3W2UA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-193
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-193
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2uA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2uA01
3WJXA 5BW6A 3O6DA 4OT7A 1VCFA 2B0MA 4L4MA 2GOUA 4NU7A 2HS8A 5LGXA 2G5WA 2J6XA 2JKAA 1LRNA 4HPJA 1OFBA 4R33A 4B5NA 3TK7A 3GAYA 2TMDA 3TU9A 1GT8A 4UTTA 3JR2A 1YDOA 5G1YA 1THFD 5U7SA 3HG2A 5D37A 2V2HA 5FESA 3THQA 2A4AA 3S1UA 1MEIA 1H5YA 5D2VA 3O1NA 2ZRWA 5DY2A 5L6UA 1Z44A 4GC4A 2F7FA 4YCOA 5K2ZA 3L0NA 4PCFA 3HJZA 2Y7DA 2QUVA 4YXGA 3S5NA 1JCNA 3LI1A 1VR6A 5HUPA 1G4SA 1X8FA 3BG5A 4PA8A 5CGQA 3I65A 4FNUA 3ABRA 4L4LA 3P8IA 4JTLA 5HMSA 3TJLA 3F03K 5AHFA 3SJ3A 1HUVA 1YTDA 3MBDA 4LVAA 5U4NA 4XBKA 5FF2A 3R8RA 4R7JA 2NX3A 3QW4B 1DQXA 3A21A 1JCLA 1XUUA 3ABSA 4O15A 3TX9A 1TRIA 1VH7A 4ZMGA 1TJRA 1WBJA 5AC8A 1I8JA 5H91A 2ZFAA 4UTLA 1A5BA 3HB9A 1KM4A 1C8VA 1YDNA 2WSYA 3WK3A 5CZJA 4N02A 4ORIA 3M7WA 3EX4A 3HGOA 1KLZA 1O60A 1U83A 3QSRA 5D33A 1JCJA 1ALDA 3W71A 2NZLA 4W9TA 4UTMA 4HIBA 4DF1A 2C18A 3D0CA 5LNVA 4LRSA 1VYPX 4NZJA 2WQPA 3WJSA 4MFDA 2W0UA 5AN7A 2VFIA 1SW7A 3O16A 1QPNA 2ALDA 3PG8A 4LWWA 4JGDA 3RNDA 5K7JA 1LDCA 3NVTA 4JDBA 2RFGA 1H7WA 4HNVA 4IMEA 4M6PA 2J27A 4MVAA 3Q2DA 2V2CA 4O57A 3PB2A 3NO5A 3CWOX 1KFBA 4KFOA 4O13A 1OX5A 1IXQA 2FLIA 1VQTA 4O17A 3DI0A 1G69A 4JTKA 4UXDA 2G97A 1H7OA 1I2PA 1RQEA 1W0MA 5DCEA 3M44A 4MY8A 4AF0B 2E6YA 2J9ZA 2CLLA 3PSVA 1XFBA 2GQ9A 3DXIA 5HINA 4DPPA 1VC4A 4OU1A 3DKJA 4QNEA 3MYOA 5G5IA 2YZRA 2NX1A 1YPIA 2ATMA 2E68A 4LC6A 4C1KA 3FFSA 1YXCA 4HNUA 2A7NA 3NPUA 4LUIA 3C2EA 1GQNA 1XBXA 3FEMA 1AW2A 3NYZA 1DJNA 3H53A 5I3IA 1M7OA 2NUYA 2JKEA 4ZL1A 1CI1A 2PE4A 4NZFA 1P4CA 1LROA 2NXIA 4Z08A 2Q8LA 3M1ZA 4JYDA 3O8AA 2R94A 1F5ZA 4XZ9A 3USBA 3M43A 4NJJA 3MI3A 1O5XA 3KRSA 4RK8A 3M6YA 2V5BA 5AYZA 4NX0A 3F4WA 1I2NA 3W22A 3G22A 1EEPA 2EPHA 4LNYA 3BARA 1C29A 1OG0A 3T4CA 4QJ1A 2P1FA 3MBFA 1F6PA 4MZ1A 4C1LA 2RKXA 1S3HA 4DELA 5KMYA 4WY0F 2QCNA 3M5VA 3QW3A 3AO0A 2NUWA 1YYAA 1YADA 5DXYA 1SZEA 2BSLA 3UWQA 1ZCOA 3CTLA 3ATYA 1EA0A 1GJPA 3LBMA 1RZMA 3NZRA 3TW6A 1MEHA 3LHZA 1OYCA 5K9XA 5LGZA 3TA6A 3LLFA 1TV8A 4EWND 1SZGA 4QAIA 3LHUA 1AMKA 1TYGA 2Y62A 3LV5A 5F2LA 4K8HA 3DZ1A 3HGRA 2RHGA 1R2RA 1OFPA 3IIOA 5C54A 3E49A 2G95A 1ZFJA 1KV5A 1Q45A 2CLKA 3VCRA 3W87A 3RMJA 1FCBA 4CLMA 1SZNA 3LRKA 2A0NA 2UV8G 2AGKA 1ZAIA 4NJHA 4JIQA 3P7YA 1Q6OA 3QMTA 5BMWA 5D2TA 2YX0A 4RZ6A 1PHQA 1XCFA 1W5PA 1W5QA 4POCA 3HQ1A 2A2IA 1KFJA 4LUJA 2V9DA 3IGSA 2OJPA 4UTWA 3MP4A 4A2SA 1Z48A 2OT0A 1LORA 3DAQA 4MKNA 2O7SA 1F74A 8TIMA 2WSQA 4O19A 3A9IA 3NAVA 3GYEA 5I3GA 2ZCGA 1DJQA 1FXPA 5CZ0A 3W2LA 3I6RA 4FNTA 3ELFA 4NVTA 3P80A 3S5ZA 3QYQA 1PVNA 4A22A 4AHQA 3OVRA 3QH2A 1VZWA 4JD4A 4TIMA 4UMCA 3H55A 4GRSA 3SGUA 3W7HA 1F73A 1W54A 4ADUA 1ADOA 4IQLA 3S1VA 4UFKA 1I2QA 2ZZ6A 1YTKA 3CIXA 3B05A 1QO5A 4WD0A 3NQMA 4TMCA 4HNTA 2QR6A 2ZRZA 3GXNA 3C4UA 5G2WA 2H8XA 1XXXA 5LNUA 4U4MA 4BWLA 4E2BA 3LV6A 4JYFA 4UTTC 3P5ZA 3W1LA 4ZQCA 4OGZA 5HNRA 5KSWA 4GBUA 2ABBA 1TB3A 3GDLA 4JEQA 4NNBA 2BLEA 2X30A 4MPQA 4UTIA 1XDMA 1X1OA 3CT7A 4OE7A 3O6CA 2X2GA 1TPB1 3OBKA 5HWMA 1NAL1 3TC6A 3MUXA 1QAPA 4MZYA 4O12A 2RDWA 1PIIA 3TC7A 3STFA 1UUOA 3SW6A 1MEWA 3PR2A 1B3OA 4PTNA 1IIHA 1KM0A 1GEQA 3GXPA 4XKYB 3NL3A 2QCDB 1TTIA 4CCEA 4PODA 2WNQA 3DBPA 3HO8A 1DORA 3A5FA 3E02A 3NQDA 1G6CA 4Z1BA 3G8EA 5FEXA 3EWYA 3UXDA 1SUXA 4MUZA 2Z0IA 3EX3A 3PAJA 2CLOA 5HULA 1WBHA 2VFGA 2CU0A 2VELA 5IBXA 3P84A 3C2OA 2CZDA 3I7QA 3LHYA 2CFFA 3C2RA 1AL8A 4RV8A 3CEUA 2E5DA 3RLVA 3ZR4A 2Q8ZA 3GR8A 4XKYA 1NVMA 2QCDA 1KFLA 1DHPA 1KA9F 5EBUA 2VFHA 2ZRYA 4LC8A 4I9AA 4O50A 3B06A 3M5XA 4WQ6A 3LM7A 2EAWA 3EKLA 2CLMA 4Y90A 3VKJA 2VFFA 4UNLA 4IXXA 1OK6A 3R89A 1AL7A 3TW7A 1GVOA 4X9SA 5BNKA 5ABTA 2Y85A 5A8GA 4AMAA 5AHMA 4H3DA 1X1ZA 3U6WA 1VLIA 5CPMA 2WNZA 2B7NA 5EKYA 4DF2A 1YDVA 3L65A 1J4EA 4LS1A 3GDRA 2CLFA 2QCGA 5AHEA 5AFDA 3VE9A 2CZFA 3IRDA 4DO6A 1A50A 3W1NA 1ML1A 3TQ0A 1TV7A 4JTEA 3KRZA 4WJEA 3DU0A 3SECA 5HJLA 3IIZA 1FCVA 4O14A 4K7VA 3W73A 3LCXA 2A7RA 2C16A 1EIXA 1H7XA 5L9FA 3QPYA 4N9EA 1JULA 2J9YA 1G4PA 1QOQA 2ISVA 1B4EA 2Y70A 4JN6A 5AHIA 2FFCA 3KRUA 2R14A 4QITA 1VRDA 3QZEA 1OFOA 2YGYA 2WNNA 3BPWA 2JKPA 2WV8A 6ALDA 3BLFA 1EP3A 2C14A 5DELA 4UFJA 2C6QA 3QPZA 2X1TA 4CNPA 2J9XA 3G18A 3DFQA 4MYAA 3P60A 3BW2A 3L2IA 1LBFA 4WXZA 1UASA 3GKAA 4GUGA 4XBSA 1XBVA 3PULA 4JTIA 5D03A 2Y7EA 1FUYA 2QF7A 3L9CA 4UMAA 3NOEA 3LRMA 3THAA 3P62A 3UWVA 4A2RA 4Y6GA 2ZA3A 2C15A 2R8WA 4O1AA 2I9EA 4LS2A 1QFEA 4ICNA 1QOPA 1KV8A 3TSBA 3BGJA 3LERA 3TH6A 3NQ2A 4UR7A 3BO9A 4O18A 1O94A 2ZZ2A 1JCYA 2YDAA 2VFEA 3G1SA 4BI7A 3B03A 4UFHA 1J2WA 2H8ZA 2ISWA 1FDJA 4NJKA 3W7GA 1KTNA 3O63A 1VHNA 2YSWA 1EP2A 3HOJA 3W72A 1W3NA 3B8DA 1AW1A 2ZRUA 2FPTA 3NQ8A 4GUJA 1ZY9A 3WJWA 4FNRA 3O6YX 1JUKA 1EPXA 3PUEA 2B7QA 3A22A 2ZDRA 1OJXA 3DFOA 1R46A 4MY1A 3ABOA 1GVFA 4IUOA 1OVDA 1S5WA 3W1MA 1I4NA 1VCGA 5AHNA 5D32A 4EF9A 4M6VA 3P82A 2PCQA 3MYPA 1YTEA 3PBUA 4N9BA 1KM6A 4O53A 1YLVA 1UJPA 1FY6A 1GYLA 3EXRA 5D09A 1DQWA 3FS2A 1R2TA 1BTMA 4A29A 3TROA 4ONVA 3W7LA 1KTCA 1LOQA 5FEZA 3K30A 1P0KA 1FDYA 4KFPA 3S1WA 3EWWA 3OA3A 5D02A 2CLEA 2QAFA 3QF0A 4DO5A 3R12A 1DL3A 3T7VA 1KBJA 3LXAA 3VNDA 3L67A 3QQ0A 3TQVA 3I68A 1V5XA 4S2BA 1BWKA 4WY0B 4N4PA 1PE1A 2A85A 3P81A 4R53A 1M5WA 1PCKA 5CKSA 1Y0EA 2P10A 4BI5A 3M5YA 1ICQA 1SW3A 3OG3A 5LHFA 1P5BA 3TAOA 3TMQA 4AHPA 3T40A 1M6JA 3UPBA 4N9DA 3G0XA 3GR7A 1QPRA 5AHLA 4OWGA 3UQNA 4Z0SA 3P5YA 4CCDA 4PL2A 4BWLC 3LCWA 1UCWA 3RU6A 3C2VA 3SI9A 5HQEA 2GJLA 1OFAA 3NQAA 1FWRA 3SR7A 3W2NA 4FNPA 4WY0A 4DPQA 3ANYA 3GKFA 2NWRA 3W70A 2JGQA 1GPWA 4M6QA 3G1FA 3FYOA 1TPH1 1XL9A 3W9ZA 2YCEA 5CG7A 2GJNA 5E93A 1H63A 2G96A 3UZ5A 2ZBTA 5LHEA 3GB6A 3SIZA 3P74A 3KFTA 3HF3A 3SFKA 4GNJA 5C5YA 3W2JA 4FXRA 2ZZ1A 2C13A 3B0VC 3N34A 5D05A 3HPZA 3PBWA 1X6UA 1NSJA 3T44A 1Q6RA 4K39A 3CM4A 3TV8A 3QQ1A 2Y61A 4GUIA 1K03A 2OT1A 3R2GA 1LOSA 2DZTA 3I7SA 2BWGA 4FNSA 3DKLA 4NXKA 3BG9A 3JS3A 3G3DA 2ZTJA 4FB7A 5I3FA 3TSDA 4FF7A 3W7NA 5IBXC 3NM3A 5F2MA 1LTDA 3LLDA 2DP3A 3M9YA 5HUOA 1EP1A 4DO4A 3NXFA 4DQWA 1TIMA 1VS1A 5D2YA 4AF0A 5KITA 2QJHA 2E6AA 5SWUA 1L6SA 4UMBA 4LV9A 1RPXA 2ABAA 1TPEA 5DBTA 1N55A 4EF8A 4MLJA 4MOZA 3WFAA 2JGYA 3PBVA 4OHQA 3WK2A 3KXQA 3MHUA 1TCDA 3GNNA 3IIXA 1QCWA 4O4WA 4K6AA 4GUHA 3KVMA 1YXYA 4CQ8A 3NPWA 4NT0A 3TDFA 3FA5A 1PS9A 3UXAA 2VXNA 4ZQPA 3W7RA 3L0GA 4AWUA 1YPFA 4OBTA 3UD6A 4O0KA 2OZ0A 3F4NA 4LOCA 3B0PA 3EWBX 5C6MA 3QFEA 1G4EA 5G2HA 2ATSA 4UTKA 4NJIA 3GDKA 5CPLA 1LP6A 1FWTA 1T0OA 4E38A 1ZHAA 3QRHA 2FPVA 3NQVA 3G1DA 3PC0A 2GPTA 2DU2A 2BZNA 4QQ3A 1QMLA 4NNCA 1ME9A 1Q3NA 2A1YA 4H4IA 1WA3A 1AW5A 1M7PA 3CIWA 3LHTA 3PF3A 5CZSA 4Z0JA 1WOBA 3LTSA 3B0UX 1OFRA 1N8FA 2FQIA 1KFKA 2OMAA 5F4SA 4XTIA 1SZFA 3W84A 4FIQA 3G1AA 1KM1A 1XDLA 2EHHA 4JR5A 1MO0A 4YCPA 5F1VA 1TJPA 4UCGA 4IOTA 3S5YA 3PS7A 3HGJA 1W3IA 2Y6ZA 1GZGA 2NXGA 4DXVA 4Y9AA 4LU0A 1LLWA 3RFAA 3W1RA 3MP5A 3MO7A 4JTGA 2C0AA 5FF4A 1W8SA 2Y63A 4DF0A 5HWJA 4RKAA 1RVGA 2VFDA 3YPIA 1OABA 5F1UA 4RZ5A 2QCMA 3DI1A 1G67A 3KOFA 2ZTKA 3LOTA 2GVJA 1K7EA 4Y8FA 1UBSA 3KHJA 3N2XA 2VEIA 3NZ1A 4JYEA 2DZPA 4JXCA 4E0CA 2A21A 4FIRA 5I3JA 2RDUA 5D30A 1O5KA 2WKJA 1N7KA 2X1SA 4DEFA 4Q33A 4JX4A 3BV4A 3UPWA 4MFEA 3CC1A 3N14A 3W7MA 1WYIA 3SZ8A 3W7PA 1K8ZA 5D38A 5J5RA 1RQHA 3W3OA 5AOUA 3EXSA 3HIJA 2FDSA 1GTHA 1TSIA 1ZJIA 4PH6A 5T26A 3W1UA 1BWLA 1F2JA 2E5CA 3E9AA 1FCQA 5TIMA 1H60A 2X16A 4WOZA 3TR2A 5CPNA 3TSMA 3N2MA 1WOAA 1OYBA 3W7CA 2YXGA 3C8FA 1TPFA 3GVGA 5AC6A 4N2YA 1TPC1 1LZOA 1J5TA 1SFJA 3M47A 4ZQNA 5EMUA 3W88A 2ZYFA 2W79A 1R30A 4BI6A 1TPDA 2CWNA 2TPSA 2JK2A 3SGZA 4FX7A 1K7FA 4WOQA 4BK9A 3ZWTA 2QAPA 3GZ3A 5A5WA 4X3ZA 5K3VA 1LCOA 2WO5A 3S42A 3NR0A 3L0KA 1H7PA 3BW3A 1WX0A 1UB3A 1LBMA 3C2FA 3C6CA 2FB2A 1FWNA 4LV4A 3NL6A 4AWSA 2V0TA 2FTPA 4IPIA 4IWWA 5DXXA 2DORA 2D73A 3PY2A 4K37A 3MHFA 2ISSA 3LGEA 4N9CA 4JY8A 3DENA 1Z41A 3NPXA 3B4UA 4O16A 4ADSA 1NF0A 1H50A 3GNDA 3QMRA 2DZXA 3NA8A 2YW3A 3N19B 4AWTA 3NQEA 4MJZA 1OX6A 1DOSA 1D9EA 4RZ4A 1SW0A 3HG5A 3TE9A 4N6FA 5AC7A 4MY9A 3QMSA 2FPYA 3N9SA 3V1PA 4IMFA 3L5LA 3STGA 3UZJA 3L21A 2A7PA 1K8YA 3E0IA 2XN0A 4G1KA 1MXSA 3DHDA 4TR9A 3KAOA 3W1TA 2AAMA 3LXBA 1QPQA 3O05A 1TPWA 2YPIA 1TQJA 2I14A 3GLCA 1WQ5A 5F2GA 4QSHA 3PVFA 4Z1DA 3R5EA 3L66A 1JQXA 3PBYA 1GVQA 5DBUA 3FKRA 3NNTA 3LCHA 4RR4A 1OX4B 4HHPA 3C52A 4UFLA 5K9DA 4P61A 4JS3A 3CWNA 1HTIA 2A6LA 1PV8A 2AQWA 4MJMA 3W7JA 1IIGA 2DZUA 3DFNA 3W1QA 2YW4A 2VENA 4JICA 1B57A 1JRCA 3TIMA 4YL2A 3G3MA 1F05A 4YLWA 1ZENA 1VHCA 3TUUA 4O28A 1GG1A 3OIXA 3A24A 1QNVA 3FYPA 5F4XA 4ZQOA 1GVSA 5CPOA 2QCLA 1G4TA 1HO1A 4S1FA 1G7UA 1IXOA 2DZWA 3IIPA 4LT9A 1TRDA 5I3KA 1TPVA 4QM1A 1CW2A 3P8JA 1OX4A 1B4KA 1O95A 2YYTA 5C55A 3NQFA 5KTLA 4RX0A 2NV2A 3BVJA 2YFOA 4GE8A 1L6WA 3HBLA 4IGHA 3UWYA 4K38A 4Q4KA 1OFQA 3F1QA 3W6YA 3QEZA 3RK8A 4RJEA 3CEPA 4JX5A 4YMZA 5LNRA 2Y88A 4IJBA 4LTSA 4R34A 1I45A 1CX9A 1D3HA 1ME8A 5DCBA 3IEBA 4GJ1A 3SSJA 5J5DA 2Y7FA 3S8HA 5CSSA 1SFLA 3U8GA 4LVFA 2VEKA 3M16A 4UIOA 3W1XA 1KLYA 3G1YA 2B7PA 2CLHA 2FB3A 1NEYA 2PURA 2NXHA 3C3NA 3MMTA 3WJYA 1K8XA 2BXVA 1LRTA 2ZZ5A 4EVZA 5EYWA 4FO4A 4AAJA 1W5OA 3FJLA 3LCLA 1W37A 3MJYA 4IMDA 4O4VA 3BK0A 2NV1A 4O0ZA 1L2UA 5E0KA 2XFWA 4OQVA 3NPVA 4RLIA 3AJXA 3LRLA 4BFAA 3G8RA 4RXFA 3PB0A 1F76A 4HSOA 1QPOA 1ZAHA 1YXDA 3TKFA 2Z6IA 4OV9A 3PM6A 2B7OA 3TXVA 3VI2A 3KVKA 1KM2A 4JX6A 2H3DA 2QCEA 3M0ZA 4ZZ9A 3EEGA 4TU1A 4O52A 4IPJA 3ZWSA 1T8XA 3Q58A 1PCWA 3W85A 1XC4A 2DJLA 1VCVA 1KM5A 2V81A 4PL1A 1P1XA 3LX9A 3W1AA 5FF0A 1SPQA 1B9BA 2ZQ0A 3DH7A 2E1DA 1ICPA 2ZA1A 3HGSA 4UTWC 4M19A 3NDOA 3KVJA 4JTHA 4ML9A 1R47A 1L9WA 4GWEA 2YYUA 4LRTA 1Z42A 4MIMA 1XBZA 3MW7A 5I3HA 1H7RA 3L68A 4JNMA 2QDGA 1FWSA 1DV7A 4MLRA 5CSRA 5KINA 2BTMA 2VEPA 3M5ZA 2NLIA 1SR9A 1MZHA 1G7VA 2ZZ3A 2BX7A 3P61A 2V8ZA 4AXKA 4CQ9A 2ZRVA 5AB3A 1KTBA 2J88A 3EX6A 3NQ7A 1TPUA 4A21A 1JUBA 3MP3A 3LDVA 3EXTA 2X1UA 5TBOA 2Q3RA 2I1OA 2YFNA 5E1QA 4J9JA 2O7QA 4KWVA 4O1BA 3A5VA 5DN1A 1H62A 4FX8A 2CW6A 2RDTA 1U5JA 2H6RA 4XWUA 3UWUA 4N6EA 3UWZA 3GDTA 2E6FA 1W1ZA 3N9RA 3W76A 1K02A 1EWEA 1P0NA 1NF7A 4XUGA 2QCHA 1HO4A 1SO6A 2PC4A 3FKKA 2CZEA 1W31A 4O10A 3Q37A 2HMCA 3N73A 2GVLA 3CHVA 3FJ6A 5BMXA 7TIMA 3LCIA 4UR8A 3WK0A 1VYRA 1GYNA 1FDZA 2OCZA 4AB4A 5K9CA 1HFBA 1WXJA 1S5VA 3WJZA 3MHGA 5HWNA 3TFCA 1C9DA 2Z6JA 5H2ZA 5HR7A 4KKXA 4UFMA 1K3UA 2QCFA 3H54A 3O06A 1H7NA 5D2XA 4JTUA 3W2KA 4UTJA 5G1TA 1MSSA 3LHWA 4GUFA 4NXSA 4LW7A 4X2RA 4QISA 2C19A 3B04A 4JTSA 5IM51 1BEUA 3G0SA 4CQAA 1KFEA 3TQKA 1GWJA 3TCEA 1NFBA 5DCDA 4D2JA 1JCMP 4H6KA 1SO5A 2QUTA 1TTJA 3W2MA 4AHOA 4NX5A 4UC5A 1SO4A 1VGAA 3LI0A 2PRMA 4M7SA 1HL2A 4JDYA 3O07A 4HN4A 3EB2A 3TXZA 1LLZA 4UTUA 2C1HA 1XKYA 4NJGA 4Y96A 1SO3A 3STCA 2WSRA 1VJIA 3G1VA 4TO8A 1H1YA 5K4XA 3NQ6A 4O1CA 3QSTA 2NWSA 3IVUA 3LTYA 3CLMA 1HG3A 3IVSA 4TX9A 3QJAA 3MI6A 3ATZA 4IXHA 4JTTA 3IVTA 4WX2A 3EX2A 1PHWA 3Q94A 5KZDA 2EF9A 4ALDA 6TIMA 1OHLA 3GXTA 3E12A 3E96A 2XN2A 2GQ8A 4OV4A 5FEWA 2A6NA 2HS6A 5EY5A 1AG1O 2QKFA 4AH7A 2P0OA 4CNOA 3W7EA 5CZTA 3RF9A 3R13A 4RXGA 3QC3A 4Z1AA 3C0JA 3S1XA 3HPSA 3OHIA 3EX1A 3LCFA 3W2UA 1GG0A 2H90A 5G4EA 3SY5A 5C2XA 3QM3A 4QIUA 4NUWA 4DBEA 1IXNA 1E51A 2IQTA 1KBIA 3GIYA 4UTHA 3G1HA 3BG3A 1TTQA 4K36A 3LBCA 4M7TA 2A5HA 3BLEA 4K8EA 2E5BA 3NQCA 3C61A 5GVJA 4ZVJA 1DKWA 4IX0A 4ZQMA 3W75A 3NG3A 3LB0A 1A53A 1FXQA 3EWUA 3DFPA 1H51A 3GK0A 3T55A 3PUDA 4HT3A 4AEOA 1QDSA 1UUMA 2Y7GA 5EPDA 1VLWA 2F84A 3UWWA 2XN1A 3W7DA 2EKCA 4FNQA 5DLCA 3M41A 3EWZA 1OK4A 1TTPA 3A23A 1H1ZA 2H3BA 2QEZA 3IV3A 1S5TA 4I7WA 2HTMA 1K7XA 4CCCA 1JJKA 1Q6QA 2OX1A 2GQAA 4K7YA 4ORMA 3G1XA 3NL2A 2V82A 3ZS4A 2X1RA 4I7VA 3FLUA 1SSDA 2PRHA 5HR6A 1T96A 1L6YA 4CNNA 3W86A 3S5OA 1F7BA 2TRSA 3PUOA 4IX2A 3VFLA 1SQ7A 1FBAA 2VKZG 5MHBA 1A5SA 3W83A 3HPXA 4WUIA 5F2IA 1IF2A 3CB8A 3CPRA 3CQ0A 4HPXA 3ABQA 2ZA2A 3W23A 1W5NA 1JCXA 1JR1A 2GUUA 4KWWA 4LVDA 3O15A 3BGGA 3LXCA 1OFDA 5LNWA 2QUUA 1FX6A 3TMLA 1QO2A 3N3MA 1IXPA 1OF8A 2E6DA 3GDMA 2B4GA 5LNSA 4LS0A 4IMGA 1VPXA 2ZRXA 4N4QA 3INPA 2PRLA 2WJZA 3NQGA 1KW1A 4UNKA 4JTFA 1F6KA 4E2DA 3HG3A 2V2DA 1A5AA 3HMJG 2QCCA 2V30A 5EA9A 3T78A 2Z2UA 4FEZA 5DY3A 5G2IA 3EKZA 4M5PA 2TYSA 4A3UA 4FX6M 1EX5A 1QR7A 4BR1A 4YWIA 4EOUA 3OVPA 1XI3A 2NUXA 4WXYA 1SSGA 1A5CA 1FCUA 1XBYA 4O1DA 3S9YA 2NX9A 5FEPA 1DBTA 5BRBA 3DFSA 3VE7A 2RH9A 4XTDA 1OF6A 1JUEA 2TSYA 2V5LA 1OFEA 3UYCA 5LZLA 1JVNA 3TJXA 4HSNA 4EIVA 1LM1A 1LYXA 2VOMA 4X22A 3DGRA 3W7KA 1XUZA 3CU2A 1RV8A 1RQBA 4O54A 4HKPA 3NEVA 4JIPA 3HG4A 1JQVA 1I2OA 3W7OA 4KFNA 3LCGA 1FQ0A 1QWGA 3W07A 1W3TA 3OEXA 1TV5A 3FOKA 1ME7A 3PSWA 1ZAJA 1ZALA 3W1PA 1W5MA 3L5MA 1PL9A 4ZQRA 3RLUA 1RR2A 1JRBA 5G4WA 4O11A 3L5AA 2J24A 4FXSA 3G0UA 3W74A 3PG9A 3STEA 1GOXA 3C56A 3IGXA 1V7YA 3PWAA 1FWWA 1T99A 5TQLA 1KFCA 2CZ5A 2QJIA 2DJXA 3EWXA 1EUNA 2W6RA 3IIVA 1ONRA 4JTJA 1GTEA 4MYXA 3V75A 1KM3A 4P2VA 4S2CA 1EWDA 3P67A 5BOOA 1TO3A 3JRKA 3LHVA 5KZEA 3NGJA 4JY9A 5LSMA 3DFTA 3BLIA 1LOLA 2CLIA 1W56A 3WK1A 4O8RA 1LRQA 1I2RA 1WV2A 1DVJA 4XQ6A 5D2WA 3FIGA 3S6DA 4QNWA 4DBDA 3NM1A 4NNAA 2DZSA 1TQXA 4I7UA 1VYSX 2FIQA 3MI2A 2WPBA 1BKSA 4PC8A 2Y89A 2VC6A 3ZFHA 2QJGA 3KVLA 5KZMA 1OYAA 1Q6LA 3LTPA 3TNOA 3UY7A 2E77A 5FF3A 2FJKA 5D04C 1RD5A 3TAKA 5LKYA 1ICSA 2E09A 2YR1A 4LVGA 3TFXA 3DHFA 4IMCA 3S0CA 5FF7A 1GVRA 4GFSA 2KZHA 1EB3A 1XM3A 3UNDA 3W7IA 1WDWA 3MWAA 5AYXA 4LY8A 2C3ZA 2GVGA 5FI8A 2ZZ4A 1R2SA 1TMHA 1WAUA 4BF9A 1ZNNA 3U2OA 2QDHA 1D3GA 3BW4A 5K4ZA 4HNNA 4FHAA 4TMBA 1TREA 4WZHA 2LLEA 2DZVA 5AYYA 3G24A 3GAKA 1EUAA 4MZ8A 5EL1A 3IGUA 3OVQA 4PEKA 3KX6A 4GXMA 2VEMA 1AK5A 1LBLA 4NQ1A 3GX9A 4AVFA 1O4UA 2ZZ7A 2Z1BA 4PFMA 3W7QA 1H61A 3I7RA 4Z1CA 2R91A 4U28A 4LVBA 4ADTA 2EGZA 4RCXA 1SU5A 1IGSA 2JBMA 4UFIA 2WOQA 2HSAA 4Q32A 2Q3OA 3UY8A 4UUIA 1X7FA 5F4WA 3NL5A
chains in the Genus database with same CATH superfamily
3VNKA 3O6DA 4WCJA 3VD7A 5M03A 1P7TA 4L4MA 2GOUA 2W66A 3EKGA 4RDYA 1A5NC 4D8AA 1T40A 4RW3A 2JEPA 4HPJA 4A4AA 3TK7A 1VEOA 3TU9A 1GT8A 4UTTA 4M3PA 2REQB 3GG0A 5G1YA 1UZDA 3U5UA 3MV01 3KZPA 2A4AA 3S1UA 3WH5A 3R0UA 5D2VA 3O1NA 1QHPA 3ITTA 3N6QA 2EPLX 4YCOA 5K2ZA 3URNA 2VGIA 1UP3A 3HJZA 3I3BA 3BAXA 1W1IE 4YXGA 2YZ5A 3S5NA 1G4SA 4ZSTA 1B3YA 5CGQA 1YE6A 3GC4A 4JTLA 1MFVA 1UMYA 4UQDA 1HUVA 1YTDA 3MBDA 4OUIA 4O1FA 3ANVA 3EAUA 1TVLA 5FF2A 3R8RA 4G8TA 4I9JA 4R7JA 3VIOA 4XIAA 1DWAM 1FWFC 1QASA 2XUCA 4XZIA 2FMOA 4O15A 1VH7A 3VDBA 1WBJA 1I8JA 1OCBA 2ANUA 3AUOA 1A5BA 3HB9A 4EPDC 1YDNA 3UJRA 1BKHA 4GI9A 3HGOA 1KLZA 3ARWA 5HNTA 3GHSA 4X60A 4FAMA 2BOEX 2BGNE 4UTMA 4KF1A 3RDKA 4DF1A 4RPPA 5LNVA 3D0CA 3K8MA 3WD1A 3MCMA 3WJSA 2DH3A 5AN7A 2VFIA 3ME3A 3PG8A 3RNDA 4Y7EA 3NVTA 4JFWA 3BURA 3PJTA 3BLKA 3GNOA 3LBOA 1H7WA 3GU1A 4F40A 4IMEA 2J27A 4Q3MA 2CXEA 3QY7A 1DJZA 1HJUA 4DLMA 1HVQA 1FFQA 1KFBA 3T2OA 3UVAA 1E3ZA 1QNQA 1OX5A 1IXQA 1MVYA 2JIEA 4O17A 4HGXA 4KCTA 4CQDA 4PR4A 1W9BM 3N17A 4MY8A 2E6YA 1DWGM 1PAMA 2GQ9A 3DXIA 3G1RA 3IAPA 1T41A 3DKJA 3MYOA 3EDFA 2NX1A 1YPIA 3ZJKA 4C1KA 4MM1A 3FFSA 1YXCA 2A3BA 2OOFA 2YB1A 2PWVA 4HJWA 3CV2A 3NYZA 2DUXA 3AJ7A 1HNYA 1AH4A 5I3IA 3W81A 1UBPC 1E4LA 1L0PA 3AI0A 1VB9A 2FVMA 3DUGA 3GRIA 3O8AA 1F5ZA 3RXZA 4XZ9A 1GVEA 4GQRA 1O5XA 3WX7A 4AD0A 3M6YA 4NX0A 3F4WA 5A3HA 2FJUB 1UPPA 3BOFA 2QQ6A 2ZIDA 3MUY1 3ANUA 4V28A 4A6GA 1LG2A 3WN6A 2QCNA 2E40A 1F3TA 1HKJA 4HNOA 3N29A 1BGGA 1O7AA 3SRDA 4HZ7A 2PSNA 2EO7A 1UP0A 3WF0A 3UWQA 1RD6A 1S38A 2WC4A 2PDXA 2PLJA 3CTLA 1XYMA 4RNIA 3SRKA 3R10A 3NZRA 3TW6A 4B9ZA 3WKZA 1MEHA 3LHZA 1EYWA 4UQEA 3O7UA 5I02A 3PZNA 4EWND 4QAIA 2DZBA 1J93A 5F2LA 1Z9AA 1FKWA 3MKCA 1BFNA 3IJ6A 2VI0A 1OFPA 1KV5A 1Q45A 2HWGA 2DIEA 2PD9A 5AECA 1JPHA 4LAKA 3UG4A 2A0NA 4GVIA 1S2WA 1ZAIA 2JQXA 3P7YA 5BMWA 2YX0A 1Y5VA 1PHQA 3QHOA 2Z29A 1W5PA 4RUBA 1QI3A 1EJWC 2XVNA 1KFJA 1DXEA 4FR6A 2BY0A 4H9VA 4CQBA 3R7MA 3EB3A 4GH1A 1TE1A 1BYDA 3NWRA 1IEWA 4HTYA 4DJEC 5CZ0A 3DDMA 1HQTA 2QV4A 4C7DA 3QYQA 4E4UA 3O6AA 4Q6JA 3RILA 3KTXA 4TIMA 3VKAA 2GZXA 1XICA 2V5KA 3UA3A 3WL1A 4IQLA 1YTKA 3CIXA 4HOZA 1QO5A 2FZ9A 4U4MA 1RP8A 1ITXA 3IJQA 5MF5A 1AJ2A 4H19A 4ZQCA 4OBSA 3Q4DA 2ABBA 4N7QA 4C6NA 3WLOA 5DT5A 3VIFA 3THCA 1TB3A 3W0KA 3RLHA 3JU2A 1GHRA 1Y5WA 2NVDA 4CGTA 4LAOA 1F07A 4F0MA 3CT7A 4OE7A 1I60A 1PDYA 2VVNA 3TC6A 1QAPA 4O12A 4DZIA 4G6CA 3STFA 1UUOA 1A4LA 1XYAA 3IJ8A 3MU7A 4PTNA 1IIHA 1EJTC 3GXPA 3KM8A 1VFHA 3DBPA 3WH9A 2WM0A 2I5IA 4AZ5A 4Z1BA 3SAZA 4M81A 3G8EA 4M51A 4WJXA 3FAWA 4MUZA 3SN4A 2FFIA 2C91A 1S2UA 3E2RA 1HN1A 4EPEC 2CU0A 2QGHA 4KCWA 5C71A 3P84A 1MQQA 5TF0A 3C2OA 2O92A 3I7QA 3UA4A 3MKVA 4R9OA 1AL8A 3PPFA 3VIJA 3KE0A 1REQA 2E5DA 3MCOA 4EPKA 1TX2A 4CD6A 5ECUA 2Q8ZA 3CV7A 2BP1A 3NO3A 1NVMA 6XIMA 5CZKA 2ZRYA 5FOOA 1MQPA 4O50A 3LM7A 3F7JA 3EEZA 4UNLA 4BZYA 3RUBL 1AL7A 4WR3A 1OZMA 2XH4A 3T0DA 2QDEA 3FCPA 3ZMRA 4AMAA 4H3DA 1X1ZA 2BMBA 3U6WA 1IWBA 4PSPA 1VLIA 3IV8A 2XIQA 2B7NA 4PMYA 3VIIA 2EJ1A 3BMVA 4KH2A 3VPLA 3SQMA 2CITA 5GJMA 3RRXA 5AFDA 1ML1A 3W1NA 4JTEA 4Z2JA 1ZJAA 3FXYA 1JZ6A 5HJLA 2PWDA 1HKWA 1VENA 4O14A 3LCXA 2A7RA 3ZJ6A 1H7XA 3QPYA 1JULA 2J9YA 5CAKA 3S1GA 4G1NA 3ZO9A 1FH7A 4W7VA 1OFOA 3L23A 4DO7A 5C7VA 2CBIA 1IZKA 2C6QA 2XGBA 5E0CA 5FIPA 3H26A 4CNPA 4EWJA 3BW2A 1W91A 3L2IA 4QSFA 3VGEA 3RX3A 4XBSA 1XBVA 2DUAA 5IRPA 3L9CA 3S9IA 1OGSA 3GH4A 2WAGA 3LRMA 3P62A 2Q8XA 3UWVA 2ZXQA 4IMAA 1W1PA 1HZYA 2R8WA 2NV9A 1MUCA 5CLTA 2VVSA 4RDVA 2I9EA 3VNIA 2AL2B 4ICNA 1Z89A 1QOPA 4D72A 1KGXA 2ZZ2A 4CEUC 1JCYA 2YDAA 4MWAD 3CHFA 2VFEA 4BI7A 2PDMA 2H8ZA 3MT1A 2ISWA 2EPMX 1CPUA 1KTNA 1OD0A 1VHNA 3HOJA 2WHMA 3W72A 1SFSA 1HKIA 4GUJA 1RY8A 4DJDD 1DP0A 3O6YX 2PFHA 2ACSA 3DFOA 3H2FA 4O1EA 3KCOA 1R46A 1B1YA 2DV0A 1OVDA 4ZO7A 3UG3A 3W1MA 4V15A 4DJFD 4IIHA 2OODA 4M6VA 3P82A 4WKAA 3UVIA 3FAXA 1UWTA 1QK2A 3BZGA 1QRQA 4N9BA 4O53A 3S47A 1YLVA 3EXRA 3FS2A 5DEZA 1VJZA 1R2TA 1R3SA 3OU8A 3TROA 2A3HA 3AAMA 3CS2A 1OG6A 1HJWA 3URQA 1KTCA 1LOQA 4XZHA 3WQ4A 1DTNA 6TAAA 4FS9A 2CLEA 4H04A 4GIRA 3L12A 3T7VA 4KEZA 3OQ8A 3QQ0A 1PIFA 3CL6A 1V5XA 2ZXAA 2QIIA 1PE1A 3WSUA 4LSBA 2XH2A 5D9NA 3GSMA 4BI5A 1ICQA 4RDWA 2POTA 4UWMA 1P5BA 3TMQA 2ISFA 3KL5A 3DC8A 2VQUA 3UPBA 1FWBC 3GR7A 1A5OC 1QPRA 3ZSTA 2C79A 4BWLC 3S9ZA 2AGTA 3LCWA 1UCWA 5ABFB 1AMYA 5BU6A 1MNSA 3WLMA 2GJLA 2XVKA 1OFAA 3SR7A 4H7CA 3W2NA 3TW9A 4WY0A 1MW2A 3E0VA 4H8NA 3I4KA 1GPWA 1PTAA 3FYOA 4H9TA 4GNVA 2YCEA 3PAOA 4IF2A 2CZVA 3UZ5A 2ZBTA 4P7OA 2HRWA 4KWUA 3SIZA 1OIMA 1PB0A 4QEHA 1FWEC 3W2JA 3NJ3A 3VX1A 4QS5A 4UQCA 3N34A 1EEXA 1QXLA 3V5CA 3KWXA 1NSJA 1E70M 4C90A 1Q6RA 4K39A 3WNKA 3CM4A 4D6DA 3NXLA 4FMVA 2Y61A 4XD6A 2BV9A 1LOSA 1EF2A 4KS0A 2Z2AA 4JIHA 3FSTA 4H8VA 4MPKA 1M53A 1CXIA 3JS3A 4ZTYA 4CVUA 4BJHA 5HUOA 2FZBA 5KITA 5DO8A 1F8IA 4G7FA 5J8LA 8A3HA 5SWUA 4PUKA 5A94A 4GG9A 2Q71A 4MOZA 1PEZA 2JGYA 3UWEA 1QHOA 4ZB5A 3ERPA 1YXYA 2YDSA 4CQ8A 3I10A 3NPWA 4Q4SA 1V3MA 1WKFA 4AWUA 1KKRA 1YPFA 3UD6A 3VOIA 4O0KA 2XPKA 3QFEA 1G4EA 2ATSA 3WYZA 1HL8A 5IOBA 4L7ZA 4CD7A 1XRSA 3QRHA 7PTDA 1QMLA 3GG7A 4NNCA 1Q3NA 1I1XA 4YHEA 2IQ0A 3DG7A 1M7PA 1CGWA 1D8CA 1CXKA 3LTSA 2ZADA 1GZJA 2PI6A 3ZT5A 1KFKA 4ZFCA 5F4SA 4XTIA 4FIQA 4Q4PA 4PCPA 2EHHA 3RX4A 4MHBA 5FL0A 1EZWA 1TVNA 1W3IA 1GZGA 2NXGA 4CNUA 2QPXA 1E0XA 3RFAA 2WHKA 1VFSA 1MYRA 1VKFA 4DXXA 4BEQA 4JIEA 3MANA 4YYCA 2BVYA 4HVXA 4RZ5A 4MWAB 5DX7A 2Y2WA 3WLRA 1KCXA 1WZKA 1K7EA 1UBSA 3MQTA 2VEIA 4AC1X 4E0CA 4IL2A 4P8VA 4GQ0A 4GYFA 4HNLA 3TN4A 5C9XA 2YBTA 3BV4A 2GSEA 2PTXA 3N14A 1PIGA 5J5RA 5HDRA 3EOEA 3V36A 1GUVA 3HIJA 4Y2WA 4Z2HA 1F2JA 2E5CA 1FCQA 4KBXA 4QDMA 2BY1A 1JZ3A 4F2TA 4AY1A 3IACA 4E6MA 3TSMA 1GKRA 1OYBA 3W7CA 4HHMA 2VX7A 3TN5A 1LZOA 2G3IA 1J5TA 1BVNP 3TVAA 4AW7A 4ZQNA 3E0WA 1M1BA 2HXUA 3VKKA 4M80A 2DVXA 2GJRA 2GJXB 3SGZA 3ZWTA 1O5RA 4UOQA 3GZ3A 5A5WA 4X3ZA 5K3VA 4Q7IA 2WO5A 3NR0A 3L0KA 1WX0A 4LV4A 3DFHA 1UKPA 2NSOA 2VX4A 4IICA 2DORA 2O9TA 4PYSA 1K9DA 4XB3A 4X61A 4A8NA 3B4UA 4O16A 4MB1A 1E0WA 1NF0A 1H50A 3GNDA 5DT7A 4OJYA 2XZ7A 3N19B 3CB3A 3HZ3A 3W28A 4JQ3A 1FP9A 1DOSA 1QI4A 1BGAA 1NDYA 3DHUA 2HNHA 3QMSA 2FPYA 4F48A 4IQDA 3LPOA 4IMFA 4B92A 3L5LA 4H1ZA 2G4FA 4CCZA 1NQ6A 3KZSA 3VX0A 4TR9A 3DHDA 2OEKA 4Z1YA 4MNMA 1L2QA 2PDNA 3WDIA 2OWCA 4AZGA 3D6NA 2AAMA 3FYYA 1BG4A 4H9YA 4HD5A 3O05A 4C6PA 1OC6A 4GD0A 5EBAA 3WDPP 3WBEA 3LMZA 1OY0A 3BJSA 4QSHA 5A8NA 3UERA 4AZCB 1MI3A 3IK2A 4B4HA 1CZ1A 1E6XM 4AZIA 1UWAA 3F4DA 4QQUA 3AC0A 1HTIA 4LANA 2PGRA 1PV8A 4MJMA 2YL8A 1PZ0A 1EOKA 3TP4A 4C5ZA 5CJ5A 3PUGA 1KQYA 1MDRA 2PPGA 3CXOA 3CQJA 1WZLA 4PB5A 4WK9A 1V03A 3BZJA 5CPOA 2QCLA 3TJIA 5LIXX 1HO1A 1IXOA 2PU0A 3IIPA 1GJUA 1QK0A 1ONEA 2INEA 5I3KA 1CW2A 2BS9A 1RH9A 4DUXA 1O95A 1GOQA 4ZXLA 5KTLA 4GE8A 3U4FA 3SCPA 3K2GA 2Y5JA 3ZJ7A 4IJBA 2WCAA 1I45A 1XJBA 1D3HA 1ME8A 4GJ1A 2Y7FA 1L6GA 4H9MA 3U8GA 4UIOA 2YBUA 4LAUA 4XKMA 3G1YA 2CLHA 2OR2A 4JL2A 4ZXOA 1NEYA 2PURA 4GIAA 4YIWA 3GXFA 2YA0A 4D9PA 2Z7GA 1RBLA 3MMTA 1K8XA 2BXVA 1EJ7L 2ZZ5A 4U5KA 3UZZA 2CIPA 2V5JA 2P0IA 3SEPA 2HEJA 1W37A 3MJYA 2IKIA 4ZR8A 4IMDA 1QPKA 4NAFA 2VUNA 4NG3A 3AJXA 3PB0A 4ERIA 1F76A 4HA4A 4J40A 2WC7A 4QG6A 3PM6A 1W9PA 4QRNA 3TXVA 4JX6A 2QCEA 3POHA 1T8XA 1PCWA 2GYIA 3TEVA 3N4FA 1O12A 2V81A 4PL1A 2VGGA 1P1XA 1D7KA 3RPTA 2HVOA 1SMAA 4YHGA 4IGMA 4L56A 2HNEA 2ZA1A 4XD4A 4M19A 1ZQ5A 3N2BA 1TJ2A 5JH2A 2QGYA 1C7SA 2XFRA 2E25A 1RJRA 1FWAC 4GWEA 6A3HA 1Q8JA 4H6QA 4MDOA 4B91A 4IP4A 3APYA 1XG3A 4LRTA 1W9VA 1M9HA 1XX1A 2RJGA 2WHJA 2YDRA 1KGWA 4IQEA 5KINA 1XRFA 4GXPA 2VEPA 2NLIA 4ZGYA 1G7VA 2JALA 2ZZ3A 2BX7A 3P61A 1V6WA 2PDWA 3A4JA 3W4RA 5DRIA 3EX6A 3ZLFA 3LG3A 3MZNA 5I79A 2X1UA 5TBOA 4ECLA 1NP2A 3A5VA 5HJYA 2CW6A 3AS2A 3UWZA 4XWUA 4PZVA 2E6FA 4AY7A 1W1ZA 3QPEA 1UG6A 1EWEA 1DJIA 4GYJA 1ZJHA 4XUGA 1SJBA 1SO6A 4GACA 1S5NA 1HKVA 1W31A 3DESA 3N73A 1VRXA 3FJ6A 5BMXA 1C7TA 2V3GA 3WQPA 1GYNA 1DWJM 2OCZA 5A69A 2ZDSA 4DBSA 1WXJA 3MSGA 4MJ4A 1UR1A 3TN3A 2VR4A 4NIRA 2Z6JA 5H2ZA 4YTRA 2VM8A 4PEEA 4UFMA 2QCFA 2ONEA 2F6XA 1XD1A 5G4HC 1MSSA 2ZX9A 4JHOA 2R82A 3WNNA 4YVVA 1G0CA 3IGHX 3G0SA 4MGGA 3LU2A 3DGBA 3TQKA 4XIMA 2BDQA 1GWJA 2FDMA 4LEFA 2QUTA 1TTJA 3DCPA 4HA1A 1WDDA 3T08A 1ZSXA 4NX5A 3AZTA 3TR9A 1KKOA 4PBFA 1Q2RA 4XK2A 1MDLA 3O07A 4HN4A 1GOKA 3WFLA 1FTXA 4C6CA 1XKYA 1NWRA 3B9OA 5XIAA 4NJGA 2QXWA 2BODX 2WJDA 2XZ9A 2FHFA 1VJIA 2WSRA 3THDA 2GL5A 3EPMA 2NWSA 4H6RA 2CEQA 3IVUA 2XM1A 1OADA 4PB4A 3CLMA 2VZOA 4MUPA 3N25A 3IVSA 3OVGA 2E8ZA 1DEDA 3QJAA 1IR1A 1AQMA 3GTXA 3W6LA 1ECQA 4IXHA 4DZAA 4D6GA 1V51A 1PHWA 3Q94A 3BOXA 5KZDA 4PRWA 4KT2A 5JBEA 4ALDA 1CWYA 5DMMA 3QZ6A 4RNFA 3UR8A 2RGLA 4C6LA 4HSHA 2IS7A 4OV4A 4PTMA 4F9JA 2QKFA 4HU8A 1XGDA 1TA3A 4PFHA 3W2UA 9CGTA 2H90A 3SY5A 3LSCA 3QM3A 4QIUA 1AVAA 1CLKA 2A79A 3GYCA 3II1A 1E6RA 4L4OA 4IJRA 3EPNA 1BF6A 2J75A 3E2QA 3BG3A 2AOSA 2A5HA 2HCVA 3PNUA 4LJ3A 4HHHA 3C61A 5GVJA 4PUWA 4B3LA 1DKWA 2VEFA 4ZQMA 4B90A 1FXQA 3EWUA 1D2KA 1H51A 2ICSA 1M03A 2D0HA 2AKZA 2YLLA 1P0BA 1E5NA 3KBNA 1UUMA 4ROPA 1W6TA 3UWWA 3AXMA 2EKCA 1PX8A 2PP1A 3T8LA 4PUDA 5DLCA 1Q7MA 3WNLA 3RCYA 1OK4A 4RZBA 2R9RA 2CHOA 4C65A 2QEZA 3IV3A 1TMQA 4I7WA 1V6VA 2PTWA 2OX1A 4LAMA 1QTWA 5FJUA 5BWFA 2GQAA 4K7YA 3F2BA 1V0MA 1DJGA 4B5UA 3LSBA 2OGJA 1F7BA 3CYJA 3N6HA 3PUOA 2PA6A 4H9ZA 4IX2A 5AC5A 3M0LA 3KRBA 3VFLA 1FBAA 5MHBA 5I7GA 1AQFA 3ICJA 4WUIA 2GGHA 2A3CA 3CQ0A 4MDPA 1QNSA 1W5NA 2PEVA 2VNCA 3O15A 3FGCA 1ECEA 5LNWA 1FX6A 3TMLA 1QO2A 2NT0A 5BOEA 3CHCA 4UTFA 2E6DA 2BGSA 1CXEA 4W8AA 1RCXB 4N4QA 2ZRXA 4ES4A 3S83A 5EMLA 3NQGA 1KW1A 3EWDA 1OM0A 1KRBC 4PUUA 5IHSA 1DTUA 1M68A 2WZMA 1NOWA 2QCCA 3AMKA 4BCEA 3T78A 2Z2UA 1H5VA 3E2SA 1CB2A 5DY3A 5G2IA 3V5FA 2P88A 4M5PA 3KP0A 1QR7A 2FYMA 3WEOA 3CK5A 1XBYA 1JGMA 2V3DA 2OWXA 4O1DA 1F3XA 3M7SA 5BRBA 4XTDA 2WCSA 3UGRA 1OF6A 1NFPA 8CGTA 3WLJA 3A6OA 2CYGA 4X22A 1XUZA 1ISXA 1JIBA 4HKPA 4JIPA 3W7OA 3MKKA 3LCGA 2D69A 2CBVA 1FQ0A 1QWGA 3W07A 3ZQ9A 1JI2A 4LCRA 4AD4A 2DT1A 3P0XA 1P6BA 1MW3A 2CNCA 5G4WA 2J24A 4PN2A 3STEA 4GYKA 5M1TA 3C56A 3WQOA 3GBEA 4WSKA 4Q4QA 3CTTA 1WPCA 3VZZA 2W92A 3WCZA 3LEPA 4B16A 1P6WA 1EO7A 3EWXA 3MMWA 1CGYA 2W6RA 4H8HA 1GTEA 3V75A 2WVUA 2BY2A 4V33A 3GH5A 1B3ZA 3ZJ8A 3P67A 5BOOA 2WZEA 3JRKA 1XYZA 4C6DA 3KOXA 3KW3A 1OCQA 3DFTA 2WMFA 4NHVA 1I2RA 3T2QA 3TZFA 3S6DA 2W91A 3Q67A 5LIYX 4YN5A 2Y8KA 2VX6A 3CGTA 2WPBA 4AMCA 3OIHA 1XCXA 5M5DA 3ZFHA 2J47A 4K3ZA 1Q6LA 4HMNA 1L8NA 4LUTB 2E77A 4TVDA 3REQB 5D04C 5LKYA 2E09A 4A05A 2YR1A 4IMCA 3UJFA 3ZSSA 3UNDA 3CZKA 3DC0A 3CZLA 3GM8A 4NYYA 5FI8A 2ZZ4A 1ZNNA 1OD8A 3U2OA 1AFSA 1TMLA 3WBWA 3H2EA 2UY4A 2IW0A 1OB0A 5CXPA 5K4ZA 2PD5A 4FHAA 4TMBA 5C7HA 2LLEA 1KNWA 1B3WA 4C6BA 4OFCA 4FZIA 4PEKA 4GXMA 2VEMA 2ZX5A 7REQA 1NTHA 2IQDA 3OODA 4AVFA 3BUVA 2Z1BA 1ITCA 2IMRA 1UD3A 4Z1CA 4ADTA 1VBJA 4RCXA 2YL9A 3PWIA 2G3NA 2HSAA 4Q32A 3I3DA 3T1GA 2CESA 5F4WA 3NL5A 3WJXA 2EJAA 3ARRA 2ZUVA 1KCZA 3H4WA 3M0XA 3ZT6A 4W87A 3W02A 4NU7A 5LGXA 2G5WA 2JKAA 3T2PA 4AEFA 1LRNA 2DVTA 3VMNA 1F4AA 3CZEA 1OFBA 4R33A 4B5NA 3GAYA 1YDOA 4DI8A 1H4PA 3BSMA 2V2HA 4XZBA 3BWWA 5FESA 4DRSA 3TOPA 3GY1A 1BTCA 1VAHA 4JTCA 4GC4A 4GVGA 3Q65A 2F7FA 3L0NA 3V0TA 2Y7DA 4GX8A 1JCNA 3BAJA 1X8FA 1GORA 3U9IA 4L4LA 3TJLA 1K70A 2WSPA 5AHFA 2YXXA 1W9XA 4LVAA 5U4NA 4LALA 3N13A 1XLKA 4E2VA 4JKLA 1R8LA 1Q4WA 4I8YA 2PGWA 1N8WA 3W6MA 3OP2A 1TR1A 3WF3A 4GXWA 1TJRA 5AC8A 5H91A 3KOYA 3WQ6A 3MC5A 2WSYA 4KRUA 1EGVA 2ZVIA 4MJ2A 2AMGA 3UCQA 3M7WA 4HQVA 1O60A 1U83A 3QSRA 4M82A 1ALDA 2NZLA 4F3HA 1VYPX 4NZJA 4NAEA 1KCKA 3O16A 1QPNA 4W8LA 2VZUA 4DJFC 2RFGA 2DSVA 4HNVA 3Q2DA 2G3MA 4J3VA 2V2CA 3IRSA 3PB2A 3NO5A 3S46A 3N2OA 2HDJA 4O13A 2FLIA 2Y5SA 3H4GA 1FP8A 1G69A 3N11A 5ABGA 2G97A 2PDJA 2XFFA 1RQEA 1KWKA 3M44A 5ABEA 2CLLA 3F4VA 3IJ9A 3PSVA 5KEZA 3L4VA 3KP1A 1LUCA 4DPPA 1UOKA 3A12A 3FN9A 3WL0A 3QZAA 4MMWA 5BRPA 8XIAA 1SMDA 4LCSA 4ZSUA 2GOKA 3C2EA 2V5DA 1GQNA 3WNMA 2PGFA 1XBXA 3EYPA 3AHVA 1DJNA 1KCLA 4JQ2A 4XVDA 2I17A 5CPTA 2NUYA 2JKEA 3PHAA 4HPGA 4ZL1A 2WMIA 4NZFA 3T81A 3CJPA 3PZ9A 1P4CA 2VR2A 3UGVA 4W88A 2NXIA 4EAYA 2Q8LA 5IHRA 2XU2A 3MJMA 3H23A 1V6UA 1VFOA 3M43A 4NJJA 4LUSB 3MI3A 8XIMA 4MTVA 3T6CA 2PGEA 3G5EA 4AUBA 2V5BA 4REQB 3B40A 3VOFA 2ZE3A 3PP7A 4DXKA 2ACUA 1EEPA 4HTBA 4V27A 3UFYA 1EC7A 1LWHA 1HGWA 4JTAA 2X8RA 4C1LA 1YBQA 2FVKA 1W1YA 4DELA 4WY0F 3HURA 4B2DD 5FJJA 3M5VA 3BSHA 2FZNA 3VUPA 4LNCA 5HJXA 4ZEPA 2WZTA 1H2JA 3M0MA 1EA0A 1GJPA 3LBMA 1OYCA 1QW7A 3PFRA 3TA6A 3LA4A 3IJLA 1XSIA 1AMKA 2PDUA 1ZUAX 3DZ1A 1CXFA 5ENLA 1O1ZA 4U3CA 2RHGA 2A3EA 2X7WA 5C54A 4W89A 1XRTA 3E49A 1UC5A 3VCRA 3W87A 3M0KA 1FCBA 1AZ2A 3LRKA 4EAMA 3CUXA 1RHCA 4QR6A 4HK6A 1GEHA 5AYIA 4NJHA 4JIQA 4KETA 2BXYA 3D47A 1ZGDA 4DIAA 4ML4A 1MUMA 1XCFA 1DE6A 3HQ1A 2A2IA 4HK5A 1SM9A 1Z48A 4S3EA 1J0ZA 3AUJA 4NASA 2F8QA 1VFUA 5IDIA 1UYQA 4MKNA 3B9EA 2O7SA 1UR9A 1NARA 8TIMA 4O19A 3NAVA 4AZ6A 1HP4A 2ZCGA 4J3SA 3WQFA 3W2LA 4XZWA 4UR9A 3N2CA 4BY3A 3BDKA 1U1JA 4JFUA 3DHPA 3QHMA 1CTNA 5DFAA 4A22A 3OVRA 3QH2A 1VZWA 4KEMA 4UMCA 2YCLB 3GW0A 2PC8A 4J4KA 1F73A 1E9IA 3NURA 5T9BG 4ICMA 4IIEA 1NFGA 3S1VA 1I2QA 2ZZ6A 4WD0A 3NQMA 4TMCA 4HNTA 2QR6A 3FNDA 2BXZA 2ZRZA 3C4UA 1XDJA 4KCUA 1E0VA 4UTTC 1F3EA 3W1LA 3E5BA 5HNRA 1HVXA 3SCWA 3GNXA 4EX4A 3GTFA 3GDLA 4NNBA 2HE5A 3GFZA 4UTIA 3GFYA 2BFGA 2J7EA 3O6CA 3POCA 3OBKA 4P7LA 2HROA 1OIFA 1BVZA 1U5HA 2XWEA 4MZYA 2RDWA 3KWSA 4AIUA 4LQ1A 3AIUA 2V69A 1B3OA 1KM0A 1GEQA 1J79A 2NVAA 3HO8A 1K9FA 5JVLA 4DX3A 3E02A 3NQDA 1EDGA 3GXDA 5FEXA 3UXDA 3H2CA 2PF0A 3EX3A 3GNPA 3PAJA 5I3DA 2QJNA 5HULA 5LXEA 5H1WA 1X8CA 2VELA 3ZYZA 3NZQA 4AD5A 3E74A 4G9PA 2CFFA 1BYCA 1S46A 3E1F1 1BVWA 5HA7A 3C2RA 1DIDA 3OG2A 1UH4A 5IFPA 5HQLA 3QOMA 4HCHA 3R0KA 3J7HA 2OQYA 1JAEA 3ENLA 4I9AA 3M5XA 4DAIA 2IXVA 4Y90A 2XVLA 1ZTVA 3B9NA 4D6HA 3VIKA 1OK6A 4BHYA 1XRVA 2PDCA 4ENLA 5BNKA 5ABTA 4CD4A 2Y85A 4GO8A 5A8GA 5CSYA 4OUEA 3W27A 4GIEA 4PB3A 4F66A 3IANA 4GKLA 3RO6A 3FW6A 4EXAA 4LS1A 1P0DA 3GDRA 1QVBA 4DO6A 3KRZA 3NO1A 4WJEA 2D2OA 3DU0A 2J7FA 3VCNA 2X40A 3OB8A 4PTWA 2VD8A 2PWUA 4K7VA 3W73A 4TVUA 2ISDA 1H09A 5BCAA 3QR3A 5L9FA 1SGJA 4GGHA 4FOJA 3GHRA 3QOKA 2D3NA 2FHCA 3KRUA 1GKPA 4QITA 2I7GA 4WVXA 1IQ8A 1VRDA 2CBJA 4LBUA 3WLTA 3S6TA 1JL8A 3BLFA 2BGQA 4Q22A 4JOMA 4G7EB 3S3GA 3GKAA 2GGIA 3QTGA 2Y7EA 2QF7A 2OFJA 3THAA 2OSWA 4KESA 2P50A 4ATWA 2G0WA 2EPNA 2HBVA 2JFEX 2J77A 2F38A 1Q7ZA 3CZGA 4L9XA 4L5ZA 2CLPA 5CPSA 4DZHA 2CHNA 3S2MA 5I6SA 2YA2A 4XO6A 3G1SA 1E4MM 4L1GA 1FDJA 3W7GA 2YL6A 3WDHA 1AW1A 2ZRUA 3H2MA 1TJ1A 3WJWA 1AQ0A 3HPAA 4PULA 2V6AA 3NGFA 4XBJA 1JDAA 4MY1A 1B54A 3ABOA 2VTFA 2EXOA 2Q09A 1PZ2A 1QT1A 4C6FA 3CZJA 3FA3A 3JVAA 1R0MA 2D20A 3LQLA 5CC3A 5AKQA 2PDIA 1H41A 2F2KA 3PBUA 1XLFA 1FY6A 1TWSA 1RA0A 4L6HA 4A29A 4IIBA 2WM1A 3TLQA 4AYGA 3WF4A 3W7LA 3LNPA 2FVLA 2X42A 5FEZA 3PJUA 1GQJA 1P0KA 1FDYA 1EA9C 2F9RA 3OA3A 3RITA 5D02A 3WDQA 3R8GA 4DO5A 2Z27A 3LXAA 3TQVA 5BROA 2DVUA 3P81A 4R53A 1M5WA 1XISA 5CKSA 1WB0A 2P10A 4FA3A 2PDFA 5EMKA 2DSUA 1YNQA 3OHMB 5BWAA 3OG3A 4HMCA 2ZX7A 4R7OA 3VDHA 5XIMA 1M6JA 5C70A 2FGBA 5AHLA 3UQNA 4Z0SA 4PL2A 1XH0A 3GNRA 4HP5A 1KRCC 2VGFA 1FWRA 1P43A 3AIWA 3ANYA 4PMRA 3GKFA 1RBOB 2JGQA 1F6YA 4M6QA 4R5EA 1ZP4A 3G1FA 4EANA 3NQBA 5CG7A 1JXKA 2GJNA 5E93A 4QDPA 4HCLA 3H22A 1TZZA 3CIVA 3PBMA 2UBPC 1GOMA 1V08A 1FWGC 3HF3A 3SFKA 3L2MA 2ZZ1A 3VOJA 3H7VA 4B9YA 1EIBA 1R85A 2OEMA 3OZPA 3VDAA 3AMDA 4YTUA 1K03A 3R2GA 3AYRA 3H70A 3F5LA 2DZTA 3I7SA 4FNSA 4NXKA 1LL4A 1Q8AA 3BG9A 5I3FA 3TSDA 1XLHA 1UR0A 4FF7A 2XGIA 1XWYA 3NM3A 4GBDA 3M9YA 2DIKA 4XAZA 4DYKA 1EP1A 4L4PA 5E09A 3PZUA 1POJA 1TIMA 4AF0A 2E6AA 1HT6A 3T0AA 1FWCC 2VX5A 1E15A 4EF8A 4MLJA 4B15A 3GIQA 3GVWA 3KXQA 1GGOA 1W1B1 2YIHA 2X05A 1TWDA 3GNNA 1QCWA 4K6AA 4JZ5A 3VUSA 4NT0A 1RCOB 2DY3A 3FA5A 4V2XA 1TA3B 3UXAA 4ZQPA 3RJYA 3W7RA 3HFYA 4OBTA 2OZ0A 4LOCA 4XAFA 3EWBX 4GLEA 4IJCA 5G2HA 4UTKA 2Y4SA 3PPCA 5CPLA 1LP6A 1UHVA 1UR4A 3CT2A 4IIFA 4AFYA 4R27A 3PC0A 1SFTA 2QS8A 4S3CA 1EC9A 1YEYA 2A1YA 4RDZA 3LHTA 2VMFA 5CZSA 4Z0JA 3ES8A 3KTCA 4P8WA 3CMFA 5EU9A 1MRQA 9XIAA 2FQIA 1SZFA 3W84A 3WDJA 1UIPA 2WMHA 4W85A 1KM1A 4JR5A 1BAGA 1BXBA 3R43A 3VKBA 2ZUTA 4CNTA 4Y9AA 2DGAA 1LLWA 2HVNA 2XFYA 3BXWA 3MP5A 1V3LA 2C0AA 3TYUA 1VPQA 1LLOA 4OOUA 4DF0A 4HN8A 4RKAA 2DIJA 1K4HA 1YNYA 3YPIA 1OABA 4C6IA 3DI1A 4HPNA 2QIWA 2OQLA 3LOTA 4N42A 2DW7A 2GVJA 4LYPA 3RR1A 1LQ0A 3KHJA 3NZ1A 4ATDA 4ZOEA 3COTA 4JXCA 1GK8A 1R3QA 4NY2A 3VIMA 1IT0A 2OVLA 2VR5A 3FGCB 2ZUNA 3BQ5A 5I07A 3S2JA 4ERGA 3UPWA 3UEQA 1WYIA 3O0KA 1VFFA 3RX2A 1RJQA 2I5QA 4MWAA 4NF7A 4W93A 1MRAA 3W37A 1KRAC 4PH6A 4L80A 4UBPC 2VWSA 1EPVA 3UT0A 5TIMA 1H60A 5I06A 4WOZA 3TR2A 5CPNA 3LGDA 4DJDA 1WOAA 2AKMA 4NILA 5HANA 1E1CB 3GVGA 5AC6A 1B30A 1SFJA 4YWSA 4ICCX 4QFUA 3LQGA 4FLRA 4BI6A 2XINA 1NOFA 2TPSA 4MWAE 4BK9A 1K7FA 4WOQA 1IZCA 4RNHA 3C6CA 1UB3A 1E56A 2FB2A 4XO7A 4J3XA 1OCNA 5D4YA 4IPIA 4DZ5A 3BANA 3KS6A 4KQNA 4K37A 3MHFA 3QY8A 4JY8A 3FJNA 3DENA 4MADA 1RUSA 5FCZA 3B0XA 4FOKA 2DZXA 2P5NA 3JUGA 1YHTA 2J7GA 3N15A 2E28A 1D9EA 2P8BA 1K9TA 1SW0A 3ITLA 4U2YA 2GJXA 3URAA 5AC7A 4MY9A 1XIIA 4PRRA 5AC4A 3N9SA 1KWGA 4WIWA 1IT7A 3VOGA 3B8WA 3L21A 4MAVA 1K8YA 2XN0A 3WLSA 2UY3A 3KAOA 2QV5A 2YCKX 3SUTA 1XS2A 1FKXA 4S3KA 2ACQA 3XISA 1DWIM 1JNDA 5A2CA 2QVNA 1TPWA 3T0BA 2YPIA 4E8DA 3ES7A 2I14A 2ALRA 3GLCA 1QBBA 4R85A 1WQ5A 5F2GA 4E5TA 3WLHA 1SJDA 1VIZA 4GH3A 4TOQA 1J12A 2V68A 3PBYA 1GVQA 5DBUA 3FKRA 4PTXA 4RR4A 1D8WA 1OX4B 3FHQA 3QV7A 4HHPA 3CH9A 4JKMA 2WCGA 5K9DA 4P61A 3CWNA 2A6LA 3FDGA 2AQWA 3B8VA 3DFNA 2YW4A 4HB7A 4JICA 4S23A 1B57A 3TIMA 2V5CA 3G3MA 5CC7A 5GPRA 2E4TA 3PZTA 3WQEA 1QNVA 4AZCA 3GG1A 1G4TA 3M4HA 1G7UA 3WELA 3ZZ1A 3VYLA 2WANA 1TPVA 3IS4A 3PANA 4U10A 3VIPA 3ITXA 1S1PA 2OZ3A 4WDTA 1B4KA 3GVRA 2YYTA 3D5HA 3NQFA 3BVJA 1R3YA 3W01A 3VM7A 2C71A 4IGHA 4NRSA 1EZ2A 2WMJA 2XVPA 2VDHA 3W6YA 3RK8A 4RJEA 2FKPA 4PMJA 2PLCA 4LTSA 2YB4A 3KOWA 1U33A 2BOFX 3B9AA 5E5CA 5FJIA 2OSXA 1WZAA 5J5DA 3S8HA 2HV5A 4CU6A 2AMXA 3L7RA 5CSSA 4NZ1A 3AOFA 4LVFA 2WLZA 2V38A 3M16A 3WD2A 1RALA 3RPMA 1KLYA 3DERA 3ITVA 5FJPA 2B7PA 1ODUA 1LWIA 4C5YA 1KR1A 3CWHA 4Q8QA 2E1WA 1EF3A 4ZODA 3WJYA 3XIMA 1LRTA 4FO4A 1UD5A 2R1NA 3FJLA 3F5JA 1V3KA 1KXTA 3GG8A 3WQCA 4O0ZA 4F4RA 1GNXA 3KBJA 2XFWA 4OQVA 4QJ3B 2C1GA 4MKSA 3LRLA 3G8RA 4RXFA 3H12A 1J0KA 3K13A 1QPOA 1YXDA 1DE5A 3OQEA 1UZ4A 4I90A 1J10A 3I6TA 4OBRA 2B7OA 3KVKA 1MUWA 3M0VA 1EQCA 4ZZ9A 2W67A 4IM4A 2EG6A 3TTYA 4IPJA 3AROA 2YLAA 4EK7A 3QV9A 1QWKA 3SUSA 5FL1A 4LYRA 2QUNA 5FF0A 3B4YA 2VQTA 5A8OA 3MDUA 4FLSA 2J4GA 4W7WA 3WH6A 1X6NA 1Z7AA 1ZS2A 3AMGA 1L9WA 4F9DA 3UJSA 1YKWA 1RXOB 4XUYA 5D8ZA 4D71A 3H2AA 1XBZA 4Y9MA 5I3HA 8RUCA 3L68A 2QDGA 1FWSA 1G9HA 1DV7A 4MLRA 2BTMA 1Y5XA 4HJFA 3FJ4A 5GNXA 2QYGA 2WMGA 4NAEB 3K8KA 2QW5A 4CQ9A 4A3HA 3BTNA 4WDWA 5AB3A 3NQ7A 1XLIA 4B5TA 4W5ZA 5E1QA 1JZ8A 1XC6A 2O7QA 1V6XA 4IGSA 1U5JA 2H6RA 2WVTA 2XSXA 3BICA 3CUZA 3EOUA 1BHGA 3LUTA 1NF7A 3HPFA 2ACRA 3AWOA 1TG7A 1VF8A 3CHVA 3GC5A 1I1WA 4LY4A 3LM3A 3SFWA 1VYRA 2GWNA 1J6OA 1LUCB 5C9WA 1HFBA 5CC6A 1GOWA 3MO4A 5HWNA 1QUMA 3TFCA 1POKA 2Z26A 4ZOBA 5HR7A 3UNTA 3ONCA 1A0DA 1K3UA 3CUGA 1ADSA 1XLJA 3BCJA 3H54A 4AZHA 4DUOA 3N3TA 4UTJA 2PU1A 3ZM8A 4GUFA 4JNZA 3TONA 4LW7A 2WMIB 4X2RA 1KR0A 4JTSA 1UH2A 1BEUA 1UA7A 3TCEA 4ZE4A 4Q8NA 1US0A 5DCDA 4D2JA 1JCMP 4H6KA 3N2TA 4K1WA 1AH0A 3W2MA 4AHOA 4WF7A 5CGTA 2G3JA 1JEZA 1SO4A 1FWDC 3M46A 1J9YA 3DEQA 3EDDA 1V6TA 1XLAA 4XD3A 3EB2A 1YBQB 1M3UA 3BAWA 1LLZA 3RG6A 2C1HA 2GSHA 4US6A 1U2YA 2NQZA 1B3XA 1H1YA 3OOQA 3NQ6A 3SIMA 1W17A 4DJED 1ZU8A 1J0HA 1E0UA 1RCQA 3OPSA 1SZRA 4LX4A 3QXBA 3AHZA 1O66A 4JTTA 4WX2A 3AU2A 3R0DA 2ZE0A 2PLKA 1C8QA 2EF9A 1OHLA 3E96A 3GXTA 5B80A 4C6MA 1H1NA 1PX3A 5FEWA 4X63A 2HS6A 1LG1A 4AH7A 4CNOA 3W7EA 5CZTA 3RF9A 3R13A 1DIOA 4QG8A 4Z1AA 3C0JA 3EX1A 3LCFA 5LIWX 3ZLGA 5C2XA 3OLIA 4NSBA 3T05A 1ZL1A 3SCTA 1HF6A 3PZGA 2JF6A 4R9XA 4M7TA 3LBCA 2J25A 5FAJA 3NQCA 5E9XA 2C1IA 4ZVJA 3VIGA 3NSMA 3QLDA 3W75A 1OGGA 1WP6A 3NG3A 4J3TA 1A53A 5DMYA 3DFPA 4W86A 7CGTA 2W5FA 1GZ1A 1V7AA 1FFRA 1PKYA 5H8PA 1DJXA 3PUDA 4JL1A 3SCQA 1Q6CA 1MQRA 2RJHA 1VLWA 4OZOA 1IWPA 1EKOA 5H8UA 2H3BA 2CPUA 3UZXA 1S5TA 4CCCA 4HHLA 2YCIX 4ORMA 3G1XA 4IGNA 3UBPC 3ZS4A 4YTSA 1E6NA 4DVOA 1UMLA 5HR6A 5HNNA 4PCTA 4NRRA 3HQPA 2DT3A 1VEMA 3W86A 4E8GA 4I6VA 1ODZA 1BG9A 1JXJA 3RJXA 5A6KA 1F8MA 1SQ7A 4I5RA 3EOOA 3QY6A 1R3VA 5I0DA 1IEVA 2XWDA 3HPXA 4KRZA 1IF2A 5F2IA 4AYSA 2BVDA 4CD8A 4HPXA 3W23A 2WWDA 5REQB 1JCXA 3BGGA 3VNMA 3AZRA 2D22A 4C6EA 1OFDA 2QUUA 1IXPA 4HYRA 4J3ZA 2B4GA 4LS0A 1VPXA 4D6JA 4KGJA 3PK7A 1F6KA 3VDGA 2V2DA 1WDQA 3VC5A 1UIOA 5EA9A 1AJZA 5D9MA 2PTDA 2FZMA 1X39A 1W3JA 2TYSA 2PMQA 3UCCA 4EOUA 4WXYA 2NQ5A 1FCUA 3KBVA 1C92A 3S9YA 7XIMA 1DBTA 4YTTA 2RH9A 4GQGA 4V1YA 3ABZA 3W25A 1MMFA 2TSYA 3OGSA 1OFEA 4GKTA 3UYCA 3GVVA 1LM1A 4QDWA 1R86A 1EJVC 4RE3A 3CU2A 3D3FA 4GABA 3NEVA 1RLDA 1JQVA 1I6NA 4ROQA 4EP8C 1GOIA 1W3TA 1TV5A 3NYDA 1ZAJA 3EMQA 1ZPTA 3W1PA 1UOZA 4Z2KA 3EMZA 1PKLA 1JRBA 1MFUA 2WBGA 4O11A 4EPBC 3WMSA 3L5AA 4FXSA 1J8VA 3FXGA 3G0UA 3W74A 4NI3A 3PG9A 3U0HA 3BCDA 2NQLA 1C9WA 3UJ2A 1KFCA 2CZ5A 1W3HA 2Y24A 3MPGA 1ONRA 4JTJA 5EFDA 4S2CA 4R7WA 3LHVA 3NGJA 5LSMA 4P8XA 1MXDA 3W00A 1EDTA 2CLIA 3VABA 1W56A 2WC3A 4FSAA 4PE8A 2PWFA 3WBYA 1DVJA 1HL9A 4QNWA 5EMMA 3NM1A 3GWQA 3PJWA 5KETA 1R7AA 5JBDA 5M3WA 3ZT7A 4JBRA 1VYSX 4KWOA 3MI2A 1BKSA 4PC8A 4L6OA 2NSXA 1IHIA 1TWWA 2QJGA 2HK0A 2QMJA 3KVLA 1PKMA 3TNOA 3H21A 4N0RA 3WNOA 1EJSC 2FJKA 3TAKA 1ICSA 4LVGA 3DHFA 1ITUA 4S38A 1XM3A 1O1HA 2C3ZA 2GVGA 1R2SA 3UXKA 1WAUA 1J11A 3AHXA 2VD9A 3EOLA 4C6OA 2OGYA 4RE4A 2Z4GA 1JFHA 4S3BA 3H8AA 1KO0A 3ARUA 3L4XA 1A47A 3GAKA 4MZ8A 2IPWA 3HQNA 4LUTA 2W27A 3REQA 5A8MA 1AJ0A 3IK4A 3SBFA 3QGKC 4MSSA 4NQ1A 4E8CA 4QS6A 4F8XA 1XGEA 3GO2A 1H61A 1S2TA 3ALGA 3DYPA 2Y5EA 1QHZA 3UY8A 3C0SA 3K1GA 2X41A 2GGJA 5BW6A 4OT7A 5E9AA 1VFTA 4XISA 2HS8A 1UWRA 3GE7A 4H00A 4UB9A 5BXTA 3KHDA 4CU8A 1BRLB 2CC0A 2TMDA 3E6EA 4Z17A 3JR2A 1E0TA 3THQA 2XG9A 1MEIA 1H5YA 3ARQA 1YRRA 5DY2A 1NU5A 3ZXWA 1Z44A 3K4DA 4M1BA 3RMEA 3R79A 1HX0A 2O9RA 5HUPA 3RM9A 4KIRA 3I65A 4FNUA 2ZX8A 4AIEA 3BOLA 5HMSA 3F03K 4QTGA 5HMDA 2PTZA 5B7ZA 3P2VA 1QOXA 4XBKA 4LYKA 2NX3A 3S2CA 3T0CA 3QW4B 1DQXA 4HU0A 3A21A 1JDDA 1XUUA 4GPNA 3VVGA 3ABSA 3TX9A 5BZAA 4ZMGA 1EHAA 1C8VA 3CUIA 2YDQA 3WK3A 2EEXA 5A6JA 5CZJA 1Q63A 4ORIA 1R3WA 1BWVA 4TXEA 5D33A 1F4HA 1JCJA 3W71A 3QHNA 5JQ9A 4W9TA 3R6IA 1WXYA 2C18A 4ZB0A 4QCFA 3BCFA 4JN8A 4LRSA 4V1XA 1JCTA 2W0UA 4Y9PA 1SW7A 3MUZ1 3S6OA 1KXQA 1TFVA 4LWWA 1LT7A 4XAYA 4JDBA 3OA5A 3RU8X 4R3UA 1NM9A 1R3RA 3DG3A 3LYEA 3T8QA 2PAJA 1FHVA 1K1DA 2ZWYA 4YS1A 3TTOA 2QULA 4KMQA 3CWOX 4JN7A 1VQTA 1TUXA 3DI0A 4LH8A 4EE9A 4UXDA 1H7OA 1I2PA 1IEXA 3SDOA 3H2OA 4QLKA 4MG4A 4AF0B 1TKKA 1PTGA 1XFBA 3NZGA 5HINA 1J0JA 1VC4A 4OU1A 4QNEA 3CV1A 5BRQA 2YZRA 2OG9A 2ATMA 1RK6A 2E68A 3LD5A 1M41A 4HNUA 2A7NA 4CN1A 3NPUA 1E1FA 2OELA 4MNKA 1PX4A 3AXKA 1CXLA 1AW2A 1V0NA 3V0UA 2ZXBA 3CL7A 1C8XA 5FACA 5A2BA 1M7OA 2GK1B 1CI1A 2PE4A 3CO8A 3PZVA 4JYDA 3UZWA 3U2CA 4FLQA 3KRSA 1UWUA 3G6LA 4UZUA 3HJEA 3G22A 3H7RA 4JIIX 4LNYA 4U2ZA 2AQOA 2O4MA 1LWJA 1YE4A 1F6PA 4MZ1A 2OLHA 3DFYA 2RKXA 1N2VA 1XLEA 1S3HA 3BSGA 3I3EA 3VDCA 4AVNA 2X0SA 3QW3A 4Q8OA 1E9YB 2NUWA 1YYAA 1YPXA 3MA8A 1KBBA 2BSLA 1W9DM 1A4MA 4YJ5A 2VRKA 2J62A 4FR1A 4LUSA 3WBAA 1B9ZA 3ATYA 4REQA 4O0QA 3CUFA 3TQPA 5GQBA 1RZMA 3NDYA 4KGLA 4FF5A 3IJ7A 4U3AA 2Y62A 1E43A 2EQDA 4Z2LA 3HGRA 3AHYA 2VZTA 5FKYA 1R2RA 1O68A 3ARTA 4C1NA 1LL7A 5A6SA 2VZSA 3RMJA 2G50A 2Z7KA 5DRCA 2H9AA 3AXXA 4GC3A 1JDCA 3BH4A 3RPDA 2J8TA 1FVPA 4ZO8A 3CBWA 5DMLA 5D2TA 4RZ6A 2VUYA 1W5QA 4POCA 4F0RA 4XSMA 4LUJA 3IGSA 2OJPA 3N9KA 4A2SA 4K1GA 2OT0A 5CBBA 1F74A 4RE2A 2JF7A 3GYEA 1MNZA 2VEGA 1DJQA 1FXPA 3I6RA 3TTEA 5HK4A 1AH3A 4J2MA 4Q4OA 4NVTA 3PWGA 1V77A 2NW0A 1EJXC 2O0TA 4AHQA 2P53A 4L1WA 1E4NA 3SGUA 1W54A 4Q8TA 3WZ0E 1GYMA 1ADOA 3B05A 3AICA 3A64A 2HPIA 4XZMX 3GXNA 3ORWA 1KFWA 1XXXA 2YKKA 4RE0A 5LNUA 2QLYA 4E2BA 1UD8A 3N12A 5KSWA 3LENA 1UWSA 1E1EA 1JPDX 3MSDA 2X30A 4MPQA 5BYWA 4IISA 1QI0A 2YCLA 2J8GA 1US3A 2GJPA 1WZMA 4GY1A 4OIFA 5HWMA 3A3WA 4KRTA 1TR9A 3MUXA 3M0HA 1UWIA 3V5OA 1TV2A 3CZ8A 1PIIA 1DJHA 1VBUA 5ECVA 2FZ8A 4LBSA 4GIYA 1E3XA 3LS9A 4XKYB 3NEHA 3IJIA 2QCDB 3NL3A 1V79A 4IFKB 3AS0A 2W61A 3L2LA 2PTYA 3W29A 5PTDA 3VZYA 2ADAA 1G6CA 4PMUA 3USZA 1BYAA 2PB1A 4G2DA 4JQ4A 3EWYA 3GC2A 1SUXA 2CLOA 5IBXA 1GONA 2IKGA 2PDQA 3VOHA 3W53A 1UW9A 1CCWB 4GVHA 4ILSA 4H2HA 1I0BA 3TYBA 1T7LA 4RV8A 2J7DA 3RLVA 3ZR4A 4KIEA 4OECA 2FGLA 1KA9F 5EBUA 4LC8A 1VBHA 4YPJA 1UH3A 2ZX6A 3VKJA 2VFFA 3EA3A 3M0YA 1RAKA 2WLYA 1BQGA 3L4ZA 3R89A 4ASTA 1GVOA 2WW5A 4M56A 1V0LA 3AS1A 5CJNA 5AHMA 2RUSA 5EB8A 4QP0A 2F61A 5CPMA 2WNZA 4CN6A 1W8GA 4GCAA 5EKYA 4DF2A 3L65A 1J4EA 2VDGA 3QGVA 1A5KC 2QCGA 5AHEA 4LPCA 3TQ0A 1AZ1A 1TV7A 2YJQA 3F5KA 4GCXA 4AWEA 3SECA 5EMYA 2PF8A 1TZ7A 4KCVA 4XVEA 4L6DA 4PBEA 1UD4A 2GWGA 1KXHA 3IARA 1C3FA 2VYOA 2C16A 2QJJA 3N1AA 2HISA 3VINA 1SJAA 1WO2A 5LA1A 2ISVA 3EMCA 1B4EA 5D9PA 2OPJA 2Y70A 5LA2A 4JN6A 5AHIA 2QDDA 4GYPA 5GJNA 4H01A 5A8QA 5HPCA 3QZEA 2YGYA 2WNNA 1M65A 3PZQA 3BPWA 4JQ1A 1W32A 1TELA 4LEQA 5MKGB 4G56A 4WRHA 6ALDA 2C14A 4UFJA 2HPMA 3GH7A 3G18A 1X96A 4DNMA 5A6TC 3P60A 1UASA 4JTIA 1OC5A 4OTKA 1FUYA 3NOEA 1LQAA 3V18A 3SRFA 1US2A 4DI9A 1RLCL 1RPKA 4FI4A 5TAOA 3TYAA 4TV5A 3U7VA 4GO9A 4P7NA 3PPHA 1XYCA 1XW8A 1KV8A 3BGJA 3TH6A 3NQ2A 4UR7A 3BO9A 4O18A 1O94A 4B2DA 4G7EA 1NOUA 3WLIA 4C7FA 3B03A 2VOTA 1EFZA 1JPMA 3BAKA 2YSWA 1EP2A 1W3NA 3B8DA 2DW6A 2FPTA 2GVEA 2BBFA 3ARXA 3NQ8A 4FLOA 4FNRA 1JUKA 3GR4A 1EPXA 3PUEA 3A22A 2ZDRA 1OJXA 1A5MC 3TYZA 3APTA 1PBGA 4C6JA 1GVFA 4PCNA 4GVFA 4IUOA 2VRQA 1S5WA 2PBOA 1I4NA 3VNLA 5AHNA 3B9DA 5D32A 4B5WA 2PCEA 2VT0A 4B5XA 1C90A 2QNEA 2WSKA 3UR2A 1YTEA 4RV3A 1UJPA 5LYRA 5D09A 5DMNA 2ZOXA 4XD5A 3C0LA 1T8QA 2OU4A 4Y9OA 3AIBA 4S39A 3B8IA 1GJWA 2INFA 3H4XA 3QF0A 3R12A 5KZ6A 3TTQA 1KBJA 3L67A 2XTKA 2W4XA 4AX6A 4QJ5B 4J3WA 3WQDA 2A85A 3U48A 1JZ5A 1PPIA 1PCKA 4ACZA 1H3GA 4B3KA 1TVPA 3WEMA 3GDBA 1Z32X 2O9OA 3T40A 4Z42C 3MS8A 2PODA 4N9DA 3G0XA 4W5UA 3SM0A 4ZO9A 3FDKA 4CCDA 1Z3NA 1E6QM 1HKKA 3AMCA 3RU6A 2W63A 3SI9A 3NQAA 1UR3M 3C3UA 4FNPA 1XIEA 2QPSA 5FD0A 2DFAA 3RHGA 1TPH1 1XL9A 2XIOA 2BASA 5E70A 1LJYA 1DJYA 5A6LA 2G96A 3VMPA 3NIYA 3GB6A 1F9CA 4GNJA 5C5YA 4CNSA 4LCQA 3MWCA 2C13A 3B0VC 2AQVA 3VNYA 3CQIA 1XYBA 5I78A 1VP5A 3QQ1A 4GUIA 1U5VA 2QT3A 4ZTXA 4DYJA 2VP8A 3VNZA 2BWGA 3DKLA 4MNLA 1YMYA 3OBEA 3G3DA 2ZTJA 2HQAA 2XSAA 3GBDA 4ZENA 2DP3A 1J01A 3K4AA 1PKNA 1FWHC 3MVIA 2C7FA 1VS1A 5D2YA 3PJXA 1ISWA 1JGIA 3KTSA 1L6SA 4UMBA 4LAZA 1TPEA 5DBTA 1N55A 1CT5A 3HV8A 1TCDA 4ZO6A 4O4WA 4PSRA 4GUHA 3KVMA 4QE5A 3TDFA 1PS9A 1R9ZA 3V16A 3F4NA 4GZEA 4NJIA 3ISIX 4ZB2A 1FWTA 3LLXA 2C8NA 2ZUMA 2IPFA 1ZHAA 5TD4A 2FPVA 3NQVA 3G1DA 2GPTA 4JEJA 2BZNA 1UQZA 1OWQA 1XH2A 4H4IA 1FH8A 2ZVRA 1WA3A 3CIWA 2Y1HA 2RDXA 2I5GA 1M7JA 1ZB5A 4JFTA 1OFRA 3CAQA 1N8FA 3SN1A 2OMAA 3ARVA 1GW1A 2WJFA