 3NO3A 1RY0A 2NX1A 3BSGA 3LI1A 4OTKA 3LV6A 3M5ZA 3H7RA 4NJKA 5J5DA 3TYEA 1KRCC 5AHEA 4WCJA 3CHDA 2WNNA 2IMRA 5E0CA 2BGSA 1VCVA 3T6CA 4QE1A 3IJ9A 4GPNA 4QROA 3W6YA 3W07A 5ABTA 1ONWA 1KBIA 2EGZA 3N2TA 2XINA 3H54A 3GVWA 3E9AA 1MUCA 1QNOA 3NG3A 2ZIDA 4JKMA 3AWOA 5G4EA 4EAYA 2NWSA 4NYYA 3NQDA 3ES7A 5K9XA 4RNHA 2XDFA 1IT0A 5E0FA 5CZKA 3STEA 3TLQA 3QY6A 2GJRA 2WMKA 1LUCB 2ZRXA 2OG9A 2V3EA 1BWLA 3HQ1A 3TC7A 3DKLA 4KRUA 2C3ZA 3I3EA 3A22A 3WN6A 1XYZA 3W37A 5HK4A 2ZUTA 3PULA 3L68A 4AC7C 4U3AA 2Y8VA 1TJPA 1MYRA 1BKHA 4O1EA 2W92A 3Q37A 4FOJA 4KWVA 3E0VA 1XIHA 2WMIB 4QJ5B 4HU8A 2HS8A 1O4UA 2R6OA 3ZJKA 2GSEA 1SMAA 4XTIA 3PBMA 1VRDA 2JF6A 1X96A 2PU1A 3K8LA 4Z0SA 3S2NA 1ZRQA 2ISSA 4ZL1A 1FWDC 1XI3A 2JF7A 1XLFA 3RJYA 4KCTA 1NM9A 4NJIA 4WZHA 2OYLA 1F76A 3ZZ1A 3E6EA 4WK9A 3RO8A 3GXNA 2FQIA 2L5HA 4ES4A 1BYDA 4S3FA 2H3BA 1OFPA 1ITXA 3QV9A 3N12A 4BF5A 5LA2A 2A3BA 4O8RA 3S83A 4ZR8A 3WBXA 2WZEA 3W72A 1REQB 3RR4A 3FAXA 4AVOA 3GU9A 1QT1A 3V0TA 5F4SA 2GYIA 2PGEA 3CT2A 3W3OA 3NQGA 1I4NA 3AIBA 4WHBA 2HQAA 2J77A 4MG4A 3FDKA 1E4MM 1F6YA 2OLHA 1UH4A 3APTA 3WLLA 4I9TA 1TZ9A 4PRRA 1OFDA 2E6FA 3KBJA 2OZ3A 1JPIA 4TR9A 3RRAA 1GTHA 1LWJA 3FGCB 5LIYX 1WKDA 1VP5A 3O15A 3S1VA 1YE6A 2EO7A 3QBUA 4UCFA 3ARZA