2YIHA

Structure of a paenibacillus polymyxa xyloglucanase from gh family 44 with xyloglucan
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
511
structure length
511
Chain Sequence
KTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDWQHSSDNYLCSNGGLTQAECEKPGAVVTSFHDQSLKLGTYSLVTLPMAGYVAADGNGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVKGYALDNEPALWSHTHPRIHPEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYKDLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETKKARMQAPRTLWDPTYKEDSWIAQWFSEFLPILPRLKQSVDKYYPGTKLAMTSYSYGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGDTSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGFDKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Activity of Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords CEL44C
total genus 178
structure length 511
sequence length 511
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12891 Glyco_hydro_44 Glycoside hydrolase family 44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2yihA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yihA02
1PJ9A 1GOQA 4Z2HA 1B31A 4J28A 5I6SA 3EMZA 3QHOA 1IZJA 2WMGA 2D0FA 3J7HA 4AIUA 5ABHA 2BHZA 2VRJA 4PTVA 4NZCA 2PB1A 2PI6A 2YFOA 5BRQA 4GZJA 4JCLA 4JKLA 4NXSA 4AMXA 1R46A 4W7VA 4AEEA 4KGJA 4HU0A 3VMPA 3TTQA 5JUVA 5GNXA 2V3EA 2CKRA 3CC1A 1FOBA 5DT7A 1QNOA 4PSRA 1C92A 2F7RA 1S46A 1J11A 4PUDA 5DEZA 1G94A 5D9NA 3T09A 1D3CA 4UCFA 4AZ6A 4LGXA 2DSVA 3VGFA 3K4DA 3RJXA 3VIIA 3AOFA 2UY4A 2GJPA 4ATLA 4W89A 4XZBA 3WN6A 4K68A 2XWDA 4CCEA 4ZXOA 1W1VA 4MPKA 3WD1A 3AIRA 3VGEA 3WFLA 4FLRA 1B1YA 1HP5A 1TFVA 4F9DA 2CPUA 3AISA 2D0GA 2NSXA 1V6VA 5AYIA 2G3NA 2VRQA 4M81A 3CLWA 1O7AA 3AIEA 2VX6A 3AFBA 2V38A 1MVYA 1KXHA 1QI3A 1XH1A 3KLLA 2VX7A 2XGBA 3BH4A 5ABFB 4NZJA 4PTWA 4UR9A 2O9PA 1VFMA 5FKYA 1H11A 1E56A 1SMAA 5I2UA 4DUVA 4PCTA 2CIPA 3MU7A 3WSUA 3HMCA 3W24A 5GNYA 1E4NA 5D9MA 3LPPA 2ZX5A 1SYTA 1J9YA 2DEPA 1C7TA 1TE1A 1EHAA 3WDRA 4C7DA 4BQ2A 2Y5EA 3AIWA 3VILA 3BLBA 1M04A 5GQBA 2VZTA 4X9YA 1GW1A 2BY2A 2J75A 1M01A 2DPEA 4W86A 1US3A 1J0JA 4HMCA 1PEZA 4KRUA 7TAAA 2VRKA 1EGZA 1TR1A 1HL9A 4W7UA 1HTYA 4XUYA 1UHVA 4TVDA 4JFTA 4ZFMA 3T08A 3ZJ6A 2IXVA 3WBEA 1WZLA 1KFWA 5E09A 1X1NA 1HNYA 3ARSA 3CBWA 4HA4A 1DHKA 1JZ7A 3BSHA 3GDBA 4TX6A 4D6GA 1V3IA 3L4TA 3K46A 4Z2JA 1DP0A 1W9XA 3WQ8A 1QHPA 4ZXLA 1ECEA 2YIHA 1QHZA 1H4PA 4QP0A 1KQYA 3VVGA 4ZEPA 3BUDA 4YPJA 4H8VA 4V2XA 3W29A 1HJXA 2WHKA 4OOZA 4EAMA 1GPFA 2J74A 3N17A 1CYGA 4E8CA 2VI0A 2DT1A 4KRTA 3AMGA 4J3VA 1OGGA 4FNSA 1VJZA 1OIFA 3BAYA 3MUZ1 1HKIA 1OB0A 5E1QA 1CLXA 1QX1A 1PX8A 1QPKA 4GI9A 4A4AA 1C90A 2YOCA 2XIIA 1H3GA 2EPLX 3AJ7A 4HZ6A 4Q7NA 1LG1A 3KLKA 2YL8A 3VX0A 4EK7A 5BYWA 1E6QM 2DSZA 1UOKA 4UQCA 3WEZA 4JFUA 3ZOAA 3NYDA 4PYSA 1K9DA 1TQTA 1CWYA 4KWUA 3VD5A 2X2HA 3RILA 4AISA 1EHNA 3PZUA 2W4XA 3PZMA 3QOMA 1MFVA 1XCXA 2XTKA 4H2CA 3VGDA 3GTNA 1UZ4A 1BG9A 3CZKA 1HJWA 4AD1A 4QCEA 1E4MM 1JAEA 3AIUA 4OUEA 8A3HA 3ARYA 2WNWA 2VCCA 2WC3A 3WQWA 1U33A 1WZKA 4M56A 1HX0A 2W62A 3D52A 3CUGA 4PMUA 1BHGA 4FNRA 3RM9A 4TTUA 1KXTA 2WKLA 4N42A 4GIAA 4CD4A 1UKPA 1N82A 3B9AA 3VOCA 3W25A 3BAJA 2J78A 1W32A 2ZX8A 2ZX6A 3QR3A 4FLQA 5I78A 4J27A 3EYPA 2CNCA 3RJYA 1GUVA 4PMYA 1EDQA 5A1AA 1ISXA 3PTKA 3JUGA 5HPOA 3MSDA 4MAVA 3DDFA 4MAZA 3VGHA 3ARVA 4QLJA 3MI6A 3MUAA 3FNDA 2OW6A 1OWQA 5LA1A 4FF5A 1ISVA 1CZ1A 4MNLA 3BUIA 2J7BA 1HP4A 1YHTA 3HN3A 4UQDA 1E6ZA 3CMGA 1LLOA 1LQ0A 1FP8A 1F4AA 5D8ZA 3VUPA 4OBRA 3VGGA 3BAWA 5BXTA 3T0DA 1L8NA 1LL6A 2Z1SA 4AZCB 1AMYA 2BHUA 4ACYA 1W1YA 4CUCA 2ESCA 2X0HA 2D0HA 2XFFA 4AD3A 4PUEA 1CTNA 2WSKA 2G8ZA 3GH7A 1UA3A 2XSAA 2WZHA 2CETA 2WHJA 3ARTA 3WQ5A 1AVAA 3WF3A 1XD0A 1EO7A 1B3ZA 3AI0A 3NUKA 3UEQA 4AD2A 2ZUVA 2CCRA 3ZT7A 3L4XA 1E73M 2WMFA 2EQDA 1VRXA 2PWEA 2X2JA 1PIGA 5IXEA 1QNQA 3II1A 3WQ6A 3IK2A 4L4OA 2WSPA 1J18A 1OGBA 4DUWA 3HG3A 1CGTA 1WDPA 1CECA 1PAMA 1V3KA 3IAPA 5DFAA 3RIKA 5HNNA 1EXPA 2J7DA 1J01A 4HP5A 2DH3A 3WD4A 2XSBA 1OIMA 2CHNA 3VPLA 2ZXDA 1ZB5A 3F5KA 3FHAA 4UNIA 1RPKA 1DWFM 1H0GA 1WDRA 1V3HA 1WP6A 3VIKA 1W9UA 5A8PA 2ZOXA 5M17A 4P7LA 3SCRA 4JL1A 1AQ0A 3RM4A 3W38A 3PZGA 5DMYA 1KWKA 1SR0A 5E6YA 1QWNA 2JEQA 3AMDA 4P7OA 4UOQA 3ZJKA 4OKDA 1KBBA 1TVNA 1B2YA 1H09A 1Q6EA 5CPSA 1WDSA 3AXHA 2E3ZA 4ML4A 4WLCA 3LX9A 4QDMA 1UKOA 4PTXA 4J3XA 2DT2A 3N18A 2E4TA 2WMKA 2X2YA 1JI2A 1BVZA 5ABEA 3VIOA 2VOTA 4LPCA 3LPOA 3MMDA 1MXGA 1E15A 4MJ4A 3MV11 3A4WA 3UETA 2CYGA 2DIEA 4OZOA 4TVCA 4GI8A 4AC1X 3N9KA 4GQRA 3FW6A 3AIVA 3ARPA 4LQ1A 2BVYA 6A3HA 2A3AA 5E9AA 1JG9A 2J4GA 3W6MA 4EKJA 4S3JA 1CEOA 3BLPX 3GNOA 1IV8A 1UWIA 1GOWA 2CBJA 2IXUA 1LJYA 2WM0A 1WZAA 3HG5A 1J0ZA 2NT1A 2OSXA 1C3FA 1Q6CA 1J0IA 1E6XM 1MFUA 2EEXA 2Z1KA 2OWCA 1PS3A 3NCOA 3MO4A 2HISA 1M7XA 2C7FA 3AYSA 1UWRA 4J7RA 2VQUA 3CIVA 2VL4A 2JIEA 2WKGA 1RH9A 4AZ7A 1Y7VA 1CNVA 1AQMA 4PCSA 3OZPA 1FFQA 3D4ZA 5A69A 4FNTA 1KR1A 3KL5A 4X0NA 2ZUSA 2J8FA 4QLKA 5EMYA 5IHSA 3L4ZA 3VMNA 1C8XA 3WDPP 5CSUA 5C8BB 2ZUNA 5GNZA 4B9YA 3UG4A 4MNMA 2WZEA 3BC9A 4U31A 3MMWA 4ZENA 4PSPA 1TQSA 2PF0A 3W81A 3MKKA 3D4YA 2D24A 2VURA 3WMBA 3CZSA 5FL1A 2TAAA 3WD0A 1US2A 3QOKA 4JKMA 1UG6A 3M46A 4UFLA 3SCUA 4D1JA 2YDRA 4WSKA 5CGTA 4DWSD 5IFPA 1EQCA 2XN1A 4IISA 1UR2A 3WNMA 5BXSA 2J7HA 3WIJA 3VD9A 3HG4A 4WKFA 2VR5A 1E6PA 3CHEA 4M1RA 1BYBA 4BS0A 3W4RA 4B16A 4FMVA 5JBEA 2E8ZA 2XIBA 4RE3A 1R7OA 4OBSA 4HMEA 1CXFA 4EE9A 4AXNA 2XN2A 3WL0A 2OYMA 2F7QA 2X2IA 3FXYA 2WLYA 4JZ5A 5HBFA 9CGTA 3K4AA 4FLOA 4B3LA 3THDA 1KWGA 1UD4A 2JALA 2C8NA 1R7AA 5FL0A 4WKAA 3A6OA 5EFDA 3DX0A 2QMKA 2CBIA 3AZTA 2OSWA 3SUWA 4DO4A 4WSJA 1E0VA 4W7WA 1HKJA 1R47A 3WDHA 2IUZA 1E9LA 2E0PA 3QHMA 5A6AA 3NIYA 1MW0A 1I1XA 1CXHA 1QNSA 3ARRA 5CPTA 2V3DA 1O6IA 2XVKA 4PEEA 1NWUA 3S5YA 1GCYA 2G3MA 1ZL1A 1LF1A 3PZVA 2J77A 1JI1A 3A21A 2YBTA 1UR1A 2QPUA 4HPHA 4IM4A 3RO8A 1E6NA 1GONA 1NOUA 2PBGA 1PZ3A 4Y7EA 1HJUA 5EFFA 3ZO9A 1CGUA 4UZSA 3NSXA 3WENA 2YJQA 2WC7A 3VNZA 2DDXA 3VM5A 1WB0A 4BQ3A 2F7PA 2BHYA 2Y24A 1WNOA 4CN4A 2EBNA 2VR4A 4GKLA 1R86A 2J7FA 3QHNA 1RD6A 1OBAA 4UFIA 1QNRA 1R75A 1ZBVA 3L4UA 3FY1A 1UZ1A 4AYSA 3POHA 1LL7A 3L2LA 3AMLA 3K1DA 4J3UA 2WVUA 1UWUA 2VJXA 3ALGA 3AZSA 1BLIA 5C71A 2CITA 3B9EA 2XVPA 1RP9A 5A6JA 1ISYA 3GZAA 3DYPA 4F9JA 1HL8A 3UG3A 1TA3A 1W3KA 3AHXA 3SUUA 1JGIA 3U7VA 1V0KA 2X05A 3ZM8A 3K8LA 2WC4A 3NSNA 4PMVA 1B3XA 2GDVA 4DWSA 2ZWYA 1DWJM 1W9BM 1NP0A 1JZ5A 4H7VA 3TV8A 3UR8A 3A24A 4D6JA 2WB5A 2Y4SA 1VEMA 1R85A 5D9OA 3VIHA 2F1AA 1E72M 1UYQA 2VVSA 2W5FA 5EBAA 4WK9A 3O6AA 2DSWA 2EACA 1UH4A 2ZUUA 1HF6A 3A5VA 1XC6A 3FHQA 2VNCA 4TVUA 5TD4A 1A3HA 1UASA 3W53A 3AHTA 3LRLA 1EA9C 4E8DA 1UD6A 1MQPA 1VJSA 3ZR5A 3KL3A 1B3VA 4PBGA 2W63A 2BY1A 2UWFA 1KGWA 3VU2A 3EJRA 3OZOA 2EPNA 4TX8A 3S5ZA 1WZMA 4P8VA 1XYZA 3CGTA 4JIEA 4MDOA 1C91A 4BQ4A 3VSVA 2BNJA 1G9HA 2J7GA 3RM8A 2WCSA 3MV01 4U33A 3WL1A 1V0LA 1H49A 2VZVA 3BMVA 1BF2A 5A2AA 3BMWA 1EOMA 4XX6A 2WHMA 3ALFA 3GBDA 2AAAA 4IUGA 3ZIZA 2X1IA 1ZS2A 2XGIA 4M80A 3WDIA 2QHAA 1G01A 3L4WA 2YKKA 2A3CA 4RL3A 2WLZA 3W0KA 5E70A 3WMSA 2EABA 4ZE4A 2W91A 3O9NA 1FH8A 4MNJA 5A94A 4P7RA 2Y8VA 4Z2GA 4TTGA 1UD8A 3DX2A 3WUEA 3WF4A 1KCKA 3A4AA 2BY3A 3GM8A 2W61A 3WMCA 1O7DC 3WNPA 4NZFA 1YQ2A 1EOKA 1CXEA 1GOOA 1LWJA 3D5HA 4AW7A 3N04A 3W26A 1T0OA 2XVGA 1GQKA 3OGSA 3KL0A 3AZRA 3MSGA 4E4PA 3TTYA 5D9PA 2JE8A 1GQLA 5I3DA 1MQRA 1ZBKA 2J7EA 3CZNA 2VMFA 2QMJA 2WVVB 4GO9A 4OGZA 4AZBA 3D51A 4A3HA 3OIHA 3LXBA 3VINA 2XFRA 3WH7A 3W37A 2D2OA 4GXPA 3RMEA 3RPMA 1BTCA 2XM1A 4PMXA 3WQVA 3OA5A 3PZOA 5IDIA 1B3WA 1UD3A 1QI0A 3L2MA 2JIWA 3VTRA 3GXMA 5BRPA 4UFKA 3ARUA 3L4VA 3GXTA 1UQZA 3ZQ9A 3VIGA 3UERA 1QI4A 2GJXA 3LRMA 5CSYA 5I77A 5CXPA 2RGMA 3SCWA 1V3JA 3U5YA 3WDQA 3B9DA 3T2OA 1GHSA 5BXPA 1MW1A 2G4FA 1B9ZA 1LG2A 3BXWA 1QI5A 2YL6A 1MQQA 3WELA 1PIFA 3A22A 3WY3A 2A3BA 1KGXA 1C93A 4CVUA 2Q8XA 2VVNA 4ZE5A 2QV4A 1K9EA 2WCGA 3WY2A 2BXYA 3ZR6A 1OT1A 3WF2A 1V6XA 3T2PA 5A95A 3M7SA 1HXJA 3CZEA 4AD4A 3GH5A 3K8MA 4B9ZA 4GINA 4PMZA 1QI2A 1KBKA 5C70A 1UR8A 2WBGA 3CHDA 2BS9A 4UQEA 3LPFA 3SCVA 4CD5A 2UY3A 1LL4A 2YDSA 4WIWA 2XN0A 4GQQA 1DWGM 3CV5A 2HVMA 4CVWA 3BVVA 4HU8A 4Q22A 2WVTA 3UG5A 1TQWA 4UQAA 5M03A 3D50A 4U3CA 1TA3B 1JZ6A 3BCFA 2O9OA 1FHDA 4P8UA 3WD2A 3W28A 2ZUMA 4AIEA 1G1YA 1VBUA 4UTFA 1XH0A 3IJ8A 3SEPA 1E0WA 3T2QA 2BV9A 3ARXA 2WK2A 3WEOA 4URIA 2DT0A 5DF0A 3OLIA 2BXZA 3BAKA 1CXIA 1TUXA 1VAHA 5AC5A 5A6SA 4CU7A 3MANA 2D3LA 4BZYA 2DGAA 2JF6A 3GNRA 3AICA 1ESWA 5A6LA 1EDGA 1MW2A 2ZX7A 1KXQA 1JXKA 3DX1A 1E71M 2ZXQA 1WCGA 3APGA 1QBBA 3VDHA 3F5LA 3VNYA 1PZ2A 1GNXA 2D22A 1GJUA 3G6MA 1BSIA 1U2YA 5CJ5A 3VX1A 1R33A 3EDDA 3BUBA 1IT0A 4UZUA 2YA2A 4NI3A 2WMIB 4MB1A 2J47A 4LYQA 1A47A 2PWHA 1Q6FA 2XPKA 4MB5A 3CMJA 4CGTA 1KTCA 5A6BD 1UD5A 2CEQA 2WMIA 2D20A 2ALWA 4UFHA 4D6HA 1HN1A 5LA2A 5M5DA 1ZJAA 4ACZB 1CXLA 3WUBA 4R27A 5AYBA 3IAQA 4WJXA 3GBEA 1V3LA 3TP4A 4F79A 1XSJA 1NOWA 3CZGA 1NP2A 4D6IA 2YL9A 3UESA 2XG9A 1FHLA 4OOUA 2VCAA 3VIJA 5AC4A 4CD7A 6CGTA 2E9LA 1JYWA 4D6EA 5I23A 1PX4A 4GZEA 3I3DA 3FAWA 3EMCA 2IGTA 4NF7A 5CLTA 5A6MA 3ZSTA 5A3HA 1UKTA 2V5DA 2D73A 4UFJA 5CPQA 2V3GA 1Z32X 4MTVA 3BSGA 2GUYA 1E5JA 3WNLA 1VEOA 3AHZA 3BVTA 2E9BA 1E3XA 1I75A 3N1AA 3PBGA 2CXGA 4IPLA 1TMQA 1J12A 3VD3A 4D6FA 4Z2LA 3LXAA 2X8RA 5HPCA 1HJVA 5E6ZA 3AQUA 2VZUA 3KZSA 2J79A 3GXNA 3SIMA 2X09A 1XD1A 2YLAA 1JL8A 4BA0A 1EO5A 1GORA 1PX3A 1GJWA 1UH2A 3KEHA 2PWDA 4MJ2A 4AMCA 1BGGA 3PZIA 2E8YA 3AMKA 4GO8A 2W92A 2G41A 4HOXA 1EQPA 3CO4A 4BF7A 4D71A 3I3BA 3WF0A 1Q6GA 4D6DA 2ZICA 1VF8A 2XVLA 1DTUA 1MWOA 5FCZA 2MANA 2PWFA 1W2PA 1J0KA 1W3JA 2E40A 2J7CA 4H8HA 1VFUA 3GYCA 4BCEA 2WXDM 1U30A 2WMJA 1EDTA 2PWGA 2B31A 1H5VA 2EPMX 4AWEA 5I79A 2XYLA 3GXFA 1ODUA 3A4XA 1V08A 4P7NA 3OBAA 2OSYA 2D3NA 3CHFA 3N12A 3H53A 4U5IA 1W9PA 4D72A 2QPSA 4N0RA 2NT0A 1BQCA 1CENA 3S6TA 2EXOA 3SCSA 1OD0A 3BCDA 3GH4A 4UOZA 2WW5A 1E40A 1ISWA 3BGAA 3VM7A 3OGRA 5ABFA 4M24A 2GSJA 3CUHA 3ECQA 3LRKA 1UKQA 1QVBA 4B15A 2YA1A 5A6KA 2PBOA 5HOSA 1JNEA 1OT2A 2FH6A 3WEMA 3SUVA 3ARZA 1UH3A 4PTMA 1JYNA 3BAXA 2WVSA 4AMWA 2OYKA 2WZIA 3W82A 3SCNA 3DHPA 1UR0A 3ZT6A 1HKMA 2JF7A 5LYRA 1XYFA 4TOQA 2F1BA 4PMNA 3RDKA 3AIBA 1ODZA 3PZ9A 1FP9A 1WKYA 1QNPA 3GXDA 3OG2A 1W3LA 7CGTA 3WH9A 1B0IA 3AXXA 1KR0A 5JIWA 2F8QA 1WDQA 1B90A 1Q6DA 2F2HA 1NQ6A 3WUGA 5M3WA 3ZJ8A 3NJ3A 3H54A 4C7GA 1OGSA 4NRSA 6TAAA 2OWWA 2RGLA 3QGVA 1DWAM 3WDJA 3CHCA 2OWXA 4JHOA 1I1WA 4P7QA 1D2KA 1W3HA 4HOZA 1M03A 2EADA 3ARWA 3CTTA 4CN6A 4QAWA 3KE0A 1W1TA 3DC0A 3MUIA 3WH8A 4CD6A 3SCPA 3SUTA 2ZWZA 3BVXA 1BYDA 2Y8KA 1BVNP 3AROA 4HPGA 1KB3A 2FYVA 3W6LA 3OB8A 2XUCA 4ATDA 3AXIA 1ITXA 1HT6A 4JFWA 1E5NA 1FH9A 3N11A 4HMDA 2FE0A 5CGMA 4OJYA 4CCCA 1NARA 1OD8A 2O9RA 2DH2A 1ZBWA 2XJ7A 3KWXA 4AZCA 3AMCA 3OLEA 1TG7A 1V03A 3NDZA 1W9DM 4QCFA 4AYGA 1JIBA 1GVYA 1WO2A 3K8KA 2XM2A 3WNKA 2A3HA 1UQYA 2EPKX 4U3AA 1E3ZA 3F4VA 1QOXA 4HA1A 3WNOA 1V6YA 4AEFA 3WBAA 4H04A 2GFTA 1ZBCA 3CZJA 1GOMA 2WBKA 4W85A 4ATWA 5KZ6A 1JF5A 5E0FA 4DM1A 1H41A 4WKHA 2AMGA 1XH2A 3SCTA 2CBVA 1UUQA 1E1EA 2WWDA 4JHZA 1Q4NX 5D8WA 1JYXA 3LMYA 2A3EA 4LYPA 3B8SA 3OGVA 1XSIA 1JDCA 1E6SM 3BVWA 3CUJA 3BAIA 5CLWA 2WVVA 4CU6A 3TOPA 3ARQA 3U7BA 1WPCA 1J0YA 3UCQA 4X0VA 2W66A 1JZ3A 1R8LA 4EANA 1F4HA 2X0YA 3VIPA 3UR7A 1OCQA 4W5UA 2YBUA 3VKKA 3VIMA 4DWSB 1JYVA 2F61A 2EPOA 2UY5A 5IHRA 4A3YA 4CCDA 1VEPA 3AS3A 1V3MA 3CZ8A 1MW3A 3WH5A 3O2LA 7A3HA 4Z2KA 1E4IA 4U2YA 1BYCA 1TQUA 5LA0A 4W5ZA 5ECUA 4YHEA 1JZ8A 2V5CA 3AS1A 1XRVA 4R5EA 1VFOA 1HVQA 2EJ1A 2QLYA 3SCQA 3ZT5A 4UOJA 1C8QA 1XCWA 1G5AA 3THCA 3AYRA 1OSEA 4XV0A 3MS8A 1SFSA 4MDPA 1L0PA 1FH7A 1M53A 4W93A 3EDEA 1BFNA 3WY4A 1E6RA 1C7SA 4HA3A 2GVYA 1XV8A 3BVUA 1JDAA 1GOKA 2G3IA 1SMDA 1CIUA 3BUQA 1JFHA 4F8XA 1OM0A 3T0BA 3DX4A 4FNPA 2WANA 4HTYA 2ZIDA 2JFEX 3WH6A 1GVIA 1KCLA 2YLLA 1E1FA 2VX5A 5CQ1A 4XB3A 2VZSA 4AZ5A 1NOFA 4AD5A 4J3SA 2ZX9A 1ZJBA 1FA2A 1JXJA 4U5KA 1AQHA 3M6DA 5A8MA 4WF7A 1K9TA 1V6WA 2VQTA 2GJRA 3HJEA 1HXKA 1NWTA 1J0HA 2D1ZA 2VO5A 1JD7A 2J25A 3EJPA 2OYLA 4FNQA 1UR4A 2FHFA 3W27A 4CD8A 1HJSA 4UQ9A 1FFRA 3WKZA 1PBGA 1JDDA 3GNPA 2CHOA 1K6AA 4H41A 3NDYA 4W87A 2XWEA 2XHYA 1V02E 2QF8A 3VGBA 1TQVA 1E55A 1X6NA 2GDUA 5EB8A 3EJQA 1R34A 2VX4A 3CUIA 4OIFA 3HU7A 1EH9A 3GXIA 3A3HA 3PTQA 4PRWA 2OW7A 4AIOA 2FH8A 3VSUA 4KH2A 1UWSA 3WNNA 1VENA 4J3TA 5JBFA 5JBDA 2FGZA 1KXVA 3VO0A 1XHGA 1JF6A 2DIJA 4TUFA 2O92A 1TVPA 2E9MA 2GK1A 1QWUA 1W9VA 4AY1A 1E0XA 3DDGA 3PZTA 4W84A 2NW0A 1CBGA 1VB9A 4HZ7A 3AS2A 3H55A 1QW8A 5ABGA 1QBAA 4YHGA 2WCAA 2VC9A 4RE4A 1X6LA 1UR9A 3DYMA 3SCOA 4GI6A 2BVDA 2F7OA 3VSTA 2D23A 5KEZA 2BFGA 4HZ8A 4W8AA 3TONA 3FN9A 1JAKA 4AZIA 1LWHA 1CGYA 3VDAA 1CPUA 2JEPA 1NH6A 4AZHA 1JD9A 3T0AA 3GXPA 1JZ2A 3EJTA 4GPNA 3CH9A 2VCBA 4JKKA 1JFXA 5D4YA 4JAWA 3TTSA 3NSMA 2XFYA 1JZ4A 1WE5A 1CGWA 3VIFA 1XGZA 3N13A 3EJUA 5A8NA 5JIPA 4P8WA 1RP8A 4V28A 4E2OA 3S2CA 2DQXA 4ACZA 1V6UA 3OLDA 5E0CA 2ZUTA 4XZWA 1HIZA 4NXKA 3EMQA 3VMOA 4HOWA 2VTFA 3D3AA 1QW9A 3ZJ7A 4LXFA 2WPGA 1V0NA 3TTOA 5BCAA 1KTBA 2ZE0A 1BG4A 5I24A 1TCMA 3RCNA 2GK1B 1CDGA 1GZJA 4UQBA 1NWRA 4W88A 2DSKA 4PMRA 3DECA 2FHCA 1KQZA 3E1F1 2ZXAA 4S3KA 3CPUA 1W91A 1UWTA 4LYRA 3PHAA 3SUSA 1VIWA 4MB4A 1DEDA 2BY0A 2CESA 3WFZA 4MNKA 4V27A 1B3YA 4AD0A 3WUFA 4W8BA 3LPGA 5A8QA 4GZIA 5FIPA 4RE2A 4FLSA 5A2CA 1BPLB 4M8UA 4D1IA 1BGAA 1XSKA 3U5UA 3POCA 4BQ5A 2ZUWA 3HZ3A 4DO5A 3BLKA 3G6LA 4H8UA 3ZMRA 4IPNB 3U57A 2UY2A 4PMQA 4MADA 4Z2IA 3EDKA 3M07A 4B3KA 4QLLA 1DWIM 1ZU8A 5IFTA 3DX3A 5CZKA 4FK9A 1E43A 5FOOA 3MMUA 4KMQA 3BUPA 1CGVA 1IZKA 4YN5A 1MYRA 1EIBA 3SURA 4NX0A 1J10A 3VDCA 1HWWA 4M82A 2G3JA 3DYOA 3IGUA 3AIQA 4CN1A 2WHLA 4MB3A 2J8GA 1CGXA 3F5JA 1K9FA 3VDBA 3A47A 2WAGA 2CKSA 1HKKA 1R87A 4M29A 3I3EA 1D7FA 2OLHA 8CGTA 1GHRA 1G0CA 3LXCA 2YFNA 1MXDA 3MUY1 1NWSA 2ZXBA 3IJ9A 4DO6A 5HDRA 2AOSA 1OINA 2FDMA 4PMOA 4AZGA 4NRRA 1BYAA 4DM2A 4JCMA 4W8LA 5BXRA 3WY1A 4PMDA 4DUXA 2BVTA 4DWSC 3ZSSA 3A23A 2YA0A 2YL5A 2VUYA 2V3FA 2FGLA 2CBUA 3EBVA 3PZNA 5CG0A 1WAWA 1DWHM 3AS0A 1CXKA 4LX4A 4PN2A 4JFSA 1CLVA 1KGUA 1PPIA 5BWFA 2CERA 2GJXB 1V0MA 5GPRA 2DT3A 2FHBA 2VT0A 3HG2A 4JL2A 1JNDA 3WD3A 2C0HA 3WQ4A 3EDFA 4NSBA 1ITCA 1GOIA 4CU8A 3AHVA 3AHYA 2EO7A 3CUFA 1NM9A 3L4YA 1VBRA 2W67A 1W2VA 4J3WA 3IANA 1UA7A 4F66A 1H1NA 5F7UA 3VD4A 1HVXA 5I0DA 3TA9A 3PTMA 2WMHA 5AY7A 1QHOA 3WF1A 1HJQA 1E70M 3N15A 1BAGA 5BROA 2VZOA 4P8XA 4JFVA 5A2BA 5DO8A 4CKQA 3EDJA 3IJ7A 1E4LA 5A8OA 1H0IA 1H2JA 3PZQA 4UFMA 2EAEA 3VD7A 3DHUA 1VFFA 4D6CA 5A6BA 1C8YA 1V02A 4L4PA 3CZLA 3FAXA 1P6WA 2O9TA 4QFUA 2WYSA 1UKSA 1ISZA 2PC8A 4KGLA 5I5RA 2WWCA 5HXMA 4U2ZA 1UD2A 3OLGA 2YDQA 1GQJA 1UWQA 3EJSA 2F18A 4TXEA 5DT5A 4C7FA 1TZ7A 5FD0A 3PN8A 1SZNA 2J62A 2DSUA 1B30A 2Y2WA 2XVNA 1W1PA 4FNUA 1GQIA
chains in the Genus database with same CATH superfamily
5CEYA 2AI0H 5D9SB 4ESKA 1YXCA 1ZT7B 3TZVB 3KOFA 2GI0A 4Z2HA 4APXA 2KZHA 4HK0A 3TBYA 1B31A 2HAZA 1N12A 1W1IE 1R9ZA 1VKFA 3QUZA 3IDIA 2VE6B 4KROB 4BFAA 4LHQB 1TREA 1A7PL 1OZTG 4Y4KA 4LY8A 2QIWA 3W7KA 1IZJA 3DUSA 3UPBA 1BQKA 1MLCA 3X3FH 4EAYA 2F19L 3PF2A 3L6FA 3NP3A 3NQ2A 1A7NL 5DUMH 1JPFA 3DRTA 5KANI 4NZCA 3CK5A 4DNHA 4EDWL 3N44B 3RX9A 1ADSA 4JCLA 4N0UE 1SO5A 3E8UL 1H5BC 1TTPA 2A4CA 4K07A 4NXSA 3EZJB 2WZMA 3CIQA 3VD0A 4QYAA 3VXMA 3IPFA 3GMNB 1T99A 4KV5F 4IP7A 2NX5A 4YSPA 2P9RA 4Y8FA 2Z64C 3CE1A 3VMPA 5DSCB 4Q9RH 1MI5B 1J1OH 4M1DH 2X1UA 3DFHA 5GNXA 4GRWB 2CAKA 3BDYH 3N19B 4O0KA 5DT7A 1KM1A 1ZGLM 4PSRA 4PJDF 3OR7A 4W9JC 4LCIH 2B20A 3RLSA 1CGSL 2A21A 5IB2A 1AHMA 5AC8A 1B0RA 3ESNA 3SDCC 1ZV5A 3G3DA 5BVJA 5D2VA 2QPEB 4B4FA 3SCMD 3MLSH 1HGYA 5D9NA 1TTJA 3AABA 3NZHH 1D3CA 3L3OB 5FV1L 3T09A 4L5FL 3SAZA 3MNVA 1N59B 3B8YA 3BKCH 1QXLA 2DB8A 1KIRA 4OGYL 5IQ9B 1J8SA 2F8OA 3FCTB 3QZBA 2JKJA 5C1MB 2CJ3A 4P0DA 1V79A 2ZOLA 3DARA 4PJ7A 3PWLB 3K80A 4OD3H 3E12A 5JHLA 4WHYH 3DESA 4GXVL 2A73A 1FF5A 4XT1C 1FKWA 4ATLA 5FEBA 3VAVA 3FQNB 3QK0A 1MDRA 5C7XH 4FXRA 3HNVL 4K68A 2WWMD 1OP5K 3WD1A 1P4UA 3UACA 1MEXH 5TPWH 2JGQA 4P5MA 4FLRA 3FQXB 1OG6A 4HIXH 4BH8B 4E9SA 4APQA 4BI6A 5JHAA 2CPUA 4F7EB 5FUCC 1T8QA 2VIRA 4DHGA 3EOTH 5LB1A 4BHUA 3M44A 1V6VA 4K37A 5DQPA 1FDZA 5AYIA 4PRPA 4Z3EA 2CR3A 5HJBA 3ZE1E 3CQJA 5F2FA 4M81A 3UFYA 5AC6A 1PLGL 3PWAA 5FHBH 2GYSA 5FYKE 4XD6A 3AIEA 2VX6A 3U48A 4GP8B 4B50A 3VRLE 3GVWA 4JICA 5JA9A 5HDQL 3L5JA 1AQFA 3GTTA 1VQTA 1CDHA 3UPRB 3DOHA 1CG9A 3UWUA 3ASNB 3O11B 4DNMA 1CI3M 2O6DA 1V8HA 4PY7A 3RP1A 1QQDB 2HJLB 3ARFB 4JQIA 3KLLA 4EKXA 1VRDA 3DO7B 2XTJB 2AJVH 2A74A 5L2KD 3PL6A 4P46D 2VX7A 3HGJA 3V6ZA 1BAFL 2QTEA 5IOPB 1WV7T 4NQSB 1UB5B 3MLRH 4NZJA 2R29L 3EXJA 1KM4A 2VXNA 4PTWA 1H11A 4UR9A 5I09A 3PUOA 3TAOA 4EUPG 1G7MB 3OGOE 4PCTA 4LCSA 4MIMA 3BW9B 1G7VA 4IG2A 4W9CC 1I3UA 6ENLA 2E46A 3G8EA 2KS0A 1PYFA 1YDPB 2CIPA 5EOTB 5D1ZC 2IH1B 4WKXA 1W5PA 3W24A 4LLMB 3NFPB 2Y7SA 1NIFA 3SBFA 3VG9B 2HCZX 4BF9A 4AVIA 1RU9L 2J56A 3K6DA 1JPIA 4DUOA 4K5OA 2NYYD 3FO2B 1RFDL 1TE1A 3CH8A 4LUIA 3SDXA 2V5YA 1WAAE 4OGXL 4K9JA 4IDJH 1GZPA 1XBXA 4HIBA 1M04A 3VILA 2DMBA 1YKWA 4FXGA 4TNGA 1AKJD 5F7BA 3CQIA 4XQ6A 1ASOA 2GBTA 1WGOA 1XEDA 1YECL 2GIXA 3RWFA 2XLLA 4EDXA 2YUXA 1XP3A 3G77A 3L3DB 3KPSD 1E7UA 1J05A 2NNAB 2CA4A 1US3A 2BSTA 5AHFA 4IFRA 3NFPA 5DLCA 4GQGA 4LKCA 4DYEA 5MEPB 5T1DL 1A3QA 3S6DA 3G6AA 4PJ8D 4IG2B 4OZIB 5GISH 5E08L 2KDYA 5TF0A 1UWEH 4NJKA 5DCCA 1BD2D 4TVDA 2V7NA 2VFHA 4ZFMA 4A05A 3T08A 3ZJ6A 5I1GH 2E74C 3M0JA 3WBEA 4PJAB 2YYUA 5E09A 1X1NA 2OZNA 4AZ5A 3U2OA 4BINA 1IAMA 1D5IL 3DO7A 2Q3OA 3BWWA 4IX0A 3F3HA 1P5VA 3QRGL 3UJRA 3VQ2C 1IEHA 3GDBA 1HL2A 3HE6B 4W9GC 1XGPA 4OFCA 1NMCC 5HHPA 4TX6A 3L4TA 4XZNX 4N2MA 2P52A 1A53A 4J4PC 1S2WA 5ADOL 4ZXLA 4K15A 1DANU 2NLJA 2CHRA 2PGWA 1OAKL 2R0ZL 2Y07L 4JEGB 4UM8B 5FW6A 4L3CA 1H4PA 3EGJA 1L9MA 2GJZB 3AXLA 2C5DC 3OKMB 5I16A 4MJMA 4HC1H 4V2XA 5IB1B 4JTTA 4INFA 2NW2A 3GSQB 3RBSA 4H8WH 4OOZA 4ROQA 1GPFA 3QZ6A 1S5TA 1NFDE 4OV4A 2J74A 2VMJA 1T2QL 4S1QH 1VKXA 5E1GA 4A63A 4RZ4A 1GT8A 5DI8A 3MV7D 2VI0A 5HBFA 3MDWA 4KWSA 3NRPA 1OAQH 2R2CA 5HVHC 3PWLA 2WUCH 4AVOA 4JY8A 4C65A 3SO5A 3KYAA 1MY5A 4DVRL 2AFNA 3BAYA 2G9HB 4JJOA 4ZX6A 3INUH 2G5UA 1SBSL 5E1QA 2FECL 1PX8A 3BGMB 5K1NA 1GQNA 1EAPA 3K5SA 4GI9A 2F54E 4A4AA 2DZEA 1BQHG 1T4WA 3MI3A 1YDVA 3RL2A 2P8MB 1KCSH 1LO4L 2XIIA 4M7TA 4S1RH 5GGTH 2EPLX 2AK4A 3AJ7A 5ICYB 4WD0A 1A5CA 4HZ6A 2HVKB 5HGAB 3LCHA 1LG1A 2CRZA 4Q7NA 5I15L 4AG4H 1EZUA 2QQLL 2E77A 3GW3A 4B60A 1BXAA 1OALA 5LG1A 1E6QM 2IW0A 4NKCA 4QSHA 3GJFB 2YBGA 2CKBB 4G2DA 4LALA 2QHRL 3RN6A 1J1OL 2VGFA 3JUZA 2PUZA 2HLAA 4LQFL 4OZ4B 3NYDA 4PYSA 4IBYA 2DUAA 2W9DL 4J40A 1B0WA 1MLCB 3WS6C 2V5LA 1K9DA 1YHPA 5HHME 3QA3B 3QFJD 4KWUA 1J2BA 5G4WA 4B2DA 2NQJA 2QGBA 3F4DA 3TJEH 4QRPD 3BKCL 2VRAA 4OZFG 3ZE0F 3ULUH 5EB9A 1LRQA 1PFOA 3KVDD 2CPCA 3G6DH 4AISA 3AUVA 4R7LA 4LNYA 1M1SA 1N5AB 4TRPL 1NCBH 3R7RA 2BSRA 4U1IB 3PZMA 2R0KL 4MMXA 5IR1A 4OCSL 1KYUA 3FT9A 1SVZA 1FP5A 4Y4FA 1OM3H 3PBYA 5F9WB 5AYUL 3V0UA 4L3AA 2WM1A 3QUKA 2EIDA 2A9NH 1GY2A 2TSBA 4HCGA 4QHUB 5CU5A 1EC9A 1SJBA 3QPYA 4A2SA 5H8MA 1RK0B 3AREA 5CINH 3OOQA 2AJUH 4M5YH 4F0RA 5IHHA 1RULH 5JW5A 1H1YA 4IGSA 4S0TD 3ARYA 2VOMA 5F6HI 2FBOJ 4IFKA 2ICES 1DVFA 1EUUA 2CGZA 4JHUA 2WC3A 3DFYA 3KTXA 4DGYH 3II3A 1XLGA 5BMXA 2D7PA 5LNWA 4KRPB 4M56A 3CHXA 3TOYA 1WXYA 1DDHB 2I5QA 4HUWA 3WS6A 4KFNA 4YZFF 1XL4A 3RUGA 1ZGLB 5FW7A 4GW4A 5I6MA 3BX7C 5M95B 2C14A 2MCG1 5EEZA 1RZIA 2NX3A 3B9AA 3KZPA 3PB2A 3VOCA 5BOEA 1Z9LA 2J78A 2YKLL 1EXHA 2IMRA 1N70A 1VFLA 3CFEB 3KOWA 2ZX6A 3CFCH 4FLQA 4LDLB 1DJHA 3QR1A 3ZTJH 4F3FA 1AJ7L 5I78A 4ADUA 3U0PB 3FN3A 4UT6A 3CVBA 1T3FB 2QELA 4PJXB 2H90A 4F48A 4P06A 4PJFB 4XBPB 4ZZKA 4WU5B 5A1AA 1MFCH 1EFZA 1FDLL 1W1ZA 3IMBA 2COQA 1B5TA 4H6RA 2NY6D 3PJLA 1AH3A 4LL1A 4FDWA 3KPRA 5TE6L 3MBDA 4WU5A 3MSDA 4MAVA 4XHQA 1GVQA 5MHSD 3O4LB 3VGHA 3WTYA 1EFXD 1NAMA 2LU3A 2Z25A 3ZFHA 1SVDA 4FNLL 2AVGA 1YEIH 4MA8H 1CZ1A 4MNLA 4B9JA 3BUIA 3JW7A 2IQ9L 4ZPVA 3CDGB 4I0PB 4RMVA 5DUPH 3S36H 4DZBA 5CLXA 1Q8JA 4UQDA 3TYZA 1E6ZA 5JXEA 4LPTA 5C7XL 1RZIB 4MWAC 1MCKA 4IKJA 3KS0H 1AZNA 5DHDA 4GUIA 2CCWA 5AOMA 5TE4L 1O95A 4M1DL 2OQLA 1U8JA 4KK8D 4KNUA 4R4FL 3G5YA 4XXWA 3GHBH 4PMJA 3M0XA 1YECH 1FWHC 3SW6A 4LPVA 1ZT1A 3ASWA 1CLOH 3RG6A 5I2IB 4L18A 2HT2C 2Y06H 1TWIA 3V6BR 3W0WE 3LKSA 2CWNA 3CTLA 1ZDQA 4D8AA 4D0DA 4PBVC 3QXAA 3NJHA 2Z1SA 5TQLA 5F7MC 1WX0A 1AMYA 4IPJA 5T1DH 2UV8G 2JB5H 3X14B 2INFA 4XNZC 1XGQA 1RZ7H 3LN4B 3DTXB 3KUMA 3MJ9A 1RCOB 2X0HA 5G5DB 1UYWL 2D0HA 1Y1DA 3FJNA 3RWJB 1E28B 1Z7JA 1VHNA 3MREA 1I1AA 4X22A 1FUNA 1GGTA 1X7SA 4QHUA 2WSKA 5SX5H 1UA3A 4X8JA 4AW4A 1VYPX 2CETA 3A6BH 1FCUA 2AJVL 1IL1A 5HWJA 3G0XA 5FPIA 1AXSB 1ZD6A 5HYJE 3RU8X 2WD0A 3HZYA 4RIRB 3ARTA 4XCEB 2E6FA 4ZQCA 1AVAA 1XF4A 2E9GA 4EQ2A 4QNPE 1RJZB 4QRRD 3KEDA 1NGWA 1MF2L 3Q45A 4PFEA 2L3BA 7ENLA 3OB0K 2VLJB 1V6TA 2ODIA 4OCXL 2QCFA 4B5XA 3L4XA 4KKNA 4QRPA 3W9EB 2ADJB 2ABBA 4MYWB 4N20A 2PWEA 1S1PA 3IVKA 3CT2A 1A7PH 4PC8A 4OJEH 4OZ4A 4UDUA 3IGXA 3CSFA 3ELAT 4PTTB 4JDZB 4RDVA 2ATPA 3KM2A 2NUTA 3IK2A 1R3QA 1FFPB 2OMVB 1PTAA 5DMNA 1NPJA 3KAOA 5SWZE 1CGTA 3QDGD 2PCYA 2XV0A 5HANA 3EWDA 4PCYA 1PAMA 1V3KA 2AF2A 5JW4R 4Z8FH 3GKZA 2QXWA 3DEQA 1XS2A 8FABB 2CJUL 5E8DH 2FLMA 3BD4A 3PTDA 2APFA 3SDOA 3LKPA 4HP5A 1YN6A 1XYCA 4M3KB 1XCQB 1EJUC 1KGYE 1KV7A 1LP9F 2FX8H 4DGIL 3AREC 2AEPH 4P46B 3UZVB 4PJ5A 4DH2A 4KPHH 1PL3A 5EO9A 1ZB5A 4OZHF 3EGDA 4LEOA 1CZ8H 3MLSL 2ZRWA 3MYJA 4KVNL 2E7DA 3P73B 3BGMA 1GWJA 1NJJA 4TTDD 4PUMA 1EIXA 1PYMA 4XWGH 1DTNA 1U42A 4ISVB 1ZHBA 4TQEL 3UJJL 1UC6A 5LQBH 1YEEL 5I5MA 1O0VA 3GK0A 5M17A 2X3BA 1KV3A 1G67A 3FYPA 3RGVD 2AJXL 3PQYA 5KJRH 3I6TA 5F3FA 3S5LA 5IMMA 3GLDA 3LHPL 1S3TC 4LVHC 1UC4A 2ZQ0A 4X8CA 3F4NA 3N2MA 4IDJL 2OR8A 3MOBH 3L3IB 2GIYA 2DY3A 5DC0A 5CJOH 1ET8A 1SR0A 3MBEB 4MMYA 5EU5A 2ZG3A 4KDTC 3VWJC 1XLMA 1A8ZA 3UTTA 4DN3H 1MO0A 5LNEA 2FTYA 3AMDA 4KROD 2I24N 3OHMB 4I4WB 4HN4A 4Q56A 1H6FA 3ZJKA 4WFHD 3Q13A 1XIMA 4KZ0A 5I8OH 3GZPA 3OKMA 5I16B 1A0DA 4A22A 3Q8FA 2TRHA 3MYJB 3O41B 1ZMYA 5FYJU 1Q6EA 1IM3B 1WDSA 4Y19D 4L65A 1I7UB 1PYWA 4W70A 4L8SC 2E3ZA 4ML4A 2H3XC 3TVMD 2XOTA 1O5DT 3BVNA 5KWYC 5L2KA 3DBSA 1DPMA 2TYSA 2C16A 1UKOA 3INOA 3LMJH 4DX3A 1E4XL 1BJ8A 4J3XA 3N18A 2OK0H 2WMKA 4P59L 4ICCX 1BVZA 4HKZA 5BO0D 1F6KA 3QYSA 3OHXA 3CXOA 2VOTA 5B39B 4NQEB 4E41B 4TMCA 2ED6A 1MXGA 3DROB 2VXTL 4CDGC 1ACYL 1NPUA 1OWRM 1LBMA 1TV8A 2EG7A 4HWBL 3BURA 3C60C 4Y2OA 1UT2A 4DQAA 1KJ3H 1X5YA 2JF1A 3K74B 3ZMNA 1JZIA 4OZOA 3U4FA 2SEBB 3RYMA 4U6VH 4UMGA 4ODXA 1NBZA 1D2PA 4GQRA 3BO9A 4GLRH 4GNKB 2EDKA 4P49A 5AZ2L 4I88A 1IWBA 3PHOB 5JLZB 3CLMA 5D1ZI 1YE6A 5DZLA 1XF5B 5E9AA 4IBVA 3O6KL 4PHXA 5F7EH 1UQSB 5SWSA 3P67A 4S3JA 1IGFL 5C08A 1BQRA 3KZ8A 2DJ4A 1D7BA 4FP8H 4JUSA 3LEXB 3ZE0E 4BE5A 1CEOA 4Q4MA 2UVFA 3BLPX 3LNIA 1I9EA 4FXGB 4M48L 2WQWA 3W11C 1AY1H 3IGLA 1KO0A 2VEKA 2WY3B 1RJCA 5FA4A 2BK8A 2AEIT 4IKIA 4JQ3A 3F6JA 1HHKA 3V0WL 1LJYA 1RL1A 2MTAA 1WZAA 3AQDA 3MREB 4JM4H 2OSXA 2SFPA 4ZA0A 1CD0A 1JN6B 1ID2A 1J0IA 4Z1CA 4UTKA 4K7PY 2W3ZA 4XPAL 4RAUA 5IIEA 4Q3MA 4P23A 1MKFA 1T1YA 1PCSA 4NENA 1HQTA 2C7FA 4CAGA 4G42B 1QOKA 3CIWA 2CD0A 1UWRA 1V93A 1YDPA 3CIVA 2VL4A 2WIIB 1AH1A 2WKGA 3KOZA 5AZ0A 2NQ9A 3ABLB 5JOFB 2L7JA 1XIWD 4AIBA 3LKSB 1FFQA 3G1YA 3D4ZA 4H1LH 3P7YA 4FNTA 1URZA 3DUHA 4GG8B 4F2ME 4QLKA 4PJIF 1UB5A 3KBHE 2KT6A 1JUBA 5JXAL 1N2VA 1N8FA 1RVGA 2HNEA 3F83A 1GPWA 1K8YA 3C8KA 3QJVB 2G60H 2ONEA 4I0KA 5F1OB 5FCUL 4JHAH 2NDFA 4HZMA 2EECA 1NLBH 3PREA 1CLOL 3CDYA 1C8XA 4H1LA 3CDGA 4I0PA 4DVBA 2L7QA 4O58L 1P4CA 4IHOA 5TE4H 4AHPA 1X5AA 2JTYA 4X50A 1FVCB 4HS6A 3CBKB 4K94H 4Z7UA 3R8HA 3OXRA 3P84A 4U31A 32C2A 3U0TB 1JWUA 4DEPB 1UXLA 4G9PA 2YPLE 3U36B 1BFVH 5BNXD 4WVXA 4RDWA 3W81A 1I3GL 1YJDL 2PTZA 1ZHNB 3EW3B 3QQ4B 3WLLA 2XZCH 2P76A 1MHHB 1F6YA 1JOIA 4RQQB 1MUWA 3WMBA 4ODSL 3GSMA 3VUSA 3KP0A 5FL1A 3WD0A 4ODBD 4GMTH 1UWGH 4Y19E 3LKOB 4J1OA 2ZXWB 4NYUA 3S0CA 1OZUA 6PTDA 1OKEA 3ECBB 1NMAH 3H56A 4PV9B 2YDRA 5AQ0A 5AAWA 3IPEA 1NMBH 2Z34A 4O2CB 4XP6L 4PJ7B 4YFEA 1KBJA 1EQCA 4DWSD 4HJ0C 3U9IA 2XN1A 4RMQA 5DD1H 5IQ9A 4NNCA 1WAPA 3U3HA 1P69B 3IGSA 1J96A 3F05A 4HUWB 4FKHA 2WOYA 3UFIA 1GKQA 2J7HA 5JYMA 1MCWW 2O7QA 3U2CA 2CDFB 2X4SB 1MFCL 3HG4A 5JHBA 4N2KA 1CDIA 4NIKB 2Y6TE 4KXCA 4DGVH 4ADSA 4AVFA 1YNQA 1O5XA 3UETA 2NXYD 1O60A 1KENL 3QJOA 1IGTA 2XG5A 4BS0A 4HKPA 2QV2A 5KBLA 3NOEA 5JBEA 1PFCA 3LH2H 5HAOA 2E8ZA 2G5BB 1MRFL 5CBBA 4GW5B 3TSBA 3TBWA 3VXMB 1TZHB 2CMRL 4NQED 2XN2A 3STBA 4A67A 5DHVB 4E41D 5JPMB 3NR0A 3SRDA 4AXNA 2PGRA 1OX4A 2ESVB 1TEFA 1NC2B 3WTWA 1IVLA 4K71B 4JZ5A 2XDFA 9CGTA 1TLMA 3K4AA 1BFSA 3B8TA 3MJ8A 4UC5A 3KCWA 1QWGA 3M1OA 2C8NA 2C9AA 4K3JH 5B7MA 1OFQA 3BV7A 5F6IB 4GNJA 4XWOD 3V1PA 3RPIB 2ZSWA 5SWZD 1DJIA 2VE6A 2LE9A 4F2MA 4XN9A 5C0BE 4C4BA 1TTFA 4R7DA 1EK3A 3MJ8B 4AITA 3ZVIA 1NCDL 2CLRB 3G1RA 1JGEB 4E9YA 2JJSA 4M1GH 1NC2A 5IVXB 4ZJ9A 3OG3A 2ACUA 3AZTA 4LIQH 4FFVC 3S6CA 2BBFA 2E9JA 4FTDA 3RDTA 3S36L 4WSJA 2VGIA 1E0VA 2R0KH 4FJZA 4RETB 3CFDA 3RJDA 3NH7H 2X4RA 4E5XB 1P5UB 4G70B 4GW5A 1UMYA 2WSQA 3N9SA 4BK8A 1E9LA 4HA0A 3QZAA 4NFBA 1HGWA 4HKBB 4C56B 4MJIB 1Q72L 1YXYA 3WIHA 1UXWB 2W07B 4J1UB 4QRRE 4PJBF 1HHJA 1MW0A 1SRDA 4GAJL 1HG3A 3NL5A 3FTSA 3U2IA 2V3DA 2Q8ZA 3S96A 2WXNA 5F1SA 4DPBX 1IXNA 3HHRB 3NL3A 4ZL1A 4K3DH 4DW2H 1T22B 3F6IA 4W6WB 1I7RB 2AKRB 3A21A 3NA9H 5T1MA 4AQ1C 4MA1B 2GQ8A 5AVZB 4UCGA 3GI8H 2O30A 5FO7A 5LO7A 4WRHA 2C9XA 4M4RB 1W31A 3UCRA 3TZNA 2WWOA 3OKNA 2EXTA 2WMPB 1SYVA 3L54A 1GONA 3CUXA 4L9YA 3FYYA 3APNA 1YNYA 4YDJB 4B3VA 2PBGA 1PZ3A 3WL9A 4DOHE 4HWBA 4RDZA 3QUMH 5CEZL 5EFFA 3HE7B 3CG8A 3NCMA 4FFZH 3ZO9A 1WUEA 4UZSA 3W0WD 4XIMA 3XINA 1PVHA 4JPVH 1SDAB 3GMRB 2VISA 3QI9D 4F15B 1FHGA 3MRHA 4QT5A 5FGRA 2E1DA 3G6JE 1XIWB 3QQ9C 4DGIH 3FQ2A 1OQOA 2PGEA 3CVHL 2BLEA 4KOBA 4N2CA 5I75B 2NY1D 1PV8A 2XQYA 3VNZA 1LO5B 1N5YL 2WQSA 4KKQA 1LORA 5EO1A 2IKIA 1MHPH 5F2GA 1DJGA 4UTAL 5IBLD 4CC1A 4UM8A 1WB0A 3R11A 4LB4A 4OLXL 1A4BA 4R9OA 5AZ2H 2VR4A 2WBXA 1W0YT 5EOCH 5I8EB 2PDCA 4NQQA 2PR4H 3BEWB 1LE5B 1B4RA 3UJSA 1BQHB 5I7GA 1R86A 2J7FA 2IG2L 2VDGA 3ELQA 3O1NA 5DC2A 4QBXA 1RD6A 4RGOL 1OBAA 5MHSE 3P3RA 1QNRA 1SSGA 4BZ2H 2XG4B 4RMWA 1TYRA 2AXFA 1QNVA 1ROCA 2OMXB 4FI8A 5FO8A 1UZ1A 1EJRC 3L45A 5BW7A 3STFA 4XVDA 2XACC 5I07A 5E5RB 4NN6B 3K1DA 2H8XA 4H7CA 2VJXA 4ODUB 4R8WH 3HBQA 4HEPA 1SR9A 1U93A 4ZVJA 3AQXA 3VCNA 1MCQA 4WAFA 5FECB 4L29A 3R89A 1IEBB 3D34A 4F9PA 2GVLA 1RULL 4D94A 1RP9A 3NP4A 1AP2B 3FQYA 4LOVA 5EO1B 1NBQA 3NIFF 5HDLA 2EXYC 5MEPA 1ISYA 5EG6C 3CVIH 4G42A 1HL8A 3UG3A 2J6VA 5DK0B 7REQA 5JH1A 3BFQG 1AGCA 3AHXA 5LGJA 3M0YA 4W9ZA 1VZIA 5FDWB 1Y18B 1G0XA 3UMNA 1EMTH 4UV4H 1RPUA 4Q6KA 4XTRC 3RU8L 1V0KA 4XNXH 4H9XA 1JCLA 4JAMA 3NSNA 4M4RA 5FF6B 1DO5A 1EX1A 1PKMA 1B3XA 4PS4H 3DRQA 5DK2A 1JVNA 3FO2A 3LEXA 2R4SH 3HCVA 2ZWYA 3IDUA 3D0VA 4AQEB 1DWJM 1BFVL 1GTFA 3ULSB 4JTDA 4J2MA 3O2WH 1PHQA 4EP8C 2IH1A 4IFOA 1F86A 4PJBB 4D6JA 2A6JB 3LZNA 4LCUB 1VEMA 1AS6A 2HKHH 1R85A 3QZEA 1DCLA 4AWSA 1INDL 1U8MB 1M6UA 4JRXB 3VIHA 3UJFA 4PVNA 4O4YH 2Z7ZA 4KBPA 1YPZE 4HDIB 4E9XA 5B38A 3EOBB 4Q6IC 4U7SA 3C52A 3LB6D 2F1AA 4F8TA 5CBAB 1XAKA 1G6RH 1IAIM 2ATAA 4MQXC 3RO6A 2IQDA 1AY1L 3B7SA 4Y2OB 2YUWA 3PL6B 3NPSB 2WJDA 4NQ1A 4WK9A 5FYJL 3H8NA 1SW7A 4LT9A 5E8DL 3SR7A 1UH4A 3ARFA 2HJLA 2P24A 2QADC 1QTYT 1JVKA 2HN7A 4NERA 3SDDD 1KV5A 5IJCC 1UIPA 5DT1H 1OP4A 1IEWA 1NMBL 3NZRA 5K1VA 2AW2A 4Q2ZB 1G6RA 4TVUA 5TGBA 3M7OA 4AIZB 4C83B 1UASA 2ITFA 4K4KA 4LF1A 1JPST 1LLWA 3EYUH 3MCNA 2ZSWB 1DLHA 1KEML 1N19A 2YD8A 3LRLA 4R0LC 1MQPA 1Z7AA 2GABA 2R1XB 2MCPL 3ZLGA 1PYWB 4XPAH 5BS0D 4WW1B 4ZQNA 4ZSOB 1WDAA 3WI9A 2AQPA 5CPNA 2W63A 1EAJA 2B1OA 5EC1A 1UJ3A 4HAGA 4LHUB 4OZHA 1K6WA 2UWFA 3NVDA 5DUJA 4FOUA 4UANA 5GGVL 2DICA 2QKIA 4JFXA 1KCZA 1GH7A 3FQXA 4BEQA 3S5ZA 3OXSB 4ENED 1WZMA 4L4TA 3MLXL 4FA6A 4P8VA 5IB3B 4C57C 2IBGA 2F54D 4Y88A 4PREB 4HGWB 1KFCA 5DK3A 2G5BA 4KO6A 4BWLC 3LD5A 2J6WA 3A6BL 2ZADA 3NG3A 4MDOA 3TYAA 3FA3A 4L8BA 1UG9A 1Q0XH 3MACH 4LUSA 4DJEA 3P5YA 3DJZA 4YC2B 4U05A 1QNZL 5AW2B 1QWHA 1AZ2A 4DVOA 3X1BA 4IYKA 1M05A 3BKJL 3GZKA 3QMSA 4JIPA 2VDLH 5KG9B 3P1VA 1D9KB 1M3IA 4POZC 3MV7E 4YDIH 1H49A 3T3ME 5JIKA 3TTEA 1FZJA 4HEPG 5C0IB 4OM0H 2CO7A 1BF2A 2FJKA 1I9JH 1PMYA 3P4OB 4ZYKB 4JS7A 1WBXB 1YY9C 3QC0A 1HAWA 2WHMA 3NH7L 4O2CA 5JUEL 5B8CB 5E2VH 2N1TE 3R25A 1OFRA 4N24A 4IUOA 5AAMA 2NX5B 3LQAC 3UAJA 2DLFH 2B1HL 3VI3F 8FABA 4BM7A 1ZS2A 3RFZA 3NJGA 1OFPA 1P5BA 2VM8A 3E1ZA 3VZZA 1SOSA 3U0HA 4G7YH 3TNMB 2DYPB 5GRUH 5T9BG 4ODHH 4NCDA 5E5UB 4RL3A 4RQQA 4Y2DC 1YBQA 4OTKA 5IF0B 3MRBB 2NUTB 1PLAA 4HXBL 5E70A 5I17A 3RWEA 2RJHA 3EKLA 3N73A 4F0LA 3HPJB 3WMSA 2OKOA 4ZQKA 2NX5D 3GVVA 1VACA 1F42A 2W91A 3DUSB 5A16B 3TYFA 3W9EA 4MNJA 2Z7YA 3J2PA 2VLJA 3SE4A 3MNZB 3PJSA 4UUJA 3WFDH 4HJGA 2LV4A 2X0WA 4IU2B 5H1WA 3E2SA 2Z8WC 1KENH 3D6GA 3BOXA 4Q32A 1QFOA 2AJXH 3ALWA 4W4QA 2FBJH 3EFOA 4FS0A 3B3DA 3LGEA 3LNMA 1YQ2A 4Y9OA 2BIPA 3GYRA 4Y16C 2TRSA 2E5EA 3LH2L 3APDA 5L7XH 1TFHA 1MN4A 3BWUF 4KFMA 3WD5L 4L8CB 3C0QA 1K8IA 1IEVA 1AZBA 2FJGB 3KPSE 1Y1UA 1ICTA 3OKOB 4HWEL 4JD4A 1O6SB 2Y7NA 2YXXA 4MS8D 2NY2B 3IXAB 1T0OA 4MZRA 1L9OA 1OCNA 4JM4L 3MC5A 5ENLA 4YMPA 2XVGA 4M6OH 1NDYA 4FI7A 2YD2A 4RX4D 4AYID 3P2BA 3GMMB 1XBDA 5GJTH 5C07E 3WKPA 1J5SA 1ZT4A 2NNRA 2F5AH 4NDMB 1FVDB 3TTYA 4FQXB 4WQOA 3Q5YA 4JG1H 4KNTA 1K70A 3KVJA 1MQRA 1KY6A 3BLFA 3QQ0A 4UB0H 4X0KB 1ZBKA 4NPJA 2J7EA 1S9KC 3M5VA 4KCUA 2WVVB 4NQVA 3RVWD 3VWKC 3BD3A 3PWPA 4LDEB 4OGZA 1DZ0A 2YD6A 2FB4H 2BIOA 4MDIA 1GOGA 3D51A 4HJGB 4QRUA 1OD7A 3KBPA 3M8OL 4NOFA 3D05A 4K94L 3FT2B 1UB6B 1ES0B 5LKNA 4I18A 5FO9B 2O0TA 2GQ9A 4O58H 5F70A 3VINA 1I1AC 4E42B 2YK1H 1Y07A 4OQTL 3W37A 4IRZL 4I9AA 2ED8A 1DVXA 1E0TA 3F04A 4K3DL 3IS4A 4A2MA 3MP3A 4LB3A 3IDGA 2XIMA 4YVVA 3HI6H 4UDTB 4PJXA 4TXVB 3KFTA 4RRPA 1H7XA 1BTCA 3Q01A 5FYKD 4L4TD 3WQVA 7FABL 4WXZA 5FA3A 3OKKB 5IDIA 4JFFA 5FK9A 3RVXD 1XIEA 3NPWA 3OHXB 1RHCA 3PWJB 5IT2L 3TPKA 1QI0A 3STCA 1TZGL 3L2MA 4FD0A 3US1A 3TFCA 4X6DE 2Z4QB 1GGCH 1YAZA 3FB8B 2WZAA 3P4OA 3X17A 4DF9A 4F58H 5AOUA 2F5BL 5DHXB 5B3SB 3W2MA 5CJ8A 4WGWB 5GS2D 2QAFA 4QKTA 4UFKA 1T21B 1GYMA 4CNIA 4HHLA 1M7UA 4C56D 5HY9B 3ITYA 1MVUB 2XWRA 4KJWC 3Q3GB 1EXUA 4LSPH 4MLIA 4G7SB 1M05B 3HBGA 4ZT1A 1UQZA 4H5SB 2XUWA 4N9BA 2DWYA 2PR4L 4WI7A 2Z1XA 4Y5VB 4QGCA 1OF8A 2HH0H 3UERA 3VIGA 3F85A 5FM5M 5I77A 4GBXB 3D18B 5CXPA 1G84A 1LCOA 3U2EA 3P8IA 3SCWA 1NTHA 5M94B 2O6FA 4IBTA 1W3IA 1JHKH 5AB1A 5SWUA 4NN5C 4JFPA 4KX8A 5IMMB 1A7RH 1FH2A 1OAQL 1P7QD 1U8CB 3FYOA 4R2GB 1RJLA 1CTMA 2DI8A 5BXPA 2IPUG 4Z3FA 4DVRH 2LGNA 4Y90A 1Y8BA 3TYGL 3T6WA 3P73A 1SFHA 1WFOA 3EGDB 4LEOB 3V4VL 3GXUB 4GJJA 3WELA 4IRSD 2GGGA 4OZGE 3MRKB 4JDYA 2X6CA 3A22A 3LQMA 1DLHB 5H4YA 2UXVA 3LY6A 3K6SA 4CNPA 2H9AB 5J6SA 4B53A 2EDLA 1DXIA 3MJGX 3LCLA 2KZBA 4NWTH 2Z3FA 1KGXA 4I5BA 1I9CB 2NNFA 2VLRA 2YMTA 4OD3L 1CFQA 1S2EA 5DJAB 3MV7B 1KIPB 4CVUA 4HOMA 3QNFA 1O1HA 1X7FA 1TETH 2BZNA 2Q8XA 2VVNA 2QV4A 3W7IA 4XVEA 1CURA 2Q2EB 4V2BA 4AQ1B 1MEHA 2B7DT 3JWDL 3KR3L 1N9PA 4XAZA 3SRKA 3WF2A 1JMXA 3CFMA 2A6DA 4XP6H 3HMJG 2EYRB 3CZEA 4HEME 2X3AA 1HEHC 4XB8A 1HSAA 3FQUA 3QXWA 2DM7A 2RR3A 4HIJA 4XNQA 4MQ7A 4DWHA 4Z7OE 3MCMA 5E2WH 4PRPD 3CMOH 3SHSA 3C0LA 4IIQA 2W9DH 1KBKA 2Y63A 5MENA 1UR8A 3BKJH 1ZUAX 3FN0H 2I25N 2XI9A 3WJXA 4NGHL 3R12A 3DK2A 2NY7L 4MAYA 5HPMB 4ZFOL 5JUEH 2I5YL 1KPRB 2GQHA 1LL4A 3TCLB 1MFAL 3L9YA 3B6SA 2XN0A 2ZP8A 3TNOA 4PMEA 4BWUA 3VRJA 1OSYA 2IWKA 3E8UH 3N42F 4LVOB 5L4FA 4TMBA 4M6UA 1EMTL 3QXVA 5I1EL 4B5WA 4GUQA 5J6GA 4OLWL 1SLWA 3RWJA 2ESVD 2WVTA 4Z23A 1KA9F 4Y8EA 2YW3A 2BWDA 4GIPD 3RLVA 1OYCA 2KBGA 3H4GA 4JBRA 3QVQA 5KAQG 4RZBA 1JZ6A 2OM5A 4A7QA 1J87A 1WWBX 4Y9FA 3BCFA 4U1NA 2L7EA 5IB1A 4MA1C 1EXUB 3KOXA 2Y6SD 4P8UA 1W16A 4U1LB 4U1JA 2MPAH 5DFWH 4G8GD 3WD2A 4OQVA 3IETB 1QDSA 1OGTB 5ENWA 1AKJB 1ZAIA 4C58B 1ETZA 2DT0A 5DF0A 3PGFL 4ANXA 4JFHE 2NXIA 1CXIA 2XICA 3UZZA 4PH8A 3IDYC 4OD1L 1VAHA 5AC5A 4HPXA 3DKJA 1P5VB 3T3MB 1Q0XL 4Z3HA 1GC1H 2CNZA 3PWVB 4PR4A 4W68A 2O26U 1HNFA 3CX2A 4XCCH 1L6XA 4FRWA 4GLRI 4HIXL 4UDTA 4IK7A 4XZUA 4ETQB 5IJVB 4QXTA 3KPRB 3QWNA 4Z3IA 2J88L 5F2LA 5I1DB 4BEUA 1CU4H 2C34A 2Y25A 2IMMA 3E2HB 4GY4A 1CCWB 4N8CL 3S9ZA 1KXQA 4FQ1H 1JXKA 3DX1A 5I1LB 3FU6A 4Y9MA 1BZQK 2P44B 3MRRB 1LXMA 2A7BA 1TXKA 3TZVC 3F5LA 4UNVA 1ZHKB 4XIAA 2Q02A 4GXUN 4O1BA 2POTA 1GW9A 1XF1A 7PAZA 5F2MA 1A4KA 5D7IB 3GMRA 4JQIH 1L5GB 5LBSA 2PETA 1R6WA 3MSYA 2OPJA 1PZDA 4MTMA 4OCMC 3N4FA 2NZ9D 4X63A 1VFSA 4EN3D 4FFWD 1U2YA 1Y6MR 3CN4A 1K7EA 3UYRH 1RSCA 5AOIA 1GZPB 4OJAA 2EDQA 3EDDA 3HC4L 4G80A 3PUCA 4PWJA 5EU3B 4XVJH 3RUGB 3SGEI 1ZGLA 3W5NA 2EDTA 2YA2A 2HJFA 3OJVC 4HQQL 2Q86A 5AYUH 5GSVB 1J1PL 5CJQH 3RF9A 4ZMWA 2EUZA 1ULVA 3SD5A 1SQMA 2WB7A 2X1WL 2J1WA 1OAKH 1I9RH 2R0ZH 4U6XA 3AVEA 3FZUD 5GRWA 3MA7B 1OF0A 3EAKA 3WHXA 4QG8A 3R0UA 3T6VA 5E9DE 3CMJA 3QJXA 3MA9L 3FJ6A 1RSYA 5LXGH 5I71B 1OFDA 1SJHB 1UD5A 3MHZA 3MROB 1A3LH 3IXAA 2D20A 4JTRA 5LKYA 2ALWA 1GKRA 2YRPA 3M0LA 3CL8A 4W81A 3PANA 4UFHA 4OV6F 1V7MH 1DFBL 2BSSA 4ZW6A 5G4HC 5M5DA 4WKZA 3AT8A 3HG1E 2KYIA 3VVVA 5CFHA 3CZFA 4K7FB 2REQB 3U30C 2GYIA 3WUBA 1HI6B 3RDTB 2CDGA 2VFIA 1RU9H 4PY7B 2OEJA 2X28A 3U6XA 1POJA 3QXBA 5EMLA 1IXQA 1ZVYA 4GOSA 4JFDB 4UILH 3QXDB 3ITOA 1L3NA 1FVEB 4R8WL 1XSJA 4TNWK 1NOWA 3IU4H 3W1UA 4AQAA 1BWMA 5FA5A 5ESQA 3CFCL 2AK1L 3CZGA 1NP2A 2DVXA 3D39E 4XPGH 3RPIA 2VXUL 2HK0A 1VCVA 4D6IA 3INUL 4FR1A 2WAQA 5FJUA 4FFYH 4PRPB 3HURA 3N2TA 1H50A 4OOUA 1UT1A 2F54A 3O3EA 1FO0L 4ZOCA 1FNEA 3L9CA 3LOTA 4ZOEA 4U10A 2A0NA 4WY0F 4DJDC 1H5BB 2P8PA 5F4WA 3TXVA 1E8WA 4FEZA 4YHGA 3IDJA 3KAAA 1YNLL 5BUAA 4F92B 1DZBA 2V68A 4UTCA 1N26A 3G5VA 3OP2A 3QJHB 3VA6A 4AVHA 2YGOA 1Q6RA 2Z93A 4IMGA 4M0XA 3CO8A 3OHIA 2JK5B 2NW3B 5JHDB 3K71B 5A2FA 3FTWA 2HVKA 3PG2A 4WIQA 5HGAA 3AXKA 4GP4B 3NJXA 4GZEA 3T4WA 1UW9A 3IU3A 4MQXD 4FQPA 3TT3H 1B4EA 2X70B 1S9VA 2FATH 2Z0BA 4YFDB 5A6MA 1WUFA 1WCBB 5FM8A 3DBNA 3LHUA 3QJAA 1UKTA 3ZKXB 4HJUA 4ATTA 3FEQA 3UZWA 5CPQA 1EAPB 5CSGA 4ZAKD 5D96B 4JS3A 3R7MA 4B27A 1G0YR 1N8WA 1MQ8A 4Y8AA 3V6OC 4R97B 3QDMB 4OI9A 2P5WB 3TN0D 3BW3A 4GYFA 4JQAA 1KB5L 1KTRL 1E5JA 4PJCB 2YAPA 1S9VB 2E6DA 4H8WL 3QULB 1ZHLB 3P9LB 2YXOA 3O4LD 3MXWL 3EHBB 4OLVL 1MI5A 4WCYL 1A14L 4HC1L 5DD3L 5LLIC 2NV1A 2JXMA 2JK5A 2NW3A 3BESR 1FWWA 3LHYA 3QPQC 5GRUL 3SYQA 3N1AA 3URQA 3G5VB 4MX7B 2IDCA 4L4JA 1J12A 3E2HC 3P3UA 2ORBH 3HPLA 4OFQA 4PJDB 3H22A 3OVQA 4KBXA 3FQWA 3NCJL 4YTSA 3E2RA 4A68A 1VD6A 2X8RA 4CA4A 4LHUA 2I9LB 4FTVA 4NZUH 2J79A 1TZOA 3SIMA 1GS6X 3N1FC 4ZSOA 2VDOL 3BQUC 4F1SA 3CMOL 2Y5SA 4YDLC 1MFAH 3H3KA 1JBJA 1BYPA 1WKDA 4Z7AA 3DXIA 2ADIB 1EO5A 1VCAA 2NY7H 3NQAA 1P0SE 4L8DB 3DI0A 4E2DA 4MASA 3VW3H 1N6VA 4HIEB 2ZXGA 3ARFC 1B4KA 3LLFA 2E8YA 3MLUH 3LRSB 1S8DA 5D9SA 3ICJA 4GO8A 5D2NE 3GHSA 1HI6A 1K7XA 3C8KB 1V4YA 4BF7A 4RX4A 1TJGL 2AXJA 3WF0A 1CFMA 3I9AA 4UBDC 1Q6GA 4GG8A 2DQTH 2DI9A 1VF8A 4WWPA 2OR9H 2ROYA 3EOBA 4K9EL 3ABQA 3WJWA 2YPVA 1DTUA 1EHLL 3VXSD 4WDWA 1W2PA 3G6AB 1F9CA 2AXHA 1ONQA 5I1AB 1FWCC 3U9UA 2AEPL 3GUFA 4NP7A 1NFIA 3WO3B 5A8GA 3KYMA 1ZVSA 3QFDB 4RZKA 1OFBA 3R1ZA 3ZVHA 4AC7C 1AZ1A 2WXDM 1MDLA 1U30A 3ATZA 4LVDA 2WMJA 1F4WL 3VKAA 3LCGA 3B9KB 1A3RL 4WEMB 3Q6FB 2BVWA 3W74A 3PNWA 1S6NA 2B31A 1VFAB 4X4ZA 4JG9A 5C0EB 2EDEA 2QCNA 3B9KC 5EU3A 2DW5A 2VN4A 2R1WA 1BYOA 3K91A 2IGLA 2K6YA 3KDMA 3T8XA 4K2UL 1V08A 4ZO9A 3GD1C 2OSYA 5AVWB 4ORGA 2D3NA 5I76A 5DEJA 1SSDA 3ZE2B 2J88H 3CHFA 3NO3A 4UINH 3EG9B 5SWSB 4U5IA 3W7LA 2X4NA 2W9EL 4G7VH 2CIIB 3QRBA 3EX4A 4GXWA 2NT0A 3TYGH 3WN5A 1GOHA 2BSED 3H9SE 1EAQA 3PHOA 5JLZA 5I66B 1B4LA 1OD0A 4QDGA 4GA8A 2VDPB 5ANMA 1GGUA 2CCLA 1G4TA 3GH4A 3BW9A 2XQYG 4TUJB 3VWJA 2OZ4H 3QDAA 4JDTL 3TURA 2WW5A 4F2EA 3FDGA 2SEBA 1R2TA 3BGAA 5HHVH 2AKMA 1RK1B 1F07A 2RD0A 5EU7C 3K2MC 5LHDA 4NQSA 1XGDA 2GSJA 4Y1AA 2V5MA 2E7FA 5FJJA 4CQCA 3DROA 1TE6A 1QQDA 1DFXA 2K6ZA 2OJZH 4JFOB 1U1HA 4HD5A 3LRKA 1KW1A 4DQWA 1AKPA 1QVBA 2E7LC 3MT1A 4I9TA 1FZOB 5JMRA 4LLVB 3BCJA 2PP9A 3O3UN 2PBOA 3W86A 5HOSA 1JNEA 1OT2A 1BQHA 3WEMA 1TJPA 2Y85A 1IKOP 3GIPA 4QTGA 5I00A 4BELD 3LS4H 1I7UA 3IETA 3GSWB 5LXGL 3DC8A 2X42A 3MGAA 1XLCA 3SUVA 4L3EE 4U6YB 3K4WA 3OU8A 3GNXA 2DDQH 3ARGB 1QFWI 2VQ1A 3QG6A 4JN7A 2AEQH 5DMLA 2RJMA 3U83A 3TXZA 2IFGA 1LO5A 3KGRA 2WVSA 2CUHA 2OSLB 3FUEA 4RGMC 3PIQB 3UL4A 4CMHB 4IPPA 3W82A 2ZZUT 4S1SH 4EMZA 3BWZA 4BQBA 3ZQXA 4Z9KB 3D0CA 3DX5A 4NEHB 3GX9A 3UXKA 3VFCA 5DUPL 2A73B 5AKVA 1W72H 3JUYA 4WFED 3GR8A 3WQEA 3P11L 1PL9A 3L81A 2IAMA 2L8AA 4I13B 1HQRA 1RZKL 1LLZA 3BP7B 3T8QA 3BOLA 5LGHL 3E9UA 3HW7A 3QFJB 1S9WB 3GXDA 5BRZE 4ZB5A 1AHWA 4XE5B 5FGSA 4AT6A 2O1AA 2PP7A 1JNHA 1CICA 2B4CL 2OL3A 3P4NA 5DXWA 4ZFOA 1YTEA 2R0LH 3GG0A 3VE7A 5HQMA 1RZJH 1FPTH 1KR0A 1U9KA 2LT9A 3QPQD 1QR1A 3MFFB 4J39A 4GJ1A 1L6GA 3E6HA 4FQ1L 3UYPB 5EO9B 3U4BL 4FQHA 7TIMA 2BVEA 2PU1A 3BOFA 4M19A 1UIOA 4I7WA 2J66A 3SDXE 3WUGA 1BBDH 4HCRH 3RGVA 4J8RA 3TGXA 5KAQF 3EKZA 2W0PA 3ZJ8A 3NJ3A 1T6WA 4FEMA 3ZRCC 2OQHA 3LLDA 1OGSA 6TAAA 2EE2A 2X1QA 3F12A 2RGLA 3QGVA 3W70A 4RFOL 1DWAM 1REQB 2OWXA 4JHOA 5JVLA 3FOMB 3P81A 1UXMA 1LBLA 3P9WB 4P7QA 4WK2B 1GC1L 4MNQA 4HOZA 1M03A 3K2UH 5E9NA 2J2ZB 1IM9A 4US6A 1L6FA 2CLRA 1CC3A 4J3OH 2F53E 3L6FB 2LW3A 2IAMC 3H23A 3CTTA 3K6SB 2E86A 4NO0D 2ADJA 4FE9A 2WYTA 3MRCB 1CU4L 4KHXL 3D0AA 1SW3A 3MRKA 1XYLA 3GUWA 1FIEA 3MUIA 4KI5D 5C6PB 3F7RA 4PJEA 5FOJA 43CAA 2Q6WA 1JQXA 2X0VA 1NIUA 3SGKA 5EEVA 2HFGH 3GTXA 2OK0L 2J6EL 5F7FA 4EEEA 2EG6A 4UTBH 3SPVA 3AU1A 1L9RA 1UWGL 1T1WB 4ODWA 3VVWA 3WE6A 3CFBA 4HPGA 1RJLB 5HHNB 3F84A 4WNQB 2MCAA 1KB3A 1AXSA 3UBXA 3W6LA 1TZHA 1WBHA 1A8JH 1W17A 2Q01A 4ATDA 1ITXA 4XSMA 1E5NA 1T1XA 4P5UA 4YL9A 1COBA 4KC3B 5EULV 4BEIA 1FCQA 5CGMA 5DBUA 3BPOB 3D18A 3FRPA 4OJYA 1OD8A 1UACH 5E6ID 2OGJA 1FYTE 3ASOB 5MENE 1WOAA 5I0WA 1ZBWA 2C1HA 2XJ7A 3IUIA 4G8EA 5K59F 5HUOA 3CCHB 1MVUA 3NDZA 2VL5A 4HIQA 1SVBA 5K5YA 2BP8A 1V03A 1GC1C 4CNIB 2NQDA 3V5KB 4R26L 5DMKB 1XLEA 2I16A 3FVDA 1ZT1B 4XX5A 2MEJB 4ELME 4Z78A 1WO2A 3K8KA 3W1PA 2H7WA 1E6OH 1F58L 4IIHA 4IP5A 3HC0A 2EPKX 3PSWA 2WXLA 1Z6KA 1I8IB 1XR8A 1X5XA 3ECBA 3F01A 4AEFA 4FG6D 1I3RB 2AQTA 3LVEA 3U7AA 3QVAA 1SFJA 4H04A 1WGVA 2OBGA 3OKKA 3QUYD 4PVLA 4YBQD 3R8BB 4L2YA 3S3PA 4EN3C 1A5NC 4IGHA 4P23D 3RZCC 2QCCA 3HPAA 3CZJA 5CP7A 1GOMA 1OE1A 2EHHA 3RDTD 1HE8A 1LO0L 3NK3A 3ARDA 3QNZB 3ROLB 4JZJA 3MW7A 2PCFB 2IXQB 4QE5A 2VAAB 1WTLA 1Z0MA 4XMLH 2CBVA 2FGBA 4JHZA 4JQVC 2WWDA 2YUZA 4P2YA 5ALCL 1RZPA 3H24A 4Q8BA 5D8WA 1THFD 2X6AA 2A3EA 4DELA 4WW2F 2DQFB 1XFCA 3E6EA 4NZRL 1IT7A 1HXMB 3Q06A 3OGVA 2PXYD 3JVGA 3S3BB 3A0OA 1ZTXH 1MCPL 1E6SM 3VOHA 3BVWA 4FMFA 3BAIA 2H0JA 2WVVA 4FLHA 4NQVB 4Q4QA 1FL5B 3V0VB 3H2FA 3EB3A 1MLBB 3BYTA 5L6YH 4FXKC 2AQRA 3B4UA 1WPCA 5DLLA 1RAMA 3UCQA 3KDOA 4X0VA 2HVJB 1F3JB 2W66A 2FLBT 4DKAA 1Z3NA 4E4UA 4Z7OB 1FVDA 1I2PA 3KVLA 3QEZA 4XH2A 1GOXA 4KKAC 5BZZA 1X3DA 4KVCL 3QI9A 4JY5L 3FB5B 3VA8A 1KJ2L 5SV3A 1AQKL 1PLGH 4AVKA 4W5UA 1L0QA 3TW9A 3HE6C 2YBUA 1FWAC 3VIMA 4DWSB 3FTXA 1BD2A 1QACA 5IHRA 5HJDA 3IGKA 4A3YA 3BN9D 5E6IC 3RNKB 1JNJA 2DV6A 3PXJA 1ZHAA 3WTTA 4XK2A 3WH5A 2V2TB 3CQKA 4IQDA 3P0VH 4IOSA 4LP5A 2WN3A 2RB8A 1WA2X 1BYCA 1AR1D 1E4IA 4JTGA 1Q65A 3W1NA 4JIRA 1NBVL 4IU2A 2I9EA 5D1QC 1JZ8A 5E4EB 2PRHA 1N5AA 4LBUA 5EUOA 2EVFA 2Y7LA 3LNPA 4HU2A 2Q09A 3H0TA 3VFGH 4O54A 2ZF8A 2GTZB 1ZTMA 4UOJA 5KZEA 3QA3A 3FLUA 1X5ZA 3WFHB 1EHLH 2E59A 4PRHE 1DUZB 4BFIA 4ZS7L 1INDH 2BLFA 4G1KA 4O4WA 4O2EB 1U8LA 1OLZA 3MRJB 4PP2B 4TSBH 1ME9A 4AF0B 3E0WA 5KSAA 4O53A 5E99L 2YLHA 1CFNA 3HE7C 1OYAA 1BFNA 4P4KC 3MBED 4JQIL 1UWAA 1F3WA 2E25A 1YEDB 1E6RA 2QSQA 1JDFA 4BWWA 4NQEA 4P4RB 4E41A 1LBFA 2PLKA 4Q6XA 1G7IB 4YNYB 4HYWA 3L9RA 5CC7A 5HMFA 3BVUA 4UINL 3ARBA 1HFUA 3FX4A 4WOQA 2D03L 1GOKA 1NF0A 3L66A 4LLWA 3MTRA 4K2UH 1MOEA 1AS8A 3FT4B 3PUUA 1EDYA 4J6RL 4JM2B 4NI6A 3O8AA 3KPRE 3L1OH 4QRQA 4RDBA 1IM3A 2YQGA 3MV8D 4AM0B 1FLRL 5J11B 3GDKA 4WGKA 3JU2A 4LNCA 1U3YA 5D2LA 3RHWK 5DCDA 1HC1A 1CVSC 5KG9A 1ZANH 4FCHA 4LRIA 2PLJA 3AT9A 2WTRA 3B2VH 2Q8LA 1SO3A 1M7IA 1CR9L 3KBSA 2B59A 4LSTL 2JFEX 3IIPA 3PC0A 1TJ2A 4JQ2A 1IEAA 1KCLA 1E67A 2YO3A 4H2AA 2JQAA 5LN8A 3PPFA 2VX5A 4RA0C 3C5SB 3LNHA 5LN4A 3QNXB 2VZSA 3C12A 2OXHB 2CWRA 5KVGL 3HJZA 5JPNB 4X99A 3BQUD 4PREA 1EL3A 1GYCA 1ZJBA 1FA2A 1TPUA 3AO0A 5IB3A 1JR1A 4Q4PA 3PQYB 5SX4H 4R2GD 1WEJH 4WF7A 4QDPA 2H26B 2PYEB 1DUYA 3QRGH 2VQTA 5KTEH 1V6WA 2XV3A 3SE8L 5AENA 3LTSA 4JIIX 4UT9A 3TC6A 1NWTA 1J0HA 3QZOA 4ZTOH 1JPMA 4H13C 1HCYA 4FXKA 4IIBA 2UY6A 4L3CB 1UR4A 4LU0A 5D5MF 1FFRA 4KHTH 4UQ9A 1MNSA 4JTIA 3OZLA 3O6FD 4UTTC 1A0QH 4F9PC 5BJTA 3O2DA 4XHJD 3IFOB 3PP3H 2Q9OA 1P1XA 5CIPB 4W87A 1II4E 1G6RL 3FB7B 2DWDA 4BJHA 5CILL 1IO4C 2FZDA 2HROA 1N55A 4KESA 3W88A 3SY1A 1IFHL 3RDTC 3KP1A 1EFQA 1TQVA 4CCZA 1G7PB 1R34A 4TSCL 4NFDA 2DQTL 2X4TB 3C2YA 1EA0A 3TNBA 1DYZA 4UF7C 1EH9A 3QUML 5CEZH 4FG4A 3TO4D 1ITQA 1LYXA 2AQOA 4TVSa 4UNLA 2IPWA 4PRWA 5HR6A 4UDUB 4G6JH 2C3ZA 2OW7A 1IWPA 4PCNA 3IJSB 2OR9L 4K9EH 3LKNA 3DGBA 1LOLA 3GHEH 3P60A 3B1UA 4I3RH 2DQCH 3D85D 4JREB 1VENA 4LKCB 5E03A 4Y7OC 3DFTA 4J3TA 3W9DB 2FZBA 4S3CA 4NM4H 4P5TD 2DTSA 5FAGA 5CAHA 2FGZA 1TZZA 3VO0A 3KTSA 2FO4B 3QKZA 4I3SH 4X5RA 3JSSA 4NUMA 4S1SL 2GY7B 1N7ML 3D87B 2EH7L 4HPYL 1K2DB 1IL1B 3CUPB 1TVPA 3EBHA 3NQCA 4NQXA 1J6PA 1CYXA 3JWOC 2GK1A 3V4BA 1BEYL 5HMDA 3GZ3A 2J9ZA 1OAUL 4L3EA 5CZRA 1BTMA 3JQOB 1QFWM 4FB7A 1OTTD 4PV1C 3MHGA 4UR8A 3EWUA 3F4CA 4PRBA 4X7TA 3T0ED 2OTWA 2V5SA 4JG5A 1SJCA 1NGZA 1EJSC 2XXMB 3B2XA 3VC5A 3UAJD 2QSCL 4M3HA 3ZY7A 1QW8A 3GM0A 3H9SA 3SE3A 1UP2A 5IB5B 1QBAA 5ABGA 1WRFA 3H9YA 3K2UL 2W9EH 1AR1C 4G7VL 5IWLA 1ZCOA 4A38A 1QCWA 1UR9A 2IS7A 3L3OC 3SCOA 3L5XH 1AP2A 4PG2C 4BE6A 3LV3A 2F7OA 5H37G 3VSTA 5GS2H 5EEUA 2D23A 1R3JB 2HG5B 3QDME 1MDTA 4DZAA 1QYGL 4WUUB 1C8VA 3GHTA 3GO1H 3ITVA 2Y9RT 5T5FL 5DTFA 3F8UB 2JQMA 2CQVA 2AKZA 2XH2A 5LNVA 4AZIA 3SPIA 4L4VE 2Z1WA 4M6VA 2X4PB 3DG6A