2YIHA

Structure of a paenibacillus polymyxa xyloglucanase from gh family 44 with xyloglucan
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
511
structure length
511
Chain Sequence
b'KTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDWQHSSDNYLCSNGGLTQAECEKPGAVVTSFHDQSLKLGTYSLVTLPMAGYVAADGNGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVKGYALDNEPALWSHTHPRIHPEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYKDLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETKKARMQAPRTLWDPTYKEDSWIAQWFSEFLPILPRLKQSVDKYYPGTKLAMTSYSYGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGDTSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGFDKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CEL44C
publication title Structure and Activity of Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 178
structure length 511
sequence length 511
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12891 Glyco_hydro_44 Glycoside hydrolase family 44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2yihA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yihA02
4ML4A 1VENA 2F18A 1A3HA 4NRRA 3I3DA 3H53A 1C3FA 2E9LA 3SCQA 3A4WA 3MMUA 3BC9A 2BHYA 1H4PA 3SIMA 4JCMA 3EDEA 3CZSA 1GPFA 4QDMA 3WMBA 2FGZA 2OWXA 4AD2A 3OLDA 3SCUA 1JNEA 4MNKA 1WDRA 2WXDM 1GQLA 4TVUA 1HVQA 4KGLA 3M7SA 1JF6A 5EB8A 1WP6A 1C7SA 3D50A 1VRXA 1XH0A 4QP0A 3VIPA 3VUPA 3TOPA 1AQ0A 1BYCA 4W5ZA 3S5ZA 1CZ1A 4XX6A 4EE9A 3CHEA 3OA5A 2CITA 4U2ZA 2G3MA 3GH5A 5HDRA 2CBIA 4YHEA 4H2CA 2WB5A 3L4WA 4NZCA 4V2XA 1NOUA 3N12A 4W86A 2VURA 5DO8A 1X6LA 2D1ZA 5CPSA 4CU8A 2GK1A 2WMJA 4BZYA 4ACZB 3WNLA 4AIOA 5ABEA 3WNOA 1JXJA 2F61A 2OW6A 2X05A 4MB1A 1UR2A 1BF2A 2XN1A 4M1RA 1KQYA 1NQ6A 3T2QA 1Q4NX 3ZQ9A 3VIGA 1B3XA 3ZSTA 4JIEA 4HOWA 4GQRA 1E5JA 2WSPA 3VX0A 5DMYA 1NM9A 3GH4A 5IHRA 1QVBA 3ZJ6A 2ZUTA 3GXNA 2VRJA 1OINA 1WNOA 3U7VA 2ZXAA 5A6LA 5GNXA 2BVDA 2J78A 1KBKA 4MJ2A 2J4GA 3VD4A 1OWQA 3DECA 1R7AA 4CVUA 1V08A 4HZ8A 3QOKA 1E1FA 4HOZA 2WHLA 4M82A 1GONA 4ATLA 1QNOA 1HL9A 1TA3B 4IPLA 1JZ3A 2FHBA 3EJSA 1NWUA 1H5VA 3VGFA 1B30A 3IANA 1U33A 3NDYA 4A3HA 3LXAA 4AZGA 1PX4A 4PBGA 3WH6A 3N15A 1CIUA 3EMCA 1D2KA 3BH4A 6CGTA 2ZX7A 1JFHA 1W9PA 5A6MA 4HMEA 3ZR5A 4WKFA 2V3GA 4W5UA 4OKDA 3AYRA 2J7GA 5D9MA 2YOCA 8CGTA 2ZXBA 2Y2WA 1W1VA 2J7CA 3VPLA 3AIRA 4RE2A 3ARTA 4AZCA 3KLLA 1KTCA 1J9YA 2WAGA 2J7EA 1H1NA 1CXLA 2VCAA 3GBEA 1GJWA 2VX6A 4P8UA 5E0FA 2J47A 3VIJA 1EQCA 3VGBA 2BY2A 2DT3A 4OBSA 1UG6A 2EPNA 1ODUA 2EJ1A 4S3JA 3NDZA 1EDGA 1J0HA 1CTNA 1H11A 5A8NA 4XZWA 4AEFA 3VIIA 5BXPA 3CC1A 3WMSA 1HL8A 2CETA 1A47A 1GVIA 2W62A 3EMZA 2JEPA 2OYLA 1UWRA 2DSKA 4X9YA 3I3BA 1L8NA 2PI6A 4CVWA 4B3KA 1W9XA 3TA9A 4HA1A 1ITCA 2EPOA 1R85A 1JL8A 1W3LA 3PHAA 5BCAA 4MNJA 1KFWA 3BUDA 1QNRA 1I1WA 4A4AA 1DWHM 1XSKA 3AIWA 4FMVA 5E1QA 3KL5A 2DIJA 3WDJA 2WVTA 3KZSA 1W3KA 1L0PA 2UY4A 5AYBA 2GJXA 3VSVA 5A3HA 3WUEA 3RM4A 3AXIA 3BVVA 2EAEA 5CXPA 1HJUA 4B15A 3RO8A 1MQPA 1BGAA 4LGXA 4JAWA 4PRWA 2XSBA 1UD8A 1QI4A 3GYCA 4UR9A 1DWJM 3RDKA 4PCTA 1TZ7A 3WUBA 2ZUVA 1P6WA 3RIKA 3VOCA 1E5NA 1BTCA 3DX2A 1E0VA 3WY2A 3WDRA 4DWSB 3BSHA 5FIPA 4J3WA 3N11A 3L4XA 4JCLA 1KWGA 1M04A 1V02A 3WY4A 4UQCA 2DT1A 2WCSA 2WNWA 3WH8A 1W3JA 5M03A 1MW2A 5FL1A 3FNDA 4M81A 3WQ5A 2BVTA 2D24A 3GNRA 3AHYA 2BXZA 1EH9A 4AIEA 3WL0A 3AIUA 3WQ4A 1O7DC 3VDAA 3AFBA 1GW1A 2YBTA 3II1A 1V3MA 2Y8VA 1E6XM 2X2YA 1VEOA 3CUJA 4UFMA 2EBNA 4GIAA 1EOKA 4M80A 1J0YA 3U5YA 3M46A 4NSBA 3LMYA 4CD4A 1GCYA 2EXOA 5CGTA 1H2JA 3CZEA 3ARYA 3EJPA 5BROA 3FHQA 3WD0A 1G9HA 2YDRA 4J7RA 4KRTA 2DGAA 1GHSA 3EDKA 1W1PA 3ALGA 1WZKA 1DWAM 2BFGA 2G3JA 3VIOA 3UCQA 2A3CA 1GOKA 1QW8A 2BNJA 3WDQA 1PX3A 3HZ3A 4XZBA 5I2UA 3ZIZA 1UA7A 2JEQA 1EHAA 2VZVA 2E8YA 4HA3A 1CDGA 1XHGA 5GNYA 1ZJAA 1V3LA 4FLSA 1JF5A 2VR4A 4CKQA 2XPKA 4PYSA 5FKYA 3WENA 2D0FA 3AQUA 1ESWA 1CXHA 4WLCA 4P7QA 3ZT6A 3T2PA 3K4AA 4OGZA 3VVGA 1H3GA 1OGBA 1JIBA 5JUVA 4WF7A 1EDTA 4FNPA 1VFOA 2WMGA 2XHYA 3BCDA 3MU7A 3CTTA 1UWSA 1QX1A 2XJ7A 2WANA 3LXBA 4FLRA 4IPNB 4PMXA 3DC0A 1UKSA 3LPFA 1JAEA 1UWIA 4KMQA 4D6CA 1EA9C 4TVDA 2DSVA 3PZNA 2O9OA 4S3KA 3CPUA 2GDUA 5DT5A 3FHAA 3EDDA 4WK9A 4AZIA 2PWHA 5ECUA 2G41A 2WZIA 4DM2A 1OBAA 3VSUA 4CD8A 4L4OA 1V0NA 2PWGA 4DM1A 3VILA 2FDMA 3AMGA 3TP4A 2ZWZA 4QAWA 1HJXA 1CGTA 1UH4A 1KGUA 1TFVA 5IXEA 1J0ZA 3WMCA 3MO4A 4CCCA 4P7LA 2JF7A 1EQPA 3MKKA 3D52A 2UY2A 2WK2A 2XSAA 3MV01 1R33A 3AYSA 1B0IA 3JUGA 2BY0A 2VO5A 2CBVA 1KR0A 2X2HA 1QHZA 1PIFA 2RGMA 2VQTA 3S6TA 1HJVA 2YL9A 4UZUA 1CGVA 1PEZA 5D9OA 5CZKA 4W8LA 5ABFB 3HJEA 1MW3A 1XSIA 2WHJA 1DTUA 2W63A 2V3FA 4JFSA 1Q6CA 1KWKA 2DT0A 1C90A 1HF6A 9CGTA 1MW0A 2F7PA 4FK9A 4IM4A 2X2IA 3CMJA 4WSJA 3GXPA 4BQ5A 3SCSA 4XB3A 1TR1A 1ZS2A 3HG5A 1VIWA 2CKSA 4UFKA 2WHMA 1HXJA 2YDQA 1OM0A 5JIPA 2C7FA 3E1F1 3ARZA 5LA1A 1TQWA 4MJ4A 1NH6A 2EEXA 4NRSA 4B3LA 4UTFA 2ZX9A 3BAKA 1OIMA 1UR0A 1ZBVA 4R27A 2WWDA 5E0CA 2Y24A 4GI8A 1BPLB 4HZ6A 2ZUWA 1KCKA 4QCEA 1CWYA 4AYGA 1IT0A 1XC6A 3H54A 1TG7A 3IK2A 1SMAA 1G01A 3WD3A 4ATWA 2NT0A 3SUWA 2W5FA 2WCAA 4PMVA 4AZ5A 1JZ6A 3VMNA 4GI6A 4JFWA 4AIUA 4HA4A 1TE1A 1E6ZA 4PMDA 4AZBA 4AZ6A 3O9NA 5ABGA 2A3AA 1J18A 2E40A 4FF5A 3BUIA 2WPGA 4Z2KA 1CGYA 1JGIA 1CGUA 3MV11 3AIQA 3BMWA 3TV8A 2J62A 3MSGA 4D1IA 3MUY1 5GPRA 4ZXOA 2YDSA 2OSWA 3MUIA 1BYAA 1LQ0A 3K46A 4P8XA 1R87A 1E15A 4HZ7A 5HXMA 3B9DA 3CZJA 4AZ7A 3NSMA 1TCMA 1W9BM 1K9EA 3CUIA 4PN2A 1GORA 1TVPA 3GBDA 3WF1A 1W1YA 1BAGA 2XVNA 1KXVA 1ISYA 2PBOA 1T0OA 3B9AA 4NI3A 5ABHA 1B3WA 1VEMA 1UD6A 1E72M 1XYFA 1ZBWA 2XWEA 3CGTA 4LX4A 4EKJA 2WVVA 3W26A 4GZIA 1S46A 1BQCA 2JALA 2YLLA 3KLKA 4TOQA 2XVLA 3DYPA 2FHCA 1TMQA 3UR7A 4JZ5A 4AMXA 2ZE0A 1HTYA 5A69A 2QPSA 3UR8A 3WBAA 1KXTA 3A22A 3OZOA 1LWHA 1SMDA 4LPCA 1KXQA 1R8LA 1JDDA 5JBEA 3N1AA 3N04A 4ACYA 1B9ZA 4PMRA 2F2HA 1SR0A 4AZHA 2EABA 4TX8A 3VNYA 2ZUNA 3OLGA 5A8OA 3D4ZA 2XYLA 2ZXDA 1UWTA 3OG2A 5GNZA 1OSEA 5HOSA 3S2CA 3KEHA 2WMKA 1TA3A 3RM9A 4D6IA 1QHOA 1PBGA 3K8LA 1RPKA 3MI6A 2EPLX 1J12A 3WN6A 4LXFA 3FN9A 3WF2A 4E8CA 1PIGA 2W4XA 1CEOA 5CGMA 3AHZA 4W89A 3CZLA 5BXSA 2JIEA 1JI1A 1ISZA 2D2OA 3VDBA 3ZT7A 1MVYA 2QF8A 1HWWA 3CZNA 2OWWA 1E6PA 1WDSA 4FNRA 2YLAA 2J7DA 3BAYA 3T08A 4GPNA 4HPGA 1CLXA 1B1YA 2WLZA 1CPUA 2HVMA 2X09A 3BAJA 4K68A 1WZMA 3ZMRA 3AI0A 2PBGA 1M03A 3BMVA 4IUGA 3VDCA 1C93A 2ZX6A 1H0IA 1PAMA 2J74A 3CUHA 5KZ6A 1V6UA 2Y4SA 2WMIA 3CH9A 2VUYA 2VMFA 1E4IA 4ZFMA 1ZB5A 1UD3A 1V03A 4AD4A 4MB3A 2OW7A 2WVUA 3CIVA 1E4LA 1DP0A 4CUCA 3A4XA 3DX0A 1OIFA 3EDFA 4E4PA 2CBJA 2CXGA 2ZUSA 1GVYA 1MQQA 4HMDA 2WSKA 3IJ9A 5BRPA 3AHXA 3L4VA 3WSUA 2D73A 7CGTA 1UWUA 4Q22A 3HU7A 2XUCA 4W88A 1GOOA 5E9AA 1UKOA 1WAWA 3VU2A 3EJQA 4KH2A 1UD2A 3W24A 5IDIA 7A3HA 1GQKA 4YHGA 3PZTA 4PSRA 2JFEX 2JF6A 3OGVA 3VD9A 1HKMA 3T0AA 1TQUA 5BWFA 1XGZA 4M56A 3K8MA 3PZOA 1CYGA 3BUBA 4Q7NA 4UFIA 1IZKA 2TAAA 1FH7A 2XGBA 4EK7A 1E4MM 4ATDA 3OLIA 2ZIDA 4A3YA 4AC1X 4CD6A 1WCGA 3BUPA 1LL4A 2J79A 3AIBA 2WYSA 1AMYA 3VKKA 1G5AA 1OB0A 4KGJA 3WFZA 1OD8A 4CD5A 2VL4A 1VFFA 1OT2A 3QOMA 3AXXA 2FYVA 2VZTA 2J7HA 3ARPA 1FH8A 2GFTA 3WQVA 3BGAA 4PTMA 1MFVA 1J01A 1GQIA 2VVSA 1UQYA 2DT2A 2XVPA 3WF4A 3WDIA 3ARSA 4UOZA 3MMWA 5E6ZA 4HMCA 2XVGA 3U5UA 4NF7A 3POCA 2DH2A 3CV5A 1VFMA 4BQ2A 3L4ZA 1C8QA 2CEQA 3GXFA 3M6DA 4AMWA 3H55A 3ZR6A 4WKHA 3LX9A 1UHVA 1HVXA 3ZJ8A 1V6VA 1QWNA 3AMKA 2F7OA 1WO2A 1RP9A 1QNPA 2VT0A 3PTQA 4BCEA 2XN2A 4CD7A 2WKLA 4U3CA 1LLOA 4P8WA 1W2PA 4AZCB 4PMZA 2FH6A 4WIWA 4UQAA 5I3DA 2VX5A 3D5HA 4CU7A 3FAWA 2VZSA 4HP5A 4GQQA 1B3YA 4H8UA 4PMOA 1JYVA 4GI9A 4JKKA 5IFPA 3LXCA 4W93A 3VO0A 4MB5A 1Q6GA 4UOJA 5A6AA 2ZX5A 5FL0A 2C8NA 1DHKA 2WMFA 3BVTA 4FNTA 4B9ZA 1XD0A 4GZEA 4J3SA 3WNPA 3W0KA 1PS3A 2VX4A 2ALWA 4E2OA 2WBKA 5BYWA 3ECQA 3N9KA 4TTUA 2QMKA 4TVCA 1GQJA 1HNYA 3DDFA 1QBBA 5CPTA 1ODZA 3A3HA 2GSJA 1E0XA 1VB9A 4MB4A 4HU0A 2WZHA 5A8QA 3K1DA 4AW7A 1GUVA 2WMHA 4JHZA 4YN5A 1NOFA 4JKLA 1XYZA 1MYRA 3BSGA 5A8PA 1JZ8A 4NXSA 4D6FA 4D6HA 3VSTA 1C7TA 5AC5A 2RGLA 4PSPA 4U33A 1PZ2A 2OYKA 4CN1A 1PPIA 5I6SA 2BV9A 4E8DA 4DUVA 4DWSD 3CHDA 2JE8A 3UESA 4FNUA 3S5YA 3GXDA 3WD1A 3WNKA 1ZL1A 4D1JA 3CO4A 4HOXA 2EO7A 2PWDA 1CXKA 4ZE4A 2VRQA 3SURA 5A95A 3NUKA 2GVYA 5ABFA 3GNOA 2BS9A 1HP4A 3ARVA 1HN1A 3CUFA 4B9YA 2E4TA 5A2BA 4U3AA 1OGSA 3AS0A 1JFXA 1UH3A 3WFLA 3VIFA 1UKPA 2YA1A 1ZBCA 4CCDA 3CZGA 2VJXA 1G94A 1M53A 3AS1A 4DO6A 1PX8A 2E0PA 2CERA 4JFTA 1HIZA 1US3A 3MUAA 1EXPA 1K6AA 2CKRA 4PMUA 1NP2A 4NZJA 3SUSA 2BXYA 2YFOA 2DSWA 3CLWA 5FCZA 4W87A 5E70A 1AVAA 1E40A 2J8FA 3PTKA 5M3WA 2JIWA 1FHDA 1DEDA 1R47A 5I77A 4JHOA 3M07A 3CUGA 4P7OA 5CG0A 3VGDA 3WNMA 5CSYA 4J3XA 2Z1SA 2EQDA 3A24A 3WQ8A 1B90A 1RH9A 3WH7A 1UR9A 3SCOA 1E9LA 3W27A 2DH3A 3LRMA 5FD0A 3KL3A 3VD7A 4PTVA 5I79A 3SCVA 2D3LA 4QLJA 3F5JA 3CBWA 3AOFA 1E43A 2A3HA 3FXYA 1HKIA 3WNNA 1N82A 4H8HA 4YPJA 1UZ4A 1JNDA 1V3HA 5D8ZA 4CN4A 2V5DA 4TXEA 3L2MA 1TVNA 1J10A 2A3BA 4M29A 3BAXA 3AIEA 1UQZA 1X6NA 1CXIA 1ISXA 3LPGA 3IJ8A 1CECA 1KXHA 2AAAA 1GZJA 5HPOA 2XWDA 3HG2A 1LL6A 3WEZA 2OSXA 4BA0A 3SCTA 1R75A 3O6AA 3THCA 1UWQA 2WC7A 4W7UA 4GO9A 3DHUA 4OJYA 4TTGA 2G3IA 3VX1A 1Z32X 2C0HA 4NXKA 3KL0A 2O9TA 2EACA 5EMYA 5LA0A 1V0LA 3A47A 5E6YA 1V0MA 3WL1A 3EJUA 2WCGA 5F7UA 3WUFA 1CXFA 4UZSA 1E6SM 4JFVA 3SUTA 1E70M 2WM0A 3VNZA 3WKZA 4MPKA 3AMLA 3TTQA 4BQ3A 1EOMA 2BHZA 2VVNA 1JD7A 2XFYA 1BYBA 4R5EA 1G1YA 5D9PA 3G6MA 1EDQA 3VIMA 2F7RA 3UG4A 2XVKA 4HU8A 1GHRA 4PUDA 3AJ7A 1I75A 2DEPA 5M17A 2VI0A 4W7WA 4C7GA 1O7AA 3THDA 1FFQA 1HJSA 1E55A 4B16A 4J3VA 1Q6FA 3BVUA 1YHTA 1UASA 3GXIA 1W9DM 1K9DA 2OSYA 2WC4A 3AZRA 1QNQA 1OGGA 1WKYA 1SYTA 2CIPA 4Z2HA 3HG4A 5AYIA 3EMQA 3POHA 3WY1A 5A8MA 3GZAA 2J7BA 1V6XA 2D22A 3PZQA 3WQWA 2OLHA 1V6WA 2XG9A 1BFNA 4X0VA 1XCWA 1HP5A 4BS0A 3NSXA 1J0IA 1CBGA 5A1AA 2UY3A 3MMDA 2VZUA 1FA2A 4Z2JA 1E71M 2W67A 6TAAA 8A3HA 2G3NA 2OWCA 3KWXA 4NZFA 1QI0A 1J0JA 1ZBKA 4CN6A 4MDPA 3AISA 4ACZA 2UY5A 2YIHA 3FW6A 3D51A 2B31A 2VCBA 1UD5A 1C8YA 2UWFA 1QW9A 3HG3A 1HKKA 2WWCA 2WZEA 3WH9A 1NOWA 1EHNA 2J77A 4U5IA 1C92A 1R7OA 1KB3A 3W53A 3UETA 1W32A 3GTNA 3A4AA 1UOKA 1CLVA 3SCWA 2J7FA 3BLPX 1BVZA 1AQMA 1QNSA 4FNSA 1W91A 3EJTA 4PMQA 3DX4A 1US2A 3J7HA 3GDBA 1QI2A 5A2AA 2V5CA 2J8GA 3BXWA 3LPPA 1V3JA 4MADA 4AWEA 1V6YA 3U57A 2VQUA 2BVYA 3CZ8A 1JAKA 1W1TA 3KE0A 1V3IA 2YFNA 1TQSA 1MW1A 3B9EA 5HNNA 1R46A 3UEQA 3VGHA 1BSIA 1BGGA 3OGSA 2XN0A 3ARRA 5D8WA 1OD0A 1E6RA 2WC3A 2W91A 2A3EA 4UQEA 5DF0A 2YKKA 3ARQA 3F5KA 4MTVA 1JZ5A 1MQRA 3T0DA 2WVVB 4FLQA 2YL8A 5EBAA 2PC8A 2F1BA 4BQ4A 1QI5A 4PEEA 1QBAA 3LPOA 1JDCA 1BLIA 5DEZA 1OT1A 4Y7EA 3WELA 2Y8KA 3AXHA 2ESCA 4RE3A 3RJYA 3W82A 2DIEA 3VMPA 1JDAA 2NSXA 2BY1A 4UFLA 5A6BD 3MS8A 3AIVA 3IAPA 3OIHA 3D4YA 1B3ZA 4MAZA 4OBRA 2VOTA 4QCFA 4JL2A 4UQ9A 3ZO9A 3L4TA 4UQBA 1QPKA 2PWEA 3G6LA 3WIJA 1HJWA 4F9DA 4AXNA 2D0HA 2QMJA 2YBUA 4J28A 1V0KA 3GNPA 4F79A 3F4VA 4N42A 4AYSA 3QGVA 2X2JA 4QLKA 3PBGA 2X8RA 1LJYA 3DYOA 1JYNA 5JIWA 3RILA 3RMEA 1ISWA 1UYQA 3W25A 4CCEA 4U5KA 4L4PA 3N17A 1X1NA 2XIBA 1SZNA 1PJ9A 2V38A 1WPCA 2E9BA 2IUZA 4QFUA 3ZM8A 4C7DA 4D72A 4H8VA 3EYPA 1VF8A 4HPHA 1H49A 3I3EA 1E4NA 4OIFA 2VC9A 2GK1B 3IJ7A 3A5VA 4OUEA 3RCNA 4P8VA 2NW0A 3W37A 1DWIM 5A6KA 1XRVA 3ARWA 1H0GA 1UD4A 3ZOAA 5LA2A 4LYQA 4DWSA 5C70A 5CJ5A 4UNIA 3AMCA 5LYRA 3PZUA 4W84A 3DHPA 1JYXA 3ZJKA 4DO5A 1U2YA 1E3XA 3T0BA 1QI3A 1KBBA 1E1EA 2WMIB 4PMNA 1XV8A 4W8BA 4LYRA 4ZEPA 4BF7A 1ECEA 3N13A 3D3AA 3VGEA 1UKQA 2VCCA 2CNCA 2XGIA 3TTYA 1W9VA 1YQ2A 3IGUA 5CLTA 4N0RA 3SCRA 3WD2A 2VNCA 1R86A 1O6IA 3CHCA 1XD1A 3PZVA 1QWUA 2ZUUA 3QHMA 5CPQA 2AOSA 1GOQA 3PZGA 2WW5A 1SFSA 2GDVA 1LL7A 5M5DA 4URIA 1NARA 3N18A 2ZUMA 1ZU8A 1B2YA 2YA0A 1K9TA 1JXKA 2VX7A 2X1IA 3VINA 4OOZA 5HBFA 1JZ2A 2VZOA 1LG1A 4W85A 2CHNA 4PMYA 2O9RA 1E3ZA 3IAQA 2G8ZA 3MUZ1 3TONA 2FGLA 2D20A 3BUQA 5HPCA 3WBEA 1BG9A 1MWOA 1V02E 3W28A 1GOWA 4V28A 1Q6EA 5I5RA 1ZJBA 1FH9A 4PUEA 2NT1A 3WQ6A 2WVSA 3DX1A 4F8XA 2QV4A 2MANA 3DYMA 2VTFA 3TTSA 1K9FA 1D3CA 1TQVA 1C91A 4LQ1A 1VJZA 3T09A 3VMOA 4GZJA 4AEEA 3GXTA 5FOOA 3T2OA 5GQBA 5AC4A 4X0NA 5KEZA 1UH2A 3WY3A 3CHFA 3WF0A 1EIBA 1TQTA 4ZENA 3K8KA 3HN3A 3WF3A 3QHOA 2O9PA 2VR5A 3L2LA 3WD4A 4AMCA 1JZ4A 1IZJA 4AD5A 1CNVA 3NSNA 1GJUA 1KQZA 4MAVA 1KR1A 1XSJA 1PZ3A 1W9UA 4QLLA 3EBVA 3O2LA 2EPMX 3B8SA 4ZXLA 3OZPA 3AS3A 5D9NA 1QHPA 3WEMA 2CHOA 1LG2A 3SUVA 3W4RA 1G0CA 2OYMA 1XH2A 2GJXB 2V3DA 1DWFM 2ZWYA 3BCFA 1H09A 5BXTA 4W7VA 2EPKX 3ZSSA 4J3TA 2DSUA 1RD6A 2O92A 3W29A 2BY3A 3UERA 4XV0A 1UR4A 2AMGA 1JG9A 5DFAA 3VD3A 1HT6A 3ZJ7A 4GINA 4MNMA 1IV8A 2WKGA 3ARXA 1VEPA 2QHAA 1WDPA 4GKLA 4DUXA 2YA2A 1B31A 5E09A 1UA3A 2J25A 3AZTA 1AQHA 1ITXA 5BXRA 4AD1A 2XTKA 4J3UA 1EGZA 4C7FA 2D0GA 3AHTA 4PCSA 5I23A 2CYGA 4OOUA 4D6JA 3A6OA 4D71A 5EFFA 4GXPA 4MNLA 2QLYA 4CU6A 4LYPA 1CXEA 2HISA 2F1AA 4DO4A 2G4FA 1KGWA 2XM1A 4TUFA 1RP8A 1QOXA 2VRKA 4WKAA 4M8UA 4PTWA 2W66A 4FNQA 4H41A 1R34A 2CESA 1WE5A 3EDJA 4UCFA 1MXDA 5I24A 3SUUA 2X0YA 4XUYA 7TAAA 3CZKA 4Z2GA 4AY1A 4KWUA 2W61A 2ZOXA 2ZXQA 3VIHA 2D3NA 2XIIA 1D7FA 1BG4A 4F66A 3U7BA 3DDGA 4HTYA 2XFRA 1FOBA 3VD5A 2QPUA 4MDOA 3UG5A 2PWFA 3WDHA 1CGWA 1H41A 1F4HA 4EAMA 3FY1A 3MANA 2IXVA 1HX0A 3APGA 3BVXA 1E56A 1XCXA 3PZ9A 2GJRA 2Z1KA 1V3KA 1UR8A 1VBUA 3UG3A 4UQDA 3RJXA 1KCLA 4J27A 3W6LA 3NJ3A 4UFHA 3BLBA 5C8BB 4FLOA 3NIYA 1M7XA 4GO8A 5DT7A 2F7QA 3PZMA 1C8XA 2FE0A 4H04A 4IISA 4D6GA 1F4AA 2DPEA 2F8QA 3RPMA 5IHSA 3BLKA 3GXMA 1JYWA 3RM8A 2FHFA 3FAXA 4JL1A 4F9JA 3W38A 4RL3A 2CPUA 2E9MA 3WEOA 2WHKA 3PZIA 3AZSA 3LRLA 1U30A 1FFRA 2PF0A 4UOQA 5A94A 1LF1A 3L4YA 3TTOA 5CSUA 1Q6DA 1WB0A 1VJSA 5D4YA 3VM5A 1E73M 1Y7VA 3A21A 2E3ZA 3VIKA 3OBAA 4UFJA 4OZOA 2ZX8A 4WJXA 1UUQA 5TD4A 1UKTA 5IFTA 4V27A 3ZT5A 1UZ1A 1E0WA 1BYDA 3BAWA 4H7VA 3VGGA 4P7NA 3SEPA 1BHGA 1W2VA 1NWRA 4AISA 4W8AA 3BAIA 1DWGM 2CBUA 3VDHA 2EADA 2GUYA 2FH8A 5AY7A 5JBFA 2WLYA 3NYDA 3VM7A 4CGTA 5A2CA 4P7RA 1WZAA 1MXGA 3PN8A 2PB1A 4JKMA 2WBGA 1GOIA 2E8ZA 2ZICA 3W81A 1NWTA 5CLWA 3OLEA 4U2YA 3SCPA 2XM2A 3ALFA 3A23A 1VBRA 3AS2A 5CQ1A 3AROA 5A6JA 3EJRA 1EO7A 3NCOA 1MFUA 3QHNA 4TX6A 2IXUA 1NWSA 4PTXA 3W6MA 3PTMA 2YL6A 1E6QM 2CCRA 1VFUA 2BHUA 5A6BA 3MSDA 1JI2A 2Y5EA 4NX0A 2X0HA 5C71A 2IGTA 5BRQA 1M01A 3OGRA 4Z2LA 3GH7A 1FP8A 1LWJA 4JFUA 4AD0A 2DQXA 3WH5A 1WZLA 1FP9A 1J11A 5EFDA 4DUWA 3GM8A 4D6DA 6A3HA 2GJPA 1ISVA 1J0KA 1JD9A 5I0DA 4U31A 1KTBA 1BVNP 4Z2IA 1CENA 3F5LA 4ZE5A 2YJQA 1GNXA 1UR1A 2DDXA 2W92A 4DWSC 1XH1A 1EO5A 3AMDA 3AHVA 1OCQA 3BVWA 2YL5A 4D6EA 5I78A 1VAHA 1CGXA 3CMGA 1GOMA 2XFFA 5JBDA 2DSZA 3SCNA 3DX3A 3OB8A 2D23A 1KGXA 1I1XA 4RE4A 4KRUA 2V3EA 4M24A 1JZ7A 1W3HA 4EANA 3HMCA 4WSKA 1HKJA 3QR3A 3WDPP 3VTRA 1FHLA 4AD3A 2Q8XA 5A6SA 1B3VA 1TUXA 1WDQA 3ARUA 1HJQA 2J75A 3AICA 3WUGA 1NP0A 3K4DA 1E6NA 3LRKA 1HXKA 3L4UA
chains in the Genus database with same CATH superfamily
5FYKL 5HMSA 5FOBA 5E00A 5J6SA 2OB3A 2AQWA 5L88H 3ASNB 5C0RH 5HY9B 1K3ZA 4JPVL 1EAPB 3VU1A 4A22A 4TVUA 4K5NA 3UZYA 4Z7OF 2DIKA 5LAXB 1SJAA 4GXVH 2XSXA 3S5ZA 4W5ZA 1CT8B 3L3KB 3D06A 3VFNA 1W8EA 4BEUA 3KPSA 2W9DL 5HUOA 4HBCL 1X6LA 3V4VA 3EYFB 4JFOA 4KCWA 1NLDL 1UR2A 2VUKA 5TFSL 1AJ2A 5DHYA 2E7BA 2HRGA 3ZSTA 2QKFA 4JHMA 3QG6A 1EFXD 1CK0H 5EZIH 2J78A 5DMMA 3MCKB 1V08A 1YMME 2PR9A 3ZZQA 1U1JA 4R26L 4EF3A 3ZLGA 5INDB 4L5ZA 4LOVA 4PJ5D 3OKOB 5SWSB 3TH4T 4PJAB 3SJVE 4HMEA 4AM0A 1JUFB 4HSOA 1J1OL 4C56A 5D9MA 3BN9D 4L65A 2ADFL 1S4IA 4GS7B 1TG8A 3LH2H 4IRJD 1WSST 3WUWG 5H4ZA 2J7EA 3GBEA 1MPAL 4P8UA 2YMTA 3VIJA 3S4TA 4OBSA 2DT3A 2CDFB 2I25N 5M94B 4RZCA 2GPTA 4TQEH 4IFKA 1MNUL 3EMZA 5FAAA 3EWCA 2XQBL 1JWSB 1PCKA 3O3AB 3N9SA 5I6MA 3UWZA 5DC9B 1J9CT 2BX7A 3UXAA 4M43H 3OXSA 5JXED 3AIWA 3KL5A 3WIIL 4Y4HB 4PLNC 4GXUM 2OCZA 5CJ8A 3BOXA 5AWNL 1AG0A 3NQCA 3QPYA 4G7EA 3PV6A 4ZMLA 3FQWA 4CA4A 1YPZA 5AVSB 2VEKA 4X5XA 4ZQRA 2YQBA 3R8BB 4H9VA 4FQLH 5FIPA 4RV3A 1T89A 3KXFA 3MRCB 3FFCA 1YDPB 3WL9A 2E9GA 1M04A 5DJ2B 1MRDL 3G6AB 1JNHB 2QGEA 3WH8A 3FNDA 1A4CA 2BVTA 4QHUA 4I48A 1AOZA 1UZGA 3ZK0A 1TDQA 5SV3A 2VMCA 5C7ZA 2EPHA 3VXUE 1SLVA 4Q9QL 1IU1A 2VDQH 1WBHA 5H4YA 1T40A 1UJQA 1I1YA 3ZS4A 7ENLA 5EU4B 3EF7A 2DI8A 1KTDA 2A2QT 3GRWH 3F7LA 1J8VA 4F7CA 4OGYL 4TUOB 2A3CA 2BNJA 4V2CB 3KLAB 3WDQA 5EEXA 5C09D 1EXBA 4YU1A 2E8YA 4HJGA 3WFBL 1FZMB 2EG6A 2D0FA 4P2OD 3D12B 3FUFA 4YBLC 1H3GA 1MWAB 3MV8E 4PI2A 4WF7A 3UYOD 2ODHA 1O94A 4HPOH 4I1PA 1S7RA 2XJ7A 3CFKB 1R3SA 3ZKNC 5CLZA 1A5UA 3RGVB 1NIUA 2FTPA 2L7EA 2O9OA 1E4HA 4R85A 4Y19D 1GMEA 1M57B 2HS8A 5IJKC 4Y1TA 1DJIA 5I15H 2P1FA 2HFFA 4PRNA 1ESOA 4PRIE 5G2NA 3TP4A 4L9DA 4N2CA 1YCSA 3ELQA 2UBPC 2VHLA 4DK5A 2R27A 3SBFA 3LQGA 3CG8A 3R58A 1WXJA 4L3AA 2IQDA 3L23A 5JW4M 2ICWI 3JUGA 2FTYA 1PTGA 4HIJA 4ZFOA 1IHIA 4JVPA 3S6TA 4NQDD 3MPGA 3PIQB 4PU2A 5FYKH 2A9NL 5HI3D 5K9QI 5FSEC 1NCUA 3HFYA 4ZW3A 4JPVH 4WKZA 9CGTA 2DWDA 4BQ5A 4LW7A 3HG5A 1VIWA 3BDYL 3ZDZF 1HJBC 3IFOA 1UIPA 1PY4A 2W9DH 3NDOA 2PW1B 3UCDA 4HBCH 3NJJA 4IBSA 5AW0B 5T3XD 5E0CA 1K8IB 3JSSA 5FHAL 5TH2A 2Y0SA 1NLDH 4YXLL 1PYFA 2OMXA 1B6DA 3VABA 2JTDA 1NSJA 5TFSH 4JTQA 2HVOA 4MJ6A 3WQGA 4MMYA 1I2QA 4FMFA 1K7XA 1AZ2A 1TG7A 4NZ1A 1R2RA 3O8AA 3PC0A 5DSCA 4OZIB 3PP7A 2WCAA 4PUNA 1VC4A 2VE6B 3IMVA 3BUIA 4EVZA 4I0PA 2WPGA 3L9RA 4L8SA 3TX9A 2KKQA 4R26H 4EP8C 4BGDA 2OSWA 4FEZA 1HQ4A 4PRHD 1J1OH 3QEQB 4Z7VF 5L2KE 4G7QB 3N34A 2ADFH 3GFUA 1DBBL 4G8IA 4WZ9A 3RQ3A 2A6KB 4C91A 4NI3A 5ABHA 4X80H 1QQDA 1MPAH 5EPMA 4AAJA 4B9CA 5CSZB 4X4YA 1BQCA 1IC0A 2ITDB 3C2SA 1PW3A 3P61A 5DD3L 2PP0A 2Y22A 1MNUH 4LVHC 3UR7A 4UBDD 3VJ6A 5EC2A 3UR8A 1KXTA 2XQBH 1T83C 1BYOA 5C9JB 1G9NL 5HJ3B 3C75A 2FJGB 3VNYA 5D2XA 3TA4D 4XCCL 2YRPA 5C0IA 3UWWA 3WIIH 2ZA3A 3IDYC 2VLRE 2QCFA 4NAEB 4EDWL 3UZXA 1QHOA 5AWNH 3K8LA 3MJ7A 3MP3A 1JE6A 4W89A 3K72A 3ZT7A 2RH9A 1DQWA 4P57A 3H8NA 3DUGA 3TQKA 3O06A 1WZMA 3ZMRA 5J57B 2AXHA 4P3DA 1MRDH 1KV7A 1P4LA 1M1SA 2C9VA 4YSTA 1AH0A 4X98B 4KWOA 3RFZB 3TXZA 2BP5M 4RISL 1CLCA 1F0LA 2MCAA 4BFIB 4IOTA 3WG6A 5GRJL 3ABRA 3A4XA 3VXNB 4HMDA 4Q9QH 4NQQA 3B5GA 3NDYE 2A4AA 2HK1A 2XUCA 4W88A 1UKOA 1VCBC 2JKTM 1F11A 4WI7A 1UB5B 1S2VA 4JFDD 1GQKA 4GKSA 4OGYH 1INEL 2KC0A 4Y9FA 3BICA 2DMHA 2HBXA 2NQ3A 4PLJC 1FH7A 4RNIA 5DRWB 1HZLA 2H3KA 1O9VA 4A3YA 5JVLA 3ULUD 1RVFL 3WFBH 2WYSA 1V79A 3EWBX 1U3HB 3VZYA 4HC1A 5JW5B 1J5CA 2WV3A 4U1JB 3GDMA 1BZ7B 3L21A 1JTTA 4KROC 3DPDA 3QOMA 3AXXA 3MHZA 3O6FC 4IBTA 1AQDB 4O2CA 3CFUA 3PP3K 3RLSA 2GFTA 4JQ2A 3ZBMA 1BLNA 3WD5L 1AG1O 2VDMB 2NOYA 2F6KA 3C12A 5J89A 2FZ3A 3BL3A 3QC5X 3MHUA 4JJ5A 4YSAA 2NQDA 3ZYIA 4NRXB 5CEZH 3HGSA 1YY8B 1JPGA 3POCA 3MXWL 4GT0A 3L4ZA 3TC9A 1D7BA 3AG1B 4WJEA 4H7CA 2C3HA 2GJZB 2KH2B 2A9ML 3ZJ8A 2OEKA 1JF1A 2R6OA 1II4E 3WIFA 1UJPA 1YEDA 1SDYA 1Q85A 1J87A 3NGJA 4G9FE 3NMEA 4PZVA 2V5MA 4WIWA 1AP2A 3FBKA 1QAWA 5KAQG 3T6WA 1DR9A 2A9NH 1PMYA 5CC5A 3F3HA 5CEYA 5CLXA 4JKKA 1KCWA 5H37A 1N9PA 3BT0A 3U9UB 1PDKA 1CDJA 4E3TA 4OJFL 5J4MA 4X5WB 4FNTA 2XJLA 1XD0A 2PN5A 2OZ3A 1JRHI 1NBZB 3TN0B 4DNHA 3BDYH 1OP5H 4IL0A 3QZWG 4L80A 1NANH 4NYUA 2P24A 4LGPB 4ODVL 4AW7A 1YMMD 1WBJA 4JKLA 5FHAH 4K3ZA 4YXLH 5D1XC 3OG6B 3VXRB 3SR7A 3T4AB 4D6HA 4M6QA 1OFEA 3HQOA 3SJVD 1P5BA 1ZPLA 2XLLA 1QFEA 4XO7A 2VMEA 3OOQA 1K5WA 4O02A 5IROA 4G1KA 3UDWA 4ZFQA 1IR2A 1WUEA 2ASHA 3WAKA 2JJTA 2DYPB 4M8RA 4HG4J 1HP4A 2QULA 3FCPA 5EIIB 3OP2A 3WFLA 2W0KA 4PBWD 3KVDD 4LEQA 1DBBH 4Z23A 1HIZA 3QULA 1R3IL 2D7QA 3OPSA 4BH7B 3PTKA 4ZMXA 3G04B 3S1WA 2BNQD 5DD3H 4LJ3A 4J3XA 2Z1SA 4OLVL 3A24A 3BSZA 3WH7A 4K7PY 2GY7B 1G9NH 4KKBD 5I79A 5KYNA 4QLJA 5IM7A 4TMBA 2O5YL 1AAJA 2N1KA 4U6TA 4XCCH 4TTDC 2J8OA 1YA5A 3IGFA 5D8ZA 4EDWH 3SDXA 4NKDB 1J10A 5EU5A 5IB4A 1X8FA 2WXKA 3MLSL 5DJXA 4K73A 5F3FA 3W56A 1H7OA 1FKXA 4INFA 2XDFA 4HCGA 2X7WA 1KPRB 4WDWA 4MSWA 1GVRA 1W5PA 1WQVT 2YLKA 3KTCA 5KITA 4BFJA 1TRIA 1V0LA 3FFDB 4WO4B 2WXNA 4XXWA 1E6SM 1EJFA 2A85A 1NOLA 1AZVA 2Y88A 1YADA 1AGFA 1UWYA 4RISH 1KFEA 3O8XA 5GRJH 3TAOA 4PP1C 4YHPB 2EECA 4XTRC 5D5ME 4XO5A 1S8DB 1FZJB 3QQ4A 3FUNA 1U8KB 5C08B 2KPNA 4DN1A 3MV8D 5DHXB 3ZMEA 1INEH 4P4KB 1WV2A 2NY0D 5FJIA 3GZAA 3VACA 3WQWA 4KUZL 5BVJB 1KJMA 3HE6C 4EVNB 4QT5A 2VB5A 1F3EA 1RVFH 3P02A 4KZ0A 3OB0H 1RA0A 2G3NA 4LCRA 3CVCA 4PRID 3KZ8A 4KV5F 4E36A 4DPAX 4EBQL 1C8YA 3WD5H 3QUML 4L2YA 5E6UB 2E7HA 3CHQA 4DX3A 2QVMA 3MXWH 2BCKA 4YDLB 5B39G 3QR2A 3W2MA 3V4PL 2AXFA 1TJRA 2Z24A 2QSCL 5AB1A 1ZLUH 1OL0A 2F8IA 4JY6A 4GIEA 3UBXI 3BQ5A 4OFVA 2W5PA 4E4FA 3LTPA 1E42A 2GSMB 2L7QA 1TV7A 1S5TA 2LTQC 2FWOA 2Y36L 1YBQB 3GG7A 3GR7A 1IC1A 1EZUA 4OJFH 2C1OB 4ZMVA 2A74C 4Y2DA 4X4ME 3MS8A 5JXAL 4MAZA 1R5YA 2VOTA 5AHLA 4CSZA 4LLMA 3W7HA 1V7NL 5EBWA 1HL5A 4ODVH 4F79A 1BYPA 8PAZA 1SSDA 4B3ZA 3GDKA 3EOBA 5EB9A 5JIWA 5KBKA 2QDVA 4KY1L 1RIHL 1ISWA 2QNEA 2PF8A 3R89A 1FWNA 1WWWX 5AYYA 5ADOL 3M41A 2E46A 2NUTB 5EOCJ 2LAGB 3P11L 3COTA 4N8UA 4U49A 5JHMA 2FLRT 3L5WA 5L2KD 4HNVA 2ONEA 4C47A 1Q9WB 4GZ7A 3TSMA 1AC0A 3HR5B 4JDZA 4R4NC 5LYRA 3JV5A 4N0CC 1ECEA 4Q7BA 3D3AA 3FU5A 3HTLX 3PBVA 1FZKB 2OT1A 2RALA 5BZXA 3DSNB 5K9KB 1T80A 1WFJA 4IGBC 4HWBA 1R3IH 3EYQD 2GDVA 1T5XA 4K5LA 4URIA 5EF0A 1N8ZA 3IXTA 5IJBC 1T4KB 3EWZA 4FGMA 4EIUA 3QCVL 3B4YA 1LL1A 2VLRD 3DUUA 2GC4C 4WR3A 1RZFL 4OLVH 3ASWA 1SHWA 4LCWB 4K8RD 1L9WA 3DX1A 3UYRH 1A3LL 2BSEA 4AE1A 2P3YA 4WW2A 3BP7A 4OTXL 4JS3A 1CO1A 4RGNE 4UM9B 2O5YH 3AWGA 5C2XA 3NIDF 3GMRB 3GXTA 1KFAL 2XVBA 2Y6TE 5M2FX 3MLSH 2IGLA 1GTEA 2B14A 1YTKA 5D7IE 3BP4B 3T65B 4FFWD 3C2YA 1MLCA 2UWEE 3TQPA 2CBQA 4G82A 3U0TB 4F58L 3QG7L 2FT8A 1WXYA 2PPCA 3FN3A 3W5NA 3FUMA 2H47C 3X3FL 1OHZA 5BMFL 3EGXB 4WJKB 3BEVA 3DDMA 2P28B 4ZX5A 1XF0A 3OR7A 3AT0A 3OKKB 4ZUTA 3VWKD 1Q9OB 4JMXA 3DPBA 4WU7A 1RPUA 2EYTB 2PYEB 4F9LA 4M8UA 4A3QA 4KUZH 4FB7A 3N6YA 2OJZL 5HHPB 2PLMA 4KJWD 4YDMA 2QVIA 1N7ML 1G7VA 3KBMA 5F72S 3FY1A 5PCYA 5SX4H 4B41A 1E56A 2J5WA 2FBOJ 4XN2A 1XLGA 3ET9F 2GJRA 9XIMA 5D96C 5I66B 4DYJA 3UG3A 3NCYS 4FTVA 4EBQH 3K7UA 3QUMH 4G6ML 4LSPL 2X4TA 1A6TA 1YC8A 1CX9A 4PJEA 4FYRA 5DT7A 2FE0A 3EZJB 3MUGA 3PWPB 3GO2A 3CU2A 4B2DD 1JVLA 1RI8A 3DG3A 1UT1A 1CLYL 3S37X 4LT9A 4UOQA 1XO8A 4GLEA 5I0ZA 3V4PH 1NGZB 4AH2B 2C7UB 5HGAA 2YUWA 3N2MA 4WV1C 4P5KA 4UFJA 4XWUA 2QSCH 3PGCA 4I8YA 1CN4A 2X6MA 1NMAL 3B83A 4L8DB 2ICES 1MFAL 1NCWL 1O0VA 2Y36H 4XAPA 3RNDA 4X2PA 2ATPB 2WTPA 3S5OA 3CCHA 1NLBL 3AROA 5JXAH 4XBMA 4FS0A 1FUNA 1BXNA 1VCVA 1U91A 1V7NH 2E5BA 1HHIB 3KCPB 4U7KA 5T1LA 1M71B 3FBQA 3GS6A 1HL4A 4KY1H 2J1WA 1RIHH 1MVUA 1U8IA 3AQYA 2Q5BA 1WVZA 1GNXA 3P11H 2IWKA 1DBTA 5F3BB 5FYJU 4GI4A 2GK0A 5FFLA 2R82A 1F1GA 3DX3A 3K6IA 1ED3B 4QRSA 3ZMNA 4PJGB 1BKSA 1EBAA 4Q8BA 2DVUA 3NJLA 3GWQA 4XO9A 2JKSA 3KWUA 3CB8A 1NFPA 2H0FA 1AK5A 2EC9U 1KYOJ 2OMNA 1ZANL 3TOYA 3U6XS 4G43A 4ZYKB 1JK9B 4KXAA 2AKRB 2QCGA 2G2NA 4DEPC 4HPNA 1L6YA 3SIMA 1GPFA 2XICA 5L4MA 3QCVH 5IMLB 4PS7A 1JF6A 4XZ9A 2DQFA 1QNVA 3PL6C 2WNQA 3VIPA 3SPJA 4WKXA 1RZFH 3NQGA 2VXQA 3R94A 3LKSA 1A3LH 4KNTA 3L4WA 3MVSA 3E2SA 2R39A 3KPRB 3V6OC 1E90A 5IRPA 4OTXH 4GOSA 4LRIA 3IJEB 5C0CE 5AL8A 3U79A 1O5KA 5DMGC 3AREA 2XN1A 5F0PB 1F18A 2WZTA 1KFAH 4HF5L 4Y16B 1AQKL 4NQCA 4F80A 5DMYA 3BDBA 4QHNA 1XXFC 2ZXAA 3NQKA 3EPMA 1G67A 1DVXA 1G0YR 3FYEB 3I6GB 3IJSB 4LAMA 5DRIA 2EYSB 4ATLA 5CD3B 2X0VA 3AXKA 3IDXL 3QG7H 4PBGA 2Z4TA 4XN9A 5FKAA 4YAQB 3RIAF 2PETA 3BWWA 2V3GA 1VGAA 2RDWA 4K2UL 5LIWX 3X3FH 3CFDB 1CFTA 5BMFH 4RDVA 4PCKA 4AZCA 2BVOA 2BIPA 1YIXA 4YDVB 5I3FA 4YTSA 4GYJA 2X1WL 2BY2A 4JFFE 4NRYA 5DJ0A 3PBUA 3O2DL 3DN5A 4K9EH 3VAEA 2QQQA 1KJ2A 3TESA 1PYWA 2Z34A 2OJZH 1EEXA 3SGGA 3MYPA 4FZIA 2YN3A 4WO4C 3L5JA 4J1UB 3W1NA 3CE1A 1N7MH 1XR9A 3PHAA 4A4AA 2HCZX 1G87A 4NJAL 2WVTA 2X9WA 1KIQA 3LDVA 3PQYB 3WLBA 3QYCA 4XBSA 1RHHA 2EAEA 1HJUA 1FC1A 3RO8A 4BHUI 4G6MH 4LSPH 1UD8A 2DJUA 1F2XK 4UR9A 1TZ7A 1F1DA 5E4IA 2HG0A 2FYYA 4L0YA 3W39B 3L4XA 2P5EE 1HCZA 5SWQB 2XFXA 1V02A 4PMFA 1CLYH 3QQDB 5LNDA 2BXZA 1FG2B 4P4KC 3RTQA 2VISB 3AIUA 1OHQA 1PFCA 1GHFL 1ETB1 2QR6A 4NT6B 4PB0L 4J5VA 1MFAH 2NQJA 4K55A 1EF3A 3ARYA 4DP5X 1NCWH 3UYPB 4FXKB 1ETZB 5AB0A 1DJXA 4XBPB 5FGCB 2DGAA 3EDKA 2Z29A 4HUUA 1H3XA 1SY6A 2P47B 1NLBH 5IVXB 1HHGB 4GRWB 4XD5A 1NAMB 3EWYA 2IKHA 3ISIX 2VR4A 1F6AA 2GUUA 4C6DA 1G9ML 1CS6A 4IP4A 2H90A 2IOOA 1WRFA 1S9VB 4H0LC 3I74A 4KKQA 4FLRA 2C1GA 3ATDA 2FIKA 5HJGA 2O6CA 1RZMA 5FA5A 4K38A 1IEAA 1DDHB 4JRXB 1XGTA 2VUOA 4GYFA 4DPCX 3W2JA 4QAWA 1VLIA 3HVDA 4FQHA 3ZDYE 4HUVB 3WMCA 1CGSL 3PUOA 1HW6A 1M2OA 3GIVB 1R33A 3C09B 2P26A 1ZANH 2VO5A 1NSNL 3MJ8A 4OCYL 3ZJAA 2RGMA 3QMRA 3MP4A 5DEJA 4YO0A 3HJEA 3RRAA 1TPB1 4RGND 1FAKT 5AYZA 4LZKA 3O3EB 5T33L 3DXAA 2F7PA 2WQ8A 3ATFA 3DIFA 1T04A 3PUGA 1F05A 1QA9B 5E5MA 5E8PB 1HXJA 1S78D 1KB9K 4W9EC 3WQCA 2GVLA 5GGSA 1GVQA 2TYSA 1VCFA 1ET7A 4UTFA 4N1HB 4HS6B 5DC0A 3LNMA 2R1WA 3BUYA 2MSPA 4UTWA 1B4EA 2ZZ5A 4KJPD 4HF5H 3WNIA 4KPLA 5T26A 1L9TA 1AQKH 1W72A 5HDWA 5T3ZE 4PY8J 3DMMD 2Y5QA 3O11B 5C6TL 4HUNB 3M17A 5AHNA 3GSVB 5E1GA 4U1KB 4AWUA 4IJCA 2J55A 4UNVA 4GJIA 2YD9A 4MMXA 4R4FL 4CDGC 1CGUA 3IDXH 4V15A 1NOAA 4D1IA 2PDMA 3VCRA 2DL9A 1L7IL 1PKNA 2WZPD 1Z6KA 3MUIA 3PG2A 2R1YB 3KAAA 4K2UH 2R4SL 2X4RA 1XLAA 5CWSA 5DUJA 2YD2A 4J4PC 1ZLVK 2V5BA 3ILQD 3RNKB 3JV4B 2QCNA 4JX6A 1E72M 2FZ9A 1E4KC 3P2VA 1OAUL 4S1DC 4F7MA 2C9QA 5FO9B 3D5OF 4HGKC 2XVLA 3VFUB 1S38A 2JXMB 4PD4K 4K8GA 1QPXA 3O2DH 3NIGE 2UZPA 2JIXB 1G7IA 4R7WA 3BWAA 2ENYA 1Y18A 4JRYB 1CD1B 5GRZA 3F5WA 3D4ZA 2HG5A 4NJAH 4ICWA 1GTNA 4Z78B 1N0LB 4YBLB 4D2NA 3SPIA 1E9PB 3JWNE 1PBGA 4GY0A 4UDTA 1CEOA 1A14H 1JI1A 4PS3A 3VDBA 2QF8A 4Z7UA 4DJFA 3F12A 2NVDA 3T08A 4BSWB 1L9NA 5LLIC 3KX6A 3FUDA 7ODCA 1G4PA 1M03A 4IUGA 4H1LB 3MJYA 4UBPC 2JLPA 3CIWA 3FQTB 1NFIB 3EAUA 3QFDA 1GHFH 3C60A 3OTRA 4XE0A 3RAOA 1T66C 2QGDA 4YWIA 4AX3A 4PB0H 4GGBA 3DGBA 2GDQA 1NAL1 1I1FB 3ICJA 1I82A 1G9NC 4YTRA 3FCGA 4MAYD 3T0AA 1XGZA 1M2VA 4UFIA 4L9LA 1U4FA 2EVGA 2HJPA 3I6KB 3VI3E 4WUUD 3FTGA 3HMXA 2PPAA 3VI4E 4NO3A 5B3NA 1ZNNA 1G9MH 1A7RL 3SBWC 3WFZA 3PM6A 3SGZA 2FPTA 1F1AA 1RALA 1BQKA 4BA8A 1OAQL 4QSHA 3HLAA 4G5ZL 5EUOE 4FF9A 3WEAA 4CQDA 3DFNA 3WDIA 4ASTA 4GAJL 2CIKB 2XVGA 3MX0A 4KT2A 1CFSB 3BSMA 2CEQA 5KBMA 2F9BT 4WKHA 4OZHA 3M7FB 3CEUA 3SSJA 1W0VA 4Z1YA 2YBRA 1EGMA 1CGSH 3BFQG 3F7YB 5J56B 4BFNA 2XIDA 3EHBD 2G97A 3MNVB 2B59B 2FECL 4B5SA 1NSNH 4OCYH 4OCMC 3QKZA 4K39A 3WFHB 3FO0L 3FAWA 4NP4L 4QTGA 3MUCA 2Y5SA 5CZRA 5C0CD 4MB5A 3LLXA 3OKEA 1TZIA 1DSFL 4GUPB 4NLAA 4ELMA 2V5JA 5T33H 1WZ1L 2QYGA 4PULA 4MHHG 5DT1L 3S4SA 3FO9A 2ATSA 4AV0A 4LEOA 3S35L 2P44B 4IRSC 5J8OA 3BZEA 1HHHB 3WYRA 1LRTA 3STFA 5A8PA 5AW1B 1J4EA 3IDYB 2IANB 3EO1B 3O4LB 1PPIA 5C6TH 3VB9A 3TX4A 3PRZA 5G5IA 5ELIA 3K0WA 5CAYB 3W7NA 2BSSB 4IS6B 1EJ7L 2EO7A 3DFPA 1PIIA 3V4VL 4R4FH 4JFFD 1L7IH 1HN1A 5JIMA 3U82B 3B0XA 3AS0A 7REQB 1JFXA 1X5LA 1T20B 4CL7A 1RKRA 1Z3GL 1IE7C 5EL1A 4CCDA 5AUMB 2R4SH 4MXVE 2VDIA 1J05B 3QLDA 1AVAA 1Q6OA 1OAUH 4UTMA 2XIJA 5E7FA 1K3UA 4OD3L 3KBHE 5I77A 3CUGA 3F4NA 5ITBL 5BOFA 3CPLA 4J8RA 4HQQL 4Z7QF 2IQ9L 3C6CA 2B7DT 1RUKL 2D9QB 4JGUA 5FD0A 3SDOA 3JBG7 3FVMA 4MWAE 2D3LA 3CBWA 2J44A 3FRUA 3TZVA 4NASA 3DTUB 1N82A 3FA5A 1NFDE 2LABA 1JNDA 2JLLA 3S6CA 2ENSA 3GLDA 1W80A 3QNYA 4JHUA 4PP2B 4KROB 5T1KB 4IJRA 1QVOA 4PY8I 5LHDA 3G6JB 3O6AA 4RA0C 3CVHB 4TTGA 4LAZA 1Z32X 4GFTB 3F64A 5G4OA 4JHVA 1B0WA 1N0XL 4IIBA 1GYMA 3FB5A 2R8SL 3BRGC 4RX0A 3AMLA 1HEZA 3IJQA 5A2IH 3PLYA 4GKZA 4AYFB 4R5EA 2VOMA 2Y23A 1IQDA 2VDOB 4B3EA 4D0DB 4OZ4B 4XCFL 1S7VB 4NO0A 4PBXA 2QPXA 4R3SB 3MRJA 1HC1A 3IVKB 2C91A 4RFEB 3VD2A 3QXDA 3OKLA 4GG6F 2VI0A 2X42A 2FX9L 1E55A 2P10A 2WXPA 5EULV 2CDGA 3SYAA 2LV4A 5E51A 3IMWA 1XRTA 4F8OA 1MCPL 4GQZA 2XG9A 2LU3A 4JJHA 2GC7C 4PJ9D 3LM7A 4LFYA 2OWCA 5GS0L 1A7RH 1A65A 2HP4A 3FQNA 4FLHA 3U0PA 4GJJA 1I7ZA 5D09A 4KX7A 3LQMA 1D5MB 5LVEA 3TA3C 4Q6JA 4G5ZH 5D1XB 1K72A 5TAOA 3FDGA 4PRBB 4XHQA 1KB3A 1A9EA 1JOIA 4GAJH 4WI0B 1BVZA 2CMRL 3FH5A 1AQMA 4TPRL 3GVRA 3O0FA 2J72A 3GLCA 5A2AA 4FXKC 2J8GA 1W31A 3SQBB 1AMXA 4FADA 2XPYA 4X9SA 2ZXWB 4MGXA 4H2HA 4AZUA 4HJWA 1FBIL 1I8LC 1G0DA 4F3FA 2JB6B 1KTJA 4KBPA 5HDOA 2C3VB 3FO0H 1X1ZA 1H3UA 2EDQA 4NP4H 3STGA 4EI5D 1ID2A 5EU6E 2F1BA 3B04A 3JWDL 1IKFL 3GLEA 2FDBP 4KTGA 1DSFH 1Z9AA 4PJCA 1MLBB 4H6RA 4A29A 4Y5VC 1WZ1H 4G42B 3DSFL 5T3ZD 2V8MA 1QPKA 2REQA 1GVEA 4F0MA 5DT1H 2X4UB 3QXVA 4ZFOL 2OG9A 3HJZA 4Z7WA 4KO7A 3EGDB 3S35H 1A5LC 3C0LA 2QT3A 5TF0A 4HYTB 3O9WA 1VLXA 1TTBA 4ZAKD 4NWUH 4U5KA 1ZHNA 2W60A 3STZB 1DZ0A 1YDVA 2CRIA 3C09C 4LCCA 1ZIBA 3I9GL 2NY6D 3A12A 4OAWB 2EIJB 4L1XA 4ZTPL 1QRNB 1CE6B 4CVXB 3OF6D 3IJIA 3C8DA 2DQUL 5B3JF 1E9YB 3V4VH 4PJBE 3UBFA 4X80L 2WINB 3KTSA 1XMWA 1ASQA 5H35A 1U8LB 3SN1A 1IFHL 2CNCA 4H88L 1RCYA 3E02A 4XPTL 2OPJA 1Z3GH 4MASA 2HLFC 5I30L 3TH2T 3EIFA 2FEEL 4GJTB 3E6HA 4U7MA 2GITA 3IIVA 3KGSA 1TYRA 4P2CG 5HYJE 1NJ9B 5M5DA 1RZGA 4LUJA 4DCQA 4OD3H 3RVWD 1ECZA 3V52L 2WMPA 2D20A 3H0TA 3TLRA 3CQKA 5E94A 5ITBH 5EMMA 4HQQH 3WLWD 2IQ9H 4M4PA 4AUBA 1CW2A 1RUKH 3HE6B 1K9FA 1C91A 1L6ZA 1VJZA 3V4UL 3UTTB 3WFCL 1TLMA 1WCBB 1A5KC 4CQCA 3RB7A 1INQA 3V4LA 2CHZA 5IBLD 4Y4KA 5F8RC 1UH2A 1Y5VA 2EH8L 4KXDA 1EIBA 4P5TD 4ZENA 3QORD 3HN3A 1QXLA 3WD4A 2HPMA 4CGUB 3ZYZA 1LP9B 4E9SA 3B8SA 1E65A 5KN5A 1X4ZA 4JN8A 1GZQA 4JM0A 1N0XH 2BSRB 1TU2B 2R8SH 4J4KA 4N1CA 5DVLA 1M5WA 3UERA 1JG9A 4PJXF 4GINA 3ARXA 1G4SA 1IGTA 4GKLA 3DUSB 4LCIL 5I19L 3OX8B 4XCFH 2DLHA 1WEJL 4AD1A 3CZFA 4JZOA 5GIRB 1EGZA 5IMMB 5E9NA 3S88L 3NCCB 1OF2A 1IBHA 4CU6A 2FX9H 3T8LA 1QRQA 2X0SA 4LL1A 2LTQB 3R4RA 1OABA 3KM2A 4JYEA 1UW9A 3ZLHA 1I8KA 5I24A 3D09A 5FJUA 1MCPH 1EC9A 4KWUA 2H2SD 2ZXQA 3H9SB 2A74B 3ZL4L 2FTWA 5D9SB 1IUZA 4IZGA 3JT0A 2Z8VC 2EXWC 5CEZL 2Q7YA 1NC2A 5GS0H 2BP3A 1CGWA 2RKXA 3GFZA 4R6UA 4ZQPA 1AD0A 1IQ8A 3LEXA 4AXWA 1P4IL 1FWBC 1ZVYA 1HUVA 3VYLA 3A3XA 1ZAHA 5B7EA 3Q6FB 3N0AA 2AJZA 1KJVA 2QPDB 4MNGB 4GRMB 1HXYB 2BVQB 4WEEA 2CMRH 3DK2A 4PWKA 4TPRH 4FHBD 5IB1B 3WEOA 1U30A 4HC1L 4EN3D 5D4YA 1XDTT 5I8EA 1J8KA 1OSPL 1H1ZA 1J6PA 1UUQA 1RIVL 2KLRA 1FBIH 2NQ9A 2WXOA 1UZ1A 1CTOA 3KBWA 4RBPH 3AO0A 3KRSA 2Z31C 3BAWA 4P7NA 1IAII 3IUIA 4A37A 3BAIA 3VDHA 4L3EE 3QUGA 4WRLA 1HHKB 3RIAK 2XKSA 5B38B 4PGCA 4IGBB 4EIBA 4ZQKB 5C9WA 2P8LB 3IN0A 3JWDH 1IKFH 5BVPL 2W80C 4U2YA 2AAVA 4BK4A 3DSFH 4PJ6A 1JWUA 1RUSA 2DV0A 1E6QM 4IU3B 5ABZA 2OX1A 4Y9CA 3TSDA 2GAZB 3FQUB 1H15B 4LLVB 4IXXA 3D3VB 3NBNA 1LWJA 4HJ0D 3BWZA 4BCXA 3SCMC 3GSNL 3IB4A 5IP4A 4LV9A 4ALAL 1J0KA 4UTAA 1SF5A 4MNHA 1YN6A 4Z2IA 2E1WA 3I9GH 1M41A 5IG7A 3AMDA 5HDBE 5J9PA 2XU9A 2UY7B 1FZOB 4OFYD 4ZTPH 2XG5A 3SCNA 4ESKA 2DQUH 4M24A 2R14A 5H37G 1Y0LB 4O11A 4AKOA 4XWOC 2A83B 1HESA 3ABOA 1NTHA 5H94B 4F9PA 1FJ1A 1IFHH 2AVGA 4H88H 4TVPL 2OK0L 1OO2A 3VVWA 3H2CA 4XPTH 5AZ0A 5I30H 3G08B 4UXDA 3KYNB 2PLCA 5A2KH 8RUCA 5JYMA 3K6SA 3G0SA 4O02L 1KMGA 5IR1A 1TIMA 5B80A 1IBFA 4QISA 5IB2A 3N41B 2AQNA 1C7SA 3V52H 1VRXA 3TOPA 5DTFB 2QLVB 1BYCA 1HNFA 3BLOA 4JX5A 1NPJA 3F1QA 4DWDA 3E6FB 4LDCA 3FU7B 2F15A 5K4ZA 1NOUA 5DGQA 4F4RA 5ISZB 4BZYA 3V4UH 3WFCH 2F61A 2OW6A 1NDWA 4APQB 4Y2LA 1HHJB 2B3IA 2EH8H 2X4OB 4KJYA 1ZT7A 4PJDF 2A0LD 4MYPA 1EAQA 5D96B 5E8EB 2UZYB 4XHJD 4B9GA 3P4NA 4AVFA 2NNFA 3LTVA 4LS0A 3VFRA 3UR2A 2Y7DA 4HZ8A 5AC7A 2P5WA 4D8OA 3IANA 3L3GB 1QTPA 3MFGB 5K1NA 2OGYA 4AF0A 1CIUA 3P69A 4LCIH 4WV1B 1CF1A 5I19H 2VQ1B 3BEWB 4LLUA 1WEJH 5E23A 5J0BA 5FF2A 3CXHK 3QZEA 3S88H 2AMUA 3K13A 5LXXA 1BMWA 5I2IA 5XINA 1EQCA 4HCIA 4IIFA 4S3JA 5DJYB 1MEIA 2AJSL 1DYZA 4NSKA 1SBBA 3PF3A 3L1GA 3U2JA 4LKXB 4P23C 1S9XA 2JEPA 3ZR4A 5CMAB 3KZPA 4OU3A 3ZL4H 2Z93A 2W3ZA 4AT6B 1DYSA 3OBKA 3SZKC 1KIUB 2A1YA 1K5NA 1TIWA 3VKBA 1I1WA 3WQOA 1XB6A 2YPVA 2BP8B 2K3TA 1FRGL 2EXSA 5TPWL 4JX4A 4R8WH 4WGWB 2BW4A 1P4IH 3DGGB 2EVIA 1IM9A 3RDKA 3MLWL 2KZ1B 5DI8B 3G9VA 3WTWA 2IDFA 3GU1A 2VAAB 6ENLA 4ECNA 4W81A 2QV5A 2WCSA 4HC1H 4LK4A 2FEDD 3NL2A 5FL1A 1MCHA 3LNHA 1AO7B 2FLMA 1EH9A 4CNOA 1EX0A 1OSPH 2VDQB 3K2GA 1RIVH 2X3CA 2E28A 3G3LA 4PIBA 3M46A 4HZAA 1T1YB 1E8ZA 4W70A 5T91A 1QPNA 1SQ2N 3D39B 2Q8BL 3W83A 1IIKA 2IH3B 4PWHA 4DEPB 3CAKA 2E59A 5BVPH 4ISVB 1GHSA 2F5AL 3RVTD 2QCHA 3COOA 1OGAB 5F0MB 5LXGL 4XZBA 3UYCA 3PL6B 5C2UB 4BSVA 3DETC 1CDGA 2HTMA 4KWVA 1OTTD 4NX5A 3GUTB 3ZT6A 4OGZA 1BVKB 1L6FA 4M3HA 5H37H 3OR6A 1PU0A 3GSNH 4QLRA 3MMEA 4ALAH 2KLTA 3LXBA 4IPNB 1MH5A 2G9HA 3QPKA 1G4RA 5INCB 4WFFE 2PW2B 1KG0B 1A3XA 4AJWA 4Y9AA 2I7OA 1E5ZA 3VKAA 1L0XA 4XAZA 3UOAB 5HYJD 4AKPA 2FR4B 3W9DA 5AALA 2FDMA 2OZNA 2V0TA 5JU6A 3D69A 1PZ0A 3RX8A 4TVPH 2OK0H 4NLHA 1UB6A 4GQBA 4O1AA 2CM6A 5EN2B 3VFTB 3CSYB 2DY2A 3AG2B 2VITB 3TQVA 4FQQA 1QHZA 4YOKA 3UYRL 2QIIA 4O02H 3WLHA 2BP1A 5HHVL 3APNA 3BVNA 4DJEA 3C6LA 4JRWA 1G9MC 3ILEA 3DVNA 3PWNB 5ICYA 2DF3A 1NDGB 5CD5D 3FQ2A 2I5IA 3W1ZA 5BNXD 1B3IA 1YEEL 1HSAA 3VXUD 3EYOB 1NEUA 4HWBL 3KPOB 4C6EA 3MLTB 3RX3A 4JGJA 3BTNA 2HDJA 5LIYX 1EYEA 3MCG1 1U8HA 1F7BA 3CT7A 1DQUA 1FORL 3UZVA 4FQ2H 1XC6A 2DJMA 3JYBA 3WUWB 4N2KA 1AA1B 1IT8A 1IEVA 3RX2A 2FAUA 4AZ5A 2K78A 3L4CA 4MFDA 4JFWA 3MJ9A 5D1ZB 4AIUA 2EDKA 1EAOA 4BRJA 2JI3A 3MRMA 1M7DB 5MEPA 1GEQA 4JG1L 2NZ9D 3EOTL 1XFBA 4RNHA 5E8OB 4PPTA 3UO1L 1NIFA 3W1TA 3VWJD 3B9DA 3MYZA 3NSMA 4A2LA 2JKRM 3MRRB 3ATYA 1AXIB 4X7FC 3DVGB 4DIAA 4XN1A 1TEGA 3I6EA 2ZG3A 5IREA 3ABXA 3UP1A 4EKJA 3W26A 3FQXB 3RDTD 2AJSH 1DQQA 2C14A 3DFQA 4LVGA 3ZE1F 3QIUA 5DK2B 3U0HA 4LPCA 5FEPA 3GR8A 1GGIL 4BELD 1FAIL 4XIAA 5KVDL 2XFWA 3OQ3B 2VABB 3HE7A 4F40A 3B03A 4AE0A 4PJAE 3WTYA 1RVGA 5HOSA 2DW5A 2CCVA 1FRGH 4L1SA 5TPWH 2BOBB 3E5PA 1TETL 2XYCA 1EDHA 3W7OA 1YG9A 3MLWH 5I06A 4Q6KA 1HWWA 1JRCA 3OHXA 3C0JA 4JY8A 2YMOA 5BPPA 2WYZA 4RDQF 3FT2B 3CWOX 2VCOA 1XIDA 3SDAC 3M0ZA 5HGGS 2WMIA 1PHQA 1MZHA 3ZXWA 2EICA 4OZGA 4PTUB 1R3KB 4CUCA 2H5UA 3D07A 1W16A 1SDDB 9PCYA 2ABBA 5KJRL 3BGFB 3WSUA 5C0ND 3UAJC 4Y4FC 3V5HB 3VU2A 4A2EA 1AD9A 3OKNA 2Q8BH 1BZ8A 4ILSA 4BFFA 5IDIA 7A3HA 3PZTA 4KMTL 5DYOB 2F5AH 4JFEE 2XV0A 1U1HA 2PTUA 4OQTA 2WXGA 2B2XL 5LXGH 2YD4A 3JS3A 2RAGA 2YXWA 2BGQA 3Q2LA 4RAVA 2GGJA 5T8IA 1NUNB 1DE4B 4L29A 3QPXL 2B20A 2VEIA 1LO5B 1XYLA 3CFEB 5U7SA 3NIFF 2F54E 5IHWA 1O5QA 1R4XA 4X99A 4GY4A 3QFJA 1JGUL 3IIOA 1AIFA 3QEUB 4HPXA 1ACCA 3GDRA 2ZP9A 1P7KA 4ORGA 1VFMA 3WE6A 1SLXA 1ZS8B 1TKWB 2NUYA 1FWDC 4TX9A 4MQ7B 3VFSA 3CB3A 1D5BB 2G4EA 5C92A 1PYMA 3W7PA 2QGYA 1R6VA 4BCEA 2WKLA 1POJA 2KLSA 4FSAA 4DGIL 4QR7A 4HH9A 1TVBB 5BOOA 2BGNE 4HD5A 1VH7A 5H1WA 5GGTL 2CWNA 5HHVH 2X0WA 5J1TC 1WKFA 4XO4A 1B5TA 1E9QB 2AQSA 4IMKC 1RSFA 2C8NA 1G7HA 3NSJA 4QDGA 5CKSA 3FUJA 2BNUB 4J3SA 1MHHA 3W07A 3QJOA 1RLBA 1P5UB 1YEEH 2OEMA 1IEQA 5CPTA 4IDLA 1E0XA 3U2SA 3M47A 2I57A 4HWBH 5J8LA 3WHXA 4QXIA 2WJEA 3WLJA 2K4WA 1X5XA 4QRRB 1FORH 2UXGA 5F1KC 1BCIA 2NX5B 4EOWL 5CFHA 1PG7X 4ACPA 1XH3B 3EJZC 4FKEA 3PWLB 3CK0L 2PWDA 3U6RB 1BFSA 4CBZA 3D6NA 2OPCA 3IETB 4JG1H 1AJ0A 4QXTB 3L3DA 2GVYA 1O5DT 2XBZA 3BWUF 3EOTH 1G6VK 2VKXA 1XBZA 3UO1H 1PVHA 3CV1A 3N9RA 2PMZA 4K9EL 5EUKA 3U48A 4FXFA 2E0PA 3FCTA 4AUUA 4N2OA 3S9DB 1K6AA 1NP2A 3WTTA 3THQA 3TJXA 1LEGB 2BG5A 4APQC 1AKPA 2VDPL 2Z0IA 1SOXA 3H7UA 1YXCA 3K1KC 4F7PA 4RFOL 1AGEB 3H4WA 4I18A 1FIEA 1GGIH 1FAIH 5KVDH 2WSDA 2Q9OA 3AT9A 4G9FD 3MRKB 3MTRA 3EFOA 2A3HA 5JNYA 2VLKE 3CLEL 4XZIA 3X17A 1H5BC 4M29A 3RPDA 3BZFA 1X6NA 1TETH 3A3WA 2JK2A 3Q67A 3BV7A 1QSEB 1HKVA 1KJ2L 1S5MA 3OKMA 3W7GA 2PPGA 2VH5L 1NWOA 3ZZLA 3E2QA 1Z9NA 2EDLA 5CGYC 4KIRA 4JM2D 2DLFL 5F7NC 1TQCC 5BW6A 3QUYD 2AQQA 1PTAA 5DQJB 3D25B 1SJDA 2QQKL 2O6PA 2YZ1A 2YJLA 3BOFA 4B5NA 4J6IA 2QCCA 5KJRH 2LFGA 1SOQA 1TPDA 1D9KC 2WW8A 1I9JL 5F96L 3THDA 1HJSA 2O4MA 4KMTH 2BERA 3GXIA 2GTZA 2OSYA 1OSYA 4D8PA 1B9KA 5DVOA 1KM4A 2O6DA 1SXSA 2BXVA 2B2XH 4CEXC 5DO2C 4X6CA 4WFFD 4PW9A 3AYVA 1ZSXA 1XCWA 3NSXA 1J0IA 2PF6A 4AGNA 5AKVA 1KTNA 4NZFA 3G1DA 4R84A 1J0JA 1HSBB 3QPXH 3GIQA 2WBXA 2FWLB 4IRSB 4FG2A 4JDVB 3FW6A 1S3RA 3IF1A 4HLZG 2APFA 2GSIA 3WH9A 1ZHBA 1G1CA 1JGUH 5LDUA 3NCJL 4ZPTB 4WX2A 2J7FA 3OHMB 4ZQMA 1W91A 4PMQA 1J9TA 2X89D 1US2A 3DOSB 1BV8A 4PIRF 1AUSL 4XAKE 2V5CA 3S1VA 3XINA 4IDJL 1K4DA 1BBDL 3QZWB 4AWEA 4OUUB 1MEXL 2ENJA 3PY2A 3MQTA 5C0AE 1AJZA 5HNNA 2P5NA 3S9YA 4GIRA 4DGIH 4GGHA 4K6AA 4HS3B 2CG9X 2X3AA 4FQXA 5GGTH 3JYCA 4MJIA 1S6NA 4BQ4A 3M5ZA 5JQ6L 1OXYA 4NZUL 2ZKYA 5DEZA 1S7XA 4R7NB 3N55A 4S3FA 3H9HB 4HHMA 3QZMA 5GS0C 2DIEA 4AYMC 3FYIB 1MI5B 2F5BL 5LXEA 2V68A 1R2TA 2VW6A 3GC2A 1S2TA 1GA2A 1VFSA 1OFAA 4RMUA 4W9JC 3DO7B 3P67A 1SZNA 3C6SB 4U05A 3K71A 2J1KA 2XQ0A 4GFIA 3SRHA 3TFKD 4EOWH 3QDJB 5K5YA 2VDGA 2QDDA 4GY1A 4ORMA 2VC9A 3O6ML 2VXVL 3PSWA 2PR4L 3EWWA 3CK0H 4LYQA 4JHBA 4DWSA 3ITLA 2VN7A 5CPLA 1JYXA 1IAOB 1EX5A 3ZQWA 4PAZA 3QHZL 3GTFA 3QJAA 3ARBD 3I9PA 3REWA 1W72L 3JWDC 4OGQC 5IT2L 1UWEL 3WD2A 1UQSB 3RKDD 4ENED 2J8UE 4OY9A 4DPPA 1NGYA 1HH6A 4PTDA 3VXRE 4PJ8C 1EXHA 2DMGA 5CPQA 4EJ1C 2V5LA 3NZQA 3WS3A 5DBUA 5LBVA 3N18A 5IM51 3AU1A 1JXKA 4W4OC 2VDPH 2OQHA 3UW6A 2XKNB 3EYVB 1KPUA 3F05A 3W28A 4RFOH 1IM3B 5C5YA 1PJWA 2ZRVA 5GRUL 3CL6A 1XCTB 3C8KB 4IBWA 4O17A 1X5JA 3ULVF 1A14L 3DYMA 5D1ZC 3EOAA 2QAPA 4NNXB 3CFNA 2I7SA 3K6FA 3UABA 4NCDA 3HS8A 3EGSA 4WAFA 3FYOA 3CLEH 5KEZA 3WY3A 4I9MA 1ZAGA 1T1XA 3ZKSD 5LKYA 4BCZA 4TQTA 1JV5B 3TA3B 2R2BA 1GJUA 4QLLA 1KJ2H 4Y5XA 1IAKA 4OECA 4XNMB 2VH5H 4TQ8A 1H09A 3CZUB 1DVFC 2Z9TA 5C0BB 1L6PA 5EEWA 1R24A 1QD0A 1YEWA 3MFFA 2GYIA 2DLFH 3ZKMC 3ETBF 3V5KB 4JFED 5SWZB 1Z41A 3S5NA 4I0PC 1W5OA 2QHAA 2QQKH 3IGKA 1GZPA 2PXYD 4O8AA 1FNAA 4ZOCA 4HU2A 2CJUL 2DM4A 2EDHA 3IDJA 3GINA 3RWGB 1FWTA 3O41B 1I9JH 2WN2A 5F96H 4IHOB 3RY6C 1K4CA 4H41A 2F54D 1WE5A 2EUXA 2BZCA 1C1EL 5AZ1A 3SAZA 2CLEA 2X0YA 3CZKA 1FQ0A 1WC7A 4Y5VB 5B39B 4D9QE 1ZHKB 1QEWB 4QYOA 3HN8A 5M1TA 2YRLA 4AHPA 3QKEA 4ML9A 1PCWA 4QDWA 4NZ3A 4DQOL 4PB4A 3WDHA 3QUMB 2IDTA 3WJMA 4XODA 5I1AB 4NHCL 3KTXA 4J27A 3BLBA 3UWQA 3DH7A 3FPYA 2YGPA 1ICQA 3FO1B 3NCJH 4P4RB 2N1TE 3BGFC 1T03L 3HMXL 1RUPL 5EBLA 3V4PB 3PZIA 1Q6DA 2PCPB 4QF1B 1VJSA 4IDJH 4H9MA 1BBDH 1GOXA 4HHPA 4ODWA 1DL7L 1LYXA 5AVZB 1MEXH 4PG9A 1UKTA 3WLOA 2ZPKL 5KOVC 3U6WA 1VKXA 4H7VA 4NJJA 2O4QA 4AISA 4GC3A 3LQZA 2BOCB 5D7JD 2JKNA 4AUJA 3DFYA 4PJIF 3RDJA 4A2RA 3MSRA 5E9DA 4J2XA 3P74A 5JQ6H 1FV1A 4NZUH 1ZT4A 2PDWA 3MZGB 3HZYB 2VKWA 2L4OA 2J6VA 5D2NA 3SCPA 3TIDB 4X6FA 3HC4L 2H32A 2PWUA 4MKSA 2F5BH 3ORJA 2WHVA 5IB5B 4YDZA 5ABDE 2R7EB 2YL6A 4K37A 3MSDA 3BI9X 4QRPA 1RHCA 1A64A 4MFEA 3TO4C 2YWZA 2GQ8A 2VW4A 4HVBA 3GLZA 1Z5LA 4P2QE 2TODA 4S2SA 3BQUC 4C1NB 3L8QA 4UWMA 3DG6A 3LRSB 4E9LA 2ADAA 5KG9A 4U31A 3ZPDA 5HYEA 4LUYA 4DO7A 3BK0A 4RDYA 3NRFA 3AHVA 1A3WA 3O6MH 5I78A 3A6BH 3QRBA 3DI0A 2VXVH 3V5DA 1T1ZA 2PR4H 4WW1B 4IIGA 2R1PA 1I2NA 5F7EL 2V3EA 1T3FB 1QKZL 1SPDA 3M45A 3ILPA 4NAJA 1KXQE 4PS4L 3QHZH 4KFPA 3ARDD 3IK4A 2HT4C 4HEPG 4AQAB 2HTKD 1W72H 1P5UC 2QXWA 5IT2H 1UWEH 4N5ED 2BH0A 4C6MA 1Z48A 3TAKA 4TMCA 3M6YA 1W1ZA 4N2FA 1MHPL 2HZHA 3MMUA 4EAEA 3IAGC 3VD1A 3KVQA 4PMJA 3EG9A 3CZSA 4PRAB 1QCWA 3I85A 5DD6B 3W11D 2VLKD 3RLGA 4ZB2A 1WDRA 2NQ5A 2HCVA 5KS9A 4AJVA 3LKRB 3IS4A 3NQEA 3BZ4A 2RFXB 3STBA 2I5QA 1EJRC 5GRUH 4ALAC 3AC0A 5DVMA 2A73B 5F97E 4DBWA 4CU8A 4I4WA 1HI6A 3BIKA 4L6OA 4MVAA 2ZYSA 1XFCA 1CVRA 4N22A 1BF2A 1ZP4A 4GD0A 1IVLA 3NZPA 2LGNA 3V9EA 4I90A 2NTFB 1DBJL 5IHRA 4UT6A 1QVBA 2I14A 3GXNA 5A6LA 2YAQA 1E2WA 2IMMA 1OWQA 4CVUA 3M1BA 1YO4A 4WENB 3FFOA 4K1GA 1M68A 1KFLA 1P7QA 4QS6A 2YSSA 2HXTA 5KYYA 4X9IA 4R7DB 1PX4A 4LCWE 2HNHA 3OAYH 4AQ8A 4YNYB 6CGTA 3URQA 5IROC 3WFDL 1W9PA 1FA4A 3C86A 1E7UA 3P9LA 3EB4A 3CH1A 3MR9B 4NZ8A 1U8MB 1UENA 2JJTC 3MRLB 1XGRA 2CJUH 1FLRL 1W37A 3W0WB 3KLLA 3CDGB 4I5RA 2Z31B 1GJWA 1KLYA 5ANMA 1AH4A 4HIPA 3IKCB 3DVFA 2MQ0A 2OMBA 5I0VA 1BJMA 3QVAA 1C1EH 3DJTA 4RIRA 4I2XB 4QHLA 2KZHA 2APSA 4NJHA 3UP6A 1RK1A 3HZMB 5FUOL 4PJFA 1UGNA 1R85A 2Q8ZA 1JL8A 4RSVA 4DQOH 1QSZA 3VH8A 4QNPE 1H6TA 1MCJA 3LM3A 4NL1A 2TRYA 4XAKD 4QRBA 3BAEL 2JELL 4UYQA 4NHCH 3SCMB 2YPLE 4LGXA 5C0AD 3FSTA 1Z9SA 5KVFL 1T03H 1BTCA 1GTFA 3HMXH 1RUPH 3ZE0F 5C0JA 2WKOA 2DMKA 1GJIA 5LWYL 1I1CA 4JCLA 2PO6A 1EJTC 2V5SA 3LNEA 2AJUL 5CP7A 2WV8A 3S2JA 3EFFA 3S3SA 1DL7H 4PRTA 4K7PX 3RUBL 4IP7A 1FWWA 2VLJB 2ZPKH 1NGQL 3PFQA 1WFTA 4DP8X 4UANA 3ZE2F 3L6FA 5CPNA 2C3ZA 2W27A 3QI9C 3O8XC 3FHQA 3EKLA 2PDKA 5HHQB 3FJTA 3O3DB 1AW5A 1VHCA 3E3HA 3ALGA 1CB7B 3PWPE 4NWUL 3VIOA 1Z7AA 3M0JA 3B0UX 4M8VA 1M05B 5EF1A 3HC4H 4JKWA 1KRCC 1IBBA 4AXKA 2K45A 4YFLI 3PWJB 2GUBA 1AS6A 5FESA 3Q0HA 3AQUA 3QDGA 5DC4B 3V0JA 3RITA 1PXGA 3FRPG 1OGBA 1K1DA 5AVWB 4EPBC 1UWSA 3ZWSA 3RL2B 2VGFA 5GRVK 4OF8A 4D6CA 3MBXL 2BNRA 1OPGL 1XIWD 4X9FA 5HD8C 1L9PA 1AR1D 2IAAC 5F7EH 2WLHA 1WA0X 1QKZH 4PS4H 5I76A 1AH1A 2NZLA 1I1AD 2ODOA 1H61A 2OQJB 3RWHB 1EK3A 5IFJB 3HI5H 2G4JA 3IGHX 3GBML 4ZBJA 1MHPH 3BZ5A 3MV9B 5F2FA 1CGVA 1UXWA 3R1GL 4ZUSB 1BKHA 2FCBA 4HN4A 5HGHB 4CEUC 2ZZ4A 2P5ED 5CBBA 2CGYA 1JXDA 2GOKA 5TDPB 3UA3A 3K81A 1MW0A 1X4XA 4IM4A 1T5WA 2VYOA 1NC4D 4LCYB 4XTDA 5FF4A 5AVQB 1CDUA 5HHOA 4P23B 4R5VA 3ZU8A 4WJ5B 4D0CB 3GMMB 4NRSA 3BAKA 2R0ZL 2GUOB 3MCNA 4WO0A 3C4UA 1TKKA 2R1KA 4QCEA 1CWYA 4MCZB 4JPIB 1DBJH 4K2SA 1AMKA 4O4VA 2ZVIA 4X7CC 2MKWA 3EWUA 2P8MA 2KZKA 4A7UA 5LNWA 5DD0L 2I07B 2HNEA 2CO2A 1OFPA 1SSGA 1TZGL 5ABGA 2A3AA 4Y0GA 2PTYA 2WWOA 1T6VN 2RFGA 2H6OA 3DV6B 3D2UA 5IWLA 1OY0A 2ED9A 3N2BA 4X9HA 4YLBA 2YDSA 3RUGF 1XR8B 4GXWA 3UFYA 3WFDH 4A8NA 4F2MB 1SO6A 4X7TA 2X6UA 1E15A 5DWPA 4AZ7A 3CUIA 2ZBTA 3HGRA 1FLRH 3NQ7A 2XVNA 3ERPA 2DW7A 5ICXB 3B1TA 2OXGA 3B5HA 3CQHA 3D85A 4P04A 5JIIA 3KP0A 2E74C 1FWHC 1MCOL 4AMXA 2Q8AL 3GYEA 1SMDA 2WIMA 5CGQA 1WTGT 1GPWA 3VFMA 1P4BL 2E75C 3FTZA 5ECGA 4WHTB 4B5WA 5FUOH 2HFEA 3I65A 3KPLA 1LM8V 5JIKA 4WFHE 3NSCA 5FYLL 2INZA 2VN4A 1R38A 4Y90A 5GNZA 2BZDA 3BAEH 4LNYA 4PMEA 3SY5A 2JELH 5TGBA 3RM9A 2JB5L 3EBGA 4IIHA 5KBPA 3UPRB 4QOKA 3LNDA 3VKCA 3T3MF 3CZLA 5KVFH 1WBXB 2OWWA 1E6PA 1DUYA 2BGSA 3O15A 3IFLL 3L16A 1B1YA 1OVDA 4C55A 2X09A 5LWYH 2ZRUA 4TV6A 4LAKA 2MOQA 4IFRA 1ZLSL 4ZXBA 2P80A 1A0QL 3AI0A 2AJUH 3RWEA 3ULAB 1XINA 4ZW7A 1OAKL 2G3ZA 1WIOA 4YIQA 1FBAA 3ZTJG 4UMCA 1KCUL 1NGQH 1X7TA 1LM1A 3DLQR 4GBXA 4PTNA 4PJHB 4GH7B 2LVCA 2XX0A 5DFVD 4X7SL 1QSFB