2YIHA

Structure of a paenibacillus polymyxa xyloglucanase from gh family 44 with xyloglucan
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
511
structure length
511
Chain Sequence
KTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDWQHSSDNYLCSNGGLTQAECEKPGAVVTSFHDQSLKLGTYSLVTLPMAGYVAADGNGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVKGYALDNEPALWSHTHPRIHPEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYKDLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETKKARMQAPRTLWDPTYKEDSWIAQWFSEFLPILPRLKQSVDKYYPGTKLAMTSYSYGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGDTSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGFDKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CEL44C
publication title Structure and Activity of Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44.
pubmed doi rcsb
source organism Paenibacillus polymyxa
total genus 178
structure length 511
sequence length 511
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12891 Glyco_hydro_44 Glycoside hydrolase family 44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2yihA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yihA02
1O7AA 2JALA 2FHCA 4B3LA 1CDGA 4AIEA 4QAWA 4MNMA 2F8QA 2J7CA 3PHAA 1J0KA 3PTKA 1UZ1A 3DX3A 4J3UA 1JD7A 4LQ1A 1CECA 3T0AA 2DH3A 3HJEA 4ATLA 1E72M 1LWHA 3WQVA 4IISA 3SURA 2PWDA 3D5HA 3WNOA 1IZKA 4B9YA 4W7UA 1UWIA 1UD2A 3DYMA 3EJQA 2WHJA 1R47A 1XYZA 3LX9A 4NRSA 3DECA 1UUQA 3A24A 2YFNA 1BYCA 4CD6A 4JKKA 2ZUSA 5AYIA 1CBGA 1UD3A 1GHRA 4BF7A 3GH4A 3MMUA 3N04A 1NWSA 3VINA 4JL1A 4H8HA 1J01A 3LMYA 5JBFA 3CIVA 3LPFA 1A3HA 3AS2A 2JFEX 4TTUA 3AMDA 1X6LA 4UTFA 1C3FA 2A3EA 1H09A 3CHEA 4CN4A 2PBGA 1H11A 4PMOA 1R7AA 1KWGA 4WKAA 2NT0A 3AICA 4NZJA 1KCLA 3L4YA 5FL1A 2F2HA 4U5IA 2DSKA 3MUZ1 4MB5A 1QI2A 2DDXA 2G3JA 5ABGA 3TTOA 1HJXA 4Y7EA 4FLRA 1W9XA 3W81A 2WCGA 2Y8VA 3W24A 4Z2JA 3BUBA 1VENA 4W88A 4NZCA 3WH6A 1US2A 2WMIB 3SUSA 3VPLA 3GNRA 3T2OA 1CYGA 6CGTA 1EGZA 1G5AA 3OLDA 3VD4A 3AS1A 3LRLA 2J75A 3U7BA 3GXDA 3ZR6A 2YLLA 4YHGA 1K9TA 3WDRA 3IANA 1E5NA 2PWFA 3BAIA 3OG2A 2YDQA 2F7RA 2FHBA 2RGMA 3S6TA 4X0VA 1UKPA 1Q6DA 5GNZA 4TX8A 3AZSA 5E0FA 4HU0A 1D3CA 1NARA 3ARYA 3BLPX 5CGTA 2YL5A 4AZCB 5C71A 1IT0A 4J3SA 5DT7A 2WM0A 3FHQA 2XFFA 4UOQA 3THCA 4UNIA 4W84A 4W5ZA 3ARRA 1CGXA 4W8AA 3W29A 1VEOA 3L4TA 4HOXA 1V6WA 1W2PA 3EJPA 2JIWA 4DUXA 1HL9A 1KGWA 1UQYA 3UETA 4FF5A 1QWNA 3N17A 4W93A 3AQUA 4XUYA 2X05A 4LYPA 3CLWA 1H0GA 3LXAA 4PTVA 4MPKA 3A47A 3EMCA 1NWTA 2CBJA 2J78A 3VD5A 2ZXBA 5I6SA 5A2AA 1KXVA 3VM5A 3A21A 3WMBA 4WF7A 2CYGA 1K9EA 2WZIA 1E0WA 1HTYA 1C8YA 3I3DA 4DO4A 1W9PA 3ZJKA 2DGAA 2UWFA 2ALWA 1MWOA 3EYPA 2V3EA 2EBNA 2C7FA 2J7BA 1JG9A 3ECQA 4J3TA 3OZOA 1VF8A 4IPLA 3AYRA 2MANA 1VIWA 1V6YA 2UY5A 1FFQA 2GUYA 2W91A 2CXGA 1Q6EA 2Y24A 2J47A 4AMWA 1JDAA 1T0OA 2VT0A 5CXPA 3SIMA 1F4HA 4E2OA 1PX4A 1AMYA 4F9JA 1JNEA 2VVNA 2XPKA 1TMQA 1KQYA 1BYAA 1ISWA 5FCZA 2WVTA 4GQQA 2VCAA 1CGTA 3WEOA 5AY7A 1W1PA 5EB8A 3VX1A 1GQJA 1TFVA 1QHOA 3TTQA 3WUGA 1GHSA 5BXSA 5F7UA 2GJXB 1YQ2A 1HVXA 3PTMA 2VX4A 1NOFA 3NJ3A 1HF6A 2EAEA 5A6BD 2OW7A 1W32A 2YJQA 4AC1X 2XM1A 2F7QA 3ZJ6A 2BNJA 3UEQA 1BGGA 1DWFM 5CPQA 2FGZA 3CH9A 3WD1A 3WH7A 3TV8A 2X8RA 3VSUA 4OZOA 5E09A 3THDA 4PMYA 3O9NA 2VX7A 4EK7A 3UR7A 1ODZA 3BLBA 1VBRA 3POHA 3WNKA 5AC4A 2JEQA 3VDAA 2D1ZA 3TTYA 3FW6A 2EO7A 3WDIA 1EDGA 3W25A 2J74A 3T0DA 3RILA 1XSIA 3PTQA 1FH7A 4Z2KA 1WDQA 2W5FA 1UKTA 4GIAA 2FE0A 2PBOA 1CIUA 2EPOA 6A3HA 3O2LA 5A94A 4CD7A 3AJ7A 1HWWA 4HA3A 1E71M 4OBSA 2D23A 3BAYA 3CHCA 2ZX7A 1R33A 2XWEA 2CHNA 2CCRA 5GNYA 1TA3A 3AZTA 4PMQA 1I1WA 2EPKX 3GM8A 4Q22A 3EMQA 5A69A 2OYMA 3PZOA 4C7DA 5M5DA 3UG4A 2WMFA 2YBTA 3RJYA 1QW8A 1H3GA 3EDJA 4MB1A 2YA0A 2XN0A 3LXCA 3PZGA 4OOZA 1UYQA 2WMKA 4LGXA 1DWJM 1E43A 4XZBA 1TQUA 4PCSA 2CEQA 3VIKA 4DO6A 3IGUA 1UOKA 1BHGA 3CMGA 2BY0A 1VEPA 1QHZA 1HJSA 3WDJA 1UR4A 3KL0A 2Y8KA 2JE8A 2J4GA 1XH1A 3E1F1 4W85A 1BVNP 2DT2A 4FNRA 1CXHA 1B3XA 1NH6A 4PMVA 3TA9A 2XUCA 3MSDA 3SUWA 4YN5A 1MW2A 2AOSA 4FNSA 4KGJA 3RMEA 3CZJA 3AIWA 2J8GA 1F4AA 1H1NA 3AXXA 1TCMA 3WF2A 3AHYA 4B16A 4J3XA 2QHAA 2OSWA 1QWUA 4P7QA 1UA7A 2G3NA 3MANA 4WKFA 1VJZA 1NP2A 1PEZA 3AS3A 3EJSA 4ACZA 4MAVA 1QI0A 3SCRA 1GQLA 2PF0A 4XV0A 4R27A 5I2UA 1JZ4A 2GJPA 2CERA 2QPSA 3WNLA 1KXHA 2VL4A 5IFTA 1V3JA 1EDQA 5A8OA 1UR2A 4P8UA 1Q6CA 3KE0A 2CETA 3PZ9A 2DH2A 3L4WA 5ABFA 3ARWA 1TG7A 2DSWA 1V02A 1DWAM 1EO7A 2W61A 3WMCA 5CZKA 1IZJA 3BVXA 5BRQA 1SFSA 4UR9A 1EH9A 1ISYA 3PZNA 5M17A 5E0CA 3PZQA 1FHLA 3AHTA 5BYWA 1UD4A 4FLOA 5E9AA 2HVMA 3CZKA 3DHUA 1XC6A 2YDRA 5AC5A 2IUZA 4MB3A 1J0IA 3KEHA 1E6ZA 3RCNA 1FA2A 2ZXAA 2PB1A 1E4MM 1QVBA 2NT1A 2FH6A 3W53A 4RE3A 1DP0A 3NSNA 1UQZA 5E1QA 3PZUA 1LG2A 2WVSA 2ZX9A 1BYDA 4J28A 2BXZA 3W82A 4CUCA 1OD0A 5ECUA 3WL0A 4NXKA 3N13A 1PPIA 4JZ5A 4GO8A 4HOWA 1J9YA 3W6MA 1QHPA 3GTNA 1Q4NX 2XM2A 1BTCA 4EANA 2D0FA 3M07A 2QPUA 1V6XA 5A95A 2D0GA 3OGRA 1M04A 2V3FA 4AYGA 5BWFA 5A8QA 1SZNA 4HA4A 2ZX5A 5A2CA 2ZUTA 2DT3A 1TQVA 5E6YA 1MQRA 1PIFA 4HP5A 4FNTA 3VVGA 3VDHA 5A6AA 3K8LA 4H7VA 1GORA 1EA9C 1GVYA 3BH4A 1FH8A 4P7RA 3M6DA 1ECEA 1OIMA 4DWSD 1W1TA 1Y7VA 4PMDA 4D6GA 1HKKA 3CBWA 1XCXA 5I5RA 4AIOA 3J7HA 1V3IA 1C93A 4GI6A 5LA2A 5HPCA 3GBDA 4AZIA 1H41A 1GOMA 4ATWA 3DHPA 2ZX6A 3L2LA 1ISZA 5IXEA 1CTNA 4CD8A 3U5UA 2A3AA 4W7VA 2XVNA 3GH5A 1NWUA 3MMWA 3WD0A 2QV4A 4MDPA 1DHKA 4NF7A 1XD1A 2ZUMA 3WF1A 2Q8XA 1MVYA 2WLYA 4U2ZA 2QMJA 3FHAA 3SCVA 1V3KA 1UG6A 1C7TA 3OA5A 3L4ZA 1TVPA 1PS3A 3ZSTA 1QX1A 1WDSA 1H5VA 3NSMA 3OLGA 3WFZA 1B31A 3VO0A 4AIUA 2O92A 1OM0A 1UR8A 1B3VA 2WHLA 1GJWA 2VCCA 1FFRA 4UFHA 1JAEA 2XFYA 4HPGA 5D9PA 1DTUA 3B8SA 1K9DA 5A6KA 1L0PA 4WLCA 2WMJA 1P6WA 2EABA 3VX0A 1O7DC 2WKLA 4UFLA 3K46A 3BGAA 1MXDA 1WO2A 3GNOA 1VBUA 3ZSSA 5CG0A 3WUBA 2G8ZA 4J27A 1WZMA 2PWEA 1CNVA 4P7OA 3EDDA 3AIQA 2XGIA 4M56A 4KGLA 3KZSA 3K4DA 4PMRA 3AROA 1QNPA 5A6LA 4YHEA 3WY3A 1CXLA 1K9FA 3WF3A 1C8QA 7CGTA 2X1IA 2DEPA 3WNPA 3L4XA 2OW6A 2YOCA 3WFLA 4N0RA 4LXFA 3VKKA 4YPJA 3WH5A 2VUYA 1JZ2A 4JHZA 2VRQA 3KLKA 1JD9A 2XVKA 2JIEA 3MSGA 4QLJA 4M29A 1CXIA 4BQ5A 5D9OA 3VD9A 3BSGA 4BCEA 2VNCA 2GDVA 1J0ZA 2WB5A 5I24A 1C92A 2EXOA 4HA1A 1GCYA 1E4NA 3ARSA 3NIYA 4PTWA 4JIEA 4ZFMA 3ALFA 1W9DM 2WAGA 1E6RA 5IDIA 3MO4A 4DO5A 2GVYA 3G6LA 2WKGA 1QI5A 4P7NA 4U3AA 2YBUA 4CKQA 3CHDA 4RE2A 4GINA 3O6AA 3U7VA 4DM1A 1QPKA 1UH2A 2YA1A 2IXUA 1CXEA 4WSKA 1HXKA 4IM4A 1AQHA 3VGBA 1VFMA 1EXPA 1R46A 1WP6A 1R34A 4KMQA 1WZAA 3CZ8A 1OWQA 3LPPA 1J11A 1H0IA 2DQXA 3GH7A 1HT6A 4F79A 1ZS2A 2VO5A 4V27A 4E4PA 3HG4A 1GPFA 4AMCA 2F1AA 1G0CA 1PJ9A 1W9VA 2WVVB 1US3A 2O9RA 3T2PA 3VGGA 1VFFA 4NI3A 2DPEA 3WNNA 1OINA 3VNYA 4UCFA 1CZ1A 3NSXA 1J0JA 1XHGA 1DWGM 1WDPA 1VFUA 3UESA 2XG9A 1WZKA 4ZXOA 1BGAA 1V0MA 4UOJA 4ZE4A 5M3WA 3WQ8A 3WQ4A 2X09A 4TVUA 3MUY1 4AD5A 5LYRA 4JFTA 3TTSA 2ZXDA 4H41A 3U57A 1E1FA 1EO5A 4NX0A 5HDRA 1W3JA 1UKQA 5A2BA 2GK1B 2FHFA 3ZM8A 1V02E 3LRMA 3W26A 1FHDA 4AW7A 3QHNA 2NW0A 3WQ5A 2YL8A 4CVWA 4P8XA 5A8MA 2BHZA 1J0YA 2HISA 4UZSA 2PI6A 2QMKA 1EOKA 4RE4A 1HX0A 3IAPA 2ZUWA 2E40A 4WJXA 1JI1A 1V3MA 3ZT7A 4LYQA 1GOWA 4JFSA 1V0KA 1G9HA 3CPUA 1M53A 3OLEA 1M01A 4XB3A 2E9BA 3EBVA 5HOSA 4H8UA 3WF4A 4P8VA 2D20A 1HL8A 1ZU8A 3D3AA 3ZJ7A 3VIJA 4TXEA 4K68A 2DSUA 1KBKA 3A22A 3IJ8A 4KRTA 1UD5A 2EADA 1E6QM 3W0KA 1ESWA 5KEZA 3POCA 2J7EA 4OGZA 2NSXA 2Z1SA 1GOOA 3VM7A 3VSVA 2WK2A 3SCWA 1WE5A 3WD3A 6TAAA 3VIMA 1QNOA 2Y5EA 4OBRA 1BVZA 2Y2WA 3ZMRA 2WANA 3CGTA 5FL0A 2VRKA 4D6HA 4PCTA 1G94A 1UWUA 3WIJA 3ZQ9A 1UKSA 1K6AA 5CJ5A 3HN3A 1PAMA 3DDGA 3LXBA 1V03A 2J7FA 4AD2A 4DWSB 3GNPA 3WD2A 4E8CA 4J3WA 1JDCA 4P8WA 1KQZA 1V6UA 3IJ7A 4MNKA 2VTFA 1GUVA 4B15A 1LQ0A 3PZIA 3BAWA 3BVWA 2ZOXA 1W3KA 2BVDA 2YL9A 3SCPA 2B31A 3VMPA 1ITCA 1B3YA 1LF1A 1VFOA 4D6EA 1IV8A 3KLLA 2CKSA 1KXTA 2J7DA 4GKLA 1AQMA 5EFDA 1BQCA 1G01A 1HJUA 2JF6A 1XSKA 4PMUA 3F4VA 1QNRA 1NWRA 1E0XA 1FOBA 1MW3A 2G3MA 5JUVA 1KTBA 1B0IA 4EAMA 2CBVA 3OIHA 2OSYA 1E6PA 1H4PA 3WN6A 5IHSA 4U33A 1OD8A 1E3ZA 4DUVA 1SR0A 2OWXA 2DT0A 2VR5A 1JXKA 4WSJA 2IGTA 1UWSA 4IPNB 1AQ0A 2WSKA 2W4XA 2CBIA 3LPGA 1R8LA 3H54A 2XN1A 3HG2A 8CGTA 3NYDA 1HP5A 1R7OA 4M80A 3BUPA 4AD0A 1UR1A 4JCMA 1BSIA 4D71A 4PMNA 3BMWA 4XZWA 3WUFA 4PN2A 3WH9A 2O9OA 4NRRA 3K1DA 3L4UA 5BXPA 5HNNA 3W27A 2QF8A 2XSBA 5FD0A 1PX8A 5DF0A 1DWIM 3PZVA 3AMKA 3TOPA 5HPOA 2WMIA 4CD4A 1JYVA 4OJYA 1E6XM 4W8LA 1JF6A 3AIEA 1BG4A 2EJ1A 1UA3A 1MW1A 5JIWA 4AZ7A 1TZ7A 1JZ7A 3D4YA 1OIFA 1XH2A 1MYRA 1WB0A 1GZJA 2XVPA 3NDYA 2WVUA 1HKIA 4NZFA 3CC1A 3L2MA 4A4AA 2XGBA 3KL5A 4D1IA 5A3HA 1E4LA 3GDBA 1ZBVA 2TAAA 3BCFA 2X0YA 3T0BA 3VUPA 4CD5A 1BAGA 1FH9A 2WXDM 3FY1A 3UG3A 4AZCA 4GI9A 1JF5A 1QNSA 1KR1A 2EQDA 3NUKA 1E3XA 1KXQA 1XSJA 1ITXA 4D72A 1OB0A 3D52A 4U5KA 2UY3A 1LL4A 3WBEA 3SUTA 3VILA 4Z2LA 3BLKA 2BY2A 1B9ZA 3VIPA 7TAAA 1R75A 1ZL1A 3W38A 2O9PA 2ZE0A 3AMCA 1EQPA 2V5DA 4CCDA 3VOCA 3AMLA 4CU6A 2VVSA 2XVLA 4CN1A 4CVUA 1A47A 3GXIA 2UY4A 1BYBA 3VD7A 4MJ4A 4OIFA 3MUAA 2WLZA 1RP9A 4R5EA 2XHYA 4W7WA 2VX5A 3UR8A 5JBEA 3AIUA 3BUQA 1W1YA 3RO8A 2V38A 4QFUA 1U33A 2OWCA 1TQWA 3RJXA 4CU8A 4AZ6A 2WYSA 4A3YA 1PX3A 2WPGA 3CV5A 3IAQA 1MQPA 4PMZA 1G1YA 3CZSA 3DX2A 3CUJA 2CITA 5BXTA 1CGYA 2GJRA 2F7OA 1GNXA 5CPSA 3SCSA 2YA2A 1CGVA 2VURA 4MJ2A 4X0NA 4A3HA 2OYLA 2YIHA 1ZB5A 1QBBA 1C90A 4WK9A 1UHVA 3AFBA 3QOKA 4W89A 2VQUA 3BAJA 3F5KA 4C7GA 4D6CA 1JYNA 1HKMA 4S3KA 1I75A 1QI4A 2A3CA 3IJ9A 3A3HA 3SCQA 2GJXA 1W3LA 5GPRA 1CGWA 1TQSA 4MTVA 4UFMA 4UFJA 2DIEA 1NOUA 1CXFA 5I79A 1JDDA 3DDFA 1OCQA 2J62A 2OSXA 1E56A 2BXYA 3KL3A 2W92A 3W28A 1O6IA 4HMCA 3BXWA 1HP4A 1JAKA 3A4AA 4U3CA 1Q6GA 2WCAA 1UKOA 4LPCA 4AYSA 4AMXA 3DYPA 4JAWA 5GQBA 3CO4A 4UZUA 1WCGA 2EPLX 3VD3A 2Z1KA 1MXGA 3AI0A 1YHTA 4FK9A 5HXMA 2W66A 1V0NA 3SUUA 4B9ZA 5ABHA 1ZJAA 4KWUA 2RGLA 3DX1A 3EJUA 1KGUA 3A23A 3W4RA 4TTGA 1TUXA 3WD4A 5FOOA 2WHKA 1GVIA 2WMGA 4TX6A 3N9KA 3VNZA 3CUIA 3L4VA 1UR9A 3WY4A 1B1YA 5D8ZA 4AD1A 5I77A 4TVCA 1C8XA 3BVTA 3CZGA 3VIIA 4V28A 4MB4A 1S46A 3WQ6A 1Z32X 1LJYA 1R87A 3HU7A 1PZ2A 5LA0A 2WNWA 3B9DA 3AZRA 4Z2GA 2CESA 2C0HA 2WBKA 4L4PA 4CCEA 3GBEA 3WDHA 4AZBA 4F8XA 2ESCA 3RPMA 4X9YA 4PSRA 2W63A 4EE9A 1TR1A 1UD6A 3APGA 1H49A 1HIZA 1XGZA 4HMEA 3B9AA 1J18A 2DSVA 3D51A 4PYSA 3OBAA 1TA3B 4UOZA 1RH9A 3RDKA 2BHYA 1HXJA 1XH0A 1QNQA 1V08A 4J3VA 3AS0A 2VRJA 5BCAA 4W86A 4BQ3A 1OGBA 1JGIA 2X2YA 5A6JA 3CMJA 1WNOA 4URIA 3A5VA 1XV8A 3UG5A 3W6LA 4JFWA 2VZOA 3M7SA 3MU7A 1BLIA 5D8WA 4CGTA 3AHXA 4PBGA 5DEZA 5GNXA 3GXPA 2ZWYA 1PZ3A 3LPOA 2J8FA 2PWHA 2FH8A 1E0VA 2D22A 1HNYA 3AHZA 3PZMA 2WWCA 1CWYA 2F61A 3S5YA 3T09A 3KWXA 3VSTA 5D4YA 1R85A 4V2XA 1OGSA 3WSUA 4UQ9A 3VIFA 1KB3A 3ARTA 4LX4A 2G4FA 3TP4A 1I1XA 3DYOA 1VJSA 4ZENA 4E8DA 1U30A 2VC9A 4L4OA 2BVYA 2E3ZA 5ABEA 1VRXA 4DWSC 1GQIA 4TOQA 5E6ZA 1V6VA 4XX6A 3VTRA 2WMHA 3I3BA 2G3IA 3GZAA 4NSBA 5EBAA 1CENA 3BAKA 4PSPA 2WZEA 3WQWA 4C7FA 5FKYA 5CLTA 1XRVA 1MQQA 1MW0A 4UFIA 4M81A 4WIWA 4ACZB 1W91A 3ARQA 3GXNA 1CGUA 3VMOA 3N15A 1JFXA 1EQCA 4DM2A 3OZPA 4JKLA 4NXSA 1SYTA 2OWWA 3MV11 1E70M 4AY1A 1HJQA 3B9EA 5ABFB 4ZXLA 3WEZA 5A8PA 1JZ6A 3VIGA 4CN6A 3BSHA 4TVDA 2BS9A 1B3ZA 1JYXA 1XD0A 3BMVA 3NDZA 1RP8A 1TQTA 3GXFA 1BG9A 3MMDA 3RM8A 1CPUA 3CZLA 1KGXA 2VZSA 1UZ4A 2XYLA 1EHNA 4UQBA 2D24A 3A4XA 3QOMA 1KR0A 3OGVA 4HMDA 2A3BA 3ZT6A 1V3LA 3GXTA 1RPKA 1EOMA 2PC8A 2WC4A 3ARZA 2J7GA 2X0HA 4MNJA 2ZUVA 3U5YA 1E6SM 1NOWA 2JF7A 4FMVA 7A3HA 4H04A 1B3WA 4MNLA 4HU8A 1VAHA 2WWDA 3SCNA 2F7PA 3WENA 2WHMA 1E55A 1HJWA 4JCLA 3RM9A 3VDBA 1DEDA 1KCKA 4AZ5A 3NCOA 3ZOAA 4M24A 2E0PA 5TD4A 1LL6A 3PZTA 5EFFA 3WMSA 4AZHA 3WNMA 2J77A 1E9LA 5A8NA 3AXHA 3CTTA 3HMCA 3RM4A 1WKYA 3AISA 4MADA 3H53A 4JKMA 1WZLA 2DT1A 4F9DA 3N12A 2YFOA 1XYFA 2E9MA 2JEPA 3W37A 1QOXA 1OT2A 2ZXQA 3BVUA 3OB8A 3BAXA 1UH4A 3ZJ8A 3VDCA 3ARPA 3VIHA 4BS0A 1E1EA 3N18A 4GZJA 4GO9A 4OUEA 3WY2A 3LRKA 4JFUA 1UASA 2Y4SA 2VX6A 3BVVA 5C70A 1LWJA 3ARUA 3M46A 3FAXA 3MI6A 1GOQA 1M03A 2A3HA 5I3DA 2YDSA 2OYKA 3I3EA 3WL1A 4UFKA 4PUDA 3N11A 1GJUA 2FYVA 2XFRA 4B3KA 2EPMX 4D6FA 3VGHA 3OLIA 4Z2IA 3SUVA 1PIGA 3ALGA 3MUIA 5FIPA 3EJRA 4M8UA 1J12A 5BXRA 1JXJA 1X1NA 5A6BA 1OT1A 5BRPA 1ZJBA 1CXKA 1FP9A 1NP0A 5C8BB 3SEPA 1M7XA 3AHVA 4HTYA 5CSYA 2D0HA 3T2QA 1VEMA 1B2YA 5CGMA 1JL8A 2GFTA 1UD8A 5I78A 4QDMA 3EDFA 2VI0A 1MFVA 1LLOA 5I0DA 3MS8A 4AD3A 4TUFA 4S3JA 4ZE5A 1NM9A 3UCQA 1W3HA 4UQEA 4GQRA 4JFVA 3F5JA 1EHAA 1JZ3A 3BUIA 4HZ6A 1KWKA 2FDMA 1HVQA 2YLAA 2D3NA 1R86A 5JBDA 2GSJA 5EMYA 5IHRA 4H2CA 3A6OA 3EDKA 1E5JA 1Q6FA 2UY2A 3CHFA 2WCSA 1E4IA 4PTXA 1X6NA 2ZUNA 2BV9A 1GW1A 5A1AA 4M82A 3GXMA 3HG5A 2VQTA 2X2HA 1JZ5A 3UERA 2O9TA 3T08A 3WELA 4GPNA 4BA0A 2D3LA 2E8ZA 1HKJA 1LL7A 2CHOA 4HZ7A 3WBAA 3K4AA 5DMYA 3H55A 4FLSA 4ATDA 5DT5A 3QHMA 3AIVA 3ARXA 4CU7A 4AEFA 2EACA 1XCWA 1EDTA 9CGTA 2CKRA 2X2JA 1UR0A 3DX0A 1V3HA 2WW5A 1HJVA 4HPHA 4W87A 1C91A 3S5ZA 3WH8A 3WEMA 3JUGA 2J25A 3TONA 1W2VA 1OBAA 2DSZA 4N42A 1WDRA 3SCUA 4D6IA 3BCDA 2WSPA 1DWHM 2V3DA 3AYSA 1E73M 2V5CA 1JYWA 3EDEA 4AXNA 3DC0A 1HN1A 4ACYA 2W62A 1UWTA 3SCTA 2X2IA 1CEOA 2VZUA 3BUDA 2IXVA 2XIIA 1OGGA 3AMGA 2YL6A 1UWRA 3EJTA 3ZR5A 4JHOA 3EMZA 2WVVA 3BC9A 2XTKA 4W5UA 4D6DA 2D73A 2F18A 1WPCA 4QCFA 3ZT5A 2OLHA 2DIJA 1N82A 5CSUA 2BY1A 4QLKA 4J7RA 2F1BA 3ZO9A 2E9LA 1ISXA 4ML4A 4HZ8A 2D2OA 2J79A 2WBGA 2GDUA 2VZVA 4U31A 1U2YA 4FNPA 1EIBA 2GK1A 2VMFA 1ODUA 3FXYA 5CQ1A 2VOTA 4FNUA 4EKJA 1H2JA 3AXIA 1JZ8A 4FNQA 4GZEA 2ZWZA 2QLYA 3SCOA 2BHUA 5DO8A 3A4WA 2VCBA 1D7FA 4GXPA 1GQKA 3K8MA 5D9MA 1J10A 8A3HA 1VB9A 4F66A 4WKHA 5CLWA 1C7SA 1W9UA 1JFHA 3AOFA 3HG3A 4RL3A 3WUEA 3VMNA 1V0LA 3S2CA 2XIBA 1D2KA 3HZ3A 4PTMA 5D9NA 3VIOA 4JL2A 3ZIZA 2VR4A 4PUEA 1MFUA 4BQ4A 3MKKA 1KTCA 5M03A 1ISVA 4AWEA 3WDPP 3CUFA 3FAWA 1BF2A 2WC7A 4ZEPA 2ZUUA 5DFAA 2VJXA 5IFPA 4P7LA 3II1A 3QR3A 4OOUA 4OKDA 3F5LA 2WZHA 1UH3A 2ZX8A 4BZYA 1PBGA 4KH2A 4H8VA 4UQCA 5KZ6A 1KBBA 1BFNA 1LG1A 1GONA 3CZNA 2V3GA 5LA1A 2AAAA 4UQAA 5AYBA 3WY1A 1FP8A 4MAZA 3K8KA 1CLVA 5E70A 3MV01 4LYRA 4AISA 2XJ7A 2CNCA 4AZGA 2AMGA 2E8YA 1CLXA 3OGSA 2XSAA 3AIBA 4QCEA 3FNDA 1BPLB 4D1JA 3QHOA 4DWSA 2G41A 4AD4A 4U2YA 3PN8A 4BQ2A 1E15A 3RIKA 1KFWA 1TE1A 3WF0A 1SMAA 3CZEA 1RD6A 3FN9A 2XN2A 3ARVA 5BROA 1UWQA 1NQ6A 2CIPA 4MDOA 5JIPA 4Z2HA 3AIRA 1ZBWA 1QW9A 3CUHA 5CPTA 1TVNA 4DUWA 2EEXA 1QBAA 2CBUA 2C8NA 1JI2A 1GOIA 3QGVA 3G6MA 2XWDA 1B30A 1JNDA 4KRUA 4FLQA 4HOZA 4W8BA 4GI8A 1E6NA 2VZTA 1ZBCA 4M1RA 5A6SA 4Q7NA 3IK2A 2ZIDA 5A6MA 3VU2A 4D6JA 1E40A 4AEEA 1AVAA 2BY3A 2FGLA 1J0HA 4UQDA 4PRWA 4PMXA 1WAWA 3CUGA 2BFGA 5HBFA 4QLLA 1SMDA 3D4ZA 4GZIA 1L8NA 2ZICA 2BVTA 1GOKA 3WDQA 1W9BM 2CPUA 3N1AA 2XVGA 2EPNA 3D50A 3PBGA 1ZBKA 3DX4A 2PWGA 4PEEA 2W67A 3VGEA 3WKZA 2E4TA 1W1VA 1OSEA 3VGDA 1JIBA 3GYCA 4QP0A 2YKKA 4IUGA 2J7HA 4CCCA 5I23A 1QI3A 2WC3A 1B90A 3VGFA
chains in the Genus database with same CATH superfamily
1MAMH 4RWYH 2QAFA 1O9ZA 3TAKA 4JN2A 3CHVA 1XP3A 4G6JH 4MHHG 5ICZB 3MCMA 4JM2D 2QDEA 5TQ0L 1DKWA 5KVDH 3HJEA 4JO3L 2HKAA 3GQFA 3SDCA 3MB9A 2EKSA 3PY9A 3GMQA 1I31A 3ES7A 5D7KD 2AHIA 3AGWA 2Q02A 4MLIA 2LVEA 2FEDD 1HXMA 3UWVA 2MFNA 4S38A 3UU0A 5HD8D 4LOCA 2CO6A 2ZXCA 5KS9A 1NWSA 3CIVA 4XNUL 3GY1A 4DPAX 4X5WB 3SN4A 4CN4A 5DD1H 5C09A 3R89A 4GYKA 4H2AA 2OTUA 2GJ6A 1H3PH 1A7BA 3MUZ1 1BLNB 1M1XA 2XKNA 1W9XA 4X2UA 2QQLL 3OHMB 4V2CB 5T3XE 2R1WA 3Q0HA 4GMSL 4HU4A 1SW0A 4UYQA 5L9DL 2QZQA 2Z35A 4HBCH 1YMMB 2EAWA 3ULUD 1MQ8A 3WDRA 7ENLA 2P24B 4B4HA 2HG5B 4QHNB 3DKJA 2PP8A 4HU0A 4TQ8A 5C86A 1TZHB 2YL5A 2AI0H 1TQCC 4CQ9A 3SQBB 3QNXB 4ES8A 3BAEH 3SZKC 3KVLA 1WSST 1YYML 4JKNA 4GJJA 2IW0A 2DIAA 2AXJA 4OCMC 2I57A 4NLAA 1EJWC 2AV1B 3I9GL 4FF5A 4FZEH 1NC2B 3SYPA 2WQDA 43C9A 2VXNA 4CSPA 4X60A 3LXAA 3QUYC 3LGGA 1NWTA 5HK4A 1WBHA 2P5EE 3SY1A 4OFVA 1IBFA 3PS7A 3LOWA 4ZUVA 1OP5H 4OZGF 3KLHC 3ZJKA 5DJAB 3DJSA 1NMBL 1SSGA 2C7FA 2DMHA 4DERA 2PXYA 2E6PA 5ID0B 4ANKA 2KZHA 4X4MA 2IANE 1EP3A 1HSAB 1PX4A 1VFTA 3BPNC 3LIZH 4O13A 1TT6A 1TREA 4JTQA 2YRZA 1NGZA 5DDHA 2BWIA 4GRMA 1CGTA 4KKRA 3UNDA 4POYA 1QHOA 2D2JA 1GHSA 4LSQH 3ZHLA 1WDAA 3CUXA 3MP3A 3S4SG 4HJGB 3MODL 4AC1X 4C90A 3IV8A 4OQTL 3QW3A 5E09A 1UURA 2VX7A 4UBDD 3UR7A 1ZHAA 1D9EA 2EIMB 4FP8L 3TVMA 3TSDA 3GM0A 4O4WA 1DFBL 3MRPB 4XNQA 2Y06L 1G9MC 1XWVA 1WDQA 3V6FB 5FCSH 1DIDA 5A94A 4JR9H 3H3KA 2CRIA 4PV9B 4XVUC 1SO3A 1F4WH 3PNWA 5A69A 5GJPA 4C7DA 2IH1A 3UW6A 1PQZA 2YPLA 2YA0A 2AL2A 2VWTA 2FX7L 4KAQL 3FYYA 1U41A 2X3BA 1UC5A 4OIIL 1XO8A 4PRID 4I5XA 1SFTA 3LQAC 3HHSA 4EPSA 4HS8L 2YBRA 4N2MA 2R23B 3WDJA 4L23A 1UR4A 3KLAA 4RVBA 2J4GA 1UM5H 3S37H 5K9OA 2JB6B 4BK8A 3AWFA 4UIMB 2YD6A 3CXFA 1R1CA 5B38B 1U8JA 3SJVA 3RUBL 5SWQB 3SUWA 1MW2A 4D9RD 3SCMA 3TA6A 1YTKA 4F57H 1I2QA 3GMQB 1VJZA 4WWKA 4FQIH 3FO9A 1GQLA 1HXMB 4XV0A 1GYCA 2Z31B 4WV1C 2QPSA 3SFKA 3TN6A 1IAIM 3UOAB 5EUOE 3MTWA 4P8UA 3RX2A 1SLWA 1FBIL 1SQMA 3PL6B 3K6OA 1MFNA 2DH2A 3ARWA 1TG7A 2VD8A 2VFIA 3BVXA 4A04A 2OTUB 4F0HA 3SKMA 5F1VA 1FHLA 3CFUA 1P4IH 5EB9A 5JW4M 5LGXA 2G2NA 3ALWA 3BO8A 3FTGB 3F2BA 2FIQA 2A9MH 3SGEI 4RE3A 2R0LL 5J13B 4MD4B 4AEHL 4KVNL 4QOKA 2X4UA 3VH8G 5DC9B 2C0AA 4X61A 4JAMA 1N5YL 1FFNB 2CK0H 2XTJE 3MRDA 3VWJA 1XGTB 2FTYA 3RTQD 2CBOA 3P02A 5JA8B 3KCLA 5BWFA 5A8QA 2PYED 3ZJAA 1ONQA 1XGRA 3BISA 1M6OA 3DIFA 4AL8C 1K8IB 4O02L 3VVGA 3EAUA 3WJMA 1GORA 2HN7B 1FH8A 3M0MA 2ITCA 1MELA 4K3ZA 3LCXA 5HPCA 1MJ8L 3GBDA 3FH7A 2XZ7A 3EJYD 3IDUA 4X99B 5FECA 3ATBA 1A2YB 4DJDC 2B0SH 3F62A 1Z3NA 2GK0A 3RFZB 5J04A 1I1AB 3O8XD 4JTSA 2GCYB 4H19A 5HANA 1XYAA 1TPWA 1QWKA 3MRRB 1MMFA 2QGYA 2ZUMA 1BJ1H 4XMLH 3SBWA 1NDGA 4PLKD 1UG6A 3PU7A 1E5ZA 2ZKHH 4YC2C 1IKFL 3NJKA 1B31A 1LBFA 1T7XA 3ZVHB 4NZ3A 1NMCC 3ENEA 4HUVA 1JAEA 3OJVC 4JDEB 3KS0H 4PRHB 3S88H 4NPJA 2FJFA 1N10A 1NGZB 4MIMA 1T96A 4TTDC 3G6DL 3UXIA 2Y5QA 1B88A 5H91A 4QPEA 3DI3B 4JX4A 3BESR 2BZNA 3KHQA 4NQVA 3DKLA 2PRMA 7CGTA 3MRQA 3FCPA 4XXWC 3TVMB 1HHHB 2YGYA 1QSZA 3D8MA 3OJ2C 3HGJA 2J5WA 5FO9A 1WUNT 4FQPA 4NZTH 2VUYA 4IX0A 4EXAA 1WBXA 4EOWH 2VQ4A 1BF5A 3JZ7A 3S47A 1DSWA 3MSGA 1IKOP 1TO3A 2E6QA 4BQ5A 2ZAGA 4L6HA 4K8RC 1JPGA 4NJAH 2VNCA 3GIYA 3U48A 2DZWA 5EUOA 1E4NA 4PTTB 3NIYA 4PTWA 4O1CA 1W9DM 4TLKA 4L0YA 4Q2ZB 1PQZB 5EBWB 4LCUA 3ESPA 2RA1A 3VUSA 4JDTH 1L2UA 1NJJA 5B7EA 1XBDA 1MUWA 2QVKA 3HHSB 4RE2A 3DIPA 3SECA 2YBRB 2FGWL 1ASQA 1MJUL 4GW5B 3W02A 5DD6A 1DQDL 1QK2A 4W6YB 1FAIH 4JO1H 1EJVC 3PPSA 4YC2B 1OWQA 1KF9B 3SJVB 1A7PL 3KVJA 3V18A 3AT9A 5CBIA 4A05A 2DAVA 3A4JA 4PRAA 4N22A 3CL6A 4PLJC 5D71H 3RF9A 3XINA 1FNGA 2UZ9A 4WDIA 2P0OA 3VFPA 4L4TE 1BGAA 4KROC 1YLVA 1XG4A 1ZV2A 2I7GA 3ANYA 3HS0C 5DQPA 3NN8B 3M0IA 5K59E 2G0KA 3HJ0A 5KBKA 5K4ZA 3D85D 3FUJA 2YEZB 3QO1B 4S1RL 1LEIA 1M4KA 4QYOB 3TBYA 5E5CA 5JXEA 3WCZA 1KTDA 2QLVB 1EOKA 3ZT7A 4JFSA 2AK4E 1TJGH 4GIOA 4RNJA 1J1OL 2VISA 5CO1A 2CFFA 3BO9A 1ECQA 5FUOL 3UBXG 4KQ4H 2HSIA 1QU4A 3MBWA 3HQOA 1P53A 2RAGA 4JAMB 4L37A 4ESKA 2IANB 3IJ8A 4KXZI 4OCWH 4OZHF 4RQQB 4R26L 4TOYL 1TU2B 2QCFA 1M6OB 3WXVL 1A3WA 2AJYH 3VSVA 2WK2A 2AP2A 3DOPA 1RY0A 5F7LB 1K2DB 1IEQA 1M1SA 5J6GB 1ZGLA 4OBRA 1F8MA 1LOQA 2ITCB 4X9FA 3KXFA 4PCTA 2W79A 2Z4QB 2VOMA 3WJWA 4O1EA 4O58H 4DHLA 3PAOA 4YHOH 3ZHKA 2GK0B 2I5GA 4HT3A 2YL9A 2QPDB 1KYFA 1GK8A 2CLZA 2YGNA 4S1QH 3QEQE 3SDAA 1L9SA 4GUGA 2V6AA 1G4PA 5D7IA 4F2UA 4V1YA 1HW6A 1P6BA 4K7PH 2PW1A 1JJKA 1Z69A 4D94A 4JD4A 3IVSA 3OIHA 5I00A 1H4PA 4U6VL 3VJ6A 3UXDA 2BX5A 1QEWB 3B4NA 1ODAA 2OWXA 1AJ2A 4DELA 5I0WA 2HYMA 5CKGA 1JPHA 3A3YB 3HZMA 1EJ6A 1CF8L 1L6FA 1XF2A 3U0TA 5K9JL 1SHSA 1EAOA 1WBYB 3SQSA 4RMRA 3KH4A 1TJPA 2YEQA 5DF0A 2DM7A 1MAJA 1JZ7A 3ZHNA 4JHAH 4LF2A 1LE9A 4U1SB 4XNYH 1J8SA 2P5PA 3HRZA 1JPGB 3MA8A 5EUOB 4NENB 1KV8A 3GLDA 5JXAH 1P84J 4LCUB 4Y9FA 3TJLA 3NUKA 1E3XA 1P7TB 2C19A 3FFCE 4GT7A 4BFJA 4U7SA 1FUNA 3VILA 4WHDA 4UILL 5FKAA 4O5LH 2A6NA 3NQIA 3EKCA 1T0MB 3W38A 4PY8J 2K7QA 5DD6B 3L81A 4OUUB 4TMBA 4I8YA 4OFQA 5J6HB 2VM4A 4KBXA 5EOTA 1V4YA 4PYGA 3NEHA 2NQ9A 4BRVA 4PG9B 3FO0H 3RJXA 4ZPTB 4N9GB 1BWLA 3PPGA 2D7NA 2XTJB 2VLMD 1BREA 4NM8L 3QC0A 3S8HA 3SCSA 1V5XA 3V5KA 4MWFB 3NA9H 2NUYA 3VFPB 1C90A 2HQAA 2GBTA 4PRNB 2Y6SC 1OAZL 1JYNA 2VXVL 4PJIF 1PYWB 4JFEE 4PRPD 3TBYB 5E6RB 1VKXA 4IP7A 2DIEA 1VRSA 2QKIC 3FU9A 3WN5C 4NRXA 2IV9A 1Q1JL 4KO9A 3T3PF 4BZ1H 3CO4A 1WCGA 4BKSC 4YXGA 3T44A 2WBJD 1KBGH 2VH5L 2WSDA 1EERB 3MHFA 4DP9X 4Y7MA 3U6RB 3NQCA 1Q9KB 2N59A 4A35A 5LXXA 4TTGA 3W4RA 3ZYZA 2LAGB 1SVBA 4LCYB 2WMGA 4P4KC 1IGML 1R0AL 4A2SA 2QKFA 3HG1D 1JDFA 1UB5A 2BSSB 4MB4A 1IU1A 1CLYL 4GRLC 43CAA 4AQZA 4Z76A 3K71B 2WNWA 4ZMPA 1TELA 2LT9A 5GS0H 4PSRA 3G1HA 2W63A 1BM3H 2R94A 2PRLA 3O0RL 1ADQH 3P4NB 2O6EA 3LI0A 2CLZB 5C0NC 4P9HH 2PTTA 1TA3B 2JKIS 4NJ9L 2J8OA 4OM0L 3GSMA 2R6OA 4WGHA 4Y4KC 4H8WC 1XV8A 3W6LA 1DO6A 3WBXA 2XINA 2APVA 2ZWYA 5FYKD 4HPJA 4P5KB 2NX5D 2PWHA 2FH8A 4U7KA 2VEFA 5B1CA 1X7FA 1ZWIA 4KV5E 1RUPH 2ICWB 4JQVA 3D06A 1SYSA 2E7CA 4Z08A 3W7JA 2VDLL 4TSCH 5EN3A 4IOFD 2JLPA 4F7CB 4YUEL 2R69H 1NLDH 3U9UB 4L8SC 1U21A 4R7WA 2OKTA 1K8XA 3U9IA 3RVVD 5F72S 4KESA 3O9WC 3BAKA 3INUL 1XRVA 4L3EE 1ZDQA 2YMXH 5BOPA 4O0KA 4L4TB 4ZW5A 2K9UA 1U93B 2XBDA 3CX2A 4KETA 1K8ZA 4OY9A 4LBEB 4O00A 3E02A 4HLJA 1U4FA 4FXKB 1WZ1H 2AZAA 4JRWA 3NDZA 1BG9A 1KPRA 4IMKA 2UUDH 2IKGA 5F3HA 3NZ1A 2F58H 4IGMA 5BOFA 1MCJA 4MF4A 2AK4B 3WSQL 5JHAA 4ENEC 3GSNH 3ARZA 4J6RL 1JNLH 2RDXA 3VUAA 3HPFA 2NV9A 4OFCA 4K6AA 2HVKB 1BFOA 1BMWA 5MP6L 15C8H 5XIMA 3B03A 2BVQB 3G9VA 1GKPA 1A9VA 2H45A 1NOLA 4XNXH 3DPBB 3DVGA 1OTTD 4XX1G 4O2CB 2Y9RT 4QNEA 1LP9A 4NHCL 3KRUA 3NA4A 5C0JB 5H1WA 2AEQH 5EORH 5EIIA 1F42A 5IBLC 4JHUA 3ATEA 1NJ9B 3S9YA 1TPUA 1CXKA 1FP9A 3QEQB 1YY8A 2VDGA 1DJGA 2QDVA 4WCYH 4FQXA 4S3JA 3J07A 4NZ1A 1JE6A 4KI5D 4ETQA 5DCDA 2D3NA 1ACYL 4Y2DB 3A6OA 4Y5XC 2FGBA 5D4IA 2R2HB 4CCZA 3O7UA 1MUJA 5DMYA 4NO0B 4PJHF 2D2GA 1NM4A 3HFYA 3PWPA 4POCA 1ZVYA 1TR7A 5EWIH 4LCSA 5IJVA 1C91A 5GXBB 1IEAB 3TONA 2Y25A 5BS0D 4N42A 3B5TA 2LFEA 3BCDA 5F0MB 1XR8A 1ZENA 4YQXL 2P8CA 1JYWA 1W72L 1VYRA 4OV9A 4PUNA 3P14A 2KZWA 1EPFA 1KCUL 1ZTXE 4RV3A 3KYNB 5JW5A 4W5UA 5B1BB 1GVOA 4PY7B 4R4ND 3GMRB 3EYQD 2BDQA 1MWAA 3O4LE 4YTTA 4Q74A 2O7QA 3T3ME 1M2OA 1WBZB 4TL5A 1HYSC 3AUVA 4GZEA 2BHUA 5IBUB 3CH8A 3KBJA 4OTXH 4Z78A 2HRHA 3GVVA 4A6YB 3TN0D 4NN5B 5GS1C 4QRQA 2JJSC 1G9NL 1OPGH 4DZBA 3P5ZA 1C9SA 3CVIH 3HZ3A 2C91A 2OPJA 4A1RA 4BQ4A 4AMKH 5D7LE 4EI5B 3UPRA 1IAKA 1MDLA 1U58A 3O07A 5IJDC 3DOSB 2QKSA 1I9JL 2HPTA 4F9PA 2J1XA 1D8CA 2PU0A 2GBVA 5DHYB 3GMNB 4LCWA 2AAAA 1FGNH 4MAZA 5E70A 3EBHA 2EUZA 1I8IA 2HZGA 2IKIA 5E6SB 2JKLA 3OB0H 2NUPB 1E15A 4E9LA 4WO4B 1F4YH 4MD5A 3NH7L 1KFKA 3TWYA 1NIAA 1UATA 1WGVA 4YNYA 4FOUA 1SVZA 4MJIE 4HS3A 4Q7NA 3MRHA 5L6YL 3VU2A 2DYPA 3R8QA 3P62A 4GVFA 3N44B 5AOKA 3NACH 2R14A 4RGND 3S35H 5JORB 1XF5A 4QLLA 5JW3H 5KETA 4Y9GA 1KTNA 4CMHC 2LVCA 1L8NA 3N85L 2W67A 3FB5A 4DP8X 4IRZL 4JPWL 2HFEA 1MZRA 4DKFL 1XYBA 4LARH 3KTXA 2CJSA 1EUTA 5GZND 3VGFA 3VNJA 2JELL 4AIEA 2GJZB 2IALA 2NXZB 1M9SA 3BUVA 1GZPA 5MEPA 1JZDC 1Z3GL 1DXFA 1NIEA 4ZUWA 3X17A 3FQNA 1NC4A 5FK9B 1XIWC 3LX9A 3A24A 5GRJH 5FYLH 1W8EA 2QT6A 2B4CC 3KCPA 5JBFA 2XA8H 2YGVA 2A3EA 3TYGL 1H11A 3LN9A 3MJYA 1CD1B 5GISL 2G3JA 3VXSD 4MMYB 3MTXA 4ZD3L 1WXJA 4W88A 1FWNA 3SUSA 1N6QH 1UXLA 1CYGA 4HPOH 3KBFA 1EGZA 2J21A 4TNWK 12E8H 1OP9A 1XR8B 1SBSL 3UGRA 1MVFA 5D7LA 1MHHA 5I7GA 1NAMH 2V33A 4L3EB 3BAIA 1A64A 4IF2A 2D31A 2FHBA 1LO2L 4MRBA 2FBJH 5JW5B 1BQKA 3DVNA 1MZHA 2GGEA 1NCAH 1X5YA 5E8DH 1XLGA 4K71C 4LE8A 3AQYA 1LDCA 3FHQA 2W8CA 1MCSA 1UT2A 4LNCA 2Y1VA 5JOPE 1UTDA 3TCTA 1MWAB 1A0EA 4JIRA 1KGWA 3JVGC 2HFTA 3HGSA 1N8OE 4J8RB 1VKFA 2ABBA 3EMCA 3ZRCC 4P3WA 3VD5A 1KFAL 2KT6A 4YLCA 4KK8D 5FF6A 5CFHA 3CXOA 1S7UA 5E08H 1W9PA 3DX9A 4XWUA 2ALWA 4DZBB 2YN5A 4OECA 1H7WA 5AALA 3VDGA 4HX1A 3UYOD 4QSHA 4IGBA 3U8GA 3JU2A 3UPRB 1FFQA 2CXGA 2J47A 1A50A 3LSCA 2DJUA 4RFOL 5DD0H 3SIMA 5DMNA 5AYUL 4F93B 1NINA 4IM8A 1IM3D 1KIUA 1CN4A 4QRUB 1ML0A 1ISWA 4LFHG 3FDGA 5C07A 2NXYB 3W2UA 4L18A 5F0LB 1FL5A 5INDA 4LF1A 2H6UA 5CBAA 1ORSB 2FGZA 3N41B 3B7UX 3SGKC 4E41D 4Y8DC 4BE5A 1A6WL 2OXGB 2MCG1 3VDAA 3FW6A 5JNYB 1AXIB 4GMTH 4MLJA 4Z2KA 1NFAA 2FE0A 4PFEA 4PULA 1HNFA 1WUZA 1HWWA 4JG1H 3D0LB 2CHNA 3R0MA 4FFZH 3GM8A 4JW3A 4W9KC 5L4FA 1PSCA 2DYPB 1UFGA 3CFBB 4OF5A 3W2LA 3PUCA 1XF5B 1F5ZA 3QLDA 1DWJM 1CB4A 4IIHA 3GJEB 5H35A 1Q94A 3VIKA 4ZXBA 1B6DA 4KPHL 3GUGA 1OZMA 3FB5B 1MHPH 5HGGS 2HFEB 2UV8G 3TIMA 1XW8A 2IDTA 1OPOA 3WKPA 1D8WA 1VPQA 2PGWA 3OZYA 2KYIA 2VC5A 5MI0C 2XQBL 1B3XA 2C9UA 5MEPB 5IK3B 3M1BB 2CGYA 3HBZA 3B9KA 1BYPA 2ED6A 2RD0A 1DORA 2Z25A 2G3NA 4ZNEA 2CKBB 1NFIB 3FQNB 2G97A 4Q6KA 4QSFA 5I3KA 5I2UA 1JZ4A 4GG6F 1BXCA 1IIHA 4C1NA 2WUCH 2FPYA 2HWZL 1YYAA 3O4LB 3L4WA 5LB1A 1H5BA 2NVDA 4IJBA 3H0TA 3T3MB 3QGAC 1FRBA 1EO7A 1AO7D 1BXXA 3U4EA 1XIGA 4P2QD 3PFQA 4Y2LA 1EH9A 5AAMC 4O52A 2HVMA 5ICXA 4JKWA 4LAMA 1H8OA 5A2JH 3IJSA 4IQJA 4LL4A 1OABA 2Z00A 4RK8A 4DW2H 3SY0A 4KPLA 4X83A 2ZDSA 3F03K 3NSNA 4XPTH 5LO7A 2OB3A 2C1GA 5K69A 4QRRA 4M3HA 4I5RA 4HJUA 3IDIB 4XO9A 5DQJB 4CUCA 5D7LB 3VXPA 1IEBA 1O5QA 3GR7A 5CIPH 1M7UA 2CUAA 3GTNA 2YPIA 1GZHA 2XM2A 4TRPH 5DRWA 4C56A 4IBWA 1Z9MA 4IIFA 2XA3A 5ETUA 1BGXL 3OQ8A 2OSLA 3F7VB 2B1HH 3S34L 3LG3A 3B7RL 5I16A 1XMWA 1Y7VA 3QFWA 4D6GA 1HKKA 1FHGA 1D2PA 5T1LB 4GI6A 4IRJB 1H41A 4PJCA 3IIXA 2WAQA 3WJYA 5ADOL 3QWRD 2WQAA 4LP4A 4XP4H 2XWTB 3ATZA 1B0RB 1NWUA 2VKZG 4GQBA 3KPNB 3QC3A 3TFKD 2V8MA 4MJIB 1IQDA 3DVFA 1PS3A 4WGWB 3IRSA 1OM0A 5A3IC 2OZ4A 4Z1YA 1JUFB 4Q4IA 1IBYA 2J55A 3LKPA 3RAJH 2V30A 1WICA 5HMSA 2XPYA 3CQJA 2HFGL 4KFNA 2VMCA 3L7RA 1UGKA 2DUXA 1E4WL 1A6AB 3BOVA 1CJYA 2G8ZA 2A9NL 3PYCA 1ZHLA 1J8KA 5GGRY 2PCEA 1PWLA 3AIQA 3UTQA 1JRCA 2YCIX 1E7VA 3BW9A 1LROA 2X87A 1Z7JA 1QACA 4MA7H 5A6LA 3BT0A 3H2MA 3BIAX 3WNPA 2CNYA 4MCZA 4FX8A 4LB8A 4W9IC 1UUMA 2JWYA 5IFHH 1OAXL 4LXFA 4ICCX 4GYPC 2KLTA 3EJJX 2P3YA 3OR6A 4QLJA 5EC2A 4LP8A 1IGTA 3BSGA 3O4OB 2EP6A 3PJNA 1QJWA 4M8QB 3PBMA 3QFGA 1PTGA 5CPLA 5HTSA 4LT7A 3VI4E 1IFRA 5CCJA 4QT5B 4MMZA 4IJCA 1S5VA 3U1SH 3WJSA 3F84A 3MLXH 5F9OH 3BRDA 5GS0D 1CXEA 4IJTA 3SIZA 5AVWB 2XXCB 5A2FA 5A40E 1TX2A 4YXHH 4J1UA 1A3XA 4JG0L 5FKPA 5L2KE 5C0AA 1J11A 4LASL 3KTCA 3ML8A 4ZTEA 4HIJB 1HT6A 4FG6C 3ARFA 3RWIB 5KOVC 5F21B 4ZQTA 3BZ5A 3UJIH 2WVVB 2C3HA 4YXKH 4UF7C 1SEBB 1OXYA 2UVFA 3PANA 4DI9A 4PWHA 5D2LA 5EULV 3PWJB 5HGDA 4XZUA 4ZXOA 1V0MA 3W1UA 2PRHA 3WQ4A 1EC7A 3WK0A 1Z9SA 4XC1L 2J88H 5CP7A 5DRZB 3ZVIA 1EJFA 3U4EB 5A8GA 3C5QA 3DV4A 3ESOA 3UGEA 3O81A 1XIEA 2EIZB 3ZK0A 1FH2A 1V10A 4RE4A 3KHOA 4YHKH 3IJSB 3HA1A 5I8CA 4IS6B 4JO4L 4OW6A 1I7UB 3ARED 4NKIL 3BURA 2CU9A 1K3IA 3VG9B 1HL8A 2GDQA 1OKEA 3UJEA 3MQIA 2WYHA 3I50H 2OOFA 3UFIA 5GIRA 2DLHA 2J7EA 5EU3A 1UPPA 3FN3A 2WJFA 3SCWA 4QRPE 4HIXH 1DIOA 5F1IA 2ALDA 3CGTA 5F7BA 2Y72A 3MJWA 4U3SA 2WYIA 3B2MA 5LVEA 4D8ZA 4W4OC 3LXBA 1WFOA 3WFBH 3IJLA 4NWTL 1SHXA 4J3WA 2HFFA 1XEUA 3E6HB 4NQSA 3TX9A 3HE6B 1LQ0A 3V5DA 1A8JH 1W3KA 8FABA 4EN3C 4FAMA 3VRIA 4O4YL 1DLFH 5ICZA 1DE5A 5KANI 5E2TL 5EFDA 5L88H 1CFMA 1HJUA 3RNDA 3FQYA 1HKFA 4KUZL 2J24A 3Q94A 3MU3A 2NZ9C 1I60A 1L7TL 2J72A 1M65A 3K5SA 1WHOA 5I8EB 4DUVA 4MWAC 1JXKA 2IGTA 4BHUA 3ITTA 2VLRD 3W0WE 2X40A 4ZB5A 3GDLA 4X5WA 1W2KT 4OBTA 3NCJL 1YEGH 4JCMA 2YMOA 4UQ2B 1VHCA 4AXKA 3SDDC 1BLNA 4JHMA 4HJTA 1PX8A 5KVGH 4LU0A 1AR1C 1NSJA 4JRYE 2W5PA 3GRBA 3GK8H 1WB0A 2GK2A 4TNWF 4P3CH 4Q9BA 4E5XG 1CZ8L 2HG5A 4DBDA 1TO5A 4XAYA 4NC2B 1RIUH 3U2SB 4QHNA 4UDUB 4LRSA 1VLXA 1TZHA 4EQ2A 3SQBA 3LNFA 3QNXA 2D03H 3B3IB 2C3ZA 3SE3A 2E6FA 3X3FL 4LBSA 5PTDA 3BLKA 1NGPL 2AV1A 4EN3B 4KJQC 1NC2A 3QPXL 4C4BA 2DW7A 3AMCA 4XWGH 3QPQD 4N9BA 1FTXA 4IUOA 2MMXA 1DPMA 3RGHA 3V0TA 4W7WA 2NQ5A 4DVOA 2X16A 1RJLB 1FC1A 4ONOA 5K9QG 5DJAA 4H2HA 1NSNH 3HKFA 4JHVA 3CUJA 4BKLB 2CITA 4JX5A 5BXTA 3W7GA 3RWCB 5ID0A 1K5NB 4GAFB 1WIPA 1XIFA 5GSRB 5HGDB 4XZUB 2QADC 1HSAA 2WQWA 1RZGB 1Z9SB 3MJMA 4AOFA 5JQ6H 2KBGA 1RBLA 1EXHA 1SEQL 1Z0NA 1MCQA 1ZPLA 2BXYA 3CQKA 1XLEA 5I8CB 3BXWA 1HP4A 1E30A 3FJ4A 3MDJA 3S83A 2VW7A 1RU9L 4A2MA 1F6LL 1MXGA 3MRPA 3RVTD 1A0DA 1PG7H 5HXMA 3V6FA 4K5NA 4MYXA 5IB2B 3S2NA 3UG8A 1H7PA 3TYFB 2YKLH 3RR1A 2IAAC 3W83A 1KB5B 3WKQA 5DFVC 3SE8H 5D8ZA 3WK1A 1F41A 4Z3TA 1K6QL 1RMFH 3W0WA 3VE7A 2KZBA 3QUYA 2ZVRA 1Q0YL 3CHXA 1GGCL 3FO1B 1O7SA 3B9DA 3T0EC 3H4XA 3V4UL 2R23A 1I7ZA 3WEBA 3LVEA 2JB6A 1Z5YD 2K45A 4UIMA 1XGZA 5B38A 3VRIB 3WCYA 4AYBA 5EFIB 5SWQA 2GB2A 1KIQA 2PAJA 2X6VA 2PPFA 4DJEC 1QTWA 1XH0A 2QADB 4LAZA 1AOZA 3IARA 5BCAA 1RHFA 3E74A 5E6IC 1WNOA 2PETA 6PCYA 2Z31A 1BLIA 3TCEA 3VI4B 3AHXA 1N59A 3C5ZC 1Q38A 2K6WA 4MNGE 3PL6A 4UQIM 1K8CA 2DQCL 3D0CA 4HPNA 1A0QL 3S5YA 2J8UE 3TWCH 3UZYA 5E95B 1WKFA 1NWPA 1KZYA 2Y07H 5AVZB 4X5RA 3H6AA 5L2KB 5C7HA 1HUVA 4N5ED 5ABEA 4TOQA 3FTGA 3Q2CA 3WLLA 2H1LM 4MD4A 1FCCA 4X4XA 5FKYA 4GY4A 4WIWA 2GOUA 2EEDA 3O05A 3OMNB 1SUXA 1FFNA 4OCYH 4L6OA 5IF0B 5FYLD 4I1NB 3BMXA 1XGTA 4C57C 1I2OA 4YK4C 2H32A 5DVKA 2JB5L 1K8IA 3BSHA 2HN7A 4DO7A 3D05A 5B39A 4XIMA 4H6EA 1F58L 1YXDA 5A5WA 3PGDB 4UQBA 5GGVH 3BLDA 3H2EA 4ENLA 5BNKA 4KRPC 2MPAH 4X99A 1A2YA 1MN4A 2PC8A 3Q2NA 1QUNB 2J7GA 3RFZA 1NOWA 1I1AA 2MQGA 2GCYA 3W07A 7A3HA 4YDZA 4MNLA 3QN3A 3MRRA 1VAHA 2YPVL 1KJ3L 2OQHA 1EEYB 2P28B 1C08B 2XOTA 4MBRA 1PZSA 4UTTA 3IUDA 1QFWL 4O18A 3MLRH 3NJFA 3ZOAA 3NJIA 5AVSB 4MQXC 3ZVHA 3O0KA 1P7QD 4AC7C 1DBBH 1WZLA 2HT2C 1IEIA 4HQQL 4PH6A 4JDEA 4QRPB 4PRHA 3QZEA 1FAKT 3MA7B 3HW7A 3RUGF 1FCVA 3M46A 1LCOA 3QARA 3EAKA 2WIIB 2EPMX 1ZE3H 1Z41A 3TU6A 1X7TA 3QDJD 1I1FB 2UYLB 1CVSC 3JWNC 2IAMD 3S36L 3ZKMD 4L1TA 1GGTA 1HHHA 5I6XC 4JZNA 4MA1C 2X6AA 2XZQL 5DVPA 5HYJE 4ICNA 1MFVA 2OTDA 1TQCB 1FNFA 4RRPA 3BUIA 2P3ZA 1IM9D 3P40A 4NGHH 5JBDA 3C2OA 4PTTA 2R1NA 1MFMA 1ZLPA 2QV2A 4MNGA 4Q2ZA 5EBWA 1M3JA 5DRCA 3W0WB 1BFSA 2X2HA 4PJ5D 3QUYB 2OX5B 1HKJA 3T55A 1CFVH 5LBSL 3WD5L 4EXQA 4WEMB 4R7DA 2JTYA 1NFBA 3Q2WA 1FH5H 1RV6X 3H7UA 1S3KH 1NCNA 5CJBA 4GW5A 5JZ7D 2APTA 3S98A 1I7ZB 5ABDE 4JRYB 3I85A 3TH6A 1OBAA 1ETB1 4YHLL 5C0RL 2V3DA 4PCNA 5ABTA 4F7PB 1HEZA 4HNNA 1KIQB 1T0PB 1QFOA 3BPNB 2WNZA 2Q3AA 1J1PH 4B9FA 1EGJH 5IT2H 5TDOB 3BP6A 4JPSA 4NLHA 1N59B 1ISXA 4AC4A 3PRZA 3CEPA 3NN8A 5CQ1A 2YEZA 3QO1A 3AXIA 2PF8A 4QYOA 2K8MA 2ZWZA 4GP8B 4JGNA 4OU3A 2P5EA 3IFNH 1A7RL 4ZMLA 4F66A 3TA3D 2NQCA 3V6BR 2JIXD 3Q5TA 2DQWA 4HNCA 2J44A 1V0LA 4PS4H 5D9NA 3PC0A 4X4XB 2ACQA 1MFUA 2E59A 1GJIA 1QR4A 4M6MH 3RWGB 2B81A 4DQWA 3MLZL 3QIWD 4ZTXA 3P84A 2FVMA 2UZPA 3S5LG 3T2NL 2IANA 2QQKL 4MD0B 3S9IA 3OD3A 4OOUA 4RQQA 1EXGA 1TU2A 2H32B 4OD2A 1UEYA 4WEEA 3NJHA 1E4KA 1VFLA 4A2DA 1CU4H 1K2DA 2A6DB 2BVOB 5J6GA 2BNQE 3W9EB 5B39B 4AHQA 1CLVA 4AISA 1HGWA 2Z4QA 5AECA 4QDGA 5RUBA 2C6QA 3BEVB 4N0YL 3IN0A 3O06A 3HI5L 1TE1A 1NKOA 3ERPA 1T04A 1S5IH 3CK5A 5K4XA 5GZOC 1QW9A 3QPKA 4DUWA 3PP4H 1DYSA 4D7PA 3G6MA 4WV1B 5C08D 1FQ0A 2YEVB 4GP5B 4ELMF 2JKJA 3ATDA 4TLTA 3WLQA 2F8XC 3B1TA 1S9YB 2FB4L 1MF2H 1WOBA 3HS0A 3F65A 1I2PA 4QQUA 1C12B 2CDEB 2YHGA 4ZMTA 1QEWA 2ZICA 3WDQA 1OCRB 2FZDA 1W1VA 4NZ8A 3FK4A 3L9BA 5C8JB 3EG9B 4KKCD 1ULVA 1G4SA 1MREH 4B9PA 1WBYA 3TKFA 1T1WB 3MXWL 3BD4A 4JO2H 4G6ML 4WFFE 3FJNA 4JZNB 4IISA 3D47A 4MZ8A 5DQ9B 3JS3A 4EKXA 2HUEA 4RAVA 1UD2A 4JTEA 5D5MF 1EJSC 4M5PA 2WV3A 1XCFA 2ITFA 2JGYA 5PCYA 3OAZH 4U1SA 1CBGA 4HIBA 4LIQH 3CSTA 4NENA 3G6JF 4KVCL 1Q72H 4MNGB 1HKWA 3LU2A 1X6LA 2JI2A 2J4WH 1P7TA 2J8UB 1WHPA 3MBEC 2NZ1A 3CMOL 3TWAA 3R79A 3S4TA 2A7RA 4R7DB 3QZAA 4Y7EA 3W81A 1T0MA 3BUBA 6CGTA 4OUUA 5J6HA 1KJMB 1TJMA 1UYWL 3ZR6A 3MCOA 1K9TA 2INFA 1HEZB 3D0VB 1NMCB 1YAIA 3IU3A 4PG9A 2AZUA 2HJKB 4OLXH 3MROB 4ZPTA 1SVDA 2FQGA 4N9GA 1OD9A 4QNPF 3KBNA 5F93C 1I8KA 3DUUB 2CBMA 4MWFA 3BP6B 4G9DB 4W8AA 4PRNA 1XCTB 4AAJA 1QABA 2ZAHA 1HL9A 1PYWA 1BQHB 5FJIA 4DVRL 3WLWC 4AG4L 4L0ZA 4JIHA 3CLWA 4B3EA 4ZS6C 5DO2D 4JANB 4A7QA 2CGRH 2P5EB 4XAWL 4WAFA 3AQZA 3MJ9H 4XWOD 4YU1A 3UX9B 1AZZC 4QRSB 1MWOA 4WXZA 2DM4A 4Z1AA 2J7BA 4F7KA 2A3LA 3QXUA 4DKDC 2FBRA 1DCLA 1Q9OB 1NZRA 3U6RA 3VCCA 3GQYA 1Q9KA 1ET7A 3MBEB 3ZKND 1IQWL 3ZDXE 4LCYA 4E2OA 1QOQA 4M19A 3OSVA 2W0FB 3V4PB 2WTRB 5FCZA 4OD2B 1L7IL 3FL7A 3VX1A 3R10A 2Z29A 4PWKA 2BSSA 1HHGA 3IACA 3K71A 4GG6E 4FQLL 4LRNH 1FVPA 3QV9A 4PMYA 1I3GH 3PWUB 1L6ZA 4TVPD 3KDOA 4NJGA 1K3UA 4UTAA 1FH7A 4P46D 5HYJB 3BDXA 4F4RA 1T04B 2PBOA 4MJ5B 3P4NA 4LDEB 5GNYA 1TA3A 2I24N 4KROB 4GABA 3RX8A 2R4RL 2WZ5A 3S48A 1UROA 1LDPH 3HS0B 4OOZA 4N2CA 2VUOA 3EF7A 1KEGH 4N90D 1MEXH 1CDYA 3MLVL 2DLFH 4P5KA 4DAGL 3VTMA 4IBVA 5CU9A 3QDHA 3WN5A 1HJSA 2Q7YB 3BANA 3QXDB 2FQFA 2ICWA 2J8TA 1USQA 1XH1A 3BVDB 1C29A 1X5FA 5H8DA 3AM8C 2OQYA 3GZOA 4F7CA 4YN5A 4GCAA 2FZ9A 1ZEAH 2B3RA 3U9UA 3VFMB 3RMEA 2X41A 2YRLA 1G9NC 3AXXA 5CUSH 5GJTH 1PUDA 5A7BA 3Q8FA 4HKBA 3RYMA 4RAVB 1KLFB 5DHVB 1U3NA 3BT2H 5J1TC 3WG6A 3UBHA 2Q87A 5EKYA 2ITEA 4L4TA 2XZZA 2Q3OA 2VN3A 1U93A 4OJDH 4LBEA 1TFPA 4UINL 4FXKA 1UM4L 4X6BB 3PV6B 3KRSA 3FKKA 2R59A 1BZQK 2IUZA 2Z7KA 4DK6A 4RXFA 1X3DA 1E6ZA 2AK4A 3OZKA 3PUUA 2XY2A 3W53A 1E9PA 1DP0A 5ISZE 4ILDA 5ACMA 3NRFA 3CIWA 1XLJA 2V9UA 1H61A 5AHIA 1VC4A 4KNSA 4X6CE 4Y4KA 4JTAA 1A4BA 3IVTA 3IU3B 2HVKA 1NGXB 4HBKA 1V55B 2BVQA 3B4YA 1DQWA 3II3A 3MREB 3HLKA 5EU6D 5A95A 2D0GA 2IPFA 2V3FA 2CJTA 1I8KB 2GIYA 2EKCA 3DPBA 4LSTL 4P07A 1OCWL 3GYRA 2GTZB 4FMFA 4JCWA 1P0KA 3MC0A 3ENLA 4EAEA 4O2CA 3BH4A 2BNQB 1MHEB 4WUIA 1RVKA 3IGFA 3W3BA 5MHSE 1MKFA 1BFVH 1G6RH 3T6ZA 5C0JA 2MOQA 3NCWA 3L3GA 4BFBD 1S7SB 4LDOB 1CLOH 1T7YA 3US0A 1NJ9A 1JBJA 4LHQB 4MAYD 1QFUL 1G1CA 4S1FA 2O6CA 3QEQA 4S2CA 1JPKA 3P69A 5IBTH 4PH8A 3GW3A 2FX9L 5F1SA 1HZYA 2QHRL 3PY2A 1X5MA 2DWDB 2BWDA 1T5AA 1XDMA 2CA4A 3QZWG 4LAQH 1P6WA 1XBXA 4OSUH 1BEYH 4Y2DA 5KUKA 1WVZA 1WO2A 4ERGA 2K4WA 1FO0L 1RPUA 2R2HA 1TJIH 4IOTA 2NSQA 2ETWA 1HHGB 3DBPA 3OMAB 4P7OA 4F33B 4NO0A 2NWSA 4PMRA 3T6VA 4AGPA 1KJ2L 5JIMA 1EO8H 3TFCA 4NUPA 1IEAA 1J5IA 5I71C 1NLBH 3N0PB 3CJPA 3WH5A 2ZCHH 2G2PA 4LSBA 3U1PA 3QCVL 1YN6B 3KYNA 2G96A 1F6AA 2GDVA 1A6ZB 4Z7NE 4UU9A 1ZT1B 3GZ3A 5JHDD 4XTRD 4PY7A 3FFCA 3GMRA 1YDNA 1EJTC 1GAFH 2QKIB 1VACA 3C0SA 1QPKA 1UH2A 4YS1A 4BUHA 4WZHA 3RDJA 3WN5B 2ZOKB 4ODUB 3Q1EA 1F8TL 1D3HA 3KGTA 1WBZA 5G55A 4Y9AA 3VE0B 4BFOA 5ISZA 3PQYE 5CEZL 2EEBA 5AW4B 1RK1B 4L05A 4X6CA 4A6YA 4ZAKD 3ABRA 3H8NA 3U0PB 4Y16C 1CCZA 4DF9A 1R3JA 4P4KB 3T2PA 1THAA 2XRAL 4HKBB 4PUBL 5E00B 3PULA 4EI5A 4Y5XA 3IPEA 2E6YA 5FO7B 2J56A 1Q3NA 3GHTA 4GRLB 3WLKX 5LYRA 3DOSA 2IMRA 3APYA 4JFEA 1AZCA 4X8GA 2GK1B 3ZM8A 4MDIB 5DHYA 1V02E 3GMNA 4AQEB 4OTKA 4S23A 2EVGA 4DNLA 1V3MA 2PCYA 3RA7L 4CDGC 4N8CH 2CXEA 5I15H 2W95A 1E9PB 2NUPA 1MCEA 4JN6A 2D3JA 4WO4A 1M01A 3H3BC 1RZ7L 5JYLA 4Q6IC 3RVXD 4P8VA 2D20A 1F2QA 4Y4KB 4ZX3A 4K68A 3W1XA 2CJUL 1UD5A 3ZDXB 4DP7X 5I1DB 4X2RA 1PCKA 2ZYHA 4MVBD 1DL7L 5JORA 5GGSB 2VN4A 2LTQC 4ZX6A 2D7TL 5FL0A 2OCJA 4GG6B 4QO1B 1F56A 5FAGA 3L3GB 3CL7A 4L8SB 1UXWA 4XPGL 1GUVA 1IXPA 2I26N 4WEVX 3O9WB 4RE0A 3ECUA 2GJZA 3FUNA 5DU7A 4C6NA 3V4LA 4DK3A 4GKLA 1J86A 3ZGIA 1UC4A 4S11A 1XSKA 1A5OC 2P5NA 3RZWA 4AVJA 3M44A 4GBDA 3M1OA 2BTMA 5FK9A 2CBVA 1FCGA 2IOMA 5L7XH 2YGOA 3WS3A 2H0JA 2AJVH 5IEHB 3NFPB 5IJBC 2O5XL 5LNEA 1UR1A 1CD1A 1QNVA 3BMWA 1CICC 3E2QA 4NRRA 1NY1A 4MMYA 3PZVA 3IPBA 5JIWA 4LPUA 4Q9CA 2C9VA 3UZWA 2AJXL 3QFJD 4L3EA 3L2MA 4XP6L 4IP4A 5ALCH 1F6AB 3ZRSA 1B6UA 3SBPA 4LHUG 5AHEA 4XHJC 4UU9B 3OL2A 4JS7A 3TBCA 3ABQA 2P50A 3FFCB 3BKYL 4HTBA 5F0PB 1U92B 4M1GH 3EYVA 2ZZ6A 2DORA 2P0IA 1IGCH 4YIQB 1VACB 4ZPVB 4J8RA 3A12A 3FJLA 5ISZB 2HTKC 1Q8JA 3MYZA 2DWTA 1TJHL 1QPPA 1BXAA 1CDJA 2RHGA 4X6CB 3MV9D 2V38A 4XCEB 3TX4A 1ZAJA 4RISL 3SR7A 3FXIC 1OAYH 3IAQA 1R3JB 1DBJL 5C0FB 1K8DA 3DX2A 1CGYA 2WTOA 3MRMB 3PHSA 1IL1B 4Y5XB 4DAFA 1SJXA 4IX2A 4D9LH 4GA8A 5DN1A 1YNKL 5EU7C 2O5NA 1NFKA 4QRUA 3AUOA 1CICB 4JFEB 2Q2EB 2BDNH 1JCLA 1V7NL 3IJ9A 3A3HA 5C54A 1YTEA 2CWNA 4LLWB 1TTUA 2W9MA 1DANU 4K23H 4LS1A 3KEDA 3DDFA 1OCQA 4YVNA 5G5IA 3G1FA 1ORSA 1CR9L 4L65A 3DYPA 2ADFL 2CNZA 2OXGA 3MLSH 5AG9A 4B5TA 5D03A 1FG9C 5JNYA 1AE6L 3AI0A 3O16A 2OMXA 1KYOJ 2QSTA 1XKYA 3HN8A 3IFPB 3D0LA 4KKBC 4O9HL 5CZXC 1KGUA 4L3AA 1BJ1J 5HVWA 4WHTB 5FOOA 4OJEH 1UVQA 4MXWL 4TX6A 3RVWD 3QYCA 2EKJA 3CFBA 4MZYA 4O28A 1IGWA 1X4ZA 1OSPH 1H19A 4HBQA 4H1ZA 5DMGC 4AYID 3KS0J 3GJEA 5I30L 5F7HA 4NHVA 5GS1B 1S9XB 1UXWB 2NR6A 1QASA 4EBQH 1JVLA 3W1PA 2ZF8A 3BN9C 4O51B 1JGDA 5F96L 3VXNB 4NIYE 2R1LA 5C5YA 5HHMD 2L8AA 1JVKA 5FV1L 2J8HA 2AGJH 3T1WA 1JJUA 4XPFH 1CD0A 3IDMB 5IK3A 3M1BA 3IMWA 5D6CB 1BWMA 4J3VA 2VRJA 2CKBA 3O6ML 4D8PB 3VFVB 4RMTA 4Z7NB 1RR2A 1NFIA 2X2YA 4UV7L 4M7KH 4JN8A 3A5VA 5J56B 4Z0XA 3DWTA 2GQHA 2OLDA 1OG6A 4OZGE 4HSAC 3WS3B 1TLKA 1AQKL 3O4LA 3LBMA 3SGKA 3LLDA 3F6JA 3ILDA 5FM8A 4HCIA 4HB7A 4OLUH 3HR5A 3PQYB 2Y7QB 1FNHA 3ILQD 3NP3A 2PDUA 4X42A 1N7KA 3MGAA 1ZPUA 1V6VA 2FATL 3EH5B 4M62L 2WMHA 4LH8A 4KHTL 1X7IA 4DJFA 2HH0H 2W1NA 3IDIA 3RU6A 3WS6A 4YSUA 5DQJA 4UFIA 3R7RA 3PWGA 1DBAL 4WHCA 3C60D 3P30H 3N15A 3OKNB 4YCOA 5C0CD 4CMHB 2GFBB 1SYTA 3B9EA 4FN0A 2OEKA 3D9AL 4ALAL 3F7VA 2ZOTA 2B77A 4WDTA 1LOSA 2CHZA 3Q8AA 1BDYA 3EYVB 3OG6B 4H01A 3QOMA 3S36X 1E9OB 3OGVA 2KHAA 5T1LA 1KN4L 3KGUA 4IRJA 3QSTA 4KO7A 5LAPA 4X8JB 2PDWA 2XWTA 1UOVA 1T66D 1B3WA 1B0RA 4HPXA 1E55A 3KPNA 3VFSB 1XIWB 4PJ9D 3DGRA 4PCPA 4WSHA 4MJIA 5LKYA 1K8DB 4PJGF 4NDMB 3LDVA 1TQBC 2Y8UA 5C0QA 1UGNA 3W56A 1OTUC 2A38A 1JUFA 3ZJ8A 3VIHA 3ITGA 3EYSH 3IETB 1CE1H 1V8HA 5AAMA 1NGYB 3G9AB 5D2TA 4ZQOA 1FLRL 1A6AA 3P3UA 1M03A 2A3HA 1SJEB 2A7BA 3GKWL 1KBIA 1IE5A 4K15A 1GTFA 2CLKA 2CRZA 2FUTA 3CVCA 1JXJA 1KPVB 1TMLA 3QE5A 4PUUA 2EZ0D 1WIUA 3QIUD 1OARL 2OMXB 1LLOA 3MS8A 4TUFA 3SZ6A 1ME9A 4K71B 4ZUUA 4JFPA 4S1DC 3GI8H 3L9RB 4HF5L 1UVQB 3LS5H 4FS9A 4H2CA 4XVDA 4M8QA 2VEGA 4GK8A 2C3VA 5BVJA 3IVUA 4ZMXA 1AYOA 2VQTA 3L1EA 2HK0A 1SYVB 4DUOA 3VVWA 4QT5A 4JFXB 4L6DA 3UD6A 2WXJA 3VGAC 4NRZB 4YFLF 1NF0A 4CBPA 4QISA 4FERA 2VDOH 3JUGA 4B9JA 3MHUA 2BERA 4HLZG 2ORBL 1JGDB 3U3HA 1U3ZA 1VDGA 2WSPA 2C9QA 4MNHA 3H12A 4GUFA 3UO1L 1MSPA 3TLQA 2J73A 1ZSDB 4HIJA 5IOKA 4BWTA 3RWIA 1OGGA 1EHLL 3OA3A 3EJTA 2GHZA 2WVVA 3EMZA 2NCEA 1SEBA 1WPCA 2ZCLH 5F71A 2VDQH 3PWJA 4Z0XB 4J7RA 4E42A 3Q1SH 3UJJH 5C0GA 2WBGA 5DRZA 2VZVA 4UIOA 3APNA 4ELME 4YBHA 4FNQA 4U4MA 5EGRA 3HR5B 2EIZA 2DFAA 3J27A 5FW7A 1O60A 4F3HA 1DE4B 1XLCA 4IS6A 1UENA 2NY2C 2Z8SA 3TZFA 3AWGA 1I7UA 4R83A 5DSCA 3G8EA 2CC0A 5EY5A 1Q7ZA 2PDCA 3GC3A 4UTJA 3DDMA 5KVEL 3HI6L 2PC4A 3EYUL 4P7LA 3II1A 2DL9A 3C4UA 3V7PA 1E4XL 4MWAE 4JJ5B 1H8SA 2ZX8A 2IDCA 4UB0L 2V3GA 3WTSA 4U6XB 5AYBA 3VAEA 2VDNL 1MRDH 1Q4WA 4RNFA 5D5ME 1AFVH 4JKPH 1NIDA 1CLXA 1RUQL 5MI0B 5CJ8A 2XSAA 4YBQC 3FNDA 5JPMC 2OMAA 3JW7A 9XIMA 3G6JE 2JI1A 3SPJA 2JVUA 4BQ2A 3W9ZA 1VESA 3E6HA 1TIWA 3HE6A 3WF0A 4I9MA 3T78A 2N56A 1QBAA 2EEXA 1JI2A 3VFCA 1RZKH 2XWDA 4V2BA 4W9LC 2LFGA 5KZCD 3GIVB 5A6MA 2CWXA 1O75A 1T03H 4QWWC 4HT1H 4ECLA 3CXDL 5I8EA 1FIGH 3USZA 2C71A 1R3LB 3EUUA 1GOKA 4RCXA 5FOJA 1MFBL 2NY2B 3GYCA 3BJSA 1HCFX 5TBOA 1OAJA 4UQ2A 3DUHA 5JTWA 5C9KA 4L1WA 5AVNA 5HGHA 5ID1B 1BIIA 5D7JD 4G1MB 2D7MA 1CC3A 2XACC 1LWHA 4Y2OB 2J1KA 4GMEA 4OD1L 2W0LA 4ZUUB 2E27H 4JFPB 4ADGA 3MJ6A 2ZWSA 4YHML 3U2SA 4R3UA 4UDUA 4O8RA 4BM7A 4OZGB 4LKXB 3V0AC 4HPYH 1MFEH 4Z7VF 2C3VB 5BVJB 5GHWH 2YSTA 3B3IA 1R7AA 3ZLQC 5DQDL 1SPQA 3OSKA 5HSFA 4EN3A 5I1JH 32C2B 4Z7QF 4OZHE 3WH6A 2EC8A 1US2A 4HMNA 4UQ3B 3D33A 2XU9A 2XWCA 4MNHB 2EDFA 1Q0EA 1RJLA 1GY2A 1Z9AA 4R4FL 4UWMA 4TUOB 4D0CA 1UP2A 1D3CA 3V0UA 4E4UA 4WTZG 4BKLA 4P9MH 3PG8A 3RWCA 2WM0A 1K5NA 5GSRA 3THCA 4E42B 4M43H 1YO4A 3QF0A 1YKWA 5C0GB 1RZGA 1UA6L 4ZT1A 3UETA 4GG8B 3T0EE 1OG0A 3SDDA 2P47B 3QHZH 2BPBA 4OGXH 7FABH 1SGKA 5KG9B 2GPTA 1NAKL 5KSBF 2Q6WB 1H0GA 1W56A 3JXAA 2ZXBA 4MPQA 5I6SA 2Y2TA 4Y7OC 3JV0A 4N87A 3A21A 4WF7A 1M05B 3FA5A 4H26A 4DO4A 1IGIH 4R88A 1QATA 4GXWA 3BDYH 3Q2LA 2UWFA 5DSCB 3GIQA 5E23A 1TTCA 2WZPD 3V9FA 1JG9A 3N40P 1VF8A 1V6YA 1TETH 5IB2A 2P76A 2W91A 4J8QA 3TYFA 1F4HA 4Q4OA 1MY7A 1KB5A 1A4LA 2WVTA 4GC3A 3WEOA 1IC7H 5AG8A 1XR2A 4PVMA 1X5LA 1AS8A 5E99H 5BXSA 1LTXA 1TENA 2QQ6A 4WOZA 3FO1A 3NL6A 2FPTA 4LPTA 3KYKL 5ILTL 1AL8A 2VP8A 2R56H 4XKMA 5HI3D 2BSCA 2JEQA 4JTUA 5KSVB 2C9RA 2J74A 3SGGA 2FJSA 5CJQL 35C8L 3RFRA 5EA0H 5EFIA 1MCNA 4NUGL 4LSVH 2P8BA 2XWEA 4N20A 3QYQA 4MZIA 1RULL 3GU2A 4NN7C 4LAUA 3UG4A 5IQ7H 2WMFA 3RJYA 3KP1A 4WUKL 3UABA 3VOJA 1TV3A 3VI4A 3LHUA 3CLEL 2ATMA 1B54A 1PF3A 4LS0A 3CMGA 4UCGA 4OIBA 4PL1A 5LNVA 5T1KD 4ZDHB 4YHNB 3CPRA 4MNQD 5DD3H 2R0ZL 5L2KA 5KYUB 3ZE0F 5HGHB 3DGDA 2JKXA 2HRWA 1BIIB 1IT9H 4NIKB 4PJIE 1TCMA 3WF2A 5DD5H 1UA7A 2VR3A 4KZ0A 1W5MA 1RUML 2MRYA 1A1OB 3N6JA 4LCCC 4JFDD 1IHIA 5IF0A 5LG6A 1M71B 3T3PE 4B90A 1SZEA 1BMZA 3R58A 4OLEA 1L5GB 4IQHA 3GRGA 5M17A 4BYHA 3PZQA 1N8IA 3DHUA 3PGDA 4XZ9A 3NZSA 5LQBH 1DDTA 4AY0A 2WWMC 3JWNE 3RZCC 2NQZA 4YLQT 3S96A 3B2UC 3GO1L 3KPSE 5EU4B 1QUNA 2WXHA 3G3LA 2EECA 4ODWB 5LSMA 4ZL1A 2P26A 1EEYA 1C08A 1E8XA 4D0CB 4OZ4B 4EANA 4N2HA 4GI4A 4MWAB 4JTHA 2VQ1B 2HS8A 2C1IA 1LZOA 2DT3A 1DJHA 1J79A 1EPXA 3K8LA 2VD9A 4QRPA 1ZD6A 3F3HA 2F7IA 5CJOH 3QDAA 4G6FB 1J4EA 3MA7A 4HXAL 5D5MB 3IBOA 3DU0A 3SDDB 1QK0A 1BYOA 2QCEA 1HSBB 3N2JA 2TSBA 3G6JB 1AR1B 2WB7A 2ZX6A 4M9OA 2WIIA 3BICA 4H26B 1I1FA 2UYLA 3MGOB 4FE9A 3FHAA 3M5YA 4B9IA 4QEGA 3ZSTA 2X6BA 3WHXA 3FJTA 5E1GA 3WFZA 4U1GC 3TEVA 3ZIYA 4Z0BH 1FPTL 4I5BB 4K39A 4O02B 3I6KB 5C6TH 2YX0A 2R27A 4YVVA 2FEJA 5HHNB 1YC8A 1CK0H 3M64A 4QI3A 1MI5D 3K2UH 1OC5A 4TSAH 2A4AA 3W7HA 2APBA 4XMPH 2OX5A 1MCPL 3OHIA 3GDKA 1OX5A 3VOFA 4LPWA 4PUKA 4PP1D 4JRYA 1H62A 3HPJA 4JQXC 2Y22A 1QT1A 2BFVL 3RITA 1H7OA 2X1XR 2ZP0T 4F7PA 1BJMA 2F8VA 3PBWA 4XGZB 4AQOA 5CCKH 4J3OG 3RGVD 4ZFMA 1WK0A 3QEGH 4AV5A 4Q8WA 4NP9A 5TDOA 4ABWA 3B56A 3NQVA 2EXYC 4M1DH 4XPHH 4GAGL 1HILA 9RUBA 1XIJA 1KD0A 3AU2A 3LSBA 3DBNA 4RLIA 2VLKD 2GEQA 4DM1A 4H88L 2QVFB 4OZHB 4U0QB 1XYLA 5I1CH 1VFMA 3KPSA 5TQ2H 4G6KH 3UZJA 4KMQA 4MZRA 2DQXA 4U1GB 2C4XA 4YXLL 2A74C 1H5YA 2CIKB 1G0CA 1BV8A 2ZBTA 1PJ9A 2A1YA 4ZSOE 4KTDL 3VGGA 4WHYG 3O6FC 3AU1A 1N3NB 4L9LC 1CDCA 1G1KA 3RWGA 4I18C 3FPYA 4H9VA 1VFUA 1OQOA