4R9XA

Crystal structure of putative copper homeostasis protein cutc from bacillus anthracis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
225
structure length
225
Chain Sequence
MLEVIATCLEDVKRIERAGGKRIELISSYTEGGLTPSYAFIKKAVEAVQIPIHVMIRPHAKSFTYTEEEIEMMKEDIVVAQKLGVAGVVLGVLNERNEVAEEKLADLLSVVDGINVTYHRAIDDIENPVEAMRTLKKFHKVTHVLTSGGQGNIVDNIPVLTDMQKISDGQIQLVVGAGVTKENIKQLLNETGISQAHVGTAVREGKSCFAEIDLNLVQELVQIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Copper homeostasis protein CutC
publication title Crystal Structure of Putative Copper Homeostasis Protein CutC from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 65
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03932 CutC CutC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.380 Alpha Beta Alpha-Beta Barrel TIM Barrel Copper homeostasis (CutC) domain 4r9xA00
2BDQA 1TWDA 4R9XA 1X7IA 3IWPA 1X8CA
chains in the Genus database with same CATH superfamily
1Q7QA 2RJHA 3S83A 1YNYA 3P74A 5KEZA 3UXLA 1S5WA 4QJ4B 3WKZA 1KM1A 5DBUA 2PZ0A 4GYKA 2GWNA 3N14A 4TMCA 1S46A 1WXJA 4LVAA 1MUWA 2PRHA 3OLEA 3CYVA 2X30A 4M82A 4JYEA 1OFDA 2YL9A 3TYEA 2G3IA 3LCWA 3W7OA 1Q6FA 1VJZA 4LF2A 1LLOA 5I3FA 3T0DA 1EO5A 4XVDA 3W2UA 1V51A 3P93A 2NQHA 4J3SA 4HYWA 4L1GA 4W5UA 1CW2A 3APYA 4YS1A 2X42A 3SY1A 1WA3A 3LZ5A 1W54A 4PN2A 1HIZA 1JI1A 4GCXA 4A3HA 2R82A 3VOGA 2WW5A 4JAWA 3FCPA 4B4HA 3I3EA 1PAMA 3DOPA 1VIZA 4ZQRA 2FMNA 1OB0A 4O8RA 1OSEA 2OXNA 3II1A 5A1AA 1OFRA 4N9DA 2GFTA 1SU5A 5EA9A 3TOPA 3R0KA 1H3GA 4AWEA 3CO4A 5G1MA 2OELA 1AL8A 3GNRA 4O14A 1XM3A 4LS0A 3G1YA 1GOWA 1EWDA 5HQLA 4K38A 4TXEA 4HZ8A 7REQA 4YIWA 4PUKA 1QATA 2NVCA 3W2MA 1K1DA 5A2CA 3O05A 2OQLA 1J0JA 2PWGA 3FGCA 4DM1A 3VGDA 1EOMA 2CYGA 1Z42A 3B8WA 4U31A 4KT2A 3W81A 5DXXA 3L23A 2HBXA 1W56A 4ONVA 3WD4A 1KCZA 4OBSA 5DLCA 1WDWA 4Z2HA 4UR8A 4OIFA 1DJYA 3R10A 5IHSA 1FVPA 1S5MA 3LRKA 3BAWA 3S8HA 2CU0A 3N6QA 3LA4A 3UZXA 1O5QA 3TXVA 2QT3A 3MHGA 4R7JA 2FFIA 3BDKA 4HIBA 4GY7A 2BB0A 1PKMA 3PBWA 1G7VA 4RV8A 4KEVA 2OWXA 4ZMGA 2FIQA 2J78A 3Q2DA 1XDMA 2O92A 3BZGA 3PZGA 3U4AA 3RCNA 3AAMA 4JTCA 2H90A 4XZIA 3TR9A 4GIEA 2OYLA 2W91A 3VCCA 3R12A 4D6JA 5DO8A 4PMNA 3IIVA 4XK2A 1G94A 1HJUA 5HQEA 1CGVA 5CC6A 1K8YA 3FAWA 1IXNA 3HPZA 1WUFA 1IZCA 2Y85A 1TYGA 2YDAA 4W5ZA 1NQKA 4RE3A 1DQXA 4M6PA 1EHAA 4HU3A 4PA8A 3VIHA 4N9CA 3TYDA 1AW5A 2PDMA 5D37A 3T81A 4NYUA 3VIKA 3W53A 1NQ6A 3ZR4A 2DZPA 2Z4GA 4B5TA 7PTDA 1A3XA 3E0WA 3GTXA 1X39A 4FMVA 2QJNA 2YW4A 1LBFA 1LOSA 4GQQA 1C9WA 3AU6A 1P5BA 4LS2A 3GDLA 4HZMA 3CASA 4C60A 3AQUA 4BQ2A 4L80A 1F05A 2ZRWA 3B03A 3WDRA 2ZZ1A 2G3FA 2VUYA 1Z6KA 2J7EA 1H1ZA 2Y88A 4N7QA 2UY4A 1LM1A 5HUOA 3E96A 1AFSA 1NWSA 3VILA 1FCVA 3CLMA 3IPWA 3V35A 1H51A 2FZBA 2EEXA 3OBKA 1S3HA 3VKKA 1A0DA 3W2LA 1E6XM 1LL4A 3HG2A 4JTUA 4WSHA 1SW3A 2QVHA 5JUVA 3QKEA 4LOCA 2DJLA 2BY3A 1GGOA 3IJDA 4RNIA 4DF1A 4X9SA 1ECQA 2VCAA 2CCRA 2DSVA 1A5AA 2QCDA 1OFPA 2ZZ7A 4FXSA 2WVSA 2A85A 2QIWA 1V0NA 4H9ZA 3GC2A 4FX6M 3EWUA 2BG5A 3U6WA 1IIHA 2Y0FA 3OBAA 1DXEA 1CGXA 1E70M 4L4PA 3AHVA 2WV8A 3ITYA 5I2UA 4PTMA 3O6CA 3BAYA 4PUUA 1AZ2A 1GPWA 2HXUA 1HW6A 2Y6ZA 3VIOA 3KBVA 2V68A 4IMGA 2CBVA 3TLQA 4S2CA 1J5SA 4LS1A 3HQOA 5AECA 3SGZA 4GJIA 5ABFB 5HUPA 4H7VA 2DDXA 3WEZA 3UY8A 1R7OA 3R5EA 3K4DA 3EXSA 1E51A 4OJYA 1E15A 1KR1A 3WUGA 3V5FA 3BJSA 5SWUA 1MUCA 4CCCA 2PDHA 3PJTA 3CAQA 4YNGA 3N6JA 4O0QA 2CZ5A 4MGGA 3E38A 1JYNA 5G1YA 2D73A 4IL2A 3MUY1 1TB3A 3GTFA 3HG5A 5HR6A 4BQ3A 5LHFA 1FX6A 2MANA 4PUMA 1E1CB 4F79A 5CPSA 3WH6A 2PTDA 2OZ8A 5D9OA 3RILA 1W3HA 4XB3A 2XVKA 1YTDA 3WQVA 5BOEA 4Q3MA 2XINA 1TA3A 2JALA 2YGYA 5IDIA 1WKFA 4Q8QA 5G4HC 3AMCA 2PC8A 1EGMA 4OKDA 3ZT6A 4MFEA 1PBGA 1E4MM 1JL8A 3H26A 4TVDA 5I3KA 5I0DA 4DO7A 1H5YA 4RK8A 3F5JA 2J6XA 1TR9A 1AW2A 3WLRA 2Z6IA 2VC7A 5CLTA 4H9YA 4ZE5A 1I1WA 3AHTA 5D2WA 1GOXA 3L4YA 2V6AA 5CBBA 3OQ8A 1JQVA 1DJQA 1VFUA 2HMCA 5D2XA 1DTNA 4TV6A 4I9AA 4E3TA 2XH0A 3LNMA 5XIMA 5LKYA 1XGEA 2BDQA 5AFDA 3TW7A 3LPOA 3AYRA 2FDSA 4WY0B 4ACZA 1UPPA 3RM9A 2H3BA 1YXYA 2ZRUA 3H70A 2BHZA 3UCQA 3GXDA 1IIGA 5AC7A 4S23A 3RO6A 3I3DA 4NJIA 1P7TB 1UD2A 1KCXA 3V18A 3OQEA 1E3XA 3CHFA 4Z08A 4XSMA 3ZYZA 4V15A 1TV2A 4AHQA 1GOKA 1PUDA 1YMYA 4UCGA 3SN0A 3PC0A 4W8BA 3M41A 3DCPA 3GFZA 3MSYA 1LRTA 1FCBA 1BVWA 1TCMA 2XSAA 5AN7A 4WXYA 3KFTA 3VDGA 1W31A 4YTSA 3UWWA 3ITXA 2DSUA 1XIHA 1YPFA 2OODA 1TV8A 3A47A 4FNTA 1OZMA 3S2LA 4B2DD 4JXCA 1AMYA 2I5GA 3PUDA 5LNVA 2W62A 3ZWSA 5E0FA 2IQDA 3DESA 3G77A 1YDYA 3H2EA 4TTGA 3B8DA 4GZJA 1BXNA 1QDSA 2EO7A 3MCOA 2D23A 3CV1A 4UTWA 3M43A 2VR5A 2MUCA 2A3HA 4V28A 1C9DA 1DJXA 4J3UA 3H7UA 3F03K 1E6QM 3QGVA 3FYPA 6REQA 1JI2A 5M03A 4C6NA 1EX5A 1UD3A 3G3MA 3C2EA 1O7AA 4AMAA 5C9RA 5K7JA 4NJHA 1GVIA 1M41A 4MLRA 2Z1BA 1UJQA 3IUIA 4C1NB 1BLIA 2PF0A 2O0TA 4LVGA 1LQAA 2DZVA 3O07A 3W1LA 3CAWA 4P8WA 1T99A 1YNQA 3MHUA 3WIJA 5C2GA 1TWDA 4JX6A 5K3VA 3NO3A 3KWSA 1Q7MA 1UD8A 4AZGA 3HV9A 1YADA 3WLJA 2RJGA 3GDTA 3KCLA 2CLLA 4UTIA 2FTWA 1FH8A 1LOLA 3RXZA 4FLQA 4R7WA 4HCDA 1DWFM 3F2DA 5GPRA 3MSRA 2ALDA 2E67A 4CVUA 2ICSA 2KAUC 1OFEA 1QOXA 5KTLA 2XISA 3D5HA 3V0TA 3P81A 4PB4A 5E6YA 4UCFA 2Z6JA 5A2AA 1R85A 2GDQA 3HBLA 1HG3A 2PU0A 3IGSA 3MV11 4QLLA 3WMCA 3NQFA 1XLGA 3QR3A 4DZAA 6ALDA 3WLIA 1P6WA 2E5CA 4M3PA 2FZDA 3TDFA 2ZXQA 3L0KA 4RZ5A 1QI4A 3QEZA 3W22A 3O9NA 3R0UA 2GGJA 2DIEA 1YBQA 1TVNA 2NWSA 5LIYX 3G0UA 3P80A 4GYPA 1GEQA 3W02A 1QXLA 4HZ7A 4WGHA 4AYGA 4I5UA 2NUYA 1ZPTA 3P7YA 4DAFA 3T9PA 4NRSA 4FXFA 3H8AA 4QDMA 4YVXA 1FY6A 2G8ZA 3D47A 3N17A 3NQBA 1ZB5A 5D9MA 2C91A 2XWDA 4GZEA 3VFLA 5D8ZA 3USZA 4Q22A 5CEWA 1U1UA 3R1ZA 2GJNA 4JKLA 1WB0A 3H4WA 3OU8A 2O4MA 2O7QA 1JCXA 3VOJA 2Z1WA 4F8XA 3OGVA 3GH5A 4Z1BA 3BCDA 4JTDA 1BF2A 2PURA 2V5LA 2X0YA 5I23A 2Y70A 5GVJA 1KBLA 1VAHA 1RBAA 1NEYA 1E9LA 1ONXA 4NVTA 5AYYA 3AOFA 1FWBC 3GHRA 2ZQ0A 4NT0A 1LWIA 1FWCC 1E4NA 3QMRA 2E40A 3H24A 5A94A 4E8GA 3DFNA 1NSJA 2FVLA 1DORA 3EPMA 3W25A 4AXNA 2E68A 1VRXA 2XGZA 3W76A 2EPKX 3G24A 3OIHA 4KCUA 2BVWA 3GKFA 4Y6GA 4FA3A 4WGXA 3N19B 2WMGA 3NGJA 3REQA 3BO9A 3M0XA 2DV0A 4FNUA 3H7RA 2C16A 4Y90A 3EKLA 3N13A 4PMYA 3O2LA 3VOCA 3LHYA 2PDKA 3PTMA 4AY7A 3QPYA 5A95A 3MUXA 1RR2A 4MLJA 5C9XA 4KFPA 1WYIA 4NL1A 4IPIA 3ICJA 1HJXA 3QV9A 2XFYA 2DEPA 4MJZA 1IGWA 1EEPA 1ICQA 3FVMA 3A23A 4HA3A 3A4XA 3CPGA 3LPGA 2Y8VA 5D32A 2OSXA 4HNUA 1RUSA 3ZR6A 1XRTA 5JBDA 2B31A 3C2OA 4DO6A 1YPXA 3WQ6A 3PPGA 3NYZA 3K8LA 4ZSTA 1JDCA 4PBFA 4TMBA 5EY5A 1NF0A 2PWDA 2NSOA 3FS2A 2VOMA 3BSMA 2NLIA 4K37A 4HD5A 3EPNA 2BVDA 3EX4A 2AQWA 2V5JA 4G7EB 1ODUA 5BMXA 1FBAA 2H8ZA 2O55A 1W5PA 1ZGDA 4NASA 2VQTA 4TTUA 4UXDA 3TOYA 3W29A 1RH9A 4HPNA 3UWQA 2F7FA 4ZTXA 4JTQA 3CIXA 2F6KA 1OCQA 3B06A 3DGBA 4N02A 1R7AA 3TYCA 3HV8A 3B9EA 2GSEA 1S2VA 1E9IA 4LTSA 3RPMA 4HSOA 3L66A 2I16A 3TTQA 3TW6A 4X63A 1HKIA 3VC6A 2W5FA 4AZ6A 2BASA 2G4JA 3SCPA 2ZUWA 4HK6A 4A3UA 2YL8A 3N15A 2CZVA 5HDRA 3P8IA 3V0UA 1VJIA 4AIEA 5H6HA 3DI0A 2OSWA 5I7GA 2DZUA 4B3ZA 3PPCA 4H7ZA 3WH9A 2J9YA 1ZBWA 3R25A 4OWGA 2EJAA 4RXGA 2Z2UA 3IS4A 4CUCA 3MANA 1WXYA 5LYRA 1AVAA 1F74A 3PJXA 3BARA 3FSUA 3NVTA 1GTHA 4TVUA 3UZ5A 4FOJA 3MUCA 2VZVA 1CIUA 4H9VA 4GVHA 3AIWA 5CPMA 1Q8AA 1EYWA 3AHXA 5AB3A 1R3RA 1IT8A 3OGSA 4KH2A 4LUTA 4DUXA 1QI0A 1HP5A 3PPFA 4WSJA 1DVJA 1LF1A 1O1HA 1KRMA 2IPGA 1HT6A 1Q4WA 4IF2A 4GQ0A 5A6LA 3UU0A 4JNMA 2DVXA 1AZ1A 5ABEA 3GH7A 3VIIA 4FOUA 2QDEA 4Z1CA 3U7BA 2NUXA 3B9OA 3RUBL 1IZKA 2X2GA 4IICA 1W3NA 1EGZA 4D72A 2P3EA 5FKYA 1E5NA 3M1ZA 3ABXA 2PDXA 5CZJA 1V02E 4KIRA 3N1AA 3UNDA 4LYQA 3E2VA 5A8OA 4L6HA 4GBDA 4KCTA 4RNFA 3GS6A 3WLKX 3B04A 3EOEA 1U5VA 1R6WA 2POTA 3WBXA 1F6PA 3BG5A 4QEEA 3E2QA 5TF0A 3UR8A 3BCFA 1AQFA 5C70A 1VZWA 4ROQA 4XAFA 2HROA 1CGWA 3QPZA 1IR2A 4GJ1A 5KZDA 3H2NA 3VVGA 3E5PA 4G5DA 1PHQA 3PF3A 4FNQA 4DLFA 4F0RA 3M0ZA 4PUWA 3EXRA 3S0CA 1OYAA 4XD6A 2ISSA 1W9PA 3G1VA 3TJXA 3EAUA 3W6MA 1R30A 5I06A 3UF9A 3OZPA 4LAMA 5FSEC 2OX4A 4V33A 2VC9A 3IJQA 1TWZA 5CQ1A 4UMCA 3UJSA 2BS9A 3H7VA 2X7VA 4NX5A 3L5MA 4NNAA 1VF8A 4YHEA 5FEPA 3VD9A 4K7VA 2HCVA 1PKYA 4AF0A 5LZLA 1CT5A 4K1WA 3IAPA 2VP8A 2D2OA 3GKAA 3PTDA 1KM4A 1UKQA 5HK4A 3S3GA 2VCBA 3KL0A 2CZDA 1QK0A 3VD4A 1IWPA 5AOUA 3NQ2A 3NVDA 2BXVA 4ZB5A 2Q01A 4AIUA 1V7YA 2PLKA 3CZEA 7TIMA 3KOWA 3RYSA 4DXVA 2W67A 4GGBA 5HPOA 1HUVA 4URIA 3DYMA 3LDVA 4DYKA 1ZCOA 3VXGA 1H7PA 3PR2A 4J1OA 1KFBA 1C7SA 3PG9A 4W8LA 4H6QA 4B9ZA 2EXOA 4CN6A 3W7LA 4X60A 4MKVA 1WO2A 3U9IA 3ITGA 3IARA 3T0AA 1GJUA 4WDTA 1ZP3A 2J8GA 4MJ2A 4BF9A 4WCJA 4AW7A 4JCMA 2G4FA 3FSTA 3WNPA 1IXQA 2QDHA 3GW0A 3CHDA 5BWAA 5T9BG 2R1MA 1GJPA 4XBSA 5MKGA 2BXYA 1CYGA 2CW6A 3P2VA 2J66A 4PYSA 2OMAA 4IGSA 1KB3A 4L5ZA 3DG6A 4QBXA 4PFHA 1EZWA 4NZCA 2BHUA 2J7GA 3W7EA 4REQA 3MI6A 5C7HA 3H54A 4R33A 3S47A 4ZODA 2NXGA 4S2BA 3RLUA 4GI4A 2BOGX 2O9TA 4GC4A 4LGXA 2WM1A 2YCLA 3F1QA 4CD4A 1UKPA 4C7DA 8RUCA 4OOUA 4W86A 1WAWA 1NDYA 5DN1A 2EG6A 1NOFA 2Z25A 1VBUA 1XINA 3KWXA 1FHVA 3LXBA 2NXIA 3LZ3A 1POKA 1UR1A 3G8EA 1OBAA 4GYJA 3TXZA 3HPFA 2IKIA 3GNXA 4CCEA 1T40A 3GTHA 2ON3A 2FZMA 1HJQA 4B9YA 4O4WA 1H7NA 1FCUA 1YIXA 4TO8A 1UC5A 2JEPA 1TTPA 3FEQA 1TV3A 4JYFA 4ZO6A 3URBA 3S1WA 5E6ZA 4X22A 4M51A 4H6KA 1E43A 3T78A 1LZOA 3KS5A 1F3XA 4NF7A 1W5NA 1CZ1A 2Y8KA 1UP2A 2WZEA 5DRCA 1GWJA 4KCVA 1MNSA 3AALA 3N9SA 4PMUA 3IAQA 4NXSA 3OB8A 1S5TA 3HO8A 4JTHA 4ZOBA 1A5SA 2FPTA 1KFEA 3KM8A 1W3JA 1G67A 4E5TA 1FWEC 1KGUA 1ZFJA 2GLKA 1H50A 4JGDA 1TKKA 1YDNA 4FXRA 3NQ8A 4LUSB 3YPIA 3TSMA 3WDQA 5A8QA 4PTXA 5DF0A 3BLDA 5CCZA 4CNNA 4DO4A 4W4QA 3NXFA 3MHFA 1BSIA 4EKJA 2XZ9A 3NWRA 4JL1A 3RF9A 2R1KA 2OEJA 1BTCA 4WQ6A 3WSUA 2ZA3A 4H8VA 3AYSA 4IG2A 5EBAA 4GNKB 2DW6A 1QCWA 4C6PA 1F3TA 2QV5A 4QQ3A 2W9MA 1XS2A 5E9AA 1YXDA 2YBUA 1YQ2A 2A0NA 4MZ1A 1YW1A 1W9VA 2P88A 3NEHA 2FJKA 1PS9A 1GW1A 4PULA 1QNSA 5CC3A 4FAMA 4GNJA 4FPSA 2F9RA 1KLZA 1RLCL 3U2EA 1JEZA 3GR7A 1F4HA 2Y7GA 1DP0A 1ZZMA 1KGWA 4GIAA 2Z7GA 4EF8A 3M5ZA 3ZJ6A 2JBMA 2ZA1A 4M8UA 1ZHAA 1UCWA 5CZ0A 4M1BA 1R3VA 4HCHA 4HZ6A 4MB1A 1H1NA 4XISA 5BRQA 3W87A 1WNOA 3B0UX 3NZPA 4BS0A 1U33A 5D30A 1W0MA 4NJJA 1UP0A 1WDSA 3W00A 1KV8A 1PE1A 4AX6A 5HMSA 3LI1A 3GZAA 4KQNA 2NLYA 3LM7A 1SZEA 4GXMA 4IIDA 3OVQA 3OZMA 3ZLGA 2DSZA 4DJED 1KTNA 4QJ3B 1DTUA 3GC4A 3WK0A 3TFXA 3TAKA 7CGTA 4B92A 4IP5A 4LH8A 2W79A 4B5NA 3M5YA 3PBYA 3R13A 3DC0A 1AQHA 1E4LA 3TSDA 3D6NA 3TU9A 4QAWA 4QCFA 4PL2A 4Z1YA 2NZLA 3WG6A 3ABZA 4GK8A 5AVHA 4HT3A 1PTAA 1KA9F 1HNYA 4XAZA 1R5YA 3S2MA 5D02A 3N11A 1TIWA 4K39A 4TV5A 4RLIA 4E2VA 3KTXA 4D6EA 5DMLA 4HQVA 2P53A 3MBFA 3NSMA 4B3LA 3T8QA 2QNEA 1CGYA 3L9CA 4E6MA 3GU2A 3VD3A 3WUBA 1KM2A 3NM1A 1TPDA 3B4UA 4UQDA 3C2VA 5BU9A 1BWLA 4Q4QA 4CU7A 3ARTA 3SCQA 1W1A1 2XN2A 1WBJA 4IFKA 5HNRA 3AWNA 2P1FA 3LS9A 4PE8A 1Q85A 3MP4A 1BWKA 1FOBA 3SGUA 5MF5A 3QV6A 4HU8A 3C56A 3KDNA 4LU0A 3DFPA 3W07A 3UA4A 4O0KA 2QDGA 4E4PA 2F84A 1H49A 3C8FA 2AQOA 1OEPA 1R0MA 3JS3A 1L6SA 1SM9A 4ADTA 3HF3A 1TV5A 4CU6A 3T0TA 3LENA 1ITCA 3SIZA 1OWQA 1TIMA 2Q8ZA 3GXIA 4C7GA 3GG0A 1QJWA 3WK1A 2FKPA 3GK0A 2ZE0A 2E1DA 3HJEA 4HPXA 3AUOA 4Q8OA 5HWNA 4ZENA 5AHIA 4PUDA 1QT1A 2J13A 1RLDA 3OYXA 4B2DA 3R43A 1CPUA 2GL5A 3C52A 1GQKA 1TUFA 4Z2KA 2WPBA 5AC8A 1W3TA 1PX4A 1KWGA 3J7HA 3PNUA 4ZXLA 3HFYA 4C6JA 3BMXA 1TPB1 2WMIB 2V30A 4NRRA 5CG7A 1L8NA 1KBKA 2J7HA 1WP6A 1OM0A 3W1QA 4G7FA 3UG8A 4LV4A 4UTWC 2OX1A 3S5YA 4JNYA 2FH6A 1MVYA 4R88A 2PTWA 1XC4A 3KXQA 3ABQA 1R3SA 1TZZA 4WXZA 4WKHA 3GIQA 5I6SA 1TPFA 4QRNA 5CZKA 1PTDA 1ML1A 4HA0A 3IVSA 1MW0A 1E1CA 1UKOA 2GDUA 1ZBVA 5AYZA 3BV7A 3TN3A 2WKJA 2OLSA 4UTHA 4M19A 1UKSA 4MWAD 3TP4A 1JDEA 3B9AA 4K7YA 2BTMA 3HMCA 1KBBA 4KW2A 1RALA 4XZ9A 4C6FA 1FKWA 1X6LA 2YYTA 2BGQA 4IFOA 2XN0A 3KHDA 1K03A 4AZHA 1S1RA 1LRNA 3VUSA 2EQDA 4ZOEA 1DEDA 2PDBA 3SN4A 3CUJA 4NJGA 2PC4A 3KP0A 1FWGC 3F5KA 3VMOA 2NXHA 4XAPA 4ES4A 2R9RA 3K4AA 3PJUA 1PDZA 4U28A 3MKKA 3N73A 1XIMA 1GVEA 2ASHA 3P3BA 1A5KC 2C15A 2GGGA 4XVEA 4D6FA 1CB7B 5LNWA 4DJDD 3BVJA 4IQDA 4J2PA 2QCFA 2GJRA 4W87A 3E02A 3LBOA 1G6CA 3MDUA 4GA8A 1S39A 3TYBA 1NIUA 1RXOB 1OZQA 4F2BA 2G3NA 5D2VA 3QYSA 4GGHA 1PZ1A 4ZQPA 3HMJG 4DI8A 1JPMA 2VTFA 3XISA 1XDJA 3QRHA 3BMVA 5GJNA 5JVLA 1ADDA 4W7WA 2WZTA 4HSNA 5C7VA 2V0TA 4XBJA 1WKYA 4MB5A 3LSBA 2JKPA 3ARPA 3TQ0A 4JYDA 1TR1A 1ZL1A 1Z41A 1F5ZA 1TELA 3WLPA 4NNCA 2L5HA 1Z44A 4TOQA 5G4EA 3CAKA 4N6EA 1EO7A 3N3TA 4MZ8A 3GQYA 1CGTA 3VC5A 3GAKA 1IR1A 3MV01 2OEMA 4R34A 2GZXA 2CWNA 4Z2LA 1V6WA 1QW9A 4S3EA 1G4SA 4NIRA 3FOKA 3RU8X 3AJXA 4JTAA 3TN6A 2D2HA 5IDZA 2WOQA 1V8EA 3F2BA 4FR6A 3WNKA 3UJRA 2QPUA 3S6TA 2QYGA 3QYQA 4WJXA 4HK5A 3ZR5A 1AQ0A 4XD3A 2J7FA 4JD4A 1C29A 1IWBA 3EBVA 3BAIA 1JNEA 3BH4A 2WBGA 4PBEA 4F66A 4DNHA 4HPGA 4PMJA 5J5RA 1EIBA 1W1VA 4DVOA 1V93A 5I78A 1AMKA 4D6HA 1O12A 4S3DA 1CXEA 3PP7A 1QNVA 5CJMA 5B80A 2JQXA 2D1ZA 4C6BA 3IRDA 4FI4A 4JFTA 3I4KA 1E5JA 3N2MA 1WZMA 4MIMA 1UIPA 1JFHA 4I6VA 4TQTA 2YDSA 3N2TA 3N29A 2CBJA 2G3JA 1JNDA 2VZSA 1VS1A 3NPUA 1OF6A 4YWIA 2J9ZA 2HVNA 3B97A 1HTIA 2Z7KA 3ZXWA 1XL9A 2NVAA 2XSBA 2YL5A 5CZTA 5DQPA 2B7QA 1REQA 3CL6A 1EDTA 1LLWA 4GVIA 4AQLA 1W9BM 3W1UA 3AXXA 5CZSA 4QDPA 3CLWA 4JX4A 4IZGA 3N12A 3HM7A 3LERA 1JPKA 2QJIA 2Y1HA 1V0MA 4NQ1A 4B5XA 3SIMA 4S3AA 5TAOA 4EE9A 3W2NA 1VFFA 3E0VA 3LU2A 1VEOA 3SI9A 1A5UA 1X1OA 4JICA 2V3EA 5I00A 4L4OA 3AWOA 4KESA 2X40A 3VA8A 3SCVA 2FPVA 4BWLA 2ZXBA 5BRPA 1WCGA 3GU9A 4XZHA 4WKFA 4KWOA 4JIHA 1VENA 4IIFA 2IKGA 3AXKA 4RZBA 1EA9C 3CH9A 1Z7AA 4IQEA 4LC8A 1FWFC 1AD4A 3A9IA 4GX9A 3D3AA 4H01A 1GQLA 5CH9A 5D9NA 2C13A 4PL1A 2OZ0A 1EC8A 2VRKA 3VNLA 3A24A 3T42A 3VGHA 1S2CA 1M7PA 1WKEA 1RJRA 3W9ZA 5FEXA 3A5VA 5BMWA 3NEVA 1GVFA 4UFJA 4I9JA 5ECVA 1OHLA 4Q4MA 1UMLA 3KCOA 2CLMA 3F4CA 1DIOA 4ZB2A 1KM3A 5BRBA 1V6TA 3THQA 3WNOA 4Q4OA 5A5WA 1RCQA 4XO7A 3KBNA 3NYDA 3TR2A 1L6GA 3IJLA 1JCNA 1FDYA 1KGXA 1CEOA 1R9XA 2XSXA 1V79A 3U5UA 1BQGA 4O11A 4RNJA 5LHEA 1GQIA 4UMAA 4B90A 2YR1A 1WAUA 1I0DA 3U2ZA 4BFAA 2I5IA 1B0IA 3SECA 4ECLA 2Z29A 3CU2A 4JL2A 2HXTA 4DPQA 1GVSA 3SDOA 3IACA 5J5DA 4FF5A 1O60A 1TJPA 3C5QA 4DNMA 3IVTA 1CB2A 2PP3A 4N4PA 1I6NA 1WOBA 2JEQA 5M5DA 4L9XA 9XIMA 3O0FA 4NZFA 1G4TA 1J0ZA 1FWNA 3W7CA 4LX4A 3QM3A 4H2HA 4N42A 1RAKA 3WUEA 5FL1A 1UMYA 3H55A 4LC6A 3O63A 1GKPA 5FL0A 2DUXA 5A8GA 3EDEA 1WV2A 2GJXA 2YZRA 3HB9A 1B4EA 3PS7A 3UT0A 4CLMA 1HJVA 2P0IA 3MKCA 2A3EA 4NY2A 1FP8A 3HJZA 4MUZA 1FXPA 5C71A 3IGUA 2PDCA 4GI9A 3VKAA 3W1TA 4UR9A 4ZL1A 4RZ6A 3WK3A 1O6IA 3QZEA 1F8MA 3UD6A 1IE7C 3RRXA 3SURA 3QZ6A 3TTYA 1HFBA 1HF6A 4IMDA 2AL2B 3EX6A 1NELA 4X3ZA 2QS8A 3QFWA 4W9TA 3DFHA 1DIKA 1M04A 2PA6A 3T0BA 2WVVA 3A4WA 4PMXA 2RDTA 4LRTA 2FVMA 1H61A 4RDYA 4KWSA 3V5CA 2XFRA 1C7TA 5I3JA 1QRQA 5F4XA 2VZOA 4GUFA 2GWGA 2VFEA 2ZUUA 1JDFA 4XIAA 1ISYA 3PWGA 3MA8A 1EB3A 1QPQA 4JIIX 4JPGA 3C2YA 3E49A 2A4AA 3ZLHA 2IMRA 3BICA 4Q8MA 2WVUA 3MWAA 2G96A 2I5QA 2DW7A 3A3XA 3DEQA 1XSJA 2OOGA 1EJXC 4GWEA 1UWRA 4RPQA 4S1FA 2C14A 1JAKA 1VFOA 2BV9A 1OYBA 3MDWA 3SCNA 1EXBA 3C2RA 4FK9A 5FJOA 1E9YB 5C54A 2E5DA 4B5WA 3M0VA 1ZLPA 4INFA 1FWWA 3EGJA 4LYRA 3TONA 1SFLA 4C5YA 1JGMA 1FP9A 2ZWYA 4EPBC 3QKZA 1XYBA 2RDWA 1S2UA 3R8GA 1TPC1 3VE7A 5G2IA 5A6SA 2V69A 1VEPA 2GVEA 4JY9A 6PTDA 2QKFA 2QLYA 2J7CA 3Q67A 1X8FA 2KZHA 3F4WA 4I5XA 1UP3A 5G2HA 4Y9MA 1UWAA 2G3MA 4D71A 5TNVA 2PDIA 3UJ2A 5CGTA 4GD0A 3L4WA 4CNSA 4UTLA 4QAIA 5RUBA 2P8BA 3WQ5A 3POHA 3W28A 3EOUA 2OLHA 4PB5A 1XIFA 2RDXA 1UOZA 1OIMA 1T5AA 4ZO9A 4N2YA 5FIPA 5DANA 1KFKA 1WOAA 5I3GA 3IGXA 1V3MA 3N2XA 3L67A 4DWSB 3KTSA 1VPXA 1B3VA 3W7GA 1SYTA 4Q8TA 1JXKA 3NQMA 3VIMA 3GHSA 3VNJA 1SW7A 3CQHA 3CS2A 1H2JA 2P8CA 3EX1A 1L2UA 2QPXA 2FDMA 1KW1A 1Q6EA 1PPIA 2UBPC 4GO9A 5HOSA 3M0IA 3EWDA 3HN3A 3PWAA 3WQWA 2VL4A 2YA2A 1FWDC 3AZSA 4GZIA 1B3WA 2J25A 2PDJA 3IIXA 1XYMA 3VNYA 2ZICA 3SADA 3HA1A 5C5YA 3QF0A 3UR2A 4D6GA 4U2ZA 3R58A 2Z28A 3BLPX 4EAMA 3WDJA 4F3HA 1ZJHA 1FKXA 4KPLA 3G1SA 2QCHA 3L4VA 2QR6A 2CLEA 3IJ8A 1VQTA 4P7OA 1YX1A 3VZZA 1OGSA 1O95A 3AIQA 5EKYA 4KRUA 2X09A 3FXYA 4HMCA 3MMWA 3OLIA 2Z27A 3ZMRA 7A3HA 4OE7A 1RJPA 2QEZA 1KR0A 1NH6A 3TWBA 1QBBA 3C6CA 1W3LA 3G1HA 4PMRA 1G01A 2ABBA 1XBXA 1NAL1 1MDRA 3M0LA 4C1KA 4CNPA 2BSLA 2AAMA 2WK2A 1X8CA 2Z00A 4ZTYA 1DL3A 1PZ0A 2PSNA 4IXHA 1W3IA 4BQ4A 4H8UA 2OEKA 3IV8A 3GLCA 3P5YA 3VI2A 2J75A 1J0IA 3BLIA 3CWHA 5DY3A 3GUGA 3KVLA 2REQB 5G2WA 3PHAA 2B81A 3WD0A 4XKYB 4H41A 4B5VA 3MWCA 4BR1A 3E2RA 2EBNA 2J6VA 4MAVA 2IS7A 2BFGA 1J18A 4BY3A 4Q7BA 1H60A 4DF2A 4H8NA 3RLGA 2CLPA 4C6OA 4E38A 1X38A 4RW5A 3S2CA 4PTNA 2EHHA 3QOKA 1KFLA 2XJ7A 2H6RA 1Q5MA 3ZZ1A 1GZ1A 2PTZA 1JZ6A 2NQJA 3TYUA 1B5TA 3E12A 3MMDA 4XV0A 4HBKA 1EF3A 1UH3A 4BZYA 2E9LA 4UTJA 1PJ9A 3U4FA 4KFOA 3WNNA 5HNTA 3C0JA 4DJEA 5F2LA 1FCQA 5ECUA 3F5LA 1UZHA 1LWHA 2WZMA 1POJA 3WYZA 4WZHA 5CJNA 3LXCA 3O6YX 2VFHA 3UESA 4DB7A 1BYDA 1GYLA 5EL1A 2WSPA 5L6UA 4MPKA 4UOZA 4DN1A 2HRWA 3KL5A 4YTTA 2W27A 4FHAA 1TX2A 3EMCA 1V6XA 3KOXA 1TV4A 2DT3A 4W89A 1RD6A 4Z1DA 1J0KA 1RP9A 1UUOA 1LL7A 4IHCA 1DIEA 1XH0A 4U5IA 1ZAHA 1W32A 3AIEA 4EP8C 3DBNA 3FV9A 5T8GA 3D0CA 3IWPA 2GOKA 3AHYA 5IHRA 1SQ7A 3THCA 2GUBA 2XVGA 1M65A 4ZXOA 5T91A 2R6OA 2V3FA 1Z69A 3FA5A 3APTA 3CGTA 1NDWA 1ONRA 3NL2A 3DFTA 1OGGA 3WMLA 4HU0A 3BAJA 3G1FA 4K36A 4GVGA 3V16A 3NURA 4ASTA 4GLEA 4M81A 4H6RA 4LB3A 2X05A 4WRHA 4YN5A 3HGRA 3OLGA 2B4GA 4EANA 5A3HA 3U8GA 2ISDA 1EQCA 4OQVA 3ENLA 2AMXA 1F9CA 4DXKA 1XBYA 1KRAC 5BXPA 1EL3A 4KRZA 1GEHA 3TCEA 4B16A 3NNTA 1OINA 4H1ZA 2QZRA 1V7AA 1XSIA 4CCZA 6CGTA 3VD7A 1XDLA 1YE6A 2WHJA 4R9OA 1OT1A 1F6YA 2XH4A 3THDA 2D0HA 3RRAA 2IUZA 4LJ3A 1E6RA 1QHPA 4AIBA 2G95A 5KMYA 4NZ4A 4EVZA 1E3ZA 5C0QA 3NDZA 2WSYA 1TTQA 4G56A 4DJFC 3RFAA 5C2XA 4KEZA 3CTLA 3BWWA 3OHIA 4HB7A 5AHEA 1RV8A 2C0AA 1YTEA 3TE9A 3LLFA 1Y0EA 1GYMA 1KCLA 1OCBA 4BEQA 3HPSA 4F48A 4L56A 3U2CA 3E0IA 3HFTA 3OVGA 1FWSA 2XM1A 4ZFMA 4MY1A 1Q6OA 5DMMA 1YE4A 2G41A 2ADAA 4Q33A 5CAKA 5FAGA 4JN7A 3PZQA 3W01A 5JH2A 2D0GA 1UR2A 4LEQA 4OUIA 3UQNA 1OCNA 3EYPA 4ZO8A 2C1GA 5JIWA 5F2IA 4J9JA 1SFJA 3PZVA 3AMKA 4J35A 5D2YA 1R87A 3K46A 4MWAA 2YOCA 4M80A 4YTRA 1MSSA 1UW9A 5HJXA 1LWJA 4AEEA 1A5CA 1B3ZA 4KF1A 3BW4A 3NQVA 3UG5A 1DXFA 3RX4A 5REQB 1XKJA 2CNCA 1XRFA 3ISIX 3BK0A 1G4PA 4G2DA 4O1EA 3W1AA 3NZQA 2R1LA 1UWTA 1QR7A 1TZ9A 3ONBA 3TNBA 4YWSA 2RHGA 1BTMA 3N18A 2C6QA 2PDUA 1JRBA 2F61A 1B4KA 1TPVA 4IMFA 3TW9A 3EWWA 4HJFA 2ZZ3A 1FH7A 3WENA 4O52A 2VDHA 5D03A 2Z2BA 5AC5A 1XPGA 4J2MA 4Z2JA 1HX0A 2XIOA 2PZNA 1UD4A 4DJDA 4PMVA 1PHWA 3NXLA 3UR7A 1ZENA 1I2PA 3N4AA 4JQ4A 4NI3A 3ME3A 4GUIA 1JZ7A 1E0VA 1J0HA 3APGA 1A4LA 5HNUA 4XIMA 5HINA 3CL7A 2ACQA 1RP8A 3VKDA 4UTTC 3COTA 3W7JA 5EMMA 3PZOA 2ZYFA 4I8YA 3W1PA 3SJ3A 3EPOA 2E77A 1BYBA 1QWGA 2FGBA 1XRVA 3SUUA 3A4JA 1VYSX 2A79A 1M53A 4A21A 1TTIA 1I2RA 3VZYA 3W1RA 3DZ1A 3AIRA 4QIUA 3GU1A 3MZNA 1QNPA 4Q4KA 4FNRA 1HKWA 1DWGM 3NO5A 1DJWA 4JS3A 1ONEA 1SUXA 3FLUA 5BOOA 1W1TA 3DFSA 1AODA 1LTDA 3B8SA 2HJPA 2QPSA 4UTMA 3PZ9A 3BZJA 4O12A 4W85A 1US0A 3C3NA 3LHZA 2ANUA 5HXMA 2OU4A 3WDHA 2FH8A 4PMZA 5HATA 5CPTA 1NU5A 4AIOA 3LEPA 2PDWA 3WH8A 1WQ5A 4Q8PA 4Y9AA 4NZJA 1UH4A 3RX3A 1RA0A 3EMQA 1B9ZA 3OVRA 3LV5A 3GTIA 5DT5A 1I60A 2J62A 1A53A 1JXJA 3B9DA 2CZFA 4ORIA 2YB4A 2QW5A 4JTRA 3I68A 3OZOA 2D3NA 2TAAA 2H9AA 7REQB 1R3TA 1BVZA 3JUGA 4HNTA 5AHLA 3OBEA 1NWRA 2PLCA 5EFFA 4CEXC 1J2WA 1MRAA 1N2VA 2X7WA 3F4VA 1J4EA 4WKAA 2BWGA 4W8AA 1DJGA 2VFIA 1T6MA 1DQWA 4KKXA 2HS6A 3WK2A 1W1YA 3AU2A 1H4PA 2D69A 3S1VA 3LX9A 2CETA 2YCKX 3WJXA 3BAKA 3PAOA 4H83A 1TJRA 2GQAA 3QBUA 1X98A 4LCQA 4QM1A 5IOBA 4A22A 1EBGA 3DH7A 1TRIA 3NG3A 3T55A 3XINA 3E9AA 3UXKA 5EGRA 2QQ6A 2VEIA 1E0TA 3GC5A 4IQLA 4LQ1A 1ISVA 4QP0A 5F1VA 4MYXA 3URAA 2ACRA 3W24A 2OTDA 1OD0A 2BY2A 5I24A 2D22A 4IGHA 4M0XA 3VKBA 1QFEA 1UUMA 3VINA 1JAEA 2X0SA 3VNIA 1SGJA 2B7NA 3EDKA 3GDRA 1P4CA 2VR4A 5FACA 5E70A 3MVTA 1FFQA 3STGA 2DT0A 1R3QA 2CLHA 5A6KA 1K8XA 2QGYA 1R2TA 4B5UA 3SCSA 1A3WA 4Q6XA 3ZLFA 4KMQA 3O16A 1JPDX 3ARVA 4H3DA 3DXIA 2FB3A 4PODA 3L4UA 2PU1A 2O9RA 4QFUA 1A5MC 3RNDA 2D3LA 1PVNA 2YW3A 1WKDA 4LFYA 3EDDA 1X7IA 1ENUA 4IP4A 4GNVA 4DM2A 2OB3A 1DOSA 1MZRA 4JHMA 1E0UA 4XBKA 4JIEA 3TROA 4BJHA 4MWAE 1Y65A 3FY1A 2WLYA 3QH2A 4JZ5A 4MPQA 4NNBA 4WDXA 2E6DA 3MTWA 5G4WA 1EJVC 4ROPA 3T07A 5G1TA 2C0HA 4JTIA 4ZQMA 1W3KA 4MNJA 5I02A 1W6TA 1V77A 2QMKA 4PCFA 5AZ1A 5LA0A 1FRBA 1RK6A 5CKSA 4H04A 3OTRA 2J8TA 1XLAA 7ENLA 5HPCA 3LTPA 1HZYA 3U7VA 3I3BA 1PDYA 5KZ6A 3TYAA 2V2CA 1GK8A 4QQUA 2CHRA 2RH9A 3VUPA 4QE4A 3ARXA 2QCDB 4EWJA 1OIFA 1SW0A 4GUJA 3ARRA 3S5OA 4LVBA 1E1FA 1M5WA 4M24A 4C6MA 1QO2A 4EXQA 3GVRA 1MQPA 4L6OA 1D7KA 1XQKA 4ATWA 4JEQA 4UC5A 1K9TA 4EPDC 3PZTA 4ML9A 1R46A 1A5LC 2D2JA 5I3IA 1XW8A 5G5IA 4CEUC 4UNKA 1JFXA 3WFLA 3CWNA 2D0FA 1LQ2A 4K8EA 1XISA 3WJSA 4MNKA 3HQNA 1R8LA 4GJJA 1XUZA 2NX9A 1XX1A 3W7QA 4P8XA 3FN9A 1SJDA 2GSHA 5JU6A 2X8RA 4F0KA 4POCA 3KLKA 1TSIA 3ALFA 1UD5A 4A05A 1UH2A 3BLEA 1L9WA 1TWSA 4NHVA 5DCBA 1VEMA 4GPNA 4IMCA 5EBUA 2J8FA 3OP2A 3VAVA 4OVXA 4OV4A 3W1MA 4UFMA 4DELA 2EGZA 1CBGA 4FX7A 2PGRA 2E25A 3GFXA 3PZNA 1W8GA 3N9KA 2VD8A 3FVDA 4CU8A 1CLXA 1ZRQA 4XZMX 3NQ7A 1J11A 1WZKA 3CTTA 2Q71A 4WK9A 1Z89A 3S42A 2QUNA 3K8KA 5IBXC 3K5XA 1UD6A 3LXAA 1V3KA 4CQBA 3MS8A 5JBEA 2PTYA 4KEUA 3FKRA 1Y5VA 2CIPA 2DZTA 3GFYA 3FHQA 4D8ZA 3H2AA 1L6FA 4E2BA 3S1UA 2QAFA 4YXGA 4O1AA 1X1NA 3ZVIA 1LOQA 1Q63A 3WQ4A 3WZ0E 1LRQA 4PZVA 3NQEA 3SN1A 3OA3A 3WX7A 4CNUA 2PF8A 3UCCA 2BY0A 4KRTA 3NPWA 2DT2A 3PAJA 4PMOA 4JTSA 1PIIA 4S38A 2J79A 1T0OA 3WBAA 1L8PA 2Q02A 3WLLA 3PBVA 5A2BA 1LUCA 2AOSA 3W1NA 3C4UA 4IFRA 4HU4A 3ZWTA 4ACZB 3V75A 4AD2A 1GKQA 2BHYA 1XYCA 6XIMA 3P67A 5IRPA 2QUTA 4DI9A 2P50A 3H2CA 4AFYA 4AVOA 2XU2A 2OCZA 3WDIA 1LBLA 2RAGA 4HCLA 4E3VA 3FDKA 4M29A 3FDGA 4XQ6A 2HE8A 4PUEA 3MBDA 4YHGA 3QTPA 3T09A 3B40A 4HNVA 3WF2A 3QW4B 3SCOA 2VRJA 4WEVX 1XD0A 3G1DA 4LUYA 4L1WA 4UB9A 1MW1A 1U5HA 3GNDA 1CDGA 2FHCA 1H7RA 2QF7A 4A8IA 1FQ0A 1TZ7A 3BJFA 1F3EA 3H6OA 1HXJA 4WF7A 3LHVA 1R2RA 4IPNB 3OO2A 1U22A 1ZJBA 3KOFA 2JF6A 3WLQA 2WCAA 3MCMA 3KAOA 1JULA 1EF2A 1W8SA 5FJPA 2GQ3A 3GY1A 3SCWA 4IISA 1VLWA 2PMQA 4GFIA 1OG6A 3R79A 4PSRA 4E0CA 4CD6A 3PWIA 3B8IA 3S6DA 2QXWA 1BEUA 4FALA 3SJNA 3QV8A 3GDMA 5HWJA 3VOFA 1V0LA 1AH0A 3QFEA 4O19A 4P8UA 3VCRA 1PWMA 2ZRZA 3ZFHA 3GDBA 5IXEA 3SCUA 3PZIA 2VQUA 2YA0A 3FEMA 1H63A 1BXCA 3P61A 4C91A 2Y8UA 3CO8A 2QCGA 1TMLA 3HQ1A 4OECA 1JF5A 1XLIA 3OG2A 5FCZA 2YXGA 2Y61A 3K30A 3B9NA 4M56A 3DERA 4D1JA 2V3DA 3W7RA 3QHMA 2C18A 3PM6A 2BXZA 1B31A 3T05A 1NFGA 4JQ2A 1TMQA 2DGAA 3T2QA 3WNMA 4R85A 3PNZA 5I77A 2OT1A 3A3WA 3R8RA 4JQAA 2YL6A 5LNSA 3TC7A 5A6BD 1W9XA 4IUOA 1VBGA 2ATSA 4WX2A 2WNWA 4UTKA 3C2FA 4JHZA 1KFJA 1QO5A 1S2AA 4FOKA 5DT7A 4K68A 3KEHA 4ERGA 3LGGA 1NDVA 4O17A 4QISA 1FHUA 2HK0A 2PCQA 2WPGA 3ZSTA 1K3UA 1EDQA 4N9BA 4PFMA 4AHPA 3ERPA 4CN4A 1XLHA 1IEXA 3I6RA 3EWXA 4U3AA 1JCYA 3GUWA 4Y8EA 2J88A 1GZJA 1DE6A 3VGEA 4JEJA 4DWSC 1K4HA 2WZIA 1UC4A 2SFPA 4J5NA 2V38A 2W61A 3WFAA 4CD5A 2PWFA 3W6LA 5JQ9A 1YBQB 2DZWA 1F2JA 4PH6A 4HN4A 3EOLA 1XLCA 1I45A 1ADOA 3OW1A 5FSDC 3LYEA 5DXYA 1PEZA 1RBOB 3G0SA 3GVQA 4KIEA 3L2IA 3LCXA 3AROA 1UR3M 2V5BA 1CTNA 4LBUA 4AZ5A 2CLOA 3BUVA 4LAKA 3UG4A 3SRDA 1XCFA 1J2BA 3UY7A 1MFUA 4LB4A 4V27A 1HKVA 1SSDA 1K8ZA 1L6YA 3QHNA 1OX4B 1F3WA 1PX3A 2FLIA 2VFGA 1GJWA 3K8MA 1G69A 1EXPA 2DSWA 4DY1A 2CKRA 4BF7A 1UZ1A 5A8NA 4D6CA 3RR4A 3RG6A 3NZRA 1UBSA 4HTYA 5AHNA 1P0DA 5FF7A 2JKEA 2WHLA 1IXPA 4XAYA 3M46A 5CBIA 2V5KA 1E6NA 2VEMA 3W7KA 4LPCA 4JTTA 1X96A 1IYXA 1ADSA 3REQB 4DPPA 4AZCA 2HV5A 1WBHA 1XYFA 1EQPA 4IOTA 3O0KA 1DWHM 3USBA 5AZ0A 4GX8A 4MB3A 3URNA 3CZ8A 1EP1A 3TQKA 3KOYA 1TQJA 2WB5A 2HBVA 1QPRA 4QG6A 1VPYA 3RJYA 2OQYA 3NAVA 2V63A 1FDJA 3NZGA 4D2JA 1ZQ5A 2FTYA 4NP7A 3QMTA 1F4AA 5KZEA 3LN3A 3MMUA 2W3ZA 1OX5A 4UNIA 3WQFA 1H11A 3CQIA 5FJTA 3W3OA 2GGHA 2VX7A 1V4YA 2WMFA 2TPSA 3MQTA 1IV8A 1KM6A 3MCNA 1SO5A 3OIXA 3MI2A 2Y89A 5LGXA 3GG8A 2R94A 2DH3A 2VWTA 1FWTA 3VKJA 4LY8A 4YCOA 3TA9A 4JX5A 1PIGA 4QR6A 5D33A 1XJBA 4RX0A 3RX2A 2JGQA 4QX4A 1GOOA 4CQ8A 3A64A 4P61A 3FXGA 3UCDA 3B0VC 5FF4A 3DBPA 1ITQA 4PSPA 3RN6A 3ZJKA 3WF3A 1R9ZA 2GVGA 3URQA 3B0XA 1H7OA 3PFRA 2WO5A 3DYPA 4XKYA 3CV2A 2ZZ4A 2I7GA 1PB0A 1ELSA 5HMEA 3CZGA 2JKAA 2PE4A 1UG6A 1CECA 2DP3A 5E09A 1SJCA 1NWUA 2CWXA 2CLIA 4YCPA 1VJSA 4GIRA 2WQPA 1WPCA 2BLEA 3NSXA 5CXPA 3V1HA 2ZC8A 1PYFA 3IJ7A 3M0HA 1XH2A 1W9DM 2QGHA 4UWMA 5FF0A 4KFNA 3SRKA 3A13A 3AFBA 3AIUA 4HNOA 1G4EA 4RCXA 4L9YA 3V4BA 1IQ8A 3LRLA 3VPLA 3CPUA 5K4ZA 3V0SA 5C9UA 1KXHA 1ZP4A 2C8NA 4KWVA 4OUEA 3PBUA 4YVVA 3EWCA 4PTWA 3RHGA 2OJPA 5I79A 3VE9A 3GYCA 4F9JA 2X41A 2G5WA 4GHRA 5TBOA 4ZR8A 3W86A 4HHHA 3MT1A 2WC7A 4LUTB 1O5XA 2OG9A 3H2OA 1I4NA 4TVCA 4GYFA 4QNEA 1J93A 5BU6A 2ZX5A 3RR1A 3GXFA 3P8JA 1JD7A 4MWAC 5KZMA 4UQBA 2X16A 2OWWA 3VX0A 1BGAA 3TTSA 4FP1A 4GC3A 3W7PA 1HKMA 4HA1A 4S3BA 3GXNA 2QUVA 1ICPA 2YFOA 5EPDA 2FGZA 3S4TA 4GZ7A 2E0PA 3KRUA 1M03A 3TAOA 3AUJA 2YX0A 5F4SA 3O1NA 1QHOA 4Z0SA 4ZOAA 3GNPA 3VM7A 4GY1A 4J3ZA 1VP5A 3PFMA 1UOKA 4IJRA 3DX5A 4WHBA 1UJPA 2YLAA 3GE7A 3M6YA 3SUSA 1G7UA 2EPNA 1ISZA 4F2UA 4GQGA 1XC6A 2PWEA 4AVFA 1VYPX 2QAPA 2QCCA 2ZIDA 4PUNA 4AEOA 3STFA 3AJ7A 1LYXA 1HP4A 4UMBA 3LPFA 2G97A 3W84A 3W74A 1T8XA 4F40A 3LMZA 3LNPA 4F0LA 2V8ZA 4KCWA 4JR5A 3EB2A 1TWIA 3NL5A 5DMNA 4DBDA 2INZA 2HQAA 4JTEA 1EIXA 2INFA 3N3MA 4F0SA 3EXTA 4GIYA 2WHMA 1IF2A 2A1YA 1GOQA 3SQSA 1BVNP 3NOEA 1EP2A 3ARWA 1A47A 5M17A 2ZUNA 2J74A 1WX0A 3JRKA 3B8VA 1UWIA 2O4QA 1CGUA 3FK4A 3GRIA 4ICNA 1W9UA 4AF0B 2E8ZA 1EC9A 2ZKMX 5K2ZA 3GHUA 4RL3A 4D6DA 1V6YA 4AXKA 2OZTA 1US2A 1MZHA 2XPKA 2ZUMA 3R89A 1NWTA 3DIPA 4ZQCA 3L65A 1EOKA 3IUDA 3TTEA 2VO5A 3B3DA 4GACA 2YCIX 1K8CA 1TVPA 3RO8A 1XLMA 3M0JA 1WUEA 2FHFA 2GK1B 3CEPA 1M6JA 1ZNNA 2XIBA 4I9MA 3AO0A 1MWOA 3QY7A 3CNYA 4R27A 1JF6A 4WR3A 3BANA 3ZQ9A 4UTUA 1H1YA 1IEIA 3KBJA 1G1YA 4ZCWA 5H1WA 4U10A 1EJSC 3EKGA 1NOWA 2C1IA 4NX0A 3FJNA 1HQTA 3DFYA 3TC6A 1IZJA 3C0QA 2XYLA 3GG7A 4DWDA 3VIJA 3RM8A 1Q2RA 4X61A 5MKGB 1THFD 2ESCA 1D3CA 2GGEA 3GR8A 5A6MA 3E74A 1RHCA 4JDBA 3U3HA 5H8UA 2ZUVA 4HMDA 1B2YA 1BKHA 1JIBA 3H22A 3R11A 4NAEA 4NZ3A 1SMAA 3C0SA 5D4YA 1VGAA 3WELA 1GVRA 3T1GA 3T4WA 5JH1A 2QCMA 4ATDA 2OKTA 2ZOXA 5LSMA 3CHEA 1X7FA 4JN8A 3K1GA 2YCLB 3NIYA 4PCTA 5LGZA 1GYNA 4HYRA 2PDNA 1OGBA 1TJ2A 4N4QA 4L4LA 1E71M 3BAXA 4DBWA 3CC1A 4DEFA 3W85A 3FA4A 3LK6A 4Y8FA 4ERIA 1KWKA 1RY0A 4QLKA 3DKLA 4E2OA 4OBTA 1BWVA 4RDWA 1Z8AA 1VC4A 2GGIA 2VNCA 2EPMX 2IQTA 1J6PA 4ZGYA 3DKJA 3I6TA 3C8NA 2NQ5A 3NQCA 4AZIA 4N0RA 1QWKA 4IX0A 3CUHA 4FIRA 2OOFA 3PSVA 1A50A 4GKLA 1LQ0A 1PYMA 5F4WA 4K2SA 1T96A 1AJ2A 1EHNA 2W92A 4M6VA 2TRSA 1LJYA 1MRQA 3CEUA 4RW3A 3EX2A 4EK7A 3RPTA 3ZS4A 1J6OA 4NU7A 1IEWA 2V9DA 3QSTA 3MSGA 4LWWA 1JPIA 4JTJA 1GQJA 1KXQA 2V67A 1FH9A 3QGAC 2E7FA 4PRTA 5F1UA 2C7FA 1TPWA 2GVJA 4IIGA 5AC4A 2JK2A 3M47A 1M7XA 1ZALA 4JFSA 3VOHA 4Z2GA 3BOLA 4HSHA 4QGCA 1VIWA 3TH6A 1KXVA 4LT9A 2Z1XA 4MHBA 3WQ8A 4MNLA 3QV7A 3QXBA 3L68A 3W37A 4ATLA 1BRLB 8XIMA 1S3TC 4ADSA 3ARZA 2VC6A 2CESA 3BG3A 5CG0A 4GMEA 4Q8UA 4IG2B 2J4GA 1JZ2A 4NILA 4MTVA 4CNOA 3EWYA 4C6QA 1JYVA 1G5AA 3UFYA 2Z1KA 1UWQA 3S9YA 4MDOA 1ZJIA 2HWGA 5A8MA 3RITA 1KKOA 3MW7A 3N6HA 1PO9A 4TUFA 4ALDA 5BXSA 2NUWA 5C6MA 3MUZ1 1EKOA 3H2FA 3PPHA 3W88A 1XBZA 4R3UA 1X1ZA 5EMJA 1AH3A 3IK4A 2OQHA 2ZZ6A 4JFWA 1NF7A 3SRHA 4PCSA 1PSCA 4Z42C 1YXCA 1FHLA 4QCEA 1GPFA 1XXXA 3GD6A 5CSUA 3SQMA 2E9MA 3SY8A 4KS0A 1QK2A 2A3AA 2VELA 1S2TA 3THAA 4AWUA 1UYQA 1DWAM 5M1TA 3DECA 3ZM8A 2PDQA 4CQCA 3A3HA 3ARYA 3IIZA 4ZB0A 1P48A 4NXKA 3UZWA 2XGBA 1I75A 3HPXA 2IXUA 5DX7A 4AY1A 3INPA 1MXGA 4MKNA 3CQ0A 3JU2A 1OK6A 4W84A 1OFOA 1YLVA 5D38A 4XG1A 4U4MA 3VO0A 2VEFA 3UERA 4XUGA 2Y24A 2J24A 1XR2A 3EMZA 1XLDA 3S1GA 2BZNA 2WM0A 5K9CA 3P5ZA 4A3QA 3M5XA 2NQ9A 3CK5A 1D3HA 2BX7A 2WMHA 4NSBA 2AQVA 1JQXA 2I17A 4MY9A 2GOUA 3T40A 4UBPC 5CJ5A 4BI7A 2VDGA 3S5SA 3VCNA 3OEXA 3K1DA 4IGNA 2E8YA 4FSAA 5XIAA 1RPKA 1TRDA 2IQ0A 2WWDA 4KWUA 2HDJA 3UYCA 1VRDA 2PP1A 1N55A 3VD5A 1UWSA 2OFJA 3AYTA 1O5KA 1JDDA 4GUGA 3BQ6A 1C93A 3EA2A 1OFBA 3SR7A 3IIOA 3EOSA 3W7DA 2WLZA 3KDOA 1M7OA 3PSWA 3FKKA 4NAFB 3RGTA 4IFKB 3WEMA 4M1RA 2H3DA 4UIOA 4ZSUA 3FHAA 4LVFA 1YPIA 1UQYA 3N2OA 3NL3A 4HHPA 3SUWA 4X2RA 2DY3A 5GNXA 2PGFA 4U2YA 3LG3A 1X6NA 3IV3A 4KGJA 1R9YA 2PS2A 5M3WA 2ISFA 3AMLA 1L0PA 1VCGA 2HEJA 2CC0A 1VB9A 2PCEA 5LNUA 3W83A 3EDJA 1YTKA 1KTCA 2E6YA 2P5NA 5LIKX 3RMEA 2ALRA 5AHMA 3DG7A 5CC5A 2B7OA 1QI2A 1JPHA 1C8XA 1U1JA 2DH2A 1FDZA 5D09A 5DFAA 4Y7EA 3LB0A 3UJFA 4EOUA 2Z24A 3MZ2A 2QCLA 1EDGA 4QITA 3E1F1 1LDCA 1L6WA 2X1IA 4DUOA 3I7RA 5FI8A 4AUBA 5CSRA 4GQRA 4L6DA 3PY2A 1ZBKA 3LRMA 3FNDA 2NV1A 1PIFA 4XD4A 1CXLA 2I9UA 2E6FA 3BSHA 3DHPA 2VZUA 4WJEA 3IIPA 1OC7A 4GKTA 4Q4SA 5HMFA 4CN1A 1VCVA 2QCNA 4PEEA 4WIWA 4LANA 1TQXA 2GPTA 4ZBCA 3P0WA 2B7PA 1JVNA 3E5BA 3VYLA 1RPXA 4GI8A 3TYZA 2G50A 3WMSA 1JUKA 1L2QA 2YZ5A 2Z2AA 1EPVA 2XH7A 4NZ1A 2VKZG 1GONA 2JE8A 3SGGA 3NTYA 4JTFA 2D24A 1DPMA 3M9YA 1CXKA 2G0WA 2ZX8A 2R14A 4C65A 2XIQA 3IJIA 3A12A 3M7WA 3M0MA 3PZMA 6TIMA 3CQKA 3DHFA 5XINA 1LG1A 1N7KA 3AS0A 5CPNA 2FJUB 3WLHA 3RM4A 1ISXA 4IQJA 2ZVIA 5BCAA 3E0FA 2Q6ZA 1OY0A 1EFZA 3SCRA 2PDYA 2PPGA 2IKHA 1CWYA 3JR2A 2QVNA 3WLMA 2ZZ2A 4LXFA 3BTNA 2WKGA 4LBRA 1EGVA 3SFKA 1IT7A 1NOUA 4LYKA 1C91A 1TTJA 3U48A 8A3HA 3FYOA 2HNHA 5A6BA 5DMYA 1CCWB 3R4IA 4MM1A 1VYRA 1X6UA 2Z0IA 5E5CA 3ARUA 3DG3A 2P10A 3OOQA 1MQRA 3BSGA 3CB3A 3PULA 2YB1A 3CAVA 3ZJ8A 1OX6A 2EF9A 3M0YA 1A0CA 4H6EA 1FWIC 4Y9OA 4K8GA 1Q3NA 4K1GA 1XLEA 5ABFA 3WH7A 4RPPA 3LTSA 3QY6A 3WMBA 4HPJA 1S38A 2WQDA 2RDUA 5GJMA 1XV8A 1MDLA 4RKAA 1T7LA 1FHDA 3O06A 3LCGA 3RMJA 1EPXA 4IWWA 4I8DA 4RUBA 4UTFA 2VFDA 3PK7A 4PMDA 5K9DA 2HVMA 3Q58A 2OPJA 3ZT7A 3AMGA 2OWCA 2DVUA 1GHRA 3L4XA 4AVNA 4M5PA 4PUJA 4OU1A 3L2LA 3M07A 3BLOA 2RUSA 4QS6A 2CFFA 2GDVA 1SMDA 3VIGA 2WHKA 2HTMA 1KXTA 2E1WA 2F38A 2QCEA 5HANA 4EXAA 1TO3A 4QJ1A 2ZTJA 4KEMA 3SQLA 4J7RA 4DJFD 1JG9A 3N34A 1VH7A 1K77A 1O66A 3OGRA 3BW2A 3BG9A 3CV7A 1KLYA 1W1IE 1U83A 4C6EA 2W6RA 3T6CA 1YKWA 4DF0A 1SO4A 4OOZA 1BSLA 4HP5A 2J77A 3WQPA 4EAYA 1VFLA 1YDOA 1CXHA 6TAAA 8XIAA 1K7XA 3WJWA 3UWEA 1QAPA 2XG9A 3SBFA 3MVIA 4MFDA 4DZIA 4YMZA 1QNOA 4LNCA 1ICSA 1OC6A 3AXMA 5ENLA 3RCMA 3QOMA 1W2VA 2WC3A 3LQLA 4NG3A 5HWMA 2NV9A 4UQCA 2ZXDA 4NKCA 2AKZA 2VCCA 5AHFA 2Q3OA 2DZBA 4WY0A 4HNCA 4PMQA 4DIAA 1TWWA 4Y9PA 4HOWA 2BGNE 1V3IA 4QTGA 3U2OA 9XIAA 4OV9A 4D8AA 1P6CA 4WOQA 3EEGA 5CSYA 5FJIA 1BQCA 1W5MA 4JTKA 5EMYA 4AH7A 1P7TA 1KM5A 2YFNA 1EWEA 1AW1A 1ISWA 2VUNA 4FNPA 3AISA 4H9TA 3UR5A 1M3UA 4C6LA 1GVYA 4NZ5A 3G6LA 1UASA 5FF3A 4MZYA 4WJ8A 2HPIA 1REQB 1S1PA 3CBWA 4GYPC 2XHYA 2XZ7A 1RY8A 3BGJA 4US6A 2F2KA 4GQBA 3V36A 1H09A 4A2SA 1M9HA 1KQZA 1W2PA 4GY0A 3QN3A 1Q66A 3WL0A 2E9BA 3E2SA 1XICA 3M16A 3VK5A 2ATMA 1NP2A 1AK5A 2DT1A 3WD2A 1DQUA 2FQIA 1PCKA 2VI0A 4UOJA 5BW6A 3VOIA 3T08A 1Y7VA 2QMJA 3A22A 3NPVA 3STPA 5T26A 3FJ6A 1XIGA 2VWSA 1O4UA 1QOQA 4DLMA 1OFAA 4ILSA 1NVMA 2HVOA 2QJGA 4Q4RA 5TD4A 4DRSA 2PBOA 1XLFA 2HE5A 1XD1A 3WDPP 3CUZA 3BMWA 2PD5A 1LG2A 1NM9A 2POZA 2A7NA 1V02A 1AL7A 1R3WA 3UG3A 4C1NA 3BGAA 5D05A 1BXBA 4C6CA 1VKFA 3I65A 4IPJA 3Q37A 2NSXA 3TJ4A 1UQZA 1HGWA 4CVWA 3H12A 4OT7A 1VBRA 4QXIA 5JIPA 3OYZA 3AZTA 1KC7A 4RDZA 3UWUA 3H4XA 4O16A 4AYSA 2BVYA 1E55A 2XVLA 1YDVA 4B5SA 1XG4A 4TX8A 1HGYA 2ZE3A 4ZOCA 2FYMA 2A3CA 4HPHA 1OX4A 2CKSA 2V82A 4B3KA 1U30A 3EKZA 4C7FA 3WO8A 2WXDM 2C71A 3AS3A 4DUWA 1PCWA 1QBAA 1B30A 1VLIA 2A7PA 3AICA 1Q6CA 1RK5A 4Z0JA 3W7NA 4DQWA 3UBPC 1K9EA 2F6UA 3WF0A 1CLKA 1YEYA 2VRQA 4O1CA 3VZXA 2PWHA 3FX4A 3WBEA 1LBMA 2P76A 3F4NA 5M2FX 4K6AA 5BXRA 4IJCA 1SFSA 3OZYA 3NDOA 5AKQA 1A80A 4PCNA 3W7HA 4GFSA 1SJAA 3WD3A 2A21A 1K7EA 2VVNA 4ZFCA 4QHRA 1IT0A 1WXZA 2DPEA 3ZJ7A 7TAAA 1LT8A 5E9XA 2Y63A 1E9ZB 4FLOA 3OLDA 2ZADA 3K2GA 1PZ2A 2CERA 4Q7NA 2CZEA 3STEA 2VEPA 3CMGA 1TG7A 2PAJA 5HBFA 3CHVA 4J4KA 3QR0A 5EMKA 1MW3A 3NUKA 3HIJA 3CT7A 4AISA 3BGGA 5KITA 3M6DA 1EUNA 2GJXB 4XTDA 4FF7A 1P6BA 3EOOA 2XVNA 3ES8A 1XGZA 3GXTA 2XIIA 3VDAA 3BURA 1KV5A 1UWUA 5F7UA 2PWVA 2VR2A 4MKSA 3KRZA 3VGBA 4P7QA 7ODCA 4IH3A 2JIEA 3WF4A 1E73M 3DDMA 1B9BA 3DYOA 5CPOA 2DQWA 4PGLA 1AA1B 4DYJA 1K6AA 1MI3A 3PTKA 1OFQA 3GVGA 2TYSA 3F2CA 2OLAA 2WVVB 3FAXA 4CD7A 4FIQA 4C6KA 4W7UA 4QSFA 3BJTA 3AS1A 2J47A 1PWLA 2CHOA 3SRFA 2OT0A 3GM8A 1DXIA 2V2HA 4O0ZA 4WSKA 4R9XA 1Z9AA 3CZKA 3SO7A 3BPWA 4AWTA 4XSLA 3IGHX 4H4IA 4JY8A 3BLKA 2YIHA 1LORA 4L7ZA 1R47A 3MC5A 1I1XA 3UPMA 3R94A 4XD5A 5ABHA 4YVPA 3SB0A 1HJSA 4EXBA 3T2PA 1ALDA 1QTWA 1DV7A 3LQGA 3GBEA 2YCEA 1UPMB 2XTKA 3W38A 3N25A 4MADA 4MF4A 1Q45A 4IM4A 3TIMA 2OVLA 5AC6A 4S3CA 1YNPA 1DBTA 3N04A 4E8DA 1W5OA 3VMPA 2F2HA 2ISWA 3T8LA 1ZJAA 2VX6A 2CEQA 3POCA 1O5RA 2I1OA 2VX4A 3LLDA 1DJIA 1NY1A 1NP0A 1ONWA 3EA1A 1WDQA 1Z32X 4O28A 3VIFA 8TIMA 3KZPA 5HA7A 3H53A 4G7EA 1KFWA 1GORA 2NQLA 3GH4A 4YTUA 1LLZA 2PLMA 1YHTA 4GBUA 2ZTKA 5FD0A 3GTNA 3L21A 4PBGA 2ACUA 4LCRA 3M5VA 3T0CA 4JHOA 2V5CA 4XZNX 3ANVA 1XGDA 2PGWA 2Y7DA 2C19A 2ZZ5A 4O1FA 1EX1A 1JJKA 2VGFA 2W0UA 4JFVA 3M7SA 1UHVA 3UWVA 4FX8A 4L4MA 2VZTA 2VMFA 3OVPA 4HHMA 3VMNA 2R8WA 3RDKA 3HPAA 1GVOA 4MJ4A 3AXHA 3TKFA 5BROA 5CGMA 5LA1A 1XBVA 2DFAA 3L12A 2P0OA 4XAGA 3RLHA 3G6MA 3DC8A 3BOFA 4ZVJA 3RAOA 4OHQA 4JDYA 3L4ZA 1M1BA 1XIBA 3CT2A 3JVAA 3TJLA 5CBJA 1H0IA 1V3JA 3QHOA 2PI6A 4Q32A 3CUGA 3WF1A 1E0XA 2WSKA 2CITA 3GZ3A 1TV7A 3HURA 1JRCA 3WH5A 5FEWA 1EA0A 1KBJA 3WN6A 5B7ZA 2BNJA 4XZWA 2PGEA 2WZHA 2W66A 4MVAA 4H9UA 4LF1A 3CZJA 2FZNA 2GYIA 3CL8A 4QROA 1HL2A 1QI3A 5I09A 3G5EA 4GH1A 1S5VA 3K4WA 4LRSA 1R86A 3RCYA 3NR0A 5U7SA 2C1HA 2WC4A 3B05A 2A6LA 3GVWA 4YJ5A 1F6KA 2OGYA 4NUWA 3SAZA 2WYSA 2QJJA 3AMDA 1Q6RA 4U3CA 5T9CE 4IT1A 2CBUA 4C6DA 1KBIA 1JCMP 2INEA 3ITLA 4D6IA 4IIEA 1EJRC 4FZIA 8CGTA 5JBFA 3PN8A 3IRSA 3TA6A 2BOFX 5H91A 1CI1A 1SPQA 3QQWA 4X2PA 1Q4NX 2GK1A 5LIXX 1V6UA 3TVAA 2JFEX 4RZ4A 3FYYA 4Z17A 2ZXAA 4MAZA 4BEUA 4TU1A 5DRIA 2BY1A 3DI1A 3JZEA 4I5RA 3QQ0A 1R3YA 2ZX7A 4JIRA 4DBUA 4DBSA 4S3KA 1P0NA 2IPFA 4LAUA 4FS9A 4A35A 2RFGA 3KHJA 1J8VA 2D2GA 1BF6A 3CJPA 3PBGA 1P0KA 3AYVA 3GDKA 1QOPA 4UFKA 3F4DA 1MO0A 4P8VA 1Z3NA 1MEIA 3GIYA 3O6DA 3CYJA 2WCGA 1KNWA 2E28A 3VIPA 1HO1A 4I7VA 3LD5A 3FJ4A 1A49A 1A5OC 1N82A 2Y7EA 4FO4A 1FWJC 1XP3A 1SZFA 3N2BA 4HMNA 3KOZA 3ITOA 4AD3A 1P0BA 3W73A 2AAAA 2A5HA 3GYEA 2VC5A 4Z2IA 3UXDA 4EIVA 1JGIA 1P1MA 1DJHA 2V2DA 4H19A 4IIBA 3W82A 2ZX6A 4B4FA 5GQBA 2HPMA 1PKLA 1MXSA 3VKCA 4DX3A 3QSRA 4OTKA 2PRLA 2CHNA 3ATYA 2A2IA 1BG9A 3KP1A 1XH1A 2DUZA 3TEVA 1GZGA 1W17A 3OJGA 3T44A 4WUIA 3G1RA 3LCFA 3NO1A 5EYWA 3BOXA 1F07A 1FA2A 3I10A 1XLLA 2ODOA 2YDQA 2J7BA 3TQVA 1I9CB 3ABRA 3OODA 5CPQA 1CX9A 2Q09A 4G6CA 1SJBA 1XLJA 5I03A 3FJLA 2O9OA 3VDCA 3SFWA 1GT8A 2UY5A 5AYIA 1KRCC 1J12A 2ZUSA 3G1XA 1IGSA 2PODA 4L1XA 1ME9A 4FEZA 5BYWA 2VENA 4RE2A 5HNNA 3DAQA 4EACA 3FW6A 4CGTA 1OK4A 3U57A 1EUAA 3JZUA 4HMEA 4MDPA 1SFTA 1BRLA 3UZJA 3HG3A 2QHAA 3WEOA 1AJZA 2FB2A 4AG0A 1JUEA 1GHSA 2PDFA 5A6AA 2CBIA 1SR9A 2TODA 2QUUA 4CNTA 3ZO9A 3KTCA 1UR9A 3PB0A 5C55A 1QPNA 2Y5SA 3GBDA 3LGDA 1DYSA 4HVXA 2R91A 4DWSD 3L2MA 4R5EA 4OFCA 1Z48A 4HNNA 1UROA 1JCJA 4P7LA 4Y96A 3QQ1A 3UVAA 4FB7A 3FFSA 3KBWA 3GSMA 4IX2A 1BHGA 1XI3A 2ZDRA 3DFQA 2HZGA 1JCTA 1PX8A 2FPYA 4QE5A 1KQYA 1XG3A 2BBFA 1GNXA 1GQNA 5D04C 1UZDA 3HQPA 3NDYA 2F6XA 5FJRA 2JGYA 3ARQA 2QJMA 2YBTA 3W26A 2A7RA 4S3FA 1XCWA 4P2VA 3TN4A 4E2DA 1EYEA 2PUZA 1DHPA 4AC1X 4JTLA 1UA7A 3T7VA 3ORWA 2QDDA 5LA2A 1CXIA 4C6IA 1MYRA 4ZZ9A 4BI5A 1I0BA 4HJWA 5B7YA 2XDFA 4JTGA 5EMUA 3DGRA 2WJZA 4LUSA 4EPKA 1C90A 4ZA0A 2VD9A 3ZVHB 2DU2A 4H00A 2V5DA 3WY1A 3AXIA 3N9RA 1MQQA 5HMDA 3V1PA 4MWAB 4YYFA 2WMKA 4S39A 3THUA 4UQAA 3DU0A 2X0HA 2O56A 1HO4A 3CXOA 4AZBA 1RCOB 4AC7C 4UUIA 3EZ4A 4WOZA 4O4VA 2DJXA 3SEPA 5D8WA 4M7TA 4UZUA 1RQHA 5E0CA 1XYZA 1CENA 2ZRYA 1ZUAX 1VHCA 3Q45A 3HGSA 4U33A 2E5BA 2R1NA 1V3HA 4IXXA 4LUJA 4RR4A 5DBTA 1NJJA 4AB4A 5LIUX 1LCOA 2WJEA 1XYLA 1NFBA 4IMEA 4PB3A 1QASA 5I5RA 4CQ9A 3D3FA 2UZ9A 3MB9A 1OF8A 5FAJA 1EEXA 1UKTA 1Y5WA 3MJMA 3BLFA 3WBYA 2VURA 4LBSA 3W70A 1ZS2A 3LTYA 3LCIA 3OPSA 4NAFA 1EJ7L 2ZFAA 4IMAA 4GG9A 4GXPA 2GSJA 1B57A 2PTXA 3A21A 4O54A 3TZFA 3W2JA 1C92A 3NOYA 2BP1A 3CPRA 3SW6A 4QJ5B 3LY0A 1JYWA 1KCKA 3DHDA 1WE5A 3A6OA 2GJLA 1JDAA 2FTPA 2EKGA 1G0CA 3LLXA 4QLJA 2VHLA 3OHMB 1QNQA 3D46A 4ZQNA 3HOJA 2V81A 4IJBA 2OO6A 4PTVA 5FA5A 2DIKA 2DIJA 1FFRA 1V5XA 1V0KA 5AYBA 2ZUTA 1IXOA 2GQ9A 3MYPA 2CLFA 4N9EA 1FTXA 1CNVA 4DJFA 3VNDA 4Y9NA 3GO2A 3BW3A 3TZNA 2R1PA 3LCLA 2J9XA 3NQGA 3R2GA 2XM2A 5AVNA 1DJZA 4GVFA 1GVQA 4JKKA 3CB8A 4UZSA 2XUCA 1IEVA 4LUIA 5CAHA 3PJWA 4FLSA 4QSHA 1F73A 3UGRA 1Q6GA 5IFPA 4Q6JA 3VABA 4BHYA 3LM3A 5A6TC 3K13A 1AQMA 4LVDA 2E09A 3ONCA 3EDFA 3L7RA 3CM4A 3T4CA 4O50A 3G8RA 5LXXA 4XZBA 2FHBA 1OVDA 2OZ3A 1YYAA 4CKQA 3VNMA 1ZTVA 2Z1SA 3OA5A 3QTGA 3LPPA 4O1DA 5IFTA 1HKKA 3GB6A 2H9AB 4LALA 3TN5A 4QG9A 4IP7A 1H0GA 1QW7A 4RNHA 4B15A 2VX5A 1BFNA 2CXGA 1XFCA 4I7WA 1ESWA 3WQDA 3A4AA 1GCYA 3L0GA 3B0PA 1DWJM 1QUMA 1XWYA 3PUEA 2PEVA 1OCJA 1MEWA 4YU1A 5C9ZA 3VTRA 5DEZA 4HHLA 5J8LA 2NT1A 3UEQA 4U5KA 2X1TA 4MSSA 2VXNA 4US5D 3MPGA 3SSZA 3NGFA 4QDWA 4MOZA 3S46A 1NDZA 3L5LA 2RGLA 1KO0A 4MMWA 2WBKA 3WLTA 1WZLA 4GISA 4YYCA 5DCDA 4OGZA 1PTGA 4CD8A 1F61A 3P82A 3BV4A 3KBMA 2KX9A 4I7UA 3V3WA 3RJXA 3NM3A 2G37A 3MU7A 1BAGA 4O18A 2EG8A 3IEBA 3WJYA 3CIVA 3VDBA 3U0HA 1VFSA 2TSYA 3A5FA 3NZ1A 3S2JA 3TQPA 2BODX 2EPLX 4FXJA 2O9PA 3TLLA 2WMIA 4A8LA 4UTTA 3P6LA 4XUYA 1JYXA 1XCXA 1I2QA 2ONEA 3H23A 3UGVA 1TFVA 1A0EA 1DHKA 2ABAA 1W1PA 2FZ9A 2GJPA 4S3GA 4JQ1A 2FZ8A 1TE1A 3CUIA 4HA4A 4HGXA 1H62A 1GUVA 2C79A 3FGCB 1OG0A 3G18A 5LXEA 2H8XA 1A5NC 2Z26A 4A6GA 5FJUA 4I9TA 3GR4A 4HYVA 3AC0A 4AZ7A 3RU6A 2OO0A 3G1AA 4PEKA 1W91A 4L64A 1MNZA 4FR1A 1K9FA 4MNMA 3CMFA 4K8HA 1J5TA 1K6WA 1HL9A 4PRRA 2VT0A 2X1RA 3GIPA 1VCFA 4AD1A 2CXEA 2W4XA 4DHGA 1ZBCA 1VFTA 4I6KA 3MUAA 1K9DA 3UW6A 2X1SA 1RQEA 1XF0A 4ENLA 3DHUA 2ZRVA 2EKCA 2FVKA 3VGFA 1D8CA 2GQ8A 4PR4A 1FWAC 1XIJA 3O15A 1RD5A 1E0WA 2UY3A 3TWAA 3PUGA 3MP3A 4E8CA 2EPOA 4AX7A 1WDRA 1VHNA 1N8WA 3GG1A 3ELFA 3SY5A 3A9BA 3QJAA 7XIMA 2E3ZA 4UFLA 4PCPA 4P7NA 1KTBA 3LGEA 3UA3A 1Q65A 3KVKA 2YJQA 3I7SA 4LW7A 4LEFA 4JOMA 4ICCX 3UPWA 1HJWA 4IL0A 5I07A 3Q94A 4UNLA 2ZA2A 1E6PA 3QW3A 4GXWA 1OC5A 3ABOA 4C90A 3LUTA 4GI6A 4Q7IA 4BWLC 4I3GA 4AD0A 3VGGA 4W93A 3MY9A 3VFCA 4RJEA 4O8AA 4BI6A 4LV9A 4HOXA 3Q4DA 6ENLA 2XGIA 2VOTA 1H5VA 3R8HA 4ICMA 5E0KA 5E1QA 3W4RA 4Q8WA 3W71A 3PBMA 2HNEA 3BE7A 5FOOA 1VD6A 3V5OA 1EP3A 5I3HA 4G9PA 3LOTA 3NCOA 3GWQA 3ANYA 4RE0A 3B8TA 4HK7A 1T41A 1PKNA 3MYOA 4DZHA 3KW3A 5E93A 1OD8A 1K7FA 2QF8A 2ZBTA 4IIHA 4MG4A 4PC8A 3NSNA 2NX3A 2ZVRA 1QHZA 1W37A 2WJDA 3MI3A 3RK8A 1P1XA 1N8FA 3TNOA 2XIMA 3W0KA 3CQJA 4GABA 2VM8A 1KD0A 3QLLA 1SZNA 2HISA 1SVDA 4TX6A 3BC9A 3QC0A 3P0XA 1VFMA 4BA0A 4A2RA 3AHZA 4NJKA 1XLBA 3RLVA 1Q2SA 1I2NA 1J0YA 1XLKA 4G8TA 3MSDA 1J01A 5CGQA 5A8PA 3KRBA 2RGMA 1PL9A 2DZAA 3TMLA 4P5UA 1QVBA 3UZZA 2IXVA 2HS8A 3LHUA 1PZ3A 3UXAA 2NVDA 1VPQA 5TQLA 3WQEA 4XZLX 2QV4A 2WVTA 3ID7A 1XHGA 1JR1A 2FGLA 2NV2A 3ABSA 4GINA 1LUCB 3C0LA 3RPDA 3WBWA 3IUHA 3O6AA 4O13A 1IWAA 2VGIA 5HULA 1QPKA 4H2CA 1DKWA 3W7IA 2WKLA 4WDWA 4QS5A 1BGGA 2YSWA 4TX9A 2XFFA 1AG1O 2Z1VA 4J3XA 3M4HA 3LMYA 1QPOA 3O3RA 2VEGA 3I4EA 4F2TA 1B90A 2Q3RA 4W7VA 2OYKA 3E3HA 1LT7A 4M6UA 4WY0F 3MUIA 1XIEA 4RE4A 2C3ZA 1UR4A 2NQZA 1WDPA 1ITUA 1JUBA 2IPJA 4J3VA 2YCJA 1Y8BA 4RDVA 4O53A 3E6EA 1EJWC 3KUMA 4H9MA 2GVLA 1C8YA 3AI0A 4M6QA 4JIQA 5KSWA 4V2XA 1TA3B 4G1KA 3TUUA 3WCZA 3CIWA 1RQBA 1D7FA 4BK9A 3ARSA 5EMLA 1RJQA 1ZSXA 3NL6A 1X97A 3W72A 1JZ8A 1IEQA 1OQFA 4JIPA 3QZAA 2PWUA 4YLWA 4C1LA 3TSBA 5DCEA 4KWWA 5EB8A 4QE1A 3EWBX 1OJXA 1FUYA 2XWEA 2J7DA 2OSYA 3G2GA 3BXWA 3HZ3A 1UIOA 3KE0A 3LBMA 1ME7A 2VVSA 2E6AA 1GG0A 4XKMA 3EEZA 3ZIZA 1E6SM 2ZWZA 4I90A 3HTWA 5ABGA 4DZ5A 1Q8JA 4CCDA 1TMHA 3B0YA 3PB2A 5D9PA 5IBXA 3P62A 3TMQA 4ORMA 1P0EA 3GXPA 4DUVA 3ZSSA 3MJYA 5C9WA 3HG4A 2EAWA 1PV8A 3PVFA 2VDIA 2PDPA 4EPEC 1M68A 1BPLB 1O1ZA 1IHIA 1TUXA 4MB4A 4JN6A 3F7JA 3I7QA 2AKMA 4GE8A 3LCHA 2X1UA 2ISVA 4BF5A 1U5JA 3QC3A 4NI8A 5GNZA 1MFVA 4LCSA 3W23A 4HTBA 2VGGA 5J04A 4H7CA 2BVTA 4LY4A 2QUMA 1E40A 1E56A 4XWUA 1RVGA 1FWRA 1MMFA 1C8QA 1KM0A 4AMCA 1Y5XA 4BQ5A 3DENA 3XIMA 1GOIA 2ZC1A 4A3YA 3L0NA 1T8QA 5F2GA 3SCTA 3I6EA 4AWSA 5DELA 3S6OA 4DBEA 3Q65A 3NA8A 1F8IA 4A3RA 5FEZA 1AUSL 4J27A 2YA1A 2I9EA 4ZEPA 2X2YA 5AYXA 1TREA 2EJ1A 2Q8LA 3HGJA 5GJPA 3UWZA 1TJ0A 1K70A 1Q6LA 1UR0A 9CGTA 5CC7A 3KLLA 3VM5A 2DZXA 6REQB 1QU4A 4E4FA 4LSBA 2NT0A 4MYAA 1S5NA 3W75A 1A4MA 3CHCA 3KBSA 1RZMA 3LBCA 3AZRA 5H8PA 1Q13A 5GNYA 1NFPA 3UNTA 2IPWA 2HSAA 1XQLA 1DE5A 3TV8A 1GG1A 2DSKA 4ERAA 3LI0A 3TTOA 5LNRA 2DZSA 3ITTA 2BMBA 1W1B1 2O7SA 4C5ZA 2GUYA 1RA5A 4QG8A 2WWCA 1YRRA 2AL2A 1TJ1A 3WJZA 2PP0A 3H4GA 4MY8A 4O15A 1PXGA 4UQ9A 3QY8A 2PDLA 1BG4A 3WQGA 3GW3A 4XX6A 5H8MA 3NQAA 2BOEX 1XSKA 5HR7A 1ZU8A 2QJHA 2PRMA 3UP8A 3LSCA 1NARA 1SO6A 2F8QA 4MUPA 3P84A 3WUFA 4KETA 2JIWA 3BLLA 3GVVA 4ZO7A 4H8HA 3SUVA 3CWOX 4Q8NA 3FA3A 3P60A 4KERA 2WSRA 3S5ZA 1VBJA 2JF7A 4J3TA 5FJJA 4AU0A 4S3JA 3P14A 4BKNA 5H2ZA 4ZQOA 2DORA 1B3OA 5F2MA 1FXQA 1MW2A 1OYCA 1C3FA 4H9XA 2YBVA 3S9ZA 3PZUA 4AZCB 1C8VA 2A3BA 1MXDA 1ME8A 1HN1A 1J79A 1M01A 3BL3A 4D8LA 2ACSA 2WNNA 3QGKC 3WQOA 1O94A 3GXMA 1SZRA 3TC3A 3KS6A 5TIMA 3T2OA 4JQ3A 1Q6QA 2DQXA 3LHTA 1O68A 1OADA 3O8AA 4ML4A 1E4IA 4ZE4A 2PBGA 3IK2A 4E4UA 4JCLA 1U2YA 3G0XA 4WVXA 4R7OA 3EX3A 4AY8A 3CZLA 4QNWA 1JZ3A 3UVIA 3UPBA 3R0DA 3G3DA 2I57A 3C3UA 3IANA 4FNSA 2LLEA 4DXXA 3B8UA 1XIIA 3ECQA 4M7SA 3EA3A 3TK7A 4A29A 2ZDSA 1D2KA 3KL3A 1I2OA 3L5AA 1UB3A 2PFHA 2VYOA 4DWSA 2I14A 3SSJA 4DJEC 3AS2A 1UR8A 1ZY9A 4GCAA 1QW8A 1V6VA 1TE6A 3UJEA 4LAOA 5BNKA 4P7RA 3GX9A 3SUTA 1J10