4NJJA

Crystal structure of quee from burkholderia multivorans in complex with adomet, 6-carboxy-5,6,7,8-tetrahydropterin, and manganese(ii)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
209
Chain Sequence
TYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGENGGKFKDADALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFGIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 7-carboxy-7-deazaguanine synthase
publication title Radical SAM enzyme QueE defines a new minimal core fold and metal-dependent mechanism.
pubmed doi rcsb
source organism Burkholderia multivorans
total genus 66
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.3.99.3: 7-carboxy-7-deazaguanine synthase.
pdb deposition date 2013-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4njjA00
1JJKA 2ZQ0A 5AHEA 3TDFA 5EKYA 3VE9A 3M44A 3TU9A 3TNOA 4K37A 4MLRA 1RZMA 5G2WA 1VC4A 1YPFA 2QEZA 1O5KA 3TCEA 1LRQA 2UV8G 2EPHA 4IMEA 4O12A 7TIMA 4FF7A 1PIIA 2ATMA 1BTMA 1QFEA 1BWKA 1S5WA 1YLVA 1IF2A 2J9XA 5ABTA 3FS2A 1SO4A 4JX6A 3LV6A 1Y0EA 3E49A 3NAVA 1UUMA 1L6YA 2Y63A 2V5LA 4PEKA 1AMKA 5LNVA 4DBDA 4UR8A 3ATYA 2C0AA 3BW2A 1H1YA 3A5FA 4MOZA 4YMZA 2ZCGA 1KFLA 4A2RA 1QOQA 3U6WA 3P74A 4YCOA 3TC7A 4K8EA 2QCFA 4MY9A 2EAWA 1W5MA 2ZRUA 4LRTA 3I65A 3BV4A 4W9TA 5CPOA 3IGXA 3LOTA 4GFSA 4MYAA 4CNNA 1PCWA 1ZAHA 3QZEA 3LHYA 3LX9A 1W54A 3L5LA 2B4GA 1K02A 3QJAA 1DORA 3QMRA 3T78A 3O6CA 5EY5A 3LI0A 2BZNA 4JY8A 3W2JA 2OX1A 4K38A 1WYIA 1KFBA 1QAPA 2J27A 4IMFA 4K39A 3NYZA 3RLVA 3W7GA 1A5SA 3AO0A 1VPXA 1XI3A 4UNKA 4R34A 6ALDA 4MJZA 2OCZA 2Z6IA 1KW1A 1R47A 2YGYA 1W3IA 4DO5A 5C55A 2C3ZA 3HPZA 1TJPA 4Y96A 4FB7A 5CZJA 4HSNA 4E2DA 3PULA 2C1HA 4RZ4A 2QUTA 2V0TA 1JULA 1LTDA 1SFLA 5G1TA 3IIPA 4GC4A 3PUEA 4JTSA 1F6PA 1OK4A 2CU0A 4MZ8A 3G8EA 1TMHA 1RV8A 3IVTA 1UASA 5KZEA 2DZWA 4A21A 2NX1A 4O10A 1W37A 1BKSA 1P1XA 4UXDA 3QSTA 4LUJA 3DHDA 3M6YA 3JR2A 5K9CA 5KSWA 2Q8ZA 1ZENA 4I7WA 2ZTKA 5I3KA 4N9DA 1Z41A 1CW2A 1QPQA 1SZNA 5D33A 3M5VA 3W9ZA 4PL1A 3H53A 1QPOA 5FF4A 1L2UA 2ZRWA 1JQXA 4FX8A 3W07A 3LCGA 3TW6A 1C29A 1G4SA 3DBPA 4MLJA 1RPXA 1I2QA 3NQDA 3O8AA 4MZYA 2NUXA 3MYPA 1JCJA 3UY7A 2VFDA 4UTTA 3C56A 2YDAA 1R2SA 3MP3A 3TC6A 2QJIA 4UFMA 4E0CA 3THQA 4GRSA 4OE7A 3KRUA 4TMBA 2G97A 3RU6A 2DU2A 4AHQA 1FWWA 1TIMA 3UXDA 3ZR4A 3MP4A 4MJMA 1H51A 3O6DA 3VE7A 5F1VA 4LWWA 5D2WA 2XN0A 3G0SA 2E6AA 1FX6A 1WA3A 3YPIA 3MP5A 5HWMA 5D05A 4KWVA 2X1TA 3G1FA 2DORA 1KFKA 4GE8A 3S5ZA 3D0CA 2NXGA 4LVDA 5C6MA 4XBSA 3OIXA 3ZWTA 3LHVA 3GIYA 3GKAA 5AN7A 5K9DA 3BG9A 1W3NA 5G2IA 3G1XA 1VZWA 4UMAA 4NUWA 1SSGA 1G67A 1THFD 3GNDA 1Q3NA 1R46A 1W56A 3GXNA 3LHWA 3C6CA 3O6YX 1GG1A 3BGGA 1OFQA 3P61A 2WKJA 4GXMA 3W2UA 4EVZA 4HPJA 3HGRA 2B7PA 4JIPA 2NWSA 1I2OA 2C18A 3NG3A 4LS1A 1P0NA 3PWAA 4UTTC 2E1DA 3KXQA 4H6KA 1EUAA 1SW0A 2GUUA 2QAFA 2R94A 1P4CA 5EL1A 3E96A 3UZJA 5AC8A 3S1WA 4WZHA 2EKCA 2JKPA 3W76A 4IPJA 1LOLA 4FIQA 5MHBA 2QJGA 2WNZA 3CHVA 3TSBA 1OFRA 2RH9A 3HBLA 4GUFA 3BW4A 1HUVA 4EIVA 3DFTA 5AYXA 3W1NA 4LC8A 3MWAA 1V7YA 3C2FA 2ZBTA 2FDSA 3L68A 1W5NA 1CI1A 3LHZA 4CQ9A 1VCFA 4JNMA 1W5PA 1D3HA 3PG8A 2DJXA 4J9JA 4YL2A 2ALDA 1TTIA 1UJPA 4FNRA 2FPTA 4OU1A 2WSQA 1K7XA 3LV5A 5T26A 3MW7A 1ZAJA 1T99A 3GDKA 4KWWA 3L9CA 3LCWA 2HTMA 2QCCA 4JTJA 3C61A 1OX4B 1V5XA 3DU0A 5KINA 2CLFA 4NNBA 1G4TA 2BXVA 2ATSA 3W1AA 1WAUA 2A21A 3SGZA 1G4PA 5A5WA 4HKPA 3LRLA 3TUUA 3M0ZA 4UMBA 3PY2A 1GVOA 4JYFA 5CPMA 3SZ8A 3M5XA 2J9YA 3UYCA 1W1ZA 4UFIA 2B7OA 1YDVA 3FOKA 3LGEA 4BR1A 4JX4A 4FXRA 3IGSA 3GYEA 2ZZ5A 1DVJA 1JCNA 4JX5A 3EX2A 3KRSA 4IWWA 3W74A 4Z1AA 3W3OA 3HPSA 3BG5A 4PCFA 3LBCA 2Y7FA 1XBVA 3NZRA 2C14A 1ICQA 3TQVA 2Y62A 1OFDA 2E5CA 3C3NA 2YYUA 3PF3A 3IVUA 4O4VA 2JGYA 2ZA2A 3VCRA 3NQ2A 3UNDA 2R91A 3W7NA 3I7SA 1DQWA 4UTIA 3B0VC 4ALDA 3RFAA 1T0OA 3DI1A 3L65A 4U28A 4MKNA 2EF9A 2W79A 3EKZA 3NM1A 3P80A 5A8GA 1KV5A 3LB0A 1K03A 3SI9A 5K2ZA 2PCQA 4IGHA 4K6AA 3OVPA 2CZFA 2VEIA 3PC0A 4O0ZA 4JYDA 4AAJA 1A5CA 1WQ5A 4Z1DA 3S9YA 5I3JA 1LOSA 4JEQA 5FF0A 2ZZ3A 3WJXA 5LNUA 2VFFA 5BOOA 4O1BA 2XFWA 3M5ZA 3WJWA 1PVNA 1ICPA 3VKJA 3LDVA 2H3DA 3B06A 3T55A 3CEUA 1BWLA 2QCHA 1DKWA 2VFEA 3W1XA 4ZQMA 4ONVA 3W23A 1LBMA 1GVFA 1G7VA 3S0CA 1VRDA 2JK2A 3BLFA 3P60A 3OA3A 3WK2A 1SW3A 1UB3A 3T44A 3B8DA 4NZFA 3MBFA 4UUIA 1Q6QA 3F03K 5AHMA 4O8RA 2GPTA 2ZZ4A 5AHLA 3EEGA 4MFEA 3L0NA 1VHNA 4LT9A 3L66A 3E0IA 3NA8A 3LLFA 1FCVA 4AH7A 2QCDA 1W0MA 3O1NA 4RK8A 5KITA 1LZOA 1NF7A 4TX9A 1OVDA 1G69A 3TFXA 3CIWA 2ZRVA 3EXRA 1YYAA 3W72A 2C6QA 2V82A 4M7SA 2TSYA 3HF3A 1IXOA 5U4NA 3STGA 1PCKA 3SGUA 4AWTA 4CLMA 2VC6A 1F6KA 3EWXA 1F73A 3HG4A 3HG3A 2DP3A 2Q8LA 2H90A 3M1ZA 3NXFA 2VKZG 4JTLA 1J4EA 4JXCA 4IX2A 5H2ZA 1ZAIA 5CZTA 1A5AA 2A5HA 2ZZ7A 4CCCA 1KM1A 4ICNA 3TAKA 1WXJA 3H54A 4M6VA 4O11A 3M16A 1XL9A 1SZEA 2W6RA 3MHGA 4NJJA 3LERA 3SW6A 4DF2A 4JTEA 3NL6A 4FNQA 2CZ5A 3UWQA 5LNRA 3NQEA 1JUEA 3QPYA 3CIXA 2CZDA 2A85A 2XN1A 3QH2A 3NNTA 1JCLA 4LVGA 4EOUA 5K4ZA 4RXGA 4I7VA 4BWLA 4S1FA 5AHNA 5TQLA 3G0XA 5F1UA 4GUGA 2B7NA 3S1VA 1QCWA 1I2RA 4UTWA 4Q33A 2RKXA 2GVLA 5G4WA 3VFLA 3TSDA 2H6RA 1KM5A 5BMWA 5DN1A 1EP3A 3S8HA 3W88A 2CWNA 3DGRA 2I14A 4DBEA 3W7KA 3LXCA 3GX9A 2QF7A 1TPH1 1GOXA 4LV9A 4OHQA 4WUIA 1AL7A 2VFGA 3O05A 1KLYA 2ZZ2A 1O60A 4ZQOA 4DEFA 3Q94A 4PA8A 2AGKA 2FIQA 4OBTA 4M6QA 4PODA 4A3UA 2TPSA 3FYPA 1LORA 2YW4A 3LI1A 2PRLA 4DXVA 3G3DA 3A21A 1QMLA 3LTYA 2EHHA 3BG3A 4EF9A 2ABBA 1VYPX 4NX5A 3W1PA 3LCHA 1TSIA 1KM3A 4O1CA 4ADUA 4PTNA 4POCA 4AHOA 3NL2A 4NJGA 2X2GA 3QYQA 2Z2UA 3N2MA 2E77A 2V2HA 4FEZA 4BWLC 4IMDA 4UTMA 1LRNA 4FNSA 3P8JA 1HFBA 5HWJA 3P62A 1OFAA 1SO5A 4UTWC 4LW7A 3WJYA 3KVKA 3UZ5A 1VHCA 2V2DA 3W7LA 5BMXA 3EXTA 5CZ0A 1ME9A 3W1RA 4FNUA 3WFAA 3TIMA 1DQXA 4QSHA 3B0PA 3W7CA 4HNVA 1TPB1 4CQAA 1LRTA 1GTHA 4XTDA 4O13A 2CLEA 2ZDRA 1LLZA 1H7XA 4LNYA 4RX0A 3DI0A 3RNDA 2E5BA 3MO7A 3UWWA 2DZSA 5HMSA 3KHJA 4XWUA 3OBKA 2ZA3A 3NQ8A 3HMJG 4JTHA 2Z6JA 3DH7A 2Y7EA 3TX9A 3R5EA 1X8FA 4ZQRA 1QWGA 1I4NA 3S5YA 4GUJA 5FF2A 4JTIA 2A2IA 4Z1BA 3GR8A 3MI6A 4LV4A 3BARA 2HS6A 4TIMA 3UD6A 4ORIA 4P2VA 5FF7A 4DPQA 3TROA 2BSLA 3ZWSA 2A7NA 2G5WA 3NVTA 3L2IA 1GT8A 2E68A 2HS8A 4QITA 4AF0B 5HQEA 1PHWA 4U4MA 1KM4A 1SSDA 2ISSA 1LLWA 3UXAA 3LRMA 2QCEA 4LVAA 4G1KA 4PH6A 3TW7A 3QW3A 3KAOA 1DV7A 3S1UA 2E5DA 2P0OA 3NPVA 3FIGA 3U8GA 1TO3A 2RDTA 2WOQA 3MHFA 2ZA1A 3NL3A 5LNWA 1KA9F 2W0UA 3INPA 3NEVA 1B9BA 3NQGA 3NPWA 1KFJA 1ADOA 5LSMA 1AW2A 3W22A 4FX7A 3GDRA 3DKJA 1AL8A 5DY2A 1OX5A 1EPXA 2YX0A 1JRCA 3DKLA 1H7OA 3NO5A 4RJEA 1QR7A 3SIZA 1TPWA 1OFPA 4YWIA 4NXKA 1GYLA 1N7KA 1KFCA 5AHIA 3MYOA 3BLIA 4L4LA 3OEXA 4GJ1A 2QR6A 2C13A 3W75A 4GUIA 1EWDA 4M6PA 2JGQA 4IQLA 1VR6A 4WQ6A 3L21A 3CLMA 4AB4A 3SSJA 1TV8A 5AC6A 2D73A 4JY9A 3G18A 3QM3A 4H3DA 3FFSA 3W85A 1AW1A 3HG2A 1TQJA 5F2GA 3A24A 2O7QA 4UTUA 2CW6A 3NPUA 4MPQA 4PL2A 1ME7A 3Q37A 3PBVA 4DELA 4ML9A 4NZJA 5AYZA 4XKYB 2YYTA 1OF8A 4AWUA 2GVJA 4KKXA 3TXZA 3TQKA 1IGSA 3G1YA 2Y85A 4JTGA 4LVBA 3ABRA 1FXPA 1YXDA 2FLIA 2NX9A 3BW3A 4UFJA 1L9WA 4HNUA 1XBYA 1GVQA 3QQ0A 2TMDA 3GXPA 4NJHA 1H7NA 1WX0A 3QSRA 3G1VA 4O53A 3N19B 3EB2A 1K7FA 3P67A 3AJXA 1ZY9A 5I3FA 5HULA 4NNCA 1K8XA 3W73A 1E51A 4UNLA 1W8SA 4AXKA 5H91A 1TTPA 3KRZA 4RLIA 3EX6A 1Z42A 4D2JA 1LYXA 1A5BA 3USBA 3B0UX 3I68A 5HR7A 1K3UA 2VENA 5I3HA 3SR7A 4LRSA 4ZZ9A 3HO8A 1DJQA 4UFHA 3HG5A 2GOUA 1VGAA 3KVMA 1TPUA 3CC1A 1TPDA 3EWWA 1XUZA 4N2YA 4LS2A 2DZUA 2V9DA 2P1FA 5BNKA 4JR5A 1SFJA 3CU2A 4UIOA 3O16A 3MUXA 5G5IA 3C4UA 4NVTA 2BX7A 1GWJA 3Q58A 1W5OA 3QMTA 2GVGA 4N02A 3PM6A 1H7PA 1MEIA 4MY8A 3LLDA 5DLCA 4N6EA 4Y6GA 4FNPA 3HIJA 1H50A 1OX4A 3EWZA 5F4SA 4LU0A 5FEPA 3W83A 5EYWA 1YTDA 3GNNA 3NQ7A 3SECA 2FPVA 1KBIA 3KVLA 3E02A 5D04C 2NV1A 5EPDA 4DF1A 2VEPA 3QF0A 3BK0A 3NQAA 4UFLA 2B0MA 1TTQA 2DZVA 4UC5A 3IRDA 4O15A 1JUBA 3DXIA 2GJNA 3S6DA 5EBUA 3OHIA 2GQ9A 2VEMA 1LM1A 4UR7A 3WK0A 3RLUA 3NOEA 1UUOA 3N9RA 1O4UA 4RCXA 5EMUA 1KTBA 1TPVA 3LHUA 3IIXA 2GQ8A 3P5ZA 1SZGA 1HO4A 3HQ1A 1MO0A 3I6RA 3GVGA 3N2XA 3PSWA 3TMQA 4Q4KA 3LTSA 1KV8A 1SPQA 5CPLA 1G7UA 2CLLA 2NZLA 3W2MA 4QIUA 1Q6RA 3FEMA 4FXSA 3JRKA 3EWYA 1FDYA 5CPNA 3I7RA 3U2OA 5U7SA 3JS3A 5E93A 4RR4A 2QCMA 1TTJA 2LLEA 2NUWA 4FIRA 3V75A 1TPC1 2Z0IA 3P5YA 5F4XA 4MUZA 2VFHA 5LKYA 4RZ5A 2DZTA 2PRMA 4CQ8A 1VLWA 2QCLA 1ICSA 1H61A 3EKLA 3O07A 2VFIA 2ZYFA 1TPFA 4CNPA 4DO4A 1NVMA 1GG0A 1EUNA 1Z44A 2YSWA 3OG3A 1TB3A 1XKYA 3B05A 1IIHA 2X1UA 2Y7GA 3W7RA 4OWGA 2OT0A 3W7QA 3IV3A 1S5TA 2PRHA 4X9SA 3W70A 5DY3A 5FI8A 1VCVA 4WJEA 1SZFA 1KBJA 1D3GA 5J5RA 3C2RA 4UMCA 5F4WA 3IIOA 3W7HA 1FWNA 1OFBA 4YXGA 2R8WA 3CEPA 4FX6M 1KFEA 1U5JA 3W7DA 4H4IA 3ABSA 3SFKA 1VLIA 3LBMA 1F05A 4JD4A 2FB2A 2TRSA 2Z1BA 1R2RA 3L5AA 3UWUA 3FKRA 1OABA 4IX0A 4QQ3A 3G1DA 3N9SA 5AOUA 3S5OA 4RV8A 5D2TA 1YTKA 4O16A 5AHFA 4ZMGA 3NQFA 5DELA 4CCDA 4MY1A 3TFCA 2DZXA 5EA9A 2YXGA 2A6NA 1F74A 4M19A 4LS0A 5K3VA 2BLEA 1P0KA 2WV8A 1O5XA 1Q45A 1J5TA 4K8HA 2FJKA 2NX3A 4MFDA 5HNRA 3G22A 1NSJA 4O18A 5DXYA 1GYNA 1H5YA 8TIMA 1OJXA 3T40A 3MI3A 1PV8A 4JGDA 4ADTA 5CKSA 1C8VA 4E38A 5FF3A 2PE4A 4N9EA 1WOBA 1G4EA 3GZ3A 3W7IA 1PE1A 4Z0SA 4P61A 4MZ1A 5C2XA 1XBXA 3T4CA 4O50A 5LNSA 3P8IA 4Z0JA 5AFDA 3HOJA 3PBYA 3TMLA 1GQNA 4C1LA 3CT7A 1M5WA 1XC4A 4OT7A 3W2LA 4I9AA 3ABQA 1LDCA 5DXXA 1DJNA 3TJLA 4KFOA 1C9DA 3EWBX 4X3ZA 1S5VA 1R2TA 3A9IA 2FPYA 1HTIA 1L6WA 2F7FA 4QISA 3TQ0A 3LCFA 5I3IA 1ZFJA 3PBWA 4HIBA 3LRKA 4QJ1A 4YLWA 5HUOA 3CM4A 1FWRA 4N9CA 4WY0B 3CWNA 4UTHA 3L0KA 1SR9A 3UWYA 3CWOX 4A29A 1LP6A 3UQNA 1XDLA 1RR2A 2VOMA 5KMYA 4BFAA 1UCWA 4JTKA 1WOAA 5KZDA 1GEQA 4BI7A 3G1HA 3LCXA 2GJLA 1LROA 3W1LA 2DJLA 6TIMA 5K4XA 1YADA 3W7PA 4DPPA 3UWVA 1OFOA 1EX5A 2A4AA 4Z08A 3GAKA 2ZRYA 1MSSA 4IMGA 3PVFA 1DBTA 4GUHA 4BI5A 3KFTA 2CLKA 2YPIA 4IXXA 3DZ1A 2ZFAA 1MXSA 4LUIA 2J6XA 2QDHA 1RVGA 1KLZA 3TA6A 3W1QA 2Y70A 3FA5A 3HPXA 3UPBA 5BRBA 2NUYA 2WSYA 2ZRXA 3LTPA 1VQTA 3L0GA 4N9BA 5HUPA 1Z48A 2JKAA 3N34A 2A6LA 2PURA 5F2MA 4AMAA 3IIZA 1OHLA 2AAMA 4EWND 5G1YA 1Q6LA 2WSRA 3QQ1A 1NFBA 5HWNA 2NLIA 3NGJA 5BW6A 1GJPA 4TMCA 4A22A 4JS3A 4N4PA 3G8RA 1AW5A 1KM2A 1FQ0A 1B4KA 1H60A 3A22A 5LGXA 1SO3A 3PR2A 1ZJIA 2G96A 1OFEA 2I9EA 3LCLA 3VI2A 3I7QA 1XDMA 5C5YA 1GVRA 1EIXA 4XBKA 4AF0A 3NZ1A 4HSOA 3SJ3A 1B3OA 1VCGA 2ZRZA 4ADSA 1BEUA 1OYBA 3W1MA 2QKFA 2QDGA 1FDJA 1LBFA 4CNOA 1M7PA 5CZSA 2PC4A 2XN2A 1SW7A 2X30A 4XQ6A 1MEWA 1X6UA 3NDOA 4IOTA 2TYSA 5KTLA 2RDWA 2Y89A 4WOQA 4WY0F 2NV2A 1LBLA 4RKAA 4NQ1A 3DAQA 3R8RA 2H8ZA 1GZGA 1RQBA 1TV7A 3R2GA 1NAL1 1EP2A 1TREA 4ZL1A 2J9ZA 3F1QA 4IMCA 3GAYA 2C19A 1JR1A 2ZZ1A 3ZFHA 5FEZA 2RHGA 3W7EA 3S5NA 2FQIA 1XFBA 5E0KA 2A1YA 2H8XA 3IIVA 4NJKA 3W1UA 1FBAA 1T8XA 3W71A 3PAJA 3TKFA 4O19A 3V1PA 1GTEA 1PL9A 3NM3A 5LGZA 4IPIA 4O1AA 4X2RA 1EB3A 5DCEA 4OGZA 1OYAA 3P84A 4X22A 5CSSA 1TCDA 4MIMA 3PBUA 4JDYA 1JVNA 4MYXA 5D03A 3A5VA 3M47A 2B7QA 4JTUA 2ISWA 3NQCA 4XKYA 4K7YA 3N73A 3QFEA 3E12A 1B4EA 4HPXA 2FFCA 3C2EA 3EXSA 4AVFA 5TBOA 3GLCA 2OJPA 4JICA 1Q6OA 3C2VA 2Y88A 3M9YA 2Y6ZA 2WNQA 3A23A 3TJXA 2VEKA 2X1RA 3IEBA 1OYCA 5D38A 3WK1A 4TU1A 4OV4A 3GB6A 3TE9A 2YW3A 1O95A 3M7WA 1VJIA 1HL2A 4O54A 3E9AA 1H63A 5L9FA 3OVQA 2Q3OA 2O7SA 3GDTA 4KFNA 3BPWA 4JN6A 3FJ6A 5FEXA 3NQ6A 1SUXA 3C0JA 1SU5A 4ZQNA 3NQVA 1QDSA 2NWRA 2WPBA 1TQXA 1WV2A 3DFNA 4Y9AA 4B5NA 1JQVA 4O0KA 1U83A 2V30A 4MVAA 1I2NA 1GPWA 4N4QA 3WJSA 4M7TA 2E6DA 3R12A 1W3TA 1YPIA 1MZHA 1QNVA 4R33A 2WQPA 2ZTJA 4NT0A 3GK0A 3DFSA 4QM1A 3MBDA 4GNJA 1EP1A 3LHTA 3W84A 3BLEA 4UCGA 3VNDA 2QUVA 4UTLA 1FDZA 3NL5A 4LTSA 4C1KA 1G6CA 4WOZA 4O4WA 3GKFA 3T7VA 4O1DA 5CGQA 5CG7A 3UPWA 5GVJA 5K7JA 3W87A 4UTJA 4DO6A 3ABOA 3C2OA 5DBUA 3Q2DA 1TRDA 1YDOA 2CZEA 5F2LA 1KM6A 1S3HA 3K30A 3C52A 5E1QA 1N8FA 3EX1A 2QUUA 4BF9A 2RDUA 4A2SA 2YCEA 1EA0A 4CCEA 5G4EA 3TR2A 2EGZA 4KFPA 1DOSA 2CLMA 4E2BA 1UBSA 5DBTA 3QPZA 4GBUA 1J2WA 1ML1A 3KVJA 1JUKA 3G24A 4N6FA 3HGOA 3STCA 3PUDA 5I3GA 4BI6A 1K7EA 2E09A 4DF0A 3GXTA 2R14A 3C8FA 3O15A 2C15A 5TIMA 1SO6A 3DFPA 4OV9A 3FKKA 1F7BA 4S2CA 1OF6A 2C16A 2WNNA 3LXBA 5D37A 2GQAA 1VS1A 5D02A 4FNTA 3UWZA 2NXIA 4ZVJA 1FXQA 3L5MA 2QCNA 1A50A 4K7VA 3HGJA 4RXFA 3O06A 3NR0A 4LC6A 3NQMA 4WXYA 1YDNA 1VH7A 1P5BA 5LHEA 5CSRA 5AB3A 3ELFA 2WO5A 1XCFA 1N55A 2V81A 1TRIA 2ZZ6A 4WD0A 3ZS4A 3W1TA 3LM7A 5D2XA 4FO4A 1FWTA 4NX0A 4Q32A 1YXYA 2OMAA 3STFA 3LXAA 5FESA 2CLHA 4EF8A 1DHPA 1F2JA 1XUUA 1RQHA 1FY6A 3CTLA 4O17A 1IXPA 1H1ZA 3R13A 4HHPA 3SY5A 5IBXA 1R30A 3W2NA 1JRBA 5IM51 3EWUA 2I1OA 5D2YA 5HINA 4ZQCA 3QMSA 1H62A 1ONRA 3LCIA 4IXHA 3P7YA 1GVSA 1SQ7A 2HSAA 1HO1A 4HN4A 5D30A 5G2HA 1WDWA 5HR6A 3CB8A 2VXNA 3P82A 2YFOA 3QRHA 1AK5A 4O57A 2JKEA 3ANYA 3G3MA 1EWEA 2CLIA 1KM0A 1TV5A 4R53A 3GR7A 1DL3A 4QNEA 1W31A 5D32A 4PC8A 1KTCA 3H55A 3FYOA 2QJHA 2V2CA 3THAA 1LCOA 1NEYA 5FEWA 5L6UA 3W7MA 1QO5A 2ISVA 4NNAA 3GDLA 1MEHA 1ZNNA 2X16A 4O28A 2A7PA 5DCDA 1H7WA 2V8ZA 3MHUA 5J5DA 3G1AA 1O94A 4I7UA 4TR9A 3M43A 4O14A 3RF9A 1IXNA 1HG3A 3PSVA 4JTFA 3GDMA 4RZ6A 3B04A 1D9EA 3L67A 3CPRA 3PB2A 3BGJA 1I8JA 3TK7A 4FHAA 1F5ZA 3N3MA 3QC3A 3PB0A 1WBHA 1KTNA 1VYRA 1ME8A 3HJZA 5D09A 5IBXC 5K9XA 1IXQA 1OK6A 2V5BA 3S1XA 2J24A 3B4UA 3TSMA 1AG1O 4QNWA 4OQVA 3TAOA 1XM3A 5LHFA 3EX4A 1NF0A 1FCUA 1TJRA 2A7RA 4UFKA 2BWGA 1TYGA 2Q3RA 4HT3A 1FCQA 3TXVA 3NPXA 2OZ0A 2VELA 5SWUA 4JIQA 2Y7DA 1VYSX 2YR1A 1X1ZA 3STEA 1X1OA 2FB3A 3N14A 3W7JA 4K36A 2OT1A 3DENA 3FLUA 1T96A 4WXZA 3O63A 3DFOA 4WX2A 5KZMA 3OVRA 3KOFA 4HNTA 1B57A 3G1SA 2HMCA 4Z1CA 5AYYA 3W86A 3MJYA 3TV8A 3PG9A 4NJIA 1RQEA 4HNNA 1XXXA 4AHPA 1X7FA 2DZPA 4IJBA 2RFGA 4ZQPA 4UTKA 3DHFA 5DCBA 1L6SA 3WJZA 4XTIA 1QO2A 4XUGA 3PS7A 2BTMA 3UY8A 4YCPA 3HB9A 2YFNA 2QCGA 3F4NA 2A0NA 3B03A 4WY0A 1JCYA 3PUOA 4QAIA 3M5YA 4S2BA 1OX6A 1FCBA 3IGUA 1ZALA 1I45A 1YTEA 1WBJA 3P81A 3ATZA 3DFQA 2NXHA 1ZCOA 3BVJA 3W2KA 3QEZA 1A53A 2QCDB 3R89A 2WJZA 3TH6A 2KZHA 3IVSA 5F2IA 1LOQA 3W7OA 3FJLA 4Y8FA 1ZHAA 2IQTA 2X1SA 4JTTA 4Y90A 1M7OA 3CQ0A 3S42A 4L4MA 5C54A 1FWSA 3MMTA 3F4WA 1ALDA 2ABAA 2QAPA 4AEOA 4PFMA 1QOPA 3W6YA 4IUOA 4JYEA 2H3BA 2F84A 4ORMA 1H7RA 3QW4B 4LY8A 4JDBA 2Y61A 2J88A 4AWSA 3G0UA 1JCMP 4LVFA 5HJLA 4XZ9A 1FUYA 3BO9A 3M41A 5AC7A 1M6JA 1OG0A 1RD5A 5D2VA 1JCXA 3EX3A 1PHQA 2YZRA 2E6FA 3KX6A 1W5QA 4NXSA 2CFFA 4TO8A 1IIGA 1K8ZA 1XBZA 4LOCA 2CLOA 2E6YA 2P10A 2FTPA 3RK8A 4M5PA 4R7JA 1QPRA 4BK9A 4GWEA 1EEPA 4NU7A 4DQWA 1QPNA 1PS9A 2JBMA 4O52A 3WK3A 1YXCA 1CX9A 2AQWA 1TPEA 3RMJA 1K8YA 3HGSA 1I2PA 5LZLA 2G95A 3MI2A 1F76A
chains in the Genus database with same CATH superfamily
2HQAA 3TDFA 4V27A 4RUBA 3M44A 1QT1A 3TU9A 3MDWA 2YXXA 1RZMA 4AD4A 4KBXA 1VC4A 1YPFA 2QEZA 1VIZA 3JZEA 5I24A 2GDQA 4IMEA 2E8ZA 7TIMA 4ASTA 2ATMA 1QFEA 3FS2A 1L2QA 1Y0EA 4GIAA 4M6UA 1AMKA 4DBDA 4CVWA 3U7VA 3BW2A 3GNXA 1IEXA 2Z28A 5HNNA 3CHDA 4MOZA 1HQTA 2Z1SA 1KKRA 4UQEA 1QOQA 3U6WA 2EKGA 4IHCA 2QCFA 4P8WA 1W5MA 3I65A 3BV4A 1LWHA 2DSVA 4W9TA 2WZEA 3SRKA 1QNQA 4KEUA 1ONWA 3OU8A 1ZAHA 1D7KA 1O6IA 3R8GA 4GACA 3LHYA 4EPDC 2B4GA 3QMRA 1E9ZB 1PEZA 4ZODA 2GLKA 4QE1A 3VNJA 4IMFA 1HL9A 5G4HC 3RLVA 2BOGX 1UC4A 1A5SA 3W7GA 1VPXA 2ZX8A 3GFXA 3D3AA 2VC9A 9RUBA 4QE5A 2YGYA 3V5FA 1GK8A 4DO5A 5C55A 3HPZA 2Z1WA 3PULA 3WD0A 4KRUA 2V0TA 1SFLA 1LTDA 2ACRA 5G1TA 4OUEA 4GC4A 1YRRA 3PUEA 4K8GA 1F6PA 1OK4A 2CU0A 4MZ8A 5XIAA 4AC1X 4C6KA 1EF2A 1TMHA 3RX3A 1UWSA 7PTDA 1F3WA 1P1XA 4UXDA 4ZOAA 2XU2A 4LUJA 4LEFA 3M6YA 3JR2A 4XO7A 2XGBA 4ZE4A 1W3JA 3GG1A 3PZIA 4DUXA 5I3KA 2DQWA 2PTWA 3WQVA 1CW2A 3W9ZA 1BVZA 3QGAC 1ELSA 1UKTA 1FH9A 5FF4A 4GX8A 5EB8A 3TW6A 1G4SA 4MLJA 3WLTA 3O8AA 3WLRA 4JFUA 2NUXA 1R38A 3UY7A 2YDAA 3ZMRA 1XIDA 3MP3A 2CETA 4G1NA 3TC6A 6TAAA 2QJIA 4QFUA 4E0CA 4OE7A 3WO8A 3DERA 3MP4A 1H51A 2GGIA 3I3EA 3BOXA 2WSKA 2NQ9A 4QDWA 4LWWA 1A5LC 2XN0A 1UD3A 3G0SA 2ZUTA 1FX6A 1WA3A 3YPIA 3EOOA 1BYCA 5HWMA 4CQCA 1B0IA 3OPSA 2PWDA 2PLKA 2X1TA 2DORA 3K5XA 4H6QA 1BAGA 4GG9A 1PZ3A 3OIXA 3ZWTA 7XIMA 1KXVA 1UZ4A 3LHVA 3B3DA 3I6TA 3KL5A 4O8AA 4B92A 1MW3A 1EX1A 1ZTVA 4BY3A 3U4FA 1G67A 1THFD 1W56A 1Q7QA 3UGVA 4GA8A 2WKJA 3U0HA 2J66A 4HPJA 3A64A 3M0YA 1UKPA 3F2DA 2C18A 4RZBA 3OLDA 2WK2A 2R9RA 1D2KA 3TJIA 1JDEA 1TR1A 1FP9A 2R94A 1P4CA 4PMOA 3UZJA 4CNTA 4IPJA 4TV5A 4FIQA 3CHVA 1A5MC 1JDFA 3AS0A 3TOPA 2PU1A 4R9OA 2CKRA 2Y24A 2XH4A 1MQRA 3RPTA 3H24A 3MWAA 3A4XA 1V7YA 1CYGA 3L68A 1W5NA 2UY4A 1CI1A 2YBVA 3TYCA 2XGIA 4LBRA 4DJFC 1B9ZA 2I56A 1VP5A 3VUPA 5LA0A 2FPTA 4JN7A 4I3GA 4OU1A 2YDQA 1U30A 2PLCA 4IPLA 3DGBA 3GDKA 1QNRA 3A47A 2HVMA 1PX3A 1E15A 1OX4B 1V5XA 3DU0A 4ATDA 4J3SA 3AMKA 1CZ1A 1XSJA 4NNBA 5F7UA 1G4TA 4F2UA 3WQWA 1UIPA 4AZGA 3ZR5A 1J79A 5EMJA 4XVDA 4JTRA 3TUUA 3BE7A 4PCSA 3T6CA 4XIAA 1F3XA 3P0XA 1BXBA 4JYFA 4Q6JA 3M5XA 1US2A 1W1ZA 3ZLFA 1BKHA 2XUCA 2ZDSA 3W81A 3AJ7A 2V67A 3MA8A 2INFA 4AD5A 4JX5A 3B9AA 1EH9A 3NFUA 1GGOA 1VRXA 4I9TA 4R85A 3NZRA 5RUBA 3ES7A 1QTWA 1OFDA 2E5CA 1YBQB 2YYUA 2ZE3A 3IVUA 1BTCA 4MF4A 3W7NA 4C6DA 1OQFA 2AAAA 3EOUA 4UB9A 1KXTA 3L65A 3S2NA 3T0BA 4BQ3A 1XPYA 2EF9A 3LENA 4L4OA 4GXPA 3QHOA 1U1UA 3P80A 3UR2A 4PMNA 3VZZA 1A5CA 3S9YA 3R58A 1LOSA 3E3HA 4JEQA 3AHYA 3H2OA 4DUOA 5IHRA 1UP2A 1U1JA 3WD4A 4V2XA 2VFFA 2PUZA 2XFWA 4JKLA 1M68A 2ZXDA 3B06A 3CEUA 1FRBA 2EPKX 3W1XA 5CPSA 1MWOA 1PWLA 3BGAA 2E9LA 1G7VA 3OQ8A 2Z2AA 1R3SA 4D72A 3H22A 2PDHA 3SY1A 3P60A 2VURA 3DYPA 3R8HA 1TG7A 2E4TA 4BS0A 4O8RA 2GPTA 3L4VA 4PTMA 1VHNA 1RBOB 1E6XM 5FIPA 4GVGA 2O55A 2CHRA 3NA8A 1WDSA 4RV3A 2XZ7A 4PMXA 4HYVA 4RK8A 2A79A 1TR9A 1UH3A 2D0GA 1CBGA 2TSYA 1E1CA 1BGAA 4AWTA 2J47A 3FN9A 1F6KA 3KW3A 2NQLA 4AY1A 3F7JA 3HG4A 4CU7A 2DP3A 6A3HA 1E9YB 2FGZA 2ZZ7A 5CBIA 1XRVA 3H54A 4RDWA 4O11A 1XL9A 4J35A 5B7ZA 3LERA 2CZ5A 3C8NA 3QV9A 4ECLA 1E0WA 3UWQA 1IT7A 3PUGA 3H4XA 3ZT7A 1T5AA 2JE8A 4RXGA 4I7VA 1XHGA 4P7LA 2QDEA 1UC5A 5AHNA 3G0XA 3EPMA 1IT0A 4GUGA 3S1VA 2D23A 1I2RA 4Q33A 2RKXA 4XSMA 1KM5A 2PDBA 4DBEA 3GX9A 4XD3A 1TPH1 4LV9A 4OHQA 2VFGA 4LFYA 5BOFA 4GYFA 4PA8A 1Z7AA 4AD2A 2AGKA 3U3HA 4AXNA 5I6SA 1LORA 2QIWA 3N1AA 3FNDA 3LTYA 3WUEA 1PB0A 2EHHA 4EF9A 2ABBA 1VYPX 4NX5A 3W1PA 4DLMA 3VZXA 1KM3A 3ECQA 4O1CA 3P2VA 2E25A 3G6MA 1EJRC 2GK1A 1EF3A 2X2GA 4DNMA 3UGRA 2E77A 4LAZA 3WFLA 2XTKA 4FEZA 4Y9MA 4UTMA 2PTDA 3B0XA 4FNSA 3GTIA 4MNKA 4BA0A 4UTWC 4LW7A 3WJYA 4ACZA 1VD6A 5DRCA 4H9ZA 1QNOA 4C7DA 2NSOA 4FNUA 1I75A 3LQLA 4S3CA 4Z2KA 2PZNA 4HNVA 1TPB1 4CQAA 1JNEA 1FHUA 5A6TC 1GTHA 2ZDRA 2G4JA 3D46A 4RX0A 4GHRA 2E5BA 4Q8UA 5HATA 4W93A 2Z6JA 3DH7A 3TX9A 1X8FA 1GOOA 3CWHA 1Q6CA 1NELA 1Q8JA 4J4KA 2PMQA 1FWFC 1REQA 2XPKA 1S2CA 3GH7A 3IARA 1GZJA 4RNFA 2EPOA 1I0DA 4LY4A 4ORIA 2E0PA 3ONCA 4MUPA 2A7NA 3NVTA 1NQKA 4IQJA 2DQXA 1VFLA 4G8TA 1SSDA 3UXAA 3LRMA 3UF9A 2QCEA 4G1KA 2CBUA 3KAOA 2P0OA 3WBYA 3TOYA 2W63A 3U8GA 1E72M 4US6A 3NL3A 5M03A 4PTXA 1B9BA 3NPWA 2VZOA 1O1ZA 2KAUC 3W22A 5ABFA 1VBGA 3LLXA 4EPEC 2PDNA 1XH0A 3GDRA 2DT0A 2J7DA 1OX5A 3R6IA 1NARA 3SJNA 3WDQA 2Y0FA 3DKLA 5EMMA 1MW0A 5LIXX 1TPWA 3UG4A 3LS9A 3WLHA 1AJ0A 4NXKA 1GYLA 3N11A 1UA7A 1QI5A 3KCOA 5CEWA 3QLLA 4A8LA 3AYRA 3M7SA 4GUIA 4GISA 1ZP4A 3GTNA 3VOGA 4L6DA 2EJAA 3DESA 3TYDA 1PTDA 2PDFA 3BWWA 4GI9A 3G18A 3S2CA 3QM3A 3WDJA 2ONEA 5HBFA 2UZ9A 5F2GA 2PWGA 3A24A 2O7QA 4UTUA 5A6BA 1FKWA 2CW6A 1ME7A 1VBHA 3Q37A 3ZVIA 1KBLA 3EPOA 3ZO9A 1ADDA 4Q6XA 1BG4A 3P6LA 2GVYA 4IF2A 3TXZA 3WH6A 1IGSA 3KDOA 5FSEC 4C6BA 4H6EA 1FXPA 3BZJA 3M0KA 2NX9A 3VAVA 3HPFA 2D3LA 4HNUA 4PMUA 4YIWA 2BBFA 1AZ1A 2TMDA 3QV8A 1KQYA 2VZVA 3GXPA 1KCLA 1WX0A 2WNWA 3AWNA 1J8VA 3B9EA 1WZKA 3P67A 4UR9A 1ZY9A 2VX5A 5HULA 4ZGYA 3VC5A 1GUVA 5EFDA 1QVBA 4AYSA 3RX4A 1ZCCA 4AXKA 1KWGA 4MPKA 2EG7A 1EDTA 2Q02A 3SCWA 1DTNA 4KH2A 3FY1A 4D2JA 3USBA 2Y1HA 1K3UA 3CIVA 1KKOA 1DJQA 4UFHA 3RRXA 1NOFA 3CC1A 1XUZA 1EJ7L 3C86A 4KEVA 2BP1A 5BNKA 3CU2A 1OBAA 3Q58A 1W5OA 3SAZA 1YW1A 4N02A 3PM6A 3NTYA 1J0ZA 1J0JA 3FK4A 2XINA 4Y6GA 3P93A 2PGEA 2OKTA 2YB4A 5F4SA 3NXLA 5FEPA 1KCKA 1IWAA 5EYWA 2G3NA 3AISA 3G1RA 3P0WA 1KBIA 2OLHA 2WSPA 3WBEA 1QASA 2J79A 4QCEA 5EPDA 3UJRA 3E2VA 1XRFA 4DF1A 3BK0A 4UFLA 1SFSA 3BJTA 2DZBA 2DZVA 4A8NA 1D8CA 4AMCA 3PNZA 2IKIA 4B91A 4WEVX 2DT2A 2IKHA 3S6DA 3GY1A 1LM1A 2A3AA 3WK0A 2E3ZA 4G56A 3LG3A 5FJIA 3WF1A 2DPEA 1AMYA 2WYSA 3O7UA 3RO8A 2ACUA 1VEMA 1HO4A 3ZZ1A 1Y65A 3W00A 3ARQA 3I6RA 3MV11 1EDQA 3WH7A 1W9BM 3EB3A 2OYMA 3S46A 1SPQA 3XINA 1G7UA 2CLLA 2VRJA 3CQHA 3W2MA 1VPQA 3JRKA 1O7AA 4GGBA 4OJYA 1FDYA 5DANA 3I7RA 3U2OA 3WLMA 2FFIA 2O9PA 3B0YA 2DVXA 4FIRA 4MWAE 4AWEA 4HU0A 1DIDA 1B30A 3LNMA 3M0XA 3P5YA 5F4XA 4Z2HA 1UWQA 1W1TA 4AFYA 4DWSD 4QS5A 1R85A 1E9LA 2PRMA 2DUZA 1VLWA 2Y5SA 2QCLA 1TKKA 1UR8A 2J77A 1SGJA 3O07A 4L1GA 3LSBA 3GXMA 2NLYA 4NZ5A 4DO4A 3L4YA 2D0FA 4B5TA 1GG0A 2J8GA 1CIUA 1TB3A 1U33A 1VIWA 4B5UA 4Q7BA 1FHDA 2FVMA 3B05A 2O9TA 2BFGA 3HN3A 5A8OA 2A3EA 2OT0A 3W7QA 2PRHA 4X9SA 4PRWA 1CECA 2YL8A 1SZFA 3CV1A 4IPPA 1EBHA 3C2RA 4L1XA 4UMCA 1FWNA 1YQ2A 1E6PA 4F9JA 3BOFA 4JIHA 4FX6M 1CENA 1S38A 2CCRA 3ABSA 3SFKA 4N7QA 4HMNA 1OD8A 2FB2A 2Z1BA 3UWUA 2XH0A 3BLLA 4WKAA 3BUVA 3WNOA 3S5OA 2Z4GA 1EC8A 5D2TA 1Z8AA 4ZMGA 4RE2A 4MY1A 2XH7A 1Q2SA 1F74A 3ZR6A 4LS0A 5K3VA 3L4UA 2ALRA 1P0KA 3SURA 5D8WA 4J27A 1Q45A 4S3KA 5A2AA 5BROA 3MMWA 4K8HA 5GJMA 2NX3A 2YDSA 4MFDA 1NSJA 4O18A 5DXYA 1QNPA 2P53A 3A12A 2OZ3A 4ERGA 4JGDA 5CKSA 1C8VA 5CC5A 1V6XA 2YKKA 1FTXA 2PE4A 1P48A 4N9EA 2O4MA 3TYAA 1PX4A 2X7VA 2HVNA 4O0QA 2GOKA 5HJXA 2QJNA 2HZGA 2QPXA 3GD6A 5C2XA 1KR0A 3UA3A 1OINA 4LCQA 1A4MA 3PBYA 4B16A 4GYPC 1V08A 3QOMA 3ITTA 1H0GA 4I9AA 2OTDA 3LBOA 4NZ3A 1L8NA 1LDCA 4D6GA 3NUKA 3AYVA 2UY3A 1MQQA 4QX4A 1S5VA 1R2TA 1HKKA 2FPYA 1LL4A 1S46A 3PZVA 3VCNA 4B2DA 4FXFA 5M5DA 3TQ0A 3VD4A 5I3IA 4E8DA 1XG3A 5CBJA 4Y9NA 4WKHA 4ZR8A 3LRKA 1HJUA 4YLWA 5HUOA 5GJNA 1X7IA 1E5JA 4N9CA 4UTHA 1JNDA 1SR9A 4CUCA 1LP6A 1XDLA 4BFAA 1WOAA 4BI7A 3W1LA 1YADA 3UWVA 3KFTA 3NSXA 1F61A 2MNRA 4KMQA 4DWSC 2ZFAA 4UWMA 4LCSA 2XSAA 2AMGA 2WMFA 3N4AA 4F40A 3HPXA 3JVAA 1OWQA 5BRBA 2ZRXA 3LTPA 1VQTA 4ZENA 3V16A 1Z48A 4A3RA 2A6LA 1ISXA 2PURA 4AMAA 5A1AA 3WLKX 2AAMA 1UMYA 2Q6ZA 4MDPA 1SJBA 1A0DA 5BRPA 3FXGA 5G1YA 4FAMA 5FCZA 1Q6LA 2WSRA 2BY2A 3GNRA 1GJPA 4N4PA 4V33A 1KBBA 4JKMA 1Q85A 1FQ0A 4QLKA 1JXKA 1CLXA 2D2GA 3WUGA 3ZLHA 5AC5A 1U2YA 3VKBA 1FWHC 1E1FA 2I9EA 1HJSA 3NIYA 4C6FA 4IIDA 3SJ3A 1VCGA 4PBGA 4AVOA 1W17A 3EMQA 4ADSA 1FA2A 3BMWA 4JFVA 3A9BA 4I6KA 3II1A 2GSHA 1W9DM 3D47A 4ZE5A 5XINA 4PTWA 3DBNA 4IOTA 5KTLA 4TTUA 3KOZA 5E6YA 4KWSA 3ZXWA 2Y89A 4KERA 3R8RA 3REQA 2H8ZA 4URIA 1WZLA 4GKLA 3S47A 1RQBA 5C8BB 3R2GA 1UMLA 1V6TA 2FMNA 4ZL1A 4H01A 2J9ZA 2HK0A 2VUYA 2ZZ1A 1JR1A 3S5NA 2FQIA 1TUFA 1XFBA 4Y2WA 5E0KA 2H8XA 4MNJA 4NJKA 1FBAA 2YA1A 2BGSA 3PAJA 2PLMA 3UZZA 3TKFA 4H04A 3V1PA 1BYAA 2OU4A 4HK5A 5A6MA 3MJMA 2OQYA 4D8ZA 3LZ3A 4YYCA 4L56A 3D5HA 3VNYA 2ISWA 1EXBA 4K7YA 4KS0A 3QFEA 1SJDA 3OODA 1OM0A 4HPXA 1R3YA 2GQ3A 2BHUA 2PEVA 3SADA 1Q6OA 2Y88A 2QPSA 5IHSA 2Y6ZA 4HA1A 4REQB 2J78A 2WNQA 1C8XA 3HQPA 3I10A 3N9KA 4FP1A 1OYCA 4TU1A 4NYUA 1RLCL 1RBAA 4N42A 3M7WA 3GWQA 1VJIA 2W62A 3BAKA 3E9AA 2EPMX 1H63A 3B8IA 2O7SA 4AIBA 3GDTA 4A4AA 2XIIA 3NCOA 4CD5A 4AU0A 3BPWA 1PUDA 3N12A 4OOUA 4DRSA 4HJWA 4DHGA 4ZQNA 3NQVA 2DVTA 3UG3A 1MFUA 4DZHA 1WV2A 3DFNA 2V30A 1XLJA 4MVAA 2NSXA 3EZ4A 1YPIA 1DYSA 5JXQA 1QNVA 4R33A 3MUIA 3JZUA 4FXJA 2ZTJA 4QM1A 3H70A 3W84A 3H7UA 4GI4A 4RNIA 3C3UA 4WVXA 4HCHA 2W91A 3I3BA 1NQ6A 3PTMA 3H2AA 5CGQA 5CG7A 3UPWA 5K7JA 4UTJA 1UR0A 3C2OA 1E73M 3Q2DA 4EXQA 1TRDA 3KZSA 3GZAA 3V35A 2HJPA 3EX1A 2QUUA 4UQCA 2QJJA 4CCEA 3TR2A 2EGZA 1JYXA 4DUVA 5A6LA 5DBTA 4GBUA 3LPFA 3S2MA 1A5KC 4ACYA 1ZJBA 2FVKA 1GNXA 4N6FA 3PBMA 3STCA 1XS2A 3PUDA 1DJYA 2PC8A 1X39A 1QHOA 4DVOA 1NY1A 2E09A 3TTSA 4DF0A 3GXTA 3N29A 3PJWA 1SO6A 4XBJA 4OV9A 4YPJA 2C16A 2WNNA 3LXBA 3UCCA 2G41A 2GQAA 4XZLX 4FNTA 2NXIA 3F4CA 3L5MA 3BL3A 1EGMA 1K9FA 4E5TA 3NR0A 3NQMA 1P5BA 4AYGA 5AB3A 5IDIA 1UWUA 1N55A 1K1DA 2V81A 3IJ9A 1TRIA 4WD0A 3ID7A 1KRBC 3O3RA 3VD7A 2XIMA 1TIWA 2P5NA 1W6TA 1XDJA 4FPSA 1W9PA 4B5WA 4H2HA 1DIKA 2PCEA 3W25A 1DHPA 1F2JA 1HKVA 5HA7A 3UVIA 1RQHA 1S1RA 3CTLA 2WPGA 1H1ZA 2QIIA 4CNUA 1V6UA 5CCZA 3W2NA 1XQKA 5HINA 4O1EA 4ZB2A 1H62A 1J9YA 1ONRA 1H49A 2HSAA 1GEHA 1E55A 3QRHA 4E2VA 4O57A 4P8UA 3G3MA 2CLIA 2XVNA 3EDEA 3VIIA 2Z26A 3K4AA 3URBA 5G1MA 1TWSA 4BJHA 3RDKA 3THAA 1NEYA 2PDJA 1POJA 4XZBA 5L6UA 4BEQA 1SMDA 4NNAA 3K1GA 3GDLA 5CZKA 1S39A 4S3DA 2X16A 3VM5A 4E2OA 2A7PA 5DCDA 3BJSA 3G1AA 2PTZA 3LMZA 2CLPA 3M43A 4ZOEA 1IXNA 3PSVA 1TWDA 2X2YA 4RZ6A 4XZIA 4NSBA 3AUOA 1D9EA 4MWAC 2XSXA 5IXEA 2HXTA 4PB4A 5HK4A 1EHNA 1M1BA 4MDOA 1BSIA 3B9DA 4G9PA 3S1XA 2J24A 2L5HA 8XIMA 1SJAA 1AG1O 4QNWA 1V0NA 2W61A 4L80A 2PDYA 1V6WA 3TXVA 1E3ZA 4IG2A 1IZCA 1CGYA 1P43A 5DMYA 5SWUA 1XLCA 4WDWA 5BU6A 3S1GA 3VKCA 4UOJA 1X1ZA 3STEA 1X1OA 1YDYA 3AOFA 3DYMA 1NOWA 4F66A 4P8VA 1O5QA 3DFOA 1E6QM 5KZMA 3KOFA 3MSGA 1WDPA 4U3CA 3VMOA 2PWVA 1F9CA 2NV9A 2FZ9A 3TV8A 3FEQA 4GQGA 4AHPA 2DZPA 2RFGA 3FA4A 1NIUA 2D3NA 2VUNA 4XUGA 3GXFA 1W9UA 2IPGA 2NW0A 2WAGA 1W1VA 2BTMA 3UY8A 2V3DA 3CTTA 1UOZA 3EDJA 1CGVA 5I78A 3TYUA 1FCBA 3WEZA 4U10A 5A6SA 3ATZA 4AD0A 3DFQA 3THDA 5REQB 3KLLA 4XISA 1A53A 2QCDB 3FCPA 4XZNX 3FJLA 3QHMA 1ZHAA 1WPCA 3S42A 1QK2A 3MTWA 3UXLA 3MMTA 5AZ1A 4ES4A 2UY2A 2F84A 4HN8A 1KQZA 4LVFA 2V5KA 1FUYA 4Z17A 3M41A 1M6JA 3CZ8A 4M56A 2ZVRA 4WJXA 6ENLA 1E0XA 1NWSA 2YZRA 2E6FA 2PWUA 1BF2A 2CFFA 2ZE0A 1XQLA 1RVKA 4LUSB 2P10A 3RK8A 4M5PA 4R7JA 4GWEA 1EEPA 5E09A 5CAKA 2HK1A 4JTAA 1PS9A 4DZ5A 3MU7A 2JBMA 2GDUA 4HOZA 1YX1A 1YXCA 2EG6A 2AQWA 1TPEA 4LPCA 1K8YA 3OG2A 5FA5A 1I2PA 5LZLA 2NQZA 3VIJA 1DXFA 3VE9A 2HBXA 3TNOA 2X1IA 2EPLX 3SQMA 1O5KA 5HNUA 4HYRA 2X0SA 3CV2A 1LRQA 4O12A 3E1F1 4KEMA 2G0WA 1S5WA 1RD6A 2J9XA 5DEZA 4PBEA 1SO4A 1AQHA 3ARPA 1JL8A 1UUMA 2BVTA 1RJPA 4UR8A 3ATYA 3GIPA 1H1YA 1KR1A 3AMLA 2QV4A 4YMZA 2ZCGA 5BXRA 4XD6A 4CNSA 5AC4A 3P74A 3WQEA 3TC7A 4MY9A 5BXTA 5CPOA 2I17A 3LOTA 1XGEA 4MYAA 5TD4A 4CNNA 6REQB 3KTSA 3BSGA 3LX9A 1W54A 3BTNA 1K02A 1BHGA 1XX1A 5A8QA 3O6CA 1H0IA 4QLJA 4JY8A 2AQOA 1F3TA 3KOXA 1LL7A 1RJRA 1VFSA 4K39A 5CH9A 3U5UA 4DUWA 1XI3A 4R34A 3GUGA 5FJOA 1HKWA 2OKOA 4W88A 3ARRA 3EKGA 2C3ZA 2J7FA 3N2BA 4Z2LA 2C1HA 3U5YA 2QUTA 4LX4A 3CASA 1R8LA 3QZ6A 1A3HA 4GJIA 3G8EA 2X40A 5JUVA 3AALA 3WQ5A 3AWOA 1XC6A 4HHMA 1V8EA 1B3XA 2J4GA 2NX1A 4O10A 1W37A 7A3HA 5FAGA 5H6HA 4Q4QA 3BDKA 1A80A 3GXDA 1ZENA 3GHRA 2CEQA 1EQPA 1JGMA 3QV7A 3H7VA 5D33A 1WO2A 3HV9A 4EPBC 1LQ0A 3F4DA 1T40A 1QPOA 3IAQA 4HVXA 2XFRA 5CGTA 3SEPA 1C29A 1PX8A 3RUBL 2ESCA 1HGWA 1Y5WA 5A6JA 3NQDA 2XGZA 4MZYA 1ZPTA 2QT3A 2VC7A 3MYPA 3SN1A 4NZCA 3P14A 3SRDA 1OC7A 2YCIX 1GONA 4UFMA 1MNSA 3THQA 3KRUA 3TN3A 2G97A 2CYGA 4A3HA 4MAVA 1TX2A 4L61A 3MP5A 2EJ1A 2PBGA 2IQDA 2WKGA 1AJ2A 4GE8A 3D0CA 3COTA 5C6MA 5C70A 3VMNA 2O9RA 4DJFA 3I6EA 2XJ7A 3HQOA 3GKAA 2Y2WA 3GE7A 2WCGA 1W3NA 3G1XA 1VZWA 2YCKX 2KX9A 4M80A 5I02A 4NUWA 2PD9A 2E8YA 1SSGA 1YNQA 1R9XA 3GNDA 1Q3NA 1R46A 3GXNA 3LHWA 4XG1A 1GG1A 1OFQA 3BGGA 2JF7A 4EVZA 1E4NA 2BVDA 4F9DA 4WDTA 3MUY1 4EXAA 1KRAC 1CPUA 1W2VA 1I2OA 4JIPA 4KCWA 4LS1A 1P0NA 4J7RA 4UTTC 4DBSA 4IP5A 2ZIDA 3AXKA 3RXZA 2PI6A 4EE9A 3TVAA 3ES8A 3S1WA 3A3XA 3W76A 1K8CA 5HOSA 4Y9PA 1ZUAX 3TSBA 2RH9A 2PB1A 1HW6A 3HBLA 3E5BA 4HSHA 4ILSA 3G5EA 4EIVA 3R7MA 4UQBA 4HHHA 4LC8A 3C2FA 3DFHA 2ZBTA 1IR2A 1PZ2A 2HISA 3DHUA 7ODCA 3SCTA 4I5RA 5FAJA 4JNMA 1W5PA 1D3HA 4FMVA 1XR2A 4J9JA 5C2GA 4JQ1A 4YL2A 3KE0A 4RDZA 1UJPA 3OJGA 1UWIA 4FNRA 1L8PA 1R87A 2WC4A 4C6QA 3BOLA 3LV5A 1ZAJA 3FW6A 1AH4A 3RITA 4YN5A 4JN8A 3C61A 5KINA 3JW7A 2BXVA 4JFTA 2ATSA 1JI2A 3SGZA 3SDOA 3LRLA 4AZCB 2VZTA 2J7HA 3AI0A 4UMBA 3UVAA 1UD2A 3PY2A 4IQDA 1GVOA 3GUWA 3UXIA 5CPMA 3T09A 1C90A 3UYCA 2X0YA 2OYLA 3OGVA 1IYXA 3LGEA 4JX4A 4C6JA 3GYEA 1MFVA 3KRSA 3W74A 4Z1AA 2XIQA 2QQ6A 1F4AA 1TJ2A 1S3TC 3W37A 1TWWA 2Y7FA 4FI4A 3AUJA 1ICQA 1S5NA 1MUWA 2Y62A 3T0DA 3C3NA 1DE5A 2JGYA 2ZA2A 3K4WA 1XLMA 3NQ2A 2R91A 2AKZA 3I7SA 3AHVA 4DO7A 1DQWA 1T0OA 1Y5VA 3U2EA 4U28A 3GHSA 3EKZA 4YVVA 3NM1A 1VEPA 1C3FA 1GKQA 3MKKA 2F6UA 2ZWZA 4NRRA 3WG6A 1QI4A 1JDAA 4K2SA 4MB4A 4LUYA 4NAFB 4OZOA 1HP4A 3SI9A 5FSDC 5K2ZA 4K6AA 2CZFA 3PC0A 3ZVHA 4JYDA 4AAJA 5J04A 4Q8NA 3VDBA 3WJXA 5LNUA 3WJWA 4V15A 3AYSA 3CLWA 1PIFA 1ICPA 1FH7A 3VKJA 3LDVA 1PIGA 2H3DA 3T55A 1WCGA 1HP5A 3RCMA 1DKWA 2VFEA 4MMWA 3R0KA 2VP8A 2NQ5A 3SB0A 1RK6A 3QGKC 3ALGA 3IRSA 2JK2A 3FA3A 3OA3A 3WK2A 1KFWA 2F6KA 1SW3A 4ZCWA 1UB3A 3MBFA 3VGDA 3T05A 5AHMA 3TTQA 5AHLA 4R5EA 1K77A 4MFEA 3L0NA 3L66A 2DUAA 3PJTA 4AH7A 1OCJA 1V03A 1LZOA 3IACA 1OVDA 3VIOA 3TFXA 3CIWA 4UCFA 3W72A 2C6QA 5U4NA 1KNWA 4CLMA 4L5ZA 2H90A 3M1ZA 4MB3A 1ESWA 4JTLA 1J4EA 1U5VA 5FJJA 2RUSA 2PDWA 2A5HA 5E0FA 2YBTA 4AW7A 3M16A 3MHGA 5JH1A 2OXNA 4OECA 4YS1A 4FNQA 1HKMA 2OPJA 2P88A 4IM4A 3QPYA 1JUEA 2JEQA 3BXWA 3CIXA 1XPGA 2XN1A 1TJ0A 5GJPA 2QDDA 1JCLA 4EOUA 5K4ZA 3O2LA 3BLPX 3ZOAA 2RGLA 2DY3A 5IOBA 1QCWA 4UTWA 2GVLA 3TSDA 3W88A 1IEWA 3DGRA 1AJZA 3PN8A 3LXCA 5ABHA 3ITVA 3HQNA 4WUIA 4XV0A 1AL7A 1KGUA 1NDZA 3O05A 5BZAA 4ZQOA 1CGTA 3CUZA 4DEFA 4H9YA 4X61A 3IUDA 4M6QA 1O12A 5CJMA 5EGRA 4ZTXA 4DAFA 3PZMA 1C91A 3URAA 3A21A 5JQ9A 3ITLA 3DDMA 1AODA 4D1JA 3LCHA 3WCZA 5GPRA 4POCA 3H6OA 4IP7A 4AHOA 4NJGA 4CD4A 1EL3A 3N2MA 2I5GA 3M07A 4W89A 2V2HA 4BWLC 3RCNA 4CN4A 1HFBA 1CXIA 3P62A 1JI1A 4JIEA 2GL5A 3VDGA 3GH5A 3EGJA 3KVKA 3UZ5A 5JBEA 3WFZA 3WLPA 3W7LA 5BMXA 1ME9A 3RRAA 3W1RA 3FV9A 4DWDA 3LA4A 1ZJAA 4P7OA 3W7CA 1MW1A 1OZQA 4NHVA 2QGYA 4O13A 2CLEA 1JZ5A 1LLZA 4JTCA 4LNYA 1IWBA 3DI0A 2C91A 4AZBA 3H2CA 3MO4A 4XWUA 1RALA 1AQFA 2ZA3A 4JTHA 2QNEA 3ZSSA 5MKGA 2Y7EA 4DJEC 3S4TA 3R5EA 4ZQRA 4NAEA 3S5YA 4GUJA 2WJFA 1V7AA 4GY7A 4W7WA 3GR8A 4XZMX 3MI6A 2ISDA 1K9TA 3UD6A 4YTSA 2HE5A 3ZWSA 2G5WA 4QG9A 4PGLA 3V0TA 4BQ4A 2OOFA 1GT8A 2E68A 4AF0B 2WWDA 3IWPA 4HU8A 9XIMA 1H09A 4U5KA 1OT2A 3AZSA 3TW7A 3S1UA 3NPVA 3AS3A 4D6FA 1TO3A 3O6AA 4MTVA 3MHFA 2ZA1A 5LNWA 5AYBA 3INPA 3CS2A 1UG6A 3W28A 3W29A 5LSMA 1UR1A 1UR9A 3W27A 4FX7A 1UH2A 1AL8A 1XLGA 2YX0A 1JRCA 2HNEA 1H7OA 3NO5A 3HFYA 3SIZA 1DWAM 3KP1A 4INFA 2DT1A 3W6MA 2PODA 3B8SA 4YWIA 4ZEPA 3PPHA 2AL2A 5ECUA 1XRSA 3OEXA 2VVSA 2IPJA 1UJQA 2QR6A 2C13A 1JEZA 2PDPA 2VJXA 4M6PA 3TR9A 4IQLA 1VR6A 4WQ6A 2BGNE 2VZUA 2WLZA 4KF1A 1S2AA 3SSJA 3LQGA 1G1YA 1TV8A 4ZO8A 5AC6A 2AGTA 3QHNA 3HG2A 5FJTA 1TQJA 3VFCA 3PANA 2C79A 4KWUA 1P1MA 4WIWA 1EYEA 3NPUA 2VD9A 1JZ2A 3IAPA 3PBVA 4DELA 4H9VA 5AYZA 2QULA 3Q4DA 2BDQA 1OF8A 2AL2B 4KKXA 3G1YA 5AY7A 2Y85A 1HJWA 1YXDA 3BW3A 4QRNA 3AFBA 1XBYA 1AA1B 4LYRA 4NJHA 4WSHA 3EA1A 4PUKA 1V4YA 3QSRA 3G1VA 4LAMA 4O53A 3L4TA 1I0BA 2GGHA 3GNOA 4C6IA 1XLFA 4JFWA 3W73A 5LYRA 3D6NA 5GQBA 5IDZA 4H9UA 2GYIA 5H91A 3WL1A 4RLIA 3N04A 1ITCA 4HMDA 4JIRA 2PF0A 3FDKA 3B0UX 2XSBA 2VENA 4L6HA 4LRSA 2DH2A 1TPUA 3VIHA 3EWWA 4H8NA 2MANA 4Q8TA 3S6TA 2DZUA 2PGWA 1UKQA 3QMTA 1M04A 4MJ2A 2PDQA 2REQB 1H7PA 4MY8A 3LLDA 4XSLA 2WLYA 2PP1A 5HQLA 3HIJA 3L2LA 1FWDC 3KZPA 2J8TA 3N18A 4Q3MA 4C6PA 2WZTA 4LF2A 3WBWA 3SECA 3T8QA 4B9YA 4TUFA 2V63A 5MF5A 1MDRA 1OZMA 1EFZA 4G7EB 2GJNA 5EBUA 2VEMA 5JIWA 4UR7A 4TVDA 3RLUA 2Z00A 4HCLA 2W5FA 1ZU8A 1XCXA 4TXEA 1BFNA 3LHUA 3IIXA 3S5SA 5EU9A 1OGSA 3A4WA 1M65A 2Q8XA 2ZADA 3WQFA 2WHJA 4IFKB 3N2XA 3TMQA 4Q8MA 4YVXA 1YNPA 1ZB5A 5A6AA 1CDGA 4DI9A 1J12A 4JBRA 3WYZA 5JU6A 5E93A 1QI3A 2QCMA 2NUWA 3OYXA 3BANA 1TPC1 1EJSC 5T8GA 4NL1A 3IJQA 3UESA 3CH9A 5I07A 4RZ5A 1A3WA 2DZTA 4GQBA 2J7GA 1EQCA 2CXGA 4U31A 1ICSA 1QHZA 1PSCA 4W7UA 4M81A 4Y8EA 1NWUA 4G5DA 1BSLA 3N2CA 1NVMA 3MANA 4QG6A 1VF8A 3EPNA 3KHDA 4GZEA 2CBJA 4C6CA 1I60A 1IIHA 4DI8A 1ADSA 3OOQA 2Y7GA 2G8ZA 2WJDA 4OWGA 2P8BA 3IV3A 3CYVA 4IIFA 1P6BA 3QY8A 3W70A 2PZ0A 4S3BA 5FI8A 1W3HA 3H4WA 4WJEA 4O1FA 1EKOA 4PULA 4KIRA 2VQTA 4F0MA 3GW3A 3ZT5A 1NOUA 4EXBA 4YXGA 3CEPA 4PUWA 3F4VA 4H19A 1U5JA 4C6EA 3U2CA 4H4IA 4U2YA 3CZKA 5M3WA 3LM3A 4PCPA 4GYPA 4JD4A 3V0UA 2TRSA 3N6HA 4PRRA 2OX4A 3G1DA 3N9SA 2Z2BA 1W1YA 1YTKA 3NQFA 4HU4A 4IFRA 4CCDA 4XIMA 3TFCA 2YXGA 4J3WA 3STPA 1YMYA 3AZRA 4B5XA 2WVSA 1O5XA 1YEYA 3A13A 1NFGA 1UROA 2FJKA 3RO6A 4E4FA 1GYNA 4D8AA 1H5YA 4ZTYA 4XB3A 4Q4OA 3T40A 3MI3A 1ITXA 1XIJA 1TVNA 4MSSA 2BY3A 4WKFA 4E38A 5FF3A 3CUJA 5DMLA 1QUMA 3ARYA 4E8CA 4Q4RA 1WOBA 3PZTA 2DSWA 5CC3A 4Z0SA 1H5VA 3RR1A 4PSPA 4O50A 4L6OA 4DWSA 2DFAA 4IT1A 3P8IA 4Z0JA 3SUSA 3HOJA 3UJ2A 3AS2A 3CZLA 3W2LA 3O0FA 5A8NA 1R3RA 1E6ZA 5DXXA 4OUIA 3TJLA 4KFOA 4E4PA 1C9DA 5LXXA 3EWBX 2DH3A 1FP8A 3A9IA 4GPNA 5CXPA 2F7FA 1R0MA 4A3YA 3LCFA 4U33A 3RM8A 3PBWA 3WLJA 4I6VA 3ITOA 4PE8A 3WMSA 1VBJA 4L4PA 4GC3A 3FHQA 3CM4A 2UBPC 4PB3A 2O0TA 1FWRA 2VNCA 4WY0B 3CWNA 2OEKA 4EWJA 3CWOX 1TZZA 3WELA 5KMYA 5I79A 5C0QA 4GNVA 3G1HA 4ZFMA 5K4XA 1LROA 2QJMA 1EX5A 5A94A 4Z08A 2ZRYA 1A5NC 2D2JA 1DBTA 4BI5A 3HTWA 2FZBA 1D3CA 4X0VA 2PA6A 2YPIA 2G3MA 3E2RA 3OZOA 3B9OA 3VC6A 1JXJA 4PUEA 3W1QA 4YJ5A 3M0LA 4LB4A 2PDUA 2Q09A 3L0GA 3IJLA 3CHCA 1NDYA 1P0BA 5I23A 4DNHA 1D8WA 2AL1A 3APGA 4B4HA 3QQ1A 1NFBA 5HWNA 1O1HA 2NLIA 3NGJA 1OEPA 2DGAA 1FH8A 4JS3A 3C0SA 3N4FA 4LQ1A 2FZDA 1KM2A 3AIBA 1H60A 3NOYA 3PR2A 1ZJIA 5FACA 1ZGDA 3URNA 3VI2A 1XDMA 3WBAA 3GU1A 5BYWA 1PXGA 1UW9A 4CD8A 1EOKA 3UR7A 2ZRZA 1JZ4A 4ZO6A 1NFPA 4L65A 4IL2A 2QKFA 4HU3A 1OCNA 1WDDA 2YA2A 4CNOA 1VFFA 1M7PA 4F48A 7REQA 2XN2A 4IQEA 3W26A 4DYKA 5CGMA 3NDOA 3B4YA 3LPPA 1GOKA 3LYEA 3DAQA 1TV7A 4ZB0A 4GX9A 2DZAA 3F1QA 4IMCA 3ZFHA 2OGJA 3CB3A 5FEZA 3W7EA 4J3VA 3RPDA 4ERIA 3ZIZA 4JQ2A 2Z27A 3D3FA 2V3FA 2A1YA 4ZXOA 1T8XA 1QI2A 4W86A 2WVUA 3KWXA 4DXXA 4O19A 2OVLA 3U48A 3NM3A 5I5RA 1TA3A 4GO8A 4LYKA 1EB3A 4X2PA 4S23A 5DCEA 1GJWA 4MIMA 3IK2A 4KT2A 3PBUA 4JDYA 1JVNA 9CGTA 4JTUA 2DV0A 4XKYA 3N73A 3BJFA 4I9MA 4H1ZA 1QW8A 4LCRA 4GOAA 3EXSA 4AVFA 4EKJA 1XV8A 5TBOA 1JDDA 3E38A 3VOHA 2OLAA 2CBVA 1AH0A 4RW5A 4OBSA 3A23A 1FWJC 1V3LA 3FJNA 3TJXA 2VEKA 4GNKB 5M2FX 4IPNB 1MMFA 1GVYA 2NVCA 2HXUA 3L4XA 3VOFA 4O54A 1JFHA 2HWGA 3H7RA 4IP4A 2I7GA 3USZA 2WHKA 2VGIA 3GU2A 4ZA0A 2YCJA 3SIMA 2WPBA 3R4IA 4Y9AA 1JQVA 4O0KA 1U83A 4JIIX 3RHGA 2MUCA 2E6DA 4B3LA 1G94A 4U2ZA 4GJJA 5EMKA 3MBDA 1EP1A 2F9RA 5CJNA 2WWCA 3UFYA 3NL5A 5CPTA 3WD1A 1IR1A 5LIYX 2ZICA 1G6CA 2VTFA 3URQA 4WK9A 2WVVA 4HOXA 3CPGA 2X0HA 2BS9A 2XIOA 3DN5A 1CGWA 1Q63A 2VDIA 4LAOA 5F2LA 2CZEA 1KM6A 3GIQA 1UKSA 2O56A 3C52A 3MSRA 3CV6A 4BF9A 1EYWA 1MYRA 1EA0A 3MS8A 4UZUA 1NTHA 1Q6DA 4WGHA 4KFPA 1DOSA 5JBDA 3U9IA 4XKMA 4QBXA 4EANA 1J2WA 1T41A 2FTWA 4KWOA 1MVYA 3G24A 1XISA 5I3GA 3OYZA 3VD3A 3C8FA 5AVNA 3PJXA 1OIMA 1C8QA 3B9NA 1VS1A 3TC3A 5D02A 3OZYA 1HKJA 2YL9A 4ZVJA 1FXQA 2QCNA 2Z25A 3E5PA 4JAWA 4K7VA 1P7TA 4RXFA 4TV6A 2XVPA 1H2JA 1XCFA 2C1IA 1UP0A 2ZZ6A 4I90A 2D24A 1IGWA 3O0KA 2HBVA 2XWEA 2E40A 1QW9A 1J01A 4FLQA 3WDIA 4HMEA 3TQPA 2OMAA 1CTNA 4I8DA 1EC9A 4ZOCA 2GJRA 1EO5A 1SFTA 4OTKA 5FESA 2HROA 2CLHA 2PDIA 4AZ6A 4B3KA 1Z69A 1CXHA 4MWAA 2INZA 4EF8A 1XUUA 4Q8OA 3R13A 1Z9AA 3MUZ1 1FKXA 2GJXA 1R30A 1VJSA 1JRBA 4US5D 5IM51 4WRHA 1SMAA 2FMOA 2I1OA 4HZ7A 4ZQCA 4PRTA 1JIBA 3LCIA 3MVTA 1GVSA 2D69A 4NRSA 5HR6A 4KCVA 2YFOA 1EZWA 3ANYA 3VIFA 2WMIA 1VENA 3VNMA 1W31A 4PC8A 4HA3A 2R24A 3H55A 3FYOA 1BLIA 2HPMA 1QO5A 3DECA 3AMGA 1MEHA 2FH6A 4IGMA 2CXEA 5J5DA 2FYMA 4FLRA 3SN4A 1CB7B 1QXLA 4TR9A 4O14A 4JTFA 2I5QA 3KCLA 3B04A 3CPRA 3SCPA 3PB2A 1J96A 1LLOA 3AZTA 3TK7A 3N3MA 3GH4A 3QN3A 3HJZA 5D09A 2PDMA 1IXQA 3VILA 4C5ZA 4AX6A 1RPKA 5LHFA 4GVIA 3LSCA 3EX4A 1NF0A 2B31A 3CGTA 1CXFA 1DWFM 3BZGA 4J2MA 2BWGA 2P76A 2Q3RA 2BXYA 2E9BA 2EXOA 3RIKA 1B54A 2EPNA 4DM1A 2PDLA 5EMYA 3AXHA 3EAUA 3TTYA 3CXOA 5TNVA 4K36A 3LUTA 3DENA 4F0HA 2XFYA 3FLUA 4WXZA 4AQLA 3OVRA 4WSKA 1B57A 3G1SA 2HMCA 5HNTA 4Z1CA 2HV5A 3W86A 3PZUA 3IUHA 5LXEA 2YDRA 1PZ1A 1NDWA 2UY5A 2DW6A 1X7FA 2XDFA 3K2GA 1BF6A 3UCQA 3DHFA 4PMYA 3VD5A 4YYFA 4XTIA 4JNYA 2WCAA 3UZWA 3IPWA 2YFNA 4X60A 2CITA 5FL1A 4FALA 2A0NA 4GVHA 3RGTA 4HNOA 4HA4A 2GDVA 4LAKA 2OELA 3M5YA 4S2BA 1WBJA 3T4WA 1ZCOA 1BVWA 1ZBVA 4PN2A 3BVJA 2XIBA 3W2KA 1AUSL 3FGCA 3PHAA 1FVPA 2YZ5A 1XIHA 2Y8VA 1LOQA 2WM1A 4GVFA 1V3KA 4GD0A 1PTGA 2QPUA 4W85A 4YVPA 4JTTA 1RLDA 4BCEA 1E1CB 1M7OA 5C54A 3NZGA 1BRLA 1FWSA 3F4WA 1ALDA 2ABAA 3GRIA 2FGBA 4IJCA 2FZ8A 2H3BA 4ORMA 1KGXA 3QW4B 4AWSA 2Y61A 3G0UA 5HJLA 5ABEA 5JIPA 1ECQA 2HVOA 3BO9A 3ZYZA 1WXYA 3VYLA 5AC7A 1OG0A 4AISA 4PMVA 5D2VA 3PFMA 4HK7A 1DWIM 3CT2A 5I06A 1ONEA 1W5QA 3TW9A 4LOCA 2BHZA 3SCRA 2CLOA 2FTPA 3SY8A 1US0A 4DQWA 3MUAA 4DB7A 2W9MA 2PAJA 4JFSA 4O52A 1ZL1A 2BOFX 1CX9A 3GG0A 2NVDA 3HGSA 3BLKA 1GQIA 4ZSUA 4YTRA 2I16A 4ZQPA 1JJKA 2C7FA 3AIEA 3WQCA 1DEDA 4K37A 2BY0A 1ODUA 2OSXA 1C92A 5G2WA 1W9VA 1V3HA 2ZX9A 1LJYA 4P7QA 2UV8G 2EPHA 2V3EA 2IXUA 3DC8A 1BWKA 5ABTA 3HMCA 1IF2A 3MUCA 2TAAA 3LV6A 2VCBA 2J7EA 3W6LA 3AMDA 1L6YA 1R86A 5LNVA 1P6CA 4M82A 2C0AA 4S3AA 1SZRA 5HANA 2C8NA 3TN6A 3SGGA 4A2RA 1FHVA 3TNBA 3UWEA 3V18A 4JEJA 4YCOA 2OB3A 5HMFA 4K8EA 3CQJA 2GK1B 4IZGA 1UYQA 2ZRUA 3WMCA 3CZEA 2PTXA 1BQGA 3A3HA 3QY6A 3SUWA 2XHYA 1JD7A 3K8MA 1B3ZA 3RR4A 1DORA 3F2CA 4ACZB 5A95A 3T78A 3CMFA 3SRFA 1NM9A 2OX1A 4K38A 2G3IA 3HURA 1WYIA 1KFBA 1QAPA 3NYZA 4QQUA 4UNKA 1TJ1A 1E43A 4MJZA 3PZGA 5E9XA 2OCZA 5HMDA 2Z6IA 3V36A 1W3IA 1TJPA 3GG7A 5CZJA 4FB7A 1T7LA 3H12A 4E2DA 2W66A 2V6AA 2WMJA 1AD1A 4JTQA 4D6HA 1J6PA 2HNHA 4RZ4A 1CB2A 3PZQA 4JTSA 4GZ7A 2E9MA 1MRAA 1LT8A 1REQB 3CO4A 4HTBA 5EMLA 3IVTA 1UASA 3SCNA 5C9UA 3R94A 2DZWA 4A21A 4GMEA 1IT8A 1MRQA 2WMHA 3OBEA 1UZ1A 5KSWA 2Q8ZA 1VB9A 4JHZA 2J6VA 4N9DA 1SZNA 1QPQA 2ZC8A 3M5VA 4PL1A 3H53A 4WJ8A 2JIEA 3EWDA 4PTDA 1RA5A 4DBWA 4CCZA 3PJUA 3T42A 2ZRWA 3LD5A 4FX8A 3W07A 4PMJA 5ABFB 1RPXA 1I2QA 1XWYA 1R3QA 1JCJA 1EGVA 4UTTA 1XFCA 3C56A 5PTDA 1R2SA 3GHUA 5DX7A 4ZO9A 4B5SA 3WDRA 4TMBA 3MVIA 2DU2A 3K1DA 4D9PA 1FWWA 1TIMA 2CBIA 3O6DA 1PBGA 3VE7A 5D2WA 4S3JA 4E8GA 2VDHA 3PWGA 5D05A 3AAMA 4W8BA 4KWVA 3G1FA 1XLDA 1JAEA 2OSYA 3VIPA 3S5ZA 2NXGA 1LUCA 3GIYA 5HPOA 2CZVA 5AN7A 2IUZA 4HNLA 1A49A 1EGZA 1DJWA 3GBEA 5DO8A 5G2IA 3W24A 1R5YA 1VEOA 4P7NA 1XCWA 4JCLA 1EJTC 4DN1A 3WENA 2X7WA 1CT5A 1X98A 3MSDA 2EBNA 3P61A 4GXMA 3W2UA 4WHBA 5I3DA 3HGRA 3W53A 2B7PA 1HJXA 3SCQA 4AZ5A 2PLJA 1R9YA 2PTYA 2E1DA 3QOKA 1EUAA 1SW0A 2GUUA 3VKAA 1LOLA 3BC9A 5MHBA 2WNZA 1GHSA 1DP0A 3BW4A 4LUTA 3OQEA 4D1IA 3DFTA 5AYXA 4P7RA 3FX4A 4PZVA 4LBUA 4M8UA 3NO1A 1RY8A 3MPGA 4AZHA 5IFTA 3LHZA 1VCFA 1SVDA 3SUUA 4LALA 2Y8UA 3PG8A 2DJXA 4B3ZA 1TTIA 2O92A 3BURA 2WSQA 1WB0A 1K7XA 3WQ4A 5T26A 3MW7A 4KWWA 4BZYA 1LQ2A 4WCJA 3L9CA 3LCWA 2HTMA 4YTTA 2QCCA 3PPFA 4LJ3A 2E67A 5DQPA 2CLFA 1UHVA 3NZPA 3SSZA 4M1BA 1DIOA 3GS6A 1E70M 4NIRA 1DXIA 1EXPA 1UQYA 1WAUA 1G4PA 4FZIA 2DSKA 2H9AA 2YB1A 3WLLA 2I57A 3M0ZA 3CPUA 2CC0A 2Y5EA 3SZ8A 3NEHA 1P0DA 4UFIA 3CYJA 1E1EA 1YDVA 3FOKA 4GI6A 4PMZA 2ZZ5A 4MB1A 1JCNA 3HU7A 4MADA 3W3OA 3HPSA 4PCFA 2RAGA 1TZ9A 1HJQA 1E56A 1XBVA 3TQVA 1GJUA 2F8QA 3F5LA 1WP6A 2X41A 2HPIA 3VCRA 2P50A 5I00A 3UNDA 1IZKA 8CGTA 1CWYA 4UTIA 5EFFA 3B0VC 3FAWA 3DI1A 2DVUA 4I9JA 3AIVA 3ZSTA 2W79A 4UNIA 4NI8A 1JPIA 2C1GA 3PTDA 2V5CA 4GCAA 4Z2JA 1KV5A 1RK5A 2QXWA 3V0SA 4KGJA 4AX7A 1GOIA 4IFOA 4IGHA 1J93A 3EDKA 2VEIA 4O0ZA 3GTXA 5LIKX 5A3HA 4Z1DA 2G37A 5I3JA 1VJZA 3HJEA 4C1NA 2Z7GA 2YCLA 3N2TA 4QR6A 1CCWB 1GCYA 3M5ZA 3EEZA 3ABXA 4QTGA 2DT3A 4F79A 5DMMA 5CG0A 4ZQMA 4ONVA 1LBMA 4QXIA 1GVFA 3DYOA 3S0CA 3KOYA 2G3JA 4GKTA 3L4ZA 1V77A 1JZ8A 2Z1VA 3T44A 1Q6QA 3F03K 3L7RA 1TVLA 5T9BG 3RJXA 1YKWA 3WLIA 3RLGA 1XLEA 4LT9A 1T8QA 4E4UA 5CLWA 2GFTA 3WDHA 1FCVA 2HRWA 5GNZA 3WMBA 3CBWA 4HA0A 1JF5A 1W0MA 3O1NA 5KITA 4PUMA 1NF7A 1G69A 2GZXA 4CEUC 3VA8A 2ZRVA 2AMXA 2V82A 3GU9A 3HF3A 1IXOA 1G01A 3SGUA 4NY2A 4CN6A 2HDJA 2D2HA 1TV4A 2Z24A 4GY0A 3O9NA 2DW7A 1PKLA 1F73A 3C2YA 3HG3A 2Q8LA 4M51A 3DFYA 1ZAIA 2F61A 5CZTA 4UQDA 3AHTA 1F07A 2IXVA 4CCCA 1WKYA 5FL0A 1WXJA 1RCOB 4KCTA 4NJJA 2OO0A 3SW6A 4DF2A 2JIWA 2WBKA 3NL6A 4D71A 3DG6A 2A85A 2NQHA 3HPAA 2G4FA 4LVGA 1R3TA 2VEFA 4BWLA 1OCQA 5LIUX 2B7NA 3VFLA 5BMWA 4RNJA 1UA3A 1JD9A 1J0YA 3OIHA 2QF7A 2E7FA 3SBFA 4F0LA 1KBKA 1XD0A 3N3TA 4FR1A 3KBVA 2DIEA 1KLYA 2ZZ2A 1O60A 3Q94A 5I2UA 2ZOXA 3UBPC 1J11A 2FIQA 3S3GA 1J10A 4KGLA 4PCNA 1ZBKA 2J75A 4PODA 4XX6A 1PKMA 1V6VA 4A3UA 3E6EA 2XIJA 3GC2A 2PP3A 3CH0A 4DIAA 2PRLA 4BF5A 3JUGA 4QHRA 5HJYA 4DXVA 4BEUA 3G3DA 1QMLA 3WLQA 4DJEA 3BG3A 2IW0A 1CGUA 3EB4A 3AU2A 4U3AA 4PTNA 2BXZA 3UZXA 3NL2A 1QU4A 3OZPA 3VKDA 4KRTA 4LBSA 1B3WA 3DUGA 1LRNA 1XIEA 5HWJA 3MV01 1SO5A 3PZOA 1O5RA 4H8VA 1IHIA 5CZ0A 1PWMA 3TIMA 1DQXA 4QSHA 1V51A 4HZ8A 2WZMA 3VO0A 3GYCA 1LRTA 3WMLA 4AC7C 2WMGA 3MO7A 2DZSA 3KHJA 1V3IA 3W38A 1MXDA 3K13A 1MUMA 1UZHA 1JYNA 2SFPA 1QWGA 3L12A 7CGTA 3N13A 1N8IA 3TYEA 5FF2A 1AFSA 4JTIA 4DJFD 4X9YA 2HS6A 1GQJA 4TIMA 1HVQA 4ZOBA 3PP7A 4IJRA 5FF7A 3AIQA 4DPQA 1DJIA 5CPQA 1PKYA 1AQ0A 3TYBA 1BXNA 4QITA 2ZUNA 1PHWA 3CAWA 1LLWA 4PH6A 3TN4A 3QW3A 4H9XA 4PFHA 2E5DA 2ANUA 1V3MA 2GUBA 3FIGA 5DFAA 2WOQA 3FDGA 5D4YA 3V4BA 1KA9F 2PWHA 3NQGA 1ADOA 5JH2A 4MB5A 3RPMA 5HXMA 1E4LA 3DKJA 5C9ZA 5DY2A 4V28A 3GW0A 1E0UA 3FSTA 3VNLA 1DWHM 1FOBA 3REQB 1OFPA 3AIRA 1N7KA 1KFCA 1TMLA 3MYOA 3BLIA 2D20A 2QF8A 3W75A 1EWDA 2JGQA 5ABGA 4J40A 5FOOA 1AQMA 3UG8A 3T2OA 3M0JA 4JY9A 2D73A 4H3DA 3W85A 2OOGA 1X97A 3KRBA 4FOUA 2R1LA 1UWRA 2ICSA 4MPQA 4AD1A 4MM1A 1A4LA 4DJDD 4NZJA 2VI0A 2YYTA 4AWUA 1RUSA 4IIBA 3TQKA 4TVCA 4GO9A 4JTGA 1VKFA 5H8MA 1XJBA 4P8XA 3MCNA 3QKZA 3UXKA 4UFJA 1L9WA 1J0HA 3V5OA 1GVQA 3QQ0A 5AZ0A 4RNHA 3M6DA 3F5KA 1H7NA 1E6SM 1DJGA 1XINA 3N19B 4QGCA 4AEFA 3UP8A 4NNCA 1K8XA 1XP3A 4UNLA 4RW3A 1DPMA 1W8SA 4KRZA 3KRZA 4PCTA 3EX6A 1Z42A 1CEOA 1A5BA 4RDVA 4KEZA 1K6AA 4ICCX 5CAHA 4ZZ9A 3HG5A 2GOUA 1VGAA 4IGSA 1TPDA