3G1HA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydrouridine 5'-monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
221
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 81
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1hA00
2B7NA 3QSTA 3KRZA 4OU1A 2FPYA 3PBYA 3UZ5A 4HN4A 3HF3A 1JCMP 5HWJA 5I3HA 3FOKA 4NJHA 5CZTA 1PIIA 3HBLA 1OABA 4NNCA 1Q6RA 5D30A 5EYWA 1KV8A 1YXCA 2J27A 3M41A 2C0AA 3THQA 2A6NA 1DHPA 1OX5A 2B7QA 5D04C 1UUMA 2DZXA 2XN2A 4AHQA 2H8XA 3EXSA 3NQ7A 2V0TA 3TQ0A 1YXYA 4DBEA 3W1UA 3WK1A 1OYCA 2NUWA 4ZQNA 1FCBA 4JICA 4UFKA 4WX2A 3HPSA 3FJ6A 1F76A 2NX9A 4K7VA 3LV6A 1TTPA 4IWWA 1KM4A 5IBXC 3GIYA 1KFJA 3L9CA 1G4PA 2OCZA 5D2XA 3UPWA 1ICPA 5HUOA 1LCOA 2AGKA 5DCDA 1SO3A 3DBPA 5F2IA 1OX4A 3S5ZA 2QDHA 3P80A 4K8HA 1K8ZA 3W76A 1KLYA 3EKZA 3NVTA 3G0UA 1A53A 4NZJA 1KM5A 3P8IA 4W9TA 3UWQA 5K7JA 3UWYA 4N6EA 3I7SA 3EWXA 4O53A 1L6SA 3RFAA 1H1ZA 4WY0A 3JS3A 4MYXA 2ZRYA 2OT0A 4IQLA 5HINA 3TK7A 2VEKA 5EBUA 2QUVA 3W7RA 3W2MA 4QAIA 1LDCA 4LV9A 1X1ZA 1V7YA 1GG0A 3W7GA 2E68A 1FCQA 1LRTA 2BZNA 4LY8A 3NL2A 1O4UA 1UB3A 2E77A 1LBMA 3NQVA 3STEA 4IMCA 4CCEA 2NX1A 4A29A 1S5WA 5CZJA 1PCKA 1KFBA 5KZMA 4LTSA 3IVTA 3SY5A 3USBA 3VE7A 2JKAA 3N2MA 1OVDA 2ATMA 5HR7A 1TJRA 1HG3A 5C2XA 4MLRA 2QCFA 1P5BA 1R2SA 2BX7A 3S5OA 1I45A 4Y96A 1XI3A 2G96A 3LGEA 3MHUA 1HTIA 3DI0A 3TXZA 4A2SA 4JDBA 3DFPA 3OVRA 5E0KA 1NAL1 2ZA2A 3DKJA 5G2IA 4GE8A 3W75A 2I1OA 2Z6JA 4C1LA 3MO7A 4OGZA 4AVFA 4N9CA 1ZALA 3KRSA 4A3UA 1SZNA 1A5AA 1G7UA 1UASA 5DCEA 3WK2A 1EB3A 5KINA 4H6KA 1JVNA 2JGYA 3GR8A 3SGUA 3W1PA 2C16A 2ZA3A 1MXSA 3F4WA 3G1AA 3QF0A 1GTEA 1I2NA 1RV8A 3G0SA 1AL7A 3NO5A 2VFFA 3TIMA 2D73A 3W7LA 5LHEA 4AHPA 3W2KA 1A5CA 4WJEA 3TSBA 2W79A 3FLUA 3GNNA 3DFOA 4TMBA 2ZFAA 3SSJA 4UFLA 3ZWSA 3NQDA 1ZHAA 4JTJA 3PUEA 1OF6A 4XUGA 5BRBA 1I2RA 1W5OA 3PWAA 2WV8A 3P82A 4JR5A 4ALDA 3IV3A 2ZZ4A 1LYXA 4S1FA 3NDOA 5H91A 3W7PA 2IQTA 1MZHA 1O60A 4JEQA 1KW1A 4HNTA 4QNWA 4UCGA 3T4CA 4ZVJA 4GRSA 4O57A 2YW4A 2ISWA 3LOTA 4K39A 4HT3A 4TO8A 1SFLA 2E6DA 1SR9A 4MJZA 4JTEA 2GVGA 3GKFA 3BGGA 4ZQPA 5BMXA 5FF4A 2V8ZA 2QEZA 4X3ZA 5CSSA 1EUNA 1GEQA 1KM1A 2H8ZA 3UXAA 3E12A 1YLVA 4FNUA 1GYLA 3S1UA 1CI1A 2ZQ0A 1H1YA 5D2TA 5EKYA 3SGZA 3O63A 1FBAA 1XBVA 1KFLA 2V82A 4LS2A 3NXFA 3RF9A 3I7QA 1H7PA 1TPEA 2YGYA 2YFNA 2OX1A 4JTSA 4WZHA 1JCLA 1QR7A 4EVZA 4IX0A 4WOQA 2B7PA 1P0KA 3UPBA 2F84A 2E1DA 1IXOA 1LBFA 1QPQA 1OFEA 4RCXA 4OT7A 4B5NA 2UV8G 3IGUA 4FEZA 2DP3A 2V9DA 3GLCA 3NQMA 2FB2A 3NQGA 1WYIA 2Z2UA 7TIMA 2Y6ZA 2J9XA 1WAUA 1T99A 5I3IA 2FIQA 4CLMA 4ML9A 3OA3A 3C8FA 3HG4A 4AHOA 3FS2A 5K3VA 3S0CA 1M7OA 3PUDA 4GUJA 1KM2A 1VGAA 4NJIA 2ZA1A 3L5LA 2XN1A 3MP3A 5D38A 4LC8A 4EIVA 2YR1A 3GNDA 3MHGA 1L6WA 3HG5A 4O1BA 4NNBA 1GQNA 3OHIA 2VFDA 1H60A 3C52A 5D02A 4FXSA 5LKYA 4BWLA 3RLUA 1O95A 1AK5A 1S5VA 3UWZA 2DZSA 1LRNA 2H6RA 3TQVA 4AAJA 4O0ZA 3Q2DA 4FNTA 4I7VA 1H7XA 3QH2A 3ELFA 2E6FA 5CZ0A 5DCBA 2J9ZA 3W7QA 3W7IA 4CNPA 1X1OA 3QW4B 3W7HA 3LHYA 3N9SA 3QSRA 3KOFA 3O07A 1L6YA 4NX0A 3W7CA 3ATYA 1LOQA 2YZRA 4G1KA 1ADOA 4ZQRA 2E09A 4BI6A 3HGSA 2Y88A 1VQTA 4OV9A 2WSYA 3C6CA 3M9YA 1LTDA 4TX9A 2OZ0A 1F2JA 3CWNA 1VHNA 1LBLA 1X7FA 4MVAA 1VCVA 3TMLA 3V1PA 1KBIA 1B4KA 3TNOA 1XUZA 3W2LA 3LERA 1ZY9A 2VKZG 4OHQA 5EMUA 4O4WA 3STFA 1W0MA 5G2WA 3C0JA 1WX0A 1GOXA 5FEPA 5LNUA 3JR2A 1W31A 1XDMA 4DELA 2A1YA 4Z0SA 4LV4A 2FDSA 2V5BA 4CNNA 5CSRA 5LNSA 4NNAA 1T96A 3LB0A 3QYQA 3TSDA 4HNVA 3W9ZA 4AMAA 4N2YA 2VEMA 5LGXA 4X9SA 1XBZA 4CQ8A 4UTTA 3M0ZA 2NWSA 5K9CA 3PC0A 3E49A 3LRKA 3P7YA 3CC1A 1SW3A 1HUVA 1VH7A 1AG1O 3A9IA 2Y85A 3O6YX 1XBXA 2RFGA 2EGZA 2I9EA 4IJBA 1WOBA 1QFEA 3N73A 3F1QA 3BK0A 4FX8A 1RQHA 2GQ9A 1YDOA 4IUOA 2EHHA 4TIMA 2WNNA 1T8XA 3TX9A 3N9RA 4NX5A 2GJLA 1QDSA 5HUPA 1BTMA 1YPFA 1KFCA 3BG5A 1TIMA 1TREA 3NZ1A 2BWGA 3KVLA 1J4EA 1PCWA 5D05A 5I3GA 3LHZA 1H51A 1G4TA 4LC6A 3TFCA 3O8AA 3UZJA 4UTUA 4M7SA 2ZZ2A 2CFFA 3M5VA 3H53A 4FX6M 3RLVA 3T55A 3HG2A 3QMRA 2NUXA 2CLOA 3A24A 1H7NA 4FNSA 4GXMA 1QOPA 3LCGA 4JX4A 1TV7A 3C61A 2VFIA 3FKRA 4HSOA 3CB8A 2QAPA 3U8GA 1ZAHA 1EA0A 1ZFJA 3W1NA 1LZOA 1RVGA 4PEKA 1B4EA 2A7NA 1H7RA 4DF2A 1QMLA 1QPOA 1G69A 5LNRA 3U6WA 4AWSA 3TV8A 1EPXA 2PRMA 3HPZA 4UTIA 4M6PA 3CPRA 4QISA 2HS6A 1SPQA 4LOCA 2RDTA 4DPPA 1M7PA 3GR7A 3LTPA 1JQXA 3LX9A 5U4NA 3SFKA 3W2NA 5GVJA 3M7WA 4ZZ9A 3LBMA 2ZRZA 5I3JA 5U7SA 4UMCA 4JYFA 2QCEA 3CIXA 4Y8FA 1OJXA 1IIHA 1W5QA 4HPJA 3HJZA 1K8YA 5HMSA 1T0OA 3TFXA 4QJ1A 2XFWA 1TRDA 2RHGA 2HSAA 1D3HA 4JTUA 1KLZA 4DF1A 5KSWA 2QUUA 3Q58A 4LVAA 3W1XA 2OT1A 3W73A 4WXZA 2B7OA 4QIUA 2Z0IA 3NA8A 5D32A 3VE9A 5CPLA 1QNVA 4ORMA 3NG3A 3TR2A 2PCQA 3W1RA 3LCXA 1WBHA 1OF8A 2X1SA 1SO4A 1GT8A 5MHBA 4A21A 3M44A 1MO0A 4Z1DA 5KZDA 3PSVA 4LWWA 3E9AA 1NVMA 5J5RA 1JULA 3A22A 1Z44A 3HB9A 3MUXA 3M6YA 3PY2A 4GBUA 5AC7A 4CCCA 2ATSA 3EXTA 5FEXA 3TU9A 1SU5A 4JYEA 2X30A 4N9DA 2VELA 3LXAA 1TYGA 4X2RA 1IGSA 3G1YA 1B3OA 1BEUA 1SW0A 3SIZA 3I6RA 5LNVA 5FF0A 2OJPA 1H63A 3PB2A 4CQ9A 4I7WA 4UTHA 3EWWA 4JX6A 3G22A 4UTJA 5G5IA 2O7SA 3BW3A 2QR6A 3FYPA 4YCOA 2YYUA 4XBKA 2YFOA 1EIXA 2ZTKA 2QCHA 3I65A 1TPC1 2VC6A 2QDGA 4N4PA 1DKWA 2FB3A 3P60A 1GZGA 1K3UA 1TSIA 1RQEA 2P10A 3U2OA 3TSMA 5HJLA 4K8EA 4QQ3A 2H3BA 2CLLA 2QJGA 4MUZA 3YPIA 3TMQA 3ZS4A 2CLHA 1FWWA 4MFDA 4BWLC 1JCXA 1RQBA 3M5ZA 3MI2A 3R5EA 5FEWA 2ZRWA 3IEBA 4YLWA 1FDZA 2YPIA 1VYSX 3NQ8A 1R2TA 1TQJA 2YCEA 1DJNA 3ZR4A 4NJGA 4XTDA 5G4WA 3G8RA 2YDAA 4L4LA 3B05A 4NJJA 3DFQA 3I68A 3S1VA 2Q3RA 1RPXA 4XZ9A 1OHLA 3G24A 3W1QA 4ADSA 2VFGA 1L2UA 5DBTA 5LSMA 1LP6A 4NXKA 3GX9A 4FNRA 3AO0A 1IF2A 4R53A 6ALDA 1YADA 3MHFA 2F7FA 5KMYA 3LHVA 1W56A 1MEHA 5F2GA 5F2MA 1TCDA 3W86A 1GVQA 1C8VA 1Q6QA 1VLWA 5FF3A 5AYXA 1ICQA 3NL3A 1H61A 3DHFA 1KV5A 3LCFA 3SW6A 3LRMA 4LS1A 3MMTA 4A2RA 4HHPA 1TRIA 4Q33A 5HWNA 3DGRA 3DAQA 5D33A 3VNDA 3DZ1A 1XFBA 2NV1A 3MP4A 4IGHA 1SSDA 6TIMA 1B57A 1IXQA 2VENA 3P62A 4S2BA 5LHFA 4H3DA 2OMAA 2A4AA 4O50A 4O52A 4S2CA 5F4XA 4IXXA 1WV2A 1CX9A 3TROA 2CLIA 5F2LA 1AW2A 2CZFA 1LOSA 3L67A 3PR2A 2ABAA 2ABBA 4ORIA 2ZZ6A 4IMDA 3EWBX 4DO6A 3L0KA 5K9DA 3LI1A 2Q8LA 3BW4A 2A6LA 4O11A 3ZWTA 1XKYA 2VFHA 1B9BA 3QC3A 2ISVA 2P0OA 3G1HA 4JY8A 1YXDA 1TTJA 4UTTC 1LOLA 2QCGA 1YDNA 1FX6A 1ZNNA 4BK9A 1VZWA 2A85A 4XWUA 1I2PA 4ZL1A 1TV8A 2CLFA 4UFIA 5CPOA 2QCCA 1KTBA 3B8DA 4MZ8A 1ME9A 4K38A 4GWEA 3P5YA 1MSSA 2Q3OA 4XKYB 4UR7A 2ZZ7A 1W1ZA 2JBMA 1YTKA 3BVJA 3NQCA 3PBVA 1F05A 1JUEA 3NZRA 1O94A 3DKLA 4JTLA 2R91A 4UUIA 3TKFA 1XL9A 3GDMA 2WKJA 3P67A 1D3GA 1YYAA 1FDJA 3I7RA 5EL1A 3LDVA 5LNWA 3M5XA 1AW1A 4O18A 3W7DA 1FCUA 1RD5A 1GWJA 3FIGA 2C13A 3EWYA 3NPUA 4ZQOA 1ZAIA 4WQ6A 1H62A 2NUYA 4O0KA 5G2HA 1W3NA 3FA5A 1TPDA 1WDWA 3GK0A 5K9XA 2PC4A 2BTMA 1OYAA 4XBSA 3MYOA 1R30A 4UIOA 5CPMA 3B04A 3IGSA 1W5NA 1K7XA 1H7WA 2VXNA 3A5VA 5J5DA 1J2WA 1P4CA 1PHQA 2A2IA 4Y9AA 4JTTA 5BOOA 1SZGA 4JIQA 1OFBA 5I3FA 2A7PA 3WK3A 3O16A 1H7OA 4MFEA 1ALDA 3STCA 2CLKA 2E5DA 1NEYA 1SUXA 2NV2A 1OX6A 3CTLA 3LCLA 3WJZA 2NXIA 4MY9A 2NLIA 1TTQA 5SWUA 4IMGA 1DOSA 1PVNA 3CEPA 4FNPA 1HL2A 2Y61A 2GJNA 3L21A 4JY9A 1WOAA 3LBCA 1L9WA 1G4SA 2RKXA 1KM3A 1JCJA 3TXVA 3DU0A 4CCDA 1TPFA 1Z41A 4PODA 5AHFA 1ZCOA 4KKXA 3ABSA 4PL1A 3NGJA 3G1FA 1FXQA 4N02A 5D2VA 4XKYA 1OYBA 3W2JA 4E38A 1YTDA 3P5ZA 4NJKA 3EX1A 4ZQCA 4LT9A 3ABRA 2E6AA 1UJPA 1AMKA 1OFQA 1WA3A 1UCWA 3GXNA 5T26A 5TQLA 3BG3A 3CM4A 3W87A 2FPTA 3L66A 3UWUA 3LTSA 1OG0A 5DN1A 2BXVA 5BMWA 3TUUA 3LV5A 1Q6LA 4RZ6A 3QJAA 3OBKA 2ALDA 4RV8A 2ZTJA 3NQ6A 2QKFA 2VEPA 3PULA 3DHDA 3MP5A 1N55A 2RDUA 4N9EA 1QOQA 2QUTA 5AHEA 1DVJA 1KFKA 4Y90A 2CLEA 2Y7EA 1H5YA 1E51A 4JNMA 4UNLA 2QF7A 3W72A 1P0NA 1S5TA 2O7QA 5ABTA 1HO1A 3UYCA 5AHNA 1JRCA 1FWTA 2NXHA 1EP2A 4D2JA 2VEIA 5CPNA 3HPXA 4GUHA 1GYNA 2WSRA 5E1QA 3HG3A 5AHMA 1NFBA 3FKKA 1J5TA 1GPWA 2G97A 3L5MA 3RU6A 4UFHA 3W7OA 3G1DA 3KRUA 1VPXA 3N2XA 3NPXA 4FF7A 2WOQA 3LCHA 4O12A 1VS1A 3EKLA 2XN0A 4PA8A 5D03A 1K7EA 5H2ZA 1EWDA 4J9JA 3W83A 4DO4A 4FB7A 4HIBA 1W8SA 3NL5A 4ZMGA 1VJIA 4DPQA 3IIPA 3UQNA 3PM6A 1JJKA 4NT0A 1FY6A 1GG1A 3QPYA 3K30A 5I3KA 3M43A 3PVFA 1ME7A 4IPIA 3PBWA 4PFMA 1WBJA 2Y89A 2YX0A 4DF0A 3BV4A 3OVPA 4P2VA 4E0CA 3WJXA 4MYAA 3TC6A 3UWVA 3L0NA 4JTKA 5CG7A 4BR1A 4YL2A 2V5LA 3CWOX 3L0GA 4K36A 2EF9A 3QQ1A 4AH7A 3LHWA 1G6CA 1W54A 2JK2A 4HSNA 3PF3A 4LVDA 3E0IA 5F1UA 4UTLA 2ZRXA 2CZDA 2AQWA 3E96A 3VKJA 4JXCA 3STGA 1N7KA 3THAA 5DY2A 1I2QA 2X1RA 4MIMA 4Z1CA 1Q3NA 1K03A 4XQ6A 2ZZ5A 4M7TA 4JTFA 1DORA 4LVGA 2AAMA 2C1HA 1I2OA 4YMZA 3G3MA 4AWUA 1QPNA 5HQEA 3GAKA 3N19B 4IMEA 4JTHA 1OFRA 5G4EA 4Y6GA 3Q37A 4RLIA 1ML1A 4E2BA 4EF9A 5AHLA 3LXBA 1QCWA 2DZWA 2TYSA 4UR8A 4CNOA 2DU2A 3UD6A 5FESA 4GFSA 2WPBA 5K4ZA 1A5SA 1HFBA 4M19A 3FYOA 4UC5A 3W07A 1VC4A 2X1UA 1O5KA 3GDLA 3W71A 3W7EA 2V81A 3G0XA 2YW3A 1GJPA 4NVTA 1KTNA 4RKAA 1LRQA 2Q8ZA 5A5WA 2FQIA 4LNYA 3GVGA 1XCFA 3R8RA 2CWNA 4TR9A 4Q32A 4RR4A 3TJLA 2E5BA 3CEUA 1JQVA 3C2OA 1WQ5A 3LHTA 2C19A 2QCDB 3MWAA 1TPH1 3BLIA 2GQ8A 3EX6A 3NM3A 1X6UA 4NU7A 2FJKA 1W3TA 1TQXA 1O5XA 4RXFA 4MKNA 4K6AA 2B0MA 3EWUA 4FNQA 1HO4A 4ONVA 3OVQA 2X1TA 1EX5A 4JD4A 4KWVA 5FI8A 1CW2A 1KM6A 1YTEA 3O1NA 1ONRA 3B06A 3QPZA 3MJYA 3FJLA 2HS8A 2FFCA 3NEVA 4GUFA 2DJLA 3MI3A 3T78A 5KZEA 1YDVA 4N4QA 3LHUA 3W7KA 1G67A 3TW7A 3UY7A 1QWGA 3IIOA 4PC8A 3HGOA 2GUUA 4HKPA 4BI5A 4U28A 4E2DA 1D9EA 2GPTA 3IGXA 2DJXA 3A21A 2Z1BA 1PS9A 2JKEA 3LRLA 3NQEA 2I14A 2P1FA 1OFOA 2FPVA 1TV5A 4I9AA 1OK6A 2Z6IA 5HWMA 4O1CA 3TJXA 1OFPA 3SR7A 2R94A 3IIVA 1DJQA 1I8JA 2HMCA 3PG8A 4WY0F 3W70A 1IXPA 3CT7A 1EWEA 3GAYA 1G7VA 3KAOA 1JRBA 4I7UA 4Z08A 3W88A 4OE7A 4FIQA 3VI2A 4WOZA 1VCFA 1BWLA 1EEPA 3EX4A 1R47A 2QCNA 2B4GA 2J88A 3DFNA 4MZ1A 3TQKA 2TPSA 4K7YA 2QCDA 2EPHA 4P61A 3L2IA 3T7VA 1Y0EA 4H4IA 4Z0JA 2EAWA 5EA9A 4JN6A 1Q45A 3P84A 4AF0B 3WK0A 4AWTA 5AC8A 3TW6A 3N3MA 3RMJA 3GXTA 3W7NA 1I4NA 1VRDA 4MOZA 3LLDA 4JTIA 4HNNA 3EEGA 4JIPA 3C2EA 5AYYA 2TSYA 3BLEA 4RZ4A 3A5FA 2GVLA 3KVKA 1XDLA 3S6DA 1V5XA 4K37A 2GOUA 2JGQA 3CQ0A 1SFJA 4LW7A 4O13A 5DXXA 5C55A 3ABQA 4KWWA 3L5AA 2QJHA 4N6FA 1H50A 1C29A 1SZFA 3DI1A 4EWND 4KFPA 1TTIA 5DELA 1SO6A 2H90A 3PG9A 3GKAA 3PS7A 3W74A 3B0PA 4R33A 1TO3A 1OFDA 4BFAA 1Z48A 3LI0A 4TMCA 1PL9A 5LGZA 3QW3A 2QCLA 4O54A 3EB2A 1SW7A 1FQ0A 1IXNA 4UFJA 3B03A 3INPA 4IOTA 2YYTA 4JS3A 1JUBA 1GTHA 1W37A 3B0UX 3S5YA 3M47A 2A5HA 3PB0A 3S1WA 1W3IA 1NF7A 4MLJA 1M5WA 2BLEA 2YXGA 2ZDRA 2Y70A 1SZEA 3EXRA 3VFLA 3ZFHA 2V2DA 3GB6A 3W1AA 4QSHA 4CQAA 2A21A 3W3OA 3QFEA 1TPWA 1S3HA 3PBUA 4EOUA 3R13A 3AJXA 4IMFA 2DZUA 3W7JA 1R2RA 2ZZ1A 4U4MA 3P74A 2DORA 3SZ8A 3A23A 1W5PA 5EY5A 3JRKA 1FDYA 4AF0A 3QQ0A 2Y63A 3DXIA 4PH6A 4ICNA 2WSQA 2HTMA 3CIWA 3C4UA 2FTPA 1LROA 1G4EA 2C14A 3W84A 4DQWA 3W23A 1VYRA 3S42A 4MPQA 1K8XA 2FLIA 3SJ3A 3RNDA 4AEOA 3BG9A 2VOMA 3MBFA 2ZBTA 5LZLA 3HGJA 2C6QA 4BI7A 4M6VA 3P81A 1KBJA 5BNKA 1PE1A 1KA9F 5CGQA 1RZMA 3NQFA 3M16A 1MEIA 3SI9A 3SECA 2WO5A 4NUWA 4KFNA 3BARA 1DBTA 3F4NA 1NSJA 1KFEA 2NX3A 1F6KA 3KHJA 4QNEA 4O19A 1TB3A 1VLIA 5FF7A 2W0UA 2RDWA 4M6QA 3KX6A 1F5ZA 1VR6A 4MJMA 3IIXA 1GVRA 1EUAA 3HIJA 3P8JA 4Z1BA 3HO8A 3NAVA 5EPDA 1AL8A 3PSWA 1A50A 3VCRA 5C54A 1UBSA 3TAOA 1DL3A 1F6PA 1FWRA 4AB4A 3H55A 1GVOA 3LLFA 1JCYA 4UTWA 4OWGA 1FWSA 3LCWA 2C3ZA 3G8EA 1XM3A 1QPRA 4KFOA 3M5YA 4NXSA 1LLZA 3S8HA 3UNDA 4LUJA 3EX2A 3O06A 1BKSA 1TPVA 1N8FA 2V2HA 1KTCA 3QRHA 4WXYA 4WUIA 5AHIA 5K2ZA 4RXGA 3L68A 3RK8A 4OQVA 3QEZA 3W22A 1NF0A 5HULA 2Y7DA 2NZLA 3W85A 3T40A 1JCNA 2CZEA 2E5CA 4UMBA 3IVSA 1DQWA 3UWWA 1LM1A 2CW6A 4GUIA 4RZ5A 5D2WA 4ZQMA 4O28A 5DY3A 4LU0A 4O15A 3O15A 4MY1A 1K7FA 4QITA 3GXPA 4ADTA 3R12A 1PV8A 4O4VA 3DENA 5IBXA 2DZVA 2WJZA 1SSGA 2WNZA 1UUOA 3W1TA 1SO5A 3O6DA 4R7JA 1OFAA 1XC4A 4FX7A 2V2CA 3NOEA 2CU0A 1IIGA 2ZRVA 2J9YA 4AXKA 1P1XA 3C2FA 3HGRA 4C1KA 2RH9A 4LRTA 3D0CA 1Q6OA 3TE9A 3TC7A 4JX5A 3G1SA 3BLFA 2Y62A 1F74A 3KVJA 4XTIA 4FIRA 2J24A 3MBDA 4N9BA 3DH7A 4OV4A 2A0NA 3KVMA 4GC4A 2PURA 5DBUA 4EF8A 1VHCA 2H3DA 3OG3A 1Z42A 5D2YA 2JKPA 3DFTA 5C6MA 3FFSA 4O1AA 4TU1A 3H54A 1EP1A 1FUYA 5HR6A 4RK8A 3KFTA 5AB3A 2QAFA 4UXDA 3W1MA 1BWKA 3M1ZA 4QM1A 5BW6A 3HQ1A 4POCA 2QCMA 2ZCGA 1WXJA 1FCVA 1DQXA 2GVJA 5D37A 1AW5A 5DXYA 2YSWA 2R14A 3GDTA 3R2GA 1FXPA 2CLMA 3O05A 4NZFA 3B4UA 3W1LA 1QO2A 3MI6A 2PRLA 3C2RA 3PAJA 1A5BA 4IX2A 4DO5A 3NYZA 2Y7GA 3QZEA 4X22A 3QM3A 4Z1AA 3NPWA 3HOJA 3TA6A 2G95A 5D09A 4YXGA 3EX3A 3NR0A 2ZYFA 4R34A 1QAPA 4O8RA 1F73A 3TCEA 2X2GA 3LTYA 1JUKA 4WD0A 5CZSA 1K02A 4O14A 3UY8A 4LUIA 3G18A 3FEMA 3IVUA 3S5NA 2J6XA 3TH6A 2NXGA 1C9DA 1QO5A 4UNKA 4O17A 1X8FA 3P61A 1R46A 5F4WA 3V75A 4RJEA 4UFMA 1W5MA 1XUUA 2G5WA 2Y7FA 3T44A 3E02A 3LCIA 4JGDA 4JYDA 1DV7A 4LRSA 1YPIA 3G1XA 3CLMA 5FEZA 3BO9A 3F03K 4DXVA 2C15A 3GDKA 4FXRA 5AFDA 4ADUA 3S1XA 3HMJG 1VCGA 3BPWA 4MY8A 3G3DA 1RR2A 5KITA 4LVBA 3IIZA 5G1YA 3L65A 3WFAA 4GJ1A 2DZPA 2WQPA 3NQ2A 4JTGA 3OIXA 5CKSA 4PL2A 3DFSA 4LS0A 1XBYA 2ZZ3A 4UTMA 8TIMA 2DZTA 2TMDA 3NM1A 3NL6A 4Q4KA 1JR1A 2R8WA 2W6RA 3EWZA 3BW2A 1U5JA 3S9YA 2NWRA 5AOUA 3IRDA 1GVFA 3WJWA 4HNUA 1ME8A 4GNJA 3N14A 3WJYA 4DEFA 5L9FA 4UMAA 5K4XA 4FO4A 3KXQA 1SQ7A 4BF9A 3O6CA 3OEXA 5C5YA 3ABOA 1FWNA 5F1VA 4FHAA 1KM0A 5TBOA 3W2UA 5IM51 1TMHA 4A22A 3Q94A 3W7MA 5HNRA 3LM7A 4GUGA 4YWIA 4OBTA 5AC6A 1XXXA 2EKCA 3C2VA 1ZAJA 1MEWA 2KZHA 2TRSA 5DLCA 3WJSA 5G1TA 1ICSA 4UTKA 5A8GA 4O1DA 4NQ1A 3W6YA 1THFD 5FF2A 5KTLA 3UXDA 3NNTA 3NPVA 3ATZA 4O10A 4IPJA 2WNQA 1PHWA 4HPXA 4O16A 2BSLA 1GVSA 2VFEA 3QMSA 1U83A 3MW7A 1OK4A 1OX4B 3R89A 1VYPX 2A7RA 4L4MA 5AN7A 2QJIA 2C18A 1LORA 3ANYA 2V30A 3N34A 3LXCA 3NQAA 5L6UA 3TAKA 4MZYA 1TPB1 3GYEA 4WY0B 4PCFA 3MYPA 5TIMA 2GQAA 2PE4A 2CZ5A 3CU2A 4PTNA 4LVFA 3TDFA 3CHVA 4M5PA 4UTWC 1EP3A 4RX0A 4IXHA 3BGJA 1F7BA 5E93A 3B0VC 3C3NA 1ZJIA 2PRHA 3G1VA 2E6YA 2X16A 4DBDA 2ISSA 3QMTA 3GZ3A 3C56A 5F4SA 4YCPA 1TJPA 5AYZA 2LLEA 1LLWA 1ZENA 1M6JA 3PUOA 1TPUA 3GDRA 2ZRUA 4JDYA
chains in the Genus database with same CATH superfamily
2B7NA 3W53A 2FPYA 3PBYA 4YVPA 4HN4A 4KESA 3B9DA 3MKVA 1MVYA 2F6XA 4YIWA 2J27A 2C0AA 3ZZ1A 2A6NA 1GQIA 1OX5A 4LAZA 3UJEA 5D04C 2EQDA 2CHOA 1RJRA 2XN2A 4AHQA 1BYBA 5E6YA 3NQ7A 3TQ0A 1YXYA 1OYCA 4ZQNA 3HPSA 5A8QA 1F76A 1UZDA 2BB0A 1KFJA 2HXUA 3CPUA 5D2XA 5GNYA 5HUOA 6ENLA 2WMIB 4K2SA 1EJRC 1NFPA 4W93A 4I9TA 2ZVRA 1DJWA 1PEZA 1FRBA 3U3HA 4YS1A 3S5ZA 5IHRA 2QDHA 3KS6A 4IPLA 3GY1A 2GJPA 2NQLA 1A53A 3M6DA 3P8IA 4MNMA 4W9TA 1R3TA 3UWYA 2W9MA 1L6SA 5XIAA 3ALGA 1EC7A 2EPKX 5HINA 1XF0A 2OFJA 1Q6CA 2DT2A 4I8YA 2EPNA 4C5YA 4ZO7A 3W4RA 3LMYA 1LDCA 4I9MA 1V7YA 1GG0A 3ZVHB 5CPTA 1LBMA 4CCEA 2O9RA 2VC9A 4YWSA 4Q7NA 3LUTA 3NEHA 4IQJA 3IVTA 3SY5A 3USBA 4B9YA 2ASHA 1JDDA 4TX6A 4CVUA 5I07A 4MLRA 1JPHA 1R2SA 1I45A 4I90A 4Y96A 3PZVA 2IPFA 1R3WA 4JDBA 3DFPA 4PRRA 5AZ1A 1O6IA 3ZMRA 4ERIA 5G2IA 4GE8A 4HB7A 3B4YA 2I1OA 3N17A 4RNJA 4N9CA 3KRSA 2EJAA 3UZZA 3B0XA 3WK2A 1XIIA 4YYCA 3F4WA 1LUCA 3G1AA 2D3LA 3WDRA 1C91A 3NO5A 1AL7A 5JIPA 3W7LA 1U5HA 3W2KA 1A5CA 2BG5A 2WK2A 2FKPA 1CBGA 3J7HA 4TMBA 2JEPA 3PUEA 4NSBA 3OZPA 1H4PA 1DWFM 2WV8A 4JR5A 4S1FA 3NDOA 4HU4A 2E25A 4LJ3A 4HNTA 1JZ6A 3MSGA 1B3WA 4GRSA 4O57A 5FJTA 4K39A 4HT3A 4MJZA 4DX3A 1K70A 2GVGA 3GQYA 4RDVA 3TOPA 5GJNA 3QY8A 2W66A 4PTDA 4LAOA 4YHEA 1TR1A 3FJ4A 1GEQA 2YL5A 4MB3A 3IANA 3UXAA 3KRBA 1ZLPA 1TZZA 3SY1A 3PFRA 1CI1A 5D2TA 3SGZA 4F0MA 4WRHA 3C86A 3O63A 1XBVA 4IGMA 2BY0A 4HYRA 4QRNA 5IOBA 4GLEA 2OX1A 1QRQA 4IL2A 2Q09A 4WOQA 1EEXA 1YX1A 4L9XA 3KBSA 1V6XA 4DNMA 4RCXA 4OT7A 4D72A 3B9OA 3ARYA 4FEZA 1Q2SA 3SN1A 2XHYA 1GPFA 1T99A 1UG6A 2C1GA 3HA1A 3WH9A 4AHOA 5K3VA 1M7OA 1UA3A 2QJMA 4GYPA 4FR1A 1U33A 4Y2WA 1KQZA 5D38A 4EIVA 5A1AA 3GNDA 1RPKA 1D2KA 1RXOB 3WH7A 3T2OA 3OHIA 4XD3A 2VFDA 3IUHA 2XVGA 4M81A 5HATA 2BY2A 3C52A 5HNTA 4FXSA 3PZNA 1GKRA 3UWZA 1P48A 3GXMA 1LRNA 5A6SA 3BSMA 2NVDA 2D2HA 3KBNA 4FNTA 4I7VA 3QH2A 3ELFA 5CZ0A 1D7KA 1BXBA 4CN1A 4XZIA 3K2GA 3KOFA 5HK4A 3O07A 4ZFCA 1QNSA 1D7FA 4B15A 4WGXA 2YJQA 6PTDA 3RITA 1X97A 3PZIA 3MUIA 3MCNA 2ZOXA 2OZ0A 1VHNA 1NOUA 2WBGA 2G3JA 3WQ5A 3AZSA 2QPUA 1XUZA 3W2LA 3BAKA 1E4IA 3L12A 2RUSA 4O4WA 2ALRA 2CXGA 1VD6A 2ZUTA 4YTUA 4JHZA 3PZUA 5FEPA 2E8YA 4HPNA 1L6FA 3OQEA 4C6MA 1YE4A 4WDWA 1XDMA 3FDGA 2QHAA 5HPOA 4Z0SA 1E56A 4QE1A 3T1GA 1W1PA 2VCAA 5CSRA 3G6MA 3QYQA 3LB0A 4KERA 4XX6A 1GORA 4AZ5A 2OGYA 1KB3A 2E1WA 4UR9A 1XBZA 4CQ8A 2BODX 2NWSA 3AXXA 1SZRA 3PC0A 3E49A 2YCJA 4F0LA 1SW3A 4J3WA 1VH7A 1RVKA 1AG1O 1XLEA 4WSKA 3VDCA 4EANA 1RJPA 5FSDC 2EGZA 5HQMA 3SUUA 2I9EA 4IJBA 1YMYA 1GHRA 3LG3A 4D1IA 4TVCA 4FX8A 1RQHA 4R3UA 5LIKX 4IUOA 3BXWA 2WNNA 1T8XA 3QBUA 2VTFA 1E5NA 4JNYA 5H8UA 4NX5A 4V1XA 5HUPA 3FGCB 1R3VA 4XZWA 3UT0A 3M0LA 2QXWA 5AYBA 1KFCA 1QW9A 3BLKA 1J4EA 1VPQA 1PCWA 4AX6A 3CQKA 3NQBA 5GPRA 3ARUA 1XWYA 3TFCA 3O8AA 3UZJA 4M7SA 4IGNA 1UC4A 5IFPA 1JDAA 1UWIA 1W9BM 3HG2A 1EOMA 1E1FA 2NUXA 2CLOA 4WEVX 3H8AA 3N9KA 4GXMA 3B9NA 3HM7A 4JX4A 1GOQA 3BZGA 1HIZA 4M56A 3FKRA 4MSSA 3URBA 2QAPA 4E4PA 3VKKA 1ZFJA 1M7XA 3PJUA 4DF2A 4L4PA 3AIBA 3H21A 1QPOA 1G69A 4M8UA 3DC0A 5LNRA 2PWFA 2CWXA 2ZXDA 1W1YA 3HPZA 3SCWA 1ZQ5A 1U5VA 4QISA 1SPQA 4LOCA 3URNA 4ACZA 3TYZA 2NSXA 1JQXA 5U4NA 1YBQB 1H0GA 3APGA 4ZZ9A 3DBNA 3LBMA 5I3JA 5A2AA 4UMCA 4JYFA 2QCEA 5KZ6A 1OJXA 3VZYA 3DG6A 2QIIA 5HOSA 3KL0A 4XSMA 1K8YA 5HMSA 1R9YA 4AVOA 3NWRA 1CB7B 4JAWA 4QJ1A 2XFWA 4H19A 3VYLA 3UEQA 3OLIA 2PDWA 1Q7MA 2QUUA 3W1XA 3KL3A 3W73A 4ZSUA 4W5UA 4ZR8A 4D71A 3E5PA 2Z0IA 3NA8A 2JFEX 5D32A 1ZTVA 3TR2A 1AODA 2HE5A 4N7QA 1GT8A 4HOWA 4A21A 4IFRA 1MO0A 1ISXA 4Z1DA 3PFMA 1BVWA 1FWCC 3OGRA 1JULA 3A22A 3HB9A 4NI3A 4G5DA 3M6YA 3PY2A 4C6PA 3GG1A 3WUEA 2A79A 3EXTA 5FEXA 3TU9A 3IJDA 4JYEA 1V6WA 2J25A 4TXEA 1TYGA 1BRLA 5LNVA 1B3OA 1E3XA 3SFWA 3SIZA 3I6RA 4PBFA 4RE2A 3U7BA 3PB2A 2DIJA 2ZUVA 3EWWA 4QG6A 1AMYA 3BWWA 1OD0A 4QEEA 2VCBA 1DXEA 1S2TA 3VKCA 3HV8A 2O7SA 2QR6A 2GK1B 1VEOA 1V3HA 3FYPA 3AI0A 5BRQA 3BCFA 4XD6A 1O1HA 1EIXA 1RCQA 2OLSA 3I65A 3RM9A 2QDGA 1D8CA 4I5UA 4XD4A 4PCTA 3S47A 1FOBA 1TMLA 2J8TA 3O0FA 2VR5A 2P10A 3TSMA 1EGZA 1CTNA 3YPIA 3TMQA 4MFDA 1FWWA 5I7GA 3NJ3A 2W63A 3UCCA 1VYSX 1HKVA 3RU8X 3NQ8A 1TQJA 2X1IA 2HVOA 3GHTA 3RN6A 4L4LA 2B81A 3N18A 5F7UA 3CZ8A 2XWEA 4LCSA 1M1BA 3W6MA 1JNEA 2E40A 3G24A 3WQFA 4JN8A 3OYZA 1UZ1A 2L5HA 5DBTA 5BRPA 2Z1XA 2W5FA 4U10A 1JI2A 4NXKA 2XINA 3UG8A 6ALDA 1IF2A 1YADA 2PDJA 1AVAA 3GHSA 3R94A 2F7FA 5KMYA 4DUOA 5CJMA 1A3WA 3ABXA 5F2GA 5F2MA 3CUHA 1TCDA 1Q6QA 3G2GA 4GY0A 3KTSA 2WHLA 1QK2A 1J96A 2PDKA 3LENA 1KV5A 4W8LA 1Z6KA 5E09A 1TRIA 1HJSA 1IT8A 3DZ1A 1XFBA 3MP4A 1B57A 3P62A 4S2BA 5LHFA 4H3DA 1FH8A 4O52A 4S2CA 4W7VA 1G5AA 2CZFA 3L67A 2ZX7A 2WKGA 2GGIA 3EWBX 2P50A 3L0KA 2E28A 3LI1A 2DEPA 3ZWTA 1B9BA 3M0VA 2P0OA 1JGMA 4UTTC 1TTJA 4OTKA 2SFPA 1YDNA 4BK9A 4XWUA 1ZBCA 2CLFA 3TZNA 3SURA 2UWFA 2V5KA 4MZ8A 1TFVA 3TTSA 3F2CA 4K38A 3ZJ7A 4DZAA 3AJ7A 4XKYB 2ZZ7A 1YTKA 3D47A 3BVJA 3VPLA 4LCQA 3R0DA 3V1HA 4H1ZA 4IGSA 1Q4WA 3GU2A 1XL9A 3WQEA 4TVUA 4NRRA 2WKJA 1JG9A 3NSNA 3ZM8A 2HXTA 3P67A 1FDJA 3I7RA 3VMNA 3OVGA 3W7DA 1FCUA 1RD5A 4GBDA 1UYQA 2C13A 4KEZA 4Q4OA 4ZQOA 2VCCA 5AC4A 1H62A 1T40A 1W3NA 2FGBA 1WDWA 5C9XA 2VGBA 2VGFA 4P7OA 1OYAA 4XBSA 3PTMA 4XG1A 3B04A 3IGSA 2AAAA 4J3TA 1M03A 2VXNA 4M3PA 2ESCA 1J2WA 1PHQA 4KIRA 5BOOA 1QI4A 1SZGA 1EA9C 5C9RA 4PCPA 3P6LA 4BEUA 2PWHA 2XH2A 1HZYA 3STCA 2BY1A 1NEYA 1AA1B 1WAWA 4I5XA 3CTLA 3WJZA 1XLBA 4HZ8A 2NLIA 2GOKA 2QPSA 1TTQA 3WQOA 1XV8A 3CEPA 4FNPA 1VFMA 1XGZA 2GJNA 4JY9A 3BJTA 1KRAC 3DHUA 4DLMA 1C8XA 4RW5A 1G4SA 1SJDA 1WUEA 4CCDA 3Q65A 1MXDA 2ODOA 5AHFA 3SUTA 1UD2A 1NU5A 3ABSA 3A12A 4PL1A 4YPJA 3G1FA 1R86A 2VX7A 3TWBA 1V03A 1DIDA 2G3IA 3W2JA 2OZ8A 5FJPA 5BYWA 4ZQCA 1UJPA 1KRMA 4MWAA 1OD8A 2OWWA 2D0FA 4DYJA 4WLCA 1EJXC 1Z8AA 3B8IA 2XH0A 1OG0A 4J4KA 4WKHA 4C6FA 3LV5A 3KWXA 3QJAA 1NTHA 3OBKA 4R9XA 4LQ1A 4CQBA 4F9DA 2BY3A 3MP5A 1FA2A 1N55A 3EBVA 5E70A 4Y90A 2CLEA 4I3GA 3VOFA 5H1WA 3QOKA 2QF7A 1S5TA 2GQ3A 4XK2A 1ITXA 3MMDA 1JRCA 3T0AA 3GC4A 2AL1A 2VEIA 1BTCA 1NP0A 2WSRA 2I17A 4HOZA 1ZJBA 3HG3A 1IZCA 3WNPA 3FKKA 2G97A 3UP8A 3II1A 3TNBA 1N8IA 1V08A 2OLAA 4U31A 3RXZA 3RUBL 3W7OA 3KRUA 3N2XA 3NPXA 3EKLA 3OBEA 9RUBA 5H2ZA 1EWDA 4J9JA 3WMBA 4ASTA 2FH8A 3MS8A 3W83A 4HIBA 1UR9A 4C7GA 4I6VA 2F6UA 1AJ2A 4ZMGA 1QI5A 1UA7A 1UWRA 3CV2A 1FY6A 1GG1A 5I3KA 3TN3A 3M43A 1ME7A 3ZR5A 2BBFA 3ZT5A 1E1EA 1UKOA 1A5MC 4PFMA 2DUZA 3VX1A 3QV8A 3A4WA 4ACZB 2HISA 3OVPA 3U2EA 1KGXA 1US3A 1HJQA 4HTBA 4MYAA 4I9JA 3S46A 2XVNA 3BLPX 3TC6A 1B90A 3C5QA 3UWVA 3L0NA 4BR1A 4W8BA 3LHWA 3IS4A 4HSNA 4H6EA 2ZRXA 1GOIA 2QDEA 2WXDM 2DQWA 5I78A 2PP3A 3WLNA 3CO4A 3I4EA 4Z1CA 1Z9AA 2EXOA 1DORA 4CD6A 1AQHA 4L56A 4AWUA 2BOFX 3N19B 3TCSA 4Y6GA 3Q37A 4RLIA 2PB1A 5AHLA 3AU6A 2DU2A 2WC7A 4U3AA 5K4ZA 4M19A 3WLHA 4UC5A 5JMUA 4QJ5B 4J1OA 4LANA 1EC8A 4R88A 4BA0A 2YW3A 1YW1A 4FLOA 1JZ5A 1S1PA 1W32A 4NIRA 1BRLB 2I7GA 1LRQA 5MKGA 5A5WA 1WDQA 1ODZA 1YRRA 1UD6A 1POKA 2E5BA 4JIEA 4AD4A 2POZA 1UKTA 3PBMA 3N6QA 1TPH1 3EX6A 5A8MA 2JIEA 2HNHA 3UR7A 3WENA 1O5XA 4RXFA 3IJ8A 3TLLA 3MVIA 3EWUA 3CYJA 3IRSA 1TVNA 3VO0A 2XUCA 1CW2A 3VDGA 2P76A 3AMLA 1YTEA 1XYCA 3BLLA 3FJLA 1UKSA 2OXNA 2FFCA 3NEVA 3NXLA 1VBJA 1K4HA 4IP5A 2PS2A 1E3ZA 3IIOA 3HGOA 3ZLHA 1KR0A 1K9DA 7PTDA 3THDA 2CLPA 5ECUA 4JPGA 2Z1BA 4S3DA 1PS9A 2JKEA 3V5OA 3QZAA 2V67A 3NQEA 2I14A 4GK8A 3IGHX 1VBRA 2FPVA 4H83A 3L4WA 4I9AA 3CNYA 4PE8A 1QNRA 1HNYA 5DT5A 1OFPA 1I8JA 3W70A 4EPBC 1GCYA 3LEPA 1EWEA 3GAYA 3OB8A 1JPDX 1E6XM 3W88A 1Y7VA 4UQCA 1F8IA 4WOZA 1VCFA 1X6LA 4B16A 5I79A 1HJVA 3EX4A 4YVVA 1CZ1A 1M65A 2J88A 1JD9A 3W6LA 3TQKA 1G1YA 2QCDA 3V7PA 2Q02A 4P61A 3BH4A 4B90A 3W82A 1Q7ZA 3P84A 5EB8A 4AF0B 4W85A 4ECLA 1EO5A 4C6CA 1B1YA 4HNLA 4X2PA 1CPUA 3AS1A 1XSIA 4GI8A 4XVDA 1I4NA 4J5NA 5M17A 1JNDA 3SCUA 3SDOA 4JIPA 5AYYA 1IYXA 2FHFA 3VGGA 2TSYA 3KVKA 3H2OA 2PLKA 1V5XA 1C8QA 4EXAA 1RCOB 3KOZA 3MDUA 2GOUA 1SFJA 3PWIA 5B7ZA 2PAJA 4O13A 4F9JA 3WDQA 4YTTA 1FH9A 1WZLA 4OBSA 2V6AA 1C29A 1TTIA 1ELSA 4CEUC 1VIZA 3EB4A 3WD0A 4YTQA 1ZUAX 4R33A 1OFDA 1B30A 3VIHA 1PKYA 1GOWA 1MW0A 5LGZA 1QI2A 2BXZA 2QCLA 4J3SA 4O54A 3W25A 1SW7A 1R87A 1IXNA 3WX7A 4UFJA 2YYTA 1JUBA 5HANA 5A6AA 5EMMA 1GTHA 1W37A 5EBAA 3B0UX 3S5YA 4JIIX 3S1WA 1W3IA 3UGVA 2Z24A 3WNOA 4MLJA 2VYOA 2YXGA 4GJIA 4NAFA 3ZFHA 2V2DA 1XLGA 1FWHC 4CQAA 1XIMA 2CZVA 4QS6A 3WLKX 3SRDA 3HTWA 3WFLA 4QBXA 1NARA 3U48A 2O4QA 4EPDC 4CU7A 3R13A 1HJUA 4IMFA 2Y4SA 4MB5A 3HQOA 3OZOA 3EMQA 1TV2A 1FDYA 3JRKA 3MDWA 4ZXLA 5FSEC 3A13A 3CHEA 2Y63A 1UR4A 3UPMA 2WSQA 2BFGA 3C4UA 2XVKA 3KTCA 4DQWA 4E3TA 3W23A 4GI6A 4MPQA 4S3FA 1RJQA 3NDZA 3ORWA 3GYCA 4URIA 4NILA 1PO9A 3BG9A 4PSPA 4Z2IA 1XQLA 2VZVA 5BXRA 3WQ8A 5LZLA 4L9ZA 1EYEA 1IGWA 1KA9F 5CGQA 1RZMA 3M16A 4L7ZA 2PMQA 3KZSA 1WP6A 2NT0A 1KFEA 1BXCA 1F6KA 3HV9A 4QNEA 1UWTA 3JVAA 1TB3A 1VLIA 5FIPA 1VR6A 4BCEA 3QFWA 3IIXA 3BDKA 3RPTA 3HO8A 1B3YA 1BAGA 3OO2A 2HZGA 1WDDA 3PSWA 1A50A 4MJ2A 2J6VA 1WZMA 4XUYA 1UBSA 4M1RA 3GNPA 1GVEA 3SRKA 4P8UA 1JCYA 3LCWA 1QI0A 1Q66A 3AROA 3S9ZA 1LLZA 3S8HA 4C6KA 2F6KA 1BKSA 1TPVA 3U2ZA 4KEVA 1N8FA 4ZO9A 2D24A 1OINA 2BMBA 2ZXQA 1XSJA 3ARRA 3LM3A 1ITCA 3ZXWA 3L68A 1HKWA 3UWEA 4OQVA 3PPHA 2DY3A 1KKRA 1DJIA 3BLOA 2NZLA 3WF1A 1JZ8A 3EEZA 3T40A 1DWHM 4UMBA 3VK5A 4GUIA 1R0MA 1YIXA 1T8QA 1UH4A 3O15A 2EBNA 4MY1A 1K7FA 4ROPA 4C90A 1EL3A 4GVHA 2QV5A 3S9IA 3SO7A 1P0DA 4O4VA 1F61A 4YN5A 1MUMA 1XD0A 2WJZA 4C6QA 3VTRA 1UUOA 4AZCA 3WH8A 1RY8A 1SO5A 3O6DA 1XC4A 4FX7A 3MVTA 2ZRVA 2J9YA 3I3EA 4B3ZA 2WMJA 2ZX9A 4C1KA 5T91A 2RH9A 4LRTA 1Q6OA 1XLCA 1I9CB 1H11A 3TE9A 1BPLB 2XWDA 2WJEA 1IQ8A 3DH7A 1Q85A 3HPFA 5A6KA 2A0NA 4GC4A 4MPKA 2C8NA 4OBRA 4PUEA 2XFFA 4KWOA 3CLWA 4CN4A 1T6MA 4GCAA 3WQVA 1GEHA 1EDTA 5EFFA 4RK8A 4F0RA 5AB3A 3CZKA 3W1MA 3VMPA 4BKNA 1UQYA 4F2TA 4EX4A 2GSHA 4D6HA 2J7DA 1PWLA 1WXJA 2OPJA 1DQXA 2GVJA 5D37A 2YSWA 5ABGA 4ZXOA 5BU6A 2Z28A 4JCMA 2IPJA 3VGDA 4M0XA 1J0HA 3W1LA 3C2RA 2A3LA 1GQKA 3TA9A 1NH6A 5C71A 3KW3A 3NYZA 3QZEA 3NPWA 5JH1A 1L8NA 4L1WA 1DWJM 1TELA 4YXGA 1OADA 3B8UA 4DM1A 4PUMA 1YNPA 5C7HA 4WD0A 1A80A 3UY8A 3DG7A 3JZUA 3KOXA 1O66A 3LLXA 3RX3A 2J6XA 2YZ5A 3TH6A 1US0A 4D6FA 4O17A 3DG3A 1KBKA 4JGDA 1GQLA 4NHVA 3K8MA 4Q8MA 2D23A 3BO9A 4DXVA 4FXRA 4NKCA 3UG5A 3HMJG 4C6NA 4MY8A 1V3LA 3GVVA 2V3GA 1NP2A 3IIZA 4QP0A 2GLKA 2OLHA 4ZENA 1UUQA 4GJ1A 3GNXA 5CKSA 1DWAM 3VCNA 2OEMA 1XBYA 2ZZ3A 2QIWA 4UTMA 4GFIA 1HKMA 2GFTA 1OY0A 1G94A 4QLJA 3B8TA 4EXQA 3LPPA 1TMQA 1XINA 1PZ1A 3N4EA 2FGLA 3S2MA 1E73M 3BW2A 1I1WA 4GZJA 5AOUA 4EP8C 2MUCA 3WJYA 3NSXA 4UQBA 5CPSA 4HQVA 3AIWA 3C0SA 3PJWA 4BF9A 3ABOA 5CBBA 5BXPA 4FHAA 1PBGA 3W2UA 1ZJHA 3H7UA 3P3BA 1K77A 3BAYA 2FYMA 2G3MA 4DYEA 1CT5A 1JYNA 3ANUA 4A6GA 1WKFA 2Y0FA 1ZAJA 1UMLA 2VC7A 2V5JA 2TRSA 1OWQA 3PPFA 1ICSA 1IT0A 4U5IA 2VVNA 3OBAA 5DFAA 3M0IA 3VDAA 3GSMA 3NNTA 2NQJA 2DVUA 4QQUA 1IWBA 3QLLA 3ATZA 2XSBA 4IPJA 1OC5A 4WR3A 3PZQA 1VFLA 4UOZA 2Y5EA 3GH4A 4H9UA 2E7FA 1R9ZA 3AWOA 2A7RA 2Z2BA 2WMGA 3VNMA 4QG8A 4ZO8A 4L4MA 3LXCA 5E9AA 5L6UA 1OT1A 4M51A 4MZYA 1TPB1 3TAKA 4KGJA 3GYEA 3RCYA 1XRTA 5TIMA 3QTPA 1T41A 2PE4A 1W1IE 2NW0A 3W27A 4GCXA 4LVFA 3VD3A 3VIGA 1R3YA 4D9PA 1F7BA 3OGVA 3B0VC 1ZJIA 2PRHA 4RE3A 4DBDA 3GZ3A 3VD7A 3C56A 4C6OA 4YCPA 5AYZA 4LYQA 2LLEA 4W86A 1TPUA 3GDRA 9XIMA 3UZ5A 4UTFA 1JCMP 5HWJA 3FOKA 1EJWC 3HBLA 4NNCA 3H22A 5PTDA 4UQ9A 1AUSL 1YXCA 2R1NA 1R3SA 4ES4A 3THQA 3FX4A 1BSIA 3CAQA 4Q7BA 3ARSA 1UUMA 2Q01A 3LNMA 2INEA 3QXBA 2H8XA 1XP3A 4DO7A 1ENUA 3WK1A 3BCJA 2NUWA 2AMXA 5J8LA 4UFKA 4WX2A 2VM8A 1SJCA 3FJ6A 4K7VA 3LV6A 1TTPA 1KM4A 3GVWA 3GIYA 1G4PA 3N13A 3W02A 1UWSA 1PZ2A 2YOCA 1WZKA 5I03A 5DCDA 4DRSA 1L6GA 2IW0A 3DBPA 3WBEA 4IMAA 3VIOA 2WYSA 4K8HA 4G2DA 3AYRA 3W76A 3NVTA 1FWIC 1GW9A 3L2MA 1XYZA 2VRQA 3EWXA 3RFAA 3RRXA 1H1ZA 4LEFA 2XIOA 2PUZA 2ZRYA 2CKRA 2VEKA 2QUVA 2QUMA 3WLLA 4DUXA 1JCTA 8XIAA 1FCQA 1E6NA 2BZNA 3LYEA 3NL2A 4B91A 1O4UA 1UB3A 5XIMA 2E77A 2Z7GA 3RO8A 3NQVA 4PRTA 3STEA 7ODCA 4LUSA 3KS5A 3ZO9A 2NX1A 1Q6DA 1S5WA 1KFBA 1PCKA 1GONA 4H7CA 4LTSA 3ENLA 2Q6ZA 3N2MA 3F7JA 1TJRA 1ESWA 2QCFA 4AIUA 3C3UA 3WD4A 2G96A 3MHUA 3TXZA 3OVRA 5CQ1A 2ZA2A 2ZXBA 1IE7C 2Z6JA 4C1LA 1JGIA 3ITXA 4NZ4A 1FWEC 1QW7A 3AC0A 1A5AA 1UASA 3E2QA 5DCEA 4ZO6A 1X98A 1JVNA 4MNKA 3RPDA 3SGUA 2C16A 2VI0A 1OIMA 1YKWA 4TTGA 1ADDA 2I5GA 1DYSA 1E9ZB 3QF0A 2DH2A 1GKPA 1I2NA 3G0SA 1KO0A 2BXYA 2PA6A 1K6WA 1A0EA 2FTYA 2D73A 3GZAA 2CYGA 4WJEA 3FLUA 3DFOA 4AZCB 1J18A 4CEXC 1V7AA 3PNUA 3NQDA 1S5MA 5D9OA 1ZHAA 4JTJA 1OF6A 3S2CA 2PDFA 5AVNA 1XS2A 3GTNA 4BZYA 1W3JA 1ZB5A 2B31A 4Q6JA 3N12A 3PWAA 3IV3A 3S4TA 3GHRA 5H91A 2BGQA 3W7PA 1O60A 1ECQA 4JEQA 4QNWA 3CZJA 4MM1A 4UCGA 4ZVJA 4WCJA 3MANA 4IH3A 2ISWA 4TV5A 1SFLA 2E6DA 1W1TA 1AD4A 5DRIA 4JTEA 3HPAA 1M7JA 5T9CE 2PDYA 1XDJA 2QEZA 4LAMA 4DJDC 1BVNP 2J66A 1BWVA 3R43A 1Q7QA 3DHPA 1LF1A 1O68A 3DUGA 4XZBA 4AUBA 3KHDA 1YLVA 3JZEA 3R25A 4FNUA 1GYLA 3S1UA 2ZQ0A 5EKYA 3GS6A 5IRPA 4Z42C 3BOFA 1KFLA 2V82A 4U2ZA 4LS2A 5B7YA 5HMDA 4DVOA 3REQB 3MKCA 1ZBWA 1U1UA 5I77A 1JCLA 3R58A 2B7PA 2F9RA 2F84A 5CC5A 3S2NA 1J5SA 2GJXA 1IXOA 1LBFA 1QPQA 2XGZA 3MWCA 4B5NA 3WBYA 2DP3A 2V9DA 5FJJA 3GLCA 3T81A 3S5SA 1J79A 2DW6A 3SQSA 3AXIA 7TIMA 2Y6ZA 3WUBA 4WJXA 4U33A 2J9XA 4PGLA 5A94A 4PCSA 4CLMA 3VA8A 3C8FA 3FS2A 1NFGA 2I16A 5BWAA 2BOEX 3PUDA 1KM2A 4HYVA 4GQ0A 4C7DA 4WK9A 3UZXA 2ZA1A 4G8TA 2XN1A 3MP3A 1QUMA 2IXVA 2YR1A 1L6WA 2XTKA 3HG5A 5D8WA 4FSAA 4O1BA 1XRFA 3QYSA 4AZBA 2CERA 3CUJA 1P7TB 3CYVA 3N2CA 2XU2A 2XFYA 4O0ZA 5DMMA 2J9ZA 3L2LA 3W7QA 3B9AA 3W7IA 1TR9A 4CNPA 1X1OA 6REQB 4KRUA 4HSHA 1QBBA 3QSRA 4GXWA 1K9TA 3LBOA 3VUPA 4UQEA 1XYMA 3FA3A 5A6BD 1BKHA 1LOQA 2O55A 2O9TA 3ZSTA 4BI6A 5CBJA 2Y88A 1VQTA 4OV9A 3B9EA 3NUKA 3C6CA 3M9YA 1G0CA 1F2JA 2YIHA 1WZAA 4IHCA 4G7EB 3OLDA 3WLIA 1KBIA 4KMQA 3WMLA 4JQ1A 4LF2A 1M41A 1SJAA 3FNDA 3LERA 4OHQA 2VKZG 2P88A 1A5UA 1UR0A 5G2WA 4Q8TA 1W2PA 1WX0A 3H2CA 2QGYA 4OUEA 5LNUA 1DHKA 4L6HA 4ZGYA 1BXNA 4DELA 4GVGA 2A1YA 4P7NA 1O5QA 2GWGA 5EMYA 2V5BA 4CNNA 1ISWA 5RUBA 5LNSA 4NNAA 5FAJA 1N2VA 5CSUA 4N2YA 2OKTA 3VUSA 2VEMA 2OO6A 5LGXA 1FHUA 4UTTA 3LRKA 3CC1A 3N25A 3NFUA 3EOOA 2Y85A 2WVTA 4EE9A 3FHAA 5CLTA 2EG8A 1WOBA 3N73A 3OLGA 2AL2B 4UBPC 4KCWA 4O1FA 2EHHA 5FL0A 2WZIA 3N9RA 1BTMA 2YA2A 4YTSA 3DFYA 2BWGA 1VFOA 3N29A 1GOOA 1G4TA 3ITCA 4LC6A 1NQKA 2OX4A 2CFFA 4KCVA 5C2GA 1CGXA 3QMRA 1BLIA 4L6OA 1JL8A 4IIEA 4FNSA 3S6TA 4HZ7A 4LF1A 4W84A 5CAHA 2VFIA 1NWTA 2DUXA 3ZLFA 3KCOA 1ZAHA 4DAIA 1JYXA 4HD5A 3CL8A 1LZOA 1RVGA 2XSXA 3PN8A 4PEKA 5M5DA 1SFSA 3A64A 4IUGA 1C3FA 4K68A 3TV8A 1EPXA 2PRMA 4Q8QA 4GMEA 2HS6A 3LPGA 5A69A 3O9NA 4DPPA 1UD8A 5REQB 3GR7A 3LTPA 3LX9A 4HN8A 3FV9A 5U7SA 4LUTA 2VMFA 4ERAA 1WCGA 1YEYA 1X96A 3VGHA 4JKKA 4HPHA 4ZE4A 1Q2RA 1XGEA 1TRDA 2HSAA 4REQB 1Z7AA 1JFXA 1XH0A 4JTUA 1A49A 3TYCA 4Q3MA 2FGZA 3AHYA 2HWGA 1R7AA 1DIOA 1UWUA 3T08A 1I1XA 4WXZA 2B7OA 1Z3NA 1MMFA 2R9RA 3VE9A 1QNVA 4ORMA 2PCQA 1E6RA 2W27A 1WBHA 1U1HA 2FZDA 4W5ZA 3MUY1 5MHBA 3CAVA 2ADAA 3VKBA 4CU8A 3PSVA 4C6BA 3V0SA 1Z44A 3FSUA 3MQTA 4Q22A 4CCCA 2ATSA 2WVVB 1SU5A 1XLKA 2WJFA 2OG9A 3CV6A 3CQHA 4G7FA 2V3EA 3G77A 1VJZA 3G1YA 1OCJA 4C6LA 1JXJA 3GG8A 4JX6A 3G22A 4H8NA 1TX2A 3MA8A 4ZODA 3ITLA 2YYUA 4XBKA 3WIJA 3WQ4A 5A2CA 3SM0A 3GW0A 2FB3A 1GZGA 3M46A 4FK9A 2INZA 4C6JA 2WCSA 2HBXA 2H3BA 4MUZA 2QJGA 2GWNA 1RQBA 3MI2A 3WO8A 2ZRWA 3HU7A 4L5ZA 2YPIA 1UD4A 1MI3A 3K8KA 1XISA 2R1LA 1JPMA 2NVAA 3ZR4A 4XTDA 2YDAA 3ITTA 3SCPA 3I68A 2Q3RA 1RPXA 1PX3A 1UP0A 3S2LA 1OC7A 1KGUA 4ADSA 2VFGA 3GXDA 3CASA 4EKJA 5LSMA 1POJA 4P8XA 3A9BA 3WQWA 3GX9A 1XIHA 5BOFA 1AFSA 1W56A 1MEHA 4GQRA 2O9OA 1QATA 2YCKX 3W86A 1GVQA 4IICA 5FF3A 3FYYA 1H61A 2QNEA 5IDZA 1XYFA 4OVXA 2DVTA 2ZADA 1MXGA 5D33A 4DWDA 3LMZA 2QJNA 1IXQA 2VX5A 4GA8A 3QV6A 1PTAA 2JQXA 1WV2A 1CX9A 2DSVA 2CLIA 2ABAA 2ABBA 2ZZ6A 1SFTA 5JU6A 4I5RA 2Q8LA 2E9MA 4C5ZA 3WBAA 4EXBA 2EG6A 2G50A 3NZQA 4JY8A 2CC0A 1Q8AA 3R79A 1ZNNA 1TV8A 4RNIA 1D8WA 3JU2A 4J3VA 2QCCA 4GQQA 1GKQA 3SUSA 4DIAA 1EBHA 3E38A 1MSSA 4L61A 3HQNA 3TYBA 1VJSA 3CHCA 3ZJ6A 4Z2LA 4F0HA 3KBMA 4LSBA 3IJ7A 3VD5A 3DKLA 2PDGA 3SCNA 3QY7A 3TKFA 3WNNA 3GDMA 5CCZA 3QLDA 1D3GA 1YYAA 2FMNA 3UCQA 5EL1A 3M5XA 1AW1A 3EA3A 4E2VA 3ALFA 2VQTA 4Z17A 2YDQA 3FIGA 1AQ0A 3NPUA 2ONEA 4WQ6A 5G2HA 3V4BA 4PTVA 4O0KA 1OQFA 4JKMA 1FKXA 3H7RA 1PB0A 4EPEC 1HKKA 4GQGA 3UA4A 5K9XA 3FAWA 1R30A 5CPMA 5M1TA 2DIKA 4RV3A 1W5NA 1H7WA 1V4YA 2WLYA 3A5VA 3N2TA 1P4CA 4Y9AA 2A2IA 2GJRA 4JTTA 3AHXA 5EU9A 4JIQA 5I3FA 2IKJA 1XJBA 3O16A 5A6LA 1A0DA 1H7OA 4AD1A 1SMAA 3TP4A 1S39A 1W3KA 1OX6A 3LCLA 2VDIA 2EPLX 4XD5A 5FA5A 4G1NA 3SSZA 1F9CA 1WE5A 4AG0A 3EDDA 4US5A 5IHSA 2RKXA 1OGGA 3HN3A 4W8AA 3EDJA 3DU0A 2J75A 2D22A 4XAGA 1VFHA 3MUZ1 2X0SA 9CGTA 1FXQA 1VRXA 4N02A 3AMKA 3POCA 5KEZA 1UJQA 1R5YA 4B5SA 1YTDA 3DYMA 3VNLA 4LT9A 4JHMA 1AMKA 1WA3A 4JCLA 5T26A 3MZ2A 1OSEA 1PKMA 3B8WA 3L66A 1XFCA 5HNUA 3CIVA 1Q6LA 1OEPA 3DHDA 3WDJA 1QOQA 2QYGA 3WEMA 1DVJA 1KFKA 5DMLA 4KQNA 3BOLA 1J0KA 3SRHA 1E51A 3W38A 4JNMA 5ABTA 1YQ2A 3R8GA 3CMFA 5AHNA 4UZUA 4HK5A 1FWTA 1EBGA 1W3HA 2CIPA 5CPNA 4H00A 3F5KA 5E1QA 1HT6A 2A3CA 4PMJA 3V3WA 1J5TA 1GPWA 4QXIA 3RU6A 4UFHA 4HVXA 2DZBA 1XSKA 3ES8A 6A3HA 4H9YA 3GR4A 2WOQA 4GJJA 1ZS2A 2XN0A 5D03A 2WLZA 2X7WA 4DZ5A 1IEIA 4FB7A 1P1MA 3RLGA 4Q8UA 4C60A 1WKYA 2Y1HA 2WMFA 3V5CA 2YDSA 2FZBA 1WBJA 2Y89A 3M0JA 4E0CA 5CG7A 2YA1A 4YL2A 1MFVA 2V5LA 1F3EA 2VD8A 3CWOX 3L0GA 3UFYA 3OTRA 3SCOA 5F1UA 1C7TA 3E96A 4JXCA 1N7KA 4C1NB 5DY2A 3IAPA 1I2QA 2A3BA 4MIMA 1Q3NA 4RPPA 1XRVA 1I0DA 2AGTA 4LVGA 1BQGA 2C1HA 4M1BA 4YMZA 4RDZA 2OSYA 1RBAA 3RRAA 4JBRA 1YNYA 2OYLA 4XIAA 2YBTA 2YDRA 1ML1A 4DWSA 2BHZA 2GUBA 4E2BA 4Q8VA 2XSAA 2G4JA 3FXYA 2TYSA 4UR8A 4CNOA 3HZ3A 2GGHA 4MKVA 3WNMA 4F2UA 1E1CA 3W07A 5FAGA 1VC4A 5ABEA 1OB0A 3QV9A 3H2AA 3DCPA 2WHKA 3N1AA 2Y24A 3COTA 1GJPA 3EDEA 2XZ7A 4QCEA 2PU1A 1B54A 1KD0A 2Q8ZA 1IR2A 4BF5A 2FQIA 3ID7A 1KCZA 5C8BB 4Q32A 4X63A 3TJLA 4Q7IA 3CEUA 3QZ6A 2TODA 3C2OA 2OZTA 1XLAA 1WQ5A 4MTVA 1REQA 2C19A 5BOEA 2GQ8A 3PPGA 1V3MA 2QUNA 4NU7A 1MUCA 3TYUA 3KBJA 4R7OA 4K6AA 3PBGA 4DUWA 4FNQA 1EJSC 1O7AA 3OODA 4HHLA 1W1VA 3VAVA 1KM6A 3O1NA 3AYVA 3QPZA 4BJHA 1DJHA 2PTDA 4DLFA 4GUFA 5KZEA 2P8CA 1EJVC 3UYIA 4N4QA 3F2BA 3LHUA 4DJEA 1KBLA 1QWGA 4L64A 4B3LA 3GNRA 2GPTA 3KWSA 2DJXA 3A21A 4NI8A 4IJRA 2P1FA 3S6OA 1OFOA 3BICA 1J9YA 3GC2A 4D6CA 3KOWA 5HWMA 1RK5A 3TJXA 2UY4A 3IIVA 2HMCA 4HJFA 2OKOA 3L4UA 2PF0A 3ZLGA 1KWKA 3AUJA 1DWGM 4S38A 3GTIA 3VI2A 3EPNA 2XPKA 1EEPA 1X38A 1EF2A 1BD0A 1P6WA 4BF7A 4MNJA 4OECA 3QR3A 4J28A 4G9PA 4IFKA 5LA0A 5JXQA 2Z1KA 1WDRA 4H4IA 2UY2A 4Z0JA 4R7WA 5EA9A 4KCUA 1Q45A 3VGEA 1FVPA 3ZT6A 3W7NA 3MCOA 3ZOAA 4E4FA 5GJPA 3AYTA 2VNCA 2AKMA 4K8GA 1IWAA 1UWAA 2PTWA 2JGQA 4JFVA 1F3XA 1MNSA 4KF1A 2ZICA 3ABQA 4WF7A 1PTDA 2FH6A 4AIOA 3BUVA 4LBUA 3WD2A 4AMCA 4IQDA 1H50A 1W3LA 3WH5A 3PG9A 3GKAA 4TMCA 3MCMA 5HMFA 1FQ0A 3BTNA 3BLDA 4B5WA 1R3QA 3E74A 3EOSA 1DE5A 1M5WA 2PDXA 2BLEA 2IKIA 2Y70A 3UW6A 3EXRA 1MW1A 4QSHA 4JTAA 1XW8A 1S3HA 3VOHA 4HYWA 2DZUA 1R8LA 4S3EA 3W7JA 1VPYA 2DORA 3SZ8A 3A23A 4YTRA 5EY5A 3VCCA 1QHOA 4JFTA 3QQ0A 4JFUA 1F4AA 3DXIA 4PH6A 3DYOA 1S5NA 4CD4A 2HTMA 4FP1A 3GTHA 1FP8A 1M68A 2EJ1A 3W84A 1VYRA 4J35A 3S42A 1JDCA 3WQCA 3A3WA 2UBPC 5CJNA 3MBFA 2ZBTA 4A4AA 3DN5A 4M6VA 1KBJA 2C91A 4B2DA 4U5KA 3ZIZA 3T6CA 1PWMA 1Z32X 2O0TA 3N04A 4KFNA 1MYRA 4HGXA 2NX3A 4QFUA 3NVDA 5FF7A 2REQA 2W0UA 2WCAA 4M6QA 3KX6A 1Q65A 1WO2A 4UCFA 1F5ZA 2HPMA 3HIJA 3WLOA 1AL8A 4U2YA 3VCRA 1AQFA 1CDGA 3TAOA 4ICCX 3QVQA 1F6PA 3BC9A 4AB4A 3H55A 1KNWA 4GOAA 5I09A 2BVTA 3K8LA 1QT1A 6XIMA 1FWSA 2C3ZA 4NF7A 2TAAA 3O0KA 3WL1A 1FWBC 3KOYA 4JKLA 5I0DA 2XH4A 4NAEB 3U9IA 1VP5A 1KTCA 3UR5A 4TTUA 4WUIA 3RX2A 4BQ5A 5AHIA 5ENLA 4RXGA 1BFNA 1KGWA 1JFHA 3QEZA 1NF0A 5HULA 3K13A 2JF7A 3W85A 1JCNA 2CZEA 2E5CA 3UXIA 1LM1A 4RZ5A 1R7OA 4ZQMA 5DY3A 1N82A 4O15A 4UWMA 1VENA 4QITA 1UOZA 1PV8A 3K4WA 3USZA 2VDHA 4V15A 4WDXA 4MHBA 1EOKA 4JN7A 1QNQA 5GNZA 2PGRA 5I02A 1TJ2A 4J27A 4A3HA 1E4MM 1EDQA 2G8ZA 4R7JA 3CZLA 2V2CA 4DJFD 2G0WA 2JIWA 3R8HA 2VZOA 2X41A 5I00A 2E9LA 4AEFA 1SYTA 3H26A 2FZ9A 2HVMA 4HTYA 1ITUA 4FIRA 3MBDA 1V93A 3VOCA 1KR1A 3KVMA 1WKEA 2FDMA 2PURA 4EF8A 1HF6A 1DJXA 3SGGA 3CV7A 1EH9A 5T8GA 1VHCA 2H3DA 3OG3A 1Z42A 1YPXA 1S1RA 4ZA0A 3V0TA 3GD6A 2JKPA 3DFTA 5C6MA 1F8MA 3BMXA 4DWSB 3H54A 1EP1A 5BZAA 4WKFA 4BS0A 3IJQA 5HR6A 3TOYA 2QAFA 1BWKA 4H9TA 3M1ZA 4QM1A 3HQ1A 4Q4MA 4LBRA 3UF9A 1SVDA 4IZGA 2ZCGA 1ZCCA 4AZ6A 1AW5A 4ACYA 2CLMA 3O05A 4PB4A 1DWIM 1G9HA 3B4UA 3MI6A 4AD0A 2FHBA 3PAJA 4GX8A 3UJSA 1A5BA 1FWAC 4LYKA 3QM3A 4Z1AA 3TA6A 2G95A 1O1ZA 3THCA 1QAPA 1F73A 1MRQA 1JUKA 1IT7A 4GHRA 4W89A 1EZ2A 3G18A 1REQB 3CL7A 3BQ6A 3FEMA 1B2YA 2YXXA 3S5NA 1E9IA 3VVGA 4QX4A 3VDHA 1X8FA 3P61A 1R46A 5JUVA 3I3BA 4GH3A 4RJEA 3D3AA 3WNLA 2Y7FA 1EJUC 3T44A 3LCIA 1CXLA 3G1XA 1E6PA 3CLMA 5FEZA 1HL8A 3VIFA 2C15A 1DIKA 3SUVA 3S1XA 4ADUA 3ICJA 4MDOA 1VCGA 3G3DA 1RR2A 1XIEA 3L65A 1XICA 2DZPA 4KIEA 3NQ2A 2WSKA 4JTGA 4LYRA 3U7VA 1S2CA 4HU0A 3P0WA 2TMDA 3MT1A 1ECEA 3NM1A 3JW7A 2Z1SA 1ISVA 4Q4KA 3T42A 1ONWA 4GZ7A 1XRSA 2PDQA 1JZ2A 1U5JA 3CUGA 3IRDA 4HNUA 4F79A 2XIJA 2PWGA 3T0TA 4IPPA 4DEFA 4IPNB 5L9FA 5DO8A 1MZRA 4DJDA 3O6CA 5C5YA 4NZCA 1ZRQA 1I0BA 5TBOA 1J11A 3FN9A 2QGHA 1UROA 4GUGA 4YWIA 7TAAA 3E2VA 2EKCA 1EXPA 3C2VA 4XSLA 5CC7A 4C91A 1DTUA 1Y65A 2KZHA 2CETA 1V3KA 4A3YA 5C2CA 3WJSA 4IFKB 2WMKA 4UTKA 5A8GA 4GY1A 1R3RA 3EAUA 1BSLA 4RDYA 5KTLA 4ZOCA 3RCNA 2VR4A 2WNQA 1GVSA 3QMSA 3AZTA 3WDIA 1OK4A 3OGSA 1P43A 5G4HC 3WMSA 4HMDA 4DBUA 1LORA 3ANYA 2J7BA 3N34A 5LYRA 4BQ4A 1HQTA 3NQAA 2V68A 3VFCA 3F5LA 4D6DA 2VOTA 2GVYA 3I3DA 3CU2A 3LN3A 2WJDA 4UTWC 1EP3A 4GNVA 4RX0A 1OCBA 3HQPA 3G1VA 3OLEA 2ISSA 3WLPA 1J10A 1V6UA 4H6RA 3WF0A 1EHNA 1LLWA 2OWCA 2OO0A 2ZRUA 2H9AA 5TAOA 2YB1A 3KRZA 1E0TA 3NZPA 3HF3A 1PIIA 4OKDA 3B8SA 4WDUA 5D30A 4HMCA 1Q63A 1DHPA 2R24A 3B40A 5T9BG 2DZXA 3SADA 4RNHA 3UCDA 4JTRA 1PTGA 3EXSA 1W9XA 2V0TA 3FSTA 3W1UA 1TV4A 4JICA 4GGBA 4I8DA 3T09A 3WDHA 3UPWA 3RMEA 1ICPA 3AIQA 1PDYA 1LCOA 1UP3A 4LYPA 4MWAC 2VGIA 3RO6A 5F2IA 1C8YA 3BSGA 1OX4A 3P80A 1LUCB 4KS0A 2J4GA 3EKZA 2QDDA 4NZJA 1KM5A 4NL1A 5K7JA 1H1NA 4O53A 2BHUA 2GUYA 3IUIA 3ZVIA 4WY0A 1FHVA 2VEGA 5DX7A 4DUVA 3JS3A 1QASA 3DC8A 1IEVA 2CESA 1UZ4A 3TK7A 3NTYA 1KRCC 3LQGA 3F2DA 1UWQA 5EBUA 3W7RA 1BYDA 5D8ZA 5GQBA 2ON3A 1W9PA 1X1ZA 4C7FA 4FLSA 5EMJA 4LY8A 4OJYA 2X0HA 4QDPA 4IMCA 3VNKA 1XD1A 5CZJA 4KT2A 5KZMA 1DPMA 3PZ9A 3MO4A 3VE7A 1IEWA 3WFZA 2ATMA 2D0HA 1AH3A 3NDYA 1LLOA 1P5BA 1MDLA 2BX7A 2IKHA 1W8GA 1XI3A 3LGEA 4F66A 2OU4A 3M64A 1R85A 4H9MA 5E0KA 2J7GA 4QJ3B 3OOQA 3RM8A 3W75A 3LK6A 5AVHA 3A4AA 2D2JA 4OGZA 1RLDA 3PPCA 1SZNA 1DQUA 2WMIA 3VNZA 4GGHA 1EB3A 5LA1A 4E5TA 2PP0A 3AHVA 5EMKA 3H7VA 4X0VA 9XIAA 3CO8A 1XLJA 1NDVA 2VFFA 3MUCA 1VKFA 1C92A 3HJEA 2ZIDA 3WKZA 3QGAC 5LHEA 1EXBA 2W79A 3EWCA 1UQZA 3GNNA 5CG0A 2ZFAA 3SSJA 4UFLA 4DY1A 4BY3A 1IZKA 2QULA 4XUGA 4C65A 5BRBA 1I2RA 1W5OA 2E4TA 2DGAA 3M7SA 3P82A 4IIHA 4WDTA 4MNLA 4D6JA 2DIEA 2QMKA 1PXGA 3EOEA 1MZHA 2R82A 3ZVHA 1IZJA 1KW1A 2CKSA 3T4CA 2P8BA 4PZVA 3MC5A 4KW2A 4HPGA 1KRBC 3VOGA 4S3AA 1XIFA 2YW4A 5HJXA 2O4MA 1FFQA 3LOTA 1DIEA 2YL6A 3BGGA 4ZQPA 4QCFA 1AJ0A 2V8ZA 5CSSA 2OTDA 2EG7A 3VIKA 4P7RA 1EUNA 3TTQA 2H8ZA 3NO3A 5BU9A 2PGEA 4H7ZA 2GGGA 3E12A 1LWJA 2BGNE 1OCNA 3GFXA 4HBKA 4AC1X 1B31A 3ZJ8A 4CD7A 1AZ1A 4CNSA 2VZSA 3SEPA 3NXFA 4AFYA 3RF9A 2BVYA 4CCZA 1E15A 1H7PA 1UIPA 1GOMA 1VBGA 2FFIA 1J93A 4JTSA 4WZHA 3IAQA 1QR7A 2C7FA 5CC3A 4EVZA 4IX0A 1P0KA 3UPBA 2YLLA 4PB5A 3GUWA 2XZ9A 4A35A 1OFEA 3KLLA 1EYWA 2UV8G 5J04A 2ZWZA 1WYIA 2YCLA 4YYFA 1WAUA 2FIQA 2EPMX 4L4OA 1NOFA 4E8GA 4GXPA 4AYGA 3HG4A 3QTGA 3V16A 3E0WA 4MMWA 3EOLA 2PU0A 4PR4A 2EPOA 1VGAA 2PD9A 1HVQA 1XLHA 4DNHA 1UW9A 1GQNA 2VX6A 2VJXA 3RLUA 1O95A 2HK1A 1S5VA 1XQKA 4MGGA 3UBPC 3WLQA 2H6RA 3TQVA 2J47A 3CHFA 3BAXA 3Q2DA 4HMEA 1H7XA 2E6FA 5DCBA 4MB1A 1QNPA 3WQPA 3QW4B 4Z2KA 4AZHA 3LHYA 1P0BA 3N9SA 1E4NA 1VFTA 2BHYA 4GYFA 1P6BA 1L6YA 3AS3A 3W7CA 3ATYA 2W3ZA 1A3HA 1X1NA 2BVWA 2Y8KA 2YZRA 4G1KA 3TW9A 2RAGA 4ZQRA 2E09A 4XAPA 2UY3A 5A8NA 2WSYA 2P5NA 1LTDA 3BJSA 3SB0A 3WN6A 3CWNA 1LBLA 1X7FA 3NCOA 4P5UA 3SCVA 4FZIA 4DZIA 1XR2A 4S39A 3TNOA 3LZ3A 1F3TA 1NM9A 3MU7A 3H23A 7ENLA 1ZY9A 2PBGA 5EMUA 3O3RA 4YVXA 5DMYA 3STFA 2Z29A 1V3JA 3C0JA 3URQA 1GOXA 1AH0A 3JR2A 3AIVA 4HNCA 4M80A 4IIBA 4LV4A 3V5FA 1PUDA 1TVPA 3TSDA 2PZNA 4AMAA 4D8AA 4KGLA 4MKSA 3G6LA 3WH6A 4R9OA 4X9SA 1NQ6A 4U3CA 4WJ8A 1M3UA 1TWSA 3B8VA 3M0ZA 1V0MA 1E6ZA 2G41A 3P7YA 1CGTA 2R1PA 2GDUA 2QW5A 1WXYA 3O6YX 1XBXA 2RFGA 4M82A 2FZ8A 2G3NA 2BGSA 1QFEA 4PUJA 4R85A 3PNZA 2GQ9A 4R27A 4JIRA 1YDOA 4MB4A 4TIMA 4ICMA 2HQAA 5I6SA 2UY5A 3TX9A 5FACA 1QXLA 4W87A 1QDSA 3TN4A 1YPFA 1TIMA 1TREA 3T8QA 4IG2A 3KVLA 5D05A 1H51A 1OGBA 4GO9A 1Z69A 4UTUA 4QAWA 5HPCA 4M24A 1JZ4A 2CHRA 1Y8BA 3RLVA 2XVPA 5I24A 2PGWA 1TIWA 2OOGA 1ODUA 1TVLA 3QN3A 2PDIA 2VL4A 4XV0A 1QOPA 3LCGA 4PUNA 4CQDA 4Q6XA 2ZUNA 5IDIA 4ZBCA 3LZ5A 2NSOA 4HSOA 1FWDC 2HROA 4GPNA 3TONA 1XGDA 4RW3A 3W1NA 1UKPA 1B4EA 1H7RA 2FTWA 2I57A 1QMLA 2E67A 2ZUSA 2DZAA 2XJ7A 3EPMA 3CPRA 3IK4A 1KBBA 2RDTA 3HMCA 2Z7KA 1RALA 3CH0A 4AY7A 3W2NA 5GVJA 3M7WA 4HP5A 2PLJA 3CIXA 3WLRA 4TX8A 4ZOEA 3KCJA 3WLSA 4DXXA 3TFXA 2YCIX 2RGMA 2RHGA 3KL5A 2CHNA 2J77A 3UG3A 3BZJA 1KLZA 4IIFA 4DF1A 5KSWA 3GTFA 3Q58A 3AFBA 4LVAA 3R6IA 2OT1A 3FGCA 4Z2JA 4UOQA 1QJWA 4LPCA 5CPLA 3NG3A 3W1RA 5BWFA 2QS8A 1OF8A 2X1SA 1CWYA 3BAIA 3K4DA 4QDMA 5C70A 5KZDA 2WVSA 1NVMA 5J5RA 2WAGA 3K5XA 4GBUA 3LPFA 3TYDA 2IXUA 3RG6A 3LXAA 2PSNA 1IWPA 4XAZA 4X2RA 3W00A 1GQJA 4CU6A 1IGSA 2IQ0A 2ZVIA 3POHA 5FF0A 2OJPA 1RP8A 1H63A 3CZGA 4I7WA 4UTHA 1LL7A 1XPGA 4JTQA 3TJIA 1GVIA 1VEPA 3BW3A 5HA7A 2J8GA 5FJIA 2OQYA 2PZ0A 1YBQA 3WEZA 2YFOA 5LIXX 3CBWA 5A95A 3UNTA 2VC6A 1RHCA 3WSUA 4ZE5A 1K3UA 1TSIA 2DSWA 1KXVA 5HJLA 2PDLA 3ZS4A 3F4VA 4GD0A 2CLHA 4GI9A 4BWLC 1JCXA 1QI3A 3R5EA 5TD4A 4PMYA 2Z2AA 1FDZA 6XIAA 4WGHA 3P93A 1K9FA 5LXEA 2J13A 4NJJA 3DFQA 3S1VA 1K1DA 4AW7A 1TV3A 2ZUMA 1OHLA 4XO7A 4HA0A 3W1QA 2HNEA 1L2UA 5ABHA 1GYMA 5MF5A 3WMCA 3AO0A 1LL6A 3CMGA 1KQYA 3MTWA 1C8VA 5AYXA 3BGAA 1ICQA 7REQA 3NL3A 3RJYA 3LCFA 3SW6A 2PTZA 2R1MA 4LS1A 1J2BA 1XH2A 4A2RA 1T7LA 1ZPTA 5HWNA 3DGRA 3DAQA 2FHCA 3E1F1 3VNDA 4IGHA 1SSDA 2DSZA 2OMAA 2A4AA 2J7EA 4IXXA 2GK1A 2W91A 3ZJKA 1AW2A 1LOSA 3PR2A 4ORIA 1CNVA 3C0LA 2WZTA 3ZQ9A 1F07A 5K9DA 2WB5A 2XIIA 2PODA 3EZ4A 3BW4A 3VC5A 1N8WA 2VFHA 3W0KA 3QC3A 2ISVA 1D3CA 1VF8A 1JZ7A 1FP9A 1YXDA 3UZYA 4DYKA 1LOLA 2FZNA 1KWGA 2QCGA 1FX6A 1MQQA 4ILSA 1VZWA 2YCLB 4B5VA 2I56A 2OEJA 2DSKA 4CNTA 5DANA 1KTBA 3B8DA 1RAKA 1SJBA 4MWAD 1ME9A 3RJXA 4UR7A 3WCZA 1W1ZA 4H7VA 3NQCA 3PBVA 4H04A 2E3ZA 4GYJA 4E3VA 3FDKA 1S38A 3WF2A 4JTLA 2R91A 4UUIA 4MWAB 3ECQA 1K6AA 2WBKA 4O18A 1KC7A 1LQ0A 4X60A 2XM1A 1ZAIA 5HBFA 1TPDA 3GK0A 1W91A 2BTMA 3MYOA 3QPEA 2QVHA 3C8NA 2Z1VA 4H41A 5J5DA 5GNXA 3IWPA 4DBWA 5CZKA 1J0IA 4PTXA 2A7PA 3CWHA 3N6HA 3TQPA 4K1GA 4HK7A 2GDQA 4PYSA 2CLK