3W2UA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-193
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-193
rcsb
source organism Trypanosoma cruzi
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2uA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2uA01
1F76A 4JX6A 4WOZA 3E49A 1H7RA 3O6YX 3BW4A 3GDLA 4I7VA 4O1BA 1QCWA 1WDWA 4DXVA 2HMCA 4QNEA 4UMAA 2XN0A 1OFRA 4Q4KA 3SIZA 2NX1A 1RVGA 1ZNNA 4O11A 4WZHA 4XZ9A 4EWND 5C55A 3M5VA 3G1XA 3P5ZA 3NVTA 1AW1A 2QDGA 3LCIA 3LBCA 2VEMA 4NX5A 4NZFA 2JKEA 4A3UA 4FF7A 4IMDA 3CEUA 4R53A 1Q6QA 3W71A 1OFEA 3DFTA 3KX6A 3L5AA 3UXDA 3ATZA 2OT0A 3NDOA 1T8XA 1IGSA 2H3DA 5K4XA 3NQ8A 4BWLC 1TTJA 5DXYA 3BG5A 1FWNA 4FXSA 3NPUA 4RJEA 3TMQA 1FDJA 4NNAA 1R47A 1KFCA 4CQ8A 5TIMA 3QMTA 3LX9A 1OFQA 4Z0JA 3PUOA 5DCBA 4OQVA 1BWLA 3RF9A 3JR2A 4KFOA 4WY0A 1NAL1 1QPRA 1GTHA 2DZUA 3P61A 5HWMA 2D73A 4UTIA 4YL2A 2AAMA 1JUEA 1G69A 1TQXA 2WPBA 4O17A 5EY5A 5LKYA 2ZFAA 4N4PA 4TMCA 2A7NA 3T40A 5LHEA 3QYQA 4JTSA 1CX9A 5C2XA 4MUZA 2J27A 3PWAA 6ALDA 3LDVA 1AK5A 1ICSA 1F5ZA 5AHLA 2RDWA 3G1DA 3E96A 2OZ0A 4N02A 2NUYA 1A50A 2VEPA 4JTFA 3NG3A 3FOKA 2GQ9A 5LNWA 3TC7A 3TFXA 4CCDA 4JNMA 2H8XA 4P2VA 3TQKA 3G8RA 5FEZA 3C2FA 3A24A 4GUJA 1LORA 1JVNA 2Q3OA 2QUVA 3FS2A 3B0VC 4BI7A 3EKZA 3G3DA 1V7YA 4LVAA 4YLWA 3MO7A 1K7FA 2CZDA 4N9BA 1S3HA 1KM0A 3LXCA 3MW7A 2W0UA 3WFAA 1LOLA 1ME7A 1ZAHA 1K8YA 4FO4A 4RK8A 4TU1A 3WJZA 3THAA 1LLZA 5EBUA 3LRMA 2DORA 3W1TA 3G18A 4IMFA 3UZJA 3S1WA 2OX1A 1MEIA 2C14A 3HF3A 2VFGA 4WUIA 3EWYA 1SU5A 3EB2A 2LLEA 2ISWA 4WQ6A 4BF9A 5LNSA 3LXBA 3M43A 1SSGA 2V2CA 1GQNA 3G0UA 2FTPA 4NNCA 2O7SA 4KWWA 4LVBA 1XBZA 1XBYA 5TBOA 3U6WA 3G1YA 2A7RA 3C0JA 1IXNA 1FDYA 1KV5A 1U83A 4K36A 1OABA 4X2RA 2PURA 3IIOA 4QISA 4JN6A 2QDHA 1GYLA 3CM4A 1BEUA 1SFJA 4WXZA 3W6YA 1T0OA 1GVRA 3LCHA 5AOUA 1OX5A 5G2WA 1F05A 1PHQA 1B3OA 2FDSA 4JTIA 1WV2A 3N2XA 2FB3A 2CLEA 2A6NA 2Z2UA 1H1ZA 3NM3A 3T55A 1TRDA 4X9SA 3DFSA 1NEYA 4C1KA 3B4UA 2W79A 2EPHA 1N55A 4DF2A 4O14A 3LXAA 1K02A 2Z0IA 4MFEA 4CLMA 3I7QA 4M6QA 3T44A 4QJ1A 1DORA 5J5DA 4BI5A 3GX9A 3QQ0A 5CZJA 1YXCA 3R13A 4ALDA 3C56A 4RKAA 3H55A 3P74A 1W56A 3LV6A 1W5PA 3MP5A 1K03A 1KLYA 3B04A 4EF8A 5AYZA 2RDTA 2CFFA 3S0CA 2QCEA 4Y96A 4K7VA 5F1UA 3HGSA 5AHMA 3DGRA 1I2PA 4JIPA 1ICPA 1UASA 1A5SA 3P8JA 3V75A 3VNDA 4RR4A 4YWIA 1G4TA 2R94A 3UY8A 1R2TA 2VFEA 1SZEA 3CWOX 4O4WA 3LCXA 4UTWA 3PF3A 4K8EA 4LVFA 4BI6A 4Y90A 3BO9A 5G4EA 1OYAA 1V5XA 1ZAIA 1GJPA 5D2YA 1JRBA 4ZMGA 3O07A 1VH7A 1ONRA 2ZA2A 4XBSA 3S8HA 3LTSA 2WSQA 3KXQA 2F7FA 3MYPA 4Z1BA 5I3KA 3PBWA 4JTGA 5FEWA 3DU0A 3LHZA 2ZTJA 1WOBA 3W1PA 5L6UA 3W7MA 5LGXA 1Z48A 4PL2A 5MHBA 1QOPA 4E0CA 2JK2A 3BVJA 4MZ8A 2C1HA 4LC6A 3M5XA 1RQHA 3PBYA 3M16A 3STGA 3BV4A 3STEA 1I45A 3CWNA 4PTNA 3NQVA 1B57A 1XUUA 3P7YA 3QMSA 1GVFA 3W86A 1VYSX 4MZYA 3M47A 4FX7A 4DEFA 3P62A 1AW5A 2ZZ2A 2A5HA 2H8ZA 5G2IA 4LS1A 2CLOA 1H51A 1S5VA 4R34A 5L9FA 4IUOA 3CC1A 1NF0A 1ICQA 3DHFA 1LP6A 5EPDA 1KBIA 3L5LA 4NJHA 1WOAA 1HL2A 3LCWA 2Y85A 1YDOA 2TYSA 2FIQA 2JKAA 4H6KA 4NXSA 3L68A 4AWSA 3JS3A 2EF9A 4ZQMA 2YDAA 4K6AA 3MI2A 1FXQA 3N9RA 1OJXA 2Y7FA 3AO0A 2OT1A 3W7EA 1DBTA 3TR2A 3NGJA 3TQVA 1A5AA 1UJPA 4Y8FA 2NUWA 1KW1A 1JCMP 5AN7A 4AH7A 2BX7A 2VOMA 5CSSA 2ZZ3A 3BGGA 1FUYA 2GVGA 1B9BA 3LB0A 2VENA 2I1OA 4DPQA 1MO0A 4DO5A 3W7IA 4RZ5A 1XM3A 4JTEA 1TMHA 2ZZ5A 3HJZA 1Z44A 4Z08A 2QCGA 2V0TA 3TAKA 5HJLA 3VFLA 4JR5A 3VI2A 1GVQA 3LERA 2RFGA 4A21A 1QWGA 5DLCA 4JTKA 3GLCA 3GDKA 4BFAA 3IVTA 2E5BA 3DKLA 3C6CA 2QCDB 3W7KA 3O63A 3IIVA 3LV5A 4R7JA 4R33A 1G7UA 3OEXA 3O05A 2FPVA 4ZVJA 1R2SA 5BNKA 4W9TA 2ZCGA 1OFAA 2I14A 2J9XA 3IGSA 1ML1A 1FQ0A 4NVTA 3QM3A 1FCBA 2V2HA 1VQTA 1W5QA 4MFDA 1C29A 2QUUA 3B03A 7TIMA 3DENA 2X1UA 1RZMA 5LSMA 3QFEA 3NQMA 3SECA 2B0MA 3P84A 1EWEA 3IEBA 1Q6OA 2DZWA 2VEIA 4Y6GA 4O57A 5LGZA 2NUXA 3W73A 1NVMA 1K7XA 3LHVA 1XXXA 3QSRA 4A22A 3H54A 3CEPA 2C13A 1I2RA 3C61A 2QAFA 2DZSA 4ZL1A 2YGYA 3G8EA 5LHFA 4PEKA 1EX5A 4FIRA 1PCKA 4HPXA 3SJ3A 2CZEA 3HGJA 3M5ZA 1JRCA 1W3IA 1UBSA 1W0MA 3ABOA 5LNRA 3SGZA 3TW7A 1GT8A 3UWVA 3USBA 3PG9A 4FIQA 3GVGA 1LRTA 3NO5A 1FWTA 1SUXA 2QJIA 1Q6RA 4IXHA 3NPVA 4HNNA 3IRDA 8TIMA 5F4SA 1UCWA 3P81A 1QOQA 3NL5A 3PSWA 1OFOA 3OVPA 4UTJA 4LU0A 2EGZA 4CQAA 3S1XA 5FF4A 5KZMA 3F4WA 4UTKA 1UUOA 1PL9A 1QPQA 4G1KA 2YCEA 1JUKA 3MBFA 3HG4A 1A53A 1W54A 3HBLA 1WYIA 2A21A 1LDCA 1MEHA 3PAJA 3LCLA 5D32A 4K39A 2GQAA 2Y70A 3LHYA 5D2TA 1ZALA 3KVJA 1LBMA 4Z1AA 2GVLA 3L9CA 4POCA 4LY8A 5EL1A 5LNUA 4FXRA 4MKNA 3M9YA 1W5NA 3EX3A 2E1DA 2YW4A 3GR7A 1H7NA 1EA0A 1WX0A 3P67A 3P80A 4DO4A 3ZFHA 1KA9F 4L4MA 2BWGA 3A21A 1H61A 1IXPA 4CQ9A 2V81A 1KM5A 1YPIA 1WA3A 1J2WA 4UTTC 1FY6A 3W1RA 2ATSA 3UNDA 3IGXA 5C54A 1TYGA 1SW0A 3C52A 5K4ZA 1DQWA 1TTIA 3LTPA 4C1LA 2AQWA 1YXYA 1G67A 3WK3A 3NAVA 1O60A 2WOQA 4QIUA 4GUHA 3S1UA 2ZRXA 3W83A 3FIGA 1H5YA 1M6JA 3GYEA 4L4LA 1YDVA 2X1SA 1QDSA 2VFFA 3W1AA 2PRLA 3MP3A 3MI3A 2V82A 1EP1A 2CZ5A 2PC4A 3UD6A 3NQFA 1P5BA 1TJRA 3PVFA 4UTMA 1ME9A 3DKJA 4RZ4A 2FFCA 4JY9A 5D2VA 4QQ3A 1OK4A 2E5DA 3CT7A 2V5BA 5FF3A 2QCLA 3L2IA 3M7WA 2CZFA 3MBDA 3S5ZA 5C6MA 2C15A 5H2ZA 3OG3A 3W7JA 2WV8A 2AGKA 4JYEA 3UWZA 1VLIA 1HFBA 1Z41A 4EF9A 1KM4A 4WY0F 3GDRA 4ZQPA 2H6RA 3DAQA 1PIIA 3UWUA 2ZZ1A 3W1QA 3OHIA 1LTDA 2R8WA 3CPRA 5HINA 3QF0A 1YTKA 4O18A 3A5VA 3TXVA 2P0OA 4TR9A 3TK7A 4WX2A 1DVJA 2Y7GA 1AG1O 4O1AA 4XBKA 4ZQRA 2Q3RA 2A2IA 4UFKA 2NZLA 3UPWA 2B4GA 4I7WA 4O8RA 2ISVA 4YCPA 3TNOA 3INPA 3C4UA 3FYOA 4O1DA 3TAOA 1WBJA 1IXQA 1K7EA 3TE9A 2Y7DA 1YPFA 4IPJA 4LW7A 3TUUA 3DHDA 4AVFA 4AMAA 2DZVA 3A9IA 1SZGA 2A7PA 2X16A 4UUIA 3TH6A 2CU0A 3W7QA 2VFDA 2ZRVA 2BTMA 5TQLA 4MJZA 2GVJA 3MP4A 4O53A 4S2BA 3STCA 4IX0A 3PBVA 1RPXA 3M0ZA 1DL3A 3KRZA 1TPWA 3DBPA 1W31A 1SQ7A 2A0NA 1K8XA 1TPDA 2BLEA 4IOTA 1OX6A 1EUNA 3MI6A 1I2NA 3FKRA 3R2GA 4U4MA 4AAJA 3R5EA 5D33A 2GQ8A 3M5YA 4O13A 1DOSA 5CZ0A 1GG0A 5K9CA 3QJAA 3BG9A 3QSTA 4NJGA 3OA3A 3C2RA 4XKYA 1KFLA 4U28A 3PM6A 3BLFA 1YDNA 3A23A 3CIXA 1ZHAA 2E68A 5CG7A 4PL1A 3TSDA 4RZ6A 1KFKA 5HQEA 2QCNA 4CNOA 2VEKA 2JBMA 2CLLA 3CLMA 1XDMA 3EXSA 1M5WA 2E77A 3S9YA 3L0NA 3UWQA 2IQTA 1TV5A 1OVDA 3DI1A 1AW2A 3PSVA 4K38A 3HMJG 3BPWA 1VC4A 1KTNA 3K30A 3W1LA 2Y7EA 2QUTA 3MJYA 5KZEA 1FBAA 2ZBTA 3EXTA 5GVJA 4EVZA 3TA6A 2PRMA 3BGJA 3EX4A 3W88A 2WSRA 2V8ZA 1FDZA 4JXCA 5KZDA 2V30A 3CQ0A 3O6DA 4A29A 1TRIA 4S1FA 1HG3A 1ZAJA 3GXNA 1HO1A 4LTSA 3U8GA 1ALDA 3QH2A 4QM1A 4IJBA 4MIMA 3NQ6A 3NXFA 3P60A 2ZZ7A 3M44A 3N19B 4LV4A 3BW3A 2H90A 6TIMA 3ATYA 3PG8A 4JD4A 4NU7A 3ABSA 1A5CA 3SSJA 3HGOA 3DH7A 5FESA 1QMLA 3NL3A 3EX2A 3L0GA 2V2DA 3WJWA 1T96A 3IVUA 3W3OA 4PA8A 4Q32A 4OWGA 3KFTA 1RQBA 3LBMA 3FJ6A 5U7SA 2FPTA 5H91A 2EAWA 1VCGA 1YADA 2F84A 4UTWC 5CPMA 3ZR4A 3NQEA 3GNNA 4GNJA 4O0KA 4N9DA 4M6VA 4FNQA 5U4NA 1M7OA 4AHQA 1Y0EA 4KFPA 4WXYA 3RLVA 5D09A 4UCGA 1OYBA 5EMUA 4OGZA 1QFEA 1G6CA 4E2BA 1TPEA 3GAKA 1OFPA 3G0XA 3OVRA 2EKCA 1PS9A 1DQXA 3W2MA 3LHUA 3A5FA 1L6SA 3W23A 1VS1A 4N4QA 4PH6A 3DI0A 5A8GA 4HPJA 4OT7A 3NR0A 1AL7A 5IBXA 1QO2A 2QCCA 2PCQA 3NM1A 3HPZA 1OK6A 4GRSA 3S5NA 2YYTA 4RV8A 3TJXA 2QJHA 1IXOA 2H3BA 2C18A 5FF2A 1SO5A 3IIZA 1GTEA 4UNKA 2Y62A 4UTHA 2E6FA 5CKSA 4NUWA 3O16A 2Y63A 1KLZA 1TPH1 4EIVA 2QJGA 3TQ0A 3EWUA 1TPC1 4QSHA 1XFBA 2CLMA 1TSIA 4JGDA 4AF0B 1TB3A 3EKLA 5DCDA 1TV7A 3WJXA 3W85A 1E51A 1JCNA 3RNDA 1FXPA 3WJSA 1FX6A 1WQ5A 4FB7A 2FLIA 4MVAA 1W5OA 1O94A 3LCGA 3HG2A 4QAIA 1OFDA 3CIWA 1XCFA 4WD0A 3H53A 4NJIA 4ORMA 2YPIA 4RXFA 1UUMA 3G0SA 4LT9A 2XN1A 1YLVA 1G4SA 1FWRA 1R2RA 1TJPA 1GPWA 3GNDA 2OCZA 5G1TA 5EYWA 3B0UX 3KOFA 5SWUA 5HWNA 3C8FA 2DZPA 3W7GA 1LBLA 5DCEA 2RHGA 2ZQ0A 1P0KA 1XC4A 4FNTA 5D30A 1JCYA 5DXXA 4Y9AA 4FNSA 4FX6M 4UR7A 2YYUA 1UB3A 5E1QA 1LOSA 1ZFJA 4GJ1A 1U5JA 5HUPA 2YR1A 1VJIA 3G1SA 4NZJA 1M7PA 1TPVA 3SFKA 1KFEA 4JY8A 3PUEA 1O5XA 3WK1A 2BSLA 4ADTA 2JKPA 3IIXA 3TMLA 1H50A 3LTYA 2ZTKA 1B4KA 2TRSA 3Q37A 5C5YA 2Y6ZA 3ABRA 3T7VA 1VHNA 3BK0A 3GZ3A 2CWNA 2G5WA 3DFPA 2NWSA 3N14A 3O8AA 1NFBA 4MLRA 1ZENA 3DXIA 1Q6LA 4WJEA 1G4PA 1LLWA 5D03A 2DP3A 1YTEA 2GJLA 4ORIA 1D3HA 4UFJA 4MZ1A 4UTUA 4UFHA 4N9CA 4OBTA 1I8JA 4WOQA 1N7KA 4WY0B 2R91A 2X2GA 2GJNA 1S5TA 2PRHA 3GK0A 5F2GA 1KM6A 4IWWA 2GUUA 3UY7A 3EWXA 4O19A 4YCOA 1X7FA 3M6YA 5K3VA 3HIJA 3LM7A 4FX8A 4LV9A 4IPIA 5G4WA 1EP3A 3HG3A 2VFIA 3N2MA 2WQPA 1DV7A 3E9AA 3M41A 3NZRA 2J6XA 4M5PA 1KM2A 3NQ2A 2G96A 4OE7A 1TREA 1ME8A 4MY8A 5D05A 1GVSA 1HUVA 4E2DA 3BLEA 4DELA 3TV8A 1HTIA 1SW3A 4NJKA 2J9ZA 4BK9A 5F4WA 4AWTA 1GWJA 2UV8G 3SGUA 5AB3A 3W7PA 3BW2A 4ZQNA 1MZHA 5I3HA 3TSMA 4MLJA 3LLFA 5E0KA 4TMBA 2ZDRA 4TIMA 2HSAA 4LRSA 4O28A 3IIPA 3LRKA 1VCVA 2PE4A 3NL6A 4DO6A 2ZYFA 1THFD 4IMGA 3SW6A 1R30A 3B0PA 1B4EA 4H4IA 4DPPA 1TPFA 1I2QA 4HIBA 1MSSA 3N9SA 3FLUA 3QQ1A 2E5CA 2YZRA 1EWDA 3N34A 4GFSA 2C6QA 3FEMA 4Z1DA 2TPSA 3VE7A 3L21A 4I7UA 2QR6A 4XKYB 1VCFA 1VR6A 2DJLA 4JDBA 5HUOA 3TKFA 4EOUA 3KVKA 4AB4A 3W1MA 3E12A 4LUJA 3PC0A 4NXKA 3IV3A 4RCXA 2NX9A 3EWBX 1HO4A 5E93A 5CZSA 4MY1A 3V1PA 3FYPA 4GUGA 1L6YA 1GVOA 1GEQA 2ZA1A 1OF8A 3KHJA 3HB9A 3C2VA 2E6DA 3HPSA 3W07A 1AL8A 1S5WA 3KVMA 3LI1A 5EA9A 3R12A 3W9ZA 4HNVA 3AJXA 4IMEA 2CLIA 2Y88A 2WKJA 3F4NA 3W7NA 3N73A 4CCCA 1XDLA 3BG3A 1XBXA 2C0AA 3TCEA 3CHVA 3HOJA 3S1VA 2ABBA 4CNPA 3EEGA 4NJJA 3BARA 3B06A 3LHTA 3C3NA 3NNTA 1P1XA 5D2WA 3GDMA 3W87A 1WBHA 1IF2A 5AHNA 3VE9A 4BR1A 3S6DA 2QCMA 4JYFA 4IMCA 3P8IA 1LRNA 3ANYA 2ZRUA 2NWRA 2WO5A 4LUIA 4P61A 2QCDA 4PODA 4HNTA 1F6KA 4JEQA 2NLIA 3B8DA 5KMYA 3BLIA 2E09A 1JR1A 3G1FA 4K8HA 4AHPA 1F74A 3LGEA 1GOXA 4M19A 4O4VA 1F73A 2BZNA 5HMSA 2X1RA 4JIQA 4ZQOA 4BWLA 1L6WA 3RMJA 1NSJA 2DJXA 2QKFA 5DY2A 3W7CA 4UIOA 1FWSA 1K8ZA 3NEVA 1KFJA 1IIHA 1SZNA 3WK0A 1DHPA 2RH9A 5CZTA 2FQIA 4O54A 1EUAA 4JICA 2ISSA 3NA8A 3W2KA 5F4XA 2W6RA 1H63A 4JX5A 3OBKA 2E6AA 5BW6A 3LLDA 3TIMA 4HT3A 4GUFA 2X30A 4LVGA 2YXGA 3L66A 1W5MA 4O10A 2QCHA 3PY2A 4HHPA 1DJQA 5F2IA 3W7LA 5LZLA 1AMKA 2YX0A 1TPUA 4I9AA 1Z42A 3OVQA 2RKXA 2ATMA 1A5BA 1KTBA 3F03K 5FI8A 1YXDA 4OU1A 2A4AA 3I6RA 3HG5A 1P4CA 1MEWA 3S42A 5I3IA 4CNNA 1JQVA 1RV8A 5K9XA 1VRDA 3GIYA 1J5TA 2WNNA 2ZRWA 5D02A 1OFBA 2QF7A 4O50A 2DU2A 3LOTA 3HGRA 3W1NA 1W37A 3I65A 2GOUA 4RX0A 2RDUA 2FB2A 1EEPA 4ML9A 4JYDA 2VXNA 1X1ZA 4O1CA 1TPB1 3W70A 1OF6A 3DFOA 3NL2A 2P1FA 5AC6A 1NF7A 1W8SA 4OV9A 2QCFA 5I3FA 3WK2A 3EWZA 4PFMA 4IXXA 1GZGA 5AYXA 4A2RA 3DFQA 4JTJA 3MHGA 3UZ5A 1BTMA 3TXZA 3NQAA 1KM1A 1JJKA 5DY3A 4O15A 4N6EA 3GB6A 3OIXA 2WJZA 3A22A 4CCEA 1TCDA 2BXVA 3I7RA 3UQNA 3QPYA 1F7BA 3NYZA 5AHEA 4FNRA 2A1YA 4QITA 3LCFA 1H1YA 3PR2A 4O16A 1KM3A 1D3GA 3W7RA 5I3JA 1H7PA 3L5MA 3GDTA 4JDYA 3W7HA 2WNZA 1OX4A 1VYPX 4S2CA 3THQA 2YFNA 4UTLA 2Y89A 4J9JA 5CGQA 5AYYA 4MYXA 1OHLA 4MJMA 5IM51 1O5KA 4PC8A 2ALDA 3MYOA 4UMCA 4M7TA 4DF1A 1TTQA 3U2OA 2CLFA 2C3ZA 2A6LA 1JULA 1LCOA 5DELA 3SY5A 2HS8A 2XFWA 5FEPA 1FWWA 1O4UA 3GXTA 4HSNA 1GYNA 1KFBA 2NX3A 1QO5A 2DZXA 4QNWA 5HR6A 1JCLA 2O7QA 3TFCA 4NNBA 4M7SA 1JCJA 5D04C 3ZWTA 1DJNA 2Q8ZA 1X1OA 1Q3NA 5DBTA 5T26A 1QNVA 1LYXA 3HO8A 4E38A 1W1ZA 1XBVA 2JGYA 3N3MA 1VZWA 1EIXA 4GUIA 3YPIA 5BMWA 4N6FA 2B7OA 4LOCA 5FEXA 1CI1A 4MOZA 3G3MA 3E02A 1MXSA 1QR7A 4ADSA 4NX0A 3W1XA 3KAOA 1SR9A 2B7PA 3PUDA 1G7VA 1X6UA 3QRHA 5DN1A 5G5IA 5KITA 1KBJA 4GE8A 1H7WA 3KVLA 2GPTA 3MHFA 1L2UA 5D2XA 3MUXA 1PVNA 3NQ7A 4GBUA 3ZS4A 2B7QA 2DZTA 3FJLA 2ZRZA 2TMDA 4UFLA 3T4CA 2NXGA 5ABTA 4JX4A 3O6CA 3S5YA 3W7OA 4XWUA 1H60A 3W76A 1SPQA 5IBXC 1XUZA 1LM1A 2WSYA 1YTDA 5EKYA 1R46A 1VPXA 5FF7A 3W2JA 1JCXA 3EWWA 5KTLA 4A2SA 2B7NA 4LS2A 1RR2A 5K9DA 4D2JA 2V5LA 2I9EA 1KTCA 2VC6A 4HNUA 2YSWA 4PCFA 1XKYA 3O06A 2ZZ4A 5K7JA 1WAUA 4IX2A 4LVDA 1WXJA 2G97A 1W3NA 3G1AA 1OYCA 3SZ8A 3W2NA 3SI9A 2CLHA 2Y61A 2KZHA 1LOQA 4DBDA 3DFNA 1SZFA 1FCUA 1SO4A 5HR7A 3L65A 4KWVA 2VKZG 4XTIA 1SSDA 4LNYA 3UWWA 3QPZA 3JRKA 1ZCOA 4UR8A 2J24A 1F6PA 3QZEA 2ZZ6A 4O52A 1JUBA 1PHWA 5G1YA 4TO8A 3D0CA 1TV8A 5J5RA 3TW6A 4MYAA 4NT0A 5D38A 1GG1A 2Z1BA 5CPOA 1SW7A 5I3GA 2TSYA 3NQGA 3C2EA 4YXGA 3QMRA 3KRUA 3W2UA 3G1VA 3ABQA 1EB3A 2VFHA 4XQ6A 3C2OA 3QW3A 4GXMA 3NQCA 1XI3A 1TTPA 1CW2A 3UWYA 3STFA 1H7XA 4UMBA 2QAPA 4HSOA 3RK8A 1PCWA 4AEOA 3RLUA 4AXKA 4AHOA 4ADUA 3RFAA 2OMAA 3UXAA 2ZRYA 5HWJA 3W2LA 4JTHA 1QPNA 4XUGA 5BMXA 3W1UA 3GKAA 4OV4A 1RD5A 2YW3A 1KV8A 3FA5A 3SR7A 1VGAA 1TO3A 3PS7A 3G1HA 3EXRA 1O95A 1YYAA 5A5WA 1VYRA 5AHIA 3VKJA 3CB8A 1Q45A 1F2JA 1PV8A 1QAPA 3W72A 2A85A 3HPXA 1OG0A 1QPOA 2NXHA 3CU2A 4FHAA 5HNRA 3VCRA 1LZOA 2OJPA 1C8VA 1ZJIA 4LS0A 4IQLA 1P0NA 3CTLA 1EPXA 3GAYA 1BKSA 4LC8A 3I68A 3NQDA 2FPYA 4MPQA 4MY9A 3W75A 4UFMA 5HULA 3WJYA 4FNUA 3PULA 2XN2A 5AHFA 2HS6A 3NPXA 3TSBA 4RXGA 3QEZA 3PBUA 4AWUA 2NXIA 4GWEA 4Z0SA 3TDFA 2R14A 4JTLA 5FF0A 3EX1A 2P10A 1J4EA 3QC3A 1TQJA 2E6YA 3F1QA 2ZA3A 4X3ZA 3Q58A 4ZQCA 2VELA 4B5NA 3TU9A 3PB0A 3O1NA 5KINA 2YFOA 3IVSA 4UFIA 1RQEA 3R8RA 1DKWA 3GR8A 5BRBA 3W22A 2EHHA 4UNLA 5DBUA 5F1VA 1FCVA 1X8FA 4Z1CA 3G24A 3RU6A 2NV1A 3O15A 3TROA 4JTUA 5BOOA 4ZZ9A 4NQ1A 1I2OA 1PE1A 4N9EA 2CW6A 4RLIA 4O12A 3QW4B 4K37A 3LI0A 3FKKA 4N2YA 3TJLA 3B05A 5CSRA 3PB2A 2C16A 1FCQA 4KFNA 5CPLA 1LRQA 1L9WA 3L0KA 3HQ1A 3UYCA 2G95A 3I7SA 3NOEA 2J88A 4O0ZA 3LHWA 2Z6JA 3KRSA 5G2HA 3MMTA 2HTMA 2Z6IA 3E0IA 5F2MA 1TIMA 2V9DA 4M6PA 5KSWA 4UXDA 3L67A 4XTDA 3EX6A 5AFDA 3LRLA 1IIGA 3MWAA 1G4EA 2Q8LA 2FJKA 1EP2A 4LRTA 4ONVA 3UPBA 5AC7A 4HN4A 3S5OA 1XL9A 2X1TA 3DZ1A 3Q94A 4DBEA 5F2LA 1W3TA 1C9DA 4K7YA 2C19A 1SO6A 5K2ZA 4UC5A 3Q2DA 1T99A 3GKFA 2WNQA 3NZ1A 4AF0A 4DQWA 3P82A 4FNPA 2CLKA 3MHUA 2J9YA 1N8FA 4HKPA 1SO3A 2NV2A 3FFSA 4JTTA 1SFLA 4UTTA 3GXPA 4YMZA 1K3UA 1LBFA 3M1ZA 3P5YA 3ZWSA 4DF0A 4X22A 1LROA 3IGUA 4IGHA 4KKXA 3TX9A 5LNVA 1ADOA 2ABAA 1VLWA 1BWKA 4TX9A 3G22A 4H3DA 3R89A 3T78A 1D9EA 5AC8A 2QEZA 3TC6A 1OX4B 1ZY9A 4GC4A 4JS3A 3W84A 3W74A 1H62A 4LWWA 4OHQA 5D37A 1H7OA 3NPWA 4ICNA 3ELFA 5CPNA 1I4NA 3W7DA 1JQXA 2JGQA 1VHCA 4FEZA 4Q33A
chains in the Genus database with same CATH superfamily
3VCNA 3RX4A 3TA9A 1H7RA 1YE4A 2QPUA 2JQXA 3KL3A 3BW4A 3GDLA 4I7VA 4ERIA 1QCWA 3XISA 2HMCA 1WO2A 3UU0A 4O11A 3ECQA 4JAWA 4HOWA 3UGRA 3VZZA 2E0PA 3GNXA 1NOUA 2QDGA 3LCIA 1HVXA 3LBCA 1K9TA 5ENLA 4A3UA 1UIOA 4IMDA 1JZ5A 1E1CA 1WDRA 3WDRA 1F3EA 3NDOA 2H3DA 3AIBA 3NQ8A 1VFOA 3CZLA 5DXYA 5HNNA 2GGIA 1UR8A 4RJEA 2O9RA 1R47A 4BQ3A 2JF7A 4W7UA 3QMTA 4IHCA 3QQWA 2X05A 1OFQA 1ITXA 3PUOA 1E3ZA 3GTIA 3NEHA 3RF9A 3N2CA 3JR2A 4KFOA 2XIBA 4J28A 1NAL1 5HWMA 3AAMA 4QCEA 1JUEA 4UQEA 3MUAA 3S5SA 5LKYA 2BY2A 6ALDA 2Y5EA 1PZ2A 4A8IA 4MF4A 3OW1A 4JTFA 1UD2A 3NG3A 4OIFA 3WUFA 3VC5A 4Q4MA 3F4DA 3VDHA 1XLDA 5LNWA 3TFXA 2O56A 4P2VA 4PUUA 2YBTA 1ZLPA 4GUJA 2F8QA 1AQFA 3GXFA 4M81A 1I9CB 3PPHA 4BI7A 3G3DA 4ZXOA 2XVLA 2G4JA 3ZLGA 1K7FA 1IWBA 1EJRC 5A6MA 1S3HA 1MNZA 3NCOA 1K8YA 4RK8A 3WJZA 1LLZA 2DORA 3W1TA 3S1WA 1JZ7A 2NQ9A 1XIEA 3GHUA 4FA3A 2VFGA 3EB2A 1DTUA 2ISWA 2XIOA 1O68A 3LXBA 3CQKA 3M43A 1UWRA 2HVOA 5HA7A 2O7SA 4LVBA 1XBZA 1N8WA 3U6WA 3BAWA 3G1YA 5B7ZA 1IXNA 3V3WA 2GJXA 4Q4SA 1ZSXA 4X2RA 4H9MA 1W2PA 2QDHA 4JN6A 1GYLA 2DT1A 3CM4A 3IJDA 1SFJA 3QV7A 3W6YA 2D2GA 1RCQA 1MW3A 1PHQA 3WF3A 2A6NA 4M24A 3SBFA 4PMJA 7XIMA 3OJGA 4ZENA 3DFSA 1NEYA 1R38A 4C1KA 1CB7B 3E5BA 4LYKA 3T44A 3W6LA 4QJ1A 1DORA 3ZSSA 1DP0A 1XSIA 4M3PA 4PMVA 3C56A 3H55A 3RRAA 3W53A 4LQ1A 3WKZA 3Q45A 4GA8A 1IQ8A 5F1UA 5AHMA 3TN5A 3WQ6A 2YBUA 4I9MA 3PHAA 3CNYA 1A5SA 1DTNA 3P8JA 4PTMA 3V75A 4RR4A 4YS1A 2VFEA 4PMYA 3SCTA 2QIIA 3GHTA 3CWOX 3LCXA 4EPEC 1E15A 2QNEA 1R8LA 4LVFA 5CPTA 2XVKA 2CEQA 2EPLX 2W61A 3BO9A 4Y90A 5DMLA 2RGLA 1V5XA 1ZAIA 1AQ0A 2W62A 4XBSA 4W84A 2WSQA 3THUA 3O6AA 2F7FA 3MYPA 4Z1BA 1VEPA 1J0ZA 4X0VA 3LHZA 1PUDA 4Q8MA 1WOBA 3ZM8A 4HD5A 4MB3A 1KWGA 1QOPA 2EG6A 2ANUA 3OVGA 4AU0A 3E38A 2WKLA 4KETA 3AMCA 4P8UA 4MB4A 3M5XA 1RQHA 3PBYA 3STGA 3BV4A 3UFYA 3CWNA 2W63A 1YX1A 3NQVA 1XUUA 5E0FA 3LY0A 4PRTA 1GVFA 1PIFA 3L2MA 4L5ZA 4MZYA 3M47A 4FX7A 3P62A 1JZ6A 5G2IA 3WDIA 2CLOA 1WUEA 2V5JA 1S5VA 4R34A 4IUOA 3CC1A 1QNOA 5AC4A 1FWGC 3N2OA 1J2BA 3WLQA 1X97A 1PTDA 4A3HA 1OIFA 3GU2A 1YDOA 2P50A 1PYMA 4Q7IA 4BF7A 4H6KA 4AWSA 3JS3A 1FHUA 4B92A 3ABZA 3MI2A 2OT1A 3KDNA 4DZ5A 4AH7A 1KW1A 1JCMP 1OD0A 2DT0A 3WMSA 3OA5A 3WN6A 5CSSA 3BGGA 4WCJA 2WKGA 1B9BA 2VENA 5JH1A 4GIEA 1AH4A 1QI5A 3IV8A 4WK9A 1FP9A 4GJJA 1P7TB 3HJZA 1Z44A 4Z08A 2FJUB 3APGA 4JR5A 1GVQA 2ZXDA 2H9AB 1Q5MA 2Z2BA 3T9PA 3R0KA 4A21A 1A80A 3BC9A 2BP1A 3FHQA 2W91A 4JTKA 3GLCA 2V3EA 3ZXWA 2QS8A 3W7KA 1G7UA 4HU4A 4ZVJA 1R2SA 1A5KC 2PDMA 3MMUA 4D1IA 2OLHA 1S3TC 2PA6A 3EA3A 4M1BA 3FSTA 1DIDA 3QM3A 1VQTA 1W5QA 2QUUA 3NO3A 2CLPA 3DENA 4CD8A 1RZMA 2QW5A 3SECA 2VEIA 2XGBA 3AHZA 5LGZA 4H9VA 4B15A 4NY2A 3BWWA 1NVMA 1F4HA 2E8ZA 4A22A 4H9XA 1BTCA 2PD5A 2C13A 4ZFMA 2AQOA 3B9NA 4RL3A 4FIRA 1PCKA 3OYZA 1UBSA 1FWBC 1HQTA 3KDOA 2RUSA 3GVGA 4IGSA 1LRTA 4JOMA 2QJIA 4KS0A 4Q4PA 3IRDA 5I24A 4FI4A 3PZUA 4B5TA 2FGBA 4UTJA 4CQAA 3S1XA 1T5AA 1TWSA 2QMJA 4G1KA 4C6KA 1MZRA 1A53A 1OCQA 3HBLA 4H83A 2PC8A 3VKAA 3EYPA 3WUBA 1LDCA 2GQAA 2OWCA 2E7FA 3KVJA 2VR2A 1LBMA 4S3JA 3WQOA 4POCA 3SCPA 3ARVA 1L6FA 3T09A 5I5RA 1C7TA 4QQUA 1H7NA 1O5RA 1EA0A 4ZO6A 4DO4A 1OG6A 3A21A 4V28A 3QTGA 1KBKA 2V81A 3PFRA 1ZUAX 4UTTC 1V02E 2ATSA 2J7BA 3GNOA 1XW8A 1YNYA 2ZADA 1SW0A 1EJ7L 5K4ZA 1TTIA 5C0QA 3UPMA 3GBEA 3HPAA 3KOZA 3AXKA 2PTYA 3UG4A 4BA0A 1W9DM 1FWCC 2GWNA 3NAVA 1O60A 4HNOA 4GUHA 2WHJA 3JU2A 2YLLA 2VFFA 2PRLA 4GZ7A 5IHSA 4DBSA 3GNPA 3OTRA 1EP1A 5A8PA 3PVFA 4UTMA 2VTFA 3DKJA 1AZ2A 1G9HA 3CTTA 2ZXBA 2VD8A 4JY9A 4LALA 3TTOA 1OY0A 3R1ZA 5D2VA 4JIRA 3CT7A 1UG6A 2PODA 1AH0A 4NILA 3S5ZA 2C15A 4GNVA 5H2ZA 3W7JA 3ZVHB 1UR1A 4C7FA 1XYZA 2CXEA 4Z2HA 4DBUA 3UWZA 1VLIA 4HPGA 5CEWA 3SUVA 3GDRA 3O3RA 3UWUA 2PZNA 1UP0A 4US5D 3VIFA 5H1WA 5XIAA 2R8WA 4C1NA 3AMDA 1A5LC 1Z6KA 3UVIA 4UZUA 1TWZA 1AG1O 1W3KA 3V0SA 2VX6A 4ZQRA 2G0WA 1V6WA 2HV5A 2Q3RA 3AALA 4NRSA 2WLZA 4MNMA 5C7HA 2GUBA 4I7WA 4J3XA 5HDRA 3SUWA 4HP5A 4O1DA 1IXQA 4IG2A 3DC8A 3TE9A 1WKYA 2Y7DA 4FXJA 3SCNA 4E6MA 3EPNA 3V16A 3KCLA 1OEPA 3DHDA 3GDBA 2DZVA 1SZGA 3FA4A 1CIUA 4U2ZA 4DAFA 3TH6A 2V69A 2E1WA 4PMXA 3WFLA 4UWMA 3W7QA 1J12A 3H7UA 2ZRVA 1MW2A 2HVMA 5TQLA 4MJZA 3WQCA 1E71M 4S2BA 3STCA 4AYSA 4IX0A 3M0ZA 4HTYA 1XPGA 1SQ7A 2BLEA 3Q67A 1EUNA 3EWDA 1I2NA 4PTXA 3OZMA 3CBWA 5D33A 1DOSA 3UR5A 1GG0A 5K9CA 1PX8A 3QSTA 4AQLA 2GJRA 4YJ5A 3N17A 1U1HA 4UNIA 1HXJA 4XKYA 1KFLA 1KXVA 4JHOA 4NI3A 1YDNA 3N15A 1ITUA 3CHFA 1CLXA 4GYFA 1XLEA 4U5KA 1KFKA 4AC7C 4IGNA 5D4YA 2JBMA 1MMFA 3SCQA 3G6MA 3R43A 3H26A 4IF2A 1E0TA 3S9YA 1TV5A 2YCIX 4CCZA 2Y0FA 2DQXA 3HMJG 4ZOCA 2RGMA 5CPQA 2AL1A 3W1LA 3EDEA 1S1PA 3MJYA 2NSXA 1BVWA 3EXTA 3TA6A 1Q6CA 3W88A 4EK7A 5TAOA 3CQ0A 4FOKA 1W6TA 4E2OA 1UWSA 4AY1A 2BVWA 4LTSA 2D22A 2OR2A 3GG8A 4GYKA 2PBGA 3QH2A 2J77A 3AS3A 3KZPA 3NQ6A 4ZFCA 3P60A 3VIPA 3M44A 4LV4A 3UG8A 4QLKA 2CNCA 3PG8A 4NU7A 4JD4A 1A5CA 1WCGA 4PUWA 3L0GA 1AQHA 2BNJA 4I9JA 3WJWA 3ZJ7A 2HXUA 1XIBA 3KFTA 1RQBA 3LBMA 1WKDA 1W9PA 4KERA 4H6RA 3FJ6A 2ACQA 2AKMA 4GVIA 3RN6A 2FPTA 1WPCA 4B2DA 4V33A 3E5PA 1TV2A 5H91A 1VCGA 1EC7A 4PUJA 3PJXA 4UTWC 4QSFA 5CPMA 5A1AA 3VOJA 1N8IA 2QHAA 2O4QA 4XB3A 1CXLA 3WNLA 1Y0EA 4WXYA 4AY8A 3WEZA 2BS9A 5D09A 4MM1A 5EMUA 3RJXA 1TPEA 2J7FA 5E6YA 3GAKA 1BG4A 4IUGA 5ABGA 1PS9A 3W2MA 2ZOXA 2ZVIA 1HGWA 4HPJA 3NR0A 2PWDA 2HCVA 1ZCCA 2PCQA 3EOSA 5FJIA 4LB3A 2YYTA 4IPLA 4HNLA 1WAWA 1ELSA 3D3FA 2ZWZA 2WCAA 3CJPA 3GVVA 5DANA 1UWIA 2VQTA 1HL8A 4Q7NA 4UNKA 1H09A 4G7FA 4F0SA 2D0HA 2GGGA 2BOFX 1TPH1 3W6MA 4OTKA 4EIVA 3BH4A 4OOUA 2BASA 1SJDA 1BKHA 1VFLA 4AF0B 1TB3A 5DCDA 3W85A 1WDQA 1JCNA 3B9EA 1QVBA 4OKDA 4QROA 1FXPA 3WJSA 4DI9A 3QVQA 3GTFA 4MVAA 3GHRA 1XHGA 2AAAA 1TJ1A 1A3WA 5A8MA 1P1MA 4QAIA 3CIWA 3GS6A 4S3DA 3G0SA 5TD4A 1UD8A 2XN1A 3S6TA 2Z7GA 1G4SA 3T6CA 1FVPA 1DJXA 4WRHA 2C1GA 3ARPA 3RXZA 5JBEA 4G7EA 2XPKA 1UH2A 1O6IA 2DZPA 1JPIA 1B1YA 5DCEA 2ZQ0A 3HV8A 4DLMA 5D30A 1R86A 3B9OA 4Y9AA 1HKWA 1UB3A 3N4EA 1LOSA 1UOKA 4W88A 1ZFJA 3TN4A 4GJ1A 4GY7A 4J3SA 1RBOB 5A2BA 1M7PA 3VGDA 4QG9A 5FSEC 2BSLA 4ADTA 1AH3A 1NP2A 2JKPA 1Q4WA 1GJUA 3WFZA 2ZTKA 4GX8A 4U3AA 2GVEA 5DT7A 2Y6ZA 3ABRA 3QY8A 3T7VA 1GOQA 2YXXA 3GC4A 2YL6A 4PUEA 3AMLA 3DFPA 2HBXA 4GVGA 3O8AA 4GFIA 1JF5A 3GBDA 3UZYA 1ZENA 3DXIA 2YBVA 1A0DA 2VGGA 3FDGA 5BU9A 1G4PA 1V4YA 2XG9A 1A47A 4UFJA 4TX6A 4UFHA 5IDIA 3IGHX 9XIMA 2FTWA 4AISA 2R91A 4PN2A 4ZCWA 1S5TA 3GK0A 3SRDA 4F40A 1R3TA 3MV11 4O19A 4PTVA 4GISA 5DQPA 3M6YA 2DT3A 3KS6A 4IPIA 1EP3A 2ZX5A 1CECA 3KCOA 3M41A 1ME8A 4MY8A 2WMKA 5D05A 1HUVA 3K2GA 2PWUA 1X7IA 1MFVA 4DELA 2Y1HA 3LGDA 1SW3A 2IS7A 3NSXA 3AUOA 2TAAA 3TOYA 5F4WA 1J6PA 1CCWB 3TSMA 3M0XA 1XJBA 1I6NA 2J8FA 4D6DA 2IQDA 3GNRA 2ZDRA 4GJIA 3FJNA 3W4RA 1QI3A 2ZYFA 4IMGA 2BVTA 1ONWA 1I2QA 3SO7A 4HIBA 3N4AA 3K4AA 1XH2A 6TAAA 2YZRA 2C6QA 4Z1DA 4IZGA 4A8NA 1XISA 1V6UA 1XYAA 3EOOA 2VX4A 1EZWA 3TKFA 4EOUA 3KVKA 1IEQA 3E12A 4LUJA 3PC0A 4NXKA 5TF0A 4RCXA 5LA2A 5E93A 2PLKA 3TQPA 3V1PA 4QJ5B 1L6YA 4P7LA 4NZCA 3T42A 2ZA1A 1NDZA 3KHJA 3HB9A 2E6DA 3W07A 1D7FA 3DG3A 4NYYA 3KVMA 3LI1A 2QIWA 3S4TA 5PTDA 1GZJA 2G50A 2DV0A 3PNUA 1QNPA 5HK4A 3CHVA 3RPTA 3S1VA 4LF2A 4PGLA 2ABBA 3VIIA 3CV7A 4GCAA 1P1XA 4R9OA 3B9AA 4NAFB 1V3IA 3GDMA 3W87A 4IIHA 1R3QA 1JXKA 2WMGA 1UD3A 1NELA 1KRBC 1PDYA 3P8IA 1EBGA 2NWRA 4I8YA 2FZDA 4R88A 2FZ8A 4EXQA 2QCDA 3W81A 4PODA 1OZMA 3EDKA 4JEQA 3BOLA 1N82A 1TA3A 3G1FA 3POHA 1P43A 5M3WA 1F74A 4A3QA 3LGEA 4RV3A 1Q8JA 2BOEX 2BZNA 3QGKC 1Z7AA 4ZQOA 3OG2A 3B8WA 5CZKA 3ITOA 1FWDC 4UIOA 1K8ZA 1KFJA 3CGTA 1OB0A 1W9UA 2RH9A 1EUAA 4JICA 3NA8A 3URAA 3W2KA 3O0KA 4AZHA 2W6RA 1H63A 2NVAA 3R7MA 3VNZA 2E6AA 5BW6A 5M17A 1H3GA 3B8UA 3NO1A 4GUFA 2YB4A 2QCHA 4KPLA 3W29A 3TTQA 1GONA 1E0VA 2CBIA 2RKXA 1BFNA 1JDAA 3FX4A 1KTBA 3F03K 5FI8A 1CXIA 1P4CA 1XX1A 5I3IA 1E3XA 3OZPA 1JQVA 1RV8A 3OO2A 2OWXA 2DU2A 3LOTA 3HGRA 2X0YA 3VIJA 1W37A 4RX0A 2RDUA 1XLCA 1GVIA 4ML9A 2BG5A 1TUFA 3CZGA 1OF6A 1VFTA 5AC6A 4MB1A 2QCFA 4JTJA 4QJ4B 5C2CA 3CUHA 3MUY1 1S2UA 2NSOA 3NQAA 2DEPA 2PDBA 3EGJA 3U2CA 1QATA 3IRSA 4O15A 1DIEA 1FHDA 2VGBA 4CCEA 2BXVA 3OLIA 2PDHA 4HJFA 3BURA 2OKOA 1F7BA 5AHEA 2PDPA 3V0TA 3LCFA 3N12A 1UOZA 4O16A 1C90A 3H21A 3VM7A 5I3JA 1H7PA 3L5MA 4I3GA 3GDTA 3W7HA 1GW9A 4GI9A 2WNZA 2QJJA 2Y89A 4J9JA 4Q8VA 5AYYA 4MYXA 4XV0A 1O5KA 4UMCA 2Z26A 1M7XA 4M7TA 3WQVA 1TTQA 3MMDA 3KBMA 3URNA 1JULA 4KCTA 2D2OA 4NHVA 1SJCA 3BJTA 1JXJA 1FWWA 3WLSA 1KKRA 3BLPX 4BF5A 3FK4A 1DWHM 2WM0A 2WBKA 1JCJA 3CAQA 2Q8ZA 4CEXC 1Q3NA 1QASA 1XICA 3U3HA 5T26A 1VBUA 2HE8A 4LUYA 3ICJA 3UCQA 3N3MA 1XIMA 3F2CA 4WJ8A 3PBMA 2B7OA 1JYXA 2Y8KA 1UWAA 4NX0A 3W1XA 2VZTA 3TZFA 4YTQA 3PUDA 4U2YA 1G7VA 2X8RA 3CLWA 3QR1A 3RPDA 3PWGA 2YL9A 4WIWA 3M64A 1L2UA 2XGZA 1PVNA 3LGGA 3NQ7A 4GBUA 1F3WA 3ZS4A 2ODOA 4YWSA 1CBGA 1V0KA 4UFLA 3T4CA 2FMOA 4D71A 2WC3A 2NXGA 4JX4A 3KZSA 2V5DA 1J10A 3W76A 3MCOA 3SEPA 1LM1A 4NZ5A 1PKLA 4LPCA 5EKYA 1VPXA 2VRJA 3EDJA 4A2SA 1PZ3A 4LS2A 1E9IA 1RR2A 4D2JA 2J7DA 2I9EA 3L4ZA 1FH7A 3R4IA 2VWSA 4HMDA 2PTDA 2ZZ4A 3H70A 1Q6GA 1WAUA 2Y24A 2PPGA 4GI6A 4R7OA 1HJVA 1OYCA 3G1AA 4S3EA 2PDWA 2XSAA 3V0UA 3UA4A 3KLKA 3ITGA 3L65A 4KWVA 4XTIA 3TYZA 3UETA 3LS9A 1JD7A 2I9UA 4PB4A 2CESA 2FFIA 5J5RA 3K8KA 4JQ3A 1SW7A 2V3GA 2TSYA 1DWJM 4YXGA 1BYCA 3KRUA 3G1VA 4WLCA 1FA2A 3U57A 2PP3A 3NQCA 4TV6A 1E6RA 3I6EA 1QJWA 1V3JA 2QAPA 4R27A 2GL5A 2GGJA 3FAXA 2PDGA 4OJYA 1CWYA 3ISIX 1CGXA 4S3AA 1VGAA 1FTXA 3DFYA 4XIMA 1CEOA 2XH0A 4D8AA 4WDXA 3GFZA 3I10A 3R25A 3I4EA 4JNZA 5AHIA 3VKJA 3WD2A 3W72A 2A85A 2ALRA 1OSEA 2NXHA 2XIQA 3RILA 3WL0A 3CO4A 2OJPA 1ZJIA 1CGYA 4LS0A 4IQLA 4Z42C 4E8GA 1BKSA 3NQDA 1TWWA 5HULA 5I07A 3UJ2A 3VNYA 4X61A 3PULA 1WUFA 2QT3A 3TZNA 3VNIA 3FXYA 3LNPA 2QQ6A 4FS9A 1MRQA 4RXGA 3DC0A 2EG7A 5CLTA 4JTLA 5FF0A 3CPGA 1NOWA 3EX1A 1E70M 1J4EA 3QC3A 1TQJA 2E6YA 3F1QA 3H6OA 1RSCA 3Q58A 4ZQCA 2VELA 3AXHA 1XINA 3HFTA 4C5ZA 4UQCA 4TTGA 1H1NA 4WJXA 1F3XA 2EHHA 3RR1A 1FCVA 1BWVA 4Z1CA 3G24A 3RU6A 2NV1A 4QFUA 3LENA 4HNCA 5BOOA 1FKWA 3VGEA 3EDFA 4RLIA 4O12A 4REQB 3CUGA 2FVMA 4YN5A 3KWSA 5CSRA 3RUBL 1S5MA 1FKXA 2XWEA 3L0KA 1HNYA 3LHWA 4CGTA 3KRSA 4M56A 3MMTA 3FYYA 4Z17A 4PCPA 3E0IA 5F2MA 4XTDA 5EMYA 3OP2A 1S38A 1MUCA 1Q2SA 3OU8A 1VEMA 3SQMA 3ITCA 4AZIA 4ICCX 3S5OA 3M7SA 5FJTA 4K2SA 4FLOA 1C9DA 4FLQA 2WVUA 4DYEA 1SO6A 5K2ZA 4UC5A 3H7RA 1VKFA 3P82A 3MHUA 4J27A 4ACZB 1N8FA 1R5YA 4RW3A 2CXGA 1SO3A 2GGEA 3FFSA 4JTTA 5CAHA 5JH2A 1ZBKA 3G5EA 4YMZA 1FH8A 1LBFA 5T9BG 4LAOA 3M1ZA 4QCFA 2FHBA 2GYIA 3P5YA 4FR1A 4BQ4A 2J4GA 2XZ7A 1E4NA 4ROPA 4KT2A 1UZ4A 3G22A 3MSGA 3P2VA 2P76A 4QEHA 1P7TA 1W8GA 3ELFA 5CPNA 2WHMA 5CBIA 3LLXA 2EPMX 4WOZA 2F38A 4A8LA 2NX1A 4B5UA 1GOIA 4WZHA 1XLGA 4IP5A 3M5VA 2VO5A 4DUVA 3G1XA 4L80A 1KXHA 3LPPA 1UR9A 3NVTA 3APYA 1TELA 2RDXA 2XVGA 4NX5A 2JKEA 4DJFC 3BAYA 3KX6A 1XLMA 2OT0A 3PN8A 1IGSA 4BWLC 4QE5A 2VR4A 2DUZA 1GKQA 3TMQA 1G1YA 1KFCA 3PK7A 4TV5A 4AZCA 4Z0JA 5DCBA 1BWLA 3MMWA 3M07A 4HU3A 4WY0A 1QPRA 1GTHA 2DZUA 2FZNA 3P61A 4FXFA 2ZE3A 1JZ4A 2D73A 4B3LA 2AAMA 1E0UA 4TVCA 1G69A 1EDGA 1TQXA 1R85A 1JZ8A 2VWTA 1KBBA 4W89A 3Q4DA 1OCJA 2IPFA 3EKGA 4M80A 5CH9A 2A7NA 4DWSD 5JU6A 1PAMA 4BQ2A 2PB1A 3KTXA 1ICSA 5EBAA 1F5ZA 1Q85A 3H2CA 1LL4A 3G1DA 2PP0A 4LSBA 4N02A 5D9PA 2ACRA 1A50A 5FJUA 1HX0A 2GQ9A 1T40A 1LT8A 4OFCA 1I1WA 3QFWA 2D0FA 4CCDA 1QK0A 4LNCA 4CVWA 3VINA 3TYEA 2H8XA 3CQIA 3TQKA 1LORA 1W3HA 1RPKA 3EKZA 3VFCA 2WK2A 1UR0A 4N9BA 3T2QA 3WFAA 3L2LA 2OZ8A 2WC7A 1K9EA 5LXEA 5ABFB 1NOFA 1WXYA 2FVKA 3LRMA 3UZJA 3G18A 4N7QA 4PULA 3WLIA 1MEIA 4B90A 2QVNA 2GK1B 2C14A 3EWYA 3IUHA 3DN5A 3D47A 3AHXA 1AVAA 1UPPA 4KCWA 3AHTA 4EPBC 2FTPA 2XSBA 5A6KA 1RJRA 4KWWA 4OECA 1XBYA 1V3KA 3EMCA 1FDYA 1U83A 4QISA 1W1PA 4I9TA 1T0OA 5A6AA 5CJMA 4ZA0A 4C7DA 4ZEPA 1DJHA 1JPHA 1ZBVA 3PAOA 2CLEA 2Z2UA 4QG6A 1JGMA 4X9SA 2W79A 2EPHA 4O14A 3TLLA 4MFEA 1U22A 3I7QA 1RD6A 3IJ7A 2YL8A 3GX9A 5CZJA 1AD4A 4LUTB 5M5DA 4RKAA 2OSXA 3P74A 5I06A 1SZRA 3BSMA 2R1LA 3ZVHA 2RDTA 4L6DA 2QCEA 4Z2JA 2INZA 4KEMA 4PRWA 1GOMA 4K7VA 3FXGA 3HGSA 5GNZA 4F8XA 4JIPA 2CC0A 3CHEA 2G3NA 2XH7A 3WMCA 2HK0A 1E6ZA 1E55A 1SZEA 4NZ3A 3ID7A 4QE1A 3PF3A 4K8EA 1XG3A 1E6XM 2BV9A 1OYAA 4I90A 3BMVA 2BBFA 3O07A 1ONRA 1KRCC 5DEZA 3FN9A 1EYEA 1SR0A 4MJ4A 5FEWA 2ZTJA 4L1WA 5L6UA 2PMQA 1B30A 2BXYA 1GHSA 1UR4A 3REQB 1MQQA 1Z48A 4OBSA 2IKJA 1GW1A 4E0CA 1EHNA 5C8BB 3VOGA 3VKKA 1M7JA 2BGQA 3TN6A 3POCA 5IDZA 1BHGA 3QV8A 1J0KA 1VENA 2J74A 3VPLA 4DBWA 1I45A 1EEXA 3C0SA 2PU1A 4PUNA 3RJYA 1ZP4A 1B57A 3KP0A 1ECEA 4DEFA 2ZZ2A 2A5HA 4LS1A 4KRTA 2BMBA 2OOGA 1UD5A 2GZXA 5CGTA 1LP6A 1KO0A 1ZS2A 2PEVA 5EPDA 3L5LA 4NJHA 4HPHA 3FV9A 2Y85A 5KEZA 2FIQA 3GY1A 5DMYA 5E5CA 4AWEA 2YDAA 4U10A 3N9RA 5AZ0A 3AO0A 3A12A 3TR2A 4XVDA 2WLYA 3TQVA 2OOFA 2VOMA 2ZZ3A 3UYIA 4MAVA 1TX2A 3WQ5A 2O55A 2PF0A 4DO5A 3W7IA 4RZ5A 4JTEA 3QHMA 3VDGA 2VRQA 4HPNA 3TAKA 3B0XA 4GIAA 5HJLA 3VFLA 4GHRA 2DIEA 1REQB 1PSCA 2VCAA 4JTRA 5I77A 1BYBA 5DLCA 4JQAA 3IVTA 3C6CA 4R33A 3IIVA 3LV5A 4R7JA 4Y2WA 2BY0A 3O05A 1UP2A 2YA1A 9RUBA 2AL2B 2ZCGA 1OFAA 2POZA 3M0LA 2ADAA 3IGSA 4GKLA 1QK2A 3OBEA 4NVTA 1FCBA 2V2HA 3WLLA 4TQTA 4MFDA 2CIPA 4ENLA 7TIMA 2X1UA 1PKMA 2FKPA 1UPMB 3WNPA 4C7GA 3GFYA 3SN1A 4JQ4A 3N04A 2OTDA 4HHMA 3EWCA 4DZAA 1B3YA 3TYCA 1K7XA 4M8UA 1C7SA 3QSRA 4PBEA 2OU4A 4B5WA 3C61A 5C9UA 1Z89A 3E2QA 2DZSA 3L7RA 2D3LA 3GZAA 4QJ3B 4GIYA 4PEKA 3VTRA 1EF2A 3N18A 4DJDA 2CZEA 1TR9A 3SIMA 1XC6A 3HQNA 3M5ZA 1JRCA 5LNRA 1GT8A 4AMCA 1GOKA 4JTAA 2DSZA 2IPJA 2WMFA 4K3ZA 4PFHA 3UNTA 1TWDA 3MV01 8TIMA 1UCWA 3P81A 3NL5A 3WNKA 1OFOA 1TV4A 3OVPA 2CBVA 5FF4A 5KZMA 3N1AA 4YTSA 2HJPA 2X2YA 4HYVA 2YCEA 4AVNA 1EZ2A 3GG1A 1W54A 1EJTC 4MTVA 5D32A 3K8LA 3DESA 4AEEA 4K39A 1ZALA 2IXVA 2VDIA 4PCTA 5EL1A 4FXRA 3WO8A 2ZX6A 3M9YA 1W5NA 3EX3A 3OLEA 3S2NA 1A5MC 3I6TA 1A4MA 4L4MA 2BWGA 1EO5A 1H61A 1VRXA 1EGMA 1IXPA 7TAAA 1ADDA 1E1EA 1DJYA 1KM5A 1WA3A 2AKZA 2DVXA 4DYJA 1FY6A 1BXNA 4UTFA 3IGXA 3C52A 1C93A 3DYMA 1KXTA 3MUIA 3SSZA 3VD4A 3LTPA 1SFSA 5LYRA 1V3MA 5CSYA 3VXGA 4QIUA 5HQMA 3VD7A 4QDMA 1J0YA 3W83A 3FIGA 1H5YA 1M6JA 3GYEA 1NH6A 1YDVA 4DUWA 1KD0A 4F0RA 3NDZA 1QDSA 1NY1A 3L4XA 3MI3A 3RX2A 5BXPA 2VDGA 3FVDA 2PC4A 3UD6A 1V93A 4WKFA 2X42A 2FFCA 3S46A 1OK4A 1XKJA 1BPLB 2E5DA 2BVYA 2F6XA 2O92A 3DIPA 3L2IA 3C2YA 5GQBA 4MDPA 1WDPA 3BZGA 3VX1A 2DDXA 2VJXA 4JYEA 1XYCA 5AECA 4YU1A 1Z41A 4JFVA 4ZQPA 2H6RA 3DAQA 4AD3A 4DZHA 4CN6A 3ITLA 2PWEA 5CBBA 3W1QA 1F4AA 3DERA 4RE0A 4GG9A 3QF0A 3MVTA 4RW5A 1XIGA 3TXVA 2P0OA 3BJSA 5A2AA 4WX2A 1PO9A 3WEMA 3WNMA 1X8CA 1X98A 4O1AA 2O4MA 4XZIA 3VGHA 3W82A 2NZLA 3EA1A 2WXDM 2FTYA 4K8GA 4KRZA 4NZ1A 1YKWA 4O8RA 4S3BA 2ISVA 2Z25A 3INPA 3C4UA 5FJRA 3UR7A 2QUNA 3W37A 4IPJA 3ZT7A 4AMAA 4IICA 1J8VA 2X16A 4V1YA 2C1IA 2WZIA 1NJJA 7A3HA 1R3WA 3CZJA 1M9HA 4GYJA 1J9YA 3QOKA 2BTMA 3H4XA 2DGAA 3IK2A 3S2LA 1K1DA 1HN1A 2GVJA 3MP4A 1H49A 3R10A 4LGXA 2CKSA 3PBVA 3KRZA 1BGAA 1W31A 3RCMA 2A0NA 1DJWA 1EL3A 1J96A 1TPDA 4IOTA 1P6BA 2CBJA 1KGXA 3CQHA 4HK7A 1ISYA 4AAJA 1XD0A 4JNYA 4O13A 2GFTA 4L61A 3EAUA 3BG9A 4NJGA 3VMOA 1R3YA 2BGNE 3E2RA 1CGUA 4W8BA 5FL0A 3C2RA 3CQJA 1DYSA 2R1KA 1ZHAA 2PF8A 2BDQA 4PL1A 3TSDA 1XSKA 2VEKA 4RNIA 1E9LA 4CNSA 2CLLA 4D6HA 3CLMA 1XDMA 3EXSA 1M5WA 3MC5A 4GH3A 3K1GA 2IQTA 2RJHA 2Y5JA 4J7RA 5HMDA 1HF6A 3R11A 1VC4A 3OODA 2ICSA 5CG0A 3TLQA 5CC5A 4Q7BA 2QUTA 1U1UA 1KRMA 1M1BA 2R82A 5GVJA 1PB0A 1UQZA 2V8ZA 2J62A 5KZDA 3A3WA 3ITYA 3LNMA 4NAFA 2ZDSA 1TRIA 1TZ7A 4XO6A 2JFEX 1E6QM 4LBUA 4QX4A 1CXKA 1ZAJA 2X1IA 3U8GA 1T6MA 2VCBA 4MIMA 2HWGA 3EOUA 4MWAC 4HBKA 1OQFA 1VIWA 3AXXA 5FESA 1QMLA 2YL5A 2VNCA 3U2ZA 4F2TA 3NL3A 4ZTXA 1E72M 3BCDA 4E3VA 3IVUA 3W3OA 3ARRA 3WBXA 4UOJA 4OWGA 4IL2A 3WMBA 3UEQA 3TYUA 3TOPA 1LWJA 2F84A 4AD0A 1YNQA 4O0KA 1JYNA 1O1HA 2Z00A 3VD5A 3RMEA 2E40A 4GY0A 4AHQA 1RP9A 1HJSA 1KR1A 3RLVA 4G2DA 3QTPA 4EE9A 4PEEA 1R7AA 2DSWA 4RPPA 4RZBA 3W23A 4E4PA 1VS1A 4C6CA 2IUZA 1QO2A 2CZVA 2QCCA 4DJEC 1DQUA 4A8RA 5C2GA 3S5NA 5B7YA 3GUWA 2JIWA 4RV8A 2GUYA 1QNRA 1OGBA 2C18A 3IIZA 4I5UA 2FZBA 5CKSA 2I5IA 3O16A 4MG4A 2Y63A 4C6OA 2QJGA 1W32A 5LXXA 1TPC1 1MVYA 1JGIA 2O0TA 5HXMA 3M4HA 4JGDA 3EKLA 3GTNA 3AWOA 1Q7ZA 1FX6A 1WQ5A 4JIIX 3WQ4A 3LM3A 5DRIA 4DO7A 3K13A 4W5ZA 5RUBA 3TEVA 3WCZA 1OFDA 1XCFA 1EBHA 3L4TA 3H53A 3L4UA 2OELA 2Z4GA 2J7GA 3B8VA 3DG6A 4F4RA 4J5NA 1YLVA 2A3EA 3GNDA 1O7AA 2OCZA 1TJ0A 5EYWA 1DXFA 1ZJHA 3B0UX 3C8FA 2PGFA 1LBLA 2RHGA 2PU0A 5DXXA 4UQAA 7CGTA 4FNSA 4FX6M 3ZLFA 3IK4A 1GOOA 3U0HA 3GVWA 2P53A 4PMUA 3MPGA 4Q4OA 1KFEA 4IPNB 1CB2A 3NOYA 4ZE4A 1VFMA 3GTXA 3TMLA 3ZJ8A 1E0XA 3P6LA 5C5YA 4CQCA 1VHNA 1BSLA 2G3JA 2CWNA 4B5XA 3WNOA 4YHEA 1EC8A 2NWSA 1VD6A 4X63A 3DFHA 3IAQA 2QPSA 3DYPA 4I5XA 1NWRA 1YTEA 5CPSA 4UTUA 3QV9A 4N9CA 5FA5A 4DI8A 4ACYA 4WOQA 2GQ3A 1YDYA 2Z1KA 4HB7A 3CAKA 4IIDA 1KM6A 4IWWA 3FSUA 2R1MA 3EWXA 4KIRA 4C90A 3MU7A 1XV8A 1E9ZB 1MDRA 5CC3A 1CNVA 1ZBCA 1D7KA 4UR9A 4FX8A 2C71A 2WYSA 1QUMA 1IZJA 4H8VA 2QPXA 1S2VA 2VFIA 3HG3A 4LB4A 5JXQA 1DV7A 1KM2A 2P88A 3KRBA 3UCDA 1TREA 2Z24A 3MTWA 3SCRA 4E2DA 3BLEA 1UKPA 4ZO8A 1HTIA 5ECVA 2J9ZA 4BK9A 2YKKA 4AWTA 2OVLA 2WJFA 5AB3A 1MDLA 4HA3A 4ZQNA 4GXWA 4MLJA 1HW6A 3LLFA 4TMBA 2GJPA 4TIMA 2HSAA 4O28A 1AMYA 4QR6A 4GQ0A 5LA1A 4XAYA 3HMCA 1THFD 4P7QA 4HA0A 1R30A 4ZGYA 1SVDA 1MW0A 3ZOAA 2AMGA 5E70A 2W3ZA 1IGWA 1H2JA 2E5CA 1EWDA 4XD4A 3QR3A 1X96A 1KQZA 2GSJA 3EOEA 4I7UA 3OQEA 1VCFA 4G6CA 3UZXA 4LBRA 2DJLA 5HUOA 1E4IA 1W1IE 1RJQA 4YPJA 2BFGA 2WCGA 3IV3A 2NX9A 3FCPA 1HO4A 2PBOA 3FYPA 4OOZA 1GEQA 3C2VA 3LQLA 3HPSA 1ONEA 4AEFA 2PS2A 5EA9A 3ENLA 4IMEA 2Y88A 3W7NA 1EJUC 3IAPA 4CCCA 3BG3A 3TCEA 3BAIA 1V03A 1DJZA 5HANA 3JVAA 1PYFA 3EEGA 2PFHA 1AJ2A 3C3NA 3NNTA 3P14A 3TCSA 4W93A 1F07A 5A6LA 4L9YA 1WBHA 3TYDA 3V36A 1IF2A 4CU7A 3CV2A 1NWUA 4B9YA 1AA1B 4F0HA 3LYEA 4NI8A 3C0QA 1BRLB 4IQJA 3KBVA 4YYFA 3HA1A 4HNTA 1F6KA 3N4FA 5KMYA 3BLIA 4AHPA 8RUCA 3LZ3A 2VX7A 1EH9A 2E25A 3VABA 3T0BA 2DJXA 2QKFA 1EXBA 3W7CA 1FWSA 2XIJA 3C3UA 3WD3A 3TTSA 3G6LA 2XTKA 3GE7A 1DHPA 1V0LA 1XLHA 2QVHA 5HJXA 2EJ1A 3RCNA 5F4XA 2VEFA 3VIMA 4KWSA 5JUVA 1XLLA 3U9IA 1HKJA 3LLDA 5M1TA 4GQRA 1WNOA 4XD3A 3GO2A 2X30A 1VBRA 5CJ5A 4GABA 4REQA 4IQEA 4H01A 3W7LA 1Z8AA 2YX0A 1TPUA 3QLLA 1J0HA 1Z42A 3OVQA 3XIMA 2VC9A 1A5BA 3V5CA 3S9ZA 3HFYA 5I03A 1JD9A 2UY5A 4HA1A 2BODX 5K9XA 3USZA 3GIYA 1J5TA 2WNNA 4L6OA 6ENLA 4IH3A 4GYPC 2OPJA 2FB2A 1X1ZA 1TPB1 3DFOA 1W9XA 3NL2A 1QT1A 1W8SA 4OV9A 3CHCA 3EWZA 1YBQB 1GZGA 4Q6XA 4A2RA 3MHGA 1XG4A 2D24A 3UZ5A 1BTMA 1MQPA 2WSPA 3A3HA 4DHGA 4AD5A 3E0FA 3AIVA 1KM1A 4MJ2A 4ACZA 4QDPA 3EDDA 1QNQA 5DY3A 5CAKA 3OGSA 2NLYA 3OIXA 1US3A 3VNLA 3WDJA 2WJZA 4JFTA 1DE5A 1AFSA 2WANA 3A4JA 2C79A 3KWXA 4BQ5A 1P0DA 1H4PA 3QPYA 3BOFA 3MDWA 3NYZA 4FNRA 2A1YA 1T41A 3WDHA 1H1YA 2G3MA 3PR2A 1NARA 1D3GA 1LL7A 1GQIA 2DUXA 5FCZA 3EMZA 1C91A 3AU2A 4XSMA 1OHLA 2D2JA 1Y7VA 2ALDA 3DBNA 3FJ4A 1XIJA 1NDWA 2C3ZA 3F4VA 1LCOA 5I09A 1B3XA 2HS8A 4HHHA 3G1RA 3ZR6A 1MUMA 1PZ0A 3GXTA 4B5SA 4DLFA 2VVSA 1QO5A 4QNWA 1JCLA 3TFCA 4NNBA 1OBAA 4LAMA 3SAZA 2JF6A 3ZWTA 1DJNA 1EJXC 5FACA 3ZMRA 4WEVX 2UY3A 1QNVA 3QY6A 5G1MA 1LYXA 4E38A 1W1ZA 2JGYA 5E9XA 1VZWA 3NSNA 4GUIA 4LFYA 3YPIA 1IWAA 2IKHA 4N6FA 4LOCA 3G3MA 1MXSA 1QR7A 4ADSA 1JZ3A 4LAKA 2VM8A 5HAOA 1AODA 4LANA 5FJPA 5KITA 1MWOA 1HJUA 1S46A 1R0MA 4GE8A 2GSEA 2VMFA 4JFSA 5H8UA 3AIRA 2B7QA 2WCSA 4XK2A 4XX6A 1E5NA 2ZRZA 2TMDA 1K9FA 2PZ0A 2NT1A 1R3RA 2Z29A 3H2FA 3O6CA 1LL6A 4GVFA 3W7OA 1M01A 4FMVA 5IBXC 1XUZA 5JIWA 2QMKA 1YTDA 1R46A 3OBAA 2A3AA 1PDZA 1JCXA 1C8XA 4MNLA 3OB8A 2V5LA 3O0FA 3NURA 2YSWA 4PCFA 3O06A 2J13A 5KETA 3EBVA 4IX2A 4FF5A 4NIRA 3H12A 2J6VA 4QXIA 6XIAA 4DWSC 1LOQA 4DBDA 4JQ1A 3R6IA 5EB8A 5HR7A 1OC6A 1IT0A 1B2YA 4TUFA 2OEJA 3VD9A 1JI1A 1FFQA 3FGCA 4H8NA 2X7WA 2ZZ6A 3IJQA 3D46A 2GK1A 4ZOEA 4V2XA 4TO8A 3D0CA 1TV8A 3TW6A 4MYAA 1QI0A 3RPMA 2Z1BA 5CPOA 3AJ7A 3PTDA 3C2EA 1XS2A 3QMRA 3W2UA 3N6QA 4B4HA 3C2OA 4GXMA 5HPCA 2XUCA 1GUVA 2HNEA 3GW0A 3KCJA 4ADUA 3RFAA 2PWHA 3AMKA 1UD4A 2ZRYA 5HWJA 3W2LA 1QPNA 1SGJA 2OXNA 4OV4A 3BSHA 1RD5A 3PS7A 1H41A 4DJFD 3WENA 1DIOA 5FSDC 2FMNA 5XIMA 3CB8A 1F2JA 1QAPA 4LUTA 1OG0A 4I6VA 1QPOA 3WLJA 3CU2A 1KFWA 2GDQA 5HNRA 3VCRA 1PKYA 4QG8A 3MSYA 1P0NA 4LC8A 3CTLA 3H4WA 4MPQA 4UFMA 3BTNA 3VDBA 4M1RA 5GNXA 3U4FA 5C9ZA 4MSSA 2W4XA 3ITXA 2HS6A 3BE7A 2XM1A 4ZO9A 3GSMA 2BHYA 3QEZA 3LEPA 3PBUA 2NXIA 2J78A 3TDFA 4Z0SA 3UZWA 3WF2A 4ZODA 1PBGA 4INFA 2DIJA 3M46A 3AS1A 4E4FA 5FIPA 3STPA 3PB0A 4AFYA 3FA3A 1PKNA 2YFOA 3IVSA 4UFIA 3VCCA 1RQEA 3QGAC 3GR8A 2R9RA 4UNLA 3V5FA 3CS2A 2B81A 5G4HC 3SRFA 3KL0A 3E1F1 1SMAA 2Q6ZA 1KCXA 4RDWA 4JTUA 4NQ1A 4N9EA 3UGVA 3VAVA 4AZ6A 1LG2A 4IG2B 4K37A 1QRQA 1XLAA 1VF8A 3PB2A 1IZKA 3E0LA 3IJIA 1XH0A 5CPLA 3A9BA 4KF1A 4C6BA 5KZ6A 4ML4A 3SRHA 3V18A 2HTMA 4MNKA 2Z6IA 3SDOA 1Q65A 4M6PA 3M0IA 3RIKA 4UXDA 4XAFA 5AFDA 3LRLA 1IEIA 4H2HA 3MWAA 3VK5A 3VMNA 1TV3A 1YE6A 4ONVA 1TKKA 1R6WA 5AC7A 4Q8WA 2F2KA 2X1TA 3DZ1A 1NU5A 4A6GA 1K4GA 5F2LA 2AGTA 1W3TA 4K7YA 1EF3A 3Q2DA 3GKFA 3SUUA 3TTEA 4LF1A 4QE4A 3BCFA 3MWCA 4KW2A 1BAGA 4UTTA 4WF7A 2PWFA 1TIWA 4QS5A 3WLOA 4XSLA 5IXEA 3UXKA 3ZWSA 4EXAA 3FDKA 1LROA 4WSHA 4HVXA 1U1JA 3TX9A 5LNVA 5D9NA 4QGCA 4H3DA 3ZSTA 5AC8A 1F8IA 4GC4A 3W84A 3W74A 3HU7A 1H62A 5D37A 1H7OA 3W7DA 3MKKA 1JQXA 4FEZA 4Q33A 1REQA 5ABHA 1F76A 2JALA 4A3YA 5HNUA 2WAGA 4JX6A 3GWQA 3O6YX 3QPEA 1FFRA 2IPWA 4B2DD 1WDWA 1B3VA 4DXVA 3MANA 4UMAA 2XN0A 3A3XA 1RVGA 2VI0A 5A6BD 4XZ9A 4EWND 2NQHA 3WF0A 1XR2A 2AL2A 3P5ZA 1GYMA 1HKMA 2XFYA 3AIWA 4H9YA 1UH3A 2BY1A 2V68A 3T8LA 3S47A 4OZOA 4FF7A 1VFFA 1UKSA 4QAWA 4E5TA 3W71A 3DFTA 1XIIA 4FOUA 1T8XA 1U5HA 4KWUA 5K4XA 4EPKA 4MADA 5DO8A 2WZMA 3VGBA 1RH9A 5GJNA 2D0GA 1A4LA 4FXSA 4LAUA 1VB9A 2OYKA 1WDDA 2ZIDA 4NG3A 4CQ8A 5TIMA 3CUIA 3SGGA 2W67A 2PTZA 4QS6A 4WSKA 5EGRA 1UBPC 3UG3A 3SM0A 3GQYA 4YL2A 5GPRA 1J11A 2CCRA 2HXTA 2WPBA 2E8YA 4O17A 3QZAA 2ZFAA 4N4PA 4E2VA 2OSWA 3ZYZA 5LHEA 3WLMA 2G37A 3WG6A 2VL4A 4KCUA 2J27A 3PWAA 4MUZA 4WHBA 1AK5A 3OLGA 1FH9A 4K1WA 2RDWA 2Q01A 2OZ0A 2FHFA 3R8GA 1WXZA 1S5NA 3TC7A 4BHYA 3M0KA 1Z69A 4JNMA 2WZEA 3NWRA 3RITA 3ANVA 5HPOA 1I60A 3C2FA 3A4AA 3W26A 3WSUA 5CQ1A 4HK6A 2Q3OA 2QUVA 3B0VC 1H5VA 1V7YA 1WKEA 1O1ZA 3ZZ1A 3LXCA 4IQDA 3VX0A 4EP8C 3MW7A 2W0UA 1LOLA 1ZAHA 4FO4A 4TU1A 3NYDA 3THAA 1TX0A 5C7VA 5EBUA 1XRSA 1RBAA 4R3UA 2ZE0A 3HF3A 3VNKA 1XQKA 2LLEA 4BF9A 5LNSA 1RY8A 2V2CA 4ICMA 3CASA 1G94A 3G0UA 4C91A 4GCXA 1G0CA 4G1NA 1Y5VA 4NNCA 4PR4A 2OGYA 1MW1A 3AROA 5TBOA 2A7RA 3C0JA 3ANUA 1KV5A 4K36A 3LBOA 1E4LA 3EZ4A 4G7EB 3UF9A 2VUNA 1BEUA 2HBVA 3ZLHA 1GVRA 5AOUA 1B3OA 2FDSA 1EOKA 2ACSA 2OYLA 4JTIA 2FB3A 3N2XA 2C91A 3UP8A 4UZSA 1VJZA 3CH0A 5FAJA 3VM5A 1YRRA 3AYTA 3B4UA 3C86A 1NFPA 1N55A 3LXAA 2Z0IA 4CLMA 1DE6A 5FJOA 2A3CA 4BI5A 2VUYA 4ALDA 3BV7A 2WWCA 3WQFA 3LV6A 1W5PA 1UWUA 2I17A 1K03A 3B04A 4EF8A 2CFFA 3S0CA 3E6EA 7REQB 4WGXA 4Y96A 2Y8UA 3DGRA 2OWWA 1ICPA 1Q2RA 1UASA 2OX4A 4YWIA 6REQA 1G4TA 1R2TA 2PDQA 5DMNA 4UTWA 5CXPA 4US6A 1A5NC 1JDEA 4BI6A 3OLDA 1CTNA 5HJYA 4PE8A 5D2YA 1YEYA 4XAPA 3S8HA 3LTSA 2J8GA 3KXQA 3KUMA 1BLIA 1CXFA 2JIEA 5I3KA 4HYWA 3W1PA 4DRSA 4Y9NA 3W7MA 1WZAA 3ARZA 1FHVA 5MHBA 2B31A 2J79A 4MZ8A 3OGRA 3C8NA 3N6HA 4H9TA 3GR4A 3URBA 4I5RA 3M16A 3QHOA 3M0MA 4PTNA 4C5YA 3GFXA 1FP8A 3P7YA 3PZ9A 1Q8AA 4S3CA 5BXSA 2DH3A 1AW5A 1ZGDA 5A6TC 1CGWA 5I79A 4YVVA 1H51A 3VIHA 4NYUA 1B54A 1ICQA 2PDJA 3DHFA 4CN4A 2KX9A 2FYMA 1LUCB 1WOAA 1VPYA 3IJ8A 3LCWA 1UHVA 2TYSA 4W86A 1EPVA 5EMKA 2JKAA 4NXSA 3L68A 3PJUA 1F3TA 2HQAA 4K6AA 4V27A 1POKA 4XISA 1F9CA 1OJXA 2Y7FA 3A47A 2NVDA 3W7EA 1UQYA 5HQLA 1DBTA 3B8SA 3ITVA 1R3SA 3NGJA 5D9OA 4Y8FA 2NUWA 1FWAC 1DWGM 5EFDA 3UJEA 2GVGA 4X0NA 2CPUA 4HN8A 1E6NA 4V15A 2V5KA 4DPQA 3ONCA 4LBSA 1XM3A 5CSUA 5IFTA 1E6SM 2ZZ5A 3R58A 5A95A 3LU2A 3LERA 2IQ0A 4AC1X 4U31A 3SJNA 4IJCA 2Y4SA 3AIEA 4F66A 4XG1A 1F8MA 2VQUA 3ARSA 3GDKA 2E5BA 3DKLA 2QCDB 3O63A 3OEXA 2FPVA 1ZRQA 5BNKA 4W9TA 4HMNA 3QV6A 1B5TA 4NKCA 3E74A 5LSMA 1PX4A 3NQMA 4AIUA 3P84A 1EWEA 3IEBA 1E5JA 1AJ0A 3QLDA 1HKIA 2QULA 2KAUC 1LQ2A 2L5HA 3GW3A 3O9NA 3PPCA 1FRBA 3PZIA 3S2MA 3K4DA 4O57A 4W8AA 4F48A 3JUGA 1E43A 3MZ2A 1UR2A 1ADSA 3W73A 2BB0A 4LXFA 3LHVA 4UB9A 5XINA 2XJ7A 2Z28A 4MKVA 5I00A 1GJWA 4ZL1A 4H8UA 2G3FA 5LHFA 4UQDA 3R0UA 3HGJA 1K77A 4O8AA 4XD5A 4CNUA 3SGZA 2TODA 2E9LA 3UWVA 5JQ9A 3PG9A 2VDHA 4FIQA 5HMFA 4Y8EA 3NO5A 3GYCA 3CL6A 1Q6RA 4IXHA 1NWTA 3AOFA 4QRNA 1XYBA 3NPVA 4HNNA 2DUAA 4JCLA 1TMLA 4NAEB 3PZNA 2NQZA 5F4SA 8XIMA 2QF8A 4L9XA 3LSBA 1HVQA 2EGZA 2X0SA 3IPWA 4LU0A 2PDUA 4UTKA 3GTHA 1CGVA 3VD3A 1GKPA 3F5LA 1WYIA 2A21A 5JBFA 4WDTA 1MEHA 3PAJA 3LCLA 1RHCA 2J75A 5A6JA 3LHYA 4JIEA 5D2TA 1QPKA 2VVNA 3L9CA 2CKRA 4LY8A 5AY7A 2YW4A 3K4WA 1WX0A 3P67A 3P80A 3ARXA 5AYBA 3ZFHA 1KA9F 5I23A 3LPOA 5I3DA 1ENUA 1XYLA 1OADA 2IPGA 4JKLA 3SUTA 1EYWA 1J2WA 3W1RA 4Z2GA 3UNDA 7ENLA 3EMQA 3VC6A 5C54A 3T0AA 3FW6A 3RLHA 1DQWA 3A4XA 1YXYA 1G67A 3WK3A 2OZTA 1FWJC 4MWAD 1XDJA 3S1UA 1DWIM 4PTDA 2YA2A 2ZKMX 3R0DA 4H41A 3H2EA 1RALA 4HMCA 1DXIA 2PWGA 3DCPA 3MP3A 2WJEA 2V82A 2DIKA 4P7OA 3V7PA 3NQFA 3PNZA 1P5BA 1TJRA 3VDAA 4YTUA 1MFUA 3FY1A 2J47A 3TYAA 4QQ3A 3PP7A 5FF3A 2OFJA 1PXGA 3SB0A 4MWAB 3M7WA 4CEUC 1D8WA 5I78A 3MBDA 5C6MA 2HNHA 4AIEA 3OG3A 2WV8A 4CQBA 2W27A 4HCHA 1HFBA 2OODA 4EF9A 5GNYA 1KM4A 1OM0A 3URQA 1Q66A 4M82A 2PUZA 2ZZ1A 1C92A 5E9AA 2EBNA 2UY2A 3OHIA 4N0RA 1LTDA 2YCJA 4UOQA 5HINA 2GSHA 4O18A 3A5VA 4DJED 1Z9AA 2WVTA 3TK7A 3IJ9A 1R3VA 2W9MA 2Y7GA 4G8TA 3GIPA 4J3ZA 2A2IA 4UFKA 3UPWA 3ARYA 4O1EA 5A94A 4AZGA 2VRKA 2B4GA 3KOXA 3TNOA 1XP3A 1JEZA 3FYOA 1KQYA 1WBJA 1K7EA 5M03A 4R5EA 1XF0A 3WQDA 4LW7A 2PDLA 2Q09A 5BCAA 1P48A 4AVFA 1GOWA 4FK9A 2INEA 2A7PA 3CXOA 1KWKA 4CU6A 4MB5A 2CU0A 1DPMA 1MQRA 2ZXQA 2AMXA 2VFDA 4P8WA 3HJEA 1MRAA 1UZDA 1IHIA 3ARUA 2IKIA 3DGBA 4PUMA 1JPDX 1UMLA 1DL3A 1TPWA 2R24A 3OHMB 2YDQA 3BLDA 3MI6A 4NRRA 1TVNA 3FKRA 4LEQA 3R2GA 4U4MA 3R5EA 3M5YA 1S2CA 5CZ0A 1ISZA 2OLAA 3CL7A 4L1GA 1M68A 1ZBWA 1K8CA 3OA3A 3KM8A 1X1NA 4GK8A 4U28A 3BLFA 3A23A 3CIXA 2E68A 3VILA 4RZ6A 5HQEA 2QCNA 2VT0A 3UJRA 5LIYX 4JPGA 2PCEA 1XIFA 1LF1A 3UWQA 1OVDA 3GH5A 2FDMA 3DI1A 1AW2A 1PWMA 2MNRA 3K30A 4DX3A 1UYQA 2Y7EA 4QDWA 2PDFA 4DN1A 1VJSA 2PRMA 3BGJA 3EX4A 1FDZA 3OPSA 5TNVA 1XLBA 4Z2LA 4XUYA 3O6DA 1C8YA 4A29A 5CGMA 3H4GA 4S1FA 3GXNA 3F7JA 3DHUA 3IJLA 1ZZMA 3MCNA 4YNGA 1BRLA 4CD6A 3LA4A 1UR3M 2ZZ7A 1K9DA 2C8NA 3BW3A 4IP7A 6TIMA 3ATYA 4XIAA 3AYRA 3U7BA 3SSJA 2D20A 3E3HA 2OG9A 5FOOA 3WMLA 3DDMA 1YMYA 2WM1A 3EX2A 1TFVA 1EQCA 1T96A 2NQLA 4NP7A 3WQPA 2JE8A 1XGZA 1GPFA 2EAWA 3AQUA 3JW7A 5BYWA 2ZUVA 5BROA 3NQEA 4GNJA 1NQKA 4FNQA 1QOXA 2BHUA 3CMJA 4JN7A 5U4NA 4CVUA 3B8IA 4P7RA 5BWAA 1WZKA 1RK5A 3QZ6A 2OO0A 4UCGA 1R7OA 1G6CA 3JZEA 2GGHA 3OVRA 4LUSB 4Q8NA 1DJIA 3XINA 3AI0A 3WLRA 4EAMA 1DQXA 3A5FA 1DEDA 4JZ5A 3H2AA 4IL0A 4PH6A 3DI0A 3W38A 1BD0A 4OT7A 1JZ2A 3SCOA 1FOBA 2DW7A 3HPZA 4GRSA 4XBJA 1GVEA 3K8MA 1W17A 4PCNA 2QJHA 1IXOA 2PDKA 3UXLA 2NQJA 1QU4A 1TZ9A 2W5FA 1IV8A 2P3ZA 4ATWA 2Y62A 4UTHA