3G1HA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydrouridine 5'-monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
221
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 81
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1hA00
3W7QA 3KX6A 3MI3A 4DF1A 4UTTC 1XFBA 1OHLA 1W3NA 3M41A 4AWTA 3TV8A 3ANYA 1V5XA 1TPB1 4U28A 3THAA 1Z41A 3PUOA 2E09A 4KWWA 1L2UA 1WBJA 1FX6A 3M5VA 4M6QA 1VJIA 1GT8A 1XBZA 1ZAHA 4IMFA 3UD6A 3A22A 5BOOA 5D2TA 3LXCA 3LGEA 3O8AA 4IMCA 1W1ZA 3P67A 5CPLA 4OT7A 3STGA 3W07A 1SW3A 5E1QA 3TMQA 1F05A 2ALDA 1NFBA 2QAPA 1FXPA 3QC3A 4CCEA 3QYQA 1K02A 3HOJA 2C18A 5CG7A 2VENA 1QAPA 2B7NA 1JCXA 4UTUA 4WX2A 2NX1A 3P8JA 2XFWA 4UIOA 5DN1A 3DHDA 3E9AA 4DPPA 4FNQA 4QIUA 2B7PA 4HHPA 5IM51 1H7XA 1SU5A 4O19A 3LBMA 3W9ZA 4UNLA 1ZHAA 3NXFA 4BI7A 3RF9A 3VE7A 3SFKA 1OYCA 2PURA 3W22A 4ZQOA 3CWOX 4GRSA 1PV8A 3MW7A 3PBWA 4WY0B 1H7OA 2AQWA 1FCUA 3W7EA 4TX9A 5K3VA 4O0ZA 3LHUA 4JYEA 5CZSA 4WJEA 3WK0A 3R13A 3PVFA 3WJZA 4A22A 2CLEA 3DI0A 1W8SA 3BARA 3R12A 4NX0A 3W7HA 3HGOA 1RPXA 1K7FA 2ISWA 3B0PA 1WOBA 3G1AA 4LU0A 1SR9A 4M7SA 4K7VA 4LS1A 3NOEA 1Z48A 4Y90A 4NNBA 3QQ0A 3P61A 4O54A 2ZYFA 3HO8A 4OQVA 3L66A 1KFLA 3UWQA 4LC6A 2H3DA 3QM3A 4X9SA 1HTIA 3DFPA 3M5ZA 1PE1A 2FPTA 4XKYB 4MY8A 1QO5A 2E6AA 3NQFA 3M5YA 1ALDA 3TNOA 5U7SA 3FOKA 3G18A 4LS0A 1O94A 1TYGA 4UFKA 3DXIA 3EWXA 3FLUA 4JDBA 3E02A 3NA8A 3H54A 4NJJA 3W7GA 1VPXA 5K9XA 4LRSA 3BG3A 4IWWA 3LDVA 5FESA 4UXDA 4BI6A 2QCNA 5AHLA 2W0UA 3LHZA 1SO5A 4NXSA 2NXGA 3B0VC 3UPBA 2YW4A 5DCEA 4LRTA 4OE7A 4JDYA 3LERA 3GB6A 1F6KA 2RDUA 4TO8A 3NPUA 1OVDA 5CPMA 3SI9A 1U83A 2CLKA 3P84A 3PUEA 3C2VA 3UY7A 1GYNA 4UFIA 1JUKA 1H63A 2ABAA 3EXRA 2AAMA 2ZBTA 4AAJA 3MJYA 3EB2A 4ORMA 2DZTA 1VRDA 4MPQA 3LXAA 3W71A 1W3TA 2H90A 4HIBA 3N19B 2Q3OA 3GNNA 5H2ZA 2CZ5A 2QCCA 1C29A 3TMLA 3GXNA 4XUGA 5DBUA 2EAWA 3R89A 4E2BA 4RV8A 1TQJA 4O13A 4AMAA 2DU2A 4FEZA 3PR2A 1WA3A 5EPDA 1FDYA 3V75A 3S5YA 3P62A 4JIPA 5D33A 3THQA 1G67A 1DL3A 3GLCA 2CW6A 3SSJA 4K36A 3TE9A 1FCVA 3SR7A 3P5ZA 3DFSA 1T96A 3B0UX 3GIYA 3C2FA 1FDJA 3JR2A 3CWNA 4ICNA 4BR1A 3W7DA 2QDGA 3LCLA 3NVTA 4CNOA 2EF9A 2FIQA 3TXZA 5FF3A 2CZDA 3H55A 1KM4A 3B05A 2WOQA 3TFCA 1ME9A 2QDHA 2G5WA 2WNZA 3AJXA 1SFJA 3WJXA 5D2WA 1GOXA 2QUUA 3PBVA 4KFOA 3KVLA 4IQLA 4ZQNA 3PAJA 1JUBA 2YSWA 3CT7A 3L65A 2ZTJA 1O5XA 3W3OA 2I14A 1SSGA 2RH9A 3N9SA 4JTLA 1XL9A 1Q6QA 3G0UA 4C1KA 2A1YA 2BLEA 5SWUA 1GTHA 4JNMA 1LORA 3P5YA 2NX9A 3ZWSA 4PEKA 1KTNA 3O1NA 1TTPA 3M0ZA 5DCDA 3Q2DA 1U5JA 2PC4A 3HQ1A 3NYZA 4N02A 5AOUA 1PHQA 3TAKA 1T99A 4FIQA 3NM1A 3EWWA 5HJLA 3RLVA 3NEVA 4YLWA 5G2IA 4O28A 1WOAA 3N73A 1XCFA 1S5TA 3DAQA 4MKNA 6ALDA 4NUWA 3A24A 2XN0A 4ZQMA 4L4LA 5FEPA 1RV8A 4RR4A 5F1VA 1R30A 1G7VA 2JBMA 1S5VA 3IIVA 4O52A 4QNEA 4NXKA 4LVFA 3IIXA 3SJ3A 5TBOA 4HKPA 2ATSA 2Y88A 2PRMA 3O16A 3CLMA 2V5LA 3C3NA 2QF7A 5LHEA 4JICA 1EEPA 4AHQA 1JR1A 4AWSA 3W7OA 1D3GA 3QRHA 2ZA1A 3LRMA 3LTPA 4TIMA 1H51A 3P60A 4MUZA 1KTBA 2C13A 3E96A 1OX4B 5TQLA 1YDVA 3T40A 4DO6A 1KFJA 3SZ8A 1LP6A 1W37A 3M44A 7TIMA 2VEMA 3DENA 3HG3A 1XDMA 2FTPA 4DF2A 5T26A 3NAVA 1GG1A 4N6FA 3FS2A 1VC4A 4ZQRA 4OHQA 3QQ1A 4XTIA 3H53A 3PSVA 5I3JA 2QCEA 3LXBA 4O1DA 3T44A 5AHMA 2E77A 2JKEA 4JS3A 2A7RA 4JTJA 3O63A 1UJPA 1G4TA 4FB7A 3E12A 4UFLA 1NEYA 5ABTA 1Z42A 4AB4A 2HS6A 1KFKA 3I6RA 4IXXA 3LCIA 4RJEA 3L0NA 4UTHA 1OFAA 2WSYA 4ALDA 1VCVA 2ZFAA 2O7QA 2ZQ0A 2FPYA 3GX9A 4QSHA 4MJZA 4CQ9A 4NZFA 4O4VA 2CLFA 2Z6JA 1O5KA 2J88A 4Q32A 5F2MA 5F4WA 4LVBA 3MMTA 4E2DA 1KLZA 3C2RA 4NNCA 1JVNA 1A50A 3OVRA 1LCOA 3ABRA 1PL9A 2A6LA 4O1CA 2DZSA 2Q3RA 2YDAA 1XUZA 3DFNA 5F4SA 3RFAA 3IIOA 1KM1A 3W7PA 3DU0A 3I68A 1G4SA 1HL2A 1LRQA 2WNNA 2OZ0A 5J5DA 5I3GA 3MYPA 1VGAA 2P1FA 1B4KA 4O18A 3TSDA 3TSBA 3DFTA 5D38A 3BVJA 4QITA 4FNPA 5KTLA 3F03K 4N4QA 3LOTA 4IPIA 3L0KA 1MEIA 1SPQA 2V30A 1QOPA 4UNKA 3TJLA 3G1YA 5HWMA 3RNDA 3WK3A 4O14A 1LOQA 3LI0A 1GQNA 3HPXA 3S6DA 2GOUA 3TJXA 3TXVA 1G7UA 3G3DA 4OWGA 2I9EA 3R5EA 3OVQA 1OABA 1UUMA 1J5TA 1TV8A 3EX4A 3MHGA 4K6AA 3FA5A 4PL2A 2HSAA 3W84A 1KM2A 2B7QA 5HMSA 3BGJA 2XN1A 1TQXA 1CX9A 1JCLA 2ZRZA 3CIXA 3UZ5A 3CHVA 2B4GA 3O6CA 4FNRA 4I7WA 4DBEA 3W7LA 1CW2A 5HULA 3NR0A 1I2PA 2Y7FA 2VC6A 3W86A 1ZNNA 3IGSA 3LLFA 3KRZA 2DP3A 3S1UA 4RCXA 4NU7A 1RQBA 3KXQA 4O17A 4PCFA 4QISA 5HINA 4O11A 5LHFA 1S3HA 1G69A 5C6MA 1TV7A 3LBCA 3G1SA 3IGXA 5D30A 3EWYA 1OFPA 1D9EA 3TQVA 5LNVA 4HNUA 2YZRA 1UUOA 2EPHA 4MLRA 4H4IA 1EA0A 1L6YA 2YCEA 4I7UA 1DVJA 3MWAA 2E1DA 3G1FA 2FB3A 2DZWA 3MI6A 3UWZA 5DELA 1DORA 1FQ0A 3N3MA 1QNVA 3O6DA 3GR7A 2C6QA 1FWSA 3TCEA 4UCGA 3V1PA 1M7PA 4S1FA 3DI1A 4X2RA 4PODA 2Q8ZA 3DKLA 2J9XA 2CLIA 3C2EA 3ZFHA 1LLWA 2HTMA 3O07A 3W2LA 2RDTA 4BF9A 3MHFA 3M6YA 4GWEA 3KVJA 4AWUA 2NV2A 5CZ0A 4Q33A 4IXHA 3DBPA 3FKKA 4FNSA 2A0NA 3BLFA 5HR7A 4UC5A 1LBLA 2EGZA 4NJGA 2WV8A 1KW1A 3BG9A 4GNJA 4MZYA 3A5VA 5EKYA 3PF3A 1MZHA 3EWZA 3KHJA 1K03A 3LI1A 4JEQA 1R47A 3EX1A 5AHIA 4JN6A 4JIQA 2HS8A 3OA3A 4XZ9A 3W70A 3DHFA 2C16A 1I2OA 1RZMA 1I45A 3LHWA 1AMKA 3ABQA 4GXMA 2A21A 4O50A 1A5AA 1DQXA 3LB0A 2ZRVA 3GKAA 4DPQA 1K7EA 4RKAA 4BWLA 2QCFA 2E5DA 3UNDA 3EX2A 4CCCA 3QF0A 2GJLA 1W54A 4UMCA 5CZTA 4TMBA 1OFDA 4GUGA 1EX5A 2VFHA 1JULA 3VE9A 4LOCA 4GUFA 5AFDA 2GUUA 5G1YA 4LW7A 3W7KA 3SGUA 1KM6A 2PE4A 2NUWA 3QPZA 3B04A 4DELA 1W5MA 5BNKA 4HPXA 1HG3A 2C3ZA 2YGYA 2ZCGA 1JQVA 3NPWA 1RQEA 3PY2A 4HPJA 3L2IA 4N2YA 4H3DA 3UWUA 3MHUA 1JRBA 4LVAA 5A5WA 2DJXA 3T78A 3BG5A 1IIGA 3RLUA 2R91A 4O4WA 1DJQA 3NDOA 3KVKA 1SZFA 1X1ZA 3UXDA 1OFBA 2G95A 4YWIA 4K38A 2YYUA 5G4WA 1SSDA 2TMDA 3A9IA 2J9ZA 4Y8FA 1LLZA 4CQ8A 1WYIA 5KZDA 3P81A 1NVMA 4IX2A 4MFEA 1B57A 4JX4A 3FIGA 3R8RA 4A29A 1DHPA 5KITA 2V8ZA 2PRHA 1X6UA 3L21A 3ATZA 1R46A 4YCOA 2ZRUA 3ATYA 3U6WA 3NM3A 3EKZA 1FBAA 4R7JA 3RK8A 1RD5A 4R33A 2WNQA 1AL8A 4IMGA 2CFFA 3WJSA 1GZGA 3FYOA 3PBYA 1VCFA 3USBA 1AW5A 4IJBA 2E5BA 1RQHA 2JK2A 3F1QA 1EUNA 4HN4A 1UB3A 2Y61A 1ICSA 3EWBX 4UR7A 4OV4A 1F5ZA 2TSYA 4TU1A 2V2CA 4QQ3A 5D32A 2KZHA 1UCWA 1V7YA 2VFEA 3GDRA 4JTUA 4N9DA 5HNRA 3M9YA 1OF8A 1XUUA 3WK1A 4CNPA 1EUAA 3G1VA 2E6YA 3TQ0A 3TH6A 1OK6A 2ISSA 1THFD 2UV8G 5HQEA 3S9YA 3EEGA 3G24A 3W1NA 1H5YA 3C0JA 4ADUA 2B7OA 1KBIA 4PH6A 2X1SA 3GYEA 1BEUA 1IF2A 3UY8A 1TPC1 4UTJA 1XBXA 5I3KA 3AO0A 3W73A 1RR2A 2ZRYA 3GZ3A 4JTKA 3BPWA 3W7JA 3OIXA 4JGDA 3S0CA 5K9CA 1MSSA 3PG9A 3W1MA 1OX6A 2Z6IA 3S5NA 2ZA2A 4JTSA 1H7WA 5DY2A 1K3UA 1A5SA 4ZL1A 1ZJIA 1IGSA 3DFOA 5LNUA 3UWVA 1GPWA 1FWRA 3BLIA 1YYAA 3WFAA 4A21A 1W5PA 1C8VA 5FEWA 1HFBA 3L0GA 5LKYA 1LM1A 3HG2A 3D0CA 3IIZA 1I2NA 4Z1AA 1M5WA 3CB8A 2DZPA 1DKWA 3LV6A 2YXGA 3MP4A 4AH7A 1KA9F 1G4PA 3NQDA 5LGZA 2ZDRA 3EWUA 1ML1A 2A5HA 3LHVA 4XTDA 1VYRA 2ISVA 4DO4A 1LOSA 3PC0A 4AF0A 3LV5A 4ADSA 1SZEA 3QMTA 1GVRA 3KVMA 2CLLA 3S8HA 1OFEA 3S42A 2XN2A 3L67A 3S1WA 1WBHA 3QFEA 4JXCA 1TJRA 4AF0B 5HUPA 4EOUA 2OX1A 2E5CA 3HJZA 4NQ1A 1LOLA 3TFXA 2FFCA 2V9DA 3EXSA 3CTLA 3A5FA 2Y63A 1W56A 1UASA 1JCJA 3O05A 4PA8A 4OU1A 3NL6A 1YPIA 2BZNA 5EL1A 3OHIA 5FEZA 3IV3A 1ZAIA 5CKSA 2QCMA 3DGRA 2YPIA 2IQTA 1GYLA 2OJPA 1MXSA 1ZALA 3NQ7A 1A5CA 4WOZA 4LT9A 1TJPA 1ZENA 3MBDA 4O8RA 4NZJA 2V81A 2Y7DA 5MHBA 2CWNA 1JCMP 4HSNA 4O57A 1LDCA 5EMUA 1VYPX 1OF6A 2YR1A 3NQAA 5TIMA 1GVSA 1W5QA 2QCDA 3P80A 2A6NA 1VLWA 5LNRA 3NQVA 3W6YA 3B03A 3RU6A 4ADTA 1AL7A 4JTEA 2E68A 2QCDB 3KRSA 3RMJA 2D73A 3O15A 3NZ1A 3TR2A 3U8GA 3B06A 3TW6A 3CM4A 4TR9A 3N14A 1H1YA 4EWND 4RXGA 4PFMA 3L5AA 2Y85A 2NXIA 3E49A 1QMLA 2ZZ4A 4DEFA 4GFSA 4DBDA 3QSRA 4E0CA 5AHFA 3GDLA 3W1LA 3U2OA 3N2MA 1F2JA 1DQWA 4IGHA 4OGZA 5C2XA 1RVGA 3VNDA 1X7FA 3TU9A 5BMWA 2QKFA 1XBYA 2G97A 4JX6A 2C1HA 2W6RA 1MO0A 3KRUA 4WXYA 1B3OA 4A2SA 2QCHA 1SZGA 3W7IA 2RKXA 2V82A 3TX9A 1XM3A 1YXDA 2NWSA 3VFLA 2LLEA 2X1UA 3DKJA 5BW6A 1WX0A 1FY6A 3NQGA 1LRTA 3C2OA 5K9DA 5F2LA 4CCDA 5E0KA 1E51A 3W1QA 3YPIA 2X1TA 1EP1A 3W1TA 4XBKA 3HG4A 1OX5A 3GKFA 4JTTA 5CSSA 2WPBA 4RLIA 3TROA 2VKZG 3PM6A 1GTEA 1BKSA 1JRCA 1KM5A 5FF4A 3GDMA 3PULA 3QH2A 2NZLA 1I4NA 2ABBA 3S1XA 3W85A 1W31A 4I7VA 1KTCA 4POCA 4NJKA 2PCQA 1R2TA 5DLCA 3G3MA 5AYZA 5K4XA 2GVLA 3BW2A 3W72A 1GWJA 1AK5A 4DQWA 3NQCA 2YFOA 3QSTA 4JD4A 3FYPA 4U4MA 3G0SA 1H50A 4GC4A 4GE8A 3ZR4A 1SFLA 3G1DA 3DZ1A 1K8XA 4NNAA 1Q6LA 5LNSA 1F6PA 3LCWA 3HMJG 4JX5A 2A2IA 2C14A 2EKCA 4BWLC 3PUDA 2NXHA 3UWYA 1W0MA 3BW3A 4LC8A 2JKAA 1K8YA 2CLHA 1G6CA 3W7NA 1OYBA 3NQEA 1YDNA 1P1XA 2G96A 3M16A 5AC6A 5D2XA 4UTMA 3NQ8A 1KFEA 1YDOA 4JYDA 4QM1A 5G5IA 1KBJA 3L5MA 2V5BA 4KKXA 2A7PA 3W1AA 4PC8A 3QW3A 1LTDA 2V2HA 3IVUA 3QEZA 3W75A 1TPEA 3N9RA 3HIJA 4JYFA 5LSMA 1P4CA 1TCDA 4UTWA 2WSRA 3M43A 1VQTA 4YMZA 1F7BA 3UYCA 3W1PA 4ORIA 4IMEA 3W2MA 1ICPA 4ZVJA 1O60A 5U4NA 1WQ5A 2CLMA 4MJMA 2FPVA 4XWUA 4HNTA 1FCQA 2GVJA 3OG3A 1VCGA 2F7FA 3GVGA 4AEOA 2FJKA 5KMYA 1YXYA 4YL2A 2V0TA 4Z0SA 4MOZA 3NL5A 4MYAA 4XBSA 4KWVA 2W79A 3TAOA 5EY5A 5HR6A 2BX7A 1KFBA 2J24A 2C15A 2Z1BA 2RHGA 3QPYA 5AHEA 3I7SA 3HB9A 3HPSA 3MUXA 4FXRA 5BRBA 3LTSA 1TIMA 2ZZ5A 3DFQA 3I7RA 1BWKA 1WXJA 1FDZA 1PCKA 3EXTA 1QDSA 4GUIA 2VEIA 1JCYA 3W88A 3W74A 1KV5A 3NQ6A 4EF8A 1JJKA 5CPOA 3SY5A 2GJNA 4Z1BA 2CLOA 3W83A 1Q3NA 2ZZ6A 1VHCA 3HGRA 4FNUA 4Y6GA 1QPOA 2Y6ZA 3QMRA 4HT3A 3TW7A 4K39A 1ONRA 4KFPA 4YXGA 4GUJA 3NO5A 2NUXA 4XQ6A 3LHTA 2BTMA 5CPNA 1TTIA 3GNDA 2RDWA 1SUXA 3S5ZA 1S5WA 4FF7A 3G1XA 3G0XA 1UBSA 5K7JA 1N7KA 1EIXA 1VH7A 5HWJA 1TTJA 3TQKA 2ATMA 3CQ0A 1H62A 2X2GA 3BGGA 4JR5A 5E93A 5K4ZA 4JTHA 4HNNA 4LV4A 1IXQA 1LRNA 5BMXA 1ZCOA 4QNWA 2J6XA 1TSIA 1OG0A 1OFRA 5G1TA 1QPQA 5D04C 3K30A 3TIMA 1TRDA 2YW3A 4CLMA 1DOSA 2GVGA 2ZRWA 4MIMA 5DY3A 3T4CA 3TKFA 5IBXA 3SGZA 5G4EA 5AC8A 1EWEA 3BV4A 3M47A 4RXFA 3VKJA 4EF9A 2TYSA 1XI3A 4D2JA 1IXNA 3SECA 3M5XA 2JGQA 2ZZ3A 4NVTA 2GQ8A 1XKYA 4UFJA 5C5YA 2C0AA 4G1KA 4WY0A 1TREA 4NX5A 1H1ZA 5AYXA 5CGQA 1XC4A 3MP5A 3PBUA 1VLIA 3PB2A 2H3BA 3CEPA 3MBFA 1WV2A 3C61A 2JGYA 5G2HA 3Q94A 1Y0EA 2ZA3A 1H7PA 2QCGA 4UTLA 4P2VA 2DZUA 1ZFJA 3KFTA 4AHOA 4LUIA 4QAIA 2GPTA 3W23A 3A21A 4IPJA 2YX0A 1L6SA 1X8FA 3UWWA 4IMDA 1SW7A 2VEPA 3GAYA 3B4UA 3NZRA 4MZ1A 1GVFA 5KINA 5F2GA 4UFMA 4AHPA 3CIWA 2QJIA 1SO6A 1TB3A 4GJ1A 2CZFA 3W1RA 3Q37A 2QEZA 1C9DA 1TPVA 2ZRXA 3OEXA 1ZAJA 5D09A 1SO3A 2E6FA 3LM7A 3TC7A 3LCHA 5C55A 1MEHA 1K8ZA 3NQ2A 1I8JA 1WAUA 1SW0A 4XKYA 3JRKA 3GXPA 4CQAA 4Z0JA 3FFSA 1QWGA 3GDKA 1Q6OA 3KAOA 4GUHA 2P0OA 2VELA 5CSRA 2AGKA 1L9WA 4H6KA 6TIMA 4UTTA 4JY9A 3G1HA 1YTKA 3W2KA 3G8EA 2Q8LA 3GAKA 1XBVA 3QMSA 1N8FA 3HGSA 3STCA 4LY8A 2DZVA 3NNTA 1H7NA 1ME7A 3QW4B 4HSOA 3G22A 2FDSA 3M7WA 3LCGA 4ZQCA 2I1OA 4TMCA 1PS9A 4FXSA 4N9BA 4O1BA 1YTEA 1LZOA 4Z1CA 1NAL1 5AN7A 3FJ6A 4LV9A 3IVTA 2H8ZA 4Z1DA 1OK4A 2J27A 1F76A 3PS7A 5AHNA 3BO9A 3QJAA 4BFAA 1KM3A 1TV5A 1TPH1 3MP3A 4OBTA 4N4PA 4A3UA 2BWGA 4ONVA 1LROA 2NUYA 1PIIA 3IGUA 4RX0A 2TRSA 3TA6A 1NF0A 1DJNA 4O10A 5DBTA 1Q45A 1QR7A 5J5RA 3ZS4A 1ME8A 1M6JA 3SW6A 3W87A 2V2DA 3SIZA 1KM0A 5FEXA 4K7YA 1VR6A 1R2SA 1TMHA 3O6YX 4UTKA 1J4EA 1EP3A 1PVNA 3ELFA 3LRKA 5LNWA 1F74A 5DXXA 3FJLA 3IIPA 3PWAA 3P82A 1QPRA 3LX9A 2WSQA 2QAFA 4IUOA 3FKRA 3VI2A 4DXVA 2Y62A 1AG1O 4CNNA 1O4UA 4ZMGA 1R2RA 2QJGA 2NV1A 4Y9AA 2ZZ1A 3L9CA 1ICQA 4X3ZA 4QJ1A 1FCBA 2Z2UA 4O15A 1FWTA 3N2XA 4S2BA 4PTNA 5D2VA 4ML9A 3IVSA 3WJWA 2R14A 2ZZ2A 3LLDA 3E0IA 4MLJA 3UXAA 4AXKA 1VYSX 1YPFA 4MFDA 5HWNA 1GEQA 4WXZA 1H61A 1IXPA 1B4EA 3CEUA 4Y96A 2C19A 4FX8A 3N34A 1G4EA 4RZ6A 1YTDA 5HUOA 2NLIA 5D37A 4UR8A 2QR6A 4C1LA 3UQNA 3L5LA 4PL1A 3TDFA 4WY0F 5AB3A 3TK7A 3ABSA 1TPWA 5L6UA 2Y89A 3DH7A 5AYYA 4JTIA 2VFDA 1GG0A 4ZZ9A 3GXTA 4WD0A 2A7NA 3IRDA 4MY1A 1FWWA 4W9TA 3R2GA 1YLVA 4J9JA 1A53A 3F4NA 2VFGA 1OYAA 4FO4A 4NT0A 5FF7A 1JCNA 1JQXA 2ZZ7A 4AVFA 4IOTA 3MYOA 1QFEA 3QZEA 5EYWA 1F73A 3JS3A 4N9CA 4P61A 3VCRA 5C54A 5DCBA 3UZJA 1KV8A 3OVPA 5I3HA 2A4AA 1YADA 5D02A 4L4MA 3EX6A 3IEBA 3W1UA 4K8EA 1TTQA 1EP2A 1TPUA 2GQAA 3NPVA 3HPZA 3W7MA 2X1RA 4WOQA 1QO2A 2QUTA 4S2CA 1Z44A 2Z0IA 5KZMA 3UPWA 2WJZA 1BWLA 4M19A 4ZQPA 3GDTA 3KOFA 2HMCA 1FWNA 1OX4A 5D05A 1T0OA 5L9FA 1J2WA 2PRLA 2CZEA 4NJHA 1KFCA 3STEA 4LTSA 1I2QA 4OV9A 2Y7GA 4UTWC 4UMAA 4R53A 5D2YA 3B8DA 4A2RA 1ZY9A 1W5OA 2FLIA 4JTGA 3BW4A 5F4XA 3GK0A 5DXYA 3PSWA 1SQ7A 4EIVA 4WQ6A 1D3HA 3BK0A 2Y7EA 1TPDA 4IX0A 3I7QA 3W7CA 5D03A 3PB0A 1VHNA 1FUYA 5CZJA 2JKPA 4LS2A 5FF0A 3P8IA 1VS1A 1H7RA 3A23A 2VEKA 2BXVA 4LUJA 3Q58A 3ZWTA 5I3IA 5F2IA 4FIRA 5FF2A 3T7VA 1JUEA 2VFIA 2VOMA 5H91A 5A8GA 1IXOA 3I65A 2NWRA 3WK2A 4BI5A 4DF0A 1W3IA 1VZWA 3INPA 4O1AA 2WQPA 4LVGA 4M6VA 1PCWA 3W7RA 3W2UA 3LHYA 3F4WA 2H8XA 1LBMA 4WZHA 1LYXA 1NSJA 4E38A 3GR8A 2VXNA 4FNTA 2NX3A 4UFHA 5F1UA 3MI2A 3TC6A 1XXXA 3NQMA 4RZ4A 3PG8A 3LRLA 2R94A 3T55A 1FXQA 3M1ZA 4RK8A 1P0KA 1GJPA 2YYTA 3C8FA 1W5NA 1M7OA 2F84A 3C52A 4M7TA 3W2NA 1SO4A 4R34A 1T8XA 1O95A 3C56A 1HO4A 3CPRA 1BTMA 4K37A 4MY9A 4UUIA 5G2WA 4B5NA 5FI8A 1K7XA 3NPXA 2BSLA 1H60A 2E6DA 2X30A 3EX3A 3P74A 3P7YA 4LNYA 4M5PA 3TSMA 1EPXA 5LGXA 4EVZA 1AW1A 1TPFA 3HF3A 4JY8A 8TIMA 1DBTA 1GVQA 4MVAA 1OJXA 3W76A 1EB3A 3L68A 3FEMA 4WUIA 1HUVA 3LTYA 4K8HA 4YCPA 1SZNA 5K2ZA 4GBUA 3CC1A 3STFA 2X16A 1LBFA 2OT0A 2OT1A 4I9AA 4KFNA 1I2RA 5AC7A 2P10A 1XDLA 4Q4KA 1DV7A 3CU2A 3W2JA 2OCZA 2QCLA 1NF7A 2DZXA 1TRIA 4FX7A 1P5BA 3OBKA 5IBXC 3LCFA 1EWDA 4LWWA 2H6RA 1L6WA 1OFOA 3O06A 2R8WA 3C6CA 1P0NA 4HNVA 3NG3A 3ABOA 1ADOA 3HG5A 1QOQA 4LVDA 4JTFA 4MYXA 3S5OA 3WJYA 5EA9A 2Y70A 4UMBA 3HBLA 5I3FA 2FQIA 1YXCA 4N6EA 2B0MA 1N55A 3LCXA 1HO1A 4NJIA 2O7SA 3C4UA 3MO7A 2DORA 4M6PA 3NL2A 3G8RA 4O12A 2DJLA 4DO5A 5EBUA 3NL3A 1GVOA 2TPSA 2VFFA 3EKLA 3W1XA 1TO3A 1Q6RA 4X22A 2OMAA 4Z08A 1QPNA 1MEWA 4O53A 2WO5A 3HGJA 2A85A 3S1VA 1X1OA 4MZ8A 1WDWA 4O0KA 2RFGA 1PHWA 2FB2A 2QJHA 5KZEA 4O16A 1KLYA 4RZ5A 4UTIA 2YFNA 1AW2A 2J9YA 2GQ9A 3BLEA 1B9BA 4N9EA 4BK9A 5GVJA 1QCWA 2CU0A 1IIHA 1A5BA 5KSWA 3NGJA 2ZTKA 4FX6M 2QUVA 3TUUA 2EHHA 1CI1A 4FHAA 5LZLA 1OFQA 2WKJA
chains in the Genus database with same CATH superfamily
3E2QA 1HKIA 3MI3A 1ZS2A 3WQ4A 4F0SA 1W3NA 3M41A 3SY8A 3KL5A 1V5XA 1TPB1 4U28A 3THAA 4WLCA 3F7JA 4FAMA 3PUOA 3MCNA 5A6BA 4R7OA 3GH7A 2WVUA 2W5FA 1XG4A 3RX3A 3GNPA 3GU9A 3UD6A 1MUMA 3A22A 3FSUA 4XISA 3T0DA 4INFA 5D2TA 1HIZA 3TN4A 5CPLA 1PO9A 1AQMA 2J7HA 4MADA 1SW3A 5E1QA 1Q6GA 1BAGA 4IICA 2WC3A 2BNJA 2YLLA 3TA9A 1FXPA 4I8YA 5DMNA 3H7UA 3QYQA 3ARWA 4FXFA 4B5TA 4GACA 3P2VA 3T2PA 5CG7A 3V5CA 1QAPA 4AY1A 4UTUA 3U2CA 2QUMA 5C71A 1E9LA 1KBBA 4WJXA 4CKQA 4F0HA 4UIOA 2OG9A 3IJDA 5DN1A 3I6EA 2B7PA 1H7XA 1SU5A 3WLRA 2FDMA 1XICA 4BEQA 3A13A 3RF9A 3HZ3A 3OZOA 4GI4A 2NSOA 1TV2A 1YKWA 4GRSA 3GDBA 1YEYA 1U5VA 4LUTB 2HEJA 1FCUA 4CNSA 4TX9A 3T0TA 1CLXA 1IEIA 3URAA 4WJEA 3BLLA 5H8MA 3OZMA 5HA7A 1KRMA 1Z3NA 3GSMA 3R12A 4BS0A 3W7HA 3HGOA 2EPKX 3A3WA 4CU6A 3DYOA 3KOZA 4LU0A 1WOBA 1NTHA 2O9TA 5TNVA 3QQ0A 3VIOA 1PXGA 2V63A 3LPOA 2ZYFA 4OQVA 1D7KA 1M68A 1XYLA 4F48A 1HTIA 4RDWA 3M5ZA 1TX0A 2CXEA 2EBNA 4TTGA 3S2NA 1T7LA 4CD6A 3E38A 3GXDA 3T08A 3G18A 3C0LA 3KZPA 2YA0A 4NJJA 1VPXA 4AD1A 2ZUNA 2VYOA 3TTQA 5FESA 2G41A 4UXDA 5AHLA 3LHZA 2Z27A 4QBXA 3QV8A 1V6YA 5FSDC 2RDUA 2WHJA 3IAPA 4L9XA 4WHBA 3NPUA 1OVDA 5CPMA 1UROA 1U83A 2ZXBA 3P84A 3UY7A 3VM7A 4UFIA 2ABAA 3EXRA 1O66A 5CPSA 1NIUA 3OLDA 3SUSA 4DZAA 4S3EA 2E4TA 3W71A 2GJXA 1W3TA 4HIBA 2Q3OA 2CZ5A 1TUFA 3PPGA 3TMLA 1MDLA 3O0KA 2DZBA 1ISXA 3MUY1 3R89A 4E2BA 4AMAA 2DU2A 3KP0A 3PR2A 2PMQA 3CZJA 4JIPA 3GLCA 2GVEA 3SSJA 3TE9A 3P5ZA 3B0UX 3JR2A 1EOMA 2J78A 3TWAA 3W7DA 2QDGA 4CNOA 2WPGA 4PCNA 6XIMA 1HZYA 5BRQA 2WOQA 4LYQA 5PTDA 3TFCA 1ME9A 1BXBA 2R1NA 1UD3A 2G5WA 1M7JA 1TR1A 4M6UA 3WJXA 5A6SA 4KFOA 4C6LA 1XWYA 4AY7A 2VX7A 1PZ2A 3RX4A 2YSWA 4ZEPA 1TZ7A 3RDKA 1U1HA 2VX4A 2XINA 2HNHA 3WD0A 2ZTJA 4Q22A 1GEHA 3W3OA 5AYIA 4LNCA 5SWUA 3K1GA 3P5YA 5JIPA 4GCXA 3ZWSA 4A8IA 1KTNA 1QW7A 1WE5A 2OODA 3WKZA 4TQTA 3Q2DA 3HQ1A 4G7FA 3WLKX 6PTDA 3HU7A 4N02A 2XFRA 1T99A 2FYMA 1ISYA 2VVSA 3LA4A 2CKRA 1F4AA 1R0MA 4GO8A 1XCFA 1YIXA 4MKNA 3A24A 4ZQMA 3ZSTA 3FXGA 5FEPA 3RRAA 1V0MA 1NDYA 1G1YA 3VNLA 3L4UA 1RLDA 3ABXA 4Q4SA 2CKSA 4HKPA 3A12A 3PBGA 2WMIA 1EEPA 4HTYA 2BGQA 1TVLA 1RY8A 3W7OA 1KRBC 1D3GA 3QRHA 4IMAA 2C91A 4QLJA 3P60A 5IFTA 4HGXA 4MUZA 1J6OA 2XFFA 4IJRA 2FMOA 4HD5A 4QHRA 1YDVA 3SZ8A 2HVNA 3KM8A 4AG0A 5CCZA 3UJFA 3E6EA 2DT1A 5A8MA 1JYXA 2O92A 3VMOA 3QVQA 1CGWA 1XIHA 4N6FA 4IIFA 4ZQRA 2J8TA 1I0DA 5I3JA 2JKEA 2QPSA 4GVGA 1G4TA 4FB7A 3VYLA 1EYEA 2Z00A 3OJGA 3TC3A 1EJUC 2WWDA 2E25A 1KFKA 1IT7A 3NO1A 7PTDA 1JYWA 1I60A 4IGNA 3LCIA 4P8WA 1B1YA 1OFAA 1UKPA 4LCQA 1VCVA 3GHTA 4HP5A 4KCWA 4P7LA 4I9MA 3IJQA 5LYRA 1GZJA 4JFTA 1XLIA 4CQ9A 4NZFA 2J79A 2CLFA 4MM1A 2VNCA 2J88A 5B7YA 1TV3A 1H2JA 2YKKA 3UCQA 2POTA 3FX4A 3MMTA 3C2RA 4NNCA 5ENLA 4RE3A 3ABRA 1PL9A 3CASA 4O1CA 2DZSA 1UIPA 3BICA 3MY9A 1XUZA 3SSZA 3RFAA 5EMMA 3IIOA 3N2BA 2GK1B 2YDRA 4I6KA 4KF1A 1UZHA 2OZ0A 3WL0A 5I3GA 1VBHA 3MYPA 1QUMA 3UERA 2P1FA 2ACRA 1BG4A 4GO9A 5D38A 1LT7A 1RK6A 2PDNA 3OODA 4N4QA 2O4MA 3LOTA 4ZB2A 2VD9A 1SPQA 2AKZA 4QX4A 2D2GA 1QNSA 3BH4A 4AZ7A 2I5GA 2GOUA 1BYAA 1IWBA 2IKHA 3MO4A 2HCVA 2YA2A 4O1FA 3R5EA 1E72M 1OABA 3W84A 5MF5A 5HAOA 1XDJA 2PDYA 1JCLA 3GNXA 3SRKA 4C7GA 2D2JA 4J3WA 3G5EA 3KE0A 4W93A 5HULA 3W7LA 1EBGA 4GNVA 1XCWA 4NY2A 1I2PA 3GC4A 5T9BG 5I07A 1FKXA 4PMYA 3PJTA 4GIEA 3LLFA 2X41A 4QLKA 1F4HA 1NDVA 3S1UA 4RCXA 1RQBA 3AI0A 3KXQA 4O11A 5CBJA 4AZCB 3C8NA 4GA8A 3UZWA 1UP3A 5C6MA 3LBCA 4MNJA 2ZUWA 1EH9A 1T40A 3IAQA 3AIUA 3LMZA 2PUZA 4ROPA 3VKBA 4YTRA 1R38A 5LNVA 1AODA 2Y8UA 4HNUA 3IANA 2HV5A 3QR3A 2E1DA 1QW9A 2FB3A 3UGRA 4B2DD 5DELA 1DORA 2BXYA 3N3MA 4RE0A 1M7PA 4X2RA 3UVIA 1LWIA 4NP7A 1Y65A 2OGJA 3C2EA 3K8LA 2WB5A 4DN1A 2CWXA 3MHFA 3KVJA 3DBPA 2NQ9A 2QS8A 4JNYA 4FNSA 3BLFA 5HR7A 4CVUA 4XVDA 4UC5A 4IZGA 3BG9A 4GNJA 4MZYA 3BJSA 4IT1A 5EKYA 1MZHA 3KHJA 4H7CA 4JEQA 3R1ZA 1IEXA 2C16A 1POKA 3CZGA 1XYBA 3BMVA 1A5AA 4PRTA 1OT1A 3N15A 5EGRA 4JQ3A 4RKAA 2P8BA 4EP8C 3EX2A 3QF0A 1YE4A 2GJLA 1W54A 1HP4A 1PWLA 3LNPA 1GK8A 4GUGA 4JQ2A 3ZIZA 3EPOA 5EFFA 1HVXA 2PB1A 2ZXDA 4L5ZA 4QDPA 1E43A 1JULA 1M9HA 3U3HA 1EJ7L 2Q71A 3EA3A 1WZKA 4PE8A 3AQUA 1KWKA 1M53A 6ENLA 1DE6A 2GUUA 2WCAA 4H7ZA 5DT7A 1UR3M 4AIOA 4DELA 5BNKA 1VEPA 5E6ZA 3MQTA 1IV8A 1ZU8A 1F6YA 3U7VA 2DJXA 3T78A 3MV11 1CGYA 3L4WA 3GHSA 2R91A 3WSUA 4DWSA 3CAQA 1ZUAX 2G95A 3VM5A 5G4WA 4Y8FA 3Q67A 4CQ8A 1WYIA 5KZDA 4PCPA 1NVMA 3AHYA 1XPGA 3FIGA 2J75A 3V0TA 4A29A 5KITA 3O2LA 2YOCA 5D4YA 1BXNA 2GWGA 3BAKA 2NT1A 3M0IA 4XZNX 4YCOA 1AH3A 3PJUA 1XIIA 3NM3A 3EKZA 1FBAA 1E5JA 3RK8A 2W61A 3ARYA 3MMUA 4XD6A 2RDXA 2UY3A 1PTDA 1AL8A 4ZGYA 2J8GA 4ZXLA 1GZGA 1RCQA 3USBA 4IJBA 5GJMA 1TA3A 3W6MA 4FLQA 2WAGA 3MC5A 1ZP3A 1EUNA 3EOOA 2ACQA 1S5MA 1DJGA 3EWBX 3ICJA 1F5ZA 4TU1A 1TA3B 1UR0A 1XGEA 5D32A 1UCWA 5HNRA 3N4AA 4M0XA 3WQ8A 4GQRA 3LBOA 4Z2IA 1DJYA 1XUUA 1ONXA 4CQDA 1XGDA 1Q7MA 2ISSA 4MAVA 2UV8G 3EEGA 2PWGA 3G24A 4IG2A 4X60A 3MTWA 2X42A 4ADUA 4W7WA 3SB0A 1AVAA 3KBWA 3UY8A 4IG2B 4JL2A 4DYJA 1XBXA 3AO0A 3BOLA 3W73A 2P8CA 5JBFA 4GYJA 3IJ6A 4JTKA 4WGXA 5LA0A 2H9AA 3CUXA 2GYIA 4Y9NA 1MSSA 1HJSA 4D72A 2W63A 2H9AB 1CENA 3ITYA 3DG6A 1K3UA 4AZGA 1A5SA 4XD4A 3H8AA 1B0IA 1ZL1A 3BLIA 4Q4MA 3RN6A 3WFAA 4A21A 3TOYA 3LSCA 5LKYA 4NRRA 3PANA 3ZXWA 5BXPA 2I7GA 3HG2A 2XU2A 1DWFM 4MPKA 3SCSA 1I2NA 4J2PA 5LA1A 3CB8A 2DZPA 3R0DA 1MFUA 2YXGA 1P6BA 1KA9F 1TWZA 5LGZA 4HCDA 5FJRA 1LQ2A 1ML1A 4J40A 3PC0A 2A3HA 1EYWA 1E3XA 2OR2A 5FD0A 3WDIA 1OFEA 3GY1A 4NQ1A 3KTCA 2FFCA 3VC5A 4CN6A 3UA4A 1V08A 1W56A 1V7AA 3O05A 1SFSA 1WO2A 2CIPA 4OU1A 3T1GA 1HGYA 2AQOA 5DMMA 4GKTA 5FCZA 3F2DA 2OO6A 5EL1A 2V68A 2P53A 4M8UA 5FEZA 3N4EA 1W1TA 3IV3A 1ZAIA 4QAWA 2QCMA 1P7TA 2ZUVA 2WZHA 3NQ7A 2BG5A 2PS2A 4J1OA 1GW9A 4YYCA 1P7TB 4BQ2A 3E2SA 2HNEA 1FHVA 1LDCA 3M0KA 1OF6A 4PYSA 4XB3A 1J11A 2V38A 4BJHA 3RM9A 4UQAA 2QCDA 2IXVA 2QGHA 2WVTA 4XBJA 2JEPA 4ADTA 1J5SA 4JTEA 2E68A 2QCDB 1T41A 4M24A 4TR9A 4AYSA 1H1YA 4EWND 4PMDA 4RXGA 3E49A 4GXWA 2PDIA 4GFSA 4E0CA 4AQLA 1SR0A 3N4FA 3GDLA 4NI8A 3W1LA 4BQ5A 1HXJA 1F07A 1ZSXA 3APYA 3LPPA 3AZSA 4QE1A 1G9HA 4IGHA 3H2FA 4YTSA 1ENUA 2J77A 4JIHA 1UD4A 5BMWA 2VDGA 4IM4A 2W6RA 1MO0A 4WXYA 1NELA 1XH1A 1GVEA 3SN4A 5A69A 3VIGA 1HNYA 1XM3A 4K1WA 2NWSA 4CNTA 2Y24A 2X1UA 3BMXA 3NGFA 3WH5A 3NVDA 4LF1A 5F2LA 3TWBA 5A95A 1E4NA 5E0KA 1E51A 3QHMA 3KW3A 3YPIA 3W1TA 2OYMA 4XBKA 3WQGA 3GKFA 2VC7A 3FYYA 3WQ6A 4O1EA 3WQCA 3KZSA 3MDUA 2VKZG 2XM2A 1GTEA 3PM6A 1HJXA 2FVMA 4JTRA 5FF4A 3GDMA 3PULA 2OXNA 2GUBA 2ABBA 3S1XA 1W31A 2IS7A 3R11A 1KTCA 2YDSA 3W82A 2INFA 4F9DA 3OW1A 1VRXA 3WYZA 3G3MA 5E70A 5JIWA 3BW2A 1VFMA 2XSAA 1AK5A 2QLYA 4UZUA 3QSTA 5GQBA 3ZR4A 1SFLA 1JCTA 4NNAA 3HMJG 2PCEA 1H4PA 5HNNA 1W1IE 3K4DA 4J3VA 3WLJA 4HOWA 3GVQA 1S2VA 2G96A 5AC6A 3AHVA 3FGCB 2V3FA 4I90A 4UTMA 4JYDA 1J9YA 5G5IA 3MSRA 2VVNA 2UBPC 3K13A 4L64A 4GBDA 3I3DA 1ELSA 2V2HA 3IVUA 2XVNA 2IMRA 3TYDA 3HIJA 1WZMA 4UTWA 1GQIA 4Y8EA 1VQTA 1DWHM 5IHSA 4B15A 2ON3A 3UYCA 3W1PA 3WQWA 3W2MA 1ICPA 4RDZA 4ZVJA 1JEZA 1O60A 2PWHA 2J7GA 3AIRA 2ZC1A 5U4NA 4MJMA 1MUCA 2VC9A 4MF4A 4HNTA 1IR2A 1YQ2A 1VCGA 3GO2A 2FJKA 5KMYA 2V5JA 4US6A 6TAAA 3NL5A 4IH3A 2XWDA 4KWVA 3UR7A 3QV9A 5HR6A 5CSYA 5G1MA 5REQA 2J24A 3BGAA 3QPYA 2RHGA 5AHEA 3I7SA 4E4UA 3DYMA 1XLHA 3HB9A 3HPSA 1JDEA 2YL6A 2ZZ5A 1O68A 3QZAA 2VC5A 1H41A 1PCKA 5C7HA 4YTTA 5I77A 1P0EA 1QNRA 4UQBA 5CPTA 2GJNA 4P8UA 4HJWA 3N6JA 3AMKA 3QYSA 1Q3NA 4UOZA 4YTQA 3HGRA 4FNUA 3QMRA 4XAFA 3T8LA 4QG6A 1J79A 3KDNA 1OGBA 3LHTA 4L4PA 4HMCA 4ZODA 5IRPA 3WUEA 3WZ0E 5BWAA 1E0UA 2FHCA 2D2HA 1UBSA 4HZMA 4GYPA 2YXXA 5HWJA 3RITA 3MPGA 3CQ0A 1H62A 2A79A 2X2GA 4PBGA 5E93A 5HMFA 1H09A 2D3LA 1DIDA 3R10A 4HNNA 4P7QA 3VIKA 4QNWA 3F5LA 3TIMA 4CLMA 3PZ9A 2GVGA 1F3TA 3TKFA 4JPGA 3W00A 1YNQA 5G4EA 1W1A1 4GG9A 3VKJA 2PGRA 4EF9A 4NAFA 3F4DA 4V15A 2ZZ3A 4M3PA 4WY0A 3ARRA 4U10A 5CGQA 3W26A 1XC4A 3GZAA 2Y8VA 3GS6A 4I9JA 3Q94A 1H7PA 1VFOA 1EO7A 4LUIA 5FJTA 3USZA 3V3WA 4QG8A 1L6SA 1T6MA 4UQEA 3B4UA 4MZ1A 1ZBCA 4I5UA 5KINA 2CZFA 2PD5A 3W1RA 1MVYA 2WJEA 2DIJA 4AZIA 4PMZA 3PZQA 2CEQA 2DSUA 3LM3A 3Q4DA 7CGTA 3QHOA 2VO5A 3A3XA 2WSKA 5D09A 4ZSTA 3T2OA 4DLFA 3LM7A 4MB1A 1K8ZA 3G6LA 3NQ2A 4G6CA 3GXPA 1JPDX 3TN5A 3URNA 2KX9A 4C6QA 4FR1A 3WD1A 4GUHA 3PWIA 4JY9A 1KWGA 4Q7NA 4S3KA 4TVCA 3GAKA 4ZTXA 1XBVA 2OLHA 3AXHA 4GYFA 2HJPA 3NNTA 2ZUTA 2POZA 3WLSA 1NH6A 4FZIA 4JKKA 4HSOA 4DBUA 4HZ6A 5B7ZA 1R5YA 1QT1A 3VILA 3HV9A 1RK5A 4N9BA 2VX5A 1ZJBA 3PUGA 3ARVA 4E8GA 4Z1CA 3BDKA 1NAL1 5AN7A 1E5NA 4ZBCA 4U33A 3WDQA 6REQB 3MUIA 4Z1DA 1OK4A 3VDAA 1ECEA 3ISIX 1N8WA 4YVVA 4BQ3A 4UTFA 1UMYA 2CLPA 4A3UA 4NIRA 2PWEA 4ONVA 2NUYA 4BF7A 4LYRA 5DBTA 2ZE3A 1QR7A 1ME8A 1M6JA 4ZFMA 1A0DA 3V5FA 2V2DA 4W8LA 1JZ3A 4E6MA 5BOFA 2WHMA 1HJWA 4UTKA 3PFMA 1RHCA 1PVNA 3ELFA 1OG6A 1F74A 2WZMA 1FWEC 2YCLB 1QPRA 3LS9A 1Q7QA 2WSQA 3AC0A 1IYXA 2WMKA 2C71A 1R2RA 2PEVA 2NV1A 1EQPA 3T2QA 3L9CA 4X3ZA 2QHAA 4O15A 1JPIA 3QY7A 4GISA 2R14A 1X6NA 3LLDA 3L2LA 3UXAA 3AHXA 2Y0FA 3BAYA 5HWNA 1F3WA 4QP0A 3CO4A 1A5UA 4JN7A 3UG3A 1E6RA 2VHLA 2BOGX 5D37A 3VDGA 4UR8A 4C1LA 3L5LA 2HXUA 3TDFA 3SM0A 2XIMA 5L6UA 2Y89A 2ZVIA 3DH7A 1EHNA 3FDGA 3QN3A 5IFPA 2D0HA 4XIMA 2PP3A 3K46A 1GG0A 4ZZ9A 3AWOA 4S3CA 3IRDA 3R25A 4J9JA 4Z2JA 1OYAA 4FO4A 2PDBA 1CGXA 3H70A 4LBUA 3LGDA 2I9UA 4IPPA 1O7AA 1EXPA 3G1RA 2A4AA 1OM0A 1YADA 4L4MA 1EX1A 3EX6A 3IEBA 1GQKA 4GX8A 3L2MA 3F2BA 2OPJA 5C7VA 2ADAA 1QO2A 2QUTA 1BWLA 4M19A 3KOFA 2AL2B 4H6EA 1OX4A 5D05A 3L23A 5L9FA 3N2CA 4CEXC 5M17A 4HMNA 3V5OA 4OV9A 1BHGA 4QJ4B 4UMAA 2DW6A 3B8DA 1W5OA 1EF2A 5DXYA 3WN6A 2Y2WA 5JBEA 3K1DA 4IX0A 3I7QA 4C1NA 1VHNA 4B16A 4IHCA 1SJAA 3A23A 2BXVA 4UOJA 3Q58A 4L56A 5I3IA 4U3AA 2WBGA 5FF2A 5T8GA 4DYKA 1L8PA 1UD5A 7TAAA 1A5LC 4ZFCA 2EG7A 4JQ4A 1PCWA 3W2UA 1JXJA 1JZ8A 1P1MA 3N6QA 2TAAA 4P5UA 4WZHA 1PEZA 3GE7A 3GR8A 2XIIA 1VB9A 3N6HA 1SZRA 3TC6A 6XIAA 1RP8A 4W5UA 3T55A 1C9WA 4RK8A 1GOMA 4X9YA 1M7OA 2F84A 3C52A 4GC3A 3W2NA 1SO4A 1O95A 1POJA 3CPRA 1BTMA 5G2WA 4G7EA 4AU0A 3V7PA 3EWCA 3EX3A 4GI6A 3P7YA 4LNYA 4AWEA 3E74A 1ZJAA 3HF3A 3S2LA 4IL0A 9RUBA 4W8AA 4HK7A 1OJXA 4HOZA 2B31A 1PIFA 1FWDC 5CJMA 1H5VA 4HU3A 2BY0A 1LBFA 2OT1A 4I9AA 1JPKA 4D6JA 3WLNA 1AH4A 1FWFC 1EA9C 2OCZA 2DZXA 3B0XA 2QIWA 1P5BA 2Z26A 3LCFA 2D0GA 5IBXC 2FVLA 1MFVA 5EFDA 1XYMA 3O06A 2R8WA 4HN8A 3WENA 4F40A 1ZLPA 3NIYA 1M01A 2V3DA 3LQLA 5EA9A 5CAHA 4JNZA 3RIKA 3HBLA 2E28A 1EOKA 1UR2A 3CB3A 1VIWA 2YCIX 1UR4A 2DDXA 3TN3A 3WUGA 5BOEA 4DI8A 4OOZA 1SJCA 4L1GA 4DJED 1XYAA 5ABEA 2TPSA 2VFFA 4ZTYA 3W1XA 1Q6RA 4GYKA 4Z08A 1PTAA 3TZNA 2WO5A 2YB4A 5HATA 2O55A 1A3HA 3QV6A 4ZO9A 2OEMA 1X1OA 2GSJA 1WDWA 2FB2A 5KZEA 3BCJA 3BLEA 2GQ9A 3V36A 2XVPA 1B9BA 2PTDA 1R9XA 3TTEA 3NGJA 2QVNA 2HK1A 2EHHA 5E0CA 3TUUA 4LPCA 4YTUA 3OOQA 2CESA 2WKJA 4B5UA 3B8UA 3KX6A 4UTTC 1OHLA 5FJOA 1TIWA 4AWTA 4D8ZA 4WDWA 3T42A 3AOFA 4ICCX 1W9UA 2E09A 1DJWA 4KWWA 3ZYZA 5I2UA 1BVNP 1REQA 1WBJA 3W28A 3M5VA 4N0RA 4GMEA 5LXEA 5E0FA 4IMCA 3O8AA 3P67A 2PDGA 2FH8A 1R87A 3STGA 3W07A 1JD7A 3UETA 2OLSA 2ANUA 2ALDA 2QXWA 4CCEA 1XKJA 1LF1A 3MVIA 4GIYA 1JCXA 3N25A 1C3FA 2FHFA 4WX2A 2NX1A 4CN1A 2XFWA 5TF0A 4S3DA 1WDQA 4V33A 3GTNA 3RX2A 4E2OA 4YVPA 4DPPA 2PZNA 2Z25A 5IM51 4XIAA 5ABFA 4O19A 4HA0A 3W9ZA 3TYEA 4UNLA 3CQKA 1ZHAA 1KR0A 1OC7A 3QFWA 2DUXA 3VE7A 5D9NA 1GORA 1PV8A 2G8ZA 5A1AA 3PBWA 1VPQA 1RJPA 1XS2A 3CQIA 2QIIA 3VIJA 3ZT6A 3W7EA 5K3VA 4O0ZA 1KCXA 4OBSA 4W85A 4C7DA 4A22A 5ECVA 5CLTA 4NX0A 4JIRA 1RPXA 2QJJA 1K7FA 1A0CA 3AYSA 2ISWA 3B0PA 4M7SA 4I5RA 4H9MA 4LS1A 4P8XA 1SYTA 2EXOA 1Z48A 3BANA 2FGLA 4MB3A 3FCPA 4JTQA 3BQ5A 2BGNE 3LLXA 1KFLA 4LC6A 1U22A 2H3DA 4L6HA 3AU2A 4DAIA 1M3UA 1PE1A 4XKYB 4PN2A 2EPNA 1QO5A 1V3KA 3NQFA 3TYUA 3M5YA 2XHYA 4H00A 4XVEA 1PKLA 3NXLA 2I17A 4LUYA 3EWXA 4IWWA 3LDVA 1CEOA 4BI6A 2VGBA 3OGRA 5A8NA 3AJ7A 2Z2AA 2ZX6A 3NUKA 2YW4A 4LRTA 4PUUA 3AIVA 4OE7A 4JDYA 3LERA 4PB5A 5GNYA 4NKCA 3WMBA 5FAJA 1F6KA 4TO8A 2PDPA 4AC1X 3AYVA 1PKMA 2CLKA 1WKEA 1CB2A 1AQHA 4H9YA 3UXLA 2CBVA 2DZTA 1VRDA 3MSYA 3LXAA 1XLKA 3ABZA 4HA4A 1C91A 1AJ0A 1EF3A 4DNMA 1C29A 1WDDA 3JZEA 1A5MC 1XIDA 2WYSA 1RLCL 4H04A 3RILA 4RV8A 4A05A 1TQJA 4JFWA 3U2EA 4IFRA 3S5YA 3P62A 4KW2A 3U0HA 1DL3A 3BCFA 4K36A 4D1IA 2HXTA 2ZIDA 4A8NA 3AIBA 1T96A 3DFSA 3GIYA 3C2FA 3AZTA 2OQLA 3LCLA 2Z2BA 2EF9A 1HKWA 1WKDA 2CZDA 3H55A 1EEXA 4XZBA 1AQFA 1L2QA 1V6WA 5ABGA 3BSHA 1SFJA 3VGHA 5BU6A 2DW7A 1CXIA 1JZ5A 4IQLA 4XD5A 1V0NA 2QMJA 2VWSA 3CT7A 1O5XA 1SSGA 1Q85A 2GDVA 5H6HA 5C2CA 2GGIA 3AS2A 4C1KA 2A1YA 3V4BA 1QK2A 4JNMA 1B54A 2NX9A 4PEKA 2WMHA 4HQVA 4GVHA 3NYZA 2VZVA 5AOUA 3W6LA 2GL5A 1NY1A 3ITOA 4KGJA 1B90A 1PB0A 1OT2A 2DEPA 1UWQA 4J3XA 5D9OA 3NYDA 3SCNA 4YLWA 3P3BA 4O28A 5ABHA 4U3CA 4ZOAA 1S5TA 2FZDA 3WMSA 1S2AA 4B4HA 4H01A 1RV8A 4RR4A 2X0YA 4ICMA 4WKAA 3EPNA 4DM1A 5CSUA 4DY1A 1G7VA 5JVLA 4QNEA 4O52A 4NXKA 3IIXA 1US0A 4PSRA 4HYRA 3SJ3A 5TBOA 1E6XM 2Y88A 3WLQA 3DDMA 3EOSA 2D3NA 4JICA 1JR1A 2ZUUA 5AC5A 5CGTA 1Z6KA 3LRMA 1S5NA 1KBLA 2PDFA 3LTPA 1H51A 1J0KA 4JCLA 2C13A 4PMRA 2PTWA 3MSDA 1H49A 3AIWA 4JQ1A 3W81A 4DO6A 4GINA 3OLGA 3R79A 4ZA0A 2PLKA 3HG3A 1XDMA 2FTPA 1DWAM 3FS2A 3SGGA 4OHQA 3QQ1A 1VFHA 4XTIA 1VFSA 1UQYA 3MKCA 3LXBA 2E77A 4JS3A 4JTJA 1UJPA 3VGDA 3S2CA 2E8YA 3E12A 4UFLA 1NEYA 3PNUA 4Q4OA 3VC6A 4IQJA 1VPYA 2WNWA 4E3VA 3ITTA 5A6BD 1BYBA 4UTHA 1VBRA 2WSYA 1XIEA 2ZFAA 1GONA 3IV8A 1DQUA 2QQ6A 3A6OA 3C0QA 2Z6JA 5F4WA 4KS0A 1KLZA 3UA3A 3HJEA 3S2JA 1JVNA 1R3WA 4Q8PA 2EO7A 5BXSA 1RBLA 2VEGA 4QDWA 4IIGA 3H2AA 2PAJA 4IQEA 3AXKA 1DE5A 2CERA 3DU0A 1OINA 4GY1A 1KCZA 1VGAA 4Z42C 3GWQA 1B4KA 4F0LA 2D1ZA 3W25A 3TSBA 5XIMA 4QITA 1OC5A 5HMDA 1X38A 1OGGA 2IKJA 4GHRA 3VDHA 1MEIA 4GQGA 2V30A 1VENA 3I4EA 1H1NA 1OWQA 5C2GA 4KPLA 4U31A 1OC6A 2Q01A 3TXVA 1XYZA 1G7UA 3DHPA 4CD4A 3AIQA 3SCRA 1J5TA 3EX4A 3MHGA 3FA5A 2HSAA 1GVIA 5DANA 4E5TA 5HMSA 3BGJA 5FJJA 1NJJA 3CHVA 4I7WA 4V1XA 4DBEA 1CW2A 3NR0A 3OQ8A 3KCJA 2D69A 3WL1A 2QMKA 2Y7FA 1V6VA 3W86A 1OCNA 3KRZA 2XFYA 2VJXA 4PCFA 3EBVA 5HINA 5KZ6A 2VGGA 5LHFA 3H4WA 4XSLA 3LPFA 1G69A 3WF4A 2KAUC 3WDPP 3GVWA 2INZA 3SQLA 3IGXA 2JQXA 1IGWA 4PUMA 4QSFA 7ENLA 3EWYA 3E2VA 1BD0A 1OFPA 5DMYA 4A3HA 1D9EA 4K8GA 1CXEA 2PLCA 1IT8A 1UUOA 2EPHA 4MLRA 1FH9A 1L6YA 4DYEA 2YCEA 4I7UA 3K8MA 3SUVA 1P6WA 1RUSA 3VNZA 3G1FA 3WMCA 1FQ0A 2IKGA 1QNVA 3O6DA 3FAXA 3GVVA 4S1FA 1FWAC 4PODA 1XLCA 2HK0A 3WIJA 3GIPA 4GWEA 3M6YA 2NV2A 4Q33A 4IXHA 4ZO8A 4DAFA 2A0NA 1A80A 2YA1A 4HCLA 9XIMA 1LBLA 3B8IA 2WV8A 1KW1A 3EWZA 3EX1A 5TAOA 3VKCA 2GGHA 4JN6A 4JIQA 4DHGA 4XZ9A 3DHFA 1I2OA 4B9ZA 4AEFA 1I45A 3LHWA 3ABQA 1LQAA 3VD5A 4PUEA 1IQ8A 4HYWA 4AD0A 4BWLA 4QJ5B 1NWTA 4EPKA 5BWFA 4CCCA 1UH3A 4AFYA 1ITCA 4UMCA 5BZAA 5CZTA 1OFDA 1EX5A 2GUYA 4DRSA 4UQDA 5AZ1A 2FZ9A 3R43A 1ZB5A 3W7KA 4G56A 3N04A 1KM6A 2NUWA 3U2ZA 3B04A 2YGYA 3RLHA 3PY2A 2WZIA 3OGSA 4H3DA 4XZWA 3UWUA 4JHOA 5JU6A 1JRBA 3EB3A 4MKVA 1IIGA 1DTUA 3GVRA 4PUWA 3NJ3A 2NLYA 1RPKA 2ZXQA 3KVKA 3DX5A 1OFBA 4K38A 2UY2A 4Q8TA 1SSDA 3A9IA 1Q5MA 4PRWA 2WVSA 4IX2A 1PDZA 2JEQA 4CN4A 2V8ZA 4QCFA 2YBTA 2PRHA 1X6UA 3CUZA 1R46A 4HZ7A 2UWFA 1V93A 3WNKA 3GH4A 3MUCA 3VOIA 3ATYA 5HANA 1OCJA 3CHFA 3LK6A 3DBNA 1JI1A 3SBFA 1IEQA 3PZOA 2V3EA 2CFFA 3BAXA 3FYOA 4DUOA 4LAUA 4R9XA 2CC0A 2OTDA 2V6AA 1VCFA 3VOHA 5LIWX 3BL3A 1WDSA 1UYQA 5I6SA 3EKGA 4HN4A 2J66A 2Y61A 2EPMX 4QCEA 1TX2A 3DESA 4B2DA 4QQ3A 2VFEA 1U30A 3WQPA 3M9YA 1EGMA 4JAWA 2OYLA 1V6TA 1L6GA 3GG1A 4CNPA 1P43A 1EUAA 2FTWA 2E6YA 3SCVA 1JAEA 5A94A 3H2EA 3G77A 1THFD 4URIA 4Q7BA 5LIXX 3FHQA 3EMQA 1ZBVA 1OZQA 4ZOEA 4DJFC 5HNTA 1E0VA 4Q4PA 4WSJA 4PH6A 2X1SA 3GYEA 1TPC1 4S38A 1XRVA 4UTJA 3DCPA 3UFYA 2FMNA 1G94A 5I3KA 1S38A 2RUSA 2ZRYA 1TCMA 2C1GA 3A4JA 1KRAC 3W7JA 3AYTA 1QBBA 2CHRA 4JGDA 3VD7A 2RJHA 4ML4A 1F8MA 1GKRA 1UWTA 2HROA 3S5NA 2ZA2A 4JTSA 3CUJA 1H7WA 1W2VA 3W4RA 4H1ZA 4ZL1A 1ZJIA 1IGSA 1DJZA 2GSEA 3DFOA 1FWRA 4RV3A 1CIUA 4G5DA 1W5PA 4DBSA 1XRFA 1C8VA 1XV8A 4LX4A 3SUTA 3TNBA 2PFHA 4FPSA 1U1UA 1LWHA 4E8CA 3LV6A 1GOWA 4AH7A 4DX3A 2Y1HA 3EWUA 3Q65A 3LHVA 4GZJA 4XTDA 3KL3A 2ISVA 4CEUC 4DO4A 4QR6A 2REQB 4I8DA 4J3ZA 4A8LA 3QMTA 1WKFA 3KVMA 1GVYA 3L67A 4ZR8A 2QPXA 4JXCA 3S1WA 1TJRA 5HUPA 4DXXA 2OX1A 2E5CA 1M41A 3HJZA 1XW8A 4IPLA 1CGVA 1CT5A 1EKOA 3UT0A 1BRLB 3A5FA 3VOGA 3W27A 2Y63A 2OQHA 1TWIA 1JCJA 3BOXA 3AXIA 4HA1A 1R85A 3SUWA 1UR1A 3NL6A 1YPIA 1VBUA 4X61A 5IXEA 1PUDA 3U5UA 1I6NA 3MCMA 1CDGA 1GYLA 4HJFA 1MXSA 1ZALA 3K8KA 1A5CA 2G3IA 1CYGA 2D23A 2P5NA 4Y2WA 4REQA 3GIQA 1KXQA 4NZJA 3P0WA 5MHBA 1W32A 2CWNA 1JCMP 3H23A 4HSNA 1JF6A 1UPMB 1EO5A 4MWAC 2YR1A 2GJRA 2D0FA 1XSKA 1KB3A 1GVSA 3P80A 4JEJA 2IXUA 5LNRA 1GQLA 2DIEA 2R1MA 3B03A 3VOCA 3ONBA 1R7AA 1AL7A 4IIEA 3OB8A 5J8LA 3P6LA 3O15A 3TR2A 3B06A 2QGYA 3WUFA 3GQYA 4MUPA 1JIBA 3L5AA 2NXIA 3EOEA 2ZZ4A 2CITA 1KXVA 1MZRA 4XX6A 1UC5A 4GGHA 1EBHA 3EA1A 4G9PA 5AHFA 3N2OA 3ALGA 3U2OA 3N2MA 2OZ3A 5FJIA 1X97A 2Y5EA 4K1GA 3VFCA 3VNDA 4E4FA 3AYRA 2G97A 2C1HA 3KRUA 4A2SA 2QCHA 1JDDA 1QXLA 1KCLA 4J3TA 3W7IA 2RKXA 1EHAA 2V82A 3TX9A 3VFLA 1R3TA 1M1BA 3ITXA 1WX0A 3C2OA 5K9DA 4PUKA 4TOQA 4CCDA 3GD6A 1TKKA 1QNPA 1FA2A 1FRBA 2WPBA 4RLIA 3TROA 4QROA 3HN3A 2DT2A 3ZT5A 1JRCA 1KM5A 5IDIA 3MT1A 4R88A 3QKZA 4ROQA 2NZLA 5E09A 3TEVA 5IHRA 4HHLA 4C6IA 3ARUA 3E0WA 1JZ4A 2XYLA 3KWXA 3N12A 1KBKA 1GWJA 5I5RA 3VD4A 1K77A 4F9JA 4JD4A 4U4MA 3G0SA 1Y5VA 3IK2A 1AJ2A 1XYCA 3VNKA 1Q6LA 3HQOA 3LCWA 4JX5A 3VK5A 1MRAA 2EKCA 3HMCA 2NXHA 3PUDA 3UWYA 4EE9A 1W0MA 3BW3A 4ZENA 2JKAA 4WIWA 1PZ1A 2J47A 4UQCA 1H3GA 1P1XA 1Y5XA 4MWAB 3NQ8A 1YDOA 4DZ5A 1QI2A 4QM1A 1KBJA 1V3HA 2CCRA 4JTDA 3L5MA 2R24A 2QPUA 2A7PA 2AKMA 1O6IA 3W1AA 2P3ZA 3KCLA 5HPOA 1OEPA 1R86A 4OFCA 1TJ2A 3QEZA 1P6CA 3MANA 1NP0A 1HN1A 4JYFA 5LSMA 1TWSA 2ZX7A 4HB7A 1Z9AA 3D3AA 1BTCA 3FK4A 1VF8A 1DYSA 3JZUA 4K3ZA 4IMEA 4JHZA 1BPLB 3MDWA 4D6IA 1RJRA 2CLMA 1E55A 3I3EA 1FCQA 1V03A 4LALA 1DWJM 1YXYA 2V0TA 4Z0SA 4MOZA 3B9OA 4XBSA 4A4AA 2VQUA 2P0IA 2W79A 2WSPA 2VDHA 2FZNA 3PTMA 4ES4A 4XAYA 2ONEA 2XTKA 4J3UA 1LWJA 2Z1BA 4IQDA 1JL8A 1CXLA 4FXRA 4MTVA 3F5KA 1CXKA 1TIMA 3KBJA 4MGGA 3I7RA 4OIFA 1BWKA 3IGHX 1FDZA 1SMAA 2NQZA 2VEIA 3C3UA 1TMLA 3W74A 1EJXC 1XLLA 4IFOA 2WXDM 3D3FA 1JJKA 2CBJA 3SY5A 3PFRA 3WF2A 2Z4GA 4EAYA 1W3JA 3NTYA 1VHCA 1QPOA 3UR2A 5FJUA 4HT3A 3VMPA 1I75A 4K39A 1ONRA 3IWPA 4MWAE 3MKVA 3DEQA 1TTIA 4GOAA 3GNDA 4L1WA 5C9RA 3WNOA 3S5ZA 1S5WA 2ALRA 4AVNA 1VH7A 5AVNA 3H21A 2Y8KA 1O1HA 2WKLA 4JR5A 2DY3A 1ISWA 1IXQA 5BMXA 2J6XA 1TSIA 3OLIA 3LN3A 5G1TA 1VKFA 5D04C 4C6DA 2YW3A 2XZ9A 1HGWA 1LUCB 2XPKA 3VO0A 4XZHA 2Q09A 2DT0A 1EWEA 4RXFA 4Y9PA 2IUZA 2TYSA 1QNOA 3AICA 4D2JA 3QPEA 4YHGA 1IXNA 1HX0A 4NVTA 2GQ8A 1ONEA 1NDWA 1XKYA 5C5YA 2C0AA 4G1KA 4JZ5A 2PDQA 4C7FA 3PBUA 4LUTA 3BJFA 3MBFA 1TELA 2HBVA 3LNMA 1W1YA 2QCGA 3AFBA 1MRQA 2DZUA 1ZFJA 3KFTA 4AVOA 2GPTA 3W23A 4IPJA 1NWRA 4A6GA 4Q7IA 3GAYA 1Y5WA 5F2GA 4AHPA 4GJ1A 4PRRA 3SFWA 3VZYA 2QUNA 1KFWA 4M56A 4GZIA 3TYBA 2RAGA 4AD3A 1QATA 4HNOA 5JH1A 3TC7A 2XSXA 5C55A 1HP5A 1SW0A 4FOKA 4CQAA 2AOSA 4LEFA 4B5WA 4Z0JA 3GDKA 1JPHA 4ZCWA 2VELA 1W1PA 1UA7A 1A4LA 1WDRA 1UJQA 6TIMA 2QF8A 3CZEA 1YTKA 3WEZA 2Q8LA 3QMSA 1N8FA 1H0IA 3STCA 4LY8A 2OEKA 3COTA 1ME7A 2F6KA 1K9DA 5B80A 2FDSA 3ZQ9A 4ZO6A 4C65A 5CC7A 3LCGA 2BHZA 4ZQCA 4WGHA 3UG5A 4TMCA 4DJDD 2AAAA 2W66A 1YTEA 3KTSA 3FJ6A 2DGAA 1UKSA 3ID7A 3UYIA 2H8ZA 1F76A 3BO9A 3QJAA 3ME3A 1KM3A 2Z28A 4GGBA 3ENLA 4GABA 3MP3A 3R94A 3HQNA 2BWGA 4PB4A 3IGUA 2TRSA 3TA6A 3LY0A 3ZS4A 3SW6A 3SIZA 1E3ZA 1KM0A 1VAHA 3CL6A 2OYKA 4K7YA 3RO6A 1R2SA 2OKTA 3XIMA 1TMHA 4AW7A 3SJNA 1J4EA 2G4JA 3CPGA 3LRKA 5DXXA 4P7RA 3WEMA 4H83A 4IUOA 3SCTA 2R6OA 4IIDA 3FKRA 3VI2A 2NSXA 2Y62A 1CBGA 1O4UA 1W6TA 4Y9AA 1AZ1A 4QJ1A 1FWTA 3N2XA 4S2BA 4PTNA 1C8XA 1V6XA 3EYPA 4ML9A 5D2VA 3IVSA 3WJWA 1U2YA 2PSNA 2QYGA 2ZZ2A 3E0IA 6CGTA 4ACZB 4AXKA 3DG7A 3LYEA 1VYSX 1YPFA 3C5QA 1HJUA 4WXZA 1B4EA 2VZUA 2C19A 2ISFA 2PWUA 2XIJA 2QR6A 1E0TA 2ZADA 2A3BA 1XFCA 4ERIA 3FNDA 4WY0F 5A2BA 3ABSA 1TPWA 1GCYA 4J5NA 4BZYA 1S46A 4W9TA 4EXAA 2VRJA 2EJAA 2VFGA 3E5PA 1K4HA 4NT0A 1ISVA 1JCNA 4GJJA 4Z2HA 1FTXA 2X09A 5M1TA 3MYOA 3WELA 4MJ4A 3QZEA 4EPDC 1F73A 5C54A 4MNKA 5I3HA 1CGTA 2DSVA 4K8EA 4ZXOA 4HPHA 2DSKA 4IFKA 4LY4A 1Q6FA 1TJ0A 5EU9A 2BASA 2PDJA 2CHOA 3W7MA 2X1RA 1IE7C 1E56A 3IRSA 4S2CA 4XAZA 5KZMA 4IFKB 4ZQPA 1XD1A 1T0OA 3RXZA 4LAOA 1KFCA 5LIKX 4PSPA 3STEA 3M0LA 3ERPA 1BFNA 4R53A 4A2RA 4JTGA 3BW4A 3SIMA 4UWMA 2XH2A 3HURA 4MMWA 1FKWA 3BK0A 2Y7EA 3EMZA 3VCCA 1EC9A 1YNYA 4X0VA 4TVDA 5CXPA 4Q4RA 3ARSA 1FUYA 5CZJA 1ZZMA 3P8IA 1V0LA 2P88A 5C9XA 2XVGA 1H7RA 3THUA 5I0DA 2CZVA 1E6PA 2VP8A 1UKOA 2EKGA 4W89A 3BQ6A 2W91A 3F5JA 3VTRA 4LJ3A 3NSMA 4M6VA 4KETA 3LHYA 4OBRA 2FKPA 3CL8A 3TW9A 2UY4A 3HPAA 1JGMA 3CV1A 3IJ9A 3WG6A 2CXGA 4H2CA 1RVKA 5F1UA 2JIEA 1FVPA 1QI0A 3MI2A 4RZ4A 2R94A 1K9FA 4WDTA 3ZM8A 1FXQA 1MYRA 4OOUA 5A8PA 2W62A 1MW3A 5DT5A 1GJPA 2YYTA 3C8FA 3GC5A 2XUCA 4YU1A 4YPJA 2BBFA 4KCTA 2GK1A 5HBFA 4R34A 1HO4A 4UUIA 2QDEA 2XIBA 3KUMA 2AL1A 5LIYX 3TP4A 1W2PA 2HISA 3NPXA 3PZGA 2X30A 1PYMA 2Z7KA 2WCSA 6A3HA 1EPXA 4EVZA 1AW1A 4LFYA 4WDXA 4KWOA 1I1XA 1TPFA 3OZPA 1DBTA 2V67A 1GVQA 1E1CB 1RBAA 3KS6A 1HUVA 4K8HA 1SZNA 4GBUA 3CC1A 4B3ZA 4KFNA 2BY2A 1I2RA 2P10A 1XDLA 2PDWA 1JZ7A 1TRIA 4FX7A 2P76A 3OBKA 4LWWA 1NQ6A 2JIWA 4X63A 3AU6A 1ZBKA 4UB9A 1P0NA 2J13A 4I9TA 1P48A 3ABOA 1RY0A 3UZZA 1ADOA 4D6GA 3HG5A 3W02A 1QOQA 2EEXA 2UZ9A 3IJ7A 1JD9A 4JTFA 4MYXA 4V27A 3S5OA 4UMBA 4QJ3B 5I3FA 1YXCA 4W7UA 2B0MA 3K4WA 5DFAA 1HO1A 3T4WA 4NJIA 2O7SA 1A3WA 2DORA 2GWNA 1MMFA 4O12A 2DJLA 4DO5A 4AZCA 3NL3A 1MQQA 3WEOA 4X22A 3APGA 1QPNA 1S39A 3BUVA 1JNEA 1PAMA 8XIMA 5D9MA 3CZKA 3S1VA 2BFGA 1XSJA 3K2GA 2Z7GA 4WSKA 3I4KA 4O0KA 3K4AA 2QJHA 2FZ8A 1KLYA 2J7BA 1AW2A 4YN5A 1QCWA 1CCWB 1IIHA 5KSWA 3FW6A 3FV9A 4FHAA 5LZLA 1OFQA 4DJEC 1CPUA 2VZSA 3TOPA 4D1JA 1XFBA 1B3ZA 1E6ZA 3RCYA 3TV8A 1EJWC 2C8NA 1Z41A 3HQPA 1L2UA 3CQHA 3CV7A 1E6SM 4EANA 1YMYA 2E8ZA 1FX6A 1X8CA 3M07A 4EACA 1VJIA 1XBZA 1XGZA 4F66A 4ZO7A 4KIEA 2V5DA 3EAUA 5BOOA 1Q8AA 3REQA 3LXCA 3LGEA 4RUBA 1W1ZA 5FIPA 4OT7A 2O9RA 3REQB 5FL0A 1J93A 4MB4A 2QAPA 3XISA 3BTNA 3TN6A 1GZ1A 3HOJA 2EPOA 3UXIA 4KERA 2W67A 2B7NA 2FFIA 3RAOA 9XIAA 1N2VA 4RNIA 4FNQA 3KOYA 1KNWA 4HHPA 3CBWA 4DUVA 4JFUA 4WSHA 2PBOA 3LBMA 1XLDA 1LJYA 1V4YA 4BI7A 3A9BA 1OYCA 1MW2A 3MW7A 4H2HA 3BLKA 3VIMA 1BKHA 4HPGA 2AQWA 3TJ4A 1B5TA 1V77A 2NQ5A 3LHUA 4JYEA 5A6JA 5CZSA 3WK0A 3WJZA 3AWNA 3B9AA 3DI0A 3NFUA 1W8SA 3GNRA 1WAWA 3G1AA 4K7VA 2E9LA 3NOEA 1M03A 4Y90A 2OWWA 1AD4A 4NNBA 4S23A 5DX7A 4XAGA 2BOFX 3UWQA 3R4IA 3OYXA 3PTDA 3KTXA 2XVKA 2ZX8A 3MKKA 3IK4A 1RCXB 2DVXA 2E6AA 5M5DA 1I1WA 2CYGA 2GFTA 4R9OA 2XG9A 3FHAA 4DI9A 3VUPA 1TYGA 3DXIA 3M0XA 4JDBA 1PKYA 3DHUA 3E02A 1JDFA 4DJFD 3NA8A 2CHNA 3H54A 2E9BA 5K9XA 3BG3A 1V6UA 3WBYA 1QHPA 5EBAA 2W0UA 4NXSA 4IPNB 4ASTA 4RW3A 4NRSA 3GB6A 3RM4A 1J0JA 1AMYA 4F2TA 4TX8A 1SGJA 3SI9A 1FFQA 4NZCA 1EPVA 1D2KA 1JDCA 1XD0A 1JUKA 1H63A 4HHHA 2ZBTA 3OVGA 1DEDA 3OQEA 3B9EA 3MJYA 4RPPA 4ORMA 3LQGA 4MPQA 1UC4A 2WZTA 3CGTA 2H90A 2VGFA 4TV5A 3C2YA 3GXNA 4LYKA 4XUGA 5DBUA 2VUNA 1GOOA 3THDA 4Y9OA 4BKNA 4W84A 3B40A 1Q2RA 1DJIA 4KESA 2VR2A 3RR4A 1FWGC 1WA3A 2VZOA 1HJVA 1FDYA 3V75A 3EDEA 3RYSA 4XUYA 3ZVHA 1EDQA 3H2MA 1FCVA 1UKTA 3FSTA 1FDJA 3CWNA 4KCUA 4ICNA 3VDCA 4H7VA 3ZVHB 5FF3A 4BCEA 3ZR6A 1KM4A 2QDHA 1NOUA 3BAIA 4LBSA 5D2WA 1GOXA 3KVLA 2QULA 3PAJA 1K6AA 4JCMA 1P0BA 4DZIA 1J12A 3T0CA 2OOFA 2HQAA 4QS5A 3QLLA 3I3BA 1E9YB 4JTLA 3PTKA 3SO7A 1Q6QA 3E5BA 4FA3A 3FJNA 1GTHA 3RJXA 2RGLA 2WMFA 5A6LA 1UH4A 2I5QA 1J01A 4FLSA 4C5YA 3TAKA 4FIQA 3NM1A 5CBBA 4QLLA 2HPIA 5HK4A 1ADSA 1R9YA 4MWAD 5G2IA 1ZPTA 3N73A 1K8CA 4UZSA 3CYJA 3QOMA 4NUWA 4FK9A 4L4LA 3W38A 5F1VA 3E3HA 3B8WA 2JBMA 1S5VA 2IW0A 1DPMA 2PRMA 3O16A 3V0UA 2V5LA 4H8HA 2VQTA 4AWSA 1RXOB 3OYZA 4TIMA 4TV6A 1DIKA 3CUGA 1QU4A 1QBAA 1CECA 1OIMA 4KCVA 1KTBA 2EJ1A 2CNCA 5AECA 3E96A 4HK5A 4OUEA 3T40A 2WMGA 3AAMA 1KFJA 2ZICA 2J74A 4YJ5A 4NZ3A 1MQPA 3H22A 7TIMA 2W92A 5T26A 4J28A 3ZT7A 3H53A 4O1DA 3T44A 5AHMA 3O63A 1PX3A 2X40A 5ABTA 3MMWA 2HS6A 2QZRA 3I6RA 4IXXA 3QGVA 2XH0A 1Y7VA 2QV4A 4OKDA 4KRZA 4FALA 3M0HA 4GPNA 2ZQ0A 2FPYA 2YB1A 2OELA 3GX9A 2ZVRA 4QSHA 1GNXA 4GH1A 1F8IA 1O5KA 1T8QA 4Q32A 4JTAA 4LVBA 4E2DA 2YCJA 4CU8A 1UBPC 1BGGA 7ODCA 3OVRA 1XLEA 1E4LA 2BODX 1R3QA 3BZJA 3T0AA 3DFNA 5F4SA 1V51A 1KM1A 3ITLA 3I68A 3WQEA 1HL2A 1Q6CA 4L6OA 2E0PA 1ITUA 4BA0A 3VAVA 3ONCA 3TSDA 1XINA 4HK6A 4FNPA 5KTLA 4S3BA 2OU4A 4XZIA 1QOPA 1WDPA 4UNKA 3TZFA 4XV0A 4JHMA 3TJLA 5HWMA 3LEPA 3RNDA 3S46A 2JF6A 4D8AA 2BOEX 3C86A 2XDFA 3FGCA 3HPXA 3S6DA 1QI4A 3G3DA 4IP5A 4OWGA 2I9EA 3S4TA 2WM0A 3UF9A 4PL2A 3NZQA 2XN1A 4JL1A 4H9XA 2YXOA 3CIXA 1RA5A 2B4GA 4KWUA 3O6CA 2Z1XA 1QPKA 2HVOA 4BY3A 2WJDA 1KQYA 4R85A 4LCRA 3B97A 2ZUSA 3H2NA 1ZNNA 3IGSA 2XVLA 2DP3A 5IOBA 3Q45A 4NU7A 4XZMX 1S3HA 3DERA 1U1JA 2FVKA 1V02E 2OGYA 3UJSA 2GDUA 4QS6A 2G37A 2PF0A 5D30A 4GKLA 3A64A 2PPGA 3TQVA 1IZJA 3GG8A 3CIVA 2WHLA 3W53A 1ONWA 3MWAA 3MI6A 4QXIA 4IIBA 3UWZA 1NOFA 3EB4A 4KEUA 2C6QA 4UCGA 2G0WA 4HCHA 2PDMA 2J9XA 2CLIA 3WLMA 4FS9A 1LLWA 3U48A 3UWEA 2HTMA 3O07A 1PKNA 1XHGA 4BF9A 2JFEX 5CZ0A 2ZUMA 3C0SA 4GI8A 4D6EA 4I5XA 3FKKA 1SM9A 4NJGA 1G0CA 3A5VA 4I6VA 3PF3A 5FKYA 1K03A 3LI1A 3QQWA 1R47A 3UPMA 4C6EA 1TG7A 2HS8A 3LG3A 4AD2A 5E9AA 3VPLA 1GQJA 1AMKA 1C92A 3TYZA 2VTFA 4O50A 1H0GA 1DQXA 3WDRA 4L7ZA 3GKAA 2CBUA 1K7EA 1UP2A 2E5DA 2A3EA 3UNDA 3GR4A 1GHRA 5CJNA 4NZ4A 4H9VA 3ARTA 3RO8A 4U5KA 4U2YA 2VFHA 1W3LA 1HKVA 1JXKA 5BROA 3ITCA 3WLPA 5AFDA 3EDDA 3UW6A 4LB4A 5G1YA 3L12A 3SGUA 2PE4A 4PTVA 3B8VA 3FA4A 3QPZA 1JF5A 2IPFA 3VA8A 1HG3A 4CUCA 5FL1A 3NPWA 1RQEA 1ODUA 4HPJA 1MXGA 5CC3A 4N2YA 2PWFA 2F6XA 4LVAA 4JFSA 5A5WA 2BV9A 3BG5A 7A3HA 3VD9A 3RLUA 7REQA 4FP1A 1X1NA 1X1ZA 4CQBA 2NQHA 1XLGA 3TTOA 4H9UA 7REQB 5CBIA 4PMVA 1UP0A 1FWHC 1LLZA 1B57A 1U5HA 4JX4A 3F2CA 3KBNA 3R8RA 3PZUA 4WCJA 3ATZA 3CV6A 1BYCA 3AISA 2ZRUA 1I0BA 2BMBA 2WVVA 3U6WA 4C6PA 4R7JA 4C6OA 1QOXA 1TFVA 2WNQA 2OVLA 4LQ1A 4XSMA 1US2A 2WVVB 3PBYA 3BAJA 3KDOA 3STPA 4NSBA 1AW5A 5AC4A 4HZ8A 4M51A 1IT0A 3F1QA 4PFHA 3B3DA 3T05A 3WQVA 3L4TA 5A6KA 3GFYA 4UR7A 4OV4A 1ECQA 2TSYA 4GZ7A 1AFSA 4N9DA 3GDRA 4JTUA 5KETA 3H24A 2GJPA 3UNTA 2Q02A 5C9ZA 6REQA 1WZAA 4XO6A 4HA3A 4MDOA 3WK1A 4S3FA 3G1VA 4C6BA 1FHLA 3O7UA 3IUIA 2J7CA 3TQ0A 1OK6A 2D22A 5HQEA 2WLYA 3S9YA 4GK8A 3W1NA 4DIAA 2YCKX 2PZ0A 2OX4A 3C0JA 1G5AA 1R8LA 2B7OA 2HE5A 5FA5A 3SCUA 4J2MA 4F8XA 2GJXB 4XK2A 4Q8NA 3M0VA 3WDJA 5DRCA 2Q6ZA 1EC7A 3GZ3A 3BPWA 3GFZA 8CGTA 2DIKA 4GH3A 3OIXA 3WF0A 4GVIA 4DUXA 2YCLA 1F3XA 3AXXA 3PG9A 4MNMA 2DH2A 2Z6IA 5JBDA 5DY2A 4PUNA 3BCDA 5FACA 1E73M 5FSEC 3CQJA 3MVTA 1PWMA 3I10A 3CHEA 1HKJA 5FEWA 2OSXA 4FMVA 3L0GA 4GY7A 3PBMA 3OA5A 3IIZA 2XZ7A 2PLJA 2PDHA 2PLMA 1DKWA 4W7VA 3TTSA 3ZJKA 4JIEA 3NQDA 1MW1A 1VYRA 5BCAA 4Q6XA 1R3SA 5CG0A 4MG4A 1KGXA 1OADA 4L4OA 5C70A 4CQCA 3VX0A 2CLLA 3S8HA 1DXEA 1WBHA 3QFEA 4EOUA 1E9IA 3S5SA 1CLVA 1LOLA 3EXSA 3SAZA 1JFXA 2AGTA 1VFFA 1JNDA 2FZBA