4AY8A

Semet-derivative of a methyltransferase from m. mazei
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
340
structure length
339
Chain Sequence
DMSEFTLKTRLLAALKGEPVDKVPVCSVTQTGIVELMDVVGAPWPEAHTNPELMAKLALANHELSGLEAVRLPYLTVLVEAMGCEINMGTKNRQPSVTGHPYPKDLEGAAVPADLLQRGRIPVVLEAIKIIREKVGPDVPIVGGMEGPVTVASDLVSVKSFMKWSIKKTDLLEQALDIATEASIIYANAMVEAGADVIAIADPVASPDLMSPDSFRQFLKSRLQKFASSVNSVTVLHICGNVNPILSDMADCGFEGLSVEEKIGSAKKGKEVIGTRARLVGNVSSPFTLLPGPVDKIKAEAKEALEGGIDVLAPGCGIAPMTPLENVKALVAARDEFYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLCOBALAMIN\: COENZYME M METHYLTRANSFERASE
publication title Structure of the Corrinoid:Coenzyme M Methyltransferase Mtaa from Methanosarcina Mazei
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Transferase
total genus 117
structure length 339
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.1.1.247: [Methyl-Co(III) methylamine-specific corrinoid protein]:coenzyme M
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 4ay8A00
2Q6ZA 1R3VA 1U1UA 3L7RA 3GVRA 3PPGA 1U1HA 1R3RA 1R3QA 3RPDA 4L65A 2NQ5A 1U22A 1J93A 4L6OA 4WSHA 3GW3A 3PPHA 1XDJA 1R3WA 1XPGA 4L5ZA 3GVWA 4AY7A 4L61A 4AY8A 4ZR8A 1JPIA 3GVQA 1UROA 3CYVA 3PPCA 1R3TA 2Q71A 4L6HA 1T7LA 1JPHA 3BQ6A 4ZTXA 1XR2A 3GVVA 3BQ5A 4QQUA 4ZTYA 1JPKA 1YPXA 2EJAA 3T0CA 1R3YA 2INFA 3PPFA 4L64A 3GW0A 1U1JA 1R3SA 4EXQA
chains in the Genus database with same CATH superfamily
1EP2A 4ALDA 4ZE4A 4YCOA 3BOLA 3H7UA 1IEWA 4N9CA 4AY1A 4XZHA 5HMFA 1TSIA 2A3AA 1KB3A 3CAVA 1UP0A 2X1RA 3IJ7A 1ESWA 1S2AA 4RPPA 3TN4A 4UQBA 3UPWA 4I90A 4A8NA 5EBUA 3F2DA 1OYBA 1QNVA 2XFYA 2ISFA 2CCRA 1Q5MA 3ES7A 4TOQA 1TRIA 1S5WA 1RJRA 3SJNA 2VX6A 1B3YA 1IXQA 5CSYA 5LA0A 1EJ7L 3KTXA 1HJUA 2XFWA 1C8QA 3KVMA 3NZRA 1SZNA 3KL0A 4I6KA 5ABFA 1GVOA 5D09A 3WQ4A 2QR6A 2WHMA 1Y65A 4FSAA 3BCJA 4PR4A 4PSRA 2P8CA 3W70A 3GYEA 3V7PA 3N04A 1TPDA 2Y7GA 1F6YA 3O3RA 3VOJA 4LVBA 1KQYA 1F74A 4ZFMA 2QJHA 3MUZ1 5HULA 4W7UA 3AICA 1NSJA 4YTTA 2VEKA 1UWRA 3UG8A 4I7UA 4LV4A 4S3AA 3NQ8A 3EYPA 3T05A 3L2LA 3G24A 1DXIA 2NWSA 4S2BA 3RLVA 1YNYA 3WLHA 1GVRA 3PUOA 3S4TA 1CDGA 2PWFA 4JL1A 4K68A 5C2CA 4ZOCA 2ZVIA 2PDGA 3ZMRA 5F4SA 4MJMA 3PZNA 5CEWA 4NXKA 4L5ZA 1JZ6A 1AH4A 1TTPA 1OF6A 7REQA 1TA3A 2NVAA 1RALA 3VKCA 1B54A 1K7EA 4UTWA 3FN9A 1OEPA 4YYCA 3C2YA 1KA9F 3VD4A 1UOZA 2VFGA 3MBDA 3DERA 4XD4A 5JBFA 4O19A 1I2PA 1H0GA 1UKTA 1GVYA 2Z2BA 2BHUA 2ZBTA 5CGTA 2KAUC 3MCOA 3ZS4A 4N9EA 4BEUA 3M5VA 1EF2A 3BMWA 3KOFA 3UZ5A 1IEVA 4N7QA 2Z29A 3MZNA 4IPIA 3OG3A 1NEYA 1FWEC 2DW7A 3WZ0E 4ZQNA 2JF6A 3ITGA 1LBFA 3BAJA 2F6UA 3BQ6A 3ZXWA 3TJIA 1H7PA 1XM3A 1H7NA 2OLHA 2IPFA 2E5CA 3HBLA 5AYIA 1ZPTA 1AQHA 2EG7A 4QQ3A 3DFOA 1E51A 4WXYA 3KAOA 1VFSA 4UR7A 4FLQA 1MDLA 1QI5A 4MB3A 1REQA 1UQZA 2ZA1A 3HOJA 2V3EA 3UWUA 4ZVJA 1W1VA 3QGAC 3E3HA 4FLSA 3W87A 2Z26A 1JXJA 4LVFA 4KWUA 4G9PA 5C7HA 1LQ2A 1QJWA 3T9PA 1EHAA 3I6EA 3GIPA 3UPBA 1KRBC 1KM3A 2O9RA 3QHMA 3KBJA 4XTDA 1HKKA 2ABBA 1IT7A 3AMCA 3WDIA 1WP6A 3TTYA 5K4ZA 4MZ1A 1E0UA 2VFIA 3GTXA 5IHSA 5D04C 3PK7A 4KF1A 2NQJA 2VEGA 2QV5A 3QKZA 2REQB 3ANYA 2R94A 5CPNA 1VJSA 3G5EA 1CBGA 4IT1A 2QPSA 1SR9A 1UKSA 1OQFA 3VGGA 2WC3A 2QJGA 9XIAA 5EMUA 1IXNA 3DZ1A 5DT5A 2BY2A 4RV8A 3GXDA 4L9ZA 3L21A 4TVCA 3NVDA 1MWOA 2P50A 4Z0JA 2R1MA 1GQNA 1NELA 3NXFA 4QE1A 1E40A 2XM1A 3OO2A 3R25A 5CAKA 4FLOA 2PS2A 4UFHA 3HMCA 3OLGA 3QZEA 1OINA 2PA6A 1TZZA 4XD3A 1W5QA 4NP7A 2GJLA 3W28A 3TOPA 4HZMA 2FPVA 2HVNA 4S3DA 4RZ6A 1VJZA 5HQEA 1KLZA 1W1A1 2VMFA 3W7GA 4B5WA 2J6VA 2ZWZA 1WXJA 1VKFA 5AHFA 4ZOBA 2BV9A 2ZE0A 1KLYA 3R1ZA 3GX9A 1NF7A 2C19A 3SIMA 3LMZA 3EKLA 3ABZA 1EJUC 4CCEA 1JGIA 2YDQA 4IIEA 4PRTA 4IGMA 2HBVA 3JU2A 4E8CA 1EPVA 1UWAA 3PZ9A 3W71A 3IAQA 1DKWA 3TTEA 5I78A 2ABAA 2WMGA 4UQ9A 4X60A 4M6UA 1E0WA 5KMYA 3IPWA 4WJ8A 1F3WA 1A47A 2VC6A 5CZKA 2O9TA 3KEHA 1KBKA 1HJXA 2X2YA 1B4EA 2P3ZA 3WJYA 1E3XA 3CL6A 1B3OA 1SO3A 3PJXA 4S3BA 4HHMA 4LTSA 3C56A 1G7UA 3WJSA 4Z2IA 2WZMA 1HL8A 4BF7A 3LHYA 3BUVA 4IL0A 3DFSA 4AUBA 3ZFHA 5JXQA 2ZRUA 5KZ6A 3ES8A 4ZQCA 2OCZA 4W85A 3W7IA 3TR2A 3V35A 1BSIA 5D2YA 4CEXC 2Q09A 2Z00A 5FD0A 1FY6A 2HXUA 3VIIA 1ITXA 2I1OA 1LL6A 3TCSA 4P2VA 2Z1VA 3SUUA 1A5LC 4ATDA 3UR7A 2YPIA 5C5YA 4DUOA 1WZKA 4YYFA 1Z7AA 1TWWA 3FJ6A 1A50A 2W67A 1P5BA 2CLIA 1UC5A 4H8NA 1D9EA 1XBZA 3F1QA 3CEUA 2DZVA 2V38A 1XLBA 2FVKA 3IJQA 5HQMA 1JCJA 4Q4RA 1W91A 5E09A 3DENA 4ROPA 3WH5A 3AXHA 2DGAA 4IF2A 2V5KA 1Q66A 3W1AA 2O9PA 3M5YA 4GY0A 1KR0A 4MWAB 5D9PA 4S38A 3D46A 4CU6A 5CSSA 3W9ZA 3ARZA 1VBJA 3NM1A 4K1GA 4O53A 5C8BB 1XDMA 4ICMA 3OZYA 4ZTXA 5HK4A 1MQPA 3G1YA 3N17A 2V5JA 3CS2A 1V3IA 1QO2A 3F5JA 4GI4A 1MXGA 4AZ5A 2WZIA 4QE4A 4E0CA 3CNYA 1DJIA 3RLGA 3MP4A 1IR1A 3FGCB 1PAMA 4E8GA 4UQCA 3B9OA 1OCNA 4GC4A 3VKKA 4ZZ9A 1FBAA 3OZMA 5FJPA 2YDRA 1G94A 5J8LA 3XIMA 1IIGA 4IQLA 5CPTA 5FJIA 1XLJA 3GIYA 2BSLA 4DWDA 4MF4A 3NPVA 3CYVA 1KD0A 4OUEA 1E6QM 1KM0A 3CL7A 3VKBA 4LBUA 2J66A 2D3LA 2WMJA 5K2ZA 4PEKA 5CZSA 1ECQA 4XQ6A 4GZIA 5G2HA 4LSBA 4Z17A 3NQFA 4LH8A 2QZRA 2VEMA 2YYTA 3E5BA 2NQHA 3PUGA 2ZUSA 2QIWA 5BU6A 2GSJA 3T4WA 3VD3A 2Z2UA 3U57A 3CT2A 3WUEA 4DYEA 1OBAA 1R2TA 3A4AA 1BKSA 4E2BA 4N02A 1CXKA 1GPFA 2WHLA 3VFLA 2OT1A 4UTFA 1KXVA 1XLMA 3GFXA 4O4WA 1ZS2A 2VCBA 1FUYA 2HS8A 2CLMA 4F2BA 1NAL1 3QF0A 2PODA 1V93A 4ZE5A 4LY4A 2W66A 4ZQRA 1NU5A 4HYRA 2C16A 1TMLA 5A6TC 2ISSA 1O1HA 1Q8AA 4NAEA 3GNPA 4JL2A 1XYMA 1ZAJA 1MRQA 2QUUA 3T0CA 4PTNA 4WKAA 3WD2A 2DIEA 3SCOA 5PTDA 1QPOA 3HQ1A 4XBJA 5FSEC 1OABA 3Q2DA 2A7RA 1R46A 4GZEA 4R33A 4V2XA 2QUVA 3L4WA 4CVUA 3OLIA 1BYCA 1XW8A 2E77A 4Y9AA 1HF6A 4CU7A 3QHOA 2D73A 3NDZA 3QPEA 4ADUA 4LUIA 4NKCA 1A3HA 3RGTA 1E1CA 1R0MA 2XPKA 3CIVA 4Q8UA 4MZYA 4AZBA 2XSBA 2FVLA 7A3HA 4MNLA 2V2HA 1NWRA 1RXOB 1US3A 2MNRA 3UF9A 1EJSC 1EZWA 8TIMA 2O92A 2AL2A 2GZXA 2TYSA 1F6KA 3L66A 2A21A 3QFWA 1K4GA 5KZMA 1A4MA 3PTQA 2V3DA 1CGUA 4UC5A 4GD0A 1JVNA 1W5OA 3WBYA 5CXPA 4PMUA 1GW9A 3AALA 1WZLA 1O5QA 3LY0A 4PMNA 3F4VA 1WOBA 4YJ5A 2WBKA 3GXMA 4S3GA 3ARYA 1P6BA 5I3GA 1L6GA 1UJPA 4LWWA 1R3VA 3IK2A 4H6KA 3HQNA 4D1JA 1SZFA 1PYMA 3V3WA 4LUSA 2JEQA 3U3HA 2NQZA 4PBFA 3VINA 2OVLA 2O56A 4CNTA 4Z0SA 1LL4A 3K4DA 3LM7A 1UJQA 5D37A 3DYOA 2ZX9A 3U2OA 1BQGA 1Z6KA 5E5CA 1E5JA 4TV5A 1IEQA 2RDWA 1RH9A 2XTKA 3LB0A 2X30A 1IF2A 3E0WA 1CW2A 1QPRA 3C0JA 1Q7ZA 3QQWA 3HG4A 4J3UA 3H2FA 1UWSA 2GDUA 1VP5A 4UCGA 3AROA 1NWSA 1GORA 6REQB 4HPNA 3KBWA 3W74A 2G41A 4QCEA 5CGQA 5BMWA 2EHHA 3VA8A 4IH3A 4C5YA 4JKMA 4C6IA 1C93A 1CECA 3AXKA 2WMIA 4LVGA 1PCWA 3CIXA 4DB7A 2R6OA 3CUXA 2NXHA 1QTWA 3WX7A 1L2UA 3GG0A 2PDYA 4JD4A 3KW3A 1HL9A 2ACRA 1JDDA 3EPOA 3MWAA 3VD5A 4KCTA 1KRMA 2WSPA 1UH2A 3W76A 1JZ3A 4ERGA 4Z2LA 4FPSA 4M80A 3W81A 2PDHA 4XZLX 4W89A 4DQWA 3EOOA 2WNZA 3QFEA 3G3DA 2WKLA 1W0MA 1NJJA 2WQDA 2Z7KA 2BXYA 2CKSA 4UFKA 1VPXA 3AI0A 3PZMA 3DECA 4Q4QA 4LW7A 4DYKA 4D6HA 4M29A 3LBMA 4TR9A 3WNPA 5D33A 1EH9A 1K8XA 6XIAA 3MO7A 3F5LA 2RH9A 2JIEA 4ERIA 3CAKA 4D6FA 1JG9A 3QJAA 1J0ZA 4DZ5A 2P8BA 4HNNA 3UD6A 2ZA3A 2VX7A 3RCYA 2EJAA 1LWIA 3TOYA 1BXCA 4UFIA 5LNSA 3H53A 3CJPA 3UR8A 1H1NA 3LLDA 3N2OA 4C7FA 1OC6A 3PBGA 3VGFA 1KCKA 4FX7A 2HK0A 3CQ0A 1QPKA 4F0LA 1OADA 3SIZA 4AHOA 1NWTA 2PTYA 1PIIA 3QR0A 4E4FA 2NVCA 1KM5A 3FEQA 2H90A 3RITA 5I3DA 5I09A 3ZWTA 1UWQA 2AAAA 5T91A 1FOBA 3THCA 3SRKA 1A0DA 5FCZA 4GIEA 3W2MA 2Q3RA 1F76A 1UASA 3IJLA 3AISA 4KCUA 2GVLA 3FJNA 4YLWA 2C7FA 3TYCA 4HNUA 2Q6ZA 4MJ4A 1RSCA 1UIOA 1W1IE 5JH2A 2BOEX 3LTSA 4XZMX 4OOUA 2WSQA 5RUBA 4F0SA 3TU9A 1J5SA 4HYWA 2FTWA 4AISA 4Q33A 4O1EA 1MSSA 1GGOA 5EA9A 1RD5A 3QW4B 3RM4A 4LUYA 1B90A 2AQWA 2Z2AA 4NZ5A 1FXQA 4J27A 5LNVA 3W37A 4F0MA 2RGMA 4S3FA 4B9ZA 3EDKA 5BMXA 5CSRA 3BCFA 1TYGA 3Q65A 1R5YA 3PNZA 1HW6A 4BI7A 1DL3A 2GUYA 1CXIA 1IE7C 3WENA 2Y24A 1WBJA 4LBRA 2Z1SA 1O66A 1P6CA 1ML1A 4H01A 2PZ0A 3DHUA 1ICQA 1X7IA 1ZENA 1NFBA 2F8QA 4UTIA 2C8NA 4N42A 3SB0A 4HSOA 3T8QA 4AQLA 4GYFA 2WAGA 4TO8A 1EXBA 3UERA 2INZA 3C2RA 3SCUA 2D23A 2MUCA 1R7OA 1PIGA 4B92A 2YCEA 3ZJ7A 1BVWA 1PIFA 3TFXA 4DBSA 3WUFA 2ACSA 3CPUA 3UCDA 5C70A 1KM1A 3ZVHA 5G1MA 1KM6A 1LBLA 4CD6A 5E0FA 2FLIA 4RDWA 2WHJA 1LG2A 1P7TB 3Q37A 5AKQA 4QJ5B 3NEHA 1UMYA 1Z48A 1SQ7A 4MB1A 3TWAA 4BWLA 1Z41A 3QV7A 4O8RA 4AWUA 1FWIC 4L80A 2CITA 4HU3A 3M5XA 4XKMA 2FPTA 4J2MA 1V6UA 5B80A 3UFYA 1K8YA 4GRSA 3WEZA 1CENA 1BGAA 1I60A 2X40A 5A6MA 4PMXA 3BQ5A 2FVMA 4U5IA 1DWHM 1IT0A 1FWAC 4JZ5A 2ZZ2A 2D2OA 1XX1A 4DRSA 1H51A 3VKJA 3N29A 3WK2A 2NQ5A 3WKZA 3OVRA 2WNQA 4LALA 1IXPA 1JNDA 1M53A 2E68A 5BZAA 2E6FA 3TJLA 2POZA 5TF0A 5DT7A 1QW7A 4JHZA 3AJ7A 4JFTA 5K9CA 3RCMA 1TQXA 1VBHA 7ODCA 1QDSA 3CEPA 4P7NA 3P74A 4MPQA 5H8PA 3EDJA 3TYUA 4UZSA 5G1YA 2EPNA 3RX2A 1W1PA 3LTPA 1VF8A 3SGGA 1N82A 3ARRA 4C1NB 4IG2A 3BSMA 2CZFA 3IIPA 3WQ8A 4OGZA 2WQPA 3G1SA 3LYEA 3CWNA 3TN5A 3PTMA 3URQA 1BAGA 4A8LA 1TWSA 5FA5A 5GJNA 4ZMGA 1X8CA 3DCPA 4GLEA 2HE8A 3FHAA 4LUTA 1JCXA 3UR5A 4MLJA 2QHAA 1UHVA 5HQLA 2ZC1A 3NOEA 4UTMA 1WDQA 3ABSA 2PU0A 4KRUA 5H8UA 2H9AB 1GVQA 3KL5A 5JIPA 4H9VA 1E5NA 1VPQA 3TTQA 1XH0A 4DUVA 1HQTA 2G3MA 5JVLA 4JX4A 3VILA 2GGGA 2QCEA 4IMFA 4AEFA 3ORWA 3CU2A 3VGBA 3CHFA 4P8WA 1IR2A 4E3VA 1CYGA 4MNKA 3WK3A 1XSKA 1UROA 2Z6IA 4J3ZA 4ZO8A 3KWSA 4ZTYA 4GI8A 5I77A 1KR1A 3LGGA 2FFIA 3WK1A 3NQDA 3OVPA 2WCSA 3UWWA 3TMLA 1RBOB 3K13A 3P62A 4KWVA 4EXBA 5BXRA 4CU8A 4C6DA 5D03A 1P1MA 3EB2A 2VFHA 3UWZA 2QCNA 1M9HA 4ATLA 3TW9A 1V02A 3DHPA 1OSEA 1TMHA 2FZNA 3PG9A 2DH2A 4EACA 3OHMB 1FKXA 2YCLB 2E0PA 2YGYA 1KC7A 5I7GA 4G7EB 3UZWA 3WQOA 1WKFA 4JN7A 1VQTA 4NAFB 1W3IA 3J7HA 4FR6A 3ATZA 1UBSA 2DZPA 2OQYA 3OBEA 2VX5A 3DESA 2J7BA 3BARA 3IUDA 3CZLA 3GU9A 4IZGA 3LQLA 1G4EA 1NARA 1T7LA 4XKYA 1JDCA 3KOYA 6ALDA 2OSYA 1J18A 5HJXA 1QHOA 1B0IA 2E8ZA 1X1NA 3QKEA 4X2PA 3WDRA 1QXLA 2J47A 3WQ6A 3SUWA 1F4AA 2AOSA 3S6DA 2XVKA 3DHDA 3KCJA 3AZSA 3QY6A 2WZEA 4FHAA 3FA3A 3IJIA 3PBWA 2QGHA 3NL6A 4YVVA 1WDSA 1X38A 1XYLA 4F0RA 3LLFA 3F4DA 1U5HA 3S6TA 1QI0A 5F1VA 1ISVA 2J62A 1FHDA 4W8LA 1JI1A 2HMCA 1R3YA 3G2GA 4AH7A 1OX6A 1XD1A 1U1UA 3C0LA 1Q65A 3TROA 1W1YA 1O6IA 1ODUA 2RGLA 5DFAA 1PHWA 3O8AA 2VFDA 4U5KA 4QIUA 5BRQA 4ORMA 1BRLA 3RJYA 3SW6A 3OGVA 4MYXA 1XFCA 2PFHA 4ZB5A 4JIHA 3SY8A 4Q8QA 1Q3NA 4S2CA 4YU1A 5A1AA 1MVYA 3SZ8A 2NT0A 2XYLA 3REQA 3CAQA 3VOIA 3MUXA 3D3FA 4U4MA 4WIWA 2CZVA 3UG4A 2VTFA 1I1WA 1LLWA 1UP2A 3PSWA 4GY1A 1PV8A 2CLKA 3ITVA 2X0HA 4EPBC 1H09A 2O7QA 2PLJA 2Q8LA 3W4RA 1CT5A 3MYPA 1SZRA 2UY4A 2WB5A 3GFZA 2HNHA 3S47A 3GAYA 4QROA 3PBMA 2DT1A 3A23A 1QFEA 1ZL1A 3FX4A 3NQ6A 2NX3A 1UOKA 2V9DA 3KVKA 2A3BA 2OODA 3DHFA 3VGEA 4PSPA 2HVOA 3U8GA 3T09A 5HINA 1M7PA 1OT2A 2EQDA 3QOMA 4QS6A 3TK7A 3AIQA 3M0JA 2JE8A 3BANA 2C79A 3GVVA 2OYLA 2YLAA 4NX0A 2PF0A 1LT7A 4GO8A 1BXNA 4LS0A 5ABFB 1XYZA 2FYMA 3CLMA 4GOAA 2PGEA 3SR7A 3CH9A 2ZDRA 3NZQA 1MUWA 2FGBA 4ACZA 1OFBA 4JTAA 1Q6CA 1AMKA 2CZ5A 3R58A 3A64A 1TJPA 4G8TA 4M81A 1XBVA 3AIVA 4R7OA 1V0MA 3OVGA 3EOSA 3PPCA 3MI2A 1R9ZA 3FNDA 2QF7A 3JVAA 1M01A 3CIWA 1PKNA 1JF5A 2XGZA 2WSRA 5T8GA 3TA6A 4KQNA 2FB3A 2ACUA 3FVMA 4XZWA 3PZTA 1K6WA 1I1XA 3ZIZA 3N6QA 1NP0A 2OZ0A 3VIPA 4KETA 4U33A 3UCCA 1H7WA 2YSWA 4UWMA 1S5NA 3T55A 4IMAA 4UQEA 1R47A 3HV9A 2Z6JA 1VHCA 4YPJA 1SW7A 3MB9A 1DIKA 2W0UA 1TTQA 3GXPA 2FMOA 4U10A 1EBGA 4AD3A 5LNUA 4US6A 3W7HA 3H7VA 3TYZA 3L0GA 2Z25A 3BO9A 4GIYA 4C1LA 3DFHA 4XBKA 3T40A 4O0KA 3KRSA 1JD9A 1RLDA 5FJUA 4YHEA 3MP5A 5CC7A 2FPYA 1LLOA 4N4QA 4LRTA 4YXGA 1ZP3A 3A24A 1E3ZA 4Z2KA 1MNZA 5AVNA 1TIWA 5HDRA 2DZWA 4EOUA 2GVEA 1ZNNA 3MHFA 2EPHA 2PE4A 3V5FA 3WLNA 7TIMA 1QMLA 4MLRA 4E2DA 2H8ZA 4UB9A 2Z4GA 1AQFA 1TO3A 4GBUA 2GWNA 4G6CA 2FFCA 3CO4A 3LDVA 1UD6A 3KLKA 2XH2A 1XIHA 3SN4A 4ZFCA 2GOKA 1RD6A 1HP5A 4L9XA 4O1AA 3CV6A 3L23A 1TV3A 2VKZG 4C6FA 1SVDA 3SAZA 1CGYA 1XI3A 3I7QA 1OZQA 4P8UA 1PDYA 4HP5A 4O8AA 3COTA 4C6QA 3IGXA 1MEHA 2W4XA 4HA4A 5F2IA 3W1PA 5XIMA 4DI9A 4GQQA 1W32A 3NZPA 2V2CA 1JCTA 1KXQA 1H41A 1DOSA 1BD0A 4ZODA 5J5RA 4JX5A 1N8FA 3C3NA 3DH7A 4MTVA 1JAKA 3E0FA 1TQJA 4DM2A 3N2BA 5M2FX 1LF1A 1DORA 3MUCA 3CXOA 4DN1A 2E25A 3IRSA 4EXAA 2XG9A 3QPYA 5IFTA 1OT1A 1K1DA 1QW8A 4BQ2A 3B8IA 1MEWA 1TPB1 3Q45A 2DP3A 1EF3A 1KFWA 1OX4A 1IT8A 4GKTA 3AXXA 3VUSA 4XSMA 3ZLGA 2FMNA 3MO4A 3H24A 3LS9A 3CAWA 2Z1WA 1V51A 1DEDA 1PZ2A 1KKOA 3R8RA 1DJNA 2NXIA 3NQ2A 2HZGA 4L6HA 3CC1A 4QJ1A 2IQ0A 4FNSA 1FWCC 1Q2SA 3WNMA 1R9XA 1ZGDA 3G22A 4PUEA 1F3EA 2B4GA 4UNKA 1POKA 1YEYA 1GZJA 2XSXA 3HG3A 1M3UA 4E38A 4C7GA 2AL1A 2YR1A 1VH7A 3ANVA 4M24A 4PTWA 1VEPA 1ZUAX 2VRJA 2J4GA 1TV8A 3EB3A 2VEIA 1W5MA 3JRKA 1VR6A 2WHKA 4GXWA 3QQ1A 4PEEA 5AC8A 2QIIA 1KGWA 3FA5A 3HJZA 3EX1A 3R8HA 2VRKA 3O63A 3QN3A 2WPGA 1JAEA 3NPXA 3AUOA 3UZXA 5E6ZA 4RDZA 3LBCA 3I68A 4C6MA 4LF1A 3URAA 3VNIA 3RRXA 4L1WA 1CWYA 4GVFA 4UFMA 4QDMA 4GNKB 4YN5A 1PSCA 3IEBA 1WA3A 5C9UA 1VRXA 3NPUA 4KESA 2WO5A 1BYBA 3G8EA 1AA1B 3QQ0A 4AXKA 3NQVA 4DLMA 4EP8C 3MTWA 3APGA 4MB5A 1BG9A 1EO7A 4BI5A 5D2VA 2QEZA 2FZBA 5HATA 3Q67A 5AC5A 4P7LA 5DMYA 1L9WA 1TPFA 2FH8A 4O18A 1FCQA 3IS4A 2E6DA 1TWDA 4M19A 1AK5A 1EC8A 3GC5A 1SZEA 4B5UA 3EWZA 2BHYA 4EKJA 2WJZA 3QZ6A 1EJWC 4CN6A 3B0XA 1WB0A 3H2AA 5E70A 1Q6RA 3SCVA 3FJLA 1H7XA 3KRUA 1CXFA 3DKJA 2Y8KA 2XZ9A 4BR1A 1WQ5A 1LWJA 5FAGA 5B7YA 3L2MA 3OLDA 5T9BG 1SW3A 3U5UA 3LCGA 3WMSA 4CD5A 3FLUA 2WZTA 2O0TA 4NZ4A 5KZDA 5AECA 3D47A 5G2IA 3C86A 3HA1A 1ADSA 2Y2WA 3LCHA 3QGKC 4FXFA 3N25A 3UJFA 4AX7A 2Y7EA 5H2ZA 3DI1A 4X0NA 1UR2A 3AIEA 3GVRA 3OZPA 4Q8TA 4GYKA 1YTEA 4NU7A 3HQPA 1YDOA 4X0VA 1FWBC 2X7WA 1SR0A 4G56A 4IGHA 4WHBA 1GG0A 2A85A 2A4AA 1EDGA 4CCCA 1HJWA 1S5TA 1B4KA 3EXTA 5D9MA 5D2XA 4DIAA 3UY7A 3S6OA 2A0NA 2GQAA 3WL1A 2QQ6A 1IIHA 4A8IA 4NNBA 3S5SA 4DPPA 2BXVA 3H2CA 3ARQA 3LERA 3IIOA 1ZTVA 2XVGA 4PUJA 1JZ2A 2R9RA 4B5NA 1B9ZA 2DDXA 2YLLA 1IWPA 1QHZA 2DSVA 4G1NA 2WVVB 4CGTA 5REQB 4IM4A 3I10A 1U2YA 1KBIA 1EJRC 2IW0A 1UMLA 2CESA 3A3WA 3W1UA 4TMBA 2PDIA 1JI2A 2ZXQA 1OGBA 3K4WA 3TZFA 3T0DA 4MAZA 4OBSA 3QR1A 4HB7A 4EANA 3L4YA 4LOCA 3LI0A 2CETA 3HG5A 3ARTA 2Y61A 4MSSA 1Q2RA 1JL8A 1FWDC 3U2EA 3NZGA 3TX9A 3DGBA 2BVYA 4L4MA 1LCOA 3CPGA 4D2JA 3ARUA 1XLFA 1ZLPA 3EWWA 3QGVA 3O6CA 4ZOEA 3POCA 2L5HA 1G4PA 4HCHA 4MAVA 3RFAA 2RKXA 2O4QA 5A8NA 3VDGA 4LB3A 1AL7A 4UTJA 1PE1A 2OZTA 5FF7A 3EOUA 5IBXA 1KFJA 5LGXA 3QH2A 3UPMA 2YZ5A 1VBRA 2ZUTA 3S9ZA 5K9XA 1YPFA 1GCYA 1Q6QA 2P10A 1GOMA 2RDXA 4IFKB 4PTDA 3W2UA 4AY7A 2HS6A 3FYOA 1LOSA 4KEZA 5H6HA 3NSXA 1RVKA 4ECLA 2RJGA 4NAEB 2PDXA 4UQDA 2JGYA 3W7EA 2C13A 3KE0A 2JFEX 1TELA 3FCPA 3C4UA 1HKWA 4MZ8A 3C2OA 4F8XA 4WY0F 1VJIA 2WXDM 3B03A 2YW4A 3STGA 2J78A 1CPUA 2BVTA 5CSUA 3INPA 1FWHC 1PWMA 1CEOA 3PBVA 2YX0A 4ZOAA 4UTTC 3DG7A 3HIJA 5DXXA 2GJXA 1N55A 2DSUA 4GGBA 3WY1A 2JKPA 4OOZA 2DV0A 4BQ4A 1XPGA 4W7WA 4JIPA 4WKHA 2OXNA 1YX1A 3SGZA 4A6GA 2VUNA 1KQZA 2B0MA 4E5TA 4UFLA 4IMCA 2CZDA 3FKKA 3NOYA 3KFTA 3EA2A 5K9DA 3MVIA 1QRQA 3EZ4A 5EY5A 3SUTA 1H3GA 2AL2B 4UXDA 5DCBA 4O4VA 4J35A 3O2LA 2XWDA 2VOMA 4D8AA 3W2LA 2BGSA 1XCFA 4GVHA 1E4IA 1DXEA 3VE9A 3RYSA 4OHQA 3OPSA 3M9YA 4BFAA 1FA2A 2QDEA 4J5NA 3W82A 2XN0A 5F4XA 3WG6A 4D6GA 4I5RA 3P2VA 3VOGA 1WE5A 2C0HA 3I4KA 4H19A 2X16A 4B5TA 5FSDC 4HCLA 1R9YA 3RHGA 4C7DA 4H2HA 4E4PA 2D20A 3ITOA 3MCMA 2A3EA 1BPLB 2VGBA 2GL5A 1P43A 4HNCA 1CNVA 3MQTA 3FSTA 1QNPA 2E67A 2ZUMA 1RHCA 2BVDA 3BH4A 3W88A 1W8SA 4HSHA 4R34A 5FEZA 1DBTA 1OF8A 3ABOA 4QGCA 3WJXA 2E1WA 3KOWA 3O7UA 1JFXA 1G6CA 5D2TA 3ZR4A 2V5CA 5HPCA 2EJ1A 3MJYA 1X96A 2EGZA 3WLKX 2DT3A 4NT0A 3PBUA 4HK7A 3QR3A 1OFEA 2C15A 2F6KA 4CNNA 3HN3A 3E12A 2WPBA 3GH7A 4AIBA 1EPXA 4K36A 1TIMA 4RNIA 3MUY1 3GVGA 4MJ2A 1DJZA 4B5SA 1XLHA 1FWRA 2R8WA 4GVIA 4JEJA 4GNVA 4H6QA 1VLWA 3L67A 3UXIA 3ECQA 5D32A 1ZBKA 4Y9NA 3SN0A 4RJEA 4F0KA 3TVAA 2RDUA 2HEJA 2BLEA 4H2CA 4A3RA 1FFRA 3ONCA 4HZ8A 5LA2A 2ICSA 3F03K 1NY1A 1Q6LA 3CTTA 3WEOA 2HPIA 4D72A 1VYRA 1ALDA 3A13A 9CGTA 4MKVA 3GC2A 4CN4A 3ICJA 2PLKA 5FEXA 2GGHA 3W7DA 1Q8JA 3SRFA 3WF0A 1V3KA 1RK6A 2G37A 1W9BM 2DUXA 1C7SA 2Y1HA 1R38A 4D6IA 3QSRA 4JIIX 2C3ZA 4ADSA 1DJXA 2R24A 1RVGA 4N4PA 1H1YA 3CTLA 1SM9A 4FZIA 1B57A 1QVBA 3RJXA 3F4CA 4AW7A 1HXJA 3S2MA 1UCWA 4QFUA 3EWCA 3SCWA 4K1WA 4KWWA 1N7KA 5J5DA 1RPKA 1SU5A 1EIBA 1U33A 2BASA 1DWJM 3N14A 1XG3A 3UEQA 5CPMA 4QDWA 3M0ZA 1GHSA 4D9PA 1ELSA 1S1PA 1LUCA 3T44A 4Q4KA 5GPRA 1U5VA 1K4HA 5BXSA 1PPIA 3CWOX 1K8ZA 3M0MA 3FXGA 3QPZA 4CD7A 2WLYA 4UTUA 4GA8A 2J79A 4GABA 2HISA 3VYLA 2BXZA 3ZJKA 2XH7A 4Z1DA 4JHMA 2DY3A 3F2BA 3IANA 1D7FA 3W2KA 3N19B 1F61A 3SO7A 1JUEA 4GYPC 4QJ4B 4H6EA 2Z1BA 2DZUA 2IKJA 3NSNA 5GVJA 3OTRA 1TJ0A 4EPEC 1UIPA 2C1IA 1V6WA 3S83A 3BLIA 1PKMA 5F7UA 2AQOA 3GHSA 1SMDA 2VURA 2VWTA 1J0IA 4D6CA 3TJ4A 4Q7BA 2GUBA 1XLDA 3NURA 2NSOA 5BYWA 1QOPA 2BZNA 3W22A 3B4UA 1XYFA 4OBRA 3WQVA 1DIDA 1F3XA 4OQVA 4EAMA 2WJDA 4PFHA 2Y5JA 3JR2A 4U2YA 5EB8A 1HO1A 4BQ3A 3BAWA 2GSEA 4PB5A 4CKQA 2OOFA 2VD8A 2Y70A 5CCZA 3O0KA 1W3TA 5CH9A 2GWGA 3MC5A 2PU1A 2FHCA 1OVDA 3TXVA 1L6WA 2J9ZA 2ALDA 3NCOA 2YCKX 3WH7A 1Q4WA 3CHEA 1GYLA 3LV5A 4PH6A 3KDNA 1GHRA 4UIOA 1E1FA 2W91A 2G3IA 4WQ6A 3KBNA 5D30A 1VCFA 3WEMA 3I3DA 3KBVA 4FOUA 4CQCA 1JZ5A 5ENLA 4J28A 3ZVHB 4D1IA 4FALA 4KWSA 1ZB5A 3E2RA 3CV1A 1I45A 4FXSA 4F3HA 1OYAA 3P93A 5G4EA 4JR5A 2VFFA 1OY0A 3VC5A 2YKKA 4FX8A 1X6LA 2QXWA 3S46A 1RBAA 2D2JA 3CHDA 4F0HA 5L6UA 1QI4A 4BA0A 2UY5A 2YBTA 3PZUA 3BLDA 1UZ1A 1KWGA 3VIJA 1E9IA 2J7CA 1YTKA 1TVLA 1TUXA 1VS1A 1WXZA 3QYQA 2IQTA 4LAKA 5BRBA 3DX5A 4DAFA 4I7WA 1FQ0A 3VOCA 9XIMA 1Z89A 1E6NA 2QT3A 3E38A 4B3ZA 3PFMA 3M0KA 1GUVA 2PP0A 1XDLA 1HX0A 3QLLA 5C55A 2CZEA 4PUUA 3KM8A 3W02A 4B5VA 2ZUUA 2WM1A 3TR9A 1MW1A 2PLMA 4D6JA 1V0NA 1Y7VA 2GVYA 4I9AA 2CYGA 1YDVA 2HBXA 1UD5A 4GMEA 3SJ3A 2WNWA 1FDZA 3LHWA 3QMTA 2HWGA 3R0DA 2I56A 1KM4A 2JGQA 3ZQ9A 3A4WA 4JY8A 2ANUA 3GXIA 3K8MA 3CQHA 1JCYA 4JS3A 1K9DA 2YXOA 3UCQA 5DCEA 2HRWA 1J11A 1WO2A 4DZIA 3W25A 4NJKA 1QNQA 3DUGA 2OPJA 4OU1A 3ZM8A 1B3ZA 2VCCA 2HK1A 4F66A 2ZRYA 4US5A 1JNEA 3MHGA 4KRTA 2ZX5A 4IQDA 4R5EA 2P88A 2CBVA 3GH5A 3PPGA 4J40A 2WK2A 3SUSA 2BY0A 1ME9A 2WMFA 8XIMA 3HTWA 2E6AA 2V69A 3TW6A 3DDMA 1VYSX 4WGHA 4ZENA 2HNEA 4JNMA 3CM4A 1TPH1 2PDUA 4UUIA 2YXXA 3C61A 3BAYA 3BGJA 2Q8XA 5I00A 7TAAA 3ZYZA 1XIFA 3G18A 1YTDA 3GDTA 3AHXA 1TWIA 3T42A 3QTGA 3WYZA 1W37A 4XAYA 2JALA 3BL3A 3CPRA 1HZYA 3SQLA 1KNWA 3S1UA 3W01A 4QLKA 3UXAA 3QOKA 4LT9A 5EMLA 4H9YA 4BY3A 3F2CA 2TMDA 3AS3A 4OE7A 2QCFA 2CXEA 1H7OA 1GK8A 3BOFA 3TN3A 3OGSA 2RUSA 5CC5A 4IPJA 4Z1CA 3U9IA 2QCHA 1ZRQA 3G1AA 1V6YA 3BAKA 4QCFA 3NQAA 2OKTA 4XAGA 3LNPA 3NR0A 4B5XA 1O4UA 3GR4A 4BS0A 3JS3A 1BWKA 4E2OA 2OEMA 3PAOA 5FJOA 1WDRA 2HSAA 1Q63A 3LA4A 4JTSA 3UVIA 1KFCA 4MWAE 1W9DM 3HPZA 2YDSA 3A6OA 2GJPA 4QNWA 2G96A 3QC0A 3DKLA 2JQXA 3GG1A 4QAWA 3O16A 3R94A 5DANA 3EWUA 3S5OA 4LVDA 1VZWA 1UA3A 1GWJA 3H6OA 3CV2A 3M47A 1TUFA 2PCQA 3LENA 2CHNA 4E6MA 1C9WA 2PI6A 3MSGA 3SY1A 1X1ZA 6A3HA 4LEFA 2YYUA 4JTFA 1A5KC 3AC0A 4JGDA 4P7OA 2YJQA 3R0UA 3IIVA 3NXLA 3AHVA 2C1GA 4NI3A 4NZFA 4Q8PA 1EEXA 3ZWSA 1ICPA 5JQ9A 1EBHA 4Q3MA 2CWNA 1EEPA 1S3TC 1W3KA 3E2VA 3K8LA 4I8YA 2D3NA 3ITYA 3SUVA 3ABXA 5D8ZA 4E8DA 3VAVA 4W8AA 1RQHA 1H2JA 4KMQA 4NJJA 2DPEA 3BAIA 2J7DA 4HT3A 2QS8A 4UZUA 3EA1A 4DJDD 2PLCA 1ADDA 4MY1A 4DO5A 2FKPA 1K8CA 1M6JA 1VB9A 4XVEA 3REQB 4M51A 2P3EA 3VGHA 1RJQA 5CPLA 1ISXA 1V5XA 5HPOA 4O54A 2ZX8A 1SO5A 1W2PA 4ORIA 4QISA 4GYJA 3GTNA 1EYWA 4RZ4A 3TC3A 3MMTA 1I0BA 1UUMA 4P8XA 5T26A 3GUGA 1K9TA 3W38A 4KFNA 3LZ3A 4JYDA 3MJMA 3S5YA 2V5LA 1VFLA 3N3TA 1QI3A 2QV4A 4NIRA 3STCA 5AC4A 4S3EA 2HV5A 1YIXA 5C6MA 5C0QA 4UTHA 2PC8A 2D0FA 1GZ1A 1X1OA 1F6PA 1GOOA 4Q4SA 1FWGC 3NPWA 3U7BA 3T0BA 3RRAA 2C91A 4JFVA 1HP4A 4DF0A 1B30A 3KP0A 1RCQA 1KFLA 3WLLA 5JH1A 2XDFA 3O9NA 3TDFA 3UVAA 5HXMA 5MHBA 4TIMA 1E72M 4A8RA 2CIPA 4GHRA 4PMZA 2EBNA 1J79A 1GOKA 3P80A 2J27A 1HIZA 2VZUA 3LK6A 5KEZA 1C90A 4ILSA 4CQ8A 1H5YA 1LZOA 2R82A 3P5ZA 1EWEA 3BVJA 1XRFA 3FXYA 3OYXA 4AHPA 1MW3A 1PZ3A 1JRBA 5AZ1A 2G5WA 1S5VA 5ABHA 2HE5A 2VCAA 5AN7A 2Y88A 1GQJA 2TRSA 3OQ8A 4Q8MA 2J8TA 3AMKA 1I2QA 2DORA 2A3HA 2OZ8A 1DWFM 1TREA 4OWGA 4DJED 1H62A 4PFMA 4AWEA 3YPIA 3W29A 2VEPA 4AF0B 2A3CA 4OJYA 3STFA 2BGQA 3H4XA 4AZHA 1F07A 1EA0A 1J93A 3L4XA 3T1GA 4P7QA 2Y7FA 4JQ2A 1H63A 4PMYA 4DJEA 2C18A 1FX6A 3N2XA 1V03A 2R1KA 4RUBA 3VVGA 2D1ZA 2PGRA 5IDIA 4F4RA 5LIUX 3TZNA 2AAMA 1OM0A 2V63A 4IHCA 4Z2HA 1QK0A 4HPXA 5AHEA 3W85A 1AODA 4AEEA 3H26A 4HVXA 2VGIA 1J0JA 1A5AA 4WF7A 4AYSA 3S1GA 2PTXA 3D0CA 4LC6A 4NRSA 1UA7A 3GZAA 4AD4A 5M5DA 3S1VA 2ZXDA 2OLSA 4MMWA 2ZUWA 1C8YA 1FDYA 3GDLA 1BFNA 3SFWA 2UBPC 4E2VA 2JKEA 4W88A 3RK8A 1D3HA 4LCRA 3NYDA 1WUEA 3ALFA 4Q8OA 2XIQA 4ZR8A 5GNZA 3S1WA 1UUQA 4X22A 1LQ0A 1A0CA 4QXIA 3UWEA 5LIKX 4PUKA 3CUFA 1R6WA 3HGSA 2CLPA 1A0EA 2A79A 3E5PA 3GM8A 4ZCWA 1GEHA 4DJFC 4JQAA 2E5DA 2ZUNA 4AB4A 5A95A 4JIQA 3UXDA 3W1XA 3W53A 4WJEA 1X6UA 2X1IA 4O1CA 3QSTA 3QYSA 3WQDA 4MWAD 1FH8A 1Q6OA 2W27A 4DO7A 4QQUA 4CNPA 3GR7A 4QEEA 3AYVA 4N9BA 4AXNA 2Z7GA 1ZJHA 3IUHA 1J0YA 1H1ZA 3WBEA 3W7MA 3Q58A 3TSMA 1A5NC 4NNCA 3LM3A 4A2RA 1XISA 5KITA 3RLHA 3NTYA 1LJYA 1GZGA 2FZMA 4UOJA 1PTDA 3E2QA 2VYOA 5I3JA 1XLKA 4DXKA 3ONBA 4LXFA 2XFFA 1H61A 1BF6A 4JN8A 2WJFA 3DAQA 4UMCA 4LEQA 4URIA 2IPWA 3LXBA 4QHRA 2W5FA 4W93A 3UZJA 2Y4SA 1U83A 5A6SA 1FWFC 3F4NA 5LYRA 3CZGA 4ZO7A 3OGRA 2ZZ5A 3HG2A 5H91A 2W79A 1MQQA 5IXEA 4FP1A 1RA0A 1R3WA 1EGVA 2OO6A 3WN6A 5I2UA 4KRZA 2HROA 3GHRA 4HMEA 1PL9A 3QW3A 5FAJA 1LBMA 3VXGA 3DXIA 1D2KA 2I7GA 1UP3A 4OV9A 1M7JA 2VC7A 3OBAA 3WBWA 3N9KA 2OQHA 4UR9A 5A69A 3QVQA 2J6XA 2HQAA 3GNXA 4RZ5A 2OSWA 4KS0A 1XKJA 1TKKA 1FRBA 1KBJA 1W9PA 4L6OA 2YB1A 3L5LA 1SUXA 2OLAA 5CBJA 4YTUA 4JTHA 4RW5A 4BI6A 1OB0A 1TV2A 1XGDA 2VDGA 3MSRA 1ZP4A 4WY0B 4AMCA 1X7FA 1HJVA 5GNXA 1VHNA 4WRHA 4H9UA 1QATA 3K30A 3VIKA 2A7NA 4M7TA 3VNKA 1VFTA 1WNOA 4RR4A 5HA7A 4O50A 4UCFA 3HPSA 3MPGA 1UWTA 3FS2A 4FNTA 1NM9A 1Q85A 4UTKA 1HG3A 4LFYA 2ZFAA 2IS7A 3AMGA 2XN2A 2FZ9A 2ALRA 4AEOA 4GX9A 1QNRA 3OHIA 2PDCA 1XLAA 1WOAA 3TE9A 4PMVA 4IISA 2XSAA 3GIQA 1X6NA 1D3GA 3M0XA 1IEIA 1OFQA 2BOFX 5B7ZA 3B8SA 1ADOA 3TXZA 1NDYA 5G2WA 4XZ9A 3ZLFA 4B15A 3PTDA 4AWTA 3WLPA 2NQLA 1UQYA 3V1HA 1OD0A 2WVTA 1I6NA 3H8AA 1O94A 2Y89A 3UU0A 3P0WA 1AZ1A 2E6YA 3ZJ8A 4N6FA 2CC0A 3MBFA 3V18A 5FESA 4V15A 3VM7A 2ZADA 4HOZA 4BCEA 3KCLA 2Z1XA 3AQUA 2XVNA 4QITA 4CD8A 3H2OA 1V6TA 3TMQA 3UP8A 1ISZA 3TUUA 5A2AA 3W2NA 2ZZ1A 4BK9A 3FJ4A 4UQAA 3AU6A 4AWSA 4PMOA 3HJEA 1PUDA 5AY7A 3S5NA 3USZA 3G3MA 3GZ3A 1EO5A 4UFJA 3MY9A 1LP6A 2OMAA 3PR2A 3G1HA 5HR6A 4QR6A 3P84A 5LNRA 3DN5A 1EZ2A 3M0LA 4UNLA 1MQRA 3LRLA 3UESA 2A6LA 3C2FA 3VZXA 1AVAA 2I17A 3AJXA 1GQKA 4GQRA 5C54A 5GJPA 1F4HA 3H55A 3IVUA 4N0RA 3BW2A 5G1TA 5DBUA 4ZB2A 2P76A 5DRCA 1F3TA 3L2IA 1T5AA 1YDNA 4I9JA 1UW9A 2BOGX 5C9WA 5LA1A 2GGEA 4LAMA 5M03A 3WMBA 3PPHA 3RM8A 1LORA 4HBKA 3WIJA 1CXLA 4PULA 3WH8A 4GG9A 2PGWA 1NQ6A 2CLEA 4WJXA 3V16A 3ISIX 1TPVA 3IACA 3O15A 2JK2A 1O12A 4F40A 1KGUA 4S1FA 2ESCA 3JUGA 2DVXA 2CBJA 4IMEA 3OQEA 3DEQA 4RE0A 4C91A 3TC6A 3U4AA 1XV8A 2DZTA 3MP3A 4HNOA 3AZRA 2J75A 3WNKA 4IPLA 3KRBA 3EWXA 4FIQA 4G1KA 1V6VA 3HZ3A 2HTMA 2V82A 1UBPC 4LB4A 4CNOA 2EKGA 4J4KA 1VIZA 5FF0A 2DZSA 4LANA 1A3WA 2CBUA 3SCTA 2PD9A 2TSYA 2YDAA 4HSNA 3GH4A 1XLIA 1CCWB 4Z1YA 1W6TA 3WDPP 1Z42A 1KCZA 2H6RA 1TJ1A 1GTEA 6TAAA 3TYBA 3W72A 2I5GA 3IVSA 3MZ2A 1AJZA 1JPIA 1R7AA 3VOHA 4Q4MA 1VFMA 3GSMA 3ZT5A 1PX3A 3GHUA 1OG0A 4DAIA 4ZQOA 1TE1A 3MYOA 4B3LA 2YOCA 4AVNA 3SEPA 3OW1A 2EPOA 2Q3OA 1Q45A 1WDDA 2ZZ6A 3EKZA 3MA8A 5DRIA 4OKDA 5FL0A 1EGMA 1G9HA 1VAHA 4W8BA 1CXHA 4EX4A 3A47A 5G4HC 1UD8A 3VPLA 4REQB 1VC4A 1H7RA 2ZICA 1JYNA 3E9AA 2QULA 5LGZA 5FEWA 3LN3A 2B7PA 2RHGA 4WSHA 3BPWA 4Z42C 3G6MA 2PP3A 3R8GA 1AH0A 1TJ2A 2CU0A 2ZUVA 4RV3A 2CERA 3IK4A 1RPXA 1EX5A 4R7JA 4GFSA 4YIWA 3ZZ1A 4Q4OA 3B4YA 2IQDA 4JFSA 4P61A 3MDUA 5EFDA 2GSHA 1XLGA 1JZ4A 2CNCA 3TA9A 4PBGA 5ABEA 1E1EA 2I16A 5D9OA 1EQPA 1YRRA 3LEPA 5IM51 2PP1A 5AYZA 3IGHX 2NSXA 5K3VA 1A5MC 1U5JA 2JIWA 4UR8A 1U1JA 4NHVA 1UUOA 4MM1A 1E56A 3FSUA 3PWIA 4MDPA 1VGAA 2OJPA 4K3ZA 1TPC1 3HO8A 2W61A 3BLFA 2EEXA 2QVNA 3H12A 1SFJA 1ITUA 2W9MA 2BODX 1M03A 3M46A 3UJEA 5HMEA 3VM5A 1AW5A 1RY0A 4FOKA 4C6BA 4M5PA 2E7FA 5AHNA 4DJDC 3VGDA 1CI1A 2X09A 1MYRA 3ABQA 3PWAA 3E96A 3DYPA 4BEQA 5TD4A 4WDXA 3MVTA 4ASTA 1C8VA 4B3KA 1KBLA 3R11A 3CUHA 4S23A 1P7TA 2VQTA 1SSGA 4Z2GA 1KGXA 4UOQA 5I07A 3W1QA 1HL2A 2ZE3A 1F5ZA 4GUFA 2QCLA 3LHUA 3KP1A 2V0TA 2SFPA 2VENA 2RJHA 3C5QA 3PPFA 5FKYA 2OSXA 4A29A 3N34A 2QDGA 3I7RA 3LXCA 4JBRA 4KCWA 1KRAC 3VMPA 3F7JA 1P48A 3N15A 2X8RA 1LWHA 3G6LA 4H8HA 3NGFA 4J3XA 1XHGA 2YIHA 2E9LA 2X0YA 4FAMA 4XIMA 5DN1A 4GJIA 3W7RA 3MDWA 3KBSA 1JCMP 1E6PA 5AHLA 3LSBA 2E8YA 3AHTA 3S9YA 2QCCA 2CFFA 1THFD 4EIVA 4S3KA 4R53A 3H22A 3P60A 3TW7A 1TMQA 1ME7A 2ZZ4A 2W63A 4QJ3B 3BXWA 1O5XA 3ENLA 2QJMA 3MV11 2O55A 4LVAA 2FB2A 2VGGA 4DBUA 2CW6A 4IIBA 2GJRA 3H2NA 1Y0EA 4GC3A 4KIEA 3A3XA 2G3JA 1G01A 1ONXA 5DMMA 1O7AA 2OGYA 4M56A 5EYWA 1MUMA 2QCDB 1K7XA 5G4WA 4RE4A 4A3YA 4DJEC 5JU6A 1SYTA 1YBQA 4I9MA 3VIOA 1I2NA 5F2GA 2H9AA 3FEMA 1DHKA 1LDCA 2VQUA 3M0YA 3UG5A 2VC9A 2XVPA 3A12A 1OK6A 3GDBA 1T8QA 3KL3A 1TV7A 1XIDA 4DWSB 1Z3NA 1XLEA 3W23A 3B8DA 5D05A 2ZIDA 1GONA 3E74A 5JIWA 3L4TA 3MUIA 3HFTA 1TPEA 4GVGA 2GJNA 3B0UX 4S3CA 4M82A 1W3LA 2CPUA 2PDKA 3BJTA 3NL3A 1XKYA 3E1F1 1UWUA 3G1RA 3EB4A 2VT0A 3G77A 2XIIA 1Y8BA 3WLSA 2GFTA 4HPGA 1DYSA 3S5ZA 2DFAA 3W7KA 4AMAA 2X7VA 3ZSTA 1NOUA 4IUGA 3ANUA 2Y8VA 1FDJA 3SI9A 3M0IA 1R3TA 3GXFA 3ITXA 5D9NA 1JCNA 1XIGA 2X1SA 2DIKA 3S3GA 1QCWA 1Q7MA 2V8ZA 1AW1A 1BHGA 2G0WA 5D02A 3D5HA 4NF7A 2B31A 1P0EA 2YCLA 2R1LA 2OELA 2XZ7A 5LNWA 2V81A 4Y9MA 4J9JA 1Q6GA 5AC7A 1EC9A 4NAFA 3UXLA 4V1XA 2Y63A 3BJSA 4MFEA 3H2EA 4GUJA 3UGVA 1LRNA 3RPTA 4O57A 4LY8A 4P5UA 1GVIA 1KW1A 3KLLA 3UA4A 4TV6A 1B1YA 4OTKA 3MSDA 5GNYA 3W07A 4D8LA 4C6PA 4DHGA 1G4TA 1NF0A 5CLWA 2ZZ3A 2EF9A 1XH1A 5DELA 4M0XA 4LNYA 4MWAC 2BMBA 3SM0A 3EAUA 1P0BA 1ISYA 4O0ZA 4H41A 1XIIA 3SSJA 3XINA 3AS0A 3IRDA 3CWHA 1B3VA 3RUBL 4X9SA 4QDPA 4HZ7A 3WDQA 4A35A 2J7HA 1B31A 3NDYA 5CGMA 3B9DA 1K9FA 4HMCA 3WNLA 4HNTA 3SBFA 4FEZA 4HK6A 3GK0A 4ATWA 3W7OA 1E0VA 4W5ZA 2RFGA 3KCOA 4DF1A 2Q71A 1SMAA 1WX0A 4NASA 1HTIA 4O1BA 4XAPA 4HOXA 4JTQA 4Q8NA 1VENA 2PUZA 2GQ3A 4YMZA 3VNMA 2E4TA 4PGLA 3N6JA 1ZFJA 2FQIA 4O0QA 2EKCA 4IP5A 4IX2A 4AY8A 2QAFA 1AJ0A 3VABA 4A4AA 1B5TA 4PL1A 1HO4A 1LOLA 1S2UA 3BV7A 4J3WA 1IWAA 5CBBA 1EC7A 4GISA 3AIUA 3P0XA 2Y5EA 3LCFA 1QT1A 2EO7A 2PPGA 1GOXA 2VELA 3SFKA 1NVMA 3GVQA 2NV9A 3B0PA 1W1B1 1XYBA 1EA9C 1YNPA 1YE6A 5DEZA 3OODA 1US0A 3LRKA 4E3TA 1V3LA 4NXSA 1QU4A 4RLIA 2DH3A 1CLKA 4LQ1A 4LCQA 1K70A 4TTUA 1JQXA 5DMLA 4OT7A 1G0CA 1V3MA 3LD5A 6TIMA 2QKFA 3LU2A 1R2SA 3NO5A 4HJFA 2NVDA 2GK1B 4IIGA 3GXTA 1ZBCA 3B9NA 4HTBA 4GUGA 1ZY9A 1KV5A 2NV2A 4HU0A 4WGXA 1YQ2A 3UG3A 1KXHA 1OJXA 2ZXAA 1XCXA 3ITTA 4IMGA 3PG8A 2E5BA 3BDKA 1LG1A 1HGYA 2XJ7A 3STEA 3C3UA 1PTAA 4YWSA 1OCQA 3RX3A 3GQYA 5CPOA 4NI8A 4WZHA 4PCSA 5D38A 3IJDA 3BZJA 3CQJA 2GGJA 1JZ8A 3C2EA 2G50A 1IGSA 4C60A 1WDWA 3TEVA 3FW6A 1E15A 5EMYA 2NUXA 3ARXA 3T08A 2AKZA 4XX6A 1IEXA 1GJPA 3LXAA 4BHYA 1I2OA 1E6SM 5L9FA 2WSKA 3TP4A 3FIGA 4M8UA 3RM9A 4O15A 3Q94A 1NDZA 1YXCA 3HGRA 2QDHA 1ZCOA 1G5AA 4JTDA 4IP7A 3OIHA 1OFAA 1FWSA 5FJTA 1B3XA 2Q8ZA 4R88A 3VCCA 5HUOA 1E6ZA 4U2ZA 1XP3A 4Y8FA 4DVOA 2Q01A 1YPIA 1VBGA 3CB3A 4UTTA 1JYXA 5C9ZA 1B2YA 1RLCL 3BTNA 4RL3A 1U30A 1XDJA 3PULA 2BWGA 3VNDA 5BXTA 3LMYA 3TSBA 1XQLA 1JEZA 3T0AA 3PJTA 3SCRA 4R9XA 5F2LA 5DF0A 1P1XA 2IKIA 5HMSA 2PWUA 4NX5A 2CLLA 4O28A 4H4IA 1J0HA 1TPWA 1Q6EA 2WMHA 3O6YX 2VI0A 3WH9A 1H11A 3TKFA 4RXGA 5DMNA 3OYZA 2FIQA 1ECEA 3VDAA 1W9XA 4DUWA 2DZAA 3IAPA 2WMKA 2QJJA 4NZCA 3W1TA 2YBVA 4PTMA 1XQKA 3O0FA 1FWNA 4QSFA 5MKGA 2OEJA 3BW3A 5A8GA 4Z1AA 3M5ZA 1OYCA 4GZ7A 2PDMA 1GVFA 4GI9A 3ZR5A 1S38A 4P8VA 5CPSA 4QTGA 4Q7IA 3PB2A 4LAZA 1OCBA 2PEVA 1GEQA 3OG2A 2CLOA 1AD1A 3GAKA 4NYYA 5AFDA 1TX0A 3U2CA 4GK8A 4JTCA 4WEVX 1N8IA 2UZ9A 2V6AA 1SW0A 1VEMA 3LHVA 3WD0A 5TIMA 3CASA 3CQIA 2VVNA 3BLPX 3SCSA 4M7SA 1ITCA 3R2GA 4TX9A 4XD5A 3BW4A 3N9RA 3I3EA 1G67A 2FHFA 3DG3A 1IWBA 4FK9A 1Y5VA 3TYDA 1KM2A 1CLXA 1P0KA 1SPQA 2OWWA 1YPXA 3GB6A 4L56A 1OFDA 4A2SA 5DCDA 2VDHA 3QY7A 7CGTA 2BP1A 4MFDA 5EGRA 4WD0A 2X05A 4DWSC 2XINA 1ZBVA 4TUFA 4LS2A 2G4JA 5AVHA 3EXRA 3A22A 4HU8A 3H23A 3L12A 3VMNA 4OV4A 4JY9A 3UBPC 1CIUA 4D6EA 1NTHA 3W6MA 3T2QA 5DLCA 3I3BA 3N4EA 4FR1A 4AX6A 1YDYA 3CO8A 1XLCA 4WSJA 5E0KA 1A5BA 3EA3A 1TPUA 3CYJA 2ONEA 3L9CA 1DJGA 2INFA 2ZTKA 4H7ZA 2UWFA 4IIFA 3NDOA 1GOIA 2I9UA 3VUPA 2I9EA 3U48A 1DTUA 4PUNA 1V3HA 4CVWA 4F9DA 3SADA 2DUAA 3RXZA 5C2GA 1G7VA 2P0IA 2WJEA 2MANA 1DQUA 4RK8A 3BG9A 4JCMA 1YXYA 1X8FA 5EFFA 4PA8A 1XF0A 3HGOA 3FKRA 4I5UA 3RO8A 1W5PA 4AD0A 2CHRA 4KEUA 1KFEA 2PDPA 4QNEA 1JIBA 1BXBA 1W5NA 1Q7QA 4MNMA 1YYAA 2KZHA 3M4HA 1A5SA 3RF9A 3VTRA 5IDZA 4JQ4A 1S3HA 4MKSA 7REQB 4AFYA 1TA3B 4D8ZA 1RQEA 4YL2A 4IP4A 4CNSA 1S2CA 4GYPA 5TNVA 4TQTA 4L4PA 2F38A 3A21A 3OLEA 3TV8A 5F2MA 2VL4A 3W24A 5FIPA 2F84A 1E55A 5HAOA 4YVPA 2V3FA 3WH6A 4EVZA 4A22A 5I6SA 4OFCA 4MNJA 7ENLA 4LCSA 2CHOA 3NQGA 1TX2A 1NFPA 3NVTA 4PUWA 4RNFA 4HJWA 4RXFA 1PJ9A 4Z1BA 1Z32X 3BWWA 3R43A 3WF2A 2E09A 3NO1A 1PYFA 3MS8A 1XL9A 1Q4NX 4L9YA 1WXYA 5DO8A 4OBTA 3G1XA 1OX5A 2OKOA 3FA4A 3VNLA 3PZOA 5KETA 3LNMA 4H1ZA 3ARPA 3M07A 3M16A 1S2VA 1XCWA 3TN6A 4O52A 4PTXA 1DJWA 4XV0A 3WO8A 4KBXA 1REQB 3T78A 4X61A 4EF9A 2ZX6A 4GBDA 2J7FA 3OVQA 3HV8A 4LNCA 1XR2A 2F2KA 3HF3A 1BTCA 2BFGA 2YL5A 2NXGA 4A05A 1DXFA 1CTNA 3AFBA 1BYAA 2ZRZA 1CXEA 3P5YA 5E0CA 1JYVA 3NSMA 3BCDA 4CN1A 3IV3A 4LYQA 4PRWA 3I6RA 1WCGA 3PM6A 1FH7A 2CWXA 4GZJA 3AIBA 4Y9OA 4J3SA 4NL1A 1D8CA 3R0KA 5AHIA 1XRTA 4YWIA 2WVVA 3NJ3A 5C7VA 5REQA 2ZC8A 4KEMA 4LYKA 2EPMX 3OP2A 3VIGA 1EP3A 1XIJA 3HB9A 2DSWA 3WMCA 3OB8A 3CHVA 3RO6A 3SCQA 4V33A 1FKWA 1AL8A 1S39A 3TTSA 1BTMA 3N2MA 3UWQA 4H9MA 2EXOA 3KXQA 3H70A 5HOSA 3QEZA 4PCPA 4JNZA 2X0SA 3PAJA 3WJWA 3CZEA 3M44A 4YS1A 2GLKA 3H21A 4LU0A 1W3JA 4DUXA 1DE6A 4I6VA 4AZ7A 2G97A 4JYFA 4X3ZA 4AD1A 4JAWA 4Q8VA 4M6QA 4DZAA 1DJYA 3NEVA 3QM3A 4QAIA 2GPTA 1ZAIA 4AVOA 2QCMA 4GXMA 3TNOA 1VIWA 2OG9A 3N12A 3GBDA 4HYVA 3GTFA 1T0OA 3U4FA 1GYNA 1WUFA 3CBWA 4H8VA 2UY2A 4BF9A 4IFKA 3L4UA 3W26A 4UBPC 3D3AA 3GNDA 8A3HA 4QE5A 3WMLA 4U3CA 4ENLA 2ZRVA 3R12A 3PZIA 1E4MM 3MSYA 2VZTA 5CLTA 2BS9A 2PDBA 1GKRA 4R3UA 3PFRA 4K37A 2ZRXA 3PVFA 3EPMA 3BSGA 2EG8A 1C91A 1L6SA 1FHVA 3FDGA 1VYPX 1A4LA 3IARA 3T8LA 4IQEA 1FWTA 1W31A 3VFCA 1X39A 3W7NA 2RAGA 1KO0A 3P81A 3R13A 2I14A 2ON3A 3URNA 5M17A 4JTJA 1LT8A 1WDPA 1TZ9A 2IUZA 2POTA 1P4CA 1QO5A 2PWDA 2J9YA 3AS1A 3BE7A 1YKWA 1ZJIA 3MANA 4K8HA 2X1UA 5ECVA 1TCMA 4H00A 3T2OA 5CPQA 4L7ZA 4IL2A 4M1BA 2FDMA 1UZHA 4O16A 5EL1A 1J4EA 4CLMA 1TV5A 2QJNA 2NLYA 3NNTA 3WQEA 2DSKA 1U1HA 5KZEA 2X42A 1UR1A 3H4WA 3NQCA 3VDHA 4W84A 6PTDA 2BY3A 4I8DA 1XJBA 4B91A 1W3HA 1DQWA 4DELA 1MEIA 5CBIA 1POJA 3NQBA 4AVFA 9RUBA 3LUTA 1DWGM 3EDDA 4H3DA 4Q7NA 2B7OA 3DI0A 1UH4A 2JEPA 3QBUA 1J2WA 1BKHA 1FTXA 2V67A 2P0OA 5LHEA 1M65A 3ITLA 3T2PA 2VR4A 4XIAA 2WOQA 2I5QA 3APYA 3ZSSA 3RAOA 2P1FA 3EBVA 3Q4DA 3CUJA 3SRDA 4QP0A 5CJNA 4GI6A 3W1MA 2C0AA 1E4NA 4F2TA 5BROA 2E40A 3WCZA 3TAKA 3PP7A 4WDWA 3CUZA 1WBHA 2BNJA 3TCEA 2OX4A 1ONEA 4L6DA 5HUPA 3L7RA 2ISDA 4IFOA 3AHZA 1VFFA 1H0IA 2OB3A 2QCGA 1UH3A 1J9YA 5BRPA 2QJIA 3CV7A 3I4EA 1VD6A 3WUGA 1OK4A 1FCBA 4HOWA 5GJMA 4J3VA 2Z24A 2J8FA 2V30A 1XYAA 5A8OA 3W6YA 1E6XM 3THDA 4NY2A 1QOXA 3NGJA 1IXOA 4C6KA 1J96A 3NA8A 5FACA 1T40A 4H83A 3T6CA 1BVNP 5D8WA 1LM1A 1V02E 5XINA 1VRDA 2A3LA 1E43A 1YW1A 4W5UA 2J25A 4GJ1A 3P14A 3C52A 2H3DA 4RE3A 2E3ZA 3GD6A 5LSMA 1UKOA 1GW1A 4CCZA 1EFZA 2QPUA 5HNNA 4EAYA 5HNTA 1WKYA 4IICA 1ONRA 4JEQA 1XWYA 3WQFA 1AQMA 2PDJA 3FAXA 4YNGA 4AU0A 3BGGA 1QW9A 1YHTA 3KZSA 1GQIA 3LCIA 4DZHA 4HGXA 1K9EA 1TV4A 3PB0A 1OC7A 3P82A 2YA0A 3P8IA 4L4OA 4RPQA 3FDKA 1UZ4A 3MKKA 4XTIA 1H5VA 4O14A 3M41A 2JKAA 2OO0A 3L68A 4EPKA 3GS6A 2DIJA 5I03A 1XFBA 1BLIA 3BMVA 3GXNA 3GDKA 5BCAA 3B9AA 3AU2A 3NM3A 3RIKA 4IQJA 3U6WA 2PWVA 4QX4A 4L65A 4XB3A 1JFHA 1E73M 4X2RA 1ZALA 3IJ8A 1ENUA 1RAKA 4JQ1A 2PRLA 2YL6A 1QUMA 1I9CB 4Y7EA 4UTWC 1K02A 4DBWA 1CLVA 3IGSA 1ZU8A 1R3SA 3BZGA 3KVLA 1V0LA 3WBAA 3A4XA 2WKGA 4Y9PA 1RBLA 4MY9A 3MCNA 4ADTA 1JDEA 3GTHA 4GO9A 3WL0A 4DYJA 4H04A 3WNNA 4DBEA 3VDBA 2A2IA 3WBXA 1E1CB 2D22A 1E71M 2J74A 2DUZA 3BG5A 3HFYA 3OU8A 3PF3A 5A94A 1C3FA 1TTIA 1FFQA 1PEZA 4QG9A 1BQCA 2A6NA 5E1QA 3QLDA 4A3HA 3GNNA 3A9BA 2E9MA 1J6PA 3LQGA 5I3KA 3SDOA 1OFRA 4AZ6A 1A5UA 3MMDA 4AD2A 3AWOA 3B8VA 1R8LA 2IXVA 5DY2A 3WLJA 3S9IA 2XH4A 4AZCA 4EE9A 3EKGA 3MHUA 2Z27A 5CJ5A 2EPKX 1QOQA 4E4UA 5A2CA 2PWEA 4EK7A 4DLFA 3C6CA 4DO6A 4O1DA 1BGGA 3VNJA 2F6XA 3E49A 1RJPA 4HNLA 1FP9A 3OIXA 1ZZMA 2FDSA 3KTCA 1F8IA 4B16A 2XFRA 4LUSB 3WLRA 4CQAA 3PZVA 1OGGA 4C5ZA 3GKAA 5CZ0A 4FI4A 4C6LA 1GOQA 1PKYA 3K2GA 4JPGA 5LIXX 3L4VA 4LUJA 1E6RA 2I57A 3DG6A 4JKLA 3O06A 3KUMA 3MUAA 1HN1A 3NQMA 4LX4A 3UWYA 1GKQA 3N2CA 3L5MA 3S42A 4MG4A 1JPKA 4K38A 4ES4A 1AQ0A 1OHLA 4IXXA 2VR2A 3W00A 4HTYA 4QM1A 3B8UA 3L65A 2A1YA 1L6YA 1DE5A 4XZBA 4WSKA 2G95A 3BOXA 1GJWA 3SN1A 3VIMA 3KRZA 1ODZA 4XAZA 2WMIB 3GFYA 1XSIA 4FO4A 5H8MA 1J6OA 3VMOA 1NDVA 5A3HA 2NV1A 4DJFD 5I0DA 5BXPA 1TG7A 4BKNA 1NOFA 4PODA 2PDQA 4YCPA 1ZJAA 4HPJA 4W9TA 2PURA 3B40A 3W7QA 2QW5A 2A5HA 4ERAA 5ABGA 1SFSA 3DYMA 4WOQA 4AAJA 3UW6A 5LIYX 1VLIA 4DJFA 3TQVA 2WBGA 1TVPA 1FCVA 1UC4A 1MI3A 2QMJA 3CT7A 4S39A 2ODOA 3LCLA 3R6IA 3BGAA 3UETA 2PRMA 1SSDA 4TU1A 1UR8A 3MV01 3HU7A 3F5KA 1Z8AA 1HUVA 2AMXA 1HGWA 1DVJA 1J8VA 4WDUA 1R3QA 1WYIA 4U28A 2J24A 4G2DA 5BWAA 1Z44A 4IMDA 1W9VA 2F61A 4JTEA 1QASA 5JBDA 1W56A 4FMVA 4IXHA 3TTOA 2AGTA 1GYMA 3G0UA 4DF2A 1OWQA 1GKPA 2J88A 1MXSA 4FOJA 2FTPA 1XINA 3EWDA 3R5EA 3GRIA 4BF5A 2WANA 1YBQB 1F05A 1LYXA 4N9DA 1DV7A 1XIBA 1R85A 2D2HA 4NRRA 1AW2A 4QLJA 1PTGA 5LIWX 1PZ0A 4K6AA 2OT0A 2VGFA 1TB3A 4N6EA 4EWJA 3KOXA 2AKMA 4R7WA 3WJZA 4YTRA 4JN6A 4MKNA 4AC7C 1P6WA 3AO0A 4IJRA 1VEOA 1R2RA 3WELA 4IPPA 2PRHA 2GDQA 3EEZA 4WOZA 1E0TA 1TFVA 3W83A 2D2GA 4V1YA 1ZAHA 2QDDA 3GR8A 2UV8G 4QLLA 4MDOA 2WV8A 2X1TA 4AZIA 1JGMA 3K8KA 1DWAM 2CLHA 3N9SA 1QWGA 4HA3A 4QBXA 4TX6A 1MNSA 4L1GA 1CGTA 1T96A 4AYGA 1DTNA 3S2LA 1KFKA 3N4AA 3GU2A 4L1XA 1UD4A 3IGUA 2F2HA 3NFUA 1K3UA 5C9XA 3FV9A 2WM0A 3GHTA 3NIYA 5K7JA 3GG8A 3BV4A 4MY8A 2BY1A 1J0KA 3VCRA 1XYCA 4PCNA 4MVAA 4A3UA 2YCIX 3PN8A 3M43A 4J1OA 3DC0A 2IMRA 4JNYA 4Q32A 1O1ZA 3OA5A 1NP2A 1A80A 1RK5A 4INFA 3GW3A 1PWLA 4IJBA 4IOTA 1VCGA 1CGXA 4IJCA 1XD0A 2EAWA 1WKEA 1XC4A 5KSWA 4NQ1A 5A6LA 2GOUA 3S1XA 4HU4A 3TC7A 4GFIA 2JBMA 4R85A 3B9EA 1UR9A 2H8XA 3BICA 4H9TA 1Y5WA 5A6KA 4O11A 4ZXLA 1EOKA 8CGTA 3LRMA 4RNHA 4BJHA 1UR4A 2Y62A 1DIEA 1AG1O 1DQXA 1GNXA 4GPNA 1A3XA 1KBBA 3THAA 1UKQA 1SO6A 4B2DD 1HJSA 4GH1A 3ZT7A 3RMJA 4JFUA 3IJ9A 5A2BA 1I2RA 1RP8A 3S8HA 1W8GA 4ML9A 2TPSA 2FHBA 4R9OA 3JZUA 3LX9A 2VO5A 3FK4A 3C8NA 1MFUA 4X9YA 1CZ1A 3N3MA 3G1DA 5D2WA 3VI2A 3UZYA 3G0SA 5IHRA 1NIUA 1EL3A 2EPLX 3DBNA 4PZVA 2XIOA 3W7LA 3MU7A 2C14A 4XBSA 4B2DA 2NZLA 3WLQA 1AMYA 2VOTA 3DFYA 1EB3A 1HNYA 4ZEPA 1B3WA 3C2VA 5HANA 3WQCA 1O5RA 1MW0A 1QNOA 2AQVA 5HR7A 1T99A 2PZNA 4MUZA 4WXZA 3MWCA 3LBOA 1SFLA 1PS9A 2IKHA 3OEXA 4HD5A 3GY1A 2XGBA 3C0SA 3P67A 4O12A 1QI2A 2NW0A 2DT0A 4CQ9A 2ZDSA 3HURA 1E4LA 4XO7A 3AWNA 1WPCA 2VHLA 4JX6A 1EUAA 1R86A 3G1FA 1TVNA 3BC9A 1JYWA 2CXGA 5AYBA 6CGTA 3WFZA 1F2JA 2VX4A 4IG2B 2LLEA 1GVSA 1EQCA 1QR7A 4W87A 1XUUA 1H60A 2Y85A 4ZO6A 3GUWA 1B9BA 2Q02A 3UZZA 4O13A 1KV8A 2WYSA 3WLMA 3ITCA 1R3RA 2FZDA 1P0NA 3M0VA 2OOGA 1CGWA 4LUTB 1GTHA 1VFUA 4DPQA 4GACA 3DGRA 1HKIA 5D4YA 4ONVA 2F7FA 3R89A 5TAOA 2GQ9A 3L4ZA 3RU8X 3WQWA 3QV8A 3RX4A 2OR2A 3R4IA 2CKRA 2QVHA 3QXBA 2V2DA 5ECUA 2OFJA 3WLTA 2WCGA 3GTIA 4H9ZA 4NVTA 1HJQA 1V08A 4NYUA 5CZJA 3CLWA 4ZSTA 4I7VA 3A9IA 3EDEA 1P0DA 5EU9A 5FF2A 1WZMA 1KTCA 1OD8A 2B7NA 3CB8A 2ZQ0A 3B06A 4H7CA 3GG7A 3ZLHA 1UZDA 1JDAA 4JICA 1N8WA 3V0SA 3K46A 4H6RA 3FOKA 2AGKA 3CZ8A 4LYPA 1V7YA 1AD4A 1IV8A 4YTQA 4P7RA 1VFHA 5F1UA 3BURA 1DP0A 3OA3A 1IGWA 5AC6A 1RCXB 1JF6A 2F9RA 4JDBA 1KRCC 2XWEA 4DI8A 1I4NA 1US2A 1RV8A 1BG4A 3GDMA 5A5WA 4LPCA 4DBDA 4AF0A 1PXGA 2NLIA 1IYXA 3GLCA 3NL2A 1ISWA 2H3BA 1Q6FA 1JQVA 4WLCA 1BYDA 5BWFA 1WKDA 3HPFA 3SQSA 3PHAA 6ENLA 4RX0A 4U3AA 3TNBA 1MDRA 1HKMA 1X98A 5U7SA 4HK5A 1JPMA 4WVXA 1D3CA 5CKSA 4GCAA 3P3BA 2ISVA 4Y2WA 3TIMA 2GGIA 4F9JA 4D71A 4XKYB 5DXYA 5IFPA 2JF7A 5M3WA 4MHBA 2VVSA 5KTLA 3EPNA 4HMNA 4A3QA 4XAFA 4DXVA 4KT2A 2D0HA 3W0KA 3W7PA 5JMUA 2XN1A 3ZR6A 4KFPA 1EOMA 3W2JA 1EXPA 4FNRA 4ZL1A 1EYEA 1JCLA 1C29A 1GJUA 4Y96A 1T8XA 3R10A 4PRRA 1ITQA 4UTLA 3OBKA 1EJTC 5BW6A 2VZSA 3TSDA 4GH3A 3VDCA 3PANA 1NDWA 4Q6JA 2XH0A 3CZKA 3V4BA 5EPDA 1JPHA 2QPXA 2ZRWA 2VFEA 2V5DA 4UMBA 2D69A 2WC7A 3M7SA 2HVMA 3M0HA 5MKGB 1DIOA 3T0TA 4POCA 3RNDA 4NZ1A 1LOQA 1OG6A 1XH2A 1XLLA 4JTIA 3EMZA 4K8EA 4KWOA 4ZXOA 2FH6A 1DPMA 5CG0A 2C71A 3RLUA 2BTMA 3VD9A 3W86A 1RQBA 5I79A 3UGRA 1BRLB 1AUSL 1QPQA 4G7FA 3N4FA 1IHIA 4DXXA 2WZHA 3N73A 4YTSA 2FZ8A 1E70M 2E1DA 4GIRA 4OECA 3ZVIA 1O60A 4MB4A 3KS5A 1ICSA 4C65A 2WSYA 2PCEA 2VXNA 5BU9A 1TTJA 3UJ2A 5E93A 2AMGA 3VO0A 2INEA 3VE7A 4HCDA 1W1ZA 7PTDA 1XUZA 4U31A 1SJBA 2VZVA 4LYRA 4O10A 1TWZA 1O5KA 1O68A 3UR2A 1A5OC 4C6JA 4JIRA 4DJDA 1PX8A 2E28A 3NAVA 2DJLA 1JR1A 3N11A 3W7CA 4KGJA 4NJGA 1F8MA 3WF4A 2ADAA 1J5TA 3LV6A 2G3NA 2DSZA 2R1NA 3CMGA 2V5BA 3VIHA 1TRDA 1D7KA 3HGJA 1K7FA 2Y8UA 2Y5SA 1Q6DA 5HWNA 2Z28A 3LGEA 4CD4A 5A6BD 1A5CA 4DO4A 3UA3A 4IFRA 5FOOA 1RUSA 3GNOA 3GYCA 2REQA 4C1KA 4QG6A 4NSBA 3BK0A 4AIEA 1LROA 5XIAA 5FF3A 4FNQA 3V36A 5FL1A 1A49A 3ARVA 3BMXA 1IZJA 4F79A 3PUDA 2WW5A 4OVXA 4GUIA 3STPA 4I9TA 4PBEA 2DQXA 3BLLA 5A6BA 3LPGA 3E6EA 1M7OA 4ACZB 1C92A 2WNNA 4ZB0A 1AJ2A 3A3HA 2OWXA 1YADA 4AZGA 1FWJC 3E0IA 3PZQA 3IWPA 3WDJA 1OFPA 3TQPA 4K8GA 3BLKA 1OIMA 4K39A 3JW7A 3B97A 5IRPA 1LRTA 1CX9A 1FXPA 2CLFA 2X2GA 4NNAA 2QGYA 1PCKA 3EX3A 3BSHA 1FCUA 3LLXA 4K7VA 2NUYA 4AHQA 4WY0A 5C9RA 1NFGA 1G4SA 3PZGA 4GINA 3ABRA 3KVJA 4OUIA 3RDKA 1BEUA 4ZA0A 1SJCA 4L61A 2B7QA 4MGGA 3M1ZA 1EHNA 4GGHA 4FF7A 4OIFA 4H8UA 4PMJA 3S0CA 4PUDA 4B9YA 2ACQA 1UYQA 5EMMA 3LPOA 3SCPA 1E9LA 3NZ1A 3EMQA 2PTZA 4JCLA 1JDFA 3LPPA 1XG4A 3WQGA 2CBIA 5I5RA 1TE6A 4ZQMA 4PN2A 3AYTA 3EMCA 1F7BA 3W75A 1H49A 3E0LA 1EX1A 2NWRA 4EF8A 3XISA 1Z69A 4CQDA 3MI3A 4JDYA 1UPMB 5I06A 3NYZA 4Q4PA 4AG0A 2VWSA 2PD5A 3NG3A 4FA3A 3KDOA 1KTNA 4IUOA 3LSCA 4BWLC 4LBSA 4JTTA 2PDWA 5HNRA 3K4AA 2KX9A 4KEVA 4XZIA 3NWRA 3BJFA 5U4NA 1W9UA 3ZT6A 3ID7A 3MMUA 4HHPA 1LTDA 4XWUA 2DU2A 1JZ7A 4PB4A 5HNUA 3THUA 3EWYA 4GIAA 5EMJA 4FXJA 2VRQA 1UG6A 4O17A 4JTLA 4JIEA 4HZ6A 3RR1A 1OC5A 3N2TA 3NQEA 4XUYA 2PC4A 4FF5A 4HQVA 3T81A 2XGIA 3SY5A 3SSZA 2C6QA 3FY1A 1UR3M 3ELFA 3SGUA 2TAAA 2PWGA 2Z1KA 4XSLA 3EEGA 1KKRA 1S2WA 3GO2A 4TTGA 3VZZA 1M68A 3R7MA 1VCVA 4ML4A 4X63A 2VDIA 2PTDA 3L0KA 3MW7A 6XIMA 1OFOA 5G5IA 4TMCA 4ZGYA 1WV2A 4HA1A 2OYMA 2PBOA 2G8ZA 4JFWA 3WLOA 3VKAA 1EJVC 2PTWA 1I75A 3A5VA 3NUKA 4JQ3A 4FNPA 2NQ9A 1GVEA 3ZO9A 4TVUA 3GNRA 4PMQA 1W3NA 3CK5A 3W27A 2BBFA 3S2JA 3KX6A 5I24A 2O7SA 3ARSA 2QMKA 3N13A 1SFTA 1J10A 1UWIA 3ERPA 3POHA 2VR5A 4MWAA 4W86A 1J12A 1NWUA 3D6NA 1FVPA 1TR1A 5LXXA 1K77A 1E0XA 1XIMA 2VJXA 3SQMA 3DU0A 3JZEA 1PKLA 3LOTA 4LRSA 3EX2A 3TQ0A 4WKFA 4JYEA 4HPHA 2ZOXA 1MUCA 1SZGA 3EOLA 4Z08A 1JJKA 4C6CA 3WSUA 4OZOA 1WAUA 4AC1X 2VP8A 3UQNA 3QTPA 3GDRA 4ICCX 3VD7A 4FX6M 1PVNA 1KCXA 1OX4B 3G8RA 2X41A 4CNUA 4M1RA 2FJUB 5BOEA 3FGCA 1L6FA 2ATSA 3DFPA 1M04A 1S5MA 2BHZA 2BDQA 3AXMA 1KXTA 3SCNA 4ICNA 5DY3A 2ATMA 4KGLA 2XIJA 1QNSA 5F4WA 3PS7A 3N6HA 3TLQA 1PHQA 4HN8A 1HVQA 5LXEA 1E9YB 2BGNE 3DFTA 2YL9A 3AMLA 2YL8A 5TQLA 2IKGA 4GKLA 2NT1A 2OU4A 3KBMA 2R14A 4MADA 2G4FA 3QZAA 3WD4A 3WF1A 4JTKA 1WZAA 1FHUA 1MFVA 1F9CA 2J7GA 2FJKA 2GYIA 1D8WA 1ZHAA 1FP8A 1ZBWA 3EOEA 4IIDA 3DFNA 3W6LA 2HCVA 3HPAA 5FEPA 3VNYA 4B4FA 2PBGA 1LL7A 3PSVA 4FB7A 4FS9A 1H50A 2ZX7A 4ZSUA 3ATYA 1PO9A 2WCAA 1KFBA 2IXUA 5LZLA 3KOZA 1I8JA 3AUJA 3S2CA 4PCTA 3VU2A 4J3TA 3ARWA 3IUIA 5A8PA 4GNJA 2D24A 3FVDA 3WD1A 3U0HA 3U2ZA 1NH6A 5BNKA 4IPNB 3KHDA 1TR9A 2BX7A 1L8NA 1ZCCA 3DIPA 3IJ6A 4PL2A 3RU6A 2QYGA 3RPDA 1Q13A 1X97A 4A21A 3LHTA 4REQA 1BWVA 1ZQ5A 2EG6A 2A7PA 4QS5A 3V5OA 5C71A 1LRQA 4CEUC 5I02A 1IZKA 1MRAA 2FGLA 1XICA 4HIBA 1HKJA 5HJLA 3SURA 3TQKA 3USBA 4GCXA 3N18A 2ZWYA 4QG8A 2PDLA 4NILA 3QHNA 2QNEA 3PTKA 5CQ1A 4CCDA 3OJGA 3F4WA 3CL8A 5CG7A 1DWIM 4WUIA 3B0YA 3NQ7A 2PAJA 1MXDA 5BOFA 2GVJA 4IX0A 3UJSA 4D6DA 4NZ3A 5HJYA 1G1YA 2NX9A 3U7VA 4FNUA 2YA1A 2J13A 3GWQA 2UY3A 4XZNX 3TFCA 2DZBA 2QUTA 3VK5A 1EDQA 2OX1A 5H1WA 4M6PA 3RILA 1UKPA 3QV9A 3A5FA 3WNOA 1V4YA 2QAPA 3PC0A 3H2MA 2VZOA 4IIHA 3WQPA 5TBOA 3FYPA 3E2SA 3FYYA 1PDZA 4XG1A 3MKCA 2QLYA 4O1FA 1FHLA 4BQ5A 5GQBA 1IZCA 1F73A 3A4JA 1JRCA 1VFOA 4IWWA 3QV6A 1XGZA 6REQA 3QRHA 4Y6GA 1V7AA 5EMKA 5HWMA 2PF8A 4PC8A 4EXQA 1GQLA 3B8TA 4Q8WA 4V27A 3S2NA 1KCLA 1MZHA 3VCNA 1W2VA 5AYYA 1ZJBA 5CC3A 1EDTA 1ONWA 2WLZA 2OYKA 2J7EA 3HMJG 5I3HA 2QUNA 4M3PA 3O6DA 2OZ3A 4TXEA 3MT1A 3P8JA 2ZZ7A 1QHPA 5FF4A 2VD9A 3V5CA 2ISWA 4I3GA 1XS2A 5K4XA 3L5AA 5A6JA 1IQ8A 4FIRA 1L8PA 1M1BA 4KW2A 3W1NA 2YB4A 1S46A 4CQBA 4XK2A 2Z0IA 1RP9A 1OZMA 4Y90A 2GQ8A 3PWGA 3I7SA 3BLOA 3ME3A 4N2YA 2DEPA 4KERA 1I0DA 5EKYA 1HFBA 3OZOA 3O1NA 4NUWA 1C7TA 1V6XA 5DX7A 2ZTJA 3M64A 1RCOB 3T07A 1LLZA 2BB0A 5E9XA 2J77A 2WVUA 3AXIA 3CMFA 4AIUA 2DT2A 1S2TA 2PSNA 2Y0FA 2YCJA 1FH9A 1NQKA 2W92A 3WFAA 5C2XA 2ZKMX 2I5IA 4F2UA 3I65A 2IPJA 3C0QA 3EWBX 3BAXA 4RE2A 1O95A 4NJHA 3EXSA 2VEFA 1XRSA 3VNZA 1EP1A 2QCDA 5LKYA 3FFSA 5E9AA 2QF8A 4MYAA 5FI8A 1C9DA 1TZ7A 3TWBA 3CHCA 1HT6A 4DWSD 2YBUA 3AYRA 3VOFA 2GJXB 2YFNA 3WUBA 4K2SA 1RY8A 3RR4A 4LC8A 1YMYA 4MUPA 2DW6A 3HPXA 1XBXA 1XRVA 3QMRA 1N2VA 3CGTA 3UT0A 4LV9A 5DQPA 4H7VA 5AB3A 5I23A 2O9OA