2YIHA

Structure of a paenibacillus polymyxa xyloglucanase from gh family 44 with xyloglucan
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
511
structure length
511
Chain Sequence
KTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDWQHSSDNYLCSNGGLTQAECEKPGAVVTSFHDQSLKLGTYSLVTLPMAGYVAADGNGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVKGYALDNEPALWSHTHPRIHPEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYKDLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETKKARMQAPRTLWDPTYKEDSWIAQWFSEFLPILPRLKQSVDKYYPGTKLAMTSYSYGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGDTSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGFDKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CEL44C
publication title Structure and Activity of Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 178
structure length 511
sequence length 511
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12891 Glyco_hydro_44 Glycoside hydrolase family 44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2yihA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yihA02
3GDBA 1QNPA 3VIOA 3RPMA 4MNJA 2VTFA 4FNSA 4AMWA 4WSJA 2VX5A 1GW1A 1J0ZA 1FP9A 1QWUA 1PZ3A 3WH9A 3QHOA 2J8FA 1QHZA 4P7OA 4S3JA 4QCFA 1VAHA 3T08A 1HN1A 2J77A 4XZWA 5BCAA 1NM9A 1ISXA 1RPKA 3NSNA 1XSIA 1XCWA 1XCXA 5M03A 3G6MA 5A6BA 1XH2A 4DUVA 4UQ9A 3W6LA 3PTMA 3TA9A 3AZTA 3VO0A 4BA0A 4AD0A 3VX1A 3QHMA 1AMYA 1PJ9A 1C7SA 4F66A 1ZU8A 1PX8A 4DWSD 1TR1A 4PMNA 2VZUA 3PTQA 3AIUA 1SFSA 2IGTA 4CD6A 2EABA 3VM7A 1DWAM 3ARRA 2WWDA 1BYCA 3IAPA 4DWSB 1YQ2A 1HJXA 3ARSA 1LG1A 3HZ3A 3PN8A 3RDKA 1HJQA 4P7NA 4DM1A 3OGRA 3U5YA 4AYGA 1D3CA 3VSTA 1CXFA 1VF8A 1OINA 3U5UA 4U2YA 5ABHA 1MWOA 2FHCA 1JNEA 1JDCA 1DWGM 2WMJA 4MADA 5ABFA 3WDJA 1V6YA 1E0XA 2PB1A 1E0VA 3SCRA 1UWIA 3VIIA 2UY4A 2GUYA 1CEOA 1CZ1A 1UWQA 3CZKA 1E6ZA 1GOQA 4QFUA 1F4HA 2XVNA 5CPQA 3CMGA 3W38A 1V3LA 1B30A 1JZ6A 3DDFA 1TFVA 4MNKA 1R7OA 1QHOA 2QMJA 1E6SM 1OSEA 1GOMA 2XTKA 2FDMA 3THDA 1MYRA 3PHAA 7TAAA 1C3FA 1E3ZA 5DFAA 1TQTA 1V02E 1JYWA 2YBUA 1LF1A 3AIEA 5I79A 3SUWA 4FF5A 1PBGA 1R7AA 3T2QA 3AQUA 3AXXA 1CXEA 4JHZA 2WZEA 2V3DA 3SCVA 3GXNA 2PBOA 4CKQA 4JFSA 3WEMA 4C7GA 2ZUUA 2VZSA 1E70M 1R85A 1IZJA 4UFJA 1IT0A 4MJ2A 1NOFA 2F1BA 5HPOA 3LPPA 1R75A 3D3AA 2XFFA 4M24A 5I5RA 1WZMA 2YA1A 3CV5A 1BFNA 3L4UA 4CGTA 2NSXA 3WF1A 3D4ZA 3EJSA 4WIWA 1JDDA 3L2LA 4HMCA 3N12A 2VX6A 4MB5A 4Y7EA 1VJZA 3NSMA 4P7LA 3PZOA 1VEPA 4H7VA 3NYDA 4V2XA 3KLLA 1MVYA 4NSBA 3H53A 1KCKA 1QNRA 1UR0A 1QVBA 2WZIA 2PI6A 2OSWA 1DWFM 3VMPA 4JFWA 5F7UA 4RE2A 5A6BD 3QGVA 1MQRA 3AZRA 4TVDA 2QPSA 3VKKA 1Q4NX 3WQ8A 4P8XA 3GNPA 2BY2A 4CN6A 4BQ3A 2GJXA 2ZUSA 2WMFA 3BH4A 5A8PA 2VR5A 2BXZA 2V3FA 1UKOA 1UR2A 2CBVA 3VVGA 4CCEA 4PMUA 3DYOA 1OGBA 1UR1A 1IV8A 3E1F1 4NZFA 3WDRA 1UR9A 4NRRA 1UOKA 3LPOA 1WNOA 3DX1A 2YL5A 2D1ZA 1J0JA 5M5DA 3MV01 3SCUA 5BXPA 2XWEA 2HVMA 1A3HA 1JF5A 4RE3A 2BVTA 4W7WA 3DHUA 1MW3A 3ARUA 2GVYA 3CTTA 5I23A 1K9DA 4PMYA 4W7VA 2WKGA 3VDBA 3PZMA 3LPFA 3UESA 1Q6CA 3MI6A 4FMVA 1R47A 2NT0A 1GONA 2BFGA 4DWSC 1G9HA 1GCYA 2ZIDA 3PZQA 3WD0A 2E8ZA 5BXSA 3LXBA 3KZSA 4HA4A 5CGMA 2DT1A 1CECA 4PMVA 4PUEA 1WO2A 1HJSA 1CNVA 1CLXA 3VD7A 4H04A 3KE0A 2D0GA 1NOWA 2W4XA 3VGFA 3W27A 1WZAA 1BYDA 1F4AA 1UH4A 3WDQA 4CD5A 5JUVA 4W8BA 1KTCA 4J3VA 1ISVA 1I75A 2W5FA 2QHAA 3GXMA 2ZXAA 4KH2A 1A47A 3EJQA 1FFQA 5IDIA 3SUUA 3W25A 1UKQA 4DUWA 4W93A 4F8XA 2XSBA 2D0HA 1TCMA 3AHXA 4WLCA 3RIKA 1E40A 3UR7A 2WNWA 1TA3A 3S6TA 2F7RA 4AC1X 2W63A 1V03A 4AZBA 4C7DA 1V6UA 1HL8A 4UFIA 2G3JA 4PTMA 5BRPA 3WL0A 4GXPA 3VGBA 2D73A 3WUEA 3A22A 4AZCA 3HN3A 3VDCA 2ZX7A 2VI0A 1M03A 4HOWA 4OKDA 4AZ5A 5A8QA 3NDZA 1VJSA 4EK7A 1PX4A 3FXYA 2VQUA 3IGUA 1J0YA 1OB0A 4U2ZA 2WYSA 4DO4A 2BVDA 3A4XA 1BVNP 4YHEA 3POHA 3EMCA 3NUKA 4J3TA 1P6WA 1QPKA 1EH9A 4QAWA 2VZVA 2DDXA 3AHVA 4N42A 3K4AA 2J25A 2AOSA 3HMCA 3W4RA 2FYVA 2C8NA 3AJ7A 3OZOA 3CZSA 5D9NA 2FH6A 4KMQA 1NP0A 3OLDA 1GQJA 4XB3A 1QNSA 5HBFA 3AS2A 1CIUA 2G3MA 3TP4A 2WHLA 3NSXA 4MB1A 1E4MM 2WXDM 3CPUA 4OBSA 4WK9A 2WCSA 3AMCA 3BVVA 2CCRA 5LYRA 3AFBA 4W5UA 1C90A 1UR4A 3BCDA 3WH7A 1W2PA 4JKMA 3RJYA 3WKZA 1PEZA 1RH9A 1J10A 2AAAA 2WMIA 3N15A 4W87A 2J47A 1JI1A 5GNZA 4YN5A 5FOOA 2WLZA 4PCTA 4MJ4A 3WQ6A 1U2YA 3MMDA 4UTFA 1JZ3A 2FH8A 4JFTA 3OB8A 2NT1A 3I3EA 4CD8A 2XVGA 2XN0A 3IJ8A 2Z1SA 1FH9A 1BPLB 3MV11 1V0KA 4LYQA 3BMVA 2BHUA 3ALGA 1HKJA 1US3A 3GH7A 3WD1A 3VSUA 3MUY1 5JBDA 2BY0A 1XRVA 4M80A 3WQVA 9CGTA 3QR3A 5M17A 4GI9A 2Q8XA 3ARPA 3HU7A 3WDIA 1KGXA 1HIZA 3FY1A 4IISA 3NIYA 2WM0A 3VPLA 1W9XA 3VIMA 3WL1A 4W7UA 5DF0A 4UQCA 1AVAA 3AYSA 5CLTA 1W9DM 2WHKA 2X0YA 5LA0A 5BROA 4TOQA 4R27A 3WDHA 3SCWA 1E4NA 4NZCA 4XZBA 3BLPX 1HTYA 3LRKA 1OD8A 1WKYA 4MB3A 3U7VA 4BQ4A 4HZ7A 4GI6A 4ML4A 4PN2A 4TUFA 3CUHA 3PTKA 4GZJA 1E72M 2E9LA 3LRLA 2DIEA 1J0KA 1HJVA 3BAXA 5CSUA 2OLHA 4E8CA 3W0KA 4PMQA 4QLKA 5GNXA 3SCTA 1TQUA 2ZE0A 2ZXQA 1OGSA 1JYXA 2FE0A 5HNNA 4H8HA 1BG4A 3AIRA 1H49A 3KL5A 2CHNA 1VRXA 4AD2A 3NCOA 1UH2A 2DSVA 3DDGA 3AHZA 5CQ1A 2PWDA 2VVSA 5DT7A 2WPGA 5CSYA 2EPOA 4HU0A 3UG3A 3DX0A 4WF7A 3BCFA 1NWRA 1JAKA 1K9TA 3AOFA 1ODZA 1BQCA 1M53A 3I3BA 3SCQA 3UG4A 5IXEA 4U5KA 2CBIA 3AI0A 1CTNA 1EDQA 3CHEA 1E6XM 4MAVA 2PF0A 3EJUA 5E0FA 1DWIM 3BUIA 1EDTA 3SCNA 4AW7A 3M46A 1B0IA 3ZJ7A 2WKLA 3WH8A 3U57A 1WCGA 1TZ7A 1JZ8A 3VD3A 2QLYA 3BGAA 3WNLA 3ZT6A 1CGVA 1XD1A 1HJUA 4UOJA 4AMCA 3TTSA 4W88A 1ECEA 3WFLA 2XYLA 2D24A 4ZXOA 3N13A 1HNYA 3DECA 1KGWA 3EYPA 5AYBA 1UD3A 4JFVA 4GO9A 2YL9A 2OW6A 1UWTA 4JIEA 1JZ4A 3AICA 2WVSA 3LXAA 3MMWA 4PBGA 3PZVA 3AMKA 1E0WA 2QPUA 1V3IA 3CUIA 1QI4A 1TVPA 4LXFA 4HOZA 3MUIA 5FL1A 2W61A 1U30A 1QX1A 1TG7A 1UD2A 1W9PA 5EB8A 2YBTA 1I1WA 4JHOA 3AS0A 5FKYA 5E1QA 1CGWA 1KCLA 2EBNA 2BV9A 3VX0A 1ZB5A 5I78A 4FNPA 3II1A 1C91A 2F2HA 3CC1A 3WN6A 3D50A 3FNDA 3WNNA 4EE9A 3FHQA 3GYCA 4GO8A 3F5KA 3TONA 4FNQA 2ZX9A 4MDPA 2GFTA 3WF4A 1KWKA 2DPEA 3LPGA 3SIMA 5FD0A 1CGYA 1IZKA 1O7DC 4LPCA 4AZGA 2J7BA 2WZHA 5EFDA 2DH2A 1OD0A 3VDHA 4W5ZA 1VFUA 1DWJM 5DEZA 2X8RA 1QHPA 4BS0A 3BAIA 4PCSA 3MKKA 4AD1A 3MMUA 2DGAA 2X2IA 5LA2A 3IJ7A 2Y2WA 1W9BM 2VCAA 1H1NA 3HJEA 4E4PA 2XVKA 1OT1A 1VFFA 4CVUA 3L4ZA 1GORA 2JEPA 2OWXA 4PMXA 1H3GA 1KR0A 5A2BA 4OGZA 5HDRA 3S5YA 4UR9A 1KXTA 3AISA 1XV8A 3WNOA 1W9UA 3N11A 1W32A 3VD5A 1KXQA 3CBWA 3WSUA 1EDGA 3W82A 1R34A 2ZWYA 5E6ZA 1YHTA 2GK1A 2DT0A 2J4GA 4S3KA 1RP8A 4UQAA 1EQPA 4GZEA 3BSGA 3K8KA 3RMEA 3M7SA 4ZE5A 2BHZA 3RM9A 1BG9A 1E3XA 1PAMA 4GZIA 4AMXA 3K8LA 3WY1A 3M6DA 3L4YA 2OWWA 4FLQA 1JFHA 2WB5A 2ZUTA 5GQBA 1WB0A 1EIBA 1KR1A 1LL7A 2J79A 1JFXA 3AHTA 6TAAA 3W37A 4BZYA 3AIVA 3DX4A 1QW9A 2UY5A 5A2AA 5HPCA 3D51A 3A4WA 1OWQA 3PZGA 2YLAA 1JXJA 3U7BA 4Z2GA 2J7FA 1EO5A 4OBRA 1TQSA 2YLLA 3VOCA 3BVTA 4FK9A 2W92A 3L4XA 1HWWA 4WKAA 2PWFA 2YFOA 3RILA 1HP5A 4P7RA 1MFUA 1PZ2A 4URIA 4NRSA 1WP6A 2E0PA 2EAEA 1DTUA 1QNQA 4HA3A 1K9EA 1UH3A 2O9OA 3SURA 5A6JA 5CG0A 4B3KA 2WMHA 4XX6A 1SR0A 3DYMA 3F5JA 2WC4A 3VU2A 1GQLA 1E4IA 2BNJA 4QLJA 3UCQA 3WQWA 3BUBA 3G6LA 4JFUA 1R86A 2WMGA 2WANA 4A4AA 4H8VA 1JNDA 1JG9A 1PX3A 4JKKA 1QNOA 3T2PA 4B9ZA 3IANA 2HISA 2W62A 1JGIA 4UFLA 3VSVA 2G3IA 3CGTA 4CU7A 1E6RA 5EBAA 2J7EA 2D2OA 2VRKA 2WBKA 1MXDA 1UD4A 1O6IA 2JALA 3WBAA 3EJPA 1EO7A 4NF7A 1KBBA 3RM8A 1JI2A 1B31A 1G1YA 3PBGA 4L4PA 4P8VA 2YOCA 4HMDA 3OA5A 3WMCA 3VGDA 1WPCA 2JIWA 3ZIZA 2JEQA 4U33A 1JYVA 2MANA 4HU8A 4ATDA 4Z2LA 2DIJA 2XN1A 4FLOA 3GBDA 1K9FA 2RGLA 3THCA 3L2MA 1E5JA 3F4VA 1G0CA 2EPMX 3BXWA 2E4TA 1XYFA 3LMYA 3MSDA 5BWFA 4P8WA 4JCLA 1R33A 3VINA 1CGTA 3CIVA 2ZOXA 1NWUA 6CGTA 1LQ0A 3CHFA 4D6FA 2EPLX 3WMSA 2BS9A 3FAXA 4NXSA 5CPTA 2F1AA 1ZBCA 2B31A 1OT2A 3ZR5A 1EQCA 3ZR6A 1UZ1A 1WE5A 1OBAA 2X09A 2CESA 1E1EA 1ESWA 4AYSA 2DT2A 5D8ZA 1LL6A 5LA1A 4JKLA 4CD4A 5DO8A 4AXNA 1BSIA 1G5AA 5I2UA 1GQIA 5AYIA 2DT3A 1W9VA 2CERA 1S46A 1UKTA 4LGXA 3FHAA 1VEMA 2QF8A 2WC7A 1J12A 4PRWA 1M04A 5DMYA 4KGJA 5E6YA 1EOKA 3MU7A 5I3DA 2JF7A 5IHSA 2ZICA 3OLGA 5IFPA 1UASA 1HL9A 4WKHA 5JBFA 4CU6A 2XUCA 4OIFA 4ZENA 4AD3A 3L4VA 2PWEA 4U31A 1T0OA 1W3JA 3AMGA 1QI3A 4PUDA 2YIHA 1HXJA 2Y8VA 3GNOA 1TVNA 1H0IA 3WENA 4WSKA 1M7XA 2DSKA 1E6QM 3WNMA 5A6MA 3WD3A 2XFYA 3K46A 1DP0A 3AMLA 1FOBA 1KQZA 4XV0A 4AY1A 1CPUA 1OIFA 1UG6A 2JE8A 1CXHA 5E9AA 4K68A 4J3UA 2ZWZA 2YFNA 4AEFA 3W29A 1XSKA 3CZ8A 1QW8A 4FLSA 4Z2IA 1K6AA 1ZL1A 5FL0A 3UERA 3W26A 3KLKA 1SYTA 5KEZA 4ACZA 4J3XA 3B9EA 1NARA 3BVXA 1U33A 2V5CA 1MQQA 1E5NA 1XGZA 4C7FA 3O9NA 3CZGA 3OIHA 2YL6A 1J01A 1ZJBA 2OWCA 4J7RA 2VOTA 1R8LA 1GJWA 1CYGA 3CUJA 5AC4A 2TAAA 5A2CA 2E3ZA 4UFHA 4UZSA 3ARWA 3O2LA 4GI8A 4Q7NA 2XIBA 3PZTA 1V02A 1Q6EA 1E55A 3WUBA 3W24A 3WELA 3MSGA 1KWGA 3VD9A 3WNKA 4QDMA 4HPHA 2XGIA 3B9AA 2VT0A 1GPFA 1OIMA 2G3NA 3WY2A 2W91A 2V3GA 4D6EA 2ALWA 4LQ1A 1VB9A 2WVVA 3AZSA 3BC9A 2VNCA 2VC9A 4QLLA 2OSXA 4TX8A 3A23A 2PBGA 1H0GA 1EXPA 2EXOA 3EDDA 4E8DA 3OG2A 4ZEPA 4KRTA 1W91A 2J7CA 3ZQ9A 4UFMA 4PEEA 3VTRA 4DM2A 1ODUA 5M3WA 1RP9A 1HT6A 1V0NA 3OGVA 4MPKA 5CLWA 1HF6A 3WH6A 1OM0A 2W66A 2WLYA 3MO4A 4HP5A 1TA3B 2VJXA 1G01A 3N9KA 1C93A 1NWTA 2VX7A 2UWFA 1MXGA 3D52A 3APGA 2EJ1A 1TQVA 1PPIA 1LL4A 5JIPA 3AYRA 5ABGA 1B3ZA 4NZJA 4HZ6A 1MW2A 4CU8A 3OLIA 3IAQA 3VMOA 1C92A 2O9TA 5BXRA 1VFMA 2IXVA 4AZCB 4M29A 3GZAA 2CETA 3ZJ6A 3VIHA 2CEQA 2Y5EA 2J74A 5E09A 3BAWA 8CGTA 4X9YA 1CWYA 3CZNA 2VUYA 1KGUA 2FHFA 1HVXA 3CZEA 2GSJA 4XUYA 3EJTA 4UNIA 3ZSSA 3WMBA 4DWSA 3B9DA 2D22A 4UZUA 3WDPP 1DHKA 2A3BA 1CGXA 2J8GA 1UKPA 3FN9A 2F7PA 2XM2A 3WBEA 5HXMA 4FNUA 3SUTA 3K8MA 2PWHA 1V3HA 4Q22A 5A8MA 2D3NA 2WCAA 1GZJA 3WD2A 4U3CA 1UD5A 1B9ZA 4D71A 1UYQA 4WKFA 3DX2A 1W1YA 3GH5A 1HX0A 4CVWA 1E56A 2D23A 2J75A 3TTOA 3GXPA 1MFVA 3QOKA 5A6LA 3EDFA 2XGBA 4B15A 3GH4A 3WQ4A 2CKSA 4NI3A 1VENA 2ZXDA 1J9YA 2QV4A 2G41A 2DSUA 1UHVA 3ZJKA 3BAYA 1B1YA 3S2CA 1FFRA 4AZHA 3A4AA 2CBJA 4ZE4A 1EHNA 2J7GA 3PZ9A 5A8NA 2XIIA 4ATLA 3ARXA 1V6XA 4F79A 3WF2A 4B3LA 3I3DA 2WBGA 2VCCA 1OGGA 2VCBA 2WMIB 5IFTA 1JD7A 3VIJA 4FLRA 3A6OA 3UETA 4HPGA 2EO7A 3AIWA 3W28A 3KL0A 2JIEA 5A1AA 1WDSA 1E43A 2IXUA 4TXEA 3ARTA 2F61A 2XG9A 4L4OA 1QOXA 3A47A 2Y8KA 2VX4A 1GOOA 2VRJA 4UQBA 2YA0A 1GHRA 5A69A 1UQZA 2WWCA 4CCDA 3W6MA 1E9LA 1GHSA 3AMDA 3VMNA 4MB4A 1L0PA 6A3HA 5D8WA 1VEOA 1JF6A 4R5EA 4V27A 3SUSA 3K1DA 2ESCA 1E1FA 3UEQA 2NW0A 1PIGA 1C8QA 4UQEA 5JIWA 1EGZA 4GIAA 1J11A 4D6IA 3AHYA 1VBUA 1MW1A 4W85A 1UUQA 5FIPA 3GXDA 1BAGA 3VIKA 2E8YA 4EAMA 5ECUA 4BQ2A 1W1TA 2DEPA 3VDAA 7A3HA 3FAWA 2A3EA 5JBEA 1VFOA 1ITCA 4D6GA 5C71A 1GJUA 1J18A 2VURA 5GNYA 3GXTA 1DEDA 2BY1A 2F8QA 3BUQA 4UFKA 4D1JA 3BUPA 1GUVA 1ISWA 3RCNA 1V0LA 3SCOA 2XVLA 4PSRA 1NWSA 2YDRA 3QHNA 2DSZA 1EA9C 3MUZ1 3VIPA 3UR8A 4MNLA 3MUAA 3GBEA 3WFZA 1E4LA 4HZ8A 1HXKA 3BAJA 4QP0A 2D3LA 2O9PA 1UD8A 4Z2HA 1OCQA 3TTYA 5E70A 2VVNA 1JZ5A 2DH3A 2E9BA 3DHPA 3GNRA 4UOZA 4HMEA 5A95A 4AISA 1W3KA 2J62A 1ISYA 1SMAA 1LWJA 3W53A 3AXIA 4M8UA 2CIPA 2YJQA 1W3LA 1W2VA 4W8AA 2O9RA 3WD4A 1TMQA 1E73M 3EDJA 2F7QA 1AQHA 1KFWA 4OZOA 3HG2A 1B3VA 5HOSA 3ZT5A 1XC6A 2CKRA 3ZM8A 3D5HA 2WMKA 5CXPA 4QCEA 1Q6DA 1XHGA 2WVTA 2DSWA 5AC5A 4DO6A 3T0DA 3WF3A 2Y4SA 1KQYA 2WCGA 1UR8A 4AD5A 5ABEA 1ISZA 1BYBA 2X2JA 2BHYA 1W1PA 1C8XA 2CNCA 3IK2A 1BVZA 5KZ6A 4AWEA 5D9MA 4RL3A 1CDGA 3OLEA 3BSHA 1E15A 4IM4A 2OYLA 2VRQA 4AIEA 3A21A 4PMRA 3EDEA 5C8BB 4U3AA 3ARQA 3UG5A 3VNYA 4TX6A 3GXIA 1DWHM 2OW7A 5I0DA 3VD4A 1BHGA 1Q6FA 4TTGA 1WDPA 1EOMA 1XD0A 2VZOA 2ZXBA 4FNTA 2WVUA 1GOKA 4BCEA 3PZUA 1GVIA 1TUXA 3WQ5A 2ZX6A 2XWDA 2BVYA 1UKSA 4MNMA 1B3WA 2X2YA 2PWGA 1FH8A 3RM4A 4AIOA 2GJRA 1H41A 3TV8A 3CO4A 4J28A 1H5VA 3BMWA 5CPSA 3EJRA 4PTXA 4AZ6A 3AIBA 2O92A 1V6VA 3SEPA 1QBAA 3J7HA 1GNXA 2YDQA 3N04A 5I77A 8A3HA 2WAGA 2A3HA 3SUVA 3VIGA 4E2OA 2X05A 1V6WA 2IUZA 3HG5A 1CXKA 4KRUA 1EHAA 3BLKA 2GDVA 2X1IA 4TTUA 1AQMA 3CZLA 1KXHA 3ARZA 3M07A 3HG4A 1M01A 2A3CA 2G4FA 1XH1A 1MQPA 2CBUA 3CMJA 3N18A 3GM8A 3EMQA 3H55A 1FHDA 4ACYA 2GK1B 4LYPA 3WNPA 4D6CA 3EMZA 1GQKA 3T09A 5I6SA 5ABFB 3CLWA 4JL2A 1ZBVA 2XVPA 4W86A 2ZUVA 3AXHA 4AEEA 1HP4A 3ZO9A 2A3AA 1UQYA 4GQQA 4D1IA 3DC0A 2D0FA 3CH9A 1CLVA 3PZNA 3VUPA 4NXKA 1C8YA 2JF6A 2XN2A 3TTQA 4N0RA 5A6AA 2UY2A 1CBGA 4P7QA 1WZLA 4WJXA 2C0HA 2XM1A 1LWHA 4GPNA 1UWRA 4UQDA 2VL4A 1H11A 3TOPA 1V08A 2ZX8A 1UZ4A 1RD6A 1J0IA 2OYKA 3QOMA 1J0HA 1R87A 3A24A 3FW6A 4BQ5A 4M1RA 3ZJ8A 1FP8A 4AD4A 2PC8A 1BGGA 1GOWA 1KBKA 1V3MA 3IJ9A 4B16A 3T0AA 4V28A 4ZXLA 1JDAA 3ZMRA 1XH0A 4HA1A 2XPKA 3WY4A 3VGEA 3WIJA 4AIUA 2VR4A 1BGAA 3ARVA 1JZ2A 2QMKA 1B90A 4LX4A 2WSPA 4JL1A 3CHCA 1B3XA 4D6HA 1B3YA 4D6DA 3OGSA 2X2HA 2FGZA 1LG2A 5GPRA 4J3SA 2WHMA 4LYRA 1XYZA 4W89A 2JFEX 5IHRA 1PIFA 4JZ5A 1HKKA 4PMOA 1JZ7A 2Z1KA 2YKKA 4M56A 1HKMA 1AQ0A 2E9MA 2C7FA 4YPJA 2J78A 2J7DA 3BLBA 3NJ3A 1KXVA 2XFRA 3PZIA 5A94A 3VIFA 3DYPA 3KL3A 2YA2A 2WK2A 2BXYA 3SCPA 3SCSA 1TQWA 3S5ZA 4GQRA 2GJXB 5TD4A 1H09A 4MTVA 3F5LA 2VO5A 2V3EA 4W8LA 1W1VA 3AIQA 1GOIA 2ZUWA 2ZUMA 4UCFA 1C7TA 1V3KA 4BF7A 3MANA 4OUEA 1SZNA 3A5VA 2GJPA 4F9JA 3BVWA 5BYWA 3HG3A 3WUFA 5EFFA 5D9PA 4OJYA 2WC3A 4PTVA 5BRQA 4H41A 5A3HA 1N82A 2EQDA 1WDRA 3AS3A 4CN4A 3CZJA 1Z32X 5FCZA 1QBBA 2CHOA 4F9DA 1JAEA 1UA7A 2VQTA 1H2JA 3L4WA 5I24A 3T2OA 4JCMA 1HJWA 4PYSA 3EDKA 3ZT7A 1KTBA 2VZTA 3BUDA 4Z2JA 4H2CA 1UA3A 1US2A 2EPNA 4W84A 1ZBKA 3OZPA 4Z2KA 2EADA 1D2KA 2EEXA 3LRMA 5CZKA 1QI0A 2ZUNA 3BVUA 7CGTA 3KWXA 4PSPA 1FHLA 3A3HA 2DQXA 3VGHA 1UD6A 3AS1A 3VGGA 1E6NA 1FH7A 3NDYA 3ARYA 4YHGA 1Q6GA 1NQ6A 4JAWA 2G8ZA 4U5IA 1ITXA 1UWSA 3WEOA 5EMYA 1B2YA 2AMGA 3POCA 4X0NA 1H4PA 2XHYA 1BLIA 2GDUA 4B9YA 3RJXA 4J27A 1WDQA 1I1XA 3WY3A 3EBVA 4TVCA 4NX0A 4OOUA 1BTCA 4P8UA 3ECQA 3WF0A 1JL8A 1XSJA 4KGLA 2V38A 1E6PA 1X6LA 5CJ5A 4EANA 3GXFA 1X6NA 3MS8A 3BAKA 4A3HA 2FGLA 1JXKA 1WZKA 1VBRA 2RGMA 5A6KA 1BF2A 1HKIA 2X0HA 3CUGA 1CENA 3DX3A 4PTWA 1Y7VA 4D72A 4GINA 1G94A 1BYAA 5D4YA 5BXTA 1ZBWA 2J7HA 2OYMA 3T0BA 3KEHA 1KB3A 1O7AA 3W81A 5C70A 3ALFA 5A8OA 5D9OA 2W67A 3VNZA 4AZ7A 2D20A 3ZOAA 4MAZA 3O6AA 2EPKX 3WUGA 2XSAA 1NH6A 1TE1A 4MDOA 2EACA 1V0MA 3B8SA 2YDSA 3WEZA 4DUXA 2WW5A 1GVYA 2CXGA 3VM5A 1UWUA 2UY3A 4FNRA 2WHJA 4HTYA 5E0CA 4M82A 2BY3A 1PS3A 3RO8A 1CXLA 3GTNA 2CITA 4CUCA 5AY7A 1R46A 4RE4A 3LXCA 4DO5A 3CHDA 4ACZB 2F18A 1LJYA 4IPNB 1JIBA 5DT5A 2V5DA 2FHBA 3L4TA 1L8NA 2OSYA 5CGTA 3N1AA 1HVQA 4D6JA 3AROA 1CGUA 4J3WA 4GKLA 1QI2A 4H8UA 3OBAA 1D7FA 2XJ7A 1FA2A 4X0VA 2YL8A 2WSKA 4IUGA 3WH5A 4KWUA 2E40A 1ZS2A 4ZFMA 1LLOA 1WAWA 2ZX5A 4PMZA 2CPUA 4CCCA 5A6SA 4A3YA 1X1NA 1NP2A 4OOZA 1V3JA 1JD9A 3CUFA 3JUGA 4UOQA 3H54A 1VIWA 1MW0A 3LX9A 1ZJAA 1W3HA 1QWNA 3ZSTA 2VMFA 1E71M 1NOUA 4IPLA 2WVVB 4PMDA 4HOXA 1JYNA 4ATWA 3D4YA 3N17A 3VILA 1SMDA 4CN1A 4EKJA 4M81A 1CXIA 2CYGA 3K4DA 1QI5A 2Y24A 4AZIA 4CD7A 2F7OA 4TVUA
chains in the Genus database with same CATH superfamily
3U36A 4JTTA 3P0GB 2X6BA 3SN0A 5GJMA 2GHZA 3WH9A 1H8OA 1YPFA 4QDWA 3N3MA 3APYA 4ZCWA 1BOGA 4WGKA 3NCYS 2WWMC 4P2QB 3O07A 2IOOA 2CU0A 2E46A 3WFCH 3K80A 1YIXA 1MLCA 3AZTA 1OK6A 3QI9D 3CCHA 1N18A 2EIZA 3T05A 1QOQA 4NN6C 4JTSA 1DLFH 2BIMA 1DWAM 2CHDA 3ARRA 5EUOE 1UUMA 2H1PL 1NFPA 2H47C 5IV2A 4BXSV 3TBSA 4QIUA 4PBEA 4S23A 2HN7A 2WOYA 3WDJA 1V6YA 1PLGL 3EFDL 3CDFA 2GUYA 4ODHH 1Y1DA 1THAA 3RNKA 2EAWA 1ITUA 3HGSA 1A53A 1JZ6A 4HBKA 3C8KB 2PO6B 1JNHA 4O4WA 1G9ML 4FQQA 3RFZC 2ZUUA 5E5MA 3QNFA 4F2ME 2OOFA 4UFJA 3QWOB 5DQJA 1D5XB 5E23A 1MI3A 1Y0EA 4Y1AD 5I5RA 2YA1A 4NCC2 3WLWC 1BFNA 4FQ1L 2YN3A 3BPCA 3NJIA 1RCOB 4CW1A 2AHIA 4PJGB 3LNEA 2ZOOA 3EJSA 4MA7L 3P84A 2BOBB 3L2LA 2DJMA 3N0AA 3RZCB 3E12A 1JWMA 3SZ6A 1R0AL 3SB0A 1CC3A 1DO6A 4JTCA 3QUMA 4G8EB 4DUOA 1N4XL 3B0VC 4L9LC 1TQXA 4FFYA 2X1XR 5A6BD 1T2QH 5GGUA 1F3TA 4JTDA 4HUKB 3V1HA 1GJIA 3GQYA 3P4NB 1UB5A 1I8MB 3BH4A 4Y5VA 5A8PA 2VR5A 4PY8J 2CBVA 2GBVA 1OP3K 3LV6A 3ENEA 2OX1A 3DRTA 1OGBA 4L4TD 1GL4B 2CO4A 3DIDA 1RIVH 2W07A 2Q10A 1XICA 2PPAA 3HGRA 4M5YL 3TUUA 4HEMA 6PTDA 4HPOL 4XAFA 3GLDA 1FFNA 4Z7VB 4MQSB 4KJPC 1WO2A 1EUNA 2ZCGA 2OOGA 1ANUA 2G5UA 3V0VA 1RUKL 2A4ZA 4NI6A 2J2ZA 2DS4A 4LCWE 1YLVA 5D70H 4W8BA 2P5EB 1T21B 3O6ML 3NJGA 1LE5B 4N2AA 5T3XD 3M7OA 4NQQA 4XTRC 5EIIA 2F53D 5BS0E 3WJXA 3IDYC 1V03A 5C0ND 3CX2A 3TMQA 1EJSC 3PK7A 4OLXL 4US5A 2P9RA 3FHEA 3NSFA 1CI3M 3IJSA 3EOUA 4KQ4H 2CO7A 2GSGB 5C97A 3PDOB 3T1GA 4YLWA 5K9JL 4JS7A 5E0QA 5CKAA 2WY3B 1J7VR 2OFJA 1DQTA 4NCDA 3DJTA 1J0YA 1NCCL 1I45A 3HHSA 3H9ZA 4F1ZA 3V9EA 4LAOA 3RR1A 1PW3A 1LO2H 4GY4A 5DURD 1UOZA 2GJ6A 2G3MA 4MB1A 4F5CA 3ITCA 1LLZA 1R9ZA 1KBJA 3P8JA 1FL5A 3FB8B 3DPBA 3VFMA 2DDQL 1U95A 4ZSOB 4YSEA 3QULB 5BJTB 4DAGH 3SCMA 1IUZA 2LU3A 5D2LB 5T1KA 5CBEA 3SR7A 4X99B 1NC4A 1TPH1 1X44A 1FH9A 3MV11 2PMQA 3IKCB 3U7WH 3ALGA 2BCMA 1US3A 4K9EH 3WQVA 4GQGA 2F9RA 4F2MA 3ARPA 3VI3E 4FQXD 4M7KH 2E7CA 3G5ZB 1KB5B 3UBXG 4B96A 2X0YA 3HCVB 3GHEH 1AC6A 4AVNA 3BKCL 3DJRA 4MA8L 4I9WE 2YD3A 3UTTB 3QDME 4JTQA 4GXVL 3PTKA 1EZUA 1TTPA 2JCCA 4D9RD 3O1NA 4LY8A 4E8CA 4AT6B 1U8LA 2GTWB 1CLOH 2ZXQA 1REIA 4PR5B 1ALDA 4YN3A 2ZUYA 1QLFB 4UV7L 3NAVA 2VM3A 3L66A 2B4CL 5AB9A 2EO9A 1SJXA 5K1JA 1JE6A 2IBZX 3KBFA 3S7GA 3FOMA 1ODZA 2AMUA 4Q52A 4P2OC 3IGLA 3AUVA 4YS1A 2EE6A 3CHEA 5E0FA 1EDTA 3DRQA 3S9ZA 3CIXA 1ETA1 1JV2B 4XQ6A 5DHDA 3ZT6A 3NFPA 4AMCA 4MDIB 1X5ZA 1KGWA 3QUML 1PG7L 1DXIA 4Z7QF 1QUNA 5E6IC 3PL6C 1J8SA 1E0WA 4A2HA 1LRTA 2HVKA 3ZVHB 4Y2DB 5DRXB 1MHHB 2BDQA 1OFPA 3FH8A 2YPKA 2P7TB 2FFCA 2DW6A 3MUCA 3QXVA 2BVWA 3WHE0 3GTVA 2DN7A 1IKFH 1C91A 3OA3A 3FNDA 3IFPA 2C13A 4UDUA 3RUBL 4WU7A 5CHNA 5EBLA 2QQQA 5A2JH 3SFWA 3DURA 2GFTA 4PA8A 4UIMA 3SIMA 4N9EA 4GS7B 1K8ZA 1OD0A 1CI1A 3VFTA 2J5LB 4H40A 2WINA 4HUWB 5SWQA 3UZEA 1TPUA 2X2IA 1N6QH 1X7IA 4DKTA 4EBQH 1H1NA 4E4PA 4NRXA 5GRZA 4ZXBD 4YVPA 3LKOA 5JHLH 4QYOA 1F4WH 5DC4B 4HK0B 3X17A 1QR7A 1CFTB 1MCQA 3S5YA 3BV4A 4PBFA 3L23A 3AISA 5DGQA 4X0KA 3FFDB 1QABA 1KCRH 4WGVB 3IFNH 2IS7A 3ANYA 5DQDH 1LGVA 1EDGA 3GPEA 2ZYIA 3DO7A 3MCKB 2DMKA 4AC4A 3A3WA 1PVHA 2D31B 1QNZL 2VC6A 3QEZA 1IC4H 1V77A 1RZIB 2ZUTA 1LL7A 4QTIH 3ZHFA 3AWNA 4KDWA 4WUUA 3EWXA 3L16A 5FGRA 4QWWD 3S36X 3VWKA 5T1MB 3TBWB 1HO4A 4S2CA 4DEPC 5EA0L 4ZS6D 2J7FA 2CLFA 3OVRA 4KO9A 5CPOA 3Q5TA 3BP5B 3NZRA 1PZ5A 1ZHLB 3C8HA 3DN5A 3PWAA 2KDGA 4N6EA 4ISVA 4L48A 4PRHE 4Y2OA 3W39A 2O9OA 2WLIB 4MCYB 3FO0H 5DEFA 5JNYB 2AK4B 5TK4A 3PJSB 1W1ZA 4JO8A 5JXAH 1BVWA 4L9XA 2FIKA 3K7UA 3KCJA 2PURA 4GKNA 4KAQH 4XAKD 3VSVA 4RDVA 2PP1A 4GUQA 3KPOB 2N56A 2Y8UA 2BLEA 3H2WA 5CKGA 3NTCH 2P5PA 1JHTB 4G5AA 3WKQA 1QUMA 4HUUB 4L4PA 4O0QA 3KD4A 4DVRL 4HMDA 2GJZA 4DI8A 4TMBA 2COVD 2EDYA 3MCNA 5I09A 1GGCL 4EDWL 3KBVA 1M7OA 2FO4B 3OHXC 2O4MA 4W9DC 4QCIA 4LS0A 3SDDB 4JM2C 4CBPA 3HE6A 1I0BA 4PJEB 3I75B 2Q20A 3SRKA 2OMAA 4C8XA 2BS9A 1ZBCA 3MLSL 3GMRA 1IC0A 5HULA 4OLYH 3HMXA 1R3SA 2CESA 3MRDB 2E6FA 3QIWC 5AZ2L 2X4PA 2PYFA 4CD4A 3NPZB 1JRHH 3BO9A 4IOIA 2CERA 2H2PD 5M94B 1LEIA 3AVEA 4YSDA 5IFJB 3O3AA 4XMKL 4R7DA 4KMLB 1CT8A 1SY6A 4RWYH 5KVFL 4DP0X 3NA9L 2YAPA 4YNYB 5D7JC 5TIMA 1BJ1H 2JKRM 1KFAH 1J86A 2NPLX 1TITA 2GQHA 4IRZH 2EE3A 4Z7OE 2QLVB 1W3JA 4OSUL 4DGVL 1U3HA 4WV1B 3I10A 3CYVA 5I00A 1F07A 5A6MA 4WY0B 1UB3A 2AQVA 2DPKA 3TESA 3CSPA 2FMOA 1U41A 1PZUB 3DROA 2E47A 3UERA 3IFLH 4UCGA 4ACZA 5ECVA 3CXHJ 3SO3C 5IHUL 2H3NA 3VCNA 4JO2H 1QT1A 4JFFB 3UTQA 2CJUH 3NURA 3MBXL 1Y1UA 5AKQA 4L6OA 2ARWA 3O2LA 1UC6A 1G1KA 1NKOA 3D3VA 5AVNA 5I02A 4DF9A 2K1MA 1U8NB 4TPRH 3MLZL 3EH3B 4BZ1H 2ACQA 4FNLL 1OYAA 4KO7A 4LVOC 1QLRB 4H1ZA 4V2BA 1E42A 3E9UA 3E0WA 4PJ5D 1OYCA 2V37A 4HJGA 3SDOA 5C9XA 2J7CA 4Q8OA 1FFOB 1UWEL 4AUBA 1DBTA 3OGVA 2H9AB 4PB9L 3KX6A 3D52A 2R0KL 5JIPA 4P2QA 3GR4A 2A4EA 1ZGDA 1MW2A 2VEFA 2F6AA 5BXRA 4FTVB 4M29A 1S3KH 3HPAA 3GKFA 4HJTA 1A14H 4IWWA 1AD0B 2CEQA 2Y5EA 4E42B 1SJEA 2Z6FA 2B7QA 4P57B 1IXQA 1EZSA 3CZEA 3WMBA 3ZSSA 4X4YA 4Y8FA 1FE8H 4LLYA 2P50A 2WXIA 5GVJA 3KLSA 3BG9A 1U8KA 1TKKA 3WBEA 2DEWX 2XGZA 2C9UA 3KWUA 4C6PA 1CW2A 3SD5A 4HYTB 5GSVB 5IB4B 4KRPD 5AECA 2B0MA 3GTXA 1I4FA 2C5DC 3SQOL 1KV3A 4I9JA 1HI6B 3EDFA 1T80A 1LRQA 2R8WA 4FXSA 1J9YA 2WGNB 3C8KA 1PE1A 1YJDC 3FOLB 4W6WB 1EHNA 4RMTA 5DGRA 1XIWC 3WF2A 2WJDA 1YTKA 3LXUX 1BWWA 3CH1B 3EOTH 4NJHA 1JDEA 3KYNB 4CL7A 1MG3C 1OAQH 3L48A 1D5XA 1PY0A 3WNIA 2N1KA 1ADQH 4L4VE 3BO8A 3WL9B 4YE0A 4BWLC 4NHUB 4JGJA 4MGXA 1XYBA 3VMNA 5KITA 1VEOA 4V27A 1F76A 4G7RB 4MX7B 2NVDA 4PIBA 3F00A 2BOBA 3RZCA 3VXQB 4RDBA 4TL5A 3V4PL 3CNYA 5D03A 5E5LA 4MZ8A 2R1MA 4G8EA 1BAGA 3ES6B 4AX6A 2IPJA 1FNLA 3C6LB 3IDIB 4UBDC 1JZGA 3ZDZF 4PB0L 4B3VA 3HMXL 3SPJA 3NDZE 1MCBA 3BK0A 3P4NA 1DEDA 5HJ3B 1VBHA 3OKDB 4JPKH 2GUBA 3OZ9L 2GGGA 4HGWB 2MQCA 3QIUC 4IDLA 4PSRA 4KKLC 2YDRA 3TXZA 1SY6L 5L4MA 2CKNA 4ZAKD 1E4KA 2P5NA 1F0LA 4I3SL 2D3LA 1EMTH 3TJIA 1QSEE 2NLIA 5GS0H 1GGIH 4Z7VA 4FKHA 4YHOH 3NPUA 4Q8WA 2J62A 1GVQA 3A9BA 3S1XA 1QPOA 2NSOA 2P5EA 3SODB 1T21A 5IBUB 1N55A 3VABA 1M6OB 2C6QA 2Z64C 1KFWA 1LE5A 4MFHA 4HB7A 1A9BA 4K71C 5L8LB 5CR8A 3FIGA 1NAMH 4CBZA 1NBYB 5AUMB 2PAJA 4HXAH 4HU2A 1BJ8A 1CB4A 4AVOA 1MH5B 1TJHH 5HAOA 4UAOC 1E9IA 3QLLA 3U2SB 4GRMB 3MLUH 4MJ5B 5F9WB 1B6UA 2YZ8A 3VD4A 2KAUC 1IBYA 3EOLA 1SN0A 4P2RB 3QW4B 5EY5A 2Z7YA 2ID5A 3ZS4A 2MJWA 4RSYA 3AWGA 2QV5A 3TX9A 3T40A 1IC7H 4UWQB 3BWUC 3V6ZB 1PNCA 1H63A 4AHOA 1I8IB 1IGMH 1IGCH 3K6DA 4N2MA 4Z77B 1ZEAL 1K7XA 1NIFA 3M07A 3CMJA 1OHQA 5H8DA 4LF3B 3FB8A 4LUSB 2GK1B 1VFAB 2A74A 1IBDA 1L9OA 4ZSOA 2O6PA 3KM1A 3S3BB 4M7LL 1SJAA 3QULA 2J1WA 5D2LA 1TCDA 4HPYH 5DZNA 4D1IA 4X99A 3IKCA 1DEEB 4HQQH 3BJSA 5A6AA 3N3EA 3B40A 3AAZB 5IK3A 3RWHA 3ZLGA 4PE8A 5FS5A 1H11A 1UCTA 5B1BB 3UDWC 3G5ZA 1KB5A 3DFQA 1GGUA 3HCVA 4JFPB 2CALA 5T3ZD 3DV6A 3DVNB 1FI8C 4LSUH 3QZWG 1B4LA 3UTTA 4M1DH 4NQEE 5FHBH 5D05A 4AD4A 3N85H 3WYZA 4V28A 2W9MA 5E2JA 1X5GA 4Q4SA 2IH1B 3COOA 3MRHA 3UJTL 1ONQB 4JFZL 4AT6A 2AXFB 2GTWA 1VKXB 1B3XA 3OW1A 4PR5A 1I9JH 4J3SA 4HBCH 1QLFA 4HYRA 1FVCA 4HKBA 4TN9A 4U4MA 2ZE3A 4M56A 4KZDH 2QDWA 4H88L 3PZIA 3MC5A 5CN3A 2XQYK 1AIZA 2DLHA 4KBPA 1FKWA 1GOIA 2P0IA 4UCFA 5ISZD 3UTZB 3HMWL 4ZMZA 3TR2A 2VDGA 2J7LA 4K94H 3H3BC 2QYGA 4CILA 3FQRB 4KVNH 3L5AA 4FMFA 5F1NB 3BW9B 3FQ4A 1IC1A 3VKDA 5FO7B 3O0RH 5AG8A 2VZTA 5E6UB 5FAJA 3FU5A 3BISA 4QXTA 4W84A 3K2MC 3KDOA 1FNEB 4Y2DA 5DRXA 4LF2A 1N70A 5K2ZA 4XXDB 1NEPA 1FH7A 1PU0A 2KDYA 2P7TA 1ETZB 4R33A 1W5PA 1TB3A 2W0KA 4I9MA 5I1LB 1Q72L 3FUEA 4KQ0A 4BUQA 3R4RA 2WMPB 5DHVB 3IRZA 2NV9A 3KPTA 2GVGA 4NB7A 2PUQT 1F3WA 1PZSA 4IBLT 3CWHA 5F2IA 4UTKA 3W3OA 5E8NB 4XBJA 1WBHA 2AK1L 4HUWA 1W15A 2RQ8A 4L4JA 2J7HA 1PF3A 4JQIA 3OPZH 2X1PA 1UXWB 2V5KA 1DVFD 1MCIA 5IQ9B 5JORB 4A7VA 4HK0A 5KJRH 1ADSA 1QWGA 2YCLB 1CFTA 2R56H 3TCSA 5FEWA 3FFDA 2WHJA 2VE6B 2Q76B 3MLVL 1BVLB 2D31A 2DMGA 1S2AA 5CP7A 1A7PL 3GLCA 1Q6QA 1CN4A 1T99A 3AROA 4P2VA 1FUYA 1OQXA 5D1XD 3ESPA 4MGGA 4IIQC 3MDJA 1CR9L 1XLAA 3R06B 1D6VL 4KWUA 5AW6B 4P8QA 3EA3A 5F1IB 5T1MA 4MYPA 3TBWA 3PUDA 1CT5A 3F4DA 4A3YA 4WCYL 1QSVA 5FV1L 2ZVIA 4IOSA 4HG4K 2NNRA 3WFAA 3VCCA 1FGVH 1ZHLA 1ACCA 2ZA2A 4Q8BA 4WI0B 5ALBL 2UWEF 4G9DB 1Q94B 4BFOA 4AZIA 2F7OA 4MCYA 1QTPA 2QPEB 3HQOA 2AK4A 2B59B 5DJ2B 4MFEA 4WSJA 3FBQA 1F8MA 3I9PA 4ROQA 1QWUA 3DX8B 1AG0A 3ETBF 3IDJB 4LRTA 4BBWA 4B9PA 1VAHA 2J77A 1NM9A 1YC8A 1GYNA 4DQWA 4KDTC 1XCXA 1AW1A 3KPOA 3SQLA 1EBHA 1IGIH 4UQ9A 4Y9GA 3PTMA 3L1EA 3MBDA 4UTTC 4O51B 3PBVA 2W65B 2CHZA 1ZU8A 4Q0XL 4X9BA 3WMQA 4ZMGA 4JFQB 1J8HE 3AAMA 1YN7B 3PN8A 5BOJA 3H23A 4LAUA 2D03L 2P4AB 3ZYZA 3I75A 5TGBB 3C60D 4UR8A 1ZKAA 3NJVA 1UMYA 2LGNA 4AAJA 2Y23A 2QMJA 3MRDA 1E3ZA 1C3FA 1SBBA 4JDEB 4NDMB 3LLFA 1U8HA 4OVUA 3WKMH 2FTYA 5IFJA 4TTDD 1RUSA 3GC2A 5HPOA 3W1UA 4YNYA 3MNZA 1F58H 3TW7A 4YZWA 2DWEA 3KRSA 4Y5XB 3LZFL 1XQLA 3WJWA 5FEZA 1KGCE 1TPWA 2W9EL 3ANUA 4TV6A 1A1NB 3OXRB 2DUXA 5F7HA 5F7AA 5FFLA 4YCPA 2M83A 3VNMA 1EUUA 3C6SB 3TJ4A 3ZJAA 4O0KA 4JFWA 1MWAH 5I73C 5CSSA 3HFMH 4BQ3A 3W22A 2WMFA 3UF9A 4G5ZL 4YAQB 5C09B 4PMUA 3DXAD 4LLUB 2NR6A 3J27A 5M5DA 3MV01 1GPOH 5IOKA 1L6PA 1XM3A 3EA2A 1CL7H 3T55A 3B06A 3LPFA 3SPIA 3MO7A 5IJCC 2NT0A 2UZIH 4NPJA 5D2NE 5KSAD 4ICCX 1E8WA 5E5RB 4MZIA 2J1ZA 5I9QC 1E2WA 4MMYB 3L3DB 5JUVA 2BVPB 2QVMA 3W25A 1CDBA 4IMCA 3VFSB 1FFOA 3G1AA 1F90L 2MCMA 2E3VA 1E40A 2QUUA 2H9AA 3VZZA 1ZXKA 3MX0B 2W63A 4POZC 1RSYA 2EVJA 3SPGA 5C0EB 1P4CA 5BRPA 4HIHB 3VXSB 2OTPA 5KVGE 3MROB 2FECL 1WA1X 3BUTA 4D9LL 4OJFL 3FMGH 3NZSA 4HWEL 4E42A 3VWJD 4HJSA 4EMZA 4FHAA 2BVDA 1MJ7H 4NP4H 2WYTA 4LLDB 5T5NF 3HMWH 3I7SA 3BWAA 2GYSA 4BM7A 4K3ZA 1KZQA 4QGYA 4GUPB 3HMCA 4G1KA 4FB7A 5IB4A 4Q8NA 5TAOA 4ZL1A 2YD6A 1U8OB 4S3CA 3RHWK 4XAWL 4BQ6A 4MKVA 4QEHA 1PWMA 4ZSUA 3BGMB 3ARGD 4F2TA 3FOLA 1MNNA 2EUXA 3VZYA 3ULVE 1HYSC 1XJBA 4JHWL 3B3IB 2CO3A 3KYNA 1SGKA 4HS8H 2WQWA 1VBJA 4ELME 1NIDA 4KEMA 3K6NA 3MMDA 4MPQA 3UD6A 2YEVB 3BMVA 3NYKA 5D1ZB 3WL9A 2ZXEB 1RQ5A 2XN9B 5M17A 3FN0H 2AAVA 3JV5A 4NHUA 4GUOA 4L1HA 1N7ML 1OSPL 4MX7A 1J79A 2XRAH 3RVUC 5DC2A 3VXQA 4JN6A 4NZ1A 3SCWA 3IE9A 3FA3A 4XZBA 1KM2A 1M1XA 9PCYA 3NIDB 3DFSA 4XPBH 4HZ7A 4BQ4A 3BH9B 3ES6A 3NOIA 3B0PA 2EC9U 4KKQA 1MCFA 3EH2A 2A0NA 4C91A 2ZCLH 3C6LA 3IDIA 4IMLB 3VE9A 3DO4A 1I3RB 4HS3B 3TPUA 4RA0C 4X6DF 5HJ3A 4Z1BA 3OKDA 3ZE2B 2FJHB 4HGWA 3TS8A 4GK8A 3AHZA 2PWDA 3LCXA 3R19A 4KS0A 4HSCX 3UG3A 1F2XK 2F15A 3ABRA 1S5WA 1UA6H 4PCYA 4DP2X 1TIWA 5DJXB 1CTNA 1ZLSH 1DWIM 5FAAA 5CZJA 3IJ6A 3ARFD 3WTWA 2Y7NA 4BK9A 5J5DA 3KJ4C 2OLSA 2J1YA 3D39E 4RDQF 1WV2A 2D24A 2WSRA 4IIEA 3U0PA 1MF2H 1M6OA 2P1YA 2DTSA 2AZUA 3PWJB 4HWNA 5MKGA 5K9OB 1W3NA 4QHLA 5I74C 3CMOL 4TKWA 5HATA 4JZJC 3LTYA 3NGFA 4B9KC 4OIIH 1OY3B 5GZOA 3CL7A 1OY0A 5AUMA 3AS0A 1GTNA 2PP3A 2WBJC 1IKOP 4R9HA 2O56A 1T89C 4UNUA 3FKUS 4OCSH 1YEFH 4A3UA 1ZB5A 2ZZ1A 3HNTL 2AJYL 1U4FA 3SJVD 3ESNA 1YPXA 3J07A 1BEYL 1UJ3A 1IAMA 1SLXA 4MJ5A 2CZVA 4I3GA 1OG0A 1NLBL 2J7BA 2WZHA 4XP4L 1IAIM 2DH2A 3DA0A 1V79A 8PAZA 3VFGH 1FYHB 1NCUA 1VFUA 4E9YA 2X8RA 4P2RA 3V4BA 2VCAA 3O9WD 4AQ8A 4ODUB 4DH2A 3L4ZA 1U8QB 3V6ZA 5IW6B 4PMXA 1I8IA 1YA5A 4M4RA 5FKPB 4YTUA 3MR9B 4Z77A 1XF3B 3UBGA 4JGMA 5HQEA 4PJDB 3WFCL 2HFGH 4LF3A 2ZWYA 4LUSA 2GK1A 4S3KA 1S9VA 3ARDC 2G30A 3BD5A 3MQTA 1D7DA 1DLFL 3M6DA 1L6FA 3SKMB 1DN0B 1QRND 1O5QA 4YK4C 1DEEA 2P8PA 4UMAA 1NAKH 3FO2B 2PDFA 4NU7A 3AAZA 4F8LA 1TV3A 4B92A 3GUWA 4JFPA 2UXTA 4ODHL 3GTTA 4JJHA 4Z2GA 1JGLH 4R88A 4MKSA 5I76A 2PXYB 1VRSA 1MZZA 4URIA 1BD2A 2IH1A 2ITCB 1ONQA 2I9LB 4XX5A 2AXFA 1EFZA 2DLEA 2NLJB 3UIZA 2WMHA 2Y61A 3T8LA 4QLJA 2C9AA 4NERA 5C5YA 1I3VA 1JG9A 2QJDA 5FDYA 2EECA 2FBRA 2OJPA 2GEEA 4O0ZA 1T03H 5EF1A 3SY0B 3EGSB 3WLIA 1E7VA 2VR2A 1AIFA 3MKVA 3FO1B 4K5NA 5FEPA 1RZ7H 3UTZA 4EN3D 3HPJA 1JI2A 3UNDA 2FWLB 2DZSA 1PIIA 3BI9X 1CFSB 3TBTB 1N0LA 5E8PA 1CU4H 4K55A 1TTAA 1TF4A 1T2QL 5EIIG 3BW9A 1N6VA 4LAZA 5HDOA 3LMJH 1FNEA 1FNGB 4MM1A 1J8KA 1E8XA 1F4XH 1MNSA 2G95A 2YXGA 4XXDA 1JGMA 3OP2A 1UW9A 1RIVL 3OQRA 1RZGA 5D7LE 5FDWA 1G4MA 5D2NC 5GZNA 4HF5H 5I1LA 4JPSA 4B95C 3RVTD 4E0RB 3O3UN 2HS6A 2WMPA 4KK5D 1GQIA 5DHVA 3U4KA 5AB1A 3LS9A 5D70L 5E8NA 4B7IA 3OLGA 1H1YA 2KZWA 1UZGA 3IDGB 1W6WA 4YC2C 5F8QC 5BW6A 3KZ8A 2FZ9A 1QI3A 3MXVH 1UXWA 4OZIB 1OD7A 3US9A 5JORA 2NQHA 4X63A 1W8EA 4KNSA 3WKYA 5D55A 4I9AA 4FXKC 5F6HI 1BSLA 2IWFA 4I0PD 1CXHA 4HNVA 4KKNA 5HHME 4KQ4L 3T8MA 3FU3A 5KJ4A 4QRUB 2BXVA 2VE6A 1CDCA 4QE5A 2Q76A 4FALA 2BZDA 1BVLA 3WHXB 3P3YA 1XL6A 1U33A 1OC6A 4QDGA 3EXJA 1D8WA 3E5BA 5EO1B 1KMGA 3QUXB 3DOIA 1CE6B 4G8AC 5AVUB 3R06A 4KUZH 1Y6NR 5D8JH 5F1IA 1LO2L 3EPMA 3GSOB 1EJ8A 1B6DA 3W24A 3LHVA 3HC4H 4ZTPH 2F7IA 5KBNC 1XLLA 1KV5A 4KXDA 4F0SA 4WI0A 4D6EA 3WTSA 4OF8A 1F45A 3CIAA 4L05A 4NJIA 3MRMB 3FKRA 1QTSA 4L1DA 1XLMA 1Q94A 4QJ4B 1RBLA 3U2CA 3TTEA 4DAGL 2B59A 3DESA 2WM1A 2Z1VA 2VGBA 4UYPA 4DRSA 2VERA 5KSBF 3CTLA 3DX8A 3U7WL 1Z48A 4K9EL 2H90A 3GHUA 3N9KA 2VX7A 3FCUB 4XNAA 4M7KL 1MDRA 3SQRA 3QWQB 4QXVA 1C29A 3V5KB 4O51A 3LSOB 4JXCA 2ICEC 4MQTB 2BWGA 3QJVB 3G1HA 3GQFA 3LTVA 4UQIM 4U7MA 4JFQA 5PCYA 4X9SA 3ESMA 3RU8H 1CWVA 5HINA 3FN9A 3JV6B 1CLOL 1V3HA 4APXB 2C1IA 5MI0B 1OZQA 4U3CA 5TGBA 2NUPB 4Q56A 2MNWA 1OFAA 5CR1A 3CPRA 4XTIA 1F6YA 4X7SH 2JB6B 3I02A 2QV4A 3NQCA 1B5TA 4DP6X 4LU5H 2XIIA 2UX6A 4HEME 1V6XA 1MLBB 3EB4A 4JDEA 4NDMA 3AXMA 3V9CA 1JD7A 4PBVC 3VIJA 2MCAA 3BH8A 3AW5A 1LWIA 1XWYA 3ILQD 4IRZA 3ARTA 2APVA 2Q02A 1Z8AA 2DZAA 5L2KB 4CNOA 3JBG7 1FZMA 4CCDA 3EH1A 4BCXA 4RPPA 4MLJA 1Q9KB 2QCGA 3OXRA 3QIBC 2C3VA 2PYED 1A4CA 2Q5BA 5JQIB 2NY2B 4D8ZA 3Q5YA 1WFOA 4RMUA 1MWAB 3C6SA 1DJYA 1IKFL 1M7DB 4YDMA 5I26A 1CDUA 3RP1A 2KZ1B 3B1UA 2OP4H 1GJUA 4UIOA 1P6AB 3OL2A 3W75A 3Q2CA 2RHGA 2F8QA 4LDEB 5C09A 4D1JA 5B1JC 1MQ8A 5D09A 4R5XA 1EJUC 4LLUA 5LN4A 3MRIB 4GLRH 1EA9C 1WYJA 3BWZA 3VIPA 1N6QL 3KM8A 5HSFA 2MOVA 2VWEE 5XINA 4A8IA 2CK0H 4EBQL 3DGGB 3W7GA 5H2BB 3EH5B 2BSBA 3GDTA 5GJSH 5JHLL 1F4WL 2GJ6E 4NNYB 5AYTA 1PMYA 5H2ZA 4F5CE 4WI7A 1WKEA 4ZG1A 3FZUD 4IMAA 4FG6C 3UA4A 1RJYB 1KCRL 3IFNL 2IPUG 4MMYA 5DQDL 3L3DA 3AREC 3AXIA 2CLLA 2VDPH 2BVPA 1TMQA 1CFQB 3XIMA 1AQHA 3ZM8A 3D5HA 3VFSA 2AABH 1IC4L 2D7TH 3D30A 3DGCR 4QOKB 4QTIL 4RX4A 4M3PA 5ABEA 2BX7A 2PP7A 2CNCA 4IRJB 4M61B 3FA4A 2OMVB 2ADYA 3MROA 2XIOA 2OYLA 4I5UA 4KW2A 4HJ1A 4KKPA 4PUMA 2DOCA 4PMRA 5KOVC 4X9GA 2Q3AA 1DWHM 2CUIA 4AVJA 4TTGA 1W1B1 2JCCE 2YEQA 4LLDA 5CEYB 3PGDA 1QRQA 3FO0L 1QPPA 5B8CB 3HVDA 1BBDH 2EDLA 4MQXC 4LGSB 5IDZA 4TNFA 3NM1A 5JXAL 4WFEE 2F6XA 4PG2C 1U8OA 4W9JC 3SUVA 4PLJD 5TH2A 3VRIA 1KXTB 3CL6A 3BGMA 4KAQL 1M6JA 2QQ6A 4GUGA 1AS7A 1OFRA 4XKYB 3U2IA 3HG4A 4MKNA 1A3QA 2VMDA 1ND0B 1EJ6A 4LIQE 4XMUA 4KY2A 3NTCL 3B3IA 4D6CA 3T9WA 1LMIA 1ADQA 4BKNA 5HYJB 2VM4A 5J5EA 4U1MB 3DZ1A 3QW9A 1UUNA 5A2LH 3CVIH 3HBLA 5D1ZA 3GSMA 4Y7OC 2FZMA 2XN9A 3IS1X 4HHAB 4XE5B 3OKNB 5HBBA 2RDUA 4ZGYA 2ZX8A 1RD6A 3CFBA 3OWRA 4NQ1A 4PJ9B 2YCKX 5KN5A 1E5UI 2XTJB 5IF0B 5JPNB 3NG5A 4DGYH 4OLYL 1NELA 3UZJA 3U9WA 4F1SA 2J71A 3QW3A 4YXGA 2DQFB 3WQGA 3WIJA 4IMLA 1JRHL 3UR2A 2IQDA 3EYQC 1PG7W 4JL1A 2ITEA 1I3RA 2VSMB 3QORC 3RPTA 2E77A 2GTQA 5GPRA 4RWYL 5I6PA 2FJHA 4I1RA 2JKJA 5IHRA 1IB5A 4XO9A 1KFAL 2F68X 5EORH 5KS9B 4IRZL 3N73A 4YPJA 4MDJA 5A94A 5C7XH 2WK2A 1AS6A 5CN2A 2WLLB 2RDXA 4KK9D 4OGXH 1ME7A 3QA3B 3U2OA 3HG3A 4I77H 5D9PA 2WC3A 1KTDB 4M00A 2AFNA 4ZUSB 4Q14A 3Q48A 1ZCRA 3UQNA 3EDKA 3IFLL 3VA2C 3PWJA 5IWLA 5K9OA 1WIOA 4JO2L 1BM7A 1ASQA 2CJUL 2H6PA 4AE0A 4NN7B 1NQ6A 4RNRB 4WUUE 2XG5A 1NFAA 4J12A 4QBXA 1QFOA 2NXZD 2A6IB 3RJXA 4E9WA 2H4EA 4TPRL 1UFUA 1VGAA 4BZ1L 2R2BB 1X1ZA 3WN5B 1XSJA 3NQAA 4HD5A 5CJ5A 3MSPA 5KZCD 4HCGA 2F5BH 1Y7VA 5HMEA 4M9PA 4GINA 3O3DB 5DFVD 3IPWA 4ZZFA 1P5UB 4Q89A 3PV6B 2W67A 3A13A 3L65A 4ODUA 4HULB 4BUGA 7PAZA 2WYHA 1EJTC 1K5WA 5FKPA 3ET9F 3RGTA 5LIUX 3SBRA 1XF3A 1UWUA 1F8IA 3GTNA 4AJYV 1S3KL 3PBMA 4L2LA 1UXSB 1A14L 1FCGA 2QVTA 1LJYA 3UABA 3SKMA 1DN0A 1RI8A 4REQB 2OSYA 3P5YA 3IU4H 4J3OC 1FE8L 3PV7A 1BWLA 3MHFA 5D5MA 1YNYA 2HVNA 3BXNB 3ML8A 4WEBH 3FO2A 3LD5A 1T5WB 4QHRA 1K4GA 1NKGA 3ALWA 3VQ2C 4Q4OA 3U7YH 5C6MA 3M9YA 2DF3A 4Z6AT 4F0KA 3CUPB 2CWXA 4ODVH 1HZKA 2L3BA 2VQ1A 2PDLA 3H54A 2PXYA 3Q6GH 2P48B 4PY8I 2CA3A 2E75C 2Y1YA 2QJJA 1VJIA 1XLDA 4EKJA 2RFXB 4XNMA 2ITCA 2I9LA 3EOTL 1QTWA 3GDBA 2NLJA 1TQBC 1NPJA 4FNSA 1OAQL 5EV7A 2VX5A 4HIIB 1HZYA 1ADQL 4N4PA 3QFDB 1RVFH 1XCWA 3SY0A 3IDUA 4AXWB 4ODWB 4ZSTA 1D9KB 1K77A 1HQRB 3RFAA 4UNVA 2JFCA 3LK6A 1PJ9A 1BLNB 3F7VB 1CFNB 1DSWA 3LKNB 4G43B 3VM7A 4DVBA 3TBTA 3ZWSA 2OMTB 3TFKD 2P3ZA 1I2PA 3ARSA 3QKEA 5I5JA 2OQJA 3TWCH 2DM7A 1YTEA 1S9YB 1A6TB 4JPKL 1YAZA 4O2FA 1FNGA 2A38A 3SCRA 1UWIA 2CE6A 1UWQA 1JP5A 4KO5A 3RU6A 4QT5B 4HWZB 4J8QA 1F4HA 3T04D 1CK0H 2RFGA 3DUGA 1UXMA 2BMKB 2Q71A 2GKIA 3TYFB 1R7OA 1TO5A 3D3VE 5DJYA 3JZEA 7TAAA 1EMTL 4M7ZC 4E0RA 4UU9B 1X7QA 2X9ZA 5GS0L 3AXXA 1GGIL 3KOZA 5FYKD 4QD2E 4YHOL 4Q8PA 4LV9A 3GKWH 3SCMC 3IDGA 2R59A 7PTDA 1X5FA 3ORJA 4CJ1A 2YCEA 3S9YA 3RI5K 4LZKA 2XV0A 1YTDA 2KUTA 5KBLA 4N2NA 4HGMA 4D0BB 1JDDA 4MS8C 3OHMB 1NAML 2NXYC 2BGSA 3KOWA 2H0FA 4HXAL 4V2XA 3KVLA 4WI5A 2BSTB 4NSBA 4P2QE 1Q2SA 3PWLB 2X38A 3JYCA 1M05B 1TJHL 3P0VH 2ED6A 2E7HA 5E4AA 2FYMA 4X4KA 3UVAA 4NVTA 3MLUL 3WHXA 1TZHB 3A4EA 2BXZA 3BX7C 4H8WC 4S2SB 3E1F1 2QEZA 1BJ1J 1UOKA 5EO1A 2PPCA 1CE6A 1A5MC 1ME8A 4O18A 5EN3A 5I23A 1M2OA 3GSOA 3PZMA 1L6GA 1J96A 3OKYA 1IC7L 5EU6D 2FKPA 1AFVH 1Q90A 2IADB 1EP2A 3V4PA 1MDTA 5CGMA 1IGML 1IGCL 1NFIB 4MJIB 2X4UB 5LXXA 5IB1B 3CHSA 1WZAA 1F4AA 3SAZA 3MRMA 1KTCA 2GW5A 4J3VA 2W5FA 4ZBJA 3GIVB 3E3QE 5ESQB 3G5EA 4HPYL 1B54A 1NFGA 4XNZB 5B7ZA 1M68A 2HXAA 3QR0A 4HQQL 1ID5I 4JQVC 3UR7A 1HU8A 2JKSA 4CJ0A 1ZGLP 4GRWF 4UFIA 2HWZH 3PXJA 3M0KA 4PJGE 2G3JA 4LASH 4P9HC 4EN2A 4P5UA 5IJVB 4PHZA 4LSUL 4M1DL 5E51A 2DZTA 5FHBL 3N85L 2NQLA 2VLME 1N59B 3RGVB 2A9AA 4X22A 1PDZA 3NUKA 3GWJA 4AVIA 3AHVA 4APXA 2ACRA 1I9JL 1HE7A 4HBCL 2EG7A 1D3HA 5DD1H 3BQUB 4M6AA 5FI8A 5C0BD 2IEPA 4KZDL 4BFJA 5IB2A 3AMCA 4IX2A 3B7UX 5HDBF 5DY2A 4YSAA 5CGYD 1G7HB 2FWUA 2AGJH 1MLBA 1OP5H 3S1WA 1WV7T 2NY1D 4Z7VE 4HJFA 2WLZA 4K94L 3FTGB 3CFMA 3JR2A 4KRZA 2RAMA 2APSA 1JPST 5HGBB 2WZ5A 5DJAB 5CZSA 4KVNL 2BVUA 2P5EE 5CU5A 2GYIA 2Q8ZA 1JMXA 4N2OA 5JBDA 1U5JA 1UB6B 4EZJA 4GI9A 3O0RL 5TPWH 1OVDA 3FCBA 3PDDA 1T7WA 5DMKB 3JWNH 1Q9KA 2XX1A 1VLWA 4GP8B 3VWKC 1OD8A 1Z9OA 4ABVA 3U7VA 1TREA 2BP5M 1M7DA 3CUHA 4MLIA 1P7QB 5HK4A 3ABGA 3WYRA 2X0SA 1T5AA 2Y1ZA 3AQZA 3B3BA 3TJHD 2EEAA 3FQUB 1BG4A 3AIRA 2H3KA 4ICNA 3SBPA 5KAQG 3BE7A 3ATEA 4S3EA 1H3WM 1SDDB 4IH3A 4JQXA 5MP6H 3QHFH 4WF7A 2G60H 3BCFA 3OPZL 3DGGA 1CGSH 1K9TA 2N01B 5H2BA 4XMVA 4NZ8A 3HPFA 1WSST 4NNYA 5KJRL 2R56L 3TN4A 3U57A 3ERXA 1ZVYA 3BGAA 3CB8A 1RJYA 3B8TA 4FJZA 3B2UD 3P54A 4N2CA 2ZDSA 4JRLA 1JRHI 4ZSOE 2PO6A 4XXWA 5D2LE 4LXFA 3MUIA 4YGVB 1KM4A 3IGFA 1EDYA 3KVJA 1U30A 4QOKA 2E5CA 3CN1A 3TAOA 3R0MA 1OB1B 3QZPA 2G9KA 3BFWA 4PB4A 3QWOA 1OCJA 5DK2B 4IRJA 3RUGF 3II1A 1RH8A 2OMVA 3MVTA 1RHCA 3JS3A 5FC9A 4WFFE 1QNVA 4PJGA 3UTTE 4ROPA 1FGVL 5KBKA 5JPMB 2MCG1 3AT9A 4ZDHB 4AVHA 2NNXA 5CZXD 4FC3E 4GG8B 1AMKA 2IWEA 4OZHF 1W9BM 4O2EB 4CVUA 2WXNA 4CMMB 1U3HC 1I8MA 3B2VH 1KXTA 1FXQA 2JH2A 4MHHI 4ETYA 2BDNH 5C92A 1ND0A 1IGIL 1LXMA 5CUSH 4LUTB 4LUYA 2ZZ2A 1SSDA 2DQTH 1DTNA 3GW0A 3K8LA 3WMLA 2J8TA 5IGXH 1KXVC 5U7SA 4U1MA 1E9OB 1JFHA 4JPWH 3AHTA 4XVJH 5C2CA 3W37A 1H60A 3AIVA 4KXZI 4JS3A 1AR1C 4HHAA 3LUTA 2V69A 3OKNA 4DP5X 4IMKA 3ESVF 4Y9OA 3WAKA 2VN6A 5AW4B 5FX3A 4LEOB 5JPNA 3RPDA 5IF0A 2I32A 2X28A 2XTLA 2BERA 4DPAX 5LNSA 2XH4A 5B22A 5CLYA 1A4KB 1UH3A 1FIGH 3WKML 4AGMA 4BHUA 3LHAA 2VLKD 2GSGA 4MXVE 3PDOA 3DIPA 3DEQA 1F58L 2V5YA 1R86A 3W2MA 5KS9A 2HISA 1B88A 3Q8EA 2G3IA 1XSOA 2RA1A 1GQNA 4YVXA 2XZCH 2TRHA 1EJOH 5I3KA 3QA3A 1KBBA 3W6YA 5B38B 1VACB 3PUGA 2ARJQ 2JJVA 4CEUC 2RMNA 1HXMB 4ES9A 3NMEA 4DK6A 2G4EA 3PJTA 1MWAL 1P5BA 4AGNA 4EI6B 3TEYA 3SDXB 3HFML 4ZUSA 3BXWA 3MV8B 1YNTB 4JCLA 1J9QA 5CKSA 1FX6A 5HR6A 4MJJA 1XPGA 1POJA 5F4WA 5BJTA 6CGTA 1YYCA 2WQUA 4W70A 4ILSA 1GPOL 4A2EA 4RNRA 3ZR5A 1WFIA 4DPCX 2FAUA 5D1ZI 1CL7L 2A6IA 4YL9A 2NY5H 1TCRB 3OYXA 2UZIL 4I9XA 4XBPB 2R2BA 2WNZA 3IGSA 2HPOA 2ZOLB 3WN5A 3B2MA 3OZLA 1UKTA 2HVBA 3O8XB 2ZYRA 1FHNA 3EX1A 1BRLB 3SE4A 2AL2B 3E3QC 2Q86B 3O3DA 3G9AB 5L2JB 4RNHA 1N12A 4OR1A 2DLGA 2AK4E 5DMLA 3F03K 1MJUH 3PV6A 3DC8A 2E59A 4HNUA 4MD0B 5CZ0A 4L56A 4EKXA 1NBVH 1E6JH 1O5KA 4RKAA 2XFYA 3RZCC 3PY2A 5ES4B 4K3EH 2A99A 3O11B 2JQAA 4AEFA 3FMGL 1UXSA 2OMNA 2O26U 3K6IA 1TJMA 2G4GA 4LLAA 5LQBH 4JIIX 1X5AA 4REQA 1MJ7L 4NP4L 1JV2A 4O00A 3DBXB 4MDIA 4KEUA 1T5WA 4AKOA 4UFHA 5D2XA 4J35A 4GI8A 3LTPA 2TODA 3PZTA 3CUPA 1FWTA 4GKTA 1E4KC 4XP5H 3T1FB 1H1ZA 2KS0A 2BSRB 3W57A 4IHBA 3ZVHA 2W91A 4QG8A 1MHHA 3AZSA 2VC9A 4OZ4B 4DJDC 1MRQA 1H0GA 5IQNA 5IOPB 4MMZC 5DSCB 2OLAA 2P5WD 4HS8L 3FQXB 3G04B 4KFMA 2PKDA 1ZT4B 4HIIA 1PSKH 3CBRA 1OM0A 3KOFA 3SE9L 3HUJB 3MO4A 2NTSP 4HP5A 3T65B 1NWTA 2UWFA 3FN0L 2RDWA 1PWLA 4ENZA 4HWBH 2IAND 3OB0K 1YEYA 1O95A 2XRAL 4ODWA 1D9KA 1HQRA 4K1GA 3GZAA 1EZLA 3F7VA 4LSRH 1ZTXE 2EH8H 4ASTA 4XPBL 1CFNA 5IBUG 3AU1B 3LKNA 4G43A 5DJZB 1EYWA 8CGTA 1MFBH 3VW3H 3W76A 3AT0A 3L45A 1EF2A 2OMTA 2ZCLL 3P9WB 4KWVA 2DBJA 1OP3H 2PR9A 4IMFA 1SO5A 4FNUA 3HO8A 2XBZA 1S9YA 4UAHA 1KSRA 3GS7A 1A6TA 3SBQA 2D3NA 4KK6D 2IBGA 3MCKA 3NYZA 3NO5A 3CWNA 5FGCB 4QT5A 4HWZA 4OZFH 1RZIA 5I19H 2BMKA 3TYFA 1FFRA 1UA6L 1A9EB 4ZE4A 3ARXA 1ZLSL 4UU9A 1BD0A 3T6QC 1A7BA 2WAQA 1LDSA 3F7RA 4H7ZA 2A74C 1TMLA 2JKIS 2CZ5A 2AZAA 5LG1A 3WQOA 3QWRD 4Q7BA 1MF2L 1S4IA 3BP5A 4YHNB 2Y8KA 1ZAJA 4X5PA 1UQZA 2GJNA 2DVUA 4DEFA 1MIEH 2ESCA 1C8QA 2WLIA 4UQ2B 1XYLA 4OIIL 5JNYA 3AHYA 3PJSA 4S39A 1UUQA 2BSTA 5FFGA 1BECA 4OCSL 1YEFL 3GDRA 4WTZA 1TV7A 4HJUA 3II3A 2HROA 3DH7A 2E68A 3PWLA 5KSVB 2CPCA 3ME0B 3FAWA 5JBEA 3PUCA 1H7XA 4L6HA 5DK3A 1TZHA 1AKJB 1JHTA 3LQLA 4S2SA 4M8VA 3P02A 3VFGL 1SLVA 4U6HB 4HUUA 3SDAC 1WFTA 1D5RA 5CZVH 4ERIA 4JG9A 4ORGB 1F1AA 3TIEB 2FO4A 3S98A 3HTWA 1OTUC 3V0SA 3SDDA 3SJNA 3M44A 1QPXA 3BZFB 1Q6OA 2LU7A 4PJEA 3DHPA 1WWWX 4UOZA 4HMEA 2VKWA 1NFIA 4MJIA 2X4UA 1UWFA 2HFGL 3TO4B 3W53A 2QPDB 4MA1C 4XODA 2CIPA 1C16B 1BEXA 3WD4A 3HE7B 3KWSA 4OI7A 3R8RA 2VW6A 4X6CF 5F89B 3GIVA 4MY1A 3W9DB 2ICCA 2CKRA 5ESQA 4AY8A 1SF3A 1I3GH 2WVTA 1NAKL 4MA3B 2Z29A 2ZRYA 3K0WA 3R12A 2WCGA 1OQOA 3M8OH 4AD5A 1ISZA 4E6MA 3GDLA 2NW2B 5IJVA 1K8YA 5EBUA 3CU7A 5JTWA 1ZHKB 2I5QA 1JGLL 5I5MA 1HQ4B 3EDEA 2BB0A 5C07B 4QRNA 3GXIA 4WV1A 3W1LA 1BHGA 2ZAIA 1N59A 3OJVC 2O5YH 2D69A 2ZT9C 4GS7C 4GY7A 3TZVC 4WY0A 3WQ5A 4NG3A 4UTWC 1RY8A 4WGXA 2FJSA 3RM4A 2YMXH 4QS5A 4FFVC 3CSTA 5AOMA 4B9IA 4M6QA 1NPUA 3TAKA 3N2JA 1AI1H 1V6WA 4CSZA 3ILPB 1EANA 3QM3A 1T03L 4JFFA 1KXHA 2W88A 1WFUA 2A3CA 1MQPA 4B4FA 2QQNH 1G7HA 3UXAA 2XY1A 1CLCA 1QFHA 1RZ7L 3NL3A 2D9CA 4Y2WA 1U8NA 3FTGA 4KWSA 1ZAHA 1LP9B 5HGBA 2NZ1A 5DJAA 1CU4L 5BMWA 1D5IH 1HUVA 3RN6A 4IJBA 1I8UA 3H1ZA 1QLRA 1UB6A 5EF0A 2XM1A 4DKAA 4WHYG 4I7VA 3N0PB 2F6UA 2P45B 3PWPD 3LMJL 4ANWA 4CNTA 3FH7A 1F4XL 4NZ4A 1KPRB 4Q6YA 4AZUA 3MN8A 1UOWA 3ZRSA 1G4SA 4M1RA 3QQ0A 1E4HA 3I9GH 4HF5L 4B16A 4GJTB 4ZXLA 1XH0A 4IYKA 4HA1A 2ISWA 3IVSA 3VG9B 5EKYA 1SFJA 2HCZX 3ARVA 3FQUA 2ENYA 2NY4D 4FTVA 2VDMH 1AD0A 4AQ1B 2W6RA 2F8VA 3GFYA 4P2RE 1JZ7A 1VHPA 4P57A 1EEZB 1GZGA 4N86A 4L37B 3MXVL 2XFRA 1NQBA 4WO4B 4W9ZA 3S5ZA 4PYGA 1SN5A 2Z4TA 4ZOAA 3ABMB 3IIXA 3AIQA 5LIWX 1BVKB 2C3WA 1MG2C 5GSVA 1SW0A 2VKZG 1HI6A 3D7PA 4LARH 3AS3A 3CZJA 1J93A 3QAZC 2YPVL 2AQTA 3CK0H 1KCSH 4LHUB 1MEXH 3CNKA 4Z2KA 4YGVA 2QCFA 3PJUA 3CH1A 1ZA6B 1FHLA 3A5FA 1DLHB 1OB1A 4KUZL 1Q6GA 5D8JL 4NL1A 4KKAD 2V30A 5F9OH 3SE9H 2OR9H 5DXYA 3BT2H 3HC4L 4ZTPL 2CLRB 5FF3A 5JPMA 4F2BA 3L5LA 5I1HH 4ZDHA 5KVEH 2ACUA 1KLZA 4YEEA 4GH1A 4AH2B 1BD2E 4S1DC 1Q5MA 5A6IA 3N4EA 4XIAA 2K6ZA 5D9OA 2IQTA 1AHKA 2P0OA 4M8RA 4RISH 1F73A 3KGUA 1NTDA 5I1IH 2EPKX 3RIFF 4AYFB 3B8SA 4YZFE 1FAIH 3DOSB 4HYWA 3CN3A 3PP4H 3UAJD 3DV4B 3EO0B 5CP3H 4LUTA 5HI5C 2WUCH 1PZDA 1R46A 2DMCA 4Z0JA 2F18A 4HJJH 3GO2A 1X98A 5HYSB 1HHIB 1E9OA 5EC1B 3RU8L 3QYSA 1YDYA 1U58B 2KC0A 2QDVA 3UTSD 2RR3A 3ZKMC 1TJXA 4IHCA 4FFWD 2Y6SC 4CLMA 1NWPA 1LLOA 3V0FA 5LZLA 4EAEA 4BFKA 2GTZB 1AGFB 1NAMB 1ZMYA 3UA3A 2R14A 4M3KB 4U6YB 4X7SL 4LEOA 1P7HL 3H9SB 3V5CA 1NBYA 4PWKA 4LU5L 4HOXA 1JYNA 2WHVA 2EVIA 4M5PA 1A4KA 4FYTA 1SFHA 4U05A 2FZDA 4TVUA 3NSMA 1MH5A 3ISRA 4O58H 4ZRGA 2JKPA 4MHHG 4H3DA 3U2SA 4GRMA 1J5SA 3BEVB 3JV4B 2F8IA 3BGFB 1Q3NA 3S46A 3HN5A 5M03A 4KI5F 4C6DA 2VDKH 4ZUUB 4R96B 4U1IB 5B38A 2IXQB 5INCB 1VACA 3C09C 2F5AH 4LAJH 5C7VA 3RCYA 3IJLA 4CD6A 4WTWA 1HXMA 4WI6A 2ZBTA 2AV1B 4U10A 4JTLA 2UY7B 2CR0A 2A2QT 4EI6A 3SDXA 4AQOA 4L8CB 3U5YA 3IGAB 1D3CA 2OP4L 3MJ7B 1YNTA 4CQCA 1VFAA 3ECVA 1UZ8B 1R3KB 4DJEA 3TWAA 4IM8A 1G6CA 4OM0H 5BZXA 2SODB 2CK0L 2OMYB 2P76A 2AQ2A 1E6SM 2MOGA 5GJSL 4XNDA 4BQ8A 1TCRA 4XX1G 3ELAT 4XBPA 5F7KC 2ZOLA 4KI5D 1RY7B 4YBHA 2VZSA 3O8XA 1R6WA 3DVNA 3RCMA 2YYUA 5CD5C 4I3RH 2VDPL 3NP4A 2AL2A 1HCZA 1BZ7B 1ZGLB 4N2DA 4XE0A 1O9VA 5L2JA 1K8XA 4JTEA 2EDJA 2AABL 4RMWA 2ZZ7A 2D7TL 4BHUI 3MA9H 3QHTC 3ZHNA 1VJZA 1JZDC 1QK0A 3NIGE 1T0MB 2VJ8A 1VKXA 1TO3A 1SXCA 4OHQA 1YRRA 4OJDH 3QQWA 1QNRA 3P11H 2QCHA 2O55A 4RE2A 2BSED 5FYKU 4IQDA 2HRWA 2JV6A 2X89A 2OU4A 4D7PA 2IV9A 1HTIA 3BPLB 1I85A 2WTRB 1MPAH 3WDRA 1WFMA 3G1YA 5BXPA 5FPIA 2NY3B 5JDJA 2P1FA 3GPSA 1JF5A 1BBDL 3FQRA 1I82A 2HT3D 4K8GA 3M0IA 4W9HC 4A2LA 5F1NA 3TDFA 5I75B 4TMPA 2PGFA 5FO7A 1YDOA 2VDIA 3T1FA 2BSRA 3W7KA 4EIUA 3B5TA 3ZU8A 3SO7A 3PABB 3MLYH 1S2EA 5JXEA 4OCLC 1GVEA 4K7YA 4FYSA 2BFVH 4JANB 3F6JA 4A7GF 2IKIA 1ETZA 1I75A 3ZWTA 5IOPA 2X1TA 5DSCA 4PL1A 2VFIA 3FQXA 3G04A 1BQLH 3W2KA 1ZT4A 4ZB5A 3CVIL 2GBAA 3HUJA 1RIHH 4HW6A 3T65A 2V9QA 4DJFA 4RETB 1H51A 3R7MA 2UXGA 1KLYA 5GZOC 4XO3A 4EI0A 4FQCH 1OGPA 4YTQA 3BJTA 3Q0HA 5JHLA 4P2OD 3UYIA 4XP6H 2A6KB 4DB7A 3OBEA 3GR8A 5DJZA 4DGYL 5IQ9A 1TLMA 1T1WB 1OB0A 1UJ3C 2YCLA 2KYIA 2OT1A 5GIRB 5AAWA 5HHPB 3HPSA 2VZVA 1DJQA 2FYVA 3CUXA 5C09E 2FH6A 4OZFB 3LQAC 2YPVH 2WXLA 3T3PF 3SZ8A 3GMMB 5EORL 4AQ8C 4L64A 2M1KA 2WKOA 1V7AA 3BVVA 5C7XL 3CWGA 1N9PA 1A9EA 5JZ7C 3GR7A 4OGXL 1W2PA 1QASA 5EUOF 2QPFA 3MTXA 4Y4HD 3PPCA 1RCXB 4I77L 2EC9T 2GLKA 3WQ6A 5K1VA 5JUEH 4UTFA 4XZMX 5K93A 1QBMH 4Y9CA 4WW2B 5H91A 1V0KA 4YHNA 3N6YA 3ULVC 4YDZA 4DETA 4LOCA 3NIYA 2VXVH 1W9XA 1NF7A 1DQIA 4PS4H 4G9DA 1KN4H 1T8XA 3P62A 4R27A 1E4NA 4NZCA 3ZDYB 2AC0A 3W0WD 1TVDA 5DJ2A 3U6XS 3QUYB 2P53A 3IDJA 4FRWA 4QSFA 4TV3A 2IKJA 2R1KA 2XV3A 3ME0A 4PL2A 3VFPB 1AACA 4UOW0 1TQUA 4XX1E 3HV8A 1IIHA 4JKPH 4LCSA 2F5BL 1UH2A 3QDGB 2W65A 4U6HA 3VFOB 4O1AA 2B5IB 5LXVA 4O8AA 4F7CB 3BVJA 1IARB 4ORGA 3TIEA 1JAKA 1YN7A 1E6XM 5BRZB 3S1GA 3SCNA 2BOFX 3M46A 1B0IA 2OV0A 2WXHA 1JZ8A 4U4BA 5IVXB 2R1NA 3LM7A 1ECEA 3TO4A 4C56D 5AYBA 1Q6RA 3HE7A 4A66A 1UWTA 4JIEA 2R0ZH 2QPUA 1QI4A 1T7YA 2FECI 2R9HD 4WEEA 5BMFH 3O4LD 3IU4L 2B2XL 1TEGA 3P3BA 3I84A 4WEBL 3M86A 4ZO6A 4RW3A 4A2SA 4MA3A 3T4CA 2XN9E 4ABUA 2NCEA 1P0NA 3DUSB 3X1BA 5I78A 3U7YL 3M4HA 4Y4FD 2NX5B 2NW2A 2Z1PA 4HIEB 2Y7FA 4ODVL 5AHNA 1RLWA 1OWWA 4Y5XA 1J5TA 5GZNC 2PFHA 3FHQA 2GGJA 1YC7A 1UP3A 1HQ4A 4GO8A 3Q6GL 2E86A 2ZX9A 3NIDE 1HHKB 3CHXA 1Q7ZA