4NJJA

Crystal structure of quee from burkholderia multivorans in complex with adomet, 6-carboxy-5,6,7,8-tetrahydropterin, and manganese(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
209
Chain Sequence
TYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGENGGKFKDADALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFGIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radical SAM enzyme QueE defines a new minimal core fold and metal-dependent mechanism.
pubmed doi rcsb
source organism Burkholderia multivorans
molecule tags Lyase
molecule keywords 7-carboxy-7-deazaguanine synthase
total genus 66
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.3.99.3: 7-carboxy-7-deazaguanine synthase.
pdb deposition date 2013-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4njjA00
3PS7A 1L6YA 1SW7A 2A6NA 1DORA 3EKZA 1L6SA 3W3OA 2PE4A 3W2NA 4K36A 3LTPA 2B7NA 2QCHA 4O10A 5G4EA 2RHGA 3B0PA 3MUXA 3G1YA 3M16A 2ATSA 1KM4A 2HTMA 1MEIA 2AAMA 4NJJA 2V81A 3DAQA 5AHEA 4OV9A 3S6DA 4Y6GA 2Q3RA 3TV8A 2NXHA 2E77A 1I2NA 1PS9A 3SECA 3IV3A 4JGDA 1JRCA 3QM3A 5CZSA 5KZMA 3OHIA 5IBXC 1KV8A 1GVQA 1QO5A 2NXIA 4LUIA 1QOQA 3D0CA 2DJLA 1B4KA 1TTQA 3LRLA 3TX9A 4EWND 3S5OA 3W1RA 3UY8A 1VHCA 3FS2A 5D04C 4C1LA 3EXRA 1JCMP 4RJEA 2NUXA 3GAYA 1GG0A 2RDTA 5D02A 2P1FA 4A22A 3USBA 3N73A 4MY1A 1DOSA 3W7QA 1WBJA 2Q8ZA 4E2BA 2I1OA 1LOLA 2QCNA 4O54A 4ZL1A 4O1BA 1KBIA 4JICA 5LNUA 2QJIA 3FA5A 1O5XA 3BG3A 3PUDA 3TC7A 3AJXA 2G95A 4LS1A 1QWGA 4JTGA 4OGZA 5D05A 1MSSA 3LERA 4K7YA 3BGGA 4LW7A 4PL2A 2QCGA 3T44A 1QPNA 5DELA 4S2BA 2CLFA 3C2VA 2X1UA 4WJEA 5HWJA 3IGXA 3NZRA 3G0XA 3HPSA 1ME8A 3HGOA 4FNRA 3MO7A 1FCBA 1A5CA 1LRTA 1NVMA 1RQHA 1KFLA 2X1TA 3G24A 4MZ1A 4JTUA 3WFAA 3HO8A 4ZQPA 1BTMA 3M1ZA 3QSTA 1GYLA 1IXQA 2A0NA 2DZSA 2VKZG 4HPXA 3T40A 3IEBA 3W7NA 4JTEA 2CU0A 3G1FA 3UWYA 3IIZA 4TIMA 3KRZA 3NO5A 3W1TA 1FDJA 1Q6OA 1VC4A 2Y88A 1C8VA 4LRTA 1JUKA 4NNCA 1N7KA 1GZGA 1VS1A 1VR6A 4WY0A 2I9EA 1AL7A 4AEOA 3DXIA 4LUJA 3HMJG 3PUEA 2NUWA 5HWMA 3NQGA 2HMCA 4XBKA 2B7QA 1KTNA 1W37A 5F4XA 4JD4A 2CLLA 4O14A 3W1MA 4DBEA 2WOQA 5AHNA 4YCPA 1W5PA 3W7PA 4YLWA 3PBWA 1WOBA 1JCJA 1SSDA 5J5DA 3HPZA 2V2DA 4TMCA 4O0ZA 1SZNA 2V2CA 2Z1BA 4N4QA 4A21A 1JJKA 3ATYA 4N9DA 3QJAA 4HPJA 2V0TA 4JTKA 1FCQA 1K7FA 3HPXA 4UTMA 3P61A 1VYRA 1WQ5A 3NEVA 1I2RA 4Y90A 1MEHA 2QAPA 4GE8A 1H5YA 4HHPA 5FI8A 1H61A 3HF3A 1W5OA 1IIGA 1L9WA 4UMBA 3LRKA 4O4VA 1XDMA 1F6PA 2QAFA 4GNJA 4KFNA 4YL2A 1QPRA 4M19A 3S5ZA 1TPVA 3A24A 3LTSA 4TR9A 2ZRYA 3VCRA 2Y63A 2GUUA 4AHPA 4BK9A 4UTKA 5AHLA 1CW2A 5HUOA 1LRNA 5K9XA 1JR1A 3PWAA 3W23A 4UTLA 5T26A 1GOXA 3O8AA 3QSRA 3IIPA 1KTCA 4PTNA 5D2WA 1W1ZA 3NQ2A 1EP1A 4FIRA 4R7JA 2ZRZA 1RR2A 1W5MA 2QCDA 2OJPA 1FDYA 1Q6RA 2RFGA 5CPOA 2R14A 3L9CA 4I9AA 4NQ1A 2OCZA 1UASA 3QRHA 5FF7A 4MJZA 2JK2A 1OFEA 4FNQA 4JYFA 4LOCA 5GVJA 1U5JA 1GTEA 1G7UA 3PR2A 1P4CA 3W83A 2J24A 4MZ8A 4ZMGA 3L66A 3UYCA 3SGUA 3W7DA 3MBFA 4DEFA 4I7WA 4K6AA 5F2IA 3QPYA 1GG1A 5DXXA 4JYDA 3U6WA 4QAIA 1K02A 3L67A 1ICPA 1X8FA 2GPTA 2UV8G 1J2WA 2Y7EA 4S1FA 2A2IA 4DBDA 4AAJA 2VEKA 4O16A 3GB6A 1VCGA 1I8JA 4CNOA 1Y0EA 5CSSA 4ONVA 1UCWA 2EGZA 2E6YA 4NZFA 4EF8A 1QFEA 1TPFA 3CWNA 3S1VA 5G5IA 3E02A 1S5WA 3C6CA 4FIQA 4FNPA 1PL9A 2J9XA 5D2XA 3T78A 3A23A 3G8RA 4GXMA 4ADSA 1EUNA 2O7QA 3G8EA 3WK0A 3NA8A 4E0CA 4Z1DA 2J9ZA 2DJXA 5AHIA 1M5WA 1ME9A 3ZS4A 3NZ1A 1MZHA 2PRLA 5BOOA 3ABSA 2Z6IA 3PSWA 2C14A 3UXAA 1R2RA 4BI7A 3RFAA 3VE7A 1O5KA 4M7SA 3LOTA 3DFPA 3PBUA 3W71A 5K2ZA 4IMFA 1R47A 1YDOA 4WXZA 5LSMA 3TXZA 3GDLA 2WSYA 1TRIA 3GXPA 3FJ6A 5G1TA 3STCA 2J27A 1OABA 3Q2DA 4LNYA 4BFAA 1RQBA 5FESA 4K7VA 4YWIA 4UNLA 4JTLA 4KWVA 4OV4A 4QM1A 2ZA1A 2BSLA 1YTKA 1EP2A 2J88A 3MHUA 3O15A 3P84A 4JR5A 3G18A 2Z6JA 4AXKA 2ISWA 1XI3A 2QCCA 4ZQCA 3LXAA 3NAVA 2C16A 3P74A 5F4WA 4E2DA 3G1DA 2QR6A 3W74A 2ZDRA 2NV2A 3HOJA 4O11A 3H55A 4FEZA 2E6AA 3HQ1A 1CX9A 3HG5A 5C5YA 3LCLA 2CWNA 4NX5A 4Q33A 1XL9A 1IXPA 3W7JA 4CCEA 2EF9A 2RKXA 3P5ZA 5KZEA 4LT9A 1VYPX 5AFDA 2YX0A 3SFKA 4NNBA 5FF0A 1YPFA 5DY2A 4P2VA 3SGZA 1OFAA 1KM2A 2C3ZA 4AWUA 2PC4A 4JEQA 4NU7A 3MHFA 1MXSA 1QPOA 3GLCA 4MYXA 3P7YA 3HJZA 4ADUA 2NLIA 3VI2A 1DVJA 4N02A 3MYPA 3M47A 1GVOA 4RKAA 4FHAA 2E68A 2H6RA 3SY5A 4EOUA 3FYOA 4UTWC 3NXFA 2A7RA 1F2JA 3UWQA 4HNVA 3W1LA 2CLOA 1QOPA 2H8ZA 3LHWA 1GWJA 3L21A 3C8FA 3L5LA 4JN6A 2CLHA 2VFIA 3TUUA 1OHLA 5AB3A 3WJZA 3NG3A 4Y8FA 4KFPA 2QCLA 3B04A 3GYEA 3PF3A 5D2TA 1K03A 1SR9A 1SZFA 4N9EA 3UWVA 1BWKA 3LLDA 4RLIA 5K4ZA 4IMDA 4JTSA 5C55A 5U4NA 1OYAA 2PURA 1H1YA 5G2WA 4IMEA 3W1NA 2HS6A 1YDNA 4IWWA 3BG5A 3HGJA 4H3DA 1W54A 3L5AA 2ZZ6A 1P1XA 1QAPA 1GPWA 3TNOA 3MW7A 1RQEA 5BMXA 4A29A 2YYTA 4IXXA 4W9TA 2GJLA 3GR8A 3O6YX 1LCOA 4OQVA 2F84A 1GYNA 5SWUA 2FPVA 2HSAA 2YR1A 4UR7A 2B7PA 2OMAA 2GQAA 3O63A 3ZFHA 2CZDA 4PA8A 1GVFA 3QYQA 3UQNA 1LRQA 1KV5A 3IVTA 1FCUA 2BLEA 3VE9A 3LCIA 1T0OA 5AC7A 1O94A 2V5BA 2LLEA 3LV5A 3E96A 3QF0A 4QSHA 3P82A 1OK6A 1SO3A 4I7UA 1YXDA 1Z41A 1ZJIA 3L0KA 1IXOA 1ONRA 3OBKA 5G4WA 1VLIA 4UIOA 4LVDA 4UFLA 3QEZA 2B7OA 1W8SA 5AOUA 2AGKA 5ABTA 4O15A 1NF7A 4LU0A 1H7PA 2YFOA 2TPSA 1V5XA 1BKSA 3GKFA 1EWEA 2YW4A 1H63A 2HS8A 1YYAA 3JR2A 5LHFA 3OVRA 2QCMA 3NM3A 1RVGA 1W5NA 3DHFA 3B0UX 2FJKA 4NX0A 3UNDA 2CZEA 3CLMA 2ZCGA 1M7OA 2Z0IA 3TC6A 3LHZA 1M7PA 3CU2A 2YPIA 2OT0A 3T55A 3MYOA 3Q94A 2JBMA 2QUUA 3K30A 2IQTA 3NPXA 1ICQA 2V2HA 1H7XA 1PCWA 5EY5A 3WJYA 3RK8A 2Y89A 4ML9A 3TJXA 1ZFJA 3TXVA 5D38A 3QH2A 3TSDA 4IJBA 3FJLA 2QCFA 5D09A 3P8JA 4QJ1A 2ZQ0A 2YXGA 2FTPA 5CSRA 5U7SA 1LBFA 4H6KA 1UUMA 4AF0A 4UTHA 1G7VA 3NPWA 4WXYA 4FNSA 2JGYA 3GKAA 4K8EA 1KFEA 4RZ4A 2G97A 3KRSA 3LCHA 4Z08A 1KFJA 1YXYA 3UWWA 3O6DA 3GDRA 3L0NA 4O1AA 5CGQA 3N3MA 1KFKA 2NV1A 1KLZA 1KLYA 2F7FA 3N2MA 4JDYA 3TJLA 1DHPA 1ZNNA 2ZRWA 4XTIA 4GBUA 3TSBA 3HGRA 1LZOA 3L68A 2WQPA 3RLVA 3STEA 4EIVA 4DELA 1TTIA 1FXPA 1UB3A 3WJWA 4UTTC 4RZ6A 3TW7A 4AMAA 3DFQA 2FDSA 1E51A 2NX3A 4JYEA 4IUOA 4CQAA 4M6QA 1TB3A 3PB0A 3FLUA 3W1QA 1JQXA 4MFEA 3NGJA 4JX6A 4BI6A 3CTLA 2YFNA 4K39A 3M6YA 5AC8A 4N2YA 3R89A 2R91A 4GUGA 1SUXA 4YXGA 1F6KA 4K8HA 2Q8LA 1R30A 2OT1A 4WQ6A 3CT7A 4WD0A 4A2RA 3EB2A 4QNWA 4ADTA 5F4SA 3P67A 4K38A 5KZDA 3QW4B 5D37A 1GTHA 1FX6A 4X3ZA 3I65A 3TQ0A 3F4NA 1XC4A 2A4AA 5C6MA 4TU1A 3F03K 3PM6A 1OYBA 4N9BA 1TPH1 4IGHA 2A5HA 3MJYA 1OFOA 2GJNA 3FOKA 3C3NA 4YCOA 2CLIA 3WJSA 4JTHA 3LDVA 1F7BA 6ALDA 4XZ9A 1XBZA 3TAKA 3MHGA 2V30A 4O17A 4DO5A 3QPZA 4O0KA 2NX1A 2C15A 1JCXA 3TKFA 5LZLA 4ORMA 2EHHA 3GXTA 1K7EA 3VFLA 3CIXA 1OX6A 4ZZ9A 4MY9A 3W6YA 3DI0A 3LXBA 2VEMA 1K3UA 4BF9A 3LV6A 3S5YA 5H2ZA 3KVLA 3MMTA 1PHQA 3S42A 2WNNA 4P61A 4OWGA 3FKRA 3LRMA 3NQ7A 1Z48A 3KHJA 1THFD 1OFDA 3P60A 3EX1A 1RZMA 1LROA 4JIQA 2XN1A 4IXHA 4J9JA 3EWYA 1LOQA 2ZZ5A 4RCXA 3LHVA 4R34A 2J6XA 2V9DA 3G1AA 1N8FA 1Q3NA 1KM1A 3W7IA 5IBXA 3LHTA 4LC6A 3R12A 3EWXA 1K7XA 5DLCA 2WV8A 1DJQA 1OG0A 4LC8A 4C1KA 1GQNA 5D2YA 4H4IA 1EX5A 1W3TA 3C4UA 3FKKA 4NXSA 2OX1A 2ZTKA 3TK7A 3W2LA 1OVDA 3KVJA 1XDLA 3PVFA 1BWLA 3RU6A 2H3BA 1H7WA 1TIMA 3CWOX 3PC0A 1VPXA 3STGA 2C6QA 5EYWA 4O53A 2GOUA 4NJHA 1FCVA 1EB3A 2CZ5A 1N55A 3PBVA 1BEUA 3O06A 1PV8A 3LXCA 1RPXA 1NAL1 4O18A 2QF7A 4U4MA 1ZAIA 1SZGA 4MLJA 3NQAA 1OFPA 3G1SA 1LBLA 5LGZA 1EWDA 5AYXA 2ZZ4A 1OF6A 4MUZA 4PH6A 2ALDA 3CM4A 5AHFA 3PG9A 1DJNA 3UD6A 1SO4A 3DHDA 3KAOA 5G1YA 4E38A 3LCGA 1J4EA 4MPQA 5D33A 3UPBA 3MWAA 5EL1A 3L65A 1VYSX 4NUWA 2CZFA 5G2HA 1LLZA 4FXRA 1TV7A 3C52A 1YADA 4MYAA 4CLMA 1GEQA 3OA3A 1VCVA 3IVUA 3NQDA 3KRUA 1LDCA 4UTTA 1G4SA 4O4WA 5FF2A 3W72A 4JDBA 3DENA 2O7SA 3S1XA 3PY2A 3QQ1A 4FNUA 4KFOA 5HQEA 4MZYA 3BV4A 4UMAA 4M6VA 5D30A 2C18A 4CNNA 1JCLA 3CQ0A 4GJ1A 1W31A 1YTDA 3TAOA 1SZEA 4QISA 2OZ0A 2A21A 3FYPA 1EEPA 1O4UA 4MOZA 2FLIA 3DH7A 1TYGA 3TFXA 1OJXA 2YCEA 3R8RA 3TR2A 3EWUA 1L6WA 2ATMA 2VENA 4O52A 4UFJA 2R94A 5J5RA 3M5VA 4HT3A 3U8GA 3UPWA 1G4EA 1XM3A 1ICSA 3JRKA 3IGUA 4IQLA 4G1KA 1HO1A 4WY0B 5I3IA 1TPWA 4O57A 3W7CA 5CZJA 3I6RA 4UFIA 1H62A 4O1CA 2JKEA 2EKCA 3BW4A 3G1XA 1NEYA 1TREA 3UXDA 1EUAA 3TMQA 3W2JA 2VOMA 2GQ9A 5HR7A 1DL3A 3QW3A 1JULA 1VRDA 3GAKA 3M7WA 3NVTA 3CPRA 4L4MA 1FDZA 4AWSA 3A9IA 1A5SA 3ZWTA 3O6CA 1CI1A 4ALDA 2I14A 3W7HA 1AW5A 3SSJA 1ZCOA 4CQ9A 4ORIA 3IRDA 3A5VA 3PULA 1TPB1 1TJPA 1TSIA 4XQ6A 1TMHA 4O1DA 1G6CA 1HG3A 1B9BA 5BW6A 1Q6QA 3RNDA 2R8WA 1B57A 4ICNA 2Y6ZA 3IIOA 4AB4A 1X1ZA 4XTDA 3EWZA 3OVPA 2FPYA 2H3DA 1XFBA 3F1QA 4QIUA 3L5MA 3W9ZA 3SI9A 1M6JA 2BZNA 5CZTA 1TTPA 3W70A 3BW2A 4N6EA 4RV8A 3G1HA 3HBLA 2E6FA 3KFTA 2DZXA 2ZZ3A 2VFGA 3ZWSA 3AO0A 3GK0A 3IIXA 3GDTA 2DU2A 3TSMA 4JY9A 4DXVA 2TSYA 2BX7A 2YDAA 5LHEA 4NVTA 4ZVJA 3LX9A 3BLEA 2QEZA 3P5YA 4Z1AA 3GX9A 4QITA 4FX8A 2H8XA 4GUJA 5DCBA 5HULA 1A50A 1D3HA 1QMLA 3ANYA 3O16A 1Q45A 3NQVA 2RDUA 3I7QA 3KOFA 3RLUA 3W87A 3W2UA 3EWBX 3NL6A 4LVFA 4Y96A 2YGYA 2Y70A 4O50A 4PFMA 3PUOA 1GVSA 3B06A 3DFOA 1EIXA 4GRSA 1XXXA 5K9CA 3ABQA 1SO6A 1SW3A 5C54A 5EPDA 1OX5A 1TPC1 1ZAHA 3B05A 3W75A 1AW2A 1VCFA 3CB8A 4NZJA 3RMJA 3NQEA 3NL2A 2NZLA 4ZQNA 3HB9A 4OU1A 1XBXA 4GUIA 5F2GA 3P80A 4O8RA 4RXGA 3ATZA 3O05A 3TIMA 4DF2A 3CHVA 3W7KA 1DBTA 1Z44A 4UUIA 4OT7A 3EX6A 3NL3A 3BPWA 2VELA 4UTJA 4LVGA 1FQ0A 3M9YA 3M41A 3TROA 4JNMA 3NYZA 1RV8A 5FEZA 3W7GA 4R53A 5E0KA 3DGRA 1ZHAA 3HG4A 5KSWA 3LTYA 2E6DA 2X16A 1R2SA 2PCQA 1AW1A 3EKLA 3L0GA 1OX4A 2C0AA 2A6LA 3N9SA 1ML1A 3BO9A 2QJHA 1YDVA 1KM6A 1ME7A 3DFSA 2WJZA 2WNQA 5TQLA 5BNKA 3MP5A 1T99A 1P0NA 4O19A 3EX2A 5D2VA 2JGQA 5BMWA 3WJXA 2VXNA 3LLFA 3S8HA 3TE9A 4CCCA 3CEUA 4LV9A 4MFDA 1DV7A 4MIMA 3N9RA 4AVFA 2DZUA 2A1YA 2DP3A 5K3VA 3QMRA 1IIHA 3N2XA 4D2JA 3WK1A 2CLEA 3OG3A 4O12A 5K4XA 1IGSA 2NWRA 3DBPA 4XKYA 1F05A 3GZ3A 3FEMA 2CLKA 4GC4A 1TO3A 1FWRA 1UJPA 5HJLA 1SO5A 3EXTA 3YPIA 4MY8A 5DBUA 4AF0B 4I7VA 1ADOA 1JCNA 2NXGA 1IF2A 1DQWA 5HUPA 3EXSA 4XKYB 4Z1BA 3WK2A 1KBJA 4LS0A 2CLMA 5L9FA 4DPPA 4NNAA 1GVRA 2VFDA 2FPTA 4GWEA 3BW3A 4IPIA 4ZQMA 3PAJA 1FY6A 3N34A 4GUHA 3W86A 1H50A 3EX3A 3NQCA 2AQWA 1G4TA 2J9YA 2VFEA 1QR7A 1TQJA 4MKNA 4UTWA 2ZRXA 4FNTA 3CEPA 7TIMA 5K7JA 1F74A 1H7RA 1PIIA 2FB2A 1X7FA 3B0VC 4EF9A 5MHBA 2X1SA 3DZ1A 3N19B 2RH9A 3LBCA 3L2IA 3TDFA 1QNVA 1WDWA 2A7PA 3O07A 4WZHA 4EVZA 1VQTA 3QMSA 2ZBTA 1WOAA 2W0UA 4JX5A 3NQ6A 5DCDA 5F1UA 3SIZA 3ABRA 3G22A 2WSQA 2ZZ1A 4DF1A 1TPDA 3HG3A 3W1UA 3W7MA 3TU9A 1L2UA 3DI1A 2V5LA 3SR7A 1I45A 5I3HA 1JRBA 1FXQA 2EAWA 1HTIA 1EPXA 5BRBA 4BWLC 4Q4KA 2FB3A 2G5WA 3W88A 2ZFAA 1QCWA 5KMYA 4UTIA 2E09A 2E1DA 1LYXA 4JTJA 2FIQA 4PODA 2VFHA 3ELFA 1I4NA 1O95A 8TIMA 4FX6M 4PEKA 5CPMA 4DO4A 1FWSA 2A7NA 1NSJA 3INPA 3R5EA 3MBDA 1D3GA 4S2CA 5HWNA 4DF0A 3BARA 4IX2A 5FEXA 4NJKA 2WSRA 2ABAA 1VH7A 3QC3A 1ZALA 4HNNA 1OX4B 1AK5A 3THAA 2E5DA 3KVMA 3A21A 3PG8A 1TQXA 4FX7A 3C2OA 3NDOA 1A5BA 4Y9AA 3SJ3A 2DORA 5K9DA 5KTLA 3VKJA 1XBYA 1DKWA 3DKLA 4N4PA 4UFMA 4FXSA 1TPUA 2YSWA 3B8DA 2WKJA 1W56A 1S5TA 2V82A 1H7NA 3TQVA 3LGEA 4LTSA 1HO4A 3P8IA 2Y7GA 3S1WA 1FBAA 1SU5A 2GVLA 1P5BA 4GFSA 5I3GA 1FUYA 4BR1A 3FFSA 3UY7A 1KA9F 3W73A 2Y7FA 1WAUA 5FF3A 1PCKA 4RZ5A 3BGJA 4TMBA 2BWGA 5I3FA 6TIMA 1EA0A 4YMZA 1G67A 1WBHA 4XWUA 3MP3A 2NX9A 1FWTA 1T8XA 4JTTA 4WY0F 4LS2A 3W84A 1A53A 1S5VA 1VZWA 4CQ8A 3NR0A 1KW1A 4HKPA 1PVNA 3ABOA 4XBSA 2P10A 5HNRA 3NM1A 3I68A 5C2XA 4RX0A 3M5YA 4IMGA 3G0UA 2NWSA 4U28A 1SFJA 2ZTJA 3LB0A 4UCGA 5CPLA 3C2FA 2NUYA 3QFEA 2GVJA 3BG9A 1XCFA 5DY3A 3STFA 4X2RA 4L4LA 3KXQA 4Z0JA 5AN7A 3S1UA 5CZ0A 4HIBA 4JTFA 3W85A 1QO2A 3CC1A 1AMKA 3QMTA 2XN2A 3C0JA 3TFCA 5E93A 4Z1CA 3GR7A 3GVGA 2DZPA 3I7RA 4JX4A 5CKSA 5AC6A 5HR6A 2Q3OA 3W1PA 3DU0A 4M6PA 1LTDA 1LBMA 5KINA 3G0SA 3TMLA 3UZ5A 1Z42A 1KFBA 1LLWA 2BXVA 3LCWA 3G3DA 4WOZA 4RR4A 1Q6LA 1C9DA 4JY8A 3LHYA 3W7OA 2QDHA 4MJMA 1ZAJA 1UUOA 5DXYA 3TQKA 4JS3A 4NT0A 5F2LA 4NJIA 3T4CA 2VEPA 4WX2A 3S9YA 3NOEA 5AYZA 2ZRVA 4O13A 3Q58A 2Z2UA 3W7LA 1I2PA 1TRDA 1KM3A 1VGAA 3UWUA 3M44A 2YYUA 5LNVA 3M0ZA 1YTEA 2ISSA 4B5NA 1F76A 1JVNA 2ZZ2A 3P81A 1SFLA 3OIXA 3E12A 3QQ0A 2C19A 1R2TA 3E0IA 4CCDA 2DZWA 2TYSA 5IM51 3M5XA 4OHQA 3QZEA 1X1OA 5AYYA 2Y62A 4Q32A 3W2MA 1OFBA 4UXDA 1JQVA 1RD5A 4N9CA 1LOSA 2C13A 2P0OA 1H1ZA 2ZZ7A 2XFWA 3TA6A 1VJIA 3R2GA 2W79A 4N6FA 2B4GA 5EA9A 3W1XA 2B0MA 3BK0A 2H90A 5CG7A 4TX9A 1ZY9A 4IOTA 5FEPA 1PHWA 1I2QA 3LM7A 4DO6A 5FEWA 3H54A 2KZHA 4LY8A 4UMCA 1O60A 5LKYA 4FF7A 2GVGA 3HG2A 4RXFA 3Q37A 1OFRA 4KKXA 3M43A 4RK8A 1KM0A 3N14A 5EKYA 4LVBA 4HNTA 4BI5A 3GXNA 3TH6A 2PRHA 2QKFA 1J5TA 1AL8A 1WX0A 1TTJA 2ZYFA 4GUFA 4UNKA 3GNDA 3PB2A 2JKAA 1W5QA 5I3JA 5E1QA 5DCEA 4DPQA 1TV5A 1X6UA 3U2OA 1U83A 4IX0A 3NQ8A 3C56A 3LCXA 4LWWA 4PCFA 3S0CA 2QCDB 3C2EA 5L6UA 3LCFA 3W7EA 3SW6A 1PE1A 4KWWA 4JXCA 3NQFA 2C1HA 4WUIA 5HMSA 1F73A 1OK4A 3HIJA 2W6RA 2VFFA 3W7RA 4QQ3A 2CFFA 3GNNA 5FF4A 4X22A 1JUBA 2Y61A 1GJPA 5A5WA 1R46A 3S5NA 4HSOA 4WOQA 4TO8A 1JUEA 1FWNA 2WNZA 3EEGA 1DQXA 3GDKA 3DKJA 2YW3A 1WYIA 3NNTA 5A8GA 5LNWA 3GDMA 3NPVA 3W22A 4X9SA 2A85A 4FO4A 4PC8A 2BTMA 1KM5A 3WK3A 4K37A 1G4PA 4UR8A 1TPEA 2D73A 3NL5A 4ZQOA 3W2KA 1NFBA 4UC5A 5AHMA 1JCYA 1HL2A 2XN0A 1I2OA 3LBMA 3OVQA 4DQWA 2FFCA 3MP4A 4A3UA 5F1VA 3EWWA 1T96A 4QNEA 1ZENA 1A5AA 2QJGA 3MI6A 1XKYA 3KX6A 1XUUA 5I3KA 4AH7A 3P62A 1SQ7A 4BWLA 1H60A 1S3HA 4AHOA 3JS3A 1SSGA 1VHNA 3A22A 3W1AA 5LNSA 3W07A 3LHUA 3KVKA 4NJGA 3BLIA 3ZR4A 1FWWA 5HINA 2ABBA 1XBVA 1TV8A 2V8ZA 4IMCA 1HFBA 3O1NA 2QUTA 1SPQA 4R33A 3NQMA 1W0MA 4IPJA 4JTIA 3DFNA 2YZRA 3MI2A 5LGXA 2GQ8A 3FIGA 3PBYA 4JIPA 3G3MA 4AHQA 3C61A 4HNUA 1MO0A 1YPIA 2TMDA 3B4UA 1K8XA 3UWZA 1OFQA 2QUVA 4LV4A 1ALDA 1WA3A 2FQIA 3RF9A 3EX4A 3IIVA 4HN4A 1OYCA 2WO5A 2VEIA 4OE7A 2Y85A 1QDSA 3B03A 1D9EA 5EMUA 4M5PA 3GIYA 4UTUA 3C2RA 1B3OA 4UFKA 3H53A 1OF8A 3HGSA 1KTBA 1TCDA 3DFTA 1B4EA 1H51A 2CW6A 2ZA2A 1WV2A 3R13A 1F5ZA 3F4WA 3NPUA 1WXJA 2RDWA 1QPQA 1HUVA 4LRSA 5LNRA 1G69A 2PRMA 3A5FA 2X1RA 3E9AA 3LI1A 4MVAA 3V1PA 4HSNA 5TIMA 2E5CA 4M7TA 2X30A 1IXNA 5EBUA 2WPBA 1KFCA 2DZVA 2Y7DA 1VLWA 1C29A 1P0KA 3OEXA 4FB7A 1W3IA 2QCEA 2EPHA 3T7VA 4CNPA 3W76A 1LORA 4LVAA 1W3NA 4AWTA 3PSVA 5TBOA 3UZJA 1K8YA 5D03A 3I7SA 4ZQRA 5F2MA 4Z0SA 1YLVA 3V75A 3BVJA 4UFHA 3LI0A 2VC6A 4A2SA 3THQA 1XUZA 5KITA 2ISVA 1YXCA 4O28A 1AG1O 3CIWA 1SW0A 4NXKA 1NF0A 5H91A 5G2IA 4OBTA 4PL1A 1H7OA 2ZRUA 1LM1A 3G1VA 1V7YA 4MLRA 3SZ8A 1MEWA 1GT8A 2TRSA 3VNDA 3TW6A 2X2GA 3MI3A 5DBTA 5D32A 4XUGA 3BLFA 3IGSA 1K8ZA 3M5ZA 3TCEA 1EP3A 2QDGA 5DN1A 2DZTA 3IVSA 5CPNA 2ZA3A 3E49A 2JKPA 1UBSA 1TJRA 1LP6A 2E5BA 4POCA 2G96A
chains in the Genus database with same CATH superfamily
1L6YA 1DORA 3W2NA 2PE4A 2OQHA 4MWAA 1PTAA 3COTA 1Z9AA 3T07A 3ALFA 3LU2A 4Q4QA 3B0PA 3MUXA 5HPCA 2AAMA 4NJJA 3AAMA 3E5BA 3VNYA 3CO4A 2DSKA 4M24A 3S6DA 4CNUA 4Y6GA 2POTA 3WDQA 2YCJA 1PS9A 4Q8NA 3SEPA 4F66A 4V33A 1JRCA 3QM3A 3SURA 1B31A 3EA3A 3KL3A 5IBXC 1KV8A 4Z2HA 2QULA 2Z25A 4LUIA 5IDIA 1IWBA 1QOQA 2PFHA 3WDHA 2DJLA 4RW3A 3VPLA 1VHCA 4XD4A 1UR9A 2E3ZA 1TV2A 3N29A 1KC7A 4S3BA 3GAYA 2DT0A 2QDEA 5D02A 2ZE3A 9RUBA 3N2BA 4MY1A 3UU0A 1WBJA 4F2BA 4XIMA 2Q8ZA 4E2BA 3TZNA 1UD3A 2GOKA 4G56A 4PUWA 2BMBA 4ZB2A 4O54A 4C6NA 3IJLA 4O1BA 3T9PA 5FIPA 4PR4A 4B4HA 3FSUA 1O5XA 4CKQA 2XM1A 3PUDA 3TC7A 2G95A 3ZXWA 4F0HA 2BV9A 1MSSA 2E8ZA 1QPNA 1M9HA 5DELA 3J7HA 5HDRA 3HPSA 1ME8A 2XH2A 3ARRA 1A5CA 4UQAA 1RQHA 1KFLA 1W1VA 2X1TA 3G24A 4JTUA 1Y5VA 3HO8A 2ZADA 3M1ZA 3NUKA 3QSTA 1IXQA 2A0NA 2DZSA 2VKZG 5HMEA 4DZAA 1BRLA 5CXPA 3VOHA 4IGMA 3T40A 2ALRA 3IEBA 3KCJA 2JEQA 4XV0A 3UWYA 3IIZA 1W2VA 3NO5A 4I6VA 3LPGA 1VC4A 1QOXA 1C8VA 4E6MA 1NU5A 1N7KA 3ANVA 1VS1A 1R7OA 1VR6A 4WY0A 2I17A 4AEOA 3EYPA 3HMJG 3PUEA 4PZVA 3A4XA 5F4XA 4NAFB 3W1MA 4DBEA 5ENLA 4Q8VA 2WCGA 2Y24A 3VNLA 3AZRA 3W7PA 4GISA 4V28A 3P0WA 4HK5A 4P7RA 5J5DA 3AS2A 8XIAA 2MANA 2V2DA 4O0ZA 2WHJA 3U2EA 4N4QA 1JJKA 2F9RA 2WMFA 4AY8A 3NEVA 1MEHA 4GE8A 1ELSA 1W5OA 2QAFA 4KFNA 3AICA 2PTZA 3H2CA 2GUUA 4BK9A 1R7AA 3H7VA 1EYEA 5K9XA 1JR1A 5BXSA 2FZDA 3W23A 1TX2A 2PGEA 4DN1A 3VCCA 1KTCA 3KL0A 4H9YA 1PO9A 1W1ZA 3NQ2A 1SJCA 4R7JA 2OJPA 4U5KA 2PF0A 1JPMA 3GXFA 3L9CA 4I9AA 2OCZA 2W9MA 3T0BA 3QRHA 2Q01A 4JTDA 3BAIA 3UJRA 1BTCA 4JYFA 2G4FA 4B9ZA 5GVJA 3PR2A 1UQYA 2J24A 2V5DA 4MZ8A 4ZMGA 3L66A 3UYCA 3PNUA 3SFWA 4Q6XA 2GJXB 3QFWA 3VIHA 2GVYA 2WBKA 4DEFA 5DXXA 1BYBA 3SCSA 5BCAA 3L67A 4OBSA 2GPTA 1J2WA 4DVOA 2A2IA 3QR3A 4CNOA 1LQ0A 1Y0EA 1NTHA 3TYBA 3AC0A 1ZP4A 4NY2A 2V3DA 1KRCC 4H6EA 2DSVA 4C5ZA 4GIAA 3GTIA 4J5NA 2FJUB 4GXMA 3KP1A 3G8EA 3SJNA 2IUZA 1AD1A 4DJDD 4Z1DA 3OYXA 1DXEA 1M5WA 3QC0A 3UJSA 2E67A 2ZICA 3LBOA 3TCSA 1V02A 5C71A 3VE7A 4ROPA 4M7SA 3LOTA 3W71A 3RRAA 4IMFA 1YDOA 3UR8A 1RLDA 2D22A 1B2YA 4ZSUA 4JQ4A 1TRIA 2F6KA 2Z1XA 4NAEB 4LNYA 5FESA 6REQB 4YWIA 4KWVA 4OV4A 1PWMA 3MHUA 3O15A 4L1WA 1GKPA 4QHRA 3P84A 3PNZA 3G18A 4IZGA 4ZQCA 2QCCA 2NLYA 2VP8A 3LXAA 2P3EA 3NAVA 3AROA 1JZ5A 3P74A 1GOMA 2R9RA 3SN0A 3W74A 3RM8A 2NV2A 3H55A 3H6OA 4FEZA 5B7YA 4H2HA 1J93A 1CX9A 2GL5A 2O0TA 4HNLA 2CWNA 2VHLA 2TODA 1XLLA 5JVLA 3VD9A 1JIBA 2AAAA 5LIWX 4IQDA 1HL8A 1UWQA 2C79A 4LT9A 3NVDA 2QUMA 4PRRA 1EIBA 5HNTA 3WH9A 3ZLFA 3KL5A 4P2VA 1KM2A 3TYEA 1AUSL 4JEQA 1MXSA 3V3WA 2BHYA 2J7CA 1HN1A 4H83A 4PEEA 1JNEA 1OG6A 1E1FA 4FHAA 3PJUA 4Q22A 1NH6A 1M7JA 1MZRA 2G41A 1V0KA 1FHDA 4C6DA 2A7RA 3WBAA 1TV3A 4Z2KA 4DJDC 3W1LA 3WQ5A 1E4IA 5CPQA 3L21A 3FAXA 2VFIA 4IIHA 1L2QA 3GRIA 3UZWA 1W1A1 3B04A 3PF3A 2PGRA 5A8NA 1F8IA 1K03A 1SZFA 2EJAA 4YVVA 1XIBA 4RLIA 1I1XA 5ABFB 3C0QA 3EOUA 2PURA 4IMEA 3FK4A 3DYOA 4PTXA 5GNYA 4OVXA 3LA4A 4IWWA 3BG5A 3HGJA 4H3DA 3WN6A 3L5AA 1XLCA 3SB0A 1KKRA 2PODA 1P1XA 1QAPA 1XLJA 1GPWA 4YYCA 1RQEA 1H09A 3IAQA 1HKIA 3I4EA 5SWUA 3D46A 2YR1A 4E3TA 1M3UA 5HBFA 1LRQA 4NZ1A 3IVTA 1FCUA 1JDDA 4HA1A 5HNUA 3T81A 1PTDA 3E96A 3O9NA 4CU6A 1S2TA 3ITTA 1OK6A 1SO3A 1ZBWA 3OODA 1POJA 4ZEPA 1ZJIA 1IXOA 3OBKA 4AD3A 2CZVA 1VLIA 1BVNP 3DG7A 3QEZA 4G7EB 3RPTA 2AGKA 3CXOA 3BAXA 3TTOA 3RUBL 3K8KA 2YFOA 2TPSA 3GKFA 4AU0A 1BGGA 1YYAA 3SCOA 2QCMA 1RVGA 3DHFA 2D0GA 2CZEA 1FWHC 3VO0A 2Z0IA 3BCFA 1XYZA 3LHZA 1M7PA 5AZ1A 4QLJA 1GHRA 3FA3A 3VK5A 3NPXA 2IQTA 1ICQA 4GVFA 2VGFA 5EY5A 5D9PA 2PEVA 2Y89A 4ML9A 3TJXA 4HYWA 3TXVA 3VUPA 4I9MA 1WB0A 4IJBA 3AS1A 3FJLA 2QCFA 1JPHA 2E0PA 4S23A 2ZQ0A 2YXGA 2FTPA 2VC9A 5CSRA 5U7SA 3A4AA 1UUMA 3L4ZA 1JD7A 4AF0A 3NPWA 4MSSA 1EXBA 1KFEA 4ZENA 3GW3A 4UWMA 2G97A 1ZJAA 1XHGA 5LIKX 4KETA 1CGXA 4B91A 2VD9A 2AL2A 5CGQA 3L0NA 1R85A 4LPCA 3N3MA 4O1AA 5I07A 1YNPA 4LAZA 1BVZA 1E1CA 1V79A 1UZHA 1ZNNA 2ZRWA 3SRDA 4QJ3B 2WPGA 2AMXA 5CJNA 1U5HA 3N4FA 1LUCA 4XK2A 5IFPA 2FDSA 1E51A 1BFNA 1TB3A 1JQXA 4MFEA 3URBA 4BI6A 1TJ1A 4D8ZA 2ZX6A 4K39A 3M6YA 4GGHA 4URIA 1D7FA 2NW0A 4P8UA 3R89A 2R91A 2G3FA 2KX9A 2IS7A 3BURA 3FJNA 2Q8LA 3RO8A 4DYEA 4RDYA 4AZ5A 4A2RA 3MY9A 3MANA 3WX7A 3H2NA 4QNWA 1UP2A 5BOEA 3P67A 4K38A 5DRCA 4DYJA 1VFFA 4X63A 2P5NA 2A4AA 1XLBA 2VDIA 3EB4A 4HTYA 6REQA 3UVAA 4N9BA 3AFBA 4W88A 4QR6A 2GJNA 3DG3A 4KQNA 2FH6A 3CT2A 4GZIA 1ZLPA 5JBDA 1TV4A 4XZ9A 1XBZA 4ATDA 2V30A 2IXVA 3RN6A 2NX1A 2C15A 2FFIA 2I5IA 3TKFA 3TJIA 4AD0A 4KEVA 1KQZA 1Z6KA 3WLKX 1OX6A 1T5AA 3CIVA 3DI0A 4FLQA 3LXBA 2VEMA 4ILSA 3N4AA 2BS9A 3VOGA 4BF9A 5H2ZA 3BAJA 5I24A 5CG0A 4GXPA 2HXUA 4IGSA 1V8EA 1NP2A 1RZMA 4JIQA 3VNMA 1K9TA 3EWYA 4RCXA 5MKGA 4IMAA 3TVAA 3CL6A 1Q3NA 1KM1A 3W7IA 2W63A 3E2VA 3F7JA 3AMDA 4LC6A 5HOSA 1O5QA 1DJQA 1E43A 1GQNA 5D2YA 1B5TA 1EX5A 3ZVHB 1W3TA 3ZOAA 4QRNA 1UMYA 1WKDA 2L5HA 3LD5A 3W2LA 5BRQA 4GQRA 1OVDA 3KVJA 1BWLA 4KEUA 2G3JA 2EBNA 1H7WA 3CWOX 2BVDA 3W82A 1EDQA 4WK9A 2CZ5A 1N55A 3PFRA 3LXCA 1NAL1 5JUVA 1V6XA 1SZGA 4EX4A 3VIKA 4MLJA 3C8NA 4GZJA 3A3WA 1LBLA 1TUXA 3SSZA 2ZZ4A 3LZ3A 2DT3A 3CM4A 3F5LA 3PG9A 3DHDA 2E9LA 2FVKA 4NIRA 4E38A 4HSHA 1F3TA 1CXLA 3MWAA 5EL1A 3TC3A 1AJZA 3DDMA 3L65A 3EZ4A 1YRRA 4MB1A 3XIMA 4FXRA 1TWIA 4DYKA 1GPFA 3OA3A 3IVUA 2VJXA 3NQDA 1I6NA 4O4WA 4JDBA 3APGA 1TIWA 2NQZA 2O7SA 1U1UA 3CQIA 3QQ1A 4MZYA 4M6VA 1JCLA 3CQ0A 1CGVA 4QISA 5I77A 3R79A 2Y8VA 3FYPA 3DH7A 1MVYA 1TYGA 3EWUA 3OHMB 4O52A 1XM3A 1UZDA 4O0QA 2EKGA 3WQDA 1Y8BA 2RDXA 4HYRA 4IPNB 2VEGA 1BD0A 4WY0B 4MG4A 4H7VA 1HVXA 4ZA0A 2V3EA 3WEZA 3IJQA 3R6IA 1E6ZA 3I6RA 4QCFA 3S46A 1YNQA 1EUAA 3TMQA 3KDNA 3A12A 4FOKA 1SGJA 2GQ9A 5HR7A 3ZLHA 1JDCA 1DL3A 3FVMA 1GQKA 3QW3A 3R0KA 1JULA 4AQLA 1EOMA 3M7WA 3CPRA 3QXBA 4AWSA 1A5SA 3NSXA 1EJXC 3SSJA 3FSTA 4D6GA 3PULA 2UBPC 4AX6A 1TMHA 1ZQ5A 4KEZA 1HG3A 3VOFA 1B9BA 4EXBA 1P0DA 2Z24A 1XJBA 5J8LA 3O0FA 4ICNA 2WCSA 1ITCA 1X1ZA 4XTDA 4OZOA 1U33A 4EXAA 2H3DA 3F1QA 3L5MA 3W9ZA 4WSJA 3SI9A 1UOZA 3M0KA 3BW2A 4PFHA 1DJXA 4RV8A 4JKLA 4HHHA 2ZZ3A 2BVWA 2EXOA 3GK0A 3O7UA 1AMYA 1A80A 3GDTA 4ZTXA 2IKJA 3N17A 4L5ZA 1J0ZA 1Q7QA 4IP7A 1J5SA 4KIRA 1ODUA 4CVUA 3F4VA 2XFYA 5HULA 1F61A 1D3HA 2WZTA 3VAVA 4H6RA 4LSBA 3I7QA 2NVAA 4LUTA 3RLUA 4RZBA 2PLMA 3LM3A 1OIMA 4LVFA 3T0TA 3ZJ8A 4PFMA 1IZKA 4DNHA 3WLIA 3VUSA 5K9CA 1SO6A 3AISA 5A6JA 1TPC1 4EAMA 3W75A 4BEQA 1AW2A 1MMFA 3MSRA 3AIEA 1D7KA 3NL2A 2AOSA 4KW2A 3SN1A 1FWAC 3MQTA 3EA1A 4OU1A 3QKEA 3VM5A 2E7FA 3QGVA 4O8RA 1FWGC 3LLXA 3FHAA 4RXGA 4DF2A 1Z44A 1CB7B 2HE8A 2HVNA 1J10A 2YKKA 4UUIA 1MDLA 3LQLA 1UHVA 4GOAA 3RITA 1EJVC 3N18A 3E0FA 3TROA 3LZ5A 2VZUA 3W24A 3W7GA 4W7WA 1O7AA 4PUUA 1ZHAA 3CPUA 1IZJA 2FZNA 2BVTA 2X16A 1E73M 3URQA 1AW1A 2WSKA 3EKLA 2OFJA 4UBPC 4H8VA 5CJMA 3RR1A 2DEPA 3QV6A 1ME7A 3DFSA 4W4QA 5BNKA 2VDHA 2WVVA 3MP5A 1P0NA 3KTXA 1XRTA 2JGQA 3LLFA 3S8HA 4Z2IA 4MFDA 1A4LA 3CV2A 4MIMA 1QHZA 3N9RA 3C3UA 1QATA 1MQPA 1ZBVA 3N2XA 2CLEA 4O12A 2XVPA 3MDWA 1IGSA 4Q8UA 3IAPA 3GNOA 5EFFA 5KZ6A 3UXLA 2CLKA 5TNVA 4DBUA 1TO3A 2PWEA 4FLSA 1MUWA 3KWXA 4IFRA 1ADOA 4JFSA 1IF2A 1QNQA 5HUPA 3EDDA 3WK2A 4Z1BA 2H9AB 3LGDA 4ML4A 1GNXA 2CEQA 3ARTA 2J13A 2RGLA 5BWAA 4GK8A 4GO9A 3BW3A 4DNMA 3W86A 4WDTA 1H50A 1G4TA 2VFEA 1QR7A 5AKQA 7TIMA 3POHA 4FNTA 2ON3A 3CEPA 1JGIA 5K7JA 1B9ZA 2C71A 5MHBA 1GOQA 3L2IA 4REQB 1WDWA 4DI9A 2A7PA 1DXFA 1P6WA 1EJUC 3QMSA 2OELA 4D72A 3WLSA 3EOEA 4JX5A 2QIWA 5EMYA 1TWDA 1K4GA 3G22A 2ZZ1A 3MWCA 1UKQA 1TUFA 4B5XA 2WMIB 1HTIA 1JZ7A 4Q4KA 2ZFAA 1PTGA 5E9AA 3VA8A 4UTIA 1UH4A 1WKYA 4C91A 5EMJA 3KS5A 4JTJA 1OGGA 3OZYA 3IACA 4GC3A 2VFHA 4FX6M 1HGWA 5CPMA 3KOZA 1V0LA 2FDMA 4H01A 1XLEA 3EA2A 3FGCA 4MTVA 4DF0A 5FEXA 2OWCA 2ABAA 4Q4PA 1QU4A 4HNNA 4DLMA 1KR1A 1TQXA 1ISVA 2QGYA 2VQUA 4EE9A 3DGBA 1CCWB 1TA3A 1NOFA 2DORA 4GGBA 5K9DA 5KTLA 3VKJA 1QI2A 1XBYA 1DKWA 3TYAA 4N4PA 4UFMA 5GJNA 2R24A 5I23A 3IRSA 2EQDA 1HO4A 3MVTA 4GVHA 1FBAA 1XW8A 2XVLA 1P5BA 5I3GA 1HKMA 1E0TA 2YL6A 3G1RA 1LG2A 3W73A 5I06A 2Y7FA 4RDZA 2BY1A 1QT1A 1WAUA 4W5ZA 3W01A 1PCKA 2WC3A 4J2MA 3L4TA 3BMVA 3BGJA 1U2YA 3Q4DA 5DX7A 1JF5A 4KESA 4YMZA 3S2CA 3MP3A 3BLOA 3SCTA 4LS2A 1S5VA 1VZWA 3NR0A 4PMNA 2OOFA 3ABOA 3WDRA 4XBSA 3LENA 3I68A 4IMGA 3WQ6A 3CYJA 3G0UA 3KCOA 2Z7KA 3RX4A 4U28A 1H0GA 3I6TA 2PDLA 3BG9A 1XCFA 2HPIA 3KXQA 1TZ7A 3N6QA 3T09A 1ONEA 4GI8A 5I3DA 4F9JA 3CC1A 4X61A 5D9OA 1J0KA 3PPFA 4TTUA 5E93A 3UA4A 2PDCA 2DZPA 1QNRA 4JKMA 3ITCA 4B5WA 4M6PA 1LTDA 1LBMA 3VCNA 3G0SA 3AQUA 1JXJA 1W9PA 4E2OA 3UZ5A 4BQ3A 1LLWA 4ZO9A 2BXVA 3LCWA 4MNLA 4WOZA 5HQLA 5G4HC 4RR4A 1M53A 1C9DA 4JL1A 4JY8A 3G2GA 3W7OA 1XQKA 1ZAJA 4DWSC 2W5FA 4Z2GA 1DIDA 4XSLA 4NJIA 4AZCB 1DQUA 3WQ8A 1R3SA 3ITYA 2GDQA 2ZRVA 4XVDA 3NTYA 2O56A 1X1NA 4Z2LA 1NJJA 1QK2A 3CHDA 3HN3A 5C9ZA 5LNVA 3SCRA 3BICA 2ISSA 1E5JA 4B5NA 2ZZ2A 3P81A 3QQ0A 4ZGYA 4PTWA 2ACUA 2TYSA 5IM51 1JDAA 4KCUA 2Y62A 1R3WA 2PD9A 3HURA 3WD0A 1RD5A 4BCEA 3L4UA 3SCQA 2C13A 3QLLA 1ZU8A 1LT8A 4IIBA 1B3ZA 3U3HA 4N6FA 5EA9A 3W1XA 2ADAA 4C6MA 2ACRA 3K8LA 4U33A 1UD8A 4TX9A 2D2JA 3A47A 3RO6A 5FEWA 3FVDA 4WSHA 2REQA 2INZA 4UMCA 3CAKA 4FOJA 3A64A 3EPOA 4TVUA 3Q37A 3WEMA 2G0WA 2WHKA 1RK5A 4KKXA 1B90A 2A3HA 2PDMA 5I6SA 1KWGA 5EKYA 4MB5A 2ZIDA 1VFOA 5H8MA 4AIOA 1GVIA 1AL8A 1WX0A 4J3UA 1TTJA 1XYCA 4GUFA 4UNKA 1ZTVA 1YIXA 4A3YA 3QKZA 2JKAA 2F2KA 4IX0A 4UQBA 3NQ8A 3LCXA 2QCDB 3VC6A 2VGGA 3C2EA 2JALA 1F07A 3LCFA 6ENLA 3SW6A 1P7TA 4KWWA 2DDXA 3KS6A 5JH2A 3NQFA 4WUIA 1OK4A 2W6RA 4ATWA 1AZ1A 4RE0A 2GSEA 3UPMA 3G77A 3CZLA 5FJTA 2Y61A 3E2RA 1GJPA 3LMZA 2ZVRA 4A05A 3RCMA 4Y9OA 1QNOA 1JUEA 1CYGA 3LPPA 4TTGA 4I8DA 4PCPA 4NYUA 4XZNX 3NNTA 3TTQA 1UWUA 4WF7A 2A85A 1YDYA 4OOUA 2BTMA 3IUIA 3QPEA 1A5MC 1EQCA 1X97A 2PGWA 3KTCA 3SQLA 1Q6FA 2DZAA 3NL5A 4ZQOA 2OSYA 4IP5A 1M04A 4KF1A 1JCYA 1I2OA 3D3AA 2IQ0A 2FFCA 3MP4A 1XGEA 3AIWA 2YLLA 3EWWA 3L4XA 2F6UA 3ZVHA 1XIEA 3F4DA 4QX4A 1A5AA 2GJXA 2QJGA 1A49A 3KX6A 4AH7A 4QJ4B 4BWLA 3SQMA 4B9YA 3JS3A 3A22A 2ZOXA 5MKGB 2MUCA 2PDBA 3QQWA 5HINA 4ZBCA 1XG4A 1XBVA 1TV8A 2C1GA 3PPHA 2V8ZA 1OT2A 4GJJA 3OGRA 2I56A 2YZRA 5A8QA 2XIQA 3AMCA 2OZ3A 1UC5A 2J66A 3QGAC 3RJYA 1RH9A 2QUVA 1W1TA 3REQA 2I16A 2WO5A 4OE7A 2Y85A 1GKQA 1EC9A 3EMZA 1SFTA 2BP1A 2QJJA 3UYIA 4K2SA 3ARUA 3C2RA 2ZC1A 1MDRA 1B4EA 4QE5A 1H51A 2CW6A 2JFEX 2W91A 2ZA2A 4JKKA 4L61A 1PXGA 4QLLA 3F4WA 3I3EA 1ECQA 4X9YA 1WXJA 3UJFA 5JU6A 4LRSA 3AUOA 3A5FA 4NI8A 1U5VA 1HJXA 3KWSA 1K6AA 4MVAA 3PZGA 4CEUC 1KFCA 4KWUA 3O3RA 3UG5A 2E9MA 4NAFA 1VLWA 1TR9A 5JBEA 4FB7A 3WNNA 3WLLA 4P7LA 3GVVA 2QVHA 1UA7A 5D03A 3ITXA 3V75A 5KITA 1TVLA 2ISVA 4YPJA 4O28A 3AALA 3OPSA 4WJ8A 4RW5A 1NF0A 4Q6JA 5G2IA 4Q8PA 2QLYA 1LM1A 4MLRA 3SZ8A 1GT8A 3BLKA 3TW6A 3MI3A 4MJ4A 4D6EA 3TCEA 3C86A 1US3A 3IARA 3GHRA 2QDGA 5DN1A 2PTXA 3EEZA 3IVSA 3Q45A 3ONBA 1HKVA 2JKPA 2PU1A 4U5IA 2CESA 4D6JA 4POCA 2JIEA 4EANA 1SW7A 3GBEA 3EKZA 3W3OA 4LAMA 4BJHA 3LTPA 1KNWA 4C6CA 4L4OA 2QCHA 1PYFA 3M0HA 3M16A 1KM4A 1RAKA 3MU7A 1MEIA 3P6LA 3CMFA 1H41A 2YB1A 3DAQA 5M03A 4AISA 4JFVA 2D0HA 4J1OA 1I2NA 3G6MA 3JZEA 1N2VA 3IV3A 4JGDA 1RCOB 5CZSA 5KZMA 3VNJA 3VGDA 3OHIA 2PBOA 4H19A 1MXDA 1CGUA 5CPTA 4KRZA 3D0CA 4N0RA 1TTQA 2PZNA 3GNXA 3R0UA 1GYMA 2ESCA 2HE5A 5D04C 4FXFA 2OYKA 1XIIA 2VUNA 1JCMP 4RJEA 3CAQA 3PN8A 1N82A 3GHSA 1XRFA 2RDTA 4PE8A 3USBA 3MV11 3W7QA 1VENA 2OZ8A 1HNYA 2I1OA 3CMJA 1LOLA 1IEQA 4LYQA 2QCNA 4ZL1A 1W9UA 4O1FA 3E38A 3MO4A 2CLPA 1KBIA 3FA5A 2PP1A 3BG3A 4MGGA 3MUZ1 2YDQA 4LS1A 3LERA 4I9TA 4K7YA 1DWAM 4PL2A 1W6TA 3T44A 1DIEA 4ICCX 2HROA 2QXWA 5EFDA 3E2SA 4S2BA 3C2VA 3ENLA 3IGXA 5D9MA 1WE5A 3G0XA 3REQB 1R9XA 1PKNA 5IHSA 2CIPA 4AW7A 2WHMA 1MYRA 1BG4A 1UG6A 1NVMA 2SFPA 4AZ6A 1VKFA 2PSNA 4HPXA 4JTEA 3L2LA 2GGHA 4TIMA 4FZIA 1FDJA 2Y88A 3ME3A 3CQKA 5C70A 2D69A 2DY3A 4NNCA 1GZGA 4LUJA 5HWMA 2FHFA 3V5OA 3QZ6A 3AIUA 1U1JA 2PMQA 2V5KA 1IT8A 5IHRA 1KKOA 4DWSB 4O14A 1CLVA 4CD8A 5AHNA 3EB3A 4YLWA 3PBWA 1WOBA 1JCJA 1EPVA 2GSHA 1U1HA 1REQA 3MA8A 4MPKA 5C0QA 1DJGA 2I5GA 3IJ9A 2PWFA 4XO6A 1FCQA 3SUSA 4UTMA 1VYRA 3S6TA 4YU1A 2QAPA 1H5YA 3PHAA 4HHPA 1L9WA 4UMBA 4O4VA 1F6PA 2VURA 4M19A 1G1YA 1X98A 5AYIA 4FI4A 3VCRA 1EBGA 2Y63A 4HNCA 4AHPA 4UQDA 5AHLA 4DRSA 4US6A 1CW2A 4Q4MA 4DWSD 4PUMA 1TWWA 7ODCA 1J12A 1VF8A 2J75A 5T26A 2OTDA 3IIPA 4XAFA 1EP1A 5T8GA 2ZRZA 1RR2A 2QCDA 3T2PA 1ZCCA 2BOEX 1CGYA 3FYYA 2OR2A 4NQ1A 1UASA 4XAPA 3A6OA 1RA5A 3RPDA 4LOCA 3V1HA 1MQQA 4B2DD 4D6IA 2Y5JA 1P4CA 3R8GA 3N2CA 3QGKC 3SGUA 3VZZA 2GWGA 3R7MA 1HF6A 3LPOA 1BQCA 4K6AA 5F2IA 4J4KA 2FZ8A 4HB7A 3OLGA 1IEIA 4S1FA 3A3XA 1ZP3A 4S38A 3ZR5A 4AAJA 2REQB 2VEKA 3IUHA 3CMGA 3GB6A 6XIMA 1Q66A 3PAOA 2PP3A 4HCDA 3HPFA 1UH3A 1C93A 2KAUC 1UPPA 4EF8A 1O1ZA 1NOWA 1AZ2A 2YOCA 3DFHA 3VC5A 1QFEA 4NRRA 1TPFA 3HV8A 4QQUA 1S5WA 4FIQA 4FNPA 2J9XA 4KPLA 3LPFA 2ISFA 2XVNA 1JFHA 2O7QA 1A5NC 3AWNA 1S2AA 3NA8A 2XFFA 3WBYA 2DJXA 5AHIA 1ME9A 4H9MA 3ABSA 4YNGA 4ERGA 2Z6IA 4MNMA 3PSWA 4LF2A 2C14A 1BQGA 1XD1A 4YN5A 2J7HA 3AHTA 1BWVA 2OSXA 5LSMA 3KBWA 3CAVA 4FXJA 1FKXA 1VIZA 3H2OA 3Q2DA 1EJSC 4XAZA 1RQBA 3GDBA 1TE1A 4UNLA 4JTLA 4ENLA 2ZA1A 2BSLA 2QPUA 3K2GA 1EP2A 2J88A 3TN5A 3WNLA 4IICA 2NSOA 1H11A 3VMNA 2Z6JA 4MB4A 2HVOA 4AXKA 2ISWA 4J2PA 5FA5A 4U2ZA 4E2DA 3GU1A 4GYFA 3GTNA 2DIJA 3QZAA 1MRQA 1PAMA 1E6RA 3HQ1A 3HG5A 1JZ4A 2BB0A 4EPEC 2Z1KA 3AJ7A 1A5UA 1Q5MA 2EF9A 2RKXA 3IS4A 1VYPX 5AFDA 2YX0A 3TA9A 1W3JA 4QXIA 4KIEA 2C3ZA 4F79A 2PC4A 3W29A 3GLCA 4MYXA 4N02A 3GNRA 3MYPA 3KBNA 1LLOA 3H2MA 5HANA 3ZZ1A 4F9DA 2H6RA 4EOUA 4UTWC 3NXFA 4ZXLA 1V3LA 1J9YA 3FJ4A 2RJHA 1ONWA 2CLHA 3IJIA 4GNVA 2OYMA 1YMYA 5AB3A 1X6NA 4Y8FA 4WKAA 3GYEA 2HBVA 3RILA 5A94A 5C7HA 1PSCA 1SR9A 3U57A 4F40A 2O9OA 3EPNA 4V27A 3ALGA 4A35A 2BNJA 5K4ZA 2WMGA 1H1YA 2ZX5A 3UNTA 1YDNA 2IPJA 4GA8A 1E9YB 1EJWC 3UGVA 1OINA 1WDPA 3BMXA 1E0VA 4ZO6A 3ZJ7A 2EPNA 2PDWA 3BLPX 4M81A 5BMXA 4A29A 2YYTA 4B4FA 4HPNA 2OQLA 1LG1A 1A3WA 4OQVA 2F84A 1GYNA 4HJFA 5A69A 1VPYA 1QXLA 3EDJA 5CJ5A 3RDKA 2OGYA 1QWKA 2OMAA 2GQAA 3O63A 2CZDA 4HGXA 4PA8A 1GVFA 3AIVA 3UQNA 5M2FX 1T0OA 3VDAA 5AC7A 1O94A 3LV5A 4QLKA 5DMYA 3S3GA 3QF0A 2Y8UA 4QSHA 2W27A 1HIZA 4XB3A 1WXZA 4I7UA 2PDGA 2W4XA 2YCLA 3L0KA 3B9NA 2CERA 5G4WA 1CT5A 2DV0A 4LVDA 4QEHA 4UFLA 2B7OA 4K8GA 3MC5A 1F8MA 1XWYA 1DE6A 3QR0A 2F2HA 2CXGA 1EQPA 2XGIA 4L1XA 1BKSA 4LYRA 2HS8A 3AZTA 1Q6GA 3JR2A 4PB3A 1VFLA 1MI3A 1W5NA 3B0UX 2FJKA 3CLMA 2GWNA 4U3AA 4XZHA 1M7OA 4DO7A 4J7RA 3TC6A 3UEQA 3LGGA 1G0CA 2YPIA 3T55A 3D3FA 4HHLA 2EJ1A 2EPKX 3LQGA 3WLRA 2JBMA 2O9RA 4NKCA 3WJYA 2ZXDA 2FTWA 1ZFJA 4ERAA 4JHMA 2FGBA 5D09A 4H7ZA 3M6DA 3DEQA 1PZ0A 1UYQA 3MMDA 3GIPA 2WJFA 1UR2A 1VB9A 4WXYA 4FNSA 3QHMA 7REQA 3GKAA 3KRSA 4HTBA 3RLHA 1KFJA 1YXYA 3MCNA 3UWWA 3VD7A 3O6DA 4NL1A 3GDRA 4P7QA 3PTQA 3EOLA 1KLYA 5EB8A 4CN6A 2OU4A 3KE0A 4XZIA 4GD0A 4RPPA 3TSBA 3HGRA 1LZOA 3RLVA 1TTIA 2VO5A 4TQTA 4J3SA 3TW7A 2ODOA 2Z1SA 3DFQA 4XX6A 2J7EA 1JD9A 3LN3A 2DH3A 4IUOA 4CQAA 5FSDC 3PB0A 4HOXA 2QJNA 2VVNA 4DB7A 2XTKA 1YE4A 4JX6A 5FOOA 4N2YA 4Y9NA 1BVWA 4RE2A 1F6YA 1W1PA 3SCVA 1F6KA 3UG3A 1R30A 1WZAA 2OT1A 3CT7A 6A3HA 4BY3A 5F4SA 3MSYA 4EWJA 1LT7A 1FX6A 4CD7A 1DE5A 1H3GA 5I0DA 2XH0A 2IW0A 3I65A 3DBNA 3VDGA 5C6MA 1P1MA 1OYBA 1UKPA 3T05A 2PDFA 1TJ2A 1TPH1 4IGHA 4TOQA 1W17A 2A5HA 3MJYA 2HK0A 1XISA 3CH9A 3HM7A 3C3NA 2CLIA 2FGLA 1F7BA 1R3YA 4C60A 2ONEA 4UB9A 4GPNA 4AXNA 4BEUA 1R8LA 4L65A 3QPZA 4O0KA 2P88A 2GDUA 3VFLA 3CIXA 1A0EA 4MY9A 1ISXA 1K1DA 1XIDA 1UA3A 3KVLA 3GG8A 2G3IA 3C2YA 4P61A 4U3CA 1V6WA 3NQ7A 1OFDA 2HXTA 3P60A 5GJMA 2OSWA 2R1KA 3THUA 4IL2A 2OO6A 1IR1A 1LROA 2OLSA 4Z2JA 4IXHA 1MUCA 3B9AA 2J8TA 4KCVA 1T41A 1FTXA 2CBJA 2WVSA 3G1AA 2V9DA 4R34A 4W93A 1FVPA 3T0DA 3GO2A 3WD3A 3R12A 3EWXA 3GUWA 3TYDA 3POCA 1EZ2A 3TWBA 2YIHA 3H8AA 4HN8A 3C4UA 2VZSA 2PLKA 1B54A 1E6NA 4NXSA 4H8UA 2OX1A 2V63A 1ADSA 3UERA 2Z7GA 4F8XA 3RU6A 2ZE0A 2H3BA 3CGTA 1DJZA 3FX4A 2VCBA 4LCRA 1K9FA 2B81A 2YCLB 1BXBA 2P53A 1S2WA 2DVXA 4K1GA 3PBVA 1BEUA 1GHSA 3O06A 1PV8A 5E0FA 3SRHA 1EBHA 1RPXA 5CC5A 4AFYA 2QF7A 1ZAIA 2GVEA 2Y5EA 1OFPA 2J79A 4WJXA 4C7FA 5AYXA 1QW8A 1J79A 1OF6A 4HNOA 4PH6A 1OCQA 2EO7A 1ZUAX 7PTDA 1CPUA 1DJNA 3UD6A 5G1YA 3GSMA 3LUTA 1J4EA 2IKHA 3UPBA 1WPCA 1EC7A 4NUWA 3MUIA 1OADA 3MTWA 4CNTA 5CSUA 3SDOA 1LLZA 3SAZA 1KCXA 2NQ5A 4ES4A 4MYAA 4CLMA 2PUZA 2OO0A 4DLFA 2Y5SA 3RLGA 4GH3A 3RHGA 3O6AA 1G4SA 3WQ4A 5FF2A 4J28A 5FJUA 3SRKA 3OB8A 3S1XA 3PY2A 3WMCA 2ZXAA 4KFOA 1ISYA 1CXEA 1XR2A 5HQEA 3A13A 4BS0A 4UMAA 4CNNA 1X39A 4MDOA 2OZ0A 1W1YA 1O4UA 2VUYA 3TR2A 5CPSA 3HU7A 5DQPA 1C92A 6XIAA 4CUCA 2X7VA 2YL9A 4UFJA 5C2CA 5J5RA 4HT3A 3UXKA 2FVMA 3TR9A 3F2BA 3TN4A 1B3XA 1M7XA 4C6LA 4HMCA 4ROQA 4AD2A 3TP4A 3QHOA 4O57A 3VU2A 5CZJA 1GZ1A 4JEJA 3AIQA 1BF2A 1KCKA 1QW9A 4HQVA 2JKEA 3BSMA 2EKCA 1ISWA 4DWDA 1E0XA 1V51A 3B8UA 1OT1A 1J6OA 3NVTA 1UD5A 4ZODA 3QVQA 3DYPA 4UTFA 4INFA 1CGWA 2I14A 3W7HA 4MKVA 1EF3A 4Q4OA 1V6TA 4CQ9A 4ORIA 3IRDA 3A5VA 1TJPA 1TSIA 4XQ6A 1BXCA 4PB5A 4C90A 4HU4A 2WANA 5BW6A 1B57A 3T2QA 5DT7A 3WF0A 4C6OA 5D9NA 3IIOA 4H9UA 1ZL1A 3EWZA 3PK7A 1EO5A 1RD6A 1S2VA 1UC4A 1TTPA 2WLYA 4N6EA 2ZX9A 5E0CA 3KZPA 2DZXA 4BQ4A 2VFGA 2GK1A 1HT6A 3B8TA 4AD5A 2DU2A 3NO1A 2TSYA 2BX7A 4JFWA 2YDAA 3KW3A 4GQBA 4HK7A 2A3AA 3BLEA 4YHGA 1FWIC 4A8NA 1TR1A 1UOKA 3V5CA 4QITA 4FX8A 2H8XA 5DCBA 3CUZA 3O16A 1Q45A 2Z1VA 1CLKA 3KOFA 3CYVA 3RYSA 4H1ZA 2YGYA 1TE6A 4J35A 3B06A 4GRSA 1PB0A 1XXXA 3ABQA 1AVAA 5REQA 2G3NA 4NZJA 2VZVA 3XISA 4ZQNA 2AQOA 1BG9A 4NP7A 3BCJA 5D8ZA 1WDDA 1PZ2A 1PKMA 2WLZA 4KCWA 1ODZA 1DWJM 1F3WA 2PA6A 1DBTA 1AA1B 3EX6A 3NL3A 3VIGA 2J78A 2VELA 4QG8A 1W3KA 3M0XA 1XLIA 3WQGA 3GS6A 4Q7BA 4W87A 3WLQA 1RV8A 5FEZA 4R53A 1JYWA 2XWDA 3ZJKA 1Q85A 1FWCC 4GINA 3PZMA 5A6AA 2VD8A 4J3WA 4Z42C 3WKZA 1OX4A 3PPCA 3GD6A 3B9DA 1ML1A 3BO9A 4ZB0A 1YDVA 3GUGA 2IQDA 5BXPA 2WJZA 1NWUA 2CCRA 1X6LA 5CBIA 3RM4A 3WJXA 5A1AA 4CCCA 4FAMA 4PRWA 3BOLA 3QOMA 3SIMA 2WC4A 3NDZA 5K3VA 3QN3A 3W00A 1GQJA 4D2JA 4XZBA 4YTTA 5K4XA 3RG6A 4IL0A 1E1CB 4NZ5A 3DBPA 4XKYA 3GZ3A 4LQ1A 3FEMA 3VTRA 3EAUA 5HJLA 4R7OA 3YPIA 4RPQA 5DBUA 1DTUA 3TJ4A 4AF0B 2C7FA 4I7VA 2NXGA 3W28A 3WF1A 3HQOA 3VZXA 1MRAA 2CLMA 3S9IA 4GX9A 4LUSA 2VFDA 4GWEA 1TJ0A 3FAWA 4IPIA 3GHTA 1FY6A 3WF2A 3N34A 4A3RA 2G3MA 1V6UA 1Q8AA 1D8CA 1KBBA 8CGTA 2J9YA 5EMLA 3GFXA 3UETA 2FB2A 2Z00A 4GMEA 4FP1A 2J25A 3N19B 2RH9A 1QNVA 2CYGA 3M7SA 4QFUA 3VGFA 4IG2B 4EVZA 2DUXA 5A8MA 4Z1YA 4TVDA 2ZBTA 3DX5A 4KERA 3OO2A 1XIMA 5CAKA 1HXJA 3PZTA 5CSYA 4BQ2A 2WSQA 3HG3A 4G7EA 3NFUA 3W7MA 1TG7A 3AMKA 3TU9A 3DI1A 1VFHA 2V5LA 1XICA 4KCTA 1I45A 3IJ7A 1FHLA 1FXQA 4DBWA 4BWLC 2GSJA 4MWAC 2G5WA 5FJPA 4MJ2A 5KMYA 2X7WA 2E09A 2OLAA 4UZSA 3BTNA 3H22A 1D8WA 1LYXA 2BHZA 3VXGA 3W27A 3U0HA 3FCPA 1V0MA 1FWSA 3VDBA 1SJDA 2BXYA 4WDWA 2YDRA 3BJTA 3QV7A 3R5EA 1UQZA 1D3GA 1GQLA 1OZQA 4S2CA 5M1TA 5HWNA 4GZ7A 3BARA 4IX2A 3S5SA 4C6PA 2WSRA 1RCXB 1R6WA 3OLEA 2AKZA 1K70A 1P6CA 2E5DA 3KVMA 3A21A 4AC1X 1DJWA 4JIRA 1UP3A 5DO8A 1A5BA 3FDKA 3TYZA 1L8NA 1QVBA 1CXFA 1QI5A 3FXYA 3GU9A 3DKLA 2A3LA 3ITLA 4D6FA 5LA0A 5ABEA 3GTXA 3VNIA 4FXSA 2WKJA 2YSWA 3B8DA 1JNDA 3ORWA 2V82A 1CXIA 2PB1A 1AH0A 1XYFA 3OBEA 4GFSA 5HJYA 1FUYA 1U22A 4QG9A 3FFSA 3WQFA 4Y8EA 3AHZA 3UJ2A 4TMBA 2BWGA 5I79A 4GI9A 1EA0A 3RU8X 3VKDA 4XWUA 4WLCA 1UMLA 2NX9A 3H4XA 2WMKA 2DUZA 3WSUA 2QV4A 2UZ9A 4G2DA 3W84A 1XGZA 4CQ8A 1KW1A 1WDRA 3LSCA 3SUWA 4PUDA 2VZTA 3KM8A 1VRXA 5C2XA 3M5YA 5LYRA 1T8QA 4IF2A 4XZLX 1SJAA 2GUBA 3B0XA 2IKIA 3ARVA 3K1GA 1SFJA 2ZTJA 5CPLA 2NUYA 4A3HA 1F4AA 1WCGA 4B16A 3IV8A 3STFA 3BL3A 1CTNA 3W53A 1UJQA 2DGAA 1J2BA 2WBGA 3C0JA 4R3UA 4ZTYA 1IEVA 5CBJA 2OB3A 3GR7A 3GVGA 3E5PA 1C7SA 1QK0A 3I7RA 4JX4A 5CKSA 5AC6A 5HR6A 1Q2SA 4DUVA 1NWTA 5KINA 3CZ8A 5B80A 2V68A 1HGYA 1RLCL 3G3DA 3FDGA 3LHYA 4NAEA 1KQYA 4IFKB 3TQKA 1Q7ZA 1DXIA 1K9DA 2VEPA 3S9YA 1A0CA 4O13A 1DJIA 2Z2UA 1I2PA 4AYSA 3M44A 3R0DA 3B8VA 2YYUA 4EPKA 4S3JA 4WEVX 4JCLA 1UIPA 1YTEA 4M51A 2DFAA 4A8RA 4MNJA 1R2TA 3E0IA 4CCDA 2GFTA 2HVMA 2X42A 1KCZA 4NRSA 2QIIA 3WY1A 3ZVIA 5AYYA 4GCXA 4Q32A 2JE8A 4OBRA 2PDUA 1MNSA 4CCZA 1UROA 4I90A 2P0OA 4J40A 1OWQA 2XFWA 3R2GA 1XLAA 5IOBA 4H2CA 3WH5A 3PBMA 1B0IA 2B0MA 3PBGA 3GVRA 3BK0A 3AYSA 1ZY9A 4IOTA 3F5JA 1AJ0A 4E8DA 2VR5A 2YXOA 2KZHA 2DVTA 3QTPA 3UCCA 2DVUA 3P3BA 4KRTA 4O1EA 1GOWA 3B4YA 3M43A 3N15A 2HJPA 3N14A 3S1GA 4LVBA 4HNTA 2OPJA 3CS2A 3GXNA 2YA2A 4YWSA 1XLHA 4AZBA 3GNDA 5E09A 1XF0A 4YTSA 1G94A 1W5QA 4RDVA 5E1QA 5DCEA 1TV5A 4KWOA 3OG2A 4LBRA 1EA9C 1U83A 3U2OA 4GHRA 4LWWA 3S0CA 5BZAA 2DSUA 5L6UA 1PE1A 3SCPA 4IIGA 4FR6A 3ARZA 4YTUA 2PI6A 1CXKA 1MW2A 1D3CA 2VFFA 3OJGA 4QQ3A 5I02A 5FF4A 3AYRA 2WC7A 1BSIA 1EHNA 1R46A 4J3VA 5A5WA 3S5NA 4HSOA 2INFA 4TO8A 3II1A 4PMVA 1XKJA 1QI3A 2Y4SA 1KWKA 1UZ1A 1C90A 1FWNA 4C7DA 1B30A 2WNZA 1DQXA 3TN6A 3DKJA 2YW3A 3S6OA 5LNWA 3CZGA 1NFGA 3VDHA 2O4MA 1KM5A 3WBEA 4JHOA 3PZNA 1G4PA 4UR8A 1KXHA 4IGNA 3N4EA 3GNPA 3V16A 1NWRA 4UC5A 5JH1A 1HL2A 2FZBA 2XN0A 4G1NA 1JF6A 2ZVIA 3VABA 1NDZA 5F1VA 3UZZA 1PZ1A 4HMDA 1OEPA 1T96A 1XLFA 2VM8A 2CBUA 3MI6A 3VGHA 4HMNA 4FSAA 5I3KA 5B7ZA 4CD5A 3BOXA 5I5RA 1S3HA 4AHOA 1VHNA 3W1AA 5LNSA 4C6KA 4DUWA 3KLKA 3ZR4A 3MCOA 3OZMA 4DM1A 3IPWA 5CGTA 4IMCA 3O1NA 2QUTA 1SPQA 4R33A 3NQMA 5LGXA 4JIPA 3G3MA 4AHQA 1IE7C 4MUPA 1EJRC 1YPIA 2TMDA 3TZFA 5C9XA 2X09A 4V2XA 4LV4A 1ALDA 1REQB 3E6EA 3ABXA 3TOPA 4HN4A 1OYCA 3C0LA 3B03A 4GCAA 4LALA 1D9EA 5EMUA 4M5PA 3GIYA 1HJWA 1B3OA 4IFOA 4UFKA 1RXOB 3H53A 4D1JA 3HGSA 3DFTA 4HVXA 3TTYA 1F5ZA 2G50A 5BROA 4GY1A 4OUIA 3K13A 1HUVA 3GWQA 3WZ0E 4A8LA 3LI1A 1O5RA 3EWDA 2E5CA 3H2FA 5EBUA 2WPBA 1AJ2A 3HA1A 1IYXA 3AXIA 1PBGA 3RCYA 3E1F1 4PN2A 1C3FA 4EPBC 1C29A 3OEXA 3GH7A 2CPUA 1QBBA 2A3EA 2EPHA 3T7VA 4CNPA 1MUMA 3UA3A 4U2YA 3T4WA 4AWTA 3UZJA 1W8GA 1E72M 5HMDA 4ZXOA 5F2MA 3BVJA 3ZT7A 3LI0A 2VC6A 2IPGA 3DFYA 4R9XA 4A3QA 1FP8A 3B40A 1AG1O 1FWJC 3CIWA 1V3HA 4CN4A 5E9XA 3GM8A 5ECVA 1JI2A 2DW6A 1UD4A 3VNDA 1SVDA 2X2GA 1CECA 1XIFA 3GXDA 2X8RA 1E4MM 3BLFA 4XUGA 4K68A 3DHPA 4IPPA 5T91A 1QI4A 3L12A 1Q4NX 1Y7VA 4MWAB 3CUJA 5CPNA 2ZA3A 3E49A 1UBSA 1JL8A 1TVPA 4GVIA 3MMWA 3ABZA 2FKPA 1WXYA 2XYLA 1V03A 3PS7A 1EL3A 4D8AA 1VEOA 2VX7A 1A0DA 1L6SA 2J7BA 4K3ZA 3ERPA 2O9PA 2WZIA 4J3TA 2B7NA 1J11A 1ZBCA 1EYWA 5G4EA 2RHGA 4Q8WA 3V18A 3G1YA 2HTMA 3APYA 3KLLA 2X0YA 1EGMA 1PX8A 5AVHA 4US5A 4BHYA 5AHEA 3N3TA 4OV9A 3AMLA 2O4QA 2Q3RA 3TV8A 2G37A 2NXHA 3S4TA 1TA3B 5TD4A 3NQBA 2VTFA 4UNIA 1R3VA 1XQLA 3C5QA 3CQHA 1CBGA 3S2JA 1AH3A 1GVQA 1US0A 4JAWA 3T8QA 4HJWA 4EWND 3S5OA 3W1RA 3UY8A 1VFSA 4JL2A 3FS2A 3VGBA 3LS9A 4KRUA 2HWGA 4A22A 3N73A 4HU3A 3V7PA 1DOSA 5PTDA 2WWDA 2DQWA 3DECA 4GIRA 2X41A 4GIYA 1EXPA 2OQYA 2DSZA 1M01A 4GVGA 4LBUA 4JICA 5LNUA 4HPGA 4GYPC 2HISA 2QZRA 3AJXA 4HP5A 1QWGA 4JTGA 4OGZA 5D05A 1WDQA 3ARQA 3BGGA 3OGSA 4JZ5A 2QCGA 5RUBA 1IZCA 4R5EA 2XSBA 2CLFA 3WLNA 4XSMA 2X1UA 2XGBA 4WJEA 2X05A 4C1NB 3NZRA 3U5UA 4B92A 3NXLA 1W91A 3HGOA 3MO7A 5GQBA 4JCMA 1LRTA 3GG1A 4LX4A 1CB2A 3MUCA 3L2MA 3WFAA 1N8IA 2ZUNA 4ZQPA 3WLHA 1GYLA 3HJEA 4HPHA 4PMDA 1SJBA 2PAJA 4G7FA 4M29A 1Q6OA 4KMQA 4HBKA 2NV9A 1H49A 5DMLA 4H00A 2I9EA 3DXIA 2E25A 2P8CA 3IK4A 1F3XA 2D1ZA 1KBLA 2NUWA 3F4CA 3SY8A 2HMCA 4XBKA 2H9AA 2B7QA 5I03A 1KTNA 2ZUTA 4JD4A 5TF0A 3TWAA 1P0BA 1DP0A 3OYZA 2WOQA 2QT3A 3PFMA 4E8CA 3VD4A 1W5PA 3GYCA 1PX3A 1SSDA 3HPZA 4GYPA 1SZNA 1YW1A 2V2CA 2Z1BA 3FA4A 5FCZA 1V93A 4NHVA 3QJAA 2Y2WA 3BAKA 4A6GA 4HPJA 4NZCA 4JTKA 1K7FA 4UOZA 1HJVA 4Y90A 4XO7A 3OU8A 5FI8A 4B2DA 3WEOA 1G5AA 1IIGA 1AQ0A 3LRKA 4M82A 1O66A 3UT0A 4F2TA 4GNJA 4YL2A 1QPRA 3AI0A 2X2YA 3S5ZA 1TPVA 4L7ZA 3A24A 4TR9A 3H70A 3VKCA 1V02E 4E4FA 3KDOA 2XFRA 1KBKA 5HUOA 2A79A 4EAYA 4UTLA 2NT0A 1GOXA 3O8AA 4PTNA 5D2WA 4FIRA 2FZ9A 3B9OA 1W5MA 4C6BA 2XINA 1Q6RA 5HA7A 2ACQA 4ACZB 4MJZA 5DMNA 1OFEA 4FNQA 1FA2A 1G7UA 4JFTA 1EGVA 4FPSA 4IPLA 4TXEA 3KOYA 2FTYA 3OQ8A 4BZYA 1K6WA 4PUEA 3KOWA 5A2BA 3MBFA 4QAWA 1KXTA 4I7WA 1GG1A 3R58A 4G6CA 3IJ8A 3U6WA 4QAIA 3PPGA 1ICPA 2UV8G 2Y7EA 3WMBA 1DJHA 4DBDA 4O16A 3KEHA 5BXRA 1I8JA 2I9UA 2OWXA 3K5XA 1PKLA 3S9ZA 2WAGA 5CSSA 1R87A 2YCIX 1UCWA 2EGZA 2E6YA 2WQDA 1KGUA 3QHNA 3CWNA 3AU6A 4D6DA 3M0LA 4F3HA 1RP8A 5D2XA 3T78A 4DJDA 1D2KA 3A23A 3LMYA 4LUTB 5M17A 1AQHA 1B3WA 1XLKA 3LNPA 2WJEA 2PWVA 3ZS4A 3NZ1A 1MZHA 2PRLA 4E2VA 3K46A 3HFYA 3T42A 1XD0A 1FWBC 4BI7A 1XSJA 1O5KA 1R3TA 3K4DA 3DFPA 3PBUA 1QJWA 3TXZA 1S1RA 3GDLA 2WSYA 4V1YA 3GXPA 4JTRA 3ARPA 3TEVA 3FJ6A 1RJPA 4LEFA 1YTKA 1FWEC 4ZE5A 3M46A 3PZ9A 4JR5A 1CNVA 2PWUA 1XI3A 2NQHA 3UGRA 2WW5A 2XM2A 4RDWA 2C16A 4KEMA 2VEFA 3S47A 4QS6A 3G1DA 1BRLB 4C6JA 2PTYA 4O11A 1ZRQA 3V5FA 2DT2A 2E6AA 3LCLA 4NX5A 3W7JA 3GY1A 5KZEA 3SFKA 3CK5A 4NNBA 4P7NA 1UUQA 5FF0A 3HTWA 5DY2A 1F3EA 5F7UA 4PCTA 2ZUVA 4NU7A 3MHFA 4MNKA 1QPOA 1Q65A 1E15A 5D4YA 4DBSA 3RX3A 3P7YA 4FLRA 1DVJA 4JIEA 3M47A 4RKAA 4F0RA 3AMGA 2O9TA 3TONA 4LCQA 4FALA 3M0VA 1RCQA 3FYOA 5CH9A 3ONCA 1F2JA 2BGSA 3OQEA 3UWQA 2OVLA 3WH6A 1WUFA 1WDSA 3L7RA 3L5LA 3ZR6A 4HA3A 3UR7A 3NG3A 1Z7AA 1HW6A 4E4PA 5D2TA 4Q8OA 4IMDA 4JTSA 4JTAA 1BF6A 5U4NA 1W9XA 5G2WA 3UG4A 1WAWA 4I3GA 9XIAA 1W54A 3N2TA 1WNOA 3AXMA 4WKHA 4YVXA 3RM9A 3URNA 2GGEA 3ZMRA 7CGTA 3WQEA 2ZUWA 4K1WA 4MADA 1GCYA 2GJLA 4CD4A 3W4RA 4PBGA 4DI8A 1GEHA 1GW9A 2R1MA 2FPVA 3OGVA 3U48A 2B7PA 5A3HA 5A6LA 4PRTA 3QYQA 3VOCA 2IMRA 1KV5A 4GI6A 1XX1A 3WNMA 3VE9A 1Z32X 4QG6A 3ZLGA 1HJUA 4M0XA 4W7VA 1J0HA 1UD2A 4IIEA 5C9UA 2J8FA 1YXDA 4LAUA 3VIIA 4LNCA 3I3BA 1IV8A 1ONRA 4NF7A 4CU7A 1Y65A 4GQQA 2AQVA 2JQXA 4H9TA 2VX5A 1R38A 5AOUA 4XVEA 5ABTA 4QE4A 4O15A 1NF7A 2CHNA 4LU0A 4B5UA 1H7PA 1EWEA 2YW4A 1H63A 1GOKA 4J3XA 5LHFA 1VJZA 3OVRA 3THDA 4LANA 4NX0A 3UNDA 4B5SA 3KZSA 3IJDA 3D5HA 5AC5A 2WZHA 4ERIA 1MW3A 3K8MA 1E5NA 3SY1A 1XYLA 3N04A 3Q94A 2BGNE 2V67A 1M41A 1E6PA 1EZWA 3K30A 2V2HA 1H7XA 1PCWA 2BGQA 4ASTA 2YBVA 2ZWYA 3GXIA 3UF9A 5D38A 1V6YA 3TSDA 1C8YA 3DN5A 1W9DM 3FY1A 3M4HA 5TAOA 2G8ZA 3P8JA 1X96A 5LA2A 1KD0A 4KGJA 4UTHA 1G7VA 4OJYA 4OOZA 5CC3A 1RALA 1DJYA 1CWYA 4Z08A 2NT1A 2P76A 1KFKA 4OECA 1KLZA 4LFYA 3VKAA 2F7FA 3E0LA 3BCDA 4JDYA 4S3GA 3TJLA 1DHPA 3TN3A 4XTIA 1V3JA 3STEA 3VNZA 3U7BA 1LWHA 3CO8A 3G6LA 3WJWA 4GXWA 4NASA 4RZ6A 3DYMA 1EHAA 5EBAA 4AMAA 2WWCA 2NX3A 1FRBA 4WSKA 4RE3A 3VIJA 3W1QA 3FLUA 3SUVA 5KEZA 3MCMA 1G9HA 3NGJA 1GVYA 1OC6A 3CTLA 2YFNA 4PULA 5HK4A 3WL0A 2HNHA 2VC5A 4H9ZA 1SUXA 4YXGA 4K8HA 4WQ6A 4BF7A 3MT1A 2QMJA 4WD0A 3ES8A 1WP6A 4ADTA 1WZLA 1LUCB 5KZDA 2PTDA 3QW4B 3WUEA 5D37A 4F0SA 1GTHA 3NSMA 4E4UA 4FS9A 3BSHA 2DH2A 4GZEA 1XC4A 4H9VA 4TU1A 3PM6A 4MAZA 2CBVA 1EOKA 2BHUA 3NOYA 2PC8A 4JTHA 2AL2B 6ALDA 3MKKA 4US5D 2MNRA 4P8XA 2RUSA 3CV6A 1NOUA 3WQVA 3JU2A 1JG9A 3KBSA 1AQFA 4W86A 1JCXA 4ORMA 3WLOA 3GXTA 1K7EA 2ZUUA 3GH5A 2OEKA 3W6YA 3TYUA 1K3UA 1XP3A 3LV6A 4JTQA 3S5YA 1PHQA 2WNNA 4WHBA 4OWGA 2C91A 1THFD 1I9CB 2ANUA 2XN1A 5XIMA 1LOQA 3WCZA 1VFMA 2ZZ5A 1GJUA 3LHVA 2CHOA 3NCOA 3WH8A 1N8FA 3UCDA 5IBXA 2R82A 4JNZA 3WF3A 1K7XA 1AD4A 2XVGA 1OG0A 1JYNA 4S39A 3WNOA 2XZ7A 2ZTKA 3TK7A 1XDLA 3PVFA 1KRMA 3RGTA 5FSEC 1TIMA 4ZE4A 5GNXA 3ID7A 3PC0A 1VPXA