3L9CA

The crystal structure of smu.777 from streptococcus mutans ua159
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
249
structure length
226
Chain Sequence
SSGLVPRSMKIVVPVMPQNIEEANQLDLTRIDSTDIIEWRADYLVKDDILTVAPAIFEKFSGHEVIFTLRTEKEGGNISLSNEDYLAIIRDIAALYQPDYIDFEYFSYRDVLEEMYDFSNLILSYHNFEETPENLMEVFSELTALAPRVVKIAVMPKNEQDVLDLMNYTRGFKTLNPNQEYVTMSMSKLGRISRLAADLIGSSWTFASLQISLADMRKIKEVLDAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title The Crystal Structure of smu.777 from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Lyase
total genus 83
structure length 226
sequence length 249
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3l9cA00
5HUPA 1C9DA 1KFCA 3FA5A 5C55A 1UASA 1W37A 5I3FA 4LRSA 3DFNA 4ADSA 2V2CA 2V5BA 3ATZA 1KLYA 1VLIA 3ZR4A 2GOUA 3FLUA 1WV2A 5IBXA 3C6CA 3LCXA 3E49A 2YGYA 3DBPA 3IIZA 4LTSA 2Y7FA 3LB0A 1RQEA 1LTDA 4JX4A 4JTIA 4L4LA 2RFGA 3QEZA 4FNSA 3S9YA 4AHPA 5C6MA 5EPDA 1KFKA 1LOQA 1TMHA 4ADUA 4Q4KA 4D2JA 3UWUA 4PA8A 3DHDA 2EAWA 3W71A 2UV8G 3NQVA 4NX0A 3FS2A 3FFSA 3M16A 1B4EA 1XBYA 4GC4A 4DO5A 1ZAIA 4PFMA 3C8FA 3GX9A 4MOZA 4KWWA 5F4XA 1SSGA 3SECA 1AL7A 2Y7DA 3QH2A 3P8JA 2FPTA 3D0CA 4KWVA 4N9BA 3ABSA 3STGA 1OK4A 3VNDA 1WOAA 4XUGA 4K8HA 3P74A 1PL9A 4ICNA 4NZFA 3RNDA 3EXRA 3W7EA 3HBLA 3IVTA 4JYEA 3I7RA 1L2UA 1I2OA 2ZRZA 2ZRUA 4JICA 1JCJA 5K7JA 3NPWA 3TJXA 5F4WA 3LXAA 2YYUA 5LSMA 3GDLA 1DVJA 3B05A 3TE9A 4MZ1A 4N4QA 4YXGA 1DV7A 4Y96A 2QR6A 4CQAA 1TPFA 1FWRA 3NQGA 4DEFA 3W73A 1BWKA 1HFBA 3L5MA 3W1UA 5D03A 3GNDA 1F5ZA 1QO2A 4ZQRA 3MI3A 4RK8A 4OWGA 3L0NA 1THFD 3T7VA 2B7QA 5KINA 3PB2A 1XCFA 4K38A 3F4WA 3W3OA 1QR7A 3QPZA 3LHTA 3R8RA 3DI0A 1JCXA 3WK2A 4FXSA 1WX0A 5HWNA 5K9CA 3GXNA 1FCBA 3IV3A 3QSRA 1R2RA 1ZALA 4LWWA 3O6YX 2C14A 1LDCA 3OBKA 3GDRA 1GYNA 3EX3A 4M6PA 4ZL1A 5HUOA 1KTCA 5D30A 2OJPA 4DBEA 1PVNA 3S5NA 4UFMA 1ZAJA 3CPRA 3DZ1A 1H7PA 3NQEA 5DCBA 2V30A 4EF9A 1O5KA 2DP3A 2YFOA 3LLDA 4A3UA 5G4WA 3NQMA 5LNWA 1VZWA 2X1RA 3A5FA 4WOQA 4ZVJA 1YTDA 4O16A 2QCGA 5DCDA 4NNAA 4IMDA 1D3GA 3W1PA 3O1NA 1F74A 1VYSX 1BTMA 5EBUA 3OVRA 2ZYFA 1N8FA 3RMJA 1L6YA 3W2MA 2ZZ6A 1R30A 2E5DA 3UWYA 5CZTA 3CTLA 1C8VA 2H3BA 3W7KA 2NV1A 4Q32A 4JTEA 1V5XA 3PVFA 3GNNA 3TROA 3CB8A 3BW3A 3PY2A 3HGOA 2YFNA 3G22A 5FEPA 1QPQA 2CZDA 3W7CA 3S1VA 2X1TA 3M1ZA 2PRHA 3MYPA 3NQCA 2BSLA 5D05A 2Y62A 4XKYA 4M7TA 4AMAA 1YTEA 4WY0F 1OX5A 1I2RA 3W1NA 5KZDA 1LYXA 1KLZA 3ZFHA 3VI2A 1OFDA 4ORMA 2DZSA 1MXSA 1GVSA 2B4GA 4O4WA 2C18A 3BVJA 2QCHA 4UMCA 5FF2A 3NNTA 4JTFA 1FBAA 3LV5A 4NUWA 4LT9A 2NXHA 4UFIA 2QDHA 3DXIA 1FDJA 2A5HA 4PC8A 3U6WA 2CZFA 1TREA 3LRMA 3H54A 4FX7A 2ISVA 2YSWA 3PBUA 1P1XA 4H4IA 1LBMA 4N02A 5CSRA 1W3IA 2DORA 3N9SA 1LLWA 1XBVA 1KBJA 4MUZA 5EYWA 3W23A 1VCFA 1GVRA 3NPUA 1SR9A 3VE7A 4X2RA 2VFDA 4AF0A 1WAUA 3CIXA 3M5VA 4FNUA 2QCDA 4MYXA 5ABTA 1TV7A 1UBSA 5G2HA 2CLIA 3W7PA 3TU9A 4UCGA 3MUXA 3LV6A 2VFFA 1IXNA 2V8ZA 5F1VA 5AHEA 1TB3A 1P0NA 3GZ3A 4JY9A 3INPA 2E68A 3I6RA 3S1WA 1JUEA 4HPXA 1ICSA 4UTJA 4WXZA 3RF9A 4BI6A 2EPHA 5FEWA 1SUXA 2C19A 2QJHA 5HWJA 4MY9A 2ZRXA 1TPDA 3PSVA 4UFKA 4BI7A 5D2WA 3LRLA 2A1YA 1NF0A 3M44A 1NFBA 2QF7A 3TXZA 3QC3A 2W6RA 5AB3A 4X3ZA 1W3NA 2IQTA 2X2GA 2Z0IA 4AWUA 1F05A 3B4UA 2G96A 1R47A 1FDZA 3LHWA 1F2JA 1LBLA 3NYZA 3WJSA 2VFHA 4IMGA 3EKLA 1GTHA 3EX6A 2NXGA 3W7OA 3L5LA 3O6DA 3CLMA 4AH7A 3FKRA 3G0UA 3QMSA 3O6CA 2CLFA 1JCLA 2YW3A 3MP5A 4O1AA 3WJZA 3RU6A 1PCWA 1PIIA 3TSBA 1MEIA 2JGQA 1SFLA 3W7LA 1B9BA 5D32A 2FB2A 1KM1A 2Z2UA 2YW4A 5K4ZA 2RDUA 3NZRA 5DLCA 2QDGA 1W5MA 2J24A 2TSYA 4TX9A 1YTKA 2VXNA 5FF3A 1R46A 4K37A 3NL3A 3UZJA 1FXPA 5HR6A 3VKJA 1JUKA 1LOLA 1OX6A 3GKFA 4E2DA 1FWNA 3GR7A 1JR1A 3TMLA 5LHFA 2NX9A 1TQJA 2Y85A 4CCEA 2ZQ0A 2H8ZA 1CX9A 4O57A 4N9CA 3WJYA 3UWQA 1VS1A 3PBVA 3ZWTA 5K4XA 1XUZA 4UFJA 2EGZA 4JGDA 3GKAA 1W1ZA 1TRIA 3I68A 5D2TA 2E6FA 3W74A 3L66A 3O05A 4OQVA 2A7RA 2FB3A 2W0UA 5G4EA 1VC4A 2J9XA 2ZZ2A 1O4UA 3QW4B 2DZVA 4OV9A 1MO0A 1TPUA 5LZLA 2B7OA 2FIQA 4NXKA 1LORA 5G5IA 3BG5A 1LRQA 4LW7A 4CQ9A 2PC4A 4FNRA 3HIJA 1LRNA 3TW7A 4ZZ9A 5CKSA 2X1UA 4A29A 4MLJA 4JIQA 5KSWA 3NXFA 3OA3A 4TO8A 5G1TA 1N7KA 4AEOA 4OHQA 3W85A 2QEZA 3TA6A 4LC8A 1HUVA 2A7NA 4QNWA 2P1FA 1NSJA 2VC6A 3EXTA 5LNSA 4KFNA 3NAVA 2E6YA 5IBXC 3M47A 3KRUA 4XBKA 5J5RA 4QSHA 2JGYA 1QPNA 1H62A 3L2IA 2GQAA 3PC0A 3M0ZA 2Y7EA 5FESA 3PF3A 4RX0A 3SGZA 3FEMA 1DJQA 5FF0A 5GVJA 1T8XA 3W7QA 5CPLA 3VCRA 1OVDA 1H7XA 4MZYA 4O12A 1TSIA 1UUMA 3MI6A 1YYAA 4EIVA 4QIUA 2DZPA 3EWWA 3G1VA 5DXYA 1ML1A 4I7VA 5F2MA 4U4MA 4BWLA 2OX1A 3LCHA 2PRMA 4R7JA 3MO7A 3P61A 1YDVA 2NX1A 1N55A 3A5VA 3C0JA 3E0IA 3BPWA 4DQWA 1B57A 4J9JA 1OFOA 2ZTJA 5D2VA 4LU0A 3G3DA 1O95A 2JKPA 3UPWA 3NOEA 1KA9F 3Q94A 4NNBA 4YWIA 4NVTA 4JR5A 4IJBA 3W1RA 3G18A 3NQ2A 2ALDA 3W1LA 1TTPA 4O10A 2A21A 2R94A 2VELA 1VR6A 5BW6A 1H1ZA 2HS8A 1QWGA 4KFPA 3L21A 3W88A 3CC1A 3L5AA 3KX6A 1LLZA 4JTKA 4QAIA 3NA8A 4LVFA 5IM51 2HMCA 2E77A 5LNVA 3STEA 1B4KA 1M5WA 3C2OA 3DFOA 3PR2A 3T40A 1ALDA 1S5TA 1AG1O 3TQVA 3G1XA 3E12A 1Z48A 4FF7A 2GUUA 2VEIA 4MLRA 3B03A 3R13A 3LCFA 5L9FA 3G24A 3PBYA 2Y63A 4O11A 4RCXA 4JIPA 3TFXA 1FCVA 3A9IA 4Y6GA 2QJIA 1UJPA 5I3IA 4N4PA 4JDBA 4RV8A 1VQTA 1GG1A 1D9EA 3TQKA 3S1UA 4OGZA 4FNQA 4XKYB 1H1YA 3DHFA 3S6DA 4Y90A 4A21A 1ME8A 3TUUA 3LM7A 4UFHA 4GNJA 2A2IA 1IIHA 2GPTA 2FQIA 2WQPA 2QCMA 1TV5A 3P62A 3LOTA 2NWRA 5C5YA 3TC7A 1QO5A 3WJXA 3W2LA 1OABA 3UQNA 3L65A 1A50A 3PULA 3FYPA 2YCEA 2B7PA 1P0KA 1DQWA 5LHEA 3ATYA 4KKXA 4PH6A 4RZ4A 2JK2A 1MEWA 3MHUA 1ZAHA 2OMAA 1XBXA 2I9EA 5EL1A 3P5ZA 3HMJG 4DF0A 3PSWA 3KRSA 5AN7A 3G1YA 1B3OA 1OF6A 3DKJA 4GJ1A 4HKPA 2Y61A 1KM4A 3W87A 3TV8A 4JTGA 1EUNA 1H50A 4ZMGA 1QOQA 3LCLA 4ONVA 4HNUA 1OFAA 3GYEA 1FWWA 3G1SA 1WXJA 3W2UA 3N19B 1KM5A 3DFQA 4PTNA 4WZHA 4I7UA 1O60A 2QCDB 3T55A 1K8XA 5DY3A 3KRZA 1TTIA 5KTLA 2VFEA 3CU2A 4LUIA 1QNVA 2GVGA 1W5PA 3W1AA 2WV8A 2C1HA 1Q6LA 3MWAA 1SZEA 3YPIA 1VJIA 3O8AA 3SFKA 4UC5A 1I2PA 3EWZA 3SJ3A 2CZ5A 5HJLA 5AYYA 3N9RA 1YDNA 4N2YA 3PB0A 3EB2A 2V2HA 2QAFA 3E96A 5DCEA 3C61A 3MJYA 5HINA 3GXTA 4HIBA 3HG2A 4EVZA 2A4AA 1RPXA 1ZFJA 4JYDA 2VEKA 5E0KA 4YLWA 4K39A 4FX6M 2CU0A 1G4TA 3QF0A 4N9DA 3CQ0A 5A5WA 4I9AA 2XN1A 1W5NA 2X30A 3W07A 3C52A 1FUYA 3C3NA 1F7BA 5G1YA 5G2IA 4AHOA 1JCMP 2WNNA 3DKLA 4IUOA 2WJZA 4Z1AA 3ABQA 2Z6IA 2DZXA 2X1SA 4WUIA 2YR1A 3TK7A 5AC6A 4DO6A 1DQXA 1KM6A 1KM3A 1TYGA 4QNEA 4FB7A 2FFCA 5L6UA 4HHPA 1FX6A 2C6QA 3UWWA 1GVOA 1DORA 3PAJA 3TDFA 5C2XA 2ZRYA 4JS3A 3W7IA 4LVDA 2RDTA 1DJNA 3HPXA 3OEXA 5FI8A 1JJKA 4UR7A 4EOUA 1FCUA 1RV8A 4AHQA 2QCNA 5BNKA 4KFOA 3U8GA 4K8EA 1WA3A 3FYOA 6TIMA 4NJJA 4M6VA 2Y70A 4DO4A 1KBIA 2GVJA 5FF7A 3P5YA 4FEZA 4PEKA 3N3MA 1U83A 3GR8A 2HSAA 5AHIA 3LXCA 3RK8A 5I3KA 3DAQA 2CLOA 3C2VA 4IMFA 4R33A 1Q6OA 3G3MA 2CLHA 1OFBA 4C1LA 1RQBA 2O7QA 2VOMA 2C13A 3HG4A 3IVUA 2DZTA 5BRBA 1K8ZA 4GUFA 4Z1CA 3DH7A 2DZUA 2ABBA 2ZTKA 4JXCA 3THQA 4YCOA 2E1DA 5I3HA 3QJAA 4TMCA 3R89A 2NXIA 4Z0JA 4MVAA 4AXKA 3KVKA 1SO5A 4M6QA 5H91A 4RZ6A 3KVMA 3TJLA 4FNTA 1P4CA 3EEGA 4PCFA 5AHLA 3W1XA 4IMEA 3I7SA 1W54A 3W84A 1ME9A 1TO3A 1HO1A 3LX9A 4HSOA 3PS7A 2NLIA 2Y89A 1A5BA 1G67A 1OHLA 3B0UX 1RD5A 2H6RA 3TNOA 4HNTA 1AW1A 1OFRA 2A6LA 1TPWA 3ANYA 4RXGA 1F73A 4QISA 2I14A 2FDSA 2WPBA 3HQ1A 1OK6A 3LCGA 2XN2A 4CCDA 4YCPA 3TX9A 4QJ1A 1W56A 4GE8A 4FXRA 3TMQA 1RQHA 3LI1A 4S2BA 4WOZA 4LUJA 5CG7A 5LGZA 2CZEA 3NQ6A 3C2FA 4Z08A 1JQXA 3H55A 3P84A 4MFDA 4UIOA 3QFEA 1KFJA 1TQXA 7TIMA 1H7OA 4O1DA 4QM1A 4NNCA 1TPC1 4LY8A 3GXPA 2C3ZA 4CNOA 4Z0SA 4POCA 5HULA 1H7RA 2CFFA 2QCCA 4IGHA 5I3GA 1OFEA 2Z6JA 1VRDA 1YPFA 2ISWA 3MI2A 3UD6A 1EP3A 1HTIA 1QPOA 1TPB1 3S1XA 4JDYA 1EUAA 4JY8A 4AWSA 3W9ZA 4O28A 2J88A 5K9XA 2WKJA 4BR1A 2CLKA 2O7SA 3KHJA 4RZ5A 1OF8A 1K3UA 2C16A 4LVAA 1GOXA 3USBA 2PURA 1QAPA 1OYCA 3HG3A 3QM3A 1F6PA 1TPH1 3PUOA 2BZNA 2OZ0A 3TIMA 3CM4A 1IXPA 4K36A 1XL9A 3R5EA 4LNYA 3B04A 3TSMA 5SWUA 3SI9A 1R2TA 2QCLA 1Q3NA 1W5QA 2Y6ZA 1MEHA 3WJWA 1W5OA 4JTLA 4BWLC 4Q33A 3QZEA 4WY0A 3W2NA 3PUDA 2R91A 4UTHA 2DJLA 3GDKA 3EX4A 1KFLA 3BG9A 1VLWA 4JTSA 2NX3A 3BGJA 5AOUA 1L6SA 1WOBA 1BWLA 4LS2A 3HGRA 3HPSA 1R2SA 4NX5A 4RJEA 1P5BA 3O63A 3P67A 4UXDA 3LXBA 4IX0A 3W2KA 5D2YA 1HG3A 1TPVA 3OHIA 5BOOA 3QW3A 1X1ZA 2PRLA 3IIXA 3NZ1A 3OVPA 2DZWA 2FPYA 2OT0A 3LHUA 4JTUA 5D38A 1XI3A 1PHWA 4ADTA 3N2MA 3E9AA 1EB3A 3NPVA 4X22A 3BGGA 3WK1A 1RVGA 3G1HA 3MBFA 3MP4A 3TC6A 3C2EA 3E02A 3KXQA 2ZZ7A 5T26A 4MKNA 2ZBTA 1EPXA 1ZCOA 2C0AA 3W1QA 1JVNA 4HNNA 3KOFA 2AGKA 2ZZ4A 1QPRA 2NZLA 3LBCA 2LLEA 3M43A 4JX6A 1AL8A 2E5BA 4YMZA 1GG0A 4K7YA 1XFBA 3QQ1A 2QCEA 4Y8FA 1G69A 4R34A 3W7RA 1IF2A 3FOKA 2RDWA 1SO3A 2Q8LA 2ATSA 3NGJA 3UYCA 3LHZA 1H60A 1JRCA 1KFBA 4NQ1A 2BX7A 5DELA 4JEQA 4IWWA 1FDYA 3T78A 2CLEA 3N14A 1JQVA 1S5WA 3OVQA 2NUXA 2E6DA 1OX4A 3BV4A 4IX2A 1I2NA 2G95A 3VFLA 2CLLA 1YADA 3GDTA 4XBSA 2YYTA 1PHQA 3WFAA 4UNLA 5F2IA 2EKCA 3QQ0A 5AC7A 1VYPX 4M7SA 5HNRA 3W7NA 1DKWA 1W8SA 2TMDA 5I3JA 3NDOA 1SQ7A 4NXSA 1IGSA 1GQNA 2Z1BA 2B7NA 3EXSA 1NF7A 3TCEA 1WYIA 4LVGA 4BFAA 1X6UA 4NJGA 2YXGA 1QDSA 5AFDA 4ZQNA 1VGAA 1BKSA 2RH9A 1EA0A 2V81A 3S5OA 2X16A 1QFEA 4GUGA 3I7QA 2I1OA 2WSYA 3EWBX 3VE9A 4O4VA 5G2WA 3P8IA 1A5AA 3EKZA 4HNVA 2WSRA 2NUYA 4O0ZA 2A0NA 2VENA 3BLEA 2JKAA 4G1KA 1TJRA 2QUUA 1K03A 4A2RA 4O0KA 2A6NA 2JKEA 3Q37A 3TAOA 1AK5A 2VFIA 4DF1A 1JRBA 3GIYA 3UPBA 2Q3RA 3EX1A 4JD4A 3Q2DA 3UY7A 4RLIA 3WK0A 5AC8A 3NR0A 4IPIA 4RXFA 1J4EA 1S5VA 1X1OA 1ZHAA 3BG3A 3M5XA 3NQ7A 4PODA 2V82A 4LRTA 4UUIA 2V2DA 5MHBA 3N73A 4WX2A 4YL2A 3PM6A 5F2LA 4UTIA 3R12A 3W70A 3BK0A 4O19A 1G6CA 1SZFA 4QITA 5E93A 1M7PA 1VCGA 5DXXA 2TPSA 3P81A 1SU5A 1TRDA 3NQFA 5AYXA 5K9DA 2Q8ZA 1ZENA 5HQEA 1PE1A 4O52A 1ICPA 3TW6A 3W72A 3TKFA 3NPXA 3O15A 2YZRA 1AW5A 4TU1A 4UTWC 1KFEA 1Z42A 2ISSA 4LV9A 4WJEA 1SO4A 2H90A 2C15A 3BLFA 3BW4A 3LDVA 3GAYA 3SZ8A 1MZHA 3KAOA 2Y7GA 3NL5A 1EEPA 1PCKA 3T4CA 1W31A 2ATMA 4FHAA 1K7FA 2ZZ1A 5KZEA 4HT3A 5D04C 4HPJA 2OCZA 4X9SA 1XBZA 3MMTA 2YPIA 3MYOA 2EHHA 2G5WA 4CNPA 4WQ6A 4UTKA 2QUTA 3O07A 4ORIA 2AQWA 1K8YA 2AAMA 3RLUA 4UMAA 3M5ZA 5TQLA 3W7DA 4AAJA 1YXCA 2Y88A 5FEZA 3LBMA 3UWVA 2FPVA 2PE4A 3CIWA 5AYZA 2XFWA 6ALDA 5CPNA 1KV8A 3W2JA 4AF0B 1UCWA 3CEPA 4O53A 5D33A 1AMKA 1RR2A 4AVFA 2WOQA 3W1MA 2DJXA 4BI5A 4A2SA 4H3DA 1M6JA 3F1QA 3EWYA 3G0SA 2ZDRA 2YX0A 1KM2A 3CHVA 1WQ5A 3LHYA 1GVFA 1GTEA 3R2GA 3GDMA 3HB9A 4O8RA 4IMCA 1V7YA 1ICQA 3UXAA 1XXXA 2FLIA 1G4PA 2Q3OA 2GJNA 3UY8A 4R53A 5HMSA 3NM1A 4P2VA 1XDMA 3LRKA 2P0OA 4LV4A 1Y0EA 4NJHA 4O18A 1X7FA 2ZA2A 3M41A 5F2GA 1XC4A 3QSTA 1VHCA 4WD0A 4ZQCA 5K2ZA 3CWOX 2E6AA 2R14A 1QMLA 3BO9A 1UB3A 4NJKA 4K7VA 5DN1A 5TIMA 2QAPA 4XTIA 3G1AA 3S5ZA 2FJKA 4FIQA 3GK0A 5HWMA 5FEXA 3P60A 4DPQA 4O50A 4P61A 5EMUA 1E51A 2ZRWA 4N6FA 1C29A 3MBDA 1O94A 3L68A 4JTJA 4HSNA 3G1FA 2H3DA 1WBJA 5AHMA 4UTWA 4CNNA 2BTMA 1F6KA 1H7NA 5BMXA 3B8DA 5AHNA 1F76A 1ZNNA 3TR2A 4ZQOA 3NVTA 5F1UA 2ZCGA 2P10A 4XZ9A 1EP2A 1SW7A 3RFAA 1GPWA 2ZA3A 1DBTA 4O54A 1ZY9A 4B5NA 1DHPA 3NQ8A 4AWTA 1SO6A 5CGQA 1GZGA 1YXYA 1NEYA 3FJ6A 3A22A 1W3TA 3F4NA 4S2CA 2R8WA 5KITA 3FJLA 4CCCA 5F4SA 5LNRA 4A22A 2V5LA 1KV5A 1J5TA 3P80A 1HO4A 4MY1A 5TBOA 2VEPA 3PWAA 4JYFA 1OYAA 4JX5A 3DFPA 4E38A 3A21A 4WY0B 4TMBA 5DBUA 4FNPA 4Y9AA 2GVLA 3SSJA 4JNMA 3QMRA 4LS1A 1GJPA 4DELA 3SIZA 2KZHA 1SW0A 1H7WA 3KVLA 2TRSA 3G8EA 3MP3A 3B0PA 4RKAA 4GWEA 4H6KA 2BXVA 1LRTA 4E0CA 4WXYA 1PS9A 3M7WA 2ZZ3A 3T44A 1I4NA 2H8XA 2VKZG 3G8RA 4UFLA 3B0VC 1TTJA 3PUEA 3W86A 4MYAA 1WDWA 1VH7A 1SPQA 1KM0A 1G7VA 3BARA 4OE7A 3UZ5A 1LP6A 3PBWA 1H63A 1TJPA 1PV8A 5D09A 4OBTA 3NEVA 1X8FA 2NUWA 4ZQMA 2TYSA 3LCIA 1AW2A 2GJLA 4NU7A 4CQ8A 1I45A 1LBFA 4ML9A 5U7SA 4GBUA 4XWUA 1JUBA 2F84A 3STCA 3W7GA 1KTNA 1SSDA 3G0XA 4UTUA 2QKFA 4W9TA 3DGRA 2ZA1A 3CEUA 5KZMA 4BF9A 2CLMA 3DI1A 1KTBA 1A5SA 3S42A 2J6XA 5E1QA 1W0MA 5CZJA 4DPPA 3SY5A 8TIMA 3LLFA 3PG9A 3M6YA 1TPEA 5D02A 1VHNA 3CWNA 2NWSA 1OX4B 1M7OA 3HGSA 4MY8A 5CZSA 1ME7A 3BW2A 4C1KA 4PL1A 1FCQA 4N9EA 3GVGA 4UTMA 2E09A 4AB4A 3A23A 1ZJIA 1EIXA 1CI1A 1YDOA 1TV8A 1GWJA 1L6WA 2J27A 1WBHA 5CSSA 1YLVA 4LC6A 3WK3A 3L0GA 4O15A 3MHFA 4JTTA 2BWGA 4K6AA 3TFCA 1IXOA 3HF3A 4M19A 4O17A 1HL2A 2CW6A 4GUIA 5BMWA 3G1DA 2PCQA 5A8GA 3IIOA 2DU2A 1GT8A 2CWNA 3HG5A 4CLMA 4FX8A 1XKYA 1A53A 5CPOA 3UNDA 4ZQPA 3C4UA 2E5CA 1GVQA 1LCOA 3GAKA 3LTYA 4UMBA 1IXQA 3NL2A 4N6EA 3LGEA 1OG0A 1EWDA 1DOSA 3W6YA 4IPJA 4EF8A 5FF4A 1QOPA 3P82A 2VEMA 4MJZA 1H5YA 1YPIA 1JCNA 1SZGA 2YDAA 4MJMA 2OT1A 1JULA 4O1CA 3M5YA 3HGJA 1MSSA 3ABRA 3W22A 4UR8A 3W75A 3N2XA 5U4NA 3THAA 1UUOA 3KVJA 1YXDA 3HPZA 2WO5A 4FIRA 4QQ3A 3UXDA 4GUJA 3IGUA 4TR9A 5EY5A 1H61A 5H2ZA 1K7EA 1LOSA 1XDLA 1LM1A 2J9YA 1Q6QA 3SW6A 2BLEA 3S8HA 3S0CA 3NO5A 3A24A 4GXMA 3SGUA 3BLIA 1H51A 4GUHA 4E2BA 2WNZA 3GLCA 3TAKA 2FTPA 1LROA 3ELFA 1LZOA 1NAL1 2WSQA 4O1BA 3HOJA 4ALDA 4OU1A 2RKXA 5KMYA 3LCWA 4NT0A 4UNKA 1GEQA 3B06A 4IXHA 2HS6A 4NZJA 4BK9A 1FWTA 2RHGA 3STFA 1SZNA 1FXQA 3P7YA 3I65A 5CZ0A 3TSDA 4IQLA 3L67A 3Q58A 4IXXA 3AJXA 4UTTC 5DBTA 1VCVA 1G7UA 1VPXA 3GB6A 3PG8A 1OFPA 2QUVA 4TIMA 1OFQA 5K3VA 4O14A 4PL2A 3EX2A 3N34A 3NQDA 3UWZA 1RZMA 3L9CA 1Z41A 3QRHA 3RLVA 5LKYA 3DFTA 2NV2A 4I7WA 1O5XA 4HN4A 2QCFA 3DU0A 1ONRA 3EWUA 1Q45A 1KW1A 1A5CA 3JR2A 3DENA 3LHVA 1G4EA 3L0KA 3S5YA 2ZRVA 3NQAA 4XTDA 1NVMA 4LS0A 2V9DA 5AHFA 3ZS4A 4JN6A 1FWSA 3FIGA 2ZFAA 1T0OA 3SR7A 4M5PA 3QYQA 3IGXA 3NM3A 4UTLA 3KFTA 1TIMA 4Z1BA 2B0MA 1FQ0A 3IEBA 3TQ0A 3V1PA 4MZ8A 1VYRA 3JRKA 3DFSA 5LGXA 2ZZ5A 1U5JA 5LNUA 4DXVA 3QMTA 5EA9A 5D37A 3ZWSA 4RR4A 3C56A 1CW2A 3IVSA 5D2XA 1L9WA 3O16A 4MPQA 3FKKA 1GYLA 3W1TA 1TTQA 3MW7A 2D73A 2V0TA 2GQ9A 4NJIA 4L4MA 2XN0A 3F03K 1OYBA 2J9ZA 1K02A 3IGSA 4U28A 5CPMA 2W79A 4LOCA 2WNQA 2ABAA 1EP1A 1SW3A 2QJGA 4LVBA 4Z1DA 3W76A 4DBDA 4EWND 2HTMA 5HR7A 1T96A 3LI0A 3AO0A 1T99A 4O13A 4MIMA 1DL3A 2F7FA 3LERA 3ABOA 1EWEA 1TCDA 3JS3A 1XM3A 5C54A 1D3HA 3TXVA 2GQ8A 4OT7A 1BEUA 4GRSA 3EWXA 3TH6A 3IIVA 4FO4A 3HO8A 3IIPA 3C2RA 3IRDA 1ADOA 3W7MA 4MFEA 2JBMA 3HJZA 2VFGA 5DY2A 3W83A 3QPYA 4XQ6A 5J5DA 3O06A 4S1FA 1J2WA 3W7JA 4IOTA 3NG3A 5EKYA 1XUUA 3OIXA 2EF9A 3LTSA 4UTTA 2A85A 3M9YA 1SFJA 1I2QA 3LTPA 3K30A 3CT7A 1QCWA 2A7PA 1FY6A 2G97A 3MHGA 1JCYA 1G4SA 4JTHA 1EX5A 3U2OA 3NL6A 1Z44A 1K7XA 3W7HA 1I8JA 4GFSA 1OJXA 3OG3A 3H53A 1IIGA 1S3HA 1Q6RA 4OV4A 3V75A 4DF2A
chains in the Genus database with same CATH superfamily
2NSXA 4XKMA 1BLIA 3FA5A 2WBKA 2V5BA 3MSYA 3WH5A 1VLIA 1RP9A 5I77A 1WUFA 3LLXA 2FTWA 4OKDA 1CENA 3EOSA 4JX4A 4AG0A 4L4LA 3TA9A 1Y65A 4E2VA 5C6MA 1KFKA 4XAFA 4PTMA 4BJHA 3DHDA 3W71A 1ZS2A 3NQVA 3M0JA 3O6AA 3OLGA 1ODZA 3M16A 1W91A 1XBYA 1WCGA 7ODCA 1VBJA 1ZAIA 3C8FA 5FSDC 4KWWA 4CGTA 2G3NA 2VO5A 1UKSA 2E28A 3LENA 1AZ1A 1KBLA 3CAKA 4ATDA 1NWTA 4DLMA 2HXUA 4ICNA 3HPFA 3EXRA 1XG3A 3HBLA 3I7RA 4E8GA 1L2UA 4HP5A 2ZRZA 4JICA 1JCJA 2VX4A 1MQRA 3TJXA 4K68A 2QVNA 5LSMA 3WFLA 1S2WA 3TE9A 1DVJA 3B05A 3WH7A 3K46A 1J6OA 2QS8A 1FWRA 3W73A 3AHVA 4Z17A 1EDGA 4OZOA 4ZQRA 1VFLA 2CITA 1THFD 3K8MA 2UY4A 4R9OA 3L12A 4P7OA 3QLDA 3W3OA 2GGEA 4M6UA 3WZ0E 3UF9A 1JCXA 2FGLA 2YBUA 2BP1A 4KWUA 3QSRA 2XZ7A 5CC6A 2C14A 1L6GA 3UR5A 2PEVA 4HB7A 3UWEA 3GDRA 2OR2A 4ZL1A 4DBEA 2WZIA 1CGXA 4ZO6A 2A3AA 1RHCA 4RV3A 4UFMA 3CPRA 2WVVB 5DCBA 2YFOA 1EIBA 4A3UA 5G4WA 2QDDA 2XIOA 3CZ8A 4F40A 3MDWA 4WOQA 1V3JA 5DCDA 1O6IA 4GG9A 4IMDA 4U5KA 1F74A 2X0YA 4HZ8A 2XU2A 2CKRA 3QTGA 3OVRA 7TAAA 3W2MA 5E0CA 1Z7AA 1XLFA 2DQXA 3W7KA 2NV1A 1V3LA 4EXAA 4Z42C 4YTUA 3UZYA 1UWTA 4EK7A 1O7AA 4LCQA 3TEVA 2VR5A 2X1TA 2BSLA 3KBNA 2Y62A 1QNRA 2Y4SA 4AIOA 2VP8A 3QHMA 1YTEA 2GSHA 1I2RA 1C90A 1NDWA 3I4KA 5KZDA 4LX4A 1J6PA 4ORMA 1MXSA 1UKPA 4G5DA 3MCNA 3WQOA 1US3A 1R3TA 3NFUA 1UA7A 5CSYA 4LT9A 3IAPA 3DXIA 3OO2A 2A5HA 2B81A 5A8MA 3WYZA 3AFBA 2CHRA 4GD0A 3FHQA 1A0DA 1BXBA 4AZCB 5BXTA 3IUHA 5CSRA 1FOBA 3N9SA 1K4HA 1LLWA 1XBVA 3K4AA 5DF0A 2E25A 1KBJA 3W23A 1VCFA 3JZUA 3PUGA 4J2MA 2VFDA 2ASHA 4XAGA 3M5VA 2QCDA 3W7PA 4FALA 4UCGA 3VOFA 4INFA 1VEOA 5F1VA 4DJDA 3ITGA 1W9XA 1P0NA 3DGBA 4JY9A 3MMDA 3INPA 2VWSA 2E68A 3I6RA 3S1WA 4I8YA 1OSEA 4HPXA 4D72A 3PZ9A 2OU4A 4RE3A 1PPIA 4UTJA 3RF9A 4BQ2A 4XAPA 4IFKA 1SUXA 1LL7A 4QEHA 3K8LA 4J3VA 5HWJA 2C0HA 2W61A 4GVHA 3GH5A 2W5FA 2QIIA 1NFBA 1IEXA 2Z1XA 1IR1A 4ASTA 2PUZA 3VCNA 4S3CA 1JAKA 4NASA 3WDRA 2ZOXA 1F05A 3EWCA 4IL2A 1FWAC 1XH0A 1QOXA 1X39A 1E15A 3LHWA 4URIA 2IW0A 3EKLA 2XVKA 3B8IA 2XH7A 3TN4A 2NXGA 3CYVA 3L2LA 1XLEA 2HJPA 2XSAA 3O6DA 3CLMA 3QMSA 3MP5A 3MMUA 4LAZA 1KCKA 3KE0A 4V28A 1XRSA 3DERA 1SFLA 1O12A 5D32A 1MXGA 1E6NA 4PTDA 2TSYA 3VK5A 3GW3A 3UZJA 1UKOA 1FXPA 3B97A 1U2YA 1LOLA 1OX6A 1QI3A 2YA2A 1JR1A 1XLLA 5LHFA 3CUIA 2QUMA 1IWBA 3B0XA 4JIRA 1CX9A 1NU5A 2CIPA 4DAFA 5CC7A 1N8IA 3GE7A 3ZWTA 2ZUMA 3R0KA 1K9FA 3R10A 2E6FA 3RCNA 1UWQA 4JHOA 3L66A 3S3GA 4OQVA 4G1NA 3T81A 5FAJA 2FZDA 3V0UA 3QW4B 1O4UA 5A1AA 3PTQA 2PDGA 1WKDA 4OECA 2B7OA 3MUCA 3GO2A 4PTVA 2XM2A 5I3DA 4NXKA 4XZIA 1V51A 4GIRA 1GKQA 3BG5A 1U33A 1LRQA 2J7BA 1J10A 2QJNA 3OP2A 4AUBA 1Y8BA 2DZAA 2X1UA 4A29A 3OA3A 1N82A 3VABA 3CZEA 3QXBA 3W85A 1XGZA 2QEZA 3N17A 1QNSA 1TKKA 4QNWA 1YQ2A 1AA1B 2VC6A 2CXGA 4KFNA 2ZICA 1LWJA 4UQEA 4CD4A 5J5RA 1QPNA 2XSBA 5DT5A 2G4JA 3PF3A 4H83A 1DJQA 2CLPA 3SCUA 1J18A 2MNRA 4GVGA 1J12A 4TX8A 1PZ1A 3VGHA 3BCDA 1J9YA 3AS0A 1PDYA 2NVAA 2IUZA 3AS2A 4GH1A 3MI6A 1DWAM 2DZPA 1KR1A 4I7VA 5F2MA 4BWLA 2OX1A 2XDFA 2AKZA 1DE6A 2XG9A 3A5VA 3AWNA 2WBGA 3BPWA 1B57A 3A4XA 3SCSA 3S2JA 2ZTJA 5D2VA 4LU0A 5IRPA 3AZSA 4JFVA 1TWIA 3HTWA 2JKPA 4DJEA 3UPWA 3Q94A 3HV9A 1P0DA 2O9PA 1EGZA 3NQ2A 1Y5VA 1TTPA 5LA1A 4DRSA 3KWXA 3CUXA 1VBRA 3KX6A 1LLZA 1JZ6A 3GVQA 3DESA 3EBVA 5GNZA 2E77A 4H6EA 2CBJA 3GFZA 1B4KA 1V0LA 3DFOA 2WWCA 3T40A 1ALDA 1S5TA 1BXNA 1VRXA 3H12A 1E6ZA 1NDZA 2J79A 1B9ZA 4MLRA 1TG7A 4YJ5A 3B03A 2WHJA 3LCFA 3T9PA 3PBYA 1AQFA 1CGYA 4JIPA 1E0XA 2B31A 3A9IA 4GY1A 2QJIA 3QHNA 4JDBA 3Q45A 4W4QA 4G7EB 3T09A 1VQTA 3AXXA 1GG1A 3TN3A 1TUXA 3WLSA 4FNQA 5XINA 3DHFA 4ZR8A 3MSDA 4Y90A 1ZJBA 1ME8A 3TUUA 3LM7A 1E40A 1XWYA 4IIBA 4LUSA 4ZBCA 3MWCA 2WQPA 5H8PA 5BCAA 3TC7A 3DX5A 4LBUA 1MVYA 1OABA 2PWUA 3V7PA 3ZOAA 1E5NA 1OD8A 3PPGA 1A50A 4XZWA 3LZ3A 2QV4A 3ATYA 3SUWA 3PJTA 4ZO7A 4XX6A 3WLKX 3CXOA 3MHUA 1ZAHA 3Q4DA 2OMAA 1V7AA 1XBXA 2GDUA 4A3YA 1XF0A 4DF0A 3QZ6A 2AGTA 3DKJA 3W87A 4JFWA 1EUNA 3LCLA 3NXLA 4ONVA 3GYEA 3VGEA 4PBGA 3G1SA 4C6OA 1J01A 1KM5A 4PTNA 4L9YA 3WLQA 1VB9A 5MKGA 1P7TB 4MB1A 1TTIA 2XPKA 4LYKA 2GVGA 5D9PA 2WV8A 2C1HA 1HW6A 3SFWA 1Q6LA 4CNTA 2V67A 4WSKA 4MNKA 3MWAA 2BOFX 4F4RA 4L6DA 1VJIA 4LBRA 4UC5A 1Y5WA 1HIZA 2XGZA 3RILA 5HJLA 3RCMA 2V2HA 2QAFA 1BQGA 1RSCA 4BS0A 3NGFA 3I10A 3GXTA 4MPKA 1JZ4A 3ZYZA 3TVAA 4MG4A 4HIBA 3HG2A 4GFIA 3GXDA 3TTSA 1FHDA 1RPXA 4AXNA 1EDQA 3DHPA 1HF6A 3U4AA 1U30A 1V0NA 2CU0A 1G4TA 2OKTA 5A5WA 1WPCA 2PTYA 3D46A 1KWGA 2OZ3A 3WDPP 4DJDC 6ENLA 4Q6XA 2WNNA 3DKLA 1WKEA 3ABQA 3APTA 2Z6IA 2X1SA 2NQZA 2QULA 2QHAA 4C6BA 4DO6A 3TCSA 4UOZA 3NO1A 4PMOA 1PB0A 2Z4GA 4B5TA 4A8IA 1UR0A 4HHPA 1GVOA 3KL0A 3AHXA 4NRSA 2Z1WA 4MF4A 3TDFA 2VX6A 1DJNA 1XLHA 4QP0A 5M5DA 4KCWA 3SIMA 1FCUA 3I4EA 1RV8A 4DX3A 2X7WA 1RCOB 1UMYA 1CXKA 2J75A 3R1ZA 3PNZA 6TIMA 1Z32X 4YWSA 4HA0A 2HBXA 2Z27A 1JZ3A 1KBIA 3O2LA 2VTFA 2GVJA 1JIBA 4RPQA 4FEZA 2VX5A 1N8WA 1VPYA 2QDEA 2HSAA 2DT1A 3M0MA 3I3EA 2CLOA 4A8NA 2BY2A 3HJEA 5M1TA 3KCOA 1OFBA 1PZ3A 1RQBA 5AVNA 2O7QA 3KM8A 5AYIA 2DZTA 2X05A 1PEZA 4AD2A 3A64A 5E9XA 3AI0A 1U1JA 3THQA 3VGDA 3ZVHA 4TMCA 4C1NB 4HGXA 3VUPA 4PE8A 1QBAA 1CNVA 1OD0A 2PAJA 3KVMA 4S3BA 2PLJA 3D6NA 4Z2KA 4Z2HA 4XISA 2JE8A 2X7VA 3SRDA 2HPMA 3CMGA 4IMEA 1XHGA 5HMDA 1E0UA 4J5NA 2VOTA 2ZXBA 3OBEA 3OPSA 5JVLA 2Y89A 1A5BA 4J2PA 4FOUA 1F61A 1RD5A 1E56A 1CWYA 3TNOA 1CEOA 3ANYA 3U2ZA 3KCJA 1XLMA 2BHUA 4QISA 4A05A 2Z1KA 1PX3A 3HQ1A 2C71A 3LCGA 1GKPA 1JD7A 4A6GA 3NQBA 3KBVA 1T7LA 2QPUA 4S2BA 2R1NA 1LUCB 3PZTA 1JQXA 1SJCA 3TTEA 2HK0A 1O1HA 3QFEA 1KFJA 7TIMA 9XIMA 1Q5MA 3Q67A 2ANUA 3FCPA 4F2BA 2ZADA 1JXJA 4GI9A 4POCA 5HULA 5AC4A 4GXWA 5ABEA 3H2NA 1YPFA 1EP3A 3S1XA 2FHBA 1SYTA 5LYRA 4PUUA 1OZMA 1FVPA 1E1CA 3USBA 2C16A 4LVAA 1QAPA 1A4LA 1WDQA 3FVMA 1PBGA 1OYCA 3HG3A 2PB1A 1TPH1 3VD3A 3KL5A 1EZWA 2BZNA 2IKGA 4H9YA 3QGAC 4K36A 3TSMA 3AS3A 1Q7QA 1IQ8A 2YL5A 5A95A 1Q3NA 1MEHA 4JTLA 1DJGA 4BWLC 3PPFA 3E38A 4NZCA 2CERA 3BOXA 4UTHA 2DJLA 3GDKA 4GI8A 3ZIZA 1XIEA 3V5CA 1R3SA 1YNQA 1WOBA 3HGRA 3P0WA 4GZ7A 4NX5A 4DJEC 4IMAA 4GJJA 4NRRA 3GH7A 4S3KA 4BKNA 3WG6A 4AD4A 3UXLA 3LXBA 4IX0A 5D2YA 4PTXA 1QK2A 3CL7A 1TPVA 4Q22A 1WDPA 1X8CA 1R3WA 1PHWA 4ADTA 3VXGA 2G4FA 4WF7A 2ZZ7A 4QLJA 2PODA 4DY1A 2ZBTA 4J27A 4YHEA 1XYFA 4IM4A 2C0AA 3W24A 4Q8PA 4HNNA 2AGKA 3KOFA 3LPPA 4IIDA 3LBCA 2LLEA 3M43A 3OGSA 3APYA 1M41A 1GG0A 1FWIC 4ZOEA 1QW9A 2A79A 1CDGA 2VUNA 2RDWA 1ECEA 1V4YA 2HRWA 2YCLA 1KFBA 4HJWA 3ONCA 4JEQA 1FDYA 3CO8A 1JI1A 1S5WA 4BA0A 3OVQA 1OBAA 4K1GA 2NUXA 5TD4A 5A8PA 1A5LC 1PO9A 2G95A 2GYIA 1ZTVA 4DB7A 4EXQA 3GDTA 1NDVA 4Y9MA 4HZMA 3GNXA 2DUAA 4PMNA 2YYTA 3WFAA 3PPHA 5AC7A 3QQ0A 1A49A 1DKWA 1CTNA 3RPTA 2TMDA 1SQ7A 1GQNA 2Z1BA 4M81A 3EXSA 1NF7A 4O0QA 1E0TA 3MVIA 1OB0A 2WJEA 1EA0A 3LUTA 4MDOA 3BLLA 4PB3A 3V0SA 2X16A 4GUGA 4ATLA 4G7FA 2G37A 4HPHA 1ZRQA 1P6CA 4IJRA 2WCAA 3P8IA 4QHRA 3WBYA 2NUYA 4IP7A 3P14A 3PBGA 4BZYA 4IQEA 3MKCA 2A6NA 3Q37A 4DF1A 1H09A 4YIWA 3VIGA 4JD4A 4EP8C 4Z2GA 1Z9AA 4IPIA 1JZ5A 1J4EA 1ZBVA 4H19A 4OOZA 2G3JA 3NQ7A 3LBOA 3WQVA 3BTNA 4WX2A 2C8NA 4YL2A 2R9RA 1P48A 2AOSA 2DW7A 2E40A 2YA0A 3N11A 1G6CA 1VCGA 3RLGA 2TPSA 3P81A 1TRDA 4KIEA 1EO7A 1NP0A 5K9DA 4C7FA 3PZOA 3NPXA 3O15A 4KESA 4RDVA 3GW0A 4IGNA 1Z42A 4LV9A 3FAWA 2Z1VA 3SUTA 4F9JA 2PDJA 3CK5A 2Y7GA 1UR1A 1PCKA 3T4CA 2ATMA 4CD8A 2ZZ1A 5D04C 5HJYA 4ERAA 3WQWA 4M0XA 4CQBA 5HANA 1F4HA 2EHHA 3F4CA 2OWCA 4WQ6A 4EAYA 2QUTA 1MQQA 4JFSA 4JKMA 2AQWA 4AZBA 3ISIX 5CJ5A 3RLUA 3HQPA 1EBGA 3WQ5A 4JHMA 3W7DA 4KEUA 3KZSA 2FMNA 4BCEA 1RALA 3CV7A 3UWVA 3TR9A 4QLLA 4M56A 4HZ7A 5AYZA 2BFGA 3W2JA 3L4WA 1R0MA 4V2XA 3R79A 3KL3A 2ZXDA 4AVFA 4YYFA 2Q01A 4BI5A 4A2SA 5HQLA 1M6JA 1ESWA 3GBEA 3LHYA 3T2OA 4O8RA 1SM9A 1K9DA 1V7YA 2Z7KA 1Q7ZA 4AEFA 4H00A 5FOOA 1F8MA 3TYCA 4W87A 5I23A 4O18A 4KERA 4L5ZA 1XC4A 2QPSA 5FCZA 3LU2A 3SEPA 1CPUA 1QMLA 1UB3A 3BO9A 4NJKA 8A3HA 1I60A 4F0LA 1RCXB 4JKLA 4KGLA 4MSSA 5FEXA 3GSMA 4DPQA 1E51A 3WF4A 3AU2A 3CAVA 4HSNA 2YBTA 3ZJ7A 2ADAA 2ZUSA 1E0WA 5IXEA 2IQ0A 3WDJA 1ZNNA 5A8QA 4J7RA 3RFAA 3S9IA 1EP2A 1DBTA 1XGEA 3KOWA 1NEYA 3FJ6A 3A22A 4QE5A 3L23A 4HHLA 5LNRA 3VZYA 2O4QA 2Z2AA 1TZ7A 3BAXA 2Y5SA 1J5TA 1OCQA 2WNWA 2EEXA 3FXYA 2VEPA 3TZFA 4FNPA 4GQGA 2ZVIA 3TJIA 3GTFA 4UQ9A 1Q7MA 4DELA 2ON3A 1GQIA 3WL1A 2PTWA 3FGCB 2NSOA 3ANUA 1ISYA 4GWEA 4AD5A 2V5CA 2ZUTA 2I9UA 4QX4A 4AYGA 4MJ2A 4IT1A 4W7UA 3M7WA 2ZZ3A 3T44A 4LCSA 1BG9A 1D3CA 4QS5A 3PUEA 4Y7EA 1K8CA 3GBDA 1I0BA 5DX7A 3URQA 1RBOB 4XB3A 3KP0A 3SQSA 2YCKX 4AZ5A 3NEVA 5JUVA 4CQDA 1UR8A 1ADDA 1AW2A 2BVYA 4CQ8A 2FGZA 4ML9A 5U7SA 2ZX7A 4GQQA 4QROA 1OGSA 2YXOA 4M3PA 1E1FA 5DT7A 4N7QA 3HMCA 4UTUA 2NV9A 1MQPA 5H1WA 4XZMX 2D0HA 4IIFA 5CC3A 1FA2A 4M1BA 3S42A 2J6XA 1MW3A 2HVMA 4FR1A 4DPPA 3SY5A 4GNKB 3LLFA 4CU7A 4NIRA 1TPEA 3FNDA 3VNLA 5D02A 3F2DA 3VIJA 3CWNA 4NAFA 1OX4B 1ME7A 3BW2A 2FKPA 1AJ0A 5G4HC 4PL1A 4QDWA 4BQ4A 4UTMA 3E0VA 4AB4A 1EC8A 4Y9NA 3IK4A 4I3GA 3K4WA 1ZJIA 4IFRA 1TV8A 3AAMA 1GWJA 1L6WA 5CSSA 3WN6A 5DRIA 3GHTA 2O55A 1QT1A 2I7GA 2WJFA 1P0BA 2WZTA 4JTTA 4JL2A 4O15A 3HF3A 3E5BA 1E72M 4GUIA 3G1DA 5HOSA 3IIOA 1UP3A 1Y7VA 2CWNA 1B3VA 1XKYA 3UNDA 2PWFA 4J3XA 1C93A 3IWPA 1LCOA 1CT5A 3ERPA 2VT0A 3NL2A 3LGEA 4N6EA 1EWDA 2O4MA 4IPJA 3WUGA 1QOPA 1BSLA 2PS2A 3ITCA 2VEMA 1JDEA 1YPIA 2YDAA 4E4FA 5EMKA 3E0WA 1JULA 4AIUA 2J8FA 1MSSA 1KCXA 1WZKA 3N2XA 2JFEX 3LPGA 4HMDA 4HYRA 4QQ3A 4TR9A 1K7EA 3WLOA 3QZAA 1KQZA 3BAIA 5DMMA 3NURA 1Q6QA 3SW6A 2WXDM 1NWUA 3BWWA 1BQCA 3S0CA 2F2HA 3NO5A 3SGUA 4GUHA 2XYLA 3CYJA 4E2BA 2WNZA 2R6OA 2D2GA 4C6KA 4RL3A 1T8QA 1LROA 1C92A 4GC3A 4JZ5A 4XZBA 1LZOA 4ZSUA 3HOJA 2RKXA 3EDDA 4GVIA 2BODX 3WD3A 2Z2BA 1OC6A 3PJXA 3GC4A 4PUJA 4EANA 4L7ZA 4BK9A 2RHGA 3STFA 3P7YA 2POTA 3I65A 3TW9A 2VDIA 3GG0A 4IXXA 1PKYA 1VCVA 5IOBA 2WM0A 1OFPA 1QU4A 3TYZA 1MMFA 4B2DD 1S1RA 1Z41A 1D7KA 3UJEA 2OEJA 2VCBA 2NV2A 5JBDA 1XLCA 2QCFA 2OWWA 1Q45A 3DENA 3LHVA 1G4EA 2ZRVA 1ODUA 2V9DA 2BOGX 4JN6A 1EJUC 3OQEA 3FIGA 3IGXA 3KFTA 3UGVA 4PUMA 1NARA 3UT0A 4F0SA 3R58A 4KETA 1VYRA 3NSXA 3JRKA 1EYWA 4OTKA 4XVDA 1GOIA 1GW1A 4HSHA 1Q2SA 1YHTA 3LMYA 4DXVA 3QMTA 3IJ6A 2P76A 4DWSA 5REQB 2O0TA 4ZCWA 3ALGA 3F4DA 3GVVA 2HEJA 3K1GA 4UR9A 3UEQA 3O16A 5CCZA 1GW9A 3P2VA 2D73A 2W3ZA 3KBWA 3UCCA 4U3CA 1FH8A 3F03K 1K02A 2W79A 1UC4A 1KR0A 4DM2A 1CYGA 4MDPA 3W76A 1B3XA 4MB3A 3EOLA 4LFYA 4O13A 3EOEA 4Q4QA 4MIMA 4W84A 1DL3A 2PFHA 3LERA 1EWEA 2GQ8A 4LUTB 4OT7A 4Q8NA 1ADOA 2VZUA 4F3HA 1JNDA 4XAZA 3QPYA 1WP6A 3TYUA 3O06A 1SGJA 1Q2RA 4D71A 5JBEA 3PZUA 3WF1A 2WYSA 3OIXA 4UTTA 1SFJA 1UD5A 4MADA 4AD0A 1QCWA 2L5HA 3NZGA 4F0HA 2A7PA 3REQB 3TONA 5DQPA 3M0VA 3QN3A 3ZXWA 1BVZA 3OG3A 2YOCA 4C6QA 1JZ7A 4DF2A 3FA4A 4I9MA 2WM1A 4RPPA 1CGTA 3URBA 5C55A 5I3FA 4J3SA 3MKKA 2Z7GA 3ATZA 1DJXA 1SMDA 3ZR4A 2GOUA 4DNMA 3UR8A 5IBXA 4AX6A 2XZ9A 3C6CA 3E49A 2WCSA 1UH2A 4D6FA 3T07A 4LGXA 1LTDA 3S2NA 1Q6CA 2RFGA 2EBNA 4MWAD 4WGXA 4LPCA 2GK1A 1TMHA 4D2JA 4IGMA 2GJRA 2EAWA 4D1JA 4PMRA 3FS2A 2DZBA 2WSKA 1B4EA 3V5OA 4HHHA 4DO5A 2EG7A 3ZVHB 4GZJA 3FEQA 4QXIA 3SECA 2V5DA 2Y7DA 3P8JA 2P5NA 2XVLA 1CLXA 1OK4A 3VNDA 5BYWA 4K8HA 3CPGA 1I2OA 2EPKX 5K7JA 1PKNA 3GU1A 3NPWA 2Y2WA 1AVAA 1UQYA 1XLBA 1TPFA 5IHRA 3VKAA 1XDJA 2WC4A 1VKFA 3KS5A 3SURA 4REQB 5IHSA 1RUSA 1HFBA 5BOFA 2HNHA 4L9ZA 5D03A 3GNDA 1QO2A 2B7QA 3A6OA 3PB2A 4K38A 3VC5A 4LH8A 2ISDA 3F4WA 3OB8A 3VZXA 3LHTA 4CVWA 3DI0A 4GVFA 3WK2A 1WX0A 1YKWA 2HROA 2BVWA 1HKMA 5HWNA 3PANA 3MS8A 3T8QA 4N0RA 4Q6JA 1AQHA 4S39A 4MWAE 1KFWA 2DT3A 3OBKA 3K13A 1GHSA 2W27A 4MB5A 4TV5A 3POCA 4M8UA 1KTCA 3S6TA 3RO8A 1AQMA 2Z00A 2DP3A 4EF9A 2POZA 8XIAA 3NQMA 2FH8A 3WMLA 2PDFA 1E1CB 4QGCA 4A8RA 1IWPA 1YX1A 5IFTA 4NI8A 4HU0A 1D3GA 3W1PA 3R8GA 3QGVA 4F79A 1VYSX 1AUSL 2ZYFA 4RNFA 1L6YA 2DVUA 3CHCA 5BROA 9RUBA 2PDXA 2E5DA 5CAKA 2H3BA 1JCTA 1UR3M 1FWJC 3PVFA 4XO6A 1YNPA 1G0CA 1P0EA 3WH6A 3TROA 3LNPA 1QPQA 2CZDA 1UD3A 3NQCA 4XKYA 4AMAA 5LIKX 1OX5A 4JQ4A 1W9DM 1KLZA 5HK4A 3ZFHA 2PWVA 2NQHA 4U5IA 2E8YA 1GVSA 2B4GA 3UXIA 4O4WA 1SMAA 2W91A 3BVJA 2QCHA 4P7NA 4H41A 3LNMA 2QDHA 1FDJA 3AYSA 3MPGA 4PC8A 3N9KA 4UQAA 4S23A 1CCWB 2CZFA 1F8IA 3NDZA 3LRMA 3H54A 4FX7A 4TV6A 1OZQA 2YSWA 5KETA 3BURA 3PBUA 1S2VA 4H4IA 4Z2LA 3AIVA 3PWIA 3P3BA 4NZ4A 4BY3A 3OYXA 3QR3A 1GORA 2XTKA 1GVRA 1XP3A 4PCPA 4CUCA 3NPUA 5BWAA 2YCLB 1POJA 4AF0A 1WAUA 4FNUA 4QJ5B 5ABTA 1MNZA 1TV7A 1UBSA 2FH6A 1GJUA 3TU9A 3MUXA 1E6SM 2RJGA 1OQFA 1MDLA 4U31A 2V8ZA 1H11A 2XVNA 3RHGA 4LUYA 3RX4A 3U5UA 5AHEA 1I0DA 3ORWA 3GZ3A 3IJLA 4ZO9A 4NF7A 3CQIA 4NP7A 1UIPA 2R1KA 4AY7A 1JUEA 4KEVA 1XYCA 3RM8A 4FA3A 4A3QA 3OGRA 4U3AA 4ZOCA 5FEWA 3FJ4A 3ARPA 1QW8A 2D22A 3PSVA 2A1YA 2DFAA 4FSAA 2NQ5A 1TWSA 3CUJA 1W3NA 3KEHA 2X2GA 2Z0IA 4YS1A 4XIAA 5CGMA 4GKLA 3T0CA 4HCHA 3OGVA 1R47A 1FDZA 1F2JA 1LBLA 1YEYA 4XSMA 3F7JA 4OUIA 4DWSC 3L5LA 3O6CA 4EPBC 2CLFA 2YW3A 5D4YA 1BF6A 3ZLGA 4PUDA 3RU6A 1R3YA 1PCWA 3TSBA 4WDXA 1ADSA 4Q8VA 2WJDA 2F9RA 1B9BA 2Z2UA 2D69A 2YW4A 5K4ZA 5I03A 4MUPA 2E9MA 3LD5A 3NZRA 5DLCA 2VXNA 5FF3A 2J7CA 3NL3A 2OKOA 2PGEA 4GO8A 1JUKA 3WCZA 2OGYA 3TMLA 4E2DA 1MW1A 1S1PA 4IG2A 2ODOA 1M03A 1RBAA 4IJCA 1S5MA 1Z6KA 3AIQA 4QJ3B 3WJYA 2OOGA 1VS1A 1DPMA 4GYFA 4YVVA 3RU8X 1C8QA 2EG8A 1XUZA 4LAMA 2EGZA 5I06A 1N2VA 1Q8JA 3WLRA 4GX8A 7ENLA 5BU6A 2CCRA 3GNRA 3I68A 5HAOA 1PTAA 3KP1A 3VOCA 2WMIA 2W0UA 1E55A 1VC4A 5FJPA 1A5KC 1FHUA 1QI0A 2GLKA 4ZENA 2DZVA 1TPUA 5LZLA 1AODA 4NAEA 4RDYA 2FIQA 3ARZA 3RM4A 3AZRA 2BGNE 5G5IA 3GR4A 2XIIA 2OVLA 4ZXLA 1X96A 3ZSTA 2WSPA 4CQ9A 3HIJA 1HVXA 4H1ZA 3TW7A 2DW6A 4ZZ9A 1QUMA 1RJPA 4JIQA 3UU0A 1C7SA 4TO8A 4KRTA 3N6HA 1N7KA 1B0IA 3TA6A 2OQYA 1HUVA 2A7NA 1NSJA 1LQAA 5LNSA 3ME3A 3GC5A 3NAVA 2E6YA 1V3IA 5IBXC 1D7FA 4QSHA 1BWVA 3TLQA 5A8OA 3PC0A 3M0ZA 2CBVA 2Y7EA 1QNPA 5EGRA 4EX4A 5I2UA 1V93A 3VKKA 5GVJA 2GJXB 4GIEA 3EA3A 1G5AA 1KRMA 1H7XA 2J4GA 1ITUA 3BJFA 4F8XA 6CGTA 1XIDA 1TSIA 3FDKA 3NO3A 3ZM8A 1YYAA 1E4NA 4QIUA 4ZEPA 3G1VA 5DXYA 4PBEA 3WNPA 1SJDA 5CGTA 4R7JA 4LF1A 3WEOA 4J1OA 2W63A 1B30A 1EGVA 4J9JA 1JGIA 3RIKA 3WQCA 5BXSA 2OZTA 1O95A 4HVXA 4NVTA 3W1RA 4OUEA 1GGOA 2ALDA 3W1LA 4S3GA 4O10A 1R85A 2VELA 1VR6A 1H1ZA 3NSNA 3UG8A 4PMZA 1MYRA 1J5SA 3L21A 3CC1A 1W1IE 4R88A 4JTKA 5I6SA 1LG2A 4QAIA 3NA8A 5LNVA 2GGHA 1EEXA 3CHEA 2VZOA 3HQNA 3NIYA 1HKKA 3TQVA 1W3JA 4I5RA 3PZQA 1G01A 5FJJA 4V1XA 3VGBA 2ICSA 9CGTA 7REQA 4Y6GA 2QXWA 1B54A 1UJPA 1W9BM 3GXMA 1HL8A 4RV8A 4YTRA 4P8WA 3T0AA 4A21A 1UWIA 1WZAA 2WLZA 1E9YB 2GPTA 2FQIA 1W17A 2QCMA 1TV5A 3LOTA 3H7UA 3H22A 2J7HA 1QO5A 3WJXA 3W2LA 5BOEA 3UQNA 1P0KA 1X7IA 4KKXA 2QJMA 2PLKA 3SUVA 3T6CA 4RZ4A 2V68A 3BXWA 6XIAA 3WQPA 2ZIDA 1PX4A 2PP0A 1GOKA 3KRSA 4PB5A 1UR9A 4GJ1A 1KM4A 2QGYA 1XPYA 4JTGA 3U5YA 1C91A 4WSJA 3BLDA 3N4AA 3K2GA 4Z1YA 3SCQA 4AVNA 2Q02A 1M68A 1WXJA 3W2UA 4JNZA 1XYZA 1EH9A 4WDTA 1L0PA 1O60A 5DY3A 3KRZA 3GNOA 1GPFA 3CU2A 3QC0A 3W1AA 1SZEA 3YPIA 1V6WA 1QNOA 4MNJA 3SFKA 1I2PA 4ZE5A 3UVAA 2CZ5A 3GWQA 4GK8A 4W8AA 5EMMA 4N2YA 5C70A 2TAAA 4HYVA 4TTUA 1MRQA 2YL8A 3C61A 1YMYA 2XGBA 4CD6A 2ZXQA 3GXFA 2WVTA 4YTTA 1MWOA 1LT7A 4YLWA 2VVSA 1I9CB 4PTWA 1VPQA 4PSPA 2YL6A 2XN1A 4W93A 1BHGA 2WPGA 3C3NA 3U2CA 4C65A 4IUOA 4Z2IA 1KO0A 4RW3A 3RLHA 2DZXA 5FSEC 3PN8A 3TK7A 1KGWA 1DQXA 3RYSA 1KM6A 4XD3A 4GNVA 2CHOA 4QNEA 4FB7A 1IZJA 1P43A 2FFCA 1JGMA 3RXZA 3KUMA 3W7IA 1QASA 1U1UA 2RDTA 3UG5A 4TTGA 3GG8A 1E3XA 3VCCA 4HCLA 1R87A 5FI8A 4UR7A 4JIHA 3BDKA 4AHQA 2QCNA 4IPNB 1CXFA 4KFOA 1WA3A 1RXOB 3KHDA 3GUWA 4NJJA 2Y70A 3RO6A 4DO4A 3O0FA 4NG3A 3P5YA 3R25A 4PEKA 3N3MA 1V08A 5AHIA 1XLDA 2CETA 3RK8A 1RVKA 5I3KA 2D3LA 3GVWA 4MTVA 3G3MA 1YNYA 1MZRA 2VOMA 3HG4A 1UROA 1QW7A 3ICJA 3IVUA 2OLHA 3H24A 4DVOA 4DI8A 1XIIA 2XSXA 4GUFA 2CKSA 1GQJA 3CASA 4JXCA 1TV4A 4B3ZA 2OX4A 3S1GA 4F0MA 3NEHA 1EJSC 5BRPA 3QV7A 3AIWA 1B90A 5H91A 3BGAA 3TJLA 3O9NA 1WNOA 4PCFA 5AHLA 5XIMA 3C86A 3DCPA 3UG4A 3W29A 2PMQA 2FYMA 1B3ZA 4AY8A 1TO3A 2HXTA 1EJVC 1HO1A 3G2GA 5HMFA 1TWZA 3ITYA 1L8NA 2J8GA 1G67A 3N29A 2VX7A 4HNTA 1AW1A 1IEWA 2A6LA 1XLIA 3ABXA 1Z89A 1V02A 1F73A 4I6KA 3B9NA 4NKCA 1FRBA 2WPBA 4IIEA 1OK6A 2XN2A 3LGDA 4YCPA 4QJ1A 2O9OA 4FXRA 1NH6A 1RQHA 3GTXA 4WOZA 5M17A 5CG7A 5LGZA 3CHFA 3WIJA 2CZEA 4WK9A 2BOEX 3C2FA 4Z08A 3P84A 2VDHA 2C3ZA 2YDRA 2YLLA 3NSMA 4IGHA 4W7WA 1OFEA 3GIPA 2Z6JA 1K6AA 5AZ1A 2Y8UA 2CHNA 3MI2A 1HTIA 4JDYA 4PSRA 1EUAA 4JY8A 4WSHA 4O28A 3VAVA 3VD7A 5K9XA 2WKJA 4AD3A 2O7SA 4RZ5A 2C1IA 1TFVA 3BQ6A 3QM3A 3T08A 1F6PA 2OZ0A 1PYFA 3KOXA 3TIMA 4PRRA 3CM4A 4TOQA 1P6WA 2Y5JA 3CS2A 1W6TA 3SDOA 1XL9A 4UQDA 3AJ7A 3SI9A 1DIDA 4JQAA 2FHFA 2Y6ZA 4L65A 1CLKA 4HNLA 3WJWA 2PDMA 3FA3A 4ML4A 3QZEA 4PUWA 3W2NA 3PUDA 2R91A 4IZGA 1DWIM 3AYRA 5D8ZA 2NX3A 4C7DA 3BGJA 5AOUA 1L6SA 1R2SA 3AXHA 1IEVA 2DPEA 4LB4A 2ZDSA 3P67A 4I9TA 2D23A 3FSUA 4UXDA 3W2KA 2AAAA 1HG3A 1HP4A 5BOOA 2H9AA 3QW3A 4H7CA 2DZWA 1R8LA 4JTUA 3B8VA 4CCZA 4RW5A 5I78A 4GYPC 3BGGA 3WK1A 3WD0A 1GZ1A 5D9MA 3OW1A 3MBFA 3MP4A 3TC6A 2XIMA 1XIHA 3S46A 5FJOA 2INZA 3VOHA 4AZHA 1KKOA 2P0IA 1ZCOA 5JIWA 1KCZA 1JVNA 4I9JA 3PTMA 3R8HA 2O92A 4BHYA 1AL8A 2E5BA 1D8CA 4YMZA 4NI3A 1OY0A 1LWHA 1XFBA 3KLLA 1RCQA 5C71A 2QCEA 2SFPA 3J7HA 1G69A 3W7RA 3FOKA 3ARSA 3NGJA 1XIBA 3E2RA 1JRCA 1ZQ5A 4NQ1A 4C6DA 3WY1A 4Z2JA 2BX7A 2VEGA 5HPCA 4MKVA 3N14A 2XVGA 3BC9A 4KW2A 4HN8A 1XFCA 3VIPA 3MY9A 2E6DA 4P8UA 3VA8A 4H2CA 1EF3A 4QDPA 1XIJA 1YADA 4XBSA 3WUEA 1PHQA 3N15A 4UNLA 2EKCA 1W9VA 3U3HA 4M7SA 3W7NA 2V69A 3RRXA 3NDOA 4D6EA 3N4FA 4NXSA 1IGSA 4YVPA 1R3QA 3RMEA 2B7NA 1TE1A 2ZWZA 3WLLA 4B16A 1X6UA 1BF2A 4QRNA 1BKSA 2RH9A 3EA2A 4GYKA 1QFEA 3WNMA 1EJ7L 4H9UA 4EKJA 1A5AA 3EKZA 3SN4A 3OVGA 1IZCA 2WZEA 3BLEA 1PTDA 2JKAA 1XYBA 1YW1A 3RX2A 3TAOA 1AK5A 1A4MA 4CN4A 3UPBA 3NVDA 2Q3RA 3UY7A 4RLIA 5HNUA 3UW6A 2ZKMX 5E6YA 1X1OA 3BG3A 4PODA 2PZ0A 2V82A 5MHBA 1CGWA 2QVHA 3BICA 1DYSA 3QTPA 2CBUA 2HE8A 1HJWA 3R12A 3W70A 1E70M 5ABFA 3H4WA 5E93A 1M7PA 4Y2WA 4MWAB 1EC7A 3QKEA 5DXXA 3NQFA 4CEUC 3MO4A 5E70A 1O5RA 1A5NC 3TKFA 4TU1A 4TVDA 1KFEA 1PX8A 2GDQA 4WJEA 2H90A 1VFOA 3AZTA 3BW4A 1UR4A 3GAYA 1JDFA 5FA5A 1MZHA 3SZ8A 3SRFA 1QTWA 2IXVA 2PPGA 4FR6A 1W31A 4FHAA 4HNOA 1K7FA 1ZGDA 3W53A 1V6TA 2V3DA 2XFRA 5KZEA 1MNSA 2QT3A 1XBZA 1RY8A 4C6JA 5D9NA 2ZC8A 4PZVA 2G5WA 5A94A 1H41A 4ORIA 5TAOA 1CXLA 3FYYA 2AAMA 4UMAA 2VQUA 4S3DA 5TNVA 4AAJA 1YBQB 1REQA 1NQKA 4P7QA 4HZ6A 2YL9A 6ALDA 5I00A 3TNBA 4AF0B 1KXVA 1UOKA 3EMZA 3CEPA 1KGXA 4O53A 3V4BA 2V5JA 2V3FA 2OODA 3MTWA 2XJ7A 1KM2A 3CHVA 1XSIA 4RZBA 3TP4A 4LSBA 1ICQA 3UXAA 3S6OA 1FHLA 1G4PA 2GJNA 5HMSA 3NM1A 1EQCA 4P2VA 4HNCA 3OTRA 2QW5A 3LRKA 8RUCA 4DLFA 3CUFA 3M41A 1XRTA 1TMQA 4ZQCA 4V15A 1WDSA 5DEZA 1S5NA 4JL1A 3BZJA 4K7VA 3CHDA 2DY3A 4DJDD 1EOKA 2QAPA 2XIQA 3G1AA 2FJKA 4FIQA 4GXPA 4P61A 1RK5A 3L4UA 1O94A 5AHMA 4UTWA 5BMXA 2KAUC 3B8DA 1F76A 3N6JA 5AHNA 1NELA 2YB1A 3FV9A 3TR2A 5F1UA 2P10A 3N13A 3VNKA 1GPWA 4O54A 3Q65A 4LY4A 3QV9A 1SO6A 1GZGA 1YXYA 4GYJA 3FJNA 3F5JA 1XYMA 3F4NA 4FOKA 3AISA 2J78A 5KITA 3WLIA 4Q4SA 5CPTA 4CCCA 3QOKA 1UMLA 3OZOA 3SCOA 3UPMA 4X63A 3P80A 4MY1A 3N04A 5A8NA 5TBOA 1TCMA 4JX5A 3A21A 4WY0B 4TMBA 5EMJA 1YPXA 3MKVA 4E3VA 5A69A 4Y9AA 3VNJA 2AL2B 1Q85A 3QMRA 4LS1A 1GJPA 3U57A 2C79A 3SIZA 2KZHA 4C6MA 2VJXA 1H7WA 3DFHA 4QQUA 2YDSA 3B0PA 1UZ4A 4RKAA 4H6KA 1TZ9A 4UNIA 1Q6FA 1R7OA 3H21A 1DJWA 5E0FA 2IMRA 3MQTA 1TTJA 1KXQA 3LEPA 4NAEB 3GH4A 1OC5A 3F2CA 3BARA 4OE7A 1W2PA 1H63A 3TYEA 2D2OA 5D09A 3VKCA 1X8FA 2NUWA 2BGSA 5JXQA 1R9ZA 2TYSA 4JQ2A 5HJXA 1LBFA 1PIFA 1JUBA 2F84A 5JH1A 3STCA 4XO7A 4D6CA 1SSDA 3PJWA 3GNPA 2ZA1A 2CLMA 1A5SA 3PNUA 4CQCA 5E1QA 1W0MA 5CZJA 1LG1A 5FD0A 3WQ6A 8TIMA 1TJ0A 3RPMA 3R0UA 1J8VA 4WGHA 1ISXA 4UZSA 4KEMA 4C1KA 3AIUA 3IAQA 4I90A 1PKMA 4OBRA 5C2GA 1DXIA 3CQJA 4PFHA 3KS6A 5A3HA 1CI1A 1H2JA 1K1DA 4ZFMA 3L0GA 3H2EA 1LQ0A 1BFNA 2JIWA 1LF1A 4KEZA 4K6AA 3TFCA 2D0FA 5BMWA 1VD6A 2PCQA 5A8GA 3W37A 3L2MA 3B8UA 1QI4A 3IGHX 4CLMA 4FX8A 3MUZ1 2WVVA 3IV8A 1TV3A 4UMBA 1IXQA 2G3IA 2Y8KA 1DOSA 3W6YA 1T41A 2WVUA 3BOLA 2XH2A 1H5YA 2HZGA 1SZGA 3VX1A 4D8ZA 2OT1A 1VENA 1XLAA 4O1CA 2QQ6A 5GJNA 3WQ4A 3HGJA 1EJXC 2W92A 1IWAA 3W22A 4XG1A 4F9DA 4UR8A 4B91A 5U4NA 3THAA 1UP0A 4MGGA 1UUOA 3KVJA 1PKLA 2WO5A 4KGJA 1NOWA 4GUJA 3WNKA 2OO0A 4DJED 1E4IA 4QE1A 1XDLA 4B3LA 1LM1A 1KRBC 2J9YA 4H9XA 1ISVA 1UD2A 1JDDA 3WLNA 1EX1A 3A24A 4GXMA 3BLIA 1H51A 3GLCA 4L1WA 2WVSA 4US6A 3TAKA 3EA1A 3GU9A 3GC2A 5GPRA 3ELFA 2D2JA 3IARA 1NAL1 2WSQA 1TA3B 1B5TA 2WB5A 1XCWA 1DE5A 2ACUA 1Q8AA 1O68A 4UNKA 1CXIA 1VBHA 2HS6A 4NZJA 1FWTA 2NLYA 1SZNA 3QY6A 3M0YA 1DTNA 5CZ0A 3TSDA 4MNLA 2VI0A 3VMOA 1JDAA 4GJIA 4C5ZA 3AJXA 1EF2A 2NQLA 1OFQA 4O14A 5LIWX 3EX2A 1DWFM 4AZCA 1TJ2A 3L9CA 3QRHA 3O7UA 3RLVA 3WFZA 1M7JA 5RUBA 3DFTA 1GVEA 5H8MA 4I7WA 5KZ6A 3U2EA 1KW1A 1UWRA 3MVTA 1A5CA 3L0KA 3WLTA 2FZNA 3S5YA 2ISFA 4XTDA 4IL0A 1OGGA 1GK8A 2RJHA 1R3RA 4DNHA 1T0OA 3EWDA 4M5PA 2QLYA 1TIMA 1WZMA 3CBWA 4HTBA 2GJPA 3V1PA 3W27A 1BGAA 2UZ9A 5I02A 2DQWA 4LJ3A 1U5JA 1LJYA 1TE6A 4GABA 5D37A 5EA9A 1CW2A 5D2XA 4C91A 4MPQA 3AHTA 4B15A 1GYLA 3W1TA 1UQZA 2GWGA 2P3EA 3MW7A 2V0TA 4D6DA 2GQ9A 3ZQ9A 3MU7A 3TYAA 1OYBA 2PA6A 1Q65A 4X60A 3CPUA 2WNQA 3T0TA 1SW3A 1AQ0A 4AW7A 3BSGA 2NQJA 2HTMA 4QCFA 1VFMA 5HR7A 1T96A 3E2QA 3LI0A 4RE4A 1B31A 5CBJA 4Q8TA 3MC5A 3AYVA 4GIAA 4ZSTA 2I5GA 3AMLA 4HJFA 2WCGA 4H01A 4WDWA 4KF1A 4HOWA 1PAMA 1XM3A 5C54A 1BEUA 1HKJA 4DZAA 1H3GA 3C2RA 3MCOA 5HBFA 3WMBA 3W83A 4XQ6A 2QNEA 3EOUA 1GEHA 3CZLA 1BD0A 3NYDA 1JDCA 2D20A 4JAWA 3M9YA 3TC3A 1I2QA 1ISWA 1NFGA 3K30A 2AKMA 3OLIA 3WLHA 2GOKA 4TVUA 4FMVA 2MANA 3U2OA 1Z44A 5T9CE 1K7XA 3URNA 1OT1A 1WZLA 4QAWA 1XKJA 4OV4A 3V75A 5HUPA 1KFCA 4GKTA 3FAXA 1GUVA 1J11A 3FLUA 1WV2A 3OQ8A 2FTYA 3LCXA 2YGYA 2PD5A 4P8XA 1BSIA 4LTSA 1EL3A 2Y7FA 1RQEA 3GS6A 4QLKA 4AU0A 4JTIA 4E4UA 1LOQA 4ADUA 5CC5A 4D6GA 3BL3A 2GWNA 4NX0A 3W28A 3FFSA 3K1DA 1KBKA 2PTZA 3VNYA 4CN1A 4MOZA 5F4XA 1SSGA 4GBDA 1AL7A 2VEFA 3MUY1 3QH2A 2NT0A 2FPTA 4N9BA 4KWVA 3ABSA 4H7VA 3STGA 3ZJ8A 4CKQA 1WOAA 4F66A 4XUGA 5JBFA 1PL9A 5T8GA 2ZRUA 3PTDA 2IS7A 3WH9A 1R3VA 4F0RA 5EMYA 5F4WA 3LXAA 3UJ2A 2PLMA 3WQGA 4N4QA 1Q13A 4YXGA 2QR6A 4IFOA 3NQGA 3MZNA 4DEFA 3R0DA 3N25A 3L4YA 4PMXA 4WJ8A 3VX0A 1DHKA 3L5MA 4DZHA 3EYPA 3SQLA 3DEQA 3MV11 3T7VA 3GXIA 5FJRA 2Q71A 3GDBA 3I3DA 3OYZA 1FFRA 3HFYA 3PBMA 1A3HA 1QR7A 3BSMA 2PF8A 4QEEA 4LEFA 1ITCA 4FXSA 2PWDA 3N6QA 3DN5A 3LM3A 5C9XA 5K9CA 3DC0A 3IV3A 1TV2A 1R2RA 1PXGA 4PULA 1ZALA 4LWWA 3O6YX 1LDCA 3B8TA 1GYNA 5F7UA 4M6PA 4KS0A 1R9YA 5D30A 4CU6A 1PVNA 1VF8A 3S5NA 3MUAA 1KC7A 2JEPA 3APGA 1ZAJA 3DZ1A 3NQEA 5E6ZA 3WL0A 3H70A 2F6KA 3LLDA 1U5VA 1K6WA 1LT8A 4DJFA 3HQOA 4YN5A 3W6LA 3T8LA 5LNWA 1VZWA 2X1RA 4CD5A 4ZTYA 1YTDA 4O16A 4W89A 2OWXA 1S38A 2QJJA 1RPKA 1F3XA 5EBUA 1UWUA 4Q4PA 1N8FA 3N2TA 2ZZ6A 1R30A 3IPWA 3BLPX 2F38A 1C8VA 1TVPA 3UCDA 4V33A 1V5XA 1EGMA 4ACZB 4XUYA 4ZXOA 4QFUA 1WO2A 3CB8A 3BW3A 5LIYX 3PY2A 3HGOA 2OQLA 4LBSA 3N4EA 4S3EA 3M4HA 1GYMA 3W7CA 4G7EA 2BHZA 3MYPA 2BY0A 4L6OA 5D05A 1A0CA 1XLKA 3FY1A 4WEVX 4M7TA 4WY0F 2J13A 3WO8A 4ECLA 3VI2A 1OFDA 4IPPA 2HVNA 3IJ9A 1F3EA 3NCOA 1FWBC 2VGBA 4UMCA 5FF2A 4L4PA 3NNTA 5CQ1A 4ZOBA 4JTFA 3LV5A 3ZO9A 4NUWA 4B5WA 4IUGA 4DXKA 4UFIA 4K1WA 1JPKA 2E4TA 1J0IA 1B3YA 3U6WA 2Z29A 2WC7A 4ZB2A 1BYCA 1QRQA 2VRJA 2ISVA 4XSLA 1U22A 4X9YA 1ZB5A 1P1XA 3U4FA 2VRKA 4N02A 3PWGA 1W3IA 4HK5A 5EYWA 3GIQA 1ZBCA 4C6FA 3VE7A 3KOZA 4RDWA 3BMXA 3HZ3A 1OCJA 4MYXA 1P7TA 1QPKA 4J28A 2X0HA 3QVQA 3S9ZA 2VFFA 1H0GA 1EKOA 1M3UA 4F2UA 2PGRA 4PUEA 2Y24A 1CLVA 2YB4A 3BLOA 1ICSA 2V5KA 1DIEA 4BI6A 4KRUA 2YIHA 3DIPA 2C19A 3C2YA 5HATA 5JH2A 3KTSA 2QJHA 4MY9A 2ZRXA 4PUNA 2CWXA 2ZX8A 1CGVA 3L4TA 2HISA 2W6RA 3SCNA 4X3ZA 2PDUA 1RJRA 3OIHA 2J25A 6REQA 3PHAA 1JI2A 3P0XA 2G96A 2GZXA 1J0YA 1JG9A 3NYZA 4JQ3A 4IMGA 3WH8A 1GTHA 3W7OA 4AH7A 3C5QA 1W1YA 4H9MA 5M03A 4O1AA 3WJZA 3VIMA 3CL6A 3BE7A 4M1RA 1TWDA 4HA1A 1MEIA 2JGQA 3W7LA 2X8RA 1R7AA 4D6HA 4X0VA 2QDGA 4TX9A 1YTKA 3PZVA 3ZVIA 1R46A 3LMZA 5HR6A 1NFPA 3VKJA 3GR7A 2NX9A 2Y85A 3AXMA 3GUGA 1DP0A 2ZUUA 5ABFB 2H8ZA 2BS9A 2G50A 3VU2A 2WK2A 4FOJA 1P6BA 3ITLA 4N9CA 3UWQA 3THCA 1ZBKA 3PBVA 5K4XA 3FX4A 2PZNA 1W1ZA 1TRIA 5D2TA 1NJJA 3O05A 1ZLPA 5G4EA 4ES4A 2ZZ2A 5EBAA 4NY2A 5I7GA 1Q6EA 3BMWA 3UCQA 4LW7A 2VR2A 4C1NA 4FNRA 3C8NA 3AWOA 1LRNA 4GHRA 4M82A 4WDUA 5CKSA 4CD7A 4AQLA 1XISA 5FACA 5KSWA 3NXFA 1C3FA 5G1TA 3SRHA 1UKQA 1RLDA 4AEOA 5A6LA 3AIRA 5C9WA 3VIOA 3IANA 3U9IA 1E43A 3A13A 4C6IA 1SR0A 3TTYA 1NY1A 1RY0A 4HBKA 3RDKA 3M47A 4C6CA 1HX0A 1R9XA 2REQA 2JGYA 1H62A 3L2IA 3PZNA 1E6QM 2PDBA 4R7OA 1DWHM 1RP8A 3WEZA 2DT0A 3SGZA 3MSRA 3FEMA 1JF6A 4G9PA 3N1AA 3AXKA 1LUCA 1T8XA 4JKKA 5J04A 3FXGA 3W7QA 3VCRA 3ITVA 4H9ZA 1WAWA 1UUMA 4EIVA 3EWWA 3SAZA 1ML1A 1VAHA 5IDIA 1GOMA 1LL4A 4FK9A 2PRMA 3MO7A 1BAGA 3P61A 3R6IA 1EBHA 1YDVA 4L9XA 1E0VA 2YJQA 5CJMA 5EFFA 3AQUA 1QHZA 3G3DA 1IEIA 3NOEA 4NNBA 4YWIA 4JR5A 3LY0A 1QNQA 2DEPA 3NWRA 4CEXC 3LK6A 2HS8A 4KFPA 1JEZA 1DQUA 3W88A 3L5AA 3BMVA 2BB0A 4J3ZA 1QHOA 2E3ZA 2BGQA 3VOIA 2VDGA 4QJ4B 1S39A 3PR2A 4GPNA 5ABGA 4FF7A 2PDKA 2VEIA 3UJFA 3G24A 4O11A 1FCVA 5I3IA 4N4PA 4GZEA 2MUCA 5CPSA 2R1PA 4IH3A 4ATWA 1D9EA 3TQKA 3S1UA 4OGZA 4P7RA 1EZ2A 4ENLA 4DJFC 4FPSA 4MAVA 4UFHA 1XH1A 1WUEA 1IIHA 4DWDA 4G6CA 3P62A 5A6KA 3KWSA 5C5YA 4DM1A 3ARYA 3L65A 4KWSA 2B7PA 3PFMA 2OLAA 1DQWA 4E3TA 5HPOA 4D8LA 4C6LA 2JK2A 2I16A 3L4ZA 3P5ZA 3S4TA 3H26A 3HMJG 4KT2A 4H8HA 4JTCA 5AN7A 2CZVA 1OF6A 4H2HA 4HKPA 2Y61A 4DZ5A 1TMLA 3RN6A 2YXXA 3TV8A 1H50A 4U2YA 1QOQA 1VFUA 1GOQA 4HNUA 1OFAA 2V38A 4U33A 4H9TA 3C0SA 4Q8MA 3QR1A 3N19B 1UH4A 4WZHA 1WKFA 5A6MA 2QCDB 2OB3A 3T55A 1K8XA 4QE4A 3SCRA 5KTLA 2VFEA 3GTHA 4N42A 2QMKA 3VD9A 3AALA 1X6NA 1W5PA 1E4MM 3GM8A 3TYDA 5AVHA 2VM8A 2OGJA 1V3HA 4Q8OA 2VGGA 2YDQA 1TR9A 3H7VA 4NZ1A 5A6TC 1W32A 3O8AA 4CNUA 5A6BA 4MKSA 3F5LA 1Z3NA 3EWZA 5CXPA 2D3NA 2VZSA 1YDNA 3VIIA 3PB0A 4PEEA 4IFKB 2VCAA 1W2VA 2EG6A 2G41A 3PP7A 2A4AA 3XIMA 3WSUA 1ZFJA 4IISA 4ZO8A 3BV7A 4K39A 4FX6M 1QHPA 2DVXA 3WBEA 3QF0A 3CQ0A 4I9AA 6XIMA 3C52A 1DEDA 1FUYA 1XH2A 7A3HA 1F7BA 5G1YA 4AHOA 5I24A 3T0DA 3TJ4A 2XINA 3UESA 3C0LA 4WUIA 2YR1A 4PMYA 1MXDA 4WRHA 4US5D 4C6NA 5AC6A 1TYGA 3PAOA 4CNSA 4R85A 5L6UA 4QS6A 1FX6A 2PWHA 2WHKA 1QBBA 1XPGA 3HPXA 2HK1A 3SQMA 5T91A 1JJKA 1BGGA 3U8GA 3CNYA 3M6DA 3V1HA 3FYOA 4YNGA 4H8UA 2JEQA 3W82A 4M6VA 1J93A 5FF7A 2VC5A 3MB9A 1SVDA 1X1NA 3HV8A 5MF5A 1G9HA 1NDYA 3GR8A 1PZ2A 4J3WA 2PD9A 3DAQA 3VYLA 3AMCA 3ARVA 3II1A 4R33A 3S5SA 4S3JA 2VQTA 4B4HA 4C1LA 4IP4A 3LYEA 1V79A 2C13A 4DYKA 1ONEA 3QR0A 5BRBA 3A12A 3GRIA 1AD4A 1K8ZA 4W8BA 2DZUA 3VKBA 2ABBA 2ZTKA 4YCOA 3MA8A 3ZJKA 2E1DA 2JF6A 1R6WA 5I3HA 3QJAA 2GGIA 1O1ZA 4PB4A 4L1XA 2NXIA 3U7BA 4GY7A 1XC6A 3KVKA 5A2BA 1HKVA 3WD1A 6PTDA 3A3XA 4FNTA 2NQ9A 2ZUNA 1P4CA 3B9EA 3W1XA 4BEQA 4L56A 4R7WA 1W54A 4J3UA 3W84A 1OADA 4NZ3A 1TELA 3PS7A 3RG6A 1A5OC 2PDWA 1RK6A 4MJ4A 1OHLA 2PSNA 2H6RA 3LA4A 1OFRA 1TPWA 4CVUA 4GISA 4RXGA 2I14A 2FVKA 1ZJHA 2FDSA 3CT2A 2EXOA 4CCDA 3TX9A 1JD9A 3TMQA 1C7TA 3LI1A 1VFSA 1E6XM 4LUJA 1ONXA 1EHNA 4MFDA 4UIOA 5CLWA 4TX6A 4QM1A 2PP1A 4ZOAA 3GXPA 1AH3A