2YIHA

Structure of a paenibacillus polymyxa xyloglucanase from gh family 44 with xyloglucan
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
511
structure length
511
Chain Sequence
KTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDWQHSSDNYLCSNGGLTQAECEKPGAVVTSFHDQSLKLGTYSLVTLPMAGYVAADGNGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVKGYALDNEPALWSHTHPRIHPEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYKDLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETKKARMQAPRTLWDPTYKEDSWIAQWFSEFLPILPRLKQSVDKYYPGTKLAMTSYSYGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGDTSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGFDKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CEL44C
publication title Structure and Activity of Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 178
structure length 511
sequence length 511
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12891 Glyco_hydro_44 Glycoside hydrolase family 44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2yihA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yihA02
1EHNA 1GW1A 4DO6A 2V5DA 3WD3A 3AIBA 5I5RA 3PZGA 5A8QA 1GZJA 4KGLA 5A6AA 3ARSA 3SUTA 4ZE4A 3AOFA 3AMDA 3UG3A 5D4YA 1FA2A 1ZL1A 3PHAA 3BSHA 3GXNA 3EMZA 5F7UA 2VT0A 4UFKA 3WL1A 6CGTA 4W93A 4W8BA 4AZCB 1H41A 3SCQA 4AIUA 2YA0A 3DYOA 3N1AA 3NJ3A 3T0AA 2BV9A 4AY1A 1GONA 4AYGA 1AVAA 3CHFA 1JI2A 3GXPA 4RE3A 1KQZA 3I3BA 2G3MA 4H8VA 4YHEA 2JALA 1E0VA 4FK9A 3K46A 1GNXA 3FHQA 3WD0A 2UWFA 1E4LA 3BVUA 3EJRA 3L4TA 3VMPA 5A2BA 2VCCA 1OGBA 5FIPA 5CG0A 4PMZA 1L8NA 4M80A 5GQBA 3FXYA 4QCEA 1QOXA 3ZJKA 2DT0A 1HKKA 2XTKA 4UR9A 1OGGA 1KQYA 1KXVA 4DWSD 3SUUA 4AMWA 1W1VA 1EHAA 3VIGA 3BH4A 2EACA 3I3DA 2Y24A 1IZJA 1HP4A 1E1FA 1EDTA 3BUPA 3TTSA 5DT5A 5GNYA 1JF6A 2D0HA 1S46A 1JZ7A 4XZBA 4HZ8A 2YL8A 3QOMA 4UOZA 1UWRA 1V3HA 4CD6A 4CD8A 3MMDA 3PZOA 1QI3A 1R33A 1BFNA 2Y5EA 1ISZA 3CZEA 4ZFMA 2GJXB 3VM5A 2B31A 4NX0A 1NWRA 3T2OA 1LWJA 3W28A 3A24A 2XIIA 5A6BA 1TQVA 2EO7A 1H09A 2WMIA 1BYCA 1QHPA 2A3HA 2WCSA 1DWIM 3MV01 3A21A 4GO8A 3WNPA 1ZJAA 1C3FA 5M17A 6A3HA 3ECQA 1V02A 3BSGA 3HN3A 3VIFA 3PTMA 1BYAA 1W9XA 3AICA 1OIFA 1UASA 1W3LA 1O7DC 1DWJM 1GJUA 3CLWA 3ZT5A 2CIPA 2OLHA 1OSEA 2OWXA 4RE2A 5D8WA 4TTGA 1UWUA 2WYSA 4ZENA 1US3A 2FHFA 2XFFA 3KLLA 1W1TA 3TA9A 4TTUA 1HKMA 3TOPA 4WK9A 4IUGA 1V3KA 3IJ8A 1HJQA 1JDDA 3W26A 2W67A 3L4UA 3L2MA 4W86A 4MB1A 1EXPA 1W1YA 4D1JA 1U30A 2CITA 3KZSA 4HU8A 3L4XA 1CXIA 3ZM8A 3GXFA 4MJ4A 3VILA 5A3HA 1UWIA 2XN0A 1ZBVA 1KB3A 2VZTA 4FF5A 4AC1X 3UR7A 2WAGA 1UZ1A 3EDFA 4Z2HA 3EJSA 3QOKA 1UUQA 3SCOA 2DH2A 3EDEA 3L4YA 4U2ZA 2VVNA 3BUBA 4PMXA 1HN1A 3SUVA 4FNTA 1CGUA 3DYMA 1YHTA 4PUEA 4OOUA 1JDAA 1PX3A 2YDRA 4PTVA 4QAWA 4YHGA 3AISA 3CZSA 2ZX6A 4JCLA 3BMWA 3VSVA 2VQUA 3WF2A 4FNPA 1XCWA 1GJWA 1P6WA 1IZKA 3VDHA 3CZKA 3CPUA 4E8CA 3D5HA 5JBFA 3M6DA 1LQ0A 5C70A 3LXBA 1QX1A 3RDKA 1V6XA 2WMKA 3EJUA 3AMGA 4ATDA 5IHRA 1EOMA 4F9JA 3OBAA 1CBGA 5DEZA 2XM2A 2ZXDA 2E8YA 3WUBA 4LXFA 2PF0A 3N12A 2ZUMA 2WHJA 1GVIA 3BLKA 1KGWA 3DX1A 2EJ1A 4U3AA 2O9TA 1HXJA 2WZHA 1XH0A 3VU2A 2WHKA 3DX2A 4QLLA 1B2YA 1IV8A 2J74A 3S2CA 1L0PA 5AYIA 3AMKA 1BG4A 4IPLA 1C8YA 3THDA 1NWUA 4UCFA 1TZ7A 2XVGA 1CZ1A 4AZ7A 3SCRA 2CBIA 2CERA 1VJZA 1UD4A 1V08A 3K8KA 3CIVA 1H5VA 2EPOA 3HZ3A 4S3KA 4WKAA 1E6SM 1UD6A 4QFUA 1VB9A 2F1BA 1EH9A 4FNSA 1FP8A 1DEDA 3WBAA 1W9BM 1E6QM 1W9PA 2J62A 1K9DA 3II1A 1CPUA 1VBRA 4MB5A 2X1IA 1JD9A 3VGEA 2EQDA 3EMCA 1GQIA 1RD6A 3AS2A 2QV4A 3WQ6A 5GNXA 4FLQA 3WY3A 4Y7EA 4MPKA 1PBGA 4MTVA 2YL9A 3CHEA 3MUY1 1FFRA 1BLIA 1J12A 2CXGA 3K8LA 1XRVA 1H2JA 1VFFA 2CKRA 1M03A 4D6CA 5IHSA 3PZTA 1BVNP 1VEOA 3ARWA 3WF3A 4MJ2A 2V3EA 2E9BA 1JYXA 2VR5A 2ZWZA 4HMCA 1NP2A 4BQ2A 2X2IA 1UQYA 4AISA 2NT1A 2IXUA 1NQ6A 2YJQA 5E6YA 3CH9A 3EJQA 1HJWA 4FNRA 5CPSA 2WKGA 1E73M 4P7RA 3ARVA 3HMCA 3A4AA 3L4WA 3K4DA 4FNUA 5KEZA 1EQPA 9CGTA 5CJ5A 1U2YA 4XV0A 3SCPA 4MAZA 2DSWA 4PEEA 3ALGA 5GPRA 1VJSA 4ML4A 2WSPA 4DWSC 4AMCA 2CBJA 1ZU8A 3D3AA 3F5KA 1PEZA 1FH8A 2YOCA 3LPGA 3BUIA 1BTCA 4DO4A 3NSMA 2G3NA 3G6MA 1DWGM 3MV11 3AIQA 1EO7A 1TMQA 4X0NA 2XYLA 5HNNA 5CSUA 3PZQA 3VOCA 2O9PA 5BXTA 2EADA 2XWEA 4CN4A 1F4AA 5IFTA 3CBWA 5D9NA 1W91A 5FOOA 3ZSTA 2ZIDA 4JFTA 1HJVA 1W9DM 5EB8A 4UQ9A 2RGMA 1UR8A 4J3UA 2O9OA 2VRQA 1JXJA 1UG6A 3GXMA 1JZ5A 4E2OA 2XWDA 5D8ZA 2V3FA 1WP6A 2QMKA 5CZKA 2J7CA 4NRRA 4MB4A 3H55A 1MW1A 4HZ7A 2ZX8A 1CNVA 4NXSA 4W8LA 4E8DA 4P7OA 4GKLA 3K8MA 1KCKA 2CBVA 1K9FA 4C7FA 3LRKA 2GUYA 1FFQA 3VUPA 1A3HA 1MQPA 2JF6A 3M46A 3LRLA 4HA3A 5I23A 2WW5A 2Y2WA 3N13A 4CN1A 4HP5A 5C71A 2BY1A 1MYRA 2OYMA 2F2HA 3BGAA 1UWTA 5JBDA 1V0NA 1SMDA 3GTNA 1CEOA 5D9MA 3ARYA 3U7BA 2YFNA 2XN2A 1KGXA 3W4RA 4JL1A 3BAJA 4U33A 1RP9A 1E15A 2V3DA 1E0WA 4PBGA 1HWWA 1VAHA 5I2UA 4GI9A 2EABA 1T0OA 5IFPA 4W87A 2F7QA 4N0RA 4UQCA 4CD7A 4RL3A 4N42A 4GZIA 1KTBA 1V6WA 1GOIA 1UR1A 5BXRA 2VUYA 2YL5A 2RGLA 2WZIA 1TFVA 3VINA 4FLSA 2VRKA 4B3KA 4Z2IA 1OB0A 3O6AA 3GYCA 1GQKA 3VSTA 3ALFA 3DDGA 1QNRA 2VCAA 3NYDA 3UERA 4M81A 1R7AA 2ALWA 2VQTA 2VZUA 3RM8A 3MSDA 5KZ6A 4C7GA 3HU7A 3TONA 5JUVA 3RIKA 4GIAA 4PCTA 2VX5A 1BGGA 3FN9A 1I1WA 3B9AA 2YDSA 4H7VA 5ABHA 1CXKA 5DMYA 4OBSA 3AS1A 2GJXA 2WC3A 4OJYA 3FHAA 3PTKA 4JFVA 2G8ZA 2QMJA 3HG3A 3K1DA 3LXCA 3VGBA 3VIOA 2ZUVA 1R8LA 1W32A 2CKSA 1JZ4A 2PC8A 3N15A 3VNYA 2WMGA 2CETA 2Z1KA 4J3XA 1VFMA 2YDQA 3CMGA 2WVVA 2ZE0A 3BUQA 1LWHA 2BFGA 2J79A 1R75A 3U5YA 2GJRA 3CUFA 1OD0A 1TUXA 4NZJA 4EANA 3QHNA 2DT1A 1HJXA 1U33A 4MDOA 4DWSA 3TTQA 2OSXA 1KWGA 4M29A 1HJSA 4CCDA 1ISVA 1IT0A 3D50A 4J3TA 1PJ9A 3HJEA 2JIWA 4GPNA 3J7HA 2QF8A 2J7HA 1AQMA 1DHKA 1WDPA 2XSAA 4XUYA 2D0GA 3IGUA 1HVQA 3W0KA 4PMUA 3PTQA 4AIOA 3WDPP 2DEPA 1XSIA 4ATLA 3VDBA 4D6EA 1KFWA 3CHCA 2VZOA 3ARRA 2DIEA 3GM8A 3WEZA 1G94A 1GHSA 2VZVA 3T2QA 1DP0A 2JE8A 1H0GA 3MUIA 4F9DA 4W7UA 4U31A 1HKIA 1C7SA 5A1AA 1M7XA 1UKSA 1X6LA 1NH6A 1LL7A 4GINA 3AZRA 2F8QA 1B9ZA 3AIVA 1VENA 3T2PA 1AQHA 4PMNA 1PAMA 2WNWA 2ZICA 1G0CA 3CZJA 2J78A 3O2LA 4NXKA 1V03A 1V0LA 2YBTA 4TX6A 4K68A 5A94A 5CSYA 4J7RA 5FD0A 2GDUA 4QLKA 4P7QA 1KBKA 3LX9A 1JGIA 2XG9A 3W53A 3IJ7A 1TCMA 3UESA 1HP5A 2GJPA 1ZJBA 3VMOA 1XC6A 3VIMA 1JDCA 4AEEA 3VIJA 2WWCA 3UG5A 4JFWA 1UHVA 3BAYA 3WH6A 2BXZA 3ZOAA 1TVPA 1C7TA 4TVUA 4UZSA 2EPNA 4P8XA 3ZIZA 1CXEA 4Z2JA 3RILA 3WNKA 2WVTA 1G01A 2CYGA 3A6OA 3AROA 2WVUA 1WKYA 1QVBA 1MW2A 4WLCA 1E9LA 5I6SA 5BRQA 2XSBA 4P8UA 4H04A 4S3JA 1E55A 3D4YA 1JAKA 5BXPA 1UZ4A 4W88A 3UG4A 4CCEA 1KWKA 1PS3A 5CLWA 4AEFA 2ZUUA 2WMHA 3F4VA 3MMUA 3FAXA 3WMCA 3A3HA 2WVVB 5I78A 3VX1A 1QWUA 4BS0A 2IGTA 4AD4A 1JXKA 1MFVA 2D3LA 4DUXA 4FLRA 4UQDA 3EDDA 3DX0A 3CUIA 1HX0A 3WENA 4OZOA 4C7DA 3WNNA 1H3GA 4DWSB 3PN8A 3TTOA 4AD3A 2FH8A 1LG1A 2VZSA 3TP4A 4PSPA 1PX8A 1XH1A 2OYKA 1BHGA 2DT3A 2J7BA 3DX3A 4P7NA 1M04A 4MNMA 3BAXA 4NI3A 3LXAA 5I24A 3VIIA 5IXEA 3CMJA 1O6IA 1XV8A 1NWTA 2CCRA 2PWDA 1V0KA 3LPPA 4ZEPA 1Y7VA 2YL6A 5HPOA 5FL1A 1MQQA 3KL3A 4DM1A 3IAQA 4HPHA 4ACZA 3EYPA 1H0IA 2UY2A 3BXWA 1PX4A 1CGVA 2WC7A 5A8NA 2EBNA 4U5KA 1XGZA 4LPCA 2X2HA 1MW0A 3EDKA 3ZJ6A 1UR9A 3ZJ7A 1WPCA 1J9YA 3BVWA 1JAEA 3BUDA 2FDMA 1NARA 1VFUA 3KL5A 3GDBA 3RO8A 1CGTA 4D6GA 3GNRA 2D0FA 1LF1A 2E9LA 4EAMA 2CBUA 1VEMA 3W6LA 1TQSA 2YLLA 3D4ZA 2ZXBA 2XM1A 4IISA 2MANA 3MANA 3VKKA 2BVDA 3AQUA 4W89A 1QW9A 3BVXA 3VNZA 4J3VA 5A6MA 3LRMA 3NIYA 1VF8A 3AHYA 4BCEA 4UTFA 2F18A 3WUGA 4TVCA 1W3HA 7CGTA 2J8FA 3AIRA 4M1RA 4UQBA 3B9EA 1JL8A 2VTFA 4PCSA 2XJ7A 3PZIA 3PZUA 3WL0A 1JNEA 3I3EA 2D22A 3MKKA 5A8OA 1FOBA 2Y8VA 1TA3A 3VVGA 1JFHA 2E0PA 4UOQA 4U3CA 1LJYA 1CWYA 3WFZA 1UKPA 5D9OA 2PB1A 1LLOA 2WCGA 3NUKA 1GOMA 2W66A 5BRPA 1AMYA 3CC1A 5A69A 3WY1A 4UZUA 1B3YA 4LYPA 3OIHA 1KXHA 4PN2A 5CQ1A 3FW6A 2YBUA 3MMWA 2EPLX 2DDXA 1MW3A 2QPUA 2J4GA 1B3ZA 3ARTA 4UOJA 2VVSA 3VGHA 5EBAA 1CXFA 1OD8A 4CVUA 1E4IA 4M56A 3WEOA 3W37A 1TG7A 2JIEA 3SCVA 5CGMA 1UWSA 3ZSSA 2F61A 2X05A 5E70A 2CNCA 2VRJA 2XN1A 2QHAA 3W81A 4ACZB 3SCTA 5HBFA 1HVXA 5E09A 2W63A 1JZ8A 2F7PA 1E4NA 1W9UA 1WB0A 1QNPA 3NSXA 2EPKX 2WB5A 1EDGA 1JYNA 4RE4A 1G9HA 1WO2A 3UCQA 1BGAA 3W29A 2C8NA 1PZ2A 4PMRA 2C0HA 1DWHM 4D71A 3WNLA 2FH6A 1VIWA 3M07A 3H54A 3W27A 4JCMA 1J0JA 4AD2A 5DT7A 3ZJ8A 2ZXAA 1G5AA 2IXVA 4A4AA 3CHDA 4FMVA 1JG9A 3WQ8A 1WNOA 3WQ5A 3RJXA 5BXSA 1J0HA 3RM4A 4MDPA 5JIWA 1JZ2A 1K9EA 1LL6A 2ZOXA 1C90A 2J77A 2UY5A 3POCA 4AZBA 4AIEA 2A3BA 1MXGA 4PRWA 1RP8A 1VRXA 5E0CA 4Z2GA 4WSJA 1XHGA 4TX8A 1RH9A 4HU0A 3LPFA 2FGZA 1UH4A 2WK2A 5ECUA 2ZWYA 2FYVA 5AC4A 4BZYA 1UH3A 3CZLA 1NOUA 3NDZA 4QLJA 1E6NA 1QPKA 3GBDA 3GNOA 4Z2LA 5BYWA 1SR0A 3OLEA 4HOXA 3TTYA 2F7RA 5HPCA 2OW6A 1JYWA 2EPMX 5BWFA 2WBGA 3W25A 3DX4A 1TA3B 2J7GA 2WKLA 3LPOA 4KRTA 3BLBA 3KEHA 4JKLA 2OWWA 2XGBA 4UFHA 3EMQA 1H49A 4WIWA 1XD1A 5A2AA 2DGAA 2OYLA 1CENA 3AHVA 3AJ7A 4TOQA 2CHNA 4V28A 3AXXA 1FHLA 3APGA 4Q22A 1ZBKA 4GXPA 3VM7A 4NF7A 1K6AA 3VDAA 3SCNA 1X1NA 3A22A 2EXOA 3BLPX 5DO8A 5ABEA 4PMVA 3U5UA 4WJXA 3IANA 1W2PA 2E4TA 2WXDM 4J27A 2ESCA 4W7WA 4DO5A 5CPQA 2DH3A 1EO5A 1KR1A 1V3MA 3MS8A 1E71M 1EIBA 1CECA 1JIBA 1UQZA 3WH5A 3AS3A 3GH4A 2J25A 3VD7A 1C92A 2DT2A 2D3NA 2X0HA 3THCA 4OUEA 2W5FA 3WELA 3SCSA 3ZMRA 5CGTA 1BQCA 1UR0A 3WDQA 5TD4A 2XVPA 4KRUA 1WZLA 2AMGA 3MUZ1 3N11A 3SCUA 3ZT6A 2BVYA 4PMDA 4A3YA 1SZNA 3ZO9A 5JIPA 1HIZA 1QHZA 5E9AA 3ARQA 2VO5A 4R5EA 3WY2A 2DSKA 4CU8A 4UFIA 2WLYA 3EJPA 2W91A 2WZEA 1V3LA 1R7OA 2DSUA 3VIHA 3WY4A 4AZIA 1KGUA 1KR0A 4OOZA 1Q6GA 2E3ZA 1UD2A 2G41A 4EE9A 4J3WA 2NT0A 3WF4A 5M3WA 3VGFA 5ABFA 4MNKA 3UEQA 4HMEA 3AXHA 1G1YA 1B31A 2BS9A 2PBOA 1W2VA 2JEPA 1MQRA 1J01A 3E1F1 1C93A 4JZ5A 2PWHA 2XPKA 3VIKA 1BVZA 1W3JA 3W24A 1XSJA 3VGDA 1QWNA 1E5NA 4TXEA 1C8QA 3VD9A 3BAWA 1N82A 1NOFA 4P7LA 2PI6A 4CU6A 1GOQA 5FCZA 3N04A 2WANA 3CZNA 2Y8KA 3MUAA 4AD5A 4GZJA 1E3XA 2ZXQA 3OLDA 1H1NA 1FH7A 2QPSA 4CGTA 2GFTA 1PIFA 1E6XM 2IUZA 3AIEA 2ZX7A 1US2A 4NZCA 2GSJA 4BQ3A 3VTRA 1KCLA 2W61A 1JZ6A 2E8ZA 4BA0A 2J8GA 4CKQA 3WUFA 2X2YA 2XGIA 1AQ0A 2VJXA 1GVYA 5I79A 1LL4A 1XCXA 4PTMA 2D23A 4WKHA 3WDIA 1E4MM 3RMEA 3MU7A 3WQ4A 4UQAA 3BVTA 4D72A 3PZNA 2WVSA 1Q6DA 2X09A 1V3IA 3FNDA 2XVNA 3AHTA 3H53A 1E1EA 4F66A 3VX0A 2VI0A 3WH8A 2CPUA 3AZTA 2V38A 1V0MA 5I0DA 1Q4NX 3WQVA 5E6ZA 3NCOA 1XD0A 1BYDA 3SURA 1OIMA 5AYBA 5E1QA 3VGGA 1GQLA 3GXTA 1ISYA 4M24A 3SEPA 1FHDA 3DHPA 2BY2A 2NSXA 4AZGA 4OKDA 2VR4A 2O92A 2V3GA 2DSZA 1HTYA 1CGYA 4AD1A 5AC5A 3HG5A 3L4ZA 5A6KA 2DPEA 2WHMA 2E9MA 4ZXLA 3ARZA 5A6JA 3WH7A 1V6UA 1XSKA 1OWQA 2D1ZA 3T0DA 4GQRA 7TAAA 1GORA 1HL8A 1D3CA 1CXHA 2EEXA 4W84A 1UD3A 3IK2A 3A4WA 3WQWA 3WDRA 4BF7A 1R46A 1XYFA 3BCDA 2JF7A 4WKFA 1J11A 3WKZA 1E6RA 1HL9A 5EMYA 1NOWA 3TV8A 4OBRA 1SMAA 5ABFB 1BSIA 3PZMA 3W82A 1WZKA 2UY4A 1EQCA 4UNIA 1ISXA 4CD4A 3CO4A 5CLTA 3VPLA 3RJYA 4M82A 3VO0A 2WSKA 1J18A 3QHOA 2FHBA 4IM4A 4WSKA 3A5VA 4U5IA 4EKJA 2VNCA 2GK1B 1PPIA 2AAAA 2YA1A 1B30A 3MI6A 2VMFA 4OGZA 1D7FA 2UY3A 1E6PA 3BC9A 2BNJA 1UA7A 3CUGA 1CLVA 4L4OA 3WNMA 4CCCA 1Q6CA 1NM9A 2G4FA 3KL0A 2X2JA 4GQQA 4PUDA 3BMVA 4ATWA 1E5JA 5CXPA 4W5UA 4YN5A 2XVLA 1WAWA 7A3HA 4H8UA 1JFXA 3PBGA 3BAIA 1NWSA 3D51A 1R86A 3AYRA 1I75A 4B15A 2F1AA 6TAAA 3RPMA 5JBEA 4B9YA 1UD5A 3JUGA 4D6JA 1XH2A 2D2OA 2PBGA 1K9TA 1ZB5A 3WMBA 1WDQA 4JKKA 4AZ5A 4H41A 4URIA 2XFRA 4U2YA 1YQ2A 1E72M 4D1IA 4MAVA 3VSUA 1ISWA 1E43A 3ZR5A 2G3JA 1V6VA 2WM0A 4J28A 3MSGA 3WSUA 3LMYA 5EFFA 3AFBA 5M03A 3IJ9A 2D20A 1QW8A 2XIBA 3SUSA 3A4XA 1DTUA 5GNZA 4HOWA 2BY0A 4AYSA 1UKOA 1QNQA 3UETA 4B16A 1A47A 1UKTA 1TVNA 2BY3A 1HXKA 1ITCA 4V2XA 4PSRA 3WMSA 3CUJA 1EOKA 4PMOA 1CXLA 3OZOA 4W85A 1TR1A 5A6BD 2WLZA 2CEQA 5EFDA 2WBKA 1Q6EA 1GPFA 1E3ZA 3N9KA 5FL0A 5LA1A 2XFYA 2FGLA 2A3AA 1CIUA 1TE1A 4YPJA 1NP0A 3BCFA 2O9RA 1ODUA 3AIUA 2D73A 1EDQA 3GZAA 4JFSA 3T0BA 1GOKA 1C8XA 3AXIA 1FH9A 2J7DA 1E0XA 1VFOA 2D24A 1V3JA 3SUWA 1JD7A 1W3KA 3WH9A 4J3SA 4AZHA 1UWQA 4EK7A 1XYZA 1PZ3A 1B1YA 1J0YA 2YKKA 2V5CA 1VEPA 1R87A 1EA9C 1B3VA 2ZUSA 1HT6A 1HKJA 3VD5A 1SYTA 5BCAA 4UFMA 3VD3A 1CGXA 5BROA 1JZ3A 5FKYA 4QP0A 1KXTA 4LYQA 2ZUNA 3WF0A 3ARPA 3CTTA 2CHOA 2J7EA 1LG2A 4MB3A 1OBAA 1J10A 4HMDA 3VD4A 2Q8XA 1B3XA 2F7OA 1C91A 2OSWA 2J7FA 3WD4A 3FAWA 2WC4A 2PWGA 4XX6A 3WF1A 1MWOA 4Z2KA 1EGZA 4GI8A 3VDCA 1F4HA 4GI6A 3AI0A 2WMIB 3B9DA 2BVTA 2J47A 2A3CA 3W6MA 1OT2A 1JNDA 4JL2A 1UOKA 4TVDA 1MVYA 2QLYA 2X8RA 2WHLA 4GO9A 1WDRA 3KE0A 2VX4A 2DIJA 3DYPA 3UR8A 4X9YA 1ZBWA 5CPTA 4LYRA 1SFSA 4D6HA 3MO4A 1QBAA 2EAEA 4P8VA 1QI4A 1M53A 5A8PA 1WCGA 3S6TA 3AHXA 1I1XA 2XUCA 4CU7A 4NZFA 4HA1A 4CVWA 4ZXOA 2W62A 4D6FA 1KBBA 4D6IA 2FE0A 3QGVA 3OGVA 3CZGA 2VOTA 3WFLA 2NW0A 3OLGA 2G3IA 3WUEA 2DQXA 5LA0A 2PWFA 4FLOA 3RCNA 2VX7A 1MFUA 1GQJA 1BPLB 1CGWA 3ZT7A 1H4PA 1M01A 3CGTA 1OGSA 3HG4A 2X0YA 4KMQA 3AIWA 3VMNA 3T09A 4PMYA 3AS0A 4W8AA 1GOWA 1E6ZA 3AHZA 4W7VA 3U57A 4PMQA 4KH2A 3WBEA 2OWCA 4HZ6A 4F79A 3AMCA 3ZR6A 3GH7A 5A8MA 2TAAA 3QHMA 4PTXA 3DDFA 2BHYA 3KLKA 1V02E 1H11A 5ABGA 3T08A 2ZX5A 4B3LA 1Z32X 4CN6A 1TQTA 2BHUA 4R27A 3EBVA 4NRSA 2XHYA 3CUHA 3RM9A 3QR3A 4FNQA 2FHCA 1ODZA 1R85A 1DWFM 4E4PA 5A6LA 1CYGA 2WCAA 1OINA 1VBUA 3N18A 3ARXA 3F5JA 5A2CA 3WD2A 1J0ZA 3PZ9A 2PWEA 4X0VA 1GUVA 4AXNA 5DFAA 1QNSA 4DUWA 3K4AA 3NSNA 1B3WA 4MADA 3GBEA 3HG2A 1KTCA 3GXIA 3WD1A 1TQUA 4HOZA 4BQ5A 1ZS2A 4AMXA 3CV5A 3G6LA 3IAPA 1KXQA 4JKMA 3BAKA 4LX4A 3WEMA 1GOOA 5D9PA 1UR2A 4XB3A 1UA3A 3ZQ9A 8A3HA 4CUCA 4GZEA 5HOSA 1CDGA 3GNPA 3EJTA 4HTYA 4JAWA 1J0KA 1FP9A 1OM0A 5LA2A 4DM2A 1WDSA 5AY7A 2E40A 2W92A 2JFEX 3FY1A 1E40A 3OA5A 1Q6FA 1OCQA 1TQWA 2GDVA 2WPGA 1B90A 1UH2A 4B9ZA 3VIPA 8CGTA 4HA4A 4MNJA 4AWEA 5LYRA 1B0IA 4H2CA 3OB8A 2WMFA 3AZSA 4LQ1A 3EDJA 4M8UA 2VURA 4WF7A 2JEQA 1W9VA 2WWDA 3U7VA 1GCYA 4JHZA 3OLIA 2YA2A 3GXDA 2HISA 4KGJA 4QCFA 1V6YA 4QDMA 2YLAA 4AZCA 3DHUA 3POHA 3L4VA 1QBBA 4DUVA 1E56A 2AOSA 3L2LA 3A47A 3A23A 1UYQA 1GHRA 2VX6A 3W38A 2ZX9A 1J0IA 1OT1A 3O9NA 4P8WA 4XZWA 1BF2A 1QI5A 2C7FA 3AMLA 5M5DA 3N17A 3M7SA 3OGRA 4BQ4A 2OSYA 1CLXA 3KWXA 1D2KA 2VL4A 1WZAA 2HVMA 1BG9A 4KWUA 1ECEA 5A6SA 2CESA 3OG2A 1QNOA 2ZUTA 1WZMA 4AD0A 4PTWA 3CZ8A 1QI2A 2YFOA 4OIFA 5E0FA 2VCBA 4ACYA 1PIGA 1ITXA 3OGSA 4L4PA 4CD5A 2YIHA 1DWAM 5HDRA 2WMJA 4HPGA 5A95A 4JIEA 1X6NA 2OW7A 4LGXA 5HXMA 3WIJA 4JFUA 3BVVA 3WN6A 1ZBCA 1R47A 3SCWA 2A3EA 4NSBA 1CTNA 1E70M 2W4XA 3F5LA 2BHZA 4AZ6A 1WE5A 4IPNB 4UFLA 2VC9A 4MNLA 2Y4SA 2GK1A 4Q7NA 3S5YA 3DECA 4H8HA 1MXDA 1HNYA 3ARUA 1R34A 1JI1A 3AYSA 5I77A 2Z1SA 3WDJA 1UR4A 4F8XA 3NDYA 2J75A 3OZPA 3GH5A 5IDIA 3WDHA 2DSVA 3S5ZA 4TUFA 1UKQA 4ZE5A 1JF5A 1O7AA 3DC0A 3B8SA 4W5ZA 5I3DA 5DF0A 1W1PA 4UFJA 4AW7A 4A3HA 1ESWA 1UD8A 2ZUWA 5C8BB 2GVYA 1BYBA 3SIMA 1HF6A 2BXYA 2XVKA 4PYSA 3PZVA 4V27A 4UQEA 1HJUA 4D6DA 1QHOA 1BAGA 1JYVA 1RPKA 3D52A 1QI0A 4JHOA 3WNOA
chains in the Genus database with same CATH superfamily
4XP6L 4ZFFB 3WEAA 1QU4A 2A3LA 4U1SB 2IDQA 4WKZB 3AMDA 5KVEE 5KYYA 1ZL1A 1SR9A 3BSHA 3W7CA 3EMZA 2XT1B 5IVNA 1H41A 2Z4TA 3UOAB 2NY0C 4RRPA 4I18C 4YHEA 1L3WA 4YR6A 4XTRC 4LAMA 3H4HA 3P9MA 5DHYB 4XPHH 2FBRA 1XF2A 1XI3A 2V0AA 2F0CA 2GYIA 5KBPA 5B38G 2OXNA 3GRWH 2ZYHA 1BVKB 4S1RH 1XFCA 5D96C 4AI7A 4JN1L 3L1FA 4Z6AT 5HI4D 4K7PH 4D8OA 2OMZA 2B2XL 3KBFA 4N5EC 3U83A 1I85A 3G6AA 1KIPA 3ZHKA 3QJFA 1JZ7A 3BZJA 1WWWX 1SEBB 1NTDA 5HTSA 5C0QA 2PPFA 1A6WH 1XTMA 1GC1C 1NGQH 1NC2A 2B31A 2BC4A 3KOXA 2MKWA 1G7JB 1BGXH 2XIIA 1LTXA 4R34A 4HPNA 3BDBA 3CXDL 3TA3C 4DXKA 5FF6B 1DWJM 1OSEA 2VMDA 4WK9A 5D2WA 1LLWA 5DVKA 3Q67A 4F9PA 3SJVD 3SKOA 3GJFA 5IQNA 1W1YA 4JG1H 3MRIB 1FNHA 3KPNB 4C56A 5TQ0H 3H6JA 3GXFA 4MJ4A 4O51B 5A3HA 2E9IA 3H7BA 5SV3A 5FF7A 3EDFA 4HUMB 4PVMA 5KVMC 3MCMA 2W9LA 3OIXA 3EDEA 1R2TA 1A6AB 4U2ZA 3CN2A 4F2MB 3H12A 5F0JB 4PL1A 3SUVA 3DYMA 4GUHA 5D70H 1WA3A 2PO6C 2X6VA 4MS8D 3VSVA 1NWOA 3C2FA 3R0DA 4BH8A 3JUYA 1IBDA 1E9ZB 1JR1A 5MEOB 3MHGA 5F9JA 2A7BA 1SXCA 4X80L 4ETYA 3UA3A 4M1GL 2J2ZB 4MKVA 3U2IA 5I6OA 4L1TA 2J9XA 2DWSA 1OLLA 2N1TE 2HPOA 1UUOA 3KH4A 1G7IB 2JVUA 3UPBA 4YFEA 2CMRH 1D7KA 3OXSB 3WTXA 1ZSDB 2R94A 1VCBC 3VE0A 4TV6A 2XH2A 4AZ7A 3LOTA 1UD4A 3ZE1B 1PBYA 5GZND 3XINA 1FPTL 2BVUA 4PP2A 2BWGA 4XPTH 4EIVA 4MJMA 3T8VA 3C0LA 5JQHC 4WK0B 2Q0ZX 2DQFA 1KLZA 2CLRB 3CUPA 2YLHA 4MB5A 3GSNH 3T1WA 3WQ6A 4L1HA 4HT1L 3VWJD 1HINL 4N2OA 3RZWA 5KZCB 1XRVA 1JV2A 1WYJA 2F6AA 5IHSA 3PZTA 1D5XB 5T33H 2UZ9A 4BQ2A 5DA4A 3TH6A 1XTLA 1NQ6A 4V33A 1YNKL 1NUNB 2WKGA 5FESA 4S2SA 2P45B 5TQ2L 3W3OA 2P28B 2CNZA 4DVBA 4YXHL 4LF3A 5JHDE 2ZOLB 3VFNA 3M88A 1WAUA 1V10A 2E6JA 4PV9A 1T5WB 3QJOA 1YTKA 3FHEA 4TL5A 3PPSA 2XZAL 2RJMA 2X7WA 1Z0NA 2HVNA 5JIQA 5D93B 1T5XB 3CDYA 3C5ZA 4WUUE 2B1HH 2ABAA 1GZHA 1FO0H 3L9RA 4MD0B 4RNFA 4Z77A 4ZFGL 4ZTYA 4NQEE 4PJDE 2YPVH 3L5XH 5CZKA 1XGYL 4NRRA 2VABA 3S3JA 5DK2B 5FF4A 5LAPA 4ZTPL 4C55A 2HPTA 1MNZA 3VRJA 2VDNB 3K8MA 4POCA 4DJDA 3LRKA 2DQ6A 1IE4A 2JF6A 1BEYH 1OW0C 2WO5A 4W6YB 3CFBA 1AS7A 5EPMB 3MHFA 4CN1A 2I9LB 4D8PB 3JWOC 3PUEA 1RD5A 4KRPD 3VXUB 4AVNA 3FSOA 4J9JA 5DVLA 2VDGA 4W70A 4BQ6A 3O6FC 4P23C 2WQWA 3MUGA 4DAGH 3S1VA 2VN5A 1V6WA 3SGUA 4BSJA 1K03A 2H3XC 1IGJA 4G7VH 2QCMA 2VN4A 1T2QL 1JK8B 3IBEA 3BLLA 3TZFA 5JIIA 4HOMA 3MREA 3RWIA 3BRFA 3QIBC 5K9CA 1NFDA 4BSWA 3NZPA 3Q5TA 5D1XE 1KENL 3VFTA 1MCIA 1P4UA 3F7JA 3SE8H 1HH9A 3SDXB 2QMJA 5LGYA 3VGBA 4ZSOE 2ESVB 4G8GB 2CKSA 2Z4GA 1VCGA 1JGDA 2ZRXA 4L3EB 1H8NA 1IWPA 4NAFA 2WMGA 2YN5A 1LWHA 2HH0L 2BFGA 3BP6A 2XQBL 4TLSA 5KYWB 1XCTB 2GJRA 1FVEB 1P2CA 4M7ZB 5GS2D 1T5KA 3BIKA 1OFAA 1OT4A 3M9YA 1P7QB 1ICSA 2E5CA 4ZFQA 4FQ1L 5I3HA 3G6JF 4XUYA 4HH9A 1XDLA 2FTYA 3CYVA 2Y36L 4Y2WA 3GM8A 1GHSA 5SX5K 2V8ZA 1NH6A 4GINA 1B9ZA 3L5MA 2ZCHH 3BKYL 4ZMOA 3IM1A 2YBTA 1RZIA 3I6SA 1XF3A 1RUSA 1IT9H 3DBXB 1LQAA 2XU2A 4J1UB 4YHYC 4APQB 2FVNA 1EJ7L 1INDL 1ZJBA 2OJZL 4M3HA 2XBDA 2V2TB 1L6SA 4TVUA 1UTDA 4C6QA 3IBOA 3UJSA 3CQKA 5EBUA 4MMZA 1XIJA 3MOAL 4LESA 3R10A 2VERN 4JQ1A 1XRSA 3RA7H 3D0LB 1GKOA 2V9UA 2W9DL 2AEPH 3EHBC 4NT0A 4G8FB 1G9MC 4IP5A 5B7YA 4PW3A 2KYIA 5GIRA 4PJIB 5I18H 1ZP4A 3CIAA 4RMRA 4L80A 4WUIA 3A3HA 2VDPL 3EZJB 4D7PA 4KEVA 3VX1A 3HGJA 2OU4A 3MO1A 5BZWA 4YGAB 1TMCB 2DD8L 2BK8A 1H3GA 1UB5B 4HS8L 4W1TA 3FFSA 1QEWB 1UWEH 1AFVH 1AS8A 3IYLW 4GQZA 4R7NB 4NFCA 4YHZL 2PDWA 3GO1L 4MJIB 3FLUA 5M7QA 2IWFA 3O0RL 1R3VA 2CCRA 2Q5BA 5LZLA 2YHGA 1A2YB 3KL3A 4JM4L 2R1YA 1OC7A 5D4HA 4Z7WF 4WY0F 3NIGF 4A2HA 3CH8A 5FDWB 1QOKA 4US5D 2Z24A 1E67A 3H9HB 3C8DA 2YPLE 4BFNA 2FEEL 1OSZB 2E28A 4Z9KB 4KDVA 32C2B 1YYLH 3FFDA 3BO8A 5FO7B 4RFNB 1M9SA 1F42A 2ZA1A 3WFCH 3LHZA 4N2YA 3SJVB 4XAFA 3REQA 1F1AA 1QW9A 4KKPA 1VF8A 2CLPA 4Z76A 1GTNA 4Q6XA 2Z6FA 4XTIA 5HHXH 3RFAA 3TAOA 3BG3A 4GUJA 3TEUA 2GJNA 2CXKA 1E4XH 4MZ2A 1KACB 4CNUA 4EI5A 2D22A 3H2PA 4X63A 1XGEA 4QLWA 2AEQH 1DJWA 3EZ8A 4Y16B 1H61A 3WFZA 4NPYA 4EZKA 2BWIA 5C7XL 3NUKA 4WGVB 5GJTL 2AZUA 5MHSE 3UO8B 4XNDA 3B34A 4IP7A 2N01B 5D2LF 3MBEA 3JWDL 1OCZB 3BD5A 1PCKA 1ETB1 2B77A 5CZVH 3O1NA 4KXZI 3S7GA 3G5ZA 2EXYC 3NO1A 4G42B 3SE3A 1MJ8H 3MV8A 1CXFA 3FQXB 4JTDA 4YDIL 3AYTA 3W37A 2NY6D 4F5CE 4JPQA 3HPAA 3W87A 2QHAA 2HX7A 1WB0A 3HEIB 4JY5H 3Q6GH 1WIUA 4OQTH 4LEOA 3UADA 1E7VA 5IJVB 1CVRA 4ELMA 3HLAA 3HGRA 1UBSA 1DE4A 4JJ5A 3KW3A 1JZJA 2PDIA 4PRWA 4PYGA 2WSYA 1P48A 4JGMA 3UD6A 5IR1A 2ZOOA 5AC4A 1FDZA 1X7FA 5BYWA 4E42A 5KSBF 2QGEA 3PL6D 5DK3A 7TIMA 3BYTA 2WQAA 1S78D 3DX4A 3D69A 1S9XB 4NZRH 4JKLA 1CFTA 2OWWA 3L7EA 1H49A 1SJAA 3ITVA 2IPTL 1LDSA 3VXTA 1TFPA 4LRIC 3OMIB 3IU3B 3CD4A 3QQ9D 3PUOA 4H1LA 4GXPA 3K6FA 3VDAA 1K6AA 1JXGA 5E9XA 2ZKWA 4PMVA 4YK4C 3B2PA 2ED9A 3ATAA 4HCLA 3AS3A 4JKWA 3S2LA 4XO8A 4XC1L 4QRAA 3O11A 1JRCA 3PWPD 2YRLA 1BQCA 1TWWA 2EYTB 1EMTH 4P2OC 3RVTC 3PWLA 5GRUH 4J8QA 3ZYIA 4AYID 3BJSA 5HHOA 1EGMA 3FCBA 5SWZA 4Y9CA 2PPEA 5MKGB 3HFYA 2PCQA 3BRDA 3QW3A 4LU5L 5C9JB 1YQVH 3NEXA 4JRWA 4K94H 4QNWA 3ABSA 2VZ3A 2G41A 4ZFCA 1K8XA 5KANI 1KRCC 3TBSB 4Q4IA 4RMWA 5IFHH 3FH7A 2G0WA 3TPUA 1D3HA 2JEPA 2JKLA 3ZKMD 1T4WA 4KRPB 5G4EA 4KETA 5FM8A 1W3JA 1TTAA 3KYNA 3U0PB 3W7RA 4IFKB 2QQKL 3BAWA 3O6ML 1T04B 1YDPA 4JTKA 4HK6A 3CZNA 4HDIB 2Y8KA 1M5WA 1E3XA 2G4GA 1TTFA 2QPSA 4R97C 4A6YH 1KCLA 2E6DA 2EDRA 2X4NA 3CHOA 2E8ZA 4YHPB 3WUFA 5B7EA 4JZJC 1PKQA 3ZIYA 3THQA 1O7DE 1G7MA 2BVPA 1X7TA 4NCDA 4MY8A 2BNRB 3PZNA 1RIUH 4OV5A 3VB9A 1FIGL 5TH2A 3VX0A 3PHQB 2VN6A 2A3TA 3QQ3A 2PP9A 1CDJA 3EYOB 2HWZH 3MNMA 3NFPB 3SY1A 4JX5A 4HFUL 2X7VA 4QO1A 4KZDH 3DHPA 1U8PA 4G6KL 2P80D 4S3CA 5KMYA 2ZBTA 3P77B 4A3RA 4J12A 1JJUA 4G70B 2PS2A 4S1QH 4XCFH 1XSKA 2CKNA 3S36L 4Z0XA 5DYFA 4ZB2A 2JKPA 4EF3A 5H37G 4W84A 3WDRA 1UIOA 2BH0A 1XYFA 5D7EA 4U4BA 4KFNA 5EMYA 1UWGL 3TV8A 2PR4H 2RDTA 1Z9LA 5D1XC 3WUWB 4HZ1A 4B9JA 1YBQB 2Z0BA 5B1AB 3ARGD 1F3JB 1D5MA 3DX7A 4EOWH 5EF0A 4B7LA 1X5AA 2PD5A 1VGKB 2WNNA 2BSRB 4W81A 3RY6C 4QRSB 5KYUB 5KBLA 3NN8B 4EIUA 1XG3A 4NKDB 2VM8A 1JFXA 1SM9A 3MC5A 1TITA 1A7PH 3MRMA 2DY2A 1KC7A 2EVJA 3EOAB 1XH2A 1R5IA 4NQVA 1BA9A 1KM1A 4UT7L 4AZ5A 1ONWA 4XPFL 1A4BA 1KDIA 3PVFA 1MHPH 3EUUA 4RX4D 5GRJL 5DHEA 2DQIL 1A3LL 1KEML 5JIKA 1F13A 3PPGA 1G6RB 1ZA3A 3QHFL 4IRJB 3GUTB 1EOKA 2FIKA 4BGDA 3GI8L 5ESAB 3CBJB 5HHQA 1D7BA 4OCRL 1XKYA 5FL0A 2I5GA 3HQ1A 2R83A 4U6HA 4NKOA 4XPGL 5LWYL 2A5HA 4RE0A 3AWFA 2YD2A 3QBTB 1N8ZB 3HM7A 2COVD 2XYCA 4RQQA 2DQEH 1A8ZA 1JCNA 1JD7A 2IAMB 4OZGA 3MLPA 1I3VA 3IMUA 3S8HA 4FXGA 4RESB 3FOKA 5AW6B 3CN3A 1XLLA 4YDZA 1FH5L 2QIIA 4LNVA 3SDDD 4J6RH 3UTPD 3W07A 2XH7A 3RUGB 4XH2B 5ICZA 3WD4A 4F2ME 2NNCA 2PWGA 3GS0A 4GAAA 4H0HB 1Y6KR 2A3CA 3PP3H 2IKJA 4TVDA 1WDRA 2ACRA 5H2BB 4Z7OF 2PNDA 3ZK0A 4HHAB 4I3RH 4BKSC 3TR9A 4IG2B 4X8JB 3TM6A 3ALPA 4MZRA 1K4CB 2NXZD 4MJ5B 1KA9F 4AX6A 3M1ZA 3WNIA 2YBGA 5K1JA 2VOTA 3I7RA 3LHAA 2H0FA 3QUYA 1F76A 4V1YA 4LOUD 1GQJA 1TZ9A 3Q8FA 3DTXA 3G5WA 5CP7A 1Q6QA 1KJMA 2X30A 3ECVA 5HDBB 3NOIA 3NABL 3U57A 1RK5A 1ACZA 3FRPB 1DLFL 4P59H 2CO1A 2PCXA 3R2GA 5IF0A 4GA8A 3ZE1E 4CN6A 1TQTA 4JM2F 2D69A 4OIIH 2GBUA 5EDSA 1XXDC 3KP0A 1ONXA 2YRBA 2NY6B 3MKVA 1C5CL 1T6VN 1B4TA 1WGVA 25C8H 4EQ2A 4ZS7H 7ODCA 1IXQA 1WFNA 1NBYB 1WIOA 3PGFH 3U9WA 3ZO0A 3D5OF 2FEEI 2VDLB 1RVKA 2FZ3A 4G8IA 1ZSXA 2VCOA 2VLLA 2IXQB 5HPMA 3GNPA 1O60A 4PLOB 4F8OA 3LJ3A 1Q6OA 3VQLA 3O9WC 3ABOA 4PA8A 2DMKA 3URBA 5EBMB 2VXQL 4JKPL 1TV2A 3SPHA 5FEBA 4DF2A 4GMSL 1V6YA 4RRPM 4G72B 2L8AA 2AOSA 3PL6B 1GHRA 4BUHA 2VX6A 3DJZA 2WSQA 4ZGYA 4KEMA 4HS6B 1T0NB 3SE4A 2CCVA 1ERNA 2HSIA 1PUDA 1QRQA 3P3TA 3KGRA 4X6EB 3ABLB 1FWXA 1K6QL 4GVFA 2OMWB 2ZP0T 3TSDA 1XMEB 3MRQA 4ZUSA 3R06A 4YMZA 4IQDA 4WNQB 3T4CA 3P0XA 2NUPA 3KPSA 4NIYE 3WKPA 1WEJH 5DT1H 4KK5D 4M3KB 2XZQH 3UZEC 4M7JL 4KWOA 5DO2D 3F5LA 2I07A 2P47B 3GTHA 2ADIA 1DXEA 1S2UA 3H6OA 4Y4FA 3VXUE 3ARUA 1AY1H 2H2SC 3KYOB 5CHNB 4ANKA 1JXFA 5JQ6H 5I00A 3HR5A 3IEAA 5JHAA 1QG3A 1NKRA 3FU9A 4N20A 5AHLA 4H20L 3UAJC 3B8SA 4BQCA 3A5FA 5J6GA 4LV4A 1ESWA 4XISA 5TDPB 5CSRA 4HGKC 2Y25A 1INQA 3APTA 2F54D 4LSVL 2YW3A 4D6DA 3V55A 1KB9K 4AX3A 2ZZ3A 3Q65A 4IWWA 4A7QA 4UNVA 2R0KL 5I3IA 2F74B 1DQMH 2NZLA 2V5DA 2Q8BL 1W54A 2W27A 2QSVA 3QULA 4YN3A 4O14A 4N5UA 1S7RA 2VDNL 1J5IA 4OZHB 3JUZA 3V5KB 3WBXA 4QRUB 4KUZH 1SJBA 3FOMB 4NRZA 3SDXE 3W86A 1FFPA 4G8GE 4L3EE 1J88A 1B4EA 1JPTH 5DUJA 1DUZB 5A2BA 2C9VA 2A9NL 5I6NA 3KPRD 1OV8A 4EACA 1K2DB 3HI1B 1FHVA 4B5ZA 3VWKC 4GABA 4NO3B 4IIDA 5D2YA 3RAJL 4WEBH 1S9KC 5DJXA 2P5WA 3WE6B 4KWSA 4YTSA 2EXWC 3MUCA 1Y0LA 1BDYA 1KJ3H 3TJLA 3NQKA 3KGUA 4X22A 1R5YA 1VFTA 5C08D 4Z3TA 4UOZA 3T6XA 1B2WL 4KTGA 3US0A 2GBTA 3GMPB 2GJXB 3HNTH 2Y7DA 4URKA 4O4YH 5GRYA 1TQVA 1O5QA 5DX7A 1BZ9A 4WWKD 4UMBA 3ARBD 5AD0A 4FQXB 4OM1H 4YOKA 6A3HA 2FT7A 2NY3C 2FKPA 3RLGA 1UASA 1YY8B 1W3LA 1O7DC 1GJUA 2EUWA 4XVUC 3LM3A 1F1DA 3FMGH 5G4WA 4M6VA 5HDQH 2P43B 1JDDA 3L4UA 3VA8A 4AIZB 1PD0A 3UJ2A 1BZEA 1VIZA 1IGWA 2XPZA 4XSMA 1IHIA 4AVKA 1ITQA 1G7LA 2ZAHA 1KNOB 1G84A 3VW3L 2NYZA 3ARGB 3UR7A 4MKNA 3IFOB 3QPQC 3QK0A 3SGEI 2VVNA 5FWRA 1I1CA 4UWQB 3JWNH 3ABZA 1ZHKB 1OK8A 4WI5A 3O4LD 3RY4A 4PJIE 2YUXA 2AV7A 3L66A 1DIKA 4XNXH 3OKEA 2ZX6A 4JCLA 1CFSB 4Z1PA 5DS8A 1GJWA 5DQDH 3KCOA 1ZTMA 1R3KB 3K6SB 1UZDA 2BIQA 1MFAL 4PY7B 1EWEA 3FQNA 3P5YA 4AYMC 4A37A 2B4CC 1XIWA 3DI2B 3CFJB 3QMTA 5FHAL 5FYJD 4ATDA 1ZT4A 1QK0A 3TJXA 1GYCA 5DEZA 3UYCA 3RRQA 4MJIE 4DP1X 2E27L 4ZQTA 3NIFF 2EJ1A 2CLKA 1G4MA 1AKJD 3ATBA 4AEOA 4YNGA 3VU2A 2BSTA 5M94B 5F1IA 4KQ4L 1J5OL 3T0EC 4PJCB 5AYIA 4S1SL 2EEFA 3G1YA 2OT1A 5D71L 2CERA 1NFIB 4BZ1L 1L5GB 1SDDB 1NFBA 4S3KA 1Z66A 1KPRB 1FGVH 1I7UA 4GLEA 5HANA 1A65A 2BSSA 3TH4T 2G60H 3JTSB 3SJVE 1YNPA 1R9FA 3GKZA 2X1IA 3BKML 2Y7OA 3KVLA 3OVGA 1HNGA 4IMCA 3D39D 3IRPX 3WY3A 2X1TA 1ZHBA 3SDDB 4HC1H 4G9PA 2BSED 1FP5A 4RPQA 5E1HB 1E30A 3TSMA 5CJQL 2ZWZA 1NP2A 4AJ0A 4AISA 4N2NA 2WYIA 4NI6A 3GK8H 2CD0A 2LAGB 1I3UA 3G9VA 5I8CB 3CXHK 3RPIA 3CAQA 4FP8H 1TJIL 2DQGH 1PS9A 5F88B 1WOAA 2ZJSH 4HX1A 2C3HA 2ZG3A 1TTCA 1ZWIB 4K23H 5EEYA 2CBJA 3V9EA 2NY2C 2H41A 4Y9BA 5KBDA 5I5MA 2XH0A 5DEFB 3QIWB 1KN4H 5CZXD 1BXBA 4JY9A 3PZQA 3LN5A 1WQ5A 5HINA 2CAKA 4D94A 4UIMB 4JFTA 5IMOB 2K4AA 4B41A 2BLEA 4F57L 3BT2H 1B0GB 3W1QA 2HVOA 2H8PB 3N0AA 3QJVB 1DVTA 4Y4KA 1C8PA 1TJGL 4GKLA 3MDWA 4TUKH 1CVSC 3JV6A 3RBGA 1NCDH 1DL7H 3MY9A 3G3MA 1FLTX 2KHAA 3M46A 4XMPH 5J06A 2WWKT 1CN4A 1J05B 1IC1A 3WJXA 1CEOA 4TN9A 4NHUB 3UYPA 2E3VA 5E4EC 4JRYB 2NW2B 1IEVA 4HIQA 3N4EA 3K1KC 2E09A 4QTGA 4XTDA 4CSTA 5E6IC 2B7OA 2E4FA 5IFPA 4H8WL 4P4KC 3HI5L 2P53A 4DGWC 3K13A 4GZIA 1V5XA 3S2NA 1FSKB 3QZNA 4AMKH 4C1NA 1HC1A 3E96A 4E3VA 2VRKA 4QY8B 1FCBA 5J1AB 3PJSB 1OGTA 5CUSL 4LVDA 4O13A 2RHGA 1GGBL 2VCAA 2WO4A 2ATPA 1VACB 5CEYB 4GNKB 4QRQA 4FR1A 5G5DB 4M5TA 2P8CA 1J1OH 4R5XA 2P50A 4BI6A 1MCSA 4NEHB 1QUPA 1MRDH 3VZZA 1RVFL 3FO0L 2DAVA 3V7AG 2BMBA 2MNJB 1Q9OA 2VQ1B 2J79A 1NIFA 3L9YA 3K2IA 3BQ5A 4PGLA 1HJXA 3TTQA 3KTCA 4M29A 1HJSA 4MZIA 5GSVB 1MCPH 2HFGH 1PJ9A 3EJZC 1D9KC 2CO7A 2OL3B 3S37X 2OJ1A 2IH3A 1MEXL 3SPJA 2R0WL 3TZVA 5B8CC 3NTCH 1QSEB 1M7XA 4FTVA 1E28A 3WLKX 3EBHA 3AZRA 1AIFB 1LUCA 2F8VA 3P7YA 1YNYA 1E8WA 2VMJA 3NCJH 5IVZB 4PJ5D 3O2LA 1YEIL 3F03K 2F54B 1CDCA 5AZ2H 2J8HA 2NY5C 3DVIA 3FU7B 1JVOA 2EIBA 2KDGA 1KTLB 3QEGL 1MCHA 3WJJC 5T26A 1MO0A 3LMJL 3E80A 2WVUA 3DMMA 3QVQA 2DJ4A 4MCZA 2JK5B 2VDOB 4JANA 2QSCH 4K7FA 1XJBA 3SRHA 1E55A 3T1FB 1JULA 4OCSL 3RWFB 4W88A 3O0LA 4FS0A 5J89A 4PRIA 4AEFA 3ZPDA 4NWUH 1D6VL 2V5SA 4YHIB 5DK0B 1SZGA 1NEZB 5HY9A 1QACA 3E3HA 4ES4A 4ZPTA 1OAKH 3KPRB 3ARDC 2J44A 3MZTA 4DQAA 1U8CB 3WENA 3NQ7A 5KSVB 5EMMA 2J27A 2H1LM 4DP7X 4P7NA 2XJKA 4UTJA 3K2KA 2OCFD 2Z9TA 2IPGA 5L9FA 3X12A 3IIPA 1KTDA 3B8TA 4TSBH 4PQXA 4HPHA 5E8DH 1WGOA 4HWZB 2EEDA 4XT1C 3QRBA 3RLUA 5AKSA 3QO1A 4WWKB 3SFWA 3ARBB 5GGTH 5L8LB 3KZPA 4K7VA 1XL9A 3Q3GA 3SSZA 2OX4A 1XPYA 4H0IA 1RPQA 1NBVH 3W6LA 4F8PA 3D4ZA 2HCZX 4AVHA 3V35A 3SBWA 2A9BA 4HHLA 5J5RA 2KLTA 4NUQA 4MDIA 3R58A 1CT5A 4U6XB 4H8PA 5AW0B 3PZIA 3T4AA 4HK3J 2X3AA 1K8IA 2HTKD 4XCEA 2UZPA 1DVZA 3O4LB 3MLWH 1H1YA 4GG6B 4PGBB 4K2UH 3DSFL 4JY4B 3ET9F 3TIEB 2W8CA 4BFKA 3IACA 3JTTA 3VVVA 3QQ0A 3EO9L 1OCBA 4YO0A 5HA7A 4E2VA 2ZUYA 4APQC 5EZOL 3QXAA 4IMFA 2EPLX 1TWDA 3P0VL 4B2DD 3MJGX 1WFJA 4UOJA 1HL2A 5ADPH 1DCEA 1JPST 3PNZA 4BI5A 4BFIB 4LY8A 1ZD6A 1DV7A 1O5KA 3L3DA 3SCVA 3FQTA 5DCBA 1UWFA 1IEBB 4FP1A 5TK2A 1AKJB 3MJ8B 1I8UA 4G43A 5CJXA 3R18A 4MAUH 4BD4A 3RTLA 5I1GL 3KPOA 3W29A 2C8NA 3RUGE 2R69A 3VXMA 1A3XA 5I6KA 4L9LA 3IEBA 4GQ0A 2ARJB 4TUOB 4K07A 5TGBB 4MGGA 4RZ5A 5FGSA 2ODIA 2AJXH 4LL1A 2KPWA 1XIIA 3LHYA 4JPSA 3DGBA 3HG1D 5AL0A 1J0HA 5D38A 1K9EA 2LU5A 3L3GB 2HVKB 1JCVA 1O66A 3GM0A 2VUKA 5IWLC 3DUSA 4OFPA 3D39B 2MQGA 1JZGA 2QR6A 1NCAL 2HFEB 4O0ZA 1L6GA 2FGZA 4CADB 4FABH 2ZWYA 5T1LA 4Z42C 1NOUA 3GRBA 4JRFA 3KPPB 1G9NH 3IFNL 2VDIA 1TV4A 2WP3T 5D1ZD 2ZTKA 4FJYA 3MYJB 1I8KB 4L5ZA 3TLQA 2WZ5A 3D12B 3P82A 5HDBE 1ZBKA 1ZT1A 4ENZA 3E2SA 1EJ8A 4Q7IA 3T40A 4PJ8B 1E71M 5EF3A 4BDVA 2BB0A 1DJGA 2FZDA 3SCSA 2G2PA 3ZMRA 4E41D 3ABKB 2AMGA 1WTGT 4M5YH 3QPKA 1A49A 2DVUA 2CKBA 2FWOA 4HKZA 2DSKA 5A5WA 4Y16C 2XA8H 3WY4A 3IE9A 3D48R 4BCZA 4EE9A 3SGDI 1H3UA 1FWGC 4EXKA 2C14A 5T1MB 1W0VB 4XVSL 3BP4A 5TIMA 3L5WB 1EX1A 1AD4A 3TO4C 1YEFL 4GLRH 4WHYG 5BS0D 2ISWA 1CBVL 2DM2A 3T0VA 1CF1A 1BXNA 1C8QA 2FJGA 4CU6A 4WI2A 4OJEH 3MUAA 3T3PF 2DZPA 3OO2A 1N0LB 4QX4A 2IALB 3BZEB 1NANH 2VDKB 1AZBA 3B4YA 3G0UA 3QHTC 4NP4H 4OM0H 4N2FA 3BDXA 5F9OL 4YEEA 4HUXB 4D72A 1R3QA 3AY4A 3WLTA 1BBJB 4K0OA 3AZTA 2L7JA 5F7AA 3G04A 3G5EA 3UYOD 2J8UB 2XXGA 3SDCD 1ICQA 4U6VH 4MWAD 4M3JA 1XLJA 1N2RA 1JPGA 2FX9H 3SDAB 2XKNB 1SOKA 3OKDA 4XKMA 5EOTA 1HHJA 1PLAA 3PR2A 3SE9H 3AY2A 4PB0L 1ME9A 4JVUA 4WKFA 1NMBH 1O9VA 1OFQA 2FIQA 4OBRA 5REQB 2IQDA 2SODB 4PB4A 2WIIB 1GG0A 3SI9A 1ISXA 4XUGA 4A05A 4ZMGA 5A40E 4PI0A 3BJTA 1F0LA 3WNJA 5C0BA 4WSKA 4X8XA 4L05A 4OIBA 1IZCA 3EKLA 3TC9A 4OZHE 4QM1A 2L4OA 2VMFA 1D7FA 4CEXC 1FE8L 5AB9A 4Y1TA 4PJ5B 1D5IH 2F19L 4PUDA 4ATWA 1E5JA 3HRPA 1SXSA 3P2VA 3IKCA 1PWMA 1QP1A 2A0LD 4G7YL 1OZQA 2AV1B 3QKZA 6TAAA 5JBEA 4DTGL 3T55A 3FS2A 5KSUA 2HZGA 4KTEH 3T6VA 4YWGH 1YQ2A 3QI9A 3ZL2A 4DFIA 3ZR5A 4MLIA 1HCVA 3T65A 3OZMA 1K8YA 2G5BB 4JQIA 4DIXA 1AXIB 4L6HA 3VKDA 4JGNA 5TNVA 1O75A 1YVLA 4PSRA 4KH9A 1FWBC 4WO4A 1SRDA 1RUAL 1R5WA 5EFDA 2WBKA 5CFAA 3V0UA 1Q6EA 1G4TA 4PS4H 2WD0A 4YHMH 4YVVA 4GRWH 3GZAA 1XB6A 3T0BA 4OCWH 3BOFA 1MRQA 4BSVA 1UGNA 1Y0EA 2KMWA 4XOBA 2GQ9A 4GT7A 3UG8A 5IBXC 4NT6B 3NFSL 4GRLA 2VLMD 5EORL 3BSZA 3W5NA 2PP8A 3RX8A 5ICUA 1SJEA 3TQVA 1CGSH 1B3VA 1HT6A 4MZ8A 1I9RH 4JRXD 4L37A 1N64L 4MB3A 1OBAA 4HMDA 1FJ1B 4EQ3A 3VI3A 3HAEB 1BG1A 2C1OB 4JHMA 5HGHB 2YCEA 3KPMB 3O8AA 4R90H 4GI6A 2JKAA 3W6MA 3K6OA 1IIHA 1WDDA 1MVYA 3S35X 1LO2H 4JVPA 1MQKH 3MSYA 3PP7A 3WUZA 1YDNA 5J11B 1WCGA 4K7YA 1FHNA 2W62A 4CQDA 4MYAA 3DI3B 4QF1B 1GIGL 3DURA 4E68A 1MAKA 1F73A 4N6FA 1RUMH 4FZ8L 4FLOA 2ZKHH 4RFEB 1HGWA 5KS9F 1AG0A 1JPEA 4AWJC 4I5BB 1OFDA 2VEFA 1WV7T 4PJCE 4DBUA 2FX8H 1AJ7H 3ZTNL 2AJVL 1E6ZA 4INFA 4LSUH 3WN5A 4KH2A 3DOSA 3J2PA 1PF3A 4ZFOB 3LMZA 4HFWB 3N1QC 2BHYA 4F7TB 3WEXA 2XUWA 5TE4H 5T91A 1TVBA 4IOFD 1FFOA 2YXGA 2BX5A 3KDMA 1N55A 1ODZA 1PDKA 4YYCA 4C90A 1EEYB 4L7ZA 4WK4B 2ITFA 3N18A 2ZDRA 1J0ZA 4JPVL 1L9SA 1H8OA 3HKFA 1I8MB 4DUWA 5TTRA 2PP7A 2WLMA 4GAYA 5C9KA 2CGRH 4GC3A 3IAPA 1RZPA 3PG2A 5C2BL 4Z7VF 1FWTA 3UTPE 1ADSA 1AE6L 3AWOA 2ZNWA 4FNLL 4IRJC 2YK1L 2GGEA 2JIXB 5LA2A 4U1IA 2W92A 3QUXD 4YTTA 1W3IA 1NZRA 4Q8NA 3HG1B 2QCFA 4ONGH 4OF5A 4DGYL 4YSDA 3N6YA 3AZSA 4LCIL 1YG9A 4Q52A 3MWAA 4RDBA 2QUVA 4XCCL 1LP9F 3VH8A 4JHZA 4N25A 4ZOBA 2IAMC 1AKPA 3GC3A 5DUPH 5LBGA 4HPYL 4DUVA 5T8GA 3MJ9H 1PLCA 5DXWA 4JY6B 1S2CA 3TBWA 2O1AA 2VW6A 2NNRA 2VLJA 2NX1A 4IHOA 4GMEA 1FL5A 3N17A 2IBGA 2EP6A 4BUGA 3KWTA 5D1ZB 3P4OA 1I4FA 1ECEA 5LNDA 3CH0A 1D7DA 3CZ8A 5HVWA 3T8QA 3BKCL 3ZQWA 1QI2A 3VCNA 3RU6A 5K9OA 3K2UH 2LT9A 2AL2B 1M56B 3N85L 2QQ6A 3NQGA 1A0CA 3SCWA 2P48B 2A3EA 4UI2A 4JFFA 2OLSA 1A6TB 1E70M 2W4XA 5F3BA 3K71A 3C2VA 1ZV9A 3V6FB 4XD6A 4E41B 3N42F 5IESH 1HNYA 4JHAH 2P1FA 4NKIL 4JRYE 3ZYJA 4BM7A 3UFIA 5MP6L 2J75A 5CD5C 5IDIA 5CIPH 5C5YA 4YX2H 2YBRB 1O7AA 4XN2A 4HJWA 5J4MA 3FYOA 3TIMA 1DSFL 2JJUA 1QHOA 4HIPA 3D52A 3WNOA 1RAKA 1EHNA 3Q8CA 2ICSA 5KTLA 4O12A 3R0UA 1PEWA 3AGWA 4Z95L 2CIKB 5A6AA 4JO3L 5AVNA 5FAGA 4HJSA 1SMOA 3S1GA 1QDSA 3JT0A 4W8BA 1G5GA 3SBPA 2PD9A 3IVSA 3T0AA 3DN5A 2X12A 1JI2A 4EAYA 4IRSA 1KQZA 5B4MC 1S5HA 3KRZA 3EJRA 1HIMH 4OLUL 4FFVD 4M80A 2QUNA 3N6HA 4FDWA 2QULA 2RDUA 1HQRA 4HWEL 2DQCL 1ES0B 2J4WH 1A4CA 1XBVA 3TYFB 2MWCA 4U6YA 5JORB 1H8SA 4L4TA 3CU2A 4WW1B 3TTSA 4LRSA 3S5LA 3ETTA 4IBQA 1QFHA 3TWCH 1CDBA 3QOMA 3AO0A 4X83A 1BFNA 2CUIA 3NJNA 1J1XH 3CDZA 4V1DD 3KLQA 1ZXQA 3Q48A 1QSEE 3PL6C 4LWWA 1H09A 2WCSA 3TW6A 1ZLSL 1GWJA 4TLTA 1EZWA 3GD1C 1E6JH 1RJYB 3FU8A 3DGCR 2UWEB 4GKZA 5KOMC 1I7RA 2F54E 4JTSA 4DN1A 3IUDA 3KLLA 1AD9A 3L3HA 4W9LC 4ZQPA 3W26A 3NGBB 2GPZA 1EXPA 4I3GA 1A5MC 5LNRA 2F5AL 4G83A 1SFTA 4X9GA 1UWIA 1D9EA 3GFZA 4G6JL 3MLYL 2V4LA 2CG9X 3MODH 1E1CA 4WGHA 3DHFA 2VMEA 3RIFF 4GIEA 2OL3L 3DJTA 2AKRA 2CWRA 2YDRA 5ESQA 4RGOL 4EWJA 1NGYA 5IJCC 3SY5A 4BWUA 3A3WA 3ILPB 3KPRE 3VDHA 5FCUL 5JBFA 2BDQA 1T8XA 3HBLA 5JMUA 1XGPA 3OBAA 3EOSA 2J73A 3OZKA 3CN4A 5T5FL 1ZTXH 1XBDA 1RSYA 3O2DH 2WZHA 3LUTA 3IJSA 6FABH 1N10A 5IMMA 2ZE3A 4HJEA 2VDOL 4QGYA 4AM0Q 3UJEA 4LL9A 1J1PL 4JFXB 3VJ6A 3T0TA 4KKBD 3B05A 4HYRA 4UNTA 3HC4H 3QNYA 1QO5A 1AGDB 2ZXWB 3BZDA 1P7BA 5I06A 1OCOB 3A67L 4E2BA 3WKNA 3ZRCC 5CEZD 4ICNA 3KVQA 5I2IB 1JVNA 4MKTA 1Q45A 3KGTA 2BDNH 4OUIA 2EQDA 3FUMA 3NSJA 3EMCA 1T7VA 2AXHA 3L12A 3I50L 2Q7AA 3UAAA 4JRXB 1PO9A 1W37A 4UTAL 1Y1DA 3GE7A 5EU7E 2A73A 2FB4H 4NAQA 1HDMB 1WF5A 1JYXA 4HMCA 3PJWA 3G5XA 4WHBA 2KQNA 3KW8A 5DGRA 3O4LE 4WFED 2OR9L 3CBKB 2ADFL 3KLHC 4GG6E 3RWHB 1BZ8A 4A21A 4LO9A 3K4DA 4FQXC 4L3CB 4FNUA 2E74C 5DD1H 3QMSA 4IXXA 5ADOL 3W1MA 3DXIA 4G56A 1GPWA 4WDUA 3ARFA 5IBLD 4M61B 5D6DC 1F3XA 6PTDA 2HJFB 4BZ2H 3BPWA 15C8L 4NNPL 2ADJB 5CAKA 3VWJB 2HLAA 4HUWA 3HI6L 2XWEA 3GJEB 2RGMA 4AEHL 4CC1A 3Q6FB 3BEWB 1I1FA 2VRQA 3GXMA 2ISVA 1K3IA 1X4YA 1X5KA 4R2GC 4C91A 1QBML 4PJ9D 3RGBA 2V8LA 1R3HA 2IPUG 3C3NA 1GYLA 2CBVA 4UTWC 5FKPB 1SEQH 5D5MA 1R2SA 3VXPB 4OJDH 4HA3A 5I23A 4H6KA 4Q6IB 4FX5A 1MYRA 1K4GA 3Q2WA 1NICA 4QAMB 1TJHH 4PJEB 3FUJA 3ARYA 4RA0C 3UDWA 5EC1A 3D39E 2EVHA 1MAMH 5FYJL 2J43A 4GI9A 4G80A 3BP7A 5E6RB 3P02A 1YDVA 5D7LA 5L88H 1QSZA 3DVNB 1EZVY 4DKFL 1MCOL 1CX9A 1MJJA 2OPCA 2V69A 4HCFA 1MAJA 4B5WA 3MOBL 3OOQA 3TK7A 5AVVB 2WYHA 2GIMA 4Z08A 3HW7A 2VDMH 2HEJA 5FEXA 2ALWA 12E8L 1T8QA 5TE6L 2WZ0A 3RIKA 4ERAA 2G37A 3K5RA 4GQBA 5EEZA 4XNUL 4K55A 4AXWA 5EA9A 3ZTJG 4YVNA 4K9EL 4NFDA 4HNTA 3TSBA 5J7CC 4Z3JA 2ICEC 3KVJA 4NB7A 3KCWA 4MNGB 4IIQB 5ELIA 5EFIB 3A0OA 3CVHH 3KBPA 3LCIA 5JTWA 3MJ7A 1KBIA 1Q0YH 3QUMB 3HZKB 3WQGA 3QEQD 3CUFA 3T9WA 2WUCL 5C9WA 4OGYH 4WCYL 3LKQA 4HYTB 3VGAB 1Q9KA 2OSXA 4OLYH 3QEHA 3UTQB 2V82A 4C83A 4GUCA 4NPJA 2PCPA 1TPVA 3CQIA 4XN7A 2ENYA 3W1NA 5TE7H 3W0KA 1O9ZA 1C9DA 1T0MB 1ZAJA 4M5ZL 1Y18A 4BCXA 2BIIA 2JE8A 2VAAB 3QIWC 3UVAA 1LZOA 3R19A 5HYJD 2OVLA 1GGCL 2AQ1A 1PAMA 4M6NL 3CZJA 2J78A 1TVHA 5JHLL 3UJTH 2O6PA 2W0KA 2GSIA 3DO7A 3UGUA 5LDUA 3NJFA 2QYGA 2GDUA 1TKKA 5KN5A 3F2CA 1TZIA 4H44C 3V0FA 3PXJA 3MRKA 3NGFA 1UXSA 3FCSA 4B5TA 3MZGB 1F6LL 2D7TH 1HILB 4H3DA 4PIBA 2J8UE 4KY2A 3ME0A 1SHWA 2CALA 3B37A 3ENEA 4MXWH 3TN3A 1EEXA 3VFUA 3QCTL 4MVAA 1AO7A 5HGBA 1GH7A 4Z8FL 3X2QB 1FSKC 3N5AA 3I65A 4G7RB 2HX9A 4XPAH 4JDVB 1W1A1 1WBYA 2QCDA 2DT3A 4GKSB 5E00B 1PU0A 3DX3A 5I1AB 4KROC 2VDKL 5I24A 3HRZC 2FR4A 1I9CB 4ZX3A 3VFVA 4OZIB 4EPEC 5FC9A 5C0IB 3S2MA 3MNDA 4Y8EA 5CP3H 2ZZ7A 2FTAA 4V1DB 2QQNH 1T7ZA 4YDVB 2DICA 3VU1A 4DAFA 4LCWA 1UUSA 4PJ5E 3W9EA 1JAEA 3STPA 1VFUA 4KEUA 5HHNA 5LHDA 3PG9A 2VISA 1LRTA 3CSTA 4PMJA 2ZT9C 2E9LA 2CBUA 5DJ6B 5CLYA 1MG3C 3D9AH 4CNTA 3OP2A 2XWXA 2F18A 4PVBA 1CL7H 3ABMB 1WXZA 1YE6A 1UA6L 1HHKB 4KX7A 3CSYB 4HS3A 4UM8B 3ULSA 3D0VB 3GEFA 4UOQA 5FK9A 1CWYA 4K3HA 5F4XA 4KFPA 4AXKA 1MQ8A 2Y2TA 3ANYA 1OF8A 3CWHA 2R0ZH 3QMRA 1CTOA 3WY1A 1YMHB 3MLUH 1M7UA 2HT4D 3MUXA 2Y72A 4KO7A 3DVGB 1GAFH 2QPUA 1KBJA 2HVJA 3OR7B 5DD0H 3EPNA 5BXFA 2I26N 3HQNA 1CB7B 3BURA 1AXSA 3QQDA 3UXFA 4N2CA 1OAQH 2CO6B 3ZSSA 1H3WM 2V9RA 3PP4H 4ZX6A 1JUKA 3T6QC 2VWSA 1JZ8A 3SCMA 3P6LA 3U30B 5ANHA 1PZUB 1PHWA 4NN7C 2FECL 3JWDC 2FH6A 4D3CH 2ZKMX 2EDFA 5EU4A 1HNFA 1Z3NA 2YJLA 3V8OA 1V7ML 3S4SG 3DH7A 4XODA 4AIEA 5C0RL 2CLHA 4Z78A 2AK1H 1TMLA 3OTRA 1YAZA 1OP5K 5IRPA 2ZDSA 5C86A 3QPXH 1F58H 1F3RB 3NDZA 5BRZD 2HLFC 1F8TL 4DEPB 4XXCA 3MDUA 1P5VB 2EPMX 2Q7YA 4FOMA 1TT6A 1MI5D 2OLAA 4NNYA 1T1WB 3IFPB 1RJQA 4G5DA 4N24A 2Q20A 1P5BA 1FHLA 1IL1A 1RZJH 3SCNA 1X1NA 4DZ8A 5FV1L 5EO0B 4MJ6A 2VGLM 4ZZ9A 1T66D 3IANA 3TCLB 3PJLA 2XXFA 1AZUA 2W59A 5MEND 1UWAA 2ZOKB 5AVSB 1CZ8H 3WDQA 5TD4A 1A7RL 3VXQB 1XMWA 3MRRA 1S7TB 3FN0H 4JLRA 4DP2X 1JGVH 4KRUA 2BVYA 4S0HA 2DZXA 4XC3L 2ITCB 3OKLA 3KHOA 3TF4A 5B38B 2XY2A 1OTSD 4FZEL 2CIIA 5J56B 3EJPA 1IAMA 3ESPA 4IBWA 2HFFA 3NEHA 1Q6RA 1S8DA 5FI8A 4KBXA 2GHZA 4OLVH 1E0OB 1G1YA 3HG1E 2C0AA 1XDMA 4GYKA 5CMAB 2PWHA 4ZFOL 1BX2B 4DNHA 1U92B 3PWPB 4IPPA 1RULH 4Z3IA 3AG1B 4IFOA 4H2AA 2NY7L 4N8VA 1WQVT 5D2NB 3GFXA 3W6YA 1FH7A 3RJQB 3FOLA 1PIFA 4LCSA 4NZCA 3HUJF 3C60D 2AQOA 1A9EB 2KT6A 2ZSVB 3WXWL 4JTQA 1X6UA 1TZHA 1Z69A 1SNRA 1L7IH 1PSKL 3L1EA 5AKQA 5CR8A 2GGJA 5AHIA 4LL4A 4ONFL 2W38A 4Y88A 2HK0A 1M68A 3C6LA 4G71B 2C16A 3MBWA 5I1IL 3BJFA 4A2RA 1WKEA 2OFJA 4E41E 8TIMA 3P80A 4QG6A 5EBLB 4Z7NF 5HMDA 4E0RA 3FC8A 3L4ZA 3QB7C 3EOBB 1NEUA 5GRZA 1V6UA 5TBOA 3N3EA 2VDHA 4OGXH 4YCPA 4QHMB 2C9AA 2GJZA 2PODA 3NA9H 4XN4A 4Y5YB 3NESA 3T42A 1M71A 4HCRL 3SQOL 3OHMB 2V7HA 1H51A 3ANVA 2OX5A 5I1CH 3CVIH 4PJ8C 1ZCOA 1MCDA 2YMXH 1SVZA 5CZXC 3LNPA 5GGSA 2VNCA 3TJEH 5CF3A 3QIUA 4HKBA 2VAJA 5D7SL 4Y5XA 2QL1A 3MX0B 1RBAA 2XSXA 3SYPA 4L64A 1AGCA 4JYDA 3C0QA 2DZWA 1IQ8A 1Q6CA 3BMVA 2UUDK 3QXDB 5AYUL 1SN2A 1B3JA 8FABA 4JPKL 3G6JB 5H6HA 5IK3B 1WBXB 3ZU8A 2KKQA 1BKHA 2C1PA 3IDIB 3K81A 3F6JA 3CO8A 4J2QA 3SR7A 2J6EH 2NQDA 5JOFA 2G2RB 4U2YA 1E72M 2YPKB 4WI8A 3FT2B 1TDQA 3GPEA 2REQA 4G6CA 3HPJA 1OFEA 3IRCA 4N9GA 4AT6B 5E5MA 1EXUA 4ABUA 3W74A 4C5YA 4HA0A 3MW7A 3GSXB 3QP3A 3U9UA 1QTYT 1TV7A 5LA1A 3FO1B 3QJUB 4ZZKA 2EECA 1LHZA 1PMYA 4ANVA 3D30A 2UWEE 3OJDA 4XAZA 3M64A 3O4OB 1VFOA 4Q0XH 4U1JB 3WH9A 3D3VD 1QKZL 3P54A 2YKKA 2GTZB 1GYWA 5BCAA 4K1GA 3JYCA 5BROA 4G7SB 3A9IA 3VD4A 4IK6A 4AJWA 4RGMB 1QUMA 5EMUA 4Q4PA 3FXIC 3SDAC 2NUTB 1ZSHA 4MY9A 4ELKB 4IOSA 5DRWA 3B2UD 1JPIA 4NRYA 4LP4A 1AL7A 2CU0A 5KJ4A 3DYPA 5BO1L 4JPWH 2EAWA 5C0AA 2EKSB 1YJDL 3P60A 5A8PA 3B9KA 1JHTA 1IT8A 3GSQB 1UPMB 4Z7WB 4KOBA 1A5FH 2RD0A 1QSVA 5LNUA 2NW0A 3EX4A 4PHXA 2DIBA 1OGSA 3TASA 1WLHA 1YAIA 4B92A 1C5DB 3DFPA 1X5IA 1LO0L 2E7LC 2XWTA 1A5OC 3PV6A 3AHZA 3Q2LA 3GGWA 3ZR6A 2OXHA 2BP8B 3VXSA 4FALA 4QEHA 3T08A 1S7VB 4R27A 3QR3A 3DOHA 2QEZA 1KF9B 1YEKL 3BLFA 1WH0A 2VLME 4DJFA 3F5JA 3NMEA 2NXZB 1XISA 1U4EA 4TQPA 1P1ZA 3HE6A 4MDJA 5SWSD 1OPGH 3GBEA 2IC2A 2J55A 5EU6A 2WKJA 3FTGB 3WD1A 1A9BA 4JRXE 4YSPA 5DBUA 1DO5A 1KXTB 2DWEA 3FCTA 4AYDC 4AFYA 5IW1B 2Y07L 4HIJB 5DFTA 2V9DA 3ROLB 2P7TA 3KR3H 4E9SA 3VI4B 2EDXA 3U0WH 1NDGA 4JAWA 4XOCA 4OLXH 5GS3A 1E9OB 3H7LA 2RDXA 4JM2D 4XN8A 1WDSA 3MLVL 1DN0B 4OZFH 2QGHA 3SD2A 1DDHB 4LJ3A 1IGYB 1A6ZA 2F6UA 4M6OL 4PRRA 4L0YA 1P4BL 4G8EB 3UZZA 1UXLA 4GIPD 2YA2A 4GXMA 2GC4C 1CE1H 4O4VA 4X99A 4AZCA 3ZTEA 3TEWA 3NCFB 3DPBA 4RNRB 1DQXA 1SQ7A 2EC8A 4OQVA 4O2CA 5GS0H 2PC4A 4QJ3B 4CDHA 4UB0H 4B97A 3OG2A 1MLBB 3CNKA 1FBAA 4I4WA 1DYSA 4DQWA 1X4ZA 4JIPA 4ACYA 1PIGA 4LLMA 2A6DA 1PTGA 1Q9WB 4WXYA 3RLVA 4LGXA 1R1CA 4XCNB 4RLIA 3WIJA 3QJSB 2B0SH 3WN6A 3WZ0E 4UZGA 1NSNH 3PJUA 3VKAA 3MV9D 2B7DT 1CB4A 4TNGA 5MENB 4ALDA 4FL4B 1M1XB 2B1OA 2CZ5A 4AIXA 4Q7NA 1PG7X 2HBVA 3KW7A 3MLZH 4PJEE 1R34A 3H22A 3IIOA 3AYSA 4Y19D 3OKNB 1T1ZB 2YDAA 2FECI 4PMEA 4LF2A 1RLBA 1W1B1 2HB0A 2BIPA 3D08A 5MEPB 1LK3L 4N6EA 3QR1A 2WNKA 2WB1A 2XVKA 4PYSA 3N19B 4V27A 1HJUA 1X5JA 4F9LC 5H91A 4RWYH 5HUOA 4R8WL 1W8GA 4HWUA 3S37H 2P42B 4O10A 4JO4H 3OZ9H 5ITBH 1GZJA 2DY3A 2OS7A 4G6ML 1IGSA 2VT0A 3RPBA 5KVFL 4W93A 3SCQA 5ITFA 1F07A 2ZSWB 1GONA 4XP1L 5G55A 5B21A 4MNGE 3W1RA 4WU5A 3CTLA 4PJXF 1BOYA 5J04A 5D93C 1N7ML 4AV5A 3CUXA 4PWKA 5D6CA 3VE7A 4EUPG 1MVFA 4Y8FA 1KQYA 1EJFA 4TU1A 4I7WA 2YD5A 2OTWB 5BZDB 1VPOL 5DT5A 1CT8B 1JF6A 4UTBA 5DRIA 3ITGA 1EANA 4YSUA 3BIBX 3BI9X 5AVHA 3O3EB 3HZYB 4I9XA 1NFGA 4V2CB 5FF2A 4ERSH 4UM9D 4AOFA 2VC7A 4PGZA 3WNPA 3FB6A 2PTZA 1DVUA 1ECYA 5M17A 1YIXA 3HN3A 3D85D 4YJZL 1OIFA 3MRLA 2OLHA 4TTGA 1K5NA 5HMFA 5DMGD 4WI6A 3QUML 2E5EA 2OMVB 2WWOA 3HMXA 4Q3MA 1NDTA 1NSJA 4D1JA 2VL5A 1VCAA 4I2XA 1EXHA 3GG8A 1U8MB 5BVJB 1A4KA 1GPOH 3X17A 2YCLB 4FC3E 3ITOA 2Q7NA 5C08B 1KPUA 1OF6A 1OCNA 3EJSA 5IMKA 4BEQA 4DKEL 2Z1BA 3U9PH 3MR9A 4Q8VA 3ETBJ 3GMLB 1A7OH 5LBSH 1IXNA 1RHHB 2OMXA 2BWDA 4LASL 3WFHB 1UP0A 3EO0B 2H90A 4KOCA 5KYXB 5I6XB 3IJEA 3U46A 2VDQL 2IPUK 3IDXH 4HJJL 1CO1A 4FKHA 3M6DA 4M7ZC 4I77H 1QLEH 4X6FB 3MOQA 1IU1A 3NSFA 1DVQA 4I18A 3SB0A 3GMMB 3KHDA 2VO8A 3LKNA 2E8YA 3NZ1A 5A2IH 4OZIE 2HTMA 4GG8B 5AAPA 2V17L 1EERB 4X7DC 4UMSA 2O6FA 4NZTH 4V1DE 1UP3A 1XRFA 5F44A 4EVNA 1FORH 4WW2F 4H9UA 3O15A 4LKCA 5I8EA 5ENLA 2GVEA 5D1ZI 3V0GA 4WKAA 2BHFA 2V0TA 4PLKC 1XIFA 3LI1A 3WBAA 4KCTA 1RV6X 3D3VB 1W9PA 2R2EB 4ZQKA 2DLFH 4HEPG 4TOYH 1MWAA 4UMAA 3NJXA 2VP8A 2IMRA 1UEMA 4MTVA 4AQEA 3U7AA 3PBVA 4DEUA 1NIEA 2ITEA 2FIRT 5TDNA 1S7SB 3TA3A 2OMUB 3EF7A 4PUBL 2F7FA 3VK5A 2BS8A 4PC8A 4FNRA 1FIEA 5GGVY 5EA0H 1E73M 4P7RA 1G0YR 4MHBA 2BOCB 9CGTA 4Z1DA 3NPVA 5BO0D 5CJBA 3CC5A 5E6SB 4D0CB 3ATFA 2OI9B 1SJHA 4ML4A 4IL0A 1SLVA 2ODHA 3SIKA 3NGBC 5EDXA 4JHWH 3F3HA 5HI4C 1BTCA 3IGAA 1TMQA 3VOCA 3FGCA 1DQQA 2PO6A 3EJYD 4XRCA 5DD6A 4OUUB 2KL6A 3URAA 4URTB 1JN6B 3TVAA 1OTUD 3B0UX 1ADQH 4HNOA 3EGXB 3WJMA 1ASQA 2G9HB 2J7CA 2EYSB 2H7WA 2W0LA 1EPFA 3WLPA 3DKJA 4KFOA 4UUIA 5AZ0A 5LGJA 4RFNC 2X4RB 5C71A 4NSKB 5CEZE 2F2HA 1HW6A 1UWTA 1V0NA 1Z9PA 5LGHL 2DTMH 3GKFA 3X11B 1ORQB 1ZLVK 3L9BA 1ORSA 4J4KA 2HRPL 1Y6MR 4JHBA 3MJYA 1MVUB 1AZCA 2F7QA 5PAZA 4UQCA 4BELD 2JGQA 2QKFA 5IW6A 2ENPA 4CW1B 5A3ID 4H0LC 4GW1A 1G7QA 1S9WB 1FVPA 3WCZA 4KI1A 3GYCA 5CCKH 4MS8C 1QNRA 3W2UA 3CLFL 2OEJA 4ADTA 5KZ6A 4GXFA 1SN5A 2JKJA 3PWVB 3S3SA 3VFSB 1CLZL 3CHQA 5E08H 4QROA 2WC3A 5BOZG 3RWEB 5EUOF 3JZEA 4H8WC 4C6DA 3EXTA 5CEZL 1CTMA 3CU7A 4AV4A 2B3RA 4POUB 3KRSA 3UBPC 1ETZA 3T6CA 1TVDA 1V51A 1OD0A 1ZANH 1DIOA 4G2DA 2WTOA 4LSSH 2JB5H 4XNYH 1S5IL 5GZNC 3NJLA 3MV9B 4L4VD 3WDPP 2JI1A 1BOGA 3IRSA 2PCFA 5AHEA 3GS7A 1RPXA 3VA2C 2HJPA 4YXKH 2DMBA 4Y19B 2RFXA 5A1AA 4JO2L 5EBWB 3VWJC 1DVFD 4GAJH 2C9PA 3PWPE 2WO3B 4Q33A 2FDBP 5D2NE 1EJ6A 1YXDA 1XGTA 1OW0A 4HU2A 1KBKA 5TF0A 3W53A 1DXFA 5AOLA 5DR5H 3VMOA 2I7SA 3OMAB 1UOZA 2WWCA 4ZW5A 2CRMA 4PH6A 3DSNB 2O7QA 3PSWA 4N68A 3WNKA 1ND0A 3AROA 3O6FA 4P23A 3CWGA 4WLCA 5GGRA 4PBXA 2WY3B 3WIFA 2HN7A 4OGQC 1TIMA 3QDJA 4TRPL 3W0WD 1PS3A 5CG7A 1UCBH 3OA3A 5G5IA 3VUSA 3PHOB 1BQRA 3KPLA 1QWUA 3Q0HA 2JJWA 1C8VA