3WDQA

Crystal structure of beta-mannanase from a symbiotic protist of the termite reticulitermes speratus
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
330
structure length
329
Chain Sequence
b'QDWNISSSPVTPSPSAGAQKLYSFLVQNFQKKIISGAMTLQGGDESAQTKEPDWLQQNAGHRPALVGLDFFQTGKGEEWYYNDSRFSKQVVNGAKSYWQKGGIPALCWHWRDPSKDTDAFYSPSSGNSATQFDADQAVKSGTAENKAILQDLAVIADQLQDLRDAGVAVLWRPLHEASGKWFWWGYKGADALKKLWKIEFDYFVKERNLNNLIWVFTAGTPIEGIADWYPGDDMVDVIGMDIYATQGDHATQQDYFNQCKSIFKGRKIVAMSECGSVPEPDLAAPWSFFMPWYNNYCIPEGSNPYNSLEFWKKTMSSSLVITLDNMPGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-mannanase
molecule tags Hydrolase
source organism Symbiotic protist of reticulitermes speratus
publication title Structural and Biochemical Analyses of Glycoside Hydrolase Family 26 beta-Mannanase from a Symbiotic Protist of the Termite Reticulitermes speratus
pubmed doi rcsb
total genus 118
structure length 329
sequence length 330
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wdqA00
1CWYA 5FL0A 5D9OA 1EIBA 1XD1A 1E6PA 4W89A 3T2PA 5A1AA 5A69A 4GI6A 2WAGA 2AMGA 4IM4A 1A3HA 4KRUA 4B15A 3CUGA 2WYSA 4WF7A 4MNLA 2XSAA 1CXEA 1VF8A 2WMIA 2X09A 2Z1SA 5BROA 1CXKA 2D0HA 4JHZA 3VIOA 3IK2A 1OGSA 4OZOA 3UETA 3EDFA 1NOUA 1V0MA 4J3TA 1C7TA 4HZ6A 2J7DA 3WF1A 3S2CA 2WMJA 1Y7VA 1RP9A 4LXFA 1EHAA 4RE3A 4X0VA 2YA0A 4QLLA 3WDHA 2XUCA 7CGTA 1TCMA 1US2A 2DT1A 3WBAA 3N18A 5A6LA 1HL9A 1J01A 6A3HA 2V3FA 3W82A 3FNDA 1GQLA 1WP6A 4MAVA 4ZXLA 3VVGA 3PZVA 1JI2A 4XX6A 1UWTA 1MW1A 4EANA 5A2AA 4UOZA 3A47A 4JAWA 2GDVA 1J18A 5I3DA 3OB8A 1D7FA 1WZMA 2W91A 3CHDA 5HPCA 3AQUA 1E0XA 2WB5A 2DDXA 1GOKA 4DWSB 1UKPA 1UD4A 1OD0A 1K9EA 1EDGA 4PYSA 3QOMA 1FA2A 1S46A 1MFVA 3W26A 2WZEA 4W87A 3WUGA 1QNOA 2E9BA 1W9XA 2PC8A 1GOQA 1UWRA 3DHUA 2XGBA 1GOWA 1DEDA 3MKKA 2W61A 3LMYA 1BTCA 3O2LA 1EA9C 2J4GA 2Y4SA 4JCLA 1UUQA 3F5KA 4B9ZA 2VX5A 5HNNA 4BQ4A 1C92A 3RILA 3AYSA 3MUY1 1ISXA 5A8OA 4AZCA 3VDBA 2WHLA 2YDRA 3WUEA 2YJQA 2YL5A 2A3CA 2ESCA 3ZQ9A 2XSBA 5A2BA 3EBVA 4CN1A 1JF6A 2WBGA 1JYVA 1FP8A 1CTNA 2CPUA 1AMYA 3LPGA 3ARWA 5BCAA 4AIUA 2QV4A 4L4PA 2J75A 2CNCA 5DT7A 4GI9A 1MQPA 1VBUA 3OGRA 5A6BA 1WNOA 1C8XA 1XH1A 2GUYA 2WKLA 3ZT7A 2G8ZA 3CZJA 2W67A 4PTVA 1CGYA 3WSUA 1ZJAA 4F9DA 1HNYA 3T2QA 3ZR5A 1DHKA 2WCGA 5CSUA 1E70M 3MUIA 4PMYA 5M03A 1FOBA 4U5IA 1GQKA 5IHRA 1GVIA 5CPQA 3KL0A 3MU7A 3VIPA 2PWEA 3HN3A 3VIHA 1XH0A 3WEMA 3VMOA 3W53A 1V3KA 4P8XA 3FAWA 5I78A 4MDPA 1TA3A 4F9JA 1ZU8A 3RO8A 4CD7A 3GYCA 1TVNA 3ZR6A 2G3JA 1F4AA 2BVTA 3K8LA 2VNCA 2ZXBA 3T0DA 5EBAA 3NSNA 2VZVA 2XFFA 1OCQA 1QI2A 3CZ8A 4IUGA 1HL8A 4MB3A 3GXIA 3AISA 4PMUA 4TXEA 4HZ8A 2ZICA 2XM1A 1CGUA 4UQEA 3VGBA 4ATLA 4W5ZA 5IHSA 1GOIA 1QNQA 1FFRA 2WWCA 4J3VA 6CGTA 1XGZA 4NZCA 2Z1KA 4KWUA 1H4PA 1QW9A 2QPSA 2J7EA 3EMQA 2VZSA 5IFPA 2CERA 3WEOA 4B9YA 3M7SA 4PTWA 3GM8A 4H8VA 4KMQA 1E3XA 1HN1A 3BCFA 5HOSA 1UH4A 2E9MA 1JZ2A 2WC7A 7TAAA 4S3JA 2WNWA 4J28A 3WDQA 1JG9A 3B8SA 3OZOA 1E6NA 4M29A 2J7CA 3NSMA 4PMZA 1UG6A 1W91A 2YA1A 2D0GA 4UFMA 5DT5A 4RE2A 3UR8A 2WVUA 2JF6A 3SCPA 1LWHA 1VFFA 4WKFA 3OBAA 1M03A 1OWQA 1CNVA 2OSYA 1NOWA 1OM0A 5A6MA 4BF7A 4P7LA 1NWTA 3KZSA 3AIUA 2O9TA 3BAKA 1WAWA 2OWWA 1B3WA 2Y24A 1CXHA 1M04A 4WIWA 5ECUA 3T08A 4AD5A 3PZTA 5ABHA 3CZGA 1E55A 1NH6A 2VI0A 4AEEA 3VINA 1GHRA 1C93A 4TX6A 2JIEA 2ZUSA 4CU6A 2X0YA 1J0ZA 2PI6A 1HIZA 1KB3A 1LJYA 4U31A 4ZFMA 1ISYA 1Q6CA 3CZEA 2D3LA 3SCOA 3WD2A 5LA0A 1DWGM 2V38A 2JE8A 2WLZA 4YN5A 1B3XA 1E43A 2YL9A 1GNXA 2RGMA 1CECA 4E8DA 4Z2JA 4U33A 4M56A 4AC1X 2FHBA 5I0DA 1E15A 1OGBA 4N42A 1V6YA 1NWUA 2BNJA 1E73M 1KQYA 4QP0A 4JKMA 1UR2A 3VIJA 3NSXA 4MTVA 4L4OA 4IPLA 1HKMA 2FGLA 1EDTA 3L4WA 3W24A 4AZ6A 3ARSA 2XG9A 4JL2A 4PN2A 2JEQA 1W3JA 3QHNA 1W1YA 3MS8A 2CBVA 1QI5A 1E0WA 3A4WA 1QVBA 4AD4A 1PEZA 1EHNA 1E6ZA 3ARPA 1H0GA 1VRXA 1MQRA 2UY5A 4U5KA 3PN8A 2WMKA 4TX8A 4MDOA 3ZJKA 3MV01 1CXFA 3PZQA 3VGFA 1UD2A 3NYDA 1UKQA 1TR1A 1W1PA 1CIUA 4AZ7A 5C71A 4TUFA 1W3HA 3IJ7A 5A8MA 4RL3A 2VOTA 2ZWYA 4CU8A 1BFNA 1UD5A 2E3ZA 2Q8XA 1AQHA 1CGVA 1NOFA 1PPIA 2VJXA 1RD6A 1NWRA 3AMLA 3KE0A 1KWGA 3AICA 3EDJA 1V3MA 2O9PA 2ZXAA 1E5NA 2DT3A 1K9DA 3SCUA 3SCVA 1CYGA 3VGDA 1JZ5A 5I5RA 2ZUWA 3OLIA 2XIIA 2D1ZA 3WKZA 4AZBA 2X0HA 4U2ZA 3W29A 3N12A 3ARTA 1W1TA 2FHCA 1HKIA 4GI8A 3VMNA 5CLTA 1I75A 4OIFA 5HBFA 2OLHA 3TOPA 2VT0A 1UKTA 4F8XA 5CGMA 2QPUA 4CVUA 5ABGA 1JZ6A 1CXIA 4BA0A 3TA9A 2BVYA 1JXKA 1PIFA 1EQCA 4W86A 3WF0A 3RPMA 5FKYA 3ZT6A 4C7GA 3VGGA 3A4XA 1NWSA 2HISA 1ISVA 1E6RA 4QCEA 1OSEA 2WBKA 2G3IA 4D6HA 1TG7A 3DYOA 4F79A 3IJ9A 1XCWA 4ACYA 2BHUA 4ZE4A 2EPKX 3AROA 1C91A 3VM5A 2C8NA 4AZCB 4HOZA 2OYMA 4RE4A 3QHMA 1J0KA 1G9HA 1HJXA 5IDIA 4WKAA 1SFSA 3M46A 3CMGA 2UY2A 5IFTA 5GNXA 3ARUA 1F4HA 2V3GA 2WC4A 4Z2GA 3CGTA 2DIEA 1JYXA 1HVQA 5CPTA 4P8WA 2G4FA 3UG4A 2J7HA 3D5HA 4J3XA 1W9PA 1V6WA 2VRKA 3DYMA 3TTQA 8CGTA 1DWIM 2ZUUA 4UOQA 1UKSA 2CYGA 6TAAA 5DEZA 3SCRA 3PZNA 5CXPA 3FW6A 3K8MA 2D24A 2Y8VA 2GVYA 3TTSA 4CGTA 2J74A 3BH4A 3AIQA 3VNYA 1XH2A 4W7VA 1ITCA 4WSJA 3THCA 2CEQA 4P7OA 3W4RA 4U2YA 3AMKA 3ARZA 1C8YA 2ZX5A 5A6JA 1GOMA 3FXYA 2WVSA 3BAIA 1W3KA 4HMDA 1E6QM 1V3LA 1V08A 1YQ2A 4PCTA 1UA7A 1J11A 3GBEA 2XHYA 1CXLA 3AHTA 1BQCA 1CGWA 5DO8A 1KWKA 4XUYA 2PWFA 3WD3A 3UR7A 3WNNA 4D72A 1HKJA 2E0PA 4CN6A 4D6JA 1EO5A 2CITA 3SURA 3QR3A 1X6NA 3ALFA 3WF4A 3WDPP 3PZUA 5GPRA 1WZKA 2YBTA 4UCFA 1W2VA 3BMVA 1HJVA 4H7VA 4AY1A 5JBFA 2WPGA 1VBRA 2WMFA 2D22A 2YLAA 2J8FA 3AS0A 4W7WA 2IXUA 1FH9A 1J0HA 1GJWA 5ABEA 1DP0A 2X05A 4D6CA 3ARVA 1B0IA 3PBGA 2YL6A 1LL4A 2XPKA 4U3AA 4NF7A 2PB1A 2XYLA 1U33A 1G0CA 1PAMA 5A94A 2ZE0A 1CPUA 1JIBA 1TA3B 4MJ4A 5F7UA 1PX4A 3AIEA 3J7HA 2ZXQA 2VR5A 1K9TA 1JZ4A 1E71M 1UH3A 1KR0A 1QI0A 1TE1A 4PRWA 2VCAA 3WN6A 2J62A 1HJSA 2J78A 2F8QA 4AMCA 1AVAA 4HTYA 3AS1A 4E4PA 5BRQA 4AZGA 2O9RA 3DYPA 2BV9A 3L4UA 3BGAA 4PUDA 3OA5A 2GJXB 3OLEA 1W9VA 3I3BA 2NW0A 4A3HA 1H09A 4P7QA 3CMJA 4CKQA 1IV8A 1I1XA 1C3FA 1TUXA 1FP9A 4MB5A 4N0RA 3VD4A 1E6SM 3B9EA 4FLOA 1CDGA 2WK2A 2ZX9A 2DIJA 3WF3A 2VRQA 4CCDA 3CHCA 3WMCA 2UY3A 4H41A 4QLKA 3GXFA 3SEPA 2WHMA 2VURA 5CJ5A 1WKYA 3VUPA 1J0JA 1HJUA 2VZTA 4PMDA 5KZ6A 4YPJA 1GPFA 3AMCA 3ZJ8A 2YOCA 1EQPA 4B16A 2WVVB 3WD1A 4HU8A 3PHAA 2XFYA 5AYBA 1TMQA 4Q7NA 2CHOA 5I24A 4W88A 1JF5A 1MXDA 3WH8A 2UWFA 1VIWA 1HVXA 2BY3A 3RJXA 3TONA 1KBKA 1L8NA 3QHOA 1YHTA 3ARRA 4ZENA 2EBNA 5FIPA 2VZOA 3RCNA 1UA3A 4JFWA 3KL3A 4Q22A 1UH2A 3WNMA 3N17A 4D6GA 2E9LA 3GDBA 3VD5A 4UFIA 1W9DM 1KR1A 2QLYA 3EYPA 3UEQA 3ZT5A 5BXRA 3I3EA 2ZUTA 4OKDA 2WCAA 4CN4A 1R85A 2PBGA 3U5YA 3WQ4A 5CG0A 2DSZA 1CLVA 1M53A 1XSIA 3POHA 4FK9A 2VUYA 4B3KA 4UTFA 5GQBA 4OJYA 1LWJA 3QGVA 2V3EA 5E09A 2ZWZA 1XSKA 3VTRA 3VO0A 4UZSA 4HMCA 1JD9A 1UD8A 3WENA 1JL8A 4D6EA 1W9UA 4TTUA 1KBBA 1BGAA 3AFBA 4W8BA 4DUWA 5AYIA 4M24A 2VX4A 3VOCA 4URIA 3WFZA 1BVZA 1EDQA 4MB1A 4HPHA 5I77A 2ZUNA 3CHFA 1JNEA 3IAPA 5C8BB 2E8ZA 4P7NA 1B3ZA 1DWFM 1UHVA 1WDPA 2XVGA 3WY1A 2VVNA 1ITXA 1SMDA 3ZSTA 1ZL1A 3AOFA 4JFUA 5DFAA 3O6AA 3W27A 3MANA 4QDMA 1LL7A 3F5JA 3CZLA 2XWDA 2NT0A 1G94A 4YHEA 1OT2A 3WQ5A 1W1VA 1KCKA 3W6LA 3OZPA 3PZGA 3RM4A 3WH7A 4HA3A 5BXTA 4CUCA 4JL1A 1O6IA 3D3AA 3CUIA 1CZ1A 2E4TA 5FL1A 1V3HA 5D9MA 2HVMA 1VEPA 4TVCA 4W84A 4F66A 3AXXA 3OLGA 3N11A 4ZE5A 1RPKA 5IXEA 1WDRA 3WEZA 5I6SA 2J25A 2DT2A 1KGUA 1UQYA 1OINA 1R7OA 1C90A 2WMHA 1UWIA 3GH7A 3WL0A 3WMBA 4OBRA 1VJZA 3NUKA 3POCA 1US3A 3AIRA 1NP2A 5FCZA 2D2OA 2BVDA 2JALA 2EPMX 1BSIA 4HA1A 2CETA 1X6LA 1E4NA 4DUVA 1OT1A 1BPLB 5M5DA 2DH2A 4GZIA 1KGWA 1MW2A 2WHJA 3RIKA 2ZXDA 1PX3A 1LL6A 1HP5A 3EDEA 2W4XA 4MNJA 1V6XA 5GNYA 2BXYA 1VFUA 1ISWA 1K6AA 1Q6DA 1GJUA 3PZMA 3BMWA 1UKOA 1GZJA 4UR9A 2WWDA 3ZOAA 5E0CA 3SUWA 3WQVA 4D6IA 2WLYA 1MQQA 2WKGA 2XIBA 1OIMA 1JDDA 3SCTA 2W62A 1HF6A 2IUZA 1B90A 3AHZA 3CH9A 4LPCA 3VX1A 1GHSA 3LPOA 5AC4A 3NJ3A 3G6MA 1AQ0A 1R8LA 2CKRA 3GH4A 2OSWA 4A4AA 1JDAA 4ACZB 3O9NA 1QPKA 2QHAA 4XZBA 1VEMA 2BS9A 4FLSA 1ZS2A 1GONA 3ARQA 3WQ8A 1EXPA 4W7UA 4QCFA 1MWOA 2PWHA 2NSXA 1Z32X 1JFXA 4DM1A 1QNSA 1CEOA 1FH7A 5HXMA 3VDAA 5A6SA 5EMYA 2OWCA 2O92A 1QI3A 3T0BA 2BHZA 5CLWA 1C7SA 3WUBA 4LGXA 1Q6EA 1I1WA 1GQJA 3WF2A 1R86A 1EH9A 4D1IA 4UQAA 2XFRA 1WZLA 3VD9A 2CHNA 2ZUVA 1UD3A 3GNOA 5M3WA 1QNRA 4HOXA 4K68A 1OBAA 1H11A 5CZKA 1H2JA 2V5CA 4Z2HA 1A47A 3L2MA 3ZMRA 4ATDA 1J12A 1KFWA 4QAWA 5EFFA 3K4AA 3VIIA 4XV0A 3AZSA 3NDZA 2PBOA 1W2PA 4XZWA 2W92A 4TVDA 4CD8A 4KH2A 4GO8A 1V3JA 1HX0A 2BXZA 4R27A 3OIHA 3WQWA 3N15A 1W3LA 4HPGA 3W28A 2BY1A 2J47A 4J3UA 4MPKA 3MO4A 5D8ZA 3MSDA 5ABFB 3W37A 2GJRA 1P6WA 3ARYA 1R7AA 4OOUA 5BXSA 2D3NA 1TZ7A 4QLJA 4NI3A 1VEOA 5KEZA 1V6UA 4PMNA 1UR1A 4AW7A 1NM9A 4P7RA 3SCSA 3L4TA 4GZEA 4PTXA 2OYKA 2E40A 5BXPA 4Z2IA 4M81A 3GH5A 4CD4A 1MW0A 3WBEA 2YKKA 3M6DA 4ACZA 5BYWA 2E8YA 5BRPA 1UYQA 2WSKA 2J79A 1UR8A 4CCEA 2DQXA 5FOOA 1U2YA 1E4LA 1XC6A 2WANA 2WVTA 3WH9A 3BAWA 3UESA 3AIBA 3AIVA 4HOWA 3W81A 3MUZ1 4DM2A 1KXQA 2GSJA 3K46A 3PZOA 4W5UA 4AYSA 3BXWA 1QHZA 3WD4A 5JIWA 2EO7A 2MANA 1UOKA 5CPSA 4A3YA 5A8QA 8A3HA 1CGTA 1FFQA 1PZ2A 3BAXA 5C70A 3VIFA 4GPNA 4HP5A 4UZUA 3W0KA 2DPEA 7A3HA 1N82A 4GINA 1E9LA 4V28A 3F4VA 4TOQA 1H3GA 3VGHA 2AAAA 1E40A 2ZX7A 3DC0A 4AZIA 2WC3A 4ZEPA 3WH5A 3BLKA 1J0YA 3T09A 4PMVA 3CPUA 4AEFA 4JFSA 4MNMA 1DWAM 1V0NA 4WSKA 3JUGA 3VD7A 2ZUMA 1QBBA 4BCEA 3VILA 1ZB5A 5LYRA 1OIFA 1U30A 2QMJA 4Z2LA 4S3KA 4M80A 1KGXA 1L0PA 2VR4A 4IISA 4AZHA 3A4AA 5A3HA 3VDCA 3L4ZA 2DSKA 1H1NA 2WHKA 2CBJA 1V3IA 5EB8A 3GBDA 2VQTA 2XGIA 3WIJA 1MYRA 3VU2A 4M82A 3DECA 4EK7A 4D6DA 1B1YA 2TAAA 3HU7A 3OGSA 1B9ZA 1OD8A 1O7AA 1J9YA 3RDKA 1LG1A 3AHXA 3N9KA 3AIWA 4NRSA 3EMZA 3ZJ6A 2O9OA 1E5JA 1M01A 1E1EA 1QI4A 1QHPA 3NIYA 1JDCA 3WH6A 1BG4A 4BQ3A 5A6AA 1IT0A 2EJ1A 2XVNA 1EO7A 3UCQA 4TVUA 2YDQA 2VRJA 3WDIA 2D0FA 4M8UA 4OUEA 4JKLA 1DWJM 3QOKA 2WXDM 2VC9A 2CBIA 2DEPA 2ZIDA 3HMCA 2VMFA 2EXOA 1E3ZA 4H04A 2XVKA 2B31A 4AZ5A 2G3NA 2IXVA 2W5FA 3MV11 3AMDA 2AOSA 2WCSA 4WJXA 9CGTA 1QW8A 4XB3A 1KXVA 3CHEA 1Q4NX 4BQ5A 2G3MA 2DT0A 2QMKA 3K8KA 2V3DA 4GKLA 2XTKA 1JXJA 5DMYA 2CIPA 1G5AA 2J7FA 2F61A 1E72M 1B2YA 4JFTA 5I23A 3WFLA 3MSGA 4AD0A 3WNKA 3VX0A 3AZTA 4DUXA 3LPPA 1VJSA 2Y2WA 2JFEX 3U7VA 2CKSA 2DSVA 2GJPA 4BZYA 3AJ7A 1HXJA 2DGAA 3EMCA 1UWUA 3F5LA 1ZBWA 2BFGA 1V02E 1WDSA 4D71A 5JIPA 3T0AA 2C0HA 3AMGA 1GW1A 3CUFA 1HKKA 3VIKA 2OYLA 1BYAA 4AIEA 1R87A 1XV8A 4MJ2A 1E6XM 3RM9A 4U3CA 5E6YA 2X2YA 1H41A 4E8CA 2BHYA 4CVWA 4EAMA 3ECQA 3KEHA 4UFJA 3FAXA 4E2OA 1G1YA 1HJWA 5LA1A 2Y8KA 5D4YA 2VX6A 4IPNB 1JZ3A 1E4IA 2XJ7A 1WB0A 4LYPA 4HA4A 2FGZA 4PMOA 2J77A 2EPNA 1ECEA 3ARXA 1D3CA 4BS0A 1QOXA 1JZ7A 1BF2A 5DF0A 3THDA 1UWSA 4ATWA 2J7GA 1JD7A 2F2HA 3SUTA 3PTQA 1BGGA 2X8RA 1B31A 3VMPA 5A8PA 2YLLA 4H8HA 4B3LA 2G41A 2W66A 4WLCA 3BSHA 2VTFA 3ZJ7A 2J7BA 2JF7A 4FMVA 4LYQA 2CXGA 4UOJA 3AHYA 5AC5A 4W93A 3CLWA 4BQ2A 4NRRA 3GTNA 3N13A 4HU0A 2W63A 2UY4A 4C7DA 1ESWA 1OGGA 2A3BA 2FHFA 3VPLA 1K9FA 3DHPA 1EGZA 3RM8A 3MMUA 1GOOA 3FHAA 2YIHA 5E0FA 1PZ3A 4CU7A 4UQ9A 1JNDA 3UG5A 3CO4A 3I3DA 3CUHA 1FHLA 3BAYA 3OG2A 4V2XA 5D9NA 3VIMA 5CGTA 4W8LA 3OGVA 4JIEA 4CD5A 3B9AA 1AQMA 1NARA 5JBEA 3LPFA 4WKHA 3VKKA 3AS2A 1Q6FA 1UQZA 1W32A 1UZ1A 2A3HA 1TFVA 3CUJA 3U5UA 4EKJA 1LG2A 4PMXA 2JIWA 3WQ6A 5D8WA 2VQUA 1BVNP 3CBWA 1IZJA 1MXGA 3GZAA 3SUVA 3RJYA 3ZIZA 4KRTA 1GUVA 3T2OA 1BG9A 2PWGA 1BYBA 3K4DA 1ZJBA 4AD1A 3AI0A 1V0LA 4JCMA 4AWEA 1SMAA 1XCXA 4H8UA 3WNOA 5JUVA 3SUUA 4J3WA 1KCLA 2V5DA 1SYTA 1XD0A 3TTYA 4AD3A 1J10A 4LX4A 2BY0A 5CSYA 1ODZA 4P8VA 5A6BD 2DSUA 5A6KA 2Y5EA 4KGLA 2ZOXA 3UG3A 1UR4A 3IJ8A 4UFKA 1XYZA 4UQBA 1HP4A 1EOMA 1WO2A 1QNPA 1NP0A 2DH3A 4AISA 3II1A 2EPLX 4J3SA 4PCSA 5CQ1A 1VB9A 4EE9A 1BYDA 1B3YA 1RP8A 1NQ6A 1LF1A 3TTOA 1MW3A 2NT1A 2GFTA 1CGXA 3RMEA 4UQCA 3WL1A 2PF0A 3K1DA 1CBGA 2YDSA 3BC9A 1MFUA 1SR0A 1JAKA 1QHOA 3PTKA 1WDQA 4PTMA 4TTGA 2ZX6A 1EOKA 4FLRA 2JEPA 4C7FA 1CENA 1ZBKA 1JYNA 3WNLA 5E6ZA 4AD2A 1GQIA 1PIGA 1UR0A 1J0IA 2WMGA 4PMRA 4JZ5A 1XYFA 4UFHA 1W9BM 3APGA 4QFUA 2XVPA 3UERA 4PEEA 4V27A 4UNIA 4FF5A 3U7BA 2OWXA 3L4XA 3B9DA 4HZ7A 5I79A 3EDKA 3AZRA 2YBUA 2YA2A 1WCGA 3GXDA 3ZM8A 3WELA 4D6FA 4JKKA 4W8AA 4PUEA 4DWSD 2QF8A 3MUAA 1VFMA 4UFLA 1KXTA 4MAZA 4PSPA 1E0VA 3GNRA 3PZ9A 3WDRA 3KWXA 4NSBA 1UR9A 3ALGA 5E9AA 5TD4A 4ZXOA 1E56A 1VAHA 1WPCA 5I2UA 5GNZA 3WD0A 2D20A 5A2CA 4PMQA 4AXNA 2CCRA 2A3EA 1UD6A 1C8QA 2WW5A 3BLPX 3U57A 2GJXA 2BY2A 1BAGA 1UZ4A 1V03A 1JZ8A 4JFVA 1E4MM 3GXMA 3SCWA 1H0IA 1ZBVA 2VL4A 1LLOA 4R5EA 1JYWA 2DSWA 3ZO9A 4AIOA 1ISZA 1ZBCA 1ODUA 2EPOA 3M07A 3WMSA 3L4YA 1OB0A 3FY1A 4YHGA 1WE5A 3IAQA 4OBSA 4W85A 3A6OA 1DWHM 2FH8A 1BYCA 1UWQA 4D1JA 1PX8A 3VDHA 1Q6GA 1G01A 4JHOA 2GK1B 1GCYA 3L4VA 4GO9A 1JGIA 2VCCA 4HMEA 3SUSA 2WMIB 1HJQA 4ML4A 1V02A 1PBGA 4GXPA 2VCBA 1RH9A 1JFHA 2D23A 1BHGA 1H5VA 4DWSC 4UQDA 1IZKA 2WZIA 5E70A 3W38A 3HJEA 3TP4A 2J8GA 3AS3A 4CCCA 2WVVA 3IANA 4Y7EA 1GVYA 1V0KA 3FHQA 3CTTA 1M7XA 1XRVA 5A95A 5BWFA 3VGEA 2PWDA 1QBAA 5M17A 3SIMA 3PZIA 3NCOA 4J27A 1H49A 2OSXA 3OLDA 4MNKA 3VNZA 2XVLA 3WDJA 3FN9A 3G6LA 2RGLA 1FH8A 4GIAA 2ZX8A 1DTUA 1CLXA 1XHGA 5ABFA 2YL8A 4MB4A 3WNPA 4DWSA 2EEXA 3S6TA 1XSJA 1TVPA 3W25A 3KL5A 5JBDA 5D9PA 1KXHA 3SCQA 5HDRA 1VENA 2A3AA 1B3VA 5LA2A 2GDUA 3L2LA 2VX7A 4PBGA 3ZSSA 2VO5A 3AHVA 3NDYA 4GZJA 2WZHA 3BAJA 4H2CA 3SCNA 1D2KA 4LYRA 1GORA 2VVSA 2FDMA 5EFDA 5A8NA 4CD6A 1WZAA 1JI1A 4X0NA 2WSPA 2X1IA 4M1RA 5HPOA 4X9YA 3E1F1 4OOZA 4J7RA 3CIVA 3VD3A 1E1FA 1JAEA 2GK1A 2FH6A 4KGJA 4WK9A 3WUFA 3VM7A 3A3HA 2CESA 3N04A 1V6VA 2CBUA 3BSGA 2XM2A 3N1AA 2WM0A 2VZUA 4FLQA 1B30A 3AYRA 3AXIA 4GQRA 3GNPA 3AXHA 1KQZA 3MMWA 2C7FA 3MMDA 4MADA 1MVYA 2EQDA 1VFOA 3BCDA 4GQQA 4PSRA 5FD0A 2XWEA 3EDDA 1HT6A 1BLIA 3VIGA 5AY7A 1LQ0A 4Z2KA 1PJ9A 3PTMA 1X1NA 4P8UA 4LQ1A 3W6MA 1FHDA 3CZKA
chains in the Genus database with same CATH superfamily
4C6CA 5BU9A 5G2WA 5FL0A 1VHCA 5HQMA 4I9JA 1XD1A 1E6PA 4FX7A 5A1AA 1ZPTA 3MB9A 2AL1A 3VOJA 4AFYA 4GQGA 5FA5A 2OOGA 1ZALA 2A3LA 2WYSA 1AH4A 4ZQRA 5C2GA 4D8ZA 1HO4A 3KRUA 2X30A 3ABSA 2WMIA 2X09A 5I3HA 5H91A 3F2CA 3IK2A 3UETA 3H22A 1L6GA 2J7DA 1PHWA 3BMXA 4FEZA 1Y7VA 1RP9A 1EHAA 3TC6A 4ZGYA 5HUPA 2V2HA 4QLLA 3WBAA 4CQ9A 1JPDX 6A3HA 2C3ZA 4LF2A 1WP6A 1I2QA 2E67A 3Q2DA 2VD9A 4XX6A 1HGYA 1QMLA 1TELA 3FVMA 1MW1A 3FX4A 3A47A 1J18A 2TODA 4O11A 4I90A 3S3GA 2GZXA 1Q6OA 1EUAA 4O53A 3QKZA 1GOKA 2VDGA 4C6JA 2CLPA 4MFDA 2WZEA 3S2LA 1QNOA 2E9BA 1UWRA 2XGBA 1DEDA 2QQ6A 1ZSXA 3O2LA 4EPBC 2XN2A 1L6YA 4E38A 1VPQA 4L5ZA 3IARA 1SZEA 4IQJA 1KTNA 3KTCA 5D04C 2P3ZA 5K4ZA 3HPAA 4AZCA 3VDBA 3PSVA 4MY1A 3NQGA 1MUMA 3LMZA 2YDRA 3E2VA 3ZWSA 4C6OA 2ISVA 1B54A 2XSBA 3WLQA 1GTHA 1EZWA 2OT0A 1JF6A 4JTHA 4PC8A 5BCAA 3LCGA 2GGEA 4AIUA 3PNZA 5REQB 3WBWA 3M64A 3NA8A 1M3UA 2QV4A 3HTWA 4L4PA 2CNCA 4HPNA 3VYLA 4F0LA 1MQPA 1QCWA 3OGRA 4ADTA 4K36A 2RFGA 4B4FA 2GUYA 2WKLA 1R0MA 1SU5A 2W67A 1UW9A 1CGYA 4IIEA 1AJZA 6REQA 3W00A 4L64A 3WSUA 3UVAA 2ZC1A 4RNIA 3T2QA 1DHKA 2TYSA 1D7KA 3I6EA 4I5UA 5M03A 1L2UA 4GYPC 1FOBA 5CZ0A 3N2BA 5CPQA 3MU7A 3VIPA 4BI6A 1AJ2A 1P0DA 4GFSA 3NTYA 2QAFA 1L6WA 2OX1A 4ERAA 3WEMA 3RX3A 1FCQA 5I78A 4MDPA 4AIBA 1F6PA 2Z29A 3ES7A 3NOYA 1LRNA 3MYOA 2VNCA 1FQ0A 3V35A 3T0DA 2D2HA 3WLMA 3MKVA 4Q8WA 5AB3A 3CZ8A 3ITGA 1CGUA 4UQEA 1IWPA 1A4LA 3VGBA 3IRDA 3BE7A 2ZZ2A 3MO7A 1FDZA 1QNQA 1EB3A 2WWCA 4J3VA 1PCWA 2Z1KA 1H4PA 1QW9A 2J7EA 3ITVA 3TYDA 5IFPA 1CW2A 2CERA 3WEOA 3M7SA 3N25A 2VP8A 4KMQA 1V8EA 1JCJA 3TSBA 1HN1A 3BCFA 3FS2A 2ZZ5A 1JZ2A 2WC7A 2HEJA 4DF2A 3FIGA 4J28A 3B8SA 3WDQA 1NJJA 1E6NA 1H5YA 4M29A 1T6MA 3CAVA 4FO4A 4ILSA 2CFFA 2YA1A 2GOKA 1NF0A 3HJZA 3GHUA 2EKCA 1BKHA 3SCPA 2PTWA 4JIHA 3E2RA 5K9XA 1LRQA 3KP1A 1T0OA 1NWTA 1OCJA 3BLIA 3URAA 1IYXA 2O9TA 3KWSA 1P7TB 1WAWA 1YLVA 2A21A 2Y63A 3NQ8A 3H7VA 1UB3A 1M5WA 8TIMA 3WFAA 5LXEA 4WIWA 3T08A 4AD5A 1I2RA 4CNPA 1OC6A 4REQA 5LNSA 4XZIA 1QPQA 1THFD 4AEEA 1EF2A 3ABRA 1PB0A 3W88A 3RPDA 1RVKA 5TNVA 5BMXA 3HG3A 2PI6A 1OYCA 4K2SA 2OX4A 4K6AA 3WCZA 3WD2A 3B9OA 4IXXA 1O68A 4PUMA 2JE8A 1UP3A 4YN5A 1B3XA 2OQYA 2RGMA 3EOEA 1QAPA 3ZR4A 4JIQA 2EHHA 4O10A 3B3DA 4M56A 2FHBA 5MHBA 1NWUA 4QP0A 1JCMP 3UFYA 2WKJA 4JTLA 3LOTA 3EB3A 3BUVA 2PDHA 3BJTA 3VIJA 1NU5A 3NSXA 4L4OA 3S2JA 2FGLA 1FWFC 3QXBA 5BU6A 4ONVA 1S2UA 3L67A 3ARSA 2CLHA 3CPGA 1W3JA 3QHNA 1W1YA 2VOMA 3FK4A 1QI5A 3LZ3A 1E0WA 1TX2A 3GDKA 3WK3A 3REQB 1PEZA 5CSRA 2C16A 3PAJA 5FACA 3N2XA 1MO0A 2F9RA 4MDOA 2ODOA 3NYDA 4Q32A 3DFTA 1TR1A 1CIUA 4AZ7A 4FAMA 3IJ7A 4E3TA 3R25A 3CQKA 3NZ1A 4RL3A 3R94A 3PBYA 1UD5A 1AQHA 1XLEA 2Q8XA 1CGVA 5CPLA 4A05A 5HQEA 4JTKA 4TO8A 4CQDA 1G4SA 1NWRA 1Q2SA 2FLIA 3WJSA 5I7GA 3MCMA 3EDJA 2O9PA 2ZXAA 4JQ4A 1E5NA 3SCUA 3SCVA 3VGDA 2C71A 1JZ5A 2XIIA 4LAMA 4O0KA 1NEYA 1XIEA 3M6YA 1W1TA 2FHCA 1XR2A 1NELA 5D38A 5HMDA 3VXGA 1EPXA 2NSOA 4CVUA 2DORA 1LDCA 1BQGA 4GC4A 3OA3A 1TVLA 4RKAA 2OEJA 3BURA 2BVYA 1ADSA 1XC4A 4W86A 4PULA 2FJUB 1D8WA 1DE6A 4DQWA 3QZEA 3ZT6A 4C7GA 3WLPA 2V67A 2CLOA 3VGGA 4ZB2A 1Q6LA 1B4EA 4I8YA 2WBKA 2YSWA 2E5CA 3NFUA 1FXQA 4D6HA 4F79A 3IJ9A 1O5XA 4RPPA 2I5IA 2BHUA 2OPJA 5LIWX 3QHMA 1HJXA 3EB2A 3FA3A 3KOXA 1DJHA 5IDIA 4WKAA 2PTZA 3CMGA 2UY2A 3KLLA 3ARUA 3I4EA 5D32A 1F4HA 3M0LA 5HULA 2NVDA 3C2FA 2PDKA 2V82A 3GXNA 3F03K 1YEYA 1K8YA 4UTJA 5FAJA 3D5HA 3P93A 1V6WA 4PE8A 3DYMA 3DESA 4YXGA 1EIXA 2LLEA 2ZFAA 4UOQA 3DFYA 4M0XA 6TAAA 3PZNA 1DXFA 2POTA 2RDXA 3KOYA 2P8CA 2BOEX 4DHGA 5CC6A 2Y8VA 5F4SA 3QTPA 1YDNA 3AWOA 4M51A 3OO2A 3HG4A 4NNCA 2CHRA 4IMEA 1VH7A 1C8YA 2ZX5A 5A6JA 4TV5A 1GOMA 3C3UA 2HNEA 3N4EA 3V5OA 3R8RA 2VC7A 3BAIA 2QVNA 3DGBA 2HBXA 3BV4A 1PSCA 4HMDA 1R30A 3NM1A 4NAFA 1UA7A 5LIKX 3W7JA 3GBEA 1KWKA 1CGWA 5DO8A 4D72A 3H54A 4ML9A 3SURA 3QR3A 2ATMA 5E1QA 3RFAA 5GPRA 2YBTA 2PDGA 1W2VA 4AY1A 5JBFA 3WK2A 2XIMA 1P43A 4C6FA 1VBRA 1SPQA 2J8FA 3LHZA 1TQXA 1U5JA 4L9YA 4ZZ9A 3FYOA 3MI2A 2IXUA 1IXQA 1FH9A 1J0HA 2HS6A 3SJNA 1GJWA 5ABEA 2X05A 4D6CA 1B0IA 3PBGA 4N9BA 2YL6A 2XPKA 2YYUA 3DG6A 1U33A 4UXDA 1RV8A 4GUJA 3W73A 5A94A 1A3WA 3HZ3A 1CPUA 5D09A 2NQHA 2ZXQA 3UBPC 2VR5A 5D37A 3T4WA 1LM1A 5GJPA 3TEVA 4JOMA 1QI0A 1TE1A 3W2LA 2A7PA 4J3ZA 4DJEA 2GLKA 3C2VA 2VCAA 3WN6A 4GABA 1RBLA 1HJSA 2J78A 3L23A 1AVAA 2XH2A 4AMCA 4HTYA 4GQ0A 4AWUA 1WXZA 1R3RA 4PUDA 3OA5A 1W9VA 2Y6ZA 1S38A 3W84A 4CKQA 4DBWA 1I1XA 1X39A 3LI1A 5CZSA 1IGWA 1TUXA 3ZWTA 2NLYA 2GJNA 3JR2A 2DUXA 3FSUA 3GX9A 2H8ZA 2VRQA 3WF3A 1X8CA 5H6HA 1XIJA 3WMCA 3ATZA 3P81A 3FKKA 3ABQA 1EGVA 3E96A 3BV7A 3DZ1A 3VUPA 4ORIA 1HJUA 2VZTA 3IJ6A 3W70A 3C0LA 4XK2A 4JIRA 3PWIA 3GTHA 3F1QA 3PHAA 5D2YA 1TMQA 4Q7NA 5FJUA 3V75A 1RY8A 3TONA 5AHFA 1DKWA 3QHOA 1G6CA 4FXRA 5FJOA 4EWJA 4GJ1A 3N17A 3IV8A 2E9LA 1A5BA 4DJFD 1W9DM 2QLYA 3QQ1A 3M7WA 4FNRA 4QM1A 4CN4A 1R85A 2PBGA 1SQ7A 4GX9A 5J04A 5CG0A 4KQNA 3SRKA 2Q71A 4UTFA 5GQBA 1EJSC 2QUMA 2XH4A 1MXSA 3VTRA 2HQAA 4ZCWA 3V0TA 1UD8A 4Q4RA 3AYVA 4DY1A 4TTUA 4O4VA 2X0SA 4IL0A 3U4AA 4QAIA 4MB1A 3TW9A 2ZUNA 2Q3RA 2Q3OA 4EIVA 1B3ZA 4PA8A 1OFDA 1UHVA 4QITA 4DAIA 1WDPA 4J9JA 5AVNA 3TE9A 1AODA 4QJ4B 3MANA 1LL7A 3GVWA 1WUEA 4GH3A 3HM7A 1GG0A 4PRRA 4WCJA 3S1VA 4F0SA 1G94A 1QASA 1FWRA 3LXCA 1W1VA 4GUIA 4G7EB 4LBRA 2Z7KA 3NDOA 2GGIA 3D3FA 2QF7A 3WH7A 3AO0A 1O6IA 3CUIA 4YWIA 1CZ1A 2E4TA 3KHJA 3XINA 3V5FA 4FXJA 4RCXA 5C0QA 4W84A 3RU8X 4F66A 3HGOA 3CH0A 2FQIA 3N11A 4MKVA 2A2IA 2VFIA 4AY8A 3NQ7A 3TN3A 1Q65A 4QSHA 5IXEA 1OJXA 4GISA 4IUOA 3W2MA 1KNWA 3G1HA 3GNXA 3F4CA 1R7OA 3IWPA 3WL0A 4OBRA 4C6KA 4US5D 3NUKA 4FX6M 3H4WA 1NP2A 2OZ3A 5FCZA 2D2OA 1JRBA 3HGRA 1X6LA 4DUVA 4LALA 2NLIA 1OEPA 3IJLA 1D8CA 5M5DA 3RF9A 3O6CA 4GZIA 1MW2A 2P0IA 1KFBA 2EG8A 2QV5A 1HP5A 4LV9A 3C2OA 4WXYA 2NUYA 4HU3A 2FDSA 3HB9A 5H8MA 3CEPA 3B4YA 2FMOA 1LBLA 4PUKA 4OT7A 3VABA 1ECQA 1B4KA 5D33A 1LLZA 3WQVA 4D6IA 4JTFA 1XJBA 2WKGA 3DH7A 2IUZA 4YCPA 3AHZA 2QJGA 1LOLA 3NL2A 4LPCA 3H21A 3GTXA 3P5YA 1GHSA 3O63A 2DQWA 4NNAA 2RAGA 4BWLC 5KITA 4JTAA 1RJPA 1R2TA 3LS9A 1T5AA 3R12A 2Y89A 2QPXA 1W37A 1LZOA 4FLSA 1ZS2A 4DIAA 1GONA 1J93A 3W02A 3G1SA 3PBMA 3V0UA 3MVTA 4NI8A 4LSBA 3O1NA 4AAJA 1CEOA 4J5NA 5HXMA 1S1PA 1AH3A 5EMKA 3NZGA 4QJ3B 5I3KA 3LV5A 3T0BA 1XYAA 3P2VA 2BHZA 4LRSA 3R8HA 1I2NA 4WY0F 3ZS4A 4GUHA 5TIMA 3EWCA 4AY7A 1UD3A 4ZQNA 4LVFA 1QNRA 5CZKA 1H2JA 2V5CA 3G18A 4MHBA 1A47A 1XBYA 4MFEA 1PIIA 4MWAC 4J40A 1QPRA 4RLIA 2OO0A 5FF2A 3UZXA 5EFFA 3UZJA 3VKJA 4AQLA 1IE7C 3IUIA 4GVIA 8XIMA 1GYLA 3AZSA 3NDZA 2BX7A 1W2PA 3JVAA 4TVDA 2PDLA 2BXZA 3OIHA 3CQIA 2F6XA 1EYWA 4HNTA 2BY1A 2J47A 4TX9A 4IP7A 4JHMA 1UMYA 4LANA 1TPB1 4DJDA 3MSDA 2HDJA 3W37A 5HAOA 5LIXX 4QIUA 1R9XA 1TZ7A 5KEZA 2DW7A 4H4IA 4AW7A 3SCSA 3O6YX 4UWMA 3A13A 5BXPA 1VCGA 1WUFA 4IMAA 2HE8A 3KTSA 3A4JA 2VXNA 5BRPA 2WSKA 3NQMA 4M6PA 5FOOA 1FCBA 3C2RA 3WH9A 3UESA 4WD0A 3Q45A 2WSQA 4HNNA 3AIVA 4NYYA 1MDRA 3U2ZA 1RR2A 4DM2A 4CEXC 3KP0A 5CPMA 3K46A 3QMTA 4OQVA 2D2JA 3GK0A 4IL2A 1QHZA 2ZZ1A 1UOKA 8A3HA 3W71A 2MUCA 4UMBA 5C70A 2PLKA 3KVKA 4RDVA 4OHQA 3U8GA 2H8XA 3W72A 1V6TA 3UU0A 2FYMA 4UZUA 3W0KA 3UXDA 4E2BA 1N82A 4TOQA 4MOZA 3DC0A 2ZX7A 4AZIA 4OV9A 1R3VA 1J0YA 1MRAA 4PMVA 4JFSA 2VEKA 1DWAM 1J6OA 5G2HA 3VFCA 4A29A 1DJGA 3JUGA 5E93A 3M5VA 4HK5A 4KWOA 4FZIA 1OIFA 1ALDA 1XLMA 2QJNA 4S3KA 2R1MA 5KZEA 4IWWA 3HGSA 1IT8A 1KW1A 3DBPA 4JY9A 1Q7ZA 4BKNA 3ITXA 3L4ZA 3VDCA 3B0VC 2DSKA 3LSCA 1H1NA 3KVJA 3G8RA 1XW8A 2WHKA 4O1AA 1HUVA 4NL1A 1V3IA 3TLLA 1DYSA 1GK8A 2VQTA 3MCOA 1MUWA 3KVMA 3EA3A 3JRKA 2B7PA 3HU7A 1D9EA 5FSDC 4L1GA 3QF0A 3RDKA 2H3DA 1GGOA 4H9YA 3NZRA 1E5JA 1M01A 3P3BA 1C9WA 3NGJA 3G1VA 2C91A 2XISA 3AUOA 1J79A 1XYCA 5DN1A 3EAUA 3IPWA 4IG2B 2PDUA 1HW6A 4FIRA 3BPWA 3N4FA 5I06A 1K8XA 3W86A 1X98A 3C8FA 3RN6A 4M8UA 4OUEA 3SFWA 3A9BA 3UG8A 3QOKA 4IPIA 1M68A 1VLWA 3QLDA 2NVAA 4XG1A 4LB4A 2VMFA 1ONRA 2EXOA 1R38A 1RCXB 1W1ZA 1NTHA 3W76A 1KV5A 3R2GA 1A80A 3MV11 2W5FA 2IKHA 1TQJA 2I5QA 4WJXA 2RDUA 1DJXA 9CGTA 2W27A 1NDZA 1KXVA 3CHEA 1Q4NX 1XKJA 3BQ5A 3CU2A 2G3MA 2RJGA 1BVWA 3PWGA 4YWSA 4CQ8A 4IGSA 2CIPA 5CH9A 1XFCA 5H8PA 1Q45A 3EB4A 1BXCA 2RDWA 4Q7IA 1S3TC 4DUXA 3LPPA 1EPVA 2P53A 3U7VA 5MKGB 1EUNA 1HXJA 1TWWA 2ZDSA 4GYJA 3SADA 4QNWA 3F5LA 3TMLA 4XSMA 1SO4A 3VCRA 2QW5A 4GQBA 3PPHA 1P48A 4L80A 4UBPC 3VIKA 1C29A 1TSIA 4DJDC 4U3CA 1H41A 3KEHA 1CT5A 1GPWA 1V7YA 3RR1A 3SN1A 1G1YA 1W54A 1IHIA 5LA1A 1LROA 1Z44A 3V1HA 1VCVA 1AL8A 3R89A 1E4IA 3C0JA 4ICNA 3OYXA 2J77A 4ZO7A 3ARXA 4EXBA 4BS0A 1QOXA 2WSYA 3DCPA 1BF2A 1UWSA 1R9YA 3GC5A 1GT8A 3SUTA 3PTQA 1BGGA 3GU2A 2BOGX 1AJ0A 4N7QA 2YLLA 1IR1A 2H9AA 1BKSA 2R94A 1U1JA 4AH7A 2G41A 2W66A 3OVPA 4WLCA 2VEMA 2J7BA 3TH6A 1JUBA 4LYQA 4UOJA 3AHYA 3I7QA 4ECLA 4ZQMA 4Y8EA 3N13A 4HU0A 1ELSA 2AKZA 1SJAA 4C7DA 3TW7A 3EWZA 1XDLA 4E6MA 1OGGA 8XIAA 1E1CB 2A85A 3QV9A 1EF3A 3FHAA 4FS9A 4RDYA 3F7JA 1JNDA 2IQTA 3CO4A 4EPEC 5D9NA 5CGTA 3G1YA 3OGVA 2AGTA 4CD5A 3TYEA 3HPSA 1AQMA 4NIRA 4X2PA 1Z7AA 5CG7A 3TV8A 4WKHA 1SZNA 3NQVA 4PFMA 1UR3M 2QT3A 1Q6FA 3QZAA 4ZOEA 3TQ0A 1MSSA 5I3GA 1UZ1A 1Q3NA 1TFVA 3OVRA 3CUJA 2YR1A 4PMXA 1K7XA 5LGXA 2VQUA 2BMBA 1MXGA 3RUBL 2DZVA 2X40A 3MTWA 3JU2A 3ZIZA 3LRLA 3OBEA 4DN1A 3HOJA 4JTSA 1UPMB 3S2NA 2Y61A 3VA8A 1YXDA 4KESA 1UCWA 1IQ8A 3U9IA 3XIMA 2ZRWA 3W7GA 3Q37A 1YE4A 1TTJA 2VD8A 1W0MA 3IJ8A 3TOYA 1HP4A 1ZNNA 1LYXA 4PBFA 4US5A 2DH3A 1H1ZA 1TR9A 2Q8ZA 3II1A 3L21A 4J3SA 4DYEA 4EE9A 3PPCA 1YBQB 1BYDA 3QR0A 1RP8A 3VKAA 3ABXA 2NT1A 4JX5A 2Z7GA 1JJKA 3RGTA 3GNNA 3TN5A 3WL1A 2YDSA 5EGRA 5HQLA 3EWWA 1JAKA 3U2EA 1QHOA 1OX4B 1JPIA 3W7OA 4GIYA 4PTMA 4ZQCA 5FF7A 2ZX6A 3SGZA 3ZYZA 4S3EA 3O16A 2YZRA 3QQ0A 4HCHA 1JYNA 3WNLA 4RNFA 2YFOA 1PIGA 1UR0A 1J0IA 2F38A 3ZXWA 4UFHA 1Y5VA 4RXFA 3KFTA 2ISFA 3UERA 4V27A 4FF5A 1VLIA 3B9DA 5I79A 4XAFA 2XN1A 4B90A 1TJ2A 3GXDA 5FJJA 3E02A 4D6FA 1SFLA 2Y8UA 3EX1A 6ALDA 2GOUA 5D30A 1K6WA 1VFMA 5FJPA 1KXTA 4FNQA 4IHCA 3NPUA 1L9WA 3FYYA 2G96A 4NSBA 4CLMA 5E9AA 1M7JA 3OHMB 5LNUA 2OFJA 1DQXA 2PMQA 1WPCA 3QZ6A 5GNZA 4JXCA 4MWAB 3NQEA 3CAQA 3U4FA 1FUYA 3OTRA 2A3EA 3NVDA 3P74A 3VOGA 1UD6A 2I1OA 3U57A 4Z1AA 1XP3A 1BAGA 4I9MA 1UZ4A 3EWYA 1E4MM 3SCWA 3W7EA 1Z48A 1H0IA 3H7UA 1GW9A 4UNKA 1LLOA 1SO5A 4R9OA 4EOUA 2PWUA 1JYWA 3S6OA 3LCIA 4DF0A 2H90A 1JCLA 1WXYA 3L7RA 4RE0A 4A3QA 2PPGA 5JH1A 2EPOA 3VNIA 2WM1A 4JTIA 3QPYA 4CQAA 3IAQA 1OADA 5D2VA 1BYCA 1GJPA 9XIMA 1Q6GA 1G01A 4JHOA 5LIYX 3RYSA 1GCYA 4LEQA 1LOQA 3P8JA 3CS2A 4GXPA 2AQVA 1RH9A 2D23A 3BG3A 1H5VA 4DWSC 2WZIA 3W38A 1H7PA 3R43A 2J8GA 3TTEA 4H6KA 3GG8A 1RXOB 4CCCA 4Y7EA 3QY6A 5SWUA 4XIMA 1M7XA 1NFGA 3EPNA 1OQFA 4WQ6A 2E6AA 5LZLA 1XCFA 3VGEA 3V7PA 2DY3A 4ZQPA 3DU0A 1VP5A 2QR6A 4F0RA 1GWJA 1VIZA 3BG9A 3WDJA 4QJ5B 3G6LA 1DXEA 4MZYA 4GBUA 2X1SA 2ZX8A 1QWKA 3NM3A 4I9TA 3W1QA 1XHGA 1Y0EA 2FJKA 3OQEA 4F40A 4BY3A 5FEXA 3WNPA 2AQWA 4DWSA 3KL5A 2UZ9A 5D9PA 1RK5A 5FESA 1GEHA 2JGQA 2PE4A 3W1PA 1LQ2A 3GVQA 4LTSA 5LA2A 3GIYA 2GDUA 5CEWA 5EL1A 4LUYA 4F0MA 5T9BG 3TK7A 4ZSUA 3SCNA 4QR6A 2FDMA 5A8NA 2PU1A 1WZAA 4NZ3A 1IWAA 4ZO8A 3MJMA 3E1F1 4J7RA 3VD3A 2GK1A 4LUSA 2FH6A 3FJ4A 4X9SA 1LBMA 7ODCA 3GTFA 2WM0A 2VZUA 1B30A 1P6CA 1US0A 4JIIX 1KQZA 4WY0B 4M5PA 3MMDA 4JQ3A 4MADA 3I68A 3BCDA 2AMXA 3FJNA 5FD0A 2XWEA 5I07A 3EDDA 1F3EA 1TV4A 3VIGA 1ZGDA 4FNUA 2W9MA 4Z2KA 2A1YA 4FOKA 4Y9OA 3CZKA 3LRKA 1CWYA 5D9OA 1EIBA 1ONWA 5A69A 4GI6A 5AC8A 2WAGA 1UROA 2AMGA 3TJIA 4IM4A 2ISWA 4KRUA 1RK6A 1R3QA 3H70A 3QGKC 3WQPA 3KOZA 3PJWA 4C1KA 3DG3A 3STCA 4IGHA 5BROA 4JHZA 3VIOA 1G7UA 1TPDA 3KZPA 1NOUA 1C7TA 4HZ6A 3WF1A 3S2CA 4DJFC 4LXFA 3NQAA 2G0WA 4X0VA 3T8LA 3WDHA 2XUCA 1EC7A 1TCMA 5CBBA 4HT3A 4TU1A 4YNGA 1KM6A 4L56A 3PZVA 1A50A 2VC5A 1UJPA 1UWTA 1GKPA 5LNVA 4MWAA 4YTTA 4L9ZA 2GDVA 3RHGA 5I3DA 1D7FA 3CHDA 5HPCA 3WLOA 4O1FA 3FVDA 2WB5A 2DDXA 2DZPA 4CNSA 3WLRA 3M41A 3A64A 1UKPA 1TV2A 4J35A 3U6WA 4PYSA 1FA2A 1XRSA 1MFVA 3WUGA 1W9XA 3VE9A 3RNDA 3DHUA 3N19B 1GOWA 4KWWA 3MKKA 1JEZA 1BTCA 3Q94A 1EA9C 2J4GA 3KBJA 1FWWA 4B9ZA 5G5IA 3R8GA 1TMHA 4K7YA 3UT0A 1H7RA 4G7EA 1O12A 1KTBA 3YPIA 3WUEA 1J6PA 3D47A 3B04A 1NF7A 4IFRA 4Y90A 4S2CA 4CN1A 1SFTA 2WBGA 3GG7A 3MWCA 1FP8A 3NQCA 1AMYA 4AYGA 1VFTA 4X3ZA 1XXXA 3GSMA 4JQ2A 2ISDA 4DZHA 3EA2A 2PLCA 3A22A 4JN7A 1VBUA 3L5AA 1YXYA 4H6QA 3EA1A 1C8XA 1XH1A 4C90A 2F2KA 3QR1A 2G8ZA 3CZJA 2QDGA 1BXNA 4JPGA 3Q4DA 4F9DA 1HNYA 3ZR5A 5AN7A 5HINA 4DO7A 4PBEA 4C6BA 1EBGA 1GQKA 5AHEA 3EWUA 1LUCB 3VIHA 1XH0A 3S47A 3VMOA 3UWEA 1U5VA 1VD6A 1ZU8A 4CD7A 4HNCA 3GYCA 4E0CA 1XPYA 2G3JA 5MF5A 2ZXBA 3LERA 5EBAA 4LY8A 4DI9A 2ACQA 3L2IA 1PZ1A 2FPVA 3LCWA 3GXIA 3AISA 4PMUA 5C9UA 4TXEA 3G22A 4ATLA 4Q33A 1RCOB 4QEHA 1GOIA 1JQXA 4I5RA 1FFRA 4OBTA 4O1BA 4O54A 6CGTA 4NZCA 2QPSA 3DFPA 3EMQA 4MY8A 3DGRA 2VZSA 3HGJA 1W1B1 5AHNA 2VGFA 2OMAA 4H8NA 4A8LA 5HOSA 5REQA 7TAAA 4WX2A 3P62A 4GYFA 2QIIA 4YYCA 1X1ZA 2VEGA 2I9UA 4LT9A 1QRQA 4UFMA 1ZQ5A 3V1PA 4RE2A 2WVUA 2V0TA 4KEVA 2BWGA 1CNVA 1NOWA 3E2SA 5A6MA 4XZMX 3KZSA 2VENA 3FV9A 4HTBA 4BWLA 3BAKA 3MBFA 5FF3A 1Q4WA 2FZ8A 1CB2A 5EMUA 4HQVA 1TYGA 2Y24A 1BWLA 2OOFA 1K7EA 4KERA 4WJEA 3PZTA 1PKNA 3CZGA 3NPVA 4I7VA 4O1CA 1ML1A 2VI0A 3VINA 2HBVA 4LW7A 1Q13A 1C93A 3R0UA 2ZUSA 4TX6A 4CU6A 2X0YA 3LHVA 1TRIA 5H1WA 1EZ2A 4U31A 2G4JA 1ISYA 4XZNX 2INEA 2D3LA 3G77A 5CPOA 2V38A 1GVQA 3UP8A 3LG3A 2PDCA 2EGZA 1K3UA 4DO5A 1DV7A 3CL7A 4U33A 2V69A 2QEZA 3L12A 2BNJA 1P1MA 5DELA 5AVHA 4JKMA 1HZYA 4XKYB 1F5ZA 3NWRA 4MTVA 4IPLA 1HKMA 1M9HA 4OVXA 2AKMA 3L4WA 2XG9A 4PN2A 3TNBA 5IRPA 2CBVA 3AU2A 1KFLA 4KEUA 4DBUA 1QFEA 1QVBA 2BVWA 2QJIA 1EHNA 2YXOA 1VRXA 1IIHA 1MQRA 4FNTA 4U5KA 3PN8A 2WMKA 4TX8A 1V79A 1CXFA 3PZQA 1UKQA 1F07A 2NV9A 5C71A 2EKGA 1TWDA 1W3HA 4XTIA 1EWEA 5A8MA 3NGFA 1FTXA 2VOTA 3M43A 4DPPA 4M1BA 2VJXA 1ZZMA 1RD6A 2X16A 2WQDA 4WGHA 3AMLA 3C2EA 4XQ6A 4ASTA 1ITUA 3KE0A 4QQ3A 4IIDA 1XIHA 3BTNA 1WQ5A 1DIKA 4HN8A 1V3MA 5C55A 4REQB 3I65A 3W7MA 2P3EA 1K9DA 3DHFA 1CYGA 3OLIA 4PODA 2D1ZA 3WKZA 3K5XA 4IIGA 4GRSA 3HO8A 7PTDA 4IGNA 1HKIA 1I75A 2DJXA 8RUCA 2QVHA 1BD0A 1UKTA 5CGMA 2QPUA 3GR8A 3C5QA 3H4GA 3GO2A 4GI4A 3W1LA 1PIFA 1JDFA 4OU1A 4UIOA 3H2EA 4MIMA 3WF0A 4DI8A 3SECA 3A4XA 3UWVA 1NWSA 2HISA 1EP1A 1E6RA 4E4UA 1OSEA 3TUUA 3RK8A 1EJXC 4AWTA 1ZUAX 1O60A 4QDWA 3MI6A 2X7WA 4ROQA 4ZE4A 1C91A 3VM5A 4K1WA 4O4WA 2YZ5A 3DOPA 4DLMA 2Z25A 1G9HA 1QW7A 1SFSA 3T81A 5IFTA 5GNXA 2V3GA 3CXOA 2WC4A 1S2CA 1O95A 1ZP4A 2CLIA 2R91A 1W3TA 2J7HA 1W9PA 2VRKA 1FKXA 2HNHA 5HMEA 5T8GA 2QNEA 1VYPX 8CGTA 5HNUA 1DWIM 3O7UA 1UKSA 5CJNA 1U22A 3BANA 4Q4PA 5CXPA 1KFJA 3OZYA 4LS0A 2ALRA 4OWGA 3TTSA 3W7KA 4CGTA 3BH4A 2FKPA 4IJRA 4PUJA 2Z4GA 1ITCA 4WSJA 2YFNA 3THCA 3AMKA 3ARZA 3KUMA 3V5CA 3G1FA 3AC0A 2YB1A 1XLAA 1V08A 3FEMA 3EKZA 4XD4A 1J11A 2XHYA 2FFIA 5FEWA 3WNNA 3FDGA 1HKJA 2E0PA 1EYEA 4CN6A 3PY2A 2Z2AA 3C4UA 2SFPA 2DP3A 5J8LA 1W5PA 4L6DA 3W22A 3WF4A 3SY1A 3UZZA 4EF9A 2OT1A 4UCFA 2WJFA 1FY6A 4H7VA 3T07A 4GLEA 3M5ZA 5CCZA 5DY2A 2BBFA 1NFPA 3ANVA 2WMFA 4M7TA 2Z2BA 3AS0A 4W7WA 3GKFA 2ZBTA 3LHUA 3GDLA 3ARVA 2GWNA 4KIRA 1FBAA 4FNSA 1F74A 4NF7A 2PB1A 1DJYA 3TYAA 2YGYA 1TA3B 1E1CA 2FZ9A 4MJ4A 3CT2A 5FEPA 1QNVA 3AIEA 3M5YA 4Z17A 1AQFA 2F6UA 1E71M 2XZ9A 3IIXA 1IXOA 3CAKA 2DIKA 5LNWA 1PYFA 2GUUA 3G0XA 2OGYA 2J62A 1TO3A 1YTEA 5KSWA 2DZUA 3AS1A 5K2ZA 5HWJA 3L4UA 3HBLA 5HA7A 5M1TA 3I3BA 3QC3A 4A8RA 1P1XA 4I5XA 3VZXA 2OR2A 4R88A 4UTTA 2Z00A 4MB5A 1E6SM 3B9EA 5EMMA 2WK2A 4KCUA 3GIPA 2ZX9A 1JULA 4PTNA 1SR9A 1PKYA 4ZL1A 4HSOA 2WHMA 2VURA 3UZWA 5CJ5A 1E9ZB 1T99A 2PAJA 1J0JA 1KM5A 3QY8A 1TV3A 5KZ6A 2JGYA 4L4MA 4B16A 2WVVB 3C0QA 1Z3NA 3WD1A 4HU8A 4DUOA 3W23A 4QGCA 3RPTA 4JIPA 4KWSA 1JF5A 3FA4A 3LV6A 4EAYA 3WK0A 1JPMA 1L8NA 1WKFA 4LWWA 4OE7A 2A7RA 1FWEC 2Y7GA 5KMYA 2VZOA 4JFWA 2QAPA 3KL3A 4D6GA 1DXIA 3G8EA 4FB7A 4UFIA 1AZ2A 1FWIC 1KR1A 3UEQA 4OKDA 3IK4A 3U5YA 3NPWA 2DSZA 1CLVA 5XINA 4FK9A 1RA5A 4B3KA 1LWJA 5E09A 4LF1A 4BF5A 3THAA 1AG1O 2D2GA 3VO0A 1WBJA 2C14A 3E0WA 4JR5A 3QFEA 1JL8A 4BR1A 4R3UA 2A4AA 1NSJA 4DUWA 3S5SA 3SGUA 5EU9A 1K70A 4URIA 3WFZA 1BVZA 2ZE3A 1EDQA 3H23A 4L61A 2QDEA 3CHFA 1JNEA 1NDVA 3IAPA 1QXLA 1DWFM 4YTSA 4XZLX 4LCSA 3PWAA 1ONEA 2VVNA 1PYMA 3AOFA 4JFUA 1BRLA 5CAKA 5C6MA 4HA0A 3W27A 4Z0JA 3UD6A 2FMNA 3F5JA 3NEHA 4MLRA 2QJHA 2PRMA 4Q8PA 3S1XA 2RUSA 3WQ5A 3CIWA 2OO6A 3W6LA 1SJCA 1H7WA 3RM4A 2BSLA 4HA3A 4IPJA 5BXTA 4IX2A 4CUCA 4JL1A 2X7VA 4KF1A 1SW0A 1A5AA 4Q8VA 4EP8C 2HVMA 3VOIA 2BODX 4B5XA 3OLGA 4GXWA 3TN4A 4G5DA 3SW6A 3TXVA 1RPKA 3TCSA 3WEZA 3M0MA 3GS6A 4N4QA 2DT2A 5E9XA 2P5NA 3CIXA 4EX4A 3FGCB 4JS3A 5KZDA 1UWIA 3GH7A 1TJRA 3WMBA 1RAKA 4AHQA 3AIRA 2PF8A 2R1NA 3IV3A 2BVDA 4Y96A 4GGHA 2EPMX 4W9TA 3ENLA 1OT1A 4H9TA 1F3TA 3T42A 5K3VA 4XIAA 4TMBA 1IF2A 1BPLB 1KGWA 4KIEA 5XIAA 2WHJA 3GRIA 4D8AA 1LL6A 4KPLA 3QSRA 3TYBA 3PZMA 1U1HA 3ZOAA 2WWDA 5E0CA 3VDGA 2WLYA 1MQQA 2XIBA 1OIMA 2W62A 1HF6A 5LHFA 4XZ9A 3CH9A 3RLVA 5AC4A 4JD4A 3NJ3A 3USZA 1WYIA 1R8LA 3LD5A 1UBSA 2OSWA 4A4AA 2PFHA 2QGHA 1WBHA 1UWAA 1T41A 3BL3A 2BS9A 4QQUA 1S1RA 3WQ8A 4H9VA 4L6HA 4M19A 2PWHA 5D03A 4C6MA 4H3DA 1Z32X 1JFXA 1QNSA 1FH7A 3VDAA 4OV4A 2O92A 3KDOA 1A5OC 5CLWA 1F2JA 2C6QA 4GJJA 4HHHA 4LC8A 3WUBA 1XBVA 1GQJA 1R6WA 3QW4B 4L65A 3WF2A 2CHNA 4C60A 1KM0A 4HOXA 1H11A 4K38A 3ITLA 2ZC8A 3L2MA 3UJRA 4EPKA 2PC4A 3WLNA 4ATDA 2J6VA 4S1FA 5BOEA 1N7KA 2C19A 2ZVRA 1X6UA 2R24A 2BGNE 4XV0A 3ISIX 4EVZA 2OEMA 4XZWA 1X1OA 1KO0A 3UYCA 4CD8A 4GO8A 1V3JA 4B91A 2VC6A 1HX0A 1N8WA 3WQWA 3P8IA 3A12A 5K9DA 6REQB 3DDMA 4MPKA 5D8ZA 3QBUA 5EKYA 5ABFB 4HYVA 2GVGA 2GJRA 4PCNA 4NI3A 4N2YA 2ACSA 1BRLB 5C9WA 2R6OA 4PMNA 1SVDA 1UR1A 4PR4A 3R0DA 4P7RA 4QS5A 1DVJA 3L4TA 5I02A 4PTXA 2YW3A 4Z2IA 2ZZ6A 3NOEA 1FDYA 4CD4A 3WBEA 4MZ8A 2DU2A 3GKAA 1XG3A 3M6DA 4DJFA 2ZVIA 1W5MA 2J79A 5AC6A 4YVXA 3NO3A 2AL2B 3MP4A 4EXQA 3PPGA 5TBOA 3E6EA 4IP5A 4J4KA 4UCGA 1DIEA 2DVXA 3MUZ1 2CLFA 1KXQA 1TUFA 1REQA 3PZOA 3R58A 5DBUA 4W5UA 1OCNA 3DERA 4AYSA 2GVJA 3UGVA 3SO7A 2EO7A 4ALDA 1WOBA 1OX6A 1PZ2A 3BAXA 4C1NA 3QM3A 2DPEA 4V28A 2AGKA 1TPH1 2AAAA 2WC3A 1AW2A 3BLKA 3T09A 2PGFA 4JNMA 3D0CA 3CPUA 4AEFA 3SB0A 3VE7A 4POCA 3EOUA 3VD7A 2ZUMA 2QCNA 3I6TA 5LYRA 4M80A 1L0PA 3MBDA 5EMLA 3G2GA 4O28A 3KBSA 4AZHA 4MUZA 3W1TA 3OZMA 2PA6A 4C65A 3TC3A 4RV8A 3INPA 1KRAC 5AYYA 3GBDA 3WIJA 3CO8A 3UWQA 3T0CA 2TAAA 4C5ZA 2INZA 2O4MA 3GAKA 4RZBA 3IIPA 3S0CA 1VYRA 1PWLA 3N9KA 4NRSA 1CLKA 1TWIA 1QI4A 1QHPA 3EZ4A 1JDCA 5A6AA 1IT0A 4M6QA 2I5GA 3UCQA 2CWNA 2FPYA 4TVUA 1KLZA 2YDQA 2J13A 2D0FA 2PDFA 3MI3A 4DF1A 1KCZA 3SBFA 3A3XA 5CZJA 4JKLA 6XIMA 3IIOA 3IIZA 1DWJM 3BQ6A 2WXDM 2FB2A 3DKJA 2DEPA 3ITOA 2ZIDA 2NUWA 3N3MA 2VGGA 4GY7A 1ONXA 1E3ZA 3KRBA 4YLWA 5DRIA 4S3DA 3UWWA 2G3NA 5LIUX 1FXPA 3C6CA 2B7OA 3M0IA 2C1HA 2XDFA 2WCSA 2NVCA 1K4HA 3UR2A 3KOWA 4BQ5A 4C6NA 3QLLA 1IT7A 2V3DA 3PAOA 5DMYA 2EF9A 4BFAA 2J7FA 2ZZ4A 1B2YA 3WFLA 4AD0A 4FXFA 3VX0A 3WNKA 2NV2A 5AHMA 2JFEX 4K8HA 3OW1A 1DOSA 2R1LA 1EJRC 2DSVA 3GC4A 3AJ7A 4BZYA 3EMCA 4TIMA 1UWUA 3EEZA 4DYJA 3APYA 2Z27A 1V02E 3E74A 5JIPA 4O57A 4ZOBA 1GW1A 2QCFA 4UTUA 4AIEA 2AL2A 3V4BA 5KETA 4MJ2A 2FVLA 3LGEA 2X2YA 2BHYA 4CVWA 4EAMA 2GGHA 3ECQA 3KHDA 3S5YA 4E2OA 1UOZA 2OVLA 1HJWA 3PF3A 1OHLA 2Y8KA 3LNPA 4O50A 3G1AA 1K03A 1QTWA 1Q8JA 2TSYA 4HCLA 1D3HA 2V81A 5FJTA 2XJ7A 4LYPA 4HA4A 1QATA 2FGZA 4PMOA 3H7RA 4IH3A 1ECEA 4H2HA 4RV3A 1D3CA 3N34A 1JZ7A 4ATWA 4MJMA 3UY8A 3B0UX 4XVEA 4LUTB 4XZHA 3P82A 4F2UA 2VTFA 2Z1XA 4FMVA 3S6DA 4BK9A 1GVEA 3H12A 3WLIA 1QJWA 1TJ1A 1E9IA 3LCXA 3CLWA 4BQ2A 1QWGA 5C5YA 4NRRA 1ESWA 4GZ7A 3VPLA 1EC9A 6XIAA 3K2GA 3BLFA 3KBMA 1K9FA 4AX7A 1EGZA 4F48A 4DPQA 4LCQA 2YIHA 5E0FA 2GJLA 4UQ9A 5AFDA 4V2XA 3OG2A 3WJXA 3QV7A 4RW5A 4E5TA 3M16A 1NARA 5JBEA 4G2DA 1EX1A 4NILA 3LPFA 4JDBA 2GYIA 3TWBA 1YNYA 3UA3A 3E0FA 3MHUA 2A3HA 3WLJA 1NDWA 3U5UA 2Y7FA 1LG2A 1T8XA 3CMFA 3WQ6A 5CC5A 3HG5A 3GZAA 1KFCA 3SUVA 1IEVA 4E4FA 1GUVA 2Y0FA 1AA1B 2YYTA 3FJ6A 3K4DA 1G4TA 1ZJBA 3H2FA 3T1GA 3M9YA 4G6CA 2NX1A 1SMAA 3HPZA 3WNOA 4J3WA 1XD0A 4AD3A 1J10A 2BY0A 1YBQA 5CSYA 4P8VA 2DSUA 2Y5EA 1M1BA 1TV7A 3EGJA 3UNDA 4LVBA 4QE1A 4XTDA 1PCKA 3U3HA 4AC7C 3BICA 3H8AA 1I2PA 3KS5A 1YRRA 1OABA 1LF1A 2E28A 1ZJHA 1CGXA 5BNKA 4UQCA 1JCTA 3K1DA 1AW1A 1XYLA 3O06A 5G1YA 4DX3A 4KWVA 5C9XA 4GHRA 4TTGA 7XIMA 4NJKA 4O52A 4FLRA 5G4EA 3Q58A 4QRNA 1QPOA 1ZBKA 2IKJA 5BWAA 4NNBA 1XRTA 5EA9A 1GQIA 3S5ZA 3DENA 3W2UA 2WMGA 3K4WA 4OECA 1N8FA 1AK5A 4PUWA 2QCEA 4NZFA 4NT0A 3M0JA 1XYFA 1W9BM 1TWZA 1K1DA 2XVPA 1DE5A 4HZ7A 3EDKA 2FIQA 2C18A 1WCGA 3WELA 1KKRA 4DWSD 3MUAA 4GG9A 4MAZA 3W85A 3AALA 1TIMA 4ZTYA 3KWXA 3F4DA 2V30A 3FCPA 3TIMA 3CQ0A 2D20A 2CZVA 4PH6A 5A2CA 2PDWA 3FEQA 4HSHA 5JQ9A 4QS6A 2PDQA 5L6UA 1UASA 4AWSA 1ZBVA 1H61A 2PODA 1EP3A 1K02A 2DSWA 5F2IA 3MCNA 4NXSA 5BW6A 4E2VA 3ZO9A 3K30A 4JX4A 1ZBCA 2QCGA 3IACA 1NDYA 1CX9A 4IIFA 3M07A 4ZO9A 2XIQA 4DBDA 1OB0A 3FY1A 1GVFA 2Y88A 2I57A 4W85A 1DWHM 5H8UA 2FH8A 4D1JA 3A21A 4H7ZA 1YDVA 3L4VA 4NU7A 4JTEA 4GO9A 3QRHA 2VCCA 3L66A 4H7CA 3SUSA 2WMIB 3NNTA 1B57A 4UQDA 3LLXA 3HJEA 3O8AA 4W4QA 3TP4A 3IANA 3N2OA 4P5UA 3FHQA 3EOOA 1XRVA 3STGA 4O1EA 3GYEA 1GEQA 4TV6A 4LBSA 5BWFA 4HSNA 2PWDA 4NYUA 3GVGA 3WQDA 4V33A 4XD5A 4J27A 5DLCA 3SY5A 2WV8A 4R53A 1KM2A 2XVLA 3FN9A 4HNVA 4ZVJA 2E09A 5HR6A 1FH8A 2VGBA 1JUEA 3CYJA 2R14A 1DTUA 1CLXA 3W6YA 4O19A 1DBTA 3GHRA 3HFYA 2QUUA 3LDVA 2PWVA 3R0KA 3UY7A 1YDOA 4XKYA 4Q6JA 1QO2A 4GNKB 3LK6A 4GCXA 4UR7A 1KXHA 3GAYA 5HDRA 5IBXA 1A5UA 3SFKA 3H26A 4MF4A 4GA8A 2VX7A 2NZLA 3NDYA 4GZJA 2WZHA 3REQA 3KXQA 4LYRA 1GORA 1K7FA 1PHQA 4ZA0A 1JI1A 4X0NA 1DORA 2WSPA 4AU0A 1OYBA 1RBOB 5HPOA 4X9YA 5G4WA 1SO3A 4GIEA 9XIAA 3H4XA 3SR7A 1JAEA 1NY1A 3MC5A 3BARA 4KGJA 5AECA 4WK9A 2CESA 4PB5A 2PD9A 2J27A 4AX6A 1MUCA 4FLQA 3L5MA 3TKFA 4GYPA 3VNDA 1XLCA 3P5ZA 2ACRA 3WQGA 2EQDA 1XISA 1VFOA 4K39A 1TZZA 4NZ4A 4Y9NA 3BZGA 4WDWA 1HT6A 1PWMA 4MYAA 1WDWA 4HZMA 2E6FA 1LQ0A 4Z1YA 2FZDA 4ZTXA 4NJJA 1FHDA 1DJZA 2ZUTA 1L6FA 1KCXA 4KFPA 3COTA 2JBMA 9RUBA 4R9XA 4ZODA 4FPSA 2O7SA 3UNTA 4L1WA 1Z9AA 4B15A 3CUGA 3QMRA 4HMNA 1O4UA 4QX4A 4MNLA 2XSAA 4WF7A 3P80A 3SRDA 4NXKA 1CXEA 3PJTA 5AKQA 3HURA 1SUXA 1CXKA 5CKSA 4IMGA 3EDFA 4JY8A 3H55A 4LAOA 2PSNA 2WMJA 3WLTA 4D8LA 3W7HA 2QDDA 5BOFA 4Y2WA 4I3GA 1XIFA 1XG4A 4J2PA 7CGTA 5FEZA 4KCVA 1US2A 2DT1A 5A6LA 1HL9A 3DI1A 2C13A 1J01A 3VNKA 2E1DA 2V3FA 2IKGA 3SY8A 3UCCA 3W82A 1GQLA 3BJSA 4MAVA 4ZXLA 3OJGA 4A22A 3M0VA 2BDQA 2BB0A 3M4HA 2ASHA 3FXGA 1TPFA 5A2AA 4UOZA 3VUSA 3CEUA 1ZFJA 3OB8A 5EBUA 3P61A 1POJA 3BGGA 1E0XA 2Y5JA 3A23A 4UMCA 2KAUC 3PTDA 4DXVA 1OD0A 1K9EA 2ABAA 4I7WA 4W87A 3RRAA 2PC8A 1GOQA 5I00A 2W61A 3LMYA 2XN0A 5JH2A 1RJQA 2Y4SA 5F2MA 4JCLA 1UUQA 3F5KA 2FTWA 5HNNA 3PG9A 4BQ4A 5FF0A 5KZMA 2GPTA 3MUY1 1ISXA 5A8OA 1F8MA 4QE5A 1R2RA 1R3TA 2CXEA 2YL5A 2A3CA 4XAGA 1XICA 1OG0A 1O1ZA 4C6PA 3EBVA 1EBHA 2QUVA 4S3GA 1CTNA 2CPUA 2X1RA 5B7ZA 3LPGA 1ZRQA 2Q02A 4H00A 5A8GA 2J75A 5DT7A 3QMSA 3HIJA 3I7RA 3WO8A 5A6BA 1F61A 3H2MA 2HRWA 3K13A 3ZT7A 4IQEA 2BGQA 3GNDA 5F1VA 3CV6A 3S9ZA 1XS2A 1XX1A 2B4GA 3R4IA 2CLEA 1ZJAA 3L65A 4JTQA 3O07A 4ZR8A 2WCGA 1E70M 3MUIA 1V51A 4PMYA 3K1GA 4U5IA 2QUTA 5IHRA 3KL0A 2PWEA 2XFWA 3HN3A 4HHMA 2E77A 2VEFA 4UTMA 3W53A 1V3KA 1S39A 4INFA 2MNRA 4LNYA 4AVFA 5FSEC 1XBXA 4HU4A 1G67A 1S5TA 2IPFA 3MHFA 3ZR6A 3LM7A 1F4AA 2BVTA 3C0SA 1IR2A 2PUZA 1UP2A 4I6KA 1R3WA 1VPYA 4KS0A 2VZVA 2XFFA 1QI2A 4IUGA 1EGMA 4MB3A 2ZADA 3C3NA 2XM1A 4O17A 2HCVA 3W7QA 5IHSA 3FOKA 1EFZA 2RJHA 4NJGA 1HTIA 5DANA 1TMLA 3GC2A 1O94A 1Q6QA 4G1NA 1MDLA 1SZGA 3TQVA 4B9YA 3GM8A 1PKMA 4H8VA 3FJLA 3PVFA 5CSSA 4YL2A 2IPJA 3S1GA 1XF0A 2PP3A 1UH4A 3LXBA 4RX0A 1ZCOA 4S3JA 2WNWA 2WPBA 1XIMA 3BOXA 2J7CA 3M1ZA 4PMZA 3N4AA 1W91A 2NQ5A 2VUNA 5IDZA 3MPGA 2D0GA 3H2OA 1U83A 1R3YA 2JF6A 3PNUA 4RNHA 1LWHA 1DJQA 4WKFA 3OBAA 1M03A 2OSYA 2YDAA 4BF7A 4P7LA 4LV4A 1YPIA 4QG9A 2C79A 3AIUA 3GDMA 1TREA 4JN8A 2WNZA 4O15A 4A3RA 2OWWA 1W8SA 3G1DA 2GWGA 4AHPA 4RZ4A 3W1XA 1VFSA 4JEJA 2KX9A 1CXHA 1M04A 1P0BA 1YTDA 5ECUA 1Q85A 4WOQA 1TKKA 1NH6A 1LCOA 2I16A 3LEPA 2QCDA 3NQBA 4AUBA 3BSMA 3GG0A 5HJYA 1HIZA 3OVQA 1LJYA 1V93A 4JTRA 3DUGA 4EF8A 1Q6CA 3QH2A 2AQOA 3SCOA 1TV8A 1EXBA 3KAOA 2IW0A 1DWGM 4JX6A 2WLZA 3FSTA 1E43A 2FVKA 4E8DA 4Z2JA 1AH0A 1XGDA 5I0DA 5HUOA 3EXSA 3NL3A 4N42A 1E73M 1KQYA 3LZ5A 5F2LA 3GTIA 4Q8MA 1DIOA 5AZ0A 1LBFA 4AZ6A 4JL2A 4PB4A 2JEQA 3CNYA 1GYMA 3E9AA 3VAVA 3MS8A 3NEVA 3A4WA 4DRSA 5HJLA 2PEVA 5E5CA 4FSAA 3KCOA 2ALDA 3ZJKA 4GYKA 1BWVA 3B9NA 1SFJA 1LRTA 1KFEA 3B8TA 4AHOA 1JVNA 4S3FA 3GE7A 3DI0A 2QCCA 1MEWA 1M7PA 4CU8A 1BFNA 4UR8A 1GOXA 3AYTA 1NOFA 5FI8A 3OIXA 3NO5A 1KWGA 1N2VA 3AICA 1XDJA 3LYEA 3WQOA 4QISA 5I5RA 2ZUWA 4AZBA 3R1ZA 4I6VA 3NZQA 3W29A 3N12A 1F05A 4AVOA 3WLKX 4B2DD 4GI8A 4XO7A 5CLTA 1JPKA 1ZJIA 3DX5A 5HBFA 1XIIA 1JRCA 2OLHA 1SSDA 1EKOA 2ZRYA 4HKPA 5K7JA 2REQB 3SRHA 5LXXA 2J6XA 2O4QA 3PUGA 1CXIA 1EQCA 1TTPA 2GVLA 5F4XA 3MUCA 3RPMA 5FKYA 4A8NA 1JDEA 4MVAA 2ISSA 4QCEA 1A0CA 3STFA 2G3IA 3N6QA 3GQYA 1TG7A 5ENLA 5G1TA 3LA4A 3RMJA 1XCWA 3RU6A 4A21A 2OQLA 3UJEA 1TX0A 4AZCB 2QZRA 3NAVA 3LNMA 1UUMA 3D6NA 2OYMA 4RE4A 3KCLA 4WXZA 1J0KA 2ZYFA 3M46A 3UXIA 4GWEA 4DAFA 4UB9A 1TE6A 3QYSA 4Z2GA 1JYXA 2O0TA 1RLDA 1EX5A 1V4YA 3ITYA 3HQPA 4DO4A 5JVLA 3TTQA 3UPWA 2VEPA 3A5VA 2ZUUA 1GVOA 1NVMA 1GVRA 1WX0A 1X7FA 3E5BA 1YMYA 2YXXA 5DEZA 3SCRA 3FW6A 1LOSA 4RNJA 2GVYA 3LCLA 1TRDA 1TV5A 2J74A 4UUIA 4WJ8A 3AIQA 4C5YA 4W7VA 3THUA 1W5OA 3BG5A 5IOBA 1PXGA 5I3JA 1TJPA 2CEQA 1OC5A 4P7OA 3A24A 3FXYA 2WVSA 1Y8BA 2HWGA 2GDQA 4C1LA 5F4WA 1E6QM 1RQHA 3TFCA 3V36A 4JTTA 1M6JA 3CV1A 1Z69A 5DXXA 2O7QA 4C91A 3BLEA 3WD3A 3UR7A 2CITA 4B4HA 1XKYA 5AYXA 1UBPC 1X6NA 3ALFA 2F6KA 7REQB 3PZUA 4QE4A 4MG4A 4AEOA 1K8ZA 3BMVA 1IEWA 2NWRA 2QCDB 2WPGA 5JU6A 2BOFX 2XINA 1HQTA 2IMRA 4B5UA 2YLAA 4LUTA 4XBSA 4FX8A 3FA5A 3IGHX 3IS4A 3MP5A 2DW6A 3R10A 4GOAA 5HMSA 3TSDA 4GVHA 2HXUA 1LL4A 1SSGA 3LCFA 1A5KC 2HE5A 2OQHA 1G0CA 1HL2A 2YW4A 4Y9PA 3I6RA 1I4NA 2PDBA 1PAMA 3LUTA 3N2MA 2ZE0A 3HFTA 1BEUA 1KM3A 2PDJA 1RQBA 1FWCC 3PJXA 7ENLA 3QGAC 1K9TA 1AUSL 4NJHA 1IEIA 1KR0A 4JNYA 2ZRXA 5U4NA 4DELA 2BZNA 4PRWA 4MMWA 4O8AA 1F3WA 1FCUA 2F8QA 3LB0A 4E4PA 2Y62A 4OFCA 3UXLA 2O9RA 2BV9A 3RLHA 3WLLA 3LI0A 2GJXB 3OLEA 2NW0A 3CMJA 1IV8A 4LBUA 3HMJG 4NJIA 3HV9A 3VD4A 1GTEA 2VFHA 3BOFA 4FLOA 5DMMA 3GDRA 5H2ZA 4CCDA 2OCZA 3CHCA 1M41A 4H41A 4QLKA 4UNLA 2YXGA 2ZDRA 4YVPA 1X96A 3OEXA 2NQLA 4Q8OA 1A5SA 3G0UA 1WKYA 4O13A 4PMDA 2C1IA 4YPJA 1UIOA 3Q67A 4FALA 3QC0A 1EQPA 2XFYA 5AYBA 1UZHA 4M3PA 3TVAA 5I24A 3O15A 4W88A 1MXDA 4DVOA 3WH8A 1VIWA 4Y9MA 3RJXA 1YHTA 3ARRA 3PUDA 2EBNA 3BO9A 3L0GA 5FIPA 3E0IA 2P88A 1SO6A 1W31A 4Q22A 1UH2A 3WNMA 4IP4A 4DJED 3GDBA 5AZ1A 3VD5A 1VFLA 3ICJA 1W1A1 3PR2A 3EYPA 5BXRA 3I3EA 1PUDA 3WQ4A 1Y65A 1M53A 1XSIA 2V3EA 4NZ5A 2ZWZA 3RXZA 1XSKA 1I60A 4FOJA 2G37A 1AMKA 3T8QA 1B5TA 4Q4OA 3GLCA 1JD9A 3UGRA 2FZNA 1T96A 4O14A 4C6EA 4NAEA 1BGAA 3QV6A 2VWTA 2ONEA 3EXRA 1A53A 4LS1A 1DQWA 1GQNA 5I77A 4V1XA 3W83A 3B03A 4M7SA 4RW3A 2ADAA 3G3DA 1JGMA 5C8BB 2GSHA 3VNJA 3NURA 2XU2A 3WY1A 1SMDA 4S39A 2QS8A 3O6AA 2OTDA 1HG3A 1VZWA 3CZLA 2NT0A 4Q4KA 3BLDA 1OT2A 3TNOA 3VNLA 1ZAIA 1RHCA 4Z1DA 3PZGA 4I7UA 4R7OA 1VFHA 1PDZA 3D3AA 5FL1A 1V3HA 5AHIA 5HK4A 2W79A 1VEPA 4TVCA 3VC6A 4GMEA 4ZE5A 3R7MA 3W7IA 1OZQA 1VS1A 1WDRA 2R9RA 2J9XA 5I6SA 3A3WA 2J25A 1U1UA 1KGUA 2ZZ7A 1UQYA 3M0XA 3P7YA 2CU0A 2WMHA 3H53A 1X38A 3THQA 3N9SA 5IBXC 1VJZA 5HR7A 2EG7A 3S8HA 1US3A 3LGDA 4ZO6A 2JALA 3UWZA 1BSIA 2CETA 1E4NA 3FLUA 1POKA 3VCNA 2WSRA 1MRQA 4JTDA 3RX2A 2V5BA 3E2QA 3LHYA 3PK7A 3TYUA 1XWYA 1OY0A 2GL5A 3ERPA 3BJFA 1PX3A 3EDEA 2W4XA 4NAFB 1J2WA 3E0VA 4GD0A 2ZA2A 5D2XA 1VFUA 5EY5A 1S5MA 4L7ZA 1Q7QA 2VR2A 2HV5A 1GJUA 3NL6A 3BMWA 4UR9A 1GZJA 1RALA 2X2GA 4EACA 3MHGA 1KV8A 5HATA 3FKRA 3H2AA 3BVJA 1O66A 1S5NA 3VX1A 3GDTA 4O18A 3LPOA 3OQ8A 5FF4A 3G6MA 1AQ0A 1O1HA 3TDFA 3GH4A 3G24A 4AMAA 4GC3A 4OTKA 3L5LA 4ACZB 3W7DA 3G1RA 1U5HA 1VEMA