3W2UA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-193
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-193
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2uA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2uA01
3NDOA 3S1VA 3QRHA 4J9JA 1S5WA 1HO4A 3W2NA 5TIMA 2B7QA 3IEBA 4FIRA 4LOCA 4HNTA 1VLWA 3UQNA 2QCEA 2TYSA 3STFA 1E51A 1AMKA 1TREA 3GAKA 2W0UA 3IVUA 4UFMA 2BLEA 3T55A 3I7RA 3UPWA 4IMEA 1DV7A 4GUGA 4NZJA 4MZYA 1TSIA 3W1UA 5IM51 2QCDA 5G1TA 3P8IA 2VOMA 5DN1A 1W3TA 1G4PA 4JTUA 1H61A 3DI1A 3CWNA 3O05A 1LBLA 1ME9A 1A5BA 2J6XA 3TDFA 2NX1A 1I2OA 1CW2A 1GG1A 1UUOA 2ATMA 2X1SA 1FCQA 5DELA 3P80A 1SPQA 1VYRA 4O10A 4GWEA 4AEOA 3HJZA 1YDOA 4JIPA 1PHWA 4HNVA 2VEKA 4MZ8A 3NQ7A 4O50A 4ONVA 1JQVA 4QITA 3M5XA 3KX6A 1QNVA 2J9ZA 3G1AA 1JUEA 1PL9A 1XBYA 4XKYA 4TMBA 1J5TA 4ZQNA 1XUUA 4M5PA 2NV2A 2X16A 3MJYA 2PE4A 3TROA 4HSNA 3LXAA 1SZEA 1IGSA 5DXYA 2Y89A 4R34A 2GOUA 1T96A 1DHPA 3B8DA 3USBA 1RQEA 5CKSA 1EWEA 5IBXC 4O4WA 2E6DA 3P81A 3O15A 2A5HA 2E6YA 4S1FA 1VH7A 1YYAA 2RDWA 1VPXA 3S42A 3PVFA 1YTKA 3S8HA 1IXNA 1BKSA 3GXPA 3PY2A 5EY5A 1V5XA 1QDSA 4UTWC 1LROA 3TUUA 1LP6A 4HKPA 1EIXA 1H1ZA 3M5VA 3NR0A 1H7RA 1TTJA 3PB0A 1MZHA 5DXXA 2ATSA 1DKWA 3KXQA 4M7TA 1MEWA 3ABQA 2ZZ7A 4WX2A 3LHUA 3E96A 1WBHA 1F6KA 2QCGA 4UR8A 3UPBA 4O18A 5EA9A 4MIMA 1KV5A 3M1ZA 3BW4A 4BI5A 5IBXA 2YR1A 4IX0A 2OJPA 2C16A 5DCBA 1N8FA 4OT7A 1JRBA 3PBVA 3EXRA 2W6RA 1TPB1 4O4VA 4Y6GA 3EKLA 3NQGA 1KTNA 3GKFA 4JR5A 4ADTA 3M0ZA 1SW0A 5H2ZA 3W74A 4LS2A 4Z0JA 1PV8A 3SGZA 3G1XA 4PH6A 3G1VA 5KMYA 1OFBA 5AB3A 3C56A 3GZ3A 5HUOA 4MFDA 3S5NA 1JQXA 2GQ8A 4HHPA 2JGQA 2ZCGA 3TAOA 5K3VA 5E0KA 3MYPA 3NQDA 4FX8A 5CPNA 1OX5A 3O6DA 3GDKA 3SSJA 2E6FA 4MYXA 2EPHA 3P8JA 4JDYA 4JD4A 3QF0A 2C13A 1EB3A 4XTDA 4LS1A 1W5MA 4LWWA 4GUHA 4O0KA 3LERA 5LNSA 2BXVA 4LVAA 3VNDA 1TRDA 2A85A 3DFPA 4RZ5A 3DFNA 3ZS4A 3BW2A 1FWRA 1SZGA 4HT3A 4OWGA 2PCQA 4UCGA 3I7QA 1WV2A 5AHNA 1I45A 3CU2A 4WUIA 3W86A 3DFOA 3PB2A 2Z2UA 2P1FA 4U4MA 1O4UA 4N02A 4NUWA 4MY9A 2E6AA 3LOTA 2Y7FA 4JTTA 2ZA1A 3M5ZA 3WK0A 1FBAA 1AL7A 1QPNA 4MY8A 1GQNA 4BFAA 3PS7A 2B7PA 4O14A 1NVMA 2B4GA 4O15A 3UWUA 2RDUA 1ZAIA 3SR7A 4GFSA 1HFBA 4ZQMA 4GUJA 4JDBA 2V0TA 1AK5A 1I2PA 3LBCA 1W5OA 1H7OA 3TXVA 4ORMA 3QPYA 1JCLA 1SR9A 4RXGA 4Y96A 1NAL1 1TO3A 5K9CA 1M7PA 3B0UX 3T7VA 3NPWA 4PL1A 2RKXA 3M6YA 3TE9A 4RXFA 3TSDA 3W7PA 3C4UA 3G0XA 2FFCA 2NXIA 3W9ZA 1H51A 2O7SA 3P62A 5EL1A 2ZRXA 1PCKA 3KOFA 4UNKA 1JUBA 3IIOA 4MZ1A 1O5KA 3S6DA 4FO4A 3L66A 3W1RA 2NX9A 4IX2A 1F6PA 3MI3A 2DU2A 4UR7A 3G22A 4K39A 1KFJA 1F5ZA 4GBUA 4A22A 3LHVA 2C19A 2GJLA 3HBLA 4DO6A 5KZDA 1XBXA 1FXQA 1HG3A 4WQ6A 3DBPA 4LT9A 3L0GA 3QH2A 5EMUA 4AVFA 1ZHAA 4K6AA 1F7BA 1P0NA 4UIOA 4LNYA 1VGAA 3ABSA 5FF7A 4Y8FA 1XUZA 1WA3A 3O07A 1UBSA 5EKYA 1C9DA 3FIGA 2DORA 4M7SA 4POCA 3GDRA 1MEHA 1BTMA 1X1ZA 3O16A 5K7JA 1K8ZA 4DF2A 3WJWA 3UZJA 1Q6RA 3KVMA 5G2HA 3QMTA 2A21A 3LTSA 2B0MA 2QJIA 3MYOA 2ZA2A 5LHEA 3IGUA 4XZ9A 2CFFA 3EWXA 5F4WA 3QM3A 2PC4A 1LLWA 3A5VA 1Z44A 1FCUA 1LRNA 4WOQA 3O63A 1JCNA 1H50A 1KLZA 3W2JA 1QPOA 3NL6A 2QCDB 3LHWA 1A5AA 2ZZ1A 4A21A 3F03K 4IOTA 3LCXA 2J88A 4O1AA 4E0CA 3TFXA 2QCHA 4JX4A 4YCOA 1H7WA 2JKEA 1N7KA 2CZDA 2PRLA 3IIVA 4AWUA 5F2MA 2FB2A 1FUYA 5F2LA 4JTSA 1KM5A 1W5NA 3EX1A 2OZ0A 4K38A 3PAJA 4N2YA 3DFQA 4RJEA 2ZFAA 2QEZA 2ZTJA 1JVNA 1X7FA 3UWWA 2GVLA 3G24A 3IIXA 2ISWA 3C0JA 1JRCA 1K8XA 4UTIA 4Q32A 4IUOA 3QJAA 1I2QA 3QSRA 4JTLA 1KM2A 4XKYB 5D02A 3O06A 4OV4A 4NJJA 4QIUA 5AC6A 2F84A 3L67A 2H8XA 1FY6A 2AQWA 4FNSA 3G1SA 1B4EA 1ME7A 4FNRA 4C1LA 3MO7A 1F05A 1VS1A 3BW3A 2BWGA 3KRZA 3KVJA 1OJXA 1RQBA 2QDGA 3G8RA 4MFEA 4AHOA 5HNRA 4JS3A 2C6QA 4M19A 3NQCA 4KWVA 3AJXA 5C2XA 1KV8A 3LTPA 4PCFA 4NNAA 1IXQA 3GDTA 3LB0A 1J2WA 4FEZA 1O95A 3DFSA 3W7GA 5DBTA 2ISVA 3Q37A 4O16A 3NQVA 4QNEA 3PBUA 3QQ1A 3UWYA 4CCDA 3F1QA 2A7RA 3Q58A 1K7EA 5G2IA 4Y90A 2WSYA 3HPSA 2A6NA 3O1NA 2YFOA 3BLFA 2O7QA 2QJHA 4DPQA 3LLDA 1ONRA 4UTLA 5DY2A 1Q45A 5CPOA 3N3MA 2FTPA 4ZQOA 3HO8A 4UTKA 2CLMA 3QW4B 1A5CA 1R30A 5D30A 3THAA 1OX6A 3ZWSA 1OFDA 3A9IA 1KBIA 1TTQA 4WY0A 3WJZA 1IXPA 4NVTA 4UTTC 5BOOA 3NM3A 1G7UA 5C5YA 4Z08A 2YPIA 2C0AA 4RR4A 1KA9F 3BV4A 1OHLA 2A4AA 2ZDRA 3LXBA 2A7NA 2QCNA 4ALDA 3IVSA 4OBTA 1K7FA 1QO2A 5HUPA 3CTLA 3C2VA 1XBVA 3N73A 2WNNA 3RF9A 3BVJA 3FJLA 1OF8A 4LRTA 3DENA 4ZL1A 5K9XA 3M5YA 3L68A 4GXMA 3GXTA 3STEA 2ZRVA 4AAJA 2V5LA 3SY5A 3C3NA 2EGZA 4OHQA 4OV9A 4MY1A 4QISA 3LI1A 1X1OA 3W7HA 1FDZA 1P1XA 3LDVA 2CLOA 2RHGA 3FA5A 3S1WA 3GR7A 3N19B 3VKJA 1NSJA 2QUVA 3SGUA 3PC0A 3T78A 3TA6A 3U6WA 1MEIA 1TIMA 4UFHA 3M9YA 3LRKA 5CZ0A 2GQAA 1TV8A 2VXNA 3W85A 5DBUA 3EWUA 3UY8A 2BZNA 3B0PA 2EF9A 2YSWA 4OE7A 4YWIA 3SZ8A 3LM7A 2E77A 1OFEA 3U2OA 2A0NA 2YX0A 4CQ9A 3BLEA 4O19A 3TW6A 3LGEA 3C2FA 3P61A 4I7UA 3PBWA 1F73A 3GDLA 5DCDA 1GYLA 4XQ6A 1AW5A 4U28A 4EF8A 1QMLA 3G0UA 3FLUA 3H55A 1FWTA 3LCFA 4NJGA 5G1YA 1UJPA 1H63A 1ZAJA 4BI7A 2V2HA 1MO0A 1L9WA 2QCLA 2V5BA 1VR6A 2YZRA 1PIIA 2ZRUA 3C52A 2P0OA 3HGOA 3N9RA 4DQWA 4TU1A 1YXYA 3OEXA 3PM6A 3W7JA 4LRSA 5FF2A 1H5YA 2OCZA 4S2BA 8TIMA 4UFKA 3GNDA 5CSSA 3NQAA 1TPWA 1QR7A 4JY9A 3P67A 2CLIA 2VELA 3GR8A 2OT0A 3S5OA 4ML9A 4UTJA 1XBZA 3TK7A 2NXGA 2DJLA 3SW6A 4DO4A 2RFGA 5DY3A 2C3ZA 1L6WA 1OFPA 1Y0EA 1W5PA 3STCA 3PR2A 3M7WA 2VEIA 5E93A 2ZRWA 1TPH1 1FCBA 2ZA3A 1F76A 1KTBA 3E49A 3NQ6A 1G4EA 3TKFA 4AF0B 2BX7A 3TMLA 1R2RA 5LNVA 3TV8A 5D2VA 1XDMA 5FEZA 3OVPA 3JS3A 4NT0A 3M41A 3S9YA 2FPYA 3LCLA 1TQXA 3LBMA 4LVFA 4NJKA 2A2IA 1B4KA 3MUXA 5LSMA 4E2DA 2WV8A 1DBTA 3LHTA 3W75A 4UMCA 4KFOA 5FEPA 3CQ0A 1PHQA 4IMCA 4C1KA 1WQ5A 3C2RA 1WXJA 3NPXA 3RLUA 3CC1A 3B4UA 1SO3A 5HWMA 2YW4A 4AWSA 2W79A 5CGQA 3L0KA 1ICSA 3B05A 2VKZG 1WDWA 3MP5A 5F2GA 1ME8A 3W22A 3OA3A 4FX6M 1P5BA 4MLJA 1SQ7A 5E1QA 3NZRA 3LCGA 1QPQA 1LRTA 1WBJA 4UTWA 4KFNA 3LHYA 3N14A 4UTMA 1OX4B 3BG9A 3W1QA 1I2NA 3TSBA 3W3OA 3NM1A 1Q3NA 3DHDA 1TCDA 3LI0A 5G4EA 3TQKA 1OK4A 3INPA 6ALDA 2Y63A 4HSOA 3DAQA 4FIQA 3WJSA 1U5JA 2Q8ZA 3A22A 3UWQA 3L9CA 3GKAA 1RD5A 3MHUA 2CLHA 3A23A 4LC8A 4RLIA 3VI2A 1TMHA 3W7OA 1SSDA 1D3GA 7TIMA 3V1PA 3DFTA 1S5TA 4LVBA 5I3JA 3W7KA 6TIMA 2R91A 3W7MA 4DELA 4MVAA 2TRSA 3VE7A 3W70A 1GVQA 3PSWA 1QPRA 5HULA 1UUMA 3R2GA 1TV5A 2E09A 4E38A 1XKYA 2YYTA 5CG7A 4MJMA 3SFKA 1FCVA 2V8ZA 1B9BA 1LLZA 2V82A 2YW3A 4S2CA 3P5YA 5D37A 3NQFA 2YGYA 2PRHA 4KKXA 1K7XA 3G18A 3DH7A 3UD6A 4P61A 3NQMA 1NEYA 1RPXA 2H90A 2WNZA 1YDVA 3KRUA 2Y7GA 4PFMA 2B7NA 2Z6JA 3WJYA 1RR2A 1G6CA 4WD0A 3W88A 3FFSA 1TV7A 4FNQA 4PTNA 3GNNA 3Q94A 3LCIA 3GB6A 4FXSA 2LLEA 2A7PA 4GJ1A 4CCEA 1GVSA 4D2JA 1KM0A 5J5DA 3STGA 1W54A 5AC7A 4JTHA 3F4WA 3NAVA 5T26A 3W2MA 2ABBA 4JTIA 3OIXA 5DCEA 3QFEA 2UV8G 3M43A 3RU6A 1LBFA 1HTIA 1WX0A 3W7CA 2C14A 2CWNA 3DKLA 3TX9A 1OFAA 1RVGA 3UXDA 4AHPA 3W84A 3NNTA 1BWLA 1TTIA 1YPIA 5FEXA 1SO6A 3B03A 4JICA 3CB8A 4O52A 3W1TA 5AOUA 4B5NA 1YXCA 4ZZ9A 1M7OA 5BNKA 4CNNA 2C18A 5HQEA 2NUXA 2QCMA 3S1UA 4CNOA 2WSQA 2J24A 1A53A 1VCFA 2CZEA 1ZNNA 1GVOA 3W72A 4ZQCA 2X1RA 3CM4A 4PA8A 2E1DA 1JCXA 2FQIA 4MKNA 4UFIA 5D05A 2YCEA 4EWND 1LTDA 2ZZ6A 4LVDA 5D32A 4YCPA 3UZ5A 3HGSA 3TJLA 3SIZA 5LNRA 2Q8LA 1W37A 1EP1A 3HPZA 3SI9A 3N9SA 3VCRA 3BGGA 2HTMA 4LC6A 4A29A 2DJXA 5G4WA 4AB4A 5HR7A 2NWSA 1B57A 3CLMA 3DZ1A 3LTYA 1QCWA 3HIJA 5HWJA 5F1UA 1J4EA 4JEQA 4K8HA 1KLYA 5D2XA 4NJHA 1AW1A 3Q2DA 4FNUA 2ALDA 4AHQA 3GIYA 4DXVA 1OVDA 4O57A 3CHVA 2QUUA 5A8GA 3B0VC 1EP2A 2CLLA 5HJLA 3R13A 3LHZA 2TPSA 1TJRA 1VRDA 1H7XA 4DO5A 4UMBA 5BRBA 5AHFA 2OT1A 3LLFA 3VE9A 1H7PA 1YLVA 4AXKA 4QAIA 3O6YX 5U4NA 2NUWA 4XBSA 4IMDA 5I3FA 3I68A 3SECA 2E68A 1FDJA 5CPMA 2XN1A 5BW6A 4N9EA 2DZUA 4O0ZA 1XC4A 3THQA 4A2RA 1AL8A 3C8FA 3S0CA 1KW1A 2H6RA 4DF1A 4E2BA 2VEMA 4JTFA 3BK0A 3IRDA 1JCMP 1JCYA 3TC7A 4WY0F 3ZFHA 1SW3A 3IIPA 4DPPA 3ELFA 4NU7A 1VQTA 5FESA 4Q4KA 1OABA 4LUIA 4M6VA 3W76A 1FDYA 4UUIA 1LOSA 2QKFA 1VZWA 2QF7A 3W71A 3BG5A 4GC4A 3NL5A 3W2UA 1IXOA 1L6SA 4ADUA 3RFAA 3MMTA 3OHIA 2CLKA 4RX0A 3LCHA 2VFHA 2JKPA 3UWZA 3EWYA 3SJ3A 1G4TA 1JR1A 3GLCA 4MOZA 3W7RA 1GWJA 4FX7A 3W23A 5EBUA 4IQLA 4UTTA 5MHBA 3HOJA 4HN4A 3GDMA 3KVKA 3P60A 4YL2A 4WXZA 4X22A 5U7SA 1SZNA 3QPZA 3W83A 3MP3A 3GYEA 3CEPA 3L5MA 3PUOA 3A5FA 1DORA 1FQ0A 2HS6A 1FX6A 4K36A 2QDHA 5L9FA 2GPTA 1H1YA 2Y88A 3NL2A 1I2RA 1P0KA 5KZEA 1EWDA 3QQ0A 3QMSA 2AAMA 3G0SA 1DL3A 3PUDA 4RK8A 5BMXA 1K3UA 3LV5A 3W2KA 2Y7EA 2Y7DA 5H91A 4HIBA 1TTPA 5LGZA 1TPVA 3NQEA 1K03A 3T4CA 3HG5A 3E12A 4O1BA 4LS0A 2WKJA 1SU5A 1TQJA 1DJNA 2A6LA 1LYXA 1D9EA 1SZFA 1JUKA 1XL9A 3BO9A 5DLCA 1GTHA 2Q3OA 1Q6QA 4ADSA 2RH9A 3T40A 3TW7A 4N4QA 3BARA 2VFEA 4UTHA 4PODA 2ZTKA 4BWLC 5I3KA 1ZFJA 3OVQA 5HR6A 2H8ZA 3W1PA 3E02A 2NX3A 3H53A 2Y70A 5AHEA 3B06A 1OG0A 1H60A 1GPWA 3FKKA 1T99A 2ISSA 2E5BA 4ICNA 1I8JA 1THFD 4HPJA 2V30A 4OQVA 4PC8A 4DBDA 1TJPA 2XN2A 1C29A 4XWUA 2CZFA 5LHFA 3P84A 2YXGA 3FOKA 1C8VA 3W07A 3UWVA 1OK6A 3GVGA 4JX5A 2VFGA 5BMWA 4O12A 3ZR4A 2JKAA 1XI3A 5F4SA 3O6CA 5KTLA 4ORIA 4JYFA 3ATYA 3QC3A 4H3DA 2R8WA 2ZRZA 1B3OA 5I3IA 3MBDA 4LTSA 2Y62A 4Z1AA 3BG3A 1OYBA 5HMSA 2FDSA 1JJKA 1X8FA 1YPFA 1G4SA 1YTDA 3NPVA 3UYCA 5AYXA 4HNNA 4N9CA 3TJXA 1EUAA 2XN0A 1OX4A 2DZXA 4BWLA 3MP4A 4I9AA 4LV4A 1K8YA 1LOLA 2QAPA 5CZJA 4GNJA 3PUEA 4CQAA 5HWNA 4YMZA 2GVGA 2WOQA 1VLIA 3NG3A 1KFBA 3VFLA 3NA8A 2FB3A 2J9XA 3KRSA 3R5EA 1TPEA 4W9TA 3G1DA 5J5RA 2DZSA 3FS2A 3UXAA 1IF2A 4A3UA 1EA0A 3DXIA 4Z1CA 5L6UA 1Z42A 3WK1A 4WY0B 3HMJG 4HPXA 1VHCA 3TMQA 4JTEA 1IIGA 5D2WA 1PCWA 3W7DA 3NGJA 4IGHA 3EWZA 5SWUA 1O94A 4O1DA 1VYPX 3OG3A 3O8AA 4IWWA 4WOZA 1GZGA 4XBKA 3TIMA 3QYQA 1Z48A 2C15A 3PULA 4R7JA 1I4NA 3LX9A 3MI2A 1ZY9A 5D2TA 4L4MA 1WOAA 4Z1BA 3HB9A 4JIQA 5CPLA 3I7SA 3HGRA 1ICPA 2WJZA 5A5WA 1M6JA 4WZHA 3W6YA 1UCWA 4N6FA 3NVTA 4O13A 3TFCA 5D09A 4TMCA 1LDCA 1SSGA 1NF0A 3HF3A 1F74A 2FLIA 3KFTA 3B04A 4JX6A 3BGJA 4DEFA 2V2CA 5D04C 1BWKA 3WJXA 1W5QA 3E9AA 4X3ZA 3W2LA 1KM3A 3UY7A 4PEKA 1CI1A 2X1UA 5AHIA 2GUUA 3BLIA 4QJ1A 5FI8A 5KSWA 3JR2A 1CX9A 2G96A 1OFOA 3LRMA 3RLVA 2EHHA 3CT7A 3QZEA 1LM1A 4RV8A 3TC6A 3C2OA 3CIWA 3EXTA 3W1LA 3MWAA 5K2ZA 3NPUA 1Q6OA 3EEGA 3F4NA 4JYDA 2QAFA 3GXNA 4FXRA 1JCJA 3MHFA 1ICQA 1FWNA 5HINA 1QWGA 4Z1DA 3DHFA 1R47A 4XTIA 3LCWA 1LRQA 5D33A 4NJIA 4L4LA 5D2YA 1QAPA 3NL3A 1FWWA 3PSVA 2GQ9A 3TU9A 3W7NA 2JBMA 1GVRA 3PBYA 4M6QA 3W1NA 2NZLA 4IMFA 3A24A 3W7IA 2WSRA 1LOQA 3TXZA 1ZAHA 2CLEA 5LNWA 5CZSA 5AC8A 2TMDA 1EUNA 1UB3A 4Y9AA 3L65A 4R33A 2DZVA 4X9SA 4HNUA 3P74A 1OYAA 1ZALA 4AMAA 1LORA 2JGYA 1ADOA 4KWWA 4A2SA 2ZBTA 4MYAA 3HQ1A 4O11A 1D3HA 2ABAA 2E5CA 2QJGA 1H7NA 3EB2A 4LUJA 1SW7A 4AF0A 2H3DA 2E5DA 5EYWA 3PG9A 2ZRYA 2Y6ZA 3C61A 4JY8A 3S1XA 4UTUA 4OGZA 1ZCOA 2G95A 4UMAA 1DQWA 5KINA 3EX2A 2X1TA 3LXCA 1KM1A 2YYUA 1G67A 3QW3A 2WQPA 3QEZA 2A1YA 5C55A 3NXFA 4DF0A 2NV1A 4Q33A 1QFEA 1WAUA 4JTJA 2VFIA 1VCVA 2CLFA 5CZTA 3QSTA 3MI6A 3P5ZA 1YTEA 1LCOA 4TR9A 3CWOX 1ZENA 3OVRA 2VEPA 2DZWA 2TSYA 2KZHA 1VYSX 4QSHA 4JXCA 1R2SA 5AFDA 2EAWA 3E0IA 4AH7A 2CW6A 1GJPA 2Y85A 1FXPA 5AHMA 3M44A 3ATZA 4BK9A 4GE8A 1LZOA 3FKRA 1GG0A 4JGDA 2WNQA 2FIQA 1PE1A 1T8XA 1AW2A 4BR1A 2OMAA 4LY8A 3NQ8A 1W3IA 1XXXA 4O1CA 4MUZA 3WK2A 5G5IA 4CCCA 3W73A 5LZLA 2I1OA 3W1AA 3NO5A 4I7WA 1XCFA 1KFKA 4FF7A 4FNPA 1LBMA 2VFDA 2CZ5A 4N4PA 5K4XA 3S5YA 3BPWA 2QR6A 2YFNA 3I65A 4N9DA 1YXDA 2BTMA 4IMGA 5CSRA 3FYPA 2RDTA 2FJKA 3DKJA 5TQLA 3A21A 3NYZA 3KAOA 3PWAA 3FJ6A 1GOXA 1YDNA 4NXSA 4UFLA 1NF7A 1QO5A 3G3DA 4CLMA 2FPTA 4O28A 1QOPA 1PVNA 2ZYFA 3WK3A 4IPJA 2CU0A 4EF9A 2V81A 2VC6A 1R2TA 4JN6A 1WYIA 2YDAA 5FF0A 4YLWA 3FYOA 5K9DA 4K37A 1S5VA 5F2IA 3W1MA 4LVGA 3G8EA 2ZZ3A 3EXSA 3TH6A 5I3GA 1AG1O 5LGXA 1VCGA 1TRIA 1DOSA 3N2XA 3V75A 3EX4A 4KFPA 1U83A 2I14A 3K30A 4G1KA 3DI0A 3G1YA 1GEQA 3HG2A 3EKZA 1O60A 2P10A 1KTCA 2Q3RA 3W7LA 5KITA 1W56A 3JRKA 1SFLA 2J27A 3G1FA 2FPVA 1N55A 1OFRA 5TBOA 1TPUA 2XFWA 1TB3A 1GVFA 3L0NA 2JK2A 4EIVA 5F4XA 1OFQA 3MHGA 2V2DA 2WO5A 2QCCA 4GRSA 3IVTA 1XDLA 3CPRA 2QCFA 3P7YA 4NX5A 4MPQA 2NWRA 4EVZA 3L5AA 1S3HA 1FWSA 4P2VA 4RKAA 2B7OA 3GK0A 5FEWA 1MXSA 3UNDA 4AWTA 3ABOA 3KVLA 1P4CA 3MBFA 4X2RA 1W3NA 1OF6A 2J9YA 3TAKA 4RCXA 4ZMGA 3TSMA 1ML1A 3TQ0A 4K8EA 3S5ZA 3TCEA 1RZMA 3TR2A 3RK8A 3T44A 2Y61A 3EX6A 1EEPA 3NZ1A 4QQ3A 4UXDA 1W31A 3C6CA 2ZZ4A 4NNCA 2QUTA 5K4ZA 4IXHA 3MW7A 1F2JA 3W7QA 2R94A 3PF3A 1TPC1 1M5WA 4LU0A 2EKCA 3L2IA 4RZ4A 1GTEA 3NQ2A 4NNBA 3W1XA 1Z41A 1BEUA 3EWBX 3KHJA 2DZTA 4NX0A 4JYEA 1RQHA 4WXYA 3NOEA 4CNPA 4UNLA 5C6MA 1O5XA 1A50A 2PRMA 1KM6A 4Z0SA 1VHNA 5AHLA 3D0CA 2VENA 4O8RA 5LNUA 3P82A 5EPDA 4UFJA 4GUFA 3GAYA 3IV3A 4R53A 1W0MA 1GYNA 1EP3A 4QM1A 1VC4A 4GUIA 2ZQ0A 5FF4A 1W8SA 4O17A 4FB7A 1K02A 4WJEA 1ALDA 3W87A 2AGKA 3RMJA 1L6YA 1DJQA 2V9DA 5AYZA 1G69A 2H3BA 1X6UA 3IGSA 4IPIA 1WOBA 3N2MA 1SO5A 2R14A 3ABRA 1HUVA 3U8GA 1R46A 4JTKA 4ZVJA 3R12A 5D03A 1SO4A 5FF3A 4O53A 3N34A 4TO8A 5LKYA 3ANYA 1TYGA 2D73A 4FHAA 4BI6A 1IIHA 1V7YA 4LW7A 1EX5A 3QMRA 2ZZ5A 3YPIA 1QOQA 3EWWA 4RZ6A 2DP3A 4TIMA 2G5WA 1TPFA 1G7VA 4YXGA 3PG8A 5C54A 3LV6A 1KFEA 4K7YA 1MSSA 1KFCA 4PL2A 2VFFA 4OU1A 3LRLA 3HPXA 3EX3A 4ZQPA 2IQTA 5AYYA 3CEUA 3DGRA 3G1HA 2NXHA 2G97A 3GX9A 2Z6IA 2C1HA 3HGJA 4MJZA 1EPXA 4IXXA 2OX1A 3R8RA 4N9BA 4DBEA 1GT8A 1W1ZA 2GVJA 4H4IA 3FEMA 4JTGA 1TPDA 3CIXA 4TX9A 1SUXA 3TQVA 1PS9A 4UC5A 4NQ1A 4FNTA 2F7FA 1KBJA 4JNMA 3HG3A 5AN7A 2HMCA 3L5LA 1H62A 1XM3A 4K7VA 1YADA 3ZWTA 1VJIA 2NLIA 2HS8A 4BF9A 5ABTA 1DVJA 5F1VA 4M6PA 1XFBA 3H54A 1JULA 5G2WA 3IGXA 4ZQRA 1ZJIA 4LV9A 1HL2A 4XUGA 1SFJA 2BSLA 4NZFA 3R89A 4CQ8A 2X30A 3OBKA 3IIZA 1DQXA 3RNDA 3AO0A 4N6EA 3M16A 3M47A 1KM4A 4O54A 4I7VA 2HSAA 3W7EA 3G3MA 3HG4A 2WPBA 3TNOA 2ZZ2A 2X2GA 2NUYA 5GVJA 1Q6LA 2PURA 4QNWA 3WFAA 5KZMA 1OYCA 2GJNA 4EOUA 1RV8A 3I6RA 2I9EA 2Z0IA 1NFBA 4NXKA 1HO1A 1UASA 3DU0A 1A5SA 1T0OA 2DZPA 3L21A 4H6KA 5D38A 3C2EA 3NEVA 4IJBA 5I3HA 4MLRA 2Z1BA 1L2UA 1KFLA
chains in the Genus database with same CATH superfamily
4DI8A 3S1VA 1AFSA 4YYCA 2R1LA 2ZADA 4HNTA 3A47A 4K2SA 2D2GA 2TYSA 3GAKA 4L64A 3PJUA 4UFMA 2BLEA 1QHPA 4GIAA 3GVQA 3P8IA 2VOMA 5MKGA 1V02A 1V0LA 2O92A 3GYCA 1S38A 2XDFA 3O05A 3G2GA 1ME9A 1A5BA 1O5RA 3UYIA 1GG1A 1UUOA 1E4IA 5DELA 2X7WA 5LXXA 1LUCB 1SPQA 4O10A 1YDOA 5FJOA 5CC6A 1XINA 2VEKA 4O50A 5M5DA 1Z69A 5JBFA 2OWCA 3NDZA 5HMEA 3TYUA 1BXBA 4XG1A 4XKYA 2WVUA 4KCWA 3DYPA 2GDQA 3LXAA 6A3HA 1SZEA 3NO1A 1IGSA 3OU8A 4DYJA 1AH0A 5DXYA 2GOUA 1TG7A 4RW5A 4DVOA 3MMDA 1S46A 1RQEA 2PWHA 5ABFB 1EWEA 4ERGA 5IBXC 4O4WA 3P81A 3I6TA 2A5HA 2E6YA 3U2CA 4PMJA 3VZYA 2YKKA 2PP3A 3A3HA 3S5SA 4AYGA 3VXGA 3PY2A 3URBA 4CN1A 5EY5A 1V5XA 4UTWC 4HKPA 1IZCA 4DXXA 3NR0A 1E1EA 3KTSA 2WLYA 1DKWA 3ABQA 2Z25A 2NQJA 4WX2A 3LHUA 1GPFA 4S3CA 4O18A 4LY4A 4MIMA 3O2LA 1OSEA 4CU6A 1KV5A 3BZJA 4MNJA 4OBRA 5A1AA 4DY1A 2C16A 1N8FA 4L6HA 4FK9A 1FRBA 1KTNA 2HZGA 2QDDA 1DWAM 3M0ZA 4HK7A 4PRRA 3TN5A 4GIRA 3WF1A 5KMYA 4OBSA 5AB3A 4C1NA 2ACRA 3S5NA 1JQXA 4HHPA 2JGQA 4INFA 4CD8A 3TAOA 4NZCA 3OZPA 5E0KA 4LAMA 1FOBA 3VGHA 1QI3A 3GDKA 1BD0A 4F9DA 2OVLA 4JD4A 4LS1A 4LWWA 4KW2A 3WCZA 4ROPA 2YZ5A 4E4UA 5AYIA 3N04A 3M0XA 2BXVA 4H00A 3SEPA 3VNDA 1OB0A 3KDOA 3VKKA 3DFPA 1TIWA 5G4HC 1SZGA 4IM4A 3R0DA 1PKYA 3UVIA 2CPUA 2P8CA 3BCFA 5AHNA 1I45A 3CU2A 4MG4A 2P1FA 4U4MA 2DT0A 3BMXA 1XV8A 3LOTA 3AUOA 2OEKA 1LUCA 2Y7FA 3CUXA 1J18A 5FIPA 4HPNA 1E6XM 1WKFA 2WC3A 3WDRA 4L61A 2BHYA 1ZGDA 4H6EA 4F9JA 1EZ2A 2PTXA 3QR1A 2B7PA 4B9YA 4X0NA 1HKWA 3UWUA 2RDUA 2QV4A 1E0UA 1E9YB 5IDIA 2PDBA 1I2PA 1UZDA 2EG7A 4PMXA 3W29A 1KRMA 1TO3A 3BMVA 4ZB2A 5K9CA 1M7PA 3B0UX 3NPWA 1C7TA 3QY8A 3GG7A 1DWFM 3ABZA 2OXNA 4XO7A 4UNKA 1SYTA 2GSJA 2QLYA 1S2WA 2UBPC 3VMOA 3MI3A 1H1NA 3AYSA 4ERIA 3B9DA 3EA3A 3HBLA 1ZCCA 5KZDA 4Q8QA 4S3AA 3MSRA 3DBPA 2QGHA 3L0GA 3QH2A 4M0XA 5G1MA 1F7BA 2D2JA 1P0NA 1RA0A 3CHEA 3CV7A 3T8QA 4P7NA 5AZ0A 1XIGA 2Y4SA 5EKYA 4PMVA 2NT1A 3ITOA 2G3FA 3OG2A 4M7SA 4POCA 4PFHA 5K7JA 5LIXX 4REQA 4J4KA 2O4QA 3MYOA 2ZA2A 1MQQA 3EWXA 5DT5A 2WZMA 2VOTA 4R5EA 5AECA 4QJ5B 4XV0A 4WOQA 1H2JA 4ZA0A 3O63A 3Q65A 1ZJHA 1QNOA 4J3TA 1TWIA 4E0CA 3F2CA 2J7BA 3TFXA 3D5HA 3MDUA 1U22A 4JX4A 4YCOA 1ZTVA 1H7WA 4F2TA 4AX6A 4S3FA 5BROA 4AWUA 1B3ZA 1BVZA 2EPNA 2BNJA 2NLYA 3EX1A 2NVDA 1A5OC 2WZIA 3EAUA 3SIMA 4N2YA 4RJEA 5ABFA 4KRUA 3N4AA 2ZTJA 1PDYA 4DWSC 1V3KA 4GI9A 1B5TA 4AG0A 4L5ZA 3IIXA 3WQVA 1I2QA 1KM2A 1C92A 2WJFA 4EXBA 3O06A 4OV4A 1A3WA 2WXDM 5AC6A 4O1EA 2F84A 5D4YA 3P2VA 3KZPA 2AQWA 4HZ8A 1XH0A 5HQMA 2O56A 4C1LA 3V35A 1E15A 1OJXA 4I9TA 4AHOA 4BQ4A 4JS3A 4H8HA 3H2OA 3NQCA 3ZOAA 5A6SA 1QNSA 6TAAA 2VZUA 4W8LA 1XYBA 1XD1A 5GJMA 1XCXA 2Z2BA 1D7KA 4QNEA 4M80A 1TUFA 1R5YA 1IQ8A 2PLKA 1UKSA 4CCDA 4PCPA 3Q58A 4G8TA 3V0SA 3HPSA 3WNOA 2XZ9A 1KRAC 3EMCA 3BMWA 1DPMA 4DPQA 4XSMA 2FTPA 4ZQOA 1PO9A 1PZ0A 4XD3A 5IHSA 4K68A 4B3LA 1QXLA 3SY8A 5D30A 3S83A 4WF7A 2VEGA 1OFDA 4WY0A 5CG0A 2EJAA 5CH9A 2EPOA 1G7UA 2BHZA 3WD1A 4RR4A 3WUEA 3AHTA 2ZDRA 3LXBA 3TTSA 3IVSA 3UEQA 5MF5A 4EKJA 1RLDA 3O0FA 1RVKA 3DENA 4GI8A 4GGBA 4JL2A 3HA1A 3GG0A 2L5HA 4AY8A 3L68A 4P5UA 4J3UA 2EGZA 4GMEA 4LB4A 5HBFA 1WDSA 4QISA 1FP8A 5LYRA 1G94A 1X1OA 2WHJA 5HXMA 3FA5A 3S1WA 2HXTA 3N19B 1MNZA 4HYWA 4WGXA 3U5UA 4FOJA 5CZ0A 2YDSA 4H7VA 4PTDA 4HPHA 1HJWA 5DBUA 2QIIA 2EF9A 3BC9A 1Q85A 3AFBA 1VIWA 4WLCA 1MYRA 3S2LA 3SCSA 1LF1A 4MB5A 4CQ9A 4RV3A 3WUGA 3BLEA 4QG6A 6REQA 4DJFD 3CYJA 3C2FA 4I7UA 3T0AA 5CXPA 3GDLA 2WZEA 4XQ6A 3ALGA 1QMLA 1DTNA 1FWTA 1RSCA 3LCFA 4NJGA 5G1YA 4IT1A 3VFCA 5EFFA 2YDQA 1VAHA 1KCLA 2V5BA 2YZRA 3T2QA 4JNYA 3SRFA 1YXYA 3PM6A 1O6IA 8TIMA 1CT5A 3KCLA 1A47A 4OECA 3NQAA 1EIBA 4W7VA 1QR7A 3EEZA 3GR8A 3L4UA 4GPNA 2OT0A 1PIGA 1RJRA 3S5OA 4ML9A 4UTJA 4E2VA 1IEIA 1G0CA 4F3HA 1HJVA 3QY7A 4IH3A 9XIMA 1UIOA 4LQ1A 1XLAA 3OVGA 4IQEA 1OFPA 2W62A 1W5PA 3PR2A 1CZ1A 4JKMA 2ZRWA 2YOCA 1FCBA 1R3YA 1F76A 1KTBA 3PPHA 2XIMA 4AF0B 3PJWA 4UQCA 2BX7A 1EKOA 3TV8A 1EOMA 1XDMA 1OGGA 4UZUA 4ZGYA 3JS3A 3CTTA 3S9YA 2FPYA 3LBMA 4LVFA 4C5ZA 3OJGA 1DBTA 4UMCA 3LHTA 3DC8A 1PHQA 4PB5A 3BZGA 3NPXA 4FAMA 4J1OA 3ITVA 3CC1A 1SO3A 4J5NA 5IFTA 5XIMA 1TZZA 4WJXA 3VOCA 1ICSA 3B05A 4ASTA 3MP5A 5F2GA 5FL0A 3WKZA 4HOXA 2WAGA 1GHRA 3LCGA 1QPQA 3RRXA 3AMDA 3GQYA 4UTMA 1OX4B 2FGBA 3TSBA 1KCZA 3NM1A 1CCWB 7A3HA 3TZFA 3SQLA 2WC4A 5G4EA 8XIMA 3INPA 6ALDA 3PZTA 3WJSA 4ACZB 1PTAA 3A22A 1Y5WA 3MMWA 1OT2A 2D3NA 3L9CA 5T91A 3ZLHA 3MHUA 4LC8A 2ZUMA 1TMHA 3UVAA 4ROQA 4US5D 3AHZA 4DUOA 3DFTA 3N15A 3RX3A 2R91A 2IW0A 4MVAA 1RALA 1DJYA 2W66A 2QS8A 3PSWA 4B2DA 3EB3A 4K1GA 3M0JA 4IG2A 1TV5A 1RA5A 1ONWA 2YYTA 2O0TA 4MJMA 2NQ9A 1AA1B 5AVHA 4V15A 4KRTA 3T2OA 1EYWA 4B4FA 3FYYA 3JVAA 4DIAA 4AZ7A 3NTYA 3G18A 4H8UA 1JNDA 3U7VA 4DM2A 1DJXA 2H90A 2WNZA 4NZ1A 1SR0A 1TKKA 4FSAA 1P43A 1O12A 3OYXA 4AD3A 3KUMA 1RXOB 3W88A 1TV7A 4PTNA 2X05A 3EWDA 2Z1KA 4FXSA 3TN6A 1Y8BA 3ES7A 1US0A 2WQDA 2PODA 2DZAA 3VNIA 3LYEA 2OEJA 3STGA 1W54A 5AC7A 4JTHA 2GUBA 1SFTA 2ABBA 3CZLA 1BWVA 4JTIA 3REQA 4ZB0A 3GFYA 2WMHA 5BCAA 4NY2A 1I0DA 4Q8NA 1TZ9A 1RVGA 1NJJA 4AHPA 3W84A 3TWBA 3NNTA 1R3SA 5FEXA 1SO6A 4ZZ9A 1ADSA 1YXCA 2V69A 1EO7A 3FDKA 3HTWA 3H7RA 3KWXA 4C7GA 4CKQA 3S1UA 2WSQA 2CZEA 4HBKA 2P3EA 4ZQCA 4L1GA 4PA8A 6REQB 5JVLA 4Q4RA 5ENLA 5D32A 1GONA 3A13A 4GKTA 5D9PA 3UZ5A 5A8NA 2BGSA 3SIZA 4OJYA 2WMKA 1W37A 1Q7ZA 4XVDA 3HPZA 4PCSA 3BGGA 2DJXA 5G4WA 4AB4A 5HR7A 3WBXA 1V4YA 3LQGA 4YHGA 2CWXA 1TE6A 1B57A 3CLMA 3DZ1A 5HANA 4FR6A 5HWJA 5F1UA 1J4EA 3CUFA 4AIOA 2W9MA 3RCYA 1VFTA 1AW1A 1XLJA 4NIRA 1Q65A 4FNUA 2ALDA 4AHQA 7REQA 3CHVA 2QUUA 4GHRA 3ISIX 3F5LA 3L23A 1EP2A 5HJLA 3LHZA 2HISA 4GFIA 3MSYA 4DO5A 4UMBA 2OT1A 3NUKA 3LLFA 1H7PA 1YLVA 4AXKA 4NKCA 5U4NA 2WCGA 2NUWA 3WMCA 4S3DA 1MUWA 4XBSA 3BAWA 4OOUA 3I68A 2P3ZA 2E68A 3MWCA 4QEHA 5A8OA 3S0CA 1KW1A 4E2BA 4OZOA 4A3YA 2VGIA 2XIJA 3BK0A 4Q8PA 3C3UA 3MC5A 1JCMP 3CZEA 3QTGA 4HZ6A 3FSTA 3S1GA 3RDKA 4TTGA 1VQTA 1OABA 3W76A 1FDYA 4UUIA 4GC4A 1SFSA 3W2UA 1NDWA 4H04A 4ADUA 1JXJA 1OWQA 3OHIA 1UD8A 3CL8A 3AZRA 2Z24A 2ZUVA 3GLCA 4MOZA 3FK4A 3W7RA 5EBUA 4JQ3A 4UTFA 3GDMA 3KVKA 5B7ZA 1VF8A 1IR2A 4YL2A 2D0GA 4WXZA 4J40A 3U4AA 3QPZA 4DBSA 2DUXA 2OOFA 1UOZA 3A5FA 1DORA 3VGFA 2QDHA 5L9FA 2GPTA 1H1YA 4N42A 1WB0A 1XLKA 1P0KA 1K6AA 3QQ0A 2AAMA 3A12A 3VDGA 1DL3A 3PUDA 2DQWA 2MNRA 4AIBA 3ARTA 3BJSA 1TTPA 4JNZA 5LGZA 1K03A 4HZMA 2I5QA 3BSGA 1F6YA 4HPGA 4LS0A 1ODZA 3PUGA 1XL9A 4C65A 4AVNA 2VI0A 3MY9A 4IIFA 5JU6A 2Q3OA 2REQA 2C79A 3S2MA 3TW7A 3BARA 4BWLC 4GD0A 4U3CA 3IAPA 2FHFA 4DM1A 7PTDA 3CPUA 5HR6A 3BQ6A 4Q8UA 3CUIA 2H8ZA 1HIZA 1NY1A 2Y70A 4GXWA 1OG0A 1H60A 2YL5A 5A6KA 3FKKA 3HQOA 4DI9A 4NAEA 2ISSA 1I8JA 1XLIA 4HPJA 5C7HA 1MQRA 2QUMA 2PDWA 5EFDA 4XWUA 2GZXA 1OD0A 1RP9A 3V5CA 4JTQA 1OK6A 3RJYA 3GVGA 4JX5A 1J2BA 4GKLA 4O12A 2JKAA 3REQB 5KTLA 1I1XA 3RPDA 4I6VA 2BOFX 4B5VA 2R8WA 5I3IA 4PULA 3VOHA 3MBDA 9CGTA 1I1WA 4LTSA 4QJ3B 4QHRA 4Z1AA 5HMSA 3F4CA 4PTWA 1JJKA 3EPOA 1YPFA 1G4SA 5HA7A 1XPGA 2RDXA 3NPVA 3GUWA 1JPHA 3TJXA 2X41A 4I8YA 2XN0A 3TTEA 4WDWA 4DUVA 4DAIA 2PPGA 1LG1A 3A3XA 1BHGA 3FAXA 4CQAA 1VD6A 5HWNA 4YMZA 1TJ1A 1AODA 3TNBA 2QVNA 1UWIA 3ERPA 2PWVA 5FL1A 1TPEA 5J5RA 2QW5A 1EH9A 3UXAA 5L6UA 3HFTA 2FTYA 1VHCA 1M41A 3TMQA 4C6EA 3IJ7A 1PCWA 3W7DA 1O1ZA 5SWUA 3OG3A 3O8AA 2NQHA 5D8ZA 3T0TA 1JZ6A 1Z48A 2C15A 3PULA 3B3DA 3ZQ9A 1IWAA 4FA3A 1GJUA 2HXUA 5D2TA 1WOAA 2BMBA 3WQFA 4ILSA 1REQA 5CPLA 1IYXA 4MWAE 2WJZA 1DIDA 2G4FA 5T8GA 4ZOEA 2E8YA 2QZRA 4XIAA 1RCQA 2W91A 1LDCA 3V0UA 1SSGA 3SRDA 2R1NA 3F2BA 2FLIA 1BWKA 1XSJA 1KM3A 3UY7A 3G5EA 4DUWA 1CI1A 2X1UA 1WNOA 3BLIA 3MUY1 1GZJA 2NT0A 3R11A 3I10A 3RLVA 3ZJ6A 1P1MA 2EHHA 3QZEA 3R25A 4RV8A 3CWHA 2EPLX 3EXTA 3MWAA 3GE7A 3RM8A 5K2ZA 3NPUA 3NXLA 3F4NA 4JYDA 5FJPA 4ERAA 1KGUA 1JCJA 1E56A 5C71A 1WO2A 4ES4A 4JIIX 1UR3M 3DHFA 4DRSA 3H6OA 3QZAA 5J8LA 4BA0A 3PSVA 3TR9A 3TA9A 1GVRA 5CGTA 1KO0A 4IMFA 2J7GA 3W7IA 4D6CA 5RUBA 3KBNA 3CZ8A 1ZAHA 2J75A 1JI1A 4YTSA 3QHMA 2BVWA 1XICA 1D8CA 3WENA 5CAKA 4BS0A 1LORA 1ADOA 4A2SA 4MYAA 5D9MA 5E6YA 3DG3A 2GDUA 3H7VA 1D3HA 2ABAA 3EB2A 1E71M 1WDDA 3AIRA 4QLLA 3ID7A 4EAMA 3C61A 3WQ4A 4C6QA 4UTUA 2AQVA 1X96A 4UMAA 3I4EA 3G1RA 3MKVA 2GGIA 3LXCA 4MWAC 2YYUA 3QW3A 3ARXA 3WNNA 3QEZA 1FWGC 2NV1A 4AD1A 1WAUA 4UWMA 1VCVA 4HK5A 2CHNA 3MQTA 1Y5VA 4PMRA 4Y7EA 3H4WA 2WANA 4TR9A 3C0LA 1R87A 3CWOX 3N4FA 1ZENA 4P8VA 4QDPA 3B40A 2KZHA 3TTYA 4QSHA 4DZIA 2PBOA 4JFTA 3VNMA 2WHMA 5FACA 3QV9A 4JHMA 1P6WA 2C0HA 3CZJA 4JKLA 1LZOA 1VFLA 3WUFA 3EPNA 3T6CA 3I3BA 2OYKA 1AW2A 5CBJA 1E0XA 1OC7A 1W3IA 1XR2A 1U5VA 5G5IA 3W73A 5LZLA 1IT7A 3W1AA 1CGXA 1XCFA 4FF7A 4FNPA 4K3ZA 3KDNA 2VFDA 2OZ8A 3CHFA 5K4XA 1VBGA 4IFKB 5CSRA 4AWEA 3VX0A 3BLPX 1ZBCA 4JCMA 4JL1A 3NURA 3W82A 1BPLB 1YDNA 3LMZA 4AW7A 2GJXA 1XLLA 5ECUA 3M4HA 1NF7A 1CWYA 2XZ7A 5ABGA 5BOEA 1T5AA 1E4MM 4Y9MA 4LEQA 1PVNA 4IPJA 4WDXA 1UHVA 4QG8A 1R2TA 1HL8A 3DC0A 4E5TA 3CXOA 5K9DA 2Y1HA 4GCXA 1S5VA 5F2IA 1VEPA 3NO3A 3LPFA 2ZXDA 4BHYA 1UA7A 1WKEA 2PDHA 1TX0A 4ZFMA 4IIEA 4KFPA 1U83A 2I14A 1NOFA 3UZZA 1EX1A 1WUFA 4G1NA 4KEVA 4JHZA 4L9ZA 2E4TA 1A5MC 3EDKA 3KEHA 2YCIX 1O60A 1W56A 2X42A 1TPUA 2PDUA 4ZCWA 1TB3A 1GVFA 2XFWA 2PDMA 4ZTYA 5FCZA 4NSBA 2V2DA 5BU6A 2P0IA 3SB0A 2QCFA 3S2JA 3N6HA 3H2CA 3CAQA 2NWRA 3GTFA 3WIJA 3L5AA 1FWSA 4JOMA 4B5UA 1F3WA 3PTDA 1B31A 3ABOA 4X2RA 3Q45A 1OF6A 2J9YA 4LX4A 2YCLA 3BAKA 1ISXA 3ORWA 3GM8A 1Z32X 2PZ0A 2EG8A 4D6IA 1CXEA 3KS5A 3QGAC 1R85A 2FJUB 1QRQA 3K2GA 3VM7A 2D1ZA 2H9AB 3O6AA 2OOGA 4NYYA 3RK8A 3EX6A 2NSOA 1EEPA 3NZ1A 4UXDA 2QUTA 1F2JA 3VMNA 2YB1A 2PF0A 1TPC1 3M0HA 4ZEPA 3TCSA 4MPKA 1BEUA 1DJWA 3KHJA 1XISA 1RQHA 4UNLA 4HCHA 1TJ0A 4MJ2A 2ZOXA 3K4WA 5C6MA 1MWOA 4XD4A 1S2VA 5FSDC 5AHLA 2VENA 2YB4A 1ONXA 1XIFA 4HHLA 4RW3A 1FFQA 2IKHA 1GYNA 4QM1A 1VC4A 4GUIA 2ZQ0A 4O17A 3N11A 1KBLA 3UETA 3RMJA 5XIAA 1HVXA 1X6UA 1F8MA 3RU8X 3WNKA 2VQTA 1R46A 4JTKA 3JZEA 1SO4A 5FF3A 1NARA 4O53A 4TO8A 3ANYA 3WLOA 2BBFA 4LW7A 3K46A 3YPIA 1MUCA 4UQ9A 4C6IA 4CEUC 2G5WA 3QGVA 1HP4A 1TPFA 3T42A 5C54A 2VFFA 3LRLA 4ZQPA 2P53A 5FJTA 2YL8A 2G97A 2Q09A 2Z26A 3TN3A 3LSCA 4LYRA 5DFAA 4FMVA 1W1TA 1OZMA 3R8RA 3DGBA 4N9BA 3PWGA 1F4AA 3FEMA 1C3FA 4AD2A 3BUVA 1SUXA 2Z1VA 8XIAA 2Y8UA 4JNMA 3CUGA 1A5KC 2Q01A 2J62A 2YIHA 2ZC8A 3WN6A 3LGGA 1YADA 1VJIA 1DJZA 1TR1A 4BF9A 1DVJA 4C91A 4U33A 3EMZA 4M6PA 3QHNA 1XFBA 3BLLA 3MSDA 1YMYA 2OO6A 2CKSA 1BQCA 3BH4A 4XUGA 2X0YA 3ZMRA 1XRVA 4JHOA 1KCXA 2X30A 3IIZA 3SCWA 3AO0A 3DCPA 1KM4A 4LSBA 3G3MA 1GORA 1LWHA 1CXKA 2NUYA 2VVSA 5KZMA 3M64A 3EWCA 1E3XA 1OYCA 1JYWA 2GJNA 4EOUA 3FVMA 2J6VA 4RPPA 3VC5A 1G1YA 1TWSA 3DU0A 1A5SA 2DZPA 3L21A 1QJWA 3C2EA 2VVNA 4IF2A 2WJDA 2Z1BA 3KBVA 4J9JA 4EXQA 4MMWA 3W2NA 3AS1A 5TIMA 4Z2LA 4FIRA 1VLWA 3OB8A 3WF4A 4NI3A 3VIFA 2XIIA 2D3LA 4FOKA 3PAOA 3LUTA 2CYGA 2WMFA 3DIPA 4L4OA 1DYSA 1DV7A 4NZJA 4AD5A 1TSIA 4QFUA 1J8VA 1TJ2A 1XGDA 3F4DA 5DN1A 2WB5A 1G4PA 4MHBA 1H61A 1UQYA 3TDFA 3VOFA 1I2OA 1C7SA 4HMEA 2ATMA 2X1SA 4HJFA 3FHQA 1FCQA 3P80A 1UH4A 1SGJA 2DIEA 2PTDA 1XQKA 4IIDA 1VIZA 3U5YA 4GWEA 3HJZA 4JIPA 4Q7BA 4HNVA 4JAWA 4Q6XA 1JQVA 3QXBA 4EXAA 4QITA 5BZAA 4N0RA 2E0PA 1RJQA 1QNVA 3H23A 1JUEA 5A6BD 4ZQNA 2ACQA 1XUUA 4I8DA 4S39A 2QMKA 2YBVA 3URNA 1BYBA 3USBA 5IHRA 3H2FA 4S1FA 2BODX 2D23A 1VH7A 5E0CA 1C8YA 3S42A 4WSJA 2ZDSA 5I5RA 3AYTA 1QDSA 2GVEA 1S5MA 1EIXA 1H1ZA 1K4GA 4PR4A 3M5VA 1H7RA 2ANUA 3PB0A 4UQBA 2ATSA 2OQHA 2V6AA 1MEWA 1MQPA 1IV8A 3E96A 3DX5A 1OD8A 1ZL1A 1UD4A 5IRPA 5IBXA 2YR1A 1IZKA 1UKPA 1Q13A 2PDPA 4O4VA 1RBLA 3EKLA 4AX7A 2C7FA 3GKFA 2PDFA 4IIHA 4ADTA 4HCDA 1SW0A 3C8NA 4EACA 4F2UA 4ATDA 4D6JA 1PV8A 2XFYA 3IJ9A 2WJEA 4PH6A 1EJUC 3GHTA 3II1A 5HUOA 3KWSA 1ITCA 4MFDA 2WM1A 1EC8A 4C6NA 1L8PA 3VM5A 4YTQA 4B90A 4YVXA 5K3VA 3APTA 3MYPA 4C6PA 3SBFA 3B8SA 3O6DA 3ZT5A 3SSJA 2E6FA 2DT1A 1DE6A 2VC5A 2C13A 5LXEA 1EB3A 4A6GA 4C90A 3UXKA 2BASA 4EPKA 5JH1A 1XDJA 2A85A 2XYLA 1XJBA 3DFNA 3ZS4A 1FWRA 1S5NA 3WBYA 2ZVIA 2DW7A 5CZKA 3I7QA 2OQYA 4JTCA 3EDEA 3D47A 4WUIA 3PB2A 2BY0A 4N02A 3UXLA 4US5A 2E6AA 1LJYA 2ZA1A 3M5ZA 1UP0A 1FBAA 1AL7A 2E3ZA 2EPKX 3T0CA 1QPNA 8A3HA 1GVYA 2WMIA 3A4XA 1GQNA 4B2DD 3MVTA 5BYWA 5HMDA 1AQ0A 4FLOA 4GFSA 1BF6A 5HNUA 4GUJA 4JDBA 2V0TA 1AK5A 1H7OA 3CIVA 3TXVA 4ORMA 4TVCA 1NAL1 4AZIA 4XIMA 3T7VA 3GVWA 3M6YA 1TVLA 3WLJA 4W5UA 3AHXA 3W7PA 3FY1A 3C4UA 3G0XA 2FFCA 1H51A 2PI6A 3TJIA 2ZRXA 3ALFA 3KOFA 2A3BA 1ELSA 3NJ3A 3L66A 3MO4A 3G22A 3MCNA 4A22A 3LHVA 2C19A 4W88A 4DO6A 4KIRA 4ACZA 2D2HA 4LT9A 5EMUA 3QHOA 4JBRA 4AVFA 4AZCA 4K6AA 4QG9A 1CGVA 1I9CB 2J66A 4DYEA 1NQKA 3ABSA 5FF7A 4ZXLA 4ACYA 3O07A 4G7FA 3UF9A 3FIGA 3CASA 2F9RA 2HPIA 3W26A 1ZJBA 4LGXA 1X1ZA 1K8ZA 3PTMA 1V77A 1VB9A 4REQB 1Q6RA 3QMTA 2WM0A 2QJIA 3VOIA 1W91A 1B3YA 2X7VA 3SRKA 3APYA 2PC8A 3QM3A 3HN3A 3BAJA 1RD6A 1FCUA 4HZ7A 3OLGA 1JCNA 5EB8A 3UA4A 3W2JA 1QPOA 2YL6A 5DEZA 3UCDA 3NL6A 1A3XA 3LHWA 4R3UA 2G50A 4HOZA 2PU1A 2HCVA 3NGFA 3LCXA 5KZ6A 3SJNA 1UR4A 2TAAA 1N7KA 2CZDA 2PRLA 1XLHA 2A3LA 1W9PA 4G5DA 1EF3A 4GLEA 4F2BA 3CUJA 5F2LA 1AZ1A 1KM5A 4JKKA 1CIUA 3UJFA 3DFQA 1V93A 5C70A 3KOWA 1X7FA 1XIJA 2DFAA 3MUAA 3RAOA 2BV9A 1UD2A 3AU2A 4GH3A 4QJ4B 1O7AA 3QSRA 4HU8A 2YLAA 4TVUA 1Z89A 2PWUA 4XKYB 1AQFA 3JZUA 1GZ1A 3A4AA 3SCPA 3VILA 3GFZA 1ZUAX 4FNSA 3SN1A 1B4EA 1EC7A 1ME7A 3BANA 4FNRA 3GU9A 1VS1A 5E09A 3KRZA 2GJXB 4HNLA 2GWGA 4IP7A 2QDGA 4MFEA 5CC5A 4YHEA 4KWVA 1U33A 2J7FA 1KV8A 3LTPA 4OTKA 4NNAA 1IXQA 4BQ2A 3LB0A 3A64A 3MKKA 2WVTA 1QI2A 3LG3A 1UROA 3NOYA 3T09A 2WPGA 2ISVA 3Q37A 4O16A 2F2HA 3HZ3A 1WZLA 2VCCA 3QQ1A 3UWYA 1HKMA 1EYEA 5FSEC 4US6A 1BXCA 3VGBA 2CBIA 4AC1X 3F1QA 2ZWYA 5G2IA 1K7EA 2BGQA 3QLDA 4ICMA 3OZOA 4PBFA 2A6NA 3C0SA 2XIOA 3BLFA 3C2YA 1BYAA 1ONRA 4UTLA 1IZJA 5DANA 5CPOA 2VD8A 3JU2A 1R3WA 5IXEA 1PKMA 3K4AA 1S3TC 3QW4B 1BFNA 4FLQA 4IPNB 1MW3A 4LF2A 3THAA 4KWOA 1OX6A 2I7GA 3OBAA 3ZWSA 3A9IA 4RE2A 4DBUA 4DHGA 3VYLA 5BOOA 3TYBA 3NM3A 5C5YA 1W8GA 2QJMA 1W1VA 1BXNA 1W1A1 4FPSA 1W2VA 2P5NA 1EPVA 1XBVA 3N73A 3E2VA 4A35A 2IXVA 4LRTA 3M5YA 5DO8A 1QT1A 2V5LA 3N9KA 2VX7A 4Q8VA 2A79A 3C3NA 3CMFA 2CKRA 3AISA 1FDZA 1P1XA 1FWAC 2A3HA 1RCOB 1MDRA 5I0DA 3S9IA 1NSJA 3SGUA 3TA6A 4HHHA 3L2MA 4UFHA 4X63A 2GQAA 2HNEA 2PLMA 4LH8A 3CLWA 4NZ3A 1XRSA 2PD5A 2ZE0A 3EWUA 2BZNA 3B0PA 2YSWA 3LM7A 4IFRA 3U2OA 2A0NA 1BTCA 5E70A 1CB7B 3VIGA 3WNMA 1LT8A 3OLDA 1F73A 2Z7GA 5DCDA 3P0XA 4YJ5A 1AW5A 1YNQA 4LYKA 4DN1A 3H55A 3FLUA 1Q66A 1IE7C 2QT3A 3IS4A 2TODA 1MO0A 3CO4A 1L9WA 2P88A 3VD5A 2QCLA 1PIIA 3WDJA 5TD4A 2XH7A 2PDNA 2P0OA 4K8GA 3SN0A 4LRSA 5FF2A 4S2BA 4KCUA 4JIEA 4UFKA 3E5PA 3S46A 5CSSA 2HV5A 1F07A 4D8AA 4MUPA 4V33A 3P67A 2CLIA 3GY1A 3RIKA 3RLHA 5CBIA 4XAYA 2V5JA 2V3DA 4DO4A 5DY3A 2C3ZA 2P8BA 3W37A 3VDHA 2VEIA 4Y9NA 3UR7A 2RJHA 3E49A 1B30A 1GEHA 5IOBA 4WJ8A 3TMLA 1R2RA 1X6LA 2XUCA 5D2VA 5A2CA 3ARUA 3GBDA 4CQDA 3EOUA 3M41A 4PTMA 5BRPA 2PDIA 4GIEA 4GINA 3LCLA 5EMMA 3WY1A 4DAFA 3UJRA 1E55A 2A2IA 3PTQA 2VMFA 4H9XA 2WV8A 1KC7A 3W75A 1CLXA 1GYMA 5AY7A 5FEPA 3KW3A 1AD4A 2PDCA 4LBRA 1WQ5A 2ZC1A 3QV6A 1WXJA 1GKQA 3IGHX 4ZFCA 3AS2A 4PRTA 4RNHA 3B4UA 5HWMA 2GGHA 2YW4A 3U2EA 3IUDA 1DIKA 2VKZG 5AKQA 3OA3A 3W22A 1ME8A 2DQXA 2XWEA 4FX6M 1P5BA 4MLJA 5E1QA 3NZRA 3GIPA 1LRTA 4UTWA 4RNFA 3LHYA 3BG9A 3ITTA 1I2NA 4O1FA 1GNXA 1V6XA 1UKTA 3TTOA 1TCDA 3TQKA 1J96A 1OK4A 3CMJA 1U30A 3ZYZA 4KWUA 3GNPA 1K9TA 2Q8ZA 3IJIA 3UWQA 3WDPP 2WK2A 3AHVA 4Q7NA 1H3GA 1NWRA 4ZENA 3VI2A 4RLIA 3W7OA 4QRNA 1JL8A 2I56A 1D3GA 7TIMA 3AWOA 2KAUC 3VDCA 3IK4A 4DELA 1ENUA 1QATA 1GVQA 3R2GA 4E38A 1XKYA 5CG7A 3VOGA 3GNRA 2V8ZA 1OIFA 2FMNA 3WYZA 3VKDA 1B9BA 2YW3A 3GUGA 5BRQA 2PRHA 3LMYA 3BDKA 3L4XA 4KKXA 1ZBWA 1K7XA 3SCOA 3FX4A 3UD6A 5T9BG 4XD6A 5A6TC 1RPXA 4GVFA 2J13A 4P8XA 4PFMA 2B7NA 2WMIB 1RR2A 1VBRA 4WD0A 4P7LA 3FFSA 2OGYA 1J79A 2BOGX 3Q94A 1WKDA 1TMQA 5TAOA 3AIBA 4X61A 1JYVA 3RM4A 2XSXA 2LLEA 4QXIA 4HA3A 2EXOA 3CHDA 3VIIA 3SCUA 2AMGA 2PDYA 4GJ1A 4CCEA 3IRSA 1GVSA 4CD5A 1J5SA 5J5DA 1QTWA 3LZ3A 2W67A 3QV7A 3F4WA 3PP7A 3QC0A 3W2MA 2INFA 3KS6A 5MKGB 4GA8A 3OIXA 3STPA 1XP3A 3QFEA 2BVTA 3M43A 3N6JA 1CXLA 3R8GA 2BS9A 2CWNA 1XIDA 1GVEA 3SUTA 1OFAA 4C6MA 5E9AA 1BF2A 5GPRA 2PBGA 3GTXA 4O52A 3T05A 4S3GA 1M7OA 4JFVA 2J7DA 4CNNA 3IK2A 2HVOA 5C2CA 1OY0A 3M0MA 5CJMA 1K4HA 2JIEA 4CNOA 2VZVA 4DJDC 1A53A 3I4KA 1VCFA 1ZNNA 2DSUA 5HOSA 4QBXA 3W72A 2E1DA 2FQIA 4MKNA 2FZ8A 2YCEA 2J8GA 4PE8A 1W9VA 2ZZ6A 4LVDA 1M01A 5DMNA 4HYVA 3IJ8A 4HP5A 1H0GA 4OUEA 2CXEA 4XAFA 5LNRA 3FEQA 2GFTA 1EP1A 3RLGA 5TNVA 4LEFA 3N9SA 3SI9A 3VCRA 4A29A 4LC6A 4F0LA 3VIHA 3HQPA 2NWSA 3LTYA 1QCWA 1REQB 3BSMA 3HM7A 3AMCA 3CK5A 3VX1A 3Q2DA 1W1B1 4DXVA 3CH0A 3THUA 5A8GA 3B0VC 1BSIA 2CLLA 2ZUTA 2TPSA 1TJRA 1E1CB 3WQEA 5AHFA 5JMUA 1HF6A 1KBKA 2J77A 3DYMA 3ABXA 3SECA 1FDJA 3VGEA 3LD5A 1JDAA 2DZUA 4O0ZA 1Y5XA 1XC4A 4DJED 1VFUA 4EE9A 3C8FA 3T07A 3TLLA 3UESA 1J0IA 2VEMA 4JTFA 1PX8A 1TWDA 3S47A 3AUJA 3IRDA 1JCYA 4QSFA 4IISA 3ME3A 6XIMA 1XIBA 4Q4KA 3GHUA 3TQPA 4M6VA 1V51A 1LOSA 2ESCA 3VNZA 3QFWA 4GNVA 2X09A 2GDVA 3NL5A 5D8WA 4KETA 1L6SA 4RX0A 1R8LA 3LCHA 2VWSA 4Q7IA 2JKPA 3KTXA 2HDJA 3GC4A 4Z1YA 5B80A 1GOMA 3OPSA 2F8QA 3KLLA 4RDZA 2ADAA 1ZJAA 3AOFA 3HOJA 4HN4A 1P7TA 4H7CA 4PMDA 1BAGA 1GQJA 1SZNA 1QW7A 3MDWA 2WHKA 3W83A 2DT3A 5M3WA 3LSBA 3G6LA 1FQ0A 3MU7A 3IV8A 4K36A 1UR8A 1XYZA 3F4VA 2F6UA 5GJNA 3NL2A 1I2RA 4X0VA 1J93A 7ENLA 3DN5A 2RUSA 4R88A 4UQDA 5BMXA 3HFYA 2EKGA 3LV5A 1TPVA 3LNMA 2YA1A 4TX8A 1XQLA 1DJNA 2A6LA 2HRWA 1NU5A 4OKDA 1GTHA 2BVYA 3WFZA 4AZGA 5H1WA 4N4QA 4UTHA 2VFEA 2ZTKA 5CPTA 1ZFJA 3OVQA 2FZ9A 3WNPA 3MZ2A 3PZVA 3E02A 1UZ4A 5AHEA 4PMQA 2UY3A 3B06A 3CV1A 3SUUA 1GPWA 1IGWA 3RJXA 3I3EA 1THFD 3P3BA 2V30A 1XYMA 3VD9A 4PMYA 3R0KA 2CBJA 4OQVA 1XLEA 4DBDA 3LK6A 2AKMA 2CZFA 2YXGA 4RPQA 1IT0A 3ZZ1A 1JXKA 3AC0A 3WDIA 5BMWA 2KX9A 3ZR4A 1XI3A 4JYFA 3ATYA 4RDVA 2YA0A 3XIMA 4LPCA 2CHRA 3EDFA 3VPLA 3BG3A 4I5RA 2OZ3A 4HMCA 1YTDA 2OO0A 3UYCA 4NYUA 4HNNA 2Z1XA 1EUAA 1OX4A 1V03A 2DZXA 3WF0A 4BWLA 1K8YA 3KP0A 1LOLA 4C1NB 4J2MA 3BAIA 4GNJA 3PUEA 2VDIA 1CGTA 2GVGA 3TC3A 2WOQA 3E74A 3PNUA 3ANUA 2CEQA 1Q6EA 1KFBA 2VNCA 1EFZA 3NA8A 1W1PA 2FB3A 3KRSA 4NILA 1L8NA 3G1DA 1CB2A 2DZSA 3FS2A 3PBGA 3MANA 1IF2A 4A3UA 3DXIA 3OTRA 2JE8A 1Z42A 3WK1A 4WY0B 1DP0A 3HU7A 1IIGA 3P93A 1GCYA 1UR1A 4NAFB 2Y8VA 3NGJA 4IGHA 4AY1A 1YX1A 4WOZA 1I4NA 3MI2A 1ZY9A 1M7JA 3CAKA 1XYLA 4Z1BA 1ICPA 1UWRA 4LUYA 1V3LA 3WQPA 1M6JA 1JDFA 3MKCA 3OOQA 2UY2A 3LPOA 7XIMA 1UD6A 2E9LA 3NVTA 3AIVA 3TFCA 5D09A 3E0WA 1XLFA 1XC6A 3GHRA 1NF0A 3URQA 5HAOA 3W25A 4JX6A 4XAZA 5D04C 1OC5A 1W5QA 4PEKA 3UR8A 2PGWA 3PWIA 3ZLGA 1LQ2A 4CVUA 3B0XA 4Q8MA 4QJ1A 5KSWA 4I90A 3JR2A 3NDYA 4KERA 1OFOA 3DYOA 3CT7A 4BJHA 3ZVIA 3TC6A 3U2ZA 3RGTA 3K8MA 3BL3A 3S4TA 4QROA 4MSSA 4C6OA 1TR9A 2OLSA 4FXRA 3R0UA 2ODOA 1EHAA 4PCNA 3MHFA 4M6UA 4RNJA 4DB7A 4Z1DA 3RPMA 4E8DA 3QLLA 4XTIA 3UZYA 3LCWA 5D33A 5D2YA 3XINA 3AXMA 3AXHA 2BG5A 1TUXA 2GJRA 3CUHA 2RGLA 3MV01 2OYLA 2CCRA 3A24A 4V1XA 1LOQA 2VO5A 3KM8A 1F4HA 3ARYA 4Y9AA 1UB3A 4R33A 2DZVA 3GH5A 1VEMA 4X9SA 1R9XA 1OYAA 1ZALA 4XVEA 1BQGA 1FWCC 2E5CA 2QJGA 1H7NA 2ZX9A 5CSYA 2E5DA 1M7XA 1W3LA 2X0SA 1EL3A 5E5CA 1X6NA 1XH2A 3S1XA 3T4WA 3FJNA 5JIPA 3SADA 1K8CA 3MUIA 2G95A 3AXKA 3ARZA 1D2KA 1G67A 1XWYA 4J3XA 4ZTXA 4YVPA 2ZX6A 1NDZA 3GH7A 5C55A 1B3WA 2QQ6A 4JTJA 2VFIA 1EJTC 1CYGA 3OYZA 4DLMA 5A69A 1LCOA 2DZWA 4DO7A 1FA2A 1VYSX 1S1RA 4F40A 1R2SA 1Q63A 5B7YA 2Y85A 3H2EA 4Q8OA 1FXPA 4ZOAA 1J0HA 2XVLA 3FKRA 2WNQA 2E67A 4QDWA 1PE1A 3GG8A 3G6MA 4TXEA 3AZSA 2PMQA 1O68A 1KFKA 4N4PA 4B5TA 1JZ5A 2R1PA 2OX4A 3VNKA 3HMCA 1YXDA 2BTMA 3FYPA 4PB3A 2RDTA 2HJPA 4RL3A 3A21A 3NYZA 3L12A 3W38A 3FJ6A 4HD5A 1ISVA 2QF8A 4NXSA 1U5HA 1UWAA 1HN1A 1QO5A 1NELA 3VNLA 2FGLA 5FJRA 3WH7A 1QUMA 1QOPA 1XIIA 2CU0A 4JN6A 4KEUA 2DZBA 1JDEA 3BAXA 3FYOA 2XINA 4K37A 3PJXA 4NAFA 4NG3A 1ZP4A 2E8ZA 1E72M 3NZGA 4GYPA 2ZZ3A 5I3GA 5LGXA 4MWAA 1DOSA 2VX4A 3V75A 4C6BA 3DERA 4YVVA 1G5AA 1J9YA 4RDYA 5HNTA 3VCCA 4MDPA 1Q7MA 4OFCA 4JEJA 7CGTA 3WQOA 4G1KA 3G1YA 2Q3RA 3EKZA 1KTCA 2P10A 3O0KA 3ITCA 4J3VA 1LL7A 2FPVA 1N55A 1OFRA 5TBOA 4EIVA 4PMOA 4GC3A 5F4XA 4X60A 2V3EA 3F2DA 1V79A 2WO5A 4GRSA 3CPRA 3P7YA 1SMDA 3GS6A 2V5CA 4MPQA 1QPKA 4DJDA 2JF7A 4P2VA 4RKAA 4DZ5A 3GK0A 4H9VA 4C6LA 4E6MA 2PWEA 4BQ5A 1QI5A 1VBJA 3WH5A 3AMLA 1UUQA 3L4WA 4D6DA 2VM8A 3F7JA 4RCXA 1MVYA 4W8AA 1NWUA 1ML1A 1XRTA 2VEFA 3PN8A 1A49A 4GVGA 1L2QA 1K70A 3GFXA 2O9RA 3S5ZA 3TCEA 3T44A 4ZO9A 4PUMA 3AZTA 1W31A 4I9MA 1UKQA 2ZZ4A 2DV0A 1UMLA 3OGRA 2R94A 3OLIA 3SQSA 4M81A 4LU0A 4RZ4A 1DTUA 4UR9A 5H8MA 2YA2A 1Z41A 1QHOA 5I7GA 2DZTA 5CGMA 1A80A 2XTKA 4CNPA 3NCOA 1UW9A 4TVDA 2PRMA 2VGFA 4Z0SA 1M04A 4BKNA 5LNUA 5EPDA 1V3MA 4GUFA 4MNMA 4FLRA 4R53A 3RO8A 4GQBA 1ITXA 1W0MA 4HSHA 4GX8A 5JIWA 1KKRA 5FF4A 3O9NA 1W8SA 2PFHA 2XU2A 4WJEA 3HJEA 1EQPA 3W87A 2PLJA 1YNPA 1FWEC 4GVHA 1EEXA 1WOBA 3N2MA 3ITXA 3ABRA 3R4IA 1JGMA 3BE7A 3PFMA 4B5SA 5LKYA 1B2YA 1EXPA 3OA5A 4FHAA 4DXKA 5GJPA 4FLSA 4H6RA 1JYXA 1EZWA 1V7YA 3QMRA 2DVXA 5A3HA 3ZVHA 4RZ6A 1DJHA 2FH6A 2AL2B 3SO7A 3LV6A 1KFEA 4NZ4A 4K7YA 5E0FA 3QKZA 4PL2A 4OU1A 2FVLA 4JCLA 5C9WA 3M0VA 3CEUA 3HURA 3WH6A 1EPXA 2OSYA 3OODA 2G8ZA 1B54A 1IT8A 3ANVA 3EOSA 5HK4A 1W1ZA 2GVJA 2JEQA 2Z27A 3BOFA 1EXBA 3CIXA 4R7WA 4U10A 1D8WA 3TQVA 2C1IA 3WQCA 3J7HA 4NQ1A 1A5LC 5H8UA 5AN7A 1PWMA 2HMCA 2XGIA 3COTA 4MAZA 1XM3A 1I60A 1V3IA 4K7VA 4DJFC 1P0DA 5ABTA 2BXZA 1RAKA 2VRQA 1V08A 1XCWA 5A8QA 4AU0A 3SAZA 4IP5A 2W92A 4P7QA 4S3BA 1E43A 3IGXA 3LS9A 4ZQRA 4LV9A 1HL2A 5FA5A 1VBHA 4XAGA 5CC3A 4GQQA 2PA6A 1EGZA 3GTHA 3M16A 3M47A 3FXGA 2HSAA 4GX9A 5BXTA 2D22A 3NSMA 2WPBA 3LGDA 1Q6LA 4QNWA 3WFAA 1RK5A 3EKGA 2I9EA 4HA4A 2J7CA 3MV11 1HO1A 4GACA 1T0OA 4KIEA 4H6KA 4KRZA 4WR3A 5D38A 3NEVA 4ZXOA 4MLRA 5JH2A 1HQTA 2VZSA 3UJ2A 1KFLA 4LUSA 1EGMA 2G4JA 4MJ4A 1S5WA 1HO4A 2E25A 3IEBA 4IJCA 4LOCA 2HPMA 1M03A 3UQNA 3STFA 3NEHA 1E51A 1AMKA 1TREA 2W0UA 2XHYA 5CLTA 4YTTA 4DJDD 3T55A 1PKNA 3I7RA 4ZO6A 4IMEA 3MTWA 3W1UA 5A6LA 4L9YA 3WZ0E 3UERA 1JD7A 3UXIA 4JTUA 2X1IA 3DI1A 1C93A 1LBLA 3IWPA 4RE4A 1EJXC 2I9UA 1K1DA 2NX1A 1G9HA 1Z7AA 1CW2A 3DECA 4JQ1A 3U48A 1PJ9A 1E70M 2QGYA 4AEOA 1GK8A 3UGRA 3SUVA 4HB7A 1UG6A 3R43A 3WX7A 3UWEA 3M5XA 2VL4A 2J9ZA 3G1AA 3WL0A 1PL9A 2GQ3A 2HVNA 4TMBA 3LPPA 1ZZMA 5ABHA 1AH3A 3FGCA 4M5PA 4YWSA 2X16A 2ICSA 4HSNA 1V6UA 1VENA 1AVAA 2XGZA 2Y89A 1T96A 3B8DA 5CKSA 3GO2A 2IQDA 4WGHA 1V8EA 3O15A 4CU7A 3SSZA 4B16A 2XVGA 4D8ZA 2RDWA 1VPXA 3PVFA 1YTKA 3S8HA 1E9IA 2WVVA 5IFPA 2J7HA 2PDGA 3TUUA 1LP6A 1CXHA 1NWTA 2J74A 3IJLA 5DXXA 2ZUSA 4EPDC 3Q67A 3WSUA 4M7TA 2ZZ7A 3RR1A 1WBHA 1F6KA 1CDGA 4AYSA 4CD4A 5EA9A 1V6YA 1PKLA 4BI5A 2XG9A 5DMLA 3VZXA 1TV3A 4IX0A 3EOOA 3GR4A 5A2BA 3PBVA 3EXRA 3CZGA 2W6RA 3IARA 4Y6GA 2G0WA 3NQGA 4JR5A 3DDMA 5H2ZA 2R6OA 1EF2A 4B92A 1EC9A 3W74A 4LS2A 1WDPA 1EDQA 2OR2A 3H4GA 2FHBA 3C56A 3NQBA 2GQ8A 4G2DA 1OG6A 2ZCGA 3UT0A 2DUAA 3DG6A 4FX8A 5CPNA 4GZ7A 3GIQA 2EPHA 3DOPA 3P8JA 2VX5A 4JDYA 3QF0A 1ZB5A 4OOZA 5JXQA 3XISA 2AQOA 4GUHA 5M03A 3LERA 8RUCA 3VOJA 1V6WA 3ZLFA 5LNSA 1TRDA 1YBQB 1ESWA 3B8TA 4RZ5A 3QYSA 5CJNA 4KGJA 4M29A 4HT3A 4OWGA 2JQXA 2PCQA 3IUIA 1WV2A 2BOEX 3SUSA 2V3GA 5JQ9A 3DFOA 2Z2UA 4ZOCA 1O4UA 4DZAA 4MY9A 1QK0A 3A3WA 2HBVA 1AJ2A 4JTTA 3AYRA 3WLRA 4GYPC 2OELA 2PP1A 1IEXA 3WDHA 1JZ3A 4B9ZA 1W1IE 3PS7A 2DSVA 2RAGA 2V67A 4O15A 3ZT6A 3SR7A 1YEYA 3LBCA 1W5OA 4V2XA 1JCLA 3WF2A 1Z9AA 1SR9A 5ABEA 4Y96A 4P8WA 4PB4A 3MMUA 4QLJA 4A05A 3HQNA 3ONBA 3MUCA 2GL5A 1VJSA 1H11A 4PRWA 1NTHA 3TE9A 4RXFA 4UNIA 3N2BA 2NXIA 3W9ZA 1QBAA 4KCVA 4JZ5A 3P62A 3VC6A 4ZODA 4HNCA 5T9CE 3IIOA 1O5KA 4IGSA 3S6DA 4F79A 4B91A 4IX2A 4YIWA 4CEXC 1WXYA 1YPXA 2F38A 1F5ZA 4A3QA 4GBUA 3RITA 3WQ6A 1GVIA 2GJLA 3WBAA 4XX6A 1UWTA 1R3VA 1KWKA 2UWFA 1HG3A 2W63A 2ISFA 4QTGA 5EU9A 4F66A 3GVRA 2EQDA 1EJRC 3B8WA 1VGAA 1R3TA 1XUZA 2I5GA 3SM0A 1UBSA 1C9DA 1ZP3A 2DORA 1DEDA 1FWFC 3A4JA 3O16A 3WJWA 4H6QA 3UZJA 4YTUA 4NI8A 3KVMA 3MSGA 1E0TA 2A21A 3LTSA 2B0MA 3H2MA 3CAVA 5LHEA 4DNHA 4D71A 5F4WA 4W86A 2PC4A 3S3GA 4J35A 4EPEC 1OIMA 2RJGA 5GNYA 2UY5A 1Z44A 3DEQA 4DLFA 1HKVA 3B0YA 2ZXBA 1H50A 1KLZA 3UU0A 3D46A 2QCDB 1A5AA 3ZJ7A 4A21A 5EGRA 4O1AA 1SJDA 4IMAA 3VABA 3B9EA 4E4FA 3IIVA 1EJWC 4JTRA 4PUKA 4WK9A 5F2MA 1QK2A 2FB2A 1FUYA 1FWHC 2Z4GA 4JTSA 2XSBA 1W5NA 2OZ0A 4K38A 3PAJA 3GXIA 5A6JA 5LIKX 2ZFAA 1CGYA 1PEZA 2QEZA 2GK1B 1E6PA 1JVNA 3K5XA 2GVLA 4HVXA 4QGCA 3C0JA 2F2KA 1ECQA 4UTIA 4Q32A 4IUOA 2FKPA 1JAEA 2WMGA 3AS0A 4QX4A 4NJJA 4QIUA 2XM2A 1MUMA 4KS0A 2H8XA 1Q5MA 3N2TA 1UWQA 1GKRA 3UP8A 3MO7A 3S2NA 3KOXA 1F05A 3BW3A 4GOAA 1XLDA 3NWRA 3G8RA 2GSHA 2C6QA 4M19A 4DWSB 5C2XA 2VWTA 4D6FA 1X38A 4PCFA 3GDTA 4W85A 5HDRA 1SJBA 4FEZA 1O95A 3DFSA 8CGTA 1WE5A 2XSAA 2FFIA 3W7GA 3GSMA 2X8RA 3KOZA 2BP1A 1Q6FA 3PBUA 3PZIA 4GY7A 4G56A 1YBQA 3NSNA 3U0HA 3QOMA 2CLPA 4Y90A 2WSYA 1B3XA 4GH1A 3O1NA 1J11A 1FKXA 2YFOA 5CC7A 2PTZA 4H9TA 3LLDA 5DY2A 3GHSA 1Q45A 1N82A 4QR6A 3N3MA 2OZTA 3UG4A 4DBWA 1UQZA 1FFRA 4UTKA 2CXGA 2CLMA 1A5CA 3VKCA 5EMLA 3JW7A 3ZM8A 4DJEA 4F0SA 3VIKA 4U3AA 3WJZA 1IXPA 3CL7A 1YRRA 4NVTA 3S2CA 4EAYA 2V3FA 2D2OA 2YPIA 4EX4A 3GNOA 3K8LA 3NVDA 4QE1A 1KA9F 3KBJA 1OHLA 3PZOA 2QCNA 3Q4DA 1OQFA 2POTA 2WSKA 1K7FA 5HUPA 3CTLA 3RMEA 1UP2A 1B9ZA 3RF9A 3BVJA 3FJLA 4PZVA 2Q8XA 1OF8A 1YNYA 3STEA 2ZRVA 3W00A 3SY5A 4Z42C 4R9OA 3T08A 3M0KA 2INEA 3LI1A 1JFXA 4LBSA 3W7HA 3RN6A 2IPGA 3LPGA 2RHGA 2CLOA 5JBEA 3GR7A 3VKJA 2QUVA 3U6WA 1TIMA 3W01A 3LRKA 3QR0A 2VXNA 1QASA 1KB3A 2PS2A 2O9PA 4OE7A 4YWIA 1QOXA 4JN7A 3DG7A 1SZRA 4A4AA 3B9AA 2BY3A 1P0BA 4LCRA 4Y9OA 2OB3A 5M17A 3H4XA 3QZ6A 1I75A 2QULA 1J10A 2YX0A 3B4YA 4O19A 1RK6A 3DUGA 4HA0A 4IHCA 3LGEA 2G37A 3PBWA 2PDKA 1GYLA 3H24A 4U28A 4MB4A 4TV6A 1Q8JA 3BSHA 5C9UA 3WLIA 4MKSA 1UJPA 2G3NA 4BI7A 1ZAJA 1EDGA 2V2HA 2XIQA 4IUGA 4L65A 1YIXA 2ZRUA 5HJXA 3FN9A 4DQWA 3IJDA 4TU1A 3OEXA 2IKIA 4S3KA 2PZNA 2UY4A 1XSIA 4XZHA 1TPWA 2VGGA 3C0QA 2XPKA 3R10A 6ENLA 2VELA 3BQ5A 3ZSTA 1J0JA 1ADDA 1DHKA 1A5UA 4X9YA 3GRIA 1XBZA 5DQPA 1LWJA 3WD4A 5A2AA 2DJLA 3ITGA 2RFGA 3IAQA 3VZZA 4MDOA 1EJ7L 1MRQA 3V3WA 2ZX8A 4FP1A 2QYGA 1TPH1 3EOEA 1VFHA 2ZA3A 3NQ6A 1G4EA 3TKFA 4MM1A 3OVPA 4W87A 4KWSA 1SJCA 1W3JA 2ZIDA 1TQXA 4NJKA 1B4KA 5LSMA 4GO9A 3IACA 3GW3A 3H26A 4PSRA 1JFHA 4KFOA 3CQ0A 3AMGA 4IMCA 3UFYA 3FW6A 4H41A 3C2RA 2BHUA 2GSEA 1E5NA 3AAMA 4AWSA 3KL0A 2HVMA 3L0KA 4ENLA 3L4ZA 1UC5A 1JPMA 1WBJA 3VNYA 3FCPA 2W61A 4V27A 4KFNA 2PLCA 3W1QA 2BGNE 3L4YA 3W3OA 3DHDA 5KETA 1POJA 1EJSC 2Y63A 2OWXA 4HSOA 4KPLA 2VX6A 1ODUA 5CPQA 3GKAA 5C8BB 1RD5A 4FZIA 3A23A 2Y5SA 3VA8A 3APGA 1CBGA 2EEXA 3CH9A 5GNZA 5D9NA 3V1PA 1E9ZB 1XH1A 3M7SA 1S5TA 3LBOA 4IPPA 3CHCA 6TIMA 2DPEA 3UCQA 3OBEA 4KCTA 3HV9A 3USZA 1FKWA 2E09A 1LLOA 3CNYA 5KEZA 4CU8A 1XFCA 3QBUA 1B3VA 1LLZA 4A3HA 4JQ4A 1J0ZA 2HK0A 3NZQA 1PX4A 5D37A 3NQFA 4MB1A 2YGYA 4P61A 1NEYA 3VU2A 1FWIC 1YDVA 4HU4A 2Y7GA 5DF0A 4MF4A 2Z6JA 1G6CA 3FAWA 2DDXA 1Q7QA 3GXMA 2O4MA 3T0BA 3GNNA 4IZGA 3T8LA 3ARQA 1NWSA 1MDLA 2CITA 1A4LA 1RPKA 2OU4A 1KXTA 4D8LA 2Z29A 2A7PA 2G3JA 3K8KA