4AY8A

Semet-derivative of a methyltransferase from m. mazei
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
340
structure length
339
Chain Sequence
DMSEFTLKTRLLAALKGEPVDKVPVCSVTQTGIVELMDVVGAPWPEAHTNPELMAKLALANHELSGLEAVRLPYLTVLVEAMGCEINMGTKNRQPSVTGHPYPKDLEGAAVPADLLQRGRIPVVLEAIKIIREKVGPDVPIVGGMEGPVTVASDLVSVKSFMKWSIKKTDLLEQALDIATEASIIYANAMVEAGADVIAIADPVASPDLMSPDSFRQFLKSRLQKFASSVNSVTVLHICGNVNPILSDMADCGFEGLSVEEKIGSAKKGKEVIGTRARLVGNVSSPFTLLPGPVDKIKAEAKEALEGGIDVLAPGCGIAPMTPLENVKALVAARDEFYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords METHYLCOBALAMIN\: COENZYME M METHYLTRANSFERASE
publication title Structure of the Corrinoid:Coenzyme M Methyltransferase Mtaa from Methanosarcina Mazei
pubmed doi rcsb
source organism Methanosarcina mazei
total genus 117
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.1.1.247: [Methyl-Co(III) methylamine-specific corrinoid protein]:coenzyme M
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 4ay8A00
1R3RA 1U1JA 1R3TA 1J93A 1XDJA 3PPGA 1JPHA 4L6OA 1XR2A 1R3YA 4EXQA 2Q6ZA 1R3WA 3T0CA 3GW3A 1R3SA 4AY8A 2Q71A 3PPHA 1U1UA 3GVRA 1UROA 1YPXA 3PPFA 4L64A 3GVWA 3BQ5A 2EJAA 3L7RA 1R3VA 4L5ZA 4L6HA 4ZR8A 4AY7A 2NQ5A 3GVQA 4QQUA 1JPIA 3GW0A 4L61A 3RPDA 3PPCA 1U22A 4ZTXA 1T7LA 4WSHA 3BQ6A 1R3QA 4ZTYA 1XPGA 2INFA 1U1HA 3CYVA 4L65A 3GVVA 1JPKA
chains in the Genus database with same CATH superfamily
3MCMA 2CZ5A 2YL9A 4Y9NA 2QW5A 2R6OA 3N19B 3O3RA 1OC5A 2DVTA 2P10A 1JQXA 3CGTA 2YXGA 3GHSA 4KCWA 1LT8A 2GDVA 3GB6A 3IJ8A 1FOBA 1O95A 4UXDA 5DELA 3F2BA 2V38A 1A5CA 1E6NA 1TX2A 1UD4A 4AVFA 4E6MA 3QRHA 2GQ3A 3UG4A 2WMIB 1D3GA 1E55A 4R5EA 1LQ2A 1QHOA 1W9UA 2VTFA 3CZKA 4POCA 1RA0A 3G1HA 3P0WA 3O6CA 4ZQRA 4R9XA 1M6JA 1V93A 4CQCA 2PWFA 2GGGA 1BXNA 5D2YA 3U3HA 2PWHA 4PEEA 3W23A 5AVNA 2XM1A 3MSGA 1VIWA 3BLFA 1IXNA 1Q6DA 2EF9A 1MNSA 5CZ0A 2BX7A 1OT1A 3EMQA 2VZVA 4IX2A 3WQEA 1F07A 4BZYA 3HO8A 2C14A 1UD6A 1XL9A 4S2CA 2JBMA 3LB0A 2FGBA 3NL2A 4AIBA 1K7EA 1RVGA 2NVAA 3UVIA 5DBTA 4EWND 3O63A 1R7AA 5LIWX 1R3RA 1J93A 1E0UA 1PVNA 1PCWA 4MJ2A 5HUPA 1GHSA 3H7RA 3WFZA 3TTSA 4ICCX 4HNTA 1W3HA 1SZEA 4FOUA 3IVSA 1VRDA 4FNRA 5IBXA 3T7VA 3NQ7A 5ECVA 1Z89A 3MP5A 3B9NA 1TTIA 2VQUA 1Y5WA 3GTFA 4Q3MA 4XBSA 5HMDA 1SU5A 2YYTA 5C2XA 2WKLA 5K7JA 1UBSA 3IIXA 1SR0A 5D37A 3T07A 5C0QA 1YDOA 2O4MA 2GJRA 3GZ3A 3UZYA 5HPCA 3T8LA 2DSWA 1EUNA 3N6QA 1V6XA 1F76A 4LF2A 2ALDA 1LORA 1OG0A 2ZXQA 3E5BA 4I5XA 1ZJAA 3V0UA 2VCCA 1OIFA 3GDBA 5HWJA 3WF2A 7TIMA 2WSPA 5FJUA 3NGJA 4L6HA 1C29A 3WF1A 5KZEA 4JNYA 4PRWA 1GK8A 4OQVA 3B4YA 2GDQA 5A6TC 5CBBA 4DZHA 4F40A 2FZ8A 3M0ZA 1CNVA 4L4LA 4J3WA 4B5XA 1XR2A 4ZODA 2QXWA 5FKYA 3W7CA 5D30A 1K77A 3GC4A 4PMNA 3HPAA 5A69A 3VNDA 4DAIA 5FACA 4F9JA 5A3HA 1TREA 2JIEA 2WHMA 4JQ3A 3WF0A 1OYBA 4MUZA 4NZFA 5HNUA 5CLWA 3CZGA 1A47A 3EAUA 5CGTA 1X1NA 2EPKX 2ACQA 4G9PA 3GNRA 5FSEC 4KEZA 3VE7A 2IPFA 4MJZA 3B06A 5CAHA 4UOQA 3EOEA 4QG9A 2QJMA 2C6QA 1E40A 3NZPA 1FCBA 1SFSA 4PMOA 1Z32X 4KIEA 1W2PA 1UJPA 3IARA 3O9NA 4C6EA 1M04A 1XLJA 4NJJA 4HSNA 4W84A 1OX4B 2UZ9A 1T0OA 3AO0A 2NZLA 1C9WA 1VLWA 1GKQA 3UJSA 3U5YA 5LNRA 2DZAA 2O0TA 1N7KA 1KCKA 4UFIA 1TUFA 4TX6A 2J8GA 4A3RA 5DF0A 1IXOA 2I57A 2V3GA 3DYMA 1V0KA 3EWCA 3WNNA 2A85A 2ZXBA 5G5IA 3HV8A 1KR1A 4JQ1A 3A12A 5HNNA 2PDNA 5CPSA 2IUZA 4I7UA 4LPCA 1BXCA 1R2SA 3OLDA 3VD4A 4P8VA 4L6OA 1VIZA 5M5DA 2FVKA 3BGJA 5F2IA 2YXXA 3VYLA 4D6IA 4LNYA 3T81A 1RBOB 5BNKA 2QDEA 3GVWA 1A3HA 2QCLA 1TIWA 4WY0F 5L6UA 3NQVA 4MY9A 4PBFA 2V5BA 3HG5A 1H4PA 1I75A 3B3DA 2CZVA 2Z1KA 5AC6A 2G41A 4X61A 1HGWA 3WQCA 3FK4A 4W7VA 1BKSA 1WUFA 1Q13A 3N3MA 3W22A 3L4ZA 2BGNE 1VFSA 2VL4A 1ZL1A 3SRHA 1CLXA 5DMNA 4LOCA 2IQDA 4HB7A 4XAPA 3WMLA 4IM4A 1YNPA 2YPIA 3L4VA 3TSMA 4BQ4A 2DW7A 1AG1O 1X7FA 3WD4A 4GH3A 2QCMA 4NASA 4XD4A 3OJGA 2J74A 2CFFA 2ALRA 4YCOA 1OFQA 4CQAA 3VU2A 3R8HA 1UZDA 3GRIA 3QSTA 1GJUA 5E5CA 3TV8A 3EB3A 1C92A 1LOSA 4IIBA 4MSSA 4QJ3B 1PCKA 2I17A 3KDNA 3LSBA 3VM7A 1OCBA 4NZ1A 5FJJA 2F84A 2INZA 4L7ZA 3GR7A 1WOAA 4XD3A 2EKGA 3LK6A 3LRLA 1OF8A 4NZCA 4MADA 1GVFA 1YHTA 4EVZA 3LEPA 4LTSA 1B0IA 4NP7A 1EC9A 3H2MA 1W3NA 4L80A 4QCEA 4KGLA 4XO7A 2XG9A 4EANA 1F3XA 1XH2A 1ITCA 4B4FA 1NWSA 1G4SA 4QX4A 1MFUA 3Q45A 5E0FA 4GBDA 2Y62A 3KOZA 1A5LC 4JIHA 4W8LA 4EE9A 4WCJA 5AY7A 3WLKX 4C6DA 1EZ2A 4WGXA 4NRSA 3AU2A 3MMWA 3GO2A 3EPOA 4DWDA 4AY8A 5D33A 4WKFA 1A3WA 2YA0A 3EX1A 2EPNA 2QUTA 3N12A 2HPIA 3VDHA 3UXIA 1US2A 2Q8XA 2ZXDA 4IL2A 1TPH1 3ZM8A 1OFBA 1XD0A 2VEPA 1OYAA 3ISIX 1PX8A 4M6VA 4QROA 3UA3A 4AISA 1DHPA 2F6UA 3LPPA 3POHA 1W5PA 2W66A 4MAZA 2VJXA 1HO1A 3PPFA 2EHHA 5A95A 3QGAC 1PE1A 4UR9A 2ZX6A 5IBXC 4R85A 4HHPA 2UY4A 1JXJA 4JNZA 3DEQA 4YHGA 1LROA 1XM3A 2BY0A 3BAIA 3ZS4A 3PFRA 1CYGA 1O1ZA 1ADDA 4ACZB 1HL8A 3NFUA 3BUVA 1XX1A 4AWEA 3QC3A 4PTNA 1VP5A 5D02A 4AXNA 4F9DA 1JZ3A 3T09A 4AZIA 3C5QA 3W7KA 4MAVA 4MZ8A 1Q3NA 5FEWA 3VOFA 3QJAA 3IJLA 4ATLA 1PZ0A 3A5FA 3TONA 3CIVA 3RPTA 2CXEA 2WK2A 2X2YA 3MWAA 1NY1A 3P60A 2NV2A 3TN5A 3I68A 3NURA 3PZMA 3WQPA 4IOTA 2WNNA 2P5NA 1KKOA 1PJ9A 3G8RA 3ZJKA 4HYVA 1FXPA 2YBTA 4QDWA 4NVTA 3CEPA 4RDWA 1CPUA 4B9ZA 1V3KA 1E1CA 4LUJA 4Q6JA 4AWSA 4CU8A 4QE5A 4N9EA 1CXLA 4D8LA 1G7UA 5I00A 4WXYA 3HJEA 1H2JA 5D9NA 5TIMA 3FA3A 1Z8AA 3PK7A 3S1GA 3GU2A 3FHAA 3B9OA 3GXMA 3SCOA 3WKZA 1GG0A 1W9BM 3VNKA 3USBA 2RGMA 2YL8A 3PM6A 2OTDA 3HM7A 3BMWA 4PODA 1SUXA 1YEYA 3E2QA 4H9YA 1OYCA 2VM8A 3A64A 3A23A 1WDQA 4RLIA 2WC7A 4LY8A 4P2VA 1H7NA 2VRKA 1F6KA 4AQLA 3SO7A 3THAA 1GW9A 3IUHA 3QW3A 2NSXA 1PIGA 2XWEA 3O16A 2CLIA 3VKJA 3MI3A 3PF3A 2Z1WA 3SY5A 4UQ9A 1R85A 4HN4A 1T7LA 3R2GA 1XUUA 4C6PA 1Y0EA 5M17A 1BXBA 3TH6A 1UKPA 1XYFA 1C8YA 2J4GA 5BROA 1OGGA 1WAUA 4RNHA 2BTMA 3URQA 1ISWA 2YOCA 3I7RA 5HWNA 1LG1A 1MQQA 1UB3A 1BLIA 4A3QA 8TIMA 3NVDA 4TR9A 2ZZ7A 2ZVRA 5G1MA 3QM3A 1IGSA 5I3KA 3M0IA 2MANA 4UTLA 3WLIA 3DHFA 4N6EA 3TE9A 1GVSA 4O11A 3PY2A 3W37A 3S47A 2DT2A 1WZAA 2BGQA 3LX9A 4N4QA 4EXQA 3B0VC 1EF2A 1DJZA 4GPNA 1W5NA 1L6SA 3FCPA 1WDWA 3QQ0A 2XVGA 3EOUA 3PNZA 1OFOA 3WQ5A 1JPMA 3KWSA 3IAPA 4IIGA 4TX8A 5BXPA 4UTKA 3M46A 2OG9A 4Z1YA 1IEVA 3ES8A 4QDPA 3WQVA 1SPQA 2HMCA 4PMYA 3BQ6A 1ZLPA 3G3DA 2R14A 1RALA 4K36A 3QZ6A 5CXPA 1OK6A 5CSSA 1AQ0A 3SN1A 4DXKA 4G7EA 1KBJA 3VD5A 1CBGA 5CCZA 4LCRA 8A3HA 4AWUA 1XJBA 1PZ2A 5AOUA 3WD3A 4MFDA 5AHLA 1TV5A 4J9JA 1ECEA 2DIEA 3UJEA 4AIOA 3W2JA 3TFCA 1Z6KA 3ORWA 4B2DD 1HKMA 3LBMA 1D7KA 5CQ1A 4XZWA 1YADA 1TV4A 4ZR8A 4IMCA 3KXQA 2EKCA 3TOYA 5LSMA 2ZOXA 4B90A 3WH6A 2YIHA 4IIEA 4J4KA 4D8ZA 1Q6GA 3RM4A 3E1F1 2GJNA 3I4EA 3SCQA 1OC7A 2XH4A 4ZFCA 4PFHA 1CXKA 2NQ9A 4XX6A 4BF5A 2GUUA 2O9OA 4Q8WA 1VD6A 1M01A 3APTA 2BVYA 3HA1A 2J62A 4LRTA 3KZSA 2XISA 2JE8A 2YXOA 1E6XM 4N4PA 4W89A 3TZFA 3MKKA 2D73A 5I24A 4US5A 1ECQA 3OIXA 3WLJA 3AXXA 5K9XA 2QF8A 1S5TA 2HXUA 1TJ2A 1EJSC 1QBAA 3OLGA 1T8XA 2VVSA 2NQHA 3WDIA 1SMDA 3PNUA 2NX1A 3HQOA 3LXCA 4RW3A 4CNOA 5BMXA 2XFYA 3GFYA 3A3XA 4IPLA 4ZCWA 3PZTA 4YPJA 2A6NA 3GKAA 1C3FA 4H9MA 1UKQA 4K8HA 4F0HA 3D3FA 2HJPA 2J79A 3W86A 3NZRA 2QV5A 4E2DA 3VDCA 1EPXA 4V1XA 2E09A 3BW3A 2YA2A 1XSKA 4ZXOA 5PTDA 3BAYA 2HSAA 4MYAA 3IJ9A 1HTIA 1RD5A 3KZPA 2DH3A 4C5ZA 1EX1A 3HF3A 4MGGA 1VFLA 4RE3A 2ZVIA 3S42A 5CAKA 1JL8A 1E6QM 4QGCA 3DHPA 3BE7A 3VTRA 4JHOA 4PCSA 1MQRA 1UZHA 4JQAA 4V15A 2P0OA 4ZOCA 5JVLA 3SJ3A 3QOKA 3CHVA 1EJVC 2XU2A 1V08A 5EMJA 2AL2B 3AS3A 2GLKA 4OFCA 3B40A 2ZICA 2DVXA 2OVLA 3KX6A 2BMBA 5G2WA 3Q67A 4S3DA 4Q8UA 3PTMA 3R5EA 4JBRA 4ROQA 1XLDA 3U7BA 5KZDA 4C6QA 2PLMA 2TRSA 3R4IA 4S23A 3NQAA 1JAKA 2REQB 3RITA 3E2VA 4LJ3A 5AHIA 4INFA 2J78A 3PPCA 4RL3A 5JIWA 4BK9A 5LNVA 1UKOA 1YBQA 3MQTA 2Y7EA 1DJWA 3OZYA 3EDFA 4IPNB 5HQEA 2Y63A 3V3WA 4Z2HA 3LPGA 3AHZA 5DCBA 3RO6A 4OU1A 5AZ0A 3LCFA 4IUOA 3W38A 3AALA 1N8WA 1GORA 4QE1A 3AFBA 4GACA 1GOMA 3BXWA 3FLUA 2NLIA 4K3ZA 1J2BA 4NU7A 3NPWA 2QAPA 1UPPA 3N9RA 4QNEA 3N18A 1ZTVA 4M6QA 3KCJA 4KRTA 4LYRA 3GXPA 3M16A 1S5NA 2ZC1A 3PJWA 2OB3A 5BCAA 1UPMB 2W67A 3EBVA 3MO4A 4PMDA 2CCRA 2POTA 2ZE3A 1WOBA 4X2PA 3QW4B 4KFOA 1D3CA 4ZOBA 2Y70A 3ARWA 3SUVA 3F2DA 1FX6A 1P7TB 1KWKA 3QC0A 2OSXA 1ZZMA 3GIPA 4V2XA 1O94A 3M7WA 3TYEA 1KM2A 2OSWA 1XGZA 3TP4A 2IXUA 2NQZA 3RUBL 1PIFA 4HP5A 1XC4A 4BFAA 3IGSA 1ZALA 1JAEA 2P3EA 5JBEA 3KEHA 1LL7A 4BS0A 2H9AB 3A4XA 2W91A 5AYBA 1W1IE 3FKKA 1WCGA 4GCXA 3B0XA 1BWKA 1MUWA 3PWIA 3UWEA 2J9ZA 1GVYA 3MW7A 2WSYA 2XDFA 1EP3A 1TELA 4YNGA 5HXMA 2VDGA 1ZCOA 2W27A 2WXDM 1G01A 4KWSA 1J0HA 1YE6A 4K8GA 5AHNA 1DJIA 2J6XA 2HE5A 1SGJA 3AYVA 4C6JA 2C7FA 3O6AA 1B3WA 2XVNA 1BWLA 4MOZA 4JX6A 2QUUA 1UWQA 1OT2A 1PX4A 1BPLB 2D0FA 2VZUA 4R9OA 2QNEA 1S2AA 1NDYA 3QFWA 1VS1A 2Z7KA 4UTMA 1O1HA 2OELA 3WMBA 1GG1A 1JRBA 3APGA 3H2EA 2QDGA 4GNJA 2WB5A 5DRCA 5F7UA 3N9SA 1R2TA 3RLHA 2X09A 2CU0A 3NOEA 3O0FA 2FYMA 5KZ6A 4DEFA 5AVHA 1CDGA 3WLQA 2OSYA 3NJ3A 3IIZA 3WSUA 5K4XA 2PGRA 3CL8A 2Y61A 2ZA3A 3U8GA 4QISA 1QPNA 2QGHA 2J8FA 3S46A 3ONBA 2F9RA 4S3KA 1KQYA 3B8IA 1QXLA 5T91A 3N11A 3SN4A 1EYEA 2OGJA 1HX0A 1E3ZA 4J2MA 4HMEA 2J25A 4ZEPA 3KDOA 4O16A 3VGBA 1AW1A 2VFGA 4GI8A 4AC7C 5HMEA 4CUCA 1JQVA 3BW2A 5AHFA 5FAGA 3TOPA 3T0DA 4P8UA 3DUGA 1DVJA 4H7ZA 3FS2A 5FF0A 4PEKA 3PB0A 3IGHX 1EJUC 5D03A 3EPMA 2V9DA 2B0MA 2VUYA 3N73A 3PG9A 5CJNA 5F2MA 3I6RA 3OGVA 5E93A 5C7HA 2CHNA 4AY1A 4YLWA 4JTCA 5HK4A 2G8ZA 1XIDA 4JTSA 4NZJA 2FGLA 1ZAIA 5H91A 1O6IA 2XM2A 3WL1A 2PS2A 4IQLA 2PP3A 1MXDA 3GBEA 4O8RA 1E9LA 4RPPA 1HN1A 3SIMA 1HJSA 2GVJA 1ZBWA 3FHQA 3AMLA 4F0KA 1UHVA 3BAWA 3VIIA 2ZUNA 4IIDA 3C2YA 3D0CA 3GW0A 5CGQA 3WQ6A 3SDOA 4A35A 3JR2A 2ZX8A 3T2PA 5EFFA 3PTDA 5AYYA 2C13A 1P6CA 3C2FA 3CUFA 4MWAD 4M81A 1NAL1 3DG7A 3UESA 2GSHA 4P7RA 3OVPA 3RJYA 1TMQA 2PDBA 1JI2A 1RD6A 4AD1A 2UV8G 2VHLA 4IL0A 4I9TA 3ZR6A 3AIVA 4G1NA 2PU0A 4BWLA 2VEIA 3G77A 4H9UA 2FDSA 3ZR4A 3RLUA 1QW8A 4R34A 2PDWA 2RDWA 4AAJA 3DI1A 5LHEA 3UGRA 2DW6A 1RQBA 3OG2A 1EO7A 4ZL1A 1ZQ5A 4HT3A 3IK2A 4PULA 1P0DA 4IGHA 2WLZA 4UIOA 1UD2A 4MNJA 5BOOA 3VKBA 3BOXA 1XWYA 2B81A 4AZ7A 4KGJA 3W6MA 1OJXA 3E2SA 3R25A 2VEFA 5D38A 1EQPA 4AMAA 5CLTA 3W83A 1W5QA 4U5IA 1O60A 1TYGA 4LBRA 4UFJA 2XHYA 4AG0A 3VDBA 2UWFA 3NQ6A 2PTWA 3CM4A 1SJCA 4DZAA 3NYDA 4GY1A 1DJYA 3QSRA 5DXYA 1R47A 5FF7A 2X05A 4FNPA 3TC7A 3N2OA 2I1OA 2E7FA 2RFGA 1GWJA 5DQPA 1XLHA 1Z41A 3RLVA 1EC8A 5DEZA 4C7GA 4LC6A 3WUFA 3SCWA 1FWCC 1ME7A 2E1DA 2DSZA 1VYSX 4V28A 4W93A 3T42A 4LALA 1E0TA 5HDRA 5BYWA 1XICA 3ABRA 1R9YA 2HPMA 4FOJA 4KERA 1VKFA 1WDSA 1PB0A 1XI3A 1I0DA 4KW2A 3EDEA 3B0YA 5A6SA 5HAOA 3FKRA 3G8EA 4X9YA 3RFAA 2QVHA 5CPMA 2NXIA 3UJFA 5D4YA 3CPGA 3APYA 1R46A 3RXZA 3NCOA 3VC6A 4EP8C 4GABA 3TC3A 2D1ZA 2BVWA 1H7RA 4W7UA 3GBDA 5H8MA 4LCSA 4TMCA 2R1NA 2V5LA 2WWCA 4H8HA 3W70A 1SYTA 3GD6A 2W6RA 2IQTA 4HOZA 4IQDA 2H6RA 2V3FA 2Z1SA 1EJXC 2B4GA 5K3VA 1ZNNA 1YQ2A 3EOSA 4HIBA 1SJDA 2D3LA 1E51A 4JTFA 3R10A 2CETA 3T08A 4E4FA 4ILSA 3W71A 2OWWA 1QRQA 4H7VA 1HP4A 1XBVA 1NELA 4EKJA 4XKMA 2WCGA 4QDMA 4P5UA 1IWBA 3HBLA 3KOXA 1M9HA 3LRMA 3M9YA 2WANA 8XIMA 2G3FA 5LNSA 1XDLA 5I03A 1IIHA 1E6ZA 3ANVA 3S5ZA 3DYOA 3IEBA 1EXBA 3BARA 2PDGA 2CIPA 4WLCA 2YW4A 5FL1A 4HJWA 4I8DA 2PEVA 2L5HA 4UZSA 2PMQA 1KLZA 4UFHA 4NXSA 2HXTA 1KCXA 4O17A 2FB3A 2QJNA 3RNDA 2VFDA 2VKZG 1A0CA 2O55A 3MI6A 4D6GA 3KLLA 3DBPA 1TPC1 1DHKA 1FKWA 2XYLA 1DIEA 4IPPA 2INFA 1UP3A 3WNKA 5K9CA 1VEOA 3KAOA 2QCFA 1YPFA 1O4UA 5A2BA 1JDCA 1PX3A 2IKGA 2V63A 1TMLA 3N17A 4H8UA 1ITUA 5AFDA 4MDOA 3RX4A 4EAMA 1T6MA 4QHRA 1MDLA 1S3HA 4GOAA 5FIPA 1DYSA 4NI3A 3M6DA 2FTYA 5DCEA 1VFOA 1Q85A 3J7HA 4KIRA 2GQ8A 4A6GA 4WSJA 5CZJA 3ZSTA 1J9YA 2HWGA 5LIXX 4D9PA 3JZEA 4WJXA 1UA3A 1MRQA 3QGKC 2ISWA 3ZVHA 3LERA 1JCYA 2PC4A 2YFNA 5DCDA 4LB4A 4ACYA 2R1PA 1FWBC 2HVNA 4LUTA 3C0SA 1AVAA 3P6LA 1L0PA 3W7JA 3H4XA 2OKOA 4OHQA 3BTNA 4V33A 5BRQA 4AYSA 4NNBA 4E2VA 1Y5VA 3NDOA 3TW7A 1KM5A 3W0KA 1J0KA 4XTIA 4Z2GA 3ARRA 1B90A 3CQHA 3UNTA 1MWOA 1U5HA 1TJ1A 1V4YA 3REQA 3GYCA 3NZGA 2VX5A 5M1TA 8RUCA 4MZ1A 1I1WA 4JTDA 1XCWA 1R8LA 4A22A 5IOBA 3PZ9A 5IXEA 1V51A 2YDSA 2WVVB 3UZZA 2VR5A 2VGIA 3P5YA 3EX3A 5U7SA 3SADA 4IPJA 3GVRA 4NZ3A 4J40A 1LOQA 3KVJA 4N7QA 3FJ4A 3H55A 3LMZA 3BCFA 3DIPA 4MLRA 1Q2SA 3USZA 3CQJA 3GM8A 4IZGA 3FY1A 1JIBA 3JU2A 1DV7A 1K1DA 3V4BA 4IUGA 4PMZA 1EIXA 5CPTA 3ANUA 4FSAA 4GHRA 1UD8A 3TU9A 2HV5A 3AS0A 3L23A 5BU6A 3UYCA 4ZTXA 3UR5A 1DORA 1NDZA 1UCWA 3IV8A 3NAVA 4F8XA 4TQTA 3ABSA 3CQIA 4X63A 2P76A 3DESA 4JNMA 4TV5A 2WMJA 4MB1A 4OECA 3O1NA 3IUDA 2RJHA 4CQBA 2ADAA 1JPIA 3E0IA 4J35A 4GWEA 2PA6A 4XBKA 3ZT5A 2YL6A 7REQB 3EXSA 2BGSA 3G22A 3K8MA 3K30A 2PBOA 3JVAA 1HUVA 4YTTA 3GVGA 1DWGM 1J2WA 1IHIA 4AIUA 4XKYB 3CB8A 1BQCA 1G4TA 4DBSA 1WQ5A 3VDGA 3W1NA 4C7DA 4DBDA 1S1RA 5D2XA 4DF0A 1FWWA 3C56A 4GI4A 1SZFA 5C9XA 1QI3A 1W9XA 2VGBA 2QMKA 4PE8A 3M0XA 2X8RA 3TTOA 3TJLA 4GE8A 4NAFA 4NJHA 1POKA 3RJXA 4UQBA 5HINA 2OEJA 3WQ4A 3TMQA 2OZTA 3F03K 1B2YA 1J4EA 2PLCA 1TPFA 2BP1A 4KT2A 1W3KA 4I9MA 3TYZA 3CC1A 2CHOA 2HS8A 5T9CE 3AMGA 4V1YA 3QLLA 2WSKA 2DY3A 2YDRA 5E09A 3CUGA 4Q4QA 3WD2A 1CEOA 2J27A 4FAMA 1KFBA 3KHDA 3L0KA 2WMKA 1VFMA 1W2VA 4M24A 3UPWA 3WBEA 3PZQA 5AN7A 3KBMA 4BEUA 1AH4A 2E6AA 5D2WA 1P6WA 2XGBA 4DZ5A 2NWSA 4F2BA 3KVKA 3WFAA 4WXZA 4N9CA 1CB2A 1OFRA 2D2HA 3Q94A 4PN2A 4WHBA 3BMXA 1G4EA 1X6UA 1K03A 1MW0A 1XRVA 3VIJA 1UWRA 4G8TA 2JIWA 2G97A 3H24A 1ZBKA 1RLDA 3VKCA 4C6BA 3LSCA 1V02A 2H3BA 2VEKA 4C6FA 4B5WA 1XPGA 2DIJA 3ICJA 4D6DA 4M6PA 1R87A 2Z0IA 2ZZ1A 2CWNA 5CBIA 4S3JA 5D32A 4LS0A 1R0MA 4J27A 2E4TA 1VFFA 3BH4A 1CIUA 3WQGA 2E67A 4QM1A 1GZJA 4GO9A 4OGZA 2VZSA 1CT5A 2QPUA 4GQQA 2NQ5A 4FS9A 3AHVA 1F6YA 4A2SA 2FB2A 2X16A 1GHRA 2OODA 4LBUA 5FESA 3QN3A 3Q58A 1B57A 4J2PA 3LCHA 4UR8A 5FJTA 1MZHA 2WBKA 4GIEA 4NNAA 5AYZA 2DP3A 4LU0A 1TWWA 3BZGA 1MYRA 4AZCA 1BRLB 2BHZA 1KO0A 1SZNA 1W37A 3V0SA 1RVKA 1QI4A 4GO8A 3P82A 2A3BA 3MUY1 5CEWA 3C61A 2MNRA 3R8RA 3N13A 4D1IA 4XZ9A 3WF4A 4GX9A 3WNMA 4XVEA 3QZEA 1GQLA 3EPNA 5I6SA 1GUVA 2CC0A 5ABHA 4FIQA 3ITGA 1US3A 1VJIA 4FXFA 3WEOA 2CBJA 4H6QA 1UZ4A 3PZIA 2P88A 2A1YA 3TNOA 1TJPA 4DNMA 3CUHA 2ZRXA 3IAQA 4PBEA 3RYSA 4KKXA 2GGEA 3C2EA 3BLPX 1N2VA 3ALFA 1FHDA 2JGQA 1BTMA 1FH9A 4H6RA 3RF9A 4YJ5A 2E68A 3LA4A 4E0CA 3WBAA 4XZNX 3W81A 2GJXB 3L0NA 4HTBA 4AD0A 3VKAA 1OSEA 5LA2A 3OZMA 3U57A 5EMUA 2WZHA 4ATDA 1BQGA 4W7WA 4FX8A 4WKAA 1LRTA 4ZENA 1WO2A 5K9DA 4AX6A 3V1HA 2F6KA 2V69A 4J3ZA 3AXKA 2WW5A 2CBIA 1OGBA 2DORA 2NVDA 4CD5A 3ARVA 4RDYA 4F4RA 2JF7A 1XLGA 2HBXA 3DG3A 1LUCA 3PULA 2JEPA 4JTEA 1LG2A 3H2AA 1ZS2A 1MW1A 2EO7A 5C6MA 3AU6A 3HIJA 3W7OA 3LI1A 2JGYA 4C60A 4NAEA 1NQKA 1IWPA 1OY0A 4UMBA 1JCJA 2JKEA 2FH8A 3P5ZA 3TUUA 1NEYA 1KTBA 3KTSA 4JQ2A 2VDIA 3EMZA 4AMCA 5C2GA 3HOJA 1REQB 3NL6A 3WH5A 4HYWA 1BEUA 3S0CA 2QLYA 1EIBA 1LJYA 4DWSB 1RQHA 4GYJA 1P0KA 2FZBA 4QG8A 1AODA 1F2JA 1MW3A 3NG3A 1VC4A 4IGSA 5AC4A 1I45A 1NM9A 1RLCL 3VA8A 1QOXA 1AQMA 3H2FA 1OX5A 1XSJA 2YDAA 3U2ZA 2DUAA 1FWAC 3NQFA 2GK1B 2XH7A 1VRXA 1W32A 4JTAA 2DZSA 3DXIA 1UWAA 3QPZA 2JKAA 4DELA 2XSXA 4ML9A 1RR2A 1K7XA 4EIVA 1HJVA 4JS3A 1GYMA 5CPNA 1JPKA 3O15A 1Q65A 2HK1A 2XVKA 4JGDA 5FEXA 1IEIA 2ASHA 3OA3A 1KBKA 2BXYA 1VF8A 1EA0A 4M3PA 3MSRA 2YLLA 1Y65A 2ZFAA 1YTDA 5MKGB 3MUZ1 3RU8X 3QHMA 1ICSA 2C15A 1I4NA 1PTAA 3IIOA 1YDVA 3UY8A 4PA8A 3PN8A 3UJ2A 3S4TA 3PUEA 3W87A 1ME9A 3HURA 3GTNA 1UP2A 4NT0A 3TIMA 3FAWA 1QNQA 3MV11 3BOFA 3BCDA 2ONEA 4QE4A 2FLIA 4FO4A 4N0RA 4LH8A 2YCEA 1U83A 4MZYA 2D69A 5HQLA 1B3VA 3OODA 2VR2A 3WMCA 3OYZA 5FD0A 3SBFA 3PAJA 1PKLA 3ZJ8A 3MCNA 4C6LA 2VC9A 2RKXA 1GTEA 1H1NA 5AZ1A 2BOEX 2EJAA 3CL6A 4GLEA 1W1A1 4KETA 2DZUA 2E28A 4AY7A 4O52A 3AIUA 2DJXA 2V5CA 2DFAA 3F5JA 1G94A 2PD5A 4MWAB 5REQB 4QR6A 2CESA 3SCPA 4Q4PA 1TFVA 1HJUA 3PBYA 2ZZ5A 3WELA 1LBLA 2B7QA 5LXEA 1TQJA 2ZZ3A 4REQB 2JK2A 3N2XA 1EP2A 5EA9A 1NFBA 3NQBA 4WUIA 4ZGYA 2O92A 5K4ZA 4HPNA 1NQ6A 5F1VA 4CD7A 1FVPA 2TYSA 1H41A 3QFEA 2TSYA 4ZB0A 3ZO9A 3FFSA 1I2NA 3LDVA 4K39A 4JTIA 4H9VA 3DGBA 2PWVA 1QUMA 3CHCA 4M5PA 2G4FA 4E8DA 3R6IA 5FJOA 3UXLA 3G2GA 1JCNA 3P74A 3L2IA 9XIMA 1XIMA 3MSYA 1O5RA 2POZA 3DZ1A 1TJRA 1V7YA 2XIMA 4O15A 2C0HA 5CZKA 3GTXA 3WQOA 1CGWA 2PWGA 3W6YA 3MI2A 4GKLA 4FHAA 1K9DA 3GQYA 3GG0A 1WX0A 4CNUA 3E9AA 1UR8A 4IJCA 1NF0A 5I78A 2E8YA 3Q2DA 4GNVA 3KP1A 2WSRA 3P8IA 3TX9A 3VD9A 2Y5JA 4Z0SA 5HBFA 4RZBA 3FYPA 4HK6A 3IIVA 2J24A 3C2RA 4E8GA 1WXZA 5CSUA 3HG4A 3HQ1A 6ENLA 1SMAA 5CSRA 4UUIA 1JPHA 3PZNA 5C55A 3E2RA 1ZBVA 4RJEA 4TVDA 2W9MA 4ZVJA 1VAHA 1NWUA 3W3OA 3EWUA 2PWUA 1GOXA 3U5UA 5G4HC 3FGCB 3TYAA 4GVHA 4U2ZA 3NA8A 2J7HA 5EMMA 3JZUA 3E6EA 1W8GA 3V0TA 3W72A 3EA1A 4DUXA 5K2ZA 2A0NA 3B0UX 6A3HA 3FOKA 4YTUA 4WY0A 3CH9A 2Y4SA 1OHLA 2EG7A 4CD4A 3UERA 1JGMA 3E0LA 3LCXA 1JUEA 1XRTA 4TX9A 3WD1A 3UR7A 3VZYA 3F5LA 4UQDA 3RDKA 4Q8OA 3A22A 3OLIA 4F3HA 4MJ4A 3W9ZA 4YCPA 4HVXA 1JCTA 4HCLA 2NQLA 1JD7A 5HOSA 3EZ4A 3D46A 3FJLA 1R3VA 2DSUA 4Q8VA 2A7RA 2XGZA 5T8GA 4GUHA 4UQAA 4PRRA 4S3AA 1RJRA 4H00A 2J7FA 2PLKA 3KHJA 4H8NA 3ZLFA 2ACRA 4HU4A 3OVGA 3MV01 3ES7A 5A8QA 4ONVA 4ZO9A 5I09A 1EOMA 4YYCA 3VZXA 3WX7A 5HNTA 4QIUA 1W56A 4PUWA 3AI0A 4DYEA 1HF6A 3B03A 4UMCA 4LY4A 4LYQA 4KWUA 4U10A 3CQ0A 2JFEX 5D8WA 3KBNA 2D2OA 4H3DA 4FOKA 4WIWA 2Y8UA 3FSUA 2CBVA 1NDVA 3W2KA 1UUOA 3N15A 4GGBA 3VFCA 1EXPA 5KMYA 2IKIA 3ZJ7A 1YTEA 3FXYA 2ISFA 3LBOA 4K1GA 1AJ2A 3W00A 3W1PA 4HK7A 4L5ZA 1ZFJA 2DZWA 3LPOA 3TN4A 3F4CA 2BY3A 1IT7A 1T5AA 4DJEC 2W0UA 3BPWA 4NKCA 4IG2B 1MSSA 2XN2A 5CJ5A 3XISA 4H04A 2FPYA 4IMEA 5KSWA 3G1VA 3GDRA 4LGXA 3T0AA 3A6OA 3W2MA 1RV8A 2J9YA 3CZLA 2CEQA 1A5NC 3I3BA 1YNYA 2V3DA 1TX0A 3QHNA 3MO7A 4XIAA 3EX4A 3TSBA 1LLWA 4WK9A 2YCIX 2VCBA 1A80A 4O0KA 4Z2KA 5A8OA 1TTJA 3LUTA 1ADSA 1FHVA 2PSNA 1LQ0A 3KCOA 1RBLA 4JKLA 3LNMA 2XIJA 3ARXA 1TR9A 3GFZA 3QYQA 1KXHA 2WZMA 2XN1A 4DZIA 1WKYA 1X39A 1DQWA 4HSHA 1KGXA 2CNCA 2HEJA 3GWQA 1ZCCA 1K4GA 2JQXA 2I16A 1BYCA 4Z2IA 3ABXA 4KBXA 1PV8A 4Z2LA 1IEWA 1SJBA 3PZOA 4IFKA 4GH1A 1G9HA 1F8IA 2WZEA 1HZYA 5DT5A 4UTWC 3WY1A 5EYWA 4CN4A 4R3UA 4Q8NA 3UJRA 1LCOA 3UT0A 5BXTA 3AXMA 3BZJA 3PP7A 2Z27A 2A3EA 4GK8A 4YWSA 2VFHA 5ABTA 4LWWA 2FJKA 1M5WA 3TC6A 4Y90A 5M3WA 1E1FA 4GYKA 2GWNA 3L7RA 3P84A 5BU9A 1XYBA 4DJED 1EJTC 4TXEA 4LVDA 3PUOA 5HQMA 4HHHA 4K2SA 3ZQ9A 3ARTA 2NUWA 3L5LA 3OVQA 1KD0A 1GQJA 1WZLA 1XCFA 2HS6A 2UY2A 3CAVA 4OE7A 2BZNA 3FVMA 2BNJA 4U3AA 1F3TA 4AUBA 1D2KA 4JTRA 1YXDA 4M6UA 3U7VA 3VI2A 4WD0A 4D8AA 2P53A 1BYBA 5IRPA 3TXZA 1D9EA 2A6LA 2UY5A 4ZQMA 3SUUA 2YCLA 1XV8A 1JD9A 1QWGA 4L9XA 1Z48A 2J13A 5EU9A 3TQPA 4DXXA 4PCFA 3L21A 2QCDA 5C9ZA 3M44A 1XS2A 3G1AA 1EJ7L 3H6OA 1Q6LA 2V67A 4H19A 2ZC8A 4GBUA 2PDLA 4WF7A 4DBUA 3VE9A 1EZWA 3L4YA 3Q65A 1SW3A 3RHGA 1IE7C 2BY2A 1QNPA 1A0DA 4LEQA 1QNSA 1ISYA 3OZOA 5E0KA 1A0EA 1LOLA 4WJEA 3OQ8A 3BICA 3IK4A 4UFMA 1DOSA 1J01A 2YFOA 3BJFA 1XG3A 4ZOEA 1UUQA 3EX6A 3AHYA 4TV6A 3CO8A 2TMDA 3BJTA 4US6A 2F61A 5BMWA 5I77A 1UR3M 3TN6A 3ZXWA 2OPJA 1JJKA 1ONWA 2VUNA 4B5SA 1R3YA 5AC5A 3M64A 1L2QA 3B97A 3R12A 1VR6A 3R8GA 3SUWA 1EDGA 1J8VA 4HGXA 1WBHA 2O9TA 4EXAA 1I0BA 1DXIA 3RMEA 1E6RA 1DWHM 3B8UA 3VCRA 3ZLHA 3IACA 4HNNA 5I7GA 2VR4A 4WRHA 3VDAA 3LGEA 4OBSA 2PDIA 3P2VA 1KM3A 1XH0A 5IM51 4Z1DA 2UY3A 1W5MA 2AQOA 4A29A 1C91A 3DX5A 1A5UA 5XIAA 3JUGA 2GYIA 3OG3A 1RA5A 5BOFA 3NSMA 3EX2A 1RUSA 4JQ4A 2QDHA 4XK2A 4QFUA 3ZJ6A 2ZXAA 4DJFC 1AUSL 3NQCA 2QEZA 4PTVA 1CGVA 4RNIA 1QO2A 3CAKA 1C7TA 1WDRA 3PTKA 1UH4A 4K38A 1YTKA 4AHQA 3UG8A 1YIXA 2BOFX 2ZZ6A 4AD3A 2ZYFA 5EKYA 2IPGA 2ZRVA 2FVMA 1G69A 3E38A 1R9ZA 3AJXA 4YIWA 1GVRA 1XFCA 2BOGX 3RCMA 4MVAA 1L6YA 4OBRA 1V77A 3HN3A 1P0BA 4PL1A 3GDKA 3B8VA 2AAAA 5LZLA 2YL5A 4L6DA 1BVZA 4M19A 1GQIA 4LV4A 1V0MA 3BO9A 4EPDC 2PP1A 4UNIA 1UW9A 2WWDA 1MEIA 3GHTA 1JDEA 3SY8A 2H8ZA 2O9PA 3KBSA 3PPHA 1ZENA 3PUGA 2BXVA 5KITA 2XTKA 2QCEA 2A4AA 4X2RA 3VUPA 5I2UA 2O7SA 3AOFA 3CWOX 3PUDA 2PRLA 3AWOA 3EEGA 5ABEA 4YTQA 1RBAA 2OMAA 3NSNA 3L67A 1RP8A 2XVPA 4GCAA 2ZX7A 1TR1A 2PZ0A 3LLFA 1DP0A 4LVGA 7ENLA 2EG8A 3B8DA 3V5OA 1CLKA 4DJFD 1KV8A 1JYVA 4P61A 3RPMA 4K6AA 3H21A 3FV9A 1NOFA 3GNXA 3LCLA 1HKIA 1L9WA 3PR2A 2VZTA 4KH2A 4MJMA 1GVOA 2BLEA 2CW6A 4Y2WA 3W1QA 2HQAA 4ZFMA 2J6VA 4GJJA 2D24A 2PRHA 4AWTA 4CN6A 1XIFA 3W7HA 4O50A 4Y9OA 1RCOB 4UTIA 5AHEA 2PCQA 3BJSA 2OYKA 3CXOA 5H6HA 1KB3A 2SFPA 4KS0A 5D9PA 2CLLA 3UPBA 4C65A 3W1RA 1QNVA 4FNTA 2H3DA 3H2NA 3STPA 5A6JA 1K02A 5JBFA 3W76A 1TV8A 4PB3A 3F7JA 4O1AA 1Q6OA 2FQIA 3SY1A 4DO5A 3LNPA 4YMZA 1NJJA 4GI6A 1F8MA 2ZWZA 1Y5XA 3TTQA 3TJXA 2C16A 1SQ7A 4S3GA 3RU6A 2D23A 2OT0A 5D2VA 4HNLA 2OQYA 3PSWA 3BLLA 4JFTA 2IKHA 3K4AA 2NXHA 3KTCA 3QV9A 4Q22A 3UW6A 4K8EA 4M1RA 4B5NA 4YYFA 3S1XA 3SCNA 2J7DA 5BWFA 3K4DA 1WXYA 5KINA 2E9LA 5LYRA 3E0WA 3AHXA 3URAA 3ARQA 1ENUA 1E43A 1X1ZA 1XIGA 5JH2A 3CYJA 5D9OA 4O54A 2A7PA 3G3MA 4JEJA 4QITA 3W1TA 3LQGA 3LZ3A 1HO4A 5EY5A 1TB3A 1EWEA 4GXPA 2J7CA 2F2KA 2VO5A 5EPDA 3MSDA 2HZGA 1ZJHA 3LM3A 3VILA 3CUIA 1F7BA 1V6VA 4LUSA 4UB9A 1AW2A 3PBMA 2XGIA 3BLDA 3OHMB 4NZ5A 4OZOA 4HCHA 1SSDA 4FX6M 4HK5A 4WJ8A 4UTTA 3KS5A 6XIMA 4QJ5B 4N6FA 3AMCA 4XB3A 2ZE0A 4EF9A 4PUNA 1DJXA 4GYPA 3WLTA 5FJRA 5B7YA 1I60A 4PL2A 2WAGA 4FF5A 1VCFA 1TVLA 4OOUA 1YLVA 1SSGA 2X40A 2W61A 1E1CB 5AC7A 3LHYA 1RP9A 1CXFA 3CQKA 2PLJA 3E96A 3TCEA 3W85A 2ZTKA 1YXYA 4Z1AA 4RNJA 1RJPA 2MUCA 2W63A 4GUFA 3ZMRA 1A5AA 4YS1A 4MNMA 1XHGA 1TV2A 2X7WA 4PUKA 5H1WA 4NRRA 1BAGA 3S5OA 1PHWA 1W17A 4MTVA 4XZHA 4MB5A 3T6CA 1XKJA 1EF3A 3NYZA 1LL6A 4AB4A 3CV2A 4PUEA 3O7UA 3KP0A 5J5DA 1VEPA 1OZMA 5IFTA 4FA3A 3QTPA 2GGIA 4ADUA 1UC4A 4B2DA 2FZ9A 4FX7A 3U4FA 1M65A 4PZVA 1TA3A 4LUYA 1ZBCA 5HJYA 1TJ0A 4TTUA 4U4MA 2KX9A 1RCXB 1US0A 2WMFA 3R79A 1N8FA 5E9AA 2AAMA 3GTIA 1P48A 1W5OA 2PGFA 2D2GA 4K37A 1HFBA 1QHPA 1FDZA 3VCNA 4L1XA 3A9BA 3SGZA 3BG9A 3O6DA 1H60A 3W1UA 3N1AA 3IGUA 5DN1A 1GOQA 3UBPC 3BV7A 1NVMA 3K2GA 4WKHA 3PZVA 5A6BD 2GPTA 1GW1A 4PTDA 1HL9A 1R3TA 3EA2A 2EGZA 1XBZA 5GNXA 3FNDA 4N9DA 4UFLA 1TKKA 4BEQA 3V18A 1VBJA 2PGWA 2E25A 3KL3A 4FR1A 3VAVA 5DO8A 2O7QA 3H2OA 3WBXA 3CNYA 4A3HA 5EL1A 2DGAA 3NQMA 4Y6GA 1FWGC 1VENA 4XAFA 5HMFA 4KCUA 3MMDA 1EGMA 1CI1A 2DT3A 1UYQA 3HPSA 4GY0A 4JTQA 5IFPA 4NZ4A 1VPQA 1VBHA 2DUXA 4S1FA 1Z42A 3TWBA 3S2MA 3IPWA 2ATMA 3QY7A 5AKQA 2FPVA 2VP8A 3WZ0E 1VBUA 3LHVA 4F2UA 4PCTA 4HA3A 1S2UA 4NY2A 2QIIA 3VNJA 3WN6A 2V6AA 1RK6A 1EFZA 1M7OA 1V6TA 3DENA 3I6EA 2LLEA 3DFSA 4Q7NA 5FI8A 5TQLA 4QCFA 3R58A 1OWQA 1J10A 3SCUA 1DE5A 3TYUA 4ROPA 1ISVA 1EL3A 3VOIA 1HJWA 1RH9A 4IMFA 4JY9A 3RRXA 1GVIA 4OWGA 4EXBA 1HKWA 5DMYA 1IV8A 1R7OA 1V02E 4D72A 5CG7A 4JZ5A 3NWRA 4RV3A 3RPDA 2HRWA 1EHNA 5F4XA 2DUZA 4RPQA 1ADOA 3WUGA 3FIGA 3T4WA 4O18A 2WBGA 1QPRA 5EGRA 3A47A 3C2OA 1NOWA 2G3IA 1BWVA 3W02A 1DIKA 2I9UA 3TXVA 1UKTA 4O0ZA 1H5VA 2XJ7A 2A3AA 3FVDA 4G7EB 2VI0A 5AC8A 2ICSA 1XCXA 2CBUA 3ARSA 4PYSA 4NI8A 3WUEA 4I9AA 4K1WA 3EWZA 1BSLA 3UF9A 1VQTA 1TCDA 3VM5A 1HP5A 1CCWB 5FA5A 1PWMA 2R24A 1VFUA 3WG6A 4CQ9A 3STGA 3RILA 5FAJA 4JOMA 4LF1A 4ZQPA 5F4WA 5IHSA 2P50A 2A5HA 4EF8A 2HNEA 4QSHA 1JFXA 1Q2RA 3EGJA 1W1TA 4CNPA 3U2OA 2VCAA 4KRZA 3IVUA 5CBJA 1AK5A 4DVOA 5GQBA 5H8UA 1DJHA 3ZT6A 2VXNA 3HU7A 3SCVA 1E4MM 3AS1A 1RHCA 4QEEA 2NUXA 3L4TA 3UGVA 3QV8A 4MG4A 3TQ0A 3CV7A 1O68A 1TSIA 1DE6A 3CLWA 2VX4A 1FXQA 3SQMA 1TWSA 3MTWA 2ZKMX 1RPKA 4Z0JA 1VCGA 2VEGA 4GJ1A 3I4KA 2OWCA 1I8JA 4WSKA 3H23A 1N8IA 1JEZA 3A24A 3MBDA 2QPXA 3H8AA 3L2LA 3GNOA 4UTHA 3BAXA 4O4WA 4D1JA 2HCVA 3ALGA 3QLDA 5C2CA 5CPLA 1WB0A 3NZQA 4UNKA 1FQ0A 5IDZA 1VH7A 3DHUA 1FFRA 2GSEA 1HGYA 1BD0A 4L64A 1Q8AA 1Q6CA 2GUBA 1DQXA 2BS9A 2G96A 4I90A 3MCOA 2G3NA 1V8EA 4PTWA 3RCYA 1XSIA 2GQ9A 3N2MA 1OBAA 1ODZA 4M82A 1IF2A 2E8ZA 3QVQA 1XLIA 4MKSA 2RHGA 3OZPA 4IMDA 4A8NA 4YVXA 2ZX9A 1JYXA 5I07A 4JTHA 1CX9A 1KTNA 4LVFA 1HKJA 3KBVA 5JIPA 1Q5MA 3PJXA 4JFUA 4KFPA 4UTTC 3MZNA 3UCDA 4V27A 3UETA 3ZWTA 1H49A 1JDDA 1Q63A 2JEQA 4B3ZA 1YRRA 4GYPC 4XAZA 4RX0A 3TLQA 3ZSSA 1B3XA 2NV9A 3WJSA 1LWHA 4YTRA 1AJ0A 4WVXA 4OV9A 1G4PA 1CB7B 1GOWA 3LYEA 2G3MA 4CNTA 2Y7DA 4XZBA 1KBBA 2E6YA 5D04C 1Q6FA 5HUOA 4QJ4B 3G5EA 3PWGA 4OT7A 5LIUX 4CEUC 4O1CA 3IGXA 1LT7A 1WZKA 4J3VA 4HPJA 2WM1A 4AF0A 1AL7A 5A5WA 2OZ8A 1K3UA 2RH9A 1FBAA 2C0AA 4O53A 6PTDA 1DTUA 1TTQA 4ES4A 4BY3A 3C3NA 1KNWA 4FLSA 3F5KA 1UD3A 1XIHA 1YBQB 2ZUMA 1HVQA 3OA5A 2OXNA 3WLHA 4CNNA 1OABA 2VEMA 1KRCC 5EBUA 5EBAA 1BSIA 1UROA 2RUSA 1XQLA 2E3ZA 4AEFA 4WOQA 4KEMA 3QF0A 4RXFA 3WLLA 2YZ5A 3STFA 1A3XA 3SFKA 5HA7A 3GYEA 1RPXA 4HA1A 4O12A 1IYXA 3UFYA 2A79A 4HZMA 4UFKA 4UQEA 4JTTA 3M5ZA 4RXGA 2XIOA 1KTCA 4JKKA 4FEZA 3MP4A 4W8BA 2E77A 5I3JA 1Q4NX 3ITXA 5C71A 2FZDA 1VHCA 3MP3A 2WYSA 1SO4A 3CS2A 6REQA 1IR2A 4C6CA 5I3FA 3OU8A 3Q4DA 4WQ6A 4HNVA 3THCA 3NDYA 2Z1VA 1Q66A 1PXGA 1OFEA 2J8TA 5KEZA 1TZ9A 4MY1A 4DF1A 2XSBA 4F0LA 1QNOA 3MA8A 4C6OA 4JTGA 1NH6A 4IXXA 1UH3A 1S2WA 1S2VA 2YYUA 1FWDC 1FCQA 2P3ZA 2F2HA 1QW9A 2ZRYA 4MKNA 1A53A 5CC6A 5JMUA 4GISA 4ORMA 2OT1A 5EMKA 3R43A 3EDJA 3S2NA 3QZAA 3AIEA 1BG9A 3KL5A 4YTSA 2ZZ4A 4H8VA 2PODA 3E02A 3QR1A 1HNYA 1V6WA 1E0VA 3TSDA 1VFTA 1H1YA 3H7UA 1FCUA 2EXOA 1FWFC 1P0NA 3WBYA 4Z1CA 2PURA 4Q4SA 2DDXA 3GUGA 3UXAA 3S6DA 4LS1A 2PU1A 4U28A 1GEHA 3K8LA 1KM1A 4FP1A 1ZRQA 4O14A 4UZUA 1I1XA 1KFWA 3GSMA 2PTDA 4Q6XA 2CLPA 2V30A 1EQCA 3VGFA 3NM1A 3G0SA 4Q33A 1QI5A 2FTWA 4DI9A 5FEPA 4IT1A 2CERA 2CLHA 3L12A 3LCGA 4GKTA 2EJ1A 3PC0A 2YSWA 4QNWA 4EPKA 1CXIA 3AUJA 1H63A 1ZHAA 3P67A 1IT8A 4QS6A 2PRMA 3S1VA 3KUMA 4B3LA 1FP9A 3CB3A 4KCVA 1HXJA 2XFRA 3OB8A 3UCCA 4BI7A 1YPXA 3M43A 4HTYA 3CL7A 1WXJA 2ZCGA 4JR5A 5EFDA 2BHUA 2OO0A 3VZZA 4CCZA 4Q32A 2QCGA 3QYSA 3H4WA 2WVSA 1S3TC 1V3MA 3SURA 1U1JA 3E49A 3P3BA 1BHGA 5TNVA 4GD0A 3IJ6A 3FA5A 3TTEA 3W7MA 3M5YA 2H90A 4B9YA 1XINA 4R7JA 3N2BA 3V16A 2Z24A 1NP0A 5G1TA 3AXIA 1R5YA 2YBUA 2IW0A 1PL9A 1PHQA 4J1OA 1KWGA 1X8CA 1XLMA 3UWYA 5H2ZA 4C6NA 3UCQA 1S2TA 2WQDA 1XXXA 3AIBA 3PZGA 3UXKA 1SW7A 4O13A 1UWUA 1PKYA 3CIWA 2G0WA 1J96A 3HPFA 5IHRA 4F66A 1XISA 3P81A 1XYCA 1NIUA 1Q8JA 3VNYA 4GQGA 1LZOA 1VB9A 3L0GA 4H9TA 1WUEA 1E5NA 2YX0A 2OKTA 3RK8A 2FFIA 3OQEA 4PTMA 3RR1A 3LS9A 2OX4A 3ONCA 1K8ZA 3CO4A 4C1NA 1XBXA 3W7PA 3GVQA 4GQ0A 2WZIA 4B5VA 1S5VA 1EGVA 3ITOA 2GDUA 4XZIA 1U30A 4XUGA 1M41A 3GC2A 1NWTA 3M47A 2FGZA 3FEQA 2FIQA 1OADA 5FEZA 5XIMA 4PGLA 1XGDA 2VRJA 2DV0A 5D09A 4U33A 1YX1A 4DBWA 4ZE4A 4NL1A 4OTKA 1W1VA 3ZIZA 3HGJA 3I7QA 4A05A 1J6PA 3NGFA 3MJMA 1UOZA 2VGFA 3GS6A 2Q02A 4M51A 3E0VA 4LVAA 2GWGA 1JGIA 1PDZA 4GYFA 4RDZA 3VINA 2V5JA 2O4QA 3W25A 1ZAHA 4L4PA 1QOQA 5I3IA 1GPWA 3B8TA 5DMMA 2DZPA 5DMLA 3VPLA 1QW7A 1LTDA 5A1AA 2Z00A 4ML4A 4B3KA 2WVUA 3B9DA 1PYMA 5C70A 4DWSC 2BVDA 2X1SA 6TAAA 2VOMA 2TAAA 4AVOA 4TO8A 1CZ1A 1P0EA 2QV4A 3BURA 3T2OA 1B4EA 3EOOA 2R1KA 5HMSA 1QTWA 3LTSA 4H2HA 3UNDA 3RN6A 2DEPA 4CQ8A 3DH7A 3QR3A 1XUZA 1XLAA 1O12A 5GJNA 2Z4GA 3B0PA 4AZHA 1WYIA 3NQDA 4DLMA 4W5ZA 2Y85A 3JRKA 3TJ4A 5G2IA 3TNBA 1AMYA 4XAGA 1QWKA 3AZRA 1UWIA 4IFOA 2DT1A 5LHFA 1LWIA 1Z7AA 3TA9A 4W85A 2Y24A 2ACUA 5LA0A 3NZ1A 1IIGA 4GINA 4GC4A 1W8SA 1RY8A 3THDA 4DJDC 5I3DA 3WH9A 3TLLA 4Y9AA 3VNIA 3K8KA 1OK4A 2WOQA 1W9DM 3NR0A 3HMCA 3HMJG 1UUMA 3KVMA 2PC8A 1A4LA 4PUMA 2QZRA 4TTGA 4JDYA 3MMTA 3S1WA 3KOYA 3PANA 2ZA1A 4EAYA 4HN8A 1TRIA 4QP0A 1MEWA 3WUBA 3C3UA 3S2CA 1ML1A 2W92A 1JVNA 5I02A 1E4IA 2PF8A 3S5NA 5LGXA 2J75A 3EMCA 3I10A 1HKVA 3GXTA 4O28A 1KRBC 3CAWA 4IMGA 4KCTA 1AA1B 3UZWA 1FY6A 4PMRA 2AGKA 4ZO6A 4NSBA 3NOYA 1CGYA 1DJGA 4MWAC 2X2GA 2PDJA 2VC6A 4DWSD 3CZJA 1ZSXA 3GK0A 3TQKA 2Q71A 4W9TA 3PTQA 5FL0A 4M7SA 4Z17A 1FWJC 3MBFA 2GVGA 4GUIA 1H09A 4XD6A 1CGTA 4YWIA 4OUEA 1E6SM 1R3WA 3GZAA 4R33A 2Y0FA 1XQKA 4JX5A 4GIYA 1R30A 2VELA 2WSQA 3FA4A 5DRIA 2OX1A 4X0VA 3NQ8A 4IMAA 1GCYA 4JPGA 1AH3A 2D3NA 4GMEA 4HPHA 4NJGA 1WKEA 3ECQA 4ZZ9A 2E5CA 2YB1A 4IP5A 4JFVA 1OX6A 1YDYA 4DI8A 1S38A 3PFMA 4DJDD 1U1UA 1PZ3A 4TVCA 4L61A 4J3SA 3WH7A 1E0WA 3CUJA 4JIPA 2YCJA 2OYMA 1M3UA 1M7PA 3LN3A 2EPHA 1F4AA 3EWXA 3QY6A 1K6WA 1IWAA 1EJWC 2E9BA 3CV1A 4JIEA 3UG5A 1TVNA 9RUBA 3GY1A 1RCQA 4C6KA 3KCLA 5I06A 2ZWYA 3DG6A 3O07A 2Y88A 5FSDC 3EYPA 3FDKA 1OCQA 2NV1A 3CMFA 5A6LA 3GNNA 1JI1A 2ODOA 1JF6A 3GH7A 2JKPA 1S5MA 3UR8A 1F61A 1GJPA 2WJZA 3II1A 3THUA 1JXKA 4LNCA 5HR7A 1I2PA 2Q8ZA 4DNHA 3MJYA 1HJQA 2OQLA 4O0QA 4FNSA 1E3XA 4GUGA 3BV4A 5G4WA 1MQPA 1KRAC 4MUPA 4MHBA 1SO6A 1CXEA 1EX5A 5LNUA 2VVNA 3WLPA 8XIAA 3B9EA 3LCIA 3ZVHB 3W82A 1C7SA 3TAKA 4LUTB 4L9ZA 1HG3A 2VC5A 3LU2A 2YGYA 1RXOB 3URNA 4EPBC 2NVCA 5M2FX 1DTNA 1SFTA 2C3ZA 2CXGA 2DVUA 1Z69A 1LM1A 4BHYA 1ZP4A 3BOLA 3TN3A 4IXHA 4Q8QA 4BQ5A 3REQB 2DJLA 3HPXA 2Y6ZA 4O19A 1EEPA 2AL1A 2I56A 5JQ9A 3RR4A 1QAPA 3GU1A 2VX6A 3IS4A 2AKZA 3DAQA 1TV7A 2ZQ0A 5DXXA 2R8WA 4K68A 5FOOA 3DI0A 1UOKA 3KRZA 4XVDA 1Q7ZA 3PBGA 4KESA 1LBMA 1GOOA 2A2IA 4P7QA 3CT7A 2FJUB 3M41A 2C18A 1TPEA 4IP4A 2ZUTA 4BCEA 1T8QA 3P0XA 1Q6RA 4HMNA 3W4RA 3W7QA 2VENA 3WK1A 1LRQA 1W1PA 3OYXA 1FWRA 1VJZA 2CLOA 4QAWA 3ARPA 3ERPA 5AHMA 3WLSA 1X7IA 2GFTA 5ABFA 1JZ5A 4JD4A 3FYOA 4UBPC 2WKJA 1E6PA 4DUOA 3BGGA 2AGTA 3YPIA 1BG4A 3MHFA 4LT9A 2NT1A 1YYAA 3CIXA 3ZWSA 5FCZA 1RSCA 3OBAA 5J5RA 2QCHA 5BXRA 2XH0A 3A3WA 1FWSA 1FP8A 4HZ6A 3H54A 4LX4A 2PD9A 2I5QA 3BC9A 2VMFA 3WEZA 3UU0A 4MB3A 4G56A 4B4HA 3MVIA 4PB4A 4UCGA 5CZTA 3W24A 2V81A 2C71A 4GVGA 2RGLA 2Y5SA 3GDMA 4XZLX 3AHTA 3KOWA 4LW7A 1ISXA 5CH9A 1FH7A 1G5AA 3KVLA 4W8AA 2JF6A 4CEXC 1QOPA 2UBPC 1XG4A 3DFHA 1QPOA 1S2CA 1M03A 4HOXA 4RUBA 3VIKA 3LBCA 2X1RA 4KMQA 1IZJA 2WMIA 1W9VA 1TWIA 4NAFB 4MYXA 1E70M 3L66A 3ABQA 2CZDA 3WLRA 5T26A 1KFKA 3LD5A 1EJRC 1E9YB 4L65A 1CGUA 3FYYA 5KETA 1KM6A 1QPQA 3ITLA 4LSBA 3EWDA 4WR3A 4LAKA 4W5UA 3P7YA 4FNQA 3N4FA 1K9TA 4AVNA 3DCPA 5LGZA 3N04A 4IX0A 2XIIA 4ZB5A 1QNRA 1EP1A 2OGYA 2OEKA 4JYDA 3PZUA 1M1BA 4QSFA 1WNOA 3WJYA 1E4LA 3DECA 4QRNA 2FH6A 1JCXA 3ZYZA 4Y96A 3B9AA 2ZRUA 4JY8A 4E2BA 4YVVA 1P43A 2IS7A 1ZAJA 2ZBTA 1GJWA 3RG6A 2ZRWA 3GAYA 1OC6A 4S38A 4RW5A 3KTXA 2V2HA 1O7AA 3L65A 4R53A 1E56A 3TJIA 3GR8A 3IANA 2GVEA 5FF2A 3R0DA 1QATA 2Y89A 4ZTYA 3P61A 3AJ7A 4BR1A 1ZB5A 1H7WA 1HW6A 3LTYA 4RK8A 3U9IA 3DFTA 4J3XA 3PBWA 4DAFA 3BL3A 3OIHA 3QY8A 2QUNA 2I5IA 2HVMA 1VBRA 2VFFA 1HJXA 3ENLA 3LQLA 3TZNA 1PKMA 3LGDA 2VQTA 1TTPA 4LXFA 3AZSA 2OLHA 2QJGA 4N02A 4TUFA 4CCCA 4P7LA 3OP2A 2WCSA 3M0LA 3AMKA 4XUYA 1OGSA 4AZCB 3QQ1A 3AC0A 3HFYA 3FN9A 1LWJA 1TCMA 4A2RA 3N6HA 3EDKA 2E5DA 4IFRA 3UD6A 3L5AA 1R6WA 2BXZA 3SJNA 1UG6A 4E8CA 3I6TA 3MPGA 5A8MA 2V3EA 3ITCA 2CZFA 1EOKA 4OV4A 2AMXA 4BA0A 1E1EA 3TYBA 4UC5A 4N2YA 1L2UA 5E9XA 2Z1XA 2GJPA 1MXGA 4AEEA 2CLMA 3MHGA 1EGZA 1ME8A 3WLOA 1BF6A 1X96A 3VUSA 5MHBA 1EB3A 3LXAA 3CJPA 2HTMA 1K4HA 3W1AA 3L68A 5CPQA 3XINA 1JZ8A 2ZUUA 3IIPA 4CD6A 1V3LA 3M0JA 5CJMA 4YXGA 5F2GA 4PUJA 3FEMA 1OX4A 3CWHA 2INEA 3VNZA 4TIMA 2W79A 3GUWA 3VMOA 1TZZA 3VC5A 2C1GA 1PSCA 2J7GA 1FFQA 3F4VA 1SM9A 3CEUA 1QJWA 4JTJA 2DU2A 4DLFA 4P7OA 1GKRA 4F0SA 3MWCA 3C0LA 2X0YA 3W73A 5SWUA 5AYIA 3GIYA 2Y8VA 1MZRA 2PI6A 3MANA 1NARA 3O8AA 3VKDA 3VOGA 2ZA2A 4MB4A 3VIFA 1VBGA 3V7PA 2ZIDA 1G1YA 1Z3NA 3I3DA 3UWZA 2BG5A 5J04A 4O57A 3UWQA 1H51A 1LUCB 5A2AA 4DM1A 2V5KA 3UZ5A 3W74A 5C5YA 3K13A 4NAEB 2QKFA 4EX4A 4DXVA 3A4WA 3SI9A 2VT0A 4D6JA 1UR2A 4E4UA 2YJQA 3QTGA 4AXKA 1XLFA 3T0BA 1P6BA 2ZTJA 3AAMA 3GX9A 1TPDA 5E70A 5GVJA 4IQJA 4XG1A 5LXXA 5D9MA 2BBFA 5EMYA 1B1YA 4Z1BA 5I5RA 5LIYX 1E4NA 4C5YA 3PS7A 2VNCA 1J12A 2QHAA 1XYLA 5G4EA 2BODX 1FWEC 2X1IA 4NG3A 2E9MA 1BYAA 4DM2A 1PEZA 1M53A 1B30A 3QH2A 4BJHA 3W27A 1EDTA 3KOFA 1WZMA 3D5HA 5H8PA 4O10A 2V2CA 3WMSA 4S3EA 3S2LA 4BQ3A 7XIMA 3B05A 5AYXA 2J7BA 1UR4A 2NX3A 1OFPA 1X98A 3N2CA 1QI0A 3U48A 4F0RA 1PPIA 3UZXA 3N9KA 1MUCA 3FAXA 1GZGA 4CLMA 4LEFA 4NJKA 2NQJA 2OZ0A 4I5RA 1HQTA 2J66A 4WDTA 2I7GA 3EB2A 3CUXA 1HT6A 3F4DA 3GW3A 3MUXA 1DWIM 1WKDA 3T44A 4D6FA 1D8WA 3DKLA 4IIFA 3F4WA 1FRBA 2PFHA 2FMNA 2XINA 1V3IA 4H6EA 3L5MA 2YLAA 4NQ1A 2QT3A 4C6MA 1A5BA 1C8VA 1TUXA 3LHTA 2QGYA 1X6NA 2J88A 3NEHA 3KRBA 2A21A 3THQA 1H7XA 3LV6A 4HHMA 5I0DA 1M7XA 1YW1A 4FMVA 4YL2A 2HBVA 4H9ZA 1SFJA 2QJHA 4OJYA 3TYCA 3W6LA 1K7FA 3R0UA 1KCLA 1WP6A 4I6KA 3R13A 1W3JA 3BAKA 4D6HA 3QQWA 4Z08A 1OIMA 3EXRA 3IJDA 4LAZA 1VLIA 5I3HA 5TF0A 3GC5A 4A21A 1GONA 2DPEA 3HG3A 3WQDA 4ZQCA 4BQ2A 2QVNA 2PDYA 2OOFA 2PCEA 1RQEA 3LHZA 2A7NA 4JTLA 4X9SA 4PC8A 3RCNA 4QQUA 4WX2A 2EPOA 3M0YA 2XFFA 3ARYA 4GGHA 2G37A 2FZMA 3CLMA 4N9BA 1AL8A 1EKOA 4X60A 1KM0A 1BKHA 2DSVA 5GNZA 1TVPA 4JAWA 4GIRA 1DQUA 4ACZA 4BKNA 3PJTA 1KV5A 4UTJA 3S9IA 4QLJA 1S39A 2DZTA 4DQWA 1KFJA 1J0JA 1QU4A 7ODCA 3S6OA 1B54A 1TPB1 3RIKA 2FDMA 2W5FA 3FXGA 4NJIA 4NUWA 1TMHA 4J7RA 1K9FA 2XZ7A 3W1LA 3HG2A 1RK5A 2C19A 2DZVA 2CLFA 1XYZA 1V0NA 3LXBA 1XPYA 2ISSA 2BV9A 3GXDA 3OLEA 4RCXA 1CENA 1T41A 3EWBX 4A8RA 1PTDA 2ABAA 7TAAA 1JFHA 3VX0A 4CVUA 5BRPA 1ZJIA 3F1QA 6ALDA 1VHNA 1UR1A 3C2VA 5CKSA 2PTYA 3VGDA 1FWIC 2WPGA 2BWGA 2C1IA 4W4QA 1XFBA 1L8PA 3QMSA 1IT0A 1AW5A 4EOUA 1SZRA 1UJQA 4L4MA 1E9ZB 2GOKA 4ADSA 4W88A 5CZSA 4OUIA 4B5UA 1JNDA 1GTHA 3M0MA 1ZGDA 2HE8A 1EHAA 4BI5A 5A2CA 4PMXA 4K7VA 4XTDA 1CGXA 3H26A 3UEQA 3ID7A 3NQEA 4LRSA 2WC4A 2PDHA 4MF4A 3A21A 5I3GA 4WY0B 2X1TA 1B5TA 3P80A 1JZ7A 4XSLA 4Z42C 1H7PA 5FF3A 4MDPA 3DERA 2CLKA 4G7FA 2WNZA 1B9BA 1DPMA 1C9DA 3A4AA 2XH2A 2AOSA 2J9XA 2X7VA 4KF1A 2HISA 2J77A 5BWAA 1ESWA 3W2NA 4JTUA 3P14A 4IQEA 1F4HA 1QCWA 1KXQA 4MNLA 2IKJA 1MMFA 1XC6A 1UR0A 1DEDA 4GZEA 3VGGA 2YB4A 1VJSA 4OOZA 2NUYA 4LBSA 5LNWA 3BSHA 1UP0A 1OVDA 4NF7A 4AZGA 3GXFA 1UKSA 3T78A 4DJEA 2CWXA 3G1XA 4CCEA 2NLYA 2Q01A 1XGEA 1F05A 3W7EA 3VIOA 2QUVA 3TAOA 3KBJA 3BQ5A 2Z2UA 4JEQA 1FDJA 3BWWA 5FJIA 1LL4A 2BASA 3NXLA 3RRAA 3O0KA 1JZ6A 4NILA 4HNCA 1M7JA 4C91A 5D05A 3NTYA 3S5SA 1CLVA 1XIIA 3WK2A 5E6YA 5G2HA 3GXNA 1AMKA 4PB5A 3U6WA 3SCSA 4FI4A 1MW2A 3H22A 2ESCA 3MUCA 1QBBA 2R91A 4XZMX 3GG7A 2CHRA 4H2CA 5C54A 4R7WA 4Y7EA 3QGVA 1XLLA 4PMUA 3SZ8A 3G6LA 4IIHA 3CT2A 4JKMA 5C7VA 3WENA 4MWAE 4RR4A 3BW4A 3TMLA 4AW7A 4IH3A 5C8BB 2VOTA 3GE7A 4LYPA 2VRQA 4UTWA 3U4AA 1ONXA 1BVNP 3BCJA 1S1PA 4AZ5A 1JDFA 3SEPA 1WKFA 3S2JA 3ARZA 3HTWA 1U5VA 4NYYA 3OBEA 1EO5A 3PJUA 4UMAA 3R1ZA 4XV0A 1UMLA 3UP8A 2E0PA 4D2JA 1KFCA 3NPUA 1B31A 2ZDRA 2DZXA 2Q6ZA 3A5VA 1XLKA 2Z2BA 1I9CB 4WGHA 3GAKA 3KBWA 3IJ7A 3R94A 3WJWA 2V0TA 1KLYA 3SGGA 1DJQA 1F3EA 3EB4A 4DB7A 1PYFA 2WMGA 1PKNA 2OCZA 3AMDA 4IFKB 4JN7A 4FLRA 2F7FA 3RX3A 4NYUA 1CTNA 2WJDA 4FK9A 3STCA 5HNRA 3HZ3A 3SN0A 1I2OA 5DLCA 1V7AA 3G0UA 1XH1A 2V68A 1FWTA 1W3TA 3D3AA 1AZ2A 1GQKA 2PWDA 2QAFA 4H1ZA 6CGTA 3B04A 4G5DA 5FF4A 3VO0A 3GDLA 3QHOA 1K70A 1U33A 1ODUA 1TE1A 1XIEA 3QV7A 3LTPA 4OKDA 4JCLA 3NO5A 5EMLA 3V5FA 4DY1A 3EKZA 1T99A 1GVEA 5E0CA 4GUJA 1OEPA 2YDQA 4MMWA 1OB0A 3BK0A 5A8GA 5FJPA 4DHGA 1NFPA 1UASA 1L8NA 1IQ8A 2Y1HA 3BG5A 1PBGA 4I7WA 2WKGA 4Q4OA 2GUYA 3ELFA 4XAYA 2H8XA 5HANA 4CQDA 3G1SA 4DO4A 3QV6A 4HSOA 3B8SA 2GSJA 4ATWA 3H12A 3M0KA 4HQVA 3A4JA 2ZZ2A 2CLEA 3LRKA 3QMRA 4FNUA 1GGOA 4PSPA 6TIMA 2HVOA 4XD5A 1EUAA 3RLGA 1P1MA 3DU0A 2OEMA 3O2LA 3SQSA 5AB3A 2EEXA 2WC3A 3CHDA 1EDQA 2YCLB 3KS6A 2FZNA 4F2TA 3VD3A 2QCDB 4PUDA 1A4MA 5KZMA 1E71M 4DUVA 3KE0A 4C90A 1L6GA 1W91A 2QCNA 5GJPA 2XWDA 5M03A 1XRSA 3DGRA 4ICNA 1MUMA 2GGJA 5C9UA 3NQGA 2ZUWA 3DKJA 1X38A 1O5XA 4F79A 4JCMA 1UIOA 3DFPA 2XIBA 2CKSA 3CAQA 1OCNA 1KR0A 2AL2A 3M6YA 4HA0A 3W7GA 1B3ZA 3M5VA 5JXQA 3VGHA 3ITYA 4H7CA 4IGMA 4I5UA 4BF9A 4DJFA 3TK7A 2FPTA 1DJNA 4XISA 5HULA 1V03A 1I2RA 2REQA 3W7NA 2VD9A 3WD0A 3VD7A 3AIWA 3WL0A 4UCFA 4J3UA 3UY7A 3VX1A 2OJPA 3DC8A 2VC7A 4LB3A 2CZEA 3ATZA 3VCCA 3IVTA 1DXEA 2OFJA 3OOQA 1TE6A 3MVTA 1TWZA 2E1WA 1H61A 3HFTA 1X97A 4WOZA 4UOJA 3HQNA 3I65A 1JZ4A 3WEMA 4RE2A 3VNMA 4Q4KA 4TMBA 3M1ZA 3V35A 2QULA 2YKKA 4WEVX 2WZTA 4RV8A 1NDWA 1KGWA 1JUBA 5DY2A 3BLEA 2IPJA 4O4VA 3H7VA 2YR1A 4H01A 2XSAA 3GTHA 4AH7A 2ZDSA 4JYFA 4K7YA 4US5D 1J5TA 1QI2A 3V5CA 1W1ZA 2WQPA 4QQ3A 3S8HA 1Q45A 2EG6A 1QMLA 3VMNA 2BY1A 3DBNA 4E2OA 3MYOA 2FVLA 3SSJA 1U5JA 4HZ7A 1BTCA 2QIWA 1F5ZA 2PE4A 1P7TA 2PTXA 4M1BA 4Q8MA 1TO3A 1PTGA 3RM8A 2BB0A 2VGGA 1DWAM 1T96A 3NPXA 2WHJA 1K9EA 4LCQA 5CSYA 3GFXA 2X30A 2H9AA 3WDHA 4PSRA 1Q7QA 4L4OA 3LOTA 4XSMA 1R38A 1N82A 4GA8A 3EOLA 2QCCA 7CGTA 4XO6A 3KW3A 2C79A 4ERAA 2V2DA 4HU8A 1MO0A 1D8CA 2GL5A 2PTZA 1LBFA 3AYRA 4Z2JA 2ZUVA 2PDKA 1W0MA 4FXSA 2J47A 4M8UA 3GIQA 1G0CA 2PZNA 4EACA 5JBDA 1UBPC 4FR6A 1IZCA 1ZUAX 3JW7A 2IMRA 3GKFA 2W62A 4JIRA 1UQZA 4H6KA 3WYZA 3O06A 1ICPA 1HIZA 1QFEA 1EPVA 3T4CA 4DO7A 2I14A 1TIMA 5U4NA 2ACSA 2VWTA 3QR0A 1Q6QA 1U2YA 2EPLX 2X1UA 3PB2A 3WF3A 1AD4A 3W07A 4QJ1A 6XIAA 1PAMA 3HB9A 1XW8A 2Z6JA 5CPOA 2ANUA 3TW9A 3HPZA 1FH8A 3QPEA 5LA1A 4B91A 3TWAA 3EKLA 3EWYA 3W2UA 3ARUA 1U22A 2E6DA 3WO8A 3BDKA 3KRSA 3M4HA 3AYSA 1NF7A 1VGAA 3NVTA 4FZIA 4JL2A 4RKAA 1UQYA 3LHWA 4U2YA 4IJRA 4M80A 4QEHA 2QF7A 1GNXA 1F73A 3DDMA 3AXHA 1TQXA 3AIRA 4KRUA 3MDWA 5DBUA 3PWAA 1DWJM 5C9RA 4AD4A 3W7LA 3DFYA 3KFTA 4KWWA 1J5SA 2D0GA 3O6YX 2R9RA 3S6TA 1KA9F 4R27A 3TR2A 4AFYA 4NX5A 1SVDA 1GVQA 3PG8A 2CYGA 1B3OA 4GQBA 4FXRA 3WIJA 3R7MA 1EC7A 4ZQNA 4BF7A 4G1KA 1E72M 4DX3A 1KFLA 3W2LA 3ZVIA 2EQDA 1H3GA 3CBWA 4C1KA 3VK5A 1I2QA 4FF7A 3WDPP 2R1MA 3K46A 2WNWA 4GJIA 5GJMA 1K8YA 3WJXA 4KQNA 1QDSA 4J28A 5A6BA 3AQUA 1FCVA 3W28A 3UG3A 4KPLA 4Y9MA 3OO2A 4WDWA 3MZ2A 3LPFA 3LV5A 3CWNA 4AX7A 5HPOA 1FUYA 4ZSUA 4DRSA 1PUDA 3OW1A 4LUIA 3VOJA 1FWNA 4UWMA 3IWPA 4ECLA 3VKKA 3KL0A 4UTFA 4RDVA 5D8ZA 4Q8TA 3SRKA 4L1WA 4FIRA 3N29A 1E9IA 1THFD 5I79A 1OFAA 1J0YA 2DT0A 1IXQA 3C8NA 4GZJA 3FDGA 1ZPTA 3C0QA 2JALA 2OOGA 5HJXA 1PWLA 4GIAA 3NL3A 4LUSB 5GNYA 3L4WA 1KRMA 1DKWA 1K8CA 4GVIA 3TFXA 3TR9A 3NPVA 4WZHA 7A3HA 3VNLA 3SAZA 1JULA 9XIAA 1A50A 2B31A 1VYPX 4U3CA 2D20A 4YVPA 4ZA0A 4CNSA 3M5XA 3EXTA 4QG6A 2XPKA 2TPSA 4H9XA 2BDQA 2R94A 2Z6IA 5HR6A 2E5BA 4XWUA 4MKVA 2ISVA 4WSHA 4GNKB 4HKPA 2GVYA 2O9RA 4FB7A 1H7OA 4QS5A 4GZIA 4AEOA 4A8IA 4JIQA 3OTRA 3MKCA 2X0SA 2OU4A 3MS8A 1Q7MA 3TTYA 1H1ZA 1W9PA 3P8JA 4DN1A 3W7IA 3LHUA 3T8QA 3LLDA 1KBIA 5TD4A 1A49A 5L9FA 4BWLC 2IXVA 4YHEA 4Y9PA 1JZ2A 1VCVA 2E40A 3LI0A 1FHLA 3RGTA 2Y7GA 2AQVA 2ATSA 5DT7A 4MNKA 5RUBA 3T1GA 4PBGA 2P8CA 1NWRA 3P62A 3LLXA 1YE4A 1TA3B 3SFWA 2PB1A 4FALA 3MYPA 4GFIA 4MLJA 4LAMA 1IEXA 4HPXA 1TPVA 3HGSA 5CC3A 3WK3A 1UMYA 2GVLA 4PCNA 3S83A 1C8QA 4O1BA 5MF5A 4HA4A 4JFSA 1Z44A 4AD5A 1DXFA 1JDAA 1OCJA 1SO3A 5DX7A 4I7VA 4HYRA 4JXCA 3IJQA 3PSVA 4ERGA 7PTDA 4XQ6A 1MDRA 4DBEA 5B7ZA 1XYAA 1G6CA 1XBYA 2QR6A 4PMVA 1W31A 5KTLA 4I6VA 2C8NA 3QPYA 4GI9A 1XDMA 1VFHA 1MVYA 2GGHA 2Z25A 1AH0A 1H0GA 2Q09A 1OM0A 1QVBA 4M56A 1YNQA 3QKZA 1NP2A 4S3CA 1NOUA 1VPXA 1R2RA 4G2DA 1KW1A 2PDXA 1JG9A 3G18A 1AD1A 3T9PA 1W1B1 2G50A 3PBVA 3D6NA 2GZXA 3V36A 2VX7A 4X3ZA 3G1DA 2V82A 1BVWA 3CZ8A 3WLNA 1POJA 5CC7A 5ABGA 2WMHA 1UZ1A 4Q7IA 3SGUA 3K1DA 5I23A 1NFGA 4HOWA 2VFIA 3CTTA 1XRFA 1YPIA 1WDDA 4HHLA 1XF0A 2XIQA 3OPSA 3MDUA 4KWOA 3CHEA 1K8XA 3T0TA 3TDFA 1QR7A 3FX4A 4CN1A 2QUMA 3WK0A 4WDXA 1J6OA 3UZJA 1GYNA 3BAJA 3CMGA 1E0XA 1XLBA 3D47A 1KXVA 2AKMA 1J0IA 4CKQA 3XIMA 4JN6A 2Y8KA 1GOKA 2ZX5A 3UYIA 1XLEA 4P8XA 3WFLA 4IHCA 1GOIA 2I9EA 1UH2A 4PMQA 4FXJA 1JYNA 2CPUA 4PRTA 4J3TA 3TROA 3EWWA 3C86A 3DYPA 1JCLA 4Q8PA 4AU0A 2Z7GA 1R9XA 4E3VA 1WV2A 1J18A 2QYGA 1EH9A 5BW6A 4EK7A 1FDYA 1IEQA 4MIMA 2DIKA 1E5JA 4Q7BA 1ITXA 1H62A 1Y7VA 3V1PA 4QLKA 2BFGA 3G1RA 2QS8A 5JU6A 4RZ5A 4NIRA 3UWWA 4O8AA 4IWWA 1MRAA 2BVTA 3I7SA 3G1FA 3BSMA 3ZZ1A 1BGGA 2CKRA 1BFNA 4NXKA 4AIEA 3VOCA 3W7RA 2WV8A 2W4XA 5CG0A 1FA2A 3TCSA 3OBKA 2B7NA 4ZXLA 5DY3A 2PDFA 4M29A 3SUTA 4H83A 2ON3A 2WLYA 3IRSA 5EB8A 1VPYA 1VEMA 3K1GA 3W7DA 4J5NA 4S2BA 3UPMA 1KXTA 3WJZA 1TG7A 2FTPA 2DQWA 2EPMX 4U5KA 4JFWA 3PPGA 2Y2WA 4HU3A 2PDUA 2NW0A 2OLAA 4B5TA 3A3HA 3S5YA 2DH2A 3ATYA 3A13A 4OVXA 3V75A 1LYXA 4D71A 2WVVA 2R1LA 4JDBA 1PZ1A 2XN0A 1ZU8A 1JRCA 1KQZA 2FHBA 4WDUA 1TWDA 1C93A 4GX8A 1XD1A 4R7OA 3SW6A 3FJNA 4UQCA 3POCA 3HJZA 1IR1A 3RMJA 1GYLA 3G24A 1ONEA 2Z29A 3MHUA 4B15A 3SR7A 3N4EA 4EPEC 5BXSA 3GH5A 1EEXA 2EAWA 3I3EA 1D3HA 2E6FA 1CECA 4IP7A 1ZP3A 3WLMA 4LV9A 1O5QA 1QPKA 3AWNA 1ITQA 3W01A 3SCRA 5ECUA 2FKPA 3LM7A 2PDCA 3SSZA 1ISZA 2OYLA 2QJJA 2C91A 5J8LA 4FLQA 1V6YA 4GVFA 1UD5A 3LZ5A 7REQA 2A3CA 4AF0B 1YMYA 3QBUA 4MY8A 4O1DA 2HDJA 4LC8A 4U31A 1VZWA 5B80A 3R0KA 4XKYA 1W6TA 2YA1A 3DFOA 2WNQA 1AJZA 2ZUSA 1D7FA 2RJGA 4IF2A 4URIA 3SCTA 4A4AA 1QO5A 5DANA 4ZO7A 4ALDA 4ZMGA 3CYVA 3C6CA 3W26A 5CC5A 1EBGA 2GOUA 1ELSA 3OVRA 4D6CA 3CV6A 5D2TA 3AISA 1V3HA 3EKGA 3LG3A 3G6MA 2G95A 3GH4A 2QPSA 1Q6EA 3SB0A 5LIKX 4M0XA 3MY9A 3WNOA 1PO9A 4LFYA 4C6IA 1JF5A 2P1FA 3ZR5A 4ZBCA 4ERIA 2RDUA 2WVTA 2YBVA 3URBA 4A8LA 4I3GA 3G1YA 4JYEA 4A3UA 1DBTA 4HD5A 4UTUA 1P1XA 3GG8A 4C7FA 3SUSA 5A6KA 4D6EA 1DIOA 1XLCA 3T05A 3WQWA 1CWYA 1ALDA 1ZY9A 3TVAA 4PH6A 3UQNA 4KEVA 4LS2A 4QBXA 3DHDA 5ENLA 6REQB 4NHVA 1SR9A 1WBJA 2KZHA 1UIPA 4FPSA 1I6NA 2HK0A 3KRUA 4DYKA 3E74A 1SW0A 5F2LA 4IISA 2V5DA 3VIGA 3N4AA 1UWSA 4NNCA 4AZ6A 2P0IA 2WCAA 1QT1A 2NXGA 3W29A 1GT8A 2ZADA 1FWHC 3WNPA 3ME3A 4AYGA 1OINA 2PGEA 1KFEA 3LY0A 2XVLA 1DIDA 4MPQA 2TODA 2YW3A 1B4KA 4CU6A 4GXWA 1N55A 3STEA 5DFAA 2GQAA 3TKFA 5HWMA 3GNDA 4ZOAA 4RE0A 2Q3OA 3UVAA 5A94A 1IZKA 1SFLA 1TV3A 4TOQA 3SM0A 3HGRA 3R89A 2WO5A 4JL1A 4QAIA 4I8YA 4KWVA 3Q37A 4F0MA 1J0ZA 4IPIA 1A5KC 4OBTA 4ZB2A 1YKWA 4DF2A 1C8XA 3M07A 2Z28A 1Z9AA 5T9BG 2IQ0A 3WDJA 4P8WA 4H4IA 2O56A 1MEHA 3FSTA 1BRLA 1KBLA 4HZ8A 1WAWA 4GZ7A 4RZ4A 4IJBA 1DL3A 4LYKA 3MU7A 3GHRA 1BYDA 3S9YA 4Y8EA 4S3FA 3ZFHA 2VD8A 3AZTA 3C8FA 1WDPA 2Q8LA 3CTLA 3WNLA 1JUKA 1JCMP 4R88A 1KKRA 1K6AA 4S39A 3GXIA 2D22A 3HV9A 3HQPA 1R3QA 4JTKA 4DPPA 4QXIA 2F6XA 2R82A 1TRDA 2C1HA 1V5XA 3NNTA 3CU2A 3QMTA 3C0JA 3ITVA 3IUIA 3MB9A 3DN5A 4MPKA 3CMJA 4Q4MA 3SQLA 4QTGA 1HVXA 1LQAA 3WH8A 3RM9A 4HNUA 1EBHA 1JNEA 2PBGA 2J7EA 2X0HA 4FLOA 1RZMA 1AFSA 3CK5A 4QLLA 3F4NA 3T2QA 1R3SA 2GJXA 3H53A 2EBNA 5F4SA 3NUKA 5BRBA 4JHZA 3K4WA 1RJQA 4O1FA 4YU1A 1O66A 2AQWA 3VABA 1HKKA 3WDRA 1KM4A