4AY8A

Semet-derivative of a methyltransferase from m. mazei
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
340
structure length
339
Chain Sequence
DMSEFTLKTRLLAALKGEPVDKVPVCSVTQTGIVELMDVVGAPWPEAHTNPELMAKLALANHELSGLEAVRLPYLTVLVEAMGCEINMGTKNRQPSVTGHPYPKDLEGAAVPADLLQRGRIPVVLEAIKIIREKVGPDVPIVGGMEGPVTVASDLVSVKSFMKWSIKKTDLLEQALDIATEASIIYANAMVEAGADVIAIADPVASPDLMSPDSFRQFLKSRLQKFASSVNSVTVLHICGNVNPILSDMADCGFEGLSVEEKIGSAKKGKEVIGTRARLVGNVSSPFTLLPGPVDKIKAEAKEALEGGIDVLAPGCGIAPMTPLENVKALVAARDEFYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Corrinoid:Coenzyme M Methyltransferase Mtaa from Methanosarcina Mazei
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Transferase
molecule keywords METHYLCOBALAMIN\: COENZYME M METHYLTRANSFERASE
total genus 117
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.1.1.247: [Methyl-Co(III) methylamine-specific corrinoid protein]:coenzyme M
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 4ay8A00
2Q6ZA 1XDJA 4ZTYA 4L64A 4ZR8A 1JPIA 1JPHA 1R3VA 3L7RA 2NQ5A 1R3SA 3GVWA 3BQ6A 3PPHA 4AY8A 3T0CA 1U1HA 1R3TA 1R3WA 1UROA 1R3QA 2Q71A 4L6OA 1JPKA 4L6HA 4AY7A 4L61A 3PPGA 4WSHA 4QQUA 3GW3A 4ZTXA 3RPDA 3GW0A 3GVQA 1XR2A 4L5ZA 1R3YA 1R3RA 3PPFA 1J93A 3CYVA 3PPCA 1U1JA 3GVRA 1U1UA 2INFA 1YPXA 1U22A 3GVVA 3BQ5A 4L65A 2EJAA 4EXQA 1XPGA 1T7LA
chains in the Genus database with same CATH superfamily
3A64A 2PGEA 4IPNB 3MW7A 2V2DA 3D3FA 3DERA 2QMJA 2PLMA 2B7NA 1YRRA 1EL3A 2XN0A 3E12A 4L4PA 3HJEA 1VPYA 2X8RA 2IXVA 2GGIA 3TSBA 4KFPA 3GX9A 3DIPA 1GZ1A 3VIKA 3VILA 3O3RA 2BHUA 3QPEA 5ECUA 4JPGA 5AOUA 2XFWA 3P5YA 3TA6A 4AD5A 8XIAA 3HOJA 1AW2A 4JKLA 3B0XA 1S3HA 1UQZA 5FI8A 3QN3A 2PA6A 5G2HA 1DWHM 2PP0A 3MUY1 4HNNA 1FCVA 4AC1X 3UP8A 6ALDA 2QDDA 3R0UA 1TWWA 3TXVA 4EP8C 2O9RA 2PBOA 2VGGA 3GNPA 3EDKA 4NHVA 3BGJA 1XPGA 2UV8G 3MHFA 1NAL1 4ZQNA 1Y8BA 3EWYA 3OIXA 3POCA 4AY7A 1PXGA 1K9DA 3EB3A 3PSWA 5LNRA 3QHNA 5EA9A 4Z1YA 2R91A 3WNPA 4LALA 1UBPC 3HJZA 4P2VA 2E9LA 3L4YA 2VEKA 5BROA 1EYWA 3W1LA 3UXDA 3WCZA 2Y5SA 3VIIA 2R82A 4QE1A 3ARTA 1AG1O 3MYOA 4IF2A 3W1RA 1QNQA 1FCUA 3O07A 4FALA 3HFTA 3SN1A 3PK7A 4FLQA 2E28A 1WXYA 4AU0A 2X1TA 1T41A 4LUJA 2AGTA 3MV11 3WF4A 4PC8A 4DJDD 3GDRA 4I8YA 4HA3A 2VX6A 5L9FA 4KQNA 3GW0A 1V03A 4HSHA 4XISA 1LLOA 2PC4A 1KBKA 1MMFA 4MB4A 2YCKX 3GAYA 4XO6A 4B91A 2PWFA 3G77A 5J5DA 1QHOA 3CTTA 2DT1A 3CL7A 1L2UA 1GPWA 4HOWA 1PKYA 4IUGA 4A8NA 3WLNA 1DQWA 3B05A 5CBIA 4GWEA 3W22A 3KDOA 2Y7FA 3V5FA 1H7PA 1Q4WA 2J7GA 3ANYA 1RJQA 4GG9A 3NVTA 2ZWYA 1QPNA 3HV9A 3S83A 4QQ3A 3QY6A 2WWCA 2WHJA 3DFHA 1MQPA 3NEVA 2DV0A 3WK3A 3RAOA 3NL5A 4PTNA 3G18A 5XINA 3WH5A 1UA7A 4YVVA 1KTBA 4H9YA 4WOQA 4QGCA 2DP3A 2F6UA 4TVCA 3N29A 1XIFA 2XGZA 3L9CA 3ZM8A 1B0IA 3ABRA 1PTAA 3L5LA 3LLDA 1KM5A 4RZ6A 1E51A 3BAJA 4FF7A 4H04A 1WA3A 1E56A 1WKEA 4MJZA 3QY7A 3W1AA 5CSUA 4B5TA 3SN4A 3RILA 2WC3A 3ABOA 4GYPA 3M0HA 4NY2A 1H7NA 3DHUA 3CUFA 3DKJA 1K4HA 4DUWA 4GIYA 4PSPA 4D6IA 2PLCA 1V0LA 1WXZA 3LLXA 3T78A 4Z2JA 5SWUA 5K4ZA 3EKZA 3IUIA 3IIPA 2BMBA 2D22A 5D2VA 5LGXA 4FNRA 1KFEA 1I9CB 1G7VA 5I5RA 3GH7A 3N2TA 1EJ7L 1XLCA 1RD6A 2XU2A 3WQVA 1ZALA 2HVMA 1W9UA 2PDJA 2A1YA 5ENLA 1F9CA 1KRCC 5AKQA 1ITXA 3OVQA 3ZR4A 1UZDA 2FJUB 2HPIA 1MNSA 3EMCA 3K8KA 3DHPA 1GG0A 3IJ6A 1NDYA 1YHTA 3B97A 1PZ0A 2GGHA 4MZYA 1KFBA 4EAMA 2V63A 3I6RA 3D46A 1EGVA 3C8NA 2TMDA 2B0MA 1UH4A 3D0CA 4ERAA 3KVKA 4JIPA 2J7HA 2F61A 3AIRA 3R0KA 4XAFA 4UTWA 3VCCA 3M0IA 3CO8A 3O7UA 3QFEA 5E0FA 1Q8AA 1OFRA 1UWAA 3IGSA 4NQ1A 1QWGA 3FHQA 5AHEA 4IHCA 3DHDA 1U83A 3MP3A 4GYFA 1RPKA 1D3CA 3F5LA 1XM3A 2WW5A 4JICA 3W24A 4B2DD 1O66A 5K2ZA 5FJRA 2ISFA 2VTFA 1QTWA 1RD5A 2VQTA 4ZBCA 4US5A 5IFPA 2PRMA 1A5BA 3OGSA 1WV2A 2G0WA 1REQA 4K68A 5IHSA 2Y85A 2QMKA 1HL2A 3NTYA 1EEPA 2VVNA 2OQHA 1T40A 3UA3A 1E40A 4MOZA 2VR2A 2ZUMA 2ZZ6A 2ZUVA 3LYEA 4FOKA 3LHVA 3SCVA 1DXIA 1ICQA 1Q7MA 3UNDA 1PPIA 1F8MA 2H3DA 4AX6A 2G3NA 3OTRA 1VFHA 5A8GA 5DXYA 4AF0B 4ZODA 5CPTA 4U5KA 1Y5VA 5HOSA 4H3DA 4PRWA 3MKVA 1DEDA 4AZHA 2GJXB 3Q65A 3M5XA 1KFKA 1UD6A 4IX2A 4KETA 4PTDA 3DI0A 1SW0A 3VFCA 3LMZA 1WDWA 5I24A 1DJQA 3MVIA 4Z1AA 3KOXA 4Q4MA 1EA9C 3RR4A 1X1OA 4P8XA 4L1XA 3UG4A 1GOWA 2ZFAA 5TBOA 3UEQA 4M56A 4XV0A 1ZJBA 2GJNA 4XZIA 4H4IA 4M82A 4OBTA 2J8FA 3G2GA 4LBRA 1XISA 4MKSA 5HAOA 2XHYA 4ZOAA 2ZA2A 3M7SA 4HK5A 4W84A 4DWSD 3BC9A 4V27A 1A5SA 3DHFA 1FFQA 3ARXA 1LBLA 4N0RA 3GTNA 3CT7A 5FIPA 1MYRA 1XIMA 3APGA 4J3TA 2YXOA 4MF4A 3AIBA 5H91A 2FB3A 3EKGA 5KETA 3BE7A 4LY4A 4NYUA 1DORA 2XGIA 3ZVHB 4F4RA 3A3XA 5C0QA 4EKJA 3CIWA 3KS6A 1ZLPA 3P0XA 4MPQA 3RG6A 3V0TA 2Y70A 2CZVA 1DTNA 1O68A 3EWDA 4AVFA 4MNLA 4DJDC 4ENLA 1NWTA 2HS8A 3L4WA 3WFLA 4WDWA 4JL2A 3EB2A 3WLPA 4JKMA 3WLTA 3Q4DA 2J25A 3PUOA 1G4SA 4PN2A 1XKYA 2Q8ZA 1RP9A 3H53A 2VO5A 6A3HA 4C6OA 3GNOA 4ZFMA 4XZHA 1I2RA 4AUBA 4E2OA 5CPMA 1TPH1 2J7FA 3L7RA 4XKYB 1X98A 2QDEA 4NIRA 3PSVA 3OLIA 3QJAA 4QAIA 3S1UA 3AICA 4WSHA 3CJPA 3ARZA 2ZQ0A 1QPRA 4ATLA 1X96A 1X8FA 4LVAA 1W2VA 3CV2A 2VFHA 4QFUA 4TQTA 1TV2A 2BASA 1QNOA 3C5QA 2P5NA 3DX5A 3BO9A 5D2XA 5EMYA 1JXKA 2J66A 1ISWA 5AC7A 4CUCA 2XZ9A 4M6PA 4WX2A 4FS9A 4QIUA 2DJLA 4IQLA 4L7ZA 3C6CA 4NP7A 4V28A 5FAJA 4Q33A 1ZL1A 4BK9A 5CSSA 1D7KA 4NJGA 6XIMA 2R9RA 3NQVA 1WQ5A 3FXYA 1R3RA 3QC3A 1C9DA 3VOIA 3T0DA 1VYPX 4POCA 3G1RA 4FZIA 4WJXA 4F0LA 1FWDC 2EHHA 4LSBA 2J74A 4UQAA 4BQ3A 2XIMA 3W2KA 4GNKB 1JZ6A 4OVXA 2P0IA 3G1FA 4M80A 1JUBA 2VKZG 2YXGA 5LIYX 4QISA 3G1DA 4I6KA 3TW7A 4YLWA 3LGEA 1M03A 1U30A 1RJRA 5FACA 2CLHA 2YZRA 2J77A 2BY1A 3W00A 3UQNA 3TLQA 3FIGA 3PBVA 5DX7A 4Q6XA 3AS1A 1PCWA 2JF6A 3QV7A 1M9HA 3BJFA 4P5UA 2IKHA 3KOYA 1IGSA 1C8VA 3NZPA 3NJ3A 4F0KA 3GR7A 5C9UA 1VBRA 1ME7A 1VYSX 3N9KA 3P62A 3TQPA 5HINA 3MZNA 1W3HA 3VIGA 4OWGA 1K8XA 3A9IA 3TMLA 3CYJA 3KTSA 2OZ3A 1GYLA 1TKKA 1HKMA 2HMCA 2DZWA 3HMCA 3ISIX 3KOFA 3DN5A 2Y88A 5D37A 1E4LA 1F76A 5D38A 1W3IA 3FFSA 3R89A 2BOEX 1R38A 3ALFA 3QZEA 4YVPA 3QSRA 4GVGA 3MP5A 3GXIA 3P8JA 1GORA 1YW1A 3ATZA 5E70A 1GG1A 3QY8A 4YL2A 1N2VA 3W9ZA 4GZ7A 3OO2A 3FJNA 5F2MA 5I23A 4EOUA 3SJNA 1ITCA 1Y65A 1NTHA 2BGSA 4JTUA 2QNEA 4JY9A 1UB3A 4GX8A 4O11A 4WR3A 3CL8A 5K9DA 1WAWA 3TAOA 3NQ6A 4LGXA 1V0KA 5FF3A 1NVMA 5A8MA 2TRSA 2JALA 2XH2A 4L9ZA 3S5NA 1E6SM 2Y7EA 2QCDB 1Z6KA 1HX0A 3GNXA 1G69A 4JR5A 1E3XA 3CWHA 3C56A 1M01A 1S5WA 1V6UA 1NP2A 5A6SA 3R12A 5A6MA 1E0UA 2E5BA 2C71A 2PCEA 1VF8A 3GYEA 5C6MA 3TE9A 2EKGA 4FNUA 2FHFA 1AVAA 2GJPA 3NA8A 4WSKA 1EO5A 3L12A 2CLOA 1KWKA 1Q6EA 1UWRA 3LHWA 3HTWA 4ZEPA 4KEMA 1J5TA 4GFIA 4U5IA 3RLHA 1TTPA 4AH7A 3DYPA 2O56A 3BSMA 3O9NA 4W5ZA 4D71A 1J5SA 1ZP4A 4Z2GA 1S2AA 4EPKA 5GJMA 3B9DA 4FAMA 2GLKA 1OC5A 4H2CA 4GH3A 1QASA 1HJQA 4BQ4A 3O2LA 2G4JA 3KXQA 4C6CA 3PTKA 3U2ZA 5LZLA 2A3LA 3T0TA 2HV5A 4YS1A 3W2LA 1OK4A 4P7RA 4FLOA 3W87A 3TZNA 1GCYA 2PTWA 3TLLA 2WVVB 4K36A 1J9YA 4WUIA 4CQDA 3R4IA 4P7OA 2EPHA 1OM0A 3GVQA 4ICMA 4HPNA 1PX8A 3A47A 4FI4A 2Z2BA 1EJUC 4UZUA 4S3GA 5BRPA 4UTHA 1V7AA 2IMRA 2WMJA 4Q4PA 1QW9A 2IPGA 1P48A 4JQ4A 2DSVA 4E0CA 1M6JA 4QG6A 4GABA 1K77A 5MKGA 3N6HA 3B3DA 2INZA 3IJDA 3SUVA 3ABQA 4K1GA 3T40A 3HPZA 3ALGA 3IV8A 4J35A 3TN6A 1LBMA 5CG0A 4HSOA 3VABA 4GYJA 4UFLA 3LTPA 4I5UA 5REQB 3AFBA 3W72A 2WNQA 4TX8A 2Z27A 2RDUA 1KLYA 2B7QA 3U6WA 5I00A 4GA8A 4PMNA 4ROPA 3KDNA 3KVMA 3H22A 1Z3NA 1QO2A 1BLIA 3C3NA 3SUUA 3UY8A 5HULA 1U1HA 1OWQA 4G7EB 1BSLA 2POTA 1US3A 1Y0EA 5LA1A 2VRQA 4HK7A 4D1IA 3MBDA 4CN6A 3OGRA 4S2BA 2R1LA 3EOSA 5ABFB 7CGTA 4UMCA 4F0RA 3LQGA 3G6MA 4ZOCA 3BCDA 1UKTA 1BXNA 4W88A 3V5CA 5FL1A 1R6WA 5CGMA 3F2DA 3ZJ6A 3MANA 2PLKA 3P0WA 4G2DA 4GH1A 4DJED 3KRBA 4LUTA 3TZFA 4OT7A 2AQOA 3PM6A 2WCSA 2BVWA 3LZ3A 3ERPA 3QOMA 4B9ZA 5JBDA 1KLZA 1TRIA 1AQHA 3T2PA 4IFOA 4DJFA 4LJ3A 3TYCA 3SCRA 3D47A 1LROA 3EMZA 1AMYA 1JPDX 2EPMX 1CYGA 4JN8A 4Q22A 2YJQA 1SGJA 1GVOA 3K8MA 3V35A 1XBYA 4CQCA 3T4WA 3VXGA 4PEKA 1XL9A 1EX1A 4D72A 4XWUA 3SY1A 2SFPA 4Q8UA 2XN2A 1H60A 3PBMA 2FTWA 4RV8A 2C3ZA 3DOPA 4PUWA 1XDLA 3F4VA 3GHUA 1KRAC 4YTTA 3ITGA 4FXJA 1ZAJA 4XD4A 2GUYA 3QH2A 3P14A 1MZRA 4LV9A 3VNIA 3SBFA 1B54A 3AYVA 4GJJA 4CEUC 4DZHA 1I1WA 1MDRA 2YSWA 4P61A 4J4KA 4ZO9A 4W86A 3SSJA 1SO6A 1NJJA 4CVWA 2Y5EA 3PR2A 2X0HA 4KWWA 1YNPA 4H00A 4R7JA 1FXQA 1DHPA 2A3HA 1RCXB 4FR6A 4IIHA 4GI9A 2DQXA 1TVPA 1NP0A 1OYBA 4PULA 3MBFA 4JTJA 1EBHA 3G24A 1XSJA 1ZP3A 2VRKA 3AIQA 4TX6A 4AZCB 1Z89A 1UWTA 4MTVA 2HNHA 3WEZA 3SUWA 4O16A 4PMDA 1AQMA 3C86A 5AHMA 3N15A 4C6LA 3M46A 5F4WA 2V82A 3H8AA 5HPOA 2VC9A 4JTLA 4TUFA 2OSYA 1XCFA 3IJ7A 1V8EA 1SR0A 5CJMA 1YNYA 2GVYA 4CU8A 2PWGA 4JNZA 3PY2A 4C6MA 1OJXA 3GAKA 2W0UA 1E4NA 4Q4QA 5CBBA 5C8BB 2YB1A 2EBNA 4FF5A 2YB4A 3QTPA 3VKKA 4KRUA 2E9MA 4MB5A 4BZYA 4MFEA 1ICSA 4PE8A 4J40A 3G22A 1QNPA 5F4SA 3ES7A 1REQB 3L4ZA 5KEZA 1CNVA 5AC5A 5K9XA 1B3VA 1T7LA 4Q4OA 3LERA 3IJQA 2ZUWA 5I3IA 4OKDA 3WUEA 3SR7A 2OU4A 4BR1A 1L6FA 4ORIA 5C2XA 3A5FA 1IWAA 2D73A 3W6MA 3DFSA 1H7RA 1JQVA 1JAEA 5FJPA 4W9TA 3EA1A 1ZFJA 1RVKA 1HN1A 1TMLA 4NYYA 2JE8A 4DUVA 5TAOA 3LEPA 4PMQA 3CL6A 5LNWA 3GRIA 3PBWA 1HO1A 4E5TA 1E0WA 3W0KA 1DWIM 4IGSA 1Q6GA 2ZDSA 1BKSA 2P10A 1JPHA 1QOXA 4MZ8A 4U4MA 1MQQA 1Q5MA 1TA3B 2V3DA 2CIPA 3EXSA 1H1NA 3RPDA 1JF5A 3AWOA 1R2TA 1N55A 3UJSA 3U5UA 1IHIA 4H1ZA 2OKOA 1A53A 1RQEA 1JQXA 4J2MA 3CLMA 1OCJA 4KIRA 1SSGA 3GFYA 3S6TA 3MQTA 1V6VA 1JAKA 2WJDA 1TO3A 4J3SA 4I7UA 3G0XA 3GZ3A 5FF4A 3O05A 4M29A 1OD0A 2A3EA 4JBRA 2ZX7A 1OEPA 1WOAA 2VVSA 2X41A 2VP8A 4CU6A 1O95A 5D8WA 1PWMA 1OFDA 2VCBA 1OSEA 4Y9OA 1MEWA 2G50A 4H9VA 3KRZA 1VAHA 1EJSC 1A5UA 3U8GA 3S47A 4XTDA 3XINA 4DEFA 4Q3MA 1Z41A 1ADDA 1ZCCA 1YBQB 4NUWA 2I17A 3B9NA 1MUCA 2NVCA 2KAUC 5KZMA 1B3ZA 3TUUA 1W3NA 3BAYA 3U48A 5G1MA 3UZZA 1LL7A 1J4EA 2XVGA 1W1VA 4TIMA 2A5HA 3IWPA 3CHDA 3UR8A 4XZMX 4X60A 1VP5A 3GDTA 2NXGA 4HPGA 4KCVA 5F2GA 1O5XA 4RE4A 4YVXA 3DEQA 5K7JA 2HRWA 5MF5A 4M19A 1R3WA 1UWIA 4AG0A 4QBXA 1TWZA 2WZTA 2CPUA 4GISA 4WJ8A 1K9TA 3BJTA 1FDZA 3C8FA 4XBJA 2J62A 4N9CA 3TSMA 3LBMA 4DHGA 1JZ4A 3VNLA 1WE5A 2W79A 3TQ0A 1FCQA 3BCFA 5M5DA 1YDVA 4ATDA 2YFOA 5HQMA 1XBVA 3HO8A 4I90A 4DAFA 4QDPA 1DXFA 1C29A 2XIBA 4O4WA 3KZSA 5ABEA 3KE0A 4FK9A 3W2JA 3ZIZA 3DI1A 3ITCA 4HU0A 3D5HA 2VRJA 4C1KA 1HKVA 4BJHA 4CD5A 3VDAA 4IX0A 4DYKA 3MUCA 2F8QA 2WJEA 1DKWA 1IIHA 3M5ZA 1IXNA 1DIOA 2F6XA 4CVUA 4ZB2A 4GIAA 1Q7ZA 1TTJA 2WXDM 5CPLA 4LB3A 3NQDA 4MAZA 2INEA 3NUKA 1ECQA 3MS8A 1KFJA 3VGBA 2VMFA 2RAGA 5GNYA 2NX9A 4OBSA 1SMDA 3LNPA 2OO6A 2GWNA 3E0WA 1TIWA 2QKFA 3T8QA 1AH4A 1EBGA 1VGAA 4HYVA 3BSHA 1W9XA 1WYIA 3GXPA 3H4XA 2A6NA 4FO4A 2D3LA 4HNTA 3TW9A 4AHPA 4IMAA 1HVQA 3S3GA 2CHRA 3SCOA 3KX6A 2DGAA 1TJRA 4ACYA 2E25A 4Y90A 2AOSA 1F7BA 3CC1A 1JD9A 3K2GA 4PFMA 1V3JA 3LOTA 4Z42C 2YBUA 7XIMA 5C9ZA 2ZZ5A 2ZBTA 4UFKA 8XIMA 1B1YA 4QEEA 5IBXA 2PDYA 3W86A 2DVTA 2I1OA 1X7FA 3PVFA 3VNMA 2ONEA 1FX6A 1OADA 1WP6A 1OG0A 1BYBA 4AIUA 1W1TA 4IPJA 2ZVRA 2DZSA 5HNRA 1NQ6A 1U22A 2CKRA 2NV2A 4OIFA 1BAGA 3W7LA 3CO4A 1GOQA 3EDJA 1IR2A 4PB3A 2V2HA 1MQRA 1FWFC 2R6OA 1G4TA 1NOWA 5CLTA 3RM9A 4CQ9A 2WPGA 2G3JA 4AHOA 4MFDA 1JCJA 1XQLA 3A22A 3JZUA 3H12A 1N8IA 5I3GA 2J24A 2BG5A 4C1NA 4NRRA 5FAGA 3HG2A 3TFXA 4UQBA 3PP7A 1R3SA 2W92A 2PZNA 4PEEA 1WDDA 1N82A 5XIAA 4V33A 1R7AA 4L4LA 3S2NA 4LOCA 2RGLA 4DWDA 4IIDA 3VDGA 1MWOA 4KEUA 1FWTA 3MPGA 1FVPA 3UVIA 4DM1A 3M44A 3ITYA 5F4XA 1BWKA 1Q2SA 5AHFA 2QPXA 1UMYA 2ACUA 1HQTA 2CWXA 4GFSA 2QDGA 4EF8A 2OELA 1KD0A 1PKMA 3BW2A 4MNJA 4V1YA 1J6OA 2ICSA 1M41A 5HWJA 3QMSA 2ZX9A 4W7WA 1X7IA 4WEVX 4C6EA 4J3WA 3ZVHA 5HPCA 4J7RA 1EHAA 1E6XM 4O1DA 4D8LA 4F79A 2DZVA 3L4VA 4GI6A 5EB8A 2G4FA 3VZYA 5C71A 2C8NA 3VIPA 3FX4A 1RLDA 2HISA 4DELA 3TTYA 1QW8A 2PDQA 3KHDA 3TR2A 4LUYA 1W0MA 3EWXA 5C55A 1FHDA 3RX4A 1E6NA 3KBSA 1TPVA 2PP1A 3EAUA 2BNJA 5EPDA 1OCQA 4G56A 3WLLA 3NL6A 1AW5A 1OT1A 2Q6ZA 5I3DA 2EG7A 3WBEA 3U7VA 2ZTJA 5I78A 2WMKA 1KGXA 3H21A 4L9YA 3S5SA 2A2IA 5JMUA 2CCRA 4RKAA 1AMKA 4NX0A 4HZ8A 4MUPA 3ZO9A 2DW7A 4UOQA 1L2QA 3EDFA 4UNKA 4ZZ9A 3PHAA 1TJ0A 2V9DA 4GIRA 2WNZA 4J3XA 3IRDA 2YCLB 5FEXA 4F2UA 3LCGA 2QVHA 4HHPA 1CLKA 1GPFA 4WXYA 3SUSA 5KTLA 3I3DA 1FDJA 5IDZA 1JDCA 3ARVA 1OFOA 4M5PA 3KOZA 4DO5A 2FZBA 1SPQA 3BG3A 5IRPA 1NDWA 3OPSA 3GS6A 3VD9A 4R9OA 4MLRA 3MDWA 3E1F1 2CXGA 3DFPA 1Q45A 1XLKA 3AS2A 4ZTYA 4K6AA 5CQ1A 1BGGA 2ZRWA 4IGHA 3LY0A 4S38A 4ZOEA 5AYZA 4KRTA 3ZT5A 3NDOA 3B8VA 4NG3A 4W93A 1EJRC 1JPMA 3CAKA 4ZB5A 1L0PA 3OB8A 4LS1A 4J2PA 2E6DA 2EAWA 3NO3A 1N8FA 5FEPA 1MI3A 4K37A 4I9AA 3N4AA 4GO9A 3V75A 4UBPC 1AQ0A 4B92A 4HU4A 5BZAA 5CG7A 2QVNA 4AISA 1VHNA 3B8UA 3QR0A 3PNZA 2QCHA 2C18A 2AKZA 2YA2A 1VEPA 3U7BA 4DAIA 1GEQA 2YDQA 3WQEA 2JIEA 2VUYA 4PUNA 2DT2A 2BP1A 5K9CA 3CMFA 4RNJA 1DQXA 3NQAA 3KBWA 3TROA 3T42A 3B9EA 1HZYA 3CLWA 1K02A 2O92A 4AZIA 1VD6A 1PEZA 3ZJ7A 4DF2A 3KBVA 4JTRA 5CJ5A 4QDMA 4ICNA 4H9XA 1T96A 2XVPA 1KA9F 2J75A 4C5YA 1TIMA 1UW9A 1RSCA 1XG3A 3M6YA 3HQOA 3T08A 3N4EA 2PS2A 3RM4A 1BD0A 4LF1A 2B81A 5U7SA 4GO8A 2VENA 1B57A 4K1WA 2PDMA 3W7MA 2XVKA 5A2AA 2DUXA 1JCNA 3SEPA 3N04A 1HXJA 1H4PA 3EDEA 1E0TA 1V02A 3B8WA 1TR1A 1B4KA 1XRTA 3C0LA 3ZSSA 4PMZA 1GTEA 4GHRA 2Y89A 3AIVA 1UQYA 3A6OA 4ILSA 3UD6A 1LOQA 5MKGB 1OFAA 3LB0A 1AODA 4TMBA 3LGGA 3HFYA 3W7QA 4WD0A 3ITOA 2VYOA 1M7JA 3WDQA 2YLAA 4G9PA 3UWUA 1PZ2A 5H8MA 2OXNA 4EPDC 1NF7A 3EB4A 4DB7A 2E40A 3VKDA 1E4IA 3T44A 5CSRA 3MJMA 4PL2A 4C6FA 3T0AA 1E0VA 1R3VA 1F6YA 2CZDA 5CC3A 4ML9A 2YA0A 1JZ3A 6CGTA 5ABGA 3HA1A 1W6TA 2GGEA 4JIEA 2QR6A 2DZBA 2Q01A 3VI2A 2P0OA 1OB0A 1ZHAA 1WUFA 4HA4A 3BLKA 1W5OA 1HKJA 1JNEA 1V3LA 3QGVA 5FKYA 4URIA 4IH3A 4JHMA 2R24A 1XLFA 4XTIA 5I0DA 1IWPA 3LI0A 1SJDA 5D30A 3DYOA 3B8SA 4DO4A 1EJWC 5RUBA 3S2LA 3H2MA 2IUZA 3SAZA 3URAA 1A5AA 2DZAA 2HBXA 2J8TA 3HB9A 1JD7A 4G8TA 2BXYA 2FGZA 3NOYA 4R53A 1UWSA 5AY7A 2G3FA 4NRSA 4MWAA 3OVGA 1PKNA 2DJXA 1TZZA 1MXGA 5BNKA 2QJIA 3COTA 4A21A 4F48A 3FV9A 3WF2A 5CBJA 3C3UA 2A3CA 1ODZA 4GYPC 3MTWA 2NW0A 2PDHA 1A5NC 3A3WA 2VJXA 1TELA 2DSWA 4Z08A 2WC4A 1GNXA 4LS2A 1GOKA 1PVNA 1DL3A 1R9YA 4CGTA 3TP4A 1D3GA 1OFPA 3TV8A 1QI3A 3N17A 2WNNA 1EEXA 3C2YA 4R88A 1UZ1A 1JFXA 3KL3A 3LSCA 1TA3A 5JH1A 3THUA 1HL8A 4KIEA 1I2OA 3QXBA 5H2ZA 3IIXA 3HV8A 1NWRA 1H41A 3GXNA 3VCNA 3VKJA 4JTSA 4JX6A 3TWAA 3ABSA 1KM0A 3KAOA 1A4MA 2VEFA 1TYGA 2PF8A 5AYYA 3MI3A 1TZ7A 1J93A 4D9PA 3T05A 3ID7A 3OBEA 1PDZA 5A1AA 1O5QA 3LUTA 1V6XA 2PWEA 1JCMP 4LCQA 5HMDA 1F4HA 4M24A 1EDTA 1W1PA 4M3PA 2VGFA 4P8UA 3ZXWA 2A85A 3AHVA 3ICJA 3WL0A 3LENA 2QCFA 1XIHA 3PPFA 4I7VA 3CQKA 3T07A 5EMLA 1LOLA 4AWUA 5J04A 1JCTA 1HGWA 4AWSA 1QI0A 3GD6A 3RDKA 5FESA 3P5ZA 4B4FA 2AL2B 1ONRA 3WFAA 2ZRZA 1ZSXA 3M6DA 3WQ6A 3O15A 5M2FX 4JTKA 2FPVA 3OU8A 9CGTA 4Q7NA 4ZO6A 4HOZA 3RU8X 4FIQA 1SFSA 4NAFA 1FH8A 3R6IA 1E0XA 2XPKA 1ZB5A 3BV7A 4KWOA 4ZSTA 2Z1WA 1RH9A 2Q02A 4CEXC 3EX3A 5DO8A 3LPGA 3W1UA 1RHCA 1CTNA 3RCMA 1CBGA 1S2TA 3W82A 3WMBA 2WM0A 4JTIA 4O1EA 1M65A 4LQ1A 1KM6A 1Q3NA 1VFOA 4H9TA 2PGRA 3G3MA 1CI1A 1K6WA 3WH9A 1VJSA 3QMRA 1QNRA 1CW2A 4W89A 1HGYA 2DIEA 2O9PA 3E0LA 3SCNA 3LV5A 3WK2A 1SO4A 2NLIA 3QOKA 1ZZMA 4OECA 2XM1A 2WMIA 4O28A 5A94A 3OIHA 2EEXA 3W83A 5TIMA 2WVTA 3FKKA 3CYVA 3S46A 3CZGA 2H90A 3PAJA 1AZ1A 1JI1A 3ZZ1A 4EXQA 3GC5A 3F2CA 3PZTA 1XYZA 4GQ0A 1EUNA 1XGZA 1LTDA 2GDQA 3VUPA 2J7DA 4O50A 2OOFA 1A80A 1IEXA 3PUDA 4Z1CA 4IXHA 3EPMA 2UZ9A 2OQLA 3E2RA 1IZCA 3RMJA 4IPPA 3KRUA 3WNOA 4EXAA 4DIAA 5HNNA 3E49A 3W7IA 3BLFA 2HS6A 4XG1A 1TPFA 3UYCA 4LYRA 1VFTA 2FTYA 2O9OA 1E1EA 2CLMA 1PIFA 3R8RA 4HA0A 1LWIA 3PTQA 3CMGA 4RPQA 4QE5A 1W3TA 5D9PA 2AAAA 3LTSA 1KFWA 4DYJA 4MMWA 4FXSA 4IL2A 4HPHA 5I2UA 3N9SA 4DNHA 3LNMA 3KVLA 3ZWTA 2NXIA 1SZEA 4DWSB 3RR1A 3AIEA 3CPGA 3V1PA 5BMWA 5L6UA 3AIWA 3JU2A 1F07A 4X0NA 1SFTA 3W7KA 1J79A 2VZSA 1PCKA 4F2TA 4E8DA 3Q94A 3QR1A 1LQ2A 3E96A 3ZR6A 3GU1A 3H2AA 1AUSL 2GGGA 3LG3A 4REQA 3TJIA 4YIWA 1VFLA 1KNWA 3MT1A 1EXPA 3J7HA 2QLYA 3TK7A 3LU2A 4UQCA 4XAPA 1C7TA 4C6KA 3P60A 4MGGA 1UC4A 4J27A 4P7QA 1PKLA 3N12A 3C61A 4R3UA 1ITUA 3LPOA 1XRSA 2EG8A 4INFA 3F1QA 2J79A 5GJNA 3BOXA 1M53A 3NPVA 2IW0A 3S1GA 1WZKA 3MO4A 3SGUA 5LYRA 4UR9A 1EQCA 3W07A 1TJ1A 5GQBA 5I7GA 4RXGA 2O9TA 1MW0A 2OSWA 1EJVC 2EPLX 2WLYA 4LAUA 1ADSA 3I3EA 5C7VA 4WDUA 3AS3A 4XSMA 1YX1A 3TQVA 4HIBA 1O6IA 2HK1A 1VENA 2I9UA 4A3RA 4HYRA 4WHBA 4U33A 1GWJA 1TV7A 3N73A 4TVDA 3PJXA 3HQ1A 2OYMA 3UCDA 4A2SA 4AXKA 2FLIA 4QROA 3NXLA 1LT8A 3CQHA 3NCOA 4GZIA 5LNSA 2R1NA 3F4WA 3F7JA 4PSRA 2QT3A 2V0TA 4I5XA 4KFOA 4PTWA 3H4WA 2OMAA 3B0YA 3BTNA 3BLPX 4WZHA 1KTCA 3S6DA 4I3GA 3V0SA 1XFBA 2G37A 1PWLA 1XDJA 1W91A 4Y9PA 4A6GA 3F03K 2F2KA 1OF8A 1R3TA 4LU0A 2VZUA 1Q6CA 1XIGA 3JR2A 1UD3A 2RDWA 4B15A 1PBGA 4MADA 2VGIA 4BS0A 3F4DA 3ZS4A 4OHQA 3GVGA 2GSJA 3HQNA 1YPIA 4DUOA 3F2BA 4UB9A 3ZJKA 5IXEA 4FXRA 3QYQA 3TWBA 4Q4SA 3GR8A 2C1IA 3PZIA 5HQLA 5JXQA 3W28A 3CU2A 2UY5A 3PBYA 3LXBA 5CEWA 1B3OA 4RNIA 2WVSA 3GTIA 3FHAA 3EKLA 3U4AA 3LK6A 4ZFCA 1R2RA 3NQCA 3IANA 1S1PA 3URQA 1G1YA 3EOLA 2ZADA 3V0UA 2P8CA 4GUGA 4D6CA 3QQ1A 5I07A 4HGXA 4YTRA 1GVIA 1HUVA 3BUVA 2PB1A 1WO2A 2JKAA 2VC7A 3R43A 5AYIA 3TN4A 4YHGA 3UG8A 4UTIA 3CHCA 3M4HA 2Q3OA 1ZPTA 1JI2A 1K1DA 1XYLA 3BURA 2CLLA 4K8GA 4A3HA 2QCLA 1VFFA 1NFPA 4GQBA 2OZTA 3ECQA 1B90A 1RY8A 1L6WA 4L9XA 2OR2A 3GO2A 4RZBA 3PWAA 2ESCA 2CXEA 2GK1A 2BX7A 3LGDA 1YMYA 3VMNA 3UWWA 1XYCA 3RGTA 2IQTA 2P3ZA 3KS5A 3O6YX 4A3QA 4ROQA 3VNYA 1LRQA 4HHHA 3VK5A 3S5ZA 3KBJA 4XX6A 2NQ9A 4GVFA 1WKFA 2VHLA 2O4MA 3QQ0A 3I6TA 1I2PA 5CC7A 1PDYA 1EF2A 1JFHA 1RK5A 3GTFA 2ZRYA 3N2MA 4MYAA 3I7QA 4PFHA 4WSJA 4KKXA 3LCHA 4I9MA 2C7FA 4HJWA 3A9BA 5G4WA 2WSPA 1V0MA 3MO7A 3VX0A 3ZSTA 2OGYA 3GG7A 3LZ5A 1JG9A 3HM7A 4WGXA 3EEGA 1E43A 4JQ3A 5CLWA 2F6KA 4H7VA 5JBFA 3HGSA 2EPNA 1MSSA 4BA0A 2CZ5A 4BF5A 3THAA 1OX6A 3UXKA 1V08A 3WH8A 4ZMGA 3UPBA 4F0MA 4PMYA 4H7CA 4WQ6A 1C8XA 3L2LA 3C4UA 1V51A 1IZJA 4O0ZA 1QPKA 3MUXA 1ADOA 1GW1A 3PFMA 4RZ4A 4WY0F 2PODA 5TF0A 4QXIA 1J01A 4Y9MA 2QUVA 1TTIA 4LF2A 3FEQA 3W81A 1QI4A 5ECVA 4E3VA 1XH0A 1R46A 5IBXC 3CZLA 1SUXA 4C6IA 1BG9A 3NQMA 4W5UA 4Y7EA 2ZXAA 3BDKA 3VIOA 3MI2A 2CC0A 2XIJA 3CB3A 3AMCA 3QEZA 1D2KA 3NM3A 4NNCA 2V3EA 5DMYA 4JN7A 1QDSA 5LNVA 4DF1A 1D3HA 3WBYA 5HMEA 3W27A 2YCJA 1WAUA 3LCXA 3Q67A 4YNGA 1NEYA 4MB1A 1FHVA 3LCFA 5E6YA 3VOFA 4PUMA 2QZRA 4F3HA 2X7VA 4HPJA 1SZFA 3O0FA 2HSAA 4BHYA 5BYWA 2XH7A 3DC8A 4Q8OA 1P0DA 3S8HA 2JQXA 4QLLA 1HIZA 1J0IA 4M8UA 1Q6FA 1W9DM 1MZHA 1WBHA 3OZMA 4FOJA 3VIMA 2H9AA 2ZA1A 3KL0A 4IMEA 5C9WA 4FIRA 5TQLA 2GDUA 3GNRA 3W38A 1RVGA 1YE6A 3WY1A 2FZDA 4US6A 4HNVA 4PRTA 2C14A 3VGHA 2XH4A 4PCFA 3HURA 4XVDA 2WZEA 4UMBA 3SJ3A 3QRHA 2WV8A 4HSNA 1ZJAA 5E9AA 3SW6A 1BTCA 1VRXA 3OG2A 4KCTA 4A29A 1A0DA 1K3UA 2V38A 1MFUA 1D9EA 1CENA 3STFA 4DXKA 3OYXA 4W7VA 2YW4A 3GU9A 4B5VA 1JPKA 3A23A 3W2UA 1K8CA 4IJRA 2CBVA 4UR8A 7TIMA 4NAEA 3AJXA 2YW3A 1XW8A 1AK5A 4FX6M 3MCMA 1IR1A 5A8PA 4A3UA 4LEQA 1MDLA 4GE8A 2OWWA 3R10A 3L2MA 3VD7A 1LWJA 4JYFA 3ABZA 5AFDA 1KQYA 4DO7A 3NGJA 4AY1A 4M51A 3AUOA 3BV4A 3SSZA 1EYEA 1GJUA 1CGVA 4DJDA 2FVKA 3M0JA 2VEPA 2X40A 2V5JA 2NLYA 1CXHA 4HA1A 4O8RA 2V2CA 1KM3A 2ZC1A 1PYFA 2Q8LA 3MWAA 2BY3A 4KRZA 5J8LA 1JF6A 3HGOA 1RPXA 1GEHA 1Q8JA 3N25A 1M7OA 2PDUA 1CB2A 2GUUA 3G1HA 2YCLA 1FWCC 3BCJA 2ZCGA 1VFSA 2EPOA 1P5BA 4Q8WA 1FTXA 1M3UA 1QOPA 1E73M 2VGBA 1R9XA 3WH7A 4XK2A 1IGWA 3WLOA 4WY0A 3LHTA 4ZR8A 3TDFA 1AH0A 2V5KA 3W6YA 2E6AA 1LG1A 3Q37A 4F0HA 1H51A 1UP2A 3TYUA 1MXSA 2E9BA 2FVLA 4JFVA 1DTUA 4UQEA 3IVTA 3QTGA 2JKEA 4GYKA 4IQDA 2P50A 1OGGA 3N2OA 5A2CA 5EFDA 3TH6A 4LH8A 2XZ7A 2YDRA 5DLCA 4K38A 1L6GA 1IXPA 3DYMA 3NURA 1P6CA 1AL7A 4JY8A 5FEWA 3PG9A 5M17A 2DT3A 1EDQA 5D03A 1YIXA 1J0JA 4WGHA 3T2OA 2RGMA 1VHCA 3DXIA 2EJAA 4XB3A 2OT0A 3FA4A 1S2CA 2X0YA 4PCPA 3IGHX 1Z69A 1XD1A 1QOQA 4C6JA 3WEMA 2AQVA 2GQ9A 3TMQA 3HPXA 4ATWA 4LC8A 4OZOA 4DJFD 2IQDA 4V1XA 3TC6A 3S9ZA 1FCBA 2WKGA 1VIZA 2PDCA 5LHEA 1KO0A 1W56A 4NAFB 3SY8A 3WEOA 2H8ZA 1Z48A 2C16A 2NSXA 1I2QA 3XISA 1CXFA 1R3YA 2GVEA 1PJ9A 1R5YA 4RL3A 4JTFA 4PMRA 1FP9A 2VEGA 4ADTA 3OYZA 1XWYA 3IUDA 4NILA 2WMGA 4JIQA 3UWEA 3V1HA 3DECA 3VMOA 4DBSA 5E1QA 3S2JA 4WVXA 2QPSA 4D6JA 4LXFA 1XIJA 4C1LA 1RCQA 4BFAA 5C9RA 2ATMA 5CZJA 1XUZA 3NEHA 2H3BA 3K30A 4ONVA 2Y62A 7ENLA 3WNKA 2Z26A 3WMCA 1UR3M 2X1UA 2Z0IA 1H7OA 5GNZA 3G3DA 4QQUA 3TTQA 3W85A 3FYYA 1S5MA 4JFSA 3CZJA 3K4AA 1XINA 4UQ9A 3N14A 3MVTA 4Q8TA 2YYUA 3H2CA 2XYLA 3UNTA 3UGVA 4CNOA 1EGZA 3GUWA 1NF0A 3GB6A 1BVNP 1FWEC 2HQAA 2QQ6A 4ZOBA 2GUBA 2W4XA 2V81A 4ZCWA 1G94A 1FRBA 3P2VA 3WD2A 1UIOA 3QLLA 1JZ5A 2C6QA 4A05A 2EJ1A 4GBDA 1O60A 3TJLA 1XLJA 4GUHA 1WKYA 1TWDA 4PYSA 2FZ9A 1CT5A 4R27A 4Q8PA 1QK0A 2FZMA 5HJYA 3MKCA 1XLMA 5G1TA 3EX2A 4GD0A 4IJBA 1IEVA 3BLEA 4RPPA 1ENUA 4LNCA 2WVUA 4ZGYA 2A7PA 2PUZA 4WLCA 1QBBA 3NQ2A 1K8YA 3S1XA 5D9MA 2HK0A 3VZXA 3WJZA 3HF3A 1UOZA 5DMMA 1NELA 4X63A 3GNDA 3C2VA 4ASTA 5D9NA 5M3WA 5HUOA 3AZRA 2GQ8A 3PJWA 4UTTC 4O1CA 2C79A 3LBOA 2DZXA 3DG6A 1LL6A 1F61A 3S4TA 2VZOA 2ACRA 3MZ2A 4DXVA 4XO7A 3UWQA 1G7UA 1VZWA 2I5GA 1BXCA 5A6BA 3RIKA 3A12A 3WD1A 4Z2LA 3LRLA 5EMKA 1SVDA 1R2SA 3FS2A 3LSBA 1ISZA 3G8RA 3HN3A 4MSSA 2RUSA 4DRSA 3GE7A 3MMTA 4XZNX 5HK4A 3TYDA 3ENLA 3IAQA 3DGRA 4HYWA 3B0PA 4NAEB 1MW2A 4HHMA 4UNLA 4UXDA 4CD8A 2R1MA 2HE8A 4DI8A 4ECLA 1UH3A 2NVAA 1XBZA 3O06A 1V3MA 1I60A 1XIDA 1ZBCA 4HVXA 2PWDA 1JCYA 4UFIA 2WHLA 4JX5A 1H7XA 4S23A 1QU4A 4IWWA 2QCEA 4CQBA 1PZ1A 5D8ZA 2XSAA 3E74A 4JNMA 1OBAA 1P6WA 1YDNA 3GYCA 4NZFA 3WX7A 3BJSA 1HJUA 3SRHA 4B2DA 1TJPA 3AU2A 3P67A 3W7OA 3W6LA 5A8NA 3IJLA 1GVRA 4JTTA 5DMLA 3CZ8A 4WKFA 3DZ1A 1BXBA 4GCXA 3LX9A 1I0DA 3WF3A 1A0EA 2ABAA 3E9AA 3N6JA 4QSFA 4ZQMA 1U1JA 1KV5A 3W25A 1GJPA 2D2OA 5A3HA 4GACA 1C7SA 1FWRA 1EP2A 4GCAA 2GZXA 1OZQA 3GUGA 5I02A 4KESA 5ABTA 2QULA 4EVZA 1GOMA 1CPUA 4AWEA 3A4WA 1J10A 1XIIA 3G1AA 5LIXX 3F4NA 3GIYA 3OVPA 4E6MA 2PU1A 1OVDA 4RV3A 4HJFA 4MKVA 2OB3A 1PL9A 1D8WA 1WX0A 3N13A 1FWIC 3SM0A 2Y61A 3ZLGA 4NT0A 5H1WA 3BWWA 4JZ5A 3C0QA 4Q32A 4H7ZA 2QV5A 2NV1A 2TAAA 4IMGA 4LW7A 1DJNA 3U4FA 2E7FA 3MMDA 3EWWA 3H7VA 1A3HA 2CHNA 3IUHA 1X6UA 1XLGA 1TR9A 3EA2A 1JYWA 3SRFA 1FWJC 4BCEA 5DF0A 1CX9A 4CCDA 2ZKMX 3EWUA 1W54A 4OV9A 3QZAA 3LXAA 4AY8A 5GNXA 5I6SA 4Y6GA 4Q8MA 2NQJA 3TQKA 3KTCA 3KWSA 1O1HA 3OJGA 1BYAA 3R5EA 1LG2A 3LXCA 4GI8A 2HROA 1XSIA 2TPSA 3N18A 3TYBA 2QS8A 1I1XA 1P7TA 2VD8A 4WDXA 1S46A 4EWND 1K9EA 5HXMA 4RNHA 5REQA 4HTYA 2JKPA 1B2YA 3UGRA 7TAAA 2CLEA 1BKHA 3FKRA 3NOEA 4C6BA 2Z24A 1ELSA 1E6QM 3N2XA 4HK6A 3JW7A 3HG3A 1V6WA 3SIZA 5G5IA 3EPNA 4DX3A 1WZAA 3CT2A 1SW3A 4Z2KA 4FPSA 4DPPA 4KWVA 2FDSA 3TR9A 1UR1A 4HD5A 1B9ZA 5D4YA 2W91A 3RPTA 5FEZA 1KCKA 2D0GA 4QRNA 1IE7C 5HNUA 2B7OA 1KR1A 4LUSA 3NNTA 4JNYA 1ML1A 4RE3A 2ZXDA 2CBIA 2XGBA 1GYNA 1BTMA 4JEQA 5A69A 4JIHA 2QCCA 3WLJA 4AYGA 1XCXA 4ZQRA 2PDKA 3H26A 3VC6A 5LKYA 4GINA 2OYKA 1WDPA 3DCPA 3K1GA 2A4AA 5EL1A 4DXXA 1IEWA 3PZNA 2QW5A 1LUCB 2WKLA 1JIBA 4PMUA 3GW3A 1EKOA 5GVJA 4OOZA 1OABA 1RCOB 5BMXA 1RA0A 2BLEA 2G3MA 1J12A 4QJ5B 4XIAA 1TZ9A 5GJPA 2AQWA 4L64A 3AU6A 1OYAA 2EF9A 5LA2A 4LS0A 1KCXA 4KMQA 1BGAA 1EUAA 2CKSA 4YTQA 1PTDA 3VCRA 3K1DA 1EGMA 5DY2A 2YA1A 4AD3A 3L68A 2Z2AA 5C2CA 3CNYA 4GXMA 1TPWA 1M7XA 1MXDA 1GT8A 3FJLA 3HIJA 3JUGA 2OKTA 1EIXA 3GZAA 1DIKA 2PEVA 2EGZA 3W7HA 5JH2A 1EPXA 4MWAE 3QSTA 3FNDA 3RYSA 1D7FA 3H23A 1EDGA 4UNIA 4JQ1A 3QQWA 4NI8A 1SO5A 2NT0A 1OGBA 1YXDA 1BFNA 4J28A 3UY7A 4GUIA 4H6KA 3TOPA 2V67A 1AH3A 4NZ5A 1HKWA 1LRTA 2OODA 3STCA 1SU5A 1C92A 2Z7GA 2WB5A 4H8UA 2OLAA 4MLJA 2NX1A 1GKPA 3JS3A 2CLPA 4E2DA 2WKJA 1P0NA 2V3GA 2X16A 1FWSA 3HG5A 3M7WA 4LAKA 1P0EA 3KBMA 1V0NA 3SUTA 3OODA 2XFYA 3N4FA 4LAMA 3BGAA 1XRFA 4US5D 4O52A 1KR0A 2DIJA 1SSDA 3M9YA 3QZ6A 7PTDA 4HOXA 4R9XA 3GXMA 5XIMA 1J2WA 4YU1A 3KCLA 2BZNA 1LL4A 3Q45A 4A8RA 1XLHA 3CZKA 2OT1A 4WXZA 3LHUA 4DJEA 2OX1A 4QR6A 2BOFX 3ORWA 2VQUA 4IQJA 4QJ4B 3VA8A 3A4AA 3WK1A 2X2YA 4EACA 5CJNA 3P74A 2EPKX 1B5TA 3V36A 1HJXA 3BZGA 2J4GA 1NQKA 2QIIA 4M6QA 2Y2WA 3O6AA 4IFKA 2PBGA 3F5KA 5DANA 3VE9A 3VGFA 1W8SA 4Q8NA 4LCRA 3VIHA 3IIZA 3EXRA 1IT8A 3VMPA 4WK9A 3KTXA 4F0SA 1EP3A 1TPC1 5BOOA 5A5WA 3KVJA 2CLKA 2QJNA 4PA8A 3AXHA 3CGTA 3ZYZA 2OX4A 1WXJA 2PD9A 3ZLHA 1QATA 3OZOA 6TIMA 3M0KA 2D0HA 2YX0A 1RBLA 3S0CA 1XC6A 3UPWA 1AFSA 1QR7A 3LBCA 4AW7A 4LBUA 4PMOA 2RHGA 2PGFA 2NWSA 2X0SA 3AYTA 1F6KA 3W1MA 4DJFC 3NR0A 1CGYA 3UR5A 4TXEA 1P1MA 5HDRA 3LD5A 3THQA 3GNNA 4X9YA 3TFCA 2FGLA 1TV8A 3S42A 3T0BA 4TV6A 1XLBA 1ZQ5A 3WLKX 2X1SA 4GK8A 4Z17A 1JULA 1JUEA 2A79A 1JVNA 3I4KA 3ITTA 3UR2A 2ZA3A 1E6RA 1BSIA 2PTYA 3B06A 2QCMA 4H6QA 1GVEA 1M68A 1XF0A 1C8YA 1MUMA 2A0NA 3ZVIA 2PRHA 3LMYA 2BHZA 4XZWA 1TWIA 1KGUA 3QW3A 1GOXA 2YL6A 2DY3A 1H09A 2Z7KA 3N19B 2IQ0A 1UA3A 3C52A 4UC5A 4GC3A 4L6OA 5EGRA 2ASHA 1VBUA 2I5QA 3YPIA 4DPQA 3EOOA 1EFZA 1AJ0A 3E02A 1JZ8A 1LLWA 4RCXA 3AZTA 3ITLA 3GTHA 4RDYA 2OEKA 3F5JA 2ALDA 4LUIA 3TX9A 2PTZA 2OCZA 3NIYA 3IK2A 1H1YA 1V3HA 1L9WA 1S5TA 1A3XA 1DVJA 2F2HA 2R1PA 1ZNNA 3FA3A 4QCEA 4FB7A 4R85A 3GDLA 1XV8A 1V7YA 1BQCA 1BPLB 2X7WA 2D2JA 1ZJIA 3W1QA 2A7RA 3QW4B 2CZFA 3PZMA 1HJSA 1SZGA 3H4GA 1KKOA 1A5LC 4NZ4A 3N2CA 5U4NA 2QYGA 3VC5A 2CW6A 5FF2A 3QGKC 3NM1A 4HPXA 3R11A 3EZ4A 1XKJA 1KXVA 4CD6A 5HATA 4CQ8A 1ECEA 1IQ8A 4DF0A 1W8GA 1E4MM 1RV8A 1RBAA 2YKKA 1UJPA 1L6YA 2XSXA 4TOQA 2QDHA 3T0CA 4LAOA 1XGEA 1LUCA 4DBEA 1Q6RA 4JDYA 2PPGA 3NQ8A 2I9EA 2V3FA 5I09A 2C0HA 4ZB0A 3U0HA 5BCAA 1B31A 4GNJA 5TNVA 4DVOA 1VJZA 3W7JA 8TIMA 2D24A 4KT2A 2VX5A 2BXZA 1D8CA 4G7FA 2Z29A 4ZSUA 1CGXA 2QF7A 4FHAA 4LYPA 2WCAA 3L4TA 4UIOA 3VDBA 1X6LA 4S3JA 2C19A 3UVAA 2FPYA 1Q4NX 3PAOA 3F4CA 5B7ZA 4IGMA 2V68A 4WRHA 2PZ0A 3P80A 1F4AA 2IKIA 3H55A 3LN3A 1E71M 2X2GA 3VTRA 3PULA 4JTCA 1UR0A 3B4UA 4H2HA 1QPOA 1IZKA 2DSKA 4OE7A 5AVHA 3ABXA 3EWCA 3M0VA 4FX7A 2VOMA 2Y0FA 3CUGA 4HU3A 4N9BA 1YTEA 4GJ1A 3CPRA 2RFGA 3BK0A 1AJ2A 1YYAA 3BMVA 2OFJA 1QBAA 1ICPA 1QW7A 3GLCA 5FCZA 4EANA 3GIPA 3CASA 2P76A 4N9DA 1SMAA 3MJYA 1YXYA 5H6HA 3TCSA 5HBFA 3B8TA 2H9AB 3AYSA 3FGCA 4IMCA 5DY3A 3WQPA 2CBUA 4LC6A 3WELA 3B03A 2BVYA 3REQB 4EXBA 5KZEA 4KW2A 2IXUA 4JQ2A 1V3KA 4IXXA 1U2YA 1E5NA 5M1TA 4NJKA 3LS9A 4JAWA 1XYAA 3FDKA 1W9PA 3DG7A 2ZRVA 3B8IA 2WMFA 3U2EA 3WQ8A 2BGQA 1C9WA 4LFYA 2D0FA 1ISVA 1XDMA 4PBFA 5K3VA 4RXFA 3VAVA 3M0YA 3E5PA 1VPXA 1RQBA 4WY0B 3PWIA 2A7NA 3AC0A 3JRKA 3LCIA 1XYFA 1IV8A 4KPLA 3HQPA 4MWAD 2QIWA 3LCWA 3CQIA 3TNBA 2FH8A 5CSYA 3STEA 2Y6ZA 1A5KC 4B16A 3R8HA 3NPUA 4JN6A 1NDVA 2YDAA 4E4UA 1P7TB 1NOFA 5J5RA 2A6LA 3GIQA 3AO0A 4HBKA 3BMXA 4C7GA 4AEEA 2QJHA 4Y9NA 3OOQA 3EEZA 3DENA 3W7CA 1F5ZA 4H8NA 4NXSA 3NQ7A 4CNPA 3CZEA 4MWAC 4AYSA 2W6RA 5BWFA 4K2SA 4IIFA 1FY6A 2PMQA 3RXZA 1GKQA 3GFXA 5DT7A 1L8NA 4AZCA 4LYKA 5D02A 1V3IA 2VC6A 3TYZA 4NASA 1IIGA 1O5KA 5CH9A 1GQJA 4H6EA 3VNKA 2WOQA 1ISXA 2YL8A 3W1XA 3WSUA 3HMJG 2B4GA 1R86A 2YCEA 4JIRA 3CIVA 3W2NA 1UASA 4AZBA 1HNYA 4Y9AA 4L1WA 1MFVA 4B5SA 3DESA 4AEFA 3LQLA 3UT0A 3NSMA 3L2IA 4J1OA 3TXZA 1OGSA 3KEHA 3C2FA 3UBPC 1HP4A 3AIUA 2J9YA 4NU7A 4NI3A 3QGAC 4Z2HA 3CH9A 3AISA 1B9BA 4N4QA 5CAHA 3WBWA 1W9VA 1JZ2A 5AB3A 1XHGA 1VJIA 5CC6A 3P84A 4DO6A 2GJRA 4B5XA 4RR4A 3ONCA 4PZVA 3UXAA 5D9OA 4OUIA 1XBXA 4M6VA 4WKAA 1UJQA 2E5CA 2XFFA 3IJ8A 4XD3A 1S5NA 1R9ZA 1FDYA 4AQLA 2NV9A 3WBXA 3AHZA 1EOKA 2ISSA 2GQ3A 3GH4A 3WG6A 4WF7A 1G6CA 1B4EA 2NUWA 4H41A 4S39A 2JFEX 3FDGA 1QVBA 2PI6A 1XIBA 3HG4A 3UZWA 4YYFA 3CHVA 5FF0A 2E3ZA 1OK6A 4QX4A 3UJ2A 4ZXLA 3VD3A 5C7HA 4MJ4A 4IOTA 1VCFA 4PTMA 2ZUUA 5G2WA 1VKFA 1WPCA 4E3TA 1DV7A 2FHCA 1EP1A 3WQCA 3G1YA 4EPEC 4O57A 4PUUA 4TU1A 4GZEA 3AI0A 3BSGA 3WZ0E 4DZAA 3ZOAA 3VGDA 3NZGA 5A2BA 2PDFA 5C9XA 3Q58A 3EOEA 4JTAA 3MP4A 2BB0A 3V4BA 1JRBA 3KLKA 3QHMA 3W70A 3USZA 2XIOA 2E77A 1HTIA 3PZQA 4JCLA 1QI5A 2ISDA 4FNTA 2G95A 4ZO7A 1IYXA 2G97A 3WMLA 1CZ1A 3IJIA 3T81A 1VC4A 4L4OA 2ZZ3A 3TYEA 1TG7A 1KFCA 1HJWA 4C65A 2ALRA 2YDSA 4GI4A 4EE9A 1Y7VA 3B9OA 1KC7A 3VVGA 1OIMA 4D8AA 4ORMA 2OTDA 1CXLA 5FA5A 4I5RA 3EX1A 3KM8A 4EIVA 1M5WA 3IRSA 2Z6IA 1SO3A 1VYRA 4N7QA 4J3UA 3WDJA 4GUJA 3CQJA 4CCCA 2Z25A 3FGCB 4QJ3B 5I3HA 1H3GA 2DH3A 1K7FA 3WLIA 5BRQA 1FOBA 4AVOA 4W8LA 2WANA 3RRXA 1NSJA 2BVTA 5LXXA 4CCEA 5CKSA 5BU9A 2FFCA 3CM4A 1DBTA 4HU8A 3DKLA 2CBJA 2WPBA 3K4DA 4KWUA 4XD5A 3WQOA 4BI6A 4NZ3A 1POKA 4W87A 2CLIA 2JF7A 3PUGA 3RCNA 2VURA 3A3HA 1MW3A 4R34A 4I8DA 1JUKA 4Q4RA 2WSKA 4W4QA 1OG6A 2G96A 3TJXA 1GVQA 1HVXA 4M1RA 5FD0A 1VH7A 2BWGA 1YE4A 5FJIA 5AHNA 3T9PA 1E15A 3VIFA 1XD0A 1T8QA 2L5HA 4M7SA 4PBGA 5FOOA 1NFBA 3OBAA 1H2JA 4TX9A 5I77A 3W75A 5IHRA 2E8ZA 3SN0A 4JTDA 2VL4A 1DXEA 3GDBA 2WK2A 1XCWA 3L0NA 2ISVA 3UG3A 3TVAA 3EBVA 1JYNA 2D2GA 5E09A 1HO4A 3HU7A 2Q3RA 4XUGA 4RNFA 2OSXA 5A6KA 5PTDA 1H50A 2J78A 4ZENA 3RF9A 5T91A 4A2RA 2XVLA 2H6RA 3C2EA 4RZ5A 2ZOXA 2DW6A 3N1AA 1GTHA 4CNTA 2PDGA 4HN8A 1SJBA 3I7SA 4PTXA 2V5LA 4LAZA 3AMDA 3SB0A 4YTUA 1LYXA 1QHZA 2WLZA 1TWSA 2C1HA 2O7SA 1V6TA 1FH7A 5I3KA 1OX5A 3JZEA 1VRDA 3WJSA 3P6LA 4C1NB 2NUXA 3L4XA 1UD5A 3TJ4A 3MA8A 1E6ZA 3CMJA 1OCNA 1DYSA 3UWVA 3G5EA 2P88A 4QITA 9XIMA 2HEJA 3QV9A 4YWIA 1UUMA 4O1BA 4H9MA 1YPXA 4X61A 3LRMA 3T6CA 2YL9A 1AZ2A 2NZLA 3BH4A 3TN3A 2XISA 3VKCA 1WUEA 1FXPA 2QGHA 2E09A 4GMEA 3WQGA 3GBDA 5D2WA 3H2NA 1E9LA 4MWAB 1QNVA 3IIVA 3UWZA 1Q2RA 5JBEA 3BLDA 3SQSA 2UY3A 2XN1A 1KM1A 3MSYA 4HZMA 3BICA 4NXKA 4BI5A 2HPMA 3MMWA 3IS4A 5M03A 1R87A 4B5UA 2HVNA 3H6OA 3V5OA 3RJXA 3RM8A 1J18A 4KCUA 1TSIA 3WQWA 1ONEA 3W7NA 2Z1SA 4LY8A 2PFHA 3CXOA 4ZXOA 3WL1A 4PGLA 2R1KA 3KUMA 1KBJA 3FVMA 3RITA 1JYXA 3CHFA 2HZGA 4S3FA 3TNOA 8A3HA 1TREA 4HN4A 2OO0A 5LNUA 2BSLA 2X42A 2BY0A 3BPWA 4PBEA 5B80A 1VCGA 2GFTA 1E3ZA 3FYPA 4B9YA 4YCPA 1E9YB 3TKFA 1UOKA 3R1ZA 2X30A 3W53A 3T4CA 1Y5XA 3VFLA 4QAWA 2PDWA 3GXDA 4L5ZA 2RKXA 2DZTA 3MHGA 3E0FA 1VBHA 5HJLA 1JDDA 2KZHA 1YTDA 2YXXA 5LIKX 3UA4A 4XVEA 5EBUA 1UD4A 5AC6A 1UD8A 4WJEA 2Z1VA 4FX8A 4CNUA 4S3EA 3E6EA 1Q6QA 4KEZA 1US0A 1JDAA 4FOUA 2WJFA 4S3KA 1S2UA 5DCDA 3BANA 3FYOA 1LCOA 2RDXA 1XXXA 2EKCA 2JEPA 1WNOA 4GBUA 4TR9A 1W1IE 3A13A 5BXSA 2D1ZA 1ONWA 4QCFA 2FH6A 4RE0A 1K03A 2ZRXA 3TOYA 1SJCA 2AL2A 4BKNA 4PMVA 3WFZA 2Y1HA 1XC4A 3ME3A 4GY0A 3T55A 3PTMA 4ZVJA 2VX4A 5DBTA 2ATSA 2QV4A 2G8ZA 2E67A 3L23A 4RLIA 5BOEA 3NVDA 4QLJA 2NT1A 2OG9A 1PHQA 3W4RA 1A5CA 5EFFA 3RMEA 3AHTA 4E4FA 3VD5A 1FQ0A 2VDHA 1UP3A 3DH7A 6XIAA 4FXFA 4XAYA 3EMQA 3SI9A 2JEQA 1QT1A 3WUGA 4FLSA 1CGUA 1J96A 1X8CA 3P3BA 1JDEA 1W5PA 4QNEA 4HMEA 3CAQA 9XIAA 4UTKA 4H8HA 1OY0A 2R94A 4W8AA 3PTDA 1QWKA 4ADSA 1YNQA 1GW9A 2D20A 4NNBA 1UD2A 3BOFA 3C0SA 5AECA 1K6AA 1L6SA 2EG6A 3RLGA 5JIWA 4J3VA 2QUMA 1PSCA 3NWRA 1J0KA 3I6EA 2PTXA 2YL5A 4HNLA 4YTSA 1KBLA 3W7PA 2WSQA 4AZ7A 5AN7A 1LDCA 5AZ0A 3WO8A 5C5YA 3VE7A 4BF9A 2HXUA 4D2JA 3WYZA 3FAWA 3OLDA 2QXWA 4UWMA 2NVDA 2VEIA 3W7RA 2C15A 4JYDA 4XBKA 1W2PA 5AC8A 2DT0A 3WJYA 2CESA 1V79A 1TFVA 3SADA 1E1FA 3VX1A 2ODOA 3TSDA 3M47A 4N6EA 5CGQA 5CPQA 3L0KA 3MUIA 1DWFM 4Q8QA 3ZQ9A 4NVTA 3WLRA 4G1NA 1N8WA 2FB2A 3ANUA 1BG4A 4MY1A 3BQ6A 4NNAA 2VC5A 1CGTA 2ISWA 1DWGM 1IT0A 1PO9A 5HANA 5D04C 3P81A 3O6CA 2ZE0A 4HT3A 4DBWA 3BQ5A 2NX3A 2OJPA 2CNCA 3M41A 2VWTA 3R58A 1Q6DA 2WCGA 3BW3A 2QAPA 1Q66A 1VBJA 4M6UA 3QVQA 3WQFA 2NQHA 2BDQA 1FA2A 3BLIA 3Q2DA 1XJBA 1M7PA 4C6PA 2E0PA 2AMGA 2WYSA 3PJTA 5HMFA 2PDBA 3ZJ8A 3EDDA 4LVGA 3LPPA 4JS3A 1P0BA 2PDIA 4KBXA 4PCSA 4HHLA 3MB9A 3IGUA 3DFYA 3QKEA 3GXFA 4IMFA 3S9IA 2DVXA 3OHIA 2DPEA 3MUAA 1OC6A 5EMUA 4E2VA 3FA5A 1JR1A 3WDHA 3EWZA 1K9FA 3WNNA 2DEPA 4B3KA 3E2QA 5LA0A 3BLOA 2XH0A 4AWTA 2W5FA 4P7LA 2FMNA 1OYCA 1ZGDA 5KINA 4ZTXA 4H8VA 1Q65A 1KRBC 2VUNA 4X2RA 3VM7A 1RA5A 3NYDA 2WJZA 1I6NA 3AHXA 4PUEA 1I2NA 2HXTA 3ARRA 2GYIA 1B3YA 1C93A 3GFZA 1TX0A 1QO5A 3CAWA 3G0UA 5AVNA 2W61A 1DJGA 3M16A 3GVRA 1P43A 3LRKA 1DQUA 1XUUA 4M81A 3RX2A 2MNRA 2J9XA 1ZBWA 4GJIA 1QCWA 1DJZA 3C0JA 1KV8A 1ZBVA 3T8LA 3GM8A 2I5IA 2HBVA 3VOCA 1J0YA 1T0OA 4U3AA 4B5NA 3UXLA 4G5DA 5CZSA 4UQDA 1JEZA 4K8HA 5FSDC 5EU9A 3V7PA 2W27A 1NM9A 2QCNA 1B3XA 3GU2A 4UTFA 1XLDA 4K7VA 3NXFA 3SRKA 4D8ZA 2PDNA 1MNZA 1EH9A 3M0MA 3TTOA 2WWDA 3NAVA 4M0XA 2LLEA 3K46A 1KQZA 2IPFA 4IUOA 1TMQA 4KF1A 1SM9A 4PL1A 4ZE4A 4F66A 3USBA 1CCWB 3UJEA 3VNDA 3KW3A 1A4LA 4OQVA 4EK7A 1E5JA 4XKMA 3VO0A 1LQ0A 4ZE5A 4UTJA 3AS0A 1EQPA 1H5YA 1EHNA 1UR2A 1KBBA 4C90A 2XG9A 4DQWA 3D3AA 1CLVA 1BF6A 2CU0A 4UTWC 3I10A 1BHGA 1KRMA 5C2GA 4YXGA 2Z4GA 3GVVA 1QNSA 3SCTA 4PUJA 1W3KA 3DFTA 3OW1A 1TVLA 3W73A 2WZMA 1LRNA 1Z42A 1E1CB 1YEYA 5JVLA 2I14A 5EYWA 5A6LA 2HVOA 3O0KA 3I4EA 5A6TC 1GOOA 3L4UA 2ADAA 1TUXA 4R33A 4E8GA 1XICA 1BYDA 1EC7A 3VKAA 1WOBA 4JTEA 1TPB1 5CCZA 4AC7C 2BGNE 3TAKA 1JGIA 4JD4A 4U10A 1GGOA 3AZSA 1JCXA 1GVYA 3TA9A 1KM2A 4O17A 3WD0A 1ISYA 5T8GA 1Z8AA 2BOGX 2FYMA 5G2IA 1CECA 3MSRA 4R7WA 1FWBC 3RRAA 1WB0A 1OFQA 3NSNA 4GPNA 3GSMA 3RLVA 4MJ2A 1U33A 2PF0A 1K4GA 4D6EA 2PE4A 3CTLA 1A5OC 3UETA 3VYLA 3UERA 2E8YA 3GC2A 4BWLC 4JYEA 4MHBA 1MVYA 3VIJA 3S6OA 1QJWA 3S5YA 4JX4A 2I16A 1F6PA 5DCBA 5LIWX 5A6JA 4JFUA 1GQNA 4AZ6A 5BOFA 1BEUA 1EC8A 5KITA 4CKQA 3WF0A 1N7KA 2OQYA 5BU6A 1BRLB 2ZC8A 4Q8VA 4Q6JA 3UPMA 1VB9A 1A47A 2ZTKA 3NGFA 3WENA 4UOZA 2ZXQA 3FW6A 1QAPA 4JTGA 4UTLA 2XSBA 3OVRA 1CIUA 1XG4A 5BW6A 1UZ4A 3MC5A 3SO7A 3KLLA 3L21A 1NARA 3I65A 1PYMA 2DU2A 2Z2UA 3V3WA 3AUJA 3P93A 2Y63A 2Z00A 4P8VA 3NFUA 3PZVA 3L5MA 4XSLA 3BAWA 3ANVA 3FOKA 3GTXA 3ZR5A 3GHSA 1CDGA 3IACA 4IIGA 2EXOA 4C6QA 4F40A 3NSXA 1EX5A 4FEZA 1SW7A 3N9RA 1FH9A 4KERA 1UIPA 3A4XA 4BQ2A 4O18A 1NY1A 1EPVA 3M1ZA 3TTEA 3SCPA 3H7RA 4Z0JA 3B8DA 1W9BM 1J0HA 5ABFA 1H0GA 4LPCA 3OP2A 2I57A 4QNWA 3B40A 3AXIA 1ZY9A 5E93A 1O94A 1QUMA 2PAJA 2YOCA 3GBEA 1U5HA 1OQFA 3E3HA 4LUTB 1EXBA 1GQLA 1HJVA 1LZOA 5JUVA 5E0CA 4UOJA 1I45A 4GQQA 4MIMA 4AAJA 1WDQA 2REQB 2DSZA 4L4MA 3E38A 2DVUA 2W67A 4U3CA 3LA4A 1OX4A 3E0IA 1RK6A 1NFGA 5E9XA 1KBIA 2XDFA 4I7WA 2VEMA 3H54A 1DIDA 2J6XA 1MEIA 4GY7A 3CH0A 3MMUA 1DIEA 3BG5A 4MY8A 5HJXA 3RUBL 3WJWA 1F3XA 3NZRA 2FQIA 3RCYA 1QRQA 3LHYA 5E5CA 1W17A 1IEIA 1GVFA 4AXNA 4HTBA 4LTSA 1GUVA 1XRVA 4XKYA 1YBQA 3A5VA 1HKIA 5KSWA 1HG3A 2W62A 1FWNA 1RR2A 4E2BA 3H70A 1EC9A 4TO8A 1P0KA 3THCA 3WQDA 1CB7B 7REQA 3TONA 2OEJA 3M0XA 4AIOA 3SQMA 4D6FA 1OIFA 2F38A 5D09A 3WLHA 2VR5A 1DJXA 3ARSA 4JCMA 4O19A 1XP3A 1P1XA 3KBNA 4HMDA 1P4CA 1SQ7A 4LANA 3LPFA 4N4PA 2QUUA 2FFIA 2GOKA 3O16A 4X0VA 1BF2A 1VEMA 4PMXA 1HKKA 4WKHA 2PDLA 4RJEA 1E9ZB 1LM1A 3NQEA 1C91A 5CC5A 1PX4A 5DEZA 4B4HA 2C0AA 4O8AA 4WDTA 1ESWA 1RY0A 1DJYA 3SCUA 3V18A 2V30A 4XZ9A 3BOLA 3RO6A 2ZWZA 3A21A 2PU0A 4OGZA 2VFEA 2OLHA 1DHKA 3SURA 4TVUA 3OQ8A 5T9BG 5I79A 3UXIA 3AHYA 5HUPA 2ZZ4A 3ARUA 4QJ1A 1F05A 1S3TC 4XZBA 3C2OA 4DNMA 1XPYA 2VR4A 4UFHA 1H63A 1H7WA 4CN4A 1VPQA 3QFWA 2FZNA 2OEMA 1WZMA 5HR6A 4O53A 2E6YA 2Q71A 6REQB 2X1IA 4OOUA 2VD9A 5CPNA 3RNDA 3W76A 1ZENA 4H6RA 1YPFA 4AF0A 1VLIA 1PZ3A 1XX1A 2DORA 3M43A 1K70A 2W63A 4B5WA 2Y5JA 3PC0A 2TYSA 4HQVA 4N02A 3E2VA 3UJRA 3BAXA 1CXKA 3URNA 3K4WA 2GJXA 4LB4A 3G8EA 2VFIA 3WIJA 3PBGA 3CUXA 2CFFA 4KS0A 1R0MA 3DFOA 1U5VA 2DIKA 3RJYA 1R47A 5FJTA 2TSYA 2ZX6A 3DAQA 1H61A 2R8WA 1W1B1 2XIQA 2E68A 1MO0A 5LIUX 5AYXA 4L1GA 2OWCA 1A3WA 3B9AA 3M64A 4ML4A 5DBUA 1GQIA 4QS6A 1VCVA 4GOAA 3E2SA 1UP0A 1Q6OA 2BFGA 1BWLA 4V2XA 3A24A 3GG1A 3PUEA 2HE5A 3STPA 3M5YA 4X3ZA 2DZPA 1WDRA 1C3FA 1XLIA 1YTKA 2XWDA 3POHA 1NDZA 4IT1A 2JIWA 3CV6A 2VFDA 4C91A 1B30A 3TW6A 3DC0A 3GKFA 1G01A 3LM3A 3IPWA 2BS9A 1JL8A 2ACSA 2CWNA 5LSMA 1J11A 4GRSA 4L56A 1G4PA 4TV5A 3KOWA 3CB8A 2QCGA 2YIHA 1F3EA 1XGDA 3E5BA 4FMVA 5DRIA 1GZGA 1G9HA 2NQZA 4HZ7A 4IIBA 4UCGA 2WSYA 4O0QA 3VOHA 2E1WA 3GC4A 2ZDRA 1GOIA 1FWHC 3GDMA 2AAMA 3K8LA 3SCWA 1SJAA 3IARA 3GR4A 1DJIA 3AXMA 3QKZA 4QP0A 2GK1B 1W1YA 3FLUA 3ZLFA 1VFUA 3FY1A 1YADA 2CLFA 3IGXA 2XM2A 1GQKA 4DWSA 2PTDA 4PODA 4YYCA 4YPJA 1A49A 4YN5A 1V93A 2WAGA 3NPWA 4FLRA 2PDXA 3TCEA 3APYA 1RXOB 1T5AA 1EA0A 1SFLA 1YLVA 4C6DA 5JQ9A 3UESA 3KP1A 1IWBA 2INFA 1JDFA 3IAPA 4LRTA 1E9IA 1RAKA 2QGYA 3L66A 4EAYA 5FSEC 3VGEA 5HMSA 7A3HA 2ZZ1A 1DPMA 2HNEA 4PB5A 2ZYFA 2CETA 1BYCA 4AZGA 4NKCA 1OINA 1QMLA 1L8PA 2V5DA 4GNVA 3U2CA 1X38A 1J6PA 1ZS2A 2ACQA 2X05A 1E72M 1OT2A 3UZXA 1R8LA 3HPSA 1O12A 1KTNA 2P8BA 3TN5A 3CWNA 4JFTA 4O0KA 3BLLA 2WHKA 3S9YA 4LV4A 3WLSA 3PZ9A 1QHPA 1EZ2A 1EZWA 3FAXA 1ZCOA 2FHBA 3P8IA 5I3JA 3TYAA 3UZ5A 1Z32X 3R7MA 2JBMA 3QR3A 2VZVA 1TX2A 2BHYA 3AROA 5CAKA 2B7PA 3P7YA 4DM2A 5A8QA 4NZJA 3G1SA 2UBPC 4A4AA 4JTHA 4BEUA 1H5VA 4RUBA 1WDSA 1POJA 1YDOA 3WUBA 1C90A 3PB0A 1V77A 1TQXA 3L67A 3AXXA 5BRBA 3K5XA 1H49A 2J7BA 2FPTA 4RDWA 2WMHA 3H2FA 4GVIA 3U5YA 3AQUA 4K39A 1DOSA 5E6ZA 2V5BA 3C2RA 8RUCA 1LLZA 3P61A 4H19A 1RQHA 6ENLA 1TV4A 2J27A 4HNOA 2RDTA 3N11A 3VPLA 1H11A 2ZRUA 2WQPA 2RJHA 1ZUAX 1UUOA 1YKWA 1ITQA 2F9RA 3LDVA 3CUHA 3W2MA 1GVSA 4MM1A 4QG8A 3TC7A 3R79A 3O1NA 3QV6A 2IKGA 4Y96A 4ES4A 1LBFA 4N9EA 2G41A 1TCMA 4C7FA 4DJEC 1VLWA 4Z0SA 4XZLX 1TRDA 5KZDA 3S5OA 3N3MA 4H9UA 3DBNA 2ZIDA 3HBLA 3ES8A 4HCLA 4QSHA 4Y8EA 4Z1BA 4G1KA 2Z1XA 1NH6A 3QPZA 4S3CA 4UCFA 4XAGA 3MKKA 4CD4A 1UWQA 5HQEA 1TV5A 1BVZA 2NUYA 4H01A 4QDWA 3QBUA 4K7YA 3D6NA 3AOFA 2OYLA 1KXHA 2CERA 3DUGA 5G4HC 1HFBA 4JQAA 4Q7BA 1F2JA 3OA3A 4S3AA 4JXCA 4GGBA 4GXWA 3T09A 3H2EA 5BWAA 3PS7A 2ZX5A 3KRSA 4CCZA 1FKWA 2OVLA 4GIEA 3W29A 3RO8A 2TODA 4MUZA 1GK8A 3FXGA 2DZUA 4OFCA 3M0ZA 1WKDA 1QI2A 3INPA 4FNQA 1S2VA 4CLMA 1O1ZA 3UF9A 4CU7A 4IICA 4MB3A 1BVWA 3NDZA 1AA1B 3CK5A 1EJTC 1GJWA 4O15A 4HNUA 4RE2A 3S1WA 4OJYA 4BY3A 4FP1A 4DY1A 4DN1A 1BWVA 4HCHA 4IFRA 3MV01 1JYVA 4RW3A 4X9SA 2QJMA 3AXKA 4LNYA 4D6GA 5DRCA 3RK8A 1NIUA 1O7AA 2QUNA 5LGZA 4JKKA 4YJ5A 1LJYA 1X6NA 3URBA 5A6BD 2JK2A 2KX9A 2I7GA 4UR7A 4GUFA 2CITA 1S2WA 3WDRA 2GVJA 3CEPA 1Q63A 4ZQOA 3QM3A 3HZ3A 1W5MA 4LWWA 4DZ5A 1ZU8A 1EJXC 1DWJM 1ZAIA 4DWSC 1FHUA 3I68A 1XLAA 4HCDA 3GY1A 1IF2A 4OTKA 3WKZA 4A8IA 5D05A 1HT6A 3PZUA 2D2HA 2UY2A 1XYBA 4FSAA 1SR9A 1H1ZA 1DJWA 1UC5A 2O7QA 4I9JA 2B31A 4M7TA 4QTGA 1XIEA 3FN9A 2GSHA 1A50A 2OGJA 2VI0A 1MUWA 4DLMA 4PH6A 1NWSA 1LF1A 4YWSA 4MKNA 1W3JA 1NU5A 2CYGA 2RJGA 1X97A 2WHMA 3NZQA 2FDMA 4KEVA 1S1RA 1G67A 2FTPA 1TE6A 5A8OA 3W23A 2R14A 1UPPA 2O4QA 3XIMA 5H8UA 3WUFA 4G6CA 2FVMA 3LHZA 5LXEA 2F84A 2PLJA 4Q4KA 4E4PA 4KCWA 2WZHA 4JDBA 2RH9A 5FJUA 4F2BA 2Y7GA 2GPTA 3CUJA 1KW1A 3MI6A 2GWGA 4HMNA 5G1YA 4O4VA 2WSRA 4PCTA 1ONXA 1G0CA 1KWGA 2E1DA 4J9JA 1PUDA 2Y8KA 1W5QA 2Z6JA 4LCSA 4D6HA 1TCDA 3GKAA 2AGKA 3S1VA 5DQPA 2ZUNA 3QV8A 5TD4A 3PPHA 4MNKA 3WBAA 5IDIA 3PNUA 5T26A 1RZMA 4JHZA 4XIMA 3PZGA 3W37A 4XD6A 2D69A 3PFRA 2OZ8A 1M1BA 1IXOA 4WCJA 1XLEA 3U2OA 4MDOA 3I7RA 4LRSA 4L80A 2PRLA 1AD1A 1K7XA 4Z2IA 1FP8A 1HW6A 4MNMA 1Q6LA 1DE6A 2QHAA 1PV8A 1X1ZA 5F2IA 4OUEA 1XH2A 3U9IA 3CIXA 5B7YA 1U5JA 3OEXA 5EMMA 3W7GA 2XIIA 4N42A 4LBSA 2Z1BA 1I4NA 3DU0A 1GKRA 2GSEA 4IPLA 4UTMA 1W5NA 3L0GA 5DN1A 1OD8A 3NYZA 2VCAA 4Q7IA 1AL8A 1W32A 3KZPA 1QPQA 1TE1A 2J13A 2VOTA 3UR7A 3LCLA 3UZYA 1JXJA 3IK4A 2OOGA 2UWFA 2MUCA 2PWUA 1R85A 2FZ8A 1ZTVA 5FF7A 4L61A 2ZUTA 4IIEA 5FJJA 2Y8VA 5AC4A 3UWYA 5G4EA 1J0ZA 5MHBA 1HP5A 3IJ9A 2ZVIA 3MU7A 4JIIX 3LTYA 4NSBA 1MRQA 2IPJA 3DFQA 4L6DA 2W9MA 3DFNA 3CUZA 1OZMA 1TMHA 1ZRQA 1QK2A 2VNCA 1UZHA 6REQA 3FSUA 2EO7A 4X2PA 3VM5A 3N3TA 3BMWA 5DCEA 4JL1A 3KCOA 3EYPA 4PB4A 2BTMA 1LORA 1EIBA 4ZA0A 4LYQA 2J7CA 4WIWA 2QPUA 4E8CA 2A3AA 2YBVA 1PIIA 1UUQA 3M07A 1OCBA 3T1GA 1M04A 1E1CA 3LV6A 4MZ1A 3UFYA 4AVNA 1CXIA 1FBAA 2BBFA 2DDXA 3B4YA 2VM8A 3CQ0A 2ZUSA 2Y24A 1FFRA 3ELFA 2YBTA 1IXQA 4OU1A 4AB4A 1TTQA 4O54A 5C70A 4MYXA 4BF7A 4GX9A 2YR1A 4Z1DA 4XAZA 1Q85A 3BAIA 1W31A 5LHFA 1VS1A 4CD7A 3BAKA 1T99A 1F3TA 1UKQA 1KCLA 1QFEA 2Y7DA 4J3ZA 2BXVA 2PP3A 4ZQCA 4QEHA 3WLMA 5I06A 1PX3A 4BQ5A 2NQ5A 2CZEA 2QEZA 5HWMA 4AMAA 1DJHA 4UTTA 3MUZ1 3CHEA 4S2CA 4LT9A 4I9TA 1K8ZA 4PTVA 3EGJA 4C60A 4MJMA 2ANUA 3ZT7A 4W85A 1MRAA 4IL0A 3PG8A 3W1PA 1WCGA 3CV1A 1V5XA 4GGHA 3SFKA 1RUSA 2PC8A 3FCPA 1PS9A 3CEUA 3QLDA 1HF6A 5DT5A 1I0BA 4NF7A 4C6NA 3DGBA 5D2YA 4ERIA 3ONBA 3BW4A 3BG9A 2FGBA 1KKRA 2J47A 2C91A 2GVGA 2PGWA 4KGJA 4UFJA 4CNNA 3AMKA 2X1RA 1EF3A 5I03A 3AJ7A 3KFTA 1PHWA 4HMCA 4O13A 6PTDA 2XFRA 3G0SA 4QHRA 4MPKA 4BWLA 1TQJA 4IP7A 2PWHA 3EX6A 3EPOA 4GC4A 3N34A 3WN6A 5AYBA 3RN6A 3CUIA 3NQFA 3ARQA 4ACZB 2YLLA 3R0DA 4DBDA 1BRLA 2IPWA 1JJKA 5CGTA 3SFWA 3OQEA 2C13A 5E0KA 3UG5A 5IFTA 1UCWA 1FHLA 3OBKA 3HGJA 4AHQA 5HA7A 4JOMA 3KL5A 1VEOA 3TIMA 2P53A 2GL5A 4YCOA 5F1UA 4CN1A 4C7DA 4UZSA 5D2TA 1WZLA 5F2LA 4GY1A 1UWUA 3R8GA 1W3LA 4LUSB 2OLSA 3PWGA 3WD3A 1PIGA 5JIPA 4ZQPA 1UKSA 4O10A 4S3BA 2REQA 3UYIA 3II1A 3B04A 2G3IA 1QXLA 4Y2WA 3TC3A 2V69A 1LWHA 2GOUA 2YPIA 3OA5A 3OLGA 4IMDA 3W7DA 3PBUA 4K3ZA 2DUZA 3BXWA 5C54A 3WDIA 1RP8A 2J88A 3R13A 1F8IA 2D3NA 3W3OA 4LEFA 3RPMA 3M5VA 4BEQA 1S39A 3W1TA 1IT7A 1K7EA 1JGMA 3RU6A 3ZT6A 2VT0A 3EX4A 4RDZA 3WQ5A 4ZO8A 1CEOA 5BXPA 2WBKA 1OHLA 1WBJA 3U57A 3VDHA 2POZA 4UFMA 4FNPA 4AZ5A 2GVLA 3CS2A 3QHOA 3ZMRA 3W01A 2FJKA 2DSUA 1H0IA 1RLCL 3ZFHA 1SZRA 1FKXA 3O63A 3NZ1A 2VDGA 2CHOA 2OPJA 4L6HA 1NWUA 1EO7A 2YCIX 2WQDA 2V6AA 3BARA 1OFEA 4LVFA 4Y8FA 1TPEA 1RBOB 3MSDA 1UKPA 3MHUA 3O6DA 3MCNA 2DFAA 3ZWSA 1XI3A 3AMLA 4QE4A 4W8BA 3B0VC 3KCJA 3SY5A 2P1FA 4YMZA 4GVHA 1PTGA 1GHSA 1XS2A 3IVSA 3PPGA 2VZTA 5IOBA 4ALDA 1AQFA 1XR2A 1V02E 2XTKA 1KXQA 3STGA 1ODUA 4HKPA 1OFBA 1KB3A 7REQB 3A4JA 2XUCA 4MVAA 3LLFA 3R2GA 4ICCX 1EOMA 1ZJHA 3RLUA 4JHOA 2NQLA 4AEOA 2X09A 4AX7A 5FL0A 4GZJA 3WDPP 2BVDA 1LOSA 2A3BA 1TPDA 2VFGA 5CPSA 5CPOA 3SDOA 3VNJA 4O1FA 4A8LA 4HNCA 4HP5A 1W37A 3CPUA 1R3QA 4F9JA 1EWEA 3VGGA 3VOJA 2F7FA 3RFAA 5HR7A 4PMJA 3APTA 3GWQA 3U3HA 3R94A 2YYTA 4TTGA 4WOZA 3ITXA 4HZ6A 1ME8A 1EB3A 1T6MA 1TPUA 7ODCA 3PPCA 1E70M 4DUXA 4P8WA 4ADUA 3N6QA 3H24A 1UKOA 4L65A 1UR4A 1VIWA 4IM4A 1AJZA 4PUKA 2E6FA 1JPIA 1HL9A 1TB3A 1S38A 3NQBA 4GQRA 3MSGA 3KWXA 1X39A 2O55A 3MDUA 4NL1A 2Q8XA 2W66A 4DZIA 4KFNA 3NDYA 4AD4A 6TAAA 4NJIA 1E6PA 5BXRA 1Q13A 4QG9A 4MDPA 1THFD