2YIHA

Structure of a paenibacillus polymyxa xyloglucanase from gh family 44 with xyloglucan
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
511
structure length
511
Chain Sequence
KTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDWQHSSDNYLCSNGGLTQAECEKPGAVVTSFHDQSLKLGTYSLVTLPMAGYVAADGNGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVKGYALDNEPALWSHTHPRIHPEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYKDLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETKKARMQAPRTLWDPTYKEDSWIAQWFSEFLPILPRLKQSVDKYYPGTKLAMTSYSYGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGDTSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGFDKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Activity of Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords CEL44C
total genus 178
structure length 511
sequence length 511
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12891 Glyco_hydro_44 Glycoside hydrolase family 44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2yihA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yihA02
1E5NA 3ARYA 3UR8A 3MMWA 3W0KA 1MQPA 3AIVA 3EDFA 1UKTA 1BYBA 2EAEA 2G8ZA 4LYQA 4NF7A 3ZO9A 1DEDA 4HZ8A 4LXFA 1SZNA 5D9NA 3D4YA 1K6AA 5A6KA 1UWSA 1OT1A 1CYGA 1C7TA 2DQXA 3QHOA 2X2JA 2BS9A 4R5EA 3B9DA 5LA1A 5E0FA 4D6EA 4ACZA 1JZ6A 3CV5A 3AYSA 5CPQA 1TUXA 4ATLA 5A6LA 1ISZA 2D20A 3HJEA 2UY5A 3OIHA 4E2OA 2J7EA 1GORA 3NCOA 4UTFA 4TX6A 3SUSA 2D2OA 4XV0A 3A5VA 5IFTA 3UCQA 4QCEA 3WNPA 1RH9A 4J28A 2HISA 3CLWA 1U33A 2GK1B 3B8SA 4TOQA 1J0KA 2PB1A 4X0VA 1C3FA 1WAWA 1JZ2A 2XGIA 3K8KA 3WMCA 3DYOA 1MXGA 2EPOA 2V3FA 1VEOA 3BAIA 4FNSA 2VCCA 5A1AA 4UFKA 3MV11 4OGZA 5C70A 3DDGA 6CGTA 1BG9A 1KBBA 4LX4A 3FW6A 3ZT5A 3ARXA 2BY0A 3N18A 3W25A 3WFLA 1GQKA 1B3VA 4NX0A 4MPKA 2FGZA 3GNOA 5BROA 1UKPA 1G9HA 4OUEA 1W1TA 5HXMA 3ZJ6A 1UUQA 2Y24A 1EO5A 2GDVA 3GZAA 1XSJA 1H09A 1B0IA 3CUGA 4JHOA 4AZGA 3PZGA 1XCWA 2A3CA 2UY4A 1E6SM 3ZQ9A 3AHTA 3CZKA 3RCNA 3UR7A 2WCGA 1ECEA 1UYQA 3NUKA 3H54A 1FH8A 2CEQA 1B30A 3APGA 1OSEA 1FFRA 2ZX8A 4YN5A 1EHNA 1QNPA 4PBGA 3KLKA 1BG4A 1Q4NX 3GXIA 2WVVB 4AISA 1QOXA 2CKSA 2VMFA 4MB4A 1UASA 3DX2A 1HP4A 5DT7A 4FNTA 3AMGA 1LQ0A 3WY2A 4KMQA 2Y4SA 3WH8A 3HU7A 1KWKA 1E4NA 3AISA 4PTXA 4WKHA 2RGMA 3MMDA 1J0YA 4R27A 3SCOA 4TTUA 1HKIA 1NWSA 1HKJA 4CD6A 3N17A 2WVUA 3WQWA 4XZWA 1ZB5A 2PBGA 3VU2A 5FKYA 4CN1A 4ZXLA 2J79A 2WMKA 3CUJA 4C7FA 4CVUA 1UD4A 3LXAA 2ZWZA 1VFOA 4CN6A 4NRRA 2X2HA 3DYPA 2XM2A 5BXTA 3DYMA 1OT2A 1H49A 4W86A 1KTCA 1UH2A 4AEEA 2WMGA 1R85A 2D24A 4BZYA 1KQZA 3MU7A 4HPGA 3WNNA 4MDPA 1XHGA 3ARQA 4AZHA 1CIUA 3VO0A 3VILA 4Z2LA 4D6DA 5EFFA 1PIGA 1C93A 4P7QA 1JD9A 5HDRA 1JDDA 4UZSA 1KCKA 1PJ9A 2DSKA 3VTRA 3OLEA 1AQHA 4JCMA 2J7HA 4S3JA 3VDAA 3LRMA 3F4VA 4JZ5A 4KRUA 4J3SA 2YL5A 4Q22A 8A3HA 4KRTA 4WKAA 3VD7A 4DM2A 3DECA 4WJXA 5FL1A 1HT6A 2X2IA 1V0KA 4A4AA 2B31A 3PZMA 3L4VA 4QLJA 1G01A 4A3HA 4TVCA 1EIBA 3W81A 1LL6A 2XN0A 2GUYA 6A3HA 1KGUA 1UKSA 4H2CA 2CITA 2DSWA 4GKLA 3UERA 1IV8A 2DIEA 3U7VA 2CXGA 3VGFA 2BHYA 3WDHA 4FLSA 2ZX9A 4LYRA 3KL0A 1E5JA 1B31A 3T08A 3VOCA 3WUBA 1JNEA 3TP4A 4JFWA 1CEOA 3AFBA 4AD0A 2MANA 5GPRA 3WNOA 1KB3A 1HNYA 4WIWA 1ISYA 3QHNA 1UR4A 4AD3A 1MFVA 2O9RA 2WHLA 3GXDA 3VGDA 1GNXA 4F9JA 3VIPA 1E6QM 3SUUA 4H8HA 2J47A 2C7FA 4KGLA 3WNMA 4JAWA 2W62A 3TTYA 1HN1A 5E70A 4D6IA 3LPOA 1WDPA 1GQIA 5D4YA 1JF6A 4DO6A 5D9PA 5HPOA 4DUXA 1V6XA 1C8QA 3D50A 3WELA 2YKKA 2QF8A 5LA0A 1V03A 2WZIA 5KZ6A 1R33A 4PCSA 2OYKA 3WDJA 3EBVA 4U3CA 1UG6A 1M04A 1B3ZA 2VR5A 1GW1A 1AQMA 1JYWA 3AIEA 1J0HA 5FOOA 3BSGA 4UFIA 2X05A 3RM8A 4UFJA 3S5ZA 1H0GA 3POCA 1SMDA 3OGRA 3O9NA 3VMPA 2GSJA 1GHRA 3SUVA 3VIIA 1E3XA 4UNIA 3GXPA 2FHFA 5DT5A 3WF4A 2V3EA 2XFFA 2IGTA 5A6MA 2JF7A 1RP9A 4M56A 3IJ8A 2WKLA 3ZJ7A 4CD5A 4ACZB 1CECA 1OM0A 4AWEA 3WBEA 4MNLA 3AOFA 1I1WA 2YL8A 5GNYA 1WP6A 3VGEA 4HOXA 2VX6A 4YHGA 5A6BD 2EQDA 3CHFA 3PHAA 1UD6A 1E0XA 2YL6A 4QDMA 4MB3A 1CGWA 5FIPA 2G3MA 4L4OA 4GI8A 2QMKA 4U31A 3OGSA 1HVQA 1VEPA 2XWEA 3PTKA 1R75A 1UD8A 1FP8A 3MMUA 1EGZA 2E9BA 4PTMA 4XUYA 3CGTA 3AYRA 1E6RA 1HVXA 1NWUA 2WBKA 2WCSA 4HMDA 3I3BA 4TVUA 3CBWA 4AXNA 1H1NA 3SUTA 2XIBA 1EOMA 5M3WA 4PTWA 5BCAA 1HIZA 3D5HA 4Z2HA 5M03A 2DH2A 4PMUA 3TTQA 1K9TA 2ZUSA 4M80A 4RE3A 3ZJ8A 3ZT6A 2C0HA 2FE0A 3KLLA 3ZSTA 3VIOA 2D0HA 2WAGA 5I0DA 3SCSA 3VUPA 3LXCA 1BVZA 3RM4A 1V3MA 3DX0A 2BY2A 4GO8A 3AXIA 4TVDA 3LPFA 1XH2A 5FL0A 1W91A 4B16A 3IK2A 3WQ4A 4KH2A 3MUIA 2Y8KA 4D71A 4HA1A 3B9AA 3WQ5A 1VF8A 5FD0A 2YDQA 1CPUA 2VI0A 4W7WA 1E6XM 1XD0A 1DWIM 2O9PA 1FHDA 2W91A 1GHSA 3PZTA 5I5RA 3THCA 1HJWA 1NOUA 3VD9A 5JBEA 1GJUA 1V6VA 2VZSA 4AZBA 1VFUA 3ARWA 4GXPA 4Z2KA 1C92A 2D3LA 1XYZA 2BV9A 1EH9A 3IGUA 2ZIDA 2F7QA 3TOPA 2CBUA 4X0NA 2WC7A 4AYGA 4M82A 5CSUA 3T0AA 3FHAA 3ARUA 1IZKA 1NWTA 2VOTA 2EJ1A 1J10A 2WLZA 1VRXA 2Z1SA 1ODZA 3EJUA 4D1JA 1X6NA 5HBFA 1V3HA 1UD5A 3KL3A 1UQZA 2OLHA 3NDYA 3BGAA 1Z32X 4HMEA 3CUIA 4U5IA 2Y5EA 4QAWA 1GONA 2PI6A 2WVSA 1CGUA 2XWDA 1QHOA 1E1EA 3BVWA 1JXJA 4GI6A 1B3XA 3CZSA 1YQ2A 4PMQA 4TUFA 2VX7A 4MDOA 1VAHA 2WC4A 4PEEA 5I77A 3D3AA 1GOOA 3VM7A 4OBRA 4UQEA 1AQ0A 3EDJA 3WF0A 5A2CA 5KEZA 1K9DA 1LWHA 3AMKA 2WWCA 2XSBA 2WHMA 2VL4A 3KE0A 2D0FA 1YHTA 4PYSA 4W89A 2YFNA 4H7VA 2OWCA 2DT0A 4CD8A 1GOIA 4F66A 2BFGA 1ESWA 4H8UA 3AHYA 1O7DC 3GXFA 3CHEA 1E6NA 2D3NA 4AMCA 3GM8A 1VJZA 4UCFA 1CGXA 3WD1A 4AD2A 1MXDA 4E8CA 1QNSA 3TV8A 3GBDA 2UWFA 3MUZ1 3BMVA 4PMRA 4P8VA 4V2XA 1UD2A 4XB3A 2X0HA 4NZFA 3WF3A 2EABA 3QGVA 2X1IA 4U3AA 2QMJA 2BY3A 3T2OA 3CZNA 4FF5A 3VMOA 1BYCA 1TQUA 2ZUTA 1JI2A 3GH7A 3SCNA 3SEPA 2HVMA 3RJXA 2VVNA 2ZUUA 4A3YA 1FHLA 3IAPA 1VIWA 5A6BA 4W5UA 2ZX6A 1TG7A 2NW0A 3AMLA 3EJTA 1J0ZA 3A24A 4QP0A 3PZ9A 3AIUA 3HZ3A 1KBKA 1UHVA 3O2LA 3W26A 1UZ1A 2CBJA 1EA9C 1E43A 3BC9A 3MUAA 1E72M 5A8QA 1G1YA 4QFUA 5E6YA 4FMVA 3WBAA 4UQAA 2E9MA 1E73M 2ZOXA 4AIUA 3VIJA 1OIMA 3OLIA 4W8BA 1OD0A 3U5UA 3OG2A 3VINA 2JIWA 2WHKA 3BUIA 3WFZA 3BUPA 3ARTA 4JCLA 3M7SA 5HOSA 1EXPA 5I79A 5CLWA 1GOQA 4GO9A 1JFHA 3TTSA 3WMSA 1QI2A 2XVLA 3GBEA 3RO8A 2IUZA 2OWWA 1E4LA 1MFUA 2PWGA 1PPIA 1H4PA 3AQUA 3VIHA 4V28A 1GZJA 5I24A 4E4PA 1QNOA 2GK1A 5LYRA 4W8LA 2FGLA 4P7LA 3WF1A 2WANA 3I3EA 3ZMRA 4HU8A 3N9KA 1TFVA 4ZE4A 2J7BA 1ZU8A 2DPEA 3L2LA 3WUEA 1ODUA 3BLPX 1EQPA 3WQ6A 1CNVA 1QHPA 2BXYA 2DT2A 2VZTA 2WZHA 2CKRA 2WLYA 4PUDA 4LPCA 2W92A 2WSKA 2J7CA 2YA2A 2G4FA 1QBBA 2VZVA 3LRLA 4HZ6A 1T0OA 3AROA 2PBOA 2ZX5A 2O92A 2UY3A 3UG5A 4P7NA 5D9OA 1G94A 1Y7VA 2Y2WA 3MI6A 2W63A 4C7DA 1CGYA 3SIMA 2E4TA 1WDQA 3W38A 4W7VA 4D6JA 3MSGA 4N42A 2W4XA 3LXBA 4J3UA 3WUGA 1O6IA 3HN3A 1UR9A 3KWXA 1E15A 1OD8A 1W3HA 3EJSA 2DGAA 4IM4A 5BRPA 3NSXA 4X9YA 1WKYA 2XGBA 1V3IA 3WDRA 4UOJA 4OOUA 1KWGA 2YJQA 4MAZA 2WK2A 3ALFA 4LGXA 4Z2JA 2XVNA 3RM9A 2C8NA 2ZX7A 1J12A 2J4GA 3L4WA 1A3HA 2CHOA 2VJXA 4URIA 1X6LA 3WEZA 2F1BA 1W9PA 1UA7A 3KL5A 3D4ZA 1NQ6A 1C8YA 1GOMA 1E56A 4PSPA 3MUY1 1HF6A 1MQRA 4IISA 4QCFA 4D6FA 3VDBA 4AW7A 1HJQA 2E8ZA 4MJ4A 1GQJA 3ECQA 3ZM8A 4AD4A 3CTTA 3A22A 2V5DA 1E70M 5I23A 2PWEA 1OWQA 3U7BA 2XFRA 2FHBA 5GNZA 2GDUA 3NJ3A 3EDEA 4MADA 1D3CA 2G3IA 3NSNA 4U33A 3U5YA 2V3GA 3T2QA 4F79A 2JEPA 2E9LA 1ZBKA 1NH6A 4CVWA 2PWFA 1BLIA 2J8GA 2XVKA 2UY2A 1CENA 3FNDA 1AVAA 2VZUA 4MB1A 1OGBA 1KXTA 3BUBA 5A2BA 5DEZA 1UR0A 1ZS2A 4BF7A 4AIOA 2YDSA 1TQVA 3MANA 4XX6A 1DWFM 1QI4A 2VRKA 2XN1A 4FNRA 2JF6A 1DWGM 4OIFA 4OOZA 4YPJA 3DX3A 3GXTA 1OGSA 1B1YA 1KXVA 5CLTA 1TQWA 1HJXA 1MW0A 3B9EA 4EKJA 3A4XA 1VFMA 5TD4A 2DSZA 4QLKA 1PEZA 2CBIA 1JI1A 2NT1A 3W27A 4C7GA 4DWSA 4NRSA 5BWFA 2DEPA 3PZUA 1HXJA 4B3LA 3WD2A 3S2CA 1FA2A 3UESA 4ACYA 3UG4A 1JZ8A 2XVPA 4JKLA 5FCZA 3WEMA 4M24A 4UQBA 3WL1A 4UZUA 3HMCA 3ZT7A 4PCTA 3HG5A 1E1FA 5A69A 4IUGA 4PMXA 1R8LA 1B3YA 4OZOA 3VD4A 4J3WA 5JIWA 4WSKA 3WNKA 4PTVA 1SFSA 1JYVA 3OGVA 4N0RA 4PUEA 2OYLA 3EJQA 1ZL1A 1QI3A 2DSUA 3GNRA 1E3ZA 3N13A 2CPUA 2VQUA 1TR1A 4D72A 4PMNA 4CU6A 2EADA 1CZ1A 1UR2A 3WH5A 1CLVA 4HU0A 2RGLA 4B15A 4LQ1A 3W24A 4J3TA 5A8NA 2OWXA 2EPKX 4M81A 3GNPA 4NSBA 1W1PA 2VX4A 4UOZA 3U57A 1D2KA 1NWRA 1NARA 3WQVA 1V08A 4TTGA 5E6ZA 5AC4A 2DT3A 1H11A 4Z2IA 5BYWA 1TA3B 1NOWA 1KR0A 3HG4A 1E0WA 3OLDA 1GVYA 2XTKA 1C7SA 3FN9A 1GQLA 1UWRA 3PZOA 3L4YA 1VB9A 1BYAA 4FK9A 1QBAA 1PS3A 1SR0A 1B2YA 3SCUA 2X8RA 3PZIA 4AEFA 2DT1A 3AICA 1WZAA 1JL8A 3QOMA 3VPLA 1KCLA 3AZRA 1QHZA 3LPPA 3NIYA 1WPCA 2D1ZA 2YFOA 2A3EA 3WH6A 3W53A 2WCAA 1L0PA 3DX4A 3MKKA 4UFMA 4EK7A 3RPMA 4PMYA 4EAMA 4ZXOA 2XYLA 3CHDA 2VT0A 1LJYA 5E0CA 1UKOA 1VBRA 1A47A 3F5KA 4W85A 1EO7A 2G3NA 1UQYA 3WDPP 4HP5A 4XZBA 5DFAA 9CGTA 1Q6CA 3DDFA 4MNKA 1E71M 1PIFA 2GVYA 3HG3A 3VX0A 4UFHA 5JIPA 1HJSA 1NM9A 4CCCA 4ZEPA 3VSTA 1J11A 2AAAA 2G3JA 4MB5A 5AC5A 1HJVA 3NYDA 2YA0A 1QNQA 3N1AA 2CERA 2VZOA 1KQYA 2VURA 2WPGA 2WB5A 4CUCA 2VC9A 3W6MA 2XUCA 3MV01 1FP9A 4CCEA 2VTFA 4J7RA 2J25A 2ZXQA 4DO4A 4P7OA 5EB8A 1OGGA 4NXSA 2WVTA 3BLBA 5DO8A 3MSDA 1TVNA 3II1A 2E0PA 1FH7A 4W8AA 3AIRA 3W6LA 2XFYA 1HL8A 1TVPA 1HXKA 2J77A 4OBSA 1IT0A 2F61A 4Z2GA 1MW3A 3LX9A 1HJUA 2ZUMA 4HA4A 3EJRA 3T0DA 5I78A 2J75A 2OYMA 2BVYA 3S5YA 5I3DA 1ZJBA 3AIBA 3OZOA 2YBUA 1XYFA 4WKFA 3SCQA 1W9UA 2Y8VA 3N11A 2WMIB 1ZBCA 3PZQA 4L4PA 4NZCA 4JHZA 1PAMA 5EFDA 2VO5A 2ZE0A 5BXPA 2XJ7A 3UG3A 1JYNA 3AZTA 5JBFA 3CIVA 1RPKA 1MW1A 1JDAA 1JZ5A 4B3KA 3W29A 5CXPA 2F7RA 3LRKA 1XCXA 3VSVA 2ZICA 2XM1A 4UFLA 2J74A 3CZLA 3UEQA 5M5DA 3BMWA 4W87A 3WUFA 4MNMA 4WF7A 2CNCA 5D8WA 5A94A 4H04A 4E8DA 3QHMA 4CD7A 1DWHM 2IXVA 2Z1KA 2ZUVA 2A3BA 1ISXA 2XG9A 1KFWA 1QNRA 2YBTA 3VNZA 1E9LA 1I75A 4MJ2A 3IJ7A 1RD6A 1WDSA 3RMEA 2WSPA 2F1AA 2J7GA 3M46A 4JKKA 2ALWA 2ZXBA 3JUGA 5BRQA 3BCFA 2EBNA 1TMQA 3W4RA 1BVNP 1U2YA 4S3KA 3AIWA 2V38A 2WXDM 1OINA 2CETA 4P8XA 1JYXA 3CZEA 3L2MA 4F8XA 4H8VA 1TQTA 3WDIA 4JIEA 1JAKA 3N12A 4ZE5A 3VD5A 1HX0A 3A3HA 3BAWA 3UETA 4D6CA 1JDCA 1UH3A 1UWTA 3GDBA 2OSWA 2CIPA 2V5CA 1H2JA 3TA9A 1BGAA 1TQSA 3ZR5A 4M1RA 5IHSA 3BVVA 2PC8A 4HOWA 2DSVA 5BXRA 3CHCA 2X2YA 5E1QA 2YLAA 5CG0A 1CGTA 2J62A 3ZIZA 1XV8A 3CZJA 3WD3A 1MVYA 2D23A 2YLLA 1BAGA 1XH0A 1KXHA 1KGWA 1CGVA 1DWAM 2VUYA 3AHVA 3OZPA 3SCVA 3KEHA 2WMHA 3AI0A 3A4AA 1JZ4A 3THDA 3AZSA 1UZ4A 2F7OA 1R7OA 2DDXA 2QPUA 2O9TA 2AMGA 1OIFA 4CCDA 4HZ7A 2TAAA 1V6YA 4DWSD 3N15A 2OSYA 1JZ7A 4P7RA 1UH4A 3BUDA 4WLCA 3MO4A 5GQBA 4UQCA 4W84A 2VQTA 3AS3A 2W67A 3VGBA 3CO4A 1WE5A 2A3AA 4D6GA 4W7UA 3L4UA 4HA3A 3CZGA 2E40A 3K4AA 1W9VA 4AZCB 4AMWA 2F7PA 4WK9A 2DIJA 1R46A 2YOCA 4FNPA 2PF0A 4J3XA 1LL4A 1UKQA 4GZIA 3GTNA 3NSMA 4AD1A 3L4XA 4JKMA 1PBGA 1Q6DA 5CGMA 2JEQA 2VRJA 3RDKA 5A8PA 3A21A 3CUFA 1R47A 1QW8A 1W2PA 5CPTA 2X09A 4Q7NA 3LPGA 5D8ZA 1JD7A 2J7FA 2JE8A 4ML4A 3OA5A 3VIGA 1R34A 4AMXA 1PX4A 2XSAA 1K9EA 3PTMA 2J78A 1VFFA 4PMVA 3H55A 1GCYA 2D22A 3VMNA 1F4AA 3BLKA 4JFUA 1TCMA 1S46A 4JFSA 1OBAA 4KWUA 1B3WA 1H3GA 3HG2A 1VBUA 3CC1A 3RJYA 3WD0A 4GZJA 4NXKA 1V6WA 5LA2A 5A6JA 1L8NA 2EPMX 3VSUA 1J0JA 4BQ3A 3SURA 1Q6FA 3ZSSA 7TAAA 2WVVA 4JFVA 4IPNB 2FH8A 3DC0A 1C90A 2XHYA 3O6AA 3VX1A 1M03A 3WH9A 3T2PA 4FNUA 4AZ5A 2BHUA 1NP2A 2X0YA 1ZBVA 1EDGA 1FFQA 2VVSA 3A4WA 4EE9A 1BF2A 1UWQA 1CXKA 4ATWA 3N04A 6TAAA 3CUHA 3FXYA 4HTYA 1EDTA 3PN8A 1BTCA 1H0IA 1I1XA 1EQCA 4GQRA 2F18A 2QPSA 4ATDA 3WY3A 1H5VA 4P8WA 2WM0A 4MTVA 1XSKA 1MWOA 4CGTA 4GPNA 3W82A 2F8QA 1XGZA 5AYBA 3WY4A 1CXFA 2BY1A 4Y7EA 5M17A 3RIKA 4RE2A 4MNJA 5A95A 2W66A 1LG2A 3IAQA 4B9ZA 1D7FA 3BVTA 1G0CA 3AS2A 3WD4A 1K9FA 5JBDA 1JIBA 1CWYA 4ZENA 3EMZA 2VX5A 1JGIA 3IANA 4K68A 4P8UA 1E55A 2JIEA 1CXIA 5DF0A 4H41A 3VNYA 3QR3A 4PMOA 2J7DA 4DWSC 1BYDA 4PMDA 1IZJA 3GYCA 1QW9A 4FLQA 1R87A 3EDKA 4TX8A 1UOKA 1J18A 1JAEA 5C8BB 5IFPA 1DP0A 4FNQA 3WIJA 2ZXDA 3D52A 3WY1A 3I3DA 2VRQA 2EO7A 1PX8A 5CZKA 4YHEA 4W88A 1OB0A 2AOSA 3VIMA 1E40A 3E1F1 1XRVA 1V0LA 3WEOA 1QWUA 1BHGA 2WYSA 3QOKA 3WH7A 1W9DM 4D6HA 1NP0A 4KGJA 3WNLA 3ZR6A 1V6UA 5ABFB 4NI3A 2FH6A 2CYGA 2WHJA 1KR1A 1PZ3A 1PX3A 1XC6A 1FH9A 3ARZA 3BAKA 1H41A 1HKKA 3F5JA 1XH1A 3VVGA 1JG9A 2WBGA 4PN2A 2WW5A 4AZ6A 3GH5A 4TXEA 4BS0A 1LLOA 3FHQA 3LMYA 1ITCA 1ITXA 3A47A 1TZ7A 3T09A 5E9AA 2V3DA 1Q6EA 1E6PA 3K46A 3CMJA 4UR9A 1BQCA 3CZ8A 3BXWA 2XIIA 4BQ5A 4F9DA 5CJ5A 1QWNA 2E8YA 1GOWA 1HKMA 3W37A 1KGXA 5EMYA 4RE4A 1BFNA 1LWJA 3AJ7A 5E09A 2WNWA 1G5AA 4RL3A 2EACA 1RP8A 1KXQA 3GXMA 5CQ1A 4AZCA 1TA3A 2WMJA 1W9XA 1CTNA 3SCWA 3PTQA 1R7AA 5IDIA 3BVUA 3OBAA 2QV4A 3D51A 4CKQA 2A3HA 4AY1A 3PBGA 4MAVA 4BQ4A 1MW2A 2QLYA 3H53A 3KZSA 1VENA 3MS8A 1LF1A 1QI5A 3PZNA 1V0NA 5A6AA 2BVDA 2NT0A 1GOKA 3G6MA 3SCTA 1GPFA 4U2YA 2BXZA 1ISWA 5ABFA 4UQ9A 8CGTA 3CMGA 1HTYA 5ABEA 4CU8A 2G41A 4WSJA 1J01A 1AMYA 3A6OA 1WZKA 4AC1X 3BCDA 3DHUA 3EJPA 3SCPA 3BH4A 5ABHA 4U5KA 4CN4A 1PZ2A 4AD5A 2BHZA 1WCGA 3BAXA 3ZOAA 3BUQA 3AHXA 3ARPA 4AZ7A 3AIQA 1W1VA 3WENA 1V02E 2EXOA 3EMCA 1US3A 3AMDA 1US2A 4AYSA 5ECUA 4OJYA 4PSRA 5IXEA 5CGTA 1JFXA 4GIAA 2OW6A 2JFEX 4JL2A 2EPNA 2XVGA 2CCRA 5I6SA 1SYTA 3SCRA 4U2ZA 3EYPA 5A3HA 5HPCA 2XPKA 1E6ZA 1O7AA 1LL7A 3WN6A 1Q6GA 3TONA 1UR1A 1VJSA 1QVBA 4M8UA 4JL1A 1NOFA 3A23A 3IJ9A 4J3VA 7CGTA 1W32A 4DUVA 1C8XA 2XN2A 4PRWA 4GI9A 3FAXA 1XSIA 2VR4A 2W61A 1QX1A 1W2VA 1N82A 5IHRA 1UWIA 1U30A 3VIKA 2EPLX 2FYVA 1M7XA 1W9BM 4AZIA 1W1YA 5AYIA 4DO5A 1J0IA 1WNOA 1OCQA 3GXNA 1JZ3A 2J8FA 1CXHA 1UWUA 1M01A 3VDHA 3AXXA 3ARRA 1QI0A 2PWDA 3EMQA 1XD1A 4B9YA 1V3JA 3L4TA 1HP5A 1WO2A 1BGGA 2ESCA 1E0VA 3ZJKA 5CSYA 1GVIA 1F4HA 2GFTA 2EEXA 1TE1A 1GJWA 2D73A 5D9MA 3T0BA 4ZFMA 3ALGA 2BVTA 3CH9A 3FAWA 5ABGA 2YDRA 3AHZA 1B90A 3POHA 1CLXA 5HNNA 1VEMA 2QHAA 5A8OA 3BSHA 1WZMA 2VCAA 3AS1A 4EANA 1CXLA 2YA1A 1V02A 1J9YA 2PWHA 2CBVA 4DM1A 1QPKA 1DWJM 4JFTA 2WMIA 3K8LA 1CXEA 3EDDA 3AMCA 1DHKA 4HMCA 1HL9A 1CDGA 3BAJA 3F5LA 4GQQA 4IPLA 1ZBWA 2GJXB 2ZWYA 2YL9A 4NZJA 2E3ZA 1WB0A 1JF5A 5C71A 4FLRA 2ZUNA 5A6SA 5F7UA 1WDRA 5CPSA 4GZEA 2BNJA 1JXKA 1BSIA 4HPHA 3K4DA 4W93A 1E4MM 3SUWA 2CESA 4BQ2A 1R86A 4BA0A 3WL0A 2FHCA 2YIHA 3K1DA 3G6LA 3OLGA 1BPLB 4BCEA 3PZVA 3VKKA 3ARVA 1UA3A 3VM5A 1M53A 2CHNA 2JALA 3WMBA 2WMFA 3VGGA 3VIFA 1JNDA 7A3HA 5A2AA 2WC3A 5I2UA 2WZEA 1EHAA 2Q8XA 5JUVA 1V3KA 2GJRA 5BXSA 3VGHA 5DMYA 3W28A 2OW7A 1LG1A 2IXUA 1ZJAA 2GJPA 1X1NA 5A8MA 3BVXA 3OB8A 1V0MA 3DHPA 4W5ZA 1W3JA 2OSXA 3TTOA 3AXHA 1B9ZA 4QLLA 3WKZA 3K8MA 3S6TA 4AIEA 5GNXA 2VCBA 1WZLA 1C91A 3M07A 1DTUA 3CPUA 2VNCA 1CBGA 1MYRA 1EDQA 3L4ZA 4UQDA 4GINA 4CU7A 5EBAA 1W3LA 3DX1A 4OKDA 1E4IA 1SMAA 1ISVA 3VDCA 1P6WA 1MQQA 3AS0A 2F2HA 2ZXAA 2NSXA 1UD3A 4D1IA 2W5FA 3RILA 1W3KA 1FOBA 1GUVA 4V27A 1KTBA 2FDMA 3J7HA 3M6DA 1V3LA 4LYPA 3WSUA 3WDQA 2O9OA 4FLOA 4HOZA 2D0GA 4PMZA 3WQ8A 3WF2A 3GH4A 2WWDA 3ARSA 2WKGA 3VD3A 2ZUWA 1UR8A 4UOQA 3BAYA 1HWWA 1EOKA 4M29A 2GJXA 3FY1A 5AY7A 4DUWA 2DH3A 4CD4A 3NDZA 4J27A 4DWSB
chains in the Genus database with same CATH superfamily
3VQ1C 3C8HA 3NIGE 2F54A 4LU5L 2VKWA 3ARYA 3JWOL 5B1AB 1BZ9A 3RBGA 2PAJA 5EF1A 4XSMA 3VNJA 4DPQA 3FYEB 3LD5A 3VXRA 1MQPA 2DJUA 3E5BA 3CH1B 3EDFA 3G1SA 5AYZA 2Z92B 3FQUB 2V8LA 3OVUB 1AR1B 1OAQH 4HWNA 1OQFA 1FFTB 3LZ3A 4OF7A 3MFFA 4LYQA 1M2OA 5ECJE 3TT1L 1L9MA 4KK6C 4O4WA 4DIAA 2PXYD 3RJDA 5F1NA 4HZ8A 4S3BA 1FL5B 3RZCB 3BW9A 1SZNA 5D72H 5E93A 1CZ8H 1EHLH 1K6AA 1KCUL 1MPAL 3D39A 3H0TB 2CLOA 4MAYC 5AVNA 1B3JA 3MJ9A 1CYGA 2DEWX 4XPGH 1NFAA 1SW0A 1Q1PA 4A7SA 4GRLA 4Y90A 5J1SC 5LA1A 5EN2A 5HDQL 3RG1C 3WJJA 1OCWL 4F7MB 4D6EA 1JZ6A 3H26A 1HHJB 5T1KA 4AG0A 3EJCA 3N73A 4JFQB 3BFWA 5IB3A 3SGJC 2GYIA 4NI6A 3L3GB 3HC0B 2FEJA 5HHOB 4PTDA 1Y6MR 4KROB 5GS1A 3HJEA 5E8DL 2Y6ZA 3VNIA 3MNMA 4JICA 4ODWB 3NCOA 2VJ0A 2PP0A 5FFOA 1T0PB 4TX6A 2DQGL 2HT3C 5HHQB 3QM3A 4NAMA 5K9XA 2PYEE 2G2RB 5EDXA 4LC8A 2O5XL 3DXAD 2ZRUA 4MQXD 2CU0A 2GGGA 5E56A 1MJ8H 1A5SA 1RH9A 4PY7A 3MUGA 2VCOA 3LGEA 2O4MA 4QJ1A 1OX6A 1XGPA 2I27N 2IO5A 2XOTA 5E8DH 5FGRA 1U33A 4A68A 4EZJA 5IQOA 3WTSA 2GK1B 2QIIA 5XIMA 4XN4A 1QEXA 3MRLB 4LEBA 3MV9E 1BRLB 3ONCA 5SX4H 2UBPC 4GBDA 4ODVL 2XGIA 3PJSA 4LLAA 3K8KA 1HHGB 1RERA 4EXKA 1MXGA 5EOTA 3QHOA 4Y2OA 1VEOA 1X4YA 1ULVA 3DCPA 4FQXD 2R0LL 4LPUA 5A1AA 1N12A 2W0KA 4XP9L 5T9BG 1R24B 5I6NA 2Q2LA 3QQDA 4XCEA 2VDRL 2JQXA 3FMGH 3R8RA 4YSUA 2JKSA 1ETJA 1PBYA 5AG9A 1TO4A 1Q0YL 4RGNC 2HFGH 3T8QA 1TJMA 1RBAA 1ZGLP 4JAMA 4G3YH 2P5WB 5KS9F 4PV8A 5HHPA 1XDLA 2I1OA 1BG9A 3SPVB 5C0DA 5CD5C 1G9EA 3NPVA 5JQ9A 1GGIL 1XYAA 3N18A 3WFLA 1EC8A 5CJQH 4HNTA 1D5ZB 5PCYA 4JJHA 4BFIB 2J5WA 5GXBB 4X4XA 5J4MA 4NX0A 5CUSH 3PWAA 3T1GA 3U2CA 3KLSA 3DI0A 1OALA 5FKAB 4MPKA 2XCMC 2H5UA 4R3UA 5HR7A 1TPXB 5CBEB 1BLNA 4A2DA 5BROA 2EXWD 2W94A 4EVZA 4I2XA 1G9HA 2QCCA 5HXMA 3ZJ6A 3Q8CA 5IV2A 4HBQA 1OCRB 1A3WA 2Y24A 3GJEB 3ATZA 2Z93A 5DJDA 1UUMA 3IDXL 1WICA 3W7JA 3FFCE 3CFEB 3E2HB 1BW8A 3GHSA 4JNYA 3BXNA 1REQB 2GDVA 1YJDH 5H8UA 2NNAB 3LENA 4JHOA 4GD0A 2OT0A 3WLTA 1L9WA 1KN4L 3I9GL 2VLKB 3DLQR 2WSQA 4GVIA 4XZUA 1XBDA 4YNYA 5J06A 2UY4A 1G0XA 1ZA3B 1GZPA 1LM1A 1DQML 3NABL 3S5LG 1M6JA 3QLLA 1AJ7H 2TSYA 1KYAA 4LCCB 4X4ZA 2MJWA 3H54A 4OCNC 2O93L 1N9PA 2YCIX 4WWID 1FH8A 3FYOA 3ZDZB 3ILEA 1UACH 3LZNA 3QFJE 3FQNA 3QO1B 4ZFQA 4TOYL 5AECA 3BDKA 2AQWA 4S23A 2V2CA 4QF1A 4Y2DC 1IEBA 3KLKA 1VFBB 5C6WH 5KSUB 2WVVB 3HC3H 3HB3B 5I8EA 2VMFA 3GSVA 5D05A 4CKVX 1ZVNA 4EIZC 1UASA 5DZ9A 3DX2A 5CIPB 3RL2B 2GPTA 3R18A 1NMCB 2WWKT 2H0JA 4HGWA 3PANA 2OK0L 4UTCA 5IV2B 3SGZA 1R2SA 3ZHKA 2R8SL 4QXIA 3H3KA 1GVQA 4KMQA 5DHDA 3EWUA 5A2IH 4KZCA 1G4PA 5CR8A 5F3BA 3DGDA 2NVDA 4AZ8B 1L7IH 3VACA 4XN1A 5F7NC 4QXUL 3LHWA 3LN3A 1KLFB 5LNRA 5BNKA 3AREA 4ZAKA 3VXSE 1WCQA 3LIZA 4KCWA 2QQQA 4PC8A 1BGXL 4PTXA 5I1LA 2W9LA 1C5BL 2W0FA 2RGMA 4NYUA 4ODSL 3T3MF 3OHXC 1RV6X 5I16B 5JW3H 1EYEA 2NX1A 4I4WB 4KETA 4R27A 1DQQB 4FFYA 2OTPA 3EOAB 1G7HB 4TTUA 4QUOA 4HK3N 3SCOA 4N26A 2GI7A 1TTGA 4CD6A 4AI7A 3ASOB 5DMKB 1YMMB 1I8MB 3GJFH 4BH8A 1TTQA 4GVFA 2Q8LA 35C8L 3VXNB 4XZWA 3USBA 4XCNB 2PBGA 2VDMB 4JTKA 2ZJSL 3VXRD 1CR9H 1CF8H 4Y4KD 4B4FA 1DQUA 4CW1B 1AXIB 4C83A 2FWOA 4L3EB 2WMKA 3EH4B 2RKXA 3CUJA 4F8LA 4W6XB 1OZUA 1AK5A 4Y4HB 2G0KA 3QG7L 1BRLA 4I9JA 2Z35A 4XMTA 1FX6A 3LXAA 4TYUA 4R9OA 5LBGA 3GU1A 1SYSA 1DBTA 1XQ4A 5FKAA 2RHGA 1G1KA 2M26A 1VFOA 3IDIB 4YUEL 4O1BA 4MZ1A 3DYMA 3G77A 3T5WA 2DV0A 2DZAA 5FO8A 1RVKA 1KTCA 3D3FA 4N1EA 1V7NH 3M5XA 1QUMA 1R85A 2D24A 4IIQB 4PJGB 2YPLD 3C09B 3KPNA 3WL9B 2F15A 1XQLA 4ELMF 4MDPA 3IRCA 1ET8A 4C4KT 1W1B1 5FV2A 3EOOA 3SR7A 4MNQB 1HDMA 1O6VA 4R84A 2Z31A 3LD8B 1CIUA 1ZEAL 1ZT1B 1M05A 4LHUG 3VO0A 4R4BB 3SDYL 2Y1HA 3JV4B 1IBFA 2BZDA 3G5XA 3C5ZD 5IJBC 5EFFA 4RX4D 3PWPE 2UZYA 4MZIA 4WNJA 4P5RA 4GRLB 4RCXA 2KZHA 3HFTA 1ZUAX 3MPGA 5C9RA 2W9MA 3GLZA 1QA9B 2XKNB 4RDYA 2WWKO 3UJFA 4U1SB 2OMYA 3GDTA 3KPLB 4P59H 3L5LA 1WISA 1IFRA 5AHNA 3W72A 1KCKA 8RUCA 2BC4B 5T1DH 1RMFL 5HHOE 1VCFA 2DSKA 4KO9A 3EA2A 2EKGA 1AQHA 1ZRUA 1EF2A 1ETA1 4S3JA 4C58B 1FFPB 3EYUL 3DMMD 3RGHA 3GXUB 4CLMA 4JIQA 3BH8A 2XIJA 4MA8L 2XJKA 4JZ5A 1GVSA 2YD3A 4XUGA 2CUAA 1FYHB 1UB6B 1CFVH 1JV5A 4Q22A 3DSFH 2G9HA 3DI2B 1UGKA 3OG4B 2A83B 3QAQA 4OZFB 1WCBB 4KRTA 2VISB 4QQ3A 4DJDD 1ZE3C 1H63A 1AANA 1IJ9A 4L56A 2BERA 3LKOB 1KC5L 3SY0A 5ISZE 5JHDE 3NL3A 4PULA 1QPOA 5JUVA 2Q8XA 3ZL2A 5GGRB 4QKTA 1GEHA 4QRRA 3W81A 5F2LA 2R0WL 1VJIA 1DVXA 3O7UA 1V7MH 1I1AB 2G50A 6A3HA 4N8VG 1IGCL 1L9RA 4GKLA 3UERA 2B59B 5E1AA 4LARL 2JIXD 2D03L 4EI5D 1IV8A 2LFEA 2XBDA 4I0PA 3B8DA 1UZHA 4WHYG 1ZSXA 2FSDA 3U7VA 1IAIL 2VW6A 3KVJA 3RY6C 3MI3A 5KJRH 3T78A 5D1XC 1NCWH 1YEEH 3BPOC 4P5TD 2ZONA 3EYFB 4LPXA 5B38B 5JMUA 3SQBB 4DK6A 2IQ0A 3RUGF 2XY1A 4CNIB 3NEOA 3HNVL 1W8GA 1DQJB 3D18A 2OU4A 4FCAA 1ZVSB 2D03H 4V2BA 3T08A 1N8ZB 3X1GA 1M68A 2ONEA 3BPCA 4L80A 1FNAA 2B7QA 4DZ8A 3QJHB 4PJDF 5AFAA 5J6HA 1I3RB 3WUBA 4XO7A 5DJXB 4PTNA 3TP4A 3AFBA 1SLWA 2Y5TB 4AD0A 3PHOB 5DVMA 1SJXA 3GSNA 1GH7A 5GPRA 3P82A 2GEEA 2EDWA 1P7KA 3WNOA 3G1FA 1VHPA 1L3NA 5REQB 3U6XS 4ZW7A 2OV0A 3CLEL 1MCDA 4S0TD 1FV1A 3EH1A 1DBAL 1DQTA 2WNGA 3GXDA 3BWSA 4XPHH 3VGDA 1JRHH 1VPQA 1AP2B 3L21A 4G8GE 1DVQA 4Z7NB 3FSWA 2DN7A 1G69A 6ALDA 5G2HA 4H8HA 2RAMA 1QG3A 2VQ4A 2ISDA 4NNYA 4C4UA 4KGLA 1K8XA 4Q8UA 3QFJB 2AV7B 3WHE0 1F61A 4WI4A 3AW5A 1KLUB 2W63A 1HN1A 1U58B 3MTRA 4GSXA 3BLFA 3RY6A 2VEMA 3GVRA 4DBDA 4D6IA 3QZWA 5J0BA 3VKJA 3GPEA 2AAMA 1MCKA 4U0RC 4WKZB 3C0LA 1E50A 2REQA 3O3BA 5D96C 1F56A 2K7QA 2VGIA 3CHOA 2BNRB 1ETB1 5BZDA 2R9RA 1C8QA 3GNNA 2NV9A 3S34L 2IALA 5E5RB 2B1AL 3DG6A 2FRGP 1JF1A 3RZCA 3D0LA 5LA0A 2HKFH 1KFGA 4B0MM 4YTUA 4X99A 3LY0A 1DBKH 3ZYIA 4Y1SA 2O4EA 2PXYA 5CN2A 4Z7QB 2W9DH 3M1BB 4PP1C 3TIDA 3W2KA 1UJTA 3NJFA 4N2IA 4PB3A 5ISZD 5DT1L 1B3ZA 3JU2A 5D37A 2VC7A 3F2CA 3R7RA 5CEXA 3AIEA 1YPZA 1Z5LA 2FQGA 1LK3H 3BSGA 3DHMA 4UFIA 4UUIA 2BNQA 5IMMA 3C09C 5B1CA 1GZPB 1CB4A 2C1PA 4EUPB 2WO2B 2CJUL 4D8PA 1SMDA 4IBWA 1XXXA 2ISWA 3OGRA 5I75B 2BGQA 5HJ3A 1I9EA 2J2ZA 4P2OC 2R1LA 1QVOB 2GSJA 4ZXBC 3QNXB 5D1QD 4LEOA 2X16A 4AK2A 3ETBJ 3GJEA 3KYMB 5I6XB 3LGDA 2Y1YA 3ZKQD 5CZVL 4H8NA 3OVGA 5LWYH 3ZE0E 1SVZA 3LNFA 4M1CC 4F1SA 3O0FA 4KDTC 3HAEB 3P2TA 3LMZA 1TZHB 3QCUH 1YNQA 1N2RB 1ZV5A 1OAQL 3CDGB 3FKUS 2WOQA 2C9RA 2CLZA 1TTBA 3F7KA 3NOIA 2TYSA 4ZTYA 3WF4A 5EUKA 5LNUA 3V2AR 2QDVA 4MCMA 2G3FA 1OAZL 2GSGB 2NXGA 4MFDA 1ID2A 4XB8A 1R9XA 3K6OA 3MB9A 4NZ8A 2Y61A 1FWFC 3PL6A 2NDGA 4LCUA 3HHRB 1XRFA 3OAUL 4TLUA 1VFLA 2DI9A 3FB7B 4M56A 3ZN6A 4ELMA 5IW1A 1OWRM 1H51A 4MIMA 3S0CA 2WKLA 4PJCA 1EBAA 1FGNL 3W3BA 2PPCA 5I1JL 3OVQA 1OM0A 5LHFA 3S2NA 4L1HA 5HJ3B 1KN2L 1NUNB 3WBEA 2PPDA 4AWEA 4MNLA 2OTWA 4PJDA 4I9TA 4PJXF 2OKTA 3FT4A 3U4EB 1I1WA 1A66A 1YMMA 5TPWL 4BZ1A 4B7IA 2ZNXA 2QTVA 3P9WB 5I76A 2ORBH 4B9FA 3WBXA 2EQDA 3CHFA 5BZAA 3B9KD 3DFHA 1CDIA 3QA3B 1QLFA 5I0XA 1E0XA 3FFDB 1MFBL 4FHJA 4B0MB 5FIPA 3N44F 5MENB 1IIHA 3L65A 3UPWA 4NZTH 2I16A 1FIGH 3WQFA 3FCUB 3E9AA 5KSBA 1QFPA 1VEPA 2VDMH 3GSUB 1HVQA 4Y5XA 4MD5B 4EZMA 1W1A1 1AKPA 4JY9A 2EDBA 3LCHA 2DQIH 2VE6B 1NICA 2PTDA 1YAZA 3D0LB 2IBZX 5DWPA 5JIMA 3LKRB 1I8KB 1XLKA 4QYOA 4F9LA 1DCLA 2E9BA 2OZTA 4G80B 4PTMA 4L2LA 3CGTA 2YB1A 2QSVA 2CHDA 4O9HL 3HC0A 1XLGA 5CILL 4B96A 2WQDA 1FWBC 4CQ8A 1DQVA 2QELA 1D8CA 3QPZA 4N6EA 1UIPA 1G9NC 1TR7A 2B08A 2WBKA 3EWDA 2M8XA 3P3TA 2QIWA 4M43L 4HMDA 4HPNA 4D9PA 3P0GB 5EY5A 2FTAA 5I6PA 4FXFA 1H1NA 2OPCA 2XIBA 5ETUB 1PY9A 4JZOB 1SU5A 4Q4QA 4PTWA 5M3WA 2PYFA 3U4KA 3ZQXA 1NAMH 4UTAL 3DV4A 3H42H 1BG1A 2DH2A 1HIZA 3LH2H 3DX6B 2NWSA 3TTQA 2A6JB 4KWSA 1NC2B 2ZUSA 4M80A 3X3FH 4S38A 2CJTA 1ZHNA 3GMQA 4XN5A 4XVUC 4FO4A 2P8LB 1UJ3C 3ZLHA 1LO5A 3IJ6A 5J04A 2XFRA 4DGYL 1ONQA 3FBKA 1FWEC 3VXOB 2A9NH 2N1KA 1V05A 4ABWA 3QJUB 3FQRA 1U8PB 4JLRB 1L2QA 1H8OA 3HLAA 4GRWH 4GO8A 4N0FB 3MSRA 1EEPA 2F54B 3OKKB 2WZ6A 3BP7B 2VDOH 4LUIA 4HUCA 4GS7B 5AHMA 1FBIL 1W91A 4JTEA 4B16A 5L4MA 2FATH 3DUSB 4KH2A 5E9DA 1DQXA 2PR9A 1FFNB 4DGYH 1GW0A 4HA1A 4WDIA 4YSPA 3KPMA 2CZ5A 2AJXH 5GJTH 3H6OA 2R2EA 1MDTA 1GJPA 3PWNB 4POCA 4PJIE 1AZUA 3IPFA 4FI7A 1X9RA 1VF8A 3ISIX 1M5WA 4M6ML 3W1MA 4IOSA 2EXYD 1CPUA 1UACL 4MAYA 1BQGA 3Q6FA 4WUUE 2LW3A 3BZ4A 3PZTA 1H0DB 4MHHG 4E0RA 3THCA 4JDZB 2NTFB 5IVXF 3LHPH 3FTGA 4I18C 4LZKA 3ZKND 3V35A 3VD9A 3AU6A 5DR5L 3S3PA 1RHFA 3YPIA 1EZUA 4MRBA 5I0ZA 5IT2L 2VZSA 3IV3A 1WUZA 1QQDB 2QJMA 1YEHH 3F2LA 1EJTC 2D3LA 3WN5A 1XYZA 2R91A 1V8EA 3TN5A 1L6SA 3HGSA 2ZIDA 3VC5A 4S1DC 4K8GA 3SQRA 2CBUA 4EXAA 2WC7A 2AQVA 1YXDA 4BFGA 4IQHA 4LH8A 4PQXA 2NY5H 3QEUA 4C56E 4XRCB 3V0TA 4N2OA 3RX3A 1DANT 2H3BA 4ODSH 3DI1A 4UM9A 3RX8A 1SO6A 2WLZA 3S8HA 4I1PA 5CUSL 3TA3A 4I0PB 1X6UA 3CSTA 4OZIE 4MJZA 1M7UA 1L4IA 4L5ZA 1L9PA 2AW2A 4D1JA 3UTSD 3W1TA 5HBFA 3QFDA 1KM4A 4LRSA 3WQCA 4NZDA 3NDYA 1SF3A 3PIQB 1U91A 3VFOA 3OG6B 4HMEA 3US0A 4BXSV 1VGEH 3AJXA 2YPIA 1DSFL 4PS3A 5DS8B 1GONA 4BUQA 4WSHA 1VFSA 1SY6A 4KBPA 4UYQA 2QV5A 3BQ6A 3APTA 3PWJA 3EA1A 4GA8A 4GWEA 2DTML 3LI1A 1FNFA 1TPH1 2RACA 2C1PB 4ATLA 1YJDL 2BFVL 3DFOA 4RNFA 2ZCZA 4DZ8B 5J6HB 4LT9A 5GRVK 3BVWA 1E9OA 1J1XL 1FAIL 2EDQA 3G6JB 4XNUL 1B3XA 1QACA 3HPXA 4JYDA 5D7JA 1ACYH 2ASHA 7REQB 3D85B 4IOSD 2MTAA 4I4WA 4JQAA 1V6TA 4ODXA 1NGXA 2HPMA 3B7YA 4P46A 1XI3A 4Y6GA 1OXYA 4IIZA 4HJIA 3EDJA 4HCIA 3NJNA 1CCZA 5DO2D 3QUZA 5A2CA 1LWHA 5E5MB 1A5BA 1II4E 3KYNA 4XMLH 4ZX4A 3R6IA 4IPIA 3WEXA 3DX6A 4KJYA 3A6CL 4WDIB 4OGYL 2PDLA 1DFBH 3QCTH 4FQIL 3VFSA 4F80A 3QQWA 4PYSA 2E7BA 5GZNC 4B95C 3PG2A 1S7TA 4HTBA 3UIYA 1OZQA 2B4GA 5FJUA 1DVTA 5FOOA 2PCFA 3UYRH 4M7LH 4NI8A 5KUMA 4JLRA 4LAKA 4WUIA 4XMLL 1OAXH 2LOEA 1CD0A 4W6WB 3FJ6A 4Z7VB 4XC3L 1TYEB 1O7DC 4RISH 3KMDA 3TNNB 1RY8A 1ZJHA 5C6TL 1DFBL 4PGEB 4OQTA 3BD4A 2FR4B 1EJVC 1BX2B 2PTVA 4UCFA 2A4CA 1TUFA 3HI1B 4OB5H 1UP3A 3BARA 5DMNA 5A6IA 4F2EA 2O61A 3DEQA 3IETA 1BJMA 3UZVB 3B6SA 2QDEA 3MRRB 3TV8A 2PCYA 4N0UE 4P8VA 5LXGL 1UD2A 4V2XA 2R8WA 5CINH 2YR3A 5EC1A 2X0HA 2K8MA 2XXFA 1ZJIA 4O0ZA 4DLMA 2NY5C 3FB5B 3VG9B 3F4WA 3IEBA 4J6RL 3ZY7A 4QY8B 2BY3A 3FOLB 3FSZA 4JFDA 5C0JA 4AT6B 1V4YA 4BEIA 3WKYA 4LIQL 1XBRA 3T0EB 3TWAA 3CU1A 1TQUA 1WD9A 2G60L 4E5XA 3HFFA 3QG7H 3TYUA 4UU9B 2KZWA 4IBSA 4JO4L 5J1AB 1IO4C 1CE1L 1JI2A 1F3JA 2YOAA 4AXWA 1LP6A 2CPCA 4ZUVB 1S9VB 5ICZA 3LRSA 1RQBA 1BMGA 3LD8C 4PB0L 4RZCB 3SEPA 3VA6A 1RZ8A 1DIOA 1MLBA 3TPUA 3P62A 3SN0A 3DBXA 5FM5M 1AHKA 1AMKA 3PRZA 1O1ZA 3VCCA 2R9HC 5CZRA 3UXKA 5MEOB 1IKFH 1VIWA 3NJKA 1FRBA 3PQYB 2AJ3A 4FL4C 2WBJD 1PD0A 3QQNA 5GZOC 2OM5A 1ZHKB 1G7VA 4NS0A 1JMZA 5HGDA 1GYVA 3PY2A 5TBOA 5F1KC 4ZZ9A 2YB4A 3N2TA 1NKRA 1NSNH 4GW5A 4JTDA 1I7TA 4D8ZA 4PB0H 1OT4A 3AITA 4OVVA 1FVPA 2C9VA 2WOYA 3S4SG 2HZHA 1XS2A 1FH5L 5I71C 3PZ9A 1E2ZA 4HUXB 2ZT9C 3AIUA 3W1LA 3ZUNC 3W71A 2CHXA 3HZ3A 4MA7L 1MNNA 2XPZA 1MCQA 2WJEA 1KBKA 5I17A 3LCYA 3C8FA 3VKAA 3IS4A 1M7IB 3T0EA 2XLLA 2EO1A 3S6CA 5FEXA 3HLAB 3K71B 1HXMB 1OX4A 4E0CA 4O12A 2WSRA 4P5SA 3BC9A 3V5KB 2BNUB 3MUAA 4M1BA 1CFBA 4IDJH 4P46D 1E72M 1S7XB 3F7QA 2OMXA 5EO0A 2QSCH 3D7PA 4YXLH 3NIDF 4CSPA 1I2PA 3GS0A 3WBAA 1EUUA 2WXGA 4I1NB 1S7QB 2H3XC 5F7AA 5HD8D 1MFDH 3LSOB 3URNA 3NPSB 1GKPA 1TPEA 1M7PA 4JY6B 4OLEA 1PB0A 2PLKA 2QDWA 4EIBA 1EJRC 2AMXA 1CE6B 1FUYA 1LO4L 3A3XA 2K9FB 3OLIA 3BJLA 3G6AB 4GW1B 4MA8H 1OD0A 1OIMA 2VD9A 1AJZA 3ARBA 3FQYA 5TDOB 4F9LC 3OPSA 1IC0A 1FO0H 2VW4A 2QSCL 4POZD 3VG0L 3BUPA 2CLHA 3FUJA 4MM1A 3CH1A 3P11H 4GZJA 5HOSA 2WGXA 3OZ9H 1EXPA 4V33A 3WN5C 1MEHA 3FS2A 3DVNB 3C0JA 5HMFA 1CICD 4PJHB 2Q8BL 1EX0A 2YYTA 3P2VA 1X5GA 3GLAA 3TTSA 2XVLA 2NQZA 1KIQB 5FJIA 1BLNB 3C6LD 2DM3A 2ATPA 1TSIA 3NCJH 1H19A 3FT9A 5EZIL 1PPIA 4NZUH 3WHE1 5MF5A 1GZJA 4POUB 3AWOA 3M0YA 4PGDB 1EDYA 5FO7B 5I24A 1QNOA 2YPVH 4E4PA 3FS9A 2EIJB 5KJRL 3WOVA 2V8MA 1EZSA 3Q2NA 1E7UA 1X5JA 4J1UB 1BOYA 5L2KA 2HTLC 2FGLA 3BMXA 3C2EA 2GSEA 3I3EA 2G95A 2O5YL 3ZMRA 4DQOL 5G4HC 5C6MA 4Y5XC 1IVLA 4XVSL 4JO8A 3UTTA 4DUOA 2WQRA 2ZYFA 3SDDB 3UZVA 1T8XA 4PUBH 1E5AA 4UINH 4LF1A 3B8YA 3BE7A 4QI3A 1I3UA 2P5EA 4I9WD 1TFVA 3D9AH 4B3VA 1QWHA 3CASA 2O1AA 4NQQA 1IC1A 3O9WB 2Y22A 2HLAB 2R4RH 3W75A 2HRHA 3H4WA 3WUEA 1YNLH 2ZP8A 4F7CB 1EQPA 5DS8A 3W2JA 4XNZC 3OKNA 3D85D 1BQHB 4ADJA 1CNVA 3GR8A 3WQ6A 4KDTA 4OV5B 2VZTA 4JHAH 1O7VA 1YADA 3QORC 2DT2A 4R5XA 3NZ8A 2CKRA 1UYWH 4L9LA 4K3EL 4P3CL 1E4JA 5DUJA 3VZZA 2YA2A 1JRHL 2BSSA 3NVDA 1QBBA 4NP9A 3RNKB 5JOPE 4FI4A 4LFYA 1A6WH 1J9RA 1X4ZA 2QR6A 3K13A 1FG9C 3BWUC 1BQ5A 4FHKA 2DAVA 1ZGDA 2K4AA 5DI8A 3HB9A 4J1UA 4POYA 1XLFA 5AB3A 3ITGA 1SOQA 2ZX5A 2XQBL 3BSZH 3EG9B 1JNHB 4RGOH 2UY3A 2ZZ3A 3Q8AA 5T1LB 1GAFL 3KVMA 3VI3F 4P7NA 4UNKA 1VGKA 1Y7VA 2Y2WA 1E7VA 1TJXA 5E6IC 1U6AL 4P2CG 4YDLB 1DZ0A 3HFMH 1WIOA 4W68A 25C8L 2XICA 1F4WL 2A77L 4XAWH 4UC5A 4ZJ9A 4JJ5B 3T4AB 1C16B 4C7DA 4HGWB 3SIMA 1TJ1A 5KZDA 4HK6A 3BFQG 3IFNH 3O8XA 4RK8A 5IOBA 2X5PA 5D2LB 4LBRA 3W87A 3IGLA 3P2DA 3WFHA 4K94C 3FFCB 4C6KA 3KXFE 2CO6B 1E15A 1A4JB 2OL3B 2MQ3A 1OD8A 3MSYA 4WTZA 1UZ6E 4WK0B 1ZLWH 1R3JA 1ONQB 2Y36H 3BCJA 5BOOA 1T03H 3E0FA 3NSXA 2Z92A 3FQUA 5KW9L 3WE6B 3IPBA 1LRTA 3LMJL 2ED8A 3TEXA 3GKWL 4CGUB 2I7GA 4M93C 2WUBL 2X53A 3L95B 3TTEA 3QEZA 4Q9CA 4EPKA 2EO9A 1RZGB 9RUBA 1JGEA 2GTWB 1KZQA 4ZPTB 1PKLA 3V6OE 5D1ZI 4Y8AA 2R29A 2ITEA 5ANMA 4HPOL 4Z2JA 4AC2A 3WQGA 3V0VA 3WMPA 4XR8C 1Z1WA 3CBJB 3G6DH 3V4VA 5J11B 3IMTA 1JVNA 4FQXC 4H1LA 5ISZA 3UPAA 4D0CA 3IMSA 4ZMVA 1T2JA 5BYWA 4WK2B 3B0VC 4HQQL 3QZ6A 5EN2B 3NIFF 1NWPA 3CHPA 3RTQC 2J4GA 1QATA 5J6SA 4ZCWA 4Q8NA 1JNLL 2F1BA 3DOIA 3FN0H 4GQ0A 5HK4A 4M48H 4AL8H 1CD8A 3R1ZA 4NY2A 5I8OL 3AC0A 2V2DA 4PD4K 3O3AA 5LB1A 3EH3B 1EJWC 3IWPA 1ZLWK 1Z3RA 2BW4A 3ZMNA 4PSPA 4UTAH 2Y7GA 5F72S 4EVNB 3MUY1 1HF6A 5D2LF 4NCC2 4JKNA 1HJQA 5JO5A 4ZPVA 1P0NA 4M6VA 3HCVB 3SODB 1M1BA 1U1JA 4LAZA 3QYNA 3BEWB 5BO1L 1T1WA 3P30H 3QR0A 5FLUA 2PNDA 1GQJA 2OELA 4IJCA 3ZL4L 3ZM8A 1TKWB 3CAKA 4DF2A 3A22A 3VFMB 1XIGA 3JWNE 1F1DA 3RR1A 2WXNA 4MLJA 4PCPA 3G5YB 4FOJA 4OCSH 3BQUC 3H9SE 3WMLA 2FHBA 1F00I 4ZQKB 4CADA 1CB2A 1G7QB 4XP5H 5L4JA 3U9PH 4LSBA 3UWEA 2G3IA 3PR2A 3NWRA 3QJQB 2GJLA 3T2QA 4RNRB 1BFTA 2K3TA 1Z3GL 1J1OL 4QHUA 3ZTJG 2JEPA 4DCQB 1UFUA 1SQMA 5ALCL 7FABH 2OO6A 2CK2A 5EBWB 3NZ1A 2NY4D 4GQPH 3RDTC 2EG7A 5E8EB 3EX1A 3VYLA 2J8GA 2H9GB 4IK7A 1DXFA 4LVOB 3D87B 2ZWKA 2VDML 3K91A 3MHGA 2VZUA 3BKML 5I1EL 2VWEE 4P9MH 1UB5B 3V0IA 2CJ3A 1YXYA 5C86A 5IM7A 1ADQL 1HEJC 1OGBA 4UWQB 2VEPA 3IDGA 1J1OH 3BUBA 1HCFX 2CSPA 1LDCA 4MPQA 4P5UA 4CEXC 2NUYA 2YGPA 3R0DA 4G7YL 3ARGB 3AXMA 4BF7A 1MWAH 4Y1AE 2OK0H 2YDSA 4HCDA 3V5CA 3B2VH 1T89A 1TQVA 3MLUL 5G5DB 1DVFA 2QGCA 2XH4A 1WDWA 5E7FA 3T7VA 1POKA 4OUIA 1DBJH 5H37G 1DWFM 1DIDA 3ZRSA 3DPBA 4BFEA 2O6EA 5C7ZA 5B4MC 1IGYB 1DWGM 3MJ8A 4RGMB 3OXSB 4AUYA 2OMAA 4BK9A 4N90D 4G82A 1IE7C 5DWUH 4ZW6A 1OGSA 4B2DD 3UZXA 2Z65C 4QROA 3PNRB 4M4PA 5LXEA 4MD5A 2CZEA 1MW0A 5AWNH 3M17B 2OXGA 4XP6L 3X3FL 4IXXA 3F05A 3C2SA 4CVXB 4EKJA 3NZUA 3A4XA 4AXKA 2ICSA 3GB7A 4XTRC 3ITTA 3B2MA 3QZEA 3D4CA 2FVNA 5BRZD 4KRPB 4G9DA 1NU5A 2OMYB 2N3JA 1WOBA 2CBIA 3MCKB 1NJJA 1TV3A 3ELFA 1VACB 4MWAB 1KCRL 3W27A 5TQ2H 4QAIA 5I1IH 4WUKH 1I45A 5BWFA 1S7QA 1T5KA 4PWHA 5IJVA 2ZQ0A 4AH2B 1S2TA 2QCLA 5HWNA 5XIAA 4S3DA 4KCTA 4OJFL 3LH8A 3C3NA 2Z1PA 2APFA 3HN8A 3S88H 4EIUA 3FO0H 3QWOB 2BFVH 2JLPA 3P02A 4X6DF 3B83A 2VXNA 1RH8A 4HN4A 2CGRL 3D30A 4M24A 4PCFA 3CXOA 4UZUA 3HMCA 1WYIA 3HI6L 4H4NA 3HG5A 3VNKA 5A69A 2WNKA 3KRZA 3HZKA 4K94L 1LWIA 5FF3A 2G3XA 4W4NA 5T1DL 1IM3B 5IGXH 4E9QA 1OJXA 5DCDA 4ELKA 3SECA 3ZJAA 3RAJL 3TW7A 4JPVL 1OTTC 2BZ7A 4N22A 3JSSA 3NG5A 4PCKA 3KTSA 3BUYA 4WSKA 3ARDD 3OGVA 1P0SE 4PUEA 2CHZA 4HALA 2VLKA 4L8BB 5IEHB 5JOEA 1N67A 3B4YA 3RO6A 4K9EC 1ZL1A 1P5UB 1CLOL 4AIZB 2N56A 4DCQA 3P8JA 2AP2A 5B80A 1T89C 1G7JB 1OE2A 4FFVD 3V5DA 3N13A 2VQUA 4L4VE 4TVPL 4CU6A 4JG1H 2EADA 3IVKA 4O0QA 1Z9OA 3O4LD 2F53A 1H3XA 3LQAC 4HWBL 3GKAA 3MW7A 1HOEA 1CLVA 4R97B 5EF3A 4HU0A 2RGLA 1FFOA 3GSQB 1RK1B 3QQ0A 1E1CA 2JKXA 5ESVA 5A8NA 2GK2A 5HYJE 3GNPA 4D0BA 2G0WA 3O4OB 1BECA 4WI5A 3QJHA 4R2GB 4GW5B 4XPBL 4LRIC 3NZHL 4HS8H 4L1LA 1Q66A 3UBFA 1H6EA 5JHDA 3ULSB 4WEMB 3II2A 1SYVB 3N1QC 4D0DB 4UOZA 5LGJA 4I7ZC 2A2IA 3TIDB 1PDZA 3VCNA 3PBVA 1ZS8B 4HV8A 3WQVA 3VXRE 4FTVD 1TIMA 5E6ZA 3T8XB 3TYAA 2G30A 1HGWA 1YMYA 3Q2VA 1H11A 4MKNA 4JM2B 3GMOB 2ZFAA 5HWMA 1MCCA 2H6UA 3IDMA 3HG4A 1J1PL 2XQYG 4HYTB 4YN3A 2IOIA 5K1VA 4Z7VA 2EINB 2GJNA 2XTKA 4GK8A 5T26A 2ZUYA 3NCMA 1KD0A 1IC7H 3CVBA 2BIOA 2WLHA 2JB5L 1R2TA 1FJ1B 3N3MA 2Q01A 4URTB 2VL5B 2BODX 2QAPA 4FQ2H 2WZ0A 5TDOA 3KVDD 4HUMB 4PRPB 1BQSA 1G6RB 2X8RA 5ESAA 4JQ3A 3THQA 1TZHA 3PZIA 2Y3NA 2W6RA 4L7ZA 2X4RB 1Q9WA 4AEFA 4KNQA 1TELA 1WZAA 2BM3A 1I9JH 3CWGA 1QT1A 3N3EA 4OZHB 1I2NA 2WXKA 1TVBA 3T2NL 3UAJA 2X6AA 5C08A 4EN3D 2BOCA 3GK8H 4I3RH 3O63A 3BZ5A 3RWDA 3DGGB 5JW5B 3RHWK 4HKBB 3VPLA 3T6ZA 1A4JA 1WWBX 5IBUG 2WPBA 4HZLA 1B0WA 3D0CA 1A1OB 4NP4H 2RJHA 2BP8A 1J05A 5FF7A 5AKSA 5JZ7D 3W53A 1L0PA 1R5VA 1YJDC 4JM2D 3VFGL 4IGSA 2QTEA 4ZQMA 1XAUA 4GOAA 3S42A 4FI8A 3HPLA 4XNMA 5CJBA 2VAAA 5DUMH 1E6OH 1I1AD 3FDGA 4R4NC 2BVEA 2BH0A 4IK6A 2DQEL 2YXFA 5JPMB 2NV2A 4YHNB 2C7UB 4DK5A 3RLGA 1NJ9B 4EPSA 1X5YA 1B2WL 2E9WA 4K15A 5I5JA 2HVKB 2XYLA 3CHDA 3CD4A 3MBEC 5CCKL 3FFDA 2DQCH 2PN5A 1MAML 1HHHA 1KYOJ 2E6JA 2VO8A 3NA9H 2DLFH 1EERB 3DDMA 5GJMA 3TAOA 5KVEE 2BCKA 3FGCB 4W9FC 4NQVA 2IOMA 3CLFL 1QA9A 3GLCA 5IUSA 2WTRB 4HP5A 3BGFB 1AA1B 2WV3A 2V0TA 5U7SA 3U6WA 2HE8A 4OZIF 5INCA 4L2YA 2GVYA 3GRWH 1I0DA 1TWDA 4UFHA 3V3WA 3IIOA 5E94A 4OI8A 5A2LH 1D5MB 1NM9A 4EZKA 4WFFE 1YPXA 3WX7A 3HUJA 1MI5D 4PJ5B 1YO4A 4US5D 3N1PC 4IDLA 4RLIA 3KPRA 4TSBH 2B39A 4QT5B 2JKLA 4GG8B 4G7QB 5ICXA 4PBEA 4PL1A 4P5MA 4FQLH 1DUYB 5G4OA 4IRJA 4DP8X 4BI6A 2YA0A 3L5WA 1V51A 1A4KB 4KVCH 1CFNA 1IKFL 2GSHA 4OLVL 4Q9QH 1B6UA 1BYNA 3VXNA 2IPJA 2VZOA 2IQ9L 4L0ZA 2DYPB 3BKJL 2F9RA 4JPWL 1V0MA 4PUUA 2O56A 3HTLX 4QO1A 1SFLA 3O6KH 5K9CA 5ICYA 1SDDA 3PJXA 3ZVHA 2WB5A 3RY4A 4L9YA 2JKIS 3NCEB 4UDUB 5CEYB 3HQ1A 2NXIA 4JEGB 4TIMA 4WJ8A 3G9VA 2XUCA 1X38A 4CNTA 2BJML 5C0BD 4PJXA 4W6YB 5M7QA 1UEMA 3L3OA 4JE0A 3B5HA 2ZF9A 4U1MA 4KQ0A 1FP9A 5GSVB 4M3PA 4HCHA 2ZZ1A 4PJ8A 4J7RA 2SODB 3Q45A 4P7OA 4LOFA 2F74B 4G7VL 1KXQE 1QW7A 5D03A 5EB8A 2R23B 5I1JH 6REQA 3ZGIA 1P7TB 1E27B 2NLJA 2X1PA 3BLBA 1RBLA 3Q1EA 3QBTB 1TVNA 3PFMA 1GYLA 3O2WL 3VFPA 4W8AA 1HYRC 3WJJC 5G4MA 3TH2T 3AIRA 2A5UA 1JUBA 1HL8A 1SBSL 1SDYA 1HXKA 4GRLC 2A6NA 3I02B 4ZPTA 5C0IB 4U3XA 5BZWA 2IH8A 3G18A 2DW5A 2B5IC 2XQBH 4GEIA 5FCSH 3VG0H 3G1VA 1TCRA 3T0EE 3TZVD 3W83A 5CSRA 1E2VA 4TPRL 3GINA 5T91A 5D6CA 2N0KA 1ZJBA 4LB3A 2FDBP 2YBUA 4HWZA 3KBPA 1O9VA 3GC5A 1BBDH 3LCGA 1XYFA 4WKFA 1K8IB 2XWRA 1W9UA 1A7OH 4XBEL 3EOEA 3N11A 2A1WH 1RAMA 3RI5K 4OT1H 4PJ8B 3SDDC 3UTQA 1M4KA 2ENPA 1ADSA 3TQVA 2XPGB 4NQEA 5SX5K 1ZBCA 4K6AA 2WXOA 1FCGA 1U4EA 2R23A 3PIQA 3WLKX 4JHZA 1G5GA 2KUTA 2MMXA 4PRTA 5EFDA 2BHFA 5F8RC 2P8MB 2VO5A 3QFJA 5I9QC 2ETWA 1RLBA 3CB8A 5HI3D 2UZIH 2QSTA 1ICPA 5BXPA 4BFOA 1BBDL 2QFPA 2UV3A 4HJWA 3ZDXF 4ZSTA 1MFBH 5DMKA 1I8MA 4XRCA 3CIVA 1RPKA 1SOXA 2OZ8A 3GTFA 5C0IA 4GRMA 4P9HC 1P4LA 2R1NA 1YRRA 3FK3A 4BHUA 1CN4A 4L18A 2POZA 4FOUA 5HUPA 4PJGA 3QV6A 7ENLA 1J6PA 2F7RA 1A1MB 5IHUH 3NIFB 3ZHLA 4DELA 4AQAA 2R83A 2VC2H 2J20A 3VFRA 1XCXA 3H6AA 3OKOA 3R1GL 2VD8A 2VLRB 1E6JL 4XWUA 4K7PX 1FPTL 4NEHB 3BG5A 1LP9F 4JFXA 3TA4D 4LRNH 3T0XA 1RCOB 1EEYB 5BW7A 2XM1A 5GS1C 5DQ9A 2VDPL 3TX4A 1VA9A 3NAVA 1JWSB 5F88B 1RIUH 4ZUVA 4IIEA 4P2QE 5M5DA 3O2VH 4I0CC 3B4UA 3BMWA 2GTZB 2A7BA 3V4UH 4LKCA 4DP1X 4OF6A 3D2UA 2LE9A 4KITB 4UQIM 4Y2OB 4FA6A 3NK4A 3ZX1A 1JNLH 5IB5B 1KOAA 5DUPL 3WUFA 4JQXC 5H4YA 2XRAL 3KLDA 5C08D 3QZMA 5SWZE 3JWDL 4CNIA 2QPDB 5GZNA 2WXHA 3H3PH 3V7PA 4GRWB 4E8DA 2GFBB 3QHMA 2KLRA 1VFBA 4YXHL 3OXRB 5T3ZE 4AEOA 4CD7A 4I2XE 2IXVA 1SUJA 3ULVF 4A8RA 2ZUVA 1KFWA 3B2UD 1JPHA 5HVWA 1KLZA 9PCYA 1KV3A 5HYJA 5FKPA 1I75A 1PSKL 1VLXA 1UWGH 2KI6A 2Z8SA 1NBQA 3IJ7A 5L6YL 3RMEA 1XGRB 1NCBL 2WSPA 1H3UA 3NFPB 5GRJH 2IVFC 4DPAX 3NGFA 3BUTA 5DR5H 4YXHH 3LPWA 4O4VA 1L9QA 5D7JC 2BBFA 2OCJA 3ET9F 3BCFA 2ADIA 3TH4T 1GK8A 1TMQA 3W4RA 4HJSA 2DD8L 4OCSL 1DL3A 4FXKA 2VM8A 2JJSA 3BT0A 4M1CD 2E74C 2I9TB 2WXDM 1UT2A 5IF0A 3Q94A 3NQ7A 1JVOA 2UYLB 1ZLUH 4Z7WB 2BXVA 4P8XA 4AF0B 1JYXA 1XF3A 2OKMA 4FQXB 3CZEA 1C9WA 3V5OA 3VNDA 2ZKHL 5A5WA 2QPEB 3L2MA 2NDFA 3CJJA 1OAUH 4ODVH 2UVEA 5BRZE 3LLFA 3VXQB 2UX7A 1W8EA 3WDIA 1A6ZB 2NUTB 3SJNA 4JIEA 4ZSUA 5FJPA 4C65A 4MY9A 4OV4A 4LNVA 2I07B 4K23H 5GGQL 3MBFA 3UETA 1FL3B 3V0FA 3SRFA 2FX7H 5GS2H 3MJ6A 3GDBA 1Y0EA 4Y9PA 1H3PL 3JWNH 4QXUH 4MX7A 4A67A 5B3JF 2CIPA 4H83A 4WI7A 1P53A 1H2JA 3HVDA 1A6TA 4JUTA 2FBJH 1BGAA 3E8UL 3KRSA 1S3KH 1XGYH 1K4DB 5I0YA 5B3NA 1K7XA 1DHPA 4GISA 1YECH 1FL6A 2HFEB 5D33A 4G9FE 3RVTC 3W3OA 5DVOA 1Q6LA 2YGQA 4JM2A 4Z3EA 1AOHA 2WO5A 5D1ZD 4QIUA 3PJSB 3SI9A 4YH6A 1MQKH 4L8SC 5IOKA 5FYJL 2ZOLB 4G1MA 2FBJL 2OX5B 2X2YA 3JWDC 3KPNB 3VRIA 3CZUB 2YLAA 4U10A 3R4IA 3C61A 1RUPL 1XV8A 2C9PA 5I5IA 1JPKA 2Y7EA 2J8OA 1QSFE 1A22B 4LSTL 4FS0A 4ZMAT 1ZAIA 4IKNA 4MMXA 3W9EB 4JO2H 2YARA 4A6YA 4OLXH 2AHIA 3W7EA 2A7NA 2UXFA 1XH0A 1F3WA 4PBFA 2B1HH 4XHQA 3TF4A 1SW3A 2GK0A 1KXHA 3V6FA 2P88A 5C0DB 3MBEA 1NAKH 3RWEB 3QKZA 5LZLA 1EZVY 4ZS6D 4DKDC 1HYSC 1CGVA 2BDQA 1GG0A 4MHHI 1P48A 2VUYA 4R9HA 4FG6C 1BIHA 3CMOH 4L64A 4B60A 3AI0A 3A4AA 5IBXA 3KH4A 4Y9MA 3THDA 3M5VA 5AW8B 4KU1A 1OHLA 2Y07L 1UZ4A 2PO6D 2W5PA 1RZIB 2F7OA 2QPUA 3DETD 3IS1X 4DERA 1OIFA 2BOLA 5LJYH 1SSGA 1XX1A 2QCGA 3ZLFA 4NQUA 3M7WA 2TAAA 1EC7A 3O16A 1JWSA 3SPCA 2EG8A 3EADA 4HHGA 4O4YL 3MSPA 1UQSA 5CCGE 3ANYA 4XO5A 4P7RA 2WAHA 3V5FA 3OG3A 3K6FA 3MACH 2X6VA 3S3DB 4OH2A 4J35A 4BKSC 3AXLB 3L3DB 3QDGB 3FRUA 4GIPD 4I48A 2BOEX 5L2JA 4C6IA 4HU2A 4K7FA 5JO5B 1JJUA 3MO4A 3WIFB 3RAJH 4W84A 5FCUL 3AS3A 4HIJA 3BKMH 4OM0L 1Z9SA 4F0MA 2YD0A 3TPKA 3UGVA 3QUYC 4UUJB 1G7LB 2IADA 3ZDYE 1I7UA 4O4YH 1WE5A 4W9EC 2A3AA 5KINA 4TNGA 3Q8BA 3RVXC 4R7JA 4HX1B 4NQTA 4UV7H 4I7UA 4PJDB 5FO2A 2R2EB 2ZZ2A 4GUHA 2FJKA 3IVTA 4AMWA 4O11A 5AHLA 4TUJA 1OF2A 1ZK5A 4WK9A 1XSOA 3HE6C 2F8VA 1S3HA 2AJSH 1DBBL 2WOBA 5KS9A 5CPMA 5CSSA 4N02A 5KOMC 1IQDB 1CFVL 1KBLA 3PXJA 1WGOA 1LL4A 1Q9KA 3QXDB 1UKQA 5G2WA 1VERA 4ZUWB 1E9PA 1YSOA 2J43A 4KKLD 5FGSA 3S47A 5AWNL 1J5DA 1IEXA 2NX3A 2YX0A 3GLEA 4E41A 5J1TC 3V0HA 4JHBA 4XZLX 1OC5A 2F38A 3B7UX 3ZKMC 3IRSA 5I03A 3UNDA 4Z1PA 4MQTB 4OCRH 1NSNL 3MGOB 1OCJA 1X96A 4HSAC 4PM1A 1GVRA 5A8PA 4I0KA 5IHLB 2HT4D 1RJPA 4JKWA 3QIUB 3SKOA 1GTFA 1D3GA 1BQRA 3VKDA 4KK8D 5DJAB 3Q65A 3LNIA 4J8RA 1I85A 2LV4A 1FZMA 2RGSA 1IGYA 3JYCA 4HWUA 3L9EA 2YAHA 1JD7A 5EG6C 2E09A 2XG4A 3OA5A 2QUNA 1FVCA 1EA0A 1HQ4B 4JFZL 1K9EA 4NB7A 1TF4A 3LBCA 5DUBB 4CNUA 2P49B 3OC5A 3F7LA 3HNVH 1V8HA 3T4AA 1RZPA 4Z7NE 4EAYA 2K78A 3RX7A 4QTHB 1JNNL 2XGZA 1XR9A 5HVHC 1X39A 3TSDA 1F6AB 3VMNA 3NEVA 3BZFA 1Q8JA 3MHUA 1JRBA 2XWCA 4LEQA 2P5ED 4JPIB 3X14A 4DP5X 1LEKB 4GRWE 3FULA 1LO4H 3C5ZC 4XBGA 3TL5A 3EG9A 4M5TA 3R7QA 2JSFA 4XMKL 3V5HB 5KTEH 4J23A 2ZYRA 2ZA2A 2AQTA 4DXKA 5DQDH 3LOWA 4P2OB 1FO0L 4BIKA 5TF0A 5F6IB 3L68A 3WD0A 2XJLA 3KYOB 1A3LL 5FEBA 1V6WA 2RDUA 2ITCB 4UT7L 4YWGH 5KETA 5F0MB 3RVWC 3VSUA 3WV0A 3EB3A 5BO0D 1S9WA 3CHXA 4S11A 5ACZB 3CUZA 3H7VA 1RJYB 2D7QA 2NY0B 4QOKA 1Q6FA 3ZSSA 2YEVB 1CFSB 1E5BA 4EI6A 4QE1A 1B4TA 4JFVA 5DQDL 1KGCE 4IGNA 5C09A 3ROLB 4H9YA 4MMZB 5E0QA 4RXFA 2YLHA 4P2AA 4X8JA 5TF1L 5AL0A 4OZGB 4ATTA 3MLTA 4KERA 1RZKL 4I5RA 3O6AA 1N19A 1Q9OB 2YPVL 4P48A 4UIKL 2WCPA 3O1NA 3PPGA 1TTJA 2D9QB 3LDBB 2PLCA 4O14A 1H8LA 1OF0A 4O02B 1AP2A 4L0YA 4Q4MA 3L3DA 3A4DA 4I48B 3DO4A 3SZKC 3C5XA 1A53A 2VKZG 4H25B 1NBVH 2BMKB 2WIMA 4PG9B 3CLFH 4RAUA 4EE9A 4ZFZB 4WQOA 2NRDA 3S34H 3HAEG 5HA7A 1A8JH 1R3TA 2IOOA 4P3DA 2B1AH 1U2CA 2FJUB 4GXUN 4PBDA 3C87A 5I82A 3BPWA 4KI1A 1CXKA 3UBGA 3Q2WA 3E0IA 2C4FT 3GNMH 4KCVA 3TQKA 2YZ1A 3KWTA 5KVEL 4R7OA 1XIHA 2AJZB 4E5TA 1W0WA 4Z7NF 3KDOA 5J56B 1UPMB 5IB4A 1S2UA 1EQCA 2FVKA 1L6ZA 1GA2A 3AWEA 5DK2A 4P06A 1RA0A 1TUXA 1F11A 3DO3A 3SCMC 1LT8A 1H5BC 1H50A 4IL2A 3TN0B 1Q2RA 1L9TA 4EAEA 1CZ8L 3KCPA 4BHUI 5IJCC 4HEMA 1MPAH 3L5IA 2WM0A 1IVTA 4F58L 1M1SA 2YD4A 4GPNA 2E7HA 4WEBL 3VFVB 4UT6H 2NZIA 2FNBA 5F96L 3GB6A 4J5NA 2PCXA 4XVEA 4EN3B 5AYBA 2PO6A 4L8DA 2G2NA 2P4AB 4XMVA 3G04B 4Y7EA 4NYLB 4RFNB 3RX5A 3W9EA 1T5AA 2KDGA 1QAWA 4K5PA 1NDYA 3PVFA 4O50A 4RE2A 5H37A 4C1NA 1M42A 2AFNA 4DGUA 4NT6B 2DBLL 1INDL 4KQNA 4WHBA 2X70B 5D02A 3MOAH 4FABH 2EE2A 2W65B 3FOKA 3P0YH 1CLKA 1E28A 2AITA 3S0PA 4PN6A 2BRQA 3BQUD 1N64H 1K9FA 3MHFA 4JOMA 4LSRH 3MRNB 4X7CC 1LO0L 5EIIB 4ONFH 5KSAA 1TB3A 1Q6QA 3LYEA 4IQLA 4MKMA 1XGTA 2AKRB 5JBDA 1U3HC 1JIBA 3ATFA 3FQ2A 4LAOA 3F58H 1CWYA 4ZENA 2R1YA 3TC9A 2NZ1A 4I7VA 3PGCA 5FIEA 2KKQA 4P8UA 2ITFA 5C55A 4ACPA 3UWYA 5HBBA 3R0UA 5GRUL 1CXIA 1NPNA 3MNVB 3QEUB 4P07A 3X17A 4AVIA 4XQ6A 3TCSA 2EEAA 3VNYA 4BZ1H 1RJCA 3BZDA 3IEAA 4BK5C 5MERA 5FA5A 4L1WA 4PMOA 2J7DA 1UM5H 2OMXB 2B9AA 3FMGL 3GI9H 3LAFA 4OIIH 4F2MA 2HS8A 2VZ3A 2R94A 4IFOA 4JAMB 1HZHL 7TIMA 2VXVL 1BYDA 1LRQA 4AEHL 5EFIB 2WO4A 4PMDA 3A67L 3K2GA 2PF8A 1QW9A 4AV5A 5EPMA 2EH8L 1R87A 1VBGA 3R5EA 4GLEA 1XGUA 2A1WL 1H9DA 2V9QA 2CG9X 2YPKB 5CGBA 4X60A 2EDDA 1KENL 1RHHA 1UURA 4OZ4B 4EDXB 4IOIB 3MBDA 1RFDL 2XH0A 1J18A 1JAEA 3TR2A 1BQHA 1X1OA 4P2RD 4IMCA 1ZCOA 4DZHA 4HH8A 3S7GA 1EWEA 3O4LB 4Y4KA 5G5IA 4AQ1C 1HZHH 1I1FB 2FL5B 3EBAA 2R59A 3WY1A 1EPXA 1V7YA 5EGRA 3UZEC 4WGKA 4HIHB 4HVXA 4XP1L 1CFMA 2DQHL 3IGAA 2DWEB 3GJFK 3O6KL 3N2XA 4JFEE 4W88A 4HNOA 3VIMA 2GSGA 1E42A 5B7MA 1O5QA 3E1F1 5CN3A 4JG9A 4MJHA 2JI1A 1XEDA 4KK9C 4LSSL 1S8DB 4M5ZH 3DSNA 1EAOA 5ALBH 4OJEH 3V4PA 3WEOA 3GNDA 1BHGA 3QOKA 4ELKB 3LRSB 5SV4A 3CAFA 3W76A 5D2WA 1IM3D 2FH6A 3CU7A 3O3DA 1UC4A 4MBRA 2XWXA 3ZL4H 2MCG1 1FWDC 4XAYA 4G7VH 1XC6A 5JQ6L 3SE4A 2J6EA 3AU1A 4XH2A 4MCYA 5FYKH 4U0QB 2ACRA 1GYAA 4K3GA 1XH1A 1LDPL 2YXVA 1JCXA 2WW5A 3KUMA 3KZ8A 1E9ZB 4AZ6A 2E56A 3GH5A 5T3XD 4BQ6A 4MKSA 4BS0A 5C1MB 3FHQA 5FECB 5I75C 4NERA 3RBSA 2OMUA 2Y1AA 7FABL 4BJLA 2OI9B 1ESOA 3SDAA 1ITXA 3O2DL 4YHMH 5CSZB 2YUWA 3GSMA 5E9AA 1MNSA 4KJYB 2H6RA 2H3KA 1KJ3L 3D2UD 3AVEA 1GT8A 5CC7A 2IMRA 3CHSA 2PU1A 2BP0B 1BQCA 1Y5WA 2WV8A 4J4PC 5C09D 2ERJB 3D46A 2Q86A 3CZ8A 3I4KA 4M4RB 3BXWA 1KLGA 2XIIA 3LDBC 1SEBA 2B77A 3RVUC 4YSTA 1OARL 5T8GA 5PTDA 1DVYA 1OAKL 2BNUA 2OZNA 4YDVB 2FFIA 3MCMA 4FB7A 4MJ6B 3SB3A 1YNPA 2AK1L 4KTYA 2QQLH 2CUMA 1BFNA 1JRCA 2ZDSA 3AJ7A 1ZVYA 1AAJA 4P0DA 1W56A 4RL3A 3G1RA 1WFMA 2H3DA 4PJGF 1YEKH 5TDPB 1KXQA 5IM51 5JA9A 3JZEA 3T6QC 4H00A 1X7QB 3QWNA 4OFPA 4ZTPH 4ZAKD 2CAKA 3NQFA 3PTQA 3IU4L 4MWAA 5BZZA 6ENLA 3BVUA 3OBAA 3QZWB 5HYSB 1G6CA 4KKRA 1EVTC 3SCMD 1FQ0A 3LQZA 3SY6A 1JPSH 4XXWC 3FXIC 3PJNA 1EEQA 5FF4A 3ULSA 4D0DA 3PQYA 3EO0A 5JIQA 3MOBH 3F7YB 3S37L 3MRBB 4NNXB 3WLWD 1EB3A 3T0TA 1Q9LA 1T83A 5T33H 4PRAB 5G2IA 3CFQA 1XLCA 5KVDL 2VC2L 4ZTPL 3UR2A 1KTLA 1EJXC 3MCYA 3FZUD 3W57A 3SIZA 3UJIL 3PZNA 4CMMA 1W15A 2YD6A 5EO1B 3N14A 2FECI 2DVTA 1U8KB 2F5AH 1A4AA 4FXKB 3F6LA 3M8OH 1GTNA 1IX2A 2NXYD 3GDMA 1HHGA 1RZ8B 1XX9C 1AH3A 4F8PA 2MQCA 2NT0A 4KVPA 1GOKA 2VDRH 3PP7A 4CADB 3JVFC 4JDVB 4C47A 1F74A 5G1TA 5ABFA 2ADFL 1AYRA 4PRDB 3PBWA 4MCZA 3DV6A 4R3SB 1MNUL 2JJSC 2NW2A