4NJJA

Crystal structure of quee from burkholderia multivorans in complex with adomet, 6-carboxy-5,6,7,8-tetrahydropterin, and manganese(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
209
Chain Sequence
TYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGENGGKFKDADALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFGIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7-carboxy-7-deazaguanine synthase
publication title Radical SAM enzyme QueE defines a new minimal core fold and metal-dependent mechanism.
pubmed doi rcsb
source organism Burkholderia multivorans
molecule tags Lyase
total genus 66
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.3.99.3: 7-carboxy-7-deazaguanine synthase.
pdb deposition date 2013-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4njjA00
3GXTA 3UWWA 2B7PA 2ZRUA 3W1MA 1KV5A 3GZ3A 4IWWA 5AN7A 3VE7A 5F2GA 3A9IA 4EF8A 1W54A 1OK6A 1UB3A 3DFPA 3O16A 1FX6A 1QWGA 3MO7A 3T7VA 5AYYA 1QPQA 4CNOA 2G5WA 3HGJA 2P0OA 3C4UA 4PH6A 3R8RA 4FNSA 2A0NA 1H7WA 2YGYA 4FB7A 2DJXA 1I8JA 3IGXA 5D32A 1ADOA 1D9EA 4YMZA 4MIMA 4Z1BA 3EX3A 3NQAA 3O6YX 3UYCA 3LCGA 2DZXA 4JTKA 1L9WA 1TPWA 4KFOA 4O4WA 3KOFA 1TTIA 3LHWA 1W5QA 2EGZA 3HJZA 2V5LA 1OX6A 3G3MA 3M1ZA 4UUIA 3B0PA 5AHFA 4P2VA 4XTIA 3G22A 6ALDA 2ZDRA 2WPBA 4JNMA 1H7RA 4CNNA 2FPYA 4WQ6A 1DJNA 1FWWA 2V82A 4RX0A 2FB3A 3C0JA 2DP3A 3W23A 3HGRA 1A5BA 4FX8A 4RK8A 3ATYA 3EKZA 4UCGA 1YDVA 1FXQA 5LZLA 3MWAA 3KXQA 3G3DA 3C2RA 4UXDA 5KZMA 3NQGA 4FNUA 4ICNA 3NQ6A 1EWDA 1OX4B 5DXXA 3NPUA 5SWUA 1G67A 3R12A 3EWBX 3LCFA 2ZBTA 2X30A 4CCDA 4NU7A 2GVJA 3E02A 1A5SA 3UWZA 3WJWA 1K8ZA 4LWWA 2C15A 2QCDB 4FHAA 3W3OA 4IMFA 4UTTA 4BI7A 1TRIA 3TDFA 3TJXA 4ORIA 5D2VA 2CLFA 1V7YA 3NDOA 3PUDA 1NF0A 4MKNA 4Z1AA 2QDGA 2B4GA 1F2JA 1KTNA 2CZDA 5HUPA 1O60A 4IX0A 1KBIA 2WKJA 3RNDA 3IIOA 1LLWA 2CZFA 3NL2A 1CW2A 3O1NA 3S1VA 2FPVA 3TXVA 2OT0A 3PR2A 2QUTA 2NLIA 3L0GA 1LROA 5LHFA 3O8AA 3QPZA 3HPZA 1HFBA 4S2BA 2OT1A 2W6RA 3W72A 1G4TA 4POCA 3TROA 1LM1A 1A50A 1VC4A 4HN4A 2R8WA 5DY2A 1F05A 2FJKA 2VEPA 3LTSA 5LGXA 1TJRA 3HG3A 4BK9A 3S1XA 1HL2A 2VEKA 4O13A 1G6CA 5C5YA 2A4AA 3DFOA 4N9DA 2FFCA 5CPLA 1Y0EA 3LXBA 2ZZ7A 4KFPA 3P8JA 3BK0A 3QSRA 1KBJA 3L0KA 3GXNA 1H62A 3L67A 3B0UX 4LT9A 3TMQA 4DPPA 3G1XA 1Z44A 1IXNA 4PEKA 4AEOA 3PWAA 4K6AA 2R91A 2YDAA 5EYWA 2EKCA 3GAKA 1L2UA 2V81A 3HPSA 4LVFA 4OWGA 5HWJA 5T26A 4EOUA 5HNRA 3EX1A 1H1ZA 5BNKA 3MBDA 3SY5A 1B4EA 1WX0A 1XC4A 2WJZA 3OVRA 4FEZA 1F6PA 3ATZA 3W7GA 1Q6RA 1K7FA 4E2BA 1YLVA 4GBUA 1F74A 2QCCA 4IMCA 2TMDA 4GUIA 2Q3OA 3B06A 4JN6A 5CSSA 1QMLA 5U4NA 3EWXA 4IQLA 1OFAA 4IPIA 1Q6LA 1N7KA 4PA8A 1KFBA 2RH9A 4XBSA 1GVQA 3QPYA 2JKPA 4QISA 3IV3A 4NJJA 3WK1A 5LNUA 1WYIA 3VFLA 4RJEA 3TC7A 4X9SA 2VC6A 3PB2A 2I9EA 5EL1A 3FA5A 1FCVA 3TKFA 5L9FA 3CEUA 3TW7A 3Q94A 5G4EA 3W2JA 2NV2A 1OFEA 4QIUA 4QNWA 1GVFA 4FXRA 4O15A 3FFSA 4GXMA 3GAYA 3TH6A 3P7YA 4O52A 2UV8G 3STGA 2C13A 1KFEA 5LNWA 1AMKA 4GUHA 5D37A 4K8HA 1XUUA 1C29A 1ONRA 1TTQA 1ZHAA 2I14A 3W7EA 4JTIA 1SO6A 1VHNA 2QKFA 1QR7A 1LLZA 1ZALA 5G2WA 1YDNA 3EB2A 3Q58A 4WUIA 2QF7A 3ZWTA 2X1RA 1KW1A 4UMAA 5E1QA 4TMCA 2NWRA 3QFEA 1TJPA 4HIBA 4NJIA 4MY9A 1VYPX 3LHUA 1ZY9A 1EUNA 3Q37A 1TSIA 5D05A 2Y7GA 1NVMA 4JIQA 5HR6A 1YTDA 4KWVA 4JX6A 3M41A 3TMLA 2DJLA 1Z41A 1EP1A 3GB6A 4MYAA 5K2ZA 4UFJA 3TQVA 4MZ1A 1QPNA 4BF9A 4WY0F 4RLIA 1JUBA 3GYEA 2BX7A 2ZRZA 3IVUA 1TPC1 1H7PA 1OG0A 1ZJIA 3GVGA 1JUEA 3W6YA 4R33A 2ZYFA 2VFIA 3C3NA 1XBVA 4GUFA 3SZ8A 5C55A 4U28A 3S6DA 4FNRA 1LRTA 2VXNA 1ZAIA 3QMTA 3KVLA 3NYZA 2GVLA 2E68A 3A21A 4OU1A 1OX5A 1T96A 3TJLA 4O11A 3G1DA 4LVGA 3W2LA 1Z42A 2CZ5A 3ELFA 2A1YA 1JCYA 1SSGA 3PUOA 4GWEA 3SGZA 2R14A 3A23A 3F03K 3RLVA 3BARA 3YPIA 3W83A 4O17A 2Y62A 3C56A 3SSJA 4L4LA 4UTTC 3BG5A 2C1HA 2G96A 2GQ8A 1J5TA 4H3DA 5F1VA 3S0CA 2A7PA 1KV8A 1DQXA 3CLMA 3TW6A 4JTGA 1W56A 5FEPA 4UTHA 2E77A 3IRDA 4CQ9A 3LM7A 1GEQA 3FIGA 3B0VC 2Z1BA 4JEQA 3ZFHA 4LW7A 4UC5A 2DZSA 3FKKA 2RDWA 4AHOA 1A5AA 2A7NA 2ZA2A 4UIOA 3G0XA 3HQ1A 5AHIA 5D38A 3P82A 2JK2A 3OHIA 3F4WA 3GIYA 2NXHA 2WNQA 1DQWA 5FF7A 3EX4A 1SO5A 2ZZ6A 4P61A 2D73A 3KX6A 4O12A 3W22A 3GDKA 3QC3A 3W2KA 3F4NA 4MLRA 4EVZA 3P5YA 4BI5A 3L5MA 2CFFA 1N55A 1YYAA 4TO8A 5DCBA 3LTPA 2GPTA 5J5RA 3MHGA 4O53A 3W87A 1BWLA 1XXXA 3W7HA 4JR5A 1GOXA 2FDSA 2J9YA 1H1YA 1SSDA 1A53A 2JKEA 1I2OA 3BGGA 5EY5A 2ZQ0A 4HSOA 4GFSA 4JY8A 2DORA 3TX9A 1YPFA 5DY3A 1SZEA 5CZSA 1OJXA 3TSDA 3TAOA 3W07A 3RLUA 2WSRA 1H60A 4KKXA 4YWIA 3FYPA 3CQ0A 2ZZ5A 3LGEA 1LYXA 4EIVA 1B9BA 4TIMA 3S9YA 4NVTA 2J88A 2NX1A 1DOSA 1O4UA 3P84A 3CPRA 1EA0A 3KRZA 5F2MA 2V9DA 5U7SA 3ABOA 2I1OA 5CSRA 4JTFA 1AL7A 1DV7A 3DHFA 1DVJA 4AWSA 4OT7A 5K9CA 3OIXA 3W7NA 2IQTA 2F7FA 4K7YA 4UMCA 5EPDA 4EWND 4ZQOA 2XN0A 3U2OA 3NA8A 3G1SA 4RXGA 5CZ0A 2ABBA 3N2XA 1DHPA 3WJYA 2CLMA 2Q8LA 1GTHA 4UNKA 1JCNA 1HUVA 4NJKA 1TPDA 1XCFA 1TQXA 3MYPA 3U8GA 5I3GA 1RZMA 2E6FA 1R47A 4GJ1A 3N3MA 3WJSA 1L6SA 3R5EA 1ME7A 4RV8A 3UZJA 4JYEA 5D2YA 3TA6A 2CLLA 1FCQA 1M7OA 3U6WA 2YYUA 2ZTJA 1EP3A 2ZZ4A 3C52A 5H91A 4I7VA 3P80A 4UTUA 1I2QA 1MEHA 2AAMA 1GVRA 3THAA 4LS0A 1FCUA 4MLJA 5D33A 3SR7A 4Y9AA 4FXSA 3S1WA 4A3UA 4JTTA 3HO8A 4H4IA 2GUUA 4M6PA 1JQVA 3HG5A 3M5VA 3QZEA 3NQ2A 3GDMA 4LRSA 2RFGA 4NX0A 1B57A 3CWOX 4FNQA 4DQWA 3S5OA 4KWWA 3TFCA 4DXVA 2Y6ZA 5AOUA 2V30A 4UR8A 2E5CA 2B7OA 3S42A 3ZWSA 3W7RA 5F1UA 1AK5A 1JCMP 3IGSA 2QDHA 2B7NA 2ALDA 4RR4A 3TNOA 5AC8A 1C9DA 4WJEA 3IGUA 2HS8A 1ALDA 1G4PA 4JTJA 1M6JA 2Z6JA 1GG0A 2Y7FA 2ZA3A 3GLCA 2X1UA 4OBTA 2RDTA 5D02A 3CIXA 4O0ZA 1LOLA 1TTPA 4OGZA 1ZENA 1P1XA 5AHLA 3I7QA 4E38A 1K02A 2YW3A 4IMEA 4D2JA 3AJXA 3SFKA 3LCWA 3EX6A 1Q45A 7TIMA 2ZZ2A 2NUYA 1GZGA 1QFEA 1IXPA 5J5DA 4NJHA 3N9SA 1R46A 4ZQNA 1H5YA 2X16A 3LX9A 3IIVA 4ZQPA 3NPXA 2CWNA 2Y88A 3N9RA 1OFQA 3EWUA 4HHPA 2VFHA 3USBA 3GDRA 2X1SA 5G2HA 3B4UA 3TK7A 1AW5A 1H7XA 3LRLA 3S5ZA 3H53A 4UMBA 1PS9A 4XKYB 3I7SA 1X1OA 4UTLA 4AMAA 1EEPA 2A6NA 4Y8FA 5K7JA 1PV8A 1VZWA 3W1TA 3P81A 3NNTA 2CLHA 2WSYA 3TSMA 5ABTA 4MY1A 4NUWA 3ZS4A 3EKLA 4IXHA 2J24A 3DKLA 4UFKA 1RQBA 3QEZA 1NEYA 3DKJA 1AW1A 4E0CA 3TCEA 5C2XA 4FNTA 4WOQA 2A5HA 4A2RA 4K38A 1OF8A 2W0UA 2R94A 2P1FA 3R13A 2NUWA 3UPWA 1SUXA 2H8ZA 3VKJA 1W1ZA 2C6QA 4O1CA 3SJ3A 1TV8A 1TO3A 4ML9A 4Q33A 4ZQMA 1SZNA 1TIMA 5I3FA 2H8XA 2H3DA 4XKYA 4HT3A 5TIMA 4PTNA 4MJZA 5A5WA 4LUIA 3HBLA 1OF6A 4RZ6A 1GJPA 4GRSA 4A22A 1NF7A 4AWTA 1H63A 3B04A 2ATSA 2RDUA 1VLWA 4MPQA 3DI0A 1OX4A 2CU0A 3CTLA 3O07A 2LLEA 5FF4A 4LTSA 2ZZ3A 4R34A 1WBJA 2GVGA 1LZOA 5AHEA 1I2RA 2QCDA 2VEIA 2Y89A 5TQLA 1K8XA 3E9AA 1UUMA 4Q4KA 4W9TA 1FDJA 3T55A 3LHTA 4O18A 3TUUA 1TCDA 1EWEA 3GNDA 4L4MA 1F6KA 4M5PA 1FXPA 1GTEA 3MP5A 1KLZA 4BI6A 4NNCA 2FLIA 4N6FA 1TREA 1X1ZA 4BR1A 2PRHA 1BTMA 1RD5A 3FYOA 3NZRA 2ATMA 3G0SA 2JKAA 3PUEA 2TRSA 4RCXA 4JX4A 4WD0A 2EF9A 3QMRA 2YFOA 4JIPA 1R2SA 1GVSA 2ISSA 3EWZA 3O63A 1KFLA 4JS3A 4NNAA 3UY7A 4DO6A 4HKPA 3NQ7A 4MFEA 3DZ1A 2XN1A 3FJ6A 5CZTA 5BW6A 1W5PA 2XFWA 1KM4A 4DEFA 3QMSA 1FY6A 4O14A 4Y6GA 1ZFJA 3KRUA 1IXQA 3NQDA 4K36A 4LS2A 1PE1A 5DCEA 3DGRA 3PM6A 1G7VA 1HO1A 4X3ZA 3GDTA 1SO3A 1FUYA 1DKWA 2CLIA 3QJAA 2H3BA 3MBFA 1VGAA 3P61A 1WDWA 1XUZA 2GJLA 3F1QA 3T40A 4LS1A 2ZZ1A 3KAOA 3PB0A 3TQ0A 5EKYA 2FQIA 3C2FA 5HR7A 4DO5A 3HOJA 3A5VA 1ME9A 2QAPA 1C8VA 5I3HA 2YW4A 5AC6A 2ZCGA 1XBYA 3PBYA 4UTWA 4PL1A 3RFAA 5K9DA 3TV8A 3W7DA 2TSYA 1H7OA 2B0MA 3DU0A 1JCLA 1S5WA 2ISWA 5CKSA 2OCZA 5F4WA 3M16A 1Z48A 3LXAA 5G5IA 3W7MA 4JD4A 3CC1A 3S5YA 3K30A 5DLCA 2WV8A 1IIHA 4K37A 1PCWA 1H61A 3QF0A 4OHQA 3W1PA 3LHZA 1F7BA 3TSBA 3HMJG 4JYFA 2E5DA 3IIXA 2PRMA 4RXFA 1KFCA 3WK2A 3PS7A 4MJMA 1HO4A 4RKAA 1SFLA 4AAJA 3O15A 2JBMA 2NXGA 2EAWA 3UXAA 1MEIA 3NM1A 5KZEA 1T8XA 3LCXA 4M19A 3W76A 1B3OA 3L21A 3HG2A 2YR1A 3M7WA 2RKXA 2W79A 2B7QA 5DN1A 5G1TA 3BG3A 3UQNA 1W5OA 1QOQA 2GOUA 3UD6A 4PCFA 3W9ZA 4QQ3A 1YADA 1LORA 4RZ4A 5CZJA 1VJIA 4Y96A 3BLEA 3HF3A 3W7QA 5HWNA 4Z1DA 4N9EA 1ICQA 4ZVJA 2Q3RA 5FF2A 4IGHA 3KFTA 4O57A 3SIZA 2VKZG 3QW4B 1WBHA 4Y90A 1VH7A 3BPWA 3B8DA 3MI3A 3OVQA 3PBVA 3ABSA 3NEVA 3PBUA 1MZHA 4QSHA 3CM4A 1W8SA 3M44A 2BWGA 1S5TA 1KFJA 2CW6A 4YCPA 5IM51 1RR2A 3LOTA 3PG9A 5EBUA 2G95A 2TPSA 3W75A 3VI2A 4ORMA 1TYGA 3LTYA 1YXCA 1IF2A 3VNDA 3W1UA 4BFAA 2YYTA 1RQEA 1JJKA 2A21A 5C6MA 3CB8A 4TU1A 4NZFA 1I45A 1X7FA 1GPWA 3MUXA 5K4XA 5A8GA 3G18A 1ZCOA 8TIMA 1AL8A 3G1HA 5HULA 1SZFA 2V2CA 4NNBA 2BXVA 4NX5A 4UFLA 3EEGA 4NT0A 3STCA 2TYSA 3EXTA 2E1DA 2DU2A 1K3UA 4A2SA 1AW2A 1DJQA 1R2RA 4BWLA 3W7LA 3PBWA 4WZHA 1OK4A 1JUKA 4Z0SA 4YL2A 1QO5A 1UCWA 5FEXA 4GUGA 4CCCA 2DZUA 5HUOA 1XL9A 5IBXA 1HTIA 4MYXA 3C2OA 2C16A 2AGKA 2QUUA 4MOZA 2VELA 3B05A 3G1VA 3CHVA 1TPB1 1E51A 2YX0A 3LHYA 1QDSA 2PC4A 3SW6A 4UTKA 1QO2A 1K8YA 2JGQA 3LV5A 1K03A 4N9BA 1TV5A 2ZRXA 4OV9A 1Q3NA 4I9AA 3DFTA 1LBFA 1WAUA 3HIJA 3P74A 4PFMA 2WSQA 4UNLA 4A21A 3NXFA 3C61A 3CWNA 5LNRA 1K7EA 3WK3A 1KLYA 1LP6A 5G1YA 3UWQA 4ADUA 1LCOA 5D09A 1JULA 1SR9A 3CEPA 5F4SA 4CQ8A 4UTIA 4B5NA 3LB0A 1P5BA 1U5JA 3PVFA 2QUVA 5D2WA 1KM1A 3QQ1A 2J9XA 3FKRA 4JTEA 4JX5A 1OYCA 3HG4A 2VFFA 4ONVA 3BVJA 1RVGA 5G4WA 4LVAA 2QAFA 1OFPA 1SFJA 1SZGA 2BTMA 4K39A 1VCVA 4TX9A 1I4NA 1EB3A 4JTLA 1VRDA 5MHBA 1WXJA 4JTHA 4Q32A 3TR2A 1G4SA 3P8IA 2NV1A 2C3ZA 4M7SA 4O8RA 2Y61A 5FF3A 2NXIA 3V75A 5HWMA 1KA9F 1OFOA 3W1RA 3NZ1A 1ICSA 3NVTA 1JR1A 1OVDA 3ABRA 3UZ5A 3E49A 5K3VA 1QOPA 3BV4A 3G1AA 3TE9A 3TQKA 1W3NA 5LNSA 1WQ5A 2YPIA 2DZTA 2J27A 3W7IA 1UJPA 1PCKA 1OABA 1EIXA 1TTJA 4LRTA 1J2WA 3N34A 4M6VA 2QCNA 5TBOA 3S8HA 4IMDA 4UTWC 2VENA 5AFDA 4HNVA 3UY8A 5LKYA 4FIQA 3M5ZA 3DH7A 1NFBA 3SI9A 4Z1CA 2XN2A 3LBCA 4M7TA 2G97A 3O06A 2ZA1A 4ZMGA 3NL5A 1TPH1 1TPEA 3BG9A 1KM5A 2J9ZA 2ZRYA 3GR7A 4LUJA 3UNDA 5BMXA 2QR6A 4C1LA 4YCOA 3RMJA 4OE7A 4N9CA 2PURA 1KTBA 1TB3A 3P60A 3P5ZA 1HG3A 2WNNA 1WV2A 2DZVA 4DELA 4ADTA 4AXKA 4WXZA 1BWKA 1GWJA 5BMWA 3BGJA 3NPWA 4IPJA 3P67A 3VCRA 4O1AA 1ZAJA 2BLEA 5H2ZA 1P0NA 3NQEA 2O7SA 3L66A 3D0CA 1GG1A 1VYRA 2Z2UA 1XBZA 1LBMA 3TU9A 2QCLA 3FS2A 2NX3A 3EWWA 3W1QA 3M5XA 4MUZA 3QM3A 2QEZA 4DO4A 4YXGA 2C0AA 3BLFA 3W2NA 2GQAA 3W88A 4O1BA 1JCXA 4O10A 1F5ZA 1J4EA 1QNVA 3DFSA 1SU5A 2YCEA 4JGDA 3W84A 4ADSA 3NM3A 1TPFA 1W37A 2YFNA 2CLEA 4FF7A 1ZAHA 4JXCA 3MMTA 2WO5A 2E6AA 3W73A 3GDLA 3AO0A 3MHUA 2A7RA 1U83A 3QYQA 3BO9A 1CX9A 3TC6A 1F76A 1PL9A 5HMSA 1VPXA 1JVNA 1W3IA 1OHLA 1VCGA 3LCIA 1KM6A 5FEZA 5HJLA 1CI1A 3NQ8A 2PRLA 5F2LA 2HTMA 3N73A 1IIGA 3BW2A 4LV9A 4QITA 4RZ5A 4AWUA 2CLKA 4UR7A 1TV7A 1UASA 3H55A 1W3TA 4IXXA 1ICPA 3ANYA 5LGZA 3PC0A 2OX1A 3C6CA 1LOQA 1MO0A 4O28A 5F2IA 4G1KA 4JDYA 1O94A 3M43A 2FPTA 3O05A 3NG3A 3QRHA 1N8FA 4BWLC 2E6YA 3KRSA 2JGYA 4DF1A 3STFA 3TIMA 1SQ7A 2DZWA 1VLIA 1XM3A 4LOCA 1FCBA 5LNVA 2QCFA 4XBKA 5IBXC 2E5BA 2Y7EA 4I7UA 2WQPA 4JTUA 3MP4A 1Q6OA 4TR9A 3LLFA 3C8FA 5DCDA 2V2DA 4NQ1A 4FO4A 3LXCA 1TPVA 2H6RA 4UTJA 3I6RA 4LNYA 4N2YA 3W7JA 4QAIA 1XKYA 3Q2DA 4X22A 5HINA 2QJGA 2C14A 1PVNA 5F4XA 1KM0A 3IIZA 3UWUA 1GYNA 5LHEA 4ZZ9A 3FEMA 2YZRA 1EUAA 3R89A 3V1PA 4AF0B 4QJ1A 1DORA 2AQWA 4ZQCA 1ME8A 2NX9A 3HB9A 1FDYA 1R2TA 3TAKA 1S5VA 2HS6A 2ZFAA 5FEWA 3QW3A 2E09A 3G1YA 5E93A 4K8EA 2A2IA 4DF0A 2VOMA 3LCHA 3EWYA 3UWYA 2FB2A 3HGSA 3M9YA 1ZNNA 4OV4A 5D2TA 3KVJA 1FWRA 2X2GA 3E0IA 3DFNA 3DI1A 1VQTA 1PHQA 1W5MA 1SPQA 3LDVA 1H50A 3GR8A 1LDCA 1XDLA 4HNNA 3W1NA 1PIIA 4A29A 4AB4A 3W7OA 3INPA 4U4MA 4AHQA 4HPXA 4AF0A 2V5BA 1D3HA 3OBKA 3ZR4A 3W7KA 4WXYA 4GE8A 1XDMA 5AHMA 1W5NA 3OA3A 1KM2A 3VE9A 3NQVA 2WOQA 1FQ0A 5DBUA 2A85A 2OJPA 4EF9A 3G0UA 1OFBA 1TQJA 3L5AA 4WX2A 5BOOA 3OG3A 4DPQA 2ISVA 3NL6A 4HNUA 4R53A 4XTDA 3W7CA 3W1XA 1KFKA 4DBEA 4JY9A 3LLDA 1FWSA 1VHCA 1G7UA 2Z6IA 3MW7A 3JR2A 4NJGA 3IIPA 3GNNA 3O6CA 4FX6M 3L2IA 4JDBA 1EPXA 3DFQA 1EX5A 4FNPA 2P10A 1T0OA 3LERA 3JRKA 3M6YA 4S2CA 2RHGA 4IMGA 4XQ6A 1GQNA 5GVJA 1GT8A 5I3KA 3STEA 3CU2A 4N6EA 3NQMA 4ZL1A 3N14A 1LBLA 5CPNA 3DAQA 5CPMA 3NOEA 4QM1A 3KVKA 1NSJA 3L0NA 4UFHA 4ZQRA 4Z08A 3W7PA 4UFIA 2V8ZA 2NZLA 3GKFA 4LU0A 4HSNA 1QPOA 4XWUA 5DBTA 3WJZA 3N19B 3BW3A 4LC8A 3GX9A 3WJXA 4PL2A 3C2VA 4LVDA 4N4QA 3CIWA 5DXYA 1W0MA 4HPJA 4O0KA 5E0KA 3LI0A 5HQEA 3W70A 4MY8A 4AHPA 3WK0A 1GYLA 2PCQA 1UBSA 5KMYA 2ZTKA 4H6KA 4NXKA 1OFDA 4LVBA 4MFDA 2YXGA 1EP2A 1VR6A 3LI1A 2F84A 3I68A 3DHDA 3A22A 1L6YA 1B4KA 3OEXA 3S5NA 3O6DA 1ML1A 3T4CA 3OVPA 3TXZA 4NXSA 5KSWA 3HPXA 1TRDA 5KITA 1LTDA 4JYDA 1BEUA 1YDOA 1I2NA 5KZDA 3NR0A 3S1UA 3EXSA 4MZYA 4LY8A 2J6XA 4XZ9A 3I65A 3W74A 3M5YA 1FWTA 2NUXA 1T99A 1OFRA 4UFMA 1V5XA 4E2DA 2EPHA 1YTKA 5KINA 2EHHA 4S1FA 5AHNA 4PODA 3IEBA 1SW7A 3PAJA 5D30A 4UTMA 3QH2A 1WA3A 3P62A 3UXDA 2C19A 5FF0A 4JTSA 2CZEA 1XI3A 2ABAA 3G8RA 2VFDA 3E12A 4HNTA 4M6QA 3PG8A 3IVSA 3BW4A 4R7JA 1VS1A 1YXYA 3I7RA 3LHVA 3L68A 5AC7A 2Z0IA 3EXRA 4O16A 5KTLA 1I2PA 4O1DA 1MEWA 3MI2A 2Y63A 1O5XA 4GUJA 2X1TA 1P0KA 3T78A 3MJYA 3C2EA 3PSVA 1F73A 3M47A 4IOTA 3W1LA 1S3HA 2Y7DA 4DBDA 4CCEA 4GNJA 1YPIA 3GK0A 3FLUA 3NGJA 3KHJA 3NL3A 3NPVA 5K9XA 1LRNA 1KM3A 1SO4A 4OQVA 3H54A 3M0ZA 4X2RA 1UUOA 5C54A 5D2XA 2H90A 1IGSA 4J9JA 2DZPA 4AH7A 1THFD 1LRQA 2CLOA 6TIMA 4O19A 3ABQA 3SGUA 4IUOA 3L65A 5L6UA 4O50A 4O54A 3NQFA 3RF9A 3MYOA 2VFEA 1QAPA 4FX7A 1VCFA 2BSLA 2ZRWA 4QNEA 1O5KA 4Z0JA 1L6WA 3NO5A 3THQA 5BRBA 1MSSA 3UPBA 2PE4A 3B03A 1DL3A 2O7QA 5I3IA 5DELA 1TMHA 1YTEA 1RPXA 1JRBA 3UWVA 5G2IA 1G4EA 3DENA 4YLWA 3W71A 5EMUA 1H7NA 4LC6A 3SECA 3W2UA 3PY2A 1RQHA 5AYXA 4FIRA 3NQCA 1SW0A 2HSAA 5FESA 1MXSA 3RK8A 3MHFA 2QJHA 2V0TA 3QQ0A 3W2MA 1NAL1 1KTCA 5AYZA 3PSWA 5LSMA 3DBPA 1O95A 2E6DA 4K7VA 5D04C 4CNPA 1X6UA 4WY0B 3HGOA 1R30A 2QCHA 4I7WA 1WOBA 1XFBA 1M5WA 4DF2A 2QCMA 1OYAA 3NAVA 2NWSA 1DBTA 4LV4A 3W86A 2OZ0A 3IVTA 3JS3A 5I3JA 2VFGA 2Y70A 1YXDA 3MP3A 5AB3A 3LCLA 5D03A 3PF3A 2BZNA 1IXOA 4TMBA 2GJNA 3G24A 5FI8A 1OYBA 1A5CA 2V2HA 1QCWA 2FIQA 4O4VA 2Y85A 3PULA 1LOSA 4WY0A 1FDZA 2FTPA 1JRCA 4IJBA 1JQXA 3TFXA 1WOAA 3LV6A 3G8EA 2OMAA 5CPOA 4IX2A 1FBAA 3E96A 3A5FA 1D3GA 2KZHA 2QJIA 1AG1O 2YSWA 3MI6A 1XBXA 1RV8A 1TPUA 3L9CA 3RU6A 4XUGA 2ZRVA 1M7PA 4MVAA 4MZ8A 5K4ZA 4CQAA 1Q6QA 5CGQA 5CG7A 4N02A 4JICA 3WFAA 2WNZA 1P4CA 1K7XA 2QCEA 3EX2A 3W1AA 2QCGA 3N2MA 4WOZA 4C1KA 1W31A 3LRKA 3A24A 3G1FA 1H51A 2HMCA 3CT7A 1G69A 2A6LA 3QSTA 4ALDA 2C18A 4GC4A 1X8FA 2VEMA 3LBMA 3KVMA 1VYSX 3BLIA 2GQ9A 4KFNA 4CLMA 3LRMA 2Q8ZA 1PHWA 4PC8A 1JCJA 3FOKA 5EA9A 3W85A 4AVFA 3R2GA 3GXPA 3L5LA 4N4PA 1SW3A 3GKAA 1FWNA 1BKSA 4NZJA 3T44A 1QPRA 1GVOA 3DXIA 3FJLA
chains in the Genus database with same CATH superfamily
2POTA 1UH2A 3CT2A 2B7PA 1M9HA 3SCTA 3OLEA 3OLDA 1KV5A 3SUUA 1QBAA 5F2GA 1W54A 2QIIA 4Q8PA 4LSBA 1ONXA 2AOSA 2G5WA 3R8RA 2A0NA 3EPMA 4FB7A 3AALA 1MZRA 4DZHA 4JCMA 3VU2A 3LGGA 5D32A 4E8DA 1QJWA 3DX5A 3TLQA 4MIMA 2C8NA 2E25A 1YPXA 2V5CA 3NQAA 3UYCA 3LCGA 4S38A 3WUBA 4MWAD 2Q02A 3BLDA 3U4AA 1TPWA 4A4AA 3R0KA 3BWWA 4UUIA 4HU4A 1E0XA 3B0PA 2PTDA 1U5VA 2OODA 5C70A 4MGGA 4FPSA 4XTIA 1O5RA 8RUCA 1E4MM 1H7RA 3SB0A 3REQB 4PGLA 1DJNA 4UZSA 2V82A 1IEWA 5HNTA 3GH5A 5GJMA 3VABA 3C0JA 2DP3A 3VIJA 3HGRA 4RK8A 3EMQA 1JEZA 3POHA 1FWBC 4M1RA 2ZOXA 3KXQA 4MG4A 3S1GA 3MUCA 4KBXA 4F79A 4M6UA 3NQ6A 5DXXA 3NPUA 4ZO7A 2E9LA 1RBAA 3VZYA 3LCFA 1CXIA 2ZBTA 4DN1A 2DT1A 2BY2A 4CCDA 3WDRA 4NU7A 4P7NA 3E02A 3UWZA 3WJWA 4LWWA 4FHAA 4UTTA 4BI7A 3TJXA 2F8QA 4ORIA 5D2VA 3V36A 7REQA 3GNXA 2CBJA 3PUDA 3R58A 4JAWA 3SCQA 4B2DA 4YS1A 3BV7A 1MVYA 4F66A 5HUPA 1KBIA 1LLWA 2CZFA 1RK6A 5BOEA 1NP2A 2J7BA 4ZO9A 4Q8MA 3CH9A 3QPZA 1TCMA 4AZGA 2BXYA 1G4TA 4POCA 3M6DA 1LM1A 1FRBA 3GDBA 3RRAA 5C9ZA 3QVQA 1TJRA 1HL2A 3BQ5A 1XD0A 2VEKA 1YIXA 1ZLPA 4N9DA 1WPCA 2FFCA 1Q8JA 1EJUC 3C5QA 1HGWA 4V28A 1IGWA 3L67A 3B0UX 1CLKA 1IXNA 1ISZA 2HVOA 3KE0A 1V0MA 5EYWA 4C6JA 3GAKA 4EOUA 1UG6A 4WHBA 1H1ZA 4W5ZA 1FWDC 1MMFA 4PUUA 1B0IA 4XISA 1Q6RA 1K7FA 1CGVA 4E2BA 1HJUA 2TMDA 2WJDA 4GUIA 3B06A 5CSSA 1IR1A 1LQ2A 4O1EA 4DJEC 4IQLA 1Q6LA 1GQIA 2C7FA 4PA8A 2EG8A 2RH9A 3VXGA 4XBSA 1GVQA 3QPYA 4XAGA 1PTAA 1RBOB 3WQVA 3WK1A 5LNUA 2GVEA 2W9MA 3VFLA 4RJEA 4YIWA 4X9SA 3CUJA 4TVCA 4B5SA 2PDUA 5EL1A 4E8CA 1XICA 1ZJAA 5AZ1A 5L9FA 1ZGDA 2WMKA 3Q67A 3Q94A 5G4EA 4W7VA 3PAOA 3GG8A 5AC5A 4QIUA 3ZIZA 3SN4A 2WHLA 4Z2LA 2UV8G 1TV2A 1KFEA 1XIFA 2FYMA 1AMKA 3CHEA 4GUHA 5D37A 4Z2HA 1LQAA 1REQB 4B4FA 1NQ6A 3GQYA 3RCMA 1E55A 2JE8A 2QNEA 4DHGA 4C6IA 1EZWA 1QR7A 3S46A 4B15A 3NJ3A 4YVVA 1XLGA 2E8YA 3CMGA 3MSYA 2Z29A 3W82A 5REQA 1TJPA 4HIBA 4NJIA 4MY9A 3ENLA 3JZEA 3UF9A 4MADA 1ZY9A 3NO3A 3Q37A 5H6HA 3SO7A 5GPRA 4J3TA 3VM7A 4JX6A 4XVDA 1Z41A 3GB6A 2P3EA 1E6QM 4XO6A 4V33A 2OLHA 4AC7C 3WF2A 1EJ7L 1DXEA 1JPMA 2NVDA 2DUZA 4GXPA 4GZIA 1UZ1A 4R33A 2ZYFA 2VFIA 3C3NA 4GUFA 5DF0A 1VFMA 4U28A 1LRTA 3UESA 2VXNA 4PSRA 4DIAA 1S39A 3NYZA 3L4WA 4OU1A 3TJLA 3RG6A 3B97A 2WCSA 3PUOA 2A1YA 3ELFA 2MANA 3WNLA 3BLLA 3SGZA 4ZSTA 4L6OA 4QR6A 4O17A 2Z25A 2Y62A 2QPXA 1A0DA 3VNMA 5A6TC 3BG5A 4PFHA 1KV8A 3TW6A 5FJUA 5BYWA 5CJMA 5FEPA 2E77A 5AYIA 3M0VA 2HBVA 4QDPA 3OVGA 4JEJA 3WD2A 2CLPA 4JEQA 2VZTA 3E0FA 1F61A 1E6ZA 1XCWA 5FA5A 3QN3A 3VGDA 3G0XA 3P82A 1B54A 2G37A 3OHIA 3F4WA 3GIYA 2G4FA 2F6XA 3WL1A 1OD0A 2A3AA 3KX6A 1J11A 1M03A 1CGTA 1JYXA 1MWOA 4G8TA 4MJ2A 1MNSA 1YYAA 3ARSA 4C6DA 1D8WA 3MHGA 4EX4A 1MW0A 4MPKA 1XIJA 4B92A 4QS5A 1XXXA 4I9TA 4JR5A 4GA8A 2FDSA 2J9YA 1H1YA 1AH3A 1I2OA 2YJQA 2DORA 3CQJA 1E0WA 1H49A 3L4TA 1XLAA 2QDDA 3T42A 2WZMA 3TAOA 4GLEA 5FJRA 1AD1A 3RLUA 1RXOB 1DJZA 3H2AA 1JPIA 1PZ0A 1B9BA 1FWHC 1KXVA 3S9YA 3GNPA 2QULA 2NX1A 4K1GA 2WWCA 3KRZA 1V08A 5U7SA 2I1OA 1AL7A 6ENLA 1O68A 4F8XA 5K9CA 3OIXA 1KQZA 5BWFA 4TVUA 1VBRA 4I5XA 1W9XA 4US5D 4EWND 1AZ2A 5C7HA 4J4KA 4QRNA 4H9ZA 1RA0A 1IWBA 1VFLA 3RILA 2ABBA 2HDJA 1YX1A 3PZTA 2Q8LA 1GTHA 2YOCA 2PZ0A 1JCNA 1E6RA 3QXBA 3IK2A 1TQXA 5I3GA 2EPOA 1RZMA 2WQDA 2MNRA 1L6SA 3EEZA 4Q7BA 5AZ0A 1UYQA 1FCQA 2QHAA 3U6WA 2ZZ4A 2HV5A 1PEZA 4I6VA 1I2QA 3WF0A 1GVRA 4LS0A 1BG9A 1ITCA 2CWXA 2UY5A 4MLJA 5D33A 1UA7A 3A6OA 4A3UA 4JTTA 1VKFA 5I00A 5BXRA 2GFTA 4H4IA 4KS0A 2ACSA 2CHNA 3K5XA 2CKRA 1OCNA 1YW1A 4NX0A 3CLWA 5DMNA 1ELSA 4DQWA 1KQYA 3TFCA 2V30A 1CWYA 3R8HA 4UR8A 2E5CA 2GWGA 3ZWSA 2G3JA 4ERIA 1DJYA 5F1UA 1AK5A 2OG9A 3H24A 2ALDA 5A69A 1E6XM 1C9DA 3WY1A 1M6JA 4GK8A 2Z6JA 1GG0A 2Y7FA 3MKCA 1CECA 1UR8A 4E6MA 3AISA 4OGZA 1ZENA 4HVXA 3I7QA 4H8HA 2YW3A 3Q65A 3U3HA 3EX6A 1CTNA 4PCNA 1XSJA 4W7UA 4C65A 3ONCA 3QFWA 3E74A 2GGHA 5J5DA 4DO7A 3GFXA 5HNUA 5PTDA 2HQAA 3USBA 3TK7A 1AW5A 1CT5A 4IFKB 1H7XA 1QNSA 4IL0A 1JGIA 4UMBA 1PS9A 2AKMA 2CC0A 1X1OA 5K7JA 1LT8A 3CAVA 3LD5A 3W1TA 3LPOA 3NNTA 2CLHA 2WSYA 1QXLA 3QOMA 3S47A 3EKLA 4IXHA 2J24A 3UXIA 3QEZA 4J35A 3TCEA 4F0MA 1S1PA 4FNTA 5FL0A 2P1FA 2PAJA 2C6QA 4LY4A 1E4LA 4ERGA 3OQEA 3NTYA 1NOFA 5ABGA 4Q4RA 3RITA 5TIMA 4PTNA 1NH6A 4PSPA 2OQLA 5A5WA 4LUIA 1GJPA 4KGJA 4DZIA 2IKJA 2VJXA 3RX3A 3ME3A 3ARUA 1UH4A 2CU0A 3CTLA 1XHGA 1HP4A 1JG9A 2ZZ3A 1GHRA 1DTUA 3ARRA 3SCVA 1WBJA 3ZR6A 2GVGA 4ZENA 3APGA 2QCDA 5CBBA 1PJ9A 5TQLA 1K8XA 2DSWA 1FDJA 3LHTA 3WFZA 2VRKA 4L4MA 2XM2A 1QHPA 3M0XA 1GTEA 4LF1A 4DBSA 3KOWA 4ZOEA 3SRKA 2PRHA 3FYOA 1PBGA 2JKAA 3AIQA 2FMOA 3UFYA 3GYCA 4AD0A 2WHJA 3R0UA 3DHUA 4WD0A 2V3GA 4W8LA 1WXYA 1P7TB 2Y8UA 4KRUA 3ZZ1A 2DT2A 4ZE5A 4DO6A 2YCLB 3CZ8A 5CZTA 3ITVA 1W5PA 4PTMA 4AXNA 1ITUA 3OIHA 1IXQA 1E1CB 4M3PA 3TCSA 3UVIA 2XINA 2VDHA 1G94A 3GDTA 1SO3A 1LUCA 4DJFD 2WJFA 2CLIA 5D9NA 1VGAA 4XBJA 1NWTA 1WDWA 4F40A 1BG4A 2Z28A 1XUZA 2GJLA 3BSHA 2ZUNA 4ATDA 4PRRA 5A6MA 1O7AA 3PB0A 4RE0A 1EHAA 5EFDA 1XH1A 3C2FA 1Z32X 3CTTA 2JFEX 3CXOA 1MUCA 3HOJA 1ME9A 2IW0A 2XWEA 1TWDA 2QAPA 1E0VA 3SCWA 1C8VA 1YBQA 1HJSA 3QR0A 3A64A 4UTWA 2PTZA 4XX6A 3EBVA 5K9DA 1POKA 3OU8A 2B0MA 1GVIA 1J8VA 3SM0A 2WVSA 2GUYA 3M16A 1G01A 1UD8A 2DQWA 1UP2A 2DV0A 3BAWA 3CC1A 1XQLA 2WMIA 4KETA 4WSKA 5LIXX 1EDQA 3PZUA 4K37A 2VD9A 4U31A 3QF0A 4OHQA 3W1PA 3LHZA 1F7BA 1KB3A 3HMJG 2OSXA 2CERA 3WK2A 4MJMA 4FLRA 1RK5A 3GH4A 3RM8A 2JBMA 1P43A 1D3CA 1E6PA 1XGDA 3UXAA 1MEIA 1OGSA 4GIYA 1E56A 1T8XA 4M19A 3W76A 4GI8A 3NURA 1UR0A 4NILA 2PS2A 2PP1A 3ANUA 2ANUA 5BROA 3GXFA 1E43A 1UOZA 3S4TA 4RNIA 2J8TA 1B90A 4NSBA 1W5OA 1W1B1 4E3VA 3LEPA 1QOQA 2GOUA 1QI5A 4GY7A 4ATWA 3GTHA 1LORA 2OX4A 1V3MA 4NAEB 4Y96A 1UJQA 1E4IA 3W7QA 4Z1DA 1QNRA 3WQOA 1M1BA 4C5ZA 3SBFA 1ICQA 2DH2A 1E0TA 2NSXA 4GCAA 3QW4B 3ABSA 3GHSA 3EKGA 4QSHA 3W26A 1BVWA 1S5TA 1KFJA 4QX4A 2TPSA 4YTUA 1IF2A 3W1UA 4Q8QA 2A21A 5C6MA 4NYUA 4NZFA 3QPEA 1JD9A 5K4XA 1Q65A 3G18A 1ZCOA 4JHZA 3M46A 1ZBVA 1H5VA 2V6AA 1S2WA 3N15A 1ZRQA 3EEGA 3QV6A 1UBPC 4J2PA 1S1RA 2VR5A 2DU2A 4DXKA 2PU1A 3N4FA 4RV3A 4CVUA 2OFJA 3BANA 5CJ5A 2BDQA 4AFYA 3J7HA 2BGNE 1JUKA 4YL2A 1QO5A 4GACA 5FEXA 4CCCA 4MYXA 3L4YA 2VELA 5JBEA 2OOGA 3CMJA 2PC4A 2OYKA 3ANVA 1PZ3A 3M07A 3KWXA 4DUOA 2ZRXA 4OV9A 3DFTA 3B0YA 1LBFA 3U4FA 4PFMA 1XD1A 3ZLHA 3WK3A 2YCJA 1KLYA 5G1YA 4ADUA 4K8GA 2X42A 3N4AA 3CV1A 4UTIA 4OECA 1PKLA 2ZWYA 3PVFA 3D3AA 3N3TA 1D2KA 4JX5A 3URAA 2C1GA 1DYSA 4ACYA 3WUEA 5CCZA 3A12A 1EGMA 1YMYA 3GG0A 4LVAA 4AIBA 2QAFA 1SZGA 2BTMA 1VCVA 1WXJA 2QYGA 1EJVC 3ARTA 2PTWA 1G4SA 2NV1A 1PKMA 2C3ZA 5FF3A 3W1RA 3SQLA 3F2CA 2IPFA 3VZXA 5IOBA 1W3NA 1VEOA 1WQ5A 2YPIA 3MZNA 2F61A 1QWKA 2OQYA 1UJPA 3G77A 1OABA 1TTJA 3N34A 2HXTA 4EACA 3FSUA 1Z69A 5JQ9A 5I78A 3L23A 4IP7A 2VENA 3ZT6A 4NL1A 4HNVA 1DIDA 3UY8A 5LKYA 1ECQA 4JTDA 2B31A 3XISA 4YJ5A 1NFBA 4H2HA 3WL0A 4CD8A 3LBCA 2G97A 2ZA1A 1Q6EA 3BG9A 4KIRA 1KCKA 3R4IA 4J3ZA 4LUJA 7A3HA 1PB0A 2VGGA 2E40A 1QI0A 1TKKA 4BCEA 3VIHA 2PWHA 3PBMA 4OE7A 2PURA 1TB3A 4GYJA 2WNNA 1WV2A 2DZVA 1OGBA 4ADTA 4R5EA 3WKZA 4AXKA 1NARA 2BGSA 4IPJA 3BUVA 3LPFA 1V77A 3SCPA 3T0BA 2BLEA 2XJ7A 1P0NA 1CDGA 1LQ0A 2Z2UA 1Q6GA 2D0HA 4U10A 4MUZA 2QEZA 3HJEA 5T9CE 3W2NA 3KRBA 4A6GA 1MRQA 2FKPA 4Y8EA 3RU8X 5BXTA 2J7FA 3RLGA 1L8NA 4IIHA 4RDYA 3LBOA 1XLDA 4JXCA 2WO5A 4AQLA 2GJXA 2A3HA 1U83A 2XIQA 3QZ6A 3BO9A 1CX9A 3QYQA 3TC6A 1VPXA 4UWMA 2ZXQA 2PD5A 5TF0A 1E6SM 1KM6A 2FHCA 4RE2A 4D72A 3SADA 4YN5A 1UP3A 4WGHA 1CI1A 3KBVA 4HTBA 2E4TA 4AWUA 1HKVA 4HYVA 1B2YA 3LN3A 4OOUA 1HVXA 1ICPA 1J18A 3CO8A 3L7RA 4F3HA 2G50A 2NQ5A 2JQXA 1O94A 3M43A 2FPTA 3CUXA 3LSCA 3NG3A 3MVTA 6PTDA 3TTYA 4EXAA 3D47A 3S6TA 2VI0A 3TIMA 1SQ7A 3TN3A 3WUFA 3WF3A 1FCBA 4UBPC 3ARPA 3RIKA 5IBXC 2Y7EA 2WQPA 4J5NA 3MP4A 4TR9A 5DCDA 2V63A 1VRXA 4IPLA 5D9MA 2QLYA 1Z6KA 4LNYA 4QAIA 1XKYA 1EXPA 2BGQA 2XSBA 1KM0A 1GYNA 2BOFX 1CNVA 3WENA 4IJCA 4DYEA 1TWSA 1VFFA 3BURA 1DORA 5EGRA 1ME8A 3QZAA 3KCLA 3TAKA 4DJED 2ZFAA 3UA3A 2F38A 1UD4A 2X05A 3ES8A 2ZE3A 3HA1A 4HNCA 4K8EA 2J78A 3LCHA 3EWYA 3MMUA 3UG5A 3DI1A 4QE5A 5A8OA 3GR8A 1XDLA 2P3ZA 4PEEA 4AB4A 2I57A 1XYLA 4PMZA 1PX4A 2G4JA 2V5BA 5I2UA 4EAMA 2HK1A 3AOFA 1HNYA 5AHMA 4PMOA 4EPBC 4DJDC 2EG7A 4PRTA 4TX8A 1FQ0A 2A85A 7CGTA 4MKVA 1XRTA 1MFVA 3DG3A 3GUGA 4WX2A 5BOOA 3LA4A 1J96A 3FW6A 3MUY1 1Q2SA 3IANA 3NL6A 4HNUA 4LPCA 5HJXA 4DBEA 4S3BA 4JY9A 4EANA 5EMKA 1G7UA 2VX6A 2Z6IA 2NQHA 3B9AA 3MW7A 4NJGA 3WQFA 4O1FA 1JZ5A 2P10A 1T0OA 3WELA 3M6YA 4S2CA 4XQ6A 4IMGA 4KRTA 2WLYA 5CPNA 2VQTA 4QM1A 4UFHA 3VC5A 2WCGA 3UR5A 3PUGA 2OTDA 5LIYX 1BWVA 1EHNA 4A8LA 4PUMA 4R9OA 4XWUA 5M17A 2IPGA 4QP0A 4RE3A 3GX9A 3WJXA 4N4QA 1W0MA 4ZOBA 4H9UA 4O0KA 4JFTA 5HQEA 4MY8A 4AHPA 3E1F1 3AIWA 4AZ5A 1U5HA 2XHYA 5CGTA 2ZTKA 4LVBA 4MFDA 3IJ7A 6TAAA 1V3IA 2VL4A 5DRIA 1JAKA 3S5NA 2RAGA 1ML1A 3NWRA 1L0PA 3BCJA 3BOXA 5KSWA 3BAJA 5KITA 1LTDA 5KZDA 3NR0A 3EXSA 3VDHA 1TZ7A 5C9WA 2J6XA 2OKTA 3QV8A 4QTGA 4JTRA 3M5YA 4W7WA 1WDQA 3C86A 1FWTA 1T99A 1KR1A 2EPHA 4B5VA 1DWGM 5AHNA 4R7OA 1ISYA 4KCUA 1YRRA 2CZEA 3A47A 2ALRA 4CVWA 1CXFA 1BAGA 4Q7NA 4K3ZA 4B91A 3IVSA 3BW4A 4R7JA 1TMQA 3M0KA 4XAYA 4DM2A 3I7RA 2GGEA 2J6VA 2AKZA 4DBUA 2Z0IA 3TYEA 5KTLA 4PCTA 4GUJA 1BRLB 1P0KA 3UJEA 4HU0A 3CL7A 1Q4WA 2YBUA 1YQ2A 4CU8A 4DBDA 1IT0A 4GNJA 3AIRA 3K4DA 3AC0A 3NGJA 2PGWA 4WDUA 5HXMA 2GOKA 1LRNA 1KM3A 4OQVA 4NZ3A 2FZMA 2HNHA 1OG6A 5A6LA 5I07A 4JKMA 3L4XA 1THFD 1LRQA 3O0KA 4Y7EA 3ABQA 3ES7A 4O50A 3NQFA 3MYOA 5D8WA 3WLKX 1O5KA 4M81A 1XG3A 4LBRA 3UPBA 4G1NA 5I3IA 1YTEA 2EPNA 2WXDM 1JRBA 3OGVA 1R3WA 1EXBA 3KP1A 5AKQA 1H7NA 1T7LA 3MWCA 1VIWA 1BFNA 3SECA 4H1ZA 3AS3A 3GWQA 3VD9A 4D8LA 3R79A 3W2MA 3N29A 3LENA 3DBPA 1O95A 2E6DA 5LSMA 4CNPA 1X6UA 1FA2A 4I7WA 3VA8A 4DZAA 1XFBA 3HMCA 4I9MA 4RNHA 4DF2A 3VOIA 3NAVA 1M01A 1DBTA 1JDEA 3JS3A 5I3JA 2VFGA 2Y70A 3BOFA 3RYSA 2VX7A 1TG7A 1IXOA 4TMBA 2G3IA 5FI8A 5BOFA 5M1TA 4AC1X 3ARWA 4TV6A 1XLHA 4MWAE 1L6FA 3GU2A 4WY0A 3TFXA 2J25A 3LV6A 3G8EA 1J0JA 1BXBA 1FBAA 2V67A 2KZHA 1XBXA 2XZ9A 1RJRA 2VMFA 5FKYA 2VZUA 3L9CA 1O12A 1IZKA 1SR0A 1HJVA 4MVAA 4C6EA 5K4ZA 4Z17A 2ZX7A 5CG7A 3XINA 1L2QA 1DWAM 1ZBCA 4BJHA 1Q63A 3GUWA 1LWIA 2EEXA 1Q8AA 3N2MA 4C1KA 1TMLA 1YKWA 4FR6A 3KL5A 1JAEA 4ALDA 2OSWA 2VEMA 6XIMA 5C9XA 3RX4A 2WMHA 3POCA 1HT6A 3OW1A 3L2LA 3F4CA 4DUWA 3BGAA 4N4PA 3QV7A 1A5KC 3WH7A 3OGRA 3QTPA 3IWPA 1UD5A 4K68A 2ZRUA 4S3KA 4KW2A 3V5CA 5EB8A 3GZ3A 4IWWA 1GJWA 4E4FA 1MQQA 4N0RA 3KDNA 3DFPA 1JD7A 1FX6A 4IQDA 1EBGA 1GKPA 3T7VA 1OB0A 1WE5A 3HGJA 2P0OA 1EJRC 4PH6A 4FNSA 4R27A 3QY7A 1H11A 3B8IA 4DLFA 1W1PA 3N4EA 1J6OA 1D9EA 3FSTA 3WH6A 4YMZA 3EX3A 3IJ6A 2DZXA 2PBGA 1U30A 3H26A 1OX6A 1L8PA 1Y8BA 3G3MA 5IRPA 1XSIA 3LY0A 3B40A 3KOYA 3RO8A 4RDZA 1GOQA 3D46A 3VDCA 1AVAA 1E9IA 4WQ6A 1M53A 1FWWA 3I10A 4RX0A 2FB3A 4OVXA 2O4QA 2PWDA 4B5TA 1A5BA 4FX8A 3EKZA 3CV2A 3ZO9A 1BYBA 1FXQA 4FA3A 5CJNA 1A49A 3C2RA 2E1WA 4UXDA 1FWIC 2F2HA 3NQGA 3SURA 1V3HA 2XIOA 4FNUA 2UY4A 2HBXA 4Z42C 3MUZ1 2HVMA 2J75A 5SWUA 5AVHA 1EOKA 3N6QA 1LG1A 4RW3A 3H8AA 3KOZA 1JNEA 3AFBA 4ZTXA 4DVOA 1V03A 2GVJA 1A5SA 1K8ZA 4JFWA 2QCDB 5CGMA 2Y1HA 1JYWA 4RL3A 1Z89A 2QQ6A 3TR9A 4ZB5A 4GIEA 4IG2B 4W5UA 3ZLGA 2QDGA 1C91A 4AISA 1Z9AA 1KTNA 1WAWA 3BTNA 4IX0A 1EA9C 4UZUA 4HPGA 3CYJA 1XIHA 3NL2A 5BU6A 3EOOA 1BYAA 3N12A 1KGXA 1KKOA 2NLIA 3L0GA 3GXIA 5CPTA 3E5PA 1A5OC 2YDQA 3UG3A 1DP0A 1A50A 1VC4A 4JFVA 3VDBA 1XGEA 5HA7A 4HHLA 1GZ1A 2Y8KA 2PBOA 2J7CA 5C5YA 2J79A 3VFCA 1LUCB 2ADAA 3A13A 1Y0EA 4Q3MA 4KFPA 3NSXA 3P8JA 5I7GA 2BB0A 3QSRA 1KBJA 2IMRA 4IFOA 5HNNA 1GVEA 1H62A 4ZTYA 4LT9A 4IGSA 2CHOA 4PEKA 2XH0A 4AEOA 2FVLA 1FHLA 2R91A 2YDAA 4ZSUA 2QJJA 3MCNA 1L2UA 2V81A 5HWJA 5HNRA 5T26A 3TTEA 3EX1A 5A1AA 5BNKA 1YBQB 3PFRA 3H2NA 2I7GA 3OVRA 2D3LA 1F6PA 1ZJHA 2I5IA 4GI6A 1YLVA 1NTHA 1FWEC 4PB5A 1OWQA 2ZUWA 3EWXA 3P3BA 3SEPA 1Y7VA 1N7KA 4PRWA 3S9IA 2HK0A 1ZS2A 2BVTA 4PMUA 2WMIB 1UWQA 1WYIA 3WLRA 3MA8A 1TWZA 2VVNA 2FGZA 2EO7A 4C7GA 3UZZA 2G3MA 3CEUA 1UWIA 2HE8A 5JMUA 3W2JA 1JYVA 1CZ1A 1NWUA 3VNKA 3FFSA 4X60A 4X2PA 4K8HA 1XUUA 1V6WA 2J66A 1ONRA 1TTQA 2I14A 3UG4A 4B5WA 4JTIA 3ALGA 4NHVA 5AY7A 1RP8A 3CQIA 2X7VA 1LLZA 2RUSA 1YDNA 2QF7A 1NDWA 1FWGC 2X1RA 4UMAA 4FALA 4TMCA 5FJJA 1S38A 2BNJA 3QFEA 3W53A 3VKAA 1YNPA 3EB3A 3LHUA 1EUNA 5DMMA 3RM4A 1TSIA 3MV01 1DQUA 1NVMA 4B2DD 2PODA 3M41A 3TMLA 2DJLA 2XVGA 4MYAA 3UBPC 1VPYA 3ZJKA 3TQVA 1QPNA 4YWSA 4WY0F 1PX8A 3DC0A 4YVXA 2VUNA 3AHXA 4AY8A 1ODZA 3IVUA 3AZTA 3TYUA 4JIIX 1TPC1 3BCDA 3WQDA 4GD0A 2A3BA 1OG0A 3FDKA 3P6LA 1ZJIA 4EKJA 4MM1A 1JUEA 1KCZA 3KTSA 1XYMA 1XBVA 3AXMA 3SZ8A 5C55A 1S2CA 4FNRA 3EDFA 2PDGA 2XUCA 2DVXA 3G1DA 4LVGA 3W2LA 1W9UA 4IT1A 2CZ5A 1JCYA 2PDHA 2R14A 3F03K 3FDGA 3A3HA 5C7VA 3E3HA 4F0HA 2PLJA 1S46A 1XFCA 3GVVA 4C90A 4LH8A 4HOZA 1DQXA 3CLMA 1I0BA 4JTGA 1W56A 3UETA 3IRDA 5DT5A 4CQ9A 3LM7A 4XO7A 2A3CA 1V0LA 1H2JA 3D3FA 3SCOA 3ZFHA 2GSHA 2QVHA 1QU4A 4UC5A 1WP6A 2RDWA 3FKKA 2VDIA 1A5AA 5BXSA 4FOJA 2ZA2A 2YLAA 2Z7KA 3OYZA 2JK2A 3FY1A 1XKJA 4W84A 1KCXA 2NXHA 2WNQA 1DQWA 5FF7A 3MMDA 1SO5A 2D73A 4TTGA 3W22A 3GDKA 3W2KA 4MLRA 4C6QA 1UMLA 1C9WA 2VP8A 6A3HA 4DXXA 3WLOA 4MWAA 5DCBA 2GGIA 1NJJA 1KRBC 4HB7A 1P0EA 4WJ8A 4O53A 1H3GA 1BWLA 1GOXA 1LWHA 3WDPP 3AICA 1A53A 3BGGA 5AC4A 2FDMA 1UKTA 3TX9A 5TD4A 1CGUA 1YPFA 3OZPA 1J9YA 2QW5A 1XLMA 1N8WA 1AQHA 5TAOA 3F2BA 1H60A 5B7ZA 3U2CA 2ZZ5A 4HN8A 1LYXA 4EIVA 3K8LA 1DHKA 3KM8A 3P84A 1ADSA 1EA0A 5GNXA 2F6KA 2DIKA 3ABOA 5CSRA 4GNKB 3DHFA 1DVJA 1WZAA 4A8NA 4W93A 4LANA 1W3KA 2VC9A 4K2SA 3LK6A 4K7YA 3IRSA 3OGSA 3U2OA 1V3JA 3EOSA 3AU6A 4QBXA 3N2XA 1DHPA 2E28A 1F4AA 1EC9A 1RCXB 4UNKA 1HUVA 1W8GA 2E6FA 4C6PA 4GJ1A 1KXQA 2XZ7A 3WJSA 1ME7A 4LEQA 4S3JA 1M7OA 2VR2A 4QE1A 2YYUA 3C52A 3GNOA 1HIZA 1MEHA 2AAMA 4WDWA 3THAA 1GEHA 4CQBA 4OIFA 3BXWA 3UXKA 4YNGA 3S1WA 3P14A 1NDYA 1GOWA 5JIPA 3HG5A 2HPIA 1DJHA 3FA3A 4I5UA 3GDMA 4LRSA 4AEEA 2V3FA 3N17A 4GINA 1KRCC 1B57A 4D6IA 4Q8WA 4GIRA 3VOHA 4KWWA 5AOUA 5D8ZA 4PYSA 5E09A 1NP0A 1UPPA 3PK7A 3VKCA 5KEZA 1BVZA 1DIKA 4AWEA 2QDHA 4F2TA 1WZKA 4JQ3A 4WKHA 3MU7A 5AC8A 3BJTA 4WJEA 1VENA 4PCPA 1XH0A 4JTJA 3PTQA 1SFTA 4NZ1A 2RDTA 3TQPA 4O0ZA 5RUBA 1P1XA 5AHLA 4E38A 4IMEA 4D8AA 3AJXA 3LCWA 2W66A 1Q45A 2ZZ2A 1WCGA 2NUYA 1GZGA 3CV6A 1R46A 1DPMA 2X16A 1E1EA 4ZFMA 5I03A 4QQUA 5T9BG 1OFQA 2CPUA 1VPQA 1CGXA 4I90A 1S2VA 2X1SA 3JVAA 5JH2A 2RGLA 3MSGA 4ZBCA 3I3BA 2PDFA 3UNTA 3LRLA 1NDVA 5GJPA 4GKLA 3RN6A 5EBAA 4XKYB 3VGFA 1LT7A 4AMAA 4DWSC 2A6NA 4Y8FA 3GE7A 5ABTA 2D2OA 3AI0A 4NUWA 3ZS4A 4DI9A 5A6KA 3CPUA 1V6YA 3W01A 1AW1A 4E0CA 3AXKA 4WOQA 4A2RA 4K38A 1OF8A 2W0UA 3S5SA 5EMJA 4CNTA 4BY3A 2NUWA 3QKEA 3UPWA 1E0UA 1C8YA 1W1ZA 2GJRA 3S2JA 2R9RA 4XVEA 4ZQMA 4P7RA 1K1DA 4IFKA 5TNVA 1WDDA 2H8XA 2FTWA 2H3DA 5E70A 1SYTA 4MJZA 3NYDA 1OF6A 4IP5A 4CU6A 2I5QA 2Z1XA 3ARXA 3HQPA 2YKKA 2QV5A 4A22A 4AWTA 5M03A 2ATSA 3TC3A 4H6RA 2WZTA 3DI0A 1OX4A 5A6SA 4KWOA 1F3EA 4LTSA 2DY3A 2OEKA 1IQ8A 1DIOA 4LUYA 2TAAA 4I8DA 2Y89A 3H2FA 3VTRA 3E9AA 4GC3A 3T55A 4O18A 3TUUA 2R1MA 3WZ0E 4C6BA 3GNDA 3VNZA 3AHYA 4M5PA 5HMFA 5ABHA 2EG6A 3NSMA 4BI6A 2PTYA 4N6FA 2ZX5A 1X1ZA 3AXXA 1JDAA 5I09A 4Y9MA 3MKVA 3ITCA 2ATMA 4IGMA 4J28A 3S83A 4F48A 2EF9A 3QMRA 4JIPA 2ON3A 3WD3A 4WSJA 3EWZA 3O63A 3IPWA 4C5YA 4EK7A 2PTXA 4NNAA 4HKPA 3DZ1A 4B5XA 4QGCA 2XFWA 1KM4A 4DEFA 3DIPA 3QMSA 1FY6A 4R85A 2QPSA 4S3GA 3KRUA 2XU2A 4K36A 2DSVA 3PM6A 4JIHA 2OU4A 3ONBA 1GOMA 4V1XA 1UWTA 2H3BA 3GRIA 3P61A 2GSJA 3NVDA 2YL9A 1R87A 1B31A 2ZIDA 3F1QA 3T40A 2Z2AA 4LS1A 2ZZ1A 1R9XA 2OEMA 5EKYA 4F0KA 1P7TA 4H41A 3SY8A 1P1MA 3M0JA 2YCLA 3A5VA 4Z2IA 1QRQA 2VCCA 2YW4A 4JQ4A 1QNQA 3PBYA 1K70A 3KHDA 1SZRA 2BODX 1E1CA 5CC7A 1H7OA 3DU0A 1JCLA 3BLKA 1RJPA 3K4WA 1S5WA 5F4WA 3QBUA 4Z2GA 3LXAA 4ICCX 2QZRA 4JD4A 4L4PA 3S5YA 1AUSL 2FZNA 3EA3A 3K30A 5BU9A 1H61A 2Z2BA 3B8WA 1VBGA 1I1WA 3P2VA 1F8IA 3IIXA 2PRMA 4RXFA 4S3FA 3PS7A 1HO4A 4ZXLA 1SFLA 4AAJA 3O15A 4PMQA 1W1VA 2EAWA 4ZO6A 3WLJA 3LCXA 2O0TA 1B3OA 4CN4A 1Q7ZA 4LB4A 1RJQA 5M3WA 4US5A 4HQVA 1EBHA 1BVNP 2J74A 2QMJA 3AIVA 4L9ZA 5G1TA 2WC7A 3IJ8A 2PI6A 1R9YA 4L1GA 5FJOA 1A47A 1YADA 2OZTA 4RZ4A 4AY7A 5HWNA 2Y5SA 5B7YA 1QASA 1HL8A 1MUMA 3KFTA 2JF6A 2VKZG 3CPGA 1IV8A 1W9DM 2PEVA 1YNYA 3B8DA 3MI3A 4TVDA 3AIUA 5KETA 4PBGA 1MZHA 3CM4A 8XIMA 4YCPA 5IM51 1RR2A 3LOTA 4GBDA 5E6ZA 3W75A 5FAGA 3VI2A 3LTYA 4JIRA 4BFAA 2YYTA 3CB8A 2XG9A 1S2AA 4GOAA 1X7FA 1J5SA 4YHEA 3D6NA 2YIHA 8TIMA 1K4GA 5JH1A 4NX5A 1HXJA 2YA1A 4LBUA 2VGBA 4GABA 4NT0A 2X1IA 1DJXA 2OB3A 4QG6A 1K3UA 1R2RA 1UKQA 2Y5JA 1EYEA 5ABFB 2VHLA 3PBWA 3ABXA 3L4VA 3T05A 1DWFM 4GUGA 2NQZA 3MTWA 2AGKA 4MOZA 3ZVHB 3B05A 3G1VA 2YX0A 1OEPA 1QDSA 4O8AA 4XZWA 3HPFA 1PWLA 3H12A 3CUHA 1SJDA 3ZJ6A 4I9AA 4XD6A 2I5GA 3TONA 3DHPA 3CZEA 2WSQA 4UNLA 4A21A 4D6EA 5LNRA 1H0IA 4BQ3A 1FFQA 1AJ0A 1K6WA 1NY1A 4ZA0A 3WEOA 2ACRA 3OYXA 5F4SA 3KDOA 2YDSA 4B5NA 1KM1A 1EQPA 1XINA 3BE7A 1OYCA 2DVUA 2VFFA 1EIBA 3EMCA 1ZPTA 2PDIA 4GH3A 1I60A 2ZE0A 5G4WA 2GVYA 4KEZA 1G9HA 4K39A 2BHYA 3CAKA 3UR7A 3FYYA 1VRDA 1E4NA 4HMCA 4ZE4A 3TR2A 4MSSA 4XZMX 2A79A 2NXIA 2ONEA 1KA9F 1ICSA 3NVTA 3CASA 3BV4A 3NFUA 3TE9A 3TQKA 1FKWA 2NV9A 3K8KA 3NZQA 4PUWA 2DZTA 1HKMA 4YVPA 2QCNA 5TBOA 2FZ8A 4WLCA 3S8HA 4IMDA 1BQCA 1A0EA 3O0FA 4FIQA 2C1IA 3QQWA 4ML4A 2QMKA 3DH7A 4LAKA 4HYRA 1GZJA 4Z1CA 1M68A 3WQ8A 3KBNA 4M7TA 2PF0A 3VMNA 4CEUC 1TPEA 1TFVA 2XIJA 1KM5A 4M82A 2ZRYA 3GR7A 2YCKX 4C1LA 4CD5A 3GFZA 1KTBA 2YLLA 3P60A 1UW9A 3P5ZA 1HG3A 1F4HA 1DJWA 1QNOA 4LEFA 3VC6A 5BMWA 4H01A 3P67A 3VCRA 4O1AA 1ZAJA 3NQEA 5JVLA 4H00A 1GG1A 1XBZA 1LBMA 2FGLA 3BLPX 2VT0A 4P8WA 3B9EA 3LMYA 2FFIA 4UQAA 3EWWA 3QM3A 2W27A 4NG3A 1W9VA 2C0AA 2WBKA 1JCXA 4NASA 1F5ZA 2Z1SA 4MKSA 3W84A 1OM0A 1JDCA 1CEOA 3MSDA 2P0IA 4C6OA 1TPFA 2YFNA 3RXZA 3E5BA 4DJFA 1PSCA 4FF7A 3MMTA 3W73A 2GK1B 2OZ3A 3GDLA 1UQYA 3MHUA 1KGUA 1SJCA 2A7RA 3C8NA 3UZWA 1W3IA 3LCIA 4J3XA 4IPPA 5FEZA 3QY6A 5HJLA 3CK5A 2PRLA 5F2LA 4IJRA 1ITQA 1VD6A 4LV9A 4QITA 4RZ5A 5GNYA 2CLKA 4UR7A 1TV7A 1UASA 3EZ4A 3M4HA 1XIDA 4LBSA 3H55A 3WNPA 1V8EA 5LA0A 3PHAA 3S2LA 1MO0A 5F2IA 4XSMA 3QRHA 1PTDA 3PANA 2BOEX 1DXIA 2XVNA 4ACZA 4BWLC 5D9PA 1B3XA 1BXNA 1VFOA 2I17A 4GXWA 2JGYA 3RCYA 3TYCA 2OZ8A 3HZ3A 4GIAA 4JN8A 4PN2A 3SN1A 2GGJA 5LNVA 1M65A 2Z00A 2E5BA 1B30A 2QUMA 3RUBL 2DZAA 4AD1A 2B81A 3LLFA 4HZ8A 5E9XA 2V2DA 1ODUA 1QOXA 2G8ZA 2INZA 4FO4A 4D6FA 3LXCA 1TPVA 5M2FX 4HBKA 3ITOA 4N2YA 3W7JA 1RY0A 4X22A 2QJGA 2C14A 4HNOA 5F4XA 3IIZA 1DWIM 5LHEA 4ZZ9A 3WMBA 1CLVA 4YPJA 3I3DA 2PSNA 3IUIA 4JZ5A 4AW7A 4GZJA 2FVKA 3CGTA 3G1YA 3WH8A 4D6DA 1L6GA 4DF0A 1PIFA 4NKCA 3UWYA 3HGSA 2DSKA 3M9YA 1YE4A 4OV4A 4DY1A 3GC2A 3U7BA 2X2GA 3E0IA 4GO9A 1F9CA 4U2YA 1IEXA 1W5MA 1PHQA 2D3NA 1RSCA 1H50A 2IPWA 1R6WA 3OQ8A 1LDCA 4EWJA 3W1NA 5BZAA 2ZX9A 2V69A 3E38A 3INPA 4U4MA 2J7HA 3ZR4A 4WXYA 2INFA 1S3TC 5JUVA 4GE8A 3CL6A 1HL9A 1KM2A 3VE9A 2WOQA 5DBUA 4EF9A 3PTMA 2VD8A 1TQJA 3I3EA 2PP3A 1TWIA 4EPEC 3OG3A 4MB1A 3DC8A 1R3YA 1PTGA 4JKLA 1EKOA 1JPHA 3W7CA 1KFKA 1BGAA 3LLDA 1FWSA 2G41A 3VKKA 3R25A 1ZCCA 4GX8A 2OXNA 3FXYA 4LCSA 3GNNA 1QK2A 5AVNA 3RPMA 3O6CA 4JDBA 3L2IA 4LCRA 1XLCA 1PKYA 3LUTA 4AY1A 3VO0A 1V7AA 3JRKA 2WPGA 4BQ5A 1R3VA 3H2CA 3T09A 3CU2A 3W27A 1UD2A 4A3RA 1LBLA 3P0WA 1UPMB 3DAQA 1W3JA 2OELA 3ORWA 3G2GA 4GVGA 4IHCA 4ZQRA 1VJZA 2E0PA 4B90A 2V8ZA 3NDZA 3GKFA 4LU0A 1JZ4A 1BYCA 4HSNA 1BF6A 1K9EA 4ATLA 2ZUTA 5DBTA 1YNQA 3AUJA 4NY2A 3C2VA 2V5JA 3WBYA 5DXYA 2E8ZA 4IGNA 5E0KA 4PUNA 3U48A 3LI0A 3KLLA 4L5ZA 3W70A 4BQ4A 3WLLA 1UKOA 1GYLA 4GY0A 2BBFA 3PZQA 1K9FA 4CD7A 4BEQA 5KMYA 4NXKA 4C60A 2PDLA 5KZ6A 1E5NA 1EP2A 2WBGA 1P48A 3I68A 2OGJA 3DHDA 3A22A 2GQ3A 2X8RA 3OEXA 1QPKA 3O6DA 1W1TA 2AL2B 4NXSA 5B80A 3HPXA 3C0QA 4JYDA 1YDOA 5FIPA 1I2NA 2JF7A 4MZYA 4GYKA 3N11A 4XZ9A 1QVBA 3CMFA 3F5LA 4IMAA 3W74A 1PXGA 1EO7A 2NUXA 3WFLA 4UFMA 1V5XA 4E2DA 3EMZA 1DIEA 2EHHA 4UTMA 1WA3A 3VDAA 1ONEA 1Q13A 3QR3A 4DYKA 3STPA 4HNTA 3E12A 3LZ3A 4KF1A 4U5KA 4M6QA 3PG8A 1OT2A 4R88A 4Q8VA 5A3HA 1W2PA 2ASHA 4DZ5A 5AC7A 3EXRA 3SUTA 1RUSA 5IFTA 1I2PA 1TWWA 4IIFA 1MEWA 1XR2A 2E7FA 1A0CA 3UYIA 3T78A 2XM1A 2YB4A 3IJIA 3QHNA 1HKWA 3FGCB 4GG9A 2ODOA 3NZPA 2O56A 3N2BA 3GVWA 2VURA 3NL3A 3B9NA 1CB2A 4MB5A 5DO8A 4KPLA 1SO4A 4GCXA 3B9DA 2P8BA 1DE6A 1LG2A 5CH9A 3TW9A 2ACUA 3ID7A 1UUOA 5C54A 1JFXA 4MWAB 1IGSA 4AH7A 1UROA 5CSYA 6TIMA 1TJ1A 4O19A 4IUOA 2EPMX 3RF9A 3AROA 4XKMA 1QAPA 2PDMA 4FX7A 2VRQA 1VFSA 1BSIA 1KGWA 1BRLA 1BSLA 4QNEA 1MW1A 2YBTA 3BICA 1L6WA 3NO5A 4L9XA 5DELA 1TMHA 1RPXA 1TR1A 8A3HA 4OUEA 3KTXA 3K46A 1G4EA 3DENA 3W71A 2PDQA 4HHMA 3VIGA 4Q7IA 1EZ2A 4GYPC 1IT8A 3PY2A 4PMXA 4NAFB 4FIRA 3NQCA 2HSAA 3KS6A 2BVDA 1MXSA 3RK8A 2QJHA 2V0TA 2QF8A 1IEVA 1QTWA 2P5NA 1JZ8A 4QG9A 4U3CA 3WLMA 3U9IA 3HGOA 2GDUA 5AECA 2YB1A 3RRXA 3W86A 4AX6A 4BHYA 2GDVA 1YXDA 2DT3A 2BP1A 3ZMRA 3LCLA 5D03A 2KX9A 2NT0A 2FH8A 4RNJA 3PF3A 2HPMA 3CZLA 1E73M 2GJNA 4A3QA 1OYBA 4ERAA 2FIQA 4OFCA 2J7DA 4LAOA 4R9XA 3H22A 4LGXA 3A3WA 1JRCA 1NQKA 1JQXA 1KFWA 1WOAA 2OMAA 1EJWC 3QC0A 3AS0A 4IX2A 4WCJA 4C6NA 2QJIA 2HROA 1HKKA 3ARZA 2ZVIA 3N18A 3RU6A 4XUGA 5EFFA 4QS6A 1M7PA 3W4RA 2CBUA 4GMEA 4H8NA 1X97A 2Q8XA 4CQAA 4YYFA 5CGQA 1ESWA 1A4MA 2BXZA 4AZ6A 4ZB2A 3WSUA 2QCEA 3EX2A 3W1AA 4DJEA 2QCGA 2QXWA 3USZA 4MB4A 1W31A 2IKIA 2ZWZA 3HQOA 1H51A 1EC7A 3UCDA 1G69A 2GSEA 2A6LA 4GC4A 3W29A 4FI4A 3EA1A 4AZ7A 3FVMA 4KFNA 3BLIA 3LRMA 1BD0A 2Q8ZA 1VFUA 2XPKA 4DWSD 1MQPA 1TZ9A 2WM1A 3W85A 1ZU8A 5HAOA 3TN4A 3GXPA 2PDNA 2ZC8A 1GVOA 3GXTA 1AJ2A 3IJDA 2Z27A 3BSMA 1IR2A 5AN7A 4WF7A 1PPIA 3SSZA 1TUFA 3A9IA 1UB3A 4CUCA 3O16A 1XLEA 1KNWA 1QWGA 4C1NA 1QPQA 2OLSA 1E9ZB 7ENLA 3KLKA 4XUYA 1H7WA 2CIPA 2YGYA 4XB3A 1SFSA 1E40A 1I8JA 1G1YA 3IGXA 3AZSA 4S3AA 5ECVA 1V0NA 3PNUA 4Z1BA 1EF2A 2PCEA 3B0XA 3AIBA 1NOWA 3O6YX 3KOFA 1TTIA 1W5QA 2EGZA 4FK9A 3HJZA 4MJ4A 3RJXA 3ZVIA 3AAMA 4XAZA 4PUJA 4MHBA 4G6CA 3N2OA 6ALDA 2R1KA 3BZGA 2WK2A 3FX4A 4D1IA 3ABZA 2FPYA 4HJWA 2J7GA 3AS1A 4W86A 1G5AA 1BPLB 3ATYA 4UCGA 1YDVA 1HGYA 1T41A 4C6FA 3URBA 3G3DA 2AGTA 5ECUA 2BHZA 3H6OA 1EEXA 3R8GA 1OX4B 2IPJA 1CGYA 2D0GA 5A8PA 4R3UA 4J3WA 3R12A 4PUKA 4UQ9A 3S6OA 4E4UA 3QHOA 1H4PA 1O6IA 3ZSSA 2VZSA 4U2ZA 3UZYA 4IQEA 3C0SA 2XFFA 4JL2A 1GONA 4G56A 3MDUA 1XRVA 4H6EA 2Z7GA 2CLFA 3NDOA 3APYA 3T6CA 4AYGA 3GHTA 1NF0A 2X09A 4MKNA 4X0NA 5I06A 1TJ2A 1TA3B 3ARVA 3W02A 2CZDA 4Q4SA 1O60A 2VYOA 4G7EB 3VOFA 4ZCWA 2VCAA 3O1NA 1XV8A 3TXVA 3HPAA 3TJIA 3HPZA 5HMEA 3VX1A 3EPOA 2VX5A 4S2BA 2GL5A 1P0DA 1P0BA 2NLYA 1W3HA 1WUFA 3TROA 1HZYA 3THUA 2R8WA 5DY2A 1F05A 2FJKA 3QR1A 1GQJA 3LTSA 5LGXA 4BK9A 3S1XA 3MUIA 1A4LA 4IG2A 4O13A 2A4AA 3DFOA 5DRCA 2FJUB 3LXBA 3MUAA 3BK0A 3RR4A 3L0KA 4HPHA 3TMQA 4GGBA 4ZB0A 3G1XA 4DPPA 4R7WA 4JOMA 3A4XA 1J12A 4KCWA 4MNLA 4OJYA 5ABEA 3PWAA 1NELA 2EKCA 4DI8A 9XIMA 2WKGA 1NM9A 2PB1A 4P7OA 3HPSA 4LVFA 3LS9A 1OBAA 3MBDA 4GHRA 1KC7A 1XC4A 4FEZA 3M64A 3UZXA 3W7GA 1QATA 5A8MA 3BL3A 2QV4A 3CUFA 4IMCA 1O1HA 2BY0A 4UOQA 3UR2A 1AD4A 3TN5A 3CIVA 3VIMA 1CGWA 3Q4DA 4FOUA 2D1ZA 1OFAA 1ISVA 4IPIA 4IIDA 3MMWA 2CBIA 1ISXA 1CBGA 1E5JA 1KFBA 3TWBA 4AD2A 2O9TA 2JKPA 4QISA 4XAPA 1R7AA 3GBDA 4I8YA 1ZP4A 3TC7A 3PP7A 4FF5A 1VB9A 3H2EA 3PB2A 1XYAA 1MNZA 3GH7A 3IAPA 4UR9A 4P8VA 1Y5VA 1FCVA 3TKFA 3TW7A 4AG0A 1WKEA 3AJ7A 1GVFA 4GKTA 4FXRA 1E6NA 2OWXA 2VZVA 3GAYA 4GXMA 4WSHA 3STGA 4ROPA 1G0CA 4PMDA 3TZFA 1ZHAA 1V02E 2Y4SA 5HATA 2OWCA 1AQFA 3W7EA 1OZMA 1SO6A 1DJIA 2PZNA 2QKFA 3H4WA 5G2WA 4WUIA 6REQB 1KW1A 2UY2A 4UTFA 3WF4A 4F0SA 1VYPX 1CB7B 3TLLA 1VP5A 1OSEA 4JIQA 5HR6A 1YTDA 1XG4A 4KWVA 3VD4A 3AUOA 2P88A 1J10A 1XLFA 1R3SA 4ZFCA 3AMDA 5K2ZA 4LXFA 3KP0A 4UFJA 4MZ1A 1US0A 1UC4A 2WVVB 4BF9A 3VGHA 3VAVA 3GYEA 2BX7A 3CUZA 3UP8A 3OO2A 3FEQA 1PDZA 4LYQA 3WLQA 5E6YA 1H7PA 1MDRA 4EAYA 4DWSB 4FXJA 3QKZA 3S6DA 3H4XA 3KOXA 1FWFC 4HA0A 1ZAIA 3KVLA 2GVLA 2E68A 3A21A 1KRAC 1OX5A 1T96A 4QCFA 4O11A 1Z42A 1WDPA 3KBMA 3R94A 2XSXA 5BWAA 4QJ5B 3EB4A 1A5UA 3CAQA 1WKYA 1CXEA 3C56A 4UTTC 2OYMA 1SMAA 2C1HA 4UQBA 1V93A 1J5TA 4GNVA 3S0CA 1GJUA 2A7PA 1UR1A 2V5DA 2VX4A 1R7OA 1ZL1A 1JNDA 2ZUSA 1KBBA 2ZUVA 4D1JA 3MJMA 2V3DA 3FIGA 4Q8NA 4LFYA 5FJIA 3GR4A 3B0VC 2W61A 4PTVA 4D6JA 2DZSA 4FSAA 3VOCA 4AHOA 2A7NA 1E1FA 1B3VA 5AHIA 2IQ0A 4LQ1A 4GX9A 3ITXA 2IKHA 1XH2A 2L5HA 3NIYA 4P61A 4A8RA 1JI2A 3WQ5A 3P0XA 1UWUA 3P5YA 4BI5A 3DFYA 3WD0A 3L5MA 3VUPA 3RDKA 2CFFA 1N55A 3E2VA 3LTPA 2GPTA 5J5RA 5I0DA 2SFPA 3ZYZA 3WQEA 3W6LA 1SSDA 2CITA 4LYKA 4OBSA 3MS8A 1YHTA 3BAIA 2ZQ0A 4HSOA 4P7LA 3V5FA 1P6BA 4JY8A 4NZCA 1WKDA 1UZHA 1SZEA 1K77A 1W1YA 1Q5MA 1OJXA 3TSDA 4EXBA 3QGAC 1UR4A 4GY1A 4KKXA 4YWIA 2O55A 3LGEA 2H9AA 1TIWA 2X2YA 3SIMA 4TIMA 3XIMA 2AMGA 2V9DA 4JTFA 2PGFA 4OT7A 4JTCA 2F7FA 4KGLA 3WDIA 4IIEA 1XS2A 1ZBKA 2C79A 4ZQOA 4REQA 4IZGA 2Y5EA 4MAVA 3ZXWA 3G1SA 4RXGA 2X40A 2GLKA 3PZNA 1T6MA 3WJYA 1ADDA 3RPDA 2E9BA 3WBEA 3EDJA 4DBWA 6XIAA 2OPJA 4PULA 1W1IE 1TPDA 4MB3A 3MYPA 3U8GA 3GTNA 3U2EA 3W38A 1R47A 5EMYA 1OC7A 3N3MA 3GC5A 2NT1A 3UZJA 5D2YA 3TA6A 2CLLA 4E4PA 3MKKA 5H91A 1F3WA 3AYTA 3T0DA 4I7VA 3P80A 1U33A 3FAXA 3LNPA 1FCUA 4Y9AA 5FSDC 2HEJA 1JZ7A 3N9KA 3HO8A 5E0CA 2FZ9A 3SRHA 2GUUA 2FVMA 3QZEA 1TX2A 4GFIA 4CGTA 3V0TA 3VGBA 1UWSA 2Y0FA 1J0YA 3IARA 3CWOX 3UG8A 1W9BM 2EXOA 4FNQA 3S5OA 1H1NA 3AHZA 3KL3A 4U3AA 2Y6ZA 1XIEA 3VIKA 4HA3A 2QPUA 3RPTA 3S42A 3OPSA 2YBVA 3W7RA 2J8GA 4C7FA 1JF6A 3IGSA 1B5TA 2B7NA 4U33A 4M29A 3MSRA 3L12A 3IGUA 5J8LA 3WO8A 3NUKA 1G4PA 4HGXA 3FJ4A 4J7RA 4OBRA 3GLCA 2ZA3A 4OBTA 5D02A 5AYBA 1MYRA 3CIXA 3UVAA 1OQFA 4XZIA 3UGRA 1TVNA 2AL1A 1K02A 1LL7A 3K2GA 4D2JA 3SFKA 5LIUX 4WVXA 3ITLA 7TIMA 4NJHA 2G3FA 3LX9A 2PP0A 2PDYA 2PPGA 3R0DA 4ZQPA 1J6PA 4P5UA 2Y88A 3N9RA 2NSOA 4ACZB 2I16A 2VFHA 5G2HA 1DWHM 2PC8A 3S5ZA 3H53A 4GZEA 1GORA 2IXVA 3GHRA 3IS4A 1FHVA 1UZDA 4X63A 3PBGA 1VZWA 2A3EA 3P81A 3TSMA 3TOPA 3DKLA 4UFKA 1RQBA 3DKJA 5C2XA 2XIIA 5CEWA 1O5QA 1D8CA 4WIWA 2ZXAA 3V0SA 2R94A 4Q4PA 2OVLA 3R13A 5FACA 2HWGA 4OZOA 2H8ZA 1EOMA 1J0IA 1TV8A 2PA6A 1TO3A 4O0QA 1WB0A 5BXPA 4C6LA 1SZNA 1TIMA 3RJYA 5I3FA 3DEQA 4XKYA 4HT3A 4E3TA 1S2UA 3IJ9A 3QHMA 3RHGA 1RLDA 2VUYA 4GRSA 3WD1A 1H63A 3B04A 2RDUA 1VLWA 3SQSA 1ZQ5A 3OZYA 4LUTA 4RPQA 3O07A 1QI3A 2LLEA 3P93A 3VCCA 5I79A 3FCPA 1LZOA 3ZT7A 1CIUA 1XYBA 2VEIA 3SDOA 3W24A 1UUMA 4Q4KA 3UWEA 3ERPA 1R5YA 3T1GA 3QV9A 3W25A 1JGMA 1KLZA 4KERA 4BA0A 4HD5A 4MUPA 2FLIA 5E0FA 1RH9A 1V0KA 3AMKA 4QAWA 5CC5A 5I6SA 4WEVX 4Y9OA 3QTGA 5FL1A 3PUEA 3R10A 4RE4A 1XYZA 3VIFA 2OO0A 4IIGA 2POZA 2TRSA 4RCXA 4JX4A 4HU8A 2ZUMA 1IEQA 3DDMA 3QLLA 4US6A 2ISSA 3VGGA 3F2DA 3TA9A 4JS3A 3UY7A 1KD0A 1C3FA 3NQ7A 3MV11 2XN1A 3GM8A 4CNSA 1XRFA 1UQZA 5BW6A 3PJWA 3BC9A 4DYJA 2DUXA 3NQDA 4LS2A 2V3EA 1G7VA 1HO1A 1V02A 4EPDC 1CYGA 1DKWA 4D6HA 3FN9A 3MBFA 2Z1WA 3MZ2A 5LYRA 4XV0A 1R38A 2F9RA 4M8UA 3KAOA 2VTFA 3OOQA 4AIUA 3TQ0A 4UCFA 1AMYA 4PBEA 4QG8A 5HR7A 1DXFA 4DO5A 3L4UA 1KXTA 4XK2A 2IXUA 1IZJA 5AC6A 3SUSA 3OTRA 1GQLA 4V1YA 4GQQA 3RFAA 4J2MA 3T8QA 3TV8A 2YZ5A 4L6HA 2ISWA 2OCZA 1Z48A 5G5IA 1TZZA 4AD5A 3LMZA 5A6JA 1T8QA 3CNYA 1KCLA 2WV8A 3GSMA 1XIIA 3SCNA 3TSBA 4JHOA