4R9XA

Crystal structure of putative copper homeostasis protein cutc from bacillus anthracis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
225
structure length
225
Chain Sequence
MLEVIATCLEDVKRIERAGGKRIELISSYTEGGLTPSYAFIKKAVEAVQIPIHVMIRPHAKSFTYTEEEIEMMKEDIVVAQKLGVAGVVLGVLNERNEVAEEKLADLLSVVDGINVTYHRAIDDIENPVEAMRTLKKFHKVTHVLTSGGQGNIVDNIPVLTDMQKISDGQIQLVVGAGVTKENIKQLLNETGISQAHVGTAVREGKSCFAEIDLNLVQELVQIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper homeostasis protein CutC
publication title Crystal Structure of Putative Copper Homeostasis Protein CutC from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Metal transport
total genus 65
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03932 CutC CutC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.380 Alpha Beta Alpha-Beta Barrel TIM Barrel Copper homeostasis (CutC) domain 4r9xA00
1TWDA 3IWPA 1X7IA 1X8CA 2BDQA 4R9XA
chains in the Genus database with same CATH superfamily
1LJYA 4NQ1A 3W29A 4NJGA 1E5JA 5HWNA 1PYMA 1OX4A 3BCJA 1E0TA 3AXKA 2FTPA 2OU4A 3O6CA 3FK4A 3W7MA 1V02A 1FWSA 1W1B1 1BQCA 4GZ7A 2H3BA 3E0VA 1UA7A 4KRUA 1WOBA 4ZO8A 4E38A 2CHRA 3H6OA 1BSIA 5LYRA 1Q6FA 1BYCA 1GOMA 1UCWA 3C86A 3WK1A 1NJJA 5D2XA 4ZGYA 1ZJAA 3TTYA 2NSXA 5IDIA 1XSJA 3TXZA 1IHIA 1ICSA 5DF0A 3GWQA 2Y7EA 1NVMA 1EYEA 2C14A 2W91A 3NQDA 1CCWB 1R46A 3F03K 1I1XA 2PTWA 2E0PA 1VJZA 3E74A 3DDMA 4DWDA 2YB4A 1B54A 1XIFA 4R9OA 1X6UA 1JPDX 3AZTA 1NIUA 1UD4A 5HQEA 1XFCA 5EU9A 5C2GA 1RLDA 3ITTA 4HCDA 3VCNA 4E3TA 5ABGA 1HTIA 1FWDC 3EWDA 2AL2B 1OYCA 3GVRA 3ABRA 4DJFC 4ALDA 4D6JA 3WL0A 3CWOX 3CMGA 3NZGA 4M24A 1KM2A 2DZBA 1E9ZB 1G5AA 1T8QA 1TWWA 3W7LA 1HFBA 3ARVA 3SIMA 2CZFA 2BY2A 1BHGA 1HGWA 3TH6A 4M1BA 3D6NA 5LIXX 5E9AA 3KCOA 3CV2A 4GA8A 4U2ZA 3OPSA 4MJ2A 4CNOA 4AEEA 2QCEA 3SCWA 3B9NA 1DJGA 1FKXA 3MV01 3DX5A 3VFLA 4NT0A 3GVWA 1HL2A 4I9TA 3KAOA 2XWEA 2R8WA 3QH2A 4Q22A 4B2DD 2GYIA 3K2GA 3UNDA 2PU1A 1KWKA 3W7EA 2PRHA 4B3KA 2J7FA 4PC8A 1XYAA 4PN2A 1KM4A 3GDKA 4IFRA 4HU3A 4UR7A 3T40A 4PMUA 4C5YA 3IIXA 3VCCA 3KVMA 3U57A 2Z25A 3MSRA 4HIBA 3W27A 1LG1A 5FESA 5A6TC 1CW2A 3S2NA 2WC4A 1VYSX 3NO1A 2ZE0A 2VD9A 1EFZA 3JVAA 3GG7A 8RUCA 1PTDA 1YW1A 4ADSA 1EHNA 2D69A 3EAUA 2YPIA 3QJAA 1PX8A 2ODOA 1XLFA 4JL2A 2VYOA 4F79A 4AY7A 2DPEA 1Z69A 1LYXA 1JGIA 3HJEA 4UFKA 1RSCA 5LNSA 5B7ZA 1PCKA 3TJLA 2FZ8A 2WZEA 1QOPA 3S1XA 4C1KA 3M0IA 1JUKA 1J93A 1Y5VA 3M1ZA 4S3FA 4O16A 4ZQOA 1Q5MA 2O92A 1D8WA 4Y6GA 2Z6JA 3KRBA 2Z1SA 3M5YA 3TVAA 2GQAA 4UMAA 3PBVA 1FP8A 2E77A 4PUDA 4E2DA 3BO9A 1TVNA 4LX4A 3PTMA 4IPJA 3K8KA 5I3DA 5KETA 3ICJA 4MUZA 4AD0A 2PAJA 1XGEA 3NNTA 2CLFA 2XFFA 4BEUA 1LBLA 3LLDA 1L0PA 3NR0A 3WEZA 2W61A 3C5QA 2YIHA 4D6DA 1EYWA 4PRWA 2A5HA 4C6BA 4BQ3A 3BLKA 4JTRA 4KWSA 5AC8A 1C7TA 1PTGA 3DC8A 2W27A 3LY0A 4JHMA 1UC4A 4KWWA 1TSIA 2ATSA 2OB3A 3EPMA 3MUXA 2YA0A 3M9YA 4OFCA 3VDGA 1HJWA 1Q6RA 5D05A 1WXJA 2GSHA 1KLZA 4JIPA 3U0HA 3C6CA 4LXFA 1NAL1 3T4WA 3VINA 1K8XA 3CASA 3SCQA 5HINA 1J9YA 3O0FA 1UJQA 4M80A 3LPOA 4MKNA 4PR4A 1LROA 4J3SA 3GU2A 1PX3A 3VZYA 4HQVA 3THUA 1UWUA 1HKIA 4Z2IA 4EXBA 2FGZA 4L9ZA 4UTLA 2XGBA 4E4UA 3KDNA 4UTKA 4QQUA 2WCAA 5IM51 4AEOA 5KZMA 3QMRA 4LYPA 2VZVA 2B7QA 2VZUA 4NJJA 2FGBA 4HU4A 1HNYA 2X0SA 1WKYA 3TTSA 3W24A 3OVGA 1S5NA 3M64A 1SO5A 1NOFA 3TN6A 4MWAB 2RDTA 1DL3A 2WMFA 3GDMA 2HJPA 1VYRA 4UFLA 3ABZA 5FEWA 2AKMA 1M9HA 2E9BA 3CAKA 4BF5A 4OUEA 3WUBA 5E93A 1SU5A 4WDUA 2QV5A 3U4FA 1X8CA 1QNQA 2GLKA 4MDOA 5REQB 2G5WA 3A9BA 1VEPA 4ZL1A 2F38A 2J8TA 2QJIA 3M0LA 4ZB0A 1NY1A 1KRAC 1OIMA 1SW0A 5CXPA 6TIMA 4UQCA 4QROA 4ACZA 1WAWA 1FH9A 3QGVA 4F4RA 5A6JA 1OGBA 3F2CA 3HO8A 2OWWA 1JYNA 5XINA 4P7RA 1FDYA 3PVFA 4JYDA 2QEZA 2Z0IA 2QCFA 1TA3A 4AX6A 4KPLA 4GACA 4C7DA 1KGXA 3EWWA 2EEXA 1VFMA 1HGYA 4RKAA 5TQLA 1Z42A 1B4KA 2JE8A 2E1DA 4TX8A 4DEFA 1JXJA 1ONXA 5L6UA 3TA9A 3BVJA 1H0GA 2VEFA 4XG1A 1Q6CA 1XCWA 3BWWA 2V81A 3NQ2A 1J18A 5M17A 1FWAC 2DJLA 2NXHA 1FY6A 4X9YA 3SDOA 4G8TA 1XBYA 1QWKA 3GXTA 1M03A 4LVAA 1V6WA 3VD5A 4IOTA 3UGRA 1PS9A 5HK4A 3BSHA 3L4TA 4BQ5A 1W54A 1MSSA 4I6VA 3OBEA 1ZPTA 2P0OA 1F3WA 5CSYA 4S1FA 1UWTA 1Q8AA 2Z7KA 5ABFB 3QQ0A 4CQ9A 4I7UA 5KTLA 3M47A 4AZCA 4C5ZA 4K1WA 4PODA 2DSWA 3NQGA 2A1YA 3CB3A 3NWRA 1X97A 2V5LA 5HR7A 4GE8A 5KINA 2PURA 4GGHA 4IFKB 4LOCA 5I3GA 5J8LA 2X40A 4MY8A 3BV4A 1PDYA 2G37A 1OX4B 4KRZA 1XYBA 2MNRA 3EA3A 3W81A 5I09A 2DP3A 4LNCA 3WQWA 1G69A 4RXFA 1TWZA 5EMYA 3GNOA 1IGSA 1KQZA 2ZE3A 3REQA 5GNXA 3H22A 3SCSA 2ZZ7A 1NOWA 3R0KA 4D8ZA 3E0WA 1EO7A 1AVAA 1FHLA 1JUBA 3WH9A 1ENUA 1XI3A 2J9YA 3NVTA 1FWHC 4OV9A 3LBMA 2J6VA 3PSWA 7A3HA 3SR7A 1ISVA 5AHNA 3FYOA 2W62A 4NRRA 1PHWA 1WDRA 3PJUA 1YMYA 4PEEA 1NF0A 4QSFA 1M68A 1TR1A 4MB4A 2P3EA 3KTCA 1PDZA 3YPIA 1OCBA 1UG6A 1H41A 4MWAD 1NARA 2OFJA 4IH3A 3M5VA 1ONRA 4ICCX 4RZ5A 2BGSA 3DOPA 1SM9A 6XIMA 1UA3A 3WMCA 2YCIX 1CZ1A 3T9PA 2TMDA 2XU2A 2RFGA 3N9SA 3URAA 1FWIC 1JCLA 3RO8A 4CNPA 3VIJA 4AZ7A 3CL8A 1E3XA 2VCBA 3J7HA 3U5YA 1D8CA 5DMNA 4DWSC 3WSUA 3VIKA 1EBHA 3E49A 2Y24A 4WCJA 5GNZA 2HK0A 3QW4B 1DXEA 3T0BA 1S2CA 3VKBA 3P62A 1PKLA 1LT8A 3W07A 1UYQA 3WO8A 2NUYA 2WKLA 2E8ZA 1VD6A 4JTLA 4EXAA 1X38A 3CK5A 4XZIA 3NIYA 3OVPA 3EX2A 3SY8A 5TAOA 2OR2A 4A8IA 1XQLA 4MDPA 2GQ9A 5H91A 3NA8A 2LLEA 4JTGA 3UJSA 4PRTA 2D1ZA 4HPXA 2HDJA 3MP5A 3W25A 3CZGA 2V9DA 7XIMA 3W7KA 3IS4A 4FNQA 5HAOA 5CBBA 2VEKA 2G3FA 4UOJA 2GPTA 3S2MA 2QDGA 3W6YA 2WKGA 2O4QA 3C2YA 3WH8A 3CV6A 4DF2A 4LGXA 1JAEA 1DJWA 1JDDA 4G56A 3EMZA 3ARQA 4DF1A 2WZTA 3EEGA 4UC5A 4P61A 3UZJA 3A3XA 3L66A 4S23A 4HVXA 4LB3A 3RHGA 1CTNA 1ZNNA 3LN3A 4W84A 4O50A 2JALA 2PP0A 1L6FA 5FJOA 1RVGA 4ACYA 2Z2AA 4Q8UA 1JYVA 4AQLA 1R38A 3UWYA 5IFTA 2BMBA 5EYWA 1OK6A 1MQRA 3QKZA 1FVPA 2VKZG 4ZE4A 3V0UA 4LY4A 4XZNX 3SCPA 3MMWA 2ZIDA 1MQPA 3M6DA 4FLOA 3CGTA 1JZ3A 4XSLA 1H4PA 4WX2A 3GNDA 4H8NA 5GPRA 3AIUA 3B0YA 4J3UA 1DJNA 1FWTA 1GVOA 4IPIA 4PCNA 5A2BA 3A64A 5CJ5A 4MHBA 3GTNA 1EPVA 4D2JA 4WUIA 2VDIA 3OZYA 2XVKA 1QPOA 2BSLA 4JAWA 3ITGA 4PUUA 2J78A 4B9YA 4JTDA 3B8DA 1UUOA 5HQMA 4ERIA 3P61A 4Q6XA 1GZJA 3UZWA 4ICNA 4UFMA 1AA1B 1HJSA 3NL5A 1LWJA 4LV4A 3LTYA 2BV9A 2YKKA 3KUMA 3SRHA 4JIEA 1OFDA 2PDPA 1W3NA 2G3JA 3AISA 1JD7A 3VNMA 3WUGA 1YADA 4JTAA 4EWJA 1VIWA 3GFYA 4I9JA 4EOUA 2CZVA 2GVYA 2ZUNA 1TPWA 1QTWA 3B03A 1RQHA 3H4WA 1W8GA 4EP8C 4TVCA 1RZMA 4IGMA 3SURA 4GMEA 1UP2A 1EQCA 4JX5A 3V36A 4LALA 2XPKA 5CZTA 1F73A 3P8JA 4LBRA 1CWYA 2PDFA 1VBGA 3NFUA 2UY4A 1SZGA 4QG9A 1Q7MA 1ADSA 5D9OA 1QU4A 1OFBA 5JBEA 4YYFA 3WJXA 3WFAA 2ALDA 4JQ2A 1JZ6A 1KA9F 4S38A 2QS8A 4L64A 2QCCA 1J11A 2FMOA 3GXIA 3GAKA 1Z44A 2UBPC 4K37A 2H90A 5A2AA 4IMEA 5AN7A 2VOMA 5XIAA 1WXZA 4UTTA 2Z1XA 2ZZ5A 4GVGA 4MZYA 4PGLA 1VBHA 1NTHA 3RGTA 4DZHA 1Q4WA 1W32A 5FJPA 3QR0A 5D30A 3KL5A 3LGDA 4W4QA 1TPDA 3WLTA 3G22A 2EG7A 2JK2A 3GR7A 1XR2A 3BAWA 3ZSSA 4OZOA 4ZSUA 2FQIA 2R14A 3ENLA 4L1GA 4EPKA 4XBSA 3Q4DA 1Z3NA 4LT9A 4POCA 3TYDA 4U28A 1XLIA 1NOUA 4QJ4B 3EPNA 3K13A 5FSEC 2VRKA 3LG3A 2DV0A 4ACZB 3KOFA 3AHZA 1B3XA 5KSWA 3MP4A 3JZUA 3APYA 4XAPA 5JBDA 1IT0A 4QLJA 3MYOA 1SJAA 3OA3A 3VGGA 1P6CA 1TA3B 1TVLA 1GKQA 2RJHA 1MEWA 3FGCA 1JPKA 3F4WA 1GHSA 1OC7A 3B05A 1ZQ5A 4GQ0A 2D2OA 4PULA 2WANA 4Q8OA 1WX0A 1R9YA 3QMTA 1S1RA 1H5YA 2A3BA 1DWAM 3FCPA 2J7CA 2VX5A 1HN1A 3NUKA 1IGWA 3CZEA 3FHQA 4MNJA 4P8UA 3H7RA 4GBUA 3R7MA 1FDZA 3KCLA 4M6PA 4LY8A 4QE1A 2D2JA 4DBUA 1A5CA 2YL5A 5KZ6A 1UH3A 2CZ5A 4LUYA 4MF4A 1I45A 2GVJA 2EPHA 1NFGA 2GOUA 3BG5A 4L80A 3ABOA 3HG2A 4H7VA 4AZCB 3ARXA 3HQPA 4GFIA 3WDQA 2NUWA 4HK6A 3QPYA 3XIMA 4F0RA 1MEHA 8XIMA 2ZBTA 1IQ8A 2NX3A 1CBGA 1K70A 4LUIA 1G6CA 1H63A 1OFEA 1NWSA 2PDWA 4DUVA 3CUIA 1Q2RA 3I3DA 3HFTA 5G1MA 2Z00A 3QW3A 2FJUB 3KP0A 1TVPA 4ML9A 3V16A 4S3JA 1L9WA 2ZRVA 1OK4A 2C18A 1H50A 1WKEA 3HB9A 4AUBA 2GDQA 4BS0A 4MJZA 1G4SA 1MW2A 2O7QA 3MCOA 1OF6A 3REQB 3V5FA 2BGQA 1Y8BA 3TCEA 3WQ8A 3VA8A 5I06A 1ADDA 1DXIA 1NP0A 2VEIA 1ODZA 3N3TA 4CD4A 1CECA 2C79A 5HBFA 3URBA 3DAQA 1EL3A 2WHJA 4MKVA 4B90A 3ITXA 2XN1A 3RG6A 1Y65A 1XJBA 1KKRA 4W8BA 3QZ6A 4J3TA 4TX9A 3TW9A 2C16A 1FWEC 3PZUA 3OP2A 3TN5A 5FL1A 4CVWA 3TC6A 5KEZA 1J5SA 4XAZA 1V6XA 4ZO9A 4RNJA 2TSYA 1IV8A 4MFDA 1OG0A 4HHHA 2QAFA 4DQWA 3G5EA 2VQTA 1M6JA 1IR2A 2XSBA 3MMDA 4QLLA 1W9XA 3WLSA 4PTDA 1FP9A 4L7ZA 4JR5A 5D2YA 5CGQA 2XG9A 3GG8A 2CLIA 3K8MA 1XH0A 2IKIA 2E3ZA 4JN8A 1KCZA 5BRPA 3IIPA 2V63A 1RPKA 4B92A 3VDBA 5BXTA 3RCNA 1L6YA 3L12A 4F0LA 1GOWA 4D6CA 2WC7A 2ISFA 1TUXA 2WO5A 3BC9A 2DQWA 3O2LA 3DYMA 3W7PA 5FF4A 4FNUA 3RUBL 1OBAA 3BJSA 1VPYA 3I7SA 4R53A 1AD1A 2VT0A 2CWNA 5HDRA 5HJLA 5AB3A 4CQAA 3N2TA 3I3BA 4PRRA 4PCSA 4XZ9A 5AECA 4WKHA 4W8AA 3I6TA 5E5CA 5ABTA 1FOBA 4JEQA 1WDWA 3NGFA 4QQ3A 1MW1A 3QPEA 5HOSA 4UQEA 2OQYA 4RDZA 1A5OC 2CBUA 3WZ0E 2BHZA 5M03A 2VGBA 2ALRA 2H8XA 2QF7A 4Q8MA 4RNHA 2I1OA 1S2WA 2WMHA 1KCKA 4OV4A 2HEJA 4ZA0A 5HMSA 1J4EA 3G2GA 4QJ5B 1AJZA 1BRLA 3MDUA 3W6LA 2VHLA 4LEQA 4N9CA 3MI2A 1R30A 1XPGA 1OZMA 4W93A 4V1YA 4G6CA 4ZTYA 2PDKA 3ARTA 3EX4A 5FJIA 1XSIA 1ELSA 1ME9A 1UJPA 3T44A 4IX0A 4PBGA 3V0TA 4LC8A 2Y0FA 3ATYA 1IXPA 2QGHA 3MS8A 2CLMA 4R33A 5IHRA 3ID7A 3M0MA 4J5NA 5A69A 2CXEA 3INPA 4JFSA 1R8LA 4Y7EA 4PMOA 1EGZA 3UZXA 2HNHA 1QVBA 1YBQA 4IF2A 2YOCA 3QYQA 4CUCA 3DFTA 1RD6A 5CC5A 3AMGA 1EF3A 4NZJA 4RDYA 3CWNA 4DUWA 3RR1A 4GUFA 4IIBA 2PDQA 1C8YA 1NM9A 1SW3A 3R0DA 3TX9A 5E6ZA 9XIAA 3II1A 3PTKA 1IEWA 1TELA 1E4LA 4GLEA 3CTTA 4DO6A 3T6CA 2WSPA 1YDYA 4HJWA 4QEEA 3UXDA 4A3UA 1O5RA 1N82A 2E67A 4P7OA 3WD4A 3KZPA 2VD8A 3OLDA 3AMCA 3UY8A 4CQBA 3EKZA 3UPWA 1EH9A 1BF2A 3PBGA 3PSVA 2BFGA 3KE0A 4LYKA 1U5JA 2CWXA 4NAEA 3WK2A 1SFSA 2ZCGA 2EPNA 1F61A 3W53A 2GUBA 5I77A 1XLKA 3A47A 3CLMA 4C6EA 3CO4A 1OD0A 1SO4A 3CS2A 1E6ZA 2ASHA 1O5XA 3W3OA 3GXFA 4FOUA 4H04A 1UZDA 2VZSA 1Z9AA 3ZT6A 4JKMA 4Z1CA 1H7PA 1UR1A 5FL0A 2W66A 4EWND 4MJ4A 1KD0A 4NZFA 4JTUA 3KOYA 7ODCA 3G0UA 4C6CA 1BKHA 1JF5A 3PZTA 4C6JA 1OD8A 4GO8A 2XIOA 1O5KA 1IEVA 3S8HA 4UWMA 2CKSA 1FHVA 3IK4A 1GK8A 4LEFA 1Q63A 1B3ZA 5K9XA 4D6IA 1NP2A 3VGBA 2RDXA 1T7LA 2DSUA 4LB4A 1DHKA 2EKGA 3TXVA 5CLWA 3VYLA 4GNJA 4A3YA 3FYYA 2WMIA 1LORA 4Q4PA 2YL6A 3WLQA 3IAQA 4R7JA 3G8EA 3T0AA 2OZ0A 3R10A 1XBZA 3PZ9A 4M7TA 3N9KA 4OUIA 2GK1A 1CLXA 4JQ1A 1WV2A 7REQA 2ZTKA 5AYZA 4ZQMA 3NQCA 2Q71A 4KGJA 4Q8PA 1K9DA 3IIVA 3DGRA 4Q32A 3TFXA 1IYXA 2TAAA 2CZDA 1X1ZA 3S3GA 5A6AA 2Y7FA 5I3IA 3TR9A 3IIOA 4RNFA 1US2A 4CN4A 2FPYA 1X39A 1QR7A 1YE6A 4ZVJA 2XJ7A 2B7PA 5DQPA 3HA1A 4JKLA 3P93A 1V8EA 4ENLA 5CEWA 3AUOA 1SZFA 3M7WA 3KM8A 4XO7A 3S5OA 2J8GA 4W89A 3UJFA 3N04A 3AYTA 3OHIA 3W72A 1TTQA 3BAXA 3RRAA 3MHGA 4YVPA 2IPGA 1W0MA 4IPNB 1B9ZA 3AQUA 3WLRA 1EGVA 1GEQA 4MWAC 4QX4A 1GT8A 3FGCB 4I90A 2HK1A 2YFNA 1ZU8A 3JS3A 1DKWA 3OU8A 3TJ4A 1MO0A 1TPVA 3NL2A 3DI0A 3GH5A 3WBEA 5A8MA 1RCOB 4KMQA 5IBXA 4PMXA 4FR6A 4K8GA 4ADTA 2FPVA 3N15A 2V3GA 2BZNA 1P7TA 5FOOA 2AQWA 3NPUA 3GNXA 3VNJA 1RXOB 3FIGA 5HWJA 2DZSA 3RIKA 4XBKA 3RM9A 4QBXA 2Y8UA 3VNYA 3MU7A 2ACQA 1CGYA 2F2HA 3NEVA 4KS0A 1EUAA 3K5XA 5LHFA 3DKLA 1JD9A 3AS2A 4XX6A 3GX9A 2WSQA 3LCIA 3B9DA 4KETA 1XIMA 4EPDC 1RP8A 5TF0A 2F2KA 3R25A 2ZOXA 2CETA 3VD3A 4AVOA 3H2FA 3AS0A 4DXKA 5AHEA 4O1EA 1UH2A 2UWFA 3WH5A 3MB9A 3BG3A 2NVDA 4IUOA 1TYGA 2BB0A 1Q7ZA 2INEA 2WW5A 4DBDA 2HVMA 2YYUA 1QI3A 5EA9A 1WDQA 1W1A1 3BLDA 1YKWA 8TIMA 3W4RA 1DVJA 3BV7A 4Z2GA 1ZJIA 1IXNA 3CHCA 2QMKA 3WQPA 3IVSA 1ZAJA 2V0TA 5CZSA 4IGSA 3UWZA 1XKYA 5CG7A 4FNPA 3KS6A 1WXYA 1I6NA 1DXFA 2POZA 2QPXA 1SUXA 1EC9A 1YTEA 3ITCA 1JZ2A 4INFA 3NTYA 5I00A 1JPMA 4YMZA 2WM1A 3PWGA 3L67A 4GVIA 2ZXDA 3AMKA 1P0KA 4QEHA 5JMUA 3W7RA 3UR2A 1BG9A 5DBTA 5LNUA 3WNMA 2WQPA 1TZZA 3CLWA 2WM0A 1TCMA 4H00A 4N9BA 1SMAA 3S5YA 1FWNA 3G8RA 3RLVA 1F05A 4IGHA 5C9WA 4HGXA 1TTPA 1TJ0A 4MAZA 3W1PA 1OC6A 3TYEA 3FAXA 1GKPA 2PTZA 1T8XA 4W7VA 5CSUA 3NZRA 3RU6A 3WLIA 3NVDA 3K8LA 3W2MA 1XRVA 4AB4A 3OLGA 2CEQA 4ATLA 1AODA 3ONBA 3LCWA 2QNEA 1M01A 3AJ7A 4HBKA 3E0LA 2ZXQA 3ZSTA 2EPOA 2ACUA 3H2EA 1R87A 1SGJA 1O66A 4GNVA 3NURA 1S3HA 1EJVC 2GVLA 1S39A 1O4UA 3TAOA 1XLLA 4PMYA 3N18A 2G97A 3F4NA 5ABEA 3WG6A 3VIFA 4QTGA 3PBMA 4IMGA 3VNKA 2C15A 2BOFX 3DFYA 1EX1A 1JPIA 3OZOA 1RHCA 4CD7A 1TPB1 1Z7AA 4Q8TA 4B5SA 4PUEA 2G41A 2YB1A 4C6IA 4H83A 2FKPA 1J79A 4GUIA 3S47A 1W1ZA 4PTVA 1QMLA 4TOQA 2W9MA 3SCUA 2NQLA 4JCMA 3RMEA 3B0UX 5AYYA 3I4EA 1TPH1 4WRHA 1XLMA 2SFPA 3NJ3A 4FLRA 1EJTC 4N0RA 3IJDA 3MT1A 3UR8A 2YA2A 5IOBA 1XYLA 4CCEA 4J40A 3P74A 5AC7A 1BWLA 3PBUA 4WY0F 3LQGA 2J9XA 6REQA 1BRLB 4Q3MA 2AOSA 4GH1A 3TTOA 2J79A 3VU2A 2YFOA 4UB9A 5E70A 3E96A 4O1BA 3R6IA 1W9UA 4I3GA 4DNHA 5FEXA 2DIEA 2YL8A 3Q58A 3EWUA 4NZ5A 2XH7A 2FH8A 3N4AA 4A2SA 1SMDA 5DY3A 4TV5A 5F1VA 3R94A 2VEPA 4ZFCA 3LRMA 4L1WA 3V5OA 4K36A 2ZA1A 4LVGA 3GNRA 1BXNA 2WQDA 3WENA 2VWTA 1PSCA 1YBQB 1CGXA 3STEA 3L68A 1H7WA 2BVTA 1J0JA 5SWUA 4YLWA 3BH4A 4HZMA 2KZHA 2VX4A 4KH2A 2NLYA 2FHFA 1BVNP 3LERA 1C8QA 4ILSA 3TZFA 3QHMA 1ZAIA 3TC7A 9RUBA 4FAMA 3PWIA 1JULA 3RLHA 2CHNA 2FZ9A 2BLEA 3GBDA 2XVGA 5T8GA 2OLHA 3O6YX 3N4FA 2J47A 3PNZA 2BXVA 1OF8A 3BGJA 4B5TA 4HSNA 3RX2A 4WGHA 3BW2A 2A6LA 2CLPA 5ABHA 3GD6A 3B4UA 1BF6A 4CVUA 4WJXA 3WQDA 1OWQA 2E9MA 1HKMA 1OYAA 4FALA 1VLIA 1IXOA 4NAEB 3SBFA 3ZLGA 2OZTA 2I5GA 1W5OA 3OJGA 3PG8A 5BW6A 2NQJA 2XVPA 3FKKA 3S4TA 2EJ1A 2OVLA 3GH7A 4BA0A 1V3HA 4IQDA 3N12A 1FWGC 4GY1A 1RUSA 3KEHA 4OBRA 4YS1A 4PUWA 1GTHA 5A2CA 3VTRA 4TTUA 2PDCA 3P60A 4HNNA 4MMWA 5HPCA 1GGOA 4YYCA 5G4WA 4PA8A 2NXGA 3LB0A 3SGUA 4AVFA 1QNSA 2YL9A 3MUZ1 3W83A 3MUY1 5HJXA 3DFOA 3IV8A 1GHRA 5I78A 3TWAA 1EP3A 2C13A 4L61A 2WMIB 3P14A 3ECQA 2Z2UA 1KFWA 3IPWA 3FJ4A 3E02A 3WFLA 4NI3A 1C91A 4QGCA 5LKYA 3TNOA 5F1UA 2FPTA 2GK1B 5I3HA 1SSDA 2PBGA 1SR0A 7REQB 3MP3A 3L4UA 5D8ZA 4P8XA 5C2XA 2XZ9A 4KEMA 1B57A 4HA3A 2OWCA 1G67A 1YXCA 2H6RA 3Q2DA 3OBKA 5E09A 5M3WA 1V6VA 4XAYA 1LQ2A 3AIRA 5F2IA 3AYVA 1EHAA 3FOKA 3FS2A 3FVMA 2RHGA 1GJUA 2R24A 3PY2A 4DXVA 1F8MA 1JL8A 1MFVA 3UXKA 2DT3A 3U7BA 4L4OA 3R8GA 2Z6IA 4GRSA 3WJSA 1RLCL 3H2MA 1KM6A 3ANVA 2OGYA 4Q7BA 3USZA 3N25A 5DEZA 4HNVA 4KWUA 3R12A 3W87A 3QBUA 1F5ZA 3G1SA 4Q4OA 3R8RA 2ZXAA 1J8VA 3WF1A 4RK8A 2QCLA 1K7EA 4GIAA 1F3XA 2I14A 3K46A 3THQA 5GJMA 2EXOA 4LAMA 2Y6ZA 3BCDA 5EB8A 1OYBA 2W4XA 5G1YA 3C0JA 1C9DA 2XM2A 4O54A 3MO4A 1Q3NA 2OKOA 4X60A 1M7PA 3ZWTA 3HGSA 2C7FA 5GJNA 2XZ7A 1NFPA 4N7QA 3HG4A 4ZTXA 4MB5A 3RJXA 1H7OA 4QJ1A 1P7TB 1T41A 3EZ4A 1C8VA 2OT1A 4AHQA 2ZX7A 3G3DA 4MY1A 3I4KA 2HS8A 3I68A 1NU5A 3MMTA 2XINA 2B7NA 4DHGA 2OODA 3AHVA 4O57A 2C1IA 1NDVA 1KR0A 3KXQA 2PTYA 1L6GA 3BW4A 4V2XA 1K8ZA 5EFFA 3WY1A 4J28A 1KBIA 1SFLA 1ZUAX 3PAOA 3S1VA 5PTDA 4BFAA 1I4NA 1AZ2A 1Z48A 3BMWA 2OQLA 5BU6A 3HGJA 1F6YA 1WUFA 2PD5A 4MPQA 3DG3A 1WZKA 2DH3A 4ASTA 2IPJA 1DWIM 1QNVA 2AGKA 4IXHA 4F9JA 2VC7A 1J2BA 1BWKA 4ECLA 3WLLA 4LAZA 2DQXA 1THFD 3BLFA 3C8NA 3GHSA 1XGDA 3QFWA 4HB7A 1LQ0A 1R7AA 3P84A 4NXKA 2CU0A 4O8RA 4GX9A 3NSNA 2VZOA 5D9PA 2CIPA 4C65A 2F84A 3I7RA 4JZ5A 3GNPA 4LAUA 2P1FA 1XBVA 3LV6A 4ONVA 1NFBA 4QITA 5D37A 3NXFA 1Q8JA 4XTDA 1KNWA 4WSJA 4DO5A 8XIAA 1M7JA 3UPBA 3LBCA 4X9SA 1UHVA 3CHVA 3S6TA 3AYSA 3UZYA 5BXRA 3IIZA 1GVRA 2HVNA 1Q4NX 3H26A 3E2SA 3RJYA 1RQBA 1K9EA 2XIJA 4O0QA 3A4AA 4MNMA 3W2JA 1K8CA 3N14A 1JJKA 1R5YA 2BBFA 2QT3A 3ANYA 3H8AA 2GGEA 2Z2BA 5AHLA 2J7DA 4XIAA 4AC7C 3S42A 1AD4A 4MAVA 1KTBA 4ORIA 2PPGA 4HHMA 3THAA 3S1WA 4ZO7A 2ZX9A 5A1AA 1K03A 3C56A 4J4KA 1MUWA 3BSMA 4AY1A 1PKNA 1SFTA 2YA1A 1DJZA 1RP9A 1DE6A 1FWRA 2YSWA 3NQFA 3RN6A 4Z1DA 1UQZA 4TR9A 5DBUA 5D09A 3VABA 1ZGDA 2V38A 2OEMA 3TC3A 3DIPA 1C9WA 4BJHA 3PS7A 3FX4A 2WBGA 2ZZ4A 1EWEA 3PK7A 1QI4A 3B3DA 4IMCA 3P2VA 4YHGA 5FSDC 4KGLA 3DHPA 2QKFA 1B0IA 4D1IA 4CN1A 1XIHA 2VUNA 1LWIA 1B9BA 2ZKMX 1W3TA 2V69A 2PEVA 2YLLA 3LPPA 3SFWA 5A3HA 2I7GA 1AW2A 1TV3A 4C91A 1RJPA 4M82A 1BQGA 4U4MA 3JU2A 3OLIA 4IIEA 2OZ3A 5FF2A 4U5KA 6ENLA 3EMQA 4LANA 3SUVA 2BNJA 3RFAA 4UCGA 3FDGA 3WLHA 6REQB 3EEZA 3CAVA 3H55A 2E09A 4ZR8A 2WSRA 3SCTA 1PL9A 4K6AA 4N02A 2YW4A 1KM1A 4O1FA 4RW3A 1UWRA 1XD0A 1QI2A 3HV8A 1FHUA 4B4FA 4S3KA 2D73A 2UY5A 2BY0A 1ZJBA 3LYEA 4NHVA 4WHBA 1TJRA 3AXXA 1CGVA 4W7WA 1NWTA 1VKFA 1R2TA 1GYNA 3W02A 3CUXA 1OX5A 1TIMA 3G24A 2Q6ZA 3GW0A 3CHFA 3IWPA 3ZQ9A 1RBLA 5A8GA 1VCGA 3F5JA 1X98A 1XF0A 4A8LA 2ABAA 4V1XA 3WIJA 3C2FA 1W3HA 4AIBA 6TAAA 3NCOA 2V3FA 4RL3A 3UT0A 4TIMA 1E0WA 3BANA 4FP1A 3KBSA 4K3ZA 3DHUA 1X7IA 5A8PA 3RLUA 3G0SA 3IACA 1D3HA 3M0XA 4AYSA 3MVIA 4MB3A 4O52A 3B4YA 2QLYA 3KTXA 4UR8A 3O63A 1TG7A 2AL2A 3GLCA 2VEMA 3PUGA 4ZQRA 2D20A 4AHPA 1KCXA 3CQKA 3VKJA 2YXOA 2OX4A 2QYGA 3B04A 1KFCA 3K1GA 3ME3A 3M16A 3UERA 1ZAHA 3GG0A 3BLEA 4UZUA 1TTJA 2WAGA 1U1JA 4WF7A 2PFHA 3CHEA 1EUNA 2FZNA 3IAPA 1WUEA 2J7BA 3OIXA 1JXKA 3G1RA 4Q33A 4D8LA 1EZWA 5C54A 3GH4A 1UKSA 3R89A 5CH9A 2G4JA 5DMMA 2QDHA 5EMKA 1H2JA 2FTYA 3GDBA 5I79A 4HZ7A 3O06A 4WVXA 3NQAA 3CUHA 3UWQA 1W6TA 2H8ZA 2GGIA 1IEQA 1WNOA 5FAGA 1RCQA 3URQA 1YQ2A 4QXIA 3WQOA 2E8YA 2PTXA 4NRSA 4AG0A 3CUZA 5DT7A 3OG2A 3WQ4A 2X2YA 4Z2HA 4H19A 3LTSA 1E9LA 2X1UA 2CBVA 3NQ8A 3G18A 1UMYA 2FGLA 4FOJA 4BWLC 3MMUA 1ZALA 4QISA 3E5PA 1GW9A 1TJ2A 3EX6A 1PIFA 2C0AA 3GHUA 2OO0A 1I0DA 3EMCA 3GYCA 1U5VA 1OINA 4DLMA 5CZKA 4ERAA 3RU8X 1P6BA 1KW1A 1W3LA 1V0MA 5TD4A 5J5DA 5G1TA 1IWBA 3WQ6A 1ZY9A 2QIIA 1J0IA 3G77A 1AQHA 3LSBA 3W22A 2OSXA 4REQA 3W23A 4GWEA 1X96A 2HQAA 4E4FA 3CYJA 4QS5A 2NSOA 1ZP4A 3HU7A 4Z1YA 1GOKA 3QTPA 4A8RA 1HVXA 4NAFA 3QGAC 5I3KA 1UBSA 3W1XA 1J96A 3GIPA 1ZTVA 1EA0A 1XWYA 5HNNA 2EKCA 1UMLA 2DT2A 4UTTC 3N11A 3VFCA 3LNPA 2DUXA 4Y9OA 1DIDA 1UC5A 4EKJA 1ALDA 3IJ7A 3SEPA 1DYSA 1VYPX 3H70A 3TMQA 3PTDA 5AY7A 3RK8A 4DLFA 1VENA 1FFQA 2PE4A 4AAJA 5GJPA 2NQ5A 2X05A 1PKYA 3GKFA 3O16A 2UV8G 3TKFA 1SJBA 3WJWA 1VQTA 3E2VA 4HA4A 1A5MC 3N34A 2RKXA 3VM7A 1W2VA 3UY7A 1FXPA 3UG3A 4PMQA 4D72A 1OJXA 4RDWA 2E5BA 2W3ZA 3BW3A 4MKSA 3WK3A 3T2PA 3FEQA 3HURA 3N2OA 2J27A 3RX3A 3W2NA 3A6OA 1M1BA 1U83A 1J01A 3NM3A 2Y2WA 1R9ZA 1DIKA 1YXDA 1K77A 4NJIA 2E6FA 4DF0A 3ZJ7A 2PDBA 2E25A 4H6KA 3SQMA 5DX7A 2Y7GA 3N17A 2P3ZA 2VFHA 2GGGA 1V6TA 2EAWA 1VIZA 4W86A 1TR9A 2W6RA 3SECA 3S1GA 4NG3A 2B7OA 3I6EA 1E6NA 2BOEX 1HUVA 5LA2A 1TQXA 4XTIA 3TN4A 5HANA 4P7QA 2J62A 4FI4A 3QZEA 2J13A 4QAWA 1TV4A 3AYRA 4HTYA 3S2LA 3RDKA 4GXMA 3W1UA 3DC0A 3EBVA 4WKAA 3ZMRA 3QMSA 5F2MA 1V51A 2ZRUA 3ITVA 1UWIA 1PIGA 1RBOB 4PMZA 3SGZA 2OOGA 4RV3A 2FVKA 3MYPA 1YE4A 3T2OA 2Q3OA 2B81A 4V28A 1SO6A 4C6KA 4LAOA 1R3SA 1ISWA 1CLVA 1M41A 1XIGA 3SN0A 2HNEA 1JNDA 3CTLA 2AGTA 1EDTA 1I2PA 4EAMA 2XN2A 4XD3A 1C8XA 1KR1A 1W9BM 1MW0A 3DERA 1EEPA 4FMVA 3W84A 2ZX5A 2YDQA 2GQ8A 2HE5A 4PSRA 3ISIX 1EC7A 1LLWA 3WQCA 2ZQ0A 1R2SA 4PB4A 5BWFA 2D0FA 1A5KC 2Y7DA 2FTWA 1DHPA 2AAMA 3S6OA 5C2CA 1ODUA 4HN4A 3STCA 2DZPA 2G3MA 4PUKA 3WLKX 2ONEA 3O15A 4M5PA 3AJXA 4YL2A 3H12A 5CPTA 3VUSA 4H6RA 5C55A 3QC3A 5HXMA 3B0XA 4V33A 3FXGA 1S2TA 1K6WA 2HCVA 4URIA 3OB8A 2WNZA 2DW7A 3PZGA 4PUMA 4TXEA 3W37A 4DZ5A 3MUIA 1L6WA 4OTKA 5FEZA 2Y8VA 4Z08A 3LK6A 3TW6A 4O28A 4WSHA 2A3EA 1T40A 2R1MA 4ZQCA 2G96A 3AIBA 4GH3A 5BOFA 1YPIA 4R7OA 3W7GA 5CSSA 3R4IA 2PDLA 1P0NA 3F4CA 7ENLA 3TUUA 3S9IA 2CW6A 3QEZA 4CCCA 4XSMA 4MTVA 3UETA 3IJ8A 3TIMA 1W1IE 3WKZA 3SADA 4PB3A 4RE0A 3UG4A 3CU2A 2NWRA 1K3UA 1E6PA 3QTGA 3CZ8A 4LVFA 3QVQA 1DQUA 1TE1A 1MXDA 4S2BA 4CCZA 2Y63A 3O3RA 2WOQA 4KWOA 1V02E 1YNYA 5TBOA 4PUJA 1UB3A 5AYXA 1GOOA 4Z2LA 4DUOA 1AK5A 4GJ1A 1YPXA 3RYSA 3RPTA 2DZTA 2QUNA 3B06A 3TSDA 1X8FA 4L6OA 3L5LA 1M65A 1SZNA 5E6YA 4A21A 3B40A 3CUJA 3LGEA 3P8IA 1O5QA 3QR1A 5H8MA 1QT1A 4WR3A 4LS0A 3SQLA 1KBKA 3MPGA 4G5DA 2QJMA 1QXLA 2Q8ZA 3ZT7A 3DYPA 4CQCA 2Z7GA 5DCBA 1FKWA 1AQMA 4XBJA 4JX6A 2X0YA 5DFAA 1I2NA 1U22A 3QXBA 5ENLA 3AICA 5L9FA 3CMFA 3LV5A 1BVWA 3SRDA 2XIMA 1PAMA 3CL6A 4B3ZA 1J12A 3IRDA 3RF9A 4LS2A 3NOYA 1HL9A 3WYZA 2HISA 4UMBA 1R3WA 3THCA 3QPZA 4GG9A 3LS9A 1AJ0A 2ZADA 4ZOAA 3LCGA 1UR2A 5C5YA 2CLOA 4IHCA 3PFMA 2XDFA 3MSYA 4LWWA 1BG4A 3HG5A 1MDLA 3ZO9A 4DWSA 2OXNA 3M44A 3WJYA 4O1DA 3CJPA 3RR4A 3TA6A 3JZEA 3QV8A 1XYMA 4GI6A 3PJTA 3OZPA 4NILA 4PBFA 4UOZA 3D3FA 3GKAA 2VMFA 4LV9A 3W9ZA 3W2KA 2V2HA 1XSKA 2PWDA 1QOXA 2PLCA 3O9NA 4IP4A 2NZLA 1XLGA 4DY1A 1AH3A 1T6MA 3UBPC 2GJPA 4M6UA 1ISZA 4IMFA 1E56A 2NT1A 2NUXA 3MKCA 1OIFA 2RAGA 4U3AA 2BDQA 4CNTA 2PDGA 1N8FA 1TWDA 3E0IA 1DWGM 1FH7A 1VAHA 4UFHA 4W88A 3SJ3A 4JXCA 1DEDA 1S38A 3NQ6A 4HHPA 2ZUVA 1E1FA 5IDZA 1NDZA 1NWRA 3N6JA 2ZZ3A 1KGWA 4GPNA 5AVNA 5I5RA 1W17A 4JHZA 4UNLA 1QBAA 4JTCA 1ZENA 3V3WA 2PZ0A 5LHEA 3TQVA 4JBRA 1Y5WA 2QW5A 1XBXA 4F0KA 3BGAA 1HP5A 3TTQA 3O07A 3UXIA 4UXDA 4PH6A 4PTXA 3AALA 2PRMA 3CQHA 1A5UA 4JYFA 3W86A 2OYMA 4IJRA 1EZ2A 1CENA 3UWWA 4HSOA 4LUSA 2GWNA 2DT0A 4REQB 4O15A 2IPWA 1VFOA 3T0CA 4GBDA 4S2CA 3W71A 4DZAA 2PWFA 3VKAA 5HA7A 1VFFA 3DXIA 1VPQA 1F8IA 4NAFB 1KM5A 4X0VA 4MPKA 4M0XA 3DESA 4Y90A 1UASA 3PM6A 1VFUA 5BXPA 2R6OA 4P7NA 5G5IA 2ZUTA 4W5UA 4ORMA 3UWVA 4J2PA 3P5ZA 3NPVA 3A24A 1KB3A 1MZHA 3MW7A 6XIAA 3BICA 1LWHA 2JBMA 1OT1A 4NNBA 4GJJA 2REQA 4UFJA 1PB0A 3AWOA 4LFYA 4GCAA 1EWDA 1EP1A 3PPGA 2P0IA 1SVDA 1KFLA 4MB1A 2F7FA 2X30A 4WK9A 2NV9A 3O6DA 3VAVA 3VI2A 5JVLA 1LT7A 3ZR6A 3SUWA 4GOAA 4WDTA 5EMLA 4QP0A 1P0BA 2GJNA 3SSJA 2L5HA 5I3FA 1MWOA 2XGIA 3QGKC 4C6FA 3FJNA 3LEPA 2A85A 2EBNA 3DYOA 3L2MA 3EKGA 3P5YA 5E0FA 3GC5A 2VXNA 4L9YA 1GUVA 1FWWA 1MFUA 4NJHA 2BVYA 2E6DA 1JCYA 2OZ8A 3GR8A 1RR2A 3UWEA 1BD0A 3L5AA 3ZIZA 3C0QA 3PZIA 1WA3A 3QOMA 4UUIA 3BE7A 2HE8A 1JDCA 3FSUA 4N2YA 1S5TA 3TLQA 1ONEA 1A3WA 3IEBA 4QLKA 3VE9A 4QRNA 3BQ6A 2E1WA 1OABA 3W82A 3H53A 2WVUA 1IZJA 2C1HA 3TK7A 3L4WA 4G9PA 2Q8LA 4PMJA 3MZ2A 4NZCA 3VVGA 1PWMA 1JFHA 4AC1X 4XQ6A 1WDDA 3NDOA 4CD5A 1WE5A 4R5EA 2FLIA 4GKTA 1H1YA 3N9RA 4B91A 1UP0A 5EGRA 3DG6A 2IUZA 1QWGA 2OG9A 5HATA 3LMYA 4IPPA 4PTMA 3TYAA 4HD5A 3HQOA 2J7HA 3STPA 3RO6A 3POCA 1VJIA 2CBJA 1TE6A 3NDYA 2ZRYA 2VC6A 1UIPA 1H51A 2Z1WA 3JR2A 4K68A 1FUYA 3FAWA 5H1WA 4DJEA 5AYBA 2PS2A 2D23A 4O0KA 4LS1A 3L4VA 1UP3A 3VX1A 4RDVA 5I02A 4GUJA 3D46A 4RUBA 4WLCA 3L23A 2EJAA 4XV0A 1KM0A 4KW2A 3GO2A 2GZXA 5EKYA 3B8TA 4AD1A 2OEJA 4NY2A 4Y8FA 3WDPP 1ICPA 2XISA 4HYWA 2P53A 1XH1A 5I03A 2HBVA 3UVIA 3WDIA 1XP3A 4UTJA 4FSAA 3ABXA 3WNKA 3FY1A 4XIMA 2WPGA 4CN6A 1KFBA 5T9BG 2VVNA 2PU0A 4J3XA 1GVEA 1XIBA 1TFVA 5AHIA 2XIQA 3F4DA 5LIYX 4Z42C 2UZ9A 2XVNA 2WWCA 4S3BA 2HRWA 4QSHA 5CCZA 7TIMA 3WMBA 4AVNA 4DYEA 1RA0A 2P10A 3SUUA 4RX0A 5E1QA 1QCWA 2ZUUA 2DIKA 1C90A 1OVDA 1WQ5A 2FVLA 3OYZA 4AMCA 1XRFA 1EDGA 4LBUA 1JNEA 2DSZA 2GDVA 1E6QM 1V3JA 4TO8A 3FA4A 1KC7A 1D3GA 4Y8EA 4FX7A 4YIWA 4UTIA 4S3AA 3T2QA 3P0WA 1NDWA 2R82A 3IGXA 2XIBA 1K6AA 4QS6A 3N1AA 4FF7A 1TV7A 1Z32X 5IRPA 1GQJA 3M0YA 1JRBA 1OFAA 2BXZA 4AZ5A 1NQ6A 6A3HA 1VBUA 3ARYA 2PSNA 1KRCC 5JIPA 2ZUMA 4GABA 4NL1A 4DNMA 3RNDA 4AWEA 1AL8A 4FR1A 5U4NA 1EC8A 3AU2A 4YTRA 3W7NA 1XUZA 3NM1A 4KERA 2ZA3A 3HJZA 1E43A 2YX0A 1K02A 3MWAA 1JG9A 3TYZA 2OMAA 3E5BA 3A13A 5K4ZA 5B7YA 1XDJA 1OB0A 3CPUA 1PZ1A 3TW7A 3L2IA 3LHTA 4AD3A 3ZR5A 4J9JA 5D04C 4WXYA 5I07A 1X6NA 1LTDA 1XS2A 4A22A 5DXYA 1ME7A 1Q85A 5HULA 3GVVA 2C0HA 4C1NA 1UR0A 3FXYA 3AHYA 4MFEA 4M56A 5JH2A 2AMXA 1KFKA 3RM4A 4JN7A 3DCPA 1BGGA 1EXPA 2E7FA 4AX7A 2DZXA 1LCOA 5I7GA 4A6GA 4PMRA 3AWNA 5A94A 1JDFA 1G4TA 3LXAA 1Y7VA 2W79A 4JIHA 3EX1A 4UTFA 4ML4A 2ICSA 2NX1A 4X2PA 3GDLA 1YHTA 1RA5A 1ZSXA 4NKCA 3HQNA 2BOGX 3AXIA 3LU2A 1YNQA 3GXMA 2W63A 1DIOA 2R9RA 3W1LA 3L4YA 1DBTA 1VP5A 4NZ3A 1GQIA 1OM0A 4P2VA 1E0UA 1WBJA 4DWSB 5DCEA 3WJZA 3SFKA 1OADA 2CBIA 4GI8A 2GSEA 2Z28A 2VX7A 4XISA 5CG0A 3LSCA 4UZSA 3CH0A 5EMJA 1GVQA 4JYEA 3A22A 2X2GA 1UQYA 4HK7A 1H3GA 4YCPA 1FDJA 4JFVA 1JQXA 2OSYA 1QASA 2F8QA 1DIEA 4NZ1A 3V4BA 3EWZA 3PANA 4KCTA 5I23A 1SQ7A 3FLUA 3G1FA 4DJDC 3G0XA 4YN5A 4EF9A 5A95A 1ISXA 1RJRA 1KRMA 4A35A 2ZRXA 1ZLPA 4JPGA 3DFSA 1FBAA 1PHQA 1UD8A 3UXLA 1JI1A 4IZGA 3R5EA 1EOMA 4GKLA 1XL9A 4R85A 5K9DA 4R7WA 5A8NA 3U8GA 1VF8A 3TWBA 3RPMA 3LHYA 4FLQA 1I2RA 2A6NA 3A4WA 2QUTA 3VGHA 3AZRA 2X1TA 1LOSA 1CB2A 3L21A 1WO2A 1QPNA 4K8HA 1SJDA 4AZIA 2IW0A 3M0KA 2I16A 4IP5A 2ZDRA 5LNVA 1G94A 1ITCA 3KVJA 3M0JA 3QM3A 1TTIA 4LUSB 4TV6A 1UD2A 5LSMA 1J6PA 4A8NA 4FS9A 3UCQA 2GSJA 2QV4A 2Q3RA 4JTKA 2HXUA 2Y4SA 2PWEA 3NPXA 3L4ZA 2A3AA 1Q6DA 2CPUA 5AFDA 3N2XA 5BWAA 4Q7IA 1HO1A 1WZLA 4LJ3A 1DJHA 2QPSA 3G1YA 1YRRA 2ZUSA 4U31A 3BLLA 2XVLA 5CZ0A 2DSVA 2REQB 1CT5A 3IJIA 4P8VA 5I2UA 3Q37A 4GHRA 5C0QA 3USBA 4JD4A 2IQ0A 4IMDA 4XUGA 4J2MA 4KKXA 5BROA 3JRKA 4XVEA 3ZZ1A 4TQTA 3BL3A 4FNTA 1SJCA 1YYAA 1E51A 2C8NA 2A21A 4Y9PA 2ZDSA 3PZMA 3UGVA 4BK9A 1B31A 2QCDA 3KVLA 3CUGA 2CFFA 4GFSA 3KRZA 4JTJA 2WSKA 2ZX6A 4E6MA 4NI8A 2BG5A 1V93A 4N42A 4AIOA 2W0UA 3NO5A 1QW7A 2RGMA 3GTHA 4B5NA 1W2PA 4G1KA 3MTWA 4HYRA 5AZ0A 2FDSA 4HK5A 2FZDA 3AMLA 2PI6A 3L7RA 2WJEA 2DY3A 1A0CA 4DWSD 1VJSA 1ZFJA 2WMGA 3M0HA 1C29A 1XH2A 2C6QA 3ARSA 5HR6A 4P8WA 2PGRA 3V0SA 1YDOA 3BURA 4LF1A 4TU1A 4ZB2A 2ISWA 3KL0A 5CPMA 4IG2A 1VPXA 3ABSA 4AWUA 3WUEA 3KWXA 3GVQA 1QHOA 3M07A 2V30A 4D9PA 3U7VA 3AI0A 4LU0A 4RE3A 2VGIA 5HUPA 3NDZA 2YDAA 5JUVA 1UKPA 2PDIA 2XFWA 4O4VA 3HPZA 4NXSA 3HIJA 3TJXA 2OTDA 5G2IA 1M3UA 1VEMA 3EXTA 3M7SA 3OVRA 3R0UA 3CAQA 2E5CA 3FJLA 3ZT5A 1ISYA 1FWBC 1F3TA 4M8UA 1JVNA 2J7GA 1QO2A 5E0KA 1MDRA 2HZGA 4WD0A 4LTSA 4GGBA 4HNTA 1H49A 4CNSA 1NDYA 3WDHA 2VM8A 3PB2A 4HP5A 4XZHA 5CZJA 3G1AA 2G95A 2NV2A 3CIVA 3KS5A 1REQA 1EO5A 5BOEA 3VIHA 4CU7A 2EGZA 1X6LA 1VR6A 3LXBA 5D02A 3A5VA 3NO3A 1TPEA 4DPQA 4LAKA 1HP4A 4BI7A 2CESA 3W1NA 1CXFA 1E6SM 3IUIA 1XX1A 3H2OA 4JX4A 5DLCA 3ITYA 7PTDA 2O0TA 2GFTA 4CQ8A 1YTDA 5FJRA 3WF3A 4LVDA 4AISA 4UTWC 3VKCA 3ORWA 4S39A 3COTA 1RD5A 1KFEA 3W2UA 2VNCA 3BPWA 3CIXA 4HZ6A 4J27A 3U2EA 4FK9A 3MY9A 1ZHAA 3F7JA 3HTWA 1XGZA 1B3WA 1CXEA 4D6GA 4GI9A 4HA0A 3GXNA 2IS7A 4MYXA 3L0NA 4Y2WA 5AZ1A 3I10A 1Z6KA 1CXIA 2INFA 3T7VA 5LIUX 3VK5A 4E8DA 1S2UA 1GG1A 1C93A 3P6LA 5B80A 3R43A 2WNWA 3M43A 3OA5A 4E2BA 4RXGA 1P1XA 1D3CA 3H24A 3RXZA 5H2ZA 1Q6LA 3VOIA 1Q13A 3W88A 5DELA 4HKPA 3LQLA 2XTKA 3VILA 3GRIA 8CGTA 3TOPA 3FHAA 3KBNA 2HS6A 2WHKA 2V82A 5A8QA 3GR4A 3VM5A 3PR2A 2ACRA 1G7UA 1UW9A 5I24A 3QF0A 3WUFA 5A6BA 4JNMA 4ZSTA 2X09A 2ZRWA 3WQ5A 3TROA 3QZAA 3NPWA 4YXGA 5CPQA 3UA4A 2QJNA 4QE5A 3O05A 2OSWA 2WMJA 1W91A 4FB7A 1GONA 3GXPA 4M7SA 1ZS2A 3EWYA 4GC3A 2VC5A 5FKYA 2NV1A 3QKEA 4QNEA 3QY8A 3MHUA 1A50A 4XK2A 1TCDA 4JTSA 2I56A 3F4VA 5M1TA 3CEUA 4WEVX 2BS9A 3EDFA 3B8IA 5GVJA 4O18A 1NQKA 2QXWA 4B16A 3W38A 4W87A 1MQQA 3DFHA 3VKKA 1DJYA 2E28A 2QVNA 4PBEA 2BASA 4J1OA 2PRLA 2Y5JA 4O19A 1V3IA 2GVEA 4C1NB 1EIBA 3EDKA 5M5DA 3E2RA 1HJXA 2ZA2A 3PZOA 4JEJA 2C1GA 5BNKA 1DWJM 1G9HA 3C0LA 1K7XA 2A7RA 3W70A 3P67A 3LTPA 2G50A 1PUDA 3IUHA 3WH7A 5DMYA 2IKHA 4RNIA 1S46A 4C7FA 5FJUA 3BOXA 4DJED 3QQWA 1F3EA 3EWXA 4LYQA 3UU0A 3LA4A 4US5A 2HSAA 3RMJA 1JDEA 3QY7A 3U2CA 2VTFA 3WDRA 4LRSA 3MQTA 2YCEA 1MRQA 5DRCA 5FA5A 3P7YA 4PE8A 2HPIA 2PLJA 5FF7A 3P82A 4JIRA 2F6XA 3S2CA 4IT1A 4D6EA 4H41A 1V6UA 1PE1A 4XAFA 3SCRA 2NXIA 4G1NA 3ZVHA 4NJKA 4PCPA 4XB3A 2DZVA 2WJDA 5ECVA 1GNXA 3L2LA 2OLSA 1A53A 4JQAA 3O8AA 3N2CA 4E4PA 4FXSA 5T26A 2J8FA 3GK0A 1A5LC 1TUFA 3TFCA 1VC4A 1VH7A 2YW3A 3WEMA 2EO7A 1LUCA 4IIFA 1W5PA 4HZ8A 4S3GA 3M5XA 1WAUA 4H3DA 4I7VA 5C9RA 4AWTA 3CIWA 2FMNA 2JKEA 1XLCA 1YDNA 2J6XA 1GJWA 1H61A 1J0KA 4XKYA 3TOYA 4EK7A 2V8ZA 3UYCA 1DE5A 2DZUA 3IGUA 3LGGA 1UWAA 3W1MA 1BAGA 1ZBKA 1FCVA 1E73M 1KV8A 3GVGA 4QNWA 4OWGA 3IJ9A 1UUMA 4UBPC 1H1ZA 1KXTA 1W9PA 4FEZA 4HMDA 5G4EA 1OFPA 3TYCA 1M04A 3K30A 5LGXA 2PWHA 4W8LA 1PBGA 4IIGA 1H5VA 3GAYA 1DQXA 1GOIA 1TO3A 4ROPA 1SZRA 4ATDA 3BLPX 4YHEA 4MJMA 1R9XA 1B3VA 4R34A 4JTQA 3NQVA 3WLPA 3LZ5A 3DU0A 1FFRA 1U1UA 5LNWA 5BMWA 4AHOA 4NX5A 1ZZMA 1TWIA 4H6QA 3H2NA 1QBBA 4O1CA 1MNSA 5HMDA 2Q01A 3PC0A 5CAHA 3BJFA 3E2QA 1OGGA 1V7AA 4JQ4A 1JR1A 1S5VA 1XIJA 5FAJA 3VXGA 2F6KA 5AOUA 2NVCA 5BOOA 3GY1A 4CEXC 1LRNA 5AHMA 3CZLA 3UR5A 3VCRA 4JTHA 4BR1A 4QG6A 4C6DA 4MVAA 1TZ7A 4JFWA 4AD2A 4IQEA 1OCJA 4UQAA 3MHFA 4YTSA 3CC1A 4OHQA 2OQHA 3A21A 2QJHA 1Y0EA 4H9YA 1AW5A 1POJA 3WNOA 4F0SA 4B4HA 1SYTA 1XIIA 1J10A 4BHYA 3W1RA 3NYZA 3AZSA 1UR3M 4PCFA 1XUUA 1C92A 3FA5A 1OCNA 2QCDB 3QV7A 1UZ4A 3ONCA 1U33A 3NYDA 3VDAA 1RBAA 4B15A 3EKLA 3C2RA 3UJ2A 4UQBA 4UTHA 1UR9A 3R11A 1K1DA 1ZRQA 2IKJA 3UR7A 1WP6A 3VD7A 2EPLX 3PZNA 4K1GA 4GINA 1OGSA 3UW6A 3POHA 3T0DA 3EYPA 3WNPA 1XDLA 3H23A 2WHMA 3PWAA 3VIMA 4CEUC 5HWMA 1E55A 1WZAA 4IIHA 4EIVA 1KKOA 1Q65A 2WBKA 5I0DA 3SGGA 4IJCA 4FOKA 1FCBA 2V6AA 4I8YA 3SUSA 3WF0A 3VOCA 4AZ6A 3EDJA 4IG2B 4R9XA 1UD3A 1GEHA 1PVNA 1J6OA 3E38A 3NL3A 5H8UA 1R2RA 1HKJA 3T05A 4X63A 4JOMA 4TVUA 3N6HA 4BQ4A 5CBIA 1AMYA 4M6VA 1TMHA 1XV8A 3UJRA 1X7FA 4PFHA 1GORA 2VFGA 2Z27A 1Z41A 2GJRA 4EAYA 2DJXA 4XAGA 3O1NA 1KWGA 3NG3A 3PFRA 3MC5A 3IGHX 4B5XA 3E0FA 3L9CA 1R0MA 1V3LA 3LI0A 4EXQA 3QC0A 4NSBA 4FPSA 3C52A 5C7VA 2J7EA 3FA3A 5CPOA 1DTUA 3S1UA 2WJZA 3ARUA 1DWHM 4J35A 3SQSA 2Y8KA 1QK2A 3GNNA 1QNOA 3B0VC 1VGAA 1REQB 1SO3A 4QDPA 4AXNA 2R1PA 3S5ZA 3TNBA 1LLOA 2WNQA 1QJWA 4J3ZA 2WPBA 3QYSA 4ADUA 5JH1A 4DBSA 4MIMA 4FXJA 4E5TA 3SM0A 4ATWA 3UA3A 4ZXOA 1CGUA 4FXRA 4O53A 1BEUA 3HV9A 1GPWA 2X8RA 2X1RA 1E6XM 4DM2A 3ERPA 3UZZA 3KOWA 4I5XA 3LI1A 3GSMA 2DVUA 1OG6A 4DVOA 1S3TC 1QFEA 3ATZA 1W56A 1HW6A 2PA6A 5D32A 3TYUA 3D47A 4KFOA 1O6IA 4HNUA 3XISA 5A6SA 1V0NA 4GD0A 4OQVA 4LSBA 3LRKA 3WLNA 5D8WA 1XIDA 4M6QA 2A3LA 2DGAA 3NQ7A 3CUFA 3C2EA 3WQEA 5RUBA 5LXEA 2HTMA 3MUAA 4GX8A 4BKNA 4PTWA 1MYRA 1CGWA 2PDYA 4IPLA 4K7VA 3S5SA 2BVWA 3PZVA 3W74A 5CAKA 3UJEA 2V5DA 2VP8A 2Q02A 4XD5A 3KP1A 1DWFM 3S83A 3TSBA 4DIAA 3GFXA 3AIQA 3V1HA 4GIEA 2J77A 1D7KA 2NQ9A 5LZLA 2NX9A 3QR3A 3WBXA 3BLOA 1S2VA 2CERA 1CDGA 4JTEA 1CIUA 5DMLA 1CPUA 4AWSA 2VZTA 3LOTA 4W5ZA 3PPHA 3URNA 3DUGA 4XUYA 3RAOA 2QQ6A 3AIWA 3EPOA 4L5ZA 3CPGA 4L65A 5EBUA 3OQ8A 2I5IA 7TAAA 1QHZA 3ZM8A 3V7PA 2JFEX 1VZWA 1JCNA 3N6QA 3T78A 3TCSA 1PIIA 4C7GA 3ZJ8A 1TX0A 4GISA 3VMNA 4KF1A 4Z2JA 1TB3A 1D2KA 3WNNA 3OTRA 3A23A 3BMVA 1PV8A 3WCZA 2A7NA 3MWCA 1BWVA 1CGTA 1NH6A 1O12A 1OEPA 1G01A 2Y62A 1XIEA 3HMCA 3AXMA 3QHNA 2UY2A 4HPHA 3VOJA 3CH9A 3ZJ6A 5EFDA 4MADA 1GOQA 2J4GA 2X41A 3LCFA 3ZFHA 2BTMA 4K39A 3IV3A 3BCFA 2CNCA 1EDQA 3TZNA 3R2GA 3D0CA 2RGLA 3FJ6A 4CD8A 1RAKA 3EGJA 1F9CA 4LCQA 4HU0A 4IQJA 1MNZA 4GQRA 3ZVHB 1AQ0A 2V5CA 4K8EA 5E9XA 4GYPA 3EDEA 4BZYA 1Q6GA 4CU6A 4Z1AA 1KM3A 3Q45A 2Z24A 4ERGA 1W1TA 3HPFA 4GI4A 4RPPA 4H6EA 2P88A 3UNTA 3BQ5A 4JIQA 1LUCB 1G4EA 2XFRA 2WVTA 5F7UA 2DORA 5KMYA 2CHOA 1LL7A 2VWSA 1M5WA 3MI3A 2WKJA 2YLAA 4KQNA 2DSKA 3T09A 3ES8A 5BXSA 3DN5A 2IMRA 4DAIA 4XKYB 3DKJA 4LH8A 1KXQA 1PZ2A 4QG8A 1MVYA 3LHUA 3VDHA 3VNZA 4GY7A 4ZQPA 3NZPA 4KCUA 5GQBA 4QJ3B 2Q09A 3W7DA 4JFUA 4A4AA 3RCYA 3BTNA 2PMQA 4PMNA 5CBJA 3MUCA 3WF4A 4QCEA 1E4IA 2VFDA 2E9LA 2ZWZA 4JDYA 3IANA 3VNLA 3RLGA 3ZVIA 4UMCA 5A6BD 2VDHA 2JEQA 1ZB5A 3W6MA 1I60A 1V77A 2CLLA 1IEXA 3EOOA 2NVAA 1LBFA 1CI1A 4M3PA 1WDPA 1BTMA 1YIXA 3WQVA 3OO2A 1JZ8A 8A3HA 1BYAA 3HPSA 1KXVA 3PBYA 4FZIA 3ZXWA 2JGYA 3I6RA 4AYGA 2WV8A 2A79A 4FF5A 4C6PA 4FO4A 4QE4A 2P5NA 1KFJA 5G2WA 3W01A 1FTXA 3HBLA 1QW9A 4A29A 1HF6A 2F9RA 3NOEA 4L6DA 3W2LA 3U4AA 4MUPA 1Z89A 1GG0A 1HKVA 4GNKB 3TMLA 4OBSA 3WD3A 5XIMA 4LPCA 3LM7A 3DFPA 3RX4A 1W1PA 4U3CA 2EPKX 1ZCOA 2XH0A 4Y9AA 3KWSA 3CT7A 3EA2A 5D2WA 4JFTA 3QHOA 3UEQA 7CGTA 4MG4A 1K8YA 5AC6A 3WBAA 2ACSA 2WNNA 1V03A 3KHDA 3GZAA 2BY3A 2G0WA 1B90A 1CNVA 1PX4A 2Z26A 1E72M 1TPC1 2V5JA 1GW1A 1HKKA 2QCHA 3C61A 1UWSA 1QO5A 2CLEA 1OFRA 3SW6A 1W9DM 4US5D 5CPNA 1R3VA 1XG4A 2CITA 4N4QA 2QVHA 5DY2A 4NF7A 1F07A 2J9ZA 1EXBA 2FDMA 1V0LA 1U1HA 3QV6A 2RDUA 3N2BA 3MI6A 4JTIA 5CQ1A 2QJJA 1O94A 3VC5A 1UD6A 1EJ7L 3HPAA 1FRBA 3OEXA 2ZYFA 2O9TA 4GXPA 5CJNA 3WLMA 4ZOCA 2WSYA 5FF3A 1S5WA 1N2VA 2JGQA 3KZSA 4C6MA 2VC9A 1HT6A 2H3DA 1E4MM 2VURA 1TWSA 4IM4A 1TX2A 1OHLA 4DB7A 3DG7A 3A4JA 4KCWA 3K1DA 3TDFA 3W28A 4DO4A 2WWDA 2KAUC 4E2VA 4W85A 4YTQA 3WN6A 5A5WA 3QFEA 4Q8WA 1Q6QA 1D9EA 2ON3A 5AYIA 2DZWA 5K3VA 2WCSA 3E6EA 2C3ZA 1FCQA 3UVAA 4Z1BA 4BWLA 2GUUA 1V0KA 5FI8A 1VHNA 2HXTA 3QSRA 3L0KA 4ZB5A 1EEXA 3IARA 3LUTA 4L4LA 1A4LA 3AOFA 2RH9A 3PUEA 2QHAA 4QAIA 5HQLA 3SCOA 2OYLA 3RRXA 3FKRA 1WYIA 2OJPA 4HCLA 4RJEA 2QCNA 3IVTA 1N8WA 4EF8A 5HMFA 2E40A 3ARRA 3H4XA 3P81A 3S9ZA 1EJXC 1TREA 4LBSA 5CLTA 4EPBC 1YPFA 5G2HA 2FFCA 3PJWA 2PDXA 4QFUA 1PTAA 1HL8A 4ZEPA 2CYGA 3PUOA 6ALDA 1UOKA 4C60A 2GJXA 1MZRA 1VFSA 4ZODA 3IJ6A 4DJEC 1VFTA 3PB0A 1XC6A 4UIOA 2YZRA 3VGDA 1HQTA 2YCKX 1T0OA 4H8HA 2AL1A 4MYAA 2QMJA 3BOFA 1B1YA 4FIQA 3P80A 1TMQA 2PDHA 1PXGA 2J25A 3A4XA 5A8OA 3DI1A 3N73A 2PCQA 1ME8A 2VENA 2EF9A 3CAWA 3SCVA 1IIGA 3THDA 1YTKA 4JS3A 1QRQA 1X1OA 1W31A 2JIWA 5H8PA 4A2RA 4EACA 3GTXA 3QLDA 4KBXA 4IUGA 4AW7A 3PBWA 1RK6A 2BP1A 2FH6A 3BAJA 1R86A 4XWUA 1PPIA 1W8SA 3SIZA 2FHCA 2XH2A 1F6KA 5HPOA 3UFYA 5D4YA 1GVSA 2VR2A 1HJVA 1HZYA 4LUTA 3EOEA 1PZ3A 5AVHA 3FYPA 3CB8A 5FACA 2YR1A 4DYKA 3MJMA 4LVBA 1EP2A 1L8PA 1Z8AA 4HMEA 2PD9A 3MVTA 2A3HA 3VNIA 1CEOA 2HMCA 3M46A 4ICMA 1AG1O 3PPFA 2POTA 3CXOA 4O17A 2X0HA 2VGGA 3S5NA 3MO7A 1LL4A 3AO0A 4PZVA 3B9AA 1XICA 2OX1A 1UR4A 2O9RA 5BCAA 1ECEA 4U33A 1RH9A 4OU1A 3W0KA 1E1CA 4NASA 3W1QA 3RITA 4UTMA 3TLLA 3TONA 1V3MA 2WMKA 3KHJA 4IX2A 5AKQA 1V79A 3CM4A 3SY1A 4DZIA 3BXWA 2IKGA 4P7LA 4GUHA 2KX9A 4ZMGA 2CLKA 3CZJA 1JPHA 2ZVIA 1AUSL 1XQKA 4ZCWA 4B9ZA 2FFIA 2EQDA 1CXKA 4CU8A 5BYWA 3VO0A 3G1VA 3KW3A 1J2WA 4NX0A 3G1HA 1V4YA 3EB3A 4GQBA 1K7FA 3WMLA 1ZCCA 4I9MA 1N55A 3LHVA 3HF3A 4HU8A 3AXHA 4JL1A 3KX6A 5CC6A 5F2GA 1OY0A 4RZBA 1Q6OA 4Z0JA 4DUXA 4F48A 3OGRA 4X22A 3W73A 3LNMA 4JTTA 1XCFA 2HROA 3CL7A 3JUGA 4NUWA 1LG2A 2XIIA 4H2CA 4GQGA 1UWQA 2OO6A 4YVXA 1UZHA 4HNOA 3KDOA 3CQJA 4F0MA 1XKJA 2Y89A 4GZIA 3SY5A 2J88A 2O4MA 2NQZA 1J0ZA 3VD4A 1XLEA 1R85A 1VS1A 1A80A 2G3NA 3AIEA 1CYGA 2ZVRA 1YXYA 1I2OA 4M1RA 1ITXA 2XSXA 1A5SA 3NEHA 4ZOEA 1U5HA 4MZ1A 1B30A 2FVMA 2IQTA 4L4MA 4UCFA 3GS6A 5M2FX 5F4XA 3TAKA 4GY0A 1QI5A 1WDSA 1UKTA 1QW8A 2PDJA 1DJIA 3VOFA 4EE9A 3DFQA 4JICA 2YXXA 1I8JA 1CXLA 1N8IA 3ELFA 1BYDA 1XYZA 4GC4A 3N19B 1PZ0A 1EGMA 3DGBA 3M6YA 2PF8A 2ZUWA 3MANA 4NNCA 4LNYA 4CGTA 4O8AA 3N13A 5KITA 1DV7A 1E0VA 2IXUA 1J0HA 1UZ1A 3LCXA 1JF6A 4LUJA 4IL0A 3EWBX 2TPSA 1TRIA 3L65A 3QLLA 1LZOA 5HUOA 4BF7A 9CGTA 5AHFA 4X0NA 3B97A 1P6WA 4IISA 3OBAA 1RPXA 1C3FA 5AC5A 1F4AA 4YWSA 1FWFC 4EANA 4Q8QA 3VIGA 1HIZA 4XKMA 1BYBA 4Q4SA 2VI0A 3ARPA 4YTUA 2X42A 4HCHA 4PMVA 4HA1A 2PGWA 3TQPA 1QK0A 4HOXA 4FNSA 1Q2SA 4H4IA 4J7RA 3FEMA 4N9EA 1WB0A 4AY8A 5DN1A 4WKFA 3LX9A 3NZQA 2G4FA 3SJNA 3ALFA 5A6KA 2RUSA 4L1XA 1GOXA 1FCUA 2AQVA 3S2JA 5DT5A 4TMBA 1GYLA 3CV7A 2D0HA 1JCXA 1TKKA 2EHHA 1H11A 4FNRA 1TRDA 1W5MA 2QIWA 5K7JA 4DJFA 1O60A 2FB2A 1E15A 4AXKA 4IJBA 2P8BA 3M4HA 1LRQA 4B5VA 3T55A 4XZWA 5CKSA 2R1KA 4TUFA 1PYFA 3EB4A 1XW8A 4IXXA 1MXSA 4XZMX 5LIKX 3CT2A 1P48A 3MZNA 3CQ0A 1L6SA 3KVKA 3QY6A 2DW6A 3SI9A 4HT3A 2I9EA 3TJIA 3QOKA 3G6MA 4MNKA 3B8UA 2J75A 5CC7A 2CZEA 5I3JA 2GUYA 3W76A 1B4EA 4Z0SA 3F1QA 1QPQA 4G7EA 4O10A 3SN4A 5C7HA 3FV9A 3U48A 4JY9A 1OC5A 3NXLA 3ABQA 2VFIA 4E2OA 4CLMA 5MF5A 2PWVA 3AU6A 2ISDA 2E6AA 3EXRA 2BHYA 1VHCA 5DCDA 4LCSA 2BODX 2Z1KA 2QCGA 4L6HA 3GUWA 4NVTA 3KBMA 4H8UA 1AL7A 3CZKA 1P0EA 3TQKA 1VB9A 3TV8A 5DXXA 5FD0A 1UPPA 1NELA 2PTDA 3LHWA 1XLAA 3NSMA 5FIPA 3NQBA 4H8VA 1UUQA 2ZC1A 3SRFA 3IJLA 4PTNA 4C6NA 3C2VA 1YLVA 5CPLA 3LCLA 4IGNA 3GFZA 4C1LA 2B4GA 2E5DA 4PB5A 1N7KA 2VELA 4Y9MA 5HNUA 3KL3A 2WB5A 1CX9A 4CQDA 5C9ZA 1O1ZA 3H54A 2ATMA 4KCVA 2OCZA 4IFOA 3D3AA 1QNPA 4KEUA 1LDCA 4L56A 4MY9A 2OWXA 2YZ5A 3IK2A 9XIMA 2QAPA 4K2SA 1OSEA 5BZAA 3AMDA 2FJKA 2F6UA 3GUGA 4E0CA 3UESA 4AF0A 1XYFA 2X1IA 1GTEA 2GJXB 3I65A 3WD2A 4EPEC 4N4PA 1R3TA 1GZ1A 4GYFA 5E0CA 3GM8A 2A4AA 1G7VA 1H09A 2C91A 2JQXA 4JIIX 3VD9A 4RZ4A 5ECUA 2VCAA 2V3EA 1GQLA 1EJWC 1W5QA 4HNCA 3WNLA 5HNRA 3F2DA 3H7VA 1LQAA 2OEKA 4F40A 2ZZ1A 1TV8A 4K7YA 2CCRA 2FHBA 3P0XA 3BUVA 2FZMA 2TRSA 3OGSA 1DP0A 1NWUA 1A5AA 1QPKA 5LA1A 2P50A 2YDRA 2VX6A 2XSAA 2QF8A 2MANA 1RK5A 2OELA 1S1PA 2WVVA 3HOJA 4WIWA 2EG6A 3CEPA 1G0CA 4PSPA 2O56A 4DYJA 2ZFAA 1WKDA 4LUTB 3GC4A 4L9XA 4M51A 3B8VA 4RCXA 2PWUA 1H1NA 3TYBA 4Z17A 2OOFA 1XG3A 3HM7A 5IHSA 3UYIA 1BTCA 2WK2A 3W7QA 3BDKA 1W3JA 1Q45A 3DFNA 3AFBA 4M19A 2D22A 2WLZA 3BJTA 3H2AA 4LW7A 5BU9A 1YDVA 3CNYA 3OQEA 6CGTA 5DANA 5LIWX 4Q4RA 5MKGA 3AAMA 3EOLA 3UG5A 3CWHA 4H9UA 4E8GA 1UROA 1FA2A 2J66A 3HN3A 4MWAE 2Y88A 1E1CB 1EA9C 2PB1A 3LMZA 3T8LA 2OYKA 4OIFA 3N29A 4GYKA 4NNAA 2RDWA 3UXAA 2OT0A 3UF9A 3CHDA 3ZJKA 2GGJA 2GJLA 3M5ZA 3UP8A 4DPPA 1IR1A 3MSDA 3XINA 2DT1A 4XZBA 2C19A 3KCJA 2QUVA 3VZZA 1FX6A 3KLLA 5TIMA 4KESA 5FCZA 2VR5A 2UY3A 3V35A 2GL5A 5D03A 1XISA 4CD6A 1UPMB 1IZKA 2X16A 2PBOA 3M0ZA 3A12A 3MSGA 4UOQA 1XLBA 1V7YA 1MMFA 4MNLA 2O9PA 1XHGA 5FF0A 3VC6A 2PLMA 1SPQA 2WZMA 3PG9A 4J3VA 2JIEA 4IMAA 1VBJA 1EPXA 1OX6A 2PZNA 2VFFA 3LCHA 2VOTA 2DEPA 2OPJA 1WKFA 3A9IA 3BAIA 2EG8A 1KRBC 2A3CA 1EJRC 3S46A 2ESCA 3LLFA 2Q8XA 1XPYA 4FX6M 4AIEA 3W00A 5TNVA 4IP7A 3VOGA 1WBHA 1GQNA 1LOLA 5C9XA 4HPGA 1U30A 1JZ7A 3U3HA 2PDNA 3PP7A 3LDVA 1A3XA 2VRJA 1VCFA 3L5MA 4Y96A 1R3YA 2WZIA 4G2DA 4Q7NA 3T42A 2XFYA 3WMSA 3Q94A 3HGRA 2CXGA 2QDEA 3M0VA 1XC4A 3M41A 3IJQA 4S3EA 3LPFA 5EMUA 3F2BA 3WF2A 3FVDA 3LHZA 3G1XA 4LCRA 1P5BA 3AS1A 3IUDA 3PZQA 1K4GA 1NF7A 4NP7A 1W3IA 4C90A 1AJ2A 3MKVA 1UOZA 4MLJA 2ANUA 3KTSA 4E3VA 1L2UA 2YCJA 4KFNA 2BGNE 1HXJA 2WHLA 3U2ZA 1FQ0A 2DFAA 1F74A 4AFYA 5I6SA 4H9VA 2GVGA 2GWGA 1EBGA 5BMXA 3O7UA 4YJ5A 3B8WA 4Q6JA 4KT2A 2PODA 3HFYA 1UH4A 2CLHA 1ZBVA 4LC6A 1HJUA 2GGHA 2V5BA 1P43A 4Q8VA 3CPRA 2QUMA 4GZEA 3NGJA 1BXCA 4O12A 4R3UA 1LP6A 1LLZA 1XDMA 2YBUA 1LF1A 1E6RA 1XLHA 2OKTA 4QIUA 4UNKA 3CMJA 1OCQA 4OGZA 2W5FA 4OT7A 3KBVA 5DRIA 3TTEA 1QUMA 4ZFMA 4JNYA 3BMXA 4V27A 2JKPA 2NW0A 1B3OA 3GXDA 3SZ8A 3O0KA 4BQ2A 4CKQA 1MRAA 3B8SA 4PMDA 4BF9A 4F2BA 1BVZA 4KEZA 3G1DA 4YPJA 3C4UA 1KCLA 5HNTA 3KLKA 4F2UA 3OOQA 3PUDA 3EB2A 1IT7A 4N6FA 3ARZA 3WD0A 1A3HA 2YCLA 4F66A 4Q4MA 2D24A 1SSGA 1B2YA 1R3QA 4FXFA 4G7FA 3WH6A 4GYJA 3LD5A 4YNGA 3UWUA 1W1VA 3OG3A 3C3NA 5BRQA 1ZBWA 1TJ1A 2VRQA 4QM1A 1E70M 4B5WA 4N9DA 4I5UA 3PHAA 4HN8A 4WQ6A 1KQYA 4WOQA 4D71A 3V1PA 4DM1A 1T5AA 4YCOA 3C3UA 2VJXA 3P3BA 2HPMA 3WFZA 1AH4A 3AROA 5LGZA 4Q4QA 2QULA 2XWDA 3W7JA 4I6KA 4GVHA 4GCXA 4UFIA 2WC3A 3W85A 4AD5A 4FA3A 1IE7C 2DUAA 3LLXA 4Q8NA 2WCGA 1QAPA 1VFLA 4DJDA 1XXXA 4DRSA 2FIQA 1AFSA 4G7EB 1A5NC 4IQLA 2WZHA 4LYRA 1R47A 1U2YA 1KBJA 3E1F1 3ZYZA 4V15A 2E68A 1EQPA 1CB7B 2FB3A 3QN3A 3RPDA 1GYMA 6PTDA 4HPNA 1EB3A 1XLJA 3WQGA 1BFNA 3TR2A 1V5XA 1TV2A 1KBLA 3KBJA 4AZGA 3OLEA 4NYYA 3T07A 5EPDA 3NL6A 1JUEA 1BPLB 4PYSA 4TMCA 1POKA 4A05A 1W9VA 4DAFA 3SCNA 3WDJA 1WZMA 4F0HA 3H21A 1A47A 4PEKA 2MUCA 4ES4A 3WQFA 4JN6A 3EXSA 3PF3A 2XYLA 3OW1A 5D38A 2W92A 2ZWYA 1LL6A 1PJ9A 1JIBA 1ITQA 1FWCC 1KTCA 3WX7A 2DDXA 1AH0A 1RY0A 3GQYA 2YGYA 1A49A 4WDWA 2NLIA 1W3KA 3AS3A 4ZE5A 2AMGA 4OECA 2V67A 3VIIA 1EJUC 1OZQA 3S9YA 2D0GA 1JI2A 1YEYA 3E9AA 3NQMA 3MCNA 5FEPA 2AQOA 4KFPA 1H62A 1GWJA 1V08A 1K4HA 3STGA 2BXYA 4RW5A 1JGMA 3ZR4A 3WLOA 3UCCA 2XHYA 4AF0B 1J5TA 3EX3A 3OIHA 1ZP3A 4XD4A 1HO4A 3FFSA 4RLIA 3FNDA 3VZXA 4ZBCA 3BLIA 3TSMA 2R1NA 3GYEA 2TYSA 4CCDA 4TX6A 1O1HA 3K4WA 3GB6A 5CGMA 2V68A 2JKAA 3RILA 1JYXA 4H2HA 1M7XA 5EL1A 2EPMX 4A3RA 1X1NA 1ZBCA 3BAYA 2I9UA 1NSJA 2C71A 2I17A 3BG9A 1HKWA 4O11A 3GZ3A 2H9AA 2Y5SA 3GDTA 3KOXA 4YWIA 1JRCA 1XRTA 2PC8A 4XD6A 4JY8A 3GU1A 4TTGA 2WVVB 3QQ1A 4DJFD 1IT8A 4IICA 3LM3A 1E71M 1L2QA 4U10A 3ARWA 4BY3A 5U7SA 2X7WA 1QNRA 1W37A 4IWWA 5GNYA 4H9TA 1E3ZA 4ZO6A 3MDWA 1V6YA 3VX0A 4US6A 4E8CA 1A0EA 1GPFA 3HZ3A 3SUTA 3SN1A 3BZGA 4B3LA 1UIOA 4HJFA 5IBXC 1EX5A 3AHXA 3DH7A 3WELA 1OFQA 1DOSA 2GDUA 4LRTA 2ZICA 4RR4A 1AW1A 2QGYA 2PDMA 5T91A 3PPCA 4A3QA 4QDWA 3W1TA 3W75A 4BI5A 4Z2KA 5CC3A 5MKGB 3RM8A 3W7OA 1XYCA 3FN9A 3UQNA 2ABBA 3SAZA 3MKKA 2O9OA 4CNNA 4GZJA 4XZLX 5HJYA 3HG3A 1PEZA 3KRUA 1GZGA 1IXQA 1DQWA 3GU9A 3LBOA 1KGUA 2QR6A 5C71A 4WXZA 2R91A 2VVSA 4JQ3A 3NQEA 2NQHA 4KWVA 1ITUA 3AHTA 3VGEA 4D6FA 4QHRA 4O1AA 3G6LA 2PGEA 4UQ9A 5EMMA 4ZXLA 1UR8A 2V2DA 5EBAA 1SR9A 2PCEA 4GQQA 1M53A 2ZTJA 2WYSA 4FX8A 1MEIA 2A7PA 1MUMA 4JDBA 4DN1A 4BCEA 1DJQA 2IXVA 3HMJG 1JZ4A 1DORA 1P4CA 2WVSA 3BOLA 3SSZA 1O68A 4ZOBA 3DEQA 2AKZA 2ZZ6A 1W5NA 1R6WA 3OHMB 3NZ1A 2YXGA 2HVOA 1GKRA 5F4WA 2NWSA 3PJXA 2PLKA 3W1AA 3TU9A 1EKOA 2I57A 1JCJA 3STFA 4UTWA 1E5NA 4D8AA 1KXHA 1I0BA 1XFBA 4AZHA 1J0YA 3ES7A 4DXXA 3Q65A 1QDSA 4QDMA 1LM1A 3E3HA 2ZZ2A 2YBTA 5CJMA 1JFXA 2P8CA 4Q4KA 5CSRA 1QHPA 4NYUA 2J74A 1QPRA 1I75A 4DBWA 4HPJA 1SZEA 2WJFA 5K2ZA 3FDKA 3ZLFA 3TEVA 1A5BA 1R3RA 3KFTA 1GJPA 2PUZA 4OVXA 5D33A 4EVZA 5C9UA 2XM1A 1AZ1A 2IPFA 4OJYA 5IXEA 2Y85A 3TE9A 1RCXB 3TQ0A 1EJSC 4WY0A 1F6PA 3PNUA 3ZWSA 4QCFA 2A2IA 1UKOA 1XD1A 3N2MA 4MOZA 3VNDA 5LNRA 2R1LA 3S6DA 3VOHA 1XLDA 1A0DA 4ZENA 4R88A 4JCLA 1VBRA 2PWGA 4B5UA 1KO0A 4M81A 1JDAA 3VMPA 2DUZA 3R13A 4GYPC 3ALGA 1H0IA 3GE7A 4ZZ9A 4AEFA 1Q66A 1RALA 4B2DA 5JIWA 1MI3A 2YYTA 1KV5A 1QOQA 1Q7QA 4WDXA 4W9TA 1LRTA 1HG3A 3W26A 1S5MA 4GXWA 4TVDA 2PGFA 4H7CA 4Y9NA 5FJTA 1VEOA 4O4WA 1DTNA 5T9CE 4DI8A 1FHDA 5K9CA 1H7NA 1E1EA 3ITLA 1T99A 3VE7A 2VQUA 4DBEA 1US0A 1D7FA 3ZLHA 3WEOA 4H1ZA 1VRDA 2Y1HA 4UR9A 1R7OA 3AC0A 5LXXA 1OT2A 2CC0A 1JCTA 1EIXA 1O95A 1TMLA 2BX7A 1LBMA 5BRBA 3MBFA 3QSTA 5JXQA 3N4EA 1JQVA 4F2TA 2QCMA 4F3HA 1H7XA 1HJQA 3HGOA 3WLJA 5J04A 2GOKA 3LENA 3VUPA 3MJYA 4JHOA 4UTUA 2YCLB 4HHLA 1BXBA 4ZQNA 4JTFA 1H7RA 1TQJA 1IWAA 2F61A 4GIRA 5EY5A 1TJPA 2JF6A 4P5UA 2XUCA 1ESWA 1L8NA 1A4MA 3L0GA 3KOZA 3I7QA 1XM3A 2ADAA 3PAJA 4NU7A 1TIWA 3ZS4A 4A3HA 4C6OA 1FWJC 5DO8A 2Y5EA 3GBEA 1G1YA 3H7UA 4FHAA 3OYXA 3OVQA 1ZJHA 4UQDA 3ITOA 4R27A 2BWGA 1RQEA 2HBXA 1E40A 1O7AA 1I2QA 3BGGA 1MXGA 1V3KA 2VL4A 4PL1A 1E0XA 2JEPA 4S3DA 3E12A 1CLKA