3L9CA

The crystal structure of smu.777 from streptococcus mutans ua159
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
249
structure length
226
Chain Sequence
SSGLVPRSMKIVVPVMPQNIEEANQLDLTRIDSTDIIEWRADYLVKDDILTVAPAIFEKFSGHEVIFTLRTEKEGGNISLSNEDYLAIIRDIAALYQPDYIDFEYFSYRDVLEEMYDFSNLILSYHNFEETPENLMEVFSELTALAPRVVKIAVMPKNEQDVLDLMNYTRGFKTLNPNQEYVTMSMSKLGRISRLAADLIGSSWTFASLQISLADMRKIKEVLDAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
publication title The Crystal Structure of smu.777 from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
total genus 83
structure length 226
sequence length 249
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3l9cA00
3P5YA 1SO4A 2TYSA 1JCYA 3TSBA 4O1DA 2DZSA 1IGSA 4P2VA 3Q2DA 3GAYA 4WY0B 3IRDA 4RXFA 2QR6A 4BFAA 2V30A 3SR7A 1DORA 2GVLA 4O28A 4FIRA 5CPOA 5C5YA 4JTFA 1THFD 1TPUA 1K3UA 4YCPA 4PH6A 4CQ9A 1ICSA 4IXHA 1FWRA 2R94A 4ADUA 5CZTA 4CLMA 3SECA 1IXNA 3FLUA 1KM0A 4DQWA 4ONVA 2A4AA 1LBLA 1GTEA 1B4KA 4WOQA 3W7GA 3SFKA 4JIPA 2FPVA 1VZWA 4IMEA 5AHMA 2YYUA 1A5SA 4YMZA 2QDHA 1PVNA 1MZHA 3N73A 3FIGA 3W74A 3G24A 4CCDA 1XBXA 1F7BA 5AYYA 3UXAA 5I3JA 4UNKA 2FB3A 3P62A 2KZHA 4MJMA 3ZWSA 4OBTA 4WOZA 4A21A 5LKYA 5HNRA 3S5YA 4QQ3A 3TJXA 1PIIA 4ADTA 3C2FA 3E02A 2A7PA 3IIXA 2Y7FA 4FXSA 3W75A 2X2GA 5KZMA 1VCGA 2CZDA 3P60A 2FQIA 2VXNA 3EWXA 3NPVA 4X3ZA 3MWAA 1VS1A 1KM3A 1FCVA 1P4CA 1MEIA 4KFNA 3G0UA 3MI3A 4H3DA 4LW7A 2V2CA 2VEKA 2VEMA 2EGZA 1ZNNA 1J5TA 1ME8A 1W5PA 2I14A 4O18A 4QM1A 4RV8A 1B57A 4MFDA 2WJZA 3PVFA 5FF0A 4CNNA 3GNNA 1QO2A 1VYRA 2Z1BA 5FEPA 3WK1A 3IEBA 3LM7A 4O12A 3C2OA 1ADOA 2NV1A 3TKFA 1DBTA 4NNAA 1YADA 2ZYFA 1XM3A 2H3BA 2A0NA 3LHUA 1BWLA 1ALDA 2W0UA 5AC7A 3LERA 4A22A 4FX6M 2E6AA 1SSDA 1T96A 2Y7EA 2ISWA 2Q3OA 4E38A 1DKWA 5EY5A 3HO8A 4ICNA 2Q3RA 1L9WA 1QPQA 6TIMA 3W6YA 2EF9A 1XUZA 4QNWA 3RK8A 3WJSA 3QPYA 4LV4A 5KZDA 3WK3A 2ATMA 3G3DA 3NG3A 1VLWA 1DJNA 3KVKA 2V0TA 3GXPA 1W37A 1QDSA 1IIHA 4WY0A 3T40A 2ZZ4A 3C4UA 3UWUA 3NPUA 5EBUA 2TMDA 3THAA 4YL2A 3FJLA 5HWJA 2ZTKA 4GNJA 1LOQA 3W1RA 4NX0A 1WA3A 1I2QA 3LXCA 1H7OA 3S1XA 1PHWA 2ZA3A 3LBMA 3LTSA 4O15A 4MY9A 2P0OA 3PG9A 3ANYA 1JQVA 1VYSX 2X1SA 3LCLA 4DEFA 4GFSA 1QMLA 1VR6A 4JICA 3W9ZA 1VH7A 3PUOA 1B3OA 4IQLA 1PHQA 4MYXA 3Q58A 2NWSA 4UTJA 1SZFA 5F4WA 2J27A 1AL8A 2E5DA 1D3GA 1T8XA 4FF7A 4TMBA 4A3UA 3UNDA 3I6RA 1H7NA 3O15A 1YXCA 3L5AA 3W1LA 2ALDA 5AHEA 3S8HA 3H54A 3OVPA 1WV2A 5I3HA 4LRTA 4JD4A 3W7RA 4O1BA 3NL5A 5G5IA 3NDOA 2VFIA 3T78A 3TXVA 2F7FA 2ZA1A 2NXIA 1W3NA 3TR2A 1KLYA 3IVTA 1TREA 4ZL1A 3KHJA 3QRHA 3F4WA 4W9TA 3CU2A 3KFTA 2QJGA 4AHPA 1K8YA 3PM6A 5AYXA 4JTGA 1FWNA 4AXKA 2C1HA 1X6UA 1M6JA 4AF0B 1R2SA 3QM3A 5CGQA 4NJJA 1YDNA 3C2EA 3DFNA 5FF3A 1I4NA 4I7WA 5E93A 1GQNA 4NJHA 3W85A 1KM4A 3BW3A 1XCFA 5T26A 1OX5A 5TIMA 1L6WA 2PRMA 4N4QA 1W8SA 1OFEA 3UY7A 3IIZA 3HPXA 3W23A 4GUJA 1DJQA 2ZZ1A 3VFLA 2CZ5A 5D2XA 4L4LA 1VCVA 3A24A 1MO0A 6ALDA 2LLEA 4NT0A 1VHNA 1LRTA 3M1ZA 3DGRA 3PWAA 5BRBA 4BWLA 3OBKA 1AL7A 2OCZA 2A21A 3RMJA 2NUYA 3LHWA 3HPZA 2AAMA 5J5RA 3INPA 1RQEA 5H91A 1ZCOA 1TRDA 1KTNA 1W5OA 1OYCA 2ABAA 1HO1A 3QSRA 5DBTA 5HMSA 1WQ5A 3OHIA 1VRDA 5HWNA 2BTMA 3NQAA 2A6NA 1H61A 4AWUA 3NZRA 3EX6A 3MI2A 4M6VA 4RK8A 3W3OA 3E12A 4NVTA 1QO5A 4ZQMA 4OGZA 3B0VC 3TQ0A 5F1VA 1TPVA 3G0SA 5G4EA 3HGRA 1YXYA 3AO0A 1I2OA 2V5LA 1NFBA 4OV9A 1PS9A 1I2PA 4BK9A 4YLWA 2G96A 1G67A 1WAUA 4WY0F 4AB4A 1FWSA 2Z6JA 5KTLA 5MHBA 4ALDA 4MFEA 2P10A 1R47A 5AC6A 3HIJA 3T7VA 1O4UA 2DZWA 4O54A 3QYQA 1SUXA 4EVZA 3A21A 3P8JA 1VCFA 1ZALA 1RZMA 1XC4A 5KSWA 3G8RA 3UPBA 4CNPA 4QNEA 5DCEA 4Z1CA 2A5HA 3W1XA 4HNVA 4GE8A 3GX9A 1F74A 5F2MA 2H3DA 2V8ZA 1JCMP 3UWVA 3GVGA 1S5TA 1TO3A 3E49A 4B5NA 3A5FA 2DP3A 3S1UA 2V2HA 3B0UX 1JUBA 3W1MA 4X9SA 3TJLA 3LX9A 3GYEA 1PCWA 1Z48A 3UY8A 2FPYA 4UTMA 2A85A 4RX0A 2H8XA 4IWWA 3NQ8A 3O06A 1UB3A 4FNUA 2UV8G 4I7UA 1K7FA 2TPSA 3FFSA 4AHQA 3MHUA 4AF0A 4DBDA 1Z42A 3W86A 3IGSA 2C0AA 2WNZA 2E68A 4WJEA 2ZA2A 3W7QA 2C14A 2WV8A 2BX7A 3P82A 5IBXA 3ABOA 2CLEA 2QCLA 1EWDA 2YXGA 3GIYA 1ZJIA 3ZWTA 5D33A 1F76A 1LOLA 5AHNA 4MPQA 2BLEA 1KM5A 1C8VA 3V1PA 4O16A 2XN0A 1KFBA 3HF3A 1SO6A 3EX4A 3SY5A 3MO7A 3M0ZA 4UFIA 1FDYA 3PSWA 3OVRA 2CU0A 3WJZA 2BWGA 2ZCGA 1H7PA 2W79A 4MZ1A 3CB8A 1OFOA 3PBUA 5K9XA 3G1AA 5CPNA 1QCWA 1KA9F 1L6YA 4DPPA 3MMTA 2QCDA 3LXAA 3SIZA 1H50A 4UTTC 2OT0A 1KV5A 4NX5A 1LLWA 1W1ZA 3IGUA 4QIUA 4I9AA 3BGGA 3SW6A 4O14A 4BI6A 4K6AA 1TTQA 3PUDA 4PC8A 4GRSA 3QQ1A 3HGOA 4GWEA 1K02A 4WXYA 4UTWC 3B0PA 3UWQA 2V5BA 3R5EA 4Y9AA 2WSQA 1EP1A 3R2GA 4WD0A 1YLVA 1R2TA 5G2HA 3HB9A 3GR7A 3TK7A 3NEVA 3PC0A 4WZHA 3PBVA 3PF3A 4MOZA 4KFOA 1FCUA 4GUFA 3W7IA 1IXPA 2GQ8A 4J9JA 1OX4B 3VE7A 3LCGA 3ELFA 1O5XA 2RKXA 4KWWA 4CCEA 1A5BA 2B7NA 1YXDA 2CWNA 2YW3A 3L0KA 1KV8A 3C6CA 4RZ4A 3DI1A 3GDKA 4JTJA 4NJGA 2ZRUA 1OX6A 4NU7A 3DKLA 2QCMA 4GJ1A 2RH9A 1TCDA 2QCEA 4C1KA 4UFHA 4MY1A 3D0CA 4AEOA 3CWNA 3LCWA 4PCFA 3S1WA 1SZEA 4UMCA 4RR4A 3LTYA 5HULA 2CLOA 1OFBA 1TMHA 3BV4A 1K03A 1P5BA 2Z0IA 3TC6A 3LRMA 4ZQOA 1S5VA 3NQ7A 1EP2A 1A53A 3L5LA 4A29A 2FDSA 3SGUA 2DZXA 4LWWA 5DBUA 1H1ZA 3TROA 4ORMA 3S0CA 2WNQA 1VQTA 3GLCA 4CCCA 1F6PA 2ISSA 4OQVA 2YFOA 3N34A 3S1VA 1KM2A 1UUOA 3LV5A 3FKRA 5D2WA 3QSTA 4UFKA 1UCWA 4N02A 1FWTA 3T44A 3W73A 3KRSA 1H5YA 1ME7A 5EA9A 2ZQ0A 3UWWA 1NEYA 4JTUA 3ZR4A 5U4NA 5AHFA 1FXPA 5HINA 1YTDA 2AGKA 4JS3A 4EF9A 2YPIA 2VELA 1JRCA 4WUIA 4XUGA 3NR0A 5SWUA 1SZGA 4H6KA 1XUUA 4LC8A 3UXDA 5LNVA 1NVMA 1GOXA 1A50A 2YCEA 3LCFA 1X1ZA 3G0XA 3LHVA 1XKYA 4ZQNA 3G18A 3LB0A 1AW2A 4MVAA 1KTBA 4BR1A 5D2YA 1YYAA 2ZRWA 3LLFA 5D09A 4JTEA 2VFFA 2B7PA 1G69A 1OK4A 5BNKA 3G1FA 2QCFA 2RHGA 1GPWA 4FB7A 3QW3A 4RZ6A 2NLIA 2Y62A 3QMRA 1EPXA 4ZQPA 5G2IA 4JXCA 4OT7A 2IQTA 4S2CA 1Q6RA 3KAOA 4OU1A 3P74A 1F2JA 4UMAA 1FDZA 3OIXA 4KFPA 4NUWA 1O95A 1PV8A 1WDWA 2I9EA 2FIQA 2HS6A 3ATZA 1EUNA 3L67A 1LP6A 1T0OA 3EXSA 3W1TA 3GXNA 3HOJA 2PURA 5CZ0A 1OX4A 3EKLA 5BW6A 4LVAA 5DLCA 3N14A 2XFWA 4XZ9A 3NPWA 4JIQA 5CSSA 3HGJA 4UR7A 3HG5A 2JKPA 1VGAA 1JCJA 3N9RA 1W5QA 1W3IA 3W7DA 5D2VA 2YGYA 4K7YA 4XKYB 1SR9A 4LUJA 1KBIA 4XWUA 1RQBA 3GDLA 1TPB1 2DZPA 2RDUA 1OYBA 1KFLA 3KVLA 3KOFA 7TIMA 1H7XA 4A2SA 1LCOA 2CLIA 5DELA 4JY9A 3HQ1A 1ZY9A 1JCLA 2EHHA 4JN6A 3M5ZA 1WBHA 3W2LA 3E96A 1OFQA 4HT3A 4N9DA 3QZEA 3O16A 5L6UA 1ZAIA 4X2RA 3N9SA 4ORIA 4MLRA 1D3HA 2ZZ3A 2ZRYA 2ZDRA 2CLFA 4HHPA 2J6XA 3P81A 3LRLA 2X1RA 3QF0A 3SI9A 4JX5A 3P61A 2FPTA 3NAVA 3PS7A 2C15A 4G1KA 5LNSA 5FF7A 1GEQA 3CTLA 3NM1A 3MBDA 4MKNA 3VI2A 3BARA 3B8DA 3TU9A 3B03A 5C54A 1DVJA 3H53A 4XTIA 2ATSA 5D05A 2JK2A 1QNVA 5DCBA 1YPFA 4WX2A 3V75A 3RFAA 3EX3A 3EWYA 3MI6A 3EXTA 5CSRA 3M6YA 5D04C 4A2RA 5EKYA 4N4PA 4NNCA 1KM6A 3UWYA 3M41A 4NXKA 3PAJA 2C16A 2ZZ7A 5K4ZA 3W7CA 3MHGA 3PBWA 1DV7A 3SSJA 5DXYA 3TW6A 1OFPA 3PR2A 3WFAA 3OVQA 5DCDA 4O1CA 4Q4KA 3O8AA 4M7TA 5TBOA 3DFQA 3GDTA 2Y70A 1TJRA 3NQMA 4Y96A 1ICPA 3H55A 1SO5A 1SQ7A 2X30A 2FB2A 5H2ZA 2C3ZA 2V2DA 3G3MA 4EOUA 3BK0A 3NQ6A 2C6QA 2D73A 3L9CA 3IV3A 4FNQA 5F4XA 1LRQA 2PRHA 1O60A 3W2MA 1X8FA 1F73A 1W3TA 2CLLA 1W56A 3QPZA 3TSMA 3FEMA 3G22A 3L21A 2GVJA 4XKYA 1JQXA 4JTIA 4AAJA 4GUHA 4NJKA 1VC4A 3NQDA 3UQNA 1TTJA 2GQAA 1IXQA 1VJIA 3QMTA 3BG9A 1LRNA 3S42A 3GKFA 3T4CA 3GDRA 1XFBA 3L65A 1AG1O 3LI0A 3B05A 3G1SA 4ZQCA 1UBSA 4ZVJA 4PTNA 4D2JA 1JJKA 4PL1A 4UR8A 5LZLA 2J88A 1DQWA 2ABBA 3NM3A 4LNYA 3U8GA 1F6KA 1OG0A 3UYCA 2G95A 3QMSA 3U2OA 2VEPA 2YSWA 2X1TA 5DY2A 3C3NA 3M5YA 3HBLA 4O4WA 1RPXA 4UTTA 4K36A 4FHAA 4LRSA 3W1NA 4K7VA 3DI0A 4JDBA 3C56A 2Y88A 1TIMA 3S6DA 1W5MA 2DJLA 1G4TA 3LHYA 4JYDA 3TC7A 2QCDB 2QKFA 3Q94A 3STCA 2OZ0A 4UTWA 3WK0A 3W84A 3DFSA 4DO4A 1N7KA 2R14A 3IGXA 4O0ZA 3NQGA 1H62A 4R34A 3W2NA 1ZAJA 2ZRVA 3W83A 3R89A 1TV5A 3W7PA 1EX5A 2CLKA 1SW7A 3DHDA 3NPXA 1IIGA 1WBJA 3LTPA 1TB3A 4O17A 4TO8A 4RCXA 3W76A 4Q32A 1SZNA 4O1AA 4DO5A 2W6RA 2Y61A 4IXXA 3W2UA 1CI1A 4LY8A 3KRZA 1GG1A 3GKAA 3SJ3A 1ICQA 3TXZA 2A7RA 3MYPA 5DXXA 2I1OA 2YZRA 4BI5A 2CW6A 1AW5A 4K37A 5I3GA 1E51A 4LVDA 1KFJA 4H4IA 2JKAA 1GG0A 2VC6A 3JRKA 1D9EA 1X1OA 4M5PA 2ZZ6A 4LT9A 4U28A 4GXMA 4M6PA 1H7WA 2NV2A 4UCGA 4EF8A 4TMCA 2E5BA 1F05A 3LLDA 1I45A 3OEXA 3LI1A 4N9CA 1ZENA 3BPWA 4UUIA 4LTSA 1SFJA 3PB2A 2GVGA 3F03K 4IMFA 4XBSA 3RU6A 1CX9A 1SPQA 1GVFA 3MYOA 1GYLA 5HWMA 4Y90A 3CWOX 1LBFA 1FBAA 2E5CA 3G1XA 3N2XA 3QH2A 2DORA 1JUKA 2E77A 2DZTA 4PA8A 4O53A 5I3KA 3TNOA 4IJBA 3TAKA 1H7RA 2H8ZA 5BMXA 1TRIA 3A9IA 2Z6IA 3TW7A 1JUEA 3BVJA 2Y7GA 3W2KA 4LUIA 4R33A 3EX1A 2A1YA 3NXFA 1EB3A 4S2BA 1FUYA 3TMLA 1JULA 1ZFJA 4UXDA 1LROA 1ZAHA 1HUVA 4O4VA 2RDWA 1Z41A 2NXGA 3BW4A 2B4GA 4ADSA 1TTPA 4HSNA 4JR5A 3MP3A 1S3HA 1N8FA 3KX6A 4UTLA 1QFEA 3DFOA 4JNMA 4UTKA 3STEA 3LV6A 4IX2A 2QUVA 3VE9A 3TX9A 4K8HA 2PRLA 2ZFAA 4UFJA 3W7MA 2PC4A 4Z1AA 1LTDA 3GZ3A 2DZVA 1MEWA 3PBYA 2AQWA 3CIXA 3TSDA 4IUOA 4CQAA 5BMWA 4QISA 2CLHA 2TSYA 4PFMA 3IVUA 5D02A 4LU0A 4BWLC 1WOAA 3QQ0A 3CEUA 4NJIA 4UTIA 3W87A 5I3FA 4FNSA 4DF0A 4AVFA 4HNTA 1IXOA 5GVJA 4FNTA 1XI3A 3LCXA 3TMQA 2P1FA 4EWND 3I68A 3P67A 4N9BA 1VPXA 2QAPA 1Z44A 1TV8A 3STFA 3CLMA 3JR2A 2J9ZA 3BG3A 2V9DA 1I8JA 2HS8A 4TU1A 4K8EA 1OVDA 4MUZA 2B0MA 3NVTA 3USBA 1YDVA 3C2RA 4M19A 4TIMA 5F2GA 2GOUA 1WXJA 4JTHA 1XBYA 4P61A 1JCNA 5L9FA 2VENA 1BWKA 1EEPA 4YCOA 1LYXA 3I7QA 3DU0A 4BF9A 5FF4A 2YR1A 1GVQA 3O6DA 4LS2A 2EPHA 3S5NA 3O05A 3NNTA 1SW0A 3S5OA 4DF1A 2JKEA 2A6LA 4BI7A 3CEPA 4EIVA 3M5VA 5G1YA 3HG2A 3L2IA 4UMBA 4IPIA 3ZFHA 1LZOA 1TPWA 1YTKA 3ABQA 1A5CA 2GUUA 1WYIA 2H90A 4DBEA 1G4SA 3W72A 2R91A 4C1LA 2ZTJA 4MY8A 2F84A 2JBMA 3ABRA 3LRKA 1PCKA 4JGDA 3P5ZA 4AH7A 5K3VA 2QDGA 3P7YA 2QCCA 5KZEA 3GXTA 3M5XA 3N19B 4YWIA 1KFCA 5FESA 1HG3A 4E2DA 2VFHA 4MZYA 3CHVA 5CZJA 4RJEA 1O5KA 1V5XA 3C52A 3NYZA 1KBJA 2NX9A 5HUOA 1I2NA 5G1TA 3WK2A 3M9YA 3PY2A 3FA5A 3RLVA 2Y63A 2GQ9A 1TPEA 4NXSA 5AN7A 4JX4A 4O57A 2HSAA 1GJPA 3JS3A 1OF6A 4KKXA 5C55A 4L4MA 5FF2A 3HG4A 2VEIA 2QJIA 3W70A 1FQ0A 3W7LA 5F4SA 3PG8A 5U7SA 4N6FA 1TPC1 2G97A 5LGZA 5ABTA 2QJHA 4XQ6A 1BTMA 3QJAA 3FOKA 3W7OA 5TQLA 1QOPA 1LDCA 3GAKA 1TTIA 3S5ZA 2OT1A 3F4NA 3MP5A 1UUMA 5CPMA 4Y8FA 2X16A 3B04A 3SGZA 5DN1A 4UC5A 3TFCA 1SW3A 2RDTA 3LOTA 1SO3A 4FO4A 4JTTA 1V7YA 4WQ6A 4FNPA 2JGYA 3CIWA 3NQ2A 4O0KA 3L0NA 1H60A 3SZ8A 5D38A 3W1AA 3EKZA 3C61A 1AK5A 4TX9A 4ZMGA 1EP3A 1RVGA 2J24A 1OFRA 1ZHAA 4PL2A 3G1DA 1LBMA 4JEQA 2VFGA 3EB2A 3W22A 2ISVA 3NQCA 2FTPA 3TH6A 3HMJG 5K9CA 3EWBX 2Y85A 2ZZ2A 2XN1A 2FLIA 2FJKA 5K4XA 4JYFA 4OHQA 1TSIA 4FX7A 3BLIA 2CZEA 4JTKA 3HGSA 3VNDA 4LC6A 3DBPA 3UZ5A 5D03A 4N9EA 4LVBA 4RXGA 1QWGA 3NA8A 1ONRA 2BZNA 4MYAA 3C2VA 3NQEA 4AHOA 3DFPA 4UIOA 3CPRA 3P84A 2VFDA 3FKKA 1KW1A 5C6MA 5EPDA 3L66A 4HNUA 2J9YA 1P1XA 3KRUA 4M7SA 2YFNA 4FEZA 5CG7A 3DXIA 1F5ZA 1AW1A 3BO9A 3EX2A 4ML9A 1OJXA 3NOEA 4N6EA 2PE4A 4LS0A 1LLZA 2FFCA 1RR2A 5E1QA 4YXGA 4UFLA 4MLJA 4JTSA 3PULA 1KLZA 3F1QA 3QFEA 2J9XA 2WSRA 4AWTA 5HR7A 1TQJA 1BEUA 3UWZA 3ATYA 1FCBA 2WOQA 2WPBA 3M44A 3FYPA 1EUAA 3N3MA 4NZFA 2A2IA 5HUPA 1YTEA 1EA0A 3IVSA 2ZBTA 3EWZA 5K7JA 1WX0A 2QAFA 1GVRA 1I2RA 2E6FA 4RLIA 4MZ8A 3M7WA 2VOMA 2CFFA 1C29A 3W1PA 1T99A 3B4UA 5LNRA 1HO4A 3UZJA 3IIVA 2NUWA 2NX3A 5EL1A 1Q6LA 2ZRZA 1B4EA 1U5JA 4MIMA 1J4EA 1Q45A 3E0IA 3P80A 3HG3A 4KWVA 2QF7A 3MHFA 1M5WA 2NZLA 1ML1A 3A5VA 2QUTA 1NSJA 4S1FA 1K8XA 5I3IA 1H1YA 1M7OA 3C8FA 4R53A 3VCRA 5AB3A 3W88A 2QCGA 3LXBA 5F2LA 4JTLA 1RQHA 1L6SA 3RLUA 3T55A 5G2WA 1Q6OA 3TQVA 4JY8A 3UD6A 4UNLA 1JR1A 1MEHA 3TAOA 3EWWA 2VKZG 1H63A 2VFEA 3W7JA 1AMKA 5D37A 3GR8A 3DZ1A 3C0JA 2E6YA 2WNNA 4IX0A 1VLIA 1RD5A 2Y6ZA 2YX0A 5A5WA 3K30A 1HL2A 1GVSA 3LDVA 4LS1A 1TPFA 1QR7A 3G1HA 3O6CA 4Z08A 4GC4A 1TJPA 3L68A 4QJ1A 4N2YA 1G7VA 2C19A 5EMUA 1O94A 1LM1A 2DU2A 2NUXA 3U6WA 2Q8ZA 4FX8A 1P0NA 1VHCA 2QEZA 1TPDA 1KM1A 2GPTA 1IF2A 2QUUA 3KVJA 3NQVA 5FEZA 1RV8A 3W1QA 1GT8A 5AHIA 1G6CA 1S5WA 2WKJA 1NF7A 2WO5A 1R2RA 8TIMA 3HPSA 4DO6A 1SU5A 3FYOA 3I7RA 3CM4A 2C13A 4IPJA 3CT7A 3GDMA 3W7EA 1EIXA 1DQXA 2E1DA 2CZFA 5K9DA 1W5NA 4JDYA 3DAQA 2YW4A 3PUEA 3AJXA 5AHLA 3I65A 1DOSA 2HMCA 1G4EA 2E6DA 4POCA 3L5MA 4E2BA 3G1YA 3GNDA 1W54A 5HR6A 3EXRA 5F2IA 3NO5A 2QCHA 5C2XA 2TRSA 1QPNA 1TQXA 4HSOA 1NF0A 3W7HA 1N55A 1XL9A 4JX6A 1VYPX 2HTMA 3THQA 5KITA 4FXRA 3LHTA 3TCEA 2O7SA 5AC8A 1R30A 3QW4B 2V81A 1SSGA 5LNWA 1OF8A 1OHLA 1W31A 2NWRA 3TFXA 3BG5A 1HFBA 2YYTA 5AYZA 3R12A 1JCXA 1GYNA 3EWUA 4O11A 5LGXA 3P8IA 1CW2A 4K38A 5LHFA 5EYWA 1Q6QA 4UTHA 3R13A 1U83A 3DHFA 1FY6A 4IMGA 1G4PA 4DF2A 3BGJA 5CKSA 3M43A 2Y7DA 3ABSA 4Y6GA 2WQPA 5HQEA 4O8RA 4Q33A 4DPQA 1FX6A 2DZUA 4PODA 5FI8A 3W7KA 3G1VA 3WJWA 2EAWA 2R8WA 5LHEA 2BSLA 1ME9A 2X1UA 4U4MA 5D30A 1XDMA 4UFMA 5KMYA 3W2JA 5K2ZA 4IOTA 4ZQRA 1QPOA 1B9BA 1TV7A 3TUUA 1UASA 2PCQA 4QAIA 2V82A 1R46A 3A22A 3R8RA 4I7VA 1FDJA 4E0CA 4M6QA 1HTIA 4O50A 3IIPA 4Z0SA 1FWWA 2G5WA 5FEWA 1Y0EA 3L0GA 2GJNA 3OG3A 5LNUA 1YDOA 3LBCA 1PL9A 1PE1A 3LGEA 4HPJA 1GWJA 1WOBA 1H51A 3ZS4A 2XN2A 3S9YA 4TR9A 3TE9A 3GB6A 1OABA 1BKSA 3N2MA 4HNNA 4DXVA 4HIBA 1K7EA 4Z1DA 4AMAA 3TDFA 1QPRA 1OFDA 2O7QA 4OV4A 4CQ8A 1GZGA 4MJZA 4FIQA 1XDLA 3WJYA 3M47A 3G8EA 5IM51 4PEKA 3MP4A 3TA6A 4O13A 1TYGA 1EWEA 5CZSA 3TIMA 3GK0A 3W1UA 4HN4A 1KFEA 3MUXA 3HJZA 5HJLA 3IIOA 1UJPA 5D2TA 4X22A 2QCNA 2WSYA 4IGHA 1J2WA 3W7NA 3W71A 1LOSA 4O10A 3DFTA 4ZZ9A 1K7XA 4NQ1A 2B7QA 3RNDA 3BLFA 5J5DA 2RFGA 3TV8A 4IMDA 2YDAA 3O1NA 3FJ6A 5A8GA 2OX1A 3STGA 2OJPA 3NZ1A 4O19A 4HPXA 4QITA 4HKPA 1FCQA 1Q3NA 4LV9A 3PSVA 3QC3A 5E0KA 1GVOA 4Z0JA 3WJXA 1JVNA 5G4WA 1TPH1 3O07A 1GTHA 4FNRA 1KFKA 1QAPA 4LVFA 4GUGA 3DH7A 3TQKA 4DELA 2NXHA 4Z1BA 3KXQA 3DENA 3E9AA 5BOOA 3OA3A 3NGJA 1A5AA 2C18A 3EEGA 1OFAA 4JYEA 3FS2A 2Q8LA 4OE7A 1XBZA 3RF9A 1C9DA 5F1UA 5AOUA 3VKJA 2EKCA 4LOCA 3MJYA 4QSHA 5DY3A 4XBKA 4OWGA 3Q37A 3UPWA 4NNBA 1YPIA 3CQ0A 2A7NA 3CC1A 5LSMA 2B7OA 3NL6A 1NAL1 1X7FA 3DKJA 2JGQA 1OK6A 4CNOA 4LVGA 4NZJA 5AFDA 2Y89A 5CPLA 2DJXA 1MXSA 3KVMA 2CLMA 1SFLA 3BW2A 5FEXA 3BLEA 3A23A 5KINA 2ZRXA 4RKAA 4GUIA 4R7JA 4XTDA 1XBVA 3NQFA 1DHPA 1K8ZA 2E09A 1DL3A 2H6RA 4GBUA 1QOQA 3NL2A 1JRBA 1G7UA 1FXQA 3O6YX 2NX1A 1MSSA 1L2UA 1M7PA 2Z2UA 3W07A 3LHZA 3B06A 3NL3A 3M16A 4AWSA 3MW7A 3O63A 3QEZA 3PB0A 2GJLA 1KTCA 4UTUA 2ZZ5A 3LCIA 3YPIA 2BXVA 1OYAA 1P0KA 3LCHA 4K39A 1W0MA 3I7SA 4IMCA 4RZ5A 5D32A 1XXXA 5IBXC 1LORA 4WXZA 2OMAA 4O52A 3MBFA
chains in the Genus database with same CATH superfamily
3IGHX 1JCYA 3RM4A 1EFZA 2DZSA 2VC7A 3V0TA 3GAYA 4WY0B 4RXFA 4NYYA 1HL9A 4HZ8A 5C5YA 4KRZA 4PH6A 3KWXA 5HJYA 4CQ9A 1HGWA 1XKJA 1FWRA 3DX5A 1UOKA 5CZTA 1OCNA 1IXNA 2WWDA 2J4GA 1MUMA 1UR3M 4DQWA 4IIBA 4B3LA 2BHZA 1GORA 1GUVA 1NM9A 4WOQA 3VGDA 5LIXX 4Q8NA 1RA0A 3RCMA 1TR9A 3ZLGA 2ODOA 4C6NA 3CAKA 3FIGA 3JUGA 1F7BA 5AYYA 1IGWA 3N6JA 4UNKA 3A4AA 1VBHA 1EHNA 3FSUA 2KZHA 2NSOA 3H8AA 1RA5A 4OBSA 4MWAC 4I9TA 3OG2A 3E02A 2A7PA 1XQLA 4FXSA 2QJNA 2CZDA 2DW7A 3P60A 4R7OA 3GU2A 1JAKA 4HPGA 1YPXA 3ZSSA 1MQRA 3ZT5A 5CGMA 4G7EA 5IFTA 1P4CA 1CGWA 5I07A 3MI3A 4EANA 2OGYA 4LW7A 2V2CA 2VEKA 3QN3A 3E2RA 5JXQA 1W1PA 2CKSA 2I14A 2OSXA 2I5IA 1B57A 1T41A 2BB0A 4RDYA 4V2XA 2Z7KA 4NILA 3TYUA 2GK1A 3WK1A 1Z7AA 3KZSA 3SN0A 1ADOA 3H26A 2NV1A 3HTWA 1DXFA 2V69A 2ZYFA 4XZLX 4F9JA 1W9BM 3F4VA 4IMAA 3KCLA 2W0UA 4A22A 5FJIA 4JPGA 2Y7EA 3NVDA 4Q4SA 3HO8A 2Q3RA 1QPQA 4QNWA 2XVLA 5KZDA 4JQ3A 1KXQA 3GQYA 3G3DA 1E9LA 1VLWA 1QI2A 2V0TA 1W37A 1EF3A 4AYGA 1QDSA 2E8ZA 1GK8A 3C4UA 3UWUA 4WJXA 2TMDA 3F5LA 1EJVC 1GQLA 4GNJA 2EKGA 1I2QA 1H7OA 3LBMA 1Q6FA 4MY9A 2VOTA 2HDJA 2E7FA 4HJFA 4C1NB 4AZ6A 4GFSA 2O92A 2G4JA 2QGYA 2F2HA 1YE6A 2DSWA 2P8CA 4LSBA 1P1MA 4HP5A 1PHQA 4MYXA 2NWSA 1E15A 3K46A 1P6CA 1IZKA 1HZYA 3EDFA 2G41A 3U5UA 2IPGA 4WSHA 2O9PA 3WO8A 4KERA 4PCTA 4AMCA 1YXCA 4LALA 1M03A 3S8HA 3H54A 2BDQA 7CGTA 1N8IA 1WV2A 5I3HA 5G5IA 3UXKA 2F7FA 5XIMA 4EXAA 1W3NA 3TR2A 4UTFA 4B4HA 2GGGA 4W9TA 3CU2A 3UW6A 4AZ7A 2P8BA 2PDWA 2C1HA 4J28A 2BVYA 1JXKA 2GGIA 4KIRA 1R2SA 4L61A 3QM3A 5FF3A 1W1A1 1XPGA 1I4NA 4QS6A 1K9DA 2ON3A 3BW3A 1E3XA 2OWXA 1UD4A 2PRMA 4N4QA 1W8SA 4DUOA 3WBEA 2FFIA 1RAKA 4GUJA 5AZ0A 3MZ2A 5F7UA 2XGZA 2ZADA 1E6XM 1F3WA 3O0KA 4NRRA 3PPGA 2Z4GA 3ITLA 4GGHA 4DY1A 2WM1A 2NQJA 2WPGA 3W01A 1L0PA 3WEMA 1ZCOA 3V3WA 3GG8A 4C6EA 4FS9A 3T08A 3AIUA 4NZ1A 1C8XA 3K8KA 1HJWA 1BKHA 2A6NA 1X7IA 3MI2A 3P0XA 3E12A 3EDDA 3WEOA 2PMQA 5F1VA 3CK5A 1TPVA 3DYPA 1F8IA 2WVTA 5FL1A 3LUTA 1I2OA 1AMYA 2CYGA 4K2SA 3BSGA 1DJHA 1PS9A 4HVXA 4F66A 1I2PA 3L4XA 1X97A 3IRSA 4WVXA 1F61A 5KTLA 1S5NA 2X40A 3HIJA 2VRJA 2W91A 1O4UA 3WF3A 3L2MA 4TVUA 4LAMA 1XGEA 4RDZA 1QATA 3S3GA 2Z7GA 1YX1A 5DCEA 1NDZA 2A5HA 4HNVA 3GX9A 1F74A 1LWHA 2H3DA 2V8ZA 1S5TA 3A5FA 4F0HA 3G2GA 2V2HA 3PPHA 3JVAA 5E6YA 4X9SA 4A3HA 2EPLX 3TJLA 4FZIA 1Z48A 1HGYA 3MUZ1 2FPYA 3M7SA 1ODZA 3UERA 4NF7A 1S2UA 4I8YA 3MY9A 3STPA 4AHQA 3W86A 3DGBA 2C0AA 1MZRA 2E68A 4WJEA 1J6OA 2IKHA 3BLOA 2GOKA 3P82A 2DT3A 5TNVA 2ASHA 1PTAA 3ZWTA 1F76A 1LOLA 5AHNA 1J10A 1KM5A 4S3CA 3HF3A 4GQGA 3MO7A 1XIEA 4K1WA 4UFIA 3WJZA 4AIEA 1SR0A 2HISA 1U2YA 2W79A 4KETA 1OFOA 1VAHA 4XAFA 5K9XA 4UQDA 1UWAA 3GTIA 2BP1A 5CPNA 1B30A 4F2TA 3SIZA 1KV5A 4C6PA 1LL4A 1W1ZA 3TJIA 4I9AA 2W61A 3BGGA 4M29A 1U1JA 3PUDA 3VFCA 3ARRA 2HE5A 4PFHA 3ITVA 3BXWA 3AFBA 1TV3A 3B0PA 1A49A 4Y9AA 1EDGA 1EXBA 3H22A 1EP1A 3WFLA 4AD4A 3TK7A 4AU0A 3PBVA 4KFOA 1MFVA 1V6TA 3F2BA 3S9IA 3C2YA 1OX4B 3CT2A 3CMFA 3ELFA 3AIRA 2EO7A 4KWWA 1A5BA 4S3DA 1YXDA 2CWNA 3R7MA 4Q8UA 4NU7A 3QR0A 5GQBA 2OLSA 1V02E 1FH7A 2OG9A 3LCWA 3WLKX 4TUFA 1DYSA 1SZEA 4UMCA 3BDKA 4Q8OA 1EJRC 4L9ZA 3NSNA 2P3ZA 1C7TA 1U33A 2DUXA 4L65A 4ZQOA 4Q4RA 2O0TA 4ICCX 2FDSA 3TN3A 5DBUA 4ORMA 2ZXBA 2KAUC 3S0CA 1V3HA 1E71M 1VQTA 3IARA 1F6PA 7REQB 2XYLA 4J1OA 3N34A 4AY8A 3MS8A 1V8EA 3A4WA 3LBOA 5HAOA 3MVIA 4PMYA 2QPUA 5JMUA 1VBUA 3U0HA 5AHFA 1YBQA 3WELA 4GJJA 4J3XA 1XIBA 2WANA 2QUMA 1QPKA 4JS3A 2AGKA 3P2VA 3N6QA 4XUGA 2J25A 3NR0A 3VTRA 3ZVHB 4NI3A 3SCVA 1GCYA 3ARUA 2YCEA 3QR1A 4HNOA 1X1ZA 3G0XA 3VOCA 3ZM8A 2VZTA 4ZQNA 1MRQA 3LB0A 2ZRWA 2X8RA 3A4JA 1KQYA 2BODX 2VFFA 1EL3A 1G69A 1F3EA 3QW3A 2NLIA 2Y62A 4U31A 5BRQA 1EPXA 3ZT6A 4OT7A 2IQTA 4S2CA 4C6FA 3MUCA 2Z2AA 3P74A 1CDGA 2Z24A 3Q65A 7XIMA 4HJWA 1S2CA 1LP6A 3TOPA 3EXSA 3M0YA 3BH4A 3HOJA 2WJEA 4M1BA 3VIIA 1EKOA 5CZ0A 3CUJA 4LVAA 2YL8A 1PX8A 1XIGA 4DXKA 2Q8XA 4UR7A 3TCSA 4AWEA 3AIVA 3IAPA 2R1KA 2O4QA 3MMDA 4K68A 3BLKA 4ZEPA 1W3IA 3W7DA 3QV6A 1A0CA 4LUJA 4YPJA 1FVPA 3W25A 1RQBA 1UR2A 1AZ2A 4IUGA 2VX5A 3KOFA 4KW2A 4HU3A 3GIQA 4A2SA 1LCOA 2CLIA 3G77A 5DELA 3G1RA 3DECA 3L4TA 1JD7A 4NP7A 1ZTVA 4JN6A 1NFGA 3E96A 1OFQA 4N9DA 2PSNA 5L6UA 4JAWA 4MJ4A 4GQQA 4KEZA 2CITA 4ORIA 2CZVA 4MLRA 1TUFA 5ECVA 2ZRYA 4HHPA 1V6YA 2X1RA 4AY1A 4PTXA 3W38A 3WKZA 3R79A 4ZE4A 1CECA 2FPTA 3NAVA 3B97A 3AMCA 3NM1A 1NQKA 3B8DA 4RE2A 4LF2A 4AC7C 3TU9A 3B03A 3LK6A 5C54A 4XTIA 1EQPA 4UBPC 4C6MA 4BY3A 1QNVA 4GO9A 3PWIA 5DCBA 1YPFA 3RFAA 3EWYA 3BCDA 3F4CA 3IK4A 2DVXA 4IIEA 3M41A 4NXKA 2HQAA 2OYLA 1BPLB 4HBKA 1ODUA 2ZZ7A 4MNJA 5HNUA 2V5JA 3MHGA 3TW6A 3QY7A 4B5SA 4UQ9A 5I00A 3PR2A 1TJ1A 1J0JA 1E55A 3OVQA 1OCBA 2J7BA 4M7TA 5TBOA 1ZSXA 1U5HA 4H8VA 1TJRA 3NQMA 2WB5A 1SQ7A 4CEXC 5LIKX 5H2ZA 2FB2A 4B90A 3DG7A 3KW3A 2DUZA 3G3MA 4AIUA 3BK0A 1QHZA 2D73A 3IV3A 3FK4A 5BROA 4FNQA 1Q66A 1ECQA 4TTGA 1KRCC 1X8FA 4PUKA 1W3TA 2CLLA 4WCJA 1W56A 3FEMA 3L21A 5C0QA 2GVJA 4ICMA 3ZOAA 4NJKA 1PX3A 5M3WA 2ZVRA 4DBWA 1CB7B 4R88A 2EG6A 4HCHA 3S42A 3T4CA 1M9HA 3GY1A 3GDRA 2ONEA 3H2CA 2REQA 4QFUA 4X60A 2P53A 4QG6A 1QASA 1WXYA 5GNYA 3WQ4A 1DQWA 2BOFX 3B4YA 4KF1A 3NM3A 4PSRA 3PPFA 3TN5A 2G95A 3GC4A 3QMSA 3CMGA 2I56A 2BVTA 2X1TA 2D22A 1RPXA 3WQOA 4UTTA 4FHAA 1G4TA 2HXTA 2JE8A 4RUBA 3W84A 4DO4A 3IUDA 4PTWA 4IFOA 3IGXA 3SBFA 4D8ZA 3PZUA 2DT1A 1A5NC 2Q01A 1XIDA 2ZRVA 2YCIX 4EWJA 1TV5A 3W7PA 3CV2A 1EX5A 4UOZA 1TA3A 4XKMA 1E73M 3UCCA 1IIGA 1WBJA 1TB3A 2V67A 4O17A 4PCPA 4GYPC 4IQJA 1B3WA 4PRTA 4HN8A 3CB3A 3KS6A 2YOCA 3W2UA 1DE6A 1UH2A 1QWKA 1B3VA 2I1OA 2WQDA 2YZRA 4BI5A 1AW5A 1GEHA 4K37A 1KFJA 3QZAA 4INFA 1GG0A 2VC6A 3JRKA 2XISA 3W82A 3GVRA 1P48A 4WGXA 4U28A 1V79A 2CETA 3IJQA 3OQ8A 1F05A 3UPMA 3LLDA 4N9CA 4XBSA 4W8AA 1GVFA 3GW3A 5HWMA 2D0FA 3E74A 1LBFA 3G1XA 3QH2A 3N1AA 4B9YA 3CZLA 2GLKA 2DZTA 2R1PA 5KEZA 1QBAA 4P7LA 1R9YA 3UXLA 3NCOA 5I3KA 3GSMA 1GOWA 4C60A 4HGXA 3TAKA 1F9CA 1KWKA 3TW7A 4WKHA 3I4EA 3IJLA 3UZZA 1WDPA 1Q7QA 3QLDA 1FUYA 2IW0A 1JULA 1W1TA 1RVKA 3TYAA 4R3UA 4LAKA 1V3KA 5FA5A 1JNDA 1EHAA 3MP3A 1S3HA 4ASTA 4KGLA 4IX2A 2WLYA 4U5KA 1E6NA 2RGMA 2ZFAA 3RITA 4EAMA 3CL7A 2PLCA 4JIRA 1V51A 4KCVA 3N2OA 1GOKA 3CIXA 4QDPA 2VZUA 3H2AA 1O7AA 3ANVA 2VTFA 3IVUA 5D02A 3ARPA 4KT2A 1XW8A 1G94A 1WOAA 3R25A 3I3BA 3E5BA 2XSAA 3H2EA 3QQ0A 3CEUA 3AQUA 3W87A 5I3FA 3U5YA 4DF0A 5EMMA 1BFNA 4KBXA 1E6SM 3LCXA 2P1FA 4EWND 4ZGYA 3P67A 1IT7A 4N9BA 5CAKA 5TAOA 1VPXA 4R5EA 1VFUA 2J9ZA 4DZAA 3BAYA 2VCBA 2O9OA 4K8EA 1HKWA 2B0MA 1YDVA 4JTAA 3C2RA 3NUKA 4M19A 3T8QA 5BZAA 1WXJA 4JTHA 2W27A 3PP7A 4G1NA 1GZ1A 4ZOEA 1BWKA 1EEPA 5T8GA 3BLPX 3MCMA 5FJRA 3FN9A 1ADSA 3OZOA 2YR1A 1UJQA 1V93A 2EPHA 3IACA 4IPLA 3WMBA 1X96A 2PFHA 3V4BA 4KCTA 2PWDA 4Z2GA 3SRHA 2UWFA 3UG4A 2JKEA 1W9XA 2A6LA 4LEFA 1K6WA 4MB3A 3ZR5A 3ZJ7A 4Z2LA 4AYSA 4UMBA 3AYVA 2CBUA 3VMPA 4H7CA 4LCRA 1LZOA 2YA0A 3DC0A 1G4SA 3W72A 2R91A 4XZIA 2F84A 5M03A 2YCLA 2ICSA 1TJ0A 3U3HA 1EJUC 2NT1A 5K3VA 2QDGA 2QCCA 3CPUA 3N19B 1UW9A 1W2PA 4E3TA 1HG3A 4Y8EA 3QHMA 1WDDA 3AWNA 1UKSA 5CZJA 2QV4A 1VPYA 1O5KA 4MAVA 3RIKA 1JD9A 2ZX7A 2IPJA 1I2NA 1XIIA 4PGLA 3URBA 4F0RA 4NXSA 9XIMA 1FOBA 2HSAA 3KHDA 3CNYA 4W8LA 1QUMA 3DYMA 3MV11 5C55A 4KWSA 2WVVB 5FF2A 4Z42C 3CZJA 4LAOA 5HDRA 4NZ3A 3TN6A 1A5OC 4H7VA 2PB1A 2PDKA 3PN8A 2HVNA 5FJUA 2QJHA 3DIPA 1CLXA 3QJAA 5LA2A 3FOKA 4XIAA 2VR2A 1QOPA 1LDCA 2XIBA 2OT1A 3WDRA 1ENUA 5CBIA 1C90A 5DN1A 1ZP4A 4WQ6A 2XH7A 1IZCA 4JNYA 2WZIA 4O0KA 3IJ8A 3L0NA 1H60A 1MDLA 4M51A 5D38A 4TX9A 4ZMGA 1RVGA 1OFRA 5CBBA 3EB2A 3W22A 2FTPA 5EB8A 1PXGA 4B5UA 3VNKA 3WFZA 3EWBX 5EFDA 1KBBA 1RBLA 4ZXLA 2QV5A 1CWYA 2CEQA 4FX7A 3BLIA 4DYJA 2PD9A 1TE1A 3MMUA 3DBPA 3CAVA 3UZ5A 4N9EA 1C7SA 2AL2A 2PDUA 1PIGA 2ZX9A 3NQEA 1ZJAA 3LMZA 4NHVA 4AX7A 3FKKA 1LL6A 5C6MA 3GO2A 2YFNA 3DXIA 1XSIA 5D8ZA 3BO9A 4ML9A 4BKNA 2D2GA 3NOEA 2XWDA 4F8XA 1LLZA 1H49A 3ZZ1A 4MLJA 4HMCA 4JTSA 1US2A 1Q6DA 1KLZA 3WQ5A 3MVTA 2XVGA 1RUSA 5REQB 4XV0A 1OEPA 3MCOA 3E2QA 3A13A 5HR7A 3VIHA 2WPBA 1RBOB 3FYPA 1QBBA 2GJXA 4H8NA 1W3LA 2OSYA 2A2IA 2XU2A 4S3KA 3APYA 1CEOA 1KCZA 1A0DA 2CXGA 4JBRA 3DERA 3EWZA 4PMOA 5K7JA 1OBAA 3A3XA 2QAFA 4JHOA 1RJPA 1CGTA 3A4XA 2GDVA 3D47A 3V0SA 3PTKA 4XZMX 3ZT7A 1I2RA 5JBFA 2I7GA 4E5TA 1Z32X 2E6FA 2ZOXA 1T99A 5HMFA 1CBGA 1PPIA 3LQGA 5HMDA 3UZJA 1TVLA 4MIMA 1JCTA 1Q45A 4JFWA 1VIZA 1M5WA 4XD6A 3A5VA 2QUTA 4F0SA 1S46A 4C6OA 3KDOA 4S1FA 1W17A 2BXZA 1GQIA 4F0LA 3AS2A 4M6UA 2PF8A 5F2LA 2F38A 1DEDA 5ABFB 5ENLA 1E4NA 1IEIA 1EXPA 5A94A 3WH9A 1HT6A 1Q6OA 4GKTA 4F48A 1POKA 3NURA 3AC0A 3UJFA 3M0VA 5MF5A 4QEHA 5A2BA 4ZOAA 1XG3A 1VLIA 2WC4A 3ANUA 1QNQA 4H7ZA 3LDVA 1GVSA 4LS1A 3VKAA 1UIPA 3HQNA 2VGGA 3O6CA 3G1HA 3OVGA 3SY8A 4CD8A 4HYRA 1XYZA 3QYSA 1TWIA 3UG3A 2QYGA 2J7EA 3RMEA 2GPTA 1IF2A 2QUUA 1H3GA 2BXYA 3KVJA 2GDUA 1K70A 3URNA 1G6CA 4NIRA 3LPOA 3VIJA 5CBJA 1NF7A 2WO5A 4JCLA 1R2RA 1I0DA 1Q7MA 4DO6A 2C13A 3R11A 1V03A 4ZO9A 5K9DA 1I75A 2YJQA 5A8OA 1W5NA 2YW4A 5G1MA 5AHLA 3QGKC 3SRKA 1UWIA 3H2NA 4H83A 4IGMA 5HR6A 3U4AA 3RPDA 2QCHA 2W92A 2BY2A 1LQ0A 1NF0A 4HSOA 4W4QA 4JX6A 2VJXA 2OYKA 1MUCA 4C7DA 3K13A 3GWQA 4FXRA 2FHFA 2O7SA 1SYTA 1DJWA 3QW4B 2V81A 1SSGA 1OF8A 2NWRA 5ECUA 1HFBA 1QRQA 3N12A 3REQB 3UYIA 3GH7A 5AECA 3VNZA 1NQ6A 3MKCA 1XGZA 3GHRA 4QJ3B 1M7JA 1Q6QA 4UTHA 3VX1A 2PU0A 9RUBA 3DHFA 1FY6A 1EDQA 4CU8A 5CKSA 4Y6GA 1KGWA 2DPEA 2TAAA 3P14A 4L1GA 4Q33A 4V1YA 4DPQA 2Z1KA 5G4HC 4U2ZA 3WJWA 1UPPA 3K2GA 1ME9A 3K8LA 4J5NA 2J7HA 5D30A 4JFTA 5D9OA 5HPCA 5IFPA 2ZE3A 3EDJA 4O1FA 4I3GA 1QOXA 3P0WA 4ZQRA 1TV7A 1FHDA 1UASA 1V7AA 4QSFA 1R46A 3ITOA 3WLPA 4E0CA 4M6QA 3WYZA 4Z0SA 3MZNA 2G5WA 2X2YA 5FEWA 3HPFA 4D6HA 2GJNA 3OG3A 4M56A 1NDVA 4TTUA 3POHA 5LNUA 3HFTA 3AUOA 1PE1A 3LGEA 4IL2A 3EGJA 2VD9A 2BGQA 2XH0A 3GB6A 4RNIA 2GYIA 4ZB0A 5J8LA 1MW1A 1ZGDA 4U3CA 5I23A 2HBXA 4PBGA 2GVYA 4FXFA 1XDLA 1XIJA 2ZE0A 5IM51 4PEKA 3N13A 1XS2A 3UA4A 5IOBA 1F4HA 2D0GA 1EWEA 1P0DA 4GHRA 3HJZA 5HJLA 1FH8A 5D2TA 4X22A 4PB4A 4CQCA 4I6KA 2A3EA 4XO6A 3MUIA 3GIPA 9XIAA 4TQTA 2PI6A 4O10A 1K7XA 1Z8AA 3DESA 2PGFA 4XZBA 4M81A 5J5DA 2WZEA 2PLJA 1MWOA 2C8NA 2WMFA 3RAOA 1MUWA 1EZWA 3O1NA 5A8GA 3NO3A 4D1IA 3STGA 2OJPA 2J79A 2WJFA 4HPXA 3FAWA 4HKPA 1Q3NA 1ONEA 2Q02A 3FCPA 2EJ1A 5G4WA 3PZIA 3BANA 1PWMA 4K3ZA 3I3DA 4LVFA 2UY2A 4GUGA 1OT2A 3WLQA 3OZYA 4DELA 5BOOA 1A5AA 4HTBA 1UZ4A 3WIJA 4DBSA 3BV7A 2WYSA 4OE7A 5CPTA 5F1UA 5AOUA 2EKCA 4LOCA 4DIAA 1JI1A 4GVHA 1LG2A 4IIFA 4P7QA 4OWGA 5GJMA 3Q37A 3UPWA 1OADA 5DANA 1X7FA 3DKJA 5AFDA 1NP2A 1JYXA 3C0LA 1EGZA 1V6XA 2WC7A 5KINA 5CC7A 4PZVA 1O66A 3CQKA 1DHPA 3GG0A 3TYBA 1UIOA 4CN6A 1BLIA 3SCTA 1G7UA 3O6YX 2NX1A 3WD4A 1UKOA 1MSSA 3W07A 3WQGA 2ZWZA 1E5NA 3MW7A 3QEZA 2W3ZA 2QPSA 2GJLA 1T8QA 2ZZ5A 3YPIA 5BU9A 3MPGA 1PB0A 2PWEA 3LCHA 4W8BA 4Q7NA 3SUSA 1H09A 2BVDA 1C3FA 1SVDA 1XXXA 1LORA 1RJQA 3GFYA 1J79A 3T0BA 1Q5MA 2VT0A 3P5YA 2VZVA 1MXDA 1S5MA 2E28A 5DEZA 4O1DA 3SR7A 1ZZMA 1BAGA 1DORA 5I79A 1THFD 1TPUA 3ES7A 1ICSA 4IXHA 4TXEA 1Y5VA 4A6GA 4ADUA 4CLMA 1UMLA 3SECA 3FLUA 4RL3A 1KM0A 4M80A 4ONVA 1ISYA 3THUA 1GTEA 1B4KA 5BXPA 1E3ZA 2FPVA 2G3IA 1VZWA 4IMEA 2PDPA 2XFYA 4QGCA 3T81A 1MZHA 3N73A 3W74A 3G24A 3KL0A 4KIEA 3QTPA 1VJZA 1ONWA 4W5ZA 3UXAA 5I3JA 3FDKA 4C6IA 4NAEB 1QW9A 4B4FA 4WOZA 4A21A 5LKYA 3S5YA 4QQ3A 4H2HA 3VVGA 4ADTA 3IIXA 1W9DM 1JDEA 5KZMA 3EYPA 3LPPA 5HQLA 4JTDA 3C3UA 1LT7A 3MWAA 3KDNA 1VS1A 4XB3A 1KM3A 2L5HA 1ZBKA 3WQCA 4ATDA 1SZRA 3VM7A 1K4GA 4KEVA 4H00A 2VX7A 3WBAA 2EGZA 4HOZA 4RV8A 1AA1B 4MFDA 2WJZA 5LYRA 5A8MA 1GZJA 4CNNA 5C7VA 3F5JA 5FEPA 2OQHA 7REQA 4O12A 5LXEA 3F7JA 3SRFA 4J3SA 3PJXA 3GNOA 4H19A 2VYOA 3FHQA 1XYLA 3EMCA 1AZ1A 1ALDA 2GQ3A 3LERA 4GCAA 1GONA 1WUEA 1SSDA 1T96A 2HPIA 1W32A 1L9WA 3NOYA 1WE5A 1IZJA 3PJUA 4G5DA 5A2CA 5A1AA 4M0XA 3B9DA 4GQRA 4BQ3A 5CSUA 4QLJA 4GYKA 2ZX8A 1E9IA 3KVKA 3GXPA 4GNVA 2HVMA 4LBSA 4AQLA 4PUJA 4DN1A 1IIHA 3S2JA 2XWEA 3CZ8A 5BOFA 1OIMA 3FJLA 5HWJA 1WAWA 3UVAA 2WC3A 3T9PA 3DC8A 3LTSA 4GJIA 3WL1A 1VYSX 3UETA 2X1SA 3BCJA 3WLLA 2FZBA 4JICA 4Q4PA 3BAJA 3WX7A 4GYFA 4UTJA 1J11A 6REQA 1SZFA 4X9YA 5F4WA 1AL8A 1D3GA 2V68A 3EMQA 4GVGA 1XLBA 1CYGA 4YVPA 8XIMA 4R7WA 1XYAA 2ZXQA 1BF2A 4WRHA 4O1BA 4OOUA 1V77A 3NL5A 3GFXA 1X98A 4QDWA 4A3YA 1BYAA 3V0UA 3B8VA 3IVTA 1TREA 1QI0A 4ZL1A 2VGBA 2QJGA 4AHPA 4JTGA 4W89A 1UKPA 1UUQA 1OSEA 3WDHA 1M6JA 1OD8A 1K1DA 4XG1A 2Y1HA 3C2EA 3DFNA 3N4EA 3AS3A 1KBLA 1LLOA 1GQNA 3W85A 1KM4A 4V1XA 3IJ6A 4PUMA 4OOZA 5CLTA 5TIMA 1JGIA 3KZPA 2PDIA 1OCQA 2XSXA 2Z00A 3GBEA 3HPXA 3D3FA 3LEPA 1VFSA 2ZZ1A 2XZ7A 1VBRA 1E1CA 3CV7A 3KOWA 4NT0A 3M1ZA 3OZMA 4C90A 4BWLA 1AL7A 3RX2A 3WMSA 1Y7VA 1DTNA 2AAMA 4YTRA 3INPA 2A3CA 5H91A 1PKNA 1TX0A 3ARZA 4IFKA 2ABAA 3A3WA 4DHGA 3KOZA 5HMSA 1V0NA 4JFUA 1UD6A 3KCJA 2YDRA 4L7ZA 1H61A 4AWUA 3EX6A 4XZNX 4CU6A 2ZX5A 3V5OA 3G0SA 2VUYA 2OWCA 2ZXDA 4ZB2A 3HGRA 2EG7A 1FWFC 1QJWA 4XZHA 1NFBA 3M0IA 3VNMA 5BRPA 4M24A 1UBPC 4OKDA 4BK9A 3TYDA 3QOMA 4YLWA 4GVFA 2G96A 1WAUA 2XFRA 4L6DA 4W7WA 5EFFA 1R47A 4U3AA 3T7VA 1W8GA 3WNOA 4ZCWA 4GYJA 4UB9A 1JYWA 4GGBA 1CGUA 2VDIA 1RZMA 4F0MA 4DJED 4GZEA 3G8RA 3UPBA 1EH9A 4CNTA 4N42A 4Z1CA 1O1ZA 1UA3A 5F2MA 1JCMP 3GH4A 3DBNA 2YKKA 3B0UX 4H9XA 1V6VA 4HNLA 3LX9A 3VPLA 3UY8A 3BMWA 2Q71A 3K5XA 1N82A 3JU2A 4RX0A 3N3TA 3FW6A 2D2HA 4IWWA 3NQ8A 3O06A 3FHAA 4FNUA 3H2OA 4JHZA 4J7RA 3TA9A 1BRLA 1A80A 2UV8G 4I7UA 4FXJA 1CGYA 3VNLA 3MHUA 4PSPA 3BC9A 2XIMA 1S1RA 4DI9A 3B0YA 4H6QA 1R3QA 1VEMA 3W7QA 3ABOA 4AIOA 4NKCA 1ZJIA 3E5PA 4Z2JA 3UJ2A 3NIYA 1YBQB 3NDYA 4O16A 4YTTA 1SO6A 1JPDX 3M0ZA 1GHRA 4DAIA 2QDDA 3SEPA 1PEZA 4ERIA 4S3BA 1JNEA 1GHSA 2DY3A 4Q6XA 3DFYA 5C2CA 1GVYA 1TCMA 3G1AA 3H4WA 4DPPA 3LXAA 1R87A 1M7XA 4UTTC 5CJ5A 4QIUA 4BQ2A 3GTNA 1BWVA 4O14A 4BI6A 3ONBA 4GRSA 4C6CA 4GWEA 1K02A 4WXYA 3VKBA 3R5EA 3GNPA 2P5NA 2PD5A 4FOKA 3VKDA 4WD0A 1YLVA 3W26A 3VK5A 2BMBA 3ZR6A 3PC0A 4WZHA 3E1F1 5I02A 3OLGA 1FHLA 3IV8A 3MA8A 1IXPA 4J9JA 3LCGA 3VIFA 3CHDA 4CCEA 1E6QM 1KV8A 3COTA 3C6CA 4RZ4A 3DI1A 4JTJA 4NJGA 2ZRUA 4GPNA 2QCMA 4L1WA 2RH9A 1MXGA 1F3TA 4QROA 3UR7A 1ZCCA 1UR1A 4ZFMA 2OOGA 4PCFA 3S1WA 1DJYA 3P6LA 3GBDA 2EPOA 1EJWC 3LTYA 1RJRA 2VDHA 2Z0IA 2PDGA 3TC6A 3LRMA 4FPSA 1S5VA 1V4YA 2QT3A 1XQKA 3RM8A 3L5LA 3TN4A 4A29A 1XF0A 5I3DA 2Y5JA 4BZYA 5D9NA 3GLCA 3S46A 3EEZA 2YFOA 3UZWA 3AZTA 3LYEA 1E0WA 3LZ5A 3QSTA 1AQHA 4UFKA 4N02A 1FWTA 3T44A 3KRSA 4HOXA 2D0HA 5FAGA 3BE7A 3B9NA 1ME7A 5TF0A 2PZ0A 2ZQ0A 2JIEA 3UWWA 3H4XA 3ZR4A 5U4NA 1FXPA 5HINA 1E70M 2OYMA 1ITUA 4EF9A 3CZGA 4WUIA 5SWUA 3D46A 3O9NA 4LC8A 3UXDA 2DIKA 1GOXA 1XRFA 1JPKA 4O0QA 5KZ6A 2OSWA 1KTBA 3QLLA 3SURA 3AUJA 4DWSB 1YYAA 4ZSUA 1JFHA 2ZWYA 3G1FA 2RHGA 4QCFA 1RCXB 3ERPA 5HNTA 4ZQPA 5HANA 5FCZA 4UMAA 3OIXA 4KFPA 4NUWA 1O95A 1PV8A 2WAGA 3VGFA 5IHSA 2FIQA 2P3EA 1EUNA 3ATZA 3L67A 5HXMA 1T0OA 3W1TA 3GXNA 4GZ7A 1P7TA 4WK9A 5I24A 4MB5A 2PURA 4YHGA 5DLCA 2GL5A 2ZICA 4XZ9A 3K4AA 3HG5A 1JCJA 4P8UA 3KBNA 1XYMA 4K7YA 1KBIA 1UC4A 4XWUA 1TPB1 3PZVA 2WMIB 1OYBA 1KFLA 4HQVA 1EZ2A 7TIMA 2EEXA 1H7XA 3WLMA 5DRIA 3IAQA 4JY9A 3HQ1A 1E4MM 5DFAA 4MJ2A 3M5ZA 3ECQA 1EO5A 4FLQA 3FAXA 2JF6A 1XH0A 3N9KA 1GYMA 3IK2A 3RJXA 1ZJBA 1T5AA 4WR3A 3KOXA 3DUGA 3VD5A 1J6PA 3M46A 1V6WA 5HATA 4AISA 2J6XA 3E0LA 5GNZA 5BWAA 2NLYA 2PWGA 5CEWA 4I5RA 3SI9A 4JX5A 3BMXA 2PF0A 3P93A 1CTNA 4KEUA 2WNWA 2C15A 3PS7A 4G1KA 4PB3A 5FF7A 1GEQA 3AALA 3CTLA 3IJ7A 4FLRA 2YIHA 4N0RA 2CNCA 3ALFA 3GHSA 2CC0A 3N18A 1IR1A 2ATSA 4XVDA 3LMYA 2JK2A 3QKZA 4PUEA 2W66A 1FWBC 1XISA 2V3FA 2NVDA 2YB4A 3MI6A 4JEJA 1XLJA 1ADDA 1A3HA 3EXTA 2GSEA 2FZ8A 4UR9A 3ITXA 1DQUA 5D04C 4A2RA 3LENA 4N4PA 1TA3B 3GTHA 4XD4A 4TX6A 4HA1A 1QI5A 5K4ZA 5CSYA 5DXYA 1OFPA 4RNJA 3WFAA 4GI4A 1LJYA 3VZZA 4Q4KA 1YMYA 3O8AA 4J27A 3DFQA 3GDTA 1DWIM 2VX4A 3U4FA 3E2VA 4Y96A 1ICPA 2DGAA 1WKFA 2X30A 2YXXA 2DSKA 1IWAA 4CGTA 1V6UA 1SJBA 2OZ3A 4QLLA 3WD3A 1DP0A 3L2LA 2C6QA 1A0EA 2PRHA 3OLDA 4DLMA 2OEMA 1U30A 3W2MA 2UY3A 2A3HA 1PYFA 4CD4A 3G22A 3CH9A 1PYMA 4UQCA 3TYZA 4P5UA 3CO8A 1CB2A 3ME3A 3MC5A 5E09A 1TTJA 2XIOA 3LM3A 1GPFA 3PZMA 5FSEC 1VJIA 3QMTA 3BG9A 3RCYA 3UCDA 1CIUA 1JJKA 1LQ2A 4UR8A 5LZLA 4XAPA 1DWJM 2GVEA 2J88A 2H9AB 5M1TA 1EGVA 5AKQA 4LNYA 2FYMA 1F6KA 3U8GA 4GA8A 3T0AA 4D6IA 1RPKA 1XLFA 1BYCA 3U2OA 2VEPA 3WUEA 3KTCA 1H0IA 4K1GA 4RDWA 3VDCA 3HBLA 1AD4A 3FY1A 1V0MA 4JDBA 1D3CA 3C56A 1R0MA 2DJLA 1QU4A 3TC7A 4YWSA 4RPQA 1M3UA 3ZJ6A 2XGIA 3W4RA 1B1YA 2WKGA 1AH3A 4L56A 1RY0A 4C7FA 4ZBCA 2ESCA 1H62A 5ABEA 1ZAJA 3QFWA 8CGTA 3R89A 2Z26A 3CASA 2CLKA 5DT7A 1WDRA 3W76A 5H6HA 3RR1A 4IP7A 1SZNA 4O1AA 3N4AA 1QK0A 2Y61A 3S2NA 4D6GA 3KRZA 3LSBA 3TXZA 2V3DA 3WH5A 2PTXA 1E4LA 5I3GA 4HD5A 1JDFA 4Q7IA 2ZZ6A 2PWHA 2HVOA 3VZYA 4GACA 3CZKA 2FMNA 2O4MA 3AIEA 1ZQ5A 2TODA 4A8RA 1I45A 2XJ7A 4S38A 3LI1A 1ZENA 4W7VA 3GDBA 4LTSA 2J47A 3CQHA 2POTA 3PB2A 1PZ0A 1SPQA 1GYLA 2E5CA 3N2XA 2PC8A 3BMVA 2W4XA 2QMKA 2NW0A 3MDUA 3AMDA 3L4WA 5E6ZA 3BJFA 3N29A 3V7PA 1H7RA 3E2SA 4DJDA 3VA8A 3MJMA 1JUEA 3GW0A 3CS2A 3BVJA 2Y7GA 3W2KA 2YCLB 4R33A 4ZO6A 4B2DA 3EX1A 3AHXA 3GD6A 1EB3A 1C9WA 4HHHA 3B9AA 4X63A 1YE4A 3OQEA 4Q8PA 4QR6A 1SJCA 2B4GA 4ADSA 1TTPA 4HSNA 4J3WA 3V36A 3ZQ9A 5I2UA 3KX6A 4KPLA 1QFEA 1VF8A 3STEA 3APGA 3BAWA 3W28A 2QUVA 3VE9A 3VAVA 1GGOA 4K8HA 4LAZA 5FACA 3THDA 3IUHA 3W7MA 5I0DA 1DWAM 2ACUA 1KCXA 1BXCA 1MEWA 3TZNA 2A3BA 2R24A 3W6LA 3TSDA 2D3NA 4DJDD 4QISA 2TSYA 4PFMA 1Q13A 5CLWA 4B2DD 4LU0A 4HU8A 3ZLFA 2PUZA 1E4IA 1TV4A 4NJIA 3OBEA 1M53A 3GS6A 4AVFA 4MWAA 1VRXA 1MW0A 1NU5A 3QY6A 3KTSA 3FVDA 3CL6A 3AHYA 3REQA 1HJUA 2QJMA 2QAPA 3STFA 3RPMA 3CLMA 3JR2A 4DJFA 2HS8A 4QJ4B 2ZKMX 2X7VA 4CKQA 4TIMA 4NY2A 3TW9A 3WSUA 1AJZA 3VILA 1JCNA 4C6BA 2ZIDA 1TWDA 4YCOA 1LYXA 1SFTA 3I7QA 1MFUA 3BQ5A 4Y7EA 5EMLA 4JQ2A 4QHRA 3NEHA 1A5MC 1GVQA 4NZCA 4XX6A 3OLEA 4IISA 3S5NA 2AL2B 3KLKA 3O05A 3NNTA 3S5OA 3PHAA 1PJ9A 3AWOA 3HZ3A 1Z6KA 4DI8A 2E4TA 3L2IA 3UR2A 4IPIA 4L1XA 1AQ0A 1TPWA 1YTKA 3ABQA 4MWAD 2GUUA 1WYIA 5H8MA 2BY0A 3VC5A 1PWLA 2ZTJA 2JBMA 3IJ9A 3LRKA 4JGDA 3GC2A 4UZSA 4ENLA 3P5ZA 3P7YA 5KZEA 3GXTA 3WNMA 1YRRA 2IUZA 4DJFD 2OFJA 5FJOA 2Z1SA 3LPGA 3FA3A 1EC7A 2ZUSA 5AVHA 4S3FA 1GOQA 4RJEA 1HW6A 3OPSA 4L6HA 3K1DA 2GJXB 5HUOA 4DM1A 1UWTA 2WHLA 4W85A 4LFYA 4GLEA 3DFHA 3M9YA 3RLVA 3KL5A 5M5DA 2BV9A 1HKKA 2GQ9A 1FKWA 1UKTA 1TPEA 2X09A 3ARYA 3R0DA 1M65A 4JX4A 3IPWA 4UOJA 2GDQA 1OF6A 2V5DA 4H9VA 3ITYA 2VEIA 3KBSA 3MKKA 3PG8A 3PAOA 1TPC1 3EOLA 4ACZB 5ABTA 2FGLA 3LGDA 2VHLA 1BTMA 4AW7A 3TTSA 1DWFM 2NT0A 3QZ6A 3S5ZA 2VC5A 5CPMA 1OGGA 3B8UA 2X16A 4RZBA 4LUSB 1EJ7L 2IKGA 4UC5A 2VM8A 4LCSA 5A95A 1H4PA 2WMKA 3LOTA 4FO4A 4JTTA 3RG6A 3S6OA 4XZWA 3C61A 2ACRA 2F6KA 2QPXA 1ZHAA 3WBYA 2VFGA 1KRMA 5C70A 3C0QA 3TH6A 3RILA 5K9CA 3GXFA 2Y85A 1RK6A 4OFCA 2ACSA 4DAFA 3VIPA 2XN1A 4UWMA 5K4XA 2CESA 4OHQA 1TSIA 1QVBA 3UFYA 4JIHA 2WCSA 5H8PA 2HNHA 4LPCA 2PBGA 2YBUA 4MYAA 2VR4A 3C2VA 3OGSA 4AHOA 1EIBA 7A3HA 1FWJC 2PGEA 1KW1A 4UQAA 5EPDA 4V28A 4WKFA 2J9YA 1EF2A 3KRUA 4M7SA 1F5ZA 1MNZA 3UJSA 4QS5A 1OJXA 3Q45A 3BJTA 4N6EA 5I09A 2EQDA 2CIPA 3JZEA 5E1QA 4KRUA 3SO7A 3VCCA 3PULA 3F1QA 2UY4A 2WSRA 1XR2A 2VEFA 2J8FA 4ZFCA 4AD3A 5DF0A 1RY8A 1XHGA 4L9YA 1REQB 3CIVA 1EA0A 3C0SA 5PTDA 3IVSA 2AGTA 4US5A 4JCMA 4JNZA 1IT0A 1GVRA 1ZBVA 2F9RA 4QE1A 2ZUNA 4MZ8A 1UPMB 2VOMA 3W29A 4RE3A 3IS4A 3B4UA 1GKRA 2NX3A 5EL1A 2POZA 3R8GA 2YA1A 2FGZA 4BEUA 3L23A 2WBKA 1FWIC 1ML1A 4P7NA 3HQOA 1K8XA 3C8FA 3T05A 5LIWX 3AISA 1RD6A 4JQ1A 4LB4A 3W88A 4JTCA 4Q4MA 2QCGA 3M6DA 2DH2A 3EWDA 2WHMA 4QE4A 1E40A 2NQLA 3SCUA 1IEQA 1MEHA 4US5D 4NAEA 1DXEA 3ARSA 2Z29A 4RPPA 4KWUA 3W7JA 1J8VA 3DYOA 5D37A 3VD9A 3C0JA 2WNNA 1MVYA 1ZP3A 3APTA 1RD5A 2Y6ZA 2YX0A 4Z08A 1PZ1A 3VDBA 1JZ8A 4Z2KA 3L68A 3QTGA 1G7VA 1O5RA 3LG3A 4HA3A 1IQ8A 2NUXA 3U6WA 4AC1X 1WZAA 3ORWA 1P0NA 4ROQA 1MW2A 3VD3A 3NQVA 4AXNA 3W1QA 1Z9AA 1GT8A 2MANA 2WKJA 1L8PA 3ZJKA 2CKRA 5A6MA 3GM8A 3W6MA 1SU5A 4PUUA 2VMFA 3CT7A 3GDMA 3W7EA 1DQXA 1XLCA 3U48A 4JDYA 3PUEA 1XDJA 4AUBA 1SGJA 3L5MA 4E2BA 3GNDA 4YU1A 1W54A 2NVCA 3B3DA 3EXRA 5A8NA 2OZTA 2VCAA 4C6KA 1WB0A 2TRSA 3UESA 1POJA 2BOEX 4BCEA 3W7HA 1N55A 3AS0A 3HV8A 4RW5A 2VCCA 4Q4QA 5HJXA 5JQ9A 1W31A 3ZVIA 2PWFA 5EMJA 3UF9A 2YYTA 5AYZA 3R12A 3BLLA 1JCXA 1DWGM 3S2MA 1K9EA 1H11A 3FGCB 1CW2A 4WDXA 3DEQA 5C9UA 1PDYA 4W93A 4F2BA 1U83A 3TQPA 5DX7A 3N4FA 1RBAA 3M43A 1FWEC 3VGBA 2Y7DA 3ABSA 1N2VA 2EPNA 4F4RA 5LHEA 5JIPA 2BSLA 3ZXWA 2WBGA 3LY0A 3CAWA 3L4VA 4U4MA 4AIBA 4EACA 2YCJA 1XDMA 2X41A 3W24A 3W2JA 5K2ZA 1HL8A 2QGHA 3GH5A 1A4LA 1XIHA 2OR2A 1RCQA 3S9ZA 3W02A 2PCQA 2NSXA 1UROA 3A22A 4W5UA 2WK2A 4QX4A 4O50A 3IIPA 4KS0A 1FWWA 1F4AA 1Y0EA 4G56A 1ECEA 4HPJA 4I5UA 1H51A 3S9YA 4TR9A 3TE9A 3CQIA 2VDGA 4LX4A 1UWQA 4DXVA 3T6CA 4HIBA 1LL7A 4AMAA 4CD6A 1TUXA 1DHKA 4GI6A 3WUGA 2E25A 3GZAA 4WLCA 1KKOA 1QPRA 1OFDA 3BTNA 1KFWA 1D7KA 4EAYA 4CQ8A 1GZGA 3RXZA 4MJZA 1HF6A 3G8EA 2QVHA 3MSGA 3WENA 3TA6A 1TYGA 3VGHA 3AMGA 1GVEA 3W1UA 1XRTA 1UJPA 1RHCA 2XM1A 1KBKA 2QCNA 3DN5A 3H7VA 2EJAA 3RPTA 3MU7A 2PAJA 4NQ1A 2B7QA 2JQXA 3RNDA 3BLFA 4C7GA 4BF5A 4NL1A 2G3JA 2J6VA 3FJ6A 1YNPA 3ITTA 4IGSA 1L6FA 4L4PA 4LV9A 4WSJA 3QC3A 4Z0JA 1TWWA 4PTMA 1PBGA 3OO2A 3O07A 4ZO8A 4FNRA 1KFKA 2QF8A 2JFEX 3KP0A 4HK7A 1KKRA 3TVAA 3M0MA 4Z1BA 3I6TA 3VOJA 3MKVA 2C7FA 3NGJA 4AD5A 3O7UA 4JYEA 3FS2A 2Q8LA 1SM9A 1XBZA 4LANA 3T42A 1TELA 1JDCA 3VKJA 4HB7A 1BXNA 2XVKA 2IQ0A 2BNJA 3AAMA 2A7NA 2F6UA 3CC1A 4OUIA 1ZS2A 1CXKA 4AD0A 1ZU8A 4A3RA 2BHYA 3WH8A 5I6SA 2CLMA 1NTHA 1D7FA 1SFLA 4GUIA 4XTDA 4QEEA 4DLFA 4NAFB 1KXHA 1XBVA 4A8NA 2E09A 4PBFA 4GBUA 1QOQA 4H9ZA 1JRBA 2BHUA 1XC6A 1FXQA 3SB0A 1L2UA 4QXIA 1M7PA 3PZNA 6XIAA 2VI0A 3B06A 3M16A 4AWSA 4F9DA 1A47A 1K6AA 1KTCA 1VIWA 2C0HA 3BOFA 1P0KA 1W0MA 2RUSA 1KR0A 5D32A 1HIZA 4O52A 1JEZA 3MV01 4JIIX 4WEVX 1GKPA 5BCAA 3TSBA 2E0PA 1IGSA 4P2VA 3Q2DA 3IRDA 1HKIA 2V30A 1ITCA 1OWQA 3A6OA 3DG6A 2GVLA 4O28A 5CPOA 2CHRA 3MCNA 1XLHA 1K3UA 5CJNA 2OTDA 2IS7A 2R94A 1NOUA 5M2FX 4IZGA 4P8WA 2A4AA 4YNGA 4WKAA 4KCWA 3SFKA 3SCPA 4OJYA 1Q63A 2YYUA 4I8DA 3H70A 4S3GA 2VC9A 2BVWA 2QDHA 3G5EA 1PVNA 6REQB 2GWGA 1K9FA 1XBXA 3NXLA 3VNIA 2FB3A 4MJMA 4OBTA 5FOOA 1XFCA 5HNRA 3TJXA 4JQAA 3KUMA 1HP5A 2X2GA 4TV6A 2DV0A 4Z1YA 5LA0A 2FQIA 2VXNA 1E6ZA 4GX9A 2AQOA 1FCVA 3ES8A 5C7HA 3SQMA 1UKQA 3G0UA 4KH2A 1PTGA 4R85A 1J5TA 3M07A 1GOMA 3PVFA 5FF0A 4ERAA 4CUCA 3GNNA 2QVNA 1QO2A 3W0KA 1HJXA 4WJ8A 3QV7A 3LM7A 4GXWA 4UQEA 2I9UA 2OODA 3ZO9A 3SRDA 1J0IA 4ATWA 3S6TA 1XM3A 1E1CB 1YW1A 1HP4A 3LHUA 4US6A 2ZX6A 4FX6M 4GISA 2E6AA 1QW7A 4ZO7A 3AI0A 4DYKA 3RO6A 2ISWA 2Q3OA 4E38A 4RV3A 3AICA 4BEQA 1KO0A 4J4KA 6TIMA 3N11A 1JFXA 3QPYA 4FR1A 4GIEA 4IFKB 4GIAA 3PBMA 3NG3A 1DJNA 2EXOA 3LZ3A 5RUBA 3KCOA 1PAMA 2XIJA 2XZ9A 1E9YB 4H01A 4CQBA 4PCNA 3L4ZA 3UNTA 3NPUA 4DWSA 4HU4A 3THAA 2Y2WA 4JN7A 2QDEA 3EWCA 3MSYA 1HN1A 4NX0A 1Q2RA 2PDMA 3LXCA 3VOGA 4GZJA 4CU7A 4EE9A 3PG9A 3K4DA 2OZ8A 1KGUA 2R9RA 3VABA 4GX8A 3LCLA 4DEFA 2GSHA 3I6EA 4LXFA 5FD0A 4BHYA 2F2KA 1GQKA 1VH7A 3PUOA 4IQLA 1KQZA 1TKKA 1ZJHA 1US3A 2BBFA 3RHGA 3GVVA 2J27A 4FF7A 2VO5A 3GG7A 3UNDA 3I6RA 1H7NA 2CBVA 3W1LA 4A8LA 5B80A 1I9CB 4LRTA 3UR8A 2WHKA 3UG8A 3U2CA 2VFIA 3TXVA 2ZA1A 2NXIA 2P0IA 4WDTA 1KLYA 1J96A 4PMUA 4J2PA 4DWSD 2AOSA 3KHJA 3NZQA 3QRHA 2PTYA 2WMIA 1JG9A 3KFTA 1BRLB 5FJJA 1FWNA 4AXKA 1X6UA 2IXUA 8A3HA 2Y5SA 2PTWA 4DRSA 4I7WA 5E93A 3NFUA 4NJHA 1XCFA 1OX5A 4MM1A 4QE5A 1OFEA 3UY7A 1JYVA 2J74A 4IPNB 3W23A 1DJQA 2Y8VA 1TJ2A 3VFLA 2CZ5A 5D2XA 4L4LA 1HX0A 1MO0A 4F2UA 1JAEA 3O0FA 2LLEA 1VHNA 1LRTA 3PWAA 3WD0A 5BRBA 5HA7A 3GXIA 3OBKA 2OCZA 2A21A 2NUYA 3HPZA 3UT0A 3N6HA 1RQEA 1E5JA 3GVWA 1TRDA 3CHFA 2G37A 3KOYA 4GQ0A 1QI3A 4Q22A 1WQ5A 3AS1A 1VRDA 5HWNA 1RXOB 3NQAA 1XIMA 4XD5A 1PIFA 2YBTA 4M6VA 2HV5A 3WNPA 1V0LA 1BSLA 2FZNA 1AH4A 1X38A 2QNEA 1XLMA 2UBPC 2DQXA 3WDJA 2V38A 4OGZA 3B0VC 1B3ZA 4DZIA 3TQ0A 1UA7A 2V63A 1BD0A 1NIUA 4YYFA 1AODA 2W9MA 3TOYA 2V5LA 1MW3A 3GU9A 6A3HA 3U7BA 3ABZA 4W88A 1XGDA 4HA0A 1E1FA 4AVOA 2I17A 1G67A 2OEKA 4WY0F 2Z6JA 1XLKA 4MFEA 5AC6A 1WKDA 2P50A 2X05A 2ZUUA 4HZ6A 2DZWA 4N7QA 4IFRA 5DMNA 4O54A 4C5YA 5I03A 1TVPA 1Q4WA 3V18A 3P8JA 1VCFA 1ZALA 1XC4A 4HMDA 2PBOA 5KSWA 3MB9A 4CNPA 2RDXA 1CXHA 3W1XA 3AU6A 3H23A 3GVGA 1QT1A 4J2MA 3E49A 5EMYA 1R9XA 3KL3A 2J62A 2PDJA 3B9OA 4IQDA 3GYEA 1PCWA 1DE5A 4DO7A 2A85A 2H8XA 1H41A 1UB3A 1E6PA 1VKFA 1UP2A 2TPSA 3FFSA 4AF0A 3AROA 4K8GA 4DBDA 3VKCA 1Z42A 2OQLA 2H9AA 2WNZA 2ZA2A 3BL3A 2C14A 5IBXA 3IANA 2DT0A 2YXGA 1OD0A 3GIYA 5D33A 3R6IA 4XBJA 2BLEA 6ENLA 1C8VA 3AU2A 3V1PA 1KFBA 3EX4A 3SJNA 4MDOA 3SY5A 2OLAA 3BOXA 3CYJA 1FDYA 3OVRA 2CU0A 2ZCGA 3PBUA 4A8IA 4AZHA 3OODA 3R94A 4FOUA 1H50A 1PZ3A 2OT0A 4NX5A 1LLWA 3SW6A 4OVXA 5KETA 3W37A 3QQ1A 3HGOA 4RNFA 1OGBA 3UWQA 4DUVA 1AJ2A 2WSQA 3O6AA 3R2GA 4JL1A 4PUWA 3SCRA 2FDMA 3HB9A 4B5TA 5J04A 3NEVA 2JEPA 1YIXA 2WCAA 4MOZA 1P7TB 3WQWA 1UQZA 4GUFA 3W7IA 2GQ8A 3FEQA 4I9JA 4XAGA 3M0JA 5EBAA 1O5XA 2RKXA 3NYDA 2B7NA 1VFHA 3RRAA 2YW3A 4IM4A 3SCNA 3OW1A 5JBEA 2QCEA 4C1KA 4UFHA 4MY1A 3D5HA 2WW5A 3D0CA 3CWNA 3E38A 4DNHA 1VFTA 1J0ZA 1UYQA 1I1XA 2YCKX 4R27A 5HULA 1XYFA 2OQYA 2CLOA 1JZ2A 3BV4A 1K03A 1P5BA 2PP1A 1OQFA 3RRXA 3ZLHA 3U57A 3KBMA 3NQ7A 1EP2A 1A53A 4FSAA 2NQZA 4LWWA 1H1ZA 3TROA 2J66A 4GY0A 1XLEA 2ZUWA 4CCCA 3UEQA 1KM2A 1UUOA 4OZOA 4AVNA 5JH2A 3W73A 2XH4A 4W84A 4DJDC 1KRBC 1X8CA 2Z27A 5B7YA 1EJXC 1NEYA 4FF5A 4JTUA 3WLOA 4E8GA 3BAIA 2PP0A 4LYKA 1YTDA 3I10A 4H6KA 1XUUA 3DG3A 2FKPA 1Q85A 3KM8A 2PTZA 1ZL1A 3NTYA 1NVMA 1A50A 1BQGA 1WNOA 2DIJA 2VEGA 1WP6A 4QG9A 1AW2A 4MVAA 3I4KA 3OB8A 5D2YA 3GRIA 1B3YA 4QTGA 5D09A 4JTEA 4EPDC 1UZ1A 2B7PA 4R9OA 4RDVA 4HPNA 3RO8A 1OK4A 5BNKA 1XCXA 2QCFA 2E9BA 2O56A 3QMRA 1P6BA 1XV8A 3EA3A 3KAOA 4OU1A 5JUVA 4OTKA 1FDZA 4H9TA 1WDWA 4A4AA 4HYVA 1A3XA 2HJPA 3T2OA 3ZIZA 4U10A 4HCLA 5A6SA 3T2QA 4S3JA 2XFFA 3N14A 4GK8A 2Z2BA 3EB3A 4HU0A 5CSSA 3HGJA 3V16A 1BVWA 3PFMA 1VGAA 1W5QA 5D2VA 1XD0A 2E9MA 2OPJA 4MHBA 2PDYA 3WDPP 2DZPA 4DJFC 5M17A 3GTXA 2PODA 3WG6A 4G6CA 2DW6A 4LAUA 1WDQA 2GGHA 1EDTA 1JCLA 4MF4A 2EHHA 1WBHA 4LBRA 3W2LA 4HT3A 2P76A 3R4IA 3QZEA 2CERA 3O16A 1ZAIA 6CGTA 4X2RA 4GI9A 5HNNA 3TP4A 3CMJA 4B5WA 3R0UA 1VD6A 2BASA 3NQBA 4ZE5A 1JZ7A 1D3HA 1WO2A 2ZDRA 2CLFA 2AMGA 1QHPA 2PWVA 1R9ZA 3LRLA 2PWUA 2DUAA 3QF0A 3T09A 4ZODA 4F79A 1XPYA 4IG2A 5LIYX 3S4TA 4MKNA 3VI2A 2JALA 2BS9A 3SDOA 4ZTYA 1NWUA 1D8WA 3V75A 4PUDA 2E40A 5HOSA 5CH9A 1AVAA 1EJTC 5CSRA 3VX0A 1E1EA 2EPKX 5EKYA 5I06A 3UWYA 3PAJA 3AMLA 4MNLA 3W7CA 3WBWA 3SFWA 3PBWA 1DV7A 3LNPA 5D4YA 4LH8A 4GCXA 3TONA 3W53A 4WDWA 4ACZA 3H4GA 3CUZA 4ATLA 5DCDA 2X42A 4S3EA 1MNSA 4H9YA 3EPNA 5CAHA 4LUSA 1XICA 3H55A 1KXVA 5LA1A 1XLDA 3TTOA 4LBUA 2PTDA 2G3MA 4AZBA 5I5RA 4UQBA 3L9CA 1LRQA 4RE0A 1O60A 3WNKA 4Z2IA 4DVOA 1F73A 1JDDA 5GJPA 3G6LA 3QBUA 4J40A 4XKYA 3EOEA 3SIMA 1JQXA 4JTIA 4AAJA 1M41A 1VC4A 3NQDA 3UQNA 1S39A 4MWAE 5CCZA 2GQAA 1IXQA 1A5LC 3I3EA 5ABHA 1LRNA 3MT1A 5DO8A 5H8UA 1XFBA 4NZ5A 1AG1O 3LI0A 3G1SA 5BU6A 1NWRA 4GIYA 2QQ6A 4WGHA 1UBSA 4ZVJA 4PTNA 4D2JA 4JIEA 1UP0A 3BGAA 1J12A 1B5TA 5JVLA 1HKMA 1OG0A 3UYCA 3WQPA 1ESWA