4NJJA

Crystal structure of quee from burkholderia multivorans in complex with adomet, 6-carboxy-5,6,7,8-tetrahydropterin, and manganese(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
209
Chain Sequence
TYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGENGGKFKDADALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFGIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7-carboxy-7-deazaguanine synthase
publication title Radical SAM enzyme QueE defines a new minimal core fold and metal-dependent mechanism.
pubmed doi rcsb
source organism Burkholderia multivorans
molecule tags Lyase
total genus 66
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.3.99.3: 7-carboxy-7-deazaguanine synthase.
pdb deposition date 2013-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4njjA00
1HO1A 3O6YX 3O05A 3W85A 2I14A 2QCGA 3FFSA 4TU1A 3W2NA 3ANYA 1XCFA 4OV4A 3VE7A 5DY3A 4Z0JA 3WJYA 1OX6A 2X16A 1EUNA 1P1XA 3T55A 3NQVA 3G1AA 1W3NA 1OYAA 2VC6A 5FF4A 3TIMA 2CZEA 2YR1A 2VENA 4O12A 4QITA 1W3IA 2YSWA 3NZRA 4O52A 4DO5A 4KKXA 1OX4A 4FX8A 2CLIA 3HQ1A 5FEZA 2R14A 1U83A 3TMLA 5FF3A 3UXAA 4A2SA 1VJIA 5FI8A 1BEUA 2TRSA 3ZFHA 1EA0A 1FWWA 3CIWA 3EXRA 2Y7EA 2PC4A 2ZRYA 5IM51 1XUUA 2CZDA 2QAPA 1FCBA 5KINA 1LTDA 5AHEA 4K39A 4IOTA 4O19A 4HT3A 3P8JA 3TUUA 4E2DA 3CIXA 3UWUA 4XQ6A 3E9AA 4IMGA 3WJWA 3GDTA 1ME8A 1EEPA 4RZ5A 3IGUA 2QCLA 2XN0A 4R53A 5HR6A 1K8YA 3ZS4A 2HSAA 4NU7A 2E09A 3JR2A 4A2RA 4XKYA 2FPTA 3TXVA 5AHMA 3OVQA 4NX0A 4CQ8A 3OIXA 5G5IA 2QKFA 3LI1A 4DELA 1QNVA 2Y89A 3U2OA 4MJMA 1ZJIA 8TIMA 3W2JA 3W9ZA 4QISA 1EB3A 3M5VA 2Y62A 1IXNA 4AEOA 2FB3A 2WNQA 3AJXA 5CSRA 3IVSA 4UNLA 3DHDA 1EUAA 3W7MA 3N34A 2BSLA 4IXXA 4IQLA 1SFJA 3EXSA 3QSRA 5D30A 4MZ1A 3K30A 5D38A 2CZFA 1OABA 4ADTA 3LCLA 1Q6RA 4OV9A 1FXPA 3CLMA 2ZTKA 5K9CA 3C4UA 3TX9A 1MSSA 4A29A 3I7QA 3NQ2A 3A22A 4GJ1A 4IGHA 2QJHA 4GXMA 4N4PA 3WJZA 4OU1A 3S5OA 3HG4A 3GR7A 1LOLA 4FEZA 1GPWA 1RQEA 2B7OA 1AW2A 1UCWA 2LLEA 3G3MA 3QMRA 4JYFA 5HWJA 2CLMA 4Y6GA 1K02A 1JR1A 3CPRA 3W2KA 1SUXA 1LRNA 2NUXA 3UWYA 3HB9A 3TW7A 1ZCOA 4DPPA 3S8HA 3SFKA 3WK2A 3N73A 5AYYA 3RK8A 4X3ZA 3LHTA 2Z2UA 5DBUA 3TV8A 1M6JA 4M7SA 4O13A 3W1XA 4M6QA 3PULA 1H7RA 3IIZA 4M19A 1WXJA 4LNYA 4LVDA 2B7PA 2WOQA 2C0AA 2ZRVA 3LCHA 1O4UA 3MBFA 3KFTA 2NX3A 1H51A 3QRHA 3RLVA 2WJZA 4FB7A 3MYOA 1ALDA 4WZHA 2FFCA 3O63A 3NR0A 4PCFA 5EKYA 2WNZA 1LROA 3FS2A 5G2IA 4CCEA 1T0OA 5AC6A 3TFCA 7TIMA 3PSVA 1WOBA 4Z1AA 2DJLA 1XUZA 3G1SA 1G4PA 2XFWA 1JUEA 1KBIA 4JTFA 1RQHA 1DVJA 1KTNA 1VLIA 2ZTJA 4NUWA 1XDLA 1MZHA 5LSMA 1XBYA 3LGEA 4IMDA 1KV8A 4AWSA 5CG7A 1QO5A 1DKWA 3L5AA 3LCGA 2ZRUA 3M5ZA 1W31A 3W7PA 3QEZA 2VFDA 5LGXA 5AYZA 4AHQA 2DZPA 2OJPA 5FF2A 1A5BA 4TX9A 4IUOA 4NJIA 4I7UA 3E12A 4ONVA 1G67A 2VFFA 4I9AA 5D03A 3ABQA 4X9SA 2ZZ7A 2A4AA 4KWVA 3L67A 5C55A 4G1KA 4HIBA 1GVRA 1S3HA 3EWBX 3L65A 2DP3A 1Q6LA 4J9JA 3LCIA 1OF6A 3MBDA 3P5ZA 2XN2A 1A5CA 1A50A 3TW6A 3T4CA 2BWGA 3W6YA 5F4SA 1DHPA 3W1LA 1J2WA 3SW6A 3EWUA 1GQNA 4MPQA 5EA9A 3TA6A 1W5QA 3B0PA 5DXXA 1B4EA 1FCQA 3PB2A 2FQIA 3SGZA 3T40A 4GWEA 3PUDA 5F4XA 5D2YA 3QPZA 3GZ3A 4UFLA 2DZXA 1NSJA 1S5TA 4TMCA 5IBXA 2V9DA 1TSIA 1VC4A 3C8FA 3P7YA 3NL5A 4BI5A 1FWTA 3TAOA 4O53A 3L5MA 3UQNA 3P5YA 2V81A 3CC1A 3LHZA 3HBLA 4JYEA 2GJNA 5HWNA 4EF9A 4RCXA 3EX2A 4RLIA 1WBJA 1O5XA 1WAUA 4K8HA 1PHWA 1J4EA 5I3HA 3G0UA 4UFKA 2HS8A 1QDSA 3W71A 3NDOA 3P81A 4FNUA 3W2UA 3W2LA 1KM1A 1QOQA 4AXKA 3W07A 4GC4A 3PBYA 4MJZA 3DKJA 4HNTA 4ZQCA 3W74A 1SPQA 4BI7A 3GX9A 2QJGA 3NL6A 1TPEA 3ZWSA 4I7WA 2DU2A 4FX6M 1TIMA 1I2QA 4O54A 4O1DA 2NUWA 1LBFA 3LHWA 5EL1A 3HOJA 3KRSA 1GT8A 4KFPA 3NPVA 4FNSA 4UTHA 3N9SA 2WV8A 1VCFA 2YYTA 1Z42A 4ZQOA 4QNWA 5AHFA 4UFMA 1Q3NA 1ZALA 2YCEA 4BK9A 1TPC1 4LU0A 1N7KA 3WFAA 5AB3A 5IBXC 1KM4A 2E5CA 1NFBA 1YPIA 5SWUA 2V5BA 3QSTA 1JQVA 4NNAA 2QDHA 3W7OA 3C2OA 1PIIA 4JDYA 2B7QA 5FF0A 4WQ6A 3PG9A 3R2GA 4Y96A 3EKZA 3PB0A 2TMDA 3QMSA 2ISWA 2V82A 2A1YA 2JGYA 3PC0A 1TTJA 1NVMA 2YYUA 4PODA 3TC7A 3PM6A 4JTIA 3CT7A 2Y7GA 3P84A 4JXCA 1FCUA 4XBSA 3QH2A 2DJXA 2CLKA 3M16A 3PAJA 3GDMA 3CU2A 1KTBA 1RQBA 4M5PA 3HG3A 3FKRA 3R12A 3S1WA 1QWGA 1ZNNA 5EPDA 2J9YA 4DQWA 2F7FA 5K4ZA 1H7OA 5LNWA 4AWTA 4O8RA 1QAPA 4DF0A 4WX2A 3L68A 3W7EA 5DCEA 3CWOX 3FA5A 4HN4A 4JYDA 4YWIA 5G2WA 3L21A 3S0CA 1WV2A 3ZWTA 3MP5A 2GVLA 3NQCA 3TR2A 1VLWA 3LRMA 5BNKA 2EAWA 4UTUA 5DELA 4YMZA 4NNCA 1SQ7A 1W1ZA 1ZAIA 2NWSA 2C16A 2ZCGA 5MHBA 1T8XA 3LV5A 1IIGA 1KLYA 5AOUA 2CW6A 4WXYA 5FESA 3LCWA 4CQ9A 4LC6A 4HPJA 4OBTA 3OVRA 2HMCA 3DFSA 4NXSA 1VCGA 4MOZA 3OHIA 4O16A 3W7DA 2FB2A 2BZNA 5K9DA 1TREA 3PY2A 1OFQA 3M47A 3M7WA 1PCWA 3VI2A 2NZLA 4LV4A 4O14A 3TDFA 3B03A 3KVLA 1OK6A 5BW6A 2V5LA 4XBKA 3S5NA 1UBSA 4WY0B 5I3GA 2ISVA 4O10A 3GXTA 3UWVA 2TYSA 1KM5A 1TMHA 3IIOA 4IPJA 4FNPA 1AG1O 4XWUA 2NUYA 4R34A 3ATYA 1SFLA 2X30A 1TTIA 4HNNA 4HHPA 2CLFA 1FQ0A 4JICA 4CLMA 1H7WA 4WOZA 4JDBA 5F4WA 1IF2A 4JNMA 3VE9A 4O1BA 2QF7A 3VFLA 4PFMA 3QPYA 3NQ7A 2IQTA 2UV8G 2R8WA 2WPBA 1R46A 1JQXA 3NPXA 3S1UA 4O57A 1FCVA 1G6CA 5TQLA 4GFSA 3NQ8A 1U5JA 4X2RA 1S5WA 3A9IA 3M43A 4IX2A 4OHQA 3U6WA 3TKFA 2AGKA 5LKYA 2Y6ZA 5I3FA 3IIVA 3ABOA 3BARA 2E6FA 3UNDA 3UPBA 5D09A 1G69A 2VKZG 1NF7A 1KM2A 1BWLA 5G4EA 1YTDA 1D9EA 1DJNA 3RNDA 3SR7A 2YX0A 2B4GA 3HJZA 4Z1CA 5AC8A 5KMYA 2ZYFA 1H7NA 4O28A 2C14A 1JCLA 4BF9A 4IMEA 3TSDA 1I45A 2NV2A 3FYOA 1K8XA 2R94A 1Q6QA 4PTNA 1TPVA 1DV7A 5D05A 5F2GA 2W6RA 2G97A 2I9EA 3CM4A 4TIMA 3TROA 3TH6A 2C1HA 1G4EA 3W73A 2ZRWA 1T99A 2JK2A 4EWND 2A21A 3LXCA 3NQAA 3GNNA 3IVTA 2YFNA 1JVNA 1X6UA 3T7VA 2FPYA 4UR8A 1K7XA 4LVGA 1E51A 4TR9A 3YPIA 3GDLA 1FBAA 4TO8A 1R2SA 5J5DA 3FOKA 4JTUA 1TPUA 4Q4KA 5LZLA 4C1KA 5HINA 1DOSA 2VEKA 5K4XA 1SW3A 3W7GA 3SY5A 5C5YA 1LZOA 1GTHA 1TTPA 3TSMA 4S1FA 3NQ6A 1LP6A 1W56A 4AHPA 4UTTA 4ZQNA 2DZVA 1KM6A 3O16A 1FWRA 1SO4A 6ALDA 2QAFA 1I2RA 4FNQA 4UTWC 3BO9A 4ORMA 4JTLA 1IXOA 4Z1BA 3KVKA 3BW4A 3A5FA 4GUIA 5AHLA 2RDWA 3CEUA 4FIQA 5F1VA 3IV3A 4ORIA 2C19A 3RF9A 3GAKA 3M44A 2W79A 3PVFA 2X1TA 5K2ZA 3STEA 5F2MA 2DZWA 4IMCA 1F5ZA 5A5WA 4A21A 3ATZA 1YDNA 1GG1A 3V75A 3CWNA 2VFHA 1G7VA 1UUOA 5G4WA 3W70A 5LNVA 2Y85A 2ZZ6A 1GG0A 1FWNA 5H91A 1PS9A 5DN1A 3F4WA 4JIQA 4LRTA 3CHVA 4LC8A 3PBUA 1D3GA 3KXQA 4O1CA 3E49A 1YDOA 1EP1A 3VCRA 4KWWA 4NJGA 1TRIA 3BV4A 1W3TA 3UY7A 5EBUA 1EWEA 2J6XA 2WKJA 2Q8ZA 4UTTC 1NAL1 2QCEA 4RXGA 2ZA1A 4QIUA 1F05A 5AFDA 4JY9A 2QJIA 3R5EA 3FEMA 1HG3A 1OFBA 1SO5A 5HMSA 1UJPA 3P8IA 3LBCA 4IWWA 4AAJA 3PSWA 3DFQA 3NOEA 5CKSA 4AVFA 4ZQRA 5I3KA 3AO0A 3IGSA 4N9DA 4MY1A 1KLZA 2ZA2A 5G2HA 3KRUA 1TV5A 2G5WA 5U4NA 4N2YA 5DBTA 3C2RA 3F03K 1TV7A 4HKPA 1KA9F 5D2WA 3NQGA 1XKYA 3DI0A 4MZYA 3O1NA 3I68A 2YXGA 5HULA 5HQEA 2P10A 3NQDA 3VKJA 4HNVA 4UXDA 3KX6A 1EPXA 3LOTA 4LS0A 3ABSA 3EEGA 2X2GA 1J5TA 4JR5A 2Y88A 3W7HA 5CSSA 1HL2A 1OYCA 3TFXA 2GQAA 3MHUA 1W5OA 1F7BA 2ALDA 3C2FA 1KM0A 1K8ZA 3MP4A 4MY9A 2WSYA 2V8ZA 3H54A 4WXZA 2H3DA 5KZDA 3SSJA 4A3UA 2DZUA 3LCXA 2YW4A 2GVGA 1VQTA 2VFIA 2ABAA 1JJKA 3DAQA 1DQXA 4LS1A 3GDRA 1BWKA 1Y0EA 3L5LA 1H50A 3TQ0A 1ME7A 1LLZA 1VPXA 1QFEA 1M5WA 1SO3A 4GUGA 4UNKA 3TXZA 2ZQ0A 4AF0B 2E5DA 1I2OA 4NX5A 3UWWA 5E93A 2C13A 4O11A 1VHNA 2CLOA 2P1FA 3G8RA 4HNUA 1HUVA 1P0KA 2PE4A 5E0KA 4YCPA 2TPSA 5CPNA 1KV5A 4NT0A 5CZSA 3WK0A 2X1RA 3NNTA 2QCNA 3PR2A 4MLJA 4QJ1A 4CQAA 2NXGA 2ZZ3A 3GR8A 1H5YA 3DFOA 3GLCA 5G1YA 4UTKA 4JTTA 2P0OA 3USBA 1TCDA 4RR4A 4H6KA 4Y9AA 3M6YA 4DEFA 1AW1A 3MJYA 3STGA 1TPFA 4MZ8A 2PRLA 2V30A 2AQWA 3EX1A 4PA8A 4FF7A 3L0KA 4JX6A 4N9EA 3LTYA 5D33A 3C2EA 3DZ1A 1MEHA 3G0XA 2JKPA 1EP3A 3DXIA 3P80A 1FDJA 2YFOA 3OVPA 2VOMA 3Q2DA 3U8GA 1KFCA 3QYQA 3P62A 3DI1A 3FYPA 4A22A 3UWQA 1OFDA 4BR1A 4DF2A 3P60A 3BK0A 3DGRA 3IIXA 1ICPA 4N6FA 3NG3A 3S5ZA 5AHIA 5F1UA 2NXIA 3IIPA 4I7VA 3W84A 1SSGA 4E38A 1S5VA 4JD4A 3OBKA 4X22A 3L0GA 4RX0A 2DZTA 3I7SA 4UTIA 3NGJA 1SZNA 1FDZA 4UUIA 3E02A 3N2MA 5L6UA 2XN1A 3LI0A 4AMAA 1JCXA 3NPUA 5D2TA 1LYXA 4FNRA 4LW7A 3LLDA 2A5HA 3EKLA 4DXVA 5EMUA 3TCEA 2OZ0A 3STFA 4CNNA 5FF7A 3W7IA 1XC4A 2JGQA 4IXHA 1OF8A 4AB4A 1V5XA 4O0KA 5ABTA 2CU0A 4MKNA 3THQA 4K36A 3TSBA 4N02A 1QR7A 1JRBA 2PRHA 2H8XA 5HR7A 4YL2A 1KTCA 1LRQA 4OE7A 5L9FA 1C9DA 4LT9A 2H8ZA 3NO5A 1L9WA 3SECA 2CZ5A 6TIMA 4MLRA 3MI3A 2JBMA 1JCMP 1AK5A 4UTLA 1YYAA 1TJRA 3FJ6A 4YLWA 2NXHA 3I6RA 3TC6A 3W1MA 3HPSA 3TU9A 2J9ZA 4O50A 1QPOA 4UFIA 1M7OA 3W7QA 3P82A 1XBXA 1GWJA 3N14A 3UXDA 4WJEA 3G3DA 3FLUA 3NVTA 4U28A 1EWDA 5LGZA 1IXQA 4DF1A 2J9XA 4IJBA 2H90A 3BG9A 5G1TA 1QOPA 2H3BA 3HO8A 3O6DA 3P67A 3GXNA 1GVQA 1LRTA 4MFDA 3EB2A 3W23A 4ALDA 5CZ0A 4O0ZA 4K6AA 1LLWA 3R8RA 1A5SA 3I65A 3W7KA 3B8DA 5FEWA 3G0SA 3KVJA 3EWWA 4JTKA 1AL8A 3MHGA 4NJKA 3QJAA 4JN6A 3ABRA 4DBEA 2H6RA 3HGRA 4LOCA 1OK4A 3S1XA 1XDMA 1GJPA 3LBMA 4HPXA 2YGYA 3IGXA 1JULA 1EIXA 4MYXA 1XL9A 4YXGA 5TIMA 2FLIA 1FX6A 1TJPA 5D32A 1MXSA 1ONRA 3QC3A 1GOXA 2AAMA 1SZEA 2V0TA 3R13A 2E1DA 4K37A 1W37A 4K7YA 4XTIA 1DQWA 4LWWA 4XUGA 3W7JA 3W22A 2RDUA 1H1YA 3WJXA 1K03A 1AW5A 3MHFA 4O1AA 2C6QA 4GRSA 3UWZA 5D04C 2GQ8A 5HJLA 1OX5A 3A23A 4XZ9A 1W5PA 4ZQPA 4WY0A 1YTKA 1YDVA 2YPIA 2E68A 3QF0A 4RZ6A 4WUIA 5C54A 2VXNA 3C3NA 3FJLA 1LM1A 3RU6A 3W75A 3NEVA 1H7PA 3UPWA 1ZENA 1B3OA 1KBJA 2GVJA 2KZHA 4L4LA 4JTSA 4IX0A 1TQXA 3P61A 3DBPA 4UMAA 3W7LA 5CPLA 4Z08A 1TPDA 3W72A 5DLCA 3B06A 3HG5A 1VRDA 4BI6A 1THFD 1VCVA 5AYXA 4LUIA 1TO3A 1QPNA 3W88A 3RFAA 4S2BA 3W1TA 1GTEA 3BW2A 3BLIA 3L9CA 4Y90A 5I3JA 3PUEA 1X8FA 1ADOA 2OX1A 4ZL1A 4M6VA 4Z0SA 2Y61A 1TPB1 1K7FA 4S2CA 3G1VA 3HPXA 2QDGA 1KFJA 1Q6OA 1EX5A 2OMAA 1X1ZA 4GE8A 3W7NA 2JKEA 3LHUA 3SI9A 1F73A 3GNDA 1VYRA 3HGJA 4UTWA 2GQ9A 3DFTA 2O7SA 5U7SA 4GNJA 2X1UA 1G4TA 4RXFA 1XFBA 3LB0A 3W1QA 1QCWA 3FIGA 3NZ1A 3NL3A 2CLLA 4Z1DA 3LHYA 3EXTA 3N3MA 4NZFA 3DU0A 4O17A 3W1AA 4MUZA 2E6DA 2NX1A 2X1SA 3A24A 2QCCA 1JRCA 1VYPX 4NVTA 5F2LA 3LRKA 2I1OA 1GZGA 2E6YA 5KTLA 4EIVA 4MIMA 3PS7A 2ZA3A 2FIQA 3O6CA 1LORA 3OG3A 2GPTA 1PVNA 3Q94A 1RVGA 2A7NA 4E0CA 3IVUA 1OVDA 1JCNA 2WNNA 1OX4B 3LX9A 3S6DA 5CPMA 4JGDA 4L4MA 3HIJA 1NF0A 2OT1A 2HTMA 2VELA 3KOFA 4H3DA 3G22A 1IGSA 2OT0A 1W54A 4RZ4A 4Y8FA 2Y7DA 2G96A 5TBOA 4RV8A 2VEPA 3TNOA 1TV8A 4P61A 1XI3A 1VYSX 3TE9A 3L0NA 3JRKA 3NQMA 3W76A 3W7CA 4FIRA 3R89A 5K9XA 4ZMGA 4P2VA 5EY5A 1X7FA 4K7VA 3S5YA 2B0MA 1MEIA 3BLEA 4JTJA 3GAYA 3KVMA 3NPWA 3RMJA 3LHVA 5F2IA 1BTMA 1OFAA 4ML9A 5AC7A 1ZAHA 3BW3A 1FDYA 1MEWA 3HGSA 1Q45A 4DO6A 3F1QA 3F4NA 4XKYB 4FO4A 1K7EA 1QMLA 4NXKA 1H61A 3C6CA 4DBDA 3GDKA 3LRLA 5T26A 1ICSA 1P4CA 4Q32A 3H55A 5CZTA 2ZZ5A 1KW1A 2PURA 3PF3A 4ZQMA 2A6LA 1TPWA 1H60A 3S1VA 3THAA 1OYBA 4FX7A 3C0JA 4OT7A 1R47A 2DORA 5LHEA 4DO4A 1JCYA 2BXVA 2CLEA 3HF3A 2CFFA 4BFAA 2ZDRA 4AH7A 3EX4A 3A21A 4CCCA 4C1LA 4MVAA 4JX4A 2YZRA 5BOOA 1F6KA 2ATSA 2FJKA 1F2JA 1CI1A 3KRZA 2HS6A 3Q58A 3B0UX 3KAOA 2ZBTA 1F76A 1ML1A 1RD5A 3LTSA 1KFBA 2EPHA 4JTEA 4XTDA 5LHFA 3DH7A 1YLVA 1JUKA 5K7JA 1ZAJA 3CQ0A 5CGQA 2F84A 2YDAA 2V2CA 1PHQA 2A85A 1ZHAA 4H4IA 3LXAA 4QQ3A 1Z44A 1CW2A 3T44A 2J27A 1V7YA 3O15A 5DCDA 1KFKA 4EF8A 3MMTA 1CX9A 3HMJG 2A6NA 3G1XA 2Y70A 3MI2A 1N8FA 4LVFA 3QM3A 1VR6A 3B04A 3QW3A 4KFNA 3QW4B 4GBUA 3G1HA 4N6EA 3WK3A 1FUYA 2ZZ4A 4MFEA 2E77A 2BX7A 2ATMA 3G1DA 1GEQA 3ELFA 3BG5A 3WJSA 5D37A 5E1QA 3MUXA 2WSRA 1UASA 3NQFA 3HGOA 1TRDA 1TB3A 1YTEA 2NWRA 4LUJA 1PCKA 2ZRZA 3RLUA 1HTIA 3M41A 1Z41A 1FXQA 2QCFA 3NYZA 2A0NA 3NXFA 2VEMA 1OFEA 3LCFA 1DBTA 1P0NA 1JUBA 4RJEA 1O95A 4K38A 1H1ZA 4NNBA 2YW3A 3PWAA 2EF9A 1IXPA 3O8AA 4IMFA 4KFOA 4OQVA 1VHCA 4LV9A 5D2XA 3W7RA 3NA8A 3W83A 5AHNA 2Z6IA 4UMCA 1L2UA 4WY0F 1G7UA 4D2JA 4O4WA 2QCDB 3QFEA 1YADA 5LNSA 3PG8A 2QCDA 3UD6A 3UYCA 1OG0A 4UFHA 3V1PA 3QZEA 2O7QA 4AF0A 2VEIA 3G24A 2Q8LA 4UTMA 1O60A 4HSOA 3W1RA 1RZMA 1LDCA 2NLIA 2V2DA 3IEBA 2E5BA 1C8VA 1W8SA 3LM7A 4WOQA 2EHHA 2ISSA 5KZMA 4YCOA 3DKLA 4JTHA 2Y7FA 3NAVA 1SW7A 2GOUA 3GVGA 1GYLA 5C6MA 3TQVA 1VH7A 1SZFA 2CLHA 2FTPA 5LNRA 3L66A 4LVAA 4R7JA 4TMBA 4HSNA 3JS3A 3BVJA 4QNEA 3C2VA 3H53A 2RKXA 3EWZA 5KITA 1PL9A 3DFPA 2Q3RA 1WBHA 4JEQA 3UZ5A 3N19B 4M7TA 1LCOA 1TPH1 1RV8A 4O15A 1RPXA 4GUHA 3C56A 1OFRA 2GJLA 3GK0A 1HO4A 5AN7A 1OFPA 3OEXA 5FEXA 1OFOA 1KFLA 3LERA 4NZJA 1P5BA 4N9CA 5GVJA 4LTSA 1YXYA 3TJLA 3M5YA 3TAKA 4NJHA 3BG3A 3W1UA 5BMXA 3M9YA 4MYAA 1I2PA 2WSQA 3BLFA 3INPA 3O06A 1GYNA 3C52A 1DJQA 3TJXA 5H2ZA 3LTPA 2VFEA 1VZWA 1AMKA 3GB6A 3SZ8A 2Y63A 3S9YA 1L6YA 3I7RA 5HWMA 1DL3A 1R2RA 1DORA 4ADSA 3B0VC 3LXBA 4PL2A 3UY8A 1XXXA 3LV6A 2PRMA 1WDWA 2QCHA 4UTJA 4LVBA 2Z1BA 1LOSA 3MYPA 1PV8A 3GYEA 3SJ3A 4WD0A 3GIYA 2A7PA 4O18A 3TK7A 1G4SA 3OA3A 2PCQA 3BPWA 4FHAA 4IPIA 2BTMA 4N9BA 5FEPA 4ZZ9A 3L2IA 5J5RA 2Z0IA 1SZGA 4FXSA 2NV1A 2FDSA 3HG2A 1W5MA 2Z6JA 1BKSA 4OGZA 4QAIA 3M0ZA 4GUFA 4RKAA 3QQ0A 1MO0A 2W0UA 1QPQA 3W1NA 3M5XA 3MO7A 3G1YA 5DXYA 3N9RA 4PEKA 4W9TA 4LS2A 1XBZA 2WQPA 1O5KA 1VS1A 3QMTA 5KZEA 4PH6A 3TQKA 2V2HA 5EYWA 4POCA 2BLEA 5A8GA 1SW0A 1I4NA 5CPOA 3PBVA 2E6AA 3IRDA 1KFEA 3E0IA 1L6SA 1WA3A 4QSHA 1ZFJA 1OJXA 4BWLA 1A53A 1WOAA 1I8JA 1OHLA 1WYIA 2J88A 1B4KA 1IIHA 2RHGA 3S42A 1GVFA 1W5NA 5D02A 3Q37A 5D2VA 1HFBA 1I2NA 4NJJA 1FY6A 1NEYA 1D3HA 3GKFA 3A5VA 2Q3OA 1ICQA 1FWSA 1GVSA 2JKAA 1K3UA 4UFJA 5C2XA 3PUOA 3MWAA 3BGJA 2A7RA 1TTQA 2WO5A 3MP3A 4K8EA 2ABBA 2QR6A 2C15A 4ZVJA 4B5NA 2CWNA 2QEZA 3HPZA 4CNPA 1C29A 4FNTA 2D73A 1M7PA 3SGUA 2A2IA 5HUOA 4FXRA 1R30A 3G8EA 4EOUA 1F74A 4JIPA 4LY8A 4JY8A 1WX0A 2ZFAA 2RFGA 1YXCA 2NX9A 3DENA 3NM1A 4Q33A 5K3VA 4UIOA 3EX6A 1UB3A 4U4MA 1Z48A 3G1FA 4AHOA 1B9BA 1R2TA 1YPFA 3BGGA 3LDVA 2QCMA 3CEPA 3EX3A 2C3ZA 4UC5A 2QUVA 5HUPA 3E96A 2ZRXA 3W3OA 1TYGA 4JTGA 1UUMA 3W1PA 2EGZA 3SIZA 5HNRA 1H62A 3D0CA 2QUUA 4M6PA 1H7XA 1PE1A 1O94A 1LOQA 1T96A 1XM3A 2OCZA 4BWLC 4UMBA 5BMWA 5DCBA 3LLFA 3MW7A 1RR2A 3M1ZA 1WQ5A 2G95A 3QQ1A 3MI6A 4ICNA 4R33A 4E2BA 4QM1A 3DFNA 1LBLA 5CZJA 2EKCA 1GVOA 1SO6A 2VFGA 2GUUA 4CNOA 3W2MA 5I3IA 3C61A 2ZZ2A 4PC8A 3WK1A 3GKAA 3PBWA 1XBVA 4RK8A 3NM3A 3CB8A 5LNUA 1JCJA 1B57A 4NQ1A 1W0MA 5DY2A 4CCDA 2QUTA 1EP2A 3KHJA 4UR7A 3O07A 5KSWA 1A5AA 4DPQA 2RH9A 1SR9A 3G18A 3ZR4A 1SU5A 1TQJA 2FPVA 4MY8A 3B05A 3GXPA 3TMQA 3VNDA 1F6PA 3B4UA 3UZJA 3FKKA 1L6WA 4PL1A 3EWXA 1AL7A 1SSDA 1QO2A 3DHFA 3T78A 2TSYA 2DZSA 2B7NA 1YXDA 3P74A 4JS3A 3NQEA 1X1OA 2J24A 4UCGA 4ADUA 4AWUA 3CTLA 1H63A 1VGAA 1QPRA 4GUJA 3NL2A 3W86A 3W87A 4N4QA 1ZY9A 1ME9A 2R91A 1KM3A 1N55A 4O4VA 3EWYA 5BRBA 4OWGA 2ZZ1A 3STCA 2C18A 1LBMA 4EVZA 2RDTA 4JX5A 4LRSA 3N2XA
chains in the Genus database with same CATH superfamily
1HO1A 4YN5A 1RY0A 1KFWA 1DJZA 4TU1A 3W2NA 1P6CA 2VYOA 2MUCA 3VE7A 3PTKA 5DY3A 3S4TA 2X16A 1PZ1A 3AIRA 5TF0A 2G37A 3R79A 4M56A 2BASA 5FF4A 3MKVA 1W9VA 4ICMA 4LX4A 4DO5A 4PE8A 1V3MA 1UOKA 3FN9A 3UCDA 5FI8A 3VXGA 2TRSA 1EA0A 4KERA 1FWWA 3EXRA 2Y7EA 4R5EA 2ZRYA 3ZLGA 5IM51 1XUUA 4PUEA 5I2UA 2QAPA 3QKEA 5AHEA 3I3BA 1UD6A 2QIIA 5FJJA 4K39A 3TP4A 4JFVA 2DQWA 3F2BA 2WBGA 2QV5A 4LAUA 1X7IA 4IIEA 3IGUA 2QCLA 2XN0A 4R53A 5HR6A 1YBQA 4XKYA 2FPTA 1KB3A 2QKFA 1AQFA 2E1WA 3LI1A 3OBEA 4DELA 1BYDA 3CAKA 1I9CB 8TIMA 4QEHA 1IWPA 3B8IA 3E38A 5TD4A 1EB3A 1HKVA 5CH9A 1ISXA 4MB4A 2Y62A 2CBUA 2NLYA 5CLTA 4AEOA 2FB3A 3RPMA 1U33A 2WNQA 5CSRA 5EU9A 1EUAA 2PD5A 4IXXA 4IQLA 1SFJA 2GJRA 1JCTA 1WCGA 1JPMA 3A6OA 3PBMA 4ADTA 1Q6RA 4OV9A 2JFEX 3S2JA 5D8WA 1RLDA 1MSSA 3M0VA 3APGA 3NQ2A 3K4DA 4GJ1A 3WJZA 4OU1A 1OC6A 3S5OA 4XIMA 1VJZA 5B80A 4FEZA 2XIBA 1TVNA 3H4WA 1AW2A 4FI4A 4QP0A 1TJ0A 2D0GA 4Y6GA 1K02A 1EHNA 2P3EA 1TG7A 3PZVA 4PMDA 2YA2A 3NURA 2NUXA 3TW7A 1ZCOA 1J8VA 4E3TA 1EDGA 2DUAA 3N73A 5AYYA 5AYIA 4ATDA 4X3ZA 4US5A 3WF4A 3TV8A 1B30A 1M6JA 4M7SA 4N42A 4O13A 1V79A 3RMEA 4M6QA 3PULA 4BEUA 2HBVA 1H7RA 5REQB 4C6CA 3IIZA 1IZJA 2XFFA 3APYA 1ENUA 4EAYA 6ENLA 3N6QA 4H2CA 1S2TA 2B7PA 4PRTA 4K8GA 1E5NA 1H51A 3QRHA 2VR4A 2WJZA 4M80A 4IP7A 4CD6A 1K6AA 5EKYA 4MKSA 4JZ5A 3QV7A 1XUZA 3G1SA 4E8DA 1RQHA 4LCQA 3N04A 1UWUA 3V36A 1MZHA 1ZL1A 3QOKA 3IAPA 3FGCA 2PP3A 2VFDA 4IQJA 2O9OA 4TX9A 4NJIA 1G67A 4LNCA 5E5CA 2ZZ7A 3L67A 4PUDA 1Q6LA 1TX0A 4J9JA 3RG6A 4H83A 3GUWA 2I5QA 4YTSA 2WM0A 5F4SA 1H11A 3EWUA 4YYCA 3ZJKA 3M64A 1P6WA 4H7VA 4JHZA 1OG6A 4Q7NA 2VRQA 4V2XA 4DM1A 3TA6A 2GVEA 1DPMA 3FEQA 1Z7AA 3FYYA 3KS5A 3T40A 3U5YA 3IJ6A 3GZ3A 5BZAA 2BY3A 1XH2A 1HN1A 1VC4A 1Q65A 3NL5A 1UWTA 4BI5A 2WHKA 1BGAA 1FWTA 4RE2A 4JYEA 4WKHA 3W0KA 2A3EA 2ZX6A 4RLIA 1WBJA 1WAUA 4QG8A 1PHWA 4PBEA 1LWIA 3B8TA 1W1VA 1MW1A 2HS8A 1QDSA 3LPPA 3W71A 4QHRA 1DIKA 3ZT7A 4DXKA 3QZAA 4XX6A 3W2LA 4DN1A 2GJXA 4AXKA 1QHPA 3TA9A 4MJZA 1GQIA 2DT0A 3GVRA 3PAOA 1MZRA 3GX9A 1JD9A 1TPEA 3NL6A 3ZWSA 2DU2A 3CMFA 4DAFA 1TIMA 2PDGA 4I9JA 3WBEA 2W63A 3VVGA 9RUBA 5C9WA 4ZO9A 1GT8A 2NQHA 4H9YA 3NPVA 4ZOEA 1AD1A 2PWUA 3EB3A 4AD3A 4I9TA 2F8QA 1Q3NA 1ZALA 4BK9A 1UOZA 3WFAA 3EDKA 1XGZA 5A6MA 1KM4A 2E5CA 1IYXA 2E8ZA 4R85A 1F3EA 2UWFA 3SUTA 2V5BA 3CUFA 1JQVA 3IUDA 4L64A 4E4UA 1V03A 4WQ6A 2WM1A 1CNVA 4EAMA 4HHHA 2OEJA 2DZAA 2ISWA 2V82A 1TTJA 4PODA 1QASA 1XYMA 3DESA 3PM6A 3TWBA 4XBSA 3PZQA 3PZGA 2CLKA 3GU1A 1R9ZA 1F3WA 2YL5A 3CU2A 3KCOA 1RQBA 3HG3A 1IEXA 1X8CA 2VRJA 1AUSL 4GXPA 5K4ZA 1H7OA 1TV3A 1ZTVA 2WBKA 3U0HA 3W7EA 2INFA 4J3TA 3FA5A 3TWAA 4JN7A 5HA7A 1B3YA 3BSMA 3ZWTA 3MP5A 2GVLA 3TR2A 1OT1A 1VLWA 5BNKA 2VTFA 2EAWA 4B4HA 4YMZA 2J8FA 5C9XA 4NNCA 3ITGA 1MUWA 4TX8A 2FTYA 3UETA 1HKIA 5DFAA 4MGGA 1M9HA 5LXXA 3C5QA 5EFFA 4CQ9A 4HPJA 3LU2A 1S2VA 4NXSA 1V77A 1SVDA 3OHIA 4Q22A 2ZE0A 3VD4A 4W8BA 1J10A 4NAEB 1UJQA 1BG9A 1PCWA 4DUOA 2NZLA 1HJVA 3CZEA 1NDZA 4XBKA 3WUEA 3VNZA 4O10A 3IIOA 4HNNA 3EEZA 1EJVC 1V0NA 2VZUA 1E0VA 3RPDA 5F4WA 4PTMA 4JNMA 1LG2A 5AZ0A 1PWLA 1RA5A 4PB4A 3KOXA 4PFMA 4GISA 4KWSA 2WPBA 2CNCA 2PDQA 5A95A 2X0HA 3S1UA 2XYLA 4C5ZA 2P8CA 1G6CA 1LWJA 3PWIA 1S5WA 3CAQA 1G1YA 1XISA 3A9IA 5ECVA 3U6WA 5LKYA 4QGCA 4OUEA 2AQOA 2IQDA 5I3FA 3KL3A 3OB8A 2G3IA 3B40A 4QFUA 1EO5A 2VKZG 1NF7A 5G4EA 3I6EA 3RNDA 4CD8A 3TTYA 2B4GA 4UQCA 4Z1CA 2ZYFA 1TUXA 2CKRA 3H26A 4O28A 4QJ4B 3VIGA 2VZSA 2EPKX 4WSHA 1ZU8A 3MKKA 3OZYA 3CM4A 4TIMA 3TROA 3TH6A 1EEXA 4C1NA 2PTXA 3W73A 4FALA 3BCDA 1P1MA 4HU4A 3SB0A 1BGGA 1M03A 1ZP3A 1JVNA 1X6UA 2WKLA 2J25A 3QFWA 4UR8A 1K7XA 3GDLA 3FOKA 2W61A 1DOSA 1PUDA 1EGVA 4O0QA 1XLAA 2DSKA 5AVNA 3W7GA 3SY5A 3TONA 3LBOA 3VIIA 1MNZA 4AZCB 3NQ6A 4KRZA 1HVQA 1PX3A 3R25A 2GSEA 2DUZA 2BVWA 3DGBA 2BY1A 1P7TA 2DZVA 3AIQA 3UXIA 4A8IA 3RX4A 3F4CA 4WJXA 3CJPA 1OCJA 1XLJA 4NILA 4Q6JA 1RAKA 4ORMA 4Z1BA 4GUIA 2HRWA 3FVMA 5A2CA 4M1RA 4C6IA 1YKWA 3MWCA 2C19A 3RF9A 2PD9A 3PVFA 5K2ZA 3STEA 3QY7A 5F2MA 4JFWA 5XIAA 3KDOA 4IIBA 2J78A 5BOEA 1H09A 4AYSA 3VC5A 3ATZA 3QY6A 4UB9A 4RV3A 3V75A 4B5TA 3F5JA 3W70A 1AA1B 2A3BA 1AQMA 5H91A 3A64A 2QPUA 5DN1A 3VCCA 3F4WA 3NIYA 2V38A 3P14A 1RP9A 2PGFA 3W27A 3PBUA 2J7BA 2ACRA 3OO2A 2EG7A 3VMNA 3KWSA 3E49A 2AL2A 5I0DA 1EP1A 3TTEA 4B15A 3BV4A 3UY7A 4H8NA 3VM7A 2POTA 3CB3A 2Q8ZA 3SFWA 3TR9A 2WCAA 4QBXA 4QIUA 2EKGA 5AFDA 2QJIA 4FR6A 4Q6XA 1E56A 1SO5A 4AVOA 5FSEC 1W9DM 1A3XA 1OCBA 4GI8A 2HNEA 1GVYA 1B3VA 1M01A 3WUGA 3PSWA 1S3TC 3NOEA 5CKSA 4AVFA 5I3KA 1CXFA 1EO7A 2ZA2A 4LAZA 2HJPA 4I6KA 5DBTA 3C2RA 1TV7A 5CJMA 3WMCA 5D2WA 1JPKA 1XKYA 2GUBA 3DI0A 3T42A 2YXGA 2ZUNA 3G6MA 2P10A 3FHAA 3B9AA 3MU7A 3AIVA 5BU9A 3KX6A 5HOSA 2VWTA 4AZ6A 3UWEA 3ABSA 3ONBA 2X2GA 2Y88A 1XIHA 2YDQA 5ABFB 3VC6A 2GQAA 3REQB 4S3JA 2ALDA 3C2FA 3V5OA 1PKNA 1K8ZA 3MP4A 4MAZA 2X0SA 4LY4A 5JBDA 3SSJA 2DZUA 5AKQA 1RPKA 2GLKA 1C7SA 2VFIA 2ABAA 2PU0A 3CHDA 3L4ZA 1QXLA 3DX5A 3FSTA 2HZGA 3TQ0A 1BSIA 5M17A 1VPXA 5HNNA 1SO3A 1YMYA 4R7OA 2ZQ0A 1GKRA 3ZXWA 3UWWA 4E4PA 3OU8A 5E93A 2PLJA 4O11A 1J5SA 1VHNA 2P1FA 3BTNA 4YCPA 1H5VA 2TPSA 5CZSA 2PDIA 4YS1A 4ZO8A 2XGZA 2ZZ3A 1YPXA 1H5YA 3DFOA 3CV1A 1YDYA 1PYFA 3F5LA 4AC1X 4S3DA 1TCDA 2EG8A 2OWXA 4RR4A 4Y9AA 1DXIA 3MJYA 5BYWA 4MZ8A 1XWYA 2V30A 2XM1A 2AQWA 2RGLA 1DEDA 2IMRA 4FF7A 4GG9A 3VOIA 4N9EA 3P6LA 2ZIDA 1WE5A 5JBFA 1UR4A 1MEHA 1UWAA 3DXIA 5M3WA 2YFOA 4Q4SA 4OVXA 1POJA 3QYQA 1PTGA 2GOKA 1AH0A 4BR1A 4DF2A 3BK0A 3DGRA 1KBLA 3A47A 4N6FA 1RK6A 1Y5WA 3IIPA 4OECA 3OBKA 5A6BD 3ARSA 2Z25A 2DZTA 5H8MA 1WO2A 3WBWA 3A12A 4UUIA 3N2MA 1HL9A 4L6DA 2GDQA 2FMNA 1JCXA 1UMLA 4PR4A 1OZMA 1LYXA 4FNRA 4LW7A 2BGSA 1JXJA 2RAGA 3STFA 2E25A 1GQLA 3I6TA 2BG5A 8RUCA 2QLYA 4HA1A 5FJIA 4JNYA 3TYZA 1V5XA 2V69A 4K36A 5EB8A 3DFHA 3M6DA 4IJRA 3XINA 2HPIA 1C7TA 3WLQA 2PRHA 4C6OA 2DVXA 4C6KA 5L9FA 2CZ5A 3MI3A 4D6CA 1JCMP 1ZP4A 4AZGA 4UTLA 2NXHA 3CLWA 4B3ZA 4GQ0A 4ASTA 3OGRA 1OZQA 3WSUA 1GWJA 3N14A 3PJTA 1XLDA 4WJEA 1W1A1 3FLUA 4HTYA 7CGTA 1EWDA 3EMCA 2J9XA 4IJBA 3G6LA 5G1TA 1QOPA 3O6DA 3GXNA 4HA4A 1GNXA 3AMLA 3W23A 4ALDA 4F0SA 3UZYA 4K6AA 3R8RA 1BXNA 3EWWA 4JTKA 1AL8A 4NJKA 4MSSA 4DBEA 3B97A 1XDMA 4HPXA 3GQYA 3UG8A 6CGTA 2X05A 2ZOXA 1GOKA 1A5NC 4YXGA 3DUGA 5D32A 1Q7ZA 1ONRA 3QC3A 4GGHA 1UBPC 1XIIA 3CMJA 1SZEA 4DJDD 2ONEA 1X39A 3WEMA 3GR4A 3O7UA 3KL5A 3PZOA 1E0WA 2WCGA 1UMYA 3SY1A 4LYPA 2RDUA 1H1YA 3GTFA 1MMFA 4IM4A 4O1FA 3ES7A 5D04C 2GQ8A 3U48A 1HXJA 2BXZA 1YTKA 2VCBA 1IQ8A 3M07A 4L1GA 4RZ6A 2BVYA 3C3NA 3UZZA 2VUNA 3NGFA 1LM1A 3W75A 1QNSA 2JF6A 3WH8A 4PSRA 1KBJA 4W93A 2KZHA 4JTSA 3WL0A 3DBPA 1TPDA 4Y8EA 3HG5A 1UR8A 1VRDA 4BI6A 1VCVA 1TO3A 3H7RA 3W88A 5HBFA 4S2BA 1YRRA 1KWGA 2PC8A 3BW2A 4Y90A 1A3HA 1RJRA 1XLKA 2OODA 1X8FA 1OY0A 2INEA 1C90A 5CC7A 2Y61A 3HV9A 4S2CA 1O5RA 3HPXA 2GWNA 1Q6OA 3E2QA 2OMAA 4MNKA 3LHUA 3SI9A 2J47A 3GNDA 4UTWA 2VGGA 2O7SA 1EL3A 4XVDA 5U7SA 1TMLA 1A49A 3FIGA 4J40A 3NZ1A 3OQEA 4JN8A 4BQ3A 4KRTA 3DU0A 1RSCA 2NQJA 1HJXA 5F2LA 3IK4A 1GZGA 4U31A 5CGMA 3SGGA 1TJ2A 3OG3A 1PVNA 2GGGA 2JALA 4L56A 1E73M 4YIWA 3VIFA 3VIPA 5I78A 1JCNA 3L2MA 5AY7A 1L8NA 1TJ1A 4IGSA 3N3TA 1NF0A 3KOFA 5HPCA 3RDKA 5EGRA 2WMHA 2WJDA 3ZSTA 2WLZA 1F8IA 1OD8A 2Y7DA 5I6SA 4RV8A 2EBNA 1UKSA 2B81A 3WF1A 1TV8A 2I17A 4RUBA 3TE9A 5F7UA 3JRKA 3O6AA 4IL2A 4FOJA 4P2VA 5EY5A 1WZKA 3CZ8A 1MEIA 4ZTYA 5F2IA 1BTMA 4ML9A 5I24A 1ZAHA 1MEWA 2ZC8A 4P8WA 1U1HA 4DO6A 3F1QA 3F4NA 2FHCA 4GI4A 1QMLA 3AYTA 4EACA 3SUSA 4Q32A 4PMRA 2JQXA 3ZJ6A 2ZZ5A 4J3SA 1KW1A 4IIGA 2P76A 4ZQMA 1H60A 3I3EA 4U33A 1OYBA 4FX7A 3C0JA 3L4UA 2J4GA 1JCYA 3EX4A 4OFCA 1BLIA 4NI8A 3CT2A 4JX4A 4P8UA 3MVIA 5D9NA 3KRZA 1BSLA 4Z2IA 1ADDA 1NJJA 2VQTA 3B0UX 4EK7A 2ZBTA 2A3CA 4QXIA 1ML1A 3AU2A 1KFBA 2PDXA 4XTDA 3AROA 1ONWA 2PZNA 3MMWA 1ZAJA 2X42A 5CGQA 4GIEA 1NQKA 3DG6A 2YDAA 3N2TA 2A85A 5BU6A 3II1A 4LJ3A 5LYRA 3WLRA 1T41A 3WH5A 1Z44A 1WDRA 3T44A 2J27A 4EF8A 1Z6KA 2Y4SA 3MMTA 3RYSA 1CX9A 1PEZA 3VU2A 1N8FA 4KEZA 4LVFA 1JAEA 2ZXAA 3E2SA 2GZXA 2FH6A 3W28A 4HOZA 2PI6A 2FVKA 2ZUWA 3P2VA 3VDHA 3ZT6A 2ATMA 1VFOA 4XIAA 1DE6A 3CAVA 3ELFA 3WJSA 5D37A 3EPNA 1GOMA 3G5EA 3PZ9A 5JUVA 1PJ9A 3W00A 4L4PA 1NDYA 3M41A 2VEMA 1OFEA 1P0NA 1ZS2A 3E2RA 3DOPA 4IMFA 4OQVA 6REQB 2VD9A 2Z6IA 4UMCA 4WY0F 4D2JA 3UCCA 1HP4A 3PG8A 3UD6A 1K4HA 2ISDA 3FAXA 3BLLA 1GOQA 4FSAA 3W25A 3V1PA 4XZBA 2EEXA 5HMDA 1VAHA 2VEIA 4ZCWA 2NVCA 3TVAA 2Q8LA 5AC5A 5GJPA 3ZM8A 3AYSA 1HP5A 1LDCA 3NXLA 3WQVA 2DIJA 4S38A 2GYIA 4PB3A 1Q66A 3NAVA 1VFTA 1VFSA 4U5IA 1UUQA 3GG0A 3ZOAA 2GOUA 5DT5A 5C6MA 4D8LA 3TQVA 3CPUA 2PWHA 1CYGA 2CLHA 5LA2A 4AW7A 3BVJA 1S38A 2DT1A 1IWBA 3KHDA 5BOFA 4WEVX 1S1RA 3T9PA 4GUHA 4H2HA 3F5KA 3TN3A 5HPOA 5C9UA 3QR3A 1OFPA 1OFOA 3FW6A 1YXYA 2VWSA 4W4QA 5B7YA 3TJLA 1QI3A 3BG3A 1F4HA 3M9YA 3WD0A 2WSQA 3BLFA 1V0MA 3OIHA 3VIOA 5DRCA 3LTPA 3GB6A 2Y63A 3S9YA 1DL3A 6XIAA 1F4AA 1MUCA 3MYPA 5KZ6A 4ZFMA 1PV8A 3GYEA 3SJ3A 4Q7BA 7TAAA 4RNJA 3BPWA 4U2ZA 2B31A 1V6VA 1BHGA 2BTMA 4N9BA 1VKFA 3CTTA 3N2BA 3TTSA 3UU0A 5J5RA 1VFLA 1KRCC 3R94A 4AX6A 3GXDA 2CXGA 2YA0A 3K1GA 1FWBC 3EKGA 3QQ0A 1MO0A 2W0UA 4NIRA 2GK1B 4XSLA 4RW5A 3KZPA 1DP0A 3G1YA 2WZTA 2ICSA 4GXWA 3EOSA 4HYWA 1ITQA 1OGGA 2OOGA 2V2HA 2YJQA 4GQGA 1I4NA 2BV9A 2E6AA 4OUIA 3VDGA 4H04A 1L6SA 1JDFA 2WZIA 4Z2GA 1ZFJA 5BRPA 1UH3A 1K9TA 2J7FA 3UBPC 1W5NA 5D02A 3Q37A 3CXOA 5D2VA 1I2NA 1E0UA 1FHUA 4PMXA 5E70A 4XKMA 4J4KA 1ICQA 1FWSA 1ESWA 1GVSA 1SJCA 2RUSA 3BDKA 1E55A 2XHYA 3SCWA 1K3UA 4UFJA 1N8WA 3PUOA 2VDHA 4LB4A 1XD0A 3MP3A 3SSZA 1LQ0A 3AC0A 2QR6A 4H7CA 4ZVJA 2CWNA 4P5UA 4EWJA 3CL8A 1M7PA 4F40A 5HUOA 3AIWA 4FXRA 2ESCA 5JMUA 4PUWA 2C1GA 1V3JA 3C0LA 1OGBA 4JY8A 2GSJA 2DSUA 1U1UA 1XCXA 2RFGA 3WLLA 4JQ3A 5K3VA 3NO1A 3H7VA 3GXMA 3WEOA 3GC2A 3ANUA 3PANA 3TC3A 4RPQA 4Y9OA 3W3OA 3SIZA 5HNRA 3D0CA 3B8WA 1QK2A 1O94A 1LOQA 1Y5VA 4UMBA 4XAPA 4B5VA 5DCBA 3LLFA 1SMDA 1M7XA 4Q8NA 4RL3A 4IISA 4DZ5A 2ZE3A 1LBLA 5CZJA 4D6EA 3WMBA 4CNOA 3GY1A 3C61A 4PC8A 3WK1A 1EGZA 3GKAA 4H00A 3PBGA 4PYSA 3CB8A 2I5IA 5LNUA 3QBUA 1JCJA 1B57A 1DWHM 4FP1A 4CCDA 1AVAA 1A5AA 4DPQA 4D9PA 3G18A 1XPYA 1SU5A 3W6MA 1XHGA 1EBHA 4F0MA 3QQWA 3TMQA 2IKJA 4KCTA 4IFOA 2PLMA 2OPJA 1QO2A 3DHFA 3ENLA 2TSYA 3GTHA 2DZSA 2Z1XA 2J24A 3CTLA 1VGAA 4PUMA 3NL2A 3V0UA 2FJUB 3W86A 3W87A 4N4QA 1ZY9A 2R91A 1KM3A 1N55A 1HF6A 3WNLA 3EWYA 4X2PA 1DJIA 1Y65A 4YTTA 3STCA 4W7WA 2C18A 2IKHA 2RDTA 4IFKB 4D6DA 3O6YX 3BJFA 2I14A 5T8GA 3FFSA 3ITVA 4PRWA 4OV4A 2C8NA 2HWGA 1EUNA 3KLKA 1P1XA 2C91A 3G1AA 3RX3A 1OYAA 2VC6A 3GHTA 5I79A 3ZLFA 2VC7A 3A4AA 2J7CA 4FR1A 3HN3A 4KKXA 4FX8A 1U83A 4ATWA 4A2SA 1EC9A 4CNSA 2OYKA 2WXDM 3R43A 3PZTA 2DZBA 4UQ9A 1CGYA 3EBVA 2E9LA 1E6SM 4HVXA 4NG3A 3WQFA 3S2LA 4IOTA 4HT3A 4DI9A 4XZMX 5E9XA 3UWUA 3ZLHA 4IMGA 2FVMA 1M1BA 1ODZA 2AL1A 3GDTA 1YBQB 3A13A 4KMQA 1HKJA 1UR1A 2PS2A 3NDZA 4NU7A 1LUCA 2Z4GA 2WZHA 5AHMA 4CQ8A 2QPXA 4KGJA 2R1LA 1JDDA 2Y89A 1ZJIA 1JYVA 2OFJA 2OYMA 3T2QA 1XICA 3BAYA 3QHMA 1HT6A 4K3ZA 4L61A 3SCUA 1TIWA 3CH0A 4UNLA 5HNTA 3DHDA 4HYRA 1GORA 2PTYA 1EXBA 4WSJA 2EPNA 5DRIA 3EDJA 5D30A 3K30A 3TTOA 3CLMA 2DSVA 2ZTKA 1MW2A 3C4UA 3SRFA 1RD6A 4NP7A 1QATA 3AWNA 4GXMA 4N4PA 4FLSA 4IICA 3VOHA 3WFZA 3ZVHB 3H2AA 4J3WA 2XPKA 2PBOA 1C8YA 1O12A 2B7OA 3A4JA 2LLEA 3QMRA 4GCAA 2DT2A 2CLMA 4JFUA 3CPRA 3TYDA 4BEQA 1J11A 1GGOA 1SUXA 1TA3A 3HB9A 1TZZA 3GTXA 4FXJA 2VOTA 3K8LA 3WK2A 4IIDA 5DBUA 3W1XA 4YVPA 2XG9A 3EDDA 1C3FA 1WXJA 4LNYA 3LENA 3STPA 4Q8VA 3VGHA 3LCHA 3MBFA 1W1PA 1E6XM 2DT3A 3AIEA 2G3JA 3CAWA 3TQPA 1Q7QA 3QN3A 1A0CA 1Y5XA 1LROA 3EA1A 3KP0A 4KRUA 3TFCA 1X38A 1XQLA 4NF7A 3U4FA 1EH9A 4PMOA 3PSVA 1WOBA 4Z1AA 3BMWA 3TCSA 5CSUA 2XFWA 1JUEA 3VD3A 2CBJA 3AHYA 2R24A 3KBSA 3WF3A 3OG2A 1QBAA 1VLIA 4NUWA 4F9JA 1XDLA 3LYEA 3BOXA 4IMDA 1FWJC 2WPGA 1QO5A 3L5AA 4QS6A 2VX5A 1OINA 2Q6ZA 4FZIA 2PWGA 3W7PA 3AOFA 3PUGA 3WKZA 5AYZA 4AHQA 2DZPA 4DWSA 1QI2A 2J74A 1EYEA 2XWEA 3S6TA 2VFFA 1Z32X 3IRSA 3C2YA 4UWMA 5LA1A 5I09A 4KWVA 5EMYA 4HIBA 3O9NA 3POHA 3RIKA 4CGTA 1I1XA 1KR0A 3LCIA 1A50A 4RDYA 1O1ZA 2QYGA 3T4CA 3LK6A 1V3HA 5CEWA 4PBFA 1R5YA 3LGGA 3SW6A 2WAGA 1GQNA 2BGQA 4YTUA 4MPQA 5EA9A 1FCQA 3U2EA 2FQIA 7REQA 1G94A 3SGZA 4GWEA 1Y7VA 3E6EA 2CC0A 4I5XA 3QPZA 4YTQA 5GJMA 1E4IA 1XLCA 1NSJA 3Q65A 4TMCA 2HVOA 5IBXA 1XC6A 1X1NA 2WMIA 3C8FA 3P7YA 3NZGA 4XZWA 2QJMA 1R3YA 4JQ2A 1GEHA 4O53A 3KTXA 3MKCA 3L5MA 1TELA 3FCPA 3P5YA 4JNZA 3CC1A 2G4FA 1CDGA 2GJNA 2Z7GA 2Q8XA 3EX2A 4C90A 3VNLA 3EMZA 1ONXA 4K8HA 2FVLA 4O1EA 3HFYA 1J4EA 1BQGA 3G0UA 1DWIM 1OIFA 4IPPA 1Q8JA 4DWSC 4DJED 4GC4A 3PBYA 4OBRA 3W74A 2ZUTA 1SPQA 4BI7A 3E3HA 1SJAA 1J96A 2QJGA 5A3HA 5LXEA 3BURA 4O54A 1T40A 2QVNA 2PSNA 5MKGB 3IACA 3LHWA 5EL1A 4HN8A 3VGEA 3KRSA 2Z29A 3RR4A 4Y2WA 3ARTA 2YB4A 3H12A 2ON3A 2WWCA 2YYTA 4ZQOA 1V02E 3AWOA 4JKMA 1E4NA 5JU6A 4UFMA 1UKTA 2YCEA 2WNWA 1GHRA 4S39A 1N7KA 2XZ7A 2PDNA 5AB3A 5IBXC 1NFBA 1YPIA 4HMDA 1QW8A 3WQ6A 5SWUA 1CGXA 1I6NA 1UH4A 3ID7A 4DB7A 2WLYA 1PIIA 4KETA 1J12A 2VGIA 3PG9A 3EKZA 3ZMRA 1Q7MA 2A1YA 3WQWA 1JPIA 1FCUA 3PJXA 2DJXA 4HCLA 2WMFA 3M16A 1XKJA 1W3JA 3PAJA 3E0WA 2HNHA 1KTBA 3FKRA 3S1WA 1JDEA 3CK5A 5LNWA 4GKLA 4WDXA 1QAPA 4DF0A 1QWKA 4JYDA 1L8PA 4AISA 4WDWA 3BLKA 3NQCA 5DF0A 4C6LA 1LT8A 1UPMB 4FLOA 2Z24A 3GDBA 1W1ZA 1ZAIA 3F7JA 2J8TA 1IEQA 2ZCGA 4WR3A 1SZRA 1T8XA 4L80A 4W7VA 2FGLA 4WXYA 1S2AA 3CQHA 4WKFA 4DM2A 1HIZA 1NOWA 4LC6A 3OVRA 2XVPA 1SGJA 3C3UA 1FWIC 4MOZA 2QGHA 1UG6A 1FH7A 3AXMA 1WDSA 4E6MA 4IQDA 1UKOA 1TREA 4E2OA 4DVOA 1QW7A 4U5KA 5A8MA 3VI2A 2XVLA 4NAFA 4XK2A 3AYVA 4LV4A 3V0TA 3N2CA 3I10A 1UBSA 4WY0B 3IJDA 2OVLA 2VURA 2FZNA 4IPJA 4FNPA 1W2PA 3SQSA 3ATYA 1SFLA 2X30A 4L5ZA 3V18A 2CLFA 1FQ0A 1NDVA 1S5NA 4JICA 1ZRQA 3T0TA 3I4KA 1N82A 4J2MA 4WOZA 4LUTA 1DWJM 2VT0A 3VZXA 3VE9A 1QNOA 2QF7A 3VFLA 2PGRA 4P7NA 4MPKA 2VZVA 2IQTA 4MDOA 2UV8G 2R8WA 4HHMA 1ZJAA 3AS1A 2I9UA 3NPXA 4O57A 1FCVA 2C1IA 4QJ3B 4D8ZA 4GFSA 4Z1YA 2R1KA 4WHBA 4X2RA 3BWWA 3S9ZA 3EPOA 3GXIA 4IX2A 4LCSA 5PTDA 4ZB0A 2AGKA 3N4FA 3SRKA 3PFRA 2OZ8A 4WDTA 3ZR6A 2WZMA 3FJ4A 4XB3A 5CPTA 3FV9A 1HKMA 3PWGA 3OVGA 4ZEPA 1KM2A 1D9EA 4ZENA 1ZJHA 1XQKA 3R0KA 2OXNA 1Z8AA 3WBAA 4ZB5A 3N18A 1H7NA 4RNFA 1XFCA 3T08A 4BF9A 2WZEA 4GA8A 4IMEA 1UQZA 2R94A 1TPVA 2G97A 5DQPA 5DX7A 2PDPA 2C1HA 4I5UA 1H41A 1T99A 2JK2A 1XLIA 3LXCA 3GNNA 2ZXDA 1FTXA 5XINA 9CGTA 4H01A 4C6EA 2FPYA 4LVGA 1E51A 1GJWA 2GFTA 3YPIA 1YE4A 4TO8A 3SURA 1J93A 3IJQA 3CIVA 1IR2A 1NELA 5LZLA 3FXYA 4JFSA 3RITA 2QJJA 3BZJA 5C5YA 3SCTA 3N13A 2FHBA 1TTPA 4HP5A 2Y5JA 2W66A 3AMCA 3WNKA 3E5BA 1P7TB 1E9IA 4LXFA 4A3RA 4AHPA 3DIPA 2PEVA 1ZQ5A 1KM6A 2A79A 4JQ4A 4CU8A 1DXEA 1I2RA 1PTAA 1U22A 4FNQA 1OWQA 1OM0A 3Q45A 4JTLA 2XU2A 2GQ3A 4LANA 2PDBA 3KVKA 3BW4A 3A5FA 5AHLA 1BYAA 2RDWA 3CEUA 2VMFA 4GD0A 3IV3A 4MADA 4ORIA 1PZ2A 3L4YA 3GAKA 2VZOA 2W79A 2FGZA 1RP8A 1SFTA 1W1IE 5I06A 1HKKA 3UXKA 1WNOA 4A21A 1NFPA 3UGRA 3KUMA 3CWNA 1VBHA 1G7VA 1UD5A 4S3CA 4F0HA 1FWNA 1PS9A 2GWGA 4J3ZA 2W67A 3RCNA 4EPBC 2PZ0A 3NQBA 4C6NA 4WSKA 3CHVA 3B8VA 3LG3A 1KWKA 2AL2B 1RCXB 1ZBKA 2YIHA 1KBKA 3H2NA 1QJWA 4KEMA 1YDOA 2OU4A 1TRIA 3WD3A 1EWEA 1B2YA 2J6XA 2WKJA 1KRMA 2QCEA 5BROA 2ZA1A 1V51A 2WSKA 4NYUA 3ERPA 1HG3A 4IG2B 1OFBA 4A8NA 3EA2A 5HMSA 2VZTA 3A3XA 2HV5A 3LBCA 5REQA 4BQ2A 3ITOA 4ZQRA 2NW0A 2V5KA 3AO0A 3KL0A 4QAWA 4N9DA 4HPGA 2G0WA 3K5XA 3F03K 3R1ZA 4PCTA 1FWFC 3NQGA 4MZYA 2DVUA 7ENLA 3VKJA 4AWEA 1XLLA 1ADSA 4X61A 3LOTA 4IP5A 2ZKMX 1J5TA 1XX1A 5CSSA 4KWUA 1X6LA 3GXFA 1F7BA 3MZNA 2HVMA 4BA0A 2WSYA 5H1WA 1JZ8A 3WDPP 2IS7A 5I23A 1B90A 1DQXA 2PP1A 2QMKA 3DBNA 4REQB 1LLZA 1I60A 1QFEA 1M5WA 3WQPA 4AF0B 5JH1A 1EKOA 4E8CA 1ITXA 1EQPA 3IANA 3WNPA 2XH2A 4ZXOA 1HUVA 5E0KA 4J3VA 1PAMA 3AICA 2FMOA 2X41A 2QCNA 4M8UA 1M53A 2NXGA 1XGEA 5G1YA 3WF0A 4LQ1A 2P0OA 3TW9A 3ARZA 4DRSA 3QGVA 3N4EA 5JXQA 2G8ZA 2XGBA 3QGAC 1ITUA 2QPSA 3MCOA 3STGA 1RALA 4Q4PA 1GONA 1UZHA 1QNRA 3EX1A 4JKLA 4PA8A 2ZWZA 4CU6A 3ONCA 1ZLPA 4K2SA 3UG5A 3C2EA 5DT7A 1XH0A 1D3CA 1GZ1A 3DZ1A 3VM5A 4GBDA 4M82A 3HQNA 1IWAA 1EP3A 2ZICA 3B0YA 2TAAA 3CO4A 3P80A 2WSPA 2F9RA 1JNEA 4G9PA 4A22A 3P0WA 1OADA 3K4WA 2YA1A 3NG3A 5F1UA 3W84A 4PUNA 3B4YA 1S5VA 4JD4A 3MSRA 4JIIX 4QR6A 1N2VA 1DHKA 1V6WA 3NGJA 3UJFA 3E02A 5L6UA 3WN6A 3LI0A 4QRNA 1EZWA 2EJAA 3NPUA 5D2TA 4HMNA 4J35A 3LLDA 3EKLA 3LMYA 4DXVA 5EMUA 2QUNA 2QZRA 3W7IA 4MWAC 4F2UA 3AZTA 1REQB 2Z27A 3H2OA 1E1EA 3G77A 3GYCA 4QSFA 4O0KA 4A3HA 2R6OA 3TSBA 4N02A 3MQTA 1OEPA 2G3NA 4YL2A 4GACA 4AG0A 1LRQA 4GJJA 4V33A 1CPUA 2CHNA 3QOMA 3EDEA 3PJUA 4FPSA 4MLRA 1TJRA 2Y0FA 3FJ6A 3R7MA 4YLWA 2YCLB 3W1MA 2BGNE 3HPSA 4GYPA 4O50A 3ZT5A 3ANVA 1P6BA 1QPOA 3VZZA 4HU3A 1Q5MA 3PFMA 5CPSA 5DO8A 3UXDA 4JTDA 4FA3A 4U28A 1AZ2A 4DF1A 1RK5A 3LQLA 4RNHA 3BG9A 2TODA 3HO8A 3P93A 1NH6A 1ZBVA 1LRTA 3VYLA 2IXUA 3E0LA 1ZB5A 1A5SA 2WCSA 1LL6A 3TN4A 3WG6A 1JAKA 3EOLA 4JN6A 3THDA 3UGVA 3AQUA 5FACA 1KRAC 4D1JA 1UR0A 1V6UA 2JIEA 2YL8A 3WFLA 2P50A 4H9VA 1NWSA 3T8QA 4ROQA 4HB7A 2FLIA 1MXSA 1GOXA 2OLAA 4I5RA 2PDMA 2V0TA 2V3FA 1W37A 4K7YA 2D3NA 4ZR8A 1DQWA 4QCEA 3M0YA 4LUSA 3W7JA 3W22A 4B3KA 3WJXA 4NAEA 1K03A 1AW5A 3MHFA 4JAWA 4O1AA 1TCMA 3CWHA 1GCYA 1OX5A 4GPNA 3CZJA 4ZQPA 5RUBA 4AZIA 1AJZA 3R10A 3FNDA 4GX8A 2OEMA 2E68A 4WUIA 3QGKC 2VXNA 4HNOA 1IEWA 3GIPA 1CWYA 4WKAA 3ES8A 2FTWA 3M46A 3RU6A 3NEVA 4GINA 4W8LA 1H7PA 3CYJA 2AKMA 2Z26A 4MB1A 1ZENA 4DZAA 2WB5A 1YHTA 3GVVA 2J7DA 2XJ7A 5FD0A 1E72M 3DG7A 1SJBA 4UMAA 5CPLA 4Z08A 5M2FX 5FJTA 4ZBCA 3RFAA 3MS8A 4H8UA 4J3XA 2OZTA 1ADOA 2O55A 1TPB1 2YCKX 4UOQA 5FA5A 3Q4DA 4GE8A 3W7NA 3CZKA 2JKEA 1AFSA 1CLXA 1VYRA 2R1NA 2GQ9A 3DFTA 1E15A 2X1UA 1G4TA 4RXFA 2Q02A 5DMNA 1E40A 2CLLA 4GVHA 3LHYA 4Z1DA 5GQBA 3UCQA 2E6DA 1SMAA 2X1SA 1CIUA 5HANA 1JRCA 3CUIA 1KRBC 4MDPA 4NVTA 3W29A 2I1OA 4EIVA 2ZA3A 2FIQA 5CBBA 3SIMA 2BFGA 2GPTA 1RVGA 3R58A 4E0CA 3IVUA 1AQ0A 1OX4B 4WVXA 4V1XA 5CPMA 1XIEA 4JGDA 4NZ5A 2VELA 4JIRA 4B5WA 3G22A 1KR1A 1XINA 4QJ5B 4J5NA 3THUA 4RZ4A 4Y8FA 4X9YA 1VYSX 5H8PA 3VOCA 3W7CA 4FIRA 3R89A 4ZMGA 3W24A 1X7FA 2WANA 4KH2A 2B0MA 3MVTA 3RXZA 3BLEA 2WWDA 3KVMA 3T81A 4IMAA 3I4EA 3P3BA 1CXIA 2VP8A 3CH9A 3BW3A 1W1TA 5MF5A 2EPLX 3SADA 3U9IA 1K7EA 1UKPA 4LF2A 2VDGA 3BAKA 4ZSUA 1A5LC 3LRLA 3WLJA 3WY1A 4OKDA 4ERIA 3TEVA 3H55A 1V8EA 4UOJA 5CZTA 4AD0A 4F66A 1F3TA 1MRQA 3OLDA 4F0RA 4PMUA 3I3DA 1V93A 3PF3A 3HV8A 3S1VA 5A6BA 1R47A 2BXVA 2CFFA 4B2DD 2ZDRA 5HNUA 1RCOB 1TWSA 3A21A 4CCCA 4MVAA 1JEZA 2Z2AA 2ZC1A 3OQ8A 1DTNA 1F6KA 2ATSA 2DH3A 5T9BG 3P0XA 3K8MA 1CCWB 2J6VA 3BXWA 2V67A 2HS6A 2BVDA 1PDYA 1KNWA 1BAGA 3UVIA 4HK7A 3WCZA 1E9ZB 2D69A 1AJ2A 1BQCA 3DH7A 1JUKA 5CC6A 4HD5A 2DVTA 5H6HA 1MYRA 2XSBA 2YKKA 3S6OA 4UZUA 1ZHAA 2XIMA 1QU4A 3D6NA 1V6YA 2F6XA 4WCJA 5DCDA 1F61A 4GZ7A 1D7KA 2Y70A 3MI2A 3CV7A 1XS2A 1CLVA 1VR6A 4L6HA 4GBUA 3G1HA 4N6EA 4YVXA 4ZE5A 4AEFA 1FUYA 2ZZ4A 4MFEA 1LL4A 2FDMA 4B4FA 2XSXA 1GEQA 4XD5A 1E9YB 2VHLA 1NM9A 4L6OA 1K4GA 5I77A 3MUXA 3NQFA 4KEVA 3HGOA 1FHLA 2ZRZA 3RLUA 1VBJA 1FXQA 3NYZA 3NXFA 3KM8A 1S2UA 1O95A 5GJNA 1H1ZA 3H8AA 4NNBA 4TVUA 4MJ2A 4X0NA 2VX6A 4GIRA 3O8AA 2PTDA 1ISZA 2MANA 4KFOA 1VHCA 1AD4A 2CEQA 4LV9A 3W83A 1A47A 2PWVA 5AHNA 3VIJA 2Q01A 4Q4QA 2IPJA 2NQLA 3HQOA 2PF0A 3QFEA 4HU0A 1RY8A 5LNSA 4CEXC 2FKPA 2BHYA 3VX1A 2O7QA 3H24A 4DJDA 1WKYA 3RJXA 3R6IA 4UTMA 1XCWA 2YL9A 3WQ5A 2W3ZA 5CLWA 4QEEA 4C65A 2E5BA 3LM7A 2ISSA 4GO9A 1XIMA 3DKLA 3D47A 1E1FA 2HCVA 1FP9A 1VH7A 1SZFA 4KF1A 2FTPA 3L66A 4H9ZA 4F2BA 4TMBA 3JS3A 1UWIA 6XIMA 4QNEA 2QGYA 4GGBA 2Y8KA 3EWZA 2GGIA 5KITA 3H23A 2Q3RA 1WBHA 4JEQA 3UZ5A 5AC4A 3R0DA 4DJFD 3DYMA 1UWQA 3GK0A 1VBGA 3AMDA 5FEXA 4NZJA 1P5BA 3CGTA 5GVJA 3AHZA 3GHRA 2PDCA 4IT1A 3RM4A 4C6DA 4WGXA 4JTCA 3W1UA 3E2VA 3AXIA 3UESA 2UY2A 2D0HA 4TV6A 3TJXA 4ERAA 5H2ZA 2VFEA 4IQEA 1AMKA 2A3AA 1L6YA 1R38A 2CETA 3AHVA 5CC3A 4ADSA 3SCOA 3B0VC 3UY8A 3VX0A 2W27A 2WVTA 4LVBA 2PDUA 1HJSA 3OOQA 1LOSA 8CGTA 2PWDA 2J13A 4G6CA 3VOJA 4O18A 3TK7A 1G4SA 4C60A 2VL4A 2P88A 4IPIA 3VGFA 1YE6A 3HPAA 4GVGA 4BKNA 3L2IA 3WLIA 3M7SA 4V15A 4RDVA 3HG2A 1W5MA 2Z6JA 4QAIA 2JEQA 3M0ZA 1UP0A 2RDXA 3L7RA 5IHSA 1CXLA 1EF3A 3M5XA 2OGJA 5DXYA 4BJHA 1DWGM 2D3LA 2OQLA 1MFUA 2VGFA 1O5KA 3QMTA 5KZEA 2V68A 3TJ4A 4POCA 3R11A 1SW0A 5CPOA 3PBVA 2GVYA 3XISA 4NHVA 3IRDA 1TV4A 3E0IA 4M1BA 1XLFA 1TWZA 3LZ5A 5E09A 1B3WA 1DWFM 4BWLA 2D23A 1IT8A 4IIFA 1WYIA 3ZQ9A 1IIHA 2W62A 4JHOA 3S42A 3IS4A 4XAGA 1HFBA 4NJJA 3GKFA 2OTDA 1NWTA 3A5VA 1EIBA 3DFYA 2IKGA 3IJ9A 3N2OA 4I90A 5FOOA 5IXEA 1H49A 3BGJA 2A7RA 3LPGA 4AIOA 1WUFA 2XFYA 1O7AA 4K8EA 5M03A 1UP3A 2C15A 4B5NA 2XINA 4QLLA 3WNMA 3QV6A 1OC7A 1C29A 4FNTA 4IZGA 1UD3A 4F8XA 2A2IA 4LEFA 1PKMA 3QHOA 1F74A 4LY8A 4P7QA 4XZHA 4ECLA 3DENA 4Q33A 4DX3A 1VPQA 4FOKA 4ZE4A 1NOFA 3G1FA 1JG9A 1B9BA 1M68A 3H7UA 3M0LA 3CEPA 5HUPA 3E96A 1FH8A 1Q13A 3W1PA 2PDJA 3IK2A 4UOZA 4EANA 3GHUA 4ZFCA 1OSEA 4R9XA 1H7XA 1VFUA 4RNIA 1XM3A 1D8CA 3GVWA 5A8OA 4FOUA 4BWLC 3VOFA 4V1YA 3TNBA 3VDAA 3BJSA 3ABXA 4ICNA 1J01A 3MI6A 4D72A 4OOUA 3L4VA 4E2BA 2HE5A 1XYCA 4QLJA 2VFGA 2GUUA 4PTVA 4I6VA 4JCMA 1CTNA 3PBWA 1XBVA 4RK8A 2E67A 2PODA 2EQDA 1EP2A 3KHJA 3URBA 1SR9A 3ZR4A 4W5ZA 3VUPA 1P48A 3VIHA 1H0IA 3T2PA 5D8ZA 3VIMA 3B4UA 1L6WA 1MXGA 2XGIA 1SSDA 3ZIZA 3VD7A 4C6QA 2OWWA 4L9YA 1X1OA 4C6JA 1PWMA 4UCGA 4DI8A 4JHMA 3GTNA 1J79A 1XIJA 1JZ6A 3M0JA 4UZSA 5BRBA 4JKKA 3GH7A 2BP1A 2IPWA 4OWGA 2ZZ1A 1A5MC 4BF7A 3N2XA 1E43A 3K8KA 1XJBA 4W87A 2JEPA 1TV2A 3H4GA 2QCGA 4CQCA 1GHSA 2VI0A 3HQPA 1EJWC 4NZ3A 2AMXA 2E7FA 1XCFA 3ANYA 4ZSTA 3ITXA 1OX6A 3ALGA 5HATA 3T55A 3TYAA 4PGLA 2VRKA 3EA3A 3NEHA 4W84A 3LQGA 4O12A 4QITA 3NZRA 2CWXA 3HQ1A 3KCJA 1AMYA 1BEUA 1WPCA 3OZPA 1MDRA 5CAHA 2PC4A 2J66A 1UP2A 2CZDA 1GKQA 1FCBA 3W01A 2DV0A 4DLFA 4QDPA 4ACZB 4IPNB 3D5HA 4ZO6A 3WDQA 5HK4A 3W81A 5BXSA 2BNJA 2D2GA 2FYMA 3P8JA 4E2DA 3MJMA 3CIXA 4K1GA 2D20A 1A4LA 4XVEA 4P7LA 2VD8A 5CBIA 3WJWA 3EOUA 1ME8A 1M04A 2YB1A 2OWCA 1HW6A 3CQKA 4EPKA 3ZS4A 2E09A 3JR2A 3LZ3A 1S39A 4A2RA 3TXVA 1CGTA 4GOAA 4Z2JA 3OVQA 2EJ1A 3D46A 4MJMA 3DC8A 4QISA 1XRFA 3ZR5A 4AY1A 3WF2A 3M5VA 1VFFA 1IXNA 3AJXA 4GCXA 4F0LA 1M65A 4QE4A 3WH9A 3W7MA 3N34A 2JF7A 1FKWA 3IJLA 3QSRA 4P8VA 2XIOA 3EDFA 2CZFA 1OABA 4RDWA 3WLSA 1FXPA 5M1TA 1EOMA 3TX9A 3MUZ1 4A29A 1XSJA 3SCNA 3I7QA 3A22A 1R3VA 4IGHA 2XVKA 4FMVA 3HG4A 1WKDA 5A94A 1GW9A 3GR7A 5ABGA 2PGEA 1BD0A 1GPWA 3NFUA 1RQEA 3VCNA 1BG4A 1EJTC 2HXUA 2XH0A 4JYFA 5HWJA 3WLKX 1JR1A 3G1RA 3U2ZA 3W2KA 4FLRA 1LRNA 3ITCA 3UWYA 2FZMA 1NQ6A 1A4MA 3VNKA 7A3HA 2E4TA 4HGXA 5E9AA 1RBOB 4AFYA 4M0XA 3RK8A 4AUBA 1FOBA 1QHOA 1RXOB 3UR5A 4M19A 2YBTA 4L9XA 2WOQA 1JF6A 2ZRVA 1O4UA 1AZ1A 3KFTA 2NX3A 2YDSA 2XFRA 4A8LA 5HQLA 3DDMA 1DE5A 2F6KA 4FB7A 1ALDA 4WZHA 3VABA 1WZLA 2ZX5A 1GVIA 3NR0A 4PCFA 1EX1A 4I9MA 3FS2A 1J6PA 1R3RA 1UR3M 3T1GA 7TIMA 1QI0A 1XLEA 4NKCA 1G4PA 1NU5A 3NVDA 1K8CA 1VIZA 3MUAA 3WBYA 1KBIA 4JTFA 6REQA 3MPGA 1I1WA 2ZTJA 2O9PA 5LSMA 2J7HA 1XBYA 2OOFA 1KV8A 4AWSA 2VC5A 1DKWA 3B9OA 3LCGA 3TZFA 2E9BA 3NYDA 4PMYA 3M5ZA 1T8QA 1VRXA 4O8AA 3CMGA 1IR1A 4DWSB 5LGXA 3KW3A 1A5BA 4IUOA 1ECEA 4I7UA 3E12A 2BOGX 5D03A 3ABQA 4S3FA 4DUWA 4DUVA 4X9SA 5C55A 4QLKA 3L65A 2DP3A 2R9RA 1OF6A 2XN2A 1A5CA 3VGBA 3WBXA 4DLMA 3TW6A 3T0DA 2BWGA 1DHPA 3W1LA 1J2WA 1DIEA 3GTIA 5EBAA 5CCZA 3ARRA 7REQB 3K13A 4YYFA 1W5QA 4AZ7A 1B4EA 2G41A 3PB2A 4Z2HA 3S46A 1V08A 5F4XA 3OYZA 4Q4RA 3MUIA 1V6XA 1CECA 4G2DA 4UFLA 4YPJA 2DW7A 3AFBA 3N12A 1TSIA 3RU8X 3NOYA 3TAOA 3UQNA 5HDRA 2REQB 3K4AA 4MHBA 3VKBA 5IDZA 4RCXA 4HQVA 4NSBA 3PPGA 1O5XA 3AXHA 1T7LA 5LIUX 4QCFA 4G8TA 2I57A 5I3HA 2YXXA 3SDOA 4UFKA 3AZRA 4TXEA 3WLNA 4FNUA 4GO8A 1QOQA 3W07A 1VEMA 1F07A 3DKJA 4LPCA 4L7ZA 3UZWA 1IV8A 4BY3A 1XP3A 1JYWA 3MDUA 4WRHA 2WJEA 5FCZA 2F2HA 4FX6M 3KS6A 3MUY1 1EJXC 2NQ9A 4GI6A 3CUGA 3RCYA 1LBFA 3N11A 3LM3A 1LF1A 4PCPA 4F3HA 3HOJA 1GQKA 2PFHA 4UTHA 3GFXA 3B0XA 1IEVA 5CJNA 1FWAC 1XSKA 2WV8A 1E6QM 3U3HA 2O4MA 4QNWA 3SM0A 1TPC1 3GW0A 1QVBA 3AALA 5GNXA 1RUSA 4BS0A 1QPKA 3W02A 2UZ9A 4G56A 3MSGA 3QSTA 3QZ6A 3SAZA 2QDHA 3W7OA 3C2OA 1B31A 3SRHA 1JGIA 1GKPA 3T0AA 3QMSA 2JGYA 3PC0A 3TC7A 3VMOA 5CAKA 3USZA 1MRAA 3ZJ8A 2CCRA 2Y7GA 3P84A 4JXCA 1W1YA 2GGJA 1TWIA 2VR2A 2YOCA 5HMEA 4M5PA 3VD9A 1JI2A 3AIUA 1QWGA 5EPDA 4DQWA 3ECQA 4AWTA 4O8RA 5ENLA 1EYWA 3CS2A 5G2WA 3L21A 2WW5A 1IZKA 4Q8UA 3AMKA 4UTUA 5DELA 1SQ7A 2C16A 8XIAA 3LV5A 1IIGA 3V7PA 1I0BA 1KLYA 2CBVA 5AOUA 5AYBA 4FLQA 5FESA 2V3EA 4HCDA 2IPFA 2HMCA 3M0IA 3BUVA 3VAVA 4O16A 3W7DA 4QQUA 3MY9A 4GVIA 3ZJ7A 2BZNA 5XIMA 5K9DA 1E1CA 2OELA 1PO9A 3PY2A 1L6GA 1OFQA 4NAFB 2WHMA 3O2LA 3SEPA 5JQ9A 3A3HA 4O14A 4LAOA 2J79A 3B03A 2VCCA 4GX9A 5I3GA 2ISVA 3VUSA 3GXTA 3H2CA 3UWVA 4OOZA 2TYSA 1TMHA 1AG1O 1FWEC 2KX9A 2NUYA 1JZ4A 3ISIX 4R34A 3BANA 3GSMA 1TTIA 3GIQA 3EPMA 1PIGA 4CLMA 2VUYA 1EXPA 4H1ZA 4MWAE 2OKTA 4O1BA 5FJRA 4WIWA 3MUCA 3L4TA 4GMEA 2JIWA 4A35A 3QXBA 5KETA 3V0SA 2NQZA 1JQXA 2J75A 3MANA 3RCMA 1FFRA 4RW3A 4X60A 5TQLA 2OSYA 3M43A 4OHQA 1DIOA 1S2WA 4S3EA 2R1MA 1U1JA 3ABOA 4JEJA 1FA2A 3UNDA 1QI4A 3V5FA 1VFHA 2ALRA 4C91A 3FA3A 1YTDA 1Q8AA 1HVXA 2YX0A 1HJQA 5EMKA 2OLHA 3BAJA 3HJZA 4IFKA 4AIBA 5AC8A 1XPGA 3F2CA 1CBGA 1KKRA 1JD7A 1JCLA 3U57A 1E6PA 1SJDA 3TSDA 2NV2A 3FYOA 3CBWA 1Q6QA 4PTNA 5F2GA 2I9EA 1LT7A 2AAAA 4LFYA 1WDPA 2ZADA 1GPFA 1KKOA 4EWND 4AD4A 3IVTA 3EYPA 2PDLA 4KBXA 4D6IA 3UR7A 3HA1A 1FWCC 3B9DA 3WDRA 3HURA 3IAQA 4PSPA 3TLLA 3PZMA 2C0HA 2VM8A 3T05A 1OT2A 4FS9A 5EFDA 1VPYA 3EMQA 5J5DA 4JTUA 3DN5A 1TPUA 4Q4KA 1R7OA 3QC0A 5HINA 2VEKA 5K4XA 3TOPA 4QDMA 1LZOA 1GTHA 4MJ4A 2EXOA 3TSMA 1JYNA 3OPSA 4GY1A 3C0QA 4P7OA 4LYKA 3SCVA 1G01A 3M0KA 3O16A 2DSZA 1SO4A 2Y5SA 6ALDA 3SY8A 4UTWC 3BO9A 4XD3A 3BICA 5IOBA 3BLDA 2QS8A 1UC4A 5FL1A 5AECA 3TTQA 5F1VA 3WMLA 3RM8A 1R9XA 4PRRA 3TN6A 4C6MA 2W5FA 3E0VA 2ZX9A 4DJEA 2X1TA 4LYQA 4XD4A 3UP8A 4JCLA 1BRLB 4S3KA 2DZWA 3VNJA 2Y1HA 3MMDA 1JZ3A 4GYFA 4GIYA 4H7ZA 4HK5A 4YHEA 1YDNA 1WXZA 1KBBA 2VFHA 1UUOA 2HQAA 1EA9C 1LG1A 4AEEA 3RRAA 1FRBA 4LRTA 2CIPA 3ZVHA 4YWSA 1D3GA 4O1CA 3CHFA 2HXTA 1M41A 4GLEA 1G5AA 4MUPA 4KWWA 1ODUA 4DZIA 3D3AA 1W3TA 2SFPA 5EBUA 3AHXA 4HZ8A 4B92A 5CPQA 1E6ZA 1NAL1 1EFZA 1UZDA 1O68A 3AUOA 3FEMA 2O9TA 2XSAA 5E6ZA 1Q6DA 1UJPA 3P8IA 4AIUA 3KLLA 4L1WA 4AAJA 4TOQA 2XISA 3JUGA 2C7FA 2UY4A 3IGSA 2HROA 1KLZA 4CD7A 3PK7A 4URIA 5G2HA 3KRUA 1TV5A 2G5WA 5FSDC 4HKPA 5DEZA 1RBAA 4ENLA 4DJEC 2WC7A 4QX4A 3CL6A 4CVUA 4LB3A 4HNVA 4UXDA 2IKIA 4CQBA 1EPXA 1XYFA 3VKDA 1U30A 3CNYA 3GM8A 4G1NA 3NWRA 1HL8A 4LUYA 1HL2A 1OYCA 1H3GA 1US2A 3GG7A 3MHUA 1ISWA 4JOMA 1R9YA 1KQYA 1KM0A 3AI0A 1EHAA 2OQHA 4MY9A 1KXVA 5CZKA 2H3DA 3OODA 4A3UA 2YW4A 5FJUA 2WVVB 3ZO9A 3B9NA 1JJKA 3GG8A 3WQ8A 4K1WA 3TXZA 1NP0A 1TZ7A 2E5DA 1I2OA 2EG6A 4B9ZA 1R3SA 3S2CA 3ORWA 2W4XA 3G8RA 4HNUA 2PE4A 2O0TA 5T9CE 5CPNA 1UKQA 4UTFA 2IPGA 1JPHA 4HJWA 2X1RA 3ME3A 4HNCA 4JQ1A 3VINA 3PR2A 3LA4A 4QJ1A 4CQAA 3OHMB 3NDYA 4JTTA 1V0LA 4MWAB 3USBA 4LAKA 3M6YA 1AW1A 1TPFA 1ECQA 4BHYA 2PRLA 4U10A 3CV2A 3NZPA 1OCQA 3L0KA 1CXHA 4IGNA 2CYGA 3PZIA 4AC7C 3LTYA 4XD6A 4RE0A 5ABEA 1XIGA 1CLKA 5IHRA