4AY8A

Semet-derivative of a methyltransferase from m. mazei
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
340
structure length
339
Chain Sequence
b'DMSEFTLKTRLLAALKGEPVDKVPVCSVTQTGIVELMDVVGAPWPEAHTNPELMAKLALANHELSGLEAVRLPYLTVLVEAMGCEINMGTKNRQPSVTGHPYPKDLEGAAVPADLLQRGRIPVVLEAIKIIREKVGPDVPIVGGMEGPVTVASDLVSVKSFMKWSIKKTDLLEQALDIATEASIIYANAMVEAGADVIAIADPVASPDLMSPDSFRQFLKSRLQKFASSVNSVTVLHICGNVNPILSDMADCGFEGLSVEEKIGSAKKGKEVIGTRARLVGNVSSPFTLLPGPVDKIKAEAKEALEGGIDVLAPGCGIAPMTPLENVKALVAARDEFYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLCOBALAMIN\: COENZYME M METHYLTRANSFERASE
molecule tags Transferase
source organism Methanosarcina mazei
publication title Structure of the Corrinoid:Coenzyme M Methyltransferase Mtaa from Methanosarcina Mazei
pubmed doi rcsb
total genus 117
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.1.1.247: [Methyl-Co(III) methylamine-specific corrinoid protein]:coenzyme M
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 4ay8A00
3T0CA 4ZTXA 1R3TA 1R3SA 1R3QA 1U1UA 3GVVA 3GW3A 1XR2A 1R3YA 2INFA 4EXQA 3PPCA 3PPFA 3GVWA 2EJAA 1UROA 1U1JA 2Q6ZA 4ZTYA 3BQ5A 4L65A 2NQ5A 3GVRA 1JPIA 1U1HA 4WSHA 4L61A 3L7RA 3GVQA 4ZR8A 1JPHA 1YPXA 4AY8A 1J93A 3CYVA 3RPDA 4L6OA 1XPGA 4QQUA 4AY7A 3BQ6A 3GW0A 1U22A 1JPKA 2Q71A 1XDJA 1R3VA 4L5ZA 1R3RA 4L6HA 1T7LA 4L64A 3PPGA 3PPHA 1R3WA
chains in the Genus database with same CATH superfamily
2Y85A 2IPWA 4PEEA 1W5NA 2TSYA 1H7OA 1IZKA 1LG2A 1KO0A 5TBOA 3GVQA 3KBMA 2VCCA 3PJXA 1FWDC 2H8XA 3E0LA 1W9DM 3N29A 5FEXA 2D22A 1XIHA 2Q3OA 3TKFA 5I2UA 3CHVA 3JUGA 2XGIA 1W1VA 1SR9A 1A80A 1BLIA 3IUIA 1Q4WA 3UGRA 4BHYA 4LS2A 3SUVA 5JIWA 1AL8A 3CQJA 1UR9A 4FS9A 3LUTA 2Y24A 1KLZA 2ISFA 4M51A 3URBA 1VP5A 4B3ZA 5LNVA 4Q4KA 1TV4A 2J74A 5T91A 1S1PA 2DEPA 3PBUA 4J1OA 4JHOA 5D38A 3DFOA 4UQDA 5CC5A 3OO2A 1FUYA 2E6FA 2NLYA 3RU6A 4B2DA 5H8UA 4HJFA 4M80A 4U2YA 2Y7GA 2Y5SA 1RCXB 4JQ3A 4O14A 1XG3A 3VCCA 3W7OA 3RM8A 3O63A 1K9DA 3GHSA 4KS0A 1H0GA 1W17A 3MWCA 4D9PA 4AAJA 2BXVA 3F2BA 2V2CA 4NXSA 3TX9A 4ZQOA 4F3HA 3O9NA 4AWSA 4IMCA 4F0RA 1EP1A 5G4WA 1M65A 1CDGA 3VDHA 3TQPA 1V3IA 2VGGA 1K6AA 3SY8A 5FJJA 4CCZA 4AQLA 3DCPA 1R46A 1RLCL 4O15A 2NX9A 3S5OA 3IIVA 2GGHA 1XYAA 2I17A 1V6YA 1ZSXA 2QW5A 4PE8A 1DJHA 1CW2A 1JIBA 3W00A 1J93A 2DSKA 1PKNA 3U2CA 4F8XA 4LS1A 2KAUC 3ABXA 4H9MA 1MXSA 4GY1A 5CZTA 3STFA 1XINA 2E9BA 1UD3A 5CJMA 3W7NA 3BGAA 2J79A 1DQUA 3NZRA 4IIEA 4PMOA 1J2BA 4I9TA 1YDOA 4E2BA 1E4LA 3N2XA 4K7YA 1WV2A 5HA7A 3QZEA 1I2OA 1HJVA 2ISWA 1W8SA 1DWJM 2ZWZA 2UWFA 3AXMA 4YXGA 2RGMA 4UOJA 1R2TA 2EPLX 5C9UA 3BGGA 1I1WA 1A5AA 2QR6A 2E67A 1YYAA 2Z1WA 3UG8A 1EBGA 1H1ZA 4L9YA 5D9NA 3J7HA 3GU9A 4Q4PA 5FI8A 3IJ7A 3RCYA 2PI6A 4HCLA 3FN9A 1KBBA 3HV9A 2DH2A 4ICCX 3VNDA 1XUZA 3E6EA 2CKRA 4D8AA 3G1XA 5G1TA 4FI4A 1M5WA 3PB0A 1C9DA 4UFMA 1IHIA 1NFGA 3GG7A 2WMIB 4B15A 4G1KA 2C1IA 3DERA 2V81A 1KKRA 2X1TA 1PHWA 1CNVA 3HPZA 3IV3A 4EP8C 3EOOA 3OJGA 5EMUA 2XJ7A 4WSHA 3MVIA 3TC7A 3KS6A 1E6ZA 4B5TA 4D6IA 4I5UA 4IMGA 1ZZMA 1H60A 2ZXBA 2BGNE 1XQKA 4PUEA 4S2BA 3NPWA 4Z0SA 1YTDA 1AH3A 1C8QA 3CNYA 1XIFA 4HK7A 4LUSB 4L61A 4L1GA 1NSJA 3BARA 2VQTA 1V7YA 3C2VA 4QDWA 4WKHA 5G5IA 1PIGA 3GUGA 4H8HA 3VUPA 3CHEA 2WM0A 4HMCA 1ISYA 3K4AA 5FACA 5CG7A 1QO5A 4P7NA 1VEMA 4ZO8A 1J0ZA 4LUSA 4B5VA 1VZWA 1Q7QA 3KM8A 3TYBA 1CXHA 1B9BA 4TVCA 2HQAA 1F4HA 1PWMA 4O8RA 3GFXA 2VZTA 1JZ3A 2GL5A 2TRSA 3A9IA 5DN1A 3NQBA 4XVDA 3V5CA 4G9PA 3NGJA 1G01A 3KTSA 5ENLA 2OJPA 3EKZA 4XV0A 3AQUA 3WN6A 2V5BA 5XINA 2X7WA 3H6OA 3ZJ8A 2PWHA 1EQPA 3E2QA 3UCDA 2JK2A 3WQ6A 1CGWA 2G3IA 1E6PA 4PTVA 3UJRA 4GRSA 3TROA 2FZBA 4I7WA 2XWDA 4C6OA 5LA1A 3F4CA 4H00A 1VLWA 2F38A 4WF7A 4LBUA 1OGSA 3W6MA 1VH7A 4ZGYA 3AS3A 3SDOA 1DJXA 2OWXA 3KZSA 1EF3A 3IGHX 3NYDA 3P0XA 3NDYA 1V6WA 3ZR6A 3L4TA 5IBXC 1BGGA 3O0KA 4GH3A 3UU0A 3WD0A 1E72M 1YW1A 5J5RA 4PUMA 1O95A 1GZJA 2D0FA 3NZGA 2ZRYA 2HXUA 4ZCWA 1M03A 2CZ5A 1UD2A 2DZPA 1JVNA 1W1ZA 4NI8A 4DBSA 1RK5A 1YLVA 1WNOA 4B5UA 3GR7A 2HDJA 2IUZA 4QNEA 3G8RA 1LROA 3KFTA 4JQ4A 3A12A 5BU9A 4AZ6A 3FKKA 4J2PA 1K4GA 2OTDA 3EOLA 1LTDA 2WSPA 1TCMA 4NY2A 3E5BA 2E1DA 4Y7EA 4WJ8A 4MDOA 3IUDA 4R7OA 3TC3A 4MKNA 1U5VA 2I57A 3RO8A 2QJJA 3N1AA 4R9OA 1GW1A 5BMWA 3XISA 3W81A 4AVNA 3L68A 4KFNA 4K6AA 4HMNA 3UJ2A 1WA3A 3VKKA 3W83A 3WQ5A 5AECA 1XH0A 3H53A 4S3AA 1RJRA 3GWQA 3AFBA 2PGEA 4FIQA 4Z2GA 1DWGM 1UZHA 3PR2A 1QHOA 1FWWA 1MQQA 1M53A 2ZA2A 2FIQA 3TN5A 3W1NA 1U83A 3NO5A 4HYVA 1QTWA 2G41A 3BK0A 4UQCA 2Z1XA 2OXNA 1BXBA 1OF6A 1GQJA 2XIBA 4EK7A 2ZDRA 2FPTA 1JRBA 4BWLA 5AB3A 4UTUA 4DRSA 2PE4A 2OB3A 3TMQA 3ZVHB 2FPVA 4PTWA 3NPVA 5CBIA 3W7CA 2TPSA 1KFEA 3AJ7A 3VIFA 4HJWA 3TZFA 1PKMA 1XIBA 3VK5A 2YA2A 1VQTA 3PG8A 1JDAA 3OYZA 3L5LA 2C14A 2D20A 5I0DA 5M17A 2CXGA 4TO8A 3WNMA 3MU7A 1S2AA 3BLEA 3BAKA 8CGTA 2OR2A 4PC8A 3BMWA 4DWSA 2WJFA 2DQXA 2R1NA 3PTDA 4HB7A 4UQ9A 3CT7A 1UHVA 3VZZA 3BLDA 1I6NA 4ORMA 2DIEA 3W1PA 1GKQA 3QQ1A 3QR1A 4YYCA 1UR4A 2R1LA 1O5KA 2DUAA 4IISA 3WLRA 4D6FA 3W53A 1UD4A 3GHTA 4FPSA 4Y6GA 3CO4A 4Z2KA 3GXFA 3M5VA 3AU2A 1O7AA 4IZGA 5CKSA 1J9YA 3CZEA 2YL6A 2QPXA 3MI3A 4IT1A 2VGBA 3EWDA 4IP4A 4NZFA 3WLMA 3VE7A 1P5BA 3O16A 1CENA 2QMKA 1HVQA 1FFRA 3KBSA 4IQLA 4K1GA 3LZ5A 4QCEA 1RALA 1GG1A 4AIUA 2OODA 3BO9A 2FH6A 5I78A 4H9VA 4KWOA 3ITCA 3T42A 3AHXA 3T2PA 2HS6A 4H9YA 5A1AA 2KX9A 3N12A 3WNOA 3Q37A 3UPMA 3TJIA 2ZUUA 2DZTA 1Z3NA 1P48A 4MGGA 1EFZA 2VX7A 4QEHA 5DXYA 3PZTA 4DJDC 3TCSA 3VE9A 4F40A 4C1NA 3QY7A 1JFHA 3CTLA 3O0FA 2C1GA 3IIXA 4ALDA 3E96A 4PMNA 3GVWA 5C9XA 2I16A 1VFHA 2C91A 4I7UA 2BOEX 3IVTA 3H23A 3Q94A 4H8NA 1V0KA 3T4CA 5I3HA 3P74A 2NT0A 4Q8WA 4ZZ9A 3WQOA 1JCMP 4HT3A 3WNKA 1GTEA 4DZAA 2RDUA 1EPVA 1WX0A 3PWIA 4S3FA 1OWQA 3MS8A 1N82A 1BD0A 1LLZA 2CKSA 2J78A 3ANYA 4AY8A 1YPIA 4J27A 3PC0A 1NWTA 2NVAA 1A3XA 1U5JA 1XW8A 1ZP4A 1YPFA 4XTIA 2CLIA 2GJXA 2R82A 4JFVA 4M8UA 1ZUAX 2DH3A 1FCBA 4MAZA 3NOEA 5EPDA 3RLVA 3VX0A 3EDEA 1TZ9A 5HMEA 4G5DA 3UBPC 1L2UA 2NVCA 4RNHA 4Z1DA 2D24A 2CW6A 4NZ3A 2PGRA 2EBNA 5FOOA 2GUYA 1W9VA 4I9AA 3S6TA 4ZOEA 2Y2WA 1QBBA 3M4HA 1TUFA 4J2MA 1OC6A 3P5ZA 3UY8A 2ZWYA 3L2MA 3DFNA 2Z1BA 1JCYA 1I0BA 3QV9A 5AC6A 4IFOA 3U0HA 4Q8UA 3E2VA 3KOYA 4TTGA 3DGBA 5FJIA 1EC9A 4JIEA 3GC2A 2VP8A 1HGYA 1VS1A 3ATYA 3UPWA 1CLVA 3CMGA 3NSXA 4UWMA 4CCDA 1HXJA 4MIMA 2PSNA 4ZA0A 1UQZA 1J0JA 3Q58A 3JU2A 5FSEC 2ZADA 4Q8NA 2GDUA 4JTAA 3S2LA 4LNCA 1F8IA 3TAKA 2XZ7A 2Y4SA 4A3YA 3E0VA 3OZPA 2VR4A 3RGTA 2WSYA 2HNEA 1W3IA 1LOQA 4OHQA 3C8FA 3E0WA 1EBHA 2E6YA 2XFYA 1EF2A 3AIBA 1WDPA 4XKMA 1H7NA 4AU0A 3LENA 4MZ1A 3BW3A 3F03K 1AZ2A 3QH2A 2ZC1A 4P8UA 5A2AA 2XFFA 3FA5A 1M7JA 3CBWA 4MUZA 3HFYA 3COTA 1GVSA 3C86A 2R14A 1AZ1A 4O13A 1OQFA 1YQ2A 3QKEA 1NFBA 3C8NA 1MQPA 1Z42A 5HNUA 1CECA 3WMLA 1XYLA 4MY9A 4GGHA 3VKDA 3T8LA 3N11A 2ZUVA 3LMZA 4S3JA 4NF7A 3T40A 3PBVA 3CB8A 2BODX 4HMDA 1NH6A 4PMVA 1UWTA 4YCPA 1KGUA 3OIHA 3GZ3A 1KTBA 1OB0A 3ONBA 3PS7A 3U9IA 2BFGA 2W63A 4LB3A 1Q6EA 5CPQA 1J2WA 3EOEA 4JTDA 4KWVA 4QP0A 1JR1A 1TWIA 3UZ5A 4Y90A 3W7QA 5A6BA 3STEA 4MB4A 4WIWA 2WMHA 4AD5A 4C6JA 4B5XA 3BWWA 1XG4A 2ZIDA 1WOBA 3IVSA 5HINA 4EIVA 3LM7A 3AROA 4EKJA 5A6MA 2XGBA 4YTRA 2E09A 1VHCA 4C7DA 2PZ0A 2QJNA 4XZWA 3UA3A 2VRJA 4MJ4A 4LAMA 1TPWA 1GOMA 3ES8A 3PBMA 4RZ6A 3TYEA 5F1UA 3BXWA 1ITCA 1OC7A 1OBAA 2Y8VA 4O1EA 2BY2A 3VOCA 4CN6A 3NL5A 1F8MA 2VRQA 3CUZA 3F5JA 4FXSA 2EQDA 1WXJA 3ZMRA 1R47A 3WQFA 3VKAA 4GQQA 2G3FA 1LL4A 4V15A 3S5NA 2PC4A 1JYNA 2WJZA 1TPVA 3GG1A 1P0KA 1GG0A 4BA0A 3W88A 3R0KA 1X38A 3FSTA 2YZRA 3MI6A 3M9YA 4FB7A 1E5JA 3CV2A 3WELA 4PL2A 3KWSA 3LCIA 3PUGA 3KOWA 5FJPA 2FHCA 3W85A 1CX9A 4O1FA 1I2NA 3IANA 1SJBA 3AMCA 2Q6ZA 4IFKA 5BXPA 3N19B 3P6LA 4NYYA 5K2ZA 1FWTA 4KRUA 4RUBA 1LT7A 3MO7A 5GVJA 1FP9A 1NWUA 7TAAA 3NEVA 4JTHA 4D2JA 1JPKA 4MFEA 2XU2A 3UZZA 3ZQ9A 4KGLA 3Q4DA 1S3HA 3NQAA 3PTKA 3PBGA 2VFGA 3CIWA 3VZYA 5A8PA 3WD4A 3RLHA 1U1HA 5D2XA 1HJSA 2P1FA 3WQPA 1O94A 2VR5A 2JF7A 4PB4A 5DMYA 4UMCA 2D2JA 4W4QA 1H49A 3QFEA 1OFOA 4NJIA 2VKZG 1LWHA 4O57A 2J88A 3H12A 4N6FA 3VAVA 3MA8A 2V3DA 3NQFA 3CH9A 2WVVB 2PD9A 1QNOA 5KZDA 3S2NA 2X0YA 3HGSA 3REQA 5DXXA 2C6QA 2GJLA 3WO8A 2GQAA 1GT8A 2WYSA 1PZ1A 4S3BA 3PG9A 3GK0A 3OGRA 3W7DA 2PTZA 3DYOA 4FOUA 4BI5A 1J10A 5G2WA 4MNLA 2QIIA 3F4DA 4AG0A 2RDTA 3W24A 1KCXA 2WVTA 3BAIA 5HUOA 3ARXA 3AWNA 3BGJA 3TR2A 4JYEA 4F2BA 1HQTA 1LLOA 3WEMA 4DYJA 3K8LA 4AD2A 3C2FA 1G5AA 2WPBA 1KKOA 2C19A 4G56A 9RUBA 2CEQA 1YADA 3ORWA 1RQEA 1AQFA 3NPUA 2HE8A 3L2IA 2E40A 4W7UA 1RJQA 1XFBA 2I5GA 4S2CA 1ISVA 3VD3A 3FIGA 2W27A 2VZVA 3UXKA 3TW9A 4UIOA 4IH3A 3V4BA 1CTNA 4AFYA 3BG5A 4JTIA 2BX7A 4DZHA 3W01A 1N2VA 3QHMA 2NSOA 3OODA 4YJ5A 1FCVA 2O92A 1YIXA 2EG7A 5I3FA 2E5CA 3SN4A 4D6HA 4AH7A 5I3KA 1KFLA 4NP7A 5AHEA 4Q4OA 1XFCA 4H2HA 1NDYA 2DSVA 2XGZA 3D47A 1BHGA 3C3UA 4QSHA 3H4GA 1T99A 2PRLA 1X7FA 3HG4A 2DW7A 4NZCA 3V35A 3CLWA 5CGTA 5CPMA 3RX2A 4GVHA 1ZAJA 2WMFA 1UWQA 3NPXA 5JVLA 3U7BA 3UJEA 3FXGA 5I02A 3VUSA 3MBFA 3ZFHA 1ECQA 3CB3A 4GYFA 2P8CA 4MNJA 1FVPA 5HMFA 2GJPA 5DF0A 3W87A 3CWNA 3CWOX 1SFSA 3QEZA 1PCWA 1WKYA 3TYDA 2OGJA 4KWWA 3A22A 4RDYA 4D1JA 2KZHA 1VCFA 3P82A 1U1UA 2QCLA 2VZUA 4JR5A 1DL3A 4PCTA 1UZ4A 3P62A 4RK8A 3BDKA 4UQAA 3UT0A 1D9EA 1LM1A 4UQBA 5CLWA 3H55A 2FTYA 2E8YA 2YW3A 4JN8A 2G37A 1K03A 4DUWA 2O9RA 9CGTA 4GY7A 2ZE3A 5M03A 1FHLA 5U4NA 1LORA 3WUBA 3ERPA 1TV5A 4DNMA 4FLQA 1AQHA 4Z1AA 1MW2A 2R8WA 4DF2A 2VEPA 2ADAA 3BH4A 4M82A 2NXHA 3W0KA 1Q7ZA 1ML1A 5CPLA 2AL2B 4H7ZA 9XIAA 3TN6A 4DNHA 5FSDC 1B5TA 5BOOA 5E0FA 4EVZA 1UKQA 3FYPA 3ABQA 4MOZA 1WZAA 5JIPA 3WF2A 2HS8A 3NQMA 2XN1A 3WENA 3TWBA 1POKA 3MB9A 2V69A 1D3HA 4HOZA 4CVWA 2HVMA 2PURA 1V02A 1AQ0A 4GCXA 2D69A 2Z1SA 3CAKA 2I9EA 3H2AA 3SECA 1BWVA 1XSJA 2VX5A 2EPKX 1EJUC 1RSCA 3GDMA 3BG3A 2YJQA 1C7TA 4LAUA 1FTXA 4M1BA 3UR2A 1TPB1 2IW0A 1F6YA 3B05A 3NAVA 3BW4A 4D6CA 3QR3A 1HP5A 2WO5A 3F5KA 5C2GA 1EOKA 1XKYA 2Z2UA 1W5PA 3BURA 5LXEA 3VNMA 7PTDA 5CEWA 2A3CA 3I6EA 1KCLA 3IJQA 2GSHA 5EFFA 5AZ1A 4AWEA 4YVPA 3GRIA 4JCMA 4ZB5A 2QV5A 4Q4MA 2Z6JA 2OX4A 2PDHA 1M3UA 4ZO9A 2PDXA 5BYWA 1GOKA 5XIMA 3BW2A 3TYZA 1FA2A 2AGTA 5G2IA 1TR9A 2J66A 1G9HA 2ZUTA 5A8OA 4K2SA 4F0SA 4Y9NA 3TLQA 5L9FA 3DI0A 4L56A 4BEQA 1Z9AA 1HO4A 1XH2A 1L6FA 4WR3A 3LBOA 5TNVA 3M0YA 3HURA 4F9DA 2P3EA 1B3VA 1FWAC 3UETA 5BRBA 3QC0A 4IX0A 2Y7FA 4XD6A 1RK6A 5H6HA 2PC8A 4WRHA 1XQLA 2ZZ1A 4NL1A 2W91A 5AC8A 4UFLA 2Y61A 2AKZA 1SUXA 5AHLA 4DO5A 3BCDA 3GBDA 2G3JA 3GNOA 2CBVA 1YE6A 1JQXA 1KXQA 4N6EA 3AZSA 4IG2B 1LZOA 3PNUA 4L4LA 3UWEA 3M5YA 1LWIA 4UR9A 3H26A 3V3WA 3VVGA 4AWTA 1E9ZB 5DEZA 3WH8A 1XLCA 1WXZA 3V0TA 3POCA 3B9NA 4MPQA 1ME8A 1N55A 3HQNA 4DBUA 3CPUA 1Q6QA 3DG7A 1BG4A 3GW0A 3TP4A 3ZSTA 3TCEA 3CS2A 5JU6A 2OEKA 1OK4A 2I14A 1DIOA 2XDFA 3IACA 5C8BB 3WD3A 3EB3A 4QDPA 3H7UA 5FF2A 3NG3A 4DI9A 2G8ZA 3LHZA 3BJFA 4H9ZA 4GQGA 1K02A 2ONEA 3BAWA 4W5UA 1EUAA 1J11A 4XWUA 1UA7A 1QMLA 2DVTA 1IF2A 4LWWA 1Q4NX 3EX6A 4PTXA 1M7OA 4TMCA 1B3OA 2YW4A 3TDFA 1X8CA 2C0HA 4UCFA 3WD1A 1QFEA 1JPHA 2X1IA 4O0ZA 1BAGA 2H8ZA 1JDFA 3NQ7A 1VAHA 2ZX8A 4N42A 1EJXC 3IARA 4N9CA 3HQ1A 4JIIX 3C2YA 2BDQA 2GK1B 3GW3A 3BV7A 3KP0A 3VGEA 5HAOA 4M1RA 3S1VA 5E0KA 4DO6A 5HWNA 4LEQA 1M01A 4PH6A 3QC3A 1BKSA 4IP5A 4FF7A 4YHGA 1JZ5A 2NSXA 1KRBC 2PWFA 4LVBA 2VHLA 3W2UA 5BWAA 3KRSA 1JDCA 3MV11 2IXVA 3W27A 2O4QA 1I75A 2PDFA 4C6BA 3K1GA 1Y5XA 1TX2A 3W07A 5IFTA 2A0NA 1DORA 1PS9A 4GVGA 3V18A 4IX2A 4B5NA 3WF1A 3W74A 3DESA 1PVNA 1JAKA 5C6MA 3AJXA 1DTUA 3EWXA 4XO6A 3CEPA 3UJSA 3IIZA 4GUFA 4NNBA 4O54A 1DQXA 1UUQA 1AG1O 2OEMA 1E9YB 4K8EA 2I1OA 3LPGA 1AH4A 1Z6KA 3MHGA 5FAJA 5I3DA 4KCUA 1CBGA 3UG5A 3N9RA 1HL2A 3WJYA 1E9IA 4OVXA 4UTMA 5BRPA 1YBQA 4R7JA 2OT0A 4N9BA 1Z7AA 1YEYA 1NP0A 1O68A 2HZGA 3WBXA 4IJCA 4P8XA 2P10A 2AMXA 2ZX7A 1CXKA 1E71M 1H51A 4M24A 2E28A 1OFRA 1UUOA 4LAZA 1OYCA 1GONA 2IKIA 2VNCA 1XISA 2NQLA 1FWBC 4JGDA 4G2DA 3ECQA 3W7LA 3QF0A 1J5TA 4FA3A 1SPQA 3MKVA 3ZLFA 5GPRA 1QNPA 3THUA 2GVLA 2ZQ0A 1EC8A 1F6PA 3QFWA 4UFJA 1SZNA 1UWUA 1R6WA 3FGCA 3W72A 3EPOA 1V3MA 1J0HA 1CIUA 4BCEA 4RX0A 4AHQA 2NQ9A 1ZQ5A 3ZR5A 4U4MA 1XUUA 4R9XA 1XICA 4JAWA 3IWPA 2B7NA 5AN7A 2Z26A 1RBAA 1HL9A 5DCDA 4HKPA 3RRXA 1CGUA 3EBVA 5D02A 5HPCA 3EOSA 5J8LA 3CK5A 3WLHA 4ZQRA 3VKJA 3G1DA 1I45A 3SRKA 4HU0A 4X3ZA 3WLIA 2IPFA 5D9MA 1FBAA 4KESA 3CPRA 5I07A 3EXRA 4W89A 3DHUA 3I3EA 3T05A 2OG9A 4DEFA 3CYVA 3DX5A 5JMUA 3NL3A 3N18A 6XIMA 1I2RA 1VKFA 3L9CA 1WOAA 1WPCA 1RPXA 1MXGA 1A0CA 1XKJA 1VRDA 4HNUA 4PEKA 3C2RA 3KVMA 2RAGA 3UXDA 1EPXA 2WCAA 4NAFA 2CBJA 3RITA 1V7AA 4LC6A 1XLFA 1TQXA 4HN8A 4RE0A 2RDXA 4M6QA 4WQ6A 5JH2A 1JD9A 5DRCA 3ARSA 3OBAA 4ICMA 2NUWA 1OSEA 1GQLA 4NZJA 3K46A 3LXBA 4ZL1A 3BV4A 1FWFC 3R2GA 2QYGA 3AXIA 5KEZA 1QT1A 1W1YA 3VPLA 3W2JA 4AD4A 2W79A 5KMYA 1B4EA 1SJAA 6REQA 4Q8TA 3FOKA 4KBXA 3MUAA 1YMYA 2FTWA 1SMAA 4IXXA 5DCEA 3S1UA 1MW1A 2G4FA 4EWJA 1DJYA 1DBTA 2V5LA 3MMWA 1T6MA 5ECVA 3FS2A 2E3ZA 4PULA 3P93A 4BS0A 1YX1A 4HHLA 1BKHA 5CBJA 1E6NA 3AIRA 1XJBA 4JQ1A 3WNPA 2VQUA 2DZXA 3DFTA 4ZENA 3AUJA 3IIPA 3WJSA 3I4EA 3LDVA 1RR2A 3TAOA 1UPPA 2R1MA 4LCQA 4WXYA 4YN5A 2FZDA 2CU0A 2GWNA 2GJNA 1YHTA 4L65A 3SY1A 3K5XA 2CLLA 1RY8A 5M2FX 1QAPA 3R8GA 1C92A 2J7BA 3MUCA 2AGKA 1ODZA 3D5HA 1H0IA 3V36A 5EFDA 2BVTA 4PRTA 3KCOA 4ACYA 3W7EA 3URQA 4BQ3A 2DT3A 4AUBA 4OV4A 2J8GA 1UMYA 3W73A 1J6OA 2IXUA 4N0RA 5C70A 4MVAA 3LCFA 4REQA 1J01A 5KSWA 4CNSA 3WL1A 5K4ZA 2WC4A 3N73A 4ASTA 3SI9A 1QPQA 3GH7A 4XVEA 1XD1A 3V75A 1AH0A 5LNSA 4MY1A 4O50A 3H21A 4CCCA 4R53A 1VFTA 3OGSA 1X6UA 4HYWA 1LYXA 2E4TA 1KM1A 3G6LA 1LOSA 1PIFA 3AIWA 1MO0A 1DIEA 3D6NA 2VEGA 1MDRA 1E6SM 2BHUA 3M0KA 1TTJA 3WF3A 2FVLA 4ZB0A 2PMQA 2WZEA 5AOUA 4J3TA 3CMJA 4O0KA 1GORA 4RL3A 4DLFA 1TJRA 3GSMA 1AD4A 4W7VA 4DO7A 1J6PA 5EGRA 2BOFX 2VWSA 4CU8A 3RN6A 1EZ2A 3NUKA 3N6HA 3M07A 1CGXA 1P1XA 1BVNP 5C71A 2B4GA 3FJNA 1XLDA 3V16A 1U22A 2FYMA 2E1WA 1XPYA 4F48A 2YPIA 1UA3A 4CNTA 4XZMX 3NM3A 2PBGA 1EJWC 2XISA 1P0DA 4GWEA 1JZ7A 3HMJG 3GIYA 3QPYA 2AQVA 1W91A 3NVTA 5D04C 2J9ZA 3N2CA 2YKKA 2DZUA 4MDPA 4TVUA 3EX4A 2HXTA 5BWFA 5A8QA 2EG8A 5CPSA 2W62A 4AMCA 2PLMA 5T9BG 2Q8XA 7REQA 1QPNA 2J8FA 3B4YA 4DUXA 4PB3A 1EX5A 2REQB 4RZBA 3UWWA 4GBDA 5CC3A 2C8NA 1TWZA 3K2GA 2CWXA 1E0VA 2V82A 4LSBA 5EMJA 1JYXA 4JPGA 1QW7A 4JFUA 2XSBA 1Q5MA 3RRAA 3EPNA 4UNKA 2QZRA 3NZQA 1WAWA 1G69A 1E3XA 2WCGA 3MP3A 1FCQA 4C60A 3E0FA 2C79A 2J75A 4DN1A 2XH0A 5LIKX 4A29A 3WMSA 4B16A 1REQB 1B3XA 2ZXQA 2Y0FA 2W66A 4ML4A 4W86A 3QJAA 1TSIA 3T1GA 3OG3A 1CXLA 1K8XA 1OCQA 3DU0A 2JFEX 1PO9A 1DKWA 4GABA 3O6DA 4AZCB 3LPPA 3F5LA 1TA3A 1JPMA 5HXMA 2XVGA 1QO2A 1W3JA 3WBYA 4LFYA 4DXXA 3SFKA 1SQ7A 1R9YA 1GTHA 1Q2SA 3PZNA 1O1ZA 4PBFA 3UXIA 4X0NA 5F2LA 1VFSA 2FZNA 3UY7A 3SCSA 1VENA 3QW3A 1Z89A 3BLPX 1IXPA 2QLYA 4PBEA 4DI8A 2PDKA 2TYSA 4NJGA 2V5KA 3BQ6A 2WZMA 1H61A 2QCDA 1UR0A 8XIAA 1KTCA 4JTCA 2WNWA 1RVKA 4Y96A 4ZE5A 4PSRA 5LNRA 1UJQA 3KLKA 2Z25A 4UFIA 4QSFA 3WK1A 4UOZA 4CGTA 3WDHA 5LA0A 4FNTA 1PZ0A 3I10A 5B7ZA 5FJTA 1TUXA 5K7JA 4AX6A 1GOQA 3LI0A 4XZLX 4GJ1A 1VCVA 1W6TA 2D23A 4MWAE 2QDGA 1E5NA 1UZDA 2X16A 3S5SA 4DBEA 4MLRA 1IEXA 1IXNA 3WQWA 2QUUA 1TV8A 5AVHA 3NA8A 3WLLA 3S4TA 3TWAA 4RNJA 3R58A 4XUGA 3MTWA 1W32A 1VPYA 4O1AA 3MUXA 3UQNA 3QOMA 3BAXA 2ZCGA 1G94A 3H2OA 4O1BA 2PGWA 5HUPA 5CJ5A 1A5OC 2C13A 3ABSA 2FVMA 3B0YA 4GNJA 4LYQA 4ATLA 3CPGA 3KBNA 2SFPA 1ENUA 1R8LA 4CD7A 3ZXWA 1AK5A 3BL3A 4REQB 4D6JA 2B81A 3UZXA 4NG3A 1F2JA 5I3GA 3SO7A 4NX0A 1ITXA 7ENLA 3WMBA 3VOFA 2JALA 1XP3A 2QAFA 1MNSA 1OEPA 2DZSA 4JFSA 4L64A 3NQ2A 3W6LA 1VGAA 3MCMA 4IL0A 1F9CA 3KCLA 1QNRA 3H22A 2GQ8A 1XCWA 3KOFA 5EMKA 3DDMA 4MSSA 4MY8A 1A4LA 3QLLA 2A21A 1JUBA 3RJXA 2OZ8A 4HK6A 4JX4A 3WX7A 1CT5A 4QTGA 1W3TA 4CQCA 1TPUA 1EJSC 3ZJKA 1TPEA 5CH9A 3CLMA 3S46A 2NUYA 4U10A 5HATA 1E56A 2E0PA 3CTTA 4PGLA 2Z0IA 4PMRA 2ZZ5A 4FNUA 2J6XA 3BJSA 1F3EA 3T0CA 3U48A 3ZWTA 5IRPA 3MHFA 3SGZA 3L5AA 4GIRA 2IKHA 4LC8A 2ASHA 2FLIA 3A21A 1EA0A 5EA9A 3M0JA 4DO4A 5AYZA 4IFKB 3S83A 1Q66A 4MFDA 3QZAA 5A8NA 4EXQA 1YXYA 3R5EA 5M5DA 1ZS2A 2FH8A 3TSBA 5MKGB 1KFWA 3N2BA 3TOPA 4IWWA 1AA1B 3VU2A 3VIKA 5I6SA 3M5ZA 4GE8A 4JTQA 2OOGA 5IOBA 4PUUA 2J7FA 2NVDA 1VJIA 1JF6A 4BY3A 1JXJA 3QHNA 4J28A 1OZQA 1US0A 4MYXA 2E5BA 4K38A 5BCAA 4WK9A 1K4HA 2WKJA 3SZ8A 4Q6JA 3SAZA 1BYCA 1JDEA 1GUVA 1RHCA 1MEWA 3VMOA 3SQLA 4HCHA 3SADA 4PL1A 1KLYA 1E0WA 2YCLA 2DW6A 4XAGA 2NWSA 2WPGA 3GNRA 5CBBA 3KRBA 1KWGA 2BGQA 1OM0A 1XYBA 3PP7A 4PTDA 1DJQA 4U5KA 3VOJA 5HQLA 2EJ1A 1JZ8A 4QGCA 4AC1X 3V0SA 1XGDA 3BVJA 4DZ5A 1XRTA 1OT1A 3RNDA 2WMIA 1E0TA 1KBLA 5K9XA 1NIUA 3FAWA 4Q8PA 1FWJC 1GVEA 1FHUA 3DI1A 5L6UA 1HN1A 1D8CA 4M19A 4B5SA 3GG0A 1HW6A 2HEJA 2VWTA 2PLJA 5KZMA 3AS1A 1KD0A 3CZGA 3W29A 1F61A 3R0UA 4LU0A 3VGHA 3EXTA 2QJGA 3BLFA 3HB9A 2YDQA 2PODA 3NQGA 1K70A 1TPDA 4HNTA 3DFHA 3PAJA 3WUFA 1TJ1A 2OLHA 5HNRA 3R7MA 1D7KA 4DELA 1WYIA 2RFGA 4AYSA 4GXPA 4A8LA 3GVRA 1DHPA 4ICNA 2Z1VA 4H04A 4GK8A 2YXGA 2YXOA 3PB2A 3QBUA 1X1ZA 3BG9A 3DKLA 3WUEA 1RPKA 4R33A 5A6SA 3QXBA 5CG0A 1A4MA 1UIPA 1CGTA 4R85A 1JULA 3S9ZA 3A47A 5CLTA 1KA9F 4C7FA 2PB1A 1J0YA 1BSLA 3CM4A 2DZAA 3T6CA 4NNAA 1L8PA 1KW1A 4WUIA 1DJGA 1XRFA 4GYPA 1GJWA 3I6RA 4WD0A 3W4RA 1ISWA 2YFNA 1W5MA 3TQ0A 3ITLA 3OVGA 4A3QA 2P50A 3WDRA 3AALA 2E68A 1HKMA 1ZL1A 2XIOA 4L1WA 4WOQA 2EPMX 1QI3A 3W1TA 2HSAA 3DH7A 1J12A 5E9AA 3C3NA 4ZO7A 3SBFA 3N15A 4UXDA 3BMVA 1CEOA 3GKFA 4PMJA 1DIDA 1Z41A 1TVPA 3E3HA 2QIWA 4WX2A 2F61A 3IRDA 4PCSA 1YPXA 4YVXA 4AIEA 5AKQA 3STPA 3LRKA 3ZVIA 4YCOA 1XBXA 1TO3A 2BWGA 1G67A 1R3TA 1B4KA 5DQPA 3O3RA 2ZUNA 4IHCA 3CUFA 5FCZA 1JPIA 4YWSA 3NXLA 4XBKA 1X6LA 3VDBA 4DJFA 4KF1A 4LNYA 1A5UA 3TNBA 5AYIA 1KBIA 3WKZA 2Q8LA 4ZSUA 4I6KA 3I7RA 1BYBA 1W3HA 3DAQA 3N3MA 3RMJA 4KWSA 1LWJA 1M6JA 4B90A 3WEZA 3EZ4A 4D8ZA 4HHMA 5C9RA 3LLXA 3BLKA 3CWHA 1PAMA 1XBZA 3OVRA 2CLOA 2J25A 3TYCA 4E3VA 3SIZA 3DG3A 3S47A 4XB3A 3GBEA 4M5PA 3OLIA 3L7RA 2UY3A 3N3TA 3GC5A 3AMKA 2OCZA 4J3SA 1DJWA 3T44A 1UD5A 1FWRA 2G50A 1YTEA 3WH9A 3LB0A 1UWRA 3MHUA 4AEFA 3MZNA 2Y63A 1JZ6A 4QIUA 6REQB 3GO2A 3W25A 3M0IA 1P1MA 3I65A 4MB1A 4X63A 3ARWA 1ZFJA 3E38A 3QZ6A 4QAIA 3JZEA 3UWQA 2VD8A 5LGXA 4UFHA 3DBPA 1B54A 3LX9A 3QV8A 1Q6GA 3LOTA 3LBCA 3AS0A 4B9YA 3P3BA 3R1ZA 5EU9A 3SCRA 4OIFA 1FWGC 3H7VA 4MHBA 2ZDSA 3PUDA 2QDDA 3T0TA 1AQMA 1DWIM 4AYGA 3NSNA 3NL6A 3T8QA 4L80A 1VJSA 2XM2A 3CHDA 4R27A 3VNZA 1EZWA 3W22A 4MADA 4YWIA 4HZMA 4JOMA 1HUVA 1TTPA 2VUYA 3VNLA 3WH6A 3O07A 1NEYA 1OFEA 2HTMA 3TMLA 5JUVA 4O17A 4WSJA 1MVYA 4IMEA 2FGZA 2XIQA 3R0DA 1A5KC 4AX7A 1S2WA 4DLMA 4CNUA 3OHMB 3A13A 2PLCA 4XZBA 5EMMA 1T0OA 1FWIC 4UOQA 3EKGA 2C71A 3AMDA 3QMRA 4OUIA 3GTHA 2G96A 4GC3A 4UMBA 4JN7A 2YLAA 4ZQCA 3MSGA 4HZ6A 5D2VA 3P5YA 3QGVA 4GX8A 2WHJA 5I09A 4HHPA 4ADTA 1VB9A 3M47A 4LEFA 2Y5EA 4FAMA 4AF0A 4X2RA 1E40A 1IEQA 1ALDA 5IFPA 1K7FA 1IGWA 2G4JA 1BF6A 2PDGA 3THQA 5H91A 4PFHA 3QGKC 4R88A 2WVSA 3L4UA 4QX4A 1PUDA 4RLIA 4KQNA 3KWXA 3LSCA 1PKLA 1SM9A 1JGIA 3DHDA 1DEDA 2W67A 1G4EA 4KEZA 2XFWA 3QYSA 3URNA 1TZZA 3EMQA 2VEKA 3GXTA 3MSYA 2IPJA 2A3EA 1A3WA 4AEOA 2QF7A 3CAVA 2Z2BA 4QJ1A 2XN0A 4PCNA 3WNNA 3FK4A 2Q3RA 2EGZA 1E4MM 4KGJA 2W3ZA 4PRRA 2QPSA 1EWDA 3EDFA 4IIBA 2BS9A 2GYIA 3GU2A 1XLIA 2Z6IA 2DV0A 2JE8A 1E4IA 4L7ZA 4QG6A 1SVDA 1YXCA 4KIRA 4Y9AA 1PEZA 2ZZ7A 4PUJA 2RH9A 2WHLA 1E15A 4ONVA 3ME3A 2VOMA 5K9CA 1NOFA 3EAUA 2HBXA 2OFJA 5EMLA 2PDBA 5A6AA 3TR9A 3HFTA 4BF9A 2CHOA 5EYWA 2VL4A 1IXOA 4HA0A 1PL9A 2VDGA 2VX6A 1UOZA 2QXWA 3BSHA 1J4EA 2JF6A 3H24A 5D30A 5E0CA 3N2OA 3HGJA 4CD6A 4FR6A 4EANA 2YL9A 3NQEA 2PDUA 3A6OA 5HBFA 4ERGA 4HPJA 1EHNA 1XS2A 1PX3A 3SJNA 4WY0F 1KBJA 3OA5A 3WK0A 5LHFA 2W0UA 1LL6A 4MTVA 3U4FA 3CV7A 1Q6DA 2XZ9A 3B8DA 4DB7A 1OADA 2WC3A 3HOJA 4WGXA 1WDQA 2HROA 2RJGA 3HV8A 3VNJA 3VM5A 2DT1A 5DBTA 1XDJA 1BWKA 4MWAA 3CMFA 3G77A 1YDVA 2ISDA 4H19A 3W1MA 1XC6A 4B92A 3FHQA 3FDKA 1ADSA 3ZOAA 2WBGA 3GXMA 3NR0A 4QR6A 1KGXA 3F1QA 3CASA 5EMYA 3N6JA 4LRSA 4AY7A 1RP9A 3QPEA 2HK1A 2DZVA 5D8WA 1EJ7L 4TUFA 4HYRA 3SCNA 1R3YA 3SY5A 4Z17A 3NQVA 4J3XA 4JFWA 4Q7NA 2PDCA 3ZSSA 4U2ZA 1GVYA 2XM1A 2GQ9A 3G1AA 1R30A 3SCWA 2QJHA 4XD4A 2GOUA 3RU8X 4HPGA 4CD4A 3OQ8A 4HNOA 3VNIA 1KM6A 4E2OA 2A7PA 1HIZA 1YNPA 4BI7A 2VENA 2WOQA 3LBMA 5HR7A 1YRRA 4PMUA 5HJYA 3CQKA 3R79A 4J3WA 2PTYA 1B31A 1W9UA 3IUHA 1R38A 3CUIA 3KVJA 4P61A 2FZ9A 1KR0A 4WEVX 1XLAA 4AXKA 1UCWA 3CV6A 3QOKA 2EPHA 4TV6A 4RDZA 1UWIA 4PCFA 2ZOXA 1QOQA 1ZP3A 4DPQA 1KRCC 3W9ZA 4ZXLA 3FLUA 3AIEA 4XIAA 3ANUA 1RV8A 1QI5A 3LSBA 3UEQA 3R8RA 2BSLA 3EB2A 5TF0A 4MM1A 1S1RA 2Y5JA 3P81A 1E6RA 4Q33A 4D71A 2O4MA 3FA4A 1XH1A 3E12A 3GD6A 4RE4A 1JGMA 1HKVA 2P76A 2X2YA 4HHHA 5HWMA 1R7AA 4YTSA 3L4YA 1OD0A 1PZ2A 4ZSTA 3IJDA 2QVHA 4CD8A 1CB7B 4BEUA 4FNSA 4DJDA 4GBUA 3AWOA 4A3UA 2GQ3A 2VOTA 2FVKA 1QBAA 3GVGA 1O5QA 2VD9A 4M6UA 3KVLA 3SCOA 3QN3A 2DDXA 1OY0A 2XINA 4L5ZA 1JNEA 1MNZA 2O0TA 4JYDA 3LCLA 3CEUA 3QHOA 1POJA 4DJEC 2ZA3A 3M6DA 3MUY1 3CV1A 4BFAA 1UKPA 4FR1A 3KXQA 3T07A 3LI1A 4RJEA 3ARTA 1G4SA 3R4IA 3IVUA 3S5ZA 3MDWA 4US5A 4ZQMA 1V3KA 1UH4A 3OPSA 3HU7A 4W93A 1EO5A 5FKYA 4XK2A 2FMNA 4MWAC 4AISA 3Q65A 2REQA 3INPA 4A2RA 5BOFA 3ITTA 2PDNA 3OA3A 3GTNA 3KL0A 1SZGA 3KLLA 1TELA 2INZA 3E2RA 1KNWA 3VOIA 1KQYA 1P0NA 2DT2A 1KQZA 2PWGA 5MKGA 4LVDA 3ARZA 5D9OA 2J8TA 2AAMA 3CL6A 4QE5A 3AI0A 1B1YA 4ZMGA 1T41A 2J7CA 1EH9A 3L0KA 3TEVA 2I9UA 1XRVA 1MUCA 4GUJA 1GOOA 4US5D 1Y8BA 1UBPC 3BOFA 2V9DA 5GJMA 1BVZA 2Q09A 1R7OA 2R6OA 4CNPA 2PP3A 2HISA 3ZIZA 2TODA 1DPMA 1FXQA 1IT0A 4V2XA 1GGOA 5HNNA 1TVNA 1UWAA 3SGUA 1Y5VA 2VC6A 2PS2A 2G3NA 1K9EA 4XSMA 2ZC8A 3NQ6A 1H63A 1XC4A 1B90A 4Z2IA 3QV6A 4MAVA 3CHCA 4Z2LA 1O66A 3SR7A 5F2IA 2PA6A 1QPRA 2JIEA 2J4GA 4S3DA 2D0HA 4A6GA 3C0LA 4IUOA 1I0DA 1IE7C 4FHAA 3CH0A 5GNZA 1K9TA 1Y65A 5DLCA 3GB6A 5D4YA 3UWZA 2HK0A 1H1NA 1NU5A 1XLBA 1OHLA 2QAPA 1JFXA 4RXFA 3PM6A 2OWWA 2XIMA 2PU0A 3M5XA 4XG1A 4E5TA 3B40A 5C55A 4GINA 3RR1A 1WUEA 3O2LA 1X1OA 1UH3A 4IQEA 4UMAA 4W7WA 1D2KA 4JXCA 3QTPA 4IMFA 1ITQA 2ZRVA 3TFCA 3QTGA 2O9PA 4TX9A 1MQRA 1S2UA 1A5NC 3MZ2A 2XH4A 2VI0A 3B04A 1GJPA 1MRAA 3GXPA 3MYOA 4JIQA 3BICA 4GNVA 1D8WA 1BSIA 2UZ9A 1VR6A 3KVKA 1XBVA 3MUIA 4O4VA 5A3HA 1AW1A 2JKAA 1RJPA 3W82A 1TJ0A 3R89A 4ZQNA 3MSRA 2EAWA 2GGGA 4HZ8A 3OYXA 2OYMA 1J96A 4JEJA 3DOPA 1RBLA 2GVGA 3BAYA 1EB3A 2QHAA 4IGHA 1FDZA 3VIIA 3CO8A 3M7WA 3DEQA 3LEPA 3QGAC 4F0MA 4H2CA 4RKAA 2D2HA 2A5HA 1XLMA 4H6RA 2GK1A 1H41A 1UKTA 1K8ZA 1GEHA 5E1QA 4D6GA 4OKDA 3HMCA 2PBOA 5I03A 4QRNA 1R2SA 4CD5A 4NJHA 5GQBA 2A85A 3HBLA 3M43A 4QG8A 2IKGA 1A47A 1HKIA 4O11A 3GNPA 3GDLA 4OECA 4GGBA 3B0PA 1BGAA 2C18A 5CZSA 3TA6A 3MP5A 4Z2JA 1MFVA 1QRQA 5HK4A 2VCAA 2GUUA 4UNIA 1WDRA 5B80A 2VURA 3VC5A 4AZIA 1DE5A 4B4HA 2OX1A 5HMSA 4LBRA 1Q3NA 3PNZA 4MKVA 3NXFA 2XN2A 1PPIA 4FP1A 1FXPA 4Q8VA 5C2XA 2BXYA 1E1CB 1EQCA 3LD5A 4JY9A 2Y88A 3KL3A 1EX1A 3A23A 3ABOA 3ISIX 2A3HA 3V7PA 1M04A 2QEZA 5CZ0A 2EXOA 1TYGA 3OLEA 4D72A 3V1PA 2VGIA 1C91A 5ABFA 4CQ8A 3P0WA 3U7VA 2F6UA 1F74A 4CN1A 3FCPA 3C6CA 4I5XA 3EA3A 1BQCA 2EG6A 4V1YA 1PKYA 1ONRA 5DY2A 3WQCA 3EDKA 3SN0A 1IEWA 1LRNA 2ODOA 4OOUA 3H2CA 5LNUA 1ZTVA 3NFUA 3T0BA 1OIMA 1N8IA 3H54A 3XIMA 1JPDX 2XYLA 3IJ9A 4K39A 1CB2A 5C9ZA 2WMJA 3S3GA 3BCJA 5KETA 5JBFA 2D3LA 2WWCA 4R7WA 5IBXA 3K8KA 1CXEA 4TIMA 4O19A 2A7NA 3WZ0E 1KB3A 1OX5A 1ZJAA 4PCPA 3DIPA 3M46A 3THAA 1TG7A 3W37A 5TAOA 1SO3A 4V1XA 3GZAA 3HA1A 3SCQA 3S1XA 4H9UA 4LT9A 1KV8A 1BYAA 4F2UA 3OZMA 4W8AA 3ZJ6A 4C6LA 1WKDA 4EXAA 3SUWA 3PN8A 1UR8A 1FWHC 4CEXC 4H9TA 1W5QA 4YNGA 2IS7A 1XYMA 4JICA 4CNNA 3M0ZA 4JTUA 1ONXA 1IXQA 4DXVA 4W8BA 4C5YA 3OU8A 1W54A 2F9RA 5I79A 2V5DA 4QS5A 1S3TC 2H6RA 3G8EA 2YBVA 5E6ZA 3TV8A 1VHNA 2Z4GA 3PJUA 1W1TA 2PWEA 2YYUA 4OE7A 3EYPA 1QI0A 2FHFA 1PTDA 4FXFA 4PTMA 2G5WA 1DHKA 3SGGA 2DFAA 3N4EA 4HN4A 4PODA 4IMDA 4XZHA 4ZXOA 2VFDA 2E7FA 3L0NA 5TQLA 3W1RA 1XIGA 3VX1A 3B8TA 4NYUA 2YA0A 3OIXA 1SJDA 1AW5A 2OKOA 1TPC1 2RDWA 3ARPA 3EEGA 3D0CA 3GDRA 3GFZA 1QR7A 3U2ZA 5JQ9A 3APTA 2DP3A 1XRSA 4LY4A 3N9SA 1Q2RA 3BUVA 1NARA 3SRFA 1A49A 3GLCA 3ITVA 4EAYA 3B8UA 3LGGA 1ELSA 1FH8A 4BK9A 1V0LA 2VDHA 1RZMA 4Y9MA 1GOWA 2BY1A 1H09A 4M0XA 3NZPA 1Q85A 4GYKA 6TAAA 2Q8ZA 5HQEA 1XD0A 1F4AA 4M6VA 4PYSA 5D2WA 4XZNX 3BCFA 3EB4A 3G6MA 1C9WA 2PU1A 4G6CA 4LB4A 4DF0A 1H7PA 1TPFA 3OHIA 3WQDA 5JXQA 1XIJA 1X8FA 2A79A 1XCFA 1UH2A 3PULA 1XDMA 3AO0A 5ABHA 1Y7VA 3T9PA 3A64A 1NF0A 2ZBTA 4FOKA 4BI6A 4X9YA 4C6PA 4DYKA 3KOZA 4CUCA 3TTOA 1NDZA 1OX6A 4PA8A 3CQHA 1HKKA 4X2PA 4U3CA 4Q8QA 4BQ2A 4MZYA 2VVNA 4A3RA 8A3HA 3B97A 1JUEA 3HJZA 4JX6A 3W2NA 3W6YA 2GPTA 3S8HA 4WHBA 2F6XA 3TYUA 3LHYA 2D3NA 4LPCA 4UQEA 2OSXA 2ACUA 5GNXA 3S5YA 3ZJ7A 2B0MA 1LJYA 1NVMA 5HQMA 1LBLA 5DFAA 1V93A 4HTYA 4I8YA 3CC1A 2FZ8A 3KRUA 3M0HA 4GQ0A 3W86A 3EWZA 4IMAA 1RY0A 5IDZA 5LNWA 4PTNA 4UTWA 2I5QA 2XSXA 4K1WA 4C6NA 3L4XA 2AKMA 1RBOB 2XFRA 1PX4A 3KUMA 2GZXA 3PK7A 3W2LA 4W88A 1IEVA 1MEHA 1P43A 4NZ4A 3LGEA 1AJ0A 1E55A 1JXKA 2J9XA 3P8IA 4S23A 3K8MA 5LIYX 3R43A 1RLDA 4JQAA 3TSMA 1G6CA 3LCHA 1PTAA 2OT1A 4UTJA 2DJLA 1TV2A 3E1F1 5FF4A 1VBHA 3GHUA 3ANVA 2QCGA 1MMFA 2YSWA 4YTTA 1A0EA 4L1XA 4JDBA 5CZKA 3IRSA 3UA4A 4F66A 3SIMA 4DJFD 4W5ZA 1MXDA 3LA4A 3O6AA 3BLOA 2V68A 4FALA 3G2GA 1Q65A 3UGVA 4IF2A 3W70A 1ODUA 1EWEA 3GVVA 3RK8A 1FCUA 4AIOA 3SCUA 4B9ZA 3WD2A 1F76A 2QT3A 1WXYA 3RCNA 4AF0B 3DGRA 2POTA 4FX8A 4LVGA 3HPAA 4UTKA 1HP4A 2WNZA 2BY0A 3HTWA 1W3KA 1I60A 1YBQB 3PZMA 4I3GA 3W02A 3NEHA 3WG6A 1NQ6A 3WEOA 1ME9A 1TWWA 3S9IA 1V8EA 1QASA 5AVNA 2OYKA 1FDYA 1BTCA 1ZCOA 5FJRA 1BG9A 3QV7A 3OVPA 1E3ZA 2CPUA 1NP2A 2ZE0A 5DCBA 4ZFCA 4WOZA 4P7LA 3G1SA 3MUZ1 2IQ0A 1A0DA 2QUTA 3M41A 4P7RA 3VOGA 2GGEA 4KETA 1W9XA 3UFYA 1N8WA 3T0AA 3O6YX 1VLIA 1VPQA 3QLDA 2F8QA 3HGOA 3W75A 3FA3A 3UJFA 4YL2A 1BXCA 4LV9A 1BRLA 4C6FA 3EWWA 2PRHA 1P6BA 2H3BA 1PX8A 3WSUA 2YL5A 4RNIA 4JEQA 1A50A 1LLWA 5FEPA 1ECEA 2Y8UA 3GQYA 1IGSA 2QDEA 2YCJA 3OVQA 4OGZA 3KRZA 4IPNB 4IQDA 3DFPA 4EPBC 2FKPA 3B0XA 3PVFA 4AZ7A 3G1RA 1WDWA 2ZZ4A 3L21A 4D8LA 3WLQA 3HGRA 2MNRA 2WANA 4MLJA 4M56A 4Z1YA 2DSWA 2QUVA 3PJTA 4GZEA 4QITA 2WLZA 1FH9A 3GDTA 1LOLA 1Q6RA 4LF1A 2FTPA 3N2MA 5HJLA 3G5EA 2VVSA 1A5BA 2I5IA 1UC5A 4ZR8A 2XPKA 2ZRUA 3GIQA 1YXDA 4QQUA 2J7EA 4H8UA 1UR1A 1UOKA 1JCXA 2RJHA 4UTFA 2O56A 1CXIA 3PPHA 3AXKA 3A3XA 2FJUB 2C7FA 3JW7A 1ADDA 4JDYA 5FL0A 3WBAA 2QGYA 3ABRA 5D9PA 3GNXA 3VIGA 7ODCA 2CHRA 1WDDA 3L4WA 4Q8MA 1KRAC 4UC5A 1K8YA 5REQB 3N6QA 3KS5A 3ZS4A 3LCWA 3N04A 2E5DA 3Q45A 2IQTA 4O1DA 1Y5WA 1I2QA 4IPIA 1HVXA 4YHEA 5TIMA 3KBWA 3UYIA 4MMWA 1E9LA 4AY1A 2IMRA 3NO1A 2DPEA 2R24A 2YCLB 4M29A 4C1NB 1MZHA 2WSKA 3RDKA 3TFXA 1SZFA 2PTXA 2FZMA 1EGMA 4YPJA 4ZBCA 3KBJA 3WLTA 1UZ1A 4AIBA 2DZBA 1HKJA 2OO6A 1XIEA 1YDNA 2Z1KA 3C0JA 2QUMA 2XVNA 3O06A 3W7KA 4E8GA 4ORIA 1OFPA 4KEUA 4PZVA 4GZ7A 1OD8A 2ISSA 3FYOA 3N13A 2CLMA 3WFAA 4KCWA 4GNKB 4OOZA 2OO0A 2V8ZA 3HPSA 3H70A 3LHUA 1AJ2A 3BPWA 1WKEA 3SN1A 3ALFA 4OFCA 5HR6A 1LCOA 1XLGA 1ZGDA 5F4WA 4HZ7A 5FL1A 2J7GA 2AOSA 2EEXA 2E9LA 3AZRA 4V27A 1JQVA 4DBWA 3WQEA 4IPPA 3VTRA 3PWAA 2OLSA 4Z08A 2CLKA 4EPKA 3DN5A 3TXZA 1CZ1A 1PHQA 1L6GA 3IAPA 1IIHA 2G97A 3QYQA 4H7CA 3U5YA 5F2GA 4C65A 1E0UA 3BANA 2BZNA 3BTNA 3LHTA 3TLLA 4ILSA 3AUOA 4UTWC 1KM4A 3LTSA 3I4KA 3R13A 1E1EA 8TIMA 3S6DA 1HF6A 5DX7A 4BF5A 2IPGA 2XHYA 1KFBA 1V08A 2VEFA 3VOHA 1SO5A 3ZM8A 3AMGA 1JI1A 1PBGA 1BXNA 3PZGA 1KRMA 4J9JA 3PSVA 1V3HA 1RXOB 4XO7A 5HMDA 3MW7A 2QCEA 2ZA1A 4LUTB 3LCXA 4GIAA 4JBRA 1ZPTA 5KTLA 2D2GA 4IXHA 4UTLA 5CGQA 3S2JA 1DVJA 3N25A 1L6SA 2ZXDA 4ZE4A 2OLAA 3OB8A 3KW3A 1ZCCA 4H3DA 3HM7A 4WSKA 3KTCA 3TQVA 5CJNA 4DUOA 3WDJA 1HJXA 1TMQA 1GHSA 4UTTA 1FKWA 4WDXA 1GPFA 3IGXA 3PFMA 5F7UA 2W9MA 4IM4A 4DPPA 3TTQA 4IL2A 2Y7EA 1D3CA 4KEVA 4XD3A 2AMGA 1RQHA 2CIPA 5EB8A 3EXSA 3ONCA 1DTNA 3B0UX 3L4VA 1PYMA 3NOYA 3MWAA 1AUSL 2XIJA 3T08A 2QMJA 3NO3A 4DJEA 3DC0A 3MANA 4S3CA 1NOUA 1W5OA 4L4PA 2ANUA 4DZIA 3AOFA 4J7RA 3CUJA 4QE1A 4AD1A 3UVAA 5FJOA 3CU2A 3I7QA 1E43A 1H7RA 1RA5A 4E0CA 3UWUA 4GVFA 2XVLA 2P88A 2Q71A 4KRTA 4L4OA 3WLKX 1QU4A 2AL2A 4R5EA 1GYMA 3I3DA 1IR2A 4QEEA 4UFKA 1VBRA 4O53A 1ZAHA 4GCAA 4HPNA 2UY2A 3C0QA 1J79A 4IIFA 3CGTA 1XYZA 1CGYA 3LXCA 1H5VA 4KIEA 1R86A 5AYXA 2PD5A 4RDVA 1O5XA 1BYDA 3KDNA 2PUZA 3KE0A 1W0MA 3FHAA 1T40A 3LLDA 4TX6A 3UR5A 1WZLA 1HX0A 3CL8A 4HBKA 3GU1A 2V5JA 3SRHA 2G3MA 3APGA 5D37A 1RCOB 1JCTA 1AFSA 4HK5A 3O8AA 3AMLA 2YCIX 4N9DA 1HGWA 2FMOA 2A6LA 3T55A 1HO1A 3FJ6A 1HJUA 3VD7A 3SUUA 5A2CA 5FA5A 3P60A 4IGMA 4D1IA 4TTUA 1EUNA 4K36A 3MSDA 1BF2A 2HCVA 1OGGA 5HOSA 4LVAA 2CBIA 3UERA 1TZ7A 1AW2A 1ZJHA 2WC7A 3NZ1A 4O52A 4XKYB 3OOQA 4GFIA 4UNLA 1JF5A 5IM51 2OYLA 2WKLA 1O5RA 1S5WA 3CT2A 4HD5A 3DBNA 1RAKA 2GSJA 2X7VA 1SMDA 3D46A 2E77A 3FVMA 4L6DA 2I56A 4WJXA 4ADSA 4NT0A 4LALA 1JZ2A 3S9YA 3RLGA 1TCDA 1W56A 4F9JA 5AHNA 4ENLA 1VYRA 3E02A 4GA8A 5LIWX 1KFKA 2W5FA 4GHRA 3W1AA 4OJYA 4X9SA 4XZIA 4CN4A 4ERIA 2DUXA 2L5HA 1MEIA 3T78A 4WGHA 5CC7A 4GX9A 3PUEA 2PDIA 1LQ2A 1FX6A 1KGWA 3BSGA 2XTKA 3W7IA 2XH2A 3UWVA 1W37A 1UASA 3TW7A 3AYVA 3LPFA 2MANA 1EA9C 2VXNA 4HSNA 3VA8A 3TXVA 2ABAA 4Z0JA 2GOKA 2WZHA 4XISA 4AW7A 3VGGA 2BV9A 3LS9A 4H9XA 4POCA 3UD6A 4YMZA 4H4IA 1LRTA 4H8VA 4EPDC 3FJLA 3NYZA 3S2MA 1IWPA 3W7PA 3HZ3A 3DZ1A 3WF0A 2DUZA 4RE2A 3B8VA 2WHKA 2X8RA 1ESWA 4MJ2A 3GUWA 4NILA 4AZHA 1OGBA 3UNDA 1ZY9A 5H1WA 1IZCA 4IICA 1OIFA 2ALRA 3LRLA 1Y0EA 2JKEA 3MC5A 3KEHA 5TD4A 4GH1A 3P14A 2VGFA 3A3WA 2B7PA 4IP7A 1CLXA 5G1MA 2B7QA 2C1HA 3Q67A 3APYA 4H6KA 4AHPA 1FH7A 6A3HA 5D03A 1OCNA 3W1QA 2YR1A 4ACZB 1UP3A 3NL2A 2E25A 3UXLA 3CZJA 3RO6A 2BVYA 5GJNA 5C0QA 1VBJA 2PDPA 3B8WA 5AC7A 2V3FA 4GJJA 3GKAA 4JTKA 3WY1A 1W31A 3BE7A 4KRZA 1ZBCA 1OYAA 3T09A 5A94A 2YB4A 3B4UA 3KHDA 2QDHA 3KP1A 4ZEPA 4DJFC 1BVWA 1PCKA 3UZWA 4Q7BA 5BU6A 3UVIA 3SCVA 2EJAA 5KINA 5DY3A 1F3TA 4DXKA 1L6YA 3G1HA 4O16A 1BPLB 4S1FA 1ZNNA 1LP6A 5FF7A 1G0CA 2OSWA 3ICJA 3IJ8A 3QY8A 3MI2A 3EX2A 1F07A 3EEZA 2GJRA 1WDSA 3NM1A 4C6CA 1GZ1A 2GSEA 3L4ZA 1JYVA 4JN6A 1QWGA 2WK2A 4FLRA 4C6EA 1C93A 3TSDA 1XIIA 2F2KA 2W92A 2PTWA 3ENLA 3DHFA 3R8HA 4RW5A 5BW6A 2VJXA 5GNYA 4AEEA 4MUPA 3JR2A 1LUCA 3SQSA 3MMUA 4XUYA 5K3VA 2CWNA 1NDVA 2Y7DA 3GTIA 1LQ0A 1DWHM 2HPIA 1JEZA 4MWAD 1WP6A 3PBWA 1ISZA 2QCMA 4C5ZA 4PBGA 4TQTA 1E6QM 4N02A 1P6CA 4L6HA 2R1PA 1E1FA 1IT7A 3VGFA 1C90A 4ECLA 2ZUMA 4GZJA 3H2NA 5E6YA 3KDOA 3SCTA 3IAQA 4AZBA 1MUMA 7TIMA 4OU1A 1EIBA 4HGXA 4E6MA 3KX6A 4RPPA 4C6DA 2F7FA 3M1ZA 2Q01A 4URIA 2UV8G 3AHVA 4P5UA 1H5YA 5C5YA 2J6VA 3M0LA 1XLLA 1QHPA 3AYTA 1T8XA 3VMPA 3IEBA 2VZOA 4P7OA 3E9AA 3L5MA 2DSUA 3SB0A 4WDUA 4Q6XA 2CC0A 3LQLA 1XLJA 5J04A 5DRIA 3T2OA 3T4WA 4DVOA 2ZRXA 1EL3A 2I7GA 3WMCA 3VO0A 1AMKA 2Y8KA 3C52A 4KW2A 7REQB 1GK8A 1UKSA 1BFNA 1TVLA 3DC8A 3CL7A 3L23A 1V79A 2F2HA 2Z28A 1TJ2A 3LHWA 4B5WA 3ITGA 3H2FA 4PMYA 1OZMA 5HJXA 2NW0A 4BWLC 4ZO6A 5ABGA 5K9DA 3F4NA 2P3ZA 2ZVRA 3RIKA 3TONA 4PUDA 4F0KA 2WSQA 1GOIA 2MUCA 2RKXA 3H4XA 2GUBA 4UCGA 4LYKA 4Q3MA 2QJMA 3HPXA 4CQBA 2F84A 2PLKA 3AXXA 4MJZA 3UYCA 2NQJA 5AHMA 5BMXA 3FV9A 3OGVA 3SRDA 2X2GA 1LF1A 1OF8A 1TFVA 1G1YA 1DOSA 3MJYA 1LBFA 4J3UA 2NQ5A 1AL7A 1TV3A 2VX4A 4KCTA 4XQ6A 1UIOA 3FJ4A 3RHGA 4JFTA 1A5CA 2ZZ6A 4U33A 3F7JA 3CXOA 2WSRA 3U3HA 1QNSA 4ZOBA 4LANA 3TN3A 4GYPC 5BZAA 3FDGA 1V6VA 4OTKA 2OVLA 3NQ8A 4HU8A 3GNNA 4A22A 3VCRA 3GAKA 4IJBA 2H90A 4ML9A 3TU9A 4WY0A 5T26A 3M6YA 4NZ1A 3BMXA 3MKCA 1GHRA 3II1A 1XX1A 3ID7A 1TE1A 5A95A 1JI2A 3CIXA 4JTTA 3VC6A 4RPQA 1V3LA 1V03A 3WFLA 2HPMA 1CXFA 3VIHA 4H41A 2VT0A 4QS6A 4NJJA 2WMKA 2HE5A 4JKLA 3V5OA 4LQ1A 4PSPA 2QGHA 5I3IA 2BXZA 4IG2A 4FMVA 1HJWA 3UXAA 5LZLA 3QM3A 1QNQA 4J5NA 4RNFA 4NKCA 1ITUA 2X0HA 3G1YA 1IIGA 2BASA 3GXDA 3VI2A 1ZALA 2ACRA 3LN3A 5D09A 3VGDA 4GC4A 2QJIA 2DVXA 5I06A 2CZFA 3RLUA 2P0OA 3NVDA 5HPOA 5XIAA 1OFDA 2V30A 1UYQA 8XIMA 2VR2A 2WCSA 3IGSA 3NQCA 3PUOA 1DQWA 3BJTA 1DV7A 4CQAA 3TJ4A 1LUCB 2OSYA 3AS2A 5M3WA 3G18A 1NY1A 4BJHA 3EWUA 1V0NA 4F79A 3A4AA 3M44A 2BNJA 4NNCA 4O8AA 1UC4A 2J62A 3LU2A 2GGIA 3WQ8A 3P67A 2EHHA 3LG3A 1AVAA 4KKXA 4MWAB 4PMDA 4YVVA 4XIMA 5T8GA 1S2CA 2D0GA 1YKWA 4H6QA 5BOEA 1QPKA 4L6OA 1S5VA 3GR8A 1P6WA 3C5QA 3B3DA 1PSCA 5LHEA 4A2SA 1UQYA 3KAOA 5G2HA 3NTYA 4UZUA 3N17A 4J3VA 4DM2A 4K8GA 5DT7A 1FWEC 4G1NA 3RX3A 4MKSA 3M0VA 4JHMA 4HSOA 1JZ4A 2NLIA 4TX8A 5AHIA 1C3FA 2V3GA 4RCXA 3W7JA 1EOMA 3ITOA 1VIWA 3AZTA 1R5YA 7A3HA 1U1JA 4QJ5B 4FIRA 3NSMA 3KZPA 1EEXA 2OWCA 3LNPA 3D3FA 4EWND 5JBEA 4UBPC 4AZ5A 1ONWA 4OWGA 4S3KA 4XAFA 3DECA 4JTLA 1MW3A 4AZCA 4HCDA 4O28A 3EA2A 4UR7A 3P7YA 4RZ5A 4KH2A 1L2QA 5LGZA 3VD9A 2CZEA 3G1VA 5C7HA 1GVIA 1OCJA 3REQB 3RR4A 2VFFA 5I00A 2VDIA 2PZNA 2ZZ3A 4JKMA 3EWCA 2PPGA 3QPZA 3EGJA 4P7QA 4J3ZA 4EACA 4LYRA 4QQ3A 1NTHA 4W84A 3N2TA 1Q6FA 1ZBKA 5E5CA 1V77A 2FB2A 1C7SA 4ROPA 2VO5A 3KOXA 4L4MA 1H7WA 1DXIA 1R9XA 3MQTA 4GMEA 4K3ZA 2PDLA 2X09A 3PZVA 5A6LA 1DYSA 3JS3A 1ISXA 4QE4A 5LSMA 2WW5A 3P80A 2BVWA 5ABEA 3PPCA 2PDYA 4TU1A 4B3KA 3CUGA 4DAIA 2FPYA 4JKKA 2A3AA 2NXIA 4IGSA 4Y8EA 5A2BA 4D6DA 2WV8A 2RUSA 3UNTA 2GVEA 2J9YA 3OBEA 3AAMA 5E70A 1S38A 1DP0A 1SO4A 4ZVJA 2ZVIA 2YBUA 3M16A 3STCA 3HIJA 3L66A 4GI6A 1D3GA 3HG2A 5F4SA 4LAOA 3U57A 2QKFA 3UP8A 3WQVA 1JD7A 5A69A 3A5VA 4LUTA 4N4PA 2C0AA 1XPGA 5ABFB 1O1HA 3K4DA 2QPUA 8RUCA 4CCEA 1VCGA 3UPBA 3FVDA 1QK2A 4GKLA 4QISA 4O18A 1R3WA 1DXFA 3IV8A 4E4UA 2CITA 3AIUA 5F1VA 5D2TA 1F7BA 4B91A 1EDQA 1PJ9A 1C8YA 2WQDA 3T81A 4A4AA 4LX4A 3TW6A 2A2IA 1Q8JA 5EY5A 1Q6LA 2OELA 3LZ3A 5CC6A 1JYWA 2Z29A 1WBHA 1G7VA 4M7SA 2HVOA 1XDLA 2D2OA 3M64A 1W8GA 3R94A 2O55A 1K7XA 2W6RA 3LHVA 2JEPA 3K13A 4LXFA 4PUKA 1MZRA 1BQGA 4GO8A 1ZRQA 1XBYA 3EOUA 1NAL1 3PSWA 4J35A 2CXEA 4OBTA 1B3WA 1AMYA 2V6AA 3VDAA 3QVQA 3UZYA 1GQKA 2O9OA 1QUMA 1TRDA 4QJ4B 3WDPP 2WZTA 5H8PA 4HP5A 1XGZA 4WKFA 3NGFA 4XKYA 3PF3A 2YGYA 4Y9OA 3ABZA 4RW3A 2EKCA 2ZX9A 1US2A 2HNHA 5KZ6A 3AIQA 3GYEA 4A21A 5CAKA 4ROQA 1T7LA 2EO7A 1GYLA 1O60A 4RV8A 1TR1A 2PGFA 3BC9A 3ES7A 4IIHA 1VRXA 3WBEA 1GJUA 2A7RA 3RUBL 2V67A 3DFSA 4C6KA 3UCCA 4Z2HA 1V3JA 3P61A 3A9BA 3P8JA 4Z1BA 3C61A 2X05A 4IIGA 3WLJA 1Q13A 1RQBA 3VIOA 1IR1A 4GO9A 4HNLA 2IKJA 1JCLA 2YCEA 3ZYZA 2BP1A 3WLPA 2PP1A 2VFIA 3TVAA 4WJEA 4BQ5A 2CBUA 4BQ4A 2VFHA 1XGEA 3GH5A 1FY6A 2V63A 5HDRA 2J77A 3K4WA 4UUIA 3NURA 4C6IA 4V28A 3WJZA 2EF9A 2WB5A 2PF8A 3VNKA 3ARUA 1M68A 4UR8A 1SO6A 4JTEA 1GKPA 3CZKA 4QXIA 1SFTA 3LTPA 4NHVA 3I3BA 3CUHA 3CUXA 3B8IA 4Q4RA 2F6KA 4X22A 1EJTC 1XWYA 3G24A 2X1RA 4WY0B 3AICA 2BGSA 1TA3B 3G0UA 1JUKA 2YB1A 3B8SA 4F0HA 1WUFA 1ZENA 4U5IA 1MDLA 3CAQA 1UR3M 1Z32X 2OEJA 4X60A 4CU6A 3F2CA 4DX3A 3WJXA 1V4YA 4HTBA 4AVFA 2HRWA 4JTRA 2Y1HA 3OLGA 3W7RA 1Z44A 2G0WA 1NOWA 1VC4A 3PZ9A 2GLKA 2VC5A 4TMBA 5AFDA 1SR0A 4JX5A 3W7MA 1E0XA 4WZHA 2DIJA 4RE3A 1JJKA 1KXVA 5CPOA 5LIXX 4PR4A 3ZT7A 1LDCA 2X41A 2VMFA 3U6WA 3IPWA 4V33A 3W1LA 4F4RA 2ZXAA 4Q4SA 3LV5A 3L12A 4OBRA 3ARQA 1W1B1 2VC9A 1HL8A 4QNWA 4IUGA 1FWSA 1NWSA 1HTIA 4R3UA 2VM8A 1E73M 5IXEA 2HWGA 4A05A 4LF2A 3B9OA 4FZIA 4QROA 4GIYA 2X1UA 3FSUA 4JIPA 3IJIA 2GJXB 4MZ8A 3G0SA 1R3RA 3OQEA 4QLJA 1W2VA 2NX3A 4JS3A 1PB0A 2PWUA 4IPLA 1FWCC 3FXYA 6ALDA 2Z24A 5I5RA 3S6OA 3CJPA 4DUVA 4NX5A 3FY1A 4HNCA 1KFCA 3W76A 2CZVA 3DYPA 1IQ8A 1FDJA 4OQVA 4E4FA 3GFYA 3UCQA 1WZKA 4ATDA 5GJPA 5IDIA 3MBDA 3GS6A 4FXRA 4GISA 4O10A 1KFJA 5I7GA 2VEIA 3IS4A 3WQ4A 3E5PA 4Z42C 1DJNA 3ZT5A 2FQIA 3W26A 2ZZ2A 5EBUA 1UP0A 2WBKA 3EDJA 3OZOA 1Z69A 1XHGA 4W85A 3W7GA 1GVRA 2Q02A 3EDDA 4GPNA 2V2DA 3F2DA 3D3AA 4FSAA 1WBJA 4M3PA 5FIPA 2X30A 3GTXA 2TAAA 3PZQA 3B9DA 1B2YA 3MKKA 5I77A 3GM8A 2Z27A 1MRQA 1XYFA 1BTMA 1IZJA 1VPXA 4JYFA 1OC5A 4BZYA 4ES4A 3OTRA 1HZYA 1EC7A 3VDGA 1GQNA 3THCA 2EKGA 3MY9A 1KM2A 1EDGA 1TREA 4LJ3A 1EKOA 1KWKA 1SW7A 4WCJA 1WE5A 2VC7A 4YIWA 6PTDA 3TQKA 1WO2A 4YLWA 1UW9A 3QMTA 4KEMA 4FX7A 6CGTA 3W71A 1KXTA 4LCSA 4XBJA 1I8JA 1K7EA 3HN3A 3LLFA 3PTQA 3W38A 3WK3A 3R12A 1GW9A 1XCXA 3L67A 4ATWA 1FHDA 4NSBA 3TYAA 2P8BA 1T8QA 1HFBA 4DJED 3BLIA 5B7YA 1A5LC 1W3NA 3H7RA 3G3DA 4GI4A 1EHAA 3A4WA 2ABBA 5LXXA 1UPMB 4WDTA 4DHGA 4PMZA 2AQOA 2PAJA 3VDCA 1V02E 1QJWA 2WZIA 3VIMA 2J27A 1HKWA 3NDOA 2UY4A 3PHAA 3HF3A 1CWYA 2VFEA 4MPKA 3GXIA 2POZA 1BWLA 3EWYA 5H8MA 1M7PA 1J0KA 5FAGA 3SEPA 4ZOAA 3VIJA 3RPTA 3IIOA 1OX4B 1NDWA 3AHZA 2YX0A 1OYBA 3QR0A 3VM7A 1UD8A 4HIBA 1E4NA 3STGA 1ICQA 5BROA 3PZIA 3QSRA 3HG3A 1Q7MA 5C2CA 2XVKA 3U2OA 2GWGA 5D8ZA 3RCMA 4NXKA 1F3XA 1XM3A 3L0GA 2ACQA 4GUGA 4INFA 2CETA 3GDKA 3A4XA 3HQOA 5LIUX 2FGBA 3W2KA 3CIVA 2OPJA 3CZLA 3FX4A 4I9JA 1TIWA 5JBDA 3RMEA 3WUGA 3VNYA 4E8DA 1V51A 1B3YA 1QI2A 3USBA 2X40A 4EAMA 4PN2A 3JVAA 2QF8A 3NQDA 1IV8A 4K8HA 3URAA 3VILA 3ZWSA 5DBUA 2J7HA 2EPNA 3O1NA 2YYTA 1VFLA 1VEPA 3H4WA 1HNYA 1NJJA 3E2SA 3TUUA 4IIDA 4O0QA 3VABA 3TIMA 1X6NA 2WXDM 1UKOA 3W3OA 4HA3A 1GZGA 3O7UA 5LYRA 3I7SA 5DELA 1SZRA 1TQJA 1DXEA 3PY2A 2HV5A 2NQHA 4QG9A 5FD0A 1B0IA 1JG9A 4LCRA 4XAZA 5HANA 5AZ0A 1NQKA 2CZDA 2JEQA 1UBSA 3HO8A 4GJIA 4FLSA 2NZLA 1GCYA 1XI3A 1PZ3A 3TJXA 4KWUA 2BHYA 4KT2A 2CYGA 5REQA 3TTEA 3I6TA 3EMZA 4HMEA 3W28A 1XLEA 4UZSA 4KPLA 4Q32A 5PTDA 5K4XA 3BOLA 2V5CA 2H3DA 1VYSX 1O12A 5LA2A 4LUYA 1OABA 1UB3A 2XSAA 1THFD 4QHRA 1X98A 1N8FA 4NAEA 3TH6A 3R6IA 3GIPA 1RH9A 3WJWA 4WDWA 1JDDA 3ITYA 1JL8A 1Q63A 1SW3A 3FAXA 4G7EA 1OX4A 4HA1A 4CNOA 4GQRA 4CEUC 5DANA 4B2DD 2DSZA 2J13A 2Z2AA 2WAGA 3DENA 1T5AA 1VBGA 3MCOA 2DGAA 3KL5A 4Z1CA 4BF7A 4FNPA 5IHRA 4AVOA 1R0MA 3TJLA 2FFCA 3OBKA 1TWSA 3WF4A 2W4XA 2PWVA 3LM3A 4NRRA 4OBSA 3BZGA 4CKQA 3UR7A 5FF0A 1XLKA 1R2RA 4NU7A 1XSKA 4E4PA 3EPMA 4KMQA 2WQPA 9XIMA 1TE6A 1VJZA 4P8WA 4ZQPA 3SJ3A 2DJXA 4MYAA 1H62A 4ZFMA 1LRQA 3E49A 1VF8A 3L2LA 4HPHA 1DWAM 3WL0A 2PDJA 3HJEA 1S5TA 2QCHA 5BRQA 2WNQA 2Z7KA 4JZ5A 3ARRA 4FXJA 4AWUA 4GXWA 4DIAA 3R10A 2VCBA 1XLHA 2R9RA 1Z48A 1DJIA 4JNMA 2D1ZA 4DWSB 4LVFA 1AODA 2GFTA 3WLOA 3R11A 4GD0A 4OUEA 1QPOA 5CSSA 4QJ3B 4B3LA 1G4PA 4NAFB 1I4NA 4C6QA 4EX4A 5AYYA 2RGLA 4HNVA 1H1YA 4ZTYA 4D6EA 3VFLA 4JTFA 1QNVA 2BTMA 2QCCA 1TTQA 3MVTA 1PIIA 4JNZA 3WNLA 3ITXA 3BQ5A 1ZU8A 5M1TA 3T0DA 2RHGA 2V0TA 3S1GA 2PP0A 4C90A 3KHJA 4ADUA 5A8GA 3S2CA 4BR1A 2A1YA 3LPOA 3VD4A 1J5SA 1PWLA 1TMHA 1ZAIA 3VKCA 1KM5A 1Q45A 4C91A 2ZX5A 1G7UA 1HT6A 3AIVA 3AYSA 3ZLHA 1FHVA 1FQ0A 1UG6A 1K77A 2NV1A 3RJYA 4E2DA 2QUNA 5DMMA 2HMCA 5CSRA 1W9PA 4ZB2A 1EXPA 1X39A 2LLEA 1EJRC 3WYZA 5C7VA 5KITA 3NDZA 1M9HA 3QQ0A 3WDQA 1EIXA 1QATA 5BXSA 4LOCA 4O12A 1U30A 2OQHA 1RVGA 2D73A 1FOBA 5FJUA 3MO4A 4E8CA 1KR1A 5CCZA 5G1YA 1VIZA 3UW6A 3TA9A 1NFPA 4EXBA 4IQJA 6TIMA 2X42A 3GHRA 3RPMA 4HOXA 1F3WA 1XYCA 2ZTKA 3ZT6A 3JRKA 4F0LA 1GOXA 2V38A 1AJZA 4UTIA 1A5SA 1YNQA 3OEXA 1SZEA 5A6BD 1W1PA 3RILA 3GTFA 5CAHA 4O4WA 4JNYA 5FESA 5FEZA 3KBVA 2ZYFA 2YLLA 1OINA 5CPTA 2YIHA 4GZIA 1OFQA 4IPJA 3ZVHA 1IWAA 1Q6CA 4HA4A 5CPNA 3DKJA 3QY6A 2YA1A 2BVDA 1C8XA 2ZTJA 1M41A 3MCNA 2P5NA 4L9XA 3PFRA 1SSDA 2PTDA 2OU4A 4LV4A 1VEOA 3DFQA 2JKPA 5KZEA 4RV3A 1UR2A 3UESA 3P84A 1UROA 2YOCA 3VXGA 4Y9PA 1PE1A 1XF0A 3K1DA 3M7SA 1LG1A 2CERA 4A35A 4LS0A 3W84A 1GNXA 1EGVA 4M7TA 3N4FA 2HVNA 2YL8A 5BXRA 1F73A 2BG5A 1RCQA 1XIMA 5E93A 5LKYA 3MDUA 3SQMA 3W2MA 4M81A 4FLOA 1Z8AA 3USZA 4GIEA 2ATSA 2YFOA 4DM1A 2E6DA 4AD3A 3O15A 1NWRA 3SCPA 4PRWA 3VD5A 1VBUA 3WDIA 5AC5A 1FP8A 3B06A 1D7FA 4G7FA 4IGNA 1XSIA 4X61A 3WLSA 1E51A 2Y89A 1V6XA 4DYEA 3MPGA 3E0IA 1GVOA 1MI3A 4KERA 4DAFA 1XIDA 1U33A 3BLLA 1XXXA 1KXHA 4AZGA 4LBSA 5I23A 3ZR4A 4FNRA 3MMTA 4QFUA 4EOUA 1ME7A 4FO4A 1PDYA 3GR4A 1JCNA 5F2MA 4ZODA 3VCNA 4Q22A 2R94A 1FWNA 3W1XA 2EPOA 1F05A 2TMDA 1CI1A 1EYWA 3NJ3A 4K7VA 1QI4A 3UG3A 1GQIA 2C3ZA 2QVNA 1SSGA 4LTSA 3FNDA 3SSJA 1BEUA 1UD6A 3LK6A 2PCQA 1OFAA 3LGDA 2V3EA 1L0PA 2NWRA 4HU4A 2VELA 1TKKA 1CLKA 3HG5A 1P7TA 1SFJA 4GI8A 4Q4QA 4W9TA 3G3MA 3N4AA 2OOFA 2OZ0A 1BRLB 5J5DA 2UBPC 4JQ2A 1GVQA 1W2PA 4HNNA 3WK2A 1TIMA 2WWDA 3NWRA 4DBDA 2JGYA 2YCKX 5AYBA 1KV5A 1S39A 1OT2A 2ISVA 1MW0A 4PFMA 3MT1A 4U3AA 2BOGX 3EX1A 2C15A 4OT7A 4RZ4A 2CFFA 5EL1A 1L8NA 2PWDA 4Y2WA 3GH4A 4UTTC 3SW6A 3AHYA 1X7IA 3WH7A 1MWOA 1QXLA 3PJWA 3QW4B 3RXZA 3LY0A 1P0EA 1QVBA 3LXAA 5D33A 2ZUSA 4FF5A 1OFBA 1PYFA 3V1HA 3IJLA 2DORA 2NV9A 4QCFA 3BSMA 3JZUA 3CYJA 2OKTA 4OZOA 1F6KA 3LQGA 5D2YA 4H6EA 3RF9A 6ENLA 1P4CA 1LL7A 3TNOA 2R91A 5G4HC 4UB9A 4XSLA 1WQ5A 2OZ3A 4QLLA 2VRKA 4E2VA 4HOWA 2WJDA 4AD0A 1CGVA 1REQA 2ZX6A 3WBWA 4W8LA 3GG8A 2FDMA 4RDWA 1PXGA 4I8DA 1L9WA 4WXZA 4DQWA 4AXNA 1UJPA 5DT5A 1C29A 3TC6A 1GEQA 2OQLA 4N9EA 1G4TA 3WQGA 4JHZA 3A3HA 4GUHA 4DWDA 1I2PA 2BY3A 3O05A 1EEPA 2VUNA 2Y6ZA 2PDMA 2XH7A 3DHPA 3M0MA 4X0VA 1OJXA 2X1SA 4GOAA 1ZJBA 1DWFM 3C4UA 2JIWA 2JQXA 3GNDA 2QQ6A 3R25A 1M1BA 5MF5A 3CQIA 2GDQA 1B57A 1K6WA 2A3BA 4P2VA 3H2EA 3GE7A 1DIKA 3UR8A 3IJ6A 1KBKA 3K30A 1YE4A 4C1KA 3CQ0A 3S0CA 4O1CA 2P0IA 2YDRA 4MG4A 3V5FA 1VFMA 2A3LA 4LUJA 1RD6A 2BB0A 3RYSA 1GPWA 1K3UA 4FX6M 1TWDA 3GX9A 4JIRA 1N7KA 2PRMA 5DO8A 3C0SA 2YXXA 3PPFA 5CXPA 1RD5A 2C16A 2Z7GA 3OLDA 2J47A 1QW9A 3FW6A 3V0UA 1PDZA 3LYEA 3EA1A 3RX4A 3FFSA 4WKAA 3ZO9A 2YBTA 1XR2A 3WCZA 1NM9A 4NVTA 7XIMA 3VFCA 3B9EA 3PANA 1S5MA 4IOTA 1ZHAA 4C7GA 3RG6A 1QOPA 4US6A 5I3JA 3NIYA 1VD6A 1VFOA 2QCFA 1IEIA 1X1NA 3FKRA 3IK4A 4YTUA 4CLMA 4JL1A 4S3GA 1OK6A 4FK9A 3BOXA 4MF4A 3EX3A 5BNKA 2JBMA 3C2OA 2ALDA 2YDAA 4Y8FA 3RM4A 2ZUWA 2E6AA 4NUWA 1B30A 3AXHA 4QM1A 1TX0A 3SURA 3MV01 1FFQA 4GACA 3B03A 2Y70A 3SM0A 4ERAA 1KCKA 1TJPA 4YYFA 4EE9A 3O6CA 2NXGA 1ADOA 1V0MA 4CU7A 1SU5A 3LCGA 4JTJA 3UZJA 1EDTA 3N9KA 3WH5A 2OZTA 5HNTA 3W23A 3VGBA 1WZMA 4MNKA 4NRSA 2A6NA 2GDVA 3S42A 1UP2A 7CGTA 4DY1A 1L6WA 3ALGA 5A5WA 1YDYA 3VKBA 2Z00A 4UTHA 4XZ9A 5A6JA 2ON3A 2QS8A 5CQ1A 4J4KA 5EKYA 1QK0A 4Q7IA 4GLEA 2QCNA 4GXMA 3P2VA 1EGZA 1H2JA 2FB3A 3SUTA 3VYLA 1B3ZA 5C9WA 1C8VA 3DUGA 4GKTA 3I68A 4A8RA 1LT8A 3PPGA 1R3QA 3SFWA 5MHBA 2PEVA 2O7QA 4EF9A 2NUXA 3AHTA 5CGMA 3Q2DA 1A5MC 2INEA 5FEWA 1HJQA 4GY0A 2PDQA 3PAOA