3WDQA

Crystal structure of beta-mannanase from a symbiotic protist of the termite reticulitermes speratus
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
330
structure length
329
Chain Sequence
QDWNISSSPVTPSPSAGAQKLYSFLVQNFQKKIISGAMTLQGGDESAQTKEPDWLQQNAGHRPALVGLDFFQTGKGEEWYYNDSRFSKQVVNGAKSYWQKGGIPALCWHWRDPSKDTDAFYSPSSGNSATQFDADQAVKSGTAENKAILQDLAVIADQLQDLRDAGVAVLWRPLHEASGKWFWWGYKGADALKKLWKIEFDYFVKERNLNNLIWVFTAGTPIEGIADWYPGDDMVDVIGMDIYATQGDHATQQDYFNQCKSIFKGRKIVAMSECGSVPEPDLAAPWSFFMPWYNNYCIPEGSNPYNSLEFWKKTMSSSLVITLDNMPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-mannanase
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Family 26 beta-Mannanase from a Symbiotic Protist of the Termite Reticulitermes speratus
pubmed doi rcsb
source organism Symbiotic protist of reticulitermes speratus
total genus 118
structure length 329
sequence length 330
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wdqA00
1V6YA 4L4OA 1XH2A 2G3MA 2O9OA 2XHYA 3F5LA 3WN6A 4UQ9A 4E2OA 3B9AA 5A6KA 1CXLA 5GPRA 2VVNA 4HTYA 4PSPA 4A4AA 1UG6A 4ATDA 1OGSA 1J0ZA 1C93A 3WUGA 2VJXA 2X1IA 3FN9A 5GQBA 4ZE5A 4UOQA 1CLXA 4NSBA 4GI8A 2WVSA 1Q6FA 2CBJA 1CENA 4J3TA 3SCWA 5HNNA 1UR9A 5GNYA 3VIPA 1WO2A 1RD6A 5TD4A 5BWFA 1UHVA 2G3NA 4LYRA 5I2UA 1CIUA 1E6XM 3W24A 3WQVA 1Q4NX 4OOUA 1QI4A 2WC7A 3UERA 1EQPA 1V6UA 3AS0A 1K9EA 2GUYA 1HIZA 5I23A 3GNOA 5CGTA 1VF8A 4Z2IA 1U2YA 4GZEA 3AI0A 3CLWA 4HA4A 1HT6A 2EPOA 3WELA 4GIAA 2QF8A 2VQTA 2OYMA 1ISWA 1BLIA 3L2LA 1VFOA 2D0GA 1KWGA 2VRKA 5A95A 1XC6A 5A8PA 1ISYA 3VGGA 3AXXA 3ARUA 3CIVA 2XGIA 2IXUA 4BQ5A 2VUYA 3F4VA 3QOKA 2XVPA 1LL6A 2DT0A 4ZFMA 1V3HA 1W1TA 5D9PA 2VVSA 1CEOA 3WEMA 4OZOA 1E56A 2CETA 1ESWA 3TONA 2WCAA 2DSZA 4H8VA 1GQJA 2BS9A 5FL0A 4D71A 1WPCA 3M46A 3ZT6A 1UD6A 2WWDA 3TTSA 1UQZA 3AMDA 3VIKA 1EA9C 1Q6GA 1HKJA 2W62A 2CEQA 2GJRA 3N9KA 4KH2A 3BGAA 4CVWA 5BXRA 3VIJA 4HMEA 3VIMA 4MB3A 3CHEA 4AIUA 3DHUA 3EDKA 4QAWA 4Z2GA 4MTVA 4JFUA 3ZR5A 1ZL1A 4MB1A 1V3IA 3ZT5A 4CCCA 3ARTA 3MSGA 3TOPA 2CHNA 1JAEA 2Y4SA 4U33A 2W4XA 1EO5A 1HL9A 4J3UA 3VNYA 5BXPA 5A94A 1F4HA 3A47A 4J28A 2OSYA 2WMKA 2NW0A 4U31A 3SUWA 4JFVA 4MJ2A 3WF3A 1BSIA 5BXSA 1OD8A 2VT0A 4CD6A 2AMGA 3THCA 3GNRA 1BTCA 4M8UA 1FA2A 3AS3A 4M81A 4WF7A 2EO7A 3WDRA 1OIFA 4KWUA 1D2KA 2Z1KA 1Q6DA 3MUIA 1M04A 1OT2A 4PBGA 1H49A 1PX4A 2YL5A 2J7DA 5DEZA 1VJZA 4H8UA 4E4PA 1XD1A 2WHMA 3AYRA 1K9TA 1WDRA 4J3XA 2CYGA 1E5NA 4A3HA 5CZKA 1BGGA 4EK7A 2J4GA 1WDSA 2QPSA 4W86A 2PI6A 2YDQA 4AMCA 3T2QA 1QNRA 3BAWA 1R7AA 5A8MA 3KL0A 1M53A 1NOWA 4CU6A 4CUCA 3ZMRA 3IAPA 4AZGA 1JZ4A 2UY5A 3GTNA 1LL4A 8A3HA 3AIVA 4NRSA 1LWJA 4Z2LA 1Q6CA 2FH8A 3WD2A 1KCKA 1PBGA 5A2AA 3BAJA 5DO8A 3W37A 4AEEA 3CUFA 4LPCA 4OUEA 1JAKA 1X6LA 1BYDA 4OKDA 1F4AA 3HN3A 2W92A 4AD4A 4PMVA 4BCEA 1MW2A 2DQXA 4Y7EA 4CD8A 2J7BA 4AZBA 3EDFA 2JF6A 1LQ0A 2QMKA 3I3EA 1NWUA 2Y8KA 1VEMA 4S3JA 1V03A 5A8NA 2YLLA 2D3LA 1QI5A 5FIPA 3EYPA 1E6NA 1G9HA 4NI3A 2OWXA 1UWQA 1IZJA 2BVYA 3POCA 4TX8A 4K68A 2OLHA 3SUVA 2VQUA 2J25A 5CPQA 4W88A 3W27A 3AXIA 1V08A 3W0KA 1WZMA 3WF2A 1UR8A 4KGJA 1JF6A 1QI0A 4ZEPA 5LA1A 1MQRA 2YDSA 1VJSA 3CHFA 5CLWA 3TP4A 3OIHA 2V3EA 3RDKA 2Z1SA 2ZX6A 4HZ6A 3ZJ6A 2YL8A 7A3HA 4AD3A 3VM5A 1CGVA 2Y2WA 1V0LA 4L4PA 5ABFB 2YJQA 3FXYA 1CLVA 5I24A 1FH7A 1UR4A 1W91A 1LLOA 1NWSA 1JD7A 3GXDA 4HZ8A 2BFGA 3VGEA 1UZ1A 4X9YA 1UWTA 1LF1A 3OG2A 3ZM8A 3MMDA 3PTKA 3WKZA 3VGHA 1ODZA 4J7RA 2WVTA 1XYZA 1G1YA 3T0AA 1IZKA 2Q8XA 3AHYA 5ABFA 3EMQA 3UESA 1HL8A 3SCVA 1C8QA 2WB5A 4MADA 1X1NA 5DT5A 3VDHA 4LGXA 1JI1A 1W2PA 2XFFA 3EMZA 3WF4A 1GVIA 2VZSA 3SUTA 1UZ4A 5I78A 4W5ZA 4C7DA 3AS2A 1TVPA 4UFIA 3GXFA 4CD5A 3AISA 5A1AA 3OGRA 4JCLA 3SCRA 5A6MA 4AZ5A 3MO4A 1KXHA 4Z2KA 1ZB5A 1DWFM 3BC9A 3WH8A 4M29A 1EDGA 3VILA 4HMDA 1QVBA 4H7VA 5I79A 2DSVA 1CECA 2D0FA 2D2OA 3A4WA 3SCSA 5A2CA 4D6FA 2VMFA 2WAGA 1CGXA 3VUPA 5EMYA 3W28A 2GDVA 4W8LA 1D3CA 4W85A 4LQ1A 3D5HA 4DM2A 1JZ7A 4J3SA 1G5AA 4LX4A 2E0PA 3RJYA 4TXEA 2WHLA 2WLZA 3AIRA 2BY2A 1NWTA 1FP9A 3CPUA 1UWSA 3PTQA 1V6WA 1HJUA 4YN5A 5ABGA 2DSUA 3WQWA 1UR0A 4P7QA 1KXQA 1QI3A 1UR1A 4PMYA 1UD8A 1UUQA 4GI9A 3U5UA 1XHGA 2ZWZA 5A3HA 3II1A 3SCOA 4NZCA 3WY1A 1TFVA 1GOMA 4KRUA 2YDRA 1R85A 4GQRA 4PSRA 1FHDA 4JHZA 4PMUA 1XRVA 4BS0A 2DIEA 1MWOA 1R87A 2DDXA 2ZX9A 3AIUA 1B3WA 4UQCA 1HNYA 2XM1A 2FH6A 1ZJAA 4D6CA 1QHZA 1VENA 1SMDA 1XYFA 1OIMA 3DC0A 1MW3A 3VD3A 4AEFA 3QR3A 3QHNA 4MDOA 2J62A 1TR1A 2XM2A 3GBDA 2HVMA 1K9DA 3UG5A 2CBVA 1ISVA 3VOCA 3WF0A 1QPKA 4M24A 1V0KA 4GKLA 1UKPA 4QCFA 3OLIA 3AS1A 1BHGA 3VD5A 3RM9A 1BVZA 3GBEA 4UFLA 4B9YA 4PMZA 1NP0A 4HA3A 4XB3A 3THDA 1CXIA 3SURA 2CHOA 4BZYA 4FLOA 4F8XA 2GSJA 1AMYA 4UOJA 1CGUA 3ARSA 1B30A 1DHKA 3DYMA 1E15A 2WC3A 1Q6EA 4CN4A 1ODUA 1BYAA 3ARVA 1E4IA 2FDMA 4JKMA 3IJ8A 4ACZB 4TUFA 1OGBA 2J78A 2CBIA 2XSBA 3M07A 4MB4A 4CCDA 1QW8A 2X09A 4TOQA 4AIOA 2EPLX 2QMJA 1VEPA 4P7LA 2CITA 1JYXA 5CXPA 1DWHM 3AICA 4ACZA 1FFRA 1W3LA 2G3IA 5E09A 3RILA 2DT2A 1B3VA 1B3XA 1BPLB 1EXPA 5D9NA 6CGTA 1CXEA 2GDUA 5FKYA 3N17A 5C71A 4B3KA 2VR5A 2F8QA 2WZIA 2AAAA 5D9OA 3UG4A 1E6ZA 1W9DM 5GNXA 1ZBWA 2E3ZA 3LPGA 2O9RA 2DSWA 1W9UA 1B2YA 2J74A 1J01A 1TA3B 1W2VA 1JI2A 4F66A 4PRWA 1UWRA 1CWYA 1WP6A 2FGZA 3WSUA 5A6BD 5HOSA 2W67A 3WEOA 5FL1A 1V0MA 5IHSA 1XD0A 3PZNA 1LG1A 3NUKA 1XCWA 4UTFA 3VX1A 2BVDA 2YA1A 3N18A 4B9ZA 5A8OA 1TA3A 2VI0A 5HPOA 1UQYA 1GCYA 2VOTA 3M6DA 4AC1X 2PWGA 4PMOA 2X2YA 1LG2A 5ECUA 1TZ7A 2WNWA 3BSHA 1QW9A 1W3HA 1W1VA 4JIEA 1E55A 3PZOA 3WMSA 4XZBA 2CERA 1VFFA 3VPLA 4C7FA 1PX8A 4HOZA 2WPGA 2YBUA 5A6SA 2MANA 1PZ3A 2PB1A 3L4ZA 1CGTA 5E70A 1FH9A 2G4FA 3AHXA 3L4TA 1CNVA 4NF7A 1E4MM 1OINA 1GQIA 3ECQA 1JDDA 4OBRA 5A6LA 5E9AA 1JD9A 1J18A 1TCMA 2J75A 2UY2A 4AD1A 1WAWA 2PWHA 2VX6A 3A4AA 1PX3A 3I3BA 2XG9A 2GJXB 3T2PA 4D6JA 1C3FA 4WIWA 3W38A 4CU8A 2FHCA 4UR9A 3U57A 4EAMA 1KCLA 3BAIA 3K4AA 1HXJA 3AQUA 3LPPA 1JYNA 1GNXA 1V3MA 4JFWA 1AVAA 4UQDA 3W26A 2PBOA 2GJXA 1HJWA 1H0GA 1QHOA 1SYTA 1V02E 3W29A 2E8ZA 1ZBVA 1V3LA 1QNPA 3VGDA 4WKFA 4HPGA 5HPCA 1HKKA 4UFJA 3WIJA 2J79A 4CU7A 3AMGA 1R8LA 1H3GA 1KR1A 1WZKA 2DT1A 4QLJA 4B16A 2A3AA 1IT0A 2BXZA 5KEZA 1CDGA 1QNSA 2ZX8A 1KB3A 1OSEA 1JXJA 3BLPX 4Z2HA 1CTNA 4YHGA 1GQLA 1TG7A 4CGTA 2XVNA 1HJSA 5CG0A 1YQ2A 4V28A 3PBGA 4QLLA 2JEPA 1HKMA 1NM9A 3IANA 2BXYA 1RPKA 1S46A 3N04A 3RPMA 3K8KA 1RP9A 4DWSD 1KFWA 3MUY1 2CKRA 3VU2A 2ZICA 3W25A 4W5UA 2E9MA 2WWCA 3CZGA 5C70A 1VIWA 2J8FA 1UD2A 2CBUA 3WNPA 2WCGA 3WQ5A 1JNDA 1EOMA 4D6DA 3WD3A 2W66A 1W9XA 4AZCB 2D24A 3OZOA 1EHNA 3WH6A 3ZIZA 1EGZA 1ITXA 3PZ9A 3WD4A 1E40A 1E9LA 4RE4A 1I75A 2CCRA 4W7VA 3DYOA 1ITCA 4AZCA 2UY3A 1E43A 1OWQA 3SCPA 4PEEA 4XUYA 4UFMA 3WNKA 1V6VA 3IJ7A 3CMGA 3CZ8A 3EDDA 2EXOA 1R86A 2BY0A 2VX5A 1NWRA 1W9PA 2CPUA 4HMCA 2D0HA 3WUFA 3LMYA 5I3DA 1E4NA 2WXDM 1LL7A 1UA7A 1RP8A 4X0NA 5A69A 1QNOA 3AIQA 2ZWYA 1EIBA 2Y5EA 1CZ1A 1H2JA 4IUGA 1HJXA 1K9FA 1E3ZA 2ZUVA 3L4VA 2V5CA 3MS8A 1H5VA 2WBGA 3WNLA 4IPNB 4OBSA 1UOKA 3WENA 4MNMA 4WJXA 1JFHA 1A3HA 2RGMA 1CXKA 3WH7A 2WHKA 3N11A 4FF5A 1V6XA 2XGBA 1U33A 1XCXA 3U5YA 1JNEA 2O9PA 1UKOA 5D8ZA 3RCNA 2WC4A 2JFEX 3MANA 2VR4A 2QHAA 1VBRA 3D3AA 1MXDA 3FAWA 3GXMA 4F79A 1UD3A 2E9LA 2XIBA 3AZRA 1EQCA 4IPLA 4MNKA 3ZSSA 4PTWA 4P8UA 1C91A 1G94A 4OJYA 1PPIA 1GJWA 1D7FA 3EDEA 3WEZA 2V3DA 4X0VA 1BQCA 3SCNA 3EDJA 2PF0A 3NSMA 3VTRA 1WZLA 3L4UA 2WMFA 2J7GA 2TAAA 3QGVA 2EJ1A 1V3JA 1FFQA 4F9DA 4D1JA 3WH5A 1PEZA 1TMQA 3EMCA 2NT1A 3DECA 5I5RA 3VX0A 3PN8A 4CD4A 1US2A 2DIJA 1JXKA 3MUZ1 4Z2JA 4FMVA 1J0HA 4CKQA 3N12A 4MNLA 4DWSC 3T0BA 3AZTA 1JZ8A 4J3VA 3WDIA 5FCZA 4TVUA 2QLYA 3RM4A 1P6WA 2O9TA 2E9BA 1ZBCA 1ZBKA 3W6LA 3ARQA 1CGWA 3VO0A 1DWJM 2X8RA 2OYKA 3O6AA 2OWCA 4E8CA 2RGLA 2WK2A 2C0HA 4BQ4A 2V38A 2VRJA 3WL0A 3VIFA 5E6ZA 3OLDA 2VCBA 3KEHA 1KQZA 2WKGA 3GZAA 4MAVA 2E8YA 2PWFA 5DT7A 1B31A 3T09A 3WBAA 1Y7VA 3WDQA 1CYGA 2DH3A 4FLQA 2AOSA 2XFYA 4UQEA 1J0KA 2YKKA 3MU7A 2WLYA 3CUGA 1BF2A 3WD0A 4OIFA 3FHAA 3MMUA 3GM8A 3BH4A 4PTMA 3ZJ7A 3CTTA 3AHTA 3AIEA 4ACYA 4HZ7A 4MJ4A 4IISA 4GI6A 2VNCA 1JL8A 3IJ9A 2G3JA 1HP4A 1NARA 2JF7A 1GPFA 4AD0A 1JZ6A 1BYBA 3QHOA 4WK9A 3ZR6A 4GXPA 4DUWA 1BVNP 2XWDA 4W87A 3CMJA 3PZMA 4PMQA 5JBDA 1US3A 3FW6A 2F2HA 3MKKA 1GOQA 3KWXA 1BYCA 1OM0A 1PIFA 5I6SA 1H1NA 1WCGA 4ATWA 3FNDA 1VBUA 1UKTA 3T0DA 3K8MA 2CNCA 5F7UA 3W81A 2EPMX 1G01A 4BA0A 3ARWA 3SCQA 3APGA 1NQ6A 1C8YA 3CO4A 4W84A 1E1EA 2J7EA 2ZX5A 1UD4A 4S3KA 5E0CA 2WYSA 3SUSA 1JDAA 4QCEA 1MYRA 5CLTA 3AYSA 2WHJA 4XX6A 5AC4A 1VB9A 3L4WA 1SMAA 2XJ7A 4QLKA 1JZ3A 5BRQA 3HMCA 1GOOA 4AXNA 1GVYA 1M7XA 4MPKA 4W8BA 5HBFA 2W61A 2IUZA 4PMXA 3VNZA 3RO8A 1NH6A 3CHDA 4GINA 1I1XA 2OYLA 2FHFA 3GNPA 2D20A 4RL3A 2VL4A 3IAQA 2J8GA 1J0YA 1E70M 3VIHA 4P8VA 2D3NA 2D22A 4EANA 3PTMA 3BSGA 6TAAA 1PIGA 3WQ4A 2V3GA 4H2CA 1DEDA 1L8NA 4IM4A 3VMOA 2XFRA 3MV01 1OBAA 1XGZA 1WDQA 3A3HA 2YIHA 2C8NA 2X05A 4JL1A 3NDZA 4W8AA 3O2LA 2ZUWA 4U5IA 1JF5A 1FOBA 1X6NA 4B3LA 4D6GA 1NOUA 1C92A 1VFMA 4GO8A 5CPSA 4CN1A 5E0FA 4AIEA 5D9MA 3WNNA 1KXTA 1MQQA 1TVNA 3PZQA 3ZOAA 3BCDA 1EHAA 3N1AA 3W53A 3PHAA 2W63A 2XVLA 1H09A 1KBBA 1UKSA 4CVUA 4TTUA 1JDCA 5JIWA 3OB8A 2E40A 2XVGA 4HOXA 1JIBA 2ZUUA 2EPNA 1W1YA 4N42A 1E73M 1WKYA 3AMKA 4V2XA 3ARZA 5GNZA 3OGVA 4YHEA 4TVDA 3BAXA 2BHUA 1EDQA 3U7VA 3WFLA 2DEPA 3HU7A 4KRTA 1O6IA 2CXGA 3GXIA 3OBAA 3WFZA 3QHMA 3AROA 3ARYA 1WNOA 1EH9A 3LPFA 4JKKA 4FLRA 4QFUA 4H04A 4P7NA 3AMLA 5JBEA 1H41A 2VCAA 1EOKA 5LA2A 1SFSA 2YA2A 3SCUA 4RE2A 8CGTA 1WZAA 1HJVA 1E72M 2BY3A 5A2BA 3B9DA 1KR0A 2A3EA 2YLAA 4HP5A 4ZE4A 2QV4A 3T08A 1KWKA 4P7OA 1KXVA 3M7SA 2ZX7A 1EDTA 1JZ5A 3F5KA 2CKSA 5LA0A 3ZT7A 3A6OA 6A3HA 1GOWA 5M5DA 4U5KA 4HU8A 5EFFA 3NIYA 3WQ8A 3ARPA 2XYLA 1QBAA 3NDYA 4KGLA 2ESCA 2YA0A 5EB8A 4JFSA 3G6MA 4XZWA 2YBTA 2WM0A 5A6JA 4WSJA 3JUGA 2G8ZA 4BF7A 3VDCA 3W6MA 3MV11 5IXEA 3E1F1 2EQDA 3SUUA 3OLEA 2GK1B 4ML4A 5IFPA 3FAXA 1W1PA 2EPKX 4EKJA 1BAGA 2VX4A 1RH9A 1DP0A 1MFVA 3W82A 2A3BA 3OA5A 2HISA 2A3CA 5HDRA 4MB5A 3GH4A 3NJ3A 3WNOA 3WH9A 1E6QM 5C8BB 1LWHA 5ABEA 2FHBA 2GK1A 2J7HA 3ALFA 4AY1A 4DUXA 4D6HA 1B90A 4UFKA 4PMDA 2VZOA 1R7OA 4UQBA 1V3KA 5M03A 4PMNA 2BVTA 5AYBA 1UKQA 5EFDA 1GOKA 2ZOXA 3VIGA 2BV9A 2PWDA 1HVQA 2DSKA 3K4DA 1JZ2A 4OOZA 4Q22A 3EBVA 1K6AA 1N82A 2DGAA 3VD9A 2WSKA 1ZS2A 2WZEA 5BRPA 4R5EA 1UWUA 4JZ5A 3KE0A 3S2CA 1E5JA 3AHVA 4DM1A 3WBEA 4HA1A 1NOFA 3WNMA 4AW7A 4UNIA 1FP8A 4CCEA 1HX0A 1UH2A 2NSXA 1DTUA 1JG9A 4D72A 4WSKA 2VRQA 5BYWA 4CN6A 1G0CA 4AISA 2WVUA 2D1ZA 3J7HA 1O7AA 3S6TA 2WVVB 3RMEA 5CSYA 2OSXA 1M01A 3L2MA 4P8XA 3LPOA 4URIA 1B1YA 3VDBA 4H8HA 2YOCA 4R27A 2VCCA 2V5DA 2QPUA 1E3XA 1GJUA 2WVVA 1J11A 2FGLA 1VFUA 3B9EA 1MQPA 2C7FA 4A3YA 3WDHA 4FK9A 1KGWA 2VZTA 2WSPA 1H11A 2PWEA 4NRRA 4GPNA 2ZUSA 1DWIM 1WE5A 2BNJA 3WDJA 1AQ0A 3VMNA 2DPEA 1GHSA 1W32A 4AD5A 1H4PA 4ATLA 5IHRA 2GVYA 2BHYA 4PYSA 5AC5A 3ALGA 3CZJA 3BCFA 4TTGA 3WMCA 4QP0A 5BXTA 1UYQA 4RE3A 1HKIA 4LYQA 1OCQA 4F9JA 1YHTA 3WF1A 1Z32X 1W3KA 2X0YA 2YL9A 3RIKA 1J12A 3N13A 3W4RA 4AZ6A 3GH5A 1E0XA 2BY1A 2ZIDA 1DWGM 3F5JA 3WQ6A 3PZIA 3WL1A 1C90A 2ZXDA 3I3DA 3B8SA 2F61A 3POHA 3IK2A 4M80A 1XSIA 3NCOA 1UH3A 4AYSA 4PUDA 5A8QA 1ISZA 4AZHA 1PAMA 4BQ3A 4W93A 1PZ2A 2ZXQA 3VD7A 4KMQA 5IFTA 2J77A 1B3YA 2ZXAA 1EO7A 4P8WA 5BROA 2IXVA 3K46A 4D1IA 5HXMA 1AQMA 4MAZA 1E1FA 1W9VA 1XH0A 2VZVA 4PTXA 1J0JA 1MW0A 3ARXA 4U3CA 4GO9A 3CUIA 2OSWA 1AQHA 1OB0A 3MSDA 1CXFA 4J27A 1W9BM 4EE9A 4FLSA 4D6EA 2W91A 4CD7A 3UG3A 3TTQA 5CQ1A 4W89A 4ZXLA 5A6BA 4AD2A 5BCAA 2G41A 3AOFA 3NSXA 2ZE0A 3T2OA 1MW1A 1C8XA 3VGBA 4P7RA 3UR8A 1CBGA 3FY1A 4UQAA 4LXFA 4PCSA 1V0NA 1GZJA 3SCTA 1HVXA 2UWFA 1IV8A 1GORA 3AHZA 2A3HA 3VD4A 2XTKA 3KZSA 3WUEA 1C7SA 3VGFA 1E4LA 2W5FA 3OGSA 4M82A 3OLGA 1VRXA 2VO5A 4LYPA 1KGXA 2WMJA 2XSAA 4TVCA 4BQ2A 3WDPP 2WKLA 1UR2A 1BFNA 3ZJKA 2BHZA 5E6YA 1QOXA 2XUCA 3TTOA 2J7FA 3CZKA 5CSUA 4HPHA 1LJYA 3ARRA 2GFTA 3PZVA 4GQQA 3VINA 7CGTA 2DH2A 3CHCA 4PMRA 3UETA 3K8LA 1TE1A 3VIIA 2EEXA 7TAAA 4ZXOA 3AZSA 1VEOA 1E6RA 1E6PA 3U7BA 1OD0A 2DT3A 3NSNA 3AFBA 4AWEA 1HJQA 4Q7NA 5JUVA 1L0PA 2JALA 1BG4A 5AY7A 1B9ZA 5LYRA 4YPJA 1ISXA 3VM7A 2VURA 1H0IA 2WZHA 2O92A 3CGTA 1GQKA 3HJEA 5M3WA 3AIBA 1ECEA 2ZUTA 2J47A 4JHOA 5I0DA 3BLKA 1E71M 5DMYA 1UA3A 4M1RA 2Y8VA 3K1DA 2WCSA 4MNJA 4JCMA 1OT1A 4D6IA 2PBGA 2UY4A 1HN1A 2Y24A 3VIOA 1FHLA 1W3JA 1CXHA 3AIWA 3PZTA 2YL6A 2WMIB 4ZENA 1GHRA 1XSKA 3UCQA 3GDBA 1QI2A 3AXHA 4AZIA 1VAHA 3WD1A 1CPUA 4WKAA 1E6SM 4QDMA 3TTYA 1GUVA 4PUEA 3PZGA 4N0RA 3BXWA 3MMWA 3CUJA 1B0IA 4DWSB 4U2ZA 3BMVA 1NP2A 1E0WA 2WMIA 4H41A 3CBWA 2E4TA 2VC9A 2D23A 4U3AA 4B15A 1E0VA 3KL3A 2XPKA 4GZJA 4JFTA 4HOWA 4AZ7A 4DWSA 1GONA 3UEQA 3ZJ8A 1UD5A 4MDPA 3SEPA 1JGIA 1TUXA 3WUBA 1JFXA 5EBAA 3ZQ9A 4M56A 1J9YA 5I77A 2WMGA 5A6AA 2JIEA 4WKHA 1ZJBA 2WMHA 5D8WA 1UWIA 1KQYA 5IDIA 2OWWA 1B3ZA 1BGAA 1J0IA 3PZUA 2EBNA 3CZEA 2XVKA 2ZUNA 4W7WA 2VX7A 4C7GA 1BG9A 2J7CA 1OGGA 2JIWA 1KBKA 5FOOA 2VTFA 5CGMA 4TX6A 1PJ9A 1ZU8A 3KL5A 4XV0A 3N15A 3O9NA 1GOIA 3VVGA 3OZPA 2WW5A 1HP5A 2V3FA 2B31A 2ZUMA 4DUVA 3BMWA 2GJPA 1SR0A 3DHPA 5AYIA 1I1WA 3DYPA 4UZUA 3ZSTA 1JYWA 5KZ6A 2WBKA 4U2YA 1HF6A 1MVYA 5CJ5A 4WLCA 1U30A 3WMBA 1XV8A 5CPTA 1WDPA 4PCTA 3RM8A 3ZO9A 3SIMA 1JYVA 1UH4A 4W7UA 4JKLA 4HU0A 4PN2A 1GW1A 9CGTA 1M03A 3TA9A 1FH8A 4J3WA 4JAWA 4UCFA 3VKKA 2CIPA 2XWEA 3AMCA 1C7TA 3FHQA 2JE8A 1DWAM 3G6LA 1QBBA 3NYDA 5FD0A 5D4YA 2XIIA 3GYCA 4GZIA 5JBFA 3GH7A 3VMPA 2WANA 4E8DA 1MXGA 1QHPA 2CESA 1A47A 2ZXBA 4V27A 3BAKA 3A4XA 5DFAA 3QOMA 3UR7A 3VDAA 3CUHA 5DF0A 4JL2A 2NT0A 1QNQA 1CGYA 3CZLA 4PTVA 4UFHA 2JEQA 3RJXA 2X0HA 4UZSA 1J10A 3L4XA 1KGUA 5ABHA 3L4YA 3CH9A 1WB0A 5JIPA 1V02A 3BAYA 1XH1A 1MFUA 3MUAA 1XSJA 2VZUA 4UOZA 5M17A 3AJ7A 2PC8A
chains in the Genus database with same CATH superfamily
1CT5A 5FSEC 2O9OA 3F5LA 3WN6A 4UQ9A 4E2OA 1SFJA 3B9AA 2ZRVA 4QTGA 4TR9A 3PFRA 4GH3A 4O1CA 1RA5A 3ICJA 2R6OA 3S0CA 3IVUA 3TYDA 1TJ0A 2PDXA 1BWKA 3LXCA 1J0ZA 2QZRA 3CT2A 1Y5XA 1WYIA 4TMCA 4GI8A 1CX9A 1CENA 3A24A 1EBHA 4O8AA 3HG3A 3HQNA 1Y5VA 3BLOA 3DC8A 5BWFA 1UHVA 1XIHA 4CNTA 3GTXA 1FXQA 1RJQA 1Q4NX 5K9XA 4OOUA 2XDFA 2WC7A 1RCXB 1EQPA 1BQGA 1NIUA 1V6UA 2MNRA 1PWLA 2PDGA 1X8CA 5CGTA 1VF8A 1XF0A 1VJIA 3SQLA 4INFA 1J6OA 3CLWA 3UGVA 1HT6A 4NNBA 4GMEA 4GYFA 3NZRA 2EPOA 4GIAA 4Q3MA 3P8JA 1ISWA 2OOFA 3SRHA 1BLIA 3L2LA 1VFOA 2VRKA 2E67A 4Q8PA 5BRBA 5A95A 1EKOA 5EYWA 3SM0A 4FO4A 3VGGA 4JYEA 4FP1A 4OHQA 2VUYA 3F4VA 3W01A 3FDGA 4IH3A 3NQVA 3IK4A 2VVSA 4OZOA 4FF7A 2WCAA 4HPXA 2ICSA 2DSZA 3RITA 4Z08A 3R94A 4D71A 3W71A 1EP2A 3EWWA 4IGSA 2PP1A 3UWUA 3N9KA 1AL7A 1DQUA 3VIJA 4HMEA 3N3MA 2QVHA 4Z2GA 4MTVA 3W7QA 2NQHA 1TYGA 4IIEA 2INEA 3MSYA 4AMAA 1ZL1A 3S9IA 4MB1A 5FSDC 3LRLA 3ARTA 3MSGA 4EPBC 2ZZ7A 4E2DA 1JAEA 1EO5A 2YBVA 5G1MA 2E6FA 3W2LA 5K4ZA 4H2HA 5EMMA 1DJQA 2GVGA 2ZVIA 2NW0A 2G0WA 3SUWA 3HPSA 3EWZA 4RR4A 3WF3A 3G1HA 1JCMP 1S1RA 4Y6GA 3EXRA 3NOEA 2WZTA 1BTCA 4GVHA 2YZRA 2E5BA 3PSWA 3L2IA 3M0YA 3AS3A 4M81A 3NAVA 1BRLA 1FDZA 3WDRA 3M7WA 5U7SA 3C0QA 1YIXA 3N6JA 3N2CA 3HB9A 1L2QA 1TJPA 3FOKA 3NPVA 3MUIA 3D6NA 3EPNA 3L5LA 1H49A 1PX4A 4OV9A 2RJGA 2YYUA 2UV8G 1JCTA 2YL5A 3FYYA 2FLIA 3C0LA 4H8UA 2V9DA 2WHMA 5AKQA 3LCXA 3N73A 3EOEA 1E5NA 2Z7KA 3SN1A 4A3HA 5CZKA 1BGGA 4DXVA 1FQ0A 4W86A 2PDKA 4AMCA 3UQNA 1UP3A 4MWAA 4HB7A 5HA7A 4Q6XA 5IRPA 3AUOA 5A8MA 3KL0A 1T99A 3TDFA 1NOWA 4V15A 5D2VA 3ZMRA 8XIMA 1QMLA 2UY5A 5I3GA 4NRSA 1LWJA 4C60A 1Y65A 4JICA 2G95A 1GT8A 3DFNA 5A2AA 1L6GA 5DO8A 4X9SA 4IPPA 4O1EA 1RHCA 3MKVA 3FVDA 4OUEA 3CJPA 1X6LA 4AD4A 2W92A 3OTRA 4BCEA 4E3VA 4MPQA 4WXYA 4Y7EA 4RV8A 2FMOA 2VUNA 1TRIA 4IFKA 2ABBA 3S4TA 1E6NA 4ADSA 4NI3A 1UR3M 3FEQA 1FXPA 3OP2A 4TX8A 4Q4MA 3EX1A 4K68A 2OLHA 4M7TA 3WF2A 2OVLA 2DVTA 4EXAA 1RBOB 3SFKA 3SI9A 1VJSA 5CLWA 1Z41A 1I2RA 3RDKA 2HWGA 1OFQA 3DOPA 2YL8A 4GABA 1WOBA 1R2SA 5EMJA 1LLZA 3PBWA 5HMFA 4Q7IA 1FH7A 1UR4A 3QV9A 2MUCA 4HZ8A 2BFGA 3WQGA 3LSBA 2NVCA 3BOXA 4BK9A 3UD6A 3MMDA 3PTKA 2PZNA 1ODZA 3W00A 5KZEA 3LCWA 1PV8A 1U83A 3R6IA 1NDWA 1EFZA 1G1YA 3T0AA 4L9ZA 3AHYA 1S2VA 3EMQA 4DF1A 4Z1YA 4NX0A 1ZY9A 4KEUA 3GVVA 3BMXA 2XFFA 2BDQA 2RKXA 2VZSA 3PULA 1UZ4A 3M0MA 1RVKA 4XVDA 5CAKA 3W86A 4UFIA 1K7EA 3GXFA 3MHUA 1NELA 2PU0A 3LB0A 3SCRA 1QDSA 2V63A 2A7PA 4L1XA 4Z2KA 3CAKA 3BC9A 4GQ0A 3UBPC 3QV8A 3VILA 4HMDA 3G77A 2IPJA 2X1RA 4HPNA 2PRLA 2D0FA 4TV6A 5T9BG 2VFIA 2D2OA 3SCSA 4L9XA 3RG6A 4G6CA 4WY0A 3VUPA 3F2BA 5T26A 4FXSA 4W8LA 1IR2A 3QTPA 2J8TA 4DZ5A 1D3CA 4W85A 3D5HA 3GR8A 1Q63A 3WO8A 3IPWA 1G5AA 2OU4A 1LP6A 4FAMA 2BY2A 1NWTA 4GC4A 1FP9A 3TXVA 2DZSA 4GY7A 3PTQA 1NJJA 3T8LA 3C86A 4XISA 1XLEA 4Q32A 4WGHA 2VD8A 2RDXA 2KZHA 3BLLA 3W7CA 4PMYA 3WG6A 3E74A 4WOQA 4HYVA 4BHYA 1M7JA 4LWWA 2FVKA 4Q4KA 1XHGA 1OX5A 5A3HA 4G1NA 3FDKA 2QIWA 1ICQA 3WY1A 1TFVA 4NHVA 4ALDA 5H6HA 1FDYA 2YDRA 4JQ2A 3QW3A 3KS6A 2E6DA 4UTIA 3T42A 1RY0A 3ZR4A 4FX8A 4G56A 3MDUA 3IGSA 4WD0A 3C8FA 2DDXA 1QAPA 3AIUA 1OEPA 1B3WA 1W56A 1XYFA 3QR3A 9XIMA 5HR7A 4E6MA 1RCQA 3LHTA 2HVMA 1QPQA 3USBA 5I3FA 5D2TA 5HNUA 4I9TA 3VCRA 3VOCA 3M0HA 4XWUA 5CBBA 1V0KA 4UMBA 2OCZA 3OLIA 3VD5A 3GBEA 4CQ9A 2PF8A 2FDSA 4GGHA 3UXAA 2CU0A 3R79A 4UOJA 4RK8A 2HXUA 4NG3A 4CN4A 3QF0A 4S38A 3FJ4A 1E4IA 4ICMA 4LUTB 2DUZA 2J78A 4JS3A 1V79A 3M07A 4HN4A 2ISSA 2X09A 3GB6A 3EWXA 4P7LA 2CITA 3H7RA 2V30A 4R88A 3AICA 1Z3NA 5KZMA 3VKAA 5E09A 2DT2A 3INPA 1B3XA 1UROA 4GK8A 3L67A 5FKYA 5C71A 4YXGA 5D9OA 1E6ZA 5IBXA 3QH2A 4B5VA 4DO5A 4AX6A 3H2FA 3UWEA 1O66A 1P6BA 1F8IA 1W9UA 2O7SA 3ANYA 1J01A 3P61A 4UIOA 3GUWA 4X2RA 2TYSA 1W2VA 4FNUA 1O94A 2QUNA 3RCYA 5A6BD 1RQBA 5IHSA 3T44A 4RDYA 5DRCA 3WLOA 3YPIA 3RRXA 5A8OA 1TX2A 1UASA 1B54A 4H9MA 4LF2A 4CNSA 2CXEA 3GQYA 1ALDA 1XINA 4JIEA 1E55A 4XZBA 1A4MA 2C18A 3VPLA 5JXQA 3OG3A 4C7FA 1TMLA 3PUGA 2WPGA 1Q6LA 5A6SA 3NR0A 1XL9A 3P8IA 4J2PA 2PB1A 2QVNA 3GU9A 5E70A 4Z17A 1FH9A 3L4TA 3W88A 3B8UA 1GQIA 3ECQA 4LS1A 4OBRA 5EPDA 5E9AA 4DJDA 5I09A 1J18A 1HW6A 4ZQNA 5CC5A 1ITQA 2QCNA 1UJPA 2PWHA 1YE6A 5D04C 3L7RA 2OMAA 4WIWA 3LS9A 4RPPA 3U4AA 1V5XA 3EX4A 4CU8A 4UR9A 1EJUC 3V0SA 3SY8A 4H19A 1HXJA 2YSWA 2ZC1A 4QSHA 1JYNA 3LZ5A 3WLJA 1TPC1 3L0NA 4AFYA 3SBFA 4UQDA 3W26A 5CBIA 3MI3A 4HQVA 1XW8A 2Y8UA 1SYTA 1V02E 5I00A 3E9AA 1VD6A 1Q45A 1FX6A 1HKKA 3GVRA 3WYZA 4GVGA 3C3UA 1EX5A 1YRRA 4CU7A 4Y9AA 1KR1A 3OQ8A 1H62A 5EMLA 2XH7A 1IT0A 1IXOA 5KEZA 4OQVA 4HD5A 1KB3A 2V5KA 3BLPX 5J5DA 1CTNA 2Y88A 1GQLA 1FWRA 3SRKA 1HJSA 4HJWA 3LENA 1YQ2A 1ZSXA 3NO3A 3KDOA 1T40A 4KCVA 3IANA 1KM5A 4DBUA 2VC6A 3PK7A 3RPMA 4KWWA 1XR2A 5C70A 1O5KA 1L6SA 4R7OA 1JRCA 3EA3A 5BWAA 1VCVA 3ABSA 2D24A 4C6NA 3WH6A 2HVOA 4HVXA 4Q4RA 3PZ9A 3WD4A 2DZBA 3NQ2A 4EPEC 1S3HA 1NAL1 2Z29A 5HNTA 3DYOA 3LCFA 4HSOA 1OWQA 4PEEA 3P81A 2ALRA 4NZ5A 4H6EA 4I5UA 4XUYA 3G8RA 3N4FA 3CQKA 3PJWA 3SN0A 4DAFA 3CZ8A 1R86A 2ZDRA 2VEGA 1Q5MA 2CPUA 2ZRUA 1AH3A 1UIPA 4H83A 2PRMA 4O0ZA 4M51A 3BLDA 4QSFA 3B4UA 1LL7A 4ROQA 4X2PA 1RP8A 3C3NA 3KS5A 2CLEA 2Y5EA 2O7QA 1HQTA 1WKDA 3L12A 1KNWA 1K9FA 1E3ZA 5LGXA 1KTNA 2BXVA 3TYBA 2Z6IA 2WBGA 2HDJA 2RHGA 4IPNB 4OBSA 5A8GA 1TVLA 4WJXA 1OC7A 2RGMA 4L64A 4WEVX 2P8CA 3N4AA 4BKNA 3MUXA 1PO9A 5D8ZA 3S6DA 3RCNA 4IQLA 1PXGA 2JFEX 3MANA 1K02A 1VBRA 3UPWA 3FXGA 3GR4A 4F79A 2E9LA 1IF2A 1FRBA 2XH2A 2XIBA 4IPLA 4PL1A 2WSYA 4F3HA 3KVMA 1AH0A 3ZSSA 4R33A 5CEWA 5LSMA 1C91A 3NZGA 5LNRA 4OJYA 1FWWA 1O1ZA 1PPIA 3EDEA 1W3IA 2ZKMX 3L66A 1BQCA 5JMUA 3SCNA 3EDJA 3QM3A 3BUVA 2PF0A 4C6KA 1ZPTA 1I6NA 5F4SA 3PUEA 2TAAA 3QGVA 1JPKA 4C65A 3M0VA 2Y63A 4D1JA 5AYYA 3WH5A 3EMCA 3RLGA 3BG3A 3PN8A 3HJZA 3ZVHB 1US2A 2DIJA 4N9BA 5C5YA 1KCXA 3TLLA 1TRDA 3S1UA 4Z2JA 3H53A 1LORA 4P2VA 1XBZA 1T8QA 1REQB 1EA0A 2QIIA 4L80A 4CKQA 3CL6A 3N12A 3T0BA 3AZTA 5FCZA 2VELA 2EF9A 3TR2A 1WUEA 4ZB5A 3Q2DA 4DZIA 1GEQA 1PKMA 3NURA 3W6LA 1H60A 1YPIA 3R0KA 4KRZA 2X8RA 2OYKA 1ZNNA 1YTEA 1XBYA 2H8ZA 1XYBA 4E8CA 2RGLA 3MTWA 3NL5A 3K13A 4K8EA 5MKGA 4UTJA 1X6UA 4BQ4A 2V38A 3WL0A 5E6ZA 4TIMA 2F6KA 1AD1A 4R34A 5DY2A 2OFJA 3A9IA 3GXPA 5DXYA 2VOMA 1MO0A 1XLBA 2XFYA 3RLVA 3CUGA 4IFOA 3VK5A 1BF2A 3WD0A 4RW3A 3MMUA 3BH4A 3E0WA 4PUKA 2PP3A 3A64A 2C91A 1TKKA 3LV5A 4JQ1A 3KRBA 1GPFA 4YLWA 4GXPA 5I02A 4DUWA 3PPGA 2XWDA 3PZMA 4IIDA 2RDTA 4PMQA 4ZOCA 1S5TA 4ILSA 4YS1A 3TR9A 5I6SA 4ATWA 1UKTA 3V5FA 4CEUC 3K8MA 3B97A 2EPMX 1KBLA 4BA0A 4LY8A 4KCWA 5K9DA 1NQKA 4IMGA 4W84A 1E1EA 4JTEA 3TCEA 1UD4A 3N6HA 1D3HA 3LGDA 3SRFA 3C5QA 1KM2A 1A80A 3ABQA 3JU2A 3AYSA 1ZUAX 1SMAA 1JZ3A 1EB3A 2PDWA 3GDKA 2Y85A 4MPKA 3RPDA 1W37A 5FF2A 5HBFA 2W61A 3RO8A 1NH6A 2FHFA 3CWNA 3GNPA 4Q8NA 2D20A 1R46A 5DANA 2J8GA 4YTQA 2VEIA 4P8VA 1GVEA 1PZ1A 2D22A 1JCYA 4NIRA 1G69A 4KT2A 3IIOA 3EA2A 4X60A 4H2CA 1V93A 1L8NA 3MV01 2P10A 2XGZA 4JL1A 4E38A 5CPLA 3O2LA 4U5IA 2ISDA 1GYLA 3VNJA 4PCFA 1VPXA 1VZWA 3AC0A 2JBMA 5F1VA 3GRIA 5E0FA 4JTDA 3WNNA 4HK7A 3BCDA 4REQA 3UY8A 4WJEA 4QS5A 1JCNA 3U0HA 4TTUA 1JDCA 3NQMA 3I68A 2XVGA 4HOXA 3M44A 1JPHA 4N42A 3AMKA 1DXFA 3ARZA 3IGUA 4C6MA 1ADOA 2PDJA 2F9RA 1YDOA 3AROA 1WNOA 4GA8A 4GG9A 4H04A 1JQXA 3P74A 3VOIA 1EOKA 1GKRA 1SFSA 3HGSA 4GH1A 4RE2A 1UZDA 3W1RA 2BY3A 3B9DA 3QSRA 2ZA2A 3NQ6A 1KWKA 1KXVA 1JZ5A 5LA0A 4B4FA 6A3HA 5CC6A 3I7SA 4LUIA 3WBWA 1TIWA 5EFFA 4LS0A 4KGLA 1K8XA 4XZWA 2YBTA 1JVNA 4FSAA 3LU2A 1ZAHA 3KAOA 3PPFA 5IXEA 3UY7A 3W1AA 4RZ5A 2EQDA 3PPCA 5JVLA 3MC5A 2A85A 3FAXA 1I45A 1BAGA 2VX4A 1MFVA 3W82A 2A3BA 3OA5A 3PJTA 3QYQA 4O16A 4MB5A 3U9IA 4FX6M 1EWEA 3WNOA 1TELA 3WH9A 4F4RA 5BOOA 4J5NA 4NAFA 4UMCA 3WJXA 2FHBA 2GK1A 2J7HA 4DUXA 1IGWA 4XK2A 4JTJA 2QDHA 4S1FA 5BOEA 3FK4A 3O07A 1UKQA 5EFDA 4YNGA 2FZ8A 2PTWA 3VIGA 3O1NA 2B4GA 1JZ2A 1SFLA 4NJIA 1K7FA 1KM0A 3EBVA 2DGAA 3WK3A 1JUBA 2WZEA 1V7AA 3MBFA 5BRPA 1E1CB 1XUZA 1UWUA 1A53A 3KE0A 1A3WA 2OB3A 4IL0A 4AW7A 3C2OA 4AF0B 4CCEA 1JCLA 2BOFX 1UH2A 2NSXA 1DTUA 4HSHA 4UR8A 4CN6A 1M9HA 1KRCC 4ZTXA 2Y1HA 2VEKA 2D1ZA 3J7HA 2C0AA 2G50A 4H7ZA 4G7EB 2V2HA 3TVAA 3P5ZA 3C0SA 1ICPA 3LPOA 1B3OA 4URIA 2W6RA 3NQFA 2H3DA 1J2WA 4R27A 1JPMA 4RDZA 4RLIA 3FJNA 1D3GA 2V5DA 1E3XA 4C6FA 1VFHA 2BOGX 2C7FA 4OT7A 3C0JA 3W1PA 3L9CA 4NRRA 1NFPA 1SZEA 1DWIM 3TX9A 1SO4A 1TWWA 4XBJA 3Q94A 3RRAA 4IUOA 1EJXC 1SFTA 3OOQA 2DPEA 4AD5A 2E7FA 3G0UA 3BSMA 1CCWB 4LUJA 1FUYA 2BHYA 3GNXA 4RZ6A 3ALGA 5AC5A 3BCFA 4FXJA 5FA5A 4H3DA 3ANVA 1U5JA 3I10A 3W1NA 3EGJA 3EPOA 4Q6JA 1QXLA 1DPMA 4A6GA 1LYXA 5CCZA 3UWZA 1YHTA 5KETA 2QCFA 1VP5A 4B5NA 2X0YA 1YMYA 2BGSA 3WQOA 1J12A 1XX1A 3NPUA 1IIHA 4EPDC 4JBRA 1EJTC 3PZIA 1F6PA 2ZA1A 2ZRWA 3DKLA 2ZXDA 1OFPA 2OZ8A 1YXYA 4QM1A 3POHA 2VDHA 3NCOA 2OQLA 4AU0A 3M5VA 2DUAA 4AYSA 5K4XA 3O0KA 2HEJA 2RJHA 3UVAA 2VC5A 1ISZA 4ZO9A 1PAMA 2FB3A 1NU5A 2VGBA 4HN8A 4QEEA 2J77A 2YW3A 1TR9A 4D1IA 3F03K 1R2RA 4KFPA 1UIOA 4PTXA 4PUNA 1QOQA 3P62A 3LM3A 3ARXA 4RDVA 2OSWA 3F2DA 2GJLA 1T41A 4TMBA 4NZ1A 2VM8A 4S3DA 3PG8A 3W1MA 3NA8A 5LIYX 5I3JA 3TAKA 3KBJA 4D6EA 1JDEA 3L65A 4DI9A 1O95A 2HBVA 2DVXA 4L6HA 2H9AA 3P2VA 2PC4A 5BCAA 2G41A 3AOFA 3GKAA 1C8XA 1U1JA 4ZCWA 3UR8A 1TREA 3GFXA 1KBIA 3FY1A 4AAJA 4ZL1A 1IEXA 4QXIA 4V1XA 3R8GA 3UA3A 1GORA 3UA4A 2PP0A 2XTKA 3KW3A 2W5FA 4C1NB 4M82A 1ZCOA 3OLGA 4HGXA 3URBA 4LAUA 2XSAA 4TVCA 4BQ2A 2WKLA 4HHPA 3TUUA 1BFNA 2J7FA 4HPHA 3AWOA 3ARRA 4GQQA 4KESA 2QJJA 3QLLA 3K8LA 4LOCA 4B92A 1NDZA 5G2IA 5HATA 4AC7C 1D7KA 3KXQA 4MY8A 3IGXA 1XIEA 3QN3A 3N25A 3HV9A 3V35A 3IRSA 4F40A 4Q7NA 1L0PA 2JALA 2CLHA 3HPAA 2OT1A 1Z89A 4YPJA 4K1WA 1FWHC 4AXKA 4Y96A 1TIMA 2WZHA 5AECA 1XIGA 1P0BA 3CGTA 1GQKA 3HJEA 5M3WA 4HHLA 4Q8QA 4IJRA 2F7FA 3AIBA 1ECEA 2ZUTA 5CPNA 5I0DA 4RNFA 3FGCA 3TWAA 4MKVA 3REQA 3R13A 1A5UA 2Y24A 3VIOA 1W3JA 1CXHA 1RXOB 2PGEA 3AIWA 3ES8A 5XINA 2YL6A 1XSKA 2V68A 3V16A 3GDBA 1YTDA 3ITYA 4WKAA 1RJRA 3DBPA 1BXBA 2NX1A 4B2DA 2XN1A 2PODA 1OABA 1AZ2A 1NP2A 3WLTA 2X1SA 4GVIA 2E4TA 1IQ8A 3H55A 4U3AA 2ZZ1A 4B15A 3T7VA 4BWLA 4Z1AA 5F2IA 4DWSA 4UTWC 3F4WA 3TWBA 3VDGA 3WUBA 4DY1A 3BANA 4DZHA 3QMSA 5EBAA 4M56A 4GY1A 1GKPA 2JIEA 4XKYB 5IDIA 1M6JA 2QCEA 2OWWA 3PPHA 5TF0A 3PZUA 2GVJA 5AVNA 4W7WA 3NG3A 2VX7A 1XPGA 4LRTA 1ENUA 1LUCA 1ZU8A 4OVXA 4QDPA 3KL5A 4XV0A 3WQPA 2O4MA 2QCGA 1K3UA 1I2QA 1JGMA 2ZUMA 4X22A 3WK2A 3A9BA 3VYLA 3ZSTA 5E5CA 3LN3A 4NVTA 1E51A 3ABOA 2QNEA 3QBUA 4WLCA 3SGUA 1FWEC 2EKCA 3RX2A 4A21A 4AY8A 4H9ZA 4PCTA 4KFOA 3NNTA 4LV4A 3RM8A 2E09A 1PZ0A 4JKLA 3CPRA 4PN2A 3GDMA 1BXCA 1XICA 1KTBA 4A29A 1FH8A 3IJIA 3H12A 3HGJA 4GBUA 3VNMA 3W7RA 1LOQA 1QBBA 2WM1A 4FEZA 3NYDA 2GVLA 3V4BA 1PYFA 1SO6A 1DQWA 3VMPA 3E6EA 5J04A 1BD0A 2QEZA 4IFRA 2A7RA 3NTYA 3FA5A 4RXFA 4V27A 3A4XA 3OVGA 3VDAA 3S5YA 4JL2A 3QRHA 3GC4A 4LT9A 4IICA 4PTVA 3RJXA 3SW6A 3ZWTA 2G3FA 3A13A 3L4XA 2FVMA 1W1A1 4ZB0A 5JIPA 3M1ZA 3BAYA 2PLCA 2YB1A 2UZ9A 1XCFA 4UOZA 3AJ7A 1J93A 2G3MA 2PTDA 2XHYA 1XXXA 1K03A 5A6KA 1I2NA 2ZZ3A 4LY4A 1KV8A 1RJPA 3V3WA 3GFYA 5TIMA 5I3KA 1OGSA 3HGRA 4WCJA 4E0CA 3ZZ1A 3WUGA 2BG5A 2X1IA 5GQBA 3MZ2A 4NSBA 2CLIA 3W2NA 5BNKA 1PHQA 3CV6A 5AB3A 2BB0A 1IHIA 3BG9A 5GNYA 1DKWA 2Z4GA 3DN5A 4AG0A 4UNKA 2G3NA 2PMQA 3R10A 4R9XA 2FQIA 2AQVA 3UERA 2OG9A 3A4JA 1K9EA 3P6LA 4FS9A 1EC8A 1QATA 3GNOA 2GWNA 1U2YA 1P43A 4QJ3B 4HA4A 4DLMA 4XD6A 5KMYA 3WELA 1EJVC 4CCZA 2C14A 2OYMA 4X63A 3WLNA 1XWYA 3BQ6A 1XC6A 3LD5A 4IX2A 1EJWC 4K7VA 4L4MA 3AXXA 3F4NA 3ARUA 3CIVA 2XGIA 3QOKA 3F4DA 1LL6A 3O63A 4MY1A 1QO2A 3KX6A 3WEMA 1NVMA 4DXXA 3R8RA 3M46A 5LHEA 3DH7A 1AQFA 2WWDA 3TTSA 2YW4A 3AMDA 3WLQA 1HKJA 3STPA 2W62A 4FZIA 2GJRA 3N6QA 4RXGA 2NZLA 3VIMA 3S9YA 4B5XA 4AIUA 3DHUA 4QAWA 4I7UA 2Q3RA 1V3IA 3E0FA 2FTPA 5LNUA 2IKGA 1K77A 4U33A 5E1QA 3LHWA 4O1DA 5PTDA 4J28A 1EJ7L 4XQ6A 5BOFA 2OSYA 3VXGA 4IHCA 1BRLB 4JN6A 4JFVA 2I9EA 3LEPA 2XZ9A 4MJ2A 1DJHA 2FZ9A 5BXSA 1OD8A 2VT0A 4NAEA 4CD6A 3THCA 2Q6ZA 4IQJA 1Q8AA 1LCOA 3XISA 3DFOA 3GG8A 3GNNA 4AYGA 4GQBA 3BGGA 4ORIA 4GYKA 1M04A 1OT2A 3GY1A 4YVPA 4HNTA 1KD0A 5G5IA 4MWAB 1FWTA 4Q8TA 3AYRA 1WDRA 5AHLA 2CYGA 1VR6A 4DELA 3SGZA 1LOLA 4EK7A 2PLJA 2Y5JA 2J4GA 4CEXC 3SY5A 1QNRA 4HCLA 2DZVA 3IIZA 1UC4A 1M53A 1S5VA 4CU6A 1T96A 1Z6KA 3TJLA 4CUCA 1RVGA 3IAPA 4XVEA 4FX7A 4Z2LA 2OLSA 3WD2A 1KCKA 2DUXA 1TZ9A 4QISA 1IXPA 3COTA 3GE7A 1BYDA 3QY6A 4OKDA 3HN3A 1MW2A 2DQXA 1MZRA 3FJ6A 4M1BA 4MKSA 2BGQA 3FYPA 4AZBA 1SZGA 3WBXA 2VEFA 5F1UA 3CB8A 1SW3A 3TC6A 1VEMA 1XRFA 2NQLA 3MO7A 5A8NA 3WCZA 2YLLA 2D3LA 5FIPA 1VIZA 1JQVA 3EYPA 4Q4SA 1UWQA 3BTNA 3POCA 3IS4A 5LIUX 4DRSA 5CPQA 3HFTA 4W88A 2HZGA 4HNLA 1WZMA 3SJNA 3UPBA 1UR8A 3CEPA 9RUBA 4ORMA 1JF6A 2I5GA 1ADDA 2HS6A 1RV8A 1TPVA 5LA1A 2WKJA 1SO5A 2OGJA 3TP4A 3MYPA 3OIHA 4LC8A 2V3EA 1LRTA 5LGZA 1TWZA 4HZ6A 3PJXA 5TBOA 3ZLFA 2Q3OA 3ONBA 1CGVA 3B3DA 3NL6A 3N34A 3KRUA 4KQNA 3OBEA 3GXDA 1LF1A 3OG2A 3ZM8A 4QHRA 3IJLA 4J7RA 1XYZA 3T40A 1IZKA 3O6DA 1AW5A 1P48A 4JIIX 4GJ1A 1EEPA 1XGEA 2XINA 3Q37A 4LGXA 1W2PA 1H50A 4HU3A 1LZOA 2INZA 1OFAA 1GVIA 1REQA 4W5ZA 2QGYA 3W72A 3MSRA 3CXOA 2HQAA 1W6TA 1EYWA 3AXMA 2Z1VA 4CD5A 4YTSA 2AL2A 1UPPA 3OGRA 4JCLA 3TQPA 4WY0B 3DX5A 4GYPC 5DRIA 3S5OA 1NF0A 2GQAA 4LV9A 4LVDA 1CECA 3W7EA 1FCUA 4QG9A 2DFAA 3AWNA 5DXXA 3IUHA 2VMFA 5T9CE 3DEQA 2GDVA 3CWOX 2BSLA 3LM7A 3O3RA 2FZNA 4B4HA 3QMTA 3GVGA 4US5D 4J3SA 2E0PA 1PS9A 5C9RA 4TXEA 2WHLA 1VPQA 3AIRA 3R12A 3NQBA 3CPUA 1V6WA 3H2EA 4GGBA 5ABGA 3A12A 3WBYA 1QI3A 4OFCA 2Z24A 1J79A 3VFCA 1C8VA 2GGEA 3VC5A 2YB4A 3PY2A 4XAFA 2IKJA 3II1A 1GVFA 4KRUA 3ES7A 4GQRA 1G4TA 4PSRA 1FHDA 4PMUA 1XRVA 1Z44A 4KF1A 1ONWA 3VC6A 1MWOA 2NQZA 1OYBA 3CAQA 2F84A 1M68A 2XM1A 2FH6A 1ZJAA 2OZ0A 2HNEA 2QXWA 4JTFA 5HWMA 3LBMA 4KFNA 4AEFA 2YGYA 3QHNA 3LY0A 2XM2A 3GBDA 2OODA 3UG5A 3EKLA 3LXBA 2CBVA 4MF4A 5DMLA 3VOJA 1ISVA 3NZPA 2W27A 3WK1A 1UKPA 4H6KA 4JXCA 4QCFA 3AS1A 1BHGA 3RM9A 1BVZA 1R3VA 2WJZA 2HXTA 4GYPA 4XB3A 4LC6A 4F8XA 3PWIA 1B30A 3KRZA 1XLDA 4O8RA 1E15A 2POTA 2WC3A 1BSLA 1ODUA 1BYAA 1OK6A 3CQHA 5DCEA 5B7YA 5HJLA 4JQ3A 2XSBA 2OZTA 4MB4A 3TC7A 4MJZA 3I7RA 3CIWA 2NV2A 1IEQA 4LBRA 5FJUA 1JYXA 2QJNA 4JIHA 4ACZA 1FFRA 2HCVA 4NJGA 1EXPA 1BPLB 1QO5A 4TV5A 1WAUA 5HQMA 1CXEA 4ZFCA 3DG7A 3N17A 4B3KA 4UTMA 2F8QA 3N9SA 4PZVA 5U4NA 3S1WA 1KM1A 5GNXA 3UJEA 4O14A 1IEIA 3LPGA 3E5PA 1GW9A 4IQDA 2GQ3A 4BR1A 2BMBA 4F66A 4PRWA 1UWRA 1CWYA 1WP6A 3WSUA 4JQ4A 5HOSA 2W67A 5FL1A 1QPNA 3EB3A 1LG1A 5HANA 2BVDA 2YA1A 4O11A 3SSZA 3N18A 5AOUA 1TA3A 3QW4B 5HPOA 4Q7BA 2VOTA 3M6DA 2PWGA 2V81A 4FNRA 4PMOA 3NQDA 5HNRA 5ECUA 1TZ7A 4CNPA 1QW9A 1W1VA 2XFWA 3PZOA 3W7HA 2CERA 1YKWA 4FXFA 4NYUA 3UR5A 3MWAA 3G1SA 1TZZA 4ZODA 4HOZA 2WQDA 2ACQA 1UB3A 2MANA 3L4ZA 1CGTA 4KEVA 3UZXA 4QDWA 4ZQPA 1E4MM 1JDDA 4WZHA 3B8TA 4EP8C 1K7XA 2JQXA 3M0JA 3GVWA 1EWDA 3A4AA 4S23A 4U28A 3I3BA 3IVSA 3BPWA 1M3UA 1UW9A 3W38A 4KW2A 3A3XA 4NNAA 4CLMA 3QQ1A 4GQGA 2REQA 3VNIA 4UUIA 3UWVA 4YWIA 1GNXA 4FIQA 1SO3A 2E6AA 4O57A 3EB2A 5DBUA 4PB5A 3C2VA 3W29A 3TAOA 2E1WA 1ZBVA 4YVVA 4QEHA 1PUDA 3VGDA 4JIQA 4WKFA 5HPCA 1F76A 3P7YA 3CMFA 1MRAA 3LSCA 1KKOA 4C6QA 4H1ZA 3UYIA 1H3GA 1LOSA 2DT1A 4LANA 1E0UA 4QLJA 4B16A 2ZTJA 2A3AA 3C52A 4LBSA 5C9UA 5J5RA 2PZ0A 3UXKA 3G1AA 2ZX8A 3CWHA 2PEVA 2O55A 5CG0A 4CNUA 5C55A 1KW1A 1HKMA 4NJHA 1KFBA 2BXYA 1S46A 4LNYA 1RP9A 1FBAA 3DKJA 1K8ZA 1OFEA 4QQ3A 1ZTVA 4W5UA 2E9MA 5A5WA 4DPPA 2ZRXA 4WOZA 4KEMA 1SUXA 1PCKA 2WCGA 4UXDA 3TQVA 1JNDA 4D6DA 3WD3A 2ZADA 2W66A 1TX0A 3UCDA 4WJ8A 3OZOA 1EHNA 4XSMA 1ITXA 3DHFA 3QKZA 1A0CA 5EMKA 5ABTA 2GOUA 4YTRA 3R8HA 1E40A 1E9LA 1YNPA 3FEMA 4RE4A 2OEJA 2CCRA 4N2YA 3E96A 2QT3A 3FKKA 1R30A 1A5NC 1E43A 3SCPA 4LB3A 3WNKA 1U5VA 3G2GA 3GHRA 2PDIA 1X1OA 2D0HA 4HMCA 3KCOA 3M4HA 3QY8A 4QAIA 1E4NA 3A21A 2RH9A 3CEUA 5LXXA 1UA7A 1SZNA 2A2IA 4X0NA 5A69A 3TK7A 1EIBA 1H7OA 1EXBA 4AUBA 4YJ5A 4A3QA 1ZENA 3W7LA 1S2WA 3F4CA 4I6VA 3RF9A 2FMNA 4RUBA 4UC5A 3L4VA 4C6JA 3MS8A 1AD4A 1YADA 4XZ9A 2FYMA 2XN0A 3TA6A 3P60A 3M0XA 4EVZA 4ZA0A 4GJJA 3S9ZA 4FF5A 3EWUA 4ZMGA 2NXIA 2XGBA 1U33A 3OHMB 3LCLA 2WC4A 2PTXA 2VR4A 3D3AA 3M5YA 1MXDA 3FAWA 3USZA 3EAUA 3AZRA 3CO8A 1XYAA 2PE4A 4RPQA 3S1XA 5FJRA 4XO7A 5J8LA 3B0VC 5REQA 1RQHA 2PDUA 4PH6A 4MSSA 3NXFA 3WEZA 1L9WA 2OGYA 3BJSA 1FHVA 4X0VA 1SJDA 2Y62A 1G67A 4GOAA 3L4UA 3W23A 2J7GA 1V3JA 4PL2A 4MWAE 4K1GA 1PEZA 1ZQ5A 5D2XA 2IPFA 5I5RA 4MM1A 1B9BA 4WDUA 5CG7A 3TJXA 3W7PA 1J0HA 1IXNA 2OPJA 1OG6A 1TTQA 3WQFA 3WLHA 1AH4A 3ABXA 4TVUA 3BZGA 3ABRA 5C2XA 1P6WA 4G9PA 4MHBA 3TNBA 5MKGB 2E9BA 4TU1A 1ZBKA 2V2DA 3VO0A 1DWJM 4QQUA 3GXNA 4GIRA 2OWCA 1DHPA 1Z8AA 5FF3A 3UJSA 4UTTC 1NF7A 4WR3A 4Z1DA 4A05A 1TE6A 5LIWX 2C0HA 4ML9A 3VIFA 2KAUC 3OLDA 3KEHA 2XH0A 2WKGA 4GVFA 4MAVA 3WDQA 4I90A 4G1KA 2FTWA 4LCQA 4FLQA 3CAVA 1J0KA 2YKKA 3MU7A 2WLYA 2QCDA 4XAPA 5AC6A 3ITCA 3DFPA 4L56A 1OF8A 3GM8A 3ZJ7A 5CH9A 3HM7A 3AIEA 4ACYA 4HZ7A 4MJ4A 3KP0A 3CHVA 4IISA 4GI6A 2A5HA 1JDFA 1DORA 5I03A 3IARA 4I8DA 2G3JA 4KWOA 1FCVA 1YDVA 2VGGA 5C9ZA 1BYBA 1BVNP 1HO1A 3CMJA 2HSAA 3GW0A 3DFHA 5HWJA 1DXIA 5JBDA 4EWJA 5AZ1A 4XZMX 2H8XA 4DPQA 4QJ1A 1H1NA 1TV7A 5C9XA 4LJ3A 4PEKA 2CNCA 3WJYA 3ARWA 1KFLA 2ZA3A 3SCQA 4QJ5B 3APGA 1KRAC 1F8MA 1I4NA 5HK4A 3LK6A 5E0CA 3K5XA 4HNCA 4AVOA 3EA1A 4QCEA 1MYRA 1S5WA 5AC4A 3L4WA 1JUEA 2V5BA 1CI1A 2XJ7A 4QLKA 1GOOA 1Z7AA 3GUGA 2ZC8A 1GVYA 1GOXA 1M7XA 1HKVA 4W8BA 4PMXA 2IKIA 3CHDA 2NX9A 3GX9A 2QYGA 4HA0A 3IAQA 3PJUA 3FKRA 3VIHA 3ATYA 3PR2A 3QQWA 2YCLB 5I06A 3V7PA 1JR1A 4IGMA 3GD6A 3TYCA 4IM4A 1HKWA 3RNDA 2XFRA 3B8IA 3TU9A 1XGZA 2QJMA 4HIBA 2X05A 4GI4A 4MWAD 1S5MA 4REQB 2Z7GA 2QPXA 3NDZA 4CQ8A 2E28A 3CV1A 3CLMA 1JF5A 2A6NA 1FTXA 1N2VA 2IW0A 3WQDA 1RALA 4M3PA 2YFOA 4OE7A 5CPSA 2QDGA 3C56A 1TVNA 4KERA 4EF8A 1EHAA 4Q8UA 3AYTA 4K7YA 1KBBA 1UKSA 3OB8A 2DZXA 5DQPA 1UC5A 3RR4A 2GUUA 3CU2A 1Z42A 4I9JA 3GHUA 1KTCA 4IWWA 4WGXA 3EKGA 4V2XA 5GNZA 3OGVA 4PODA 5CZTA 4TVDA 2EGZA 1A50A 2BHUA 2ABAA 2OKTA 2DEPA 4JTSA 3W70A 3WFLA 4KRTA 4Q8MA 4PCNA 4C6DA 3OBAA 3WFZA 1Q65A 1VQTA 3ARYA 1U1HA 3LPFA 1WXYA 4FLRA 2FFIA 3LBOA 4P7NA 1H41A 1SSGA 2GGJA 5BU6A 3EB4A 3G3MA 4GXWA 5H91A 5LA2A 2YA2A 3SCUA 3VCCA 1WZAA 5CZ0A 8CGTA 1NFBA 3TZNA 1KR0A 1Q7MA 2A3EA 4HP5A 2ZBTA 2QV4A 3TYUA 3A3WA 3Q65A 5LXEA 3M7SA 1EDTA 4YVXA 4O1BA 1DJGA 1GOWA 2Z2BA 4HU8A 5FJIA 3WJZA 3NIYA 3WQ8A 6XIMA 1F6YA 2XYLA 1PKNA 1QBAA 3NDYA 2PDMA 2ESCA 5EB8A 3S2MA 4YCPA 1Z69A 3C4UA 2WM0A 5A6TC 3NZ1A 5L9FA 3M0LA 3W6MA 3MV11 4RNJA 3E1F1 5HINA 4NP7A 4NAFB 2ANUA 4BF9A 2GK1B 5AC8A 4MIMA 4MFDA 3VNKA 5IFPA 3VOFA 1W1PA 2EPKX 3K1GA 3W7GA 1DP0A 4PTNA 2F2KA 4AIBA 2A3CA 5HDRA 4I8YA 3GH4A 3NJ3A 3QYSA 1E6QM 2Z6JA 4MKNA 4R7WA 3M47A 4A2SA 4C1KA 2Q01A 2I56A 4LW7A 1B90A 4PMDA 1R7OA 3G3DA 1XDJA 2PWVA 5M03A 4D9PA 5AYBA 3GTFA 3NWRA 3E0LA 2ZOXA 1F5ZA 2DSKA 1UZHA 5AFDA 4Q22A 3DIPA 4Q4QA 1ZS2A 3MPGA 3I6TA 3U2OA 1L2UA 5BW6A 1IE7C 2TPSA 4JZ5A 2E77A 1E5JA 3AHVA 4DM1A 1I9CB 3DBNA 3QY7A 2ZTKA 3S8HA 3LRKA 1J5TA 5TAOA 4XZLX 1ZP4A 3H26A 4MWAC 1QNVA 3MVTA 1GZGA 4IJCA 3W07A 1J2BA 1TPUA 4A3RA 1KFCA 3KVJA 2WVUA 4QNWA 1VYSX 4L6OA 1DE6A 2GOKA 4DQWA 2Z28A 3VDBA 1OX4A 4A8LA 3HO8A 3WQCA 3VOGA 1AW2A 2BZNA 1T7LA 1Q3NA 3PWGA 5CBJA 4S2BA 4DBEA 3ZLGA 1A5AA 5CPMA 3U2EA 2PURA 1VFUA 1MQPA 1VCFA 1SVDA 4FK9A 1KGWA 2WSPA 4FOKA 2PWEA 4AQLA 4GPNA 2ZUSA 1OYAA 4O1FA 1RPXA 4UTKA 2CLPA 3SN4A 1WE5A 5G4EA 1P4CA 3FX4A 3CUXA 2C79A 4ATLA 2NLIA 4I5XA 2ADAA 1EPXA 4PYSA 4MGGA 2QJHA 3TZFA 4TTGA 3WMCA 1R0MA 1DJWA 3JS3A 3P93A 1Q6QA 3T0TA 1HKIA 2B7PA 3GR7A 4Y8FA 4PBEA 4KIEA 4B5TA 3CL7A 5G4WA 3SGGA 4KBXA 1E0XA 2BY1A 3WQ6A 3TQ0A 1EF3A 1C90A 1XKYA 1XLGA 3I3DA 3TEVA 3B8SA 2F61A 4PUDA 4AZHA 1WA3A 2QUUA 2D2GA 5FJJA 4W93A 1PZ2A 4BQ3A 3A23A 2ZXQA 3VD7A 2ZXAA 1BWLA 1EO7A 3KOFA 4P8WA 3K46A 5HXMA 1AQMA 4MAZA 4QE5A 1E1FA 1XH0A 2H9AB 3DG6A 1LT7A 4MFEA 4U3CA 4GO9A 2CWNA 4EE9A 1DYSA 4D8AA 4FLSA 2W91A 2X7VA 4J9JA 4QRNA 3UG3A 3E2QA 4XUGA 3TTQA 5CJMA 3TYEA 2POZA 7REQB 1OJXA 1XLJA 2HTMA 1PTDA 3NSXA 2ZE0A 3T2OA 3S5NA 5EY5A 1TWIA 4YWSA 5FJOA 1JPIA 3MW7A 3HQOA 3P0XA 3TXZA 4LXFA 3NQGA 3SCTA 1HVXA 4RZ4A 3AHZA 5F4WA 1XYMA 1W1ZA 3WUEA 3VGFA 1E4LA 3OU8A 3KUMA 1KGXA 3U4FA 4H9UA 1TTPA 2GL5A 2BHZA 5E6YA 1FWAC 1QOXA 1US0A 1RY8A 1LJYA 4XTIA 3HGOA 3PZVA 1AZ1A 2DH2A 3CHCA 4JTLA 4MOZA 4NUWA 1LBFA 4DJFD 4DJDD 1DJZA 3NOYA 1TE1A 3VIIA 2EEXA 2DJLA 1VEOA 1IEWA 1WX0A 3U7BA 3KLLA 1P6CA 2DT3A 3OZYA 3OW1A 4S2CA 4E5TA 5CAHA 4AWEA 1WOAA 5JUVA 2PWUA 5AY7A 3FGCB 3REQB 3VM7A 1H0IA 2DV0A 3LLXA 3STCA 3KCLA 1XDLA 2X40A 3IWPA 2O92A 4MG4A 5FF4A 3B9OA 2NQ5A 1SU5A 2JK2A 4G7FA 4M1RA 5CGQA 2ACUA 3MP3A 2WCSA 2EG6A 4GIYA 4MNJA 1OT1A 4K6AA 4OUIA 3LNMA 3M5ZA 1FHLA 5JU6A 3U8GA 3PZTA 2R1LA 4PCPA 1YPFA 4DBDA 1QI2A 4AZIA 3WD1A 4HNOA 1E6SM 2P88A 3AYVA 3TTYA 1GUVA 3BXWA 3W7JA 3E02A 3OPSA 1GWJA 4DWSB 4U2ZA 4DN1A 3QGKC 7TIMA 3R0UA 4H41A 3HPXA 5G4HC 3BW4A 3OEXA 4GZJA 3EOLA 3E38A 4FNSA 1XGDA 3IJQA 1GONA 3UEQA 3VAVA 4NZFA 1UD5A 2V2CA 3SEPA 4J1OA 4C5YA 4ZSTA 5IBXC 4DXKA 1PHWA 2A6LA 5E0KA 5LNSA 4GE8A 1GJPA 5I77A 1LUCB 3OIXA 1ZJBA 2OZ3A 5D8WA 1UWIA 1AW1A 1U5HA 4UTHA 3E0IA 4GLEA 2ZUNA 1BG9A 2BVWA 1KBKA 1TJ1A 2VTFA 5CGMA 1O68A 3N15A 1GOIA 2V3FA 2B31A 3KOYA 4DUVA 1I1WA 4BEUA 3TN3A 4UZUA 3UFYA 1JYWA 5KZ6A 1LTDA 3UR2A 1HF6A 1W3TA 3A5FA 3WMBA 3V0TA 5CPTA 2ON3A 4IIGA 1WDPA 3BURA 4XSLA 1D9EA 1IWBA 3H4GA 3UP8A 1JYVA 2TRSA 2INFA 3M6YA 2RDWA 4DJFC 4DJDC 1FCQA 1VC4A 1LQ2A 2QCMA 1C7TA 1W8SA 2GUBA 2NWSA 4RKAA 3BG5A 5G1TA 3ANUA 4HK5A 5HR6A 3P80A 1S2UA 4ERGA 1XIBA 3U2ZA 3NEVA 3H2MA 2QJIA 1PCWA 2C1HA 3O06A 2WANA 3ZLHA 3I65A 5IDZA 3HG4A 1MXGA 1RD5A 5HAOA 2WZMA 2WSRA 1A47A 1OYCA 2WNZA 2ZXBA 3BAKA 3H4XA 3H7VA 3HFYA 3EEGA 3E5BA 3QOMA 5DFAA 3QPZA 3UR7A 1F74A 3CUHA 5DF0A 3SDOA 4WHBA 2QULA 4Q4PA 5F2LA 1Q13A 3CZLA 2OR2A 4UFHA 2JEQA 1CB2A 3V36A 2X0HA 3S2JA 1SZFA 1KGUA 4HU4A 1X39A 4O19A 3QGAC 4QG8A 2ZZ4A 4W9TA 3MUAA 3PBVA 4MZ8A 2GLKA 4O50A 1MUMA 1BVWA 2E1DA 3PP7A 1V6YA 3TSMA 3LDVA 1XH2A 4H7CA 1GYNA 1ZJHA 4N9DA 4M6QA 1R9YA 3SAZA 2G5WA 2PAJA 4MZ1A 2VVNA 4HTYA 4M6VA 1AMKA 3KOZA 4PSPA 3IEBA 4A4AA 2Z26A 4K8GA 3D47A 2PDCA 1TQXA 1C93A 2PGRA 2VJXA 4ZE5A 4UOQA 1CLXA 3NGJA 4LAKA 2WVSA 3GTIA 2CBJA 3P67A 5EGRA 1UR9A 1UBPC 3RU8X 3L0GA 3VIPA 4DJFA 3A22A 4LYRA 4FI4A 3BV7A 3W24A 4E2VA 1QI4A 4YL2A 4BEQA 5I23A 4JTCA 1QWGA 2QKFA 1XKJA 4POCA 3EOUA 3CB3A 2ZFAA 3LCHA 1J6PA 4RNHA 2QF8A 2VQTA 2R14A 5FEXA 4IPIA 2D0GA 1KWGA 1O60A 4IMFA 4IMAA 5A8PA 3GSMA 3W6YA 3OQEA 5LHFA 3F2CA 1I2OA 4BQ5A 1DJNA 2XVPA 1V3HA 1I0DA 1S38A 3DAQA 2CZFA 5D9PA 3W2KA 4ADTA 3I6RA 1CEOA 4AY7A 1E56A 4XZIA 1ESWA 2YYTA 1VCGA 3TONA 1UWAA 3U3HA 3MVIA 5D05A 4H8VA 3JW7A 1M1BA 5FL0A 1BKSA 3LERA 1UQZA 3VIKA 1EA9C 4O12A 1Q6GA 3EWDA 2FTYA 3KVLA 3RX4A 4KH2A 3BGAA 4JYDA 1BKHA 4H6QA 4C91A 3CHEA 4GZ7A 3EDKA 2WQPA 2DZWA 3ZT5A 2R9RA 3KCJA 8RUCA 4NAEB 2W4XA 4LVAA 1HL9A 3UGRA 4ZQOA 2OTDA 3RCMA 5A94A 5C2GA 2DZAA 4JTAA 4LRSA 4Z42C 4HJFA 3QFEA 4F0SA 4PFMA 4R3UA 1VPYA 2AMGA 3NVDA 3UU0A 4M8UA 3DENA 4WF7A 2X2GA 3TH6A 4ERAA 2EO7A 2FFCA 1OIFA 2X41A 4KWUA 2NUXA 1D2KA 1MSSA 2Z1KA 1KBJA 1C29A 4FA3A 4PBGA 7PTDA 2VDGA 1Q7ZA 3RFAA 1WDDA 2YXGA 3N2MA 1VJZA 6TIMA 4C6EA 4E4PA 1XD1A 1OZMA 4J3XA 3R5EA 2YPIA 5B7ZA 2X30A 5BMXA 3HOJA 3R4IA 1DIOA 2VYOA 3H21A 2QPSA 1WDSA 1LQAA 3KBMA 2PI6A 3SQMA 2YDQA 4AVFA 1EC7A 3W9ZA 3T2QA 1R7AA 2YCJA 1MEHA 4BI7A 4YU1A 3GZ3A 3S83A 4XIMA 1W54A 4AZGA 1JZ4A 2WNQA 3GTNA 4ZBCA 3AIVA 4ZQRA 1V77A 4IIBA 3C2EA 3RU6A 5AHFA 2FH8A 4HHMA 3UXLA 1EEXA 1MEIA 1QRQA 3CUZA 3W37A 4AEEA 1HTIA 1E9IA 3CUFA 1JAKA 3LI0A 1F4AA 4LYKA 3VABA 3V75A 1I8JA 1I2PA 2X16A 3MI6A 4CD8A 3M64A 4JQAA 2J7BA 1EPVA 1LRQA 2JF6A 3MWCA 2QMKA 1NWUA 4H6RA 4S3JA 1V03A 3WMLA 5H8UA 1IYXA 1QI5A 3NZQA 3UW6A 3H2NA 2ZQ0A 1P0EA 3IACA 3AUJA 1M7PA 2AGTA 1W0MA 1ONEA 1G6CA 4ASTA 2OWXA 5FEZA 2EG8A 3DFSA 1XG3A 2QCLA 2VQUA 2NSOA 1V08A 3W0KA 4KGJA 1GTHA 3LUTA 2VFHA 3Q45A 4IMEA 1L8PA 3TW9A 2GGHA 3TN6A 2ZX6A 3ZJ6A 1EL3A 3N2TA 4GNJA 3PTDA 1LBLA 3VM5A 3SRDA 1V0LA 3QPEA 4GNKB 5I24A 1VH7A 3GG1A 3O05A 1LLOA 1JD7A 5C6MA 4DF2A 1UZ1A 1RQEA 1UWTA 4WX2A 3BJFA 1OCNA 3UXIA 1H5YA 2WVTA 2BLEA 5JQ9A 2XISA 2W79A 4F2BA 3QFWA 5CJNA 5ABFA 1HL8A 3SCVA 2WB5A 1X1NA 1FHUA 2AL2B 2PD5A 1TPWA 1JI1A 1UOZA 5EL1A 3WF4A 3SUTA 4JIRA 4C7DA 3AS2A 1TVPA 2OKOA 3BOLA 3CH0A 4N7QA 2YR1A 3AISA 4GIEA 2PLKA 3DI1A 4XIAA 1KXHA 3WFAA 5DN1A 1DWFM 4EAYA 2HRWA 4H7VA 5I79A 1HUVA 1UUMA 2DSVA 1FKWA 3DHDA 3PAJA 5A2CA 3GAKA 1CGXA 1Q6RA 3W28A 1F05A 4H9TA 4S3BA 1R3TA 4LQ1A 1UPMB 3VI2A 3GG7A 3BO9A 1NY1A 4DM2A 4LX4A 3RJYA 3W83A 3W7KA 4JOMA 1LT8A 4C5ZA 5DY3A 2PA6A 5AHMA 4YN5A 4HCHA 1KXQA 1OX6A 3VOHA 3DESA 5HJXA 1IEVA 3WJSA 1UD8A 1UUQA 4GI9A 1T8XA 3HMJG 3FLUA 2ZWZA 4WY0F 3LI1A 3SCOA 2C19A 4NZCA 4EACA 1GOMA 3EXSA 5FF7A 1R85A 4L1WA 2DVUA 2NXGA 2DIEA 1TJRA 3UXDA 1I0BA 2VEPA 4Q8WA 2OO0A 3MCNA 2ZX9A 2WV8A 1YDYA 5FF0A 4D6CA 2YFNA 1OIMA 3DC0A 3CK5A 2XH4A 2PTYA 3C2FA 3W1LA 2QV5A 3CL8A 3TMLA 3URAA 2P3EA 1XLCA 3C2RA 3H24A 3WF0A 1QPKA 2Y7EA 4GKLA 4IIHA 4R9OA 5D30A 4B9YA 4UFLA 1S5NA 4LNCA 4PMZA 1NP0A 3E2VA 4HA3A 3T78A 2P50A 2B7NA 1DV7A 1OC6A 3SURA 4HYRA 4FLOA 2AKZA 2GSJA 1AMYA 2P0IA 4N6FA 3DYMA 1DHKA 2EHHA 4IGNA 3UZJA 1Q6EA 4LH8A 1F3EA 5C54A 1X1ZA 3G22A 3E2SA 4ACZB 4TUFA 1OGBA 2YCLA 2CBIA 3AU2A 3L5AA 1J8VA 4IT1A 1P0DA 4Y2WA 1VLIA 2EPLX 1B4EA 1DWHM 1D8CA 1QCWA 3MJYA 3W2JA 4GC3A 3T55A 1W3LA 4LCRA 3H2OA 3FIGA 5ECVA 2DP3A 2G3IA 3LCIA 3R0DA 1TV8A 5HJYA 5I7GA 1R3QA 2GDUA 3VZZA 4JEJA 5AYZA 3UG4A 1S2TA 1W9DM 2NX3A 5IM51 2E3ZA 4ZQCA 2O9RA 2DSWA 1H7XA 2NVDA 1KCZA 1B2YA 2PDQA 3OVQA 2J74A 3Q67A 1TA3B 2JKEA 2OELA 4YYFA 4IMCA 3PZNA 4G8TA 2NQJA 3OVRA 1K70A 3QEZA 3NUKA 1XCWA 5BZAA 3VX1A 1O5RA 4FALA 1SJAA 1WQ5A 4B9ZA 2YXOA 4DIAA 1LWIA 4JNMA 2W0UA 2VI0A 1UQYA 1H7WA 1SQ7A 4FIRA 4AC1X 1AA1B 2R1NA 2X2YA 5C7VA 3KDNA 1LG2A 2RDUA 2TODA 1D8WA 3BSHA 1XS2A 3AJXA 4ZOBA 4F0RA 4B5UA 1XYCA 4JYFA 4NL1A 1O4UA 1O5QA 3RMJA 2RFGA 2HVNA 4CQBA 1ZP3A 1OVDA 3T1GA 3XINA 4HHHA 1OINA 4MMWA 2CLFA 3U2CA 1UMLA 1JD9A 4JX4A 3VE7A 2A1YA 1NTHA 2REQB 1WAWA 2DW6A 3ITLA 2VX6A 1PX3A 3QKEA 2XG9A 1N8FA 3T2PA 1YNQA 4QGCA 2FHCA 3W2UA 3U57A 4O4VA 2G96A 4EOUA 3K4AA 3LPPA 4OTKA 1V3MA 4JFWA 1AVAA 3B0XA 2PBOA 2GJXA 3V5CA 4QROA 3FA3A 1H0GA 1ICSA 2E8ZA 2XZ7A 3GNDA 3GYEA 1V3LA 2I1OA 1KC7A 3HQPA 5KZDA 2W9MA 1XYLA 3TTEA 3K2GA 4HPGA 3PS7A 4UFJA 4FNPA 4PRRA 4XD3A 1UMYA 2J79A 2BODX 3AAMA 4LU0A 3QPYA 2HNHA 1TV2A 3AMGA 4C6IA 1QUMA 2BASA 4IL2A 2Q8LA 1OHLA 3KBNA 4B2DD 2BXZA 3MYOA 3CV7A 1CDGA 3MI2A 1MMFA 1MDLA 1DJIA 2PUZA 4Q8OA 2NWRA 2XIOA 4Z2HA 4LAOA 1XLFA 4YHGA 2XVNA 5D37A 1YNYA 4L9YA 2J24A 4QLLA 2LLEA 1OCJA 1QFEA 3IJDA 5TQLA 3U48A 1DJYA 1RPKA 3BQ5A 2CLLA 3K8KA 1X38A 4DWSD 1TTJA 2ZICA 1TQJA 3W25A 2H90A 3CZGA 3T4WA 4F2UA 1A5MC 1RBLA 4JN8A 2BWGA 2ISVA 4F0HA 1VRDA 1B57A 4FHAA 1EOMA 2GSHA 1W9XA 5FACA 5H8PA 3ZIZA 1L6WA 1EGZA 2OQYA 3EKZA 3GW3A 3TFXA 3V0UA 4PR4A 4AZCA 4JTGA 3BDKA 5DCBA 1UP2A 3VKDA 2E6YA 4UFMA 1RK5A 3B06A 1N8WA 1ZAIA 3IJ7A 1JULA 3CMGA 3DGBA 4MY9A 4GUFA 3EDDA 2BY0A 3V5OA 1NWRA 4C6LA 3LBCA 3W85A 1QTWA 2Z1WA 5I3DA 2WXDM 1Q66A 4B5SA 1G4SA 1QNOA 1CZ1A 1H2JA 2I5IA 3BLEA 4IF2A 3NO5A 1HJXA 1XQKA 4HMNA 5DX7A 1QW7A 2ZUVA 3HG5A 2V5CA 4AHOA 4HNVA 1H5VA 3ORWA 4ZO8A 5I3HA 2PLMA 3WNLA 1UOKA 4MNMA 1A3HA 1CXKA 3WH7A 3ZFHA 3MY9A 3QC0A 4LS2A 2WHKA 3N11A 1V6XA 3E3HA 3IIPA 2BOEX 2NV9A 1VBGA 1O12A 1XCXA 3U5YA 1JNEA 2ISWA 1W5QA 1UKOA 3DERA 2CHRA 1BTMA 1FWJC 5REQB 2QHAA 4AX7A 1MI3A 3GWQA 2I57A 2OOGA 3DUGA 1OADA 1W5MA 4MNKA 1XIJA 1V4YA 4GHRA 4P8UA 1GJWA 1D7FA 4L5ZA 1F07A 1WKFA 3NSMA 1WZLA 1Z48A 4YCOA 1FFQA 1K8YA 2Y89A 2J66A 7REQA 3U6WA 4CNOA 3VX0A 1QJWA 4S3EA 2A4AA 4DF0A 1JXKA 5DMNA 3MUZ1 1RK6A 4FMVA 4KS0A 4BWLC 2FJKA 1PKYA 3NGFA 2Z0IA 4MNLA 4DWSC 1SSDA 5G2HA 1JZ8A 4QJ4B 3L21A 4JTKA 6REQA 4U4MA 2O56A 2H3BA 3TCSA 4WVXA 1CGWA 2CWXA 2G37A 3O6AA 2BTMA 4GX8A 1N8IA 4MLRA 5K7JA 2CZVA 3VZXA 2QCDB 1FWGC 2WK2A 2HPIA 1IZCA 3VKCA 1KRBC 1MZHA 2C71A 1H1YA 4CQDA 2VCBA 2B7QA 3GZAA 2PWFA 3WBAA 4DZAA 1CYGA