4AY8A

Semet-derivative of a methyltransferase from m. mazei
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
340
structure length
339
Chain Sequence
b'DMSEFTLKTRLLAALKGEPVDKVPVCSVTQTGIVELMDVVGAPWPEAHTNPELMAKLALANHELSGLEAVRLPYLTVLVEAMGCEINMGTKNRQPSVTGHPYPKDLEGAAVPADLLQRGRIPVVLEAIKIIREKVGPDVPIVGGMEGPVTVASDLVSVKSFMKWSIKKTDLLEQALDIATEASIIYANAMVEAGADVIAIADPVASPDLMSPDSFRQFLKSRLQKFASSVNSVTVLHICGNVNPILSDMADCGFEGLSVEEKIGSAKKGKEVIGTRARLVGNVSSPFTLLPGPVDKIKAEAKEALEGGIDVLAPGCGIAPMTPLENVKALVAARDEFYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLCOBALAMIN\: COENZYME M METHYLTRANSFERASE
publication title Structure of the Corrinoid:Coenzyme M Methyltransferase Mtaa from Methanosarcina Mazei
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Transferase
total genus 117
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.1.1.247: [Methyl-Co(III) methylamine-specific corrinoid protein]:coenzyme M
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 4ay8A00
1XDJA 3CYVA 1JPHA 1UROA 1R3SA 4ZTXA 3PPFA 3PPHA 4L61A 3GVWA 1XPGA 1R3VA 1R3QA 2EJAA 2Q6ZA 3L7RA 1U1HA 3PPGA 1JPKA 3GVRA 1R3YA 3GW0A 3PPCA 4QQUA 4AY7A 4L6OA 3GW3A 4L6HA 4L65A 1JPIA 2NQ5A 4EXQA 1U1UA 3GVVA 3BQ6A 1T7LA 3GVQA 4AY8A 2Q71A 4ZR8A 3BQ5A 4L5ZA 4L64A 4ZTYA 1U22A 1U1JA 1YPXA 3RPDA 2INFA 3T0CA 1J93A 1R3WA 1R3TA 1XR2A 1R3RA 4WSHA
chains in the Genus database with same CATH superfamily
5FF4A 3CMGA 4XBSA 2FDSA 1QI3A 1HTIA 3UU0A 1WKDA 3CAVA 3EKLA 3LCIA 1J2WA 3PY2A 3FLUA 3QLDA 1PZ3A 3PZOA 3POHA 1RPKA 5H1WA 3MKCA 3LK6A 5I2UA 2OQYA 3LEPA 5D9MA 3BURA 2G3MA 2FHFA 4P8XA 1GEQA 3BMVA 3EX2A 2ZUWA 1AQFA 1XC6A 2OFJA 1XIEA 3OQ8A 2YFNA 2X0SA 2BGQA 2GGEA 3SAZA 4P8UA 2CETA 1K1DA 1EUNA 3FV9A 1TPB1 2PURA 4DWSC 4PBEA 4E38A 1AW1A 2XFFA 2W62A 1K8XA 4KIRA 4ILSA 2XFRA 2B31A 4O12A 4HZ8A 3RDKA 4KH2A 1CXKA 2O9TA 4L61A 4GY7A 2PGEA 1IZCA 4JNZA 3W7KA 1Q6LA 2Y85A 4M6PA 1QTWA 3S5YA 3EXRA 1KA9F 4JFUA 2GPTA 1F6YA 1U30A 1W5PA 4JIQA 5CG7A 1JZ3A 4IJCA 4RE4A 3NQMA 3KCJA 4IFKB 2GUBA 3CJPA 4C6PA 5JBEA 4IP7A 1IIGA 1EJVC 1XM3A 2WMIA 4H7VA 3GUWA 3T08A 4P7OA 3LQLA 3W74A 2VZSA 3WF3A 4JFWA 1DQXA 1KWKA 1H09A 3VZYA 3GBDA 3SI9A 1SR0A 4YTUA 3T6CA 4EX4A 3AIWA 3M9YA 3M64A 1E72M 1HGWA 4JTHA 3B0YA 3LRLA 1LQ0A 3GE7A 4X60A 2VUYA 2BDQA 3PR2A 3DFYA 4JD4A 3H4GA 2UWFA 2PU1A 3PTMA 4GYKA 1JGMA 4WGHA 1OCNA 3AICA 1TZ7A 4P61A 3W7QA 1KBIA 4B9ZA 3WF4A 1VKFA 3A3WA 5A1AA 4Y9MA 3RITA 3KBSA 2FHCA 5AYBA 4U33A 1X97A 3EWUA 3LLXA 2XTKA 4LAOA 2BVDA 3WJSA 3HV9A 3THQA 2HV5A 2VC6A 4Q4PA 4XAGA 1F07A 2Y7EA 3H2MA 1YLVA 4V27A 4AC7C 1O1HA 5A95A 4HJFA 2VEFA 3SCWA 2PZ0A 5LA0A 2Z2AA 4W87A 1OB0A 2X2GA 3SN4A 4DJFD 2J78A 4JDYA 4K7YA 1V93A 1IT8A 2W3ZA 3LS9A 2CHNA 2ZBTA 2V5JA 2DFAA 2ZTJA 3D0CA 3BLFA 1QNRA 3KS6A 2VNCA 3N9RA 4MB4A 4RNFA 1HFBA 3BG3A 1XR2A 1W37A 4XISA 3BCFA 5K2ZA 1PPIA 3EKGA 6TIMA 1ITQA 2XUCA 3V5FA 4C6BA 2CERA 1IQ8A 1FWCC 1NM9A 2IQDA 4DN1A 4E5TA 1JZ4A 5CZ0A 4C6NA 3CQKA 4ZFCA 3EX3A 3W38A 3VNKA 2WVSA 2WHKA 2NVCA 4N6FA 3GNNA 4ZXLA 2OJPA 1E4NA 2BMBA 2P0IA 1XBXA 1FH7A 3OJGA 3LGEA 3WDHA 3B9DA 4S3GA 3IK2A 4QLKA 4PCTA 1P5BA 4LVDA 1GWJA 4DJEC 1Q6QA 4DO7A 3LQGA 2C91A 3LM3A 1DPMA 3C0QA 3MBDA 4UMAA 1KTCA 1E1EA 1VYSX 5K4ZA 1O5XA 5IHSA 3CB3A 4EPBC 1ZBCA 4GI9A 2BNJA 1AMKA 1R0MA 5HJYA 5E0KA 5SWUA 4IGHA 3WDPP 1CXHA 4CN6A 4XWUA 2G3FA 2QT3A 3AOFA 4G1NA 5AVNA 1A3WA 4U2ZA 1DV7A 2XYLA 3LGDA 5EMYA 4MADA 1Y5XA 2BY2A 3GIPA 1FHUA 4UQCA 1F8MA 7PTDA 1J11A 1U1HA 3APYA 4GUHA 5A6LA 1Z32X 2XVGA 3QY7A 1CX9A 4C1NA 4IG2B 4LEFA 1ZBWA 4F4RA 1EZWA 1TIWA 4AQLA 3VMOA 4GOAA 2I9EA 2PD9A 4Z1AA 3AZRA 3WJZA 5LHFA 1TQXA 2F38A 3II1A 1WDQA 1MXDA 2VDGA 1BRLB 3EMQA 1SYTA 1PE1A 2C0AA 4CNSA 2FGLA 1XLJA 3PNZA 1GG0A 1DWIM 3F1QA 4DYEA 5GNZA 4U5IA 3SSZA 4QDWA 2P8BA 3FVMA 3Q37A 4A4AA 4Y90A 3NQBA 4N2YA 2WM1A 3HPSA 3NL5A 4CCZA 2DQWA 4LCQA 4IMFA 4UNLA 2VZUA 4AHQA 2EJAA 1S3HA 3F4NA 1WUEA 1MUMA 1TWDA 1OIMA 8RUCA 1MW0A 1VZWA 4AXNA 3C2OA 3HOJA 2E6FA 1IE7C 3WBXA 3B9OA 1ADOA 4GNJA 4AWEA 1FH8A 1UR0A 1PXGA 2WZMA 3LMYA 4REQB 4DNMA 2HPMA 1UHVA 5JBDA 3MPGA 3MUAA 2VGFA 2QDHA 3T05A 4IFOA 4UOZA 4TXEA 2CEQA 2NV1A 5HQEA 2EAWA 1PZ0A 1TV7A 3WF2A 2V38A 1UKOA 1R2TA 4O19A 3AJ7A 2H6RA 2ZC1A 3V16A 1K7EA 2CHRA 2ZICA 2I56A 1H51A 4RZBA 1H60A 1A4MA 2QCMA 4IMAA 3TIMA 4ZTYA 3TWBA 3EWDA 3PZIA 3L2MA 1F73A 4LUTA 1OT1A 5L9FA 3KHJA 2IXUA 2ZDRA 1KM2A 4R5EA 4JY8A 2GQ8A 3ZJ7A 4FNRA 2G41A 2Z1SA 1WX0A 3WNLA 1XYFA 2HWGA 2YYUA 4NJKA 4CCEA 1FA2A 3MHUA 3FYPA 3IWPA 2Y24A 3WNPA 4KFOA 3BAIA 3S9IA 3E12A 1OHLA 3XISA 5AYXA 1X96A 1JG9A 1L9WA 3TOYA 4LOCA 3WQOA 4CD7A 1UC5A 5HOSA 2CFFA 2NXHA 5I78A 1H41A 2RH9A 4F40A 1V6WA 4HU0A 1UKQA 3I10A 3TLLA 5A6BA 3VOGA 3MT1A 2FTPA 5CGMA 1X7FA 3W1PA 5CSRA 4Z2HA 1V4YA 1LUCB 4WZHA 5LGZA 3P61A 2JEQA 5H2ZA 3HFYA 2W92A 1AUSL 1XISA 2P5NA 2FZBA 2Y89A 4ATLA 1R7AA 2FYMA 3CAKA 1CW2A 4E2DA 1XGDA 2NQ9A 2X30A 3NSXA 2ZADA 1IYXA 3JUGA 3EOLA 4LFYA 4BI5A 3EB2A 1BHGA 1JZ8A 1UROA 5REQA 3NYZA 5IBXA 4PZVA 1NSJA 1QMLA 5DBUA 1OEPA 1JDAA 3H70A 1XGZA 1P48A 1TPC1 1YBQA 3B04A 4J2PA 2EKGA 3SGUA 2J75A 4NJJA 2A6NA 5I3GA 5LA1A 3HO8A 3W2LA 1ISZA 2WJFA 1TVNA 4NJHA 4HMDA 4UFHA 1KFEA 2WLZA 3CZJA 3EXTA 1GQIA 2OYMA 3NQDA 4S3AA 4K38A 1HZYA 3UXLA 4IPLA 4Y9OA 3PBYA 3CZGA 1P0DA 2OZ0A 4HCDA 4ZSTA 5TD4A 1XC4A 2PDPA 2EG7A 3KZSA 1QT1A 2ZZ4A 2ZZ5A 3P81A 5G2IA 2EJ1A 4GQBA 1EJTC 2G97A 4W8LA 3UZ5A 4PTWA 5HNRA 1PDYA 4P7QA 1FWGC 1L6SA 2PUZA 4Z0JA 4HHMA 1OYBA 3BAWA 4UTIA 1X7IA 1B9BA 1ODZA 4MY1A 1FXPA 3ARRA 4OTKA 3VIJA 3HMCA 2ZQ0A 2WOQA 4BI7A 4B90A 4DHGA 3ABZA 4JR5A 2OZ3A 4EPDC 5CC3A 1YPIA 5F2IA 3CWHA 4G2DA 2B7PA 4TUFA 4DPPA 3H4XA 4HNTA 1V7YA 3UJSA 2WSKA 3AIQA 5JUVA 2A21A 3ITXA 3NQAA 3O06A 3UGVA 1XYBA 2VX4A 3SCQA 1Q5MA 3BG5A 5H8MA 2BB0A 1U5VA 1JYXA 2XIMA 4EXQA 4QTGA 2E5DA 2Y62A 3H7UA 4CLMA 3GVQA 2DPEA 2RFGA 3VIPA 4LPCA 5A8NA 3C0SA 4MZYA 4ZODA 3FA3A 4N0RA 1K8ZA 3NEVA 1XW8A 3VNDA 3GB6A 2CLMA 2OWWA 2A3HA 3B8IA 4TV6A 2G50A 3EWCA 4PUWA 1WQ5A 3CIVA 2CW6A 1UB3A 1UASA 3A21A 3JS3A 4ML4A 3O7UA 2VMFA 2NT0A 1S39A 4E4PA 1ZBKA 4IWWA 1ADSA 2OT1A 2HCVA 3AXKA 1RVGA 3MKVA 2ABBA 1WCGA 4NP7A 3BJSA 4GQGA 5F1VA 1KFBA 2RDWA 3DGRA 1R46A 3N4AA 4QNEA 3TQPA 2Q8LA 3UQNA 2QJNA 2Y5JA 3EDDA 5CBBA 3R2GA 3TJXA 1LCOA 4WUIA 4NI8A 2V81A 1TIMA 2GLKA 1XRSA 3VIHA 1X1OA 4KGLA 3FJNA 4JAWA 3W87A 4DAFA 2DSVA 4J3VA 1RK5A 3WUGA 1FCBA 1DJZA 4XKYA 1I0DA 2ASHA 3BV4A 1W2VA 3BXWA 3P0WA 4ERGA 1VHNA 2HE5A 3WZ0E 4A8IA 4AZBA 4O1DA 3HGSA 3VFCA 3CEPA 1J01A 1N8FA 4AB4A 5EFFA 3QHNA 1E1CB 4GABA 3TZFA 4FXFA 5AYYA 1EXPA 3ONBA 3J7HA 5HR6A 1X38A 2QJIA 4YL2A 3V5CA 3QH2A 3WFLA 3ZLHA 3TX9A 2VQUA 2DVTA 4XK2A 2WJDA 4A8NA 1OCBA 2ZCGA 4F3HA 3DCPA 4XZHA 4UUIA 2X42A 4NAFA 1G4EA 2QNEA 4UWMA 1H63A 4NAEA 2WNNA 3I68A 3XIMA 5FF2A 4Z2GA 2BXVA 1F2JA 3ZZ1A 2DIJA 4PUUA 3QW3A 5CPQA 6ALDA 2E8ZA 4FIQA 3NZ1A 4W93A 4HPXA 1CB7B 1EWDA 4JIIX 2ZRYA 3P62A 1EP3A 1QRQA 2POZA 4FNUA 1E0WA 3WDIA 2CLKA 1E9IA 2Y8KA 3PPFA 1XL9A 3WNKA 2WK2A 5LIWX 2HNHA 5DT7A 2Q3OA 1CB2A 1FY6A 1GOQA 4WK9A 3VC5A 1JDCA 4PTMA 4RW5A 4PMZA 3AHZA 1BD0A 5DXYA 2MUCA 2RHGA 1WZMA 5C2GA 1I2NA 5K3VA 5DT5A 3OHIA 1K9DA 2PWUA 3AAMA 1JZ6A 1S46A 1XDMA 1UPMB 1FKXA 3ZO9A 5A3HA 3QR0A 2PDJA 2G8ZA 4X2PA 1Z42A 3GH5A 3PZNA 3WQ5A 3D46A 4MAZA 1IEVA 1MEWA 3BLLA 2VZTA 4U28A 4O1AA 3W7MA 3UWQA 2DSUA 1I75A 3W23A 1JPDX 5I0DA 1UJQA 2VQTA 1CLVA 2XN1A 4O13A 3DDMA 1I2QA 1ME8A 1WDSA 4L1XA 2YB4A 3T0CA 3APGA 3SY1A 4KCWA 1ODUA 2VR5A 4IH3A 3NVDA 2WVVB 3VNLA 1YE4A 2DUAA 3T0TA 4LC6A 4W8AA 5CC7A 5A6BD 4MWAC 2VCBA 2A2IA 4QEEA 1Z8AA 2YBTA 3O6AA 2RGMA 4NNAA 2E77A 1O68A 5DMLA 3WJXA 1OC6A 3MMDA 4E8GA 1FHLA 4IFKA 4M19A 1K6AA 1GVQA 2A3AA 3UA3A 1EHNA 1UW9A 4YTSA 1BVWA 4MUPA 1E9LA 3SSJA 2F84A 3W1AA 4JQ3A 3TMQA 4ZQMA 3CZ8A 3LENA 1HKKA 1Z89A 3EPNA 1Q4WA 3L4XA 5T9CE 1MQPA 3L4WA 2NLIA 3O6YX 4AEFA 5J5DA 1YIXA 3WQWA 2J13A 1A53A 3LYEA 5C2CA 3M0LA 4Q8MA 4AHPA 1POJA 4OVXA 3GH7A 1U1UA 1BYBA 1KM1A 1XLKA 4AIOA 3HPXA 3QF0A 4NASA 4QSFA 2HS6A 4HNNA 4AD0A 2FZMA 2C0HA 4KBXA 1EJ7L 2XISA 3TDFA 5HATA 1KLZA 4GC4A 1LWJA 4IMEA 1IWPA 4HBKA 3L7RA 1NOWA 4JIHA 2VWTA 4H41A 1GEHA 5EMJA 3G1FA 1DEDA 1Z7AA 2BOGX 2VEGA 1EKOA 3HPAA 2NQHA 3OW1A 4PTNA 4PC8A 5DCEA 1ONWA 2CZFA 3WJYA 5C0QA 3V0SA 1JYVA 2OEKA 1PKNA 3KFTA 3GW0A 1TVLA 2RGLA 3SGZA 1NQKA 5IOBA 3VNYA 2I14A 3QN3A 4JEQA 3SCNA 3O07A 4MKNA 3FNDA 3UXIA 4TVCA 3KS5A 3PFRA 1V7AA 1UD3A 1TTQA 4LVGA 3NZGA 2H8ZA 2WB5A 4ZOCA 1PX8A 4DJEA 3T78A 3TH6A 4GIRA 2ZWZA 1JF6A 1OGBA 4U3AA 1EO5A 1S2CA 1UYQA 1PIFA 4E8DA 3ERPA 3FGCA 4J3WA 3R12A 1G4TA 3BLOA 3IGHX 1JEZA 3PVFA 2CLIA 2YPIA 3NO1A 1S2WA 3Q58A 4M1RA 3WLMA 1MFVA 1DBTA 4GIEA 4I5UA 1FDZA 4K8HA 4QAIA 1VYRA 3QR3A 4V15A 4LYRA 3GFZA 4NVTA 2PC4A 4XTDA 3TVAA 2X41A 1H7OA 4R7WA 3A4AA 2QDDA 2ZDSA 5JIPA 3QSTA 1XYMA 4QQUA 3RR4A 3PJTA 2X0YA 1OBAA 1PVNA 2DT1A 3TA9A 4LNCA 2A4AA 3UYCA 3KVLA 1DWHM 4OBRA 1EL3A 1GQLA 3CB8A 2E40A 2VZOA 1L2UA 3LGGA 3KLLA 4L7ZA 4JNYA 3INPA 1KV5A 2NX1A 3R0UA 4OWGA 4FA3A 2JQXA 4LGXA 1T8XA 3CL6A 3DU0A 3CT2A 5AVHA 3W7IA 5FJUA 1AMYA 3U8GA 4MJMA 5FAJA 3GXNA 3P8IA 1W3NA 1SJCA 2PDNA 1GKQA 1X1ZA 4FLRA 4QBXA 2ATMA 4P5UA 3MI2A 5CXPA 4J4KA 3PNUA 4WSKA 3BOFA 4IG2A 3GHRA 3LCFA 3GDRA 3DBNA 3IK4A 2WQDA 1M65A 1B3VA 2PWVA 2J74A 3LTPA 3KOWA 2D0GA 1Y7VA 2CKSA 2D3NA 5FOOA 2ZRUA 2PWGA 2PDFA 5HXMA 1H62A 1YTKA 3ZQ9A 1KWGA 1XYCA 1BRLA 3NJ3A 4C7DA 4YPJA 1OF6A 2E25A 3KOZA 1AODA 3DC0A 3VAVA 2J7BA 3U7VA 2E6DA 3ZS4A 4UMCA 1E51A 4J3TA 2EBNA 2QR6A 5D38A 2ZKMX 4PUDA 4LNYA 2A85A 2E5CA 3HFTA 2JIEA 2W9MA 1EFZA 4OZOA 1KCKA 1JZ7A 4C6OA 5HBFA 2DDXA 3O6DA 1XI3A 5A8QA 3K8LA 3FKRA 5BU9A 2QCHA 1IZKA 5IM51 3BUVA 3FS2A 3EB4A 4FI4A 1L6FA 4JKKA 2YDSA 4NYUA 3M46A 3W7CA 4AZ7A 1ZPTA 4D6GA 1OINA 2GVEA 3WH9A 1ISYA 2AQWA 4K36A 1TWIA 3EWZA 4DWSD 4REQA 3L5LA 4LV9A 1JIBA 1GK8A 6ENLA 4BEUA 3NZRA 1XIFA 5CSYA 3GDLA 3DZ1A 4UTUA 4UMBA 4MUZA 4HCLA 1TTIA 4BCEA 3U2ZA 1UCWA 3H54A 3IAPA 3LM7A 3IIXA 2HVNA 3L0KA 4DBEA 4Y96A 3QZEA 3WNOA 1IF2A 4V1YA 1V51A 2PWFA 1E71M 4FX6M 2DUZA 2VD9A 3VD7A 1BWKA 4PRWA 3RUBL 4F0RA 1SO3A 3UG8A 2FLIA 1PHQA 2XIQA 5IFTA 3CMJA 3GVRA 3DYOA 4GVHA 3W3OA 4RUBA 4IL0A 4H9MA 4GK8A 3G2GA 1EPVA 1OD0A 3FAWA 3CLWA 3O63A 4TX6A 1I2OA 1RUSA 4US6A 5CPSA 3P14A 2HISA 1NJJA 3W6YA 3TN3A 4DB7A 4XD3A 1GJWA 2NT1A 3PBUA 4W84A 2FJKA 1MRAA 1ZGDA 4AYGA 4GUIA 3OGSA 3TYBA 3BJFA 3TSMA 1OVDA 4KERA 4DBWA 1LQ2A 1PX4A 3BAXA 4GGBA 3WL1A 1SFLA 4LS2A 5GQBA 3UA4A 2UY5A 4CEUC 3S6TA 3OG2A 3ITTA 3N2BA 4K39A 4RNJA 3V4BA 1AW5A 4Z2KA 1GTHA 4B92A 1Q7MA 2DZPA 4L4MA 3SDOA 1VPQA 3B4YA 1U2YA 3IVTA 4MDOA 5LNVA 2GYIA 5EPDA 1LUCA 4A29A 1C92A 1IXQA 4NZCA 2R9RA 1S38A 3JR2A 1OZQA 1TV4A 4R34A 3KCLA 2DVUA 1RA0A 5D8ZA 4HVXA 2W67A 3G3DA 3PUOA 1ZAIA 3OZPA 2PDHA 3GVVA 3HG5A 2X1IA 4L6OA 3W1LA 3MJYA 1Y65A 3LPPA 1CGTA 2OSWA 4FNSA 3R0DA 1W1ZA 5A2CA 3O9NA 2Z25A 1UQZA 4IF2A 2YIHA 3I6TA 3UP8A 3GW3A 4PODA 4AU0A 2R1PA 4M6VA 3SECA 1YNPA 1Q6GA 4NL1A 3AC0A 2AOSA 4UIOA 4IMDA 1JDFA 3K8KA 4OHQA 3SEPA 3P74A 3WDJA 3VOJA 2QCEA 1G7VA 3FKKA 3TK7A 2YYTA 2WC7A 3BH4A 2Z4GA 4HPNA 1MO0A 1DWGM 2Z29A 3NO3A 4LS1A 4XBKA 4LBSA 4HKPA 1GOWA 1W9DM 2VDHA 3G18A 2WC3A 1ZCCA 1PHWA 3EMCA 1FCUA 4KIEA 2GJRA 2X1UA 1VFFA 5CGQA 5F1UA 3REQB 5AC7A 4QSHA 3BJTA 2XSAA 4HNOA 4AX7A 1K02A 2D1ZA 3H2AA 3HIJA 2XH4A 1J4EA 2GGHA 3QM3A 2ISSA 4EPKA 2YL6A 4JYFA 4ZA0A 3CV2A 3VDCA 3BW3A 4ZENA 1CGXA 4KQNA 3RLGA 2HE8A 2C13A 4QJ4B 2WHMA 1DTUA 1F61A 3W72A 1RCQA 2E6YA 4DF0A 2I7GA 7ENLA 3ITCA 4JTQA 4W85A 4B5WA 4A3RA 4J5NA 4Y9AA 1Y0EA 3FSTA 1IR2A 3V1PA 1F4AA 1BQCA 3LU2A 3BE7A 4DO6A 3UFYA 1CGUA 3GUGA 4JTGA 4GD0A 3QW4B 1TRDA 1R3VA 2F8QA 2VCCA 4O1BA 3I65A 3G3MA 4XO6A 4MLRA 4V33A 4PRRA 1HXJA 3WH6A 2DSWA 3SW6A 4CD8A 1LL4A 3WDRA 4O1CA 3AWOA 5E70A 4Q7NA 3ZWTA 3MP4A 4PFMA 1YMYA 5MHBA 2ZUNA 1FWAC 3H7RA 4YVVA 1T0OA 2J7CA 3MC5A 1TWWA 1SR9A 5K9XA 4E6MA 4F0LA 1EJUC 1ZALA 3FDGA 1N7KA 4HZMA 1PL9A 2VEPA 5DO8A 2J66A 5A6TC 3S2MA 1UWIA 5FEXA 2ABAA 1RY0A 4GQ0A 1WKYA 5CBIA 1F3EA 3R0KA 4JKLA 1WXYA 3FAXA 4HK5A 3RXZA 4YYFA 4UFLA 4XQ6A 4CEXC 1Z44A 1K6WA 1B57A 1UPPA 4C6DA 1N55A 1FHVA 3Q67A 4YCPA 3WG6A 6XIAA 3MVTA 3EA1A 1TMQA 4XD5A 5EMLA 3HU7A 4KFNA 2IUZA 2AGKA 3PG8A 2WNQA 3DFSA 4PEKA 2ZRZA 4FLQA 2WC4A 4F0SA 3FCPA 3DG6A 4A3QA 1TUXA 3G6LA 2ZOXA 3EGJA 3SFWA 3ZR4A 3HQNA 1EDQA 6XIMA 1OFBA 1R3QA 5D05A 2BY1A 4E2OA 3NXFA 3QKEA 1E1CA 5ECUA 5C9XA 1MXSA 2E09A 1LBLA 2C71A 2ZX5A 1OX5A 1P0NA 3ARVA 2GWGA 2J7FA 3RK8A 4WVXA 5LIUX 1GONA 5E0CA 3SCUA 2WO5A 5F7UA 5FJOA 2ACQA 3H26A 1W2PA 1LOQA 5DANA 4H1ZA 1D3HA 2GFTA 4ADSA 1I6NA 3O16A 3WD1A 2Y5EA 4UB9A 4H04A 2HZGA 4RJEA 1JL8A 1XLAA 4K2SA 1G9HA 2PDGA 1ZJBA 5E09A 2J79A 1RBOB 5T9BG 2FB2A 2PU0A 3I7SA 1K9FA 4Z42C 3AMKA 3S2JA 5CZJA 4PBGA 1SVDA 1ZL1A 4JKMA 2C19A 4IMGA 3BSMA 3TYCA 1J93A 1ONXA 3WD4A 1VRXA 5HK4A 5HWNA 3OU8A 4IICA 1R9YA 2D69A 3E5PA 3U5UA 3PPCA 3SCOA 3TEVA 4GY1A 3A3XA 1S5TA 3PWGA 5LKYA 3UG3A 4S39A 2GUUA 1WZKA 2JKPA 4O1EA 3MSDA 3CIXA 2LLEA 1Y5WA 3WX7A 4H2CA 2GQ3A 4HOWA 3AQUA 3WMBA 1VFSA 3B3DA 4B2DD 2JE8A 1V77A 2DGAA 2QJHA 3LUTA 2E1WA 1UH3A 3RM4A 3ZJ8A 2GOKA 4GO9A 1W9UA 2VC9A 3PTQA 7TAAA 4NIRA 4JQAA 1TO3A 4GNVA 2OLHA 4QDMA 3RG6A 4IISA 5I07A 1NAL1 3C3UA 1CBGA 3AS2A 2XPKA 4F8XA 3WFAA 5AC4A 5GJNA 4UFJA 1FCVA 1R6WA 4DJFC 3WBEA 3KCOA 4GC3A 3OBEA 3BQ6A 4H4IA 4BK9A 2EPKX 2OT0A 4XAZA 1CGYA 3ABOA 1EH9A 5M2FX 3H23A 2CNCA 4M7TA 3EOSA 4Z17A 3KM8A 4S3JA 1SUXA 3MU7A 5GJPA 5BROA 1ITXA 4E3VA 4LVBA 4MHBA 2WVVA 4YWIA 3BMWA 3GY1A 3EDKA 5A8MA 1VENA 1XQKA 5F4WA 2RJHA 1KFCA 2CC0A 4BI6A 4NJIA 4WOQA 1GZGA 4BFAA 4QG9A 3S9ZA 1R3RA 1JR1A 5D4YA 5AC6A 4NZJA 3QYQA 2Z6IA 1SO6A 1NIUA 2B7NA 3VA8A 1K7XA 1V0MA 1JFXA 3SCPA 2ZX8A 2FZDA 3GYEA 3KEHA 4F9JA 3CUHA 3QVQA 4IP4A 3D3AA 4LF1A 1TPUA 2PSNA 4HPJA 3ALFA 2G0WA 4GH1A 2ZE3A 3GC5A 4AY8A 3BGAA 4OUEA 4O0KA 4JHMA 1H49A 2GDVA 4B15A 4WJEA 2EQDA 2YGYA 1ZJHA 1DTNA 3B9EA 4XO7A 3G1SA 4FNPA 4PCPA 5KZDA 3S2CA 4W9TA 5EMKA 1IGWA 3BK0A 1YTEA 1IXOA 3GSMA 3TAKA 1EA9C 1TJ0A 1W9XA 3KL5A 1SJAA 1RLDA 4OKDA 2BHYA 3M5VA 1UZDA 4X63A 1IXNA 1KM3A 2GVGA 3W7LA 1C29A 5GNXA 3T4WA 1YEYA 3R89A 1JDDA 1UR2A 2XGZA 3PUGA 1Q7QA 1GVRA 3W2UA 4Q4OA 3WYZA 4Y9PA 1MEIA 1GOIA 3TCSA 2HBVA 4GI6A 5FESA 4CUCA 1REQB 1IWAA 3TW7A 3CPRA 4JBRA 3I4KA 4WX2A 3A4XA 3RMEA 3LRKA 3LA4A 3IV8A 5DEZA 1FFRA 1N2VA 1Q6FA 4IGNA 3C6CA 1H50A 3VD5A 4RNHA 3KE0A 2W4XA 3FIGA 5GJMA 1BGAA 5FA5A 2E7FA 3CWNA 1KQZA 1DE5A 2BASA 2PWDA 3NOYA 2X05A 1OADA 1KBJA 1YDYA 3GTXA 1IIHA 4L4PA 1EQCA 5GNYA 1E6ZA 2YW4A 5EKYA 5HULA 1IGSA 3H8AA 3AYRA 2HS8A 2IQ0A 4Q8VA 5KMYA 3TC7A 4WY0F 1J0YA 2IS7A 4Q33A 5BRBA 2EPHA 1MSSA 1A50A 4RK8A 3CUIA 4H9VA 3L4VA 3W07A 3K2GA 3MUZ1 1FWHC 3K1GA 1A5UA 4US5A 3VKAA 1FWNA 1DYSA 4HMNA 4GKTA 4W88A 2ZA2A 4DVOA 2ZRWA 2A3BA 4HNVA 3GFXA 1NWSA 2J7DA 1EIBA 1UH2A 2Q8XA 3MUY1 4M6UA 4YVPA 2YKKA 1ME7A 1JNEA 4E4FA 3GR7A 1KFLA 4G7FA 1E9YB 3VABA 3V18A 1J12A 3W73A 4RV8A 3O0KA 4JN8A 5A6JA 1GPWA 3IJ9A 5DN1A 3SCRA 3K4DA 2VGIA 2Y6ZA 4M1BA 5AC5A 3WLIA 2PDBA 3B8SA 2VFFA 3UPBA 3WMCA 4IFRA 1S1PA 4JTRA 3W84A 1GT8A 2J9ZA 3JVAA 5HNUA 1KKRA 3V3WA 4L6DA 3SURA 2VR4A 2OO0A 3W86A 3CXOA 3MYPA 1TRIA 3NFUA 1TE1A 4H8HA 3POCA 1W9PA 4H9YA 3OIXA 1TX0A 4UR7A 1HJUA 4HSHA 5BWFA 2WMJA 1EZ2A 2HQAA 5I5RA 1GHRA 2D3LA 4D2JA 1LL6A 1YXDA 1OFEA 5LYRA 2VGGA 4UFKA 3M0HA 1MW2A 1VCVA 3BAKA 2AL2B 5G5IA 3SUWA 2G5WA 3Q94A 3AS1A 2DZWA 2PI6A 3HG3A 2INFA 3R79A 2GUYA 2X7WA 5JVLA 1JCTA 2QF8A 1VPXA 3W1XA 1M04A 4U4MA 4CD6A 2XM2A 2PDMA 3SZ8A 5IXEA 1PZ1A 3VKBA 4JS3A 3IUDA 1K3UA 2XINA 2O9RA 1EX1A 2O55A 4NNCA 1HF6A 3KL3A 1QPRA 4O0QA 2W66A 3TZNA 3DOPA 2PTXA 2WJZA 1ISXA 4BWLC 3QV9A 3VUPA 4U5KA 3GNRA 2ESCA 2VKZG 7A3HA 4NRSA 2YLAA 3GVWA 1LT8A 3FSUA 1OD8A 1CI1A 2IPWA 1KKOA 2OB3A 4IJRA 4ONVA 1JFHA 2POTA 3ITLA 1YW1A 1G4SA 5MF5A 2PP3A 5HWMA 2OQLA 4MWAD 3EAUA 3SN0A 2GL5A 1UD4A 3GHTA 3G1XA 2Q02A 1NARA 3MCNA 3CAQA 2CZEA 2PA6A 3A9BA 3YPIA 3A5VA 2VVSA 5KZ6A 1E6RA 3CTLA 4LTSA 1V3LA 3E2RA 2EHHA 4GVIA 4BY3A 1VJIA 1EEPA 4Q32A 4C6IA 4W89A 4GA8A 1XDJA 5FI8A 5AHFA 3M47A 3SRHA 2PD5A 4MPQA 2DZAA 4P7NA 1A3HA 3M0JA 4ZE5A 2YZ5A 3UZYA 3S1VA 3CUGA 2YB1A 3OVRA 1H7PA 4HMCA 2O0TA 5C7VA 3B8UA 2XHYA 4RKAA 3R8HA 1Z69A 4JTAA 1LG1A 5CGTA 4P7LA 4LSBA 4UTWA 4OBSA 3LZ5A 2CXGA 2XH0A 2Z1XA 3WCZA 3W1MA 4ENLA 3LI0A 5D03A 1SZFA 4UTHA 5JU6A 3EA3A 4CQ8A 3AXMA 1JCNA 1EQPA 1P1MA 2HSAA 3EEZA 2WNZA 1XICA 5C9WA 1QAPA 1FDYA 4JX5A 4IL2A 3S5SA 1VB9A 5IFPA 3U48A 4UTMA 1CZ1A 3BWWA 5G2WA 1TQJA 1VR6A 4C6CA 1W1A1 5EU9A 1DORA 2V5BA 4ZVJA 1EJWC 2ZWYA 3VNMA 3TN5A 5FD0A 2YL8A 1YQ2A 4M5PA 3VKDA 4Q6JA 3PK7A 3WENA 1C8XA 1SU5A 2HK0A 1QHPA 1E6QM 3AMLA 3LPGA 1EDTA 5T26A 3C3NA 1CLKA 1J96A 1F74A 3NVTA 4HK7A 1U33A 2RDXA 1PAMA 1MQQA 4I6KA 1HG3A 4RZ5A 1PDZA 3H53A 4O16A 3I4EA 1YPFA 4K68A 4Y6GA 3K4WA 3SY5A 3I3EA 1W0MA 2V2HA 2QJGA 5FEWA 4LB4A 1UP2A 3GR8A 1KO0A 1TPVA 1GOXA 3UEQA 3OA3A 3FHQA 4AMAA 3GHUA 1BAGA 1PS9A 4AUBA 2V5LA 4O54A 2VWSA 5B80A 3W6LA 1NH6A 1UBSA 5I3IA 4GISA 2FH8A 2W79A 3W2NA 3E0IA 3REQA 4HU8A 4ERIA 5A6MA 1WYIA 3KRBA 2WAGA 3K30A 3OLIA 3UR8A 4AY7A 5K9DA 1AFSA 3O1NA 3TMLA 1J0IA 4B3ZA 1O5KA 4JTDA 1DP0A 4RE0A 2VD8A 3FJLA 5AHIA 3TTOA 3Q4DA 1UZ1A 2VVNA 3BLIA 1QPOA 3CPUA 4N6EA 1C8YA 4AF0B 5U7SA 4BQ3A 4QXIA 4OIFA 4J28A 2BP1A 2JF6A 4DXXA 3BMXA 3VNJA 1JAEA 2HBXA 4WHBA 4UQEA 3WD3A 4ATWA 1OF8A 3LHTA 3GNDA 2BFGA 3OLDA 4LUTB 3GTIA 5CG0A 5GPRA 2NQZA 3UNDA 3NIYA 1UUMA 3GXTA 2P76A 3VIMA 3UETA 3MBFA 3D5HA 1UP3A 5I3FA 1E4LA 5FJRA 3RR1A 2WWCA 3N9SA 1NTHA 3T8QA 1C9WA 3WK1A 3OVGA 1G67A 4CNNA 4DXVA 1NOUA 2C18A 3GFYA 1V0LA 1W6TA 2ICSA 1OGGA 2G4FA 2XU2A 3CASA 1SZRA 1UC4A 4EF9A 3EWXA 1XLCA 3AIEA 4GCXA 3ZVHB 2G96A 3CNYA 1T6MA 5DELA 3ANVA 4POCA 3WQ4A 1GCYA 4PCFA 1K8YA 3GDTA 2CBIA 5T91A 1MDLA 3DFPA 2Y4SA 2BXZA 3GXFA 3MYOA 1ISWA 4DUOA 2L5HA 3Q45A 9CGTA 1VCGA 5EBUA 2CLPA 2FB3A 2P50A 4UR8A 5DX7A 1XCXA 4MFEA 2ZC8A 2QCDA 4R85A 3PM6A 4XZBA 3G1AA 3OEXA 3EA2A 3GDKA 4JXCA 3GZ3A 4KPLA 3TYDA 1C8QA 2I17A 1XYLA 3IIVA 2XN0A 1KCLA 1UA3A 4LVFA 3GVGA 2TYSA 3VOHA 3N18A 3M6DA 3WQEA 3GBEA 1BXCA 1B3OA 3CQHA 1OK6A 4GVFA 2GQAA 5ABFB 1XLBA 4QR6A 3UPMA 3MMTA 4H7ZA 3U4FA 3HMJG 5LIKX 1YBQB 5CBJA 2WPGA 3BOXA 1TWSA 1XFBA 2GJPA 1X1NA 4UQBA 5EYWA 4AY1A 3QYSA 3QPYA 1LF1A 4KS0A 4QJ1A 5U4NA 1W1IE 4V2XA 2Q6ZA 3WLNA 4BR1A 4E0CA 4JIRA 1TV8A 4U10A 3LI1A 4DI9A 3JU2A 1RV8A 5KEZA 4UNKA 4KEMA 2O9PA 2HNEA 4AWTA 4LVAA 4DZ5A 5D33A 3ICJA 4MB1A 3CQ0A 4NYYA 2FDMA 3TP4A 3T1GA 4HNUA 2IMRA 1IT7A 1TYGA 4S3EA 1L8PA 4MTVA 3L65A 1JJKA 4ALDA 1G7UA 3P67A 1N8IA 3KBVA 2E5BA 3LDVA 1BYCA 3SCSA 3WLOA 2Y2WA 2EXOA 4GWEA 3LXAA 4ICNA 1Q13A 2BY0A 2WZEA 2XH7A 4DJFA 4CGTA 2HVOA 1EGVA 4DELA 1TR9A 5DXXA 3KVKA 1RJQA 1US2A 4I9JA 1MZRA 2V5KA 2DJXA 4AD2A 2C16A 4WF7A 3I3DA 4KWWA 1OX4B 1OFDA 1R5YA 1Q63A 3TN6A 1EPXA 2WZIA 3S46A 3IANA 4O17A 4CQBA 5AC8A 1U5HA 3L21A 5CPNA 3DFTA 5IDIA 1WXZA 3EEGA 2MANA 5A8PA 4AXKA 1JQVA 1SMAA 5L6UA 1D8WA 3OO2A 3QEZA 3RO8A 3N4FA 3IGXA 2ZZ7A 3BGJA 4FOJA 4MJZA 3ZSSA 3HQ1A 1AL7A 2XVKA 4J2MA 1W8SA 4PBFA 2B81A 3S6DA 4PMVA 3A5FA 1RQHA 3DECA 2E4TA 1O66A 5I00A 3W24A 2VT0A 3H21A 4EXAA 3O8AA 3TV8A 3VNIA 3QMSA 2F2KA 4IQEA 2EPLX 1TJRA 3MUIA 4GJJA 3MTWA 4H8UA 4MAVA 1GG1A 4MIMA 3USZA 3R94A 3GDBA 3GTNA 2JF7A 2CBUA 1GQKA 3HGOA 1G5AA 1EUAA 4D6HA 2ALDA 2IXVA 4YJ5A 2QAFA 1PYFA 5CZTA 4WIWA 3VILA 3IJLA 4RX0A 3UXAA 2WWDA 1N8WA 3KOFA 3SBFA 2G3IA 3FEQA 1YDOA 4FXJA 4R7JA 3MCOA 4DLFA 5AHLA 1ITUA 2Z2BA 5JQ9A 1KGXA 1DQWA 2NUWA 3VPLA 4QNWA 2XWEA 1PO9A 5FAGA 2BGSA 3TNBA 3AUJA 5E9XA 3DHDA 3WELA 3DI0A 2CU0A 1BVZA 2ZX9A 3ZSTA 4JTFA 1MDRA 1KV8A 2PRMA 3AI0A 3IUIA 5E1QA 2ISDA 2Z00A 2KAUC 5D9PA 3N6HA 3A4JA 1HKVA 1HJSA 4UFIA 5HWJA 3U6WA 1L6YA 3ARYA 1SFSA 4WKFA 1BYDA 2Y5SA 1FX6A 1V3JA 4HHHA 1EYEA 3BARA 2CWXA 3MW7A 1B3ZA 3FVDA 4TTUA 1UKSA 4E8CA 3QFEA 4C90A 1ZAHA 3V35A 2E1DA 3B8DA 3VM5A 3OBAA 1GZ1A 5E0FA 3RNDA 4ML9A 4CNTA 3AHVA 3H22A 2AKZA 3E6EA 1X8FA 4IQLA 1KR1A 3OVQA 1A0DA 1SO4A 4GXPA 3L4ZA 4DO5A 3CQIA 3DAQA 1REQA 1E0VA 5M17A 1S5MA 2JBMA 4DWSB 1KQYA 3PAOA 4QLJA 1XCFA 3G22A 3ABXA 1CWYA 4IQJA 5FKYA 3B0VC 4S1FA 3W83A 3DN5A 4R7OA 3L66A 1ICSA 3OYXA 4I7VA 1I2RA 9XIMA 3MHGA 5GVJA 1OSEA 3N29A 3ZYZA 4AZHA 3IGSA 4QM1A 4O0ZA 2QAPA 1OFAA 3JZUA 4CKQA 2R1KA 3NQ2A 3P3BA 4DPQA 4YHGA 1TX2A 3GK0A 3NYDA 5BMWA 3VE7A 2YCEA 3V5OA 2XM1A 4JHZA 4MG4A 1L2QA 1PB0A 1QJWA 3VCNA 1F05A 1SO5A 3CHCA 5I02A 1V6TA 2QDEA 3JZEA 3S5ZA 3E49A 3TYEA 4JTEA 4UNIA 2P3EA 1H1NA 2CZ5A 3FHAA 1A3XA 1L0PA 3T0BA 2D20A 3LB0A 5HQMA 1QWGA 2A5HA 2VFGA 5KETA 1XLMA 4IJBA 3UZJA 4LQ1A 1HP5A 4B5XA 1A0EA 1NWRA 1BKSA 9XIAA 5FEZA 2QUMA 2DV0A 4WDXA 3T55A 2OXNA 2DH3A 3OZOA 4UTTC 5I3KA 4G9PA 4YS1A 1EJXC 3MV01 2FZ9A 1B9ZA 1S1RA 2E3ZA 1CGWA 1HUVA 3E3HA 2VC7A 4WQ6A 1Q4NX 1Z3NA 2OPJA 3G1VA 1AW2A 1UJPA 2WVTA 4NHVA 4J1OA 1A5MC 1PWMA 2HJPA 1DXIA 6CGTA 2JIWA 4RPQA 2ZYFA 5AKQA 3SIMA 2V9DA 3CZEA 5ABEA 4DUVA 1E6PA 1J6OA 1Q6CA 2OEJA 1R9ZA 5EL1A 3VGHA 4B5NA 1RBLA 1Q45A 3E0FA 2NSOA 1LLOA 3NA8A 6REQB 3ME3A 2I5IA 2OELA 3QLLA 2OOFA 5DCDA 3RX3A 4QLLA 3E2VA 1U1JA 1IZJA 3ARUA 1MUWA 3UR2A 2VI0A 3EX6A 1KTBA 3CYJA 2XN2A 4IT1A 1A80A 2AL2A 3KP0A 5DRIA 1KNWA 3PS7A 2DUXA 4O15A 3NL6A 1TSIA 1G1YA 1DJIA 5CZKA 4K1WA 3G24A 1X6LA 2F9RA 1M01A 3AO0A 4PMNA 5CH9A 5FL1A 2J88A 1FTXA 1TJPA 4GMEA 1TMLA 4KEUA 1H4PA 2PBOA 1WA3A 4C1LA 2YCKX 1XH2A 1ISVA 2RDTA 4JYDA 4LAKA 4FHAA 2VO5A 3R11A 1TMHA 1WPCA 1XKJA 4GUGA 4BZYA 1SZGA 3MP5A 1GVIA 1XGEA 2IKHA 3QV8A 3ZIZA 3FGCB 1OG0A 4EWJA 1BYAA 3WBWA 2OSYA 1UA7A 1QW9A 4GYFA 2NQLA 1PSCA 1YADA 4JFSA 3CWOX 2FMNA 5TNVA 4BQ2A 2WMGA 2GJLA 4H00A 4LCRA 4NG3A 3DH7A 1EO7A 2JGQA 3AYVA 3GD6A 3TW6A 4GFIA 4AD3A 2OYLA 2OKOA 4H19A 1JCXA 5D9NA 3VGGA 1DWFM 5AHEA 3HTWA 3LBCA 3ARXA 2YL9A 3QPZA 3FJ4A 3LZ3A 5FJIA 4LWWA 1QUMA 3FOKA 3H2CA 5KTLA 4C1KA 1RHCA 1NFPA 3LHZA 2A0NA 1J0KA 4MY8A 3T4CA 4NX0A 1PV8A 1SZNA 1KM6A 3GM8A 4FPSA 1M9HA 4Z1CA 2BGNE 1BWVA 1I9CB 5KITA 1NVMA 1T8QA 3LCXA 3CEUA 1HKIA 3BL3A 1B90A 2HTMA 5G4HC 3E38A 3GR4A 4KEVA 1XUUA 2BV9A 3D3FA 2PFHA 1AZ2A 3P8JA 2C15A 4MYAA 4XB3A 2NW0A 4H9TA 4DYJA 1VIWA 4B5UA 4L9ZA 2OZTA 1WP6A 1YDNA 3T40A 3IJIA 3BZJA 1J18A 1C7TA 3DC8A 4KFPA 3HB9A 4AVOA 3L68A 3KZPA 4NQ1A 2BY3A 4HSNA 1VP5A 2ZVRA 3CIWA 3SRDA 2CLOA 2GK1B 5G4EA 3DKLA 1VLIA 2YCIX 1R2SA 2NUYA 1Q6OA 2HEJA 1VQTA 1F9CA 4J35A 3WH7A 5EA9A 5M03A 1VFMA 4QE4A 1V02E 4LYKA 3NM1A 1XRFA 2A3CA 2Y8VA 2JFEX 3WUBA 1GZJA 1BTCA 4K1GA 1W3IA 3L4TA 1Z41A 4M80A 4LRTA 1WAUA 4K6AA 3ZT5A 1YKWA 4YMZA 3BDKA 3WLHA 5DY3A 1GHSA 4G5DA 1OFOA 2VFEA 1ZQ5A 4JL2A 1OC7A 3ZT6A 1BF2A 3SUVA 1QHOA 4K3ZA 2CLHA 4Z08A 3A9IA 4PH6A 4HA3A 2QV4A 4C65A 1F5ZA 5CSSA 5DMYA 1QWKA 1O4UA 2VRJA 4RDYA 3LERA 2NVDA 2OGYA 1RCXB 2X1TA 4D71A 1F3TA 1JCLA 3HG4A 4KT2A 2UY4A 3STPA 5KZEA 2WSQA 4NILA 1X8CA 3BCDA 1TVPA 4D6FA 2PGFA 1HVQA 4RL3A 3UY7A 1ESWA 1JZ5A 4B91A 1AQMA 3NOEA 4DWDA 2C7FA 1LWHA 1XQLA 4LU0A 3UZWA 4JTLA 4XD4A 1XV8A 5TQLA 4GO8A 4KCTA 4AF0A 4BF7A 8XIMA 2J7HA 4UOJA 2PLJA 1RJPA 1VJSA 4M24A 2GZXA 4ZOEA 2WPBA 4JHOA 1V6UA 5G2HA 1YRRA 2GJNA 4OV9A 1QXLA 1JQXA 1CDGA 2CYGA 1PWLA 4WJ8A 1C9DA 2DJLA 3E0VA 2FTWA 4DRSA 3N4EA 1XLIA 4GINA 4O8RA 4EK7A 5FSDC 3SJ3A 2WCGA 1F6PA 3DBPA 2ZIDA 1BTMA 4PUJA 1L6GA 4CVUA 3LBOA 2W5FA 3VDGA 1JRCA 1VBHA 2CLEA 4I6VA 5FEPA 1E3XA 2W63A 5AOUA 3GX9A 5C71A 2GVLA 4DO4A 4UFMA 3K4AA 3WMSA 4IPIA 2PDQA 3CV1A 1ZU8A 3QHMA 2FKPA 1JF5A 5H91A 4X61A 4EPEC 4HGXA 2WZTA 4Z2IA 2YA0A 1E4IA 3C2VA 3O0FA 2WHJA 3VXGA 1T41A 3UZXA 2E0PA 5DQPA 3KUMA 4DBDA 3AYSA 1E0XA 1CECA 4YTQA 3ZVHA 4TOQA 1R3WA 2IKGA 2W91A 1VIZA 4QFUA 3LLFA 5G1YA 2UY3A 2E9BA 3CL7A 1MRQA 3WQFA 3M5ZA 3WUEA 2VELA 2QCCA 4GFSA 1UZHA 5AHNA 5A8OA 3A22A 1XRVA 2F6UA 3OHMB 1SJBA 1UD8A 2YCJA 3AYTA 5AECA 3RJYA 4M81A 1EYWA 2PTDA 1D8CA 3VU2A 3RGTA 3OGVA 4NZ4A 5LHEA 2NLYA 3P84A 2QGYA 2AGTA 3UG5A 1WBJA 1E0UA 3KTXA 3QR1A 4FX7A 4LUJA 1B30A 4UTJA 4CCDA 3AIVA 4Q7BA 1RPXA 2FHBA 1E5JA 3IJ6A 5DMNA 1PTGA 3SB0A 1G0CA 1VH7A 5FSEC 4LBRA 1S2TA 5RUBA 5ABFA 1NF0A 1FXQA 7REQA 5AB3A 4FO4A 2IPFA 3DX5A 1Q6DA 3VGDA 2VFIA 4XIMA 3UWZA 1KXQA 1EWEA 1JYNA 4S3DA 2R6OA 1W8GA 4DF2A 3TONA 1CXLA 3U5YA 2C14A 5ABTA 3VD4A 4JTKA 2GDQA 3PPGA 1D2KA 2DZTA 3IJ7A 3S2NA 1AQ0A 1V0NA 3GO2A 2OVLA 5I7GA 3C0LA 3U4AA 1C8VA 4ZCWA 1YTDA 3SGGA 3GKAA 1B31A 2ZVIA 4HTBA 4M6QA 3QSRA 2GGIA 3KW3A 3F2BA 4NZ5A 4N4PA 3MUXA 3WLJA 3SFKA 2QUTA 5KZMA 2WW5A 3BICA 3PBVA 4JN6A 4G6CA 3BW2A 2NX3A 2QPSA 2NZLA 5JIWA 1FCQA 2ADAA 3IVUA 1OX4A 3NM3A 1WNOA 2IKIA 4TTGA 2UZ9A 1AA1B 3DESA 1HP4A 1UR1A 3Q65A 4DUWA 2Z1VA 3CM4A 2VXNA 2O4QA 3U57A 1UWUA 1VAHA 3QTPA 3HZ3A 2I5GA 3NTYA 3W6MA 2I16A 1HJVA 3PULA 4ACZB 3WLQA 1B4KA 4W4QA 1LLZA 4OUIA 1LRNA 4CQDA 5F2MA 3UJRA 1BQGA 1XLLA 1CXIA 2YW3A 3E02A 1TG7A 5BZAA 1LBMA 2BOFX 4H8VA 4QAWA 3GXPA 3T7VA 3MWAA 1RY8A 3P82A 2A7NA 4LAZA 3FN9A 1HN1A 3C61A 3WEZA 3IAQA 4LANA 3IJ8A 3ONCA 1LG2A 3H24A 1CNVA 4U2YA 1C93A 1E6XM 1GJUA 3ITVA 4FXRA 3BLEA 3MI6A 1HQTA 3EMZA 1JPHA 4S3BA 1TJ1A 3LX9A 5K9CA 1KXVA 1XSKA 2I1OA 4LW7A 5I06A 3W2MA 4YNGA 4Y8FA 4AH7A 3OA5A 3M4HA 4KF1A 1UUQA 1YYAA 3QPEA 4EAMA 5C6MA 1OZMA 3ITOA 4W86A 1W3KA 5HUOA 1LLWA 5XIMA 1H7WA 4MNMA 3CU2A 4IXHA 4I5XA 3R58A 3WEMA 1DHPA 3VOCA 4JQ1A 3CUFA 3EDFA 3CLMA 4R27A 2BTMA 3STEA 4WKHA 4PEEA 1JPMA 4MKSA 3E96A 4NZFA 1QO5A 1MMFA 3VYLA 2J6VA 3KTSA 5AY7A 3AALA 2X09A 5C9UA 2DIEA 3WN6A 2VEKA 1QPQA 4H6QA 5C2XA 2C79A 3T44A 2A1YA 3TCEA 3TTSA 2WYSA 4QROA 1QNOA 3STCA 1QI2A 3QMRA 4OFCA 3RU8X 3FX4A 4S2CA 3W26A 3TR2A 5CLWA 5B7ZA 4W7UA 1LORA 3ZLFA 3GDMA 1CTNA 4DM1A 4K8GA 4D8AA 3L9CA 2XZ9A 1E4MM 2VZVA 4IOTA 1O60A 4JGDA 3VDHA 4DWSA 1V02A 3VIFA 3EX1A 4HHLA 4D1IA 4GZIA 5EFDA 4IPJA 3BLDA 2WZHA 4HU4A 4O53A 3NQGA 3F03K 4PCSA 5G4WA 4ROPA 4MWAB 2JALA 2FPTA 3HPFA 4UTTA 3WQ6A 1IXPA 4C7FA 4OBTA 3UW6A 2VX5A 3RLHA 3W37A 3ARQA 3URQA 1XJBA 4Z1DA 1UQYA 3W27A 4AD1A 4C6JA 3LTSA 4L56A 3MDUA 3SCVA 2REQB 1FWSA 4M29A 1XLHA 3APTA 2PTYA 4IIHA 2DY3A 1DOSA 1OCJA 1W54A 4CU7A 4DAIA 2YJQA 1RK6A 2NWSA 4YIWA 1VHCA 1GVYA 3TOPA 1LROA 3GWQA 1ITCA 3WJWA 1KM4A 3THCA 3AXIA 4TX8A 1J10A 4JTJA 4LBUA 3PSVA 4KRUA 1EA0A 3WQPA 4Q4RA 1VEOA 1D7FA 5FF3A 1PTAA 3SJNA 3W22A 3PF3A 1QPNA 4Z1BA 5ENLA 4R33A 3WK0A 1F7BA 3M0YA 3N11A 2YA1A 4RDZA 6PTDA 3SRFA 1SW3A 2VTFA 2IW0A 4GQQA 5H6HA 3M1ZA 3IJDA 4M51A 2D23A 1HJXA 3N3TA 3ZXWA 1V6YA 1ZBVA 2G3JA 4I3GA 1CT5A 1QK0A 3B06A 3FEMA 2BVWA 4DEFA 3NL3A 2EGZA 1XLGA 3EOEA 4WXZA 4LUIA 2BXYA 4EVZA 6REQA 2QCGA 3ABRA 1SFJA 4RZ6A 3TLQA 3FXYA 2AMXA 4TVDA 3CYVA 1KB3A 2PDKA 3SCTA 1A5AA 4C6QA 3NGJA 3LV5A 1M53A 3LXCA 3OIHA 4GUJA 1LP6A 1OFRA 2VX6A 3E74A 1LT7A 4ZB2A 4R53A 1NWTA 2B4GA 4I90A 1VFUA 4HMEA 3OODA 3B8TA 3G1HA 7XIMA 2V5DA 2V63A 4GYPC 3TU9A 3V75A 3ES7A 4ZXOA 3WH5A 2QF7A 4GACA 5A6KA 2QULA 4F2TA 3GXMA 2PCEA 3NPXA 4QQ3A 1TTJA 4QHRA 1I1XA 3C2RA 2X1RA 2XSXA 1UWRA 4MB5A 3VGBA 1V3IA 3UR7A 1XPYA 1R2RA 3N13A 3RPMA 4EKJA 5M1TA 1IT0A 3RRAA 2P88A 5AYIA 3L0GA 1M7XA 4GIAA 4D6IA 4G1KA 4ICCX 4MZ1A 1QW8A 3K13A 2PEVA 5D2TA 4H6RA 2CZDA 4KWOA 3BCJA 1QVBA 4JTTA 4A3UA 2QDGA 3WNMA 3W7PA 4GXMA 4XAYA 4E2BA 1UMYA 4ASTA 5A69A 1JD9A 1Q2RA 4EWND 2XVPA 2P1FA 4Q22A 4GG9A 1I0BA 3R4IA 4YTTA 3ZOAA 3RCMA 3DERA 5D8WA 1A5CA 2J62A 4JTCA 4K8EA 5K4XA 4ZTXA 3L23A 4A6GA 1FWRA 1ZJIA 3W7JA 3F5KA 4KGJA 1RH9A 3FA4A 5ABGA 1QCWA 1XXXA 4N9BA 3KXQA 4ZQPA 4WKAA 2GDUA 2ZZ2A 4PUNA 3B8WA 1QI0A 4Q7IA 1E15A 3NQ6A 4S3FA 3TW9A 3MSGA 1W9BM 2YBVA 3UR5A 3AZTA 1ZB5A 3DI1A 1BXNA 5DFAA 3IIZA 3KVMA 2ZUTA 2XWDA 1V3MA 3ATYA 2Y61A 1W3LA 3CBWA 4Q8QA 4O4WA 2QMJA 4ICMA 2XIJA 1GOOA 3A6OA 4Q8WA 4W5ZA 2X1SA 4WSJA 3LOTA 4QE5A 1CLXA 1DJWA 1RLCL 3STFA 2PRLA 5C8BB 2V2DA 2V3DA 3M0IA 2ZZ6A 1H0GA 2HXUA 2GK1A 4QX4A 1V5XA 1WDDA 3P5ZA 3RO6A 1PX3A 3EDEA 4HN8A 2RKXA 3JRKA 3VIIA 1VBUA 1FDJA 3UCCA 3QQ0A 2TSYA 5F2GA 1H1YA 1XYAA 3PWAA 3LCWA 3T2OA 4M56A 3G1YA 4I8DA 3QGVA 4X2RA 4DM2A 5JH2A 1EC7A 2VEMA 1JCYA 4FK9A 3TUUA 4M0XA 3IV3A 4D9PA 2OMAA 4GJIA 1CGVA 4FEZA 4QITA 4MWAE 2R14A 4FAMA 1T7LA 4AHOA 1B54A 4FNTA 1HO1A 1H3GA 4LYPA 1O5RA 4IGSA 1K70A 1VYPX 3VK5A 1AH0A 3WNNA 5PTDA 2QMKA 1YXCA 3QTGA 1WDWA 4TX9A 1E0TA 1P7TB 5LIYX 3EWWA 1KRCC 1H0IA 1MW1A 1FWWA 1KFKA 5HINA 1ONEA 1OQFA 2QPUA 3C2FA 3GG7A 4JQ2A 1IEXA 1O5QA 4DJDD 1E5NA 3LN3A 3KDNA 3WLRA 3M7WA 5I24A 4N02A 3B9NA 1G6CA 3F5JA 4MM1A 3B0XA 3VDBA 3QOKA 3I3BA 3OG3A 1KBLA 4FX8A 4E4UA 2ACRA 1LTDA 4OOUA 1T96A 5HMFA 2QGHA 2E68A 1TCDA 4P2VA 3RLVA 4CU6A 2WANA 4EANA 1ECEA 4XV0A 1UUOA 4DXKA 5CJNA 2EEXA 5ABHA 4O28A 5BXTA 3UF9A 3W70A 4RZ4A 3SQMA 3QV7A 3CC1A 4RW3A 3N1AA 4NF7A 3BLPX 1UR9A 2C1HA 2AAAA 5DRCA 4F0MA 3W00A 4AZ5A 3DHFA 5FF7A 2X7VA 3AXXA 4GPNA 4PTXA 4B2DA 1MZHA 3LBMA 2E9MA 2G37A 4PMYA 5EY5A 3VCRA 5DF0A 1EXBA 3MKKA 2ZZ1A 3PZVA 5MKGB 3AJXA 2BLEA 4IQDA 3A3HA 1WZLA 1PUDA 4GZEA 4TR9A 4GCAA 1UH4A 2BODX 3CHVA 1AK5A 1HVXA 1GVFA 4CQ9A 1ZAJA 3S8HA 4NZ3A 5I77A 2XSBA 7CGTA 3S0CA 2YZRA 3OZYA 1E40A 4KRZA 3CZKA 4W7WA 2CESA 1RQEA 1J0ZA 4FSAA 2NXGA 4L80A 2C6QA 4WDTA 3GXDA 3M0VA 4L4OA 2XGBA 3M0MA 2QVHA 4AZ6A 2D0FA 1UR4A 4MNJA 3DFNA 3E1F1 3RRXA 1FHDA 3N6JA 1D3GA 2O7SA 2VURA 3IVSA 1GORA 2INEA 3W7EA 1CEOA 3DYPA 1BG9A 2OQHA 3KAOA 3T07A 5LNUA 4UQAA 1IEIA 1XLEA 4IIFA 5CC6A 4R9OA 4DIAA 3USBA 4PL2A 3S47A 3M07A 2P53A 1UP0A 1AJ0A 2YL5A 3UY8A 1FFQA 2FPVA 2PAJA 5D02A 2D2OA 3N15A 3VKCA 3RILA 1B3WA 3P60A 1LJYA 2V82A 2A7RA 3UWWA 1QW7A 4RDWA 2VCAA 2VOTA 4A22A 2V0TA 3M43A 3WDQA 1M1BA 2BX7A 1F8IA 1J79A 3GQYA 1F6KA 1A4LA 1LOSA 1P4CA 1DJGA 3NDZA 1X39A 3EOUA 4AG0A 3MUCA 3GS6A 3KOXA 1WDPA 4A8LA 5D2WA 4ZB0A 1Q2SA 3RIKA 1TFVA 1JCJA 4FR1A 5JXQA 3WQCA 3TTQA 2FPYA 4ZGYA 1RZMA 3EWBX 3NPVA 3LCLA 1JPIA 2B0MA 3CPGA 5EBAA 2J7GA 1WOBA 3R7MA 4WCJA 1U22A 4BHYA 5EMMA 1XH0A 3PJUA 1B5TA 2NV2A 4ADUA 1X98A 1PCWA 1Y8BA 3QY8A 3HA1A 2DW6A 9RUBA 2Z27A 2A3EA 1VJZA 4MSSA 3RCNA 2IKJA 4JICA 4F2BA 3NQEA 3ATZA 4MMWA 2YBUA 1BG4A 1EF2A 2O7QA 1YDVA 3MS8A 1Q6EA 1TPDA 3GXIA 1JAKA 3BW4A 3QGAC 4XZMX 3G0SA 3VIGA 2NUXA 2NSXA 4FS9A 3UWVA 4OQVA 5A94A 2PDXA 2Y70A 2RDUA 1KXHA 1GYLA 4M3PA 4H8NA 4MPKA 4ZE4A 1UD2A 1A5SA 1TZZA 2VHLA 4KCUA 5F2LA 1R3YA 3A64A 1S5VA 1DWJM 3C0JA 1XIGA 5CPMA 3L2IA 5B7YA 3QQ1A 1VFHA 3DUGA 5CPLA 3ZMRA 3L5MA 4O4VA 4XZWA 4ACZA 5CAHA 1OABA 1LBFA 4MJ4A 2YDAA 4GRSA 1IR1A 1NFBA 1VEPA 3HGRA 3XINA 2R94A 3UJ2A 1M5WA 3RAOA 1R8LA 3W53A 4N9EA 3ANYA 3QC3A 3R13A 2F61A 2V3GA 8CGTA 3DG7A 5BXSA 3RPDA 1PTDA 1H5YA 2QJMA 3N04A 4WSHA 3PPHA 3ZFHA 3PJXA 4N9CA 1V8EA 1XIDA 4A3YA 3B4UA 4GI4A 2GSEA 1CXEA 1K9TA 2PLKA 2PS2A 4HNLA 5BMXA 4Z2LA 3T09A 1ME9A 2PWEA 4KESA 4FMVA 4QEHA 4H83A 2R91A 5HR7A 1AH4A 1FH9A 3GG1A 3P5YA 3UJFA 2QCDB 4NZ1A 4LX4A 4YTRA 3RCYA 3KLKA 3VMPA 2AQVA 4FLOA 4LV4A 5D2XA 4XIAA 3BGGA 2ISFA 4HA1A 1O7AA 1BKHA 4OGZA 4CN4A 2X2YA 3ZR6A 1JCMP 3U2EA 3UXKA 2VGBA 3PUDA 4PMXA 3S4TA 2O4MA 1TZ9A 4YYCA 4IX0A 3W82A 4IX2A 3B9AA 3ARZA 2CIPA 4DBSA 1TR1A 4D8ZA 4DUXA 1LDCA 1O94A 4UCGA 3TQKA 3THUA 5DY2A 4AD5A 4H9UA 4K7VA 3O2LA 1HNYA 4XZNX 3BAJA 2H9AB 4GNKB 2DH2A 3WSUA 4IUGA 4JQ4A 4B3LA 3AROA 3PB2A 3UGRA 4XSLA 3H12A 4CCCA 4AMCA 1DIOA 1U5JA 4UR9A 4DI8A 3FDKA 2P8CA 3NQ7A 4GUFA 4GZ7A 3OB8A 1JNDA 1FWBC 1FOBA 4HT3A 3DEQA 5HMDA 4MOZA 1P0BA 5LIXX 3C2YA 4RR4A 2TRSA 4E3TA 3TTYA 2G95A 3BOLA 1QDSA 4JZ5A 4PUKA 1W3HA 2QCFA 1KGWA 3ITGA 1WE5A 3CH0A 1LZOA 3TN4A 2D22A 2H90A 1MUCA 3BAYA 3QZAA 4IHCA 1I1WA 2UV8G 4FZIA 1NP2A 1EJRC 1UMLA 5J04A 3LD5A 3GRIA 3N17A 3WQ8A 5F4XA 1W56A 1BWLA 4MWAA 3OZMA 3BANA 3TA6A 5BW6A 2PODA 3KP1A 4DQWA 4F0KA 4ES4A 3L4YA 1GKRA 4F66A 4QGCA 4D8LA 1WBHA 1M68A 4QG6A 4HA4A 1H5VA 4RXGA 1DXFA 3H2OA 1AG1O 1VD6A 4FF5A 2PC8A 1OFQA 2REQA 3CO8A 3WEOA 4A8RA 1UKTA 8A3HA 1V3KA 1JD7A 3CQJA 2VR2A 3IUHA 4DNHA 2X0HA 1FBAA 1ZCOA 2E8YA 3EKZA 3OVPA 1XYZA 4N4QA 2KX9A 3HV8A 4WEVX 1VEMA 3AXHA 5M3WA 3WQDA 5I03A 3T0AA 4NT0A 1TV2A 1KBKA 3PBWA 1QHZA 3S6OA 3FXGA 1AQHA 2OO6A 1NFGA 1NQ6A 1A5LC 4B4HA 3AMGA 3W85A 3TJ4A 1W31A 2QLYA 1S2AA 3A47A 3KRZA 4ZB5A 1RSCA 3I6RA 1NELA 3COTA 4LJ3A 3W1RA 3MV11 8XIAA 2PGWA 1BF6A 1RXOB 4GY0A 3PZQA 3G0XA 4WY0B 3RYSA 4GYPA 1VLWA 4FALA 1A47A 4NUWA 2BS9A 2V8ZA 3QQWA 4TV5A 1AJ2A 2GQ9A 5E6YA 4ZEPA 4HJWA 2A79A 3AIRA 3UBPC 1EGZA 3GU9A 3QXBA 1EBGA 3WMLA 5CSUA 3PZ9A 2PP1A 1J5SA 4AYSA 2NVAA 2CLLA 5IDZA 2R82A 1XWYA 3E9AA 3GHSA 3KRSA 3NCOA 1C91A 1AJZA 3DKJA 4ROQA 2V3EA 4C6EA 1UR8A 2CXEA 3AWNA 2FIQA 1R7OA 1Q3NA 1Y5VA 4XTIA 1ICQA 1KRAC 3VE9A 2V30A 1JXJA 1WOAA 3UERA 3V0TA 1A0CA 5HAOA 1ZENA 1HX0A 2DZXA 4UZSA 3GU2A 4C5ZA 1RD5A 4Q4MA 2BHUA 3VFLA 1TPFA 1J6PA 4GIYA 5BU6A 4XUGA 3LNPA 3ORWA 1EC9A 3VNZA 4KEZA 3LTYA 1OCQA 3NGFA 3WO8A 1C3FA 4IXXA 3WL0A 2HXTA 2HMCA 5C70A 1GYNA 1GOKA 1QOXA 1ZTVA 2PRHA 3G1DA 3UCDA 3VDAA 2H3DA 3O6CA 3S1GA 1FWFC 1S2VA 1E55A 3CL8A 3U2OA 6TAAA 2O56A 2Z7GA 4QIUA 2XGIA 1RQBA 3UXDA 3VIKA 1T40A 1AVAA 2HVMA 3GYCA 1EOKA 4WGXA 4L1GA 1GNXA 4YHEA 4PMQA 2WHLA 2DT2A 5TBOA 1W1YA 3VGFA 1DJYA 2PWHA 2WCSA 1OFPA 2QUNA 1PEZA 3PB0A 2Y0FA 1W5OA 2GGJA 2BG5A 3L0NA 3E2QA 5ECVA 2OR2A 3AFBA 3S5OA 3QGKC 4GZJA 2PZNA 3NR0A 1K4HA 3IACA 1VBGA 2PCQA 2J9YA 3KWXA 4GGHA 3WBYA 4K37A 1MYRA 3CUXA 4JCLA 4CD5A 4Y7EA 1GGOA 3R6IA 1Z6KA 1CPUA 1E70M 2CLFA 3NG3A 2I9UA 4JTIA 1HL9A 1HJWA 2Y7DA 4J40A 2Q09A 5HDRA 1THFD 4B5TA 5LNRA 3VIOA 1HJQA 5HA7A 3KBWA 4UCFA 4IMCA 3TROA 4PUMA 1XIJA 1ZRQA 3RU6A 2ZXBA 2OCZA 4XZ9A 1WDRA 4Y8EA 3I6EA 3F4WA 4EOUA 3EWYA 3G77A 4AW7A 5IHRA 4R9XA 1XP3A 4FB7A 2DT3A 1M7OA 2Z26A 4ORIA 4XUYA 3TSDA 1J9YA 1QI5A 5I79A 4Z2JA 2Y7GA 1V6VA 5G1TA 5C5YA 4Q8PA 1A5KC 2PB1A 2Z1WA 1V0KA 1XDLA 1EDGA 1TTPA 1TE6A 1SMDA 1I2PA 4AEOA 1YNQA 2VM8A 4FF7A 1HIZA 3W1UA 1K8CA 4F0HA 2QEZA 3L12A 4C6FA 1LWIA 1XINA 5I6SA 2DZUA 2ACSA 5XINA 1UG6A 2YR1A 2D2HA 3FK4A 4C91A 1UWAA 1OYAA 4B9YA 1XF0A 2X40A 3D6NA 1XSIA 1RCOB 4LH8A 4RV3A 3WIJA 3IARA 1E56A 4XKMA 2WKJA 2Z2UA 1W91A 1D9EA 2W0UA 2QCLA 4AWUA 4U31A 5CJ5A 1UOKA 2Q3RA 2OG9A 2VFHA 1KRMA 1ML1A 3W7HA 2RJGA 3RM9A 2AAMA 3KX6A 1P7TA 3VI2A 4ZR8A 4H6EA 2BSLA 5D04C 3S1WA 3P6LA 2WNWA 2DU2A 1Q66A 4F79A 3SO7A 3WQVA 3VTRA 1ZUAX 1VPYA 2C3ZA 3BG9A 4GJ1A 2QJJA 3MY9A 1W3JA 4GE8A 4R88A 2W6RA 2VL4A 4F2UA 4HU3A 3BPWA 1XBYA 4HZ6A 1XBZA 1ALDA 3EZ4A 2W61A 2PPGA 3HJZA 2E6AA 5CAKA 5IRPA 4IUOA 1NDYA 1S3TC 1R47A 3AHYA 3W71A 2NQ5A 2WXDM 3DHUA 3NEHA 3UNTA 1XLDA 4TIMA 1O12A 2WQPA 2CBVA 4J7RA 1I45A 1RAKA 2H3BA 3UVAA 2XJ7A 4PA8A 4FR6A 3NQ8A 1OGSA 1W1VA 3MMUA 5TF0A 1K7FA 1DKWA 2HDJA 4GXWA 5MKGA 1RP9A 5HPCA 3I7RA 3CZLA 1ECQA 3RX2A 1XG4A 2WM0A 1WB0A 3ZJ6A 1QU4A 2J9XA 3TYZA 3H2EA 4WLCA 3PZMA 4O52A 3CHEA 4XD6A 5CEWA 3RMJA 2R24A 2NQJA 1DIDA 2YXGA 2ODOA 3ZR5A 4QJ3B 3KOYA 2YOCA 4XZLX 1ZP4A 2VENA 2CCRA 1GKPA 1W32A 3GIYA 5HNTA 1H2JA 1RD6A 3M41A 1JGIA 5E5CA 5C55A 3R1ZA 4B3KA 2OU4A 3DHPA 4GX8A 2QVNA 4PYSA 1JDEA 4HNCA 4FIRA 2GJXB 3QJAA 3F4DA 3D47A 1Q8JA 3NAVA 4ZO7A 4PB4A 3CS2A 3DFQA 3HGJA 2EPMX 4GBUA 3PBGA 4WDUA 3PTDA 1TA3B 3KWSA 4O50A 2OWXA 3LLDA 2VJXA 2YCLB 2A6LA 1W3TA 3WD0A 4LF2A 3U7BA 4UOQA 3DENA 2INZA 3C2EA 3WBAA 4ZO6A 3PZGA 1KFJA 3SQLA 1BSLA 2FTYA 3H6OA 4HA0A 2DSZA 4JFTA 1OJXA 3MVIA 5AFDA 3MSYA 4ZBCA 4LB3A 3W1NA 5DLCA 4IZGA 3DIPA 3EYPA 1RA5A 2XVNA 5A2AA 3IRSA 4KKXA 3PZUA 1EC8A 2WCAA 5FJTA 1Z9AA 3OYZA 3BC9A 3Q2DA 3BV7A 5DMMA 4C6MA 3TQ0A 3WFZA 3N14A 1UIPA 1VF8A 4AIBA 2F6KA 2Z7KA 4RXFA 3W75A 2HK1A 1DWAM 2ZXAA 1YE6A 3UJEA 4DZIA 1QNQA 2G3NA 2ZUMA 3NZPA 2EPOA 3W4RA 4Q8OA 3LV6A 4LALA 3M0KA 4EXBA 4GH3A 3C8NA 5FIPA 1J0HA 1CXFA 3TFXA 1I60A 2VP8A 2XDFA 4I9MA 5A6AA 5G1MA 3BSHA 2ZUUA 3MJMA 3PG9A 1HO4A 4Q8TA 2GVJA 1BEUA 2EG6A 3A4WA 3TQVA 1YXYA 1QBAA 3OGRA 1O6IA 2Z24A 4J3UA 4HB7A 3FA5A 2DZVA 3ZT7A 1PIIA 4TU1A 1NF7A 3JW7A 1OC5A 4MYXA 1OK4A 4N42A 3WKZA 3RF9A 1F3XA 1MQRA 1W1PA 3M6YA 4M7SA 1TKKA 3VD9A 1BXBA 1IWBA 4P8VA 3NURA 2YLLA 3VKJA 1UR3M 4L6HA 1BLIA 4MF4A 3GNOA 1HL2A 2YXXA 3FJ6A 1Q6RA 4UTFA 1ZJAA 4ZFMA 3WF1A 2X16A 4X22A 2J25A 1XIMA 2OEMA 4JX4A 4H9XA 4ECLA 1DHKA 3W01A 3W29A 2ZA3A 3N2XA 3EOOA 1KTNA 1WKEA 4GI8A 5I09A 1GQJA 3B40A 2R1LA 4JOMA 3A24A 5D2YA 1SW7A 4NY2A 1H11A 1JUEA 3KBMA 3B8VA 1KC7A 2QXWA 3CMFA 1ZFJA 2OYKA 3H7VA 2QIIA 1DVJA 3SIZA 1PJ9A 1R85A 3M0XA 2YDRA 4PMDA 3SR7A 1M03A 2HRWA 3T42A 2TAAA 3U3HA 3C8FA 1SW0A 3MCMA 5J5RA 2FH6A 3TJLA 2F6XA 4XAPA 3B0UX 1YX1A 1MFUA 2V5CA 1KR0A 3EXSA 4HZ7A 3R8RA 2PTZA 2WBKA 1QBBA 1WKFA 1RVKA 1XKYA 2JKEA 4AFYA 1SJDA 2OX4A 4JFVA 1X6UA 4GX9A 3BQ5A 4X3ZA 1EIXA 1QATA 2VYOA 2GGGA 2WSRA 2YX0A 1ENUA 3OP2A 3G8RA 2RAGA 3H4WA 4HCHA 5A2BA 7REQB 4HYWA 4G56A 1C90A 1OY0A 3MQTA 4NU7A 4IM4A 4TO8A 4UTWC 2JGYA 1K9EA 3PUEA 1E73M 3DFHA 5H8UA 3NDOA 4EF8A 3C5QA 4XAFA 1R3SA 5AN7A 1P0EA 4UZUA 1S2UA 3N34A 3DG3A 2H9AA 3AHXA 5FJPA 1NWUA 3LHYA 4QS5A 3VO0A 2J7EA 1EBHA 2EG8A 1WAWA 2NXIA 2PMQA 2VRKA 2FZ8A 1ADDA 3VD3A 3WLKX 4TMBA 3HURA 2F7FA 2PLMA 2D73A 4GYJA 2QW5A 1JPKA 2Y1HA 3T2PA 4WXYA 1H7XA 4H9ZA 1UWTA 3WY1A 3K46A 5D30A 4NRRA 1UOZA 3QMTA 1ZSXA 3MI3A 4S38A 2ISVA 4DJED 1I8JA 3S1XA 4HPGA 3GC4A 2PF8A 2C1GA 4WOZA 5BCAA 4L9XA 3N2TA 1F3WA 1E9ZB 3LHUA 4Z0SA 5CKSA 3HJEA 4QCEA 1VGAA 3NL2A 4PSPA 2ZXDA 1EX5A 4PMUA 1KM0A 1Q65A 3N2CA 4RLIA 4QCFA 3FY1A 4GQRA 4D6CA 3EPOA 2PDYA 4YWSA 4UQ9A 4KETA 3WLPA 3KVJA 4Q8UA 4B5SA 3AMCA 3MO4A 4CVWA 2GOUA 3EB3A 2DZBA 2OOGA 4KW2A 1RALA 4URIA 3MSRA 1MW3A 4MLJA 4TQTA 4C6KA 1M41A 3IS4A 4MY9A 4JIEA 2OLAA 2JKAA 3UD6A 4LUYA 3WUFA 1XLFA 2FQIA 3MMWA 5FJJA 4JL1A 1VBJA 4QRNA 3KL0A 1UD5A 4B16A 1KFWA 1BGGA 2J4GA 4ZZ9A 4QJ5B 2EF9A 2Z6JA 4GHRA 3WK3A 4JDBA 3LG3A 3W02A 2FFIA 5LZLA 3W2JA 3F5LA 1OM0A 1KXTA 3PBMA 4IIBA 4DBUA 1DXEA 4AC1X 4ZMGA 1W5QA 1PKYA 1GPFA 5H8PA 1KCZA 3GKFA 1G94A 1GW1A 4QG8A 2AQOA 2F2HA 3SRKA 4X0NA 4LUSB 3V0UA 4F9DA 3L67A 4AZCB 1W5NA 3F4CA 4WY0A 3IJQA 4AD4A 3ARTA 1QASA 3L2LA 3BSGA 1AZ1A 4EP8C 4DZHA 2V2CA 1Q85A 4I7UA 2EPNA 5KINA 4DLMA 4V28A 1O1ZA 3TC6A 4J3SA 4LAUA 3UYIA 1TV3A 3PN8A 5HJLA 3UWYA 2E9LA 2BVYA 5D09A 4A2SA 5BYWA 4AZIA 4U3CA 1U83A 3IEBA 4E2VA 1F76A 1QPKA 5HMSA 4A21A 1KW1A 1TREA 3GNXA 3UWEA 4M8UA 1RP8A 3N2MA 3W7GA 4CU8A 1L8NA 4PMJA 4JPGA 2YFOA 4NX5A 3AZSA 4L1WA 4G8TA 2PTWA 3PFMA 4H2HA 1POKA 4DF1A 3E2SA 1RR2A 4JX6A 1HKJA 4XZIA 3L4UA 4O14A 3P0XA 5AHMA 3F7JA 3TTEA 3AIUA 1ZY9A 1PKLA 5A8GA 1JYWA 4C7GA 1K4GA 1R86A 1Q8AA 4TVUA 3QV6A 2PP0A 2QYGA 3A12A 1QNVA 1SM9A 2HROA 2QV5A 3B97A 4JTSA 1GTEA 4RPPA 3SM0A 3QRHA 5I3HA 3SUUA 2E28A 3T2QA 4KWSA 3T8LA 3LSBA 5HUPA 4N9DA 4QE1A 4KWVA 1V08A 2ON3A 5C9RA 4UC5A 1SSDA 4MKVA 4MNLA 3EX4A 3NQVA 4GLEA 4Q4QA 1J8VA 1MNSA 4OV4A 3GH4A 4NSBA 1FP9A 3N3MA 5J8LA 4LXFA 4JIPA 1MWOA 5E6ZA 4HOXA 3W76A 1NDVA 4D72A 1AD4A 3ZWSA 3THDA 3URNA 2VDIA 3N12A 1GYMA 3TWAA 3MA8A 4UBPC 2NWRA 4PCNA 4DJDC 2CZVA 4H6KA 4W8BA 2XVLA 1XUZA 2PDIA 4BEQA 4BQ5A 4ERAA 3ANUA 3LPFA 3WH8A 3CGTA 3ARPA 4CD4A 3NQFA 3VCCA 3BLKA 2GWNA 4H3DA 2DZSA 4I9AA 2WJEA 2QS8A 4FOKA 3MWCA 5BOEA 1ZS2A 2WSYA 2I5QA 3CHDA 1W1B1 3HN3A 4NXSA 4AX6A 4YCOA 1PZ2A 4Q4SA 4ZQOA 2PE4A 2V68A 2WLYA 4ZQNA 3SADA 2TODA 2XIOA 4JNMA 4D6JA 1NP0A 1R87A 1LRQA 1UKPA 2PBGA 4B5VA 4KMQA 1LL7A 4PE8A 3VUSA 1FKWA 4ZO9A 2P10A 3AUOA 5CQ1A 5EMUA 1OT2A 3TYAA 1MXGA 4G7EB 4OU1A 4AISA 2FVKA 2PDLA 3QZ6A 2PLCA 4LEQA 1HW6A 3AIBA 4JTUA 3CHFA 4C60A 2HPIA 1A5OC 4XVDA 3OLGA 4BWLA 1IHIA 1OYCA 2FMOA 1EEXA 2OX1A 3NWRA 1V6XA 3RFAA 2VOMA 2WVUA 5I23A 2G4JA 2CHOA 1W9VA 1XHGA 1FWJC 3GIQA 1WZAA 5CZSA 4LY8A 5HANA 1XSJA 1EF3A 1M6JA 1LM1A 3PJWA 1E43A 3HQPA 4PTVA 5LXXA 1YHTA 4ZQCA 1TUFA 1OX6A 1A5BA 5JH1A 2D2GA 3ARWA 4PTDA 5JMUA 2Z28A 4Z1YA 2J47A 2YXOA 4JCMA 1G01A 5BOFA 2CKRA 2FFCA 3LNMA 3QC0A 3PZTA 2YA2A 3RX4A 4AZGA 1I4NA 2XG9A 3R5EA 5EB8A 2J27A 1MEHA 5KSWA 4DY1A 4HP5A 1A5NC 1E3ZA 1WXJA 2AL1A 4W7VA 3ARSA 3QKZA 1XPGA 2GVYA 5CC5A 3VKKA 3W2KA 4AAJA 3T0DA 3LCHA 3OQEA 4I9TA 3NDYA 4KCVA 1V3HA 4YVXA 3GZAA 2Z1KA 2IPJA 4ZOBA 3P2VA 4YLWA 3P93A 4FP1A 4FLSA 3IIOA 2BOEX 4N7QA 1M3UA 2RUSA 1HKMA 3VGEA 1US0A 4HD5A 2NV9A 1TPEA 2DORA 4EE9A 1S5WA 2BWGA 3PWIA 1E6NA 1PYMA 4UXDA 3DXIA 3PANA 3K5XA 3S5NA 2QUVA 2DQXA 4LRSA 5E9AA 3ITYA 4MZ8A 2WV8A 1IEWA 4YN5A 1VFLA 1TCMA 5BWAA 2Y8UA 1US3A 4IP5A 3UWUA 1LQAA 1VRDA 4GBDA 3ZVIA 2XIBA 3TXZA 3GNPA 3GTHA 5XIAA 4HSOA 3W9ZA 1UIOA 1D3CA 3W25A 3NQCA 2EO7A 3UVIA 2ZUVA 4LS0A 1PKMA 1DJQA 1JULA 4INFA 2W27A 2ANUA 3CO4A 4WRHA 1T99A 4PR4A 3UPWA 3V1HA 3CH9A 3E5BA 3ID7A 3TYUA 1D7KA 4IPPA 2OTDA 4O10A 1FRBA 1MI3A 3ES8A 4NXKA 4WD0A 3L5AA 3N25A 3OPSA 3ZLGA 1ICPA 3EPMA 3W1QA 1K77A 1GQNA 1ZLPA 5K7JA 2BBFA 4GKLA 4HHPA 2Y63A 2GJXA 1R9XA 1PBGA 3C86A 1WV2A 1IV8A 4AWSA 1TA3A 1BPLB 1B3XA 2WMIB 5I3DA 2ONEA 2YCLA 2AMGA 4XVEA 5AYZA 4O8AA 4PL1A 3NPUA 2VFDA 2PDCA 2NX9A 1QI4A 1FWIC 2VX7A 3P7YA 1YPXA 3LSCA 2JEPA 2J8GA 1KCXA 4CQAA 4RCXA 1VFOA 1KD0A 4F48A 3WLLA 4PN2A 1QO2A 4UTKA 3URBA 3KRUA 4KWUA 3V7PA 2D2JA 3UT0A 2J8TA 3MZNA 1YNYA 1QFEA 3R43A 3QHOA 4D6EA 4HOZA 4S2BA 3SY8A 2ZA1A 3PC0A 1F4HA 1DE6A 3MB9A 1ZHAA 3WQGA 4Q6XA 3WK2A 4UTLA 3F2CA 4O57A 3BVJA 2UBPC 2VEIA 3TE9A 4D6DA 3IGUA 5D32A 3GAKA 4BQ4A 3W7NA 3CUJA 1EB3A 1NDZA 1RBAA 4J3XA 4LT9A 1UZ4A 3K1DA 1CYGA 2OGJA 2QUUA 4ATDA 4UQDA 4EACA 5JBFA 4IIGA 3ISIX 3W1TA 3P80A 3O05A 1EHAA 4PB3A 3CTTA 3E0WA 3ALGA 4FOUA 3SN1A 2QZRA 2A3LA 2PDWA 3C52A 3NZQA 3BZGA 2BVTA 2ALRA 5A5WA 3MP3A 2YSWA 1R3TA 2C1IA 3W7RA 3IRDA 3GG8A 3H55A 4EIVA 3G6MA 3PHAA 3NO5A 4MJ2A 7TIMA 1GW9A 6A3HA 3M5YA 3S42A 1E6SM 1GJPA 1LYXA 2WKLA 5HJXA 1OWQA 1XG3A 3DFOA 2XIIA 3FW6A 3VC6A 4ZO8A 1TB3A 2DP3A 4HIBA 3GG0A 1GVOA 5BXPA 4W5UA 3UESA 3PSWA 1SPQA 2ZZ3A 2WKGA 3W81A 1XX1A 1KRBC 1FWEC 3STGA 5BRPA 4A2RA 3MANA 2FGZA 4FXSA 4MNKA 4LYQA 1GVEA 4DYKA 1XS2A 3UG4A 1BFNA 1B3YA 2A7PA 3VM7A 1P0KA 1TWZA 3LHVA 2CPUA 2OZ8A 1JVNA 3H2FA 1LRTA 4S3CA 1XD0A 3VINA 2GSHA 4DZAA 1JI1A 2FJUB 2DIKA 1KBBA 3TAOA 4IIDA 2TMDA 5TIMA 3AMDA 1FWTA 5D37A 1J2BA 1XCWA 2QPXA 4HTYA 1DIEA 3SQSA 2WMHA 1WUFA 3S1UA 4C1NB 4HYVA 4PMOA 2ISWA 2B7QA 2ZX6A 3E0LA 4S23A 4I8YA 3LPOA 1HL8A 5LA2A 1DIKA 1CENA 2XH2A 3TR9A 1KGUA 2V6AA 3QFWA 1XIBA 3AHTA 4L4LA 4ZOAA 5AZ1A 4IGMA 1PIGA 2CBJA 2P0OA 3B05A 3UZZA 5D2VA 1UD6A 1DJHA 4O11A 4PUEA 4I5RA 4AIUA 5C7HA 1JZ2A