3L9CA

The crystal structure of smu.777 from streptococcus mutans ua159
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
249
structure length
226
Chain Sequence
b'SSGLVPRSMKIVVPVMPQNIEEANQLDLTRIDSTDIIEWRADYLVKDDILTVAPAIFEKFSGHEVIFTLRTEKEGGNISLSNEDYLAIIRDIAALYQPDYIDFEYFSYRDVLEEMYDFSNLILSYHNFEETPENLMEVFSELTALAPRVVKIAVMPKNEQDVLDLMNYTRGFKTLNPNQEYVTMSMSKLGRISRLAADLIGSSWTFASLQISLADMRKIKEVLDAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title The Crystal Structure of smu.777 from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Lyase
total genus 83
structure length 226
sequence length 249
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3l9cA00
1TPC1 4TO8A 5HJLA 4RZ6A 3W7HA 1W8SA 1DHPA 1KLZA 1AW1A 4LRSA 2X2GA 1KM6A 2G96A 2QR6A 1HO1A 8TIMA 1SUXA 2J9XA 3Q37A 1LCOA 5EY5A 3LCXA 1AK5A 1F05A 2WNQA 3O16A 5CPMA 1QR7A 3LRMA 4AEOA 4FNUA 3H55A 3W88A 3L0KA 4TMCA 3B0UX 4IMEA 2A4AA 3H53A 4FEZA 1NF0A 2P1FA 2YFOA 3GXNA 3GXPA 4PL2A 1YDOA 3LHZA 4UFKA 1EUAA 3I65A 4E0CA 1ZAJA 2TMDA 3BW3A 1I2PA 3SSJA 3U6WA 2CLHA 3IIXA 2NUYA 1W3NA 2ZFAA 3BLFA 4A29A 1SW7A 1FWSA 3IGUA 4X9SA 4UTUA 4ICNA 3W07A 2NX9A 3PWAA 1SFJA 2YDAA 4YMZA 2QJHA 1KFKA 2H3DA 3N19B 3TKFA 4FHAA 1FWNA 1O95A 2F84A 1IIHA 4GBUA 4MLRA 4MUZA 3UWYA 1YADA 3PULA 3TFXA 1M6JA 4JY9A 2DJXA 1AW5A 4A21A 2QCNA 4JR5A 4N9DA 1XUUA 4DPQA 4DO4A 3P62A 4DXVA 5AYYA 2CWNA 3WK3A 3O6YX 3GDKA 2Y63A 3RF9A 4IMFA 2OZ0A 5HWNA 4LVFA 4O28A 4YCPA 2GPTA 3W2LA 3S6DA 3WK0A 3GAYA 5HUPA 4RK8A 1WBHA 4WXYA 2ISSA 4NVTA 1H7WA 5EBUA 1WQ5A 2YX0A 1OG0A 1JUKA 2ZRYA 3W74A 2QCCA 4PC8A 2YR1A 4CQ8A 4AB4A 1VJIA 4H4IA 2XFWA 1YPFA 5HR6A 1Y0EA 3LV6A 1Q6QA 4QNWA 5F1UA 1K7XA 1ZCOA 1HL2A 3BG9A 2JKPA 1VLIA 3S9YA 4UXDA 1EA0A 3IGSA 1EX5A 3BW2A 4E38A 4JX5A 4N9CA 4C1LA 2YSWA 2WSRA 1OFBA 5DN1A 1ALDA 4HSOA 4RKAA 5CGQA 3N2XA 5FEZA 1X6UA 5LHEA 2CZEA 2NXGA 2VOMA 3QH2A 4GXMA 5E1QA 2A6NA 5DXYA 3B4UA 4LVBA 1XI3A 5H91A 2V2DA 2RFGA 4LV9A 3S5NA 3NL5A 1ME8A 3SZ8A 1KFBA 2H6RA 3INPA 4GUJA 2ABAA 2NZLA 3LCIA 3SY5A 3P8JA 5LNUA 4K8EA 5EA9A 4FNPA 1WYIA 2RHGA 3I6RA 1TPH1 1XCFA 1VLWA 3GNNA 3GKAA 1QDSA 3RK8A 4AMAA 5DY3A 4Z1AA 1YTDA 2GJLA 4UTIA 2WSYA 5F2GA 5FEXA 4CCDA 3HGSA 1LLZA 3FJ6A 4JTIA 4O50A 1SQ7A 3LTSA 1PV8A 4XKYA 2DZSA 1U5JA 3G22A 4O1DA 4AXKA 3W7MA 3R8RA 3UWVA 3QM3A 4UTWC 3L21A 2Y7DA 2ZZ2A 1OFQA 3O6DA 4UUIA 5F4WA 5LGZA 3C2RA 3W1NA 3T7VA 3B8DA 2QCMA 4KWVA 3C2EA 1O94A 1J2WA 4UC5A 1PL9A 1LRNA 4JN6A 4JTFA 3C3NA 2E1DA 1S5VA 5CPOA 3GX9A 1LROA 2JGYA 1KM3A 3B03A 4QQ3A 1PIIA 1X1ZA 3BK0A 4PTNA 1P0NA 1K8ZA 1SU5A 3MHFA 2A5HA 1JCXA 2KZHA 5A8GA 4UTLA 1TPB1 3BG5A 1THFD 1I2NA 1QPNA 3EX2A 3CIXA 4O19A 3EWYA 1I8JA 4RX0A 3PG9A 1YDNA 1H1ZA 5E0KA 3DZ1A 3QRHA 3TDFA 5F2IA 2YW4A 3G1YA 3KAOA 1W5MA 2BX7A 5L9FA 2VEKA 5C6MA 2PCQA 4MJZA 5FF2A 5AC7A 1M7PA 5LGXA 3KRZA 5HMSA 5AN7A 1UUOA 3BPWA 2A21A 3F1QA 1OF6A 4BR1A 3T55A 2X30A 4KFOA 2XN0A 3GB6A 3S1VA 1SR9A 3TIMA 1NAL1 4ZQNA 3T44A 4R53A 1IF2A 4JDYA 3TFCA 3T78A 2ISWA 3FS2A 1XBZA 3C52A 3QJAA 1QO5A 3M5ZA 1GTEA 5AOUA 1TJPA 5KMYA 1BWKA 3TMLA 5KINA 4BF9A 1DQXA 1LRQA 4K6AA 1GWJA 4AVFA 3W83A 2I9EA 4HSNA 5CKSA 3NEVA 2YW3A 3FLUA 2CLKA 1K7FA 1LRTA 3G0UA 2YYTA 2BZNA 5D03A 4ALDA 3GXTA 5HR7A 3ABRA 1GVRA 1KBIA 1GOXA 1TJRA 3NM1A 1B9BA 4HHPA 1TMHA 3P61A 3UXDA 5AC8A 3MMTA 5CZTA 1EP2A 2QAFA 4CLMA 4DF0A 3W7EA 1SO6A 1LP6A 2Z2UA 3QFEA 2Z1BA 4UMAA 1JCJA 4UMBA 4JXCA 3LHUA 3ZS4A 2CLLA 1TTIA 4NU7A 1OK4A 4MYAA 2W6RA 4X3ZA 3HG3A 3EEGA 1OFOA 4JYEA 2WNZA 1KA9F 5C54A 3W2UA 1G69A 3M16A 2C1HA 2FQIA 2E77A 1AW2A 1CI1A 2B7NA 4LWWA 3W2KA 2QCLA 1VYPX 2JKAA 5AHNA 1YTEA 2HMCA 3GDMA 1LM1A 3OBKA 2ATMA 5FI8A 3OA3A 4QIUA 1UUMA 3GLCA 3C6CA 3I7QA 3P84A 4M7SA 3MBFA 3LDVA 3NA8A 5K9DA 1L6SA 5KITA 1TREA 4Z0JA 3Q58A 3Q2DA 2D73A 2CLMA 3E12A 3W86A 5FEWA 2WOQA 1O4UA 1JJKA 1SZGA 3R2GA 1P0KA 4UTKA 3LCFA 5BOOA 3FKKA 1MXSA 2VC6A 1S5WA 2WKJA 3HGRA 3HQ1A 3F4NA 1H60A 2V8ZA 2GQAA 3JS3A 2Q8ZA 3NXFA 4GWEA 5F4SA 1SPQA 3TROA 4PODA 5G4WA 1DJQA 4PA8A 5D2XA 4UNLA 1VPXA 1A50A 1TTPA 2Y61A 1FCBA 1VH7A 5CSSA 1GTHA 3V1PA 1JQXA 3LHYA 2GVJA 5DBUA 3S1XA 4U28A 4JX4A 3P74A 4HNUA 2QCGA 2C18A 3NQ8A 2A2IA 3WK2A 3UNDA 3NG3A 3KOFA 2QUUA 2QCDA 3NQGA 2J24A 1FQ0A 4JTJA 2V82A 3W70A 3TCEA 4NT0A 3UPBA 4HN4A 4Z08A 5K7JA 3HIJA 5D05A 1KW1A 3EWWA 1IGSA 4NQ1A 1H51A 2RDTA 3AO0A 3CQ0A 3TW6A 4GUIA 3C2VA 1W0MA 3L66A 2JK2A 2GVGA 3MJYA 1KFLA 3N14A 4Y6GA 5BRBA 1W54A 3LLDA 1SO3A 5FF4A 4JEQA 4MJMA 4FX8A 2PRLA 2ZA1A 4AF0A 3TC6A 2C6QA 2EHHA 4UFHA 3RMJA 4JD4A 3TR2A 4NXKA 3MP5A 4WOZA 3WJXA 2PRHA 4RZ5A 3F03K 2Z6JA 3DGRA 3L9CA 1EP1A 3QW4B 3UWUA 1EUNA 4O14A 3CLMA 3W22A 1T8XA 4M6QA 1QNVA 1GYLA 1HTIA 2QKFA 3GDLA 3B0PA 1YXYA 2DZVA 3NQCA 3PY2A 2C15A 3G8RA 1A53A 5BW6A 1W31A 3DFTA 3S42A 4ZZ9A 4OQVA 4N2YA 5AC6A 3HG2A 4GFSA 4M6VA 2OT1A 3IV3A 2C14A 4R33A 1SW0A 5DCDA 5FEPA 1IXQA 1OHLA 1KM1A 2YGYA 1SSGA 1KBJA 3VE7A 4JTKA 1DJNA 4MY9A 3A22A 1W37A 2CFFA 2BLEA 1QPOA 1HUVA 3CEPA 3ABOA 4NJKA 3E49A 1Q45A 4ZQRA 3TW7A 2R91A 1UCWA 1M7OA 4ZQOA 1TPVA 2V5BA 2ZDRA 1HG3A 1G67A 3IIOA 1E51A 1F7BA 4MZYA 4POCA 3DU0A 5EPDA 1I2RA 5D37A 4XWUA 2V81A 1B4EA 1PS9A 3OEXA 3LXAA 3DAQA 3UPWA 1FDYA 5KSWA 3P60A 4AHOA 3OG3A 3B0VC 1EB3A 1Q6RA 1WV2A 4MFDA 3UY8A 1VRDA 3PM6A 3P81A 4CQ9A 4LV4A 4QNEA 4BI7A 1D9EA 2R94A 4UMCA 3CM4A 2X16A 2Y89A 4JTGA 2B4GA 1XDLA 1CX9A 3GZ3A 1LBFA 3DHFA 2Z0IA 1BTMA 4WY0F 5D2TA 4LOCA 2W0UA 1FCQA 4FXSA 1TRIA 2ZRZA 1WX0A 4ADSA 3P7YA 1RD5A 2H90A 2Y85A 2Y62A 2BSLA 4RXGA 1BKSA 2FPVA 5AHIA 4OBTA 3NL2A 3VI2A 4O57A 3B04A 2E5BA 2WPBA 3N2MA 3NM3A 3LGEA 3M0ZA 5DELA 1UASA 2ZZ3A 3NDOA 3W73A 4QITA 2ATSA 1SZFA 4S2BA 5LSMA 1RR2A 3N9RA 3HOJA 3T40A 3R12A 3SJ3A 3QSTA 3W72A 4DBDA 3LXCA 3RLVA 1W3TA 4RJEA 4UFMA 1K8YA 3GIYA 3WJWA 2QCFA 3HO8A 3O07A 1A5AA 3PSVA 3PUEA 1H7PA 5DCBA 1QOQA 4HT3A 3H54A 4EVZA 5I3IA 4PL1A 3IVUA 2X1SA 4LVAA 1SSDA 1XBVA 3DHDA 2CZ5A 4O17A 4H3DA 3ZFHA 3I68A 3TC7A 3IGXA 5LNRA 2PRMA 4NJGA 2WO5A 3FFSA 4IJBA 3QQ1A 4MKNA 4Y90A 1ONRA 3ATYA 2VKZG 1TTQA 2WSQA 4WJEA 2CW6A 1P1XA 2E6FA 1G6CA 3QW3A 2QEZA 3M5YA 3JR2A 2QDHA 3HG4A 3WJYA 5DLCA 1S5TA 3W1RA 2OJPA 2EPHA 4BWLC 3C56A 3TMQA 4WY0A 4K37A 1GZGA 3MP3A 3OVQA 1XL9A 1GQNA 1U83A 2JBMA 3TQKA 3W1PA 3W7QA 1D3HA 5G4EA 4OGZA 1J5TA 2DU2A 3IIVA 3R13A 3NQEA 3G1DA 4PH6A 4AWUA 2OCZA 3PF3A 3HPSA 1C29A 3RFAA 3THAA 4CNPA 3L5LA 2ZBTA 1S3HA 1R30A 1F73A 1TCDA 1VHCA 2IQTA 3S8HA 2FJKA 1VCGA 3EWUA 1C9DA 7TIMA 3LLFA 4Y8FA 3UZ5A 1LTDA 2C0AA 4FXRA 5HQEA 1TPUA 1ML1A 4IWWA 2A1YA 1QPRA 3MP4A 4N9BA 2J88A 3M1ZA 4UTJA 1OX5A 4WY0B 3UWQA 1NEYA 5BMWA 2RH9A 1NF7A 4YXGA 1XKYA 2YFNA 1QWGA 3LERA 3W87A 3G18A 4EWND 3P8IA 4JTSA 4DO6A 4YCOA 1QFEA 1GG1A 4A2RA 2B7QA 2P0OA 2ZTJA 2VEPA 4IPIA 5I3HA 3KHJA 1XBYA 5U4NA 3NQ7A 5D2VA 3W3OA 2V2HA 4MOZA 2DZPA 3NQDA 2BWGA 1WDWA 3MYPA 3STCA 3NGJA 3LHTA 1H50A 3ZWSA 4QM1A 2NLIA 4LNYA 4GNJA 1IXPA 3TUUA 4NXSA 3NVTA 3BO9A 4FIRA 1LLWA 3KFTA 5AHMA 3G0XA 4XTIA 5ABTA 1AL7A 2YXGA 5D09A 4XKYB 4LW7A 5HWJA 4LC6A 1GVOA 1I2QA 4N4PA 4LS1A 3NAVA 3ZR4A 2E09A 1IIGA 2E6AA 5AHLA 1W5QA 5K4XA 3FIGA 1LOLA 5CG7A 1DORA 5J5DA 2J9ZA 1WXJA 5K3VA 2GQ8A 3FKRA 5E93A 3CB8A 5HUOA 4DPPA 3DFPA 2QAPA 4O15A 2C13A 2NXHA 5KZEA 4Y96A 1OVDA 4UIOA 3CPRA 3C2OA 5DXXA 4IX2A 5FF3A 1JCLA 1GEQA 3LX9A 5K9CA 2YCEA 4DO5A 3MI6A 3AJXA 1MSSA 1W56A 1HO4A 1ZJIA 2V9DA 4FNQA 3P80A 3W1AA 3LRLA 1KM4A 4CNOA 3THQA 3G3MA 4ZQMA 1KFJA 2V2CA 1O5XA 2VFDA 3S5OA 1OFAA 3L5MA 1VGAA 3EX1A 3QPZA 4N9EA 1OJXA 3HB9A 4M7TA 4LVDA 2QCEA 3E02A 3STFA 3NQVA 4GUGA 1KTNA 3ABSA 3G0SA 5LNSA 1ME7A 3DKJA 3I7SA 5LNWA 2QUVA 4KKXA 1TV8A 1Q6LA 3PUDA 2Q8LA 2R8WA 1AG1O 3SECA 3KVMA 2BTMA 2B7PA 3STEA 2ABBA 2OT0A 4MFEA 4BI5A 1G4SA 3SIZA 4UTMA 4YL2A 4Z1BA 1K3UA 2ZQ0A 5KZDA 2A7NA 2QDGA 1K8XA 2HS8A 3FJLA 3OHIA 2WNNA 3O1NA 3PVFA 4FIQA 4K39A 4JDBA 4NNCA 2VFHA 5G2HA 1PHWA 3M7WA 3VFLA 3A24A 3A9IA 3MI2A 1XBXA 4HKPA 4I7WA 2G95A 5BNKA 3FYPA 4FNTA 3SGUA 4N6EA 3VNDA 3DFNA 1L6YA 3LM7A 3MHGA 2NX1A 1HFBA 1VQTA 2ALDA 3LB0A 4FX6M 3W7LA 1AMKA 3M43A 2NWSA 2DZXA 2VEMA 3DBPA 1F6PA 1UJPA 3QF0A 3EWBX 3TAOA 5MHBA 2ZTKA 3MHUA 3G8EA 4FNSA 3KRSA 3GYEA 2I14A 1FWRA 3CU2A 5IBXC 2VELA 2FIQA 4EOUA 1VYSX 3MUXA 5C55A 3V75A 4YWIA 1WOBA 3BLEA 4NUWA 4LUIA 3TQVA 5HNRA 3FA5A 2TPSA 1WA3A 1G7VA 4RZ4A 4RV8A 3S0CA 3ATZA 1MEHA 2NWRA 4LTSA 4RR4A 3BARA 3TSBA 4HNTA 3A21A 3G24A 2NXIA 2DORA 1FXQA 1M5WA 3W71A 3WK1A 4C1KA 5F2MA 2CLOA 1ICPA 4FB7A 1KV8A 3DH7A 1QPQA 4N4QA 1H5YA 1O5KA 5IM51 1H1YA 1PVNA 4JNMA 5D33A 3TSDA 4UTHA 3QPYA 3M41A 3D0CA 1L2UA 4O52A 4JYDA 2CLEA 4X2RA 4QJ1A 1KM5A 3PR2A 4UNKA 1F74A 3M5XA 3TNOA 1KM2A 5EL1A 3W1UA 4JGDA 1FUYA 3N3MA 1SFLA 4IUOA 3N9SA 3ABQA 4MY1A 4LS0A 3P5YA 3RNDA 5AHEA 4MVAA 1JUBA 1RQEA 3NZRA 4O13A 3CWNA 5U7SA 4UR7A 2PE4A 2ZA3A 3IVTA 4NX5A 3BG3A 4WQ6A 3NQMA 1VYRA 4K8HA 1FXPA 2ZRUA 4UCGA 5CZJA 3GDRA 1GVQA 2HTMA 3W7DA 3GKFA 1Q6OA 2ZZ4A 4N02A 4NJIA 1TPFA 3CHVA 5G2IA 3UZJA 4JYFA 4ONVA 5D2WA 3E0IA 5HULA 1FX6A 3KX6A 3W7GA 1J4EA 4E2BA 3IIZA 4O8RA 2I1OA 4FF7A 2GOUA 6ALDA 4NJHA 1A5CA 3TA6A 3NO5A 4LVGA 3PBUA 3KVLA 3LV5A 1BWLA 2QCHA 3QZEA 2Y7EA 1XC4A 1P4CA 4HNNA 4IGHA 3NPUA 3NZ1A 4NX0A 3TH6A 2Y6ZA 3TQ0A 3W1QA 2E5CA 1GT8A 2ZRVA 5KTLA 1LOQA 1XUZA 5TQLA 4GRSA 3IIPA 2FLIA 1QAPA 1JCYA 2QCDB 4EIVA 2F7FA 4Q32A 3WJZA 5A5WA 1KFCA 1Q3NA 1BEUA 4AWTA 1OX4A 3W7IA 2E68A 1KFEA 1D3GA 3DXIA 3NQFA 3BGJA 1EEPA 4DF2A 3HMJG 3E9AA 2H8XA 2TSYA 1TIMA 1IXOA 1I2OA 2DZTA 2LLEA 1OYAA 3C8FA 3KVKA 3TXVA 3W84A 1F2JA 3JRKA 4OU1A 2ZYFA 1LOSA 3GNDA 1ZENA 4CCCA 4AF0B 3HPXA 4M6PA 3W7NA 3IEBA 1JR1A 1YTKA 3W9ZA 3MYOA 4Q4KA 2Q3RA 3A23A 3LRKA 1A5SA 3TK7A 3G1VA 1OX4B 2YPIA 1XXXA 2CLFA 3M44A 4JY8A 1OYBA 4FX7A 5LNVA 1WAUA 3G1SA 3W7CA 4HPXA 1OX6A 3LCHA 5LHFA 2FB2A 2G97A 1H7NA 4K38A 1PCKA 3PC0A 3L2IA 3I7RA 5C5YA 3CTLA 3S1WA 2JKEA 5FF0A 4IPJA 2J9YA 2QUTA 3CIWA 5BMXA 4O11A 4XBSA 4BWLA 2GJNA 1LBLA 4PCFA 4KFNA 2VXNA 4O10A 3PB0A 4JTUA 4AHQA 1WOAA 1ZY9A 3B06A 3LCGA 3LOTA 1W5NA 1MO0A 1F5ZA 2W79A 4OE7A 3TX9A 3W6YA 2DZWA 3DKLA 4E2DA 4IMCA 2NX3A 3USBA 4XUGA 1PE1A 5F1VA 2A85A 5AYXA 1JQVA 4L4LA 4DELA 1LZOA 4JX6A 3G1HA 1XDMA 5FESA 3WJSA 4YLWA 1NSJA 1QO2A 2FB3A 4I7VA 1V7YA 5K9XA 3MWAA 3KRUA 4P61A 1TPDA 3QYQA 2PC4A 3BLIA 2A7PA 1NVMA 4S2CA 3RLUA 1H7XA 1GPWA 2QJIA 2Y7GA 5I3FA 4I9AA 4UTTC 4QAIA 1SO5A 4BK9A 3S5ZA 2FTPA 3IVSA 1MZHA 4LC8A 1DQWA 3A5FA 3L0GA 4O16A 3HJZA 3PBYA 4AWSA 2OX1A 4NZFA 3U2OA 4UTWA 3TJLA 2V0TA 4R34A 2EGZA 4XBKA 3OVPA 4O1BA 1FDZA 3DFOA 4IXXA 3EX3A 3A5VA 1JRCA 3NL6A 1T99A 1ADOA 1YDVA 2QJGA 3NNTA 3NQ6A 3M5VA 4FNRA 1YPIA 2C19A 3DFSA 4JTTA 3GDTA 3LTPA 4RCXA 4N6FA 2O7QA 3W2MA 3UXAA 3M6YA 3UWZA 3HPZA 2ZZ5A 3GAKA 1SZEA 5K2ZA 1R2TA 3DENA 4GJ1A 3MW7A 1OF8A 5I3JA 1OFRA 4IMDA 3R89A 4JTHA 5EKYA 1MEWA 4UR8A 1T0OA 5HWMA 1AL8A 2NV1A 3EX6A 4CQAA 1FWWA 4JIPA 4OV9A 1OABA 3PG8A 4ORIA 4O12A 1FCUA 4TR9A 3C0JA 3L67A 2H8ZA 4GUFA 4WD0A 3C2FA 2RDUA 5D04C 4FO4A 4OHQA 2G5WA 1I45A 1VHNA 3WFAA 2Z6IA 1Z44A 1NFBA 2DP3A 3FYOA 5D38A 1FDJA 4D2JA 1EPXA 1TB3A 4MPQA 2O7SA 1I4NA 3VKJA 4AAJA 3EX4A 3GK0A 4ADTA 3M9YA 4O53A 4U4MA 4RXFA 4TMBA 1JRBA 4LT9A 3P5ZA 3P82A 5TBOA 2B7OA 4DF1A 1W3IA 3NYZA 5G1YA 1OYCA 3HG5A 2JGQA 1N55A 3R5EA 2E6YA 2RDWA 4AHPA 3BV4A 3S1UA 1TV5A 1TV7A 1DKWA 4BFAA 2ZA2A 3DFQA 3LCLA 4MLJA 2DJLA 3UY7A 3VCRA 4MIMA 1EP3A 3O06A 5TIMA 5L6UA 3EKZA 2E6DA 4CCEA 3S5YA 4LU0A 4ZQCA 3L5AA 4HPJA 3G1AA 4JIQA 1YYAA 4KWWA 1PCWA 1RZMA 3LCWA 4L4MA 5T26A 5HINA 1GVSA 1PHQA 2VFEA 4HIBA 1Z48A 3EXRA 3L68A 3K30A 3W1LA 5F4XA 3W75A 4RLIA 4M5PA 3KXQA 3EWXA 3EWZA 1R46A 2FDSA 3BGGA 2AQWA 3PBWA 5DBTA 2ZZ6A 2FFCA 4DBEA 3RU6A 4O0ZA 4O1AA 3IRDA 1JVNA 1GG0A 1VS1A 2Y70A 3NL3A 4TIMA 5IBXA 1DV7A 1ZFJA 2CLIA 3QSRA 3NQAA 4NNAA 1F6KA 1XM3A 1TQXA 4OV4A 1DL3A 1B57A 3MBDA 4GUHA 1DBTA 4Q33A 1F76A 1LYXA 3LHWA 4IX0A 4JTEA 4A3UA 3B05A 4OT7A 4HNVA 3MO7A 1RPXA 1EIXA 2XN2A 4NJJA 3QMRA 3W7JA 1ZAIA 3DI0A 3HGJA 5H2ZA 4OWGA 3ELFA 1VR6A 2Y7FA 2HS6A 4WOQA 3DI1A 4ZMGA 4ZL1A 1XFBA 5GVJA 4IOTA 4TU1A 2VEIA 3W2NA 4I7UA 1WBJA 1VCFA 2WV8A 4IXHA 5AHFA 3MI3A 4MZ1A 3EXSA 3SW6A 1K7EA 2ZRXA 4GC4A 1QMLA 3NPWA 2WJZA 2BXVA 3EKLA 1YLVA 4JS3A 1LBMA 3GR7A 3Q94A 3LI0A 1KTCA 3CEUA 5G2WA 3W2JA 2XN1A 5CZSA 5J5RA 5EMUA 2V30A 1YXCA 2EAWA 2VENA 3PAJA 4XTDA 3UD6A 3TE9A 4Z0SA 3PS7A 1JUEA 5D2YA 1VC4A 3G1FA 1RQHA 6TIMA 3HBLA 4O0KA 1KV5A 4MYXA 2ZRWA 4B5NA 3L0NA 2GVLA 1RVGA 3TU9A 1TYGA 1UB3A 2X1RA 4PFMA 5CZ0A 3UYCA 3SR7A 2B0MA 3O6CA 4K7YA 1EWDA 1G4EA 3FEMA 4ORMA 4WXZA 4LRTA 2CU0A 4J9JA 4Z1CA 3NQ2A 4UFIA 4S1FA 5F2LA 3LXBA 4ZQPA 3UWWA 5C2XA 1O60A 3EXTA 3TXZA 1L6WA 3FOKA 4H6KA 5KZMA 3LBMA 3YPIA 3W1TA 1Z42A 2E5DA 2H3BA 5AFDA 4NNBA 4IMGA 3E96A 4WZHA 1GYNA 1UBSA 4O4WA 2A6LA 2VFFA 3OIXA 5I3GA 5G1TA 1W5PA 5AYZA 2Q3OA 4IQLA 1KM0A 3L65A 2DZUA 1B3OA 2P10A 2HSAA 4K36A 1G7UA 4PEKA 1VZWA 2NV2A 4O54A 3GR8A 2EKCA 1G4PA 1ICQA 1TRDA 1V5XA 2YYUA 3TAKA 1GVFA 2VFGA 4CNNA 1CW2A 1EWEA 3QC3A 3CT7A 3F4WA 5DY2A 1TSIA 1OFEA 2GQ9A 3STGA 1G4TA 1FY6A 1SW3A 2TYSA 1ZNNA 1VCVA 3UQNA 4KFPA 1OFPA 1MEIA 4MZ8A 3W7KA 3PB2A 1R47A 3ZWTA 3EB2A 4A22A 2X1TA 1KTBA 4A2SA 2QF7A 4ZVJA 3W7RA 1X7FA 3TJXA 1JCNA 3O63A 1IXNA 4ADUA 3HGOA 3O05A 3W7OA 1FBAA 1YXDA 4UFLA 3GVGA 2OMAA 4QISA 1LDCA 1P5BA 1QOPA 3O15A 4G1KA 5LKYA 2R14A 5DCEA 1TQJA 3G1XA 3KVJA 2X1UA 5AB3A 2ZCGA 1ZAHA 4M19A 4R7JA 3HF3A 4AH7A 1JULA 1R2RA 2NUWA 1TPWA 5SWUA 1TTJA 2CZDA 4W9TA 1K03A 1SZNA 2ISVA 4O1CA 1W1ZA 2A0NA 1TO3A 3VE9A 2A7RA 1W5OA 3BVJA 3T4CA 3M47A 3SFKA 5K4ZA 3CC1A 4EF9A 4EF8A 4O4VA 4GE8A 1OFDA 3NPXA 1TPEA 3QEZA 5EYWA 1KLYA 1JCMP 2WQPA 3G3DA 1R2SA 3LBCA 4WX2A 4WUIA 3QMSA 1H7RA 5CSRA 1H61A 4DEFA 5G5IA 2YZRA 2AAMA 1FWTA 1X8FA 3N34A 1SO4A 2C16A 3LHVA 1H63A 4Y9AA 2EF9A 2ZZ1A 2ZZ7A 4X22A 3W1MA 2GUUA 4O18A 2TRSA 2Y88A 1ICSA 3O8AA 5CPNA 3SI9A 1C8VA 1B4KA 1FCVA 4UTTA 1H62A 2AGKA 1L9WA 1ME9A 2RKXA 2C3ZA 4JTLA 5FF7A 4QSHA 5CPLA 4MY8A 4Z1DA 2J6XA 5I3KA 1N7KA 1OK6A 3TV8A 2PURA 3CWOX 4NZJA 3U8GA 3NPVA 4LUJA 3SGZA 3W76A 1ZHAA 4P2VA 3N73A 3OVRA 3BW4A 4XZ9A 4BI6A 1GJPA 4LY8A 3W85A 4XQ6A 2NUXA 5D32A 1QCWA 3C61A 1DOSA 2CZFA 1RQBA 1T96A 2V5LA 3LTYA 1RV8A 4K7VA 4TX9A 2J27A 2VFIA 3QQ0A 1X1OA 4DQWA 1Z41A 1ZALA 1LORA 2FPTA 1H7OA 3LI1A 2UV8G 3PBVA 3W1XA 3NR0A 3W7PA 3PSWA 4ML9A 5D30A 5D02A 4UFJA 3TSMA 2FPYA 1N8FA 3C4UA 5LZLA 1K02A 3ANYA 1A5BA 4LS2A 3PUOA 3W23A 3P67A 3QMTA 4JICA 3NOEA 1DVJA
chains in the Genus database with same CATH superfamily
1CGVA 4LF1A 4TO8A 1K9FA 2ZUMA 1KM6A 2QR6A 1M65A 3HA1A 3VIJA 1LT7A 2HRWA 2O4QA 4US5D 3MY9A 4FNUA 5A94A 4BS0A 3EMZA 2G37A 4FEZA 1NF0A 4AUBA 3U57A 3LHZA 5A6JA 3DECA 1EUAA 4F48A 1QK0A 2XVLA 2HK1A 3QXBA 1MI3A 3IRSA 3RDKA 3GBDA 3U6WA 1W9XA 2CLHA 3IIXA 2IPWA 3QV7A 4QAWA 3O2LA 1RY8A 1FWSA 3VUSA 2NX9A 2PD5A 2BOFX 3PWAA 1F8MA 4QXIA 4PMDA 3M0LA 2H3DA 4FHAA 1ADDA 4MUZA 4X63A 1SJBA 3DFYA 1C8XA 2CKSA 1AW5A 4V2XA 3CIVA 4JR5A 4N9DA 3KW3A 1JI1A 1K6AA 4WSHA 2NQ9A 2I5GA 5CPSA 2OZ0A 4WHBA 2FZDA 4YCPA 2GPTA 1UH2A 3GC5A 3W2LA 1BAGA 4RK8A 5FL1A 3QKEA 1H7WA 4KS0A 2D2JA 5FIPA 3KOYA 2QCCA 4LAOA 2GZXA 3GVRA 4CQ8A 1Y0EA 1Q6QA 2NT0A 3BG9A 2JKPA 1JEZA 4GMEA 4IIFA 4UXDA 3BW2A 1NOWA 4K8GA 4JX5A 4N9CA 1EGMA 1M03A 4HSOA 4RKAA 3N2XA 1X6UA 2OTDA 5FJOA 1UR9A 3W53A 4GXMA 3EDJA 5DXYA 3T42A 1CCWB 2V2DA 2RFGA 4LV9A 2NV9A 3ARZA 1ME8A 3SZ8A 4H04A 3AFBA 3ZM8A 2NZLA 4GC3A 1WUFA 3UYIA 3GIQA 1SJCA 5LYRA 3I3BA 3ZT7A 1F8IA 4J3WA 1J79A 4KCUA 3WCZA 1VJSA 4PR4A 1TPH1 3AHYA 4MJ2A 3LBOA 4DLFA 1V0KA 1Z3NA 4H9YA 4NZ4A 2UY3A 3R8GA 5F2GA 3HGSA 3SRKA 3FJ6A 1NWTA 4F4RA 2PBOA 1U5JA 2AKMA 2XIQA 3G22A 3W7MA 2BY0A 2ZZ2A 4C5ZA 1XWYA 4DUXA 3SGGA 4KRZA 1WB0A 4KWVA 3MCMA 1JZ4A 4L61A 4GINA 5RUBA 4W86A 4FI4A 4QG8A 1PL9A 4M1BA 4JNYA 2E1DA 1LQ0A 1UOZA 5B7YA 4GH3A 1S5VA 3CAWA 2QUNA 2J77A 2JGYA 3UGRA 3AWNA 4LH8A 3B03A 1F4HA 1X1ZA 5T8GA 3WLJA 5BU9A 1R0MA 1P0NA 2GVEA 1SU5A 3CZKA 1GJWA 3RIKA 4UZUA 4HCLA 1XICA 4A8IA 2Q71A 3EWYA 4PCNA 5E0KA 3DZ1A 3FXGA 1NFPA 1UYQA 4I90A 2PWUA 4OUIA 4IPPA 3GM8A 4EX4A 1PZ1A 2WZEA 3AU2A 3ABZA 3TOPA 2VEKA 2GJXA 5C2GA 3M7SA 1XYFA 3DDMA 2GFTA 2O4MA 3WH6A 3URNA 1JZ5A 1GGOA 3TIMA 4ZQNA 4LPCA 2MNRA 2WMFA 3SADA 3H2AA 1FFRA 5KEZA 3FAWA 3C3UA 1XBZA 3APGA 1A0CA 1TZZA 1S1RA 3SDOA 2GJXB 1DQXA 5DF0A 4K6AA 4HB7A 1GWJA 2DUAA 1GW9A 3W83A 3PZVA 3NEVA 2YW3A 3G0UA 3I10A 1S2AA 3GSMA 1KBIA 1GOXA 3FVMA 1TCMA 3UXDA 5AC8A 1DJHA 1EP2A 4DF0A 3WF2A 4C65A 3GFZA 2FGBA 1SO6A 1SFSA 3BTNA 4QLLA 4UMAA 1J0JA 3FN9A 4L4PA 2BVTA 4GQBA 4JXCA 5H8UA 2CLLA 2X41A 4MYAA 3ZSTA 3AYSA 3URQA 1CWYA 2BBFA 1KXVA 4WVXA 2P5NA 1G69A 4LUSA 1CI1A 1US2A 2OLSA 3W2KA 4MKVA 2QCLA 2JKAA 4GPNA 3FYYA 3CUJA 3VOHA 1YTEA 1JXKA 2OLHA 1TJ0A 2VGBA 3P0XA 1L2QA 5FI8A 3MUCA 3GLCA 3VU2A 3I7QA 3N4FA 1YBQB 4G1NA 2PWEA 4ML4A 1L6SA 5FJTA 3C5QA 4HHHA 1VJZA 3Q58A 2CLMA 4C6OA 4W8LA 1ZJAA 1CB7B 1SZGA 1P0KA 4UTKA 3LCFA 4LUSB 5BOOA 1W3JA 1JNDA 2VC6A 1S5WA 2RJHA 3VNKA 2J8GA 4WRHA 1H60A 2GQAA 3JS3A 2Q8ZA 3D46A 2I17A 2VP8A 2Z1XA 3CPUA 1SPQA 4BQ5A 3LZ3A 5J04A 3WX7A 1QBAA 2Y61A 2D0FA 2XYLA 1EC9A 5A6SA 1X96A 3GD6A 3R0DA 3TTSA 3B0XA 2ESCA 5IFPA 4Y9MA 5CEWA 2QCGA 4MF4A 3NQ8A 2BXYA 3USZA 2HBXA 2QUUA 1UQYA 3A6OA 4GO8A 2J24A 1ODUA 2V82A 3TCEA 4HN4A 4D6JA 3RX4A 1HX0A 2NQ5A 1TUFA 3O6AA 4LYQA 1H51A 3AO0A 3CQ0A 3OLGA 4GUIA 2QXWA 3TW6A 3C2VA 2GVGA 3AMGA 4QQUA 1LG2A 1M01A 3M0HA 1SO3A 4JEQA 3PZMA 2PRLA 4UFHA 4YIWA 1NQKA 4HBKA 4JD4A 4CNTA 2WLZA 3MP5A 3T0AA 3F03K 3JZUA 4PMUA 3DGRA 3L9CA 4W7UA 1EP1A 4GNKB 1EUNA 3PZNA 2VVNA 3TA9A 1T8XA 1BQCA 1KQYA 1VP5A 3WFLA 3WLIA 3KBSA 1WAWA 1YXYA 2DZVA 1UPMB 3GUGA 1ISZA 3DFTA 4QJ3B 5AC6A 3R4IA 2C14A 4R27A 4R33A 1PX8A 3VX1A 2QIWA 1KM1A 2C79A 1SSGA 2O9TA 3VE7A 4MY9A 4PTMA 4E2OA 1F3EA 2CFFA 2BLEA 1HUVA 4UB9A 3THUA 3DFHA 1UW9A 4C6JA 5FJPA 3E49A 3TW7A 2R91A 3FGCA 2VEGA 1M7OA 3EA2A 3WQ5A 1JFXA 1JPDX 1G67A 1F7BA 3A4XA 2NVCA 1J6PA 2V81A 1B4EA 3OEXA 2X2YA 4MNMA 1A0EA 3PZIA 5BXTA 4E6MA 1VRDA 4F0RA 3CMFA 2HPMA 4R9XA 4LV4A 3CMJA 4BI7A 1DYSA 1CLKA 3EWCA 1JZ8A 4Q4RA 1G9HA 1CX9A 3DHFA 2Z0IA 3CV1A 3UJRA 1AJ2A 3FGCB 5IFTA 2OU4A 5D2TA 3ONBA 1TRIA 3AIVA 4KMQA 2ZRZA 4ADSA 3VM7A 2Y85A 2Y62A 5CLTA 3GTNA 1V02A 3CQKA 4RXGA 5AHIA 4Y2WA 3B8TA 4O57A 4C6IA 3WNMA 2B31A 4O1EA 2IQDA 3NM3A 1T6MA 2DV0A 2ZZ3A 1UA3A 3AXKA 1Q2SA 3CQIA 4EE9A 1UC5A 4XD5A 5LSMA 1YEYA 1S5NA 4H9UA 3N9RA 3HOJA 1NJJA 1UWQA 1CXIA 4W5UA 1I1XA 4JIIX 3QSTA 4DBDA 5CJNA 4A05A 4DNHA 3RLVA 4UFMA 3VC5A 5D9OA 4WJXA 5DCBA 1QOQA 3SCSA 4KESA 4LVAA 4GX8A 4ZO9A 3PHAA 3IGXA 2XIMA 1WP6A 4PYSA 3OU8A 3ARTA 4IJBA 3QQ1A 3SRHA 1PTDA 1MQRA 1W6TA 4L6HA 3ATYA 1BXCA 1HT6A 4WJEA 1EFZA 2E6FA 1AODA 5E9XA 1RUSA 3CPGA 3HG4A 4LCSA 5DLCA 4BWLC 3W1RA 4B2DA 2OQYA 3TMQA 4MB4A 4F2UA 3OVQA 2JBMA 1EOMA 2IPJA 4B3LA 2DU2A 4JTRA 3IIVA 4Q8TA 3UWEA 3NQEA 1RPKA 3N29A 2DDXA 2WVVB 2W63A 2ZVIA 3L5LA 4CNPA 3I6EA 1EJ7L 3S8HA 3CAVA 1C9DA 2YOCA 2YCIX 4P8WA 1JNEA 4HU4A 1TPUA 3F5KA 3ZO9A 2D20A 3A9BA 2J88A 3M1ZA 4UTJA 3VD4A 2YFNA 4EWND 3P8IA 4M3PA 2PEVA 4YCOA 1EC7A 4PULA 4E8GA 1JPHA 1J2BA 3GNXA 4NF7A 4XVDA 3ARUA 3CAKA 4GH1A 3KHJA 4GABA 4R7WA 3AYRA 2ZVRA 1WZLA 5A8MA 2DZPA 1UD3A 3EDFA 2VX4A 1Q5MA 3WMSA 1GORA 4NILA 2WPGA 3STCA 4MTVA 4H7CA 2PDPA 1H50A 1JYXA 4JKKA 4J3ZA 3EOSA 2J4GA 3TUUA 4H83A 1XLCA 4FIRA 4DX3A 2FZNA 4V15A 1M7XA 1TMLA 3G0XA 4Q8OA 2J25A 1B1YA 9CGTA 2BY1A 4LW7A 3WEZA 4BQ4A 1XKJA 2DQXA 4QFUA 4LS1A 1DPMA 2E6AA 1MW2A 3WQDA 1LOLA 2H9AB 1DORA 3B8WA 4J35A 2Y8UA 5CCZA 2PS2A 1J10A 1KB3A 2HK0A 1C90A 3AS1A 4DPPA 2XFYA 3DFPA 2QAPA 4O15A 3LY0A 4F0SA 3CPRA 1MW3A 4GOAA 4XAZA 1PSCA 1XLLA 4CQCA 4FALA 5K9CA 4DO5A 3MI6A 2VWTA 2OX4A 2AOSA 4DJEC 5HQLA 4W87A 4FNQA 3W1AA 3LRLA 5JH2A 3VNLA 4ZQMA 1XH1A 3WDJA 3LZ5A 1O5XA 2VFDA 3L5MA 1YNQA 4N9EA 1DIKA 1JAKA 1Y8BA 1I1WA 3NQVA 4GUGA 2PP0A 3DKJA 3I7SA 1UKSA 5LNWA 3MMUA 1XYLA 3SECA 3KVMA 2Z1WA 3VDGA 3MMWA 1QNSA 3Q67A 4H2CA 3STEA 2ABBA 3VKBA 1KQZA 1M04A 1G4SA 4UTMA 5HOSA 4LQ1A 4Z1BA 3WLHA 4JQ1A 4J7RA 3NQBA 1W3HA 2A7NA 2QDGA 1K8XA 4DJDD 1RALA 1R87A 3CO4A 4U10A 3QZAA 4ROPA 3I6TA 3ZJ8A 2VRQA 4K39A 4JDBA 1EJWC 4NNCA 4FR1A 2PWHA 3M7WA 3UJ2A 2GDVA 3A9IA 2P53A 3KL5A 7A3HA 1XBXA 1JZ7A 4HKPA 4AZGA 3D3AA 4DNMA 5BWAA 2XSAA 4M29A 5BNKA 3FYPA 3BICA 2GGIA 4AZIA 2PTWA 4AWEA 2YJQA 3DFNA 3LM7A 3MHGA 3ANUA 2F9RA 4IFKA 1XIGA 3VIPA 2NWSA 2DZXA 5CSUA 3AAMA 1EX1A 4KEMA 1UJPA 2YL9A 2WCGA 3R7MA 1WDDA 3TAOA 3EMCA 3MHUA 2HV5A 4UQ9A 3UT0A 4FNSA 7ODCA 3CU2A 7REQA 3M64A 3M0VA 4HZ8A 2CEQA 5HNRA 4KWOA 4AIOA 1G7VA 1ZBKA 1WXYA 4ENLA 3S0CA 2V5DA 1MFUA 3DBNA 3GVQA 4RR4A 4HNTA 3A21A 1KD0A 3W71A 4C1KA 5JH1A 4HMNA 1WUEA 2CLOA 5LA0A 1UJQA 4FB7A 1CTNA 3E74A 4C6LA 3UZZA 1H5YA 1A5MC 1DE5A 1ZTVA 1XX1A 4JNMA 4ZOCA 3PNUA 5D33A 4DWSC 3QPYA 3M41A 5A6TC 7REQB 3RJXA 3H6OA 3APTA 4DXKA 4JYDA 2YBVA 2GUBA 2P50A 2FMOA 4JIRA 4JGDA 1SFLA 3N9SA 4MY1A 3MZNA 3P5YA 4UR9A 4MKSA 5I00A 1EIBA 1L6GA 4NSBA 4MVAA 1V0NA 4O13A 4EP8C 1X7IA 3CWNA 1AD4A 3IWPA 4UR7A 2PE4A 3W00A 2ZA3A 3IVTA 3AIRA 3CLWA 3OTRA 1NTHA 4GIRA 5IDZA 2ZRUA 2HTMA 3H26A 3W7DA 2ZX6A 3O0KA 5D2WA 3CO8A 5HULA 4WIWA 3MKKA 2PP3A 3W7GA 2V3GA 3UG4A 1FHVA 4H9XA 1A5CA 3TA6A 1YX1A 4LVGA 3KVLA 3LV5A 2QCHA 2Y7EA 1XC4A 4B5SA 2ZIDA 4PBFA 4NX0A 3TH6A 4V1XA 3SCRA 1ECEA 4IP7A 2F61A 4I5UA 1XLAA 1VBRA 3F5LA 4GRSA 1E1FA 1JCYA 2B81A 3ARXA 4L1XA 4LAUA 2DVXA 1RCQA 1BEUA 4AWTA 5TNVA 1TJ2A 4CD5A 3T8LA 3DXIA 1EEPA 4DF2A 4OFCA 4D71A 1XLEA 2PDWA 4AZ6A 3LPPA 4CNSA 4L5ZA 3WDHA 1IXOA 1I2OA 2DZTA 5FKYA 3MJMA 3LMYA 2BASA 1BGAA 5AY7A 4OU1A 5FOOA 3GNDA 4AF0B 4YTTA 5E9AA 2HQAA 4M8UA 4OJYA 2PGEA 4K1WA 1PZ0A 3PZTA 4DB7A 3W9ZA 4IGMA 8CGTA 1XIIA 4Q4KA 3A23A 3TK7A 4S3JA 2YPIA 4JY8A 4HJWA 2FTWA 1W9VA 2FB2A 2BP1A 1H7NA 2G97A 2W4XA 2Q8XA 1FFQA 1OBAA 5C5YA 1W1YA 3CTLA 5CC6A 2JKEA 3I4KA 4AQLA 3SQMA 4O11A 4XBSA 4BWLA 3H8AA 4O10A 4AHQA 4M1RA 1G94A 1XLBA 1ZY9A 3B06A 3LOTA 1W5NA 3PTDA 1MO0A 1Q63A 4F9JA 2FHCA 5C9ZA 2VQTA 4E2DA 2C1IA 1MDRA 3DHUA 3L4XA 3RILA 4BEQA 3AIEA 5F1VA 4JHOA 4DELA 4JX6A 3WY1A 1QO2A 4I7VA 1V7YA 1QHOA 1TPDA 3QYQA 4AIEA 4QS5A 3VNYA 4JTDA 3WBEA 3CL6A 3RLUA 1H7XA 1GPWA 3RXZA 2QJIA 4CEUC 3IS4A 5I3FA 5EB8A 4QAIA 5JXQA 3DERA 1SO5A 3S5ZA 5LIYX 4Q7IA 2VMFA 4L65A 4LC8A 4CN1A 4O16A 3TCSA 1CBGA 3OQ8A 5CZKA 2D2GA 2VD8A 3OLEA 4R34A 3H2EA 1DJGA 4XBKA 3OVPA 1JDFA 2QDEA 5DMNA 1VBGA 2ZX7A 4LAMA 1JIBA 1JRCA 4FMVA 3URAA 3OPSA 3MUZ1 3OVGA 3DFSA 4ZOEA 1JD9A 5A8NA 1CEOA 3GDTA 3LTPA 3RG6A 3WNLA 4N6FA 2EJAA 3NZGA 1ONWA 3AYTA 4GJ1A 3DENA 2OEKA 3MKCA 2BNJA 3IANA 4TXEA 3C8NA 5LA1A 3D3FA 5A2CA 3R89A 1E9YB 4KRUA 4JTHA 3GG1A 1T0OA 5HWMA 4CQAA 1FWWA 4JIPA 1XH0A 4IG2B 3ITXA 2WHJA 4ORIA 5CG0A 1FH8A 3KWXA 1XD0A 1V03A 1E9ZB 4IUGA 1G01A 2QF8A 3L67A 2H8ZA 3VKKA 4WD0A 4DJEA 4DUOA 2DQWA 4FR6A 2G3IA 3MS8A 4KERA 2G5WA 1U30A 1ZGDA 2Z6IA 1Z44A 3H2MA 3S2MA 4MPQA 3VKJA 3M9YA 4U4MA 4IHCA 5CBIA 3CQHA 4RXFA 2AQOA 1XPYA 4DHGA 2HDJA 1W3IA 3IJ9A 2PGWA 2VI0A 2VRKA 4BFAA 2XGZA 2ZA2A 2GDUA 3OLDA 3QV6A 2DJLA 2J7HA 1HN1A 3V18A 1UPPA 2V6AA 3UY7A 3VCRA 3EPOA 5I3DA 4MIMA 5TIMA 2NLYA 3AMCA 3EKZA 1UD4A 4GGHA 3JU2A 4LU0A 4KWWA 4JIQA 1RZMA 1PHQA 2V38A 2VFEA 2XSBA 4ATDA 1OIFA 4URIA 3EXRA 2VO5A 3VZYA 1LWIA 1W3KA 1EHNA 3KXQA 3SJNA 1B2YA 1R7OA 1HKJA 3QV8A 4PCPA 1C3FA 4DBEA 5DX7A 3NSNA 3RU6A 4J5NA 1ESWA 1A5KC 1VS1A 4HA3A 4MHBA 1DV7A 1ZFJA 4NNAA 2OB3A 5BXPA 2PDIA 3BJFA 1PEZA 1XM3A 1O12A 1B57A 4GVIA 3GQYA 3BC9A 1T40A 4MNJA 3WLOA 1HVQA 3VYLA 4DYJA 3UJEA 3SY1A 1V7AA 2FZ9A 1EIXA 5GNZA 4C6EA 4QR6A 4NG3A 3LPFA 2AKZA 1OM0A 3G5EA 3LSCA 1YPXA 3IARA 2ZUTA 3DI1A 1RVKA 2PDBA 2REQA 4ZL1A 2EG7A 4DWSA 1XYZA 3KM8A 4TU1A 3W2NA 2PU1A 5AHFA 4W85A 2X8RA 4PUKA 3MI3A 3OODA 2ZRXA 3U4FA 4E8DA 1QMLA 3TR9A 4JS3A 5LIKX 3GR7A 4M6UA 3CEUA 5JQ9A 1Q6DA 1J18A 1YXCA 2EAWA 4NY2A 2FVKA 3PAJA 2ADAA 4UCFA 2NW0A 3QOKA 4TTGA 3MSRA 3E1F1 3TE9A 2REQB 4H8VA 5ABFA 4DWSB 4W4QA 3EB4A 3G2GA 4LYKA 1JUEA 2X09A 5D2YA 2X7VA 2GQ3A 4XZNX 3HBLA 1M1BA 1CXLA 2XWDA 1KV5A 4MYXA 2ZRWA 2A3BA 1P0DA 2GVLA 3P2VA 2VOTA 4LBSA 3JW7A 3UYCA 3SR7A 3MQTA 2ZC1A 1D8WA 1E15A 1EWDA 1G4EA 4TV6A 3VPLA 3IACA 3FEMA 1OZQA 3IUHA 1UUQA 2CU0A 5EMJA 4J9JA 1ENUA 4S1FA 5CGMA 1O60A 3EXTA 2YA0A 3AOFA 3TXZA 1EF3A 4GG9A 5ABFB 7XIMA 5KZMA 1QI2A 3IUIA 3W1TA 2E1WA 3POHA 5AFDA 3GUWA 4O0QA 3MA8A 1A47A 1GVEA 3M0MA 4Q3MA 3E0WA 3HMCA 3E96A 4WZHA 3OIXA 1Q4WA 2PFHA 4HMCA 4KWSA 3TP4A 3L65A 1HJSA 2XWEA 1KXHA 5C0QA 2YYUA 1J01A 4IZGA 3TAKA 1CGTA 3FAXA 3KHDA 1E9IA 1XLHA 1ZNNA 3QY8A 4C91A 3FHAA 3W7KA 1HKVA 4P8VA 4RW5A 3GNOA 2X1TA 1KTBA 2QDDA 3UCDA 1IXNA 3HGOA 4WLCA 1YXDA 4Q6XA 2OMAA 3AHZA 1LDCA 1P5BA 3AS2A 2R14A 5DCEA 5BCAA 3M0IA 5BXRA 1PX3A 3NYDA 3ZQ9A 4R7JA 3VMOA 3IJIA 4GFIA 3SCNA 1R2RA 1CNVA 1GZ1A 1TPWA 1UR8A 1TTJA 2CZDA 3L7RA 4Y9PA 2A0NA 2W27A 2DSVA 2PMQA 2VTFA 1UP0A 1DIDA 1S2WA 3DG6A 4O4VA 4GE8A 4EF8A 2J6VA 1EYWA 4AX6A 1E6ZA 1KLYA 1SVDA 4BA0A 3G3DA 4WUIA 5CSRA 5HMFA 4Q4OA 4FLSA 2AAMA 1UA7A 3RR1A 5FJJA 1O1HA 4Y9AA 1JDEA 2ZZ1A 4Z2GA 2GUUA 3K5XA 4IF2A 2Y88A 4DJFD 2R1MA 1ICSA 3O8AA 5JU6A 2DW6A 3JUGA 1B4KA 5HANA 4P5UA 4A6GA 1ME9A 5CPLA 3U5UA 5I3KA 3RU8X 2FGZA 4JBRA 4NZJA 2GGEA 3U8GA 4YVVA 2HVNA 3NPVA 3AIWA 3OVRA 4PUDA 4YVPA 3W85A 1QCWA 4Q8WA 3GDBA 1XS2A 2CZFA 1E4NA 4XSLA 3U2CA 1DE6A 1Z41A 3FCPA 3LI1A 3PZOA 1LL4A 3DHPA 3B9DA 4GBDA 1V08A 5D30A 4D6IA 3AYVA 1L8PA 3LYEA 1QWKA 3C4UA 4HOZA 3ANYA 1A5BA 2CHOA 4G7FA 3GXMA 3NOEA 5GJMA 1RJPA 1DVJA 3IK4A 5BU6A 4AC7C 1V6XA 5E6ZA 4W93A 1DHPA 1KLZA 2VNCA 4PGLA 4HOWA 3TNBA 2PTYA 2CXGA 1HO1A 2F2HA 1ZPTA 1IWPA 1SUXA 2J9XA 4Q6JA 4ZCWA 3RX2A 4HYVA 4TX6A 2OGJA 1AK5A 1A5OC 1F05A 3LRMA 4TMCA 4W7VA 4JQ4A 4IMEA 1Q8AA 2PDUA 2SFPA 3AI0A 3IAPA 4R85A 3GXPA 4WDXA 4N7QA 4OTKA 2PBGA 4UFKA 1GOOA 2POTA 2TMDA 4KCTA 1I2PA 1XC6A 3M0JA 3AWOA 2P3ZA 4XG1A 2ACQA 3VKCA 1W3NA 1V3LA 2QV4A 4BEUA 4QEHA 2OXNA 3CS2A 1PX4A 1DHKA 1U22A 4J4KA 3W07A 1V93A 2OFJA 2YDAA 1MQQA 3ZR6A 3EPMA 3RMEA 1FWNA 4N42A 4MLRA 2AGTA 4AY1A 1M6JA 1MZRA 1E9LA 3D47A 4C6FA 1QATA 3OZMA 3VGEA 1ZZMA 7CGTA 3UXLA 4DO4A 2PTXA 3KBJA 2Y63A 4IMFA 3GFXA 4F66A 5ECUA 1NP2A 5FAGA 3WK0A 5HPCA 1UMYA 4ILSA 1WBHA 1HKWA 2PWFA 1GOIA 5EBUA 2PTZA 2YX0A 1JUKA 3ARPA 3W74A 1US0A 3R43A 4MJ4A 3WQPA 3BAYA 3SY8A 1W1PA 1Q13A 1JDDA 2XFWA 2I5QA 3LV6A 1K7XA 4OBRA 4PRWA 2GL5A 3W6MA 1UIOA 5E0CA 3AALA 1WKFA 4OBSA 3AS3A 2EPLX 3IGSA 1EX5A 3QBUA 4E38A 2YSWA 2OOFA 2WSRA 1EXPA 3SFWA 3S4TA 2W66A 2YL8A 1H49A 1Q66A 4L6DA 1DWHM 3QH2A 1JF5A 2A6NA 4LVBA 1MWOA 2VZTA 3S5NA 4C6KA 4HU3A 2PDXA 2VC7A 4HMEA 2H6RA 3INPA 4GUJA 4AZHA 3U7VA 4OVXA 3HPFA 3LCIA 3RPTA 4JTCA 1E1EA 5LNUA 2WZHA 3WH9A 3I6RA 2A3EA 1XCFA 3GKAA 1FWIC 1T41A 5JMUA 3S2NA 3RK8A 3WDRA 4AMAA 4XK2A 2GWGA 3L2LA 2ZOXA 5BXSA 2WSYA 4O50A 3LTSA 3WQVA 1TVPA 3T9PA 1M53A 4Q4SA 2DT0A 2DT1A 2PODA 3F5JA 4O1DA 4XSMA 4E4UA 3UWVA 4UTWC 3L21A 2Y7DA 1V79A 1YHTA 1BYCA 4B91A 5DO8A 5F4WA 3B8UA 3C2RA 3W1NA 2GSHA 2WW5A 3B8DA 3KBMA 4PUEA 3VOFA 1X6NA 2DEPA 3C2EA 3OOQA 4JCMA 4A3RA 4WSKA 1J2WA 3AS0A 2C7FA 3L4TA 1JDAA 4HA4A 1LRNA 4JN6A 4JTFA 2PDHA 2VT0A 1PIFA 5CPOA 1EJRC 3R10A 3KBNA 3PBGA 4QQ3A 1PUDA 1PIIA 1XRVA 2O9RA 1I0BA 1O6IA 3BK0A 4PSRA 2GWNA 3MHFA 3DCPA 5A8GA 4UTLA 2QPXA 1PTAA 1QI4A 4H9VA 1THFD 3FK4A 3HU7A 1BFNA 4O19A 4XD4A 3PG9A 1ONEA 2E28A 3QRHA 4CD7A 3KP0A 4U2ZA 4W8BA 5F2IA 1UWRA 2YW4A 4GIEA 4OKDA 3T81A 4WDUA 4B3ZA 1W5MA 5C6MA 2V68A 5PTDA 5AC7A 1M7PA 1PPIA 5LGXA 3KRZA 1UUOA 3S3GA 4BR1A 1DXIA 1HP4A 1T5AA 3AZSA 4CD8A 3GB6A 3CBWA 3QLLA 1AVAA 4GI4A 2YKKA 3FS2A 4J3TA 3QJAA 4L9YA 2CIPA 2WCAA 1CXHA 4JHMA 5KMYA 2PZ0A 1BWKA 1NWUA 2C8NA 5KINA 4BF9A 1LRQA 1EC8A 4AVFA 1P7TB 3BJSA 1RP9A 2CLKA 1K7FA 3B8IA 5D03A 2YYTA 3WMBA 5HR7A 3RR4A 1GVRA 4QTGA 3NM1A 2TODA 2R1PA 3S9IA 1TMHA 1OSEA 5CZTA 1OGBA 1I0DA 3W7EA 1GPFA 1ZUAX 3K46A 4GZIA 4F2TA 3E2SA 3G6MA 1LP6A 2Z2UA 1JD7A 3WL0A 4UQBA 4A35A 4MAZA 4X3ZA 5GPRA 1WPCA 3S2LA 3VIMA 3V5FA 1NU5A 3HG3A 4H7VA 4JYEA 1A4MA 1V0MA 1KA9F 4JOMA 3W2UA 3ZVIA 3EOLA 1IWAA 3KLKA 2C1HA 2FQIA 3EGJA 1RJRA 4GJJA 4NYUA 1AW2A 3KDNA 1V3JA 4LWWA 3W26A 1U1JA 3UFYA 3H23A 4BF7A 3GDMA 1UZ4A 3OBKA 3CUIA 2QW5A 3OA3A 4QIUA 1JAEA 4WGXA 3P84A 3MBFA 4UNIA 3LDVA 4D6CA 5K9DA 1MFVA 1TREA 4XZHA 3O7UA 2D73A 3WUFA 3E12A 3RCMA 1E1CA 1E3XA 5REQA 1MXSA 3HQ1A 3F4NA 4GWEA 5M3WA 1IZJA 3TROA 5G4WA 1K9EA 2V63A 1VPXA 4J27A 2HJPA 1VH7A 4AG0A 3V1PA 4HZ7A 3J7HA 4Y9NA 1B30A 1JZ6A 3AHVA 5A2BA 4LYPA 3UVAA 3NIYA 1UQZA 3P74A 2C18A 1E55A 1OT1A 3WLRA 4EK7A 1OADA 3UNDA 3NG3A 3KOFA 4WKHA 2QCDA 3OG2A 3NQGA 1NDZA 4W84A 1GJUA 4HHMA 5K7JA 3HIJA 5D05A 2QLYA 2E3ZA 3EWWA 3GRIA 5CLWA 2RDTA 1Q65A 4JEJA 3WSUA 1W0MA 3L66A 2JK2A 3WQOA 5A6MA 4LBUA 2RGMA 1BG4A 4ACZA 4Y6GA 5BRBA 1UMLA 1IR1A 4C6QA 5CJMA 4ZTXA 3RPMA 2EHHA 2VM8A 5HMDA 1GOWA 2ICSA 1VFHA 3E2VA 4Q8NA 1TWSA 3HPAA 4LF2A 3UR7A 4M6QA 1QNVA 3GE7A 3CUZA 2QKFA 2QNEA 3GDLA 2XIJA 3NQCA 2DUXA 2QPSA 1LL6A 3PWGA 1YW1A 2VUNA 2R1NA 4ACZB 3S42A 3U0HA 3HG2A 4M6VA 1BD0A 1R3RA 3MV01 2GSEA 1HL8A 1XFCA 5DCDA 5FEPA 1IXQA 3VO0A 2YGYA 4FSAA 2HNEA 2YXOA 4JTKA 3A22A 1P6BA 2X7WA 1QPOA 3CEPA 3QHMA 1AQMA 1DQUA 4NJKA 1Q45A 2YIHA 3BAIA 8A3HA 1A80A 3WENA 3L4VA 3U2EA 4IFOA 3LUTA 4ZQOA 3LLXA 2V5BA 3IIOA 4PRTA 3W0KA 3DU0A 4D9PA 5ABEA 3DIPA 5BRQA 3DAQA 4CN6A 5LIXX 2XJ7A 4AYSA 3UPWA 3OG3A 2AL1A 1Q6RA 1WV2A 1WDRA 3PM6A 3P81A 5IOBA 1B0IA 2R94A 4UMCA 2X16A 2Y89A 2B4GA 1XDLA 2OQHA 4H9MA 2JFEX 5I78A 3N18A 1BTMA 4LOCA 1FCQA 2OYMA 4I9JA 4FXSA 2J8TA 4GYFA 3P7YA 3MO4A 1BKSA 2D69A 3VI2A 1XLGA 4M0XA 4Z17A 2R1KA 3PJTA 4X2PA 3N2MA 2WVUA 4PRRA 1UASA 4QE5A 2EJ1A 3LSBA 5BZAA 2OLAA 4QITA 1Y65A 4QDWA 2R24A 1SZFA 4S2BA 2VDIA 3ARVA 2HE5A 4GCAA 1F9CA 3W72A 4JQAA 1HJWA 4S3EA 1PAMA 3LXCA 4HA0A 4UZSA 3HO8A 2BMBA 1TWWA 4C6BA 3TYZA 2X1SA 3HV9A 1OC7A 3ZFHA 3MUY1 1CDGA 3S83A 4IL2A 3RM4A 1XIFA 4WR3A 3FFSA 3F2CA 4WDTA 5B80A 1OGSA 2VCCA 3QPEA 2WSQA 4I5XA 1KXQA 4FP1A 1G6CA 3WF4A 1D3CA 3M5YA 1J0YA 3JR2A 2QDHA 2PF0A 5C8BB 1Q7ZA 1KO0A 2CBIA 3MKVA 1NELA 3VA8A 5JVLA 2PWGA 2EPHA 5HNTA 4K3ZA 4ZE4A 3FW6A 1GQNA 4CU8A 1U83A 3W81A 3LNMA 2UWFA 2WMHA 1J5TA 4XISA 2WM0A 4WKAA 1XYCA 3RFAA 3EOOA 2ZBTA 3TN6A 1S3HA 2QS8A 3EDDA 4UQCA 2OQLA 4FA3A 1VCGA 4LUTB 3EWUA 7TIMA 2EPOA 3A64A 3UA3A 4GXPA 1E4LA 1ML1A 3PWIA 2WK2A 4TQTA 4IWWA 3MP4A 1POJA 3BSGA 1OC5A 1XKYA 2W9MA 3BSMA 1K8CA 1QWGA 3EKGA 3LERA 1XCWA 1QFEA 4JPGA 3UCQA 1TJ1A 2J13A 4A2RA 4UWMA 3PN8A 4XZLX 2ZTJA 1F6YA 2VEPA 2EPNA 3R11A 5D2VA 2AMGA 1PO9A 2V2HA 5H6HA 4MOZA 1O5RA 2UY2A 4QLKA 1ISVA 3TZNA 4IJCA 3MYPA 1DXEA 1LQ2A 3ZWSA 4QM1A 4LNYA 3WH5A 1IXPA 2PP1A 2RAGA 4C6DA 4FS9A 3WLTA 3ZIZA 3NVTA 1CXEA 2NSXA 3FJ4A 4V1YA 4IISA 1U5HA 1DWFM 1XIMA 4XKYB 5HWJA 4LC6A 1OQFA 2BB0A 1U5VA 1IIGA 5D8ZA 5K4XA 3FIGA 5CG7A 1PKLA 3PANA 3QGAC 5K3VA 3QQWA 4HPGA 3RO6A 2V5CA 4PMOA 1E56A 2IPGA 3GHRA 5KZEA 2C13A 2WJFA 3GXIA 2Z00A 5IRPA 3LX9A 4B5TA 2ZX9A 3AIUA 1MSSA 3WLLA 3U3HA 1G5AA 2PU0A 5F7UA 1KC7A 2DH3A 1KM4A 4CNOA 1HJQA 2V2CA 3VGFA 3LPGA 1OJXA 2PWVA 3HB9A 2QCEA 3STFA 3TONA 3ABSA 3GU1A 3THDA 2IS7A 4KKXA 1TV8A 2HXUA 2Q8LA 3SAZA 2WHMA 2BTMA 4FAMA 3QTPA 4DN1A 4MFEA 2D3NA 4US5A 4M24A 4ROQA 1JYVA 4HZ6A 4X0VA 2VX5A 3SN0A 1K3UA 5KZDA 2WVSA 2ISFA 4KW2A 3EMQA 3CZGA 3LGDA 2WMGA 4BCEA 4LYRA 3CV6A 1TX0A 2YLLA 3A24A 2ACUA 3G6LA 4Q8QA 2QZRA 4I7WA 4HCDA 1XSIA 3HJEA 4NKCA 4R7OA 4FNTA 3SGUA 2YB4A 4R5EA 1HFBA 3NO3A 3W7LA 1AMKA 3MT1A 1CYGA 3UZWA 1YMYA 4F0LA 3DBPA 5AZ0A 1F6PA 5I02A 3AHXA 2QYGA 1MDLA 3N4EA 4PSPA 5MHBA 1EQCA 3KRSA 3GXDA 3SCOA 1AQFA 1F4AA 5IBXC 2FIQA 3PFRA 2E9BA 4YWIA 3BLEA 4LCRA 4LUIA 1WA3A 1C7TA 3VOCA 4RZ4A 1R86A 4RV8A 4UOJA 3ZLGA 4LTSA 4MB5A 5DRCA 5GNXA 2QJNA 3IJ6A 3H21A 2NXIA 3HQOA 3ITYA 3GG8A 3NFUA 1KV8A 3V5CA 3BAWA 4KIEA 4HTBA 1A5UA 1PVNA 4U33A 3WNKA 3D0CA 3VDHA 4X2RA 4J3XA 4QJ1A 3WUEA 4EWJA 4UNKA 3M5XA 3TNOA 1KM2A 2PI6A 2WSPA 4XUYA 2IW0A 1OGGA 4PMNA 3UVIA 1BVWA 2BG5A 3QGVA 1JUBA 1GHSA 5A6LA 3NZRA 5U7SA 3BG3A 3SSZA 4BZYA 4WQ6A 3NQMA 4UCGA 5CZJA 1GVQA 4ZA0A 4HD5A 1Q6OA 1Q7MA 2ZZ4A 4N02A 4QHRA 1TPFA 3ZJKA 2CXEA 1UKOA 4Q7BA 3E0IA 3SUTA 1KCKA 1QW9A 3N3TA 3MPGA 5DT5A 4C1NA 1LWJA 4E2BA 4ZO6A 3IIZA 4O8RA 4AZ7A 2FFIA 4AC1X 6ALDA 1PBGA 3NO5A 4F79A 1BWLA 2NQJA 1GEHA 4IMAA 4P8UA 4HNNA 4IGHA 5I5RA 4AEFA 4DXXA 1ZQ5A 2E5CA 1FHDA 4MWAD 1LOQA 1SJAA 5TQLA 4P7NA 4ZB0A 1FWDC 1QW7A 3ORWA 3EOUA 4EIVA 2E8YA 2F7FA 1S39A 3COTA 1HKKA 4Q32A 3WJZA 4V28A 2DVUA 4NZ3A 2FHBA 3ZJ6A 6XIMA 2I16A 4KCVA 3V4BA 1D3GA 3BGJA 5HA7A 3E9AA 1UZDA 2Z28A 3UJSA 3R79A 1B31A 4HMDA 2LLEA 4LAKA 4H19A 3HQNA 4PUNA 3KVKA 3EB3A 3N6JA 3TXVA 4IQJA 3EYPA 3FEQA 2ZYFA 1W1B1 1LOSA 1JZ3A 1ZENA 6A3HA 4H2HA 1B54A 5ABHA 3KWSA 3VD9A 3OIHA 2CBJA 1YTKA 1A5LC 3MYOA 3GG7A 2Q3RA 2OYLA 2GYIA 1H11A 2J75A 2CLFA 2D2OA 3AJ7A 4F40A 1WAUA 3W7CA 5C7HA 4HPXA 3IJ8A 1OX6A 1C9WA 4ZR8A 3BGAA 1PCKA 3PC0A 3L2IA 8RUCA 3GY1A 2ACSA 5FF0A 3KS5A 2J9YA 1U1UA 2QUTA 3ME3A 2FH6A 2GJNA 4PCFA 1LBLA 4KFNA 1WOAA 3LCGA 2W79A 1XSJA 4TTUA 1FWAC 1RH9A 3CZJA 5HJXA 3NURA 3VOJA 3V1HA 2NX3A 1QNPA 2P8BA 1DJIA 1VRXA 4XKMA 5AYXA 6CGTA 4L4LA 3M6DA 3OZOA 3WJSA 1NSJA 3K8LA 5K9XA 3MWAA 2PDQA 2PC4A 4I8YA 4XD6A 4YTQA 4LBRA 1BXNA 1YKWA 1HJXA 3BLOA 2DIJA 4I9AA 1TMQA 3VAVA 4BK9A 3B8SA 5IDIA 4DIAA 3PBYA 1R38A 4NZFA 4HTYA 3HURA 1ZB5A 1QXLA 4OOZA 3TJLA 4W8AA 4GHRA 3GFYA 4IICA 1GONA 3EX3A 4TVCA 3ENLA 3RUBL 3GTXA 3M5VA 4FNRA 1YPIA 2C19A 2Z26A 4JTTA 1V3MA 2O7QA 3CL8A 4XZWA 3U7BA 2ZZ5A 1SZEA 1R2TA 1AFSA 3S47A 3N2BA 4YTRA 1OFRA 4IMDA 4DI8A 1MEWA 4JKLA 3RPDA 5I6SA 4UR8A 3SQSA 2JE8A 4R88A 3WL1A 3WZ0E 1AL8A 3EX6A 2YCJA 4DUVA 4O12A 3S6OA 3SURA 3C0JA 4FOUA 2YB1A 4GUFA 4NHVA 3PAOA 4DJDC 2VX6A 1VBUA 4M81A 1VFMA 2P0IA 2ZWYA 4OHQA 2A3AA 2AL2A 4OZOA 3N1AA 1NFBA 1EPXA 3A3HA 1OD0A 3CJPA 2PGRA 3W02A 3T6CA 1I4NA 1ITUA 5EGRA 4AAJA 4ADTA 4O53A 2PZNA 1GQLA 4TMBA 4LT9A 3TJ4A 4LUYA 1HW6A 3PP7A 2JGQA 1N55A 4REQB 4GY7A 4PUWA 3F4VA 1TV5A 3IJQA 2XVNA 1DKWA 3DFQA 3LCLA 3OQEA 3UXKA 2AL2B 1E0VA 1EP3A 2F8QA 5DEZA 1JG9A 2VGGA 3QHNA 1E0XA 2E6DA 5IHRA 3TYDA 4L4MA 1RBLA 1YYAA 1PCWA 3O3RA 5T26A 2BXZA 3WELA 1X39A 4Z1YA 3L68A 4JFUA 3K30A 3W1LA 1ECQA 1XINA 3EWZA 5DBTA 2GOKA 2FFCA 1ZJHA 4NAEA 1GKPA 3KLLA 4O1AA 3L12A 3RX3A 4ASTA 2Y70A 1XIJA 3VIOA 5IBXA 2CLIA 2F6UA 3QSRA 3N04A 1F6KA 3GNRA 2WCSA 1TQXA 4OV4A 3MBDA 4GUHA 2HISA 1K70A 1DBTA 4RE3A 1F76A 1LYXA 2VDHA 1H0GA 2HZGA 1UHVA 2YDQA 2WZMA 1MQPA 4A3UA 4OT7A 4HNVA 4HPHA 4KBXA 1ZP3A 2YDRA 2GLKA 3W7JA 1ZAIA 3KL3A 3ELFA 4NAEB 2BDQA 2VGFA 1KGUA 2PSNA 3BLKA 1IQ8A 1XV8A 2DH2A 4P7RA 4I7UA 1WBJA 2FKPA 1E6QM 1B3YA 4MZ1A 3WNNA 1UKQA 1K7EA 5C70A 3TN3A 5EMKA 3EKLA 3B4YA 2AMXA 2HVOA 2VQUA 3W2JA 4J3VA 3R0UA 1EL3A 4U5IA 4KCWA 3PPHA 1W8GA 3LU2A 4XTDA 5GNYA 3NXLA 4MNLA 3ANVA 4A4AA 1W9PA 3PS7A 1HVXA 3G1FA 6TIMA 3A12A 2PUZA 3L0NA 4DLMA 1OIMA 4FLOA 2G0WA 1TYGA 3VNJA 2X1RA 4PFMA 5CZ0A 4RDWA 2V5JA 1GHRA 2B0MA 1BF6A 4WXZA 4LRTA 4Z1CA 1YBQA 3NQ2A 2E67A 2WC7A 2Z4GA 4ZQPA 3UWWA 5XIMA 1TELA 1X97A 4H6KA 2BY2A 1Z42A 2D0GA 2E5DA 3B9NA 2PDGA 4CNUA 5AVHA 3B40A 4ZB2A 1JFHA 3LA4A 4C7GA 1GYNA 3E6EA 2VFFA 5ENLA 2I7GA 1KM0A 3APYA 2DZUA 1SFTA 2P10A 2BHZA 4K36A 5MF5A 1G7UA 2XINA 2NV2A 2EKCA 1G4PA 1S2UA 3HZ3A 5EMYA 1O1ZA 4XB3A 2E25A 2GSJA 1GVFA 1X38A 2VC5A 1V3IA 2VR2A 1EWEA 3MCNA 1TSIA 2GQ9A 3AISA 4TV5A 1SW3A 3CYJA 3UQNA 1WE5A 4KFPA 4MZ8A 2XH0A 4A22A 3UESA 1BWVA 2YA1A 4A2SA 2QF7A 4ZVJA 5EMMA 3N12A 1VEOA 1MXDA 1X7FA 1JCNA 3O63A 1E6RA 1FBAA 3VKDA 1SZRA 4UFLA 3NZQA 3NUKA 1FWHC 5LKYA 3G1XA 1KCLA 1ZAHA 4RUBA 1R3QA 1TZ9A 2ZUUA 2A79A 2NUWA 1IGWA 4S38A 4J3UA 3LS9A 1SZNA 2EKGA 3VE9A 1E4IA 5EMLA 3QN3A 3M47A 4B9ZA 4UTFA 1AJZA 5K4ZA 3VK5A 1OFDA 2XIBA 2J7DA 3B0YA 3NPXA 1YDYA 1R3YA 4RNFA 1ITXA 2J62A 2O0TA 2WQPA 4ZODA 3LBCA 5DMMA 1H7RA 1EA9C 4DEFA 1FWTA 1CZ1A 3EDKA 3LHVA 3BUVA 2A3LA 1J8VA 3W1MA 1CGYA 1ISWA 1Q8JA 3F4CA 2WLYA 3SI9A 1NWRA 1C93A 1H62A 2VYOA 3KOZA 5FF7A 4JTLA 1DWGM 4MY8A 2J6XA 4IGNA 5H8PA 1N7KA 4AW7A 2Y5JA 1A3WA 2QV5A 2EO7A 4ATLA 4S23A 4NZ5A 1F3WA 3SGZA 1FH7A 4TUFA 4XZ9A 1GJPA 2D2HA 3BDKA 1V6VA 2NUXA 3ONCA 5D32A 3VINA 4HQVA 1RQBA 1T96A 2J78A 2V5LA 3LTYA 1RV8A 3QQ0A 2G3JA 4DQWA 4EXAA 2UV8G 3PBVA 4AXNA 3PSWA 5D02A 3OHMB 4UFJA 2BVYA 1IR2A 2Y1HA 3UA4A 5LZLA 1K02A 4XAPA 1ITCA 5BOFA 3RO8A 3W23A 4HA1A 1VFLA 1E3ZA 4MB1A 3GAYA 2I9UA 5FESA 1TPC1 4GIAA 4I6VA 3S5SA 1KGWA 4RZ6A 3W7HA 4LRSA 2BOEX 3CL7A 3Q37A 5A8OA 1PWLA 1GVIA 2PTDA 5EY5A 3LCXA 4DJDA 1RJQA 2YCLA 3O16A 5CPMA 3CNYA 1QR7A 3W88A 3L0KA 5MKGA 3B0UX 3FJNA 3GTFA 2A4AA 2MANA 3TTYA 3BWWA 2XSXA 1GYMA 4LALA 2YFOA 3GXNA 4PL2A 4ZFCA 3I65A 3KTSA 4CGTA 2WYSA 1E72M 4A8LA 4DAIA 1XRTA 2NUYA 4CU7A 3FXYA 2ZFAA 4G56A 2J8FA 3WQ6A 4A29A 3U5YA 1XGEA 4OUEA 3IGUA 4X9SA 4UTUA 2JF6A 4ICNA 5FA5A 2YCLB 1EXBA 2QIIA 3N15A 1SFJA 4YMZA 2QJHA 1KFKA 1S2VA 3TKFA 5MKGB 3VD5A 2F84A 4GBUA 4QG9A 2IXVA 4PMVA 3UWYA 2ANUA 3ITGA 5HDRA 4RE2A 4EPBC 1Q4NX 1XP3A 2DJXA 4TVUA 3SIMA 4A21A 1XUUA 4DPQA 3M46A 3P62A 5AYYA 1RHCA 1BHGA 3WK3A 3O6YX 3GDKA 3H70A 4ZGYA 3CYVA 2XM1A 4LVFA 4O28A 4X60A 5CC5A 2BGNE 5EU9A 3S6DA 1ISXA 5HUPA 1KCXA 1UZ1A 3EPNA 2WVVA 2VR4A 1OG0A 2ZRYA 4MPKA 4PC8A 4GGBA 3WKZA 1VJIA 5HR6A 4FF5A 3W82A 3LENA 2XH4A 5F1UA 4BJHA 1I60A 1HL2A 1VENA 1EZ2A 3T0TA 1R8LA 1EA0A 2NT1A 1EEXA 2VD9A 3ZYZA 4C1LA 1OFBA 3IPWA 3UERA 5FEZA 2FVMA 5LHEA 2CZEA 4PN2A 2NXGA 4ZOAA 2VOMA 4KGLA 1B5TA 4PMZA 2DY3A 2R6OA 1XI3A 2QMJA 3QTGA 4NI8A 3II1A 4PTWA 1E4MM 1W91A 2ABAA 3SY5A 3SCWA 4GACA 4FNPA 1BSIA 1WYIA 3GNPA 4HN8A 3QY6A 1E73M 2POZA 3AXXA 5M17A 1LF1A 3MVIA 5DY3A 2GJLA 4UTIA 3MSGA 3MC5A 4WF7A 4RV3A 4CCDA 2WSKA 1LJYA 3A47A 3EAUA 1EYEA 4JTIA 1PV8A 4LEFA 2XISA 4WEVX 2H9AA 1HGYA 1OFQA 3O6DA 5LGZA 3N11A 2Y8VA 1O94A 2JF7A 2WBKA 3NDYA 3TOYA 1DTNA 2QGHA 1HF6A 3C3NA 1DIOA 3AU6A 2YLAA 3QC0A 5DQPA 3R1ZA 3PZ9A 1KM3A 2EG6A 3V0UA 3UPMA 4IH3A 4HK5A 3R8HA 2A5HA 1JCXA 1IEWA 2KZHA 2W62A 3WNPA 1EQPA 5TF0A 4MG4A 3BG5A 4YN5A 1I2NA 4KIRA 4Z2KA 3C2YA 4ZO8A 1D8CA 1H1ZA 3WDQA 4PMRA 3TDFA 2XFFA 1V3KA 3G1YA 3KAOA 2BX7A 1N82A 4MJZA 5CC3A 5FF2A 3VOIA 3RGTA 1W32A 3B9AA 3TTEA 5HMSA 5AN7A 2A21A 3F1QA 1OF6A 4UQEA 4NZ1A 3ARSA 1XCXA 2OOGA 2X30A 4KFOA 2XN0A 3S1VA 4HVXA 1I9CB 1SR9A 3TFCA 3KL0A 2ISWA 1T8QA 2ZADA 2ON3A 1V02E 2AQVA 3C52A 3EA1A 1KRCC 1P0EA 5C2CA 1QO5A 1GTEA 3TMLA 1BTCA 4XVEA 2WWCA 1NH6A 1XLDA 2QMKA 4XZBA 4JIHA 4HSNA 5CKSA 4LANA 4LY4A 1NWSA 4PTDA 4ALDA 3GXTA 5AVNA 2DIEA 1OC6A 4AY7A 4XZIA 4DJFC 1B9BA 3WLMA 3P61A 3MMTA 4QROA 3OZYA 3RM8A 2WHLA 4B90A 4D6FA 5BWFA 2IMRA 3GHUA 3RHGA 1OT2A 4ZXOA 4QLJA 1L6FA 4IM4A 3KOWA 4UMBA 4IL0A 4X61A 1RK6A 2PDFA 4MSSA 1TTIA 4NU7A 1VIZA 1OK4A 1GKRA 1O7AA 2W6RA 4R9OA 1O66A 4A8RA 2PLJA 4BF5A 4ERGA 1NY1A 1TVNA 3ALFA 1QASA 1S2TA 1ZBWA 1V8EA 4WJ8A 1RXOB 2WZTA 4L4OA 4MDPA 3R94A 5AHNA 1C8YA 1P1MA 4GKTA 2CESA 1XHGA 3C6CA 3I3EA 3AXHA 2I5IA 1UR2A 3NA8A 1K4HA 4Z0JA 2E0PA 4B4HA 3Q2DA 1FWGC 1V4YA 3SN1A 3W86A 5AC4A 5FEWA 3C0LA 3UETA 3WLNA 1KXTA 1A49A 3FKKA 3HGRA 5HNNA 1RBOB 4ES4A 3VM5A 4B16A 5F4SA 3A4WA 1VKFA 4PODA 1E0WA 2J74A 5D2XA 3WDPP 4UNLA 1A50A 1TTPA 5CSSA 2PDLA 1GTHA 2VZUA 5I0DA 1POKA 1JQXA 1ZP4A 1L8NA 2GVJA 1BSLA 3KRBA 4U28A 1G0CA 9RUBA 1FWBC 5FCZA 4WSJA 1EF2A 4HNUA 1XIBA 4GKLA 5BYWA 3MU7A 3GW0A 2VCAA 1K4GA 3WK2A 3FV9A 1DWAM 4GQ0A 2Q01A 3WDIA 3VCCA 3N2OA 3FA3A 4P8XA 3H4GA 1JGMA 1IGSA 4NQ1A 3ZZ1A 2XH7A 3F2BA 1M3UA 3WLQA 4PEEA 2BHYA 3BQ5A 2HCVA 3MJYA 3WFZA 3N14A 3RCYA 3VIKA 3TYCA 3AZTA 3LLDA 5FF4A 4MJMA 1ELSA 4FX8A 2ZA1A 4AF0A 3TC6A 1ODZA 2X1IA 4L64A 3ZOAA 3AZRA 3RMJA 2UZ9A 3WJXA 4WOZA 1OCQA 2PRHA 4RZ5A 3N2CA 3L4WA 3EWDA 2JIWA 3QW4B 1KKRA 3UWUA 3CLMA 1V3HA 1FA2A 1HTIA 3W37A 3W28A 3A3WA 5LIUX 1DJYA 1VD6A 2WB5A 4RDZA 2Z1KA 3PY2A 3K1DA 2C15A 3G8RA 1A53A 1H09A 3T1GA 5BW6A 4ZZ9A 4JQ3A 4N2YA 2OSWA 3WH8A 2OT1A 3IV3A 1SW0A 4KWUA 4IP5A 3ZJ7A 3TEVA 1OHLA 1XGDA 4IGSA 1JI2A 2EPKX 1KBJA 3ICJA 1DJNA 1W37A 4NZCA 3CV7A 1UZHA 3CHEA 1UIPA 1R7AA 4ZQRA 2OZ8A 3WYZA 1XIEA 1L0PA 1TPVA 4Q22A 2EPMX 2GJRA 1HG3A 5LA2A 1E51A 4MZYA 1I2RA 5D37A 1X98A 3LXAA 4GZ7A 3RLHA 1FH9A 4KEUA 5KSWA 3VZZA 1NFGA 3ARYA 3B0VC 4GX9A 1EB3A 4OOUA 1NOUA 3L2MA 3UR2A 4MFDA 3RLGA 1BVZA 2Y4SA 4TVDA 4N0RA 1J0IA 2XG9A 1SMDA 3XINA 3W6LA 2PLKA 2PWDA 1V51A 3GZ3A 1LBFA 4WY0F 3ZVHA 4HOXA 4GI9A 2W0UA 4TX8A 2ZE0A 1WX0A 2H90A 1M41A 1E5JA 2BSLA 1QUMA 2FPVA 3NL2A 2BFGA 3K4WA 1YQ2A 4WK9A 2E5BA 2XDFA 1AJ0A 2ZUWA 2DZAA 3LGEA 3M0ZA 5DELA 3NDOA 4NP7A 3BOXA 3BZGA 4G6CA 4FK9A 3TLQA 3P14A 3ZVHB 4U31A 3F7JA 1CGUA 3SJ3A 4RL3A 4H7ZA 4I9MA 3GIYA 2QCFA 3O07A 3PSVA 2OVLA 3V16A 1H7PA 2XZ7A 4BQ3A 1XLKA 1UP2A 4EVZA 5I3IA 4PL1A 1SSDA 1XBVA 3DHDA 2CZ5A 4O17A 3CASA 4H3DA 3PPGA 2HEJA 3MV11 3QKZA 2G4FA 5FJUA 4IG2A 2PRMA 4B15A 3Q45A 3N4AA 1EDTA 3UR5A 1LWHA 3ZXWA 1XG3A 4OECA 4MAVA 2CW6A 1P1XA 4DZIA 4F0KA 3WJYA 3GIPA 1RY0A 1SM9A 1S5TA 1DXFA 2UBPC 4K37A 1XL9A 3P3BA 2EG8A 4M56A 1DIEA 3TQKA 3W1PA 2OSXA 3W7QA 1D3HA 4QE4A 5A3HA 5G4EA 4FLQA 2PDKA 4I8DA 3G1DA 4PTVA 5C9WA 1VFSA 3BMVA 1C29A 3THAA 4JFWA 5M03A 1R30A 1F73A 3KP1A 4AD5A 1TCDA 1VHCA 2IQTA 4CD6A 3LLFA 2G50A 3CHFA 4Y8FA 4D8AA 5HQEA 3GBEA 4YVXA 3TWBA 4XZMX 4IPNB 3UF9A 4IP4A 2A1YA 4N9BA 3ARQA 1OX5A 2P76A 3LQLA 3UWQA 1NEYA 2RH9A 4YXGA 1HJUA 1K6WA 4DY1A 1FWFC 1GW1A 1EGVA 4QP0A 1UD2A 4BQ2A 2B7QA 2PLCA 2P0OA 1AMYA 1BGGA 2CPUA 2QGYA 2WBGA 5I3HA 1GNXA 2CLPA 3SO7A 3LN3A 3TZFA 3W3OA 3B8VA 4H9ZA 4AIUA 3W01A 2BVWA 2BWGA 1TWDA 3LHTA 1S46A 4DJFA 2OSYA 3BO9A 3AMKA 1LLWA 2VVSA 5AHMA 4XTIA 3I3DA 1FVPA 5D09A 4JN8A 4L80A 3WQGA 1K9DA 1GVOA 2VZOA 3T0DA 1I2QA 4N4PA 3NAVA 1IEQA 4NI3A 3ZR4A 1B90A 1J11A 2E09A 4ERAA 1W5QA 1R3TA 4X0NA 5J5DA 2ACRA 1WXJA 2J9ZA 2GQ8A 1QHPA 5C71A 3LQGA 4GNVA 5HUOA 2V5KA 4Y96A 1OVDA 4E3TA 4UIOA 1Z9AA 3B9OA 4IX2A 3BH4A 1DEDA 3H7UA 1GEQA 2YCEA 3PJWA 1W2VA 3AJXA 3VD3A <