3W2UA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-193
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-193
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2uA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2uA01
2GVJA 1UCWA 1B57A 4GUIA 4NZJA 3G1SA 3S1VA 1PIIA 4AHPA 5I3FA 3QZEA 3W7QA 4KFPA 4O53A 4UR8A 5LSMA 3DU0A 4IX0A 2X1TA 3W76A 4AB4A 1DHPA 1JCNA 1OF8A 1LBLA 2QAPA 3C6CA 3ZR4A 4TMBA 1VCFA 1JCLA 3G1VA 3TCEA 4RXGA 1OHLA 2WNZA 1JCJA 4Z0SA 4QSHA 1TPVA 3TSMA 3L5AA 4H3DA 3OA3A 3W2LA 1SU5A 1XBVA 1ZFJA 3CHVA 4K37A 1KBIA 5IBXC 4WY0B 5AHMA 4LUJA 4AWSA 2R14A 4IMCA 4HSOA 4MVAA 2E1DA 3MP3A 4JTJA 3CT7A 4UR7A 3GX9A 4O11A 1OFQA 4ZQNA 5LNWA 4GXMA 3MUXA 4KWVA 3UNDA 2V2CA 4X22A 4ORIA 3QW4B 4O52A 4O12A 1QOPA 4IJBA 3O05A 5FF7A 5F4XA 2AAMA 3CTLA 3UZ5A 2WQPA 1C29A 1B4EA 4D2JA 3HGOA 1Q6OA 2WNQA 2YYTA 3E96A 2BSLA 5H91A 3HOJA 3NPWA 3VCRA 1NEYA 4MOZA 5KITA 5K4XA 1TO3A 1H5YA 1QWGA 1WA3A 3TXVA 2YX0A 1QNVA 3EX2A 1HO1A 3W1TA 3BLEA 2WNNA 1RV8A 4LW7A 5HWNA 1N8FA 4UTKA 3B05A 2ZA1A 4X3ZA 2RH9A 1K8XA 1H1YA 1M5WA 4BI5A 2NWRA 3L21A 1TIMA 4JTTA 2ZFAA 2ISWA 3MP5A 1ME7A 3SECA 4MFEA 1I8JA 3P62A 4IMEA 2FTPA 4N9BA 1CI1A 5LKYA 3ZWSA 4JDYA 4LY8A 4ADUA 3GYEA 2VELA 5CZJA 1YXYA 1LBMA 5HMSA 2QCHA 4MZYA 3NG3A 1QFEA 2TMDA 5T26A 4IXHA 4UTIA 3AJXA 2C14A 3MO7A 5EYWA 3TK7A 1LLWA 1JUKA 3Q94A 3C61A 1SZGA 2DZUA 2AGKA 3T7VA 2A7PA 3W7GA 5CG7A 4UFLA 2GQ8A 4NJHA 3N19B 3NL5A 4O57A 4O19A 1R46A 5A8GA 5A5WA 3M0ZA 3NR0A 3EXSA 5KZEA 3E49A 1JQXA 3CB8A 4WOQA 1XM3A 4XBKA 1M7PA 2JKEA 2CLOA 4UTMA 2I1OA 1PHWA 4S1FA 4MFDA 3NZRA 1RD5A 2QCFA 3S1XA 2G5WA 3M16A 4X9SA 3W1UA 3FA5A 4ZL1A 3HQ1A 4K39A 4FIQA 3OBKA 2C6QA 3FOKA 3TX9A 2QCEA 2QCNA 2RDUA 1KA9F 2J9ZA 1VCGA 4NX0A 1VCVA 4LV9A 4UNKA 1GVSA 3R8RA 3W83A 3BPWA 3GIYA 2ZYFA 3KRUA 3DXIA 3YPIA 2DZVA 4AWTA 2V81A 2NV1A 2YXGA 2E77A 3UY8A 4UC5A 3I6RA 3DH7A 2B7QA 1IXPA 1OFBA 4QNWA 2E6DA 1W5OA 1FQ0A 1P4CA 1WYIA 1HL2A 4O54A 2A21A 3CWOX 1T99A 4ORMA 4JTIA 3SSJA 2ZRZA 1IIHA 1SW7A 2WSYA 3DFNA 3QJAA 3EWZA 3F03K 1X8FA 5F4WA 2DZSA 3E9AA 4UNLA 3P74A 3TQVA 3R2GA 1N55A 4JIPA 3TAOA 5LGZA 1TRIA 4MUZA 2BZNA 1A5SA 1ICQA 3PR2A 3W2KA 3NNTA 4NJJA 1DL3A 4QNEA 1TV7A 2QEZA 1JCYA 5D03A 1N7KA 3IVTA 1VR6A 4YCOA 4NJKA 4MY9A 3R12A 5C2XA 4BWLA 2X1SA 4JYEA 3NQ7A 2D73A 1LBFA 4LRSA 3MHGA 2A6NA 2O7SA 4TU1A 2PC4A 3RK8A 4TMCA 1G6CA 1UUOA 4LS2A 3QEZA 2EAWA 2B7OA 1A5CA 2GVGA 4MYAA 1TPB1 3UWUA 5FI8A 1EUNA 2YCEA 2V8ZA 1TCDA 1XKYA 1GOXA 1KTNA 1WBJA 4RZ4A 1EUAA 5AHLA 5D33A 2EHHA 1Z44A 1H63A 1AL7A 4JTHA 1TMHA 1QPOA 3P8IA 5HR7A 1TYGA 3TJLA 2W0UA 2WPBA 4JY9A 4UUIA 3OVQA 4AMAA 1T0OA 1TTQA 4OV4A 4FNQA 2OT1A 3N3MA 3L5LA 3VE9A 1OFDA 1GPWA 1MEWA 1OYAA 2DZPA 3PY2A 1W5NA 4O15A 4U28A 1KM4A 2C15A 3NL6A 3QFEA 4BWLC 3H54A 4NNBA 5BMWA 3W1LA 1AW5A 4CCCA 4FB7A 3LCXA 4Z1AA 4KFNA 4K6AA 1KM1A 2V5LA 2CZ5A 1YTEA 1VRDA 4JTLA 3W71A 1KM6A 2J24A 3LBMA 3ATZA 4O16A 5HNRA 3QH2A 3ZFHA 2BWGA 3DKJA 3M41A 3EXRA 3LRMA 4WY0F 3NQ2A 1BEUA 4NXSA 3RMJA 4GBUA 3QMSA 2Z6JA 3G3DA 1DBTA 4JXCA 2HS6A 3PVFA 1BKSA 3HG2A 4JTFA 4RX0A 2G97A 2OZ0A 2Q8ZA 2C0AA 3W1PA 4Z08A 3L67A 2QJIA 4GE8A 3TNOA 1SO4A 4N02A 3STFA 2FLIA 1LROA 3S42A 1UB3A 3LCIA 1GVQA 3FIGA 5AB3A 1VPXA 3SJ3A 3R89A 4RR4A 2CZEA 3W86A 1SR9A 3PBVA 3M47A 3ANYA 3LCFA 1TPDA 4Y90A 1H50A 1NF0A 2Y61A 4EIVA 2B7NA 3DFQA 5D2XA 3BGJA 3GDLA 3LLFA 1P1XA 3EKZA 2Y7EA 5AHFA 1XUZA 4IUOA 4RCXA 4IMFA 2QCLA 3EKLA 1SQ7A 1NSJA 3S5YA 1FX6A 3W7EA 2Y62A 1GVRA 4K38A 3LTYA 4R33A 7TIMA 3C52A 1OJXA 4DF1A 2VEMA 5G1YA 1SZNA 4H6KA 3HGJA 4HPXA 1FDYA 1OX4B 2PRLA 3W2NA 1CW2A 5TIMA 5FF3A 3O06A 3EX6A 2QCDA 1QPNA 4ZQMA 2NXHA 5KINA 5AC7A 2QR6A 3T44A 3TW7A 3T78A 3MW7A 4A3UA 4QM1A 4DEFA 3IGXA 3WK0A 4PL1A 2ALDA 3LTPA 2H8ZA 4JNMA 5DBTA 3TMQA 1U83A 1R2TA 5E0KA 4EOUA 3O15A 2XFWA 5D32A 5TQLA 2VEKA 1OFPA 1B4KA 3HGSA 5D09A 4ZQOA 3G8RA 2C13A 4XBSA 3BV4A 3O6DA 3GXTA 4IGHA 1JR1A 3M43A 2NX1A 2JGQA 2EPHA 3W22A 3W85A 3UZJA 5F4SA 2IQTA 2CLKA 4EF9A 3W7MA 1PCKA 4HPJA 4JS3A 2BTMA 1S5VA 2R91A 1G4PA 3CIXA 5TBOA 3LM7A 2FB2A 3CLMA 4OBTA 2NLIA 4JTSA 1MO0A 4FF7A 1BWKA 3HF3A 1IIGA 3HG5A 1Q6LA 4O18A 1Z42A 1X1ZA 3GLCA 1VHCA 3LV5A 1QOQA 1QO5A 5HUPA 1OK4A 2Y85A 4O13A 4HSNA 3DFTA 1LYXA 4Z1CA 4QJ1A 3STCA 1LRQA 3IV3A 4I9AA 1FCUA 1VZWA 1R47A 2CLHA 3A9IA 1H1ZA 4A22A 3FKRA 3LOTA 3GKAA 3KVKA 4GUJA 4N2YA 2OX1A 3NQVA 1XL9A 5I3JA 4NVTA 1VC4A 3LRKA 4YLWA 1JVNA 2H3DA 2GOUA 2ZBTA 4K8EA 4Q33A 5FEWA 3PG8A 2NXIA 1BWLA 3MP4A 3O1NA 2CU0A 5C5YA 4CQAA 1DOSA 3W7CA 3QRHA 5I3KA 1TV5A 4K7VA 1TTIA 1RVGA 2EGZA 1OX6A 3LCGA 2F84A 3Q58A 3MYOA 4UTLA 3PSWA 5K7JA 1Q45A 2DJXA 1F5ZA 5F1UA 2NUXA 3UPWA 2A7NA 3I68A 3IIPA 1QMLA 3L0KA 5BOOA 2Z0IA 4LT9A 1KV5A 5L6UA 3G18A 1IGSA 1VYRA 5K9DA 3C2VA 1T96A 5E1QA 3EX3A 3IGSA 4UMBA 2JBMA 4JEQA 1ZENA 2PURA 5DXXA 3GXPA 4M6VA 4Y96A 5BRBA 2NV2A 3W6YA 1EP3A 3TSBA 4FX7A 3BG3A 5AC6A 1O5KA 3BVJA 3DHFA 3T4CA 5AYYA 4EF8A 3NGJA 1C8VA 3NQGA 4TIMA 1YTDA 3IIOA 2ZZ2A 1EB3A 1FY6A 1KM5A 3F1QA 3W72A 3HMJG 3F4NA 1FCQA 1DKWA 4MJZA 4M6PA 5K9CA 1O95A 4PL2A 1GVFA 1GTEA 2GQAA 3N2XA 1H7OA 3NO5A 3G1YA 1A5BA 1SSGA 4LV4A 4I7VA 3W84A 3A22A 5CZTA 3S5ZA 3MI3A 1L6WA 3DI0A 3EX1A 1ZNNA 3LTSA 1I2QA 2Y88A 5AN7A 1JJKA 3PWAA 1LRTA 5HWMA 1SO6A 3LHZA 4JN6A 4E0CA 3EWXA 1YLVA 3W87A 4UFIA 2FDSA 1MEHA 1PVNA 3ATYA 1KM0A 4O14A 3T40A 3W2JA 2GJLA 1DJQA 3QSRA 2Y89A 3W1AA 1XBZA 3RF9A 1ME9A 2X16A 4ZQRA 1KV8A 1TV8A 2CLFA 3NM3A 5CPOA 5G2IA 1FWRA 2PCQA 4JDBA 3MYPA 3HPXA 3UWZA 3THQA 3GAKA 1H7XA 1R30A 2C1HA 3TIMA 3HJZA 2W79A 1MZHA 4NJGA 3FLUA 3B0PA 3KOFA 1UBSA 3MHFA 1A53A 4DBDA 5F2LA 2BXVA 3IVSA 2FJKA 2I9EA 1VGAA 4JYFA 3BLIA 2WV8A 3JS3A 3RFAA 2Y70A 1H61A 2Q8LA 2OJPA 4MLJA 4UTWA 4QAIA 3G22A 3UD6A 1I2RA 3GKFA 1CX9A 1Q6QA 5LNUA 3PBYA 2NWSA 1JCXA 2RKXA 4S2BA 2VKZG 1K03A 4BI7A 5SWUA 5KZMA 2QDGA 6ALDA 3GXNA 3N9RA 1IF2A 1DJNA 5LNVA 4CNOA 1OFRA 5EL1A 3P5YA 3BG9A 4OHQA 3FJLA 4UCGA 1OYCA 5LHFA 2G95A 1AL8A 4O1BA 1RQHA 5BNKA 2ZZ7A 3W7LA 3I65A 3R5EA 1V7YA 3LX9A 1KFJA 3GR7A 4FXSA 5AHEA 3UWWA 3B04A 4CCEA 5H2ZA 1S3HA 2QCGA 1ML1A 4M19A 1G69A 1I2NA 4FIRA 1YPIA 3S8HA 1W3NA 2C16A 4MZ1A 4UTWC 4ONVA 1D3HA 3L66A 3V75A 2O7QA 5CSRA 1FWNA 3CM4A 3G1XA 1SZFA 5LNSA 3C2OA 2G96A 4LVDA 4RLIA 3HO8A 1T8XA 4TX9A 1VLIA 1HFBA 1I2PA 1YPFA 4R7JA 3Q2DA 3KRZA 1VJIA 1W1ZA 2VFEA 3EWWA 5D05A 2JGYA 4HKPA 5D2WA 4KWWA 4HN4A 2Z1BA 4TO8A 2YPIA 1EA0A 3QSTA 4OE7A 4UMCA 4YXGA 4NZFA 1ICSA 1YDVA 4IMGA 3HG3A 4N9DA 5ABTA 3I7QA 5EA9A 3SR7A 1FDZA 2OCZA 1W37A 4PEKA 5FF0A 4O8RA 1Z48A 3NQAA 1XDLA 3GVGA 4O4WA 3NM1A 1EP2A 3LHUA 1JCMP 1J4EA 1HTIA 3ZWTA 4LVBA 1S5WA 4PTNA 4P61A 1YDNA 1ZAIA 3W75A 5I3IA 1B3OA 5LHEA 2BLEA 2E6YA 4LVGA 5F2IA 5FESA 3G1HA 3IIZA 4NNCA 1JRBA 4MYXA 2YR1A 2X2GA 5G4WA 2VFIA 5DBUA 3EWUA 3N73A 1M7OA 2WO5A 3M7WA 2QUVA 3KVLA 3U2OA 2TRSA 5AYZA 4UMAA 1OF6A 1IXNA 2OT0A 4UTTA 3C8FA 3TXZA 4DO6A 1PV8A 5HULA 1WQ5A 3NQ8A 1I45A 1GVOA 5G2HA 3H55A 3EX4A 1LLZA 3LB0A 3W3OA 1WOBA 3TFXA 2FFCA 2QF7A 3UY7A 4A21A 3WJWA 2H6RA 4LNYA 5C6MA 1QCWA 4AAJA 4O17A 3HIJA 5DY3A 4NX5A 3QPYA 5DLCA 4K7YA 3G1FA 4QIUA 2UV8G 2GJNA 4UTHA 3NXFA 4ZZ9A 2FPYA 2C19A 3SI9A 3LRLA 1J5TA 3NA8A 2KZHA 3G3MA 5CPNA 5G4EA 4BFAA 3SGUA 2QAFA 3M1ZA 4RXFA 3A23A 2ZCGA 1X1OA 4AEOA 3LV6A 1GT8A 5GVJA 3B0VC 1G7VA 1ONRA 3P80A 2ZA3A 4M5PA 3E12A 3A5FA 5DCBA 3GNDA 1LP6A 3JR2A 3M6YA 1TJRA 2JK2A 4IX2A 4DXVA 4P2VA 4UTTC 2H3BA 4QITA 3LLDA 4AH7A 4FO4A 1AW2A 3GB6A 1A50A 3N14A 3TE9A 4JTUA 2JKAA 4FNTA 3W74A 4Z1DA 1H7PA 2Y6ZA 1PL9A 2HTMA 2A0NA 3ABSA 2ZRVA 5LGXA 3V1PA 3ZS4A 2A1YA 3W7NA 3UWQA 3W7IA 3FKKA 1PCWA 3NQMA 4U4MA 4X2RA 3QC3A 5EY5A 2B7PA 3HG4A 1LDCA 4IWWA 1C9DA 5DXYA 2OMAA 3A21A 3NQEA 4XKYA 3UYCA 4AHQA 3DFSA 2XN2A 3BW3A 1I4NA 2B0MA 2QDHA 2YZRA 4R34A 5DCEA 3GDMA 3S5NA 3NPUA 3TROA 4TR9A 1AMKA 4JY8A 4DF2A 3PC0A 3CPRA 2YW4A 3UWVA 3HPSA 1FCBA 4IXXA 4BF9A 3MI6A 3NPVA 5I3HA 3PUEA 4JYDA 1TPH1 3O63A 4NNAA 3IVUA 3L68A 2NUYA 3GDRA 3PUDA 5CSSA 1NVMA 4LOCA 2ZRUA 1OFEA 3G24A 1FWSA 3VKJA 1SPQA 5KMYA 3KX6A 3RNDA 4O1AA 3QM3A 2P0OA 2GQ9A 1H62A 3SFKA 1G4TA 4AWUA 4HNNA 2R8WA 2ATSA 2V9DA 3DFPA 3LXBA 4AF0A 1O5XA 1J2WA 1K3UA 1KW1A 3THAA 2Z2UA 4UFJA 3GAYA 2A85A 2ZRWA 1GJPA 4K36A 5LNRA 2VEIA 3GR8A 2Y7DA 1AK5A 2I14A 1HO4A 2V5BA 3P67A 1SW0A 3TSDA 4DO5A 5F2MA 4N6EA 3TU9A 2QJHA 1W8SA 2Y7FA 4XTDA 1GTHA 3LI1A 3HGRA 1TPUA 4DPPA 2E5DA 2E09A 2Q3OA 3G1AA 3T55A 1YTKA 1TPC1 4I7UA 3GDTA 5HR6A 4LRTA 5IM51 2FQIA 4PFMA 1LZOA 1RQEA 2AQWA 4LVAA 4WUIA 2ZRXA 3BW2A 5AFDA 4A2RA 1LTDA 4FX6M 4RK8A 1TPFA 1OX5A 4DQWA 4PA8A 4FNUA 1OYBA 3M9YA 4NUWA 3STGA 2X30A 3LXAA 1XBYA 3WK1A 4WX2A 4ZMGA 3NAVA 2YGYA 3W1MA 3PB0A 1JRCA 3QF0A 1W3IA 1L6YA 2DU2A 3W1NA 4ADTA 3TUUA 1SZEA 2A6LA 3WJZA 3W73A 1ALDA 5HWJA 4E38A 2QCMA 4CQ9A 5DY2A 4M7SA 3M5YA 1DQXA 1K7FA 3LCHA 1F74A 3TDFA 3DBPA 2GVLA 1ZCOA 3JRKA 4I7WA 4IPJA 3LBCA 1I2OA 2DZXA 3DHDA 4JIQA 1PE1A 2QUUA 3QQ1A 2E68A 1LRNA 3MI2A 4MY8A 1EPXA 3B4UA 1JUEA 2A4AA 3W7PA 3M5XA 1GZGA 1FDJA 2JKPA 3PSVA 1F76A 2ZZ5A 5CGQA 4XQ6A 1SUXA 3GNNA 3NZ1A 2V30A 1ZAHA 4RZ6A 1ZJIA 1XI3A 3C0JA 5G5IA 4HNVA 5FF4A 4JX4A 1O60A 2WSRA 5K2ZA 1Q3NA 3S1UA 1D3GA 3UXDA 3F4WA 1YYAA 1KFLA 2PRHA 3TR2A 3C3NA 4N4QA 2RFGA 6TIMA 1P0KA 3VE7A 4CLMA 4J9JA 2ZTJA 3CC1A 2CFFA 2EKCA 5L9FA 3TMLA 1WV2A 3KFTA 5KSWA 3LGEA 1UASA 3W7HA 3W2MA 3B8DA 3USBA 1LOQA 1TTJA 4RZ5A 2CLEA 5BMXA 3W1RA 2RDWA 3QW3A 3CU2A 1Q6RA 4FNRA 2VXNA 1NFBA 1XFBA 3BK0A 2C18A 3NOEA 1P5BA 1G7UA 4QQ3A 1VQTA 3DGRA 5DELA 5K3VA 2ATMA 1H7NA 4PCFA 1KFBA 4C1LA 3DFOA 3BARA 1GG1A 2Q3RA 4GWEA 1EX5A 3W7OA 1H51A 4MIMA 4N9EA 2V2HA 4EVZA 1K02A 3MWAA 2VOMA 4FEZA 4WY0A 5D30A 5C55A 1XBXA 3P60A 1KTBA 1E51A 1QR7A 1XUUA 3ABQA 1R2RA 1DORA 1FXQA 2TPSA 5G1TA 3QQ0A 4PC8A 3WJXA 3UQNA 2CLMA 3RLUA 3DI1A 2WKJA 4JX5A 1DVJA 4N9CA 1QAPA 3L0NA 3NVTA 3DKLA 2J9YA 3GK0A 3KVMA 4G1KA 3UPBA 2XN1A 4OWGA 3STEA 2DP3A 4OQVA 4Z0JA 3W7DA 2ZQ0A 1KBJA 3ABOA 1SFJA 3PULA 1V5XA 1OFAA 1L6SA 2V0TA 3IGUA 3C2EA 3BW4A 3E02A 3PBWA 2ZZ6A 5EMUA 1OABA 3C2FA 3OVRA 2HS8A 2YYUA 1Y0EA 2DZWA 4MPQA 3W23A 4Q4KA 4UTUA 4BK9A 3NYZA 2WJZA 3W07A 4UTJA 2YFNA 5J5DA 5CPLA 3G1DA 3EWBX 1O4UA 3P8JA 5D37A 2B4GA 1FBAA 4JICA 5FEPA 2PE4A 3NEVA 1FCVA 1Z41A 1ICPA 4KKXA 4JTKA 4HHPA 1L9WA 3OEXA 4DO4A 1RPXA 2ZZ4A 3MHUA 4YWIA 2CW6A 1F2JA 1RZMA 5AHNA 2FPTA 1EP1A 4GUGA 3BGGA 4E2DA 1KLYA 5D2YA 3O07A 1F73A 2H8XA 4UFKA 4JGDA 4FX8A 1DQWA 3CQ0A 3TQ0A 1HG3A 3FS2A 2QJGA 3NL3A 4O4VA 2NX9A 1EIXA 3WK3A 4LS1A 5C54A 1SO5A 3M5ZA 1JUBA 1D9EA 3QMTA 1G4SA 5J5RA 3PB2A 4JTEA 3HB9A 3NL2A 2VFDA 2E5CA 4JX6A 1ZALA 3SIZA 1GYNA 1LCOA 3M44A 3QPZA 3Q37A 4UIOA 1H7RA 4ADSA 1AW1A 4LU0A 4IMDA 5FEZA 3FYPA 1OFOA 2NXGA 2Y63A 3IIVA 4GJ1A 4O1CA 3WJSA 3G0UA 5LZLA 3L65A 3IEBA 4O0ZA 5K9XA 3TJXA 4WXZA 4XZ9A 1FWTA 4YL2A 4C1KA 1B9BA 2ZZ1A 3P7YA 3VFLA 3O8AA 3FYOA 3WK2A 1WBHA 4WJEA 1FXPA 3DAQA 2HMCA 1TRDA 3TC6A 3TAKA 3QYQA 1W5PA 5CKSA 1X6UA 3QMRA 4MKNA 5D38A 1TREA 1XC4A 3DZ1A 1TPEA 2VFGA 4R53A 1TQXA 1EWDA 1X7FA 4DF0A 4DELA 1OVDA 2F7FA 2RHGA 2ZA2A 2W6RA 3NQ6A 4M7TA 1W3TA 2DZTA 4AXKA 1KM3A 4CCDA 2ZDRA 3HPZA 1K8ZA 3LXCA 2QCCA 1ZY9A 1OK6A 1MEIA 3G0SA 1VYPX 5AC8A 4QISA 5HUOA 3C2RA 4AHOA 4NXKA 4ZQCA 1QPRA 4FXRA 3KAOA 1JULA 3L2IA 4HNUA 3SY5A 2R94A 3W1XA 1ADOA 1WOAA 1F6KA 1QPQA 2NX3A 3LCWA 4YCPA 3W7JA 1LOSA 4DBEA 4GUHA 3W2UA 2X1RA 2Y7GA 3GDKA 4O0KA 4IQLA 3NPXA 1VS1A 2QUTA 2VC6A 3LDVA 3TH6A 3S6DA 3W7KA 1IXOA 4L4MA 3U8GA 1F05A 4OV9A 4IPIA 1U5JA 3WJYA 2ZZ3A 4WOZA 1F6PA 2EF9A 3TKFA 4UFHA 3TV8A 1ZHAA 1TPWA 5FF2A 1NF7A 1W5QA 3SGZA 1WAUA 3EXTA 2FPVA 5DCDA 4MJMA 5HINA 1W5MA 2FB3A 1F7BA 1KFKA 2C3ZA 4NT0A 4K8HA 3TA6A 1TQJA 1P0NA 1G4EA 3MMTA 1GEQA 3BLFA 3SW6A 3G8EA 3UXAA 4O10A 4ML9A 2GUUA 3EWYA 1MXSA 3DENA 5KTLA 5FEXA 1JQVA 3KXQA 4HIBA 2RDTA 1LOLA 3TQKA 4JD4A 1SW3A 4CNPA 4GRSA 5AYXA 1UUMA 5HQEA 2YDAA 2DORA 1YADA 4JTGA 3A5VA 2A2IA 1K7XA 1GQNA 3KHJA 4WQ6A 5D2VA 4JR5A 3LHVA 4LUIA 3HBLA 1LORA 4RJEA 2QKFA 1UJPA 1ZAJA 2J27A 5G2WA 2LLEA 3NQFA 4FNPA 1GYLA 2FIQA 4KFOA 3N9SA 1YXCA 4NU7A 5AHIA 1S5TA 1KLZA 1O94A 2CLIA 3U6WA 1WDWA 5CZSA 2Z6IA 3GZ3A 4FNSA 3OHIA 4LTSA 3KVJA 3S5OA 4ICNA 2ZTKA 4CNNA 1VYSX 3I7RA 1G67A 2E6AA 1QO2A 4YMZA 1BTMA 4L4LA 1AG1O 5K4ZA 4IOTA 4FHAA 2TSYA 3IIXA 1TJPA 3D0CA 4A2SA 1EWEA 4H4IA 1YXDA 3E0IA 3H53A 1GWJA 3PG9A 3IRDA 2ABBA 2ISSA 3W88A 2CWNA 4UXDA 1WX0A 5EBUA 2DJLA 2V2DA 3L0GA 3UWYA 3B0UX 1TSIA 4XKYB 3I7SA 3C4UA 2V82A 2P10A 3P81A 1XDMA 3ABRA 4POCA 3TC7A 4PODA 3VNDA 3W7RA 1W0MA 5EKYA 3O16A 2X1UA 3TFCA 3LI0A 2A7RA 3PF3A 2VENA 3MBDA 1GG0A 3LHWA 5F1VA 4O1DA 4N4PA 5U4NA 3CEUA 3L5MA 2ABAA 2CLLA 1KTCA 3G0XA 5BW6A 2XN0A 4LC8A 3W70A 1K7EA 4XTIA 3WFAA 2A5HA 2ISVA 1SO3A 2YSWA 3BO9A 5CZ0A 5HJLA 2VFFA 3C56A 3N34A 3NDOA 1VH7A 4M6QA 2WOQA 1W56A 2E5BA 4BI6A 2QCDB 1OG0A 1H60A 2GPTA 3LERA 4AF0B 4WZHA 2TYSA 4GFSA 2CZDA 2VFHA 3LCLA 2PRMA 3W1QA 1IXQA 1KFEA 1VHNA 4Y9AA 1TTPA 1DV7A 3CEPA 3CWNA 3L9CA 4ZQPA 3W9ZA 2ZRYA 5AOUA 1EEPA 1WXJA 3CIWA 4WD0A 1KM2A 3P5ZA 3RU6A 4LVFA 4NJIA 3OVPA 3FFSA 3B03A 8TIMA 4O28A 2E6FA 3EB2A 1OX4A 3SZ8A 2WSQA 4MZ8A 3O6YX 4RKAA 4XUGA 3ELFA 4N6FA 4OU1A 4XWUA 4A29A 4DPQA 4GNJA 1W54A 2P1FA 3TW6A 1RQBA 5MHBA 3NQCA 1QDSA 3MBFA 1SSDA 1VLWA 4RV8A 4PH6A 3PS7A 4OT7A 3B06A 3LHYA 5CPMA 1SFLA 4AVFA 5KZDA 4HNTA 4NQ1A 5E93A 3N2MA 1LM1A 4LC6A 4ZVJA 2J6XA 3PUOA 3KRSA 2BX7A 2HSAA 1HUVA 3M5VA 3NQDA 1A5AA 4LWWA 4EWND 2H90A 3A24A 3O6CA 5D2TA 1KFCA 3PBUA 2CZFA 4B5NA 4Z1BA 1XXXA 3P82A 4BR1A 3LHTA 2YFOA 3K30A 3VI2A 3S9YA 5EPDA 3BG5A 1W31A 3INPA 3RLVA 1RR2A 5D04C 1MSSA 3S1WA 4S2CA 4GC4A 1M6JA 3MJYA 2J88A 3FEMA 3P61A 3OG3A 4E2BA 1PHQA 1FUYA 1YDOA 4GUFA 4W9TA 4OGZA 1R2SA 4LS0A 5I3GA 1XCFA 1L2UA 4MY1A 4CQ8A 1K8YA 1THFD 3PM6A 5F2GA 3R13A 1ME8A 1FWWA 4ALDA 2J9XA 3S0CA 1TB3A 3P84A 2NUWA 1NAL1 5D02A 3FJ6A 1H7WA 4O50A 3AO0A 5IBXA 4MLRA 2VEPA 2YW3A 5U7SA 4Y6GA 1PS9A 3PAJA 5DN1A 4Q32A 2NZLA 4HT3A 3EEGA 4Y8FA 4UFMA 3OIXA 4WXYA
chains in the Genus database with same CATH superfamily
3R94A 4J2PA 3D3AA 3BICA 2HZGA 1GZ1A 3OG2A 1B57A 4GUIA 2NQJA 2V67A 4OOUA 4C60A 1UR9A 5CJ5A 3W7QA 3E0VA 1EGMA 1ZQ5A 1DHPA 1LBLA 3WLKX 3ZR4A 1JCLA 3TCEA 3PHAA 4Z0SA 1TPVA 4IP7A 1UIOA 4D6CA 3CBWA 4H3DA 3BSHA 2WM0A 4J1OA 4MUPA 5JMUA 3F2BA 1XBVA 3CHVA 2C8NA 1PAMA 4BEUA 4CNUA 3W81A 3PZVA 4GZEA 3WQ8A 3REQB 1XX1A 3MP3A 2JALA 3UZXA 4UR7A 3MSDA 4JZ5A 1MZRA 4UQ9A 4H83A 4KWVA 3UNDA 3B8SA 3PPHA 4O12A 2JF6A 4NILA 1KCLA 2AAMA 2OX4A 3VDHA 1LWJA 2F2KA 1EC7A 3ARSA 4WDUA 3U2ZA 2WQPA 1C29A 3TYAA 2PP0A 2CERA 1W1IE 4YN5A 4GD0A 4D2JA 1LUCA 4HOWA 1KQYA 2WNQA 1F8IA 3SQMA 4PUNA 4WIWA 1W1VA 3VCRA 4MOZA 3UZZA 2NQLA 4R7WA 2Z27A 5E5CA 1Z7AA 1WA3A 1R3WA 4EPBC 3CT2A 1EC8A 1QNVA 3V0TA 2WBKA 4CVUA 2OSXA 5CSYA 3GC5A 4GNKB 3WQ4A 1RV8A 1NDZA 5HWNA 2OELA 2QQ6A 3SCUA 1N8FA 3AS3A 1A5NC 3A13A 4X3ZA 2XISA 1K8XA 1H1YA 1ZRQA 1XYLA 2OKOA 2ZFAA 2PDWA 1LG2A 3MCOA 3MP5A 4F2UA 3RHGA 4GINA 1IR2A 3QHMA 5LXXA 1YQ2A 3RRAA 2G8ZA 5LKYA 3H2EA 5CBJA 3O0KA 3PPFA 4MMWA 5HMSA 3CAWA 3IJ8A 3NG3A 2ZX5A 3GNXA 4IXHA 4UTIA 3MO4A 2C14A 1W9BM 1VFMA 2REQA 4RDWA 2OPJA 2AGKA 3GTNA 1BYAA 4BS0A 3FA4A 5CG7A 3NFUA 2Y5JA 2PLJA 3N19B 1ZBCA 3NL5A 5FJTA 4O57A 3WNLA 3NR0A 1W1B1 3ITOA 3LPFA 3JUGA 1XM3A 2A3AA 4MTVA 3AJ7A 1PHWA 2ZE0A 4S1FA 2XFFA 2VQTA 2CIPA 3S1XA 2G5WA 5CAHA 1JEZA 1TR1A 3OZMA 1XG4A 9XIMA 1V3IA 3T0TA 2YIHA 3GH5A 2QCEA 2TAAA 4NG3A 4KH2A 2XJ7A 4NX0A 4HOXA 3VILA 3ID7A 3U2EA 4M56A 3BAYA 3GW3A 4IIBA 2IKHA 3BPWA 3GIYA 3KRUA 2WHLA 3DXIA 4I5XA 3MUZ1 3CUIA 4IQEA 3WLRA 4AWTA 3CQJA 2E77A 4UC5A 3VKCA 3W24A 3DH7A 3VUPA 4QNWA 1R7OA 5A6BD 1W5OA 4B5UA 4O54A 1YPXA 4JTIA 1IIHA 5IHRA 4GACA 1C3FA 1SJCA 2VGBA 2Z1VA 1X8FA 4GYJA 2DZSA 4HTYA 1RVKA 3E1F1 4LYQA 5LGZA 1PJ9A 1TRIA 3PR2A 5IFPA 1R7AA 2FGLA 3W2KA 4LJ3A 4JEJA 1DTUA 1OWQA 4QNEA 2QEZA 2FYMA 3BQ6A 3LENA 2VYOA 1N7KA 5BWFA 4NJKA 4MY9A 5C2XA 4JQ1A 2OZTA 1RCQA 1I1XA 4LRSA 2A6NA 3MHGA 3RK8A 1G6CA 4LS2A 1XPYA 2X41A 5XINA 2B7OA 1A5CA 3UWUA 1H11A 4QLLA 3CXOA 2QULA 5DF0A 2GDUA 2G3FA 2HQAA 4H8NA 5FD0A 3CQKA 2A3CA 4GA8A 1XRSA 1XYCA 3UJ2A 3T0AA 1TMHA 3P8IA 3UJFA 4XISA 2CBIA 1MNSA 4QE1A 4CQCA 3L5LA 3RX3A 4ERAA 1R3QA 1MEWA 1OYAA 2DZPA 3PY2A 1W5NA 4IJRA 4U28A 4B2DD 4C6NA 1KM4A 1PIGA 2C15A 3QFEA 5CH9A 1UP2A 3FN9A 4FB7A 3LCXA 3Q65A 1A0EA 1E4MM 3DCPA 1KM1A 4IFKB 3PPGA 4OOZA 3OO2A 3SRDA 1HKIA 5HNRA 4D1IA 3ZFHA 3V5OA 2BWGA 4GI4A 4AZHA 4Q7IA 4RNHA 4S3KA 4GYPA 6PTDA 1O5RA 3HG2A 4RX0A 3RRXA 1P0DA 2C0AA 3WNKA 3W1PA 1SO4A 3STFA 2NLYA 2G37A 1JDCA 5AB3A 2F8QA 3EOLA 3R89A 4PMRA 1A49A 4R3UA 2CZEA 4RR4A 1GOIA 1SR9A 5HXMA 3NIYA 3ANYA 2EO7A 4GI9A 1H50A 2Y61A 4EIVA 1UJQA 4Q8WA 3OU8A 3N4AA 4C6DA 4R27A 3T0DA 5BU9A 3EKLA 4NAFB 1NSJA 3S5YA 1P7TA 3RGTA 1MW1A 3LTYA 7TIMA 3PBMA 2BNJA 3C52A 2CPUA 3RR1A 3SIMA 5C9ZA 1V7AA 3RIKA 2O9TA 1R85A 4NAEA 3PZQA 3FXGA 1R3TA 5AC7A 3T44A 2INEA 3T78A 1UWRA 4DEFA 1XLAA 3GY1A 2CHOA 3GH4A 1JGIA 3TZFA 3LTPA 5CLWA 4DIAA 5EMLA 1RLDA 4JNMA 5DBTA 3T2OA 8RUCA 1R2TA 3WF1A 4RPQA 2R1KA 3E3HA 1BRLB 1J10A 5D32A 2E9BA 5TQLA 4Y9PA 1XCWA 3HGSA 4ZQOA 4XBSA 3L12A 1JR1A 3E2SA 4GKTA 3W85A 3ZJ8A 3WF4A 3IJ7A 4UQDA 5CC6A 4EF9A 2WMFA 3W7MA 7PTDA 4HPJA 4JS3A 1CT5A 3AHXA 1LG1A 2R91A 1RK5A 3E0LA 2ALRA 3CIXA 5A8NA 1GNXA 3LM7A 1PZ2A 1DWIM 4HSHA 2NLIA 4IGNA 1MWOA 1MO0A 4UOJA 2QNEA 4FF7A 4H19A 4UQBA 1IIGA 1EBGA 4MDOA 1Z42A 3GLCA 1CIUA 2E3ZA 1QOQA 1QO5A 3OLEA 1NFGA 4DBSA 5M03A 3WDJA 4OTKA 3HZ3A 1LYXA 5BXPA 1LRQA 2R1NA 4J4KA 3CHDA 4JQ2A 3W28A 4I5UA 4N2YA 1BHGA 1IQ8A 4NVTA 1VC4A 3LRKA 2GOUA 2ZBTA 4K8EA 4B5SA 3WH6A 2NXIA 4HP5A 3EWDA 2CU0A 4X0NA 3RPMA 3T0CA 4CQAA 5I3KA 4IIGA 3W26A 1L2QA 2EGZA 1X96A 3Q58A 3KTSA 1MMFA 3MYOA 3PSWA 4HB7A 4UTLA 5CXPA 2YCLA 3BTNA 5F1UA 2WKGA 3KDOA 2A7NA 1EZ2A 3MV01 4GX9A 2NW0A 2P8BA 2IMRA 4WJ8A 4MNJA 2YL9A 3IGSA 1JYVA 4JEQA 2WPGA 4AX7A 1ZENA 1XGZA 2WVTA 3GXPA 4Y96A 3G2GA 3H7UA 1UR4A 4FX7A 4WGXA 1E1FA 3DHFA 5MKGA 4DRSA 4LY4A 4P7OA 3ARPA 2VVNA 3NGJA 1C8VA 3PK7A 1WZAA 2C91A 1YTDA 3SDOA 3FV9A 4U31A 4NIRA 4AYGA 4B5WA 3TJIA 1FCQA 4LYRA 1DKWA 4M6PA 2GZXA 5K9CA 3VD3A 4PL2A 3T09A 3KWSA 4HYWA 1GTEA 1KXQA 4F9DA 4I7VA 4KCVA 5H6HA 2DUXA 3EX1A 1ZNNA 2Y88A 2HE8A 5AN7A 2OOFA 3D3FA 5D4YA 3N12A 2P53A 1XRVA 1B0IA 5HWMA 4H00A 4E0CA 4LH8A 2F6UA 4F66A 5E9XA 2FDSA 1MEHA 3GM8A 3QV9A 1PVNA 3TOPA 3M0JA 2FVKA 3QV8A 1LT8A 3ZM8A 5EMMA 2Y89A 5HOSA 1K9EA 3HTWA 1JZ3A 3GG7A 4HD5A 4YS1A 1BSLA 4R9OA 4DWSB 3GTXA 2GUBA 1TV8A 1AVAA 2VZTA 3H2NA 5CPOA 5CC3A 1DP0A 3MYPA 3HPXA 2Z2AA 3GAKA 3AUJA 1H7XA 2VI0A 2VEFA 3CL8A 3N4EA 1MZHA 4IICA 3E0FA 3KOFA 3WSUA 4MNMA 5F2LA 3AMLA 3IVSA 5KZ6A 3O9NA 3JS3A 2Y70A 4GQRA 2PF8A 3PJTA 4MLJA 2GJPA 3UD6A 5A6BA 5LNUA 1D7FA 3PBYA 3PNZA 1BKHA 2NWSA 3R8HA 1CGXA 2DUZA 2RKXA 2YB1A 2OOGA 2BFGA 5KZMA 7XIMA 2QDGA 3F5KA 3L2LA 1CB7B 1V6YA 2QPSA 4U5IA 3DG6A 1UR8A 2NSOA 1UOKA 4OHQA 4JCMA 4YJ5A 3VPLA 3ICJA 2IQDA 2D2HA 1C7TA 3BAJA 4PB3A 5BNKA 3N1AA 4B90A 3W7LA 3I65A 5BZAA 4FXSA 4CCEA 4OBSA 4XAGA 4O1EA 3S8HA 4JTDA 1W3NA 2C16A 1CGTA 1D3HA 3V75A 3U57A 2O7QA 3WQ6A 3GD6A 4QEHA 1DHKA 3V5FA 4MPKA 1E6NA 1O68A 3B9AA 1SZFA 5RUBA 3C2OA 1XR2A 4C5ZA 1GOWA 3GBEA 3WLHA 1T8XA 3MSGA 2BHZA 3KRZA 3EWWA 4G6CA 5D05A 2JGYA 4GI8A 5FA5A 2YPIA 2FTWA 4UMCA 5ABTA 2OCZA 3CAVA 4F48A 4O4WA 2OTDA 4B2DA 3UA3A 4J3SA 1J4EA 1K70A 4TUFA 3IUHA 1RUSA 1S5MA 1P0EA 3VOGA 1S5WA 4TX8A 2I17A 1U1HA 4CD5A 4P8WA 1QNQA 3W75A 1EDTA 2VTFA 1E70M 1B3OA 5LHEA 2BLEA 5F2IA 5FESA 3MTWA 1GHSA 4QG9A 3WQGA 2X2GA 1I1WA 5G4WA 1CXHA 3FYYA 2D69A 1TVNA 4GJIA 3EZ4A 3N73A 5G4HC 5LYRA 5B80A 1UR2A 3LUTA 5AYZA 3TN5A 5FAGA 3NSNA 1E6QM 4DO6A 1OCBA 5HULA 1WQ5A 4EACA 3EX4A 2VRQA 4TTGA 5HDRA 3LB0A 2BGSA 3OGRA 1JD7A 2FFCA 4A21A 3WJWA 2H6RA 4IGMA 1TA3B 1QCWA 3IJIA 4LCQA 4O17A 2DIKA 3HIJA 5DY3A 4NX5A 5DLCA 4PBEA 4C6MA 4Q4SA 2V68A 4W5ZA 4RE2A 4PRWA 3G1FA 2ZXBA 1HVXA 1OIFA 3UVAA 1DIOA 5A69A 2FPYA 2QZRA 4B5XA 3G3MA 1TELA 5CPNA 5I79A 5JBFA 2QAFA 3M1ZA 2ZCGA 3CZGA 3LPGA 4AEOA 1OGGA 1GT8A 4PTXA 3P80A 1F3EA 4M5PA 6XIMA 3A5FA 5DCBA 4P7NA 1EOKA 3TLQA 2PZNA 3H12A 4DXVA 4QITA 2WVSA 4M8UA 3GB6A 5ABFA 1A50A 3TE9A 4R85A 5A6KA 3RJYA 2PGFA 5DFAA 4Z1DA 3GIQA 3AALA 2Y6ZA 4ICMA 1TE1A 5M1TA 4FXFA 3ABSA 2X0HA 3ZS4A 4H6RA 1JYXA 3FKKA 1PCWA 5GNXA 1AJZA 1NP2A 4ZXLA 1PIFA 3CO8A 4S3GA 4LNCA 1RA5A 1CYGA 4AHQA 5CSUA 2GSHA 3W01A 3BW3A 1J5SA 1KCXA 1BTCA 2QDHA 3GDMA 3VNMA 2I9UA 3NPUA 4H9XA 2F6XA 4WF7A 4TR9A 1WKEA 4NZ3A 1WP6A 3H22A 3PZNA 2YW4A 1FCBA 5A2CA 3KBVA 4GIAA 4I90A 3MI6A 3UGVA 3VKKA 1J93A 1TPH1 3UG4A 3L68A 2NUYA 3C0SA 4AC7C 1JF6A 3WF3A 3L4UA 1OFEA 3G24A 4ZTYA 1HXJA 5KMYA 3KX6A 3RNDA 3K1GA 1POKA 1VPYA 3MU7A 1NY1A 5ENLA 2VC5A 2A3BA 1GQJA 4FLSA 7REQB 3FY1A 4HNNA 2R8WA 4H7VA 1O5XA 1J2WA 1K3UA 1KW1A 1L6FA 3GAYA 6A3HA 4JQ4A 4OUEA 3URNA 2ZX7A 4TV5A 2I14A 4PCNA 3D5HA 1YRRA 3AS1A 2V5BA 1GORA 3EPNA 2AL2B 3IPWA 3ISIX 5I3DA 1J8VA 1GTHA 4MG4A 1KGWA 2DUAA 2E09A 2Q3OA 3G1AA 3T55A 1M03A 3ZLGA 3GDTA 5IM51 1LZOA 1RQEA 4WUIA 1UZHA 4FX6M 5I03A 3I6TA 1J12A 1OYBA 3RR4A 2X30A 3LXAA 3WK1A 4ZMGA 4XD4A 3NAVA 3B0XA 2YGYA 3W1MA 4HK7A 1FWJC 1XC6A 1L6YA 2DU2A 1E15A 1H41A 5CC5A 4EXQA 5HWJA 1MQQA 2UY2A 5DY2A 3R11A 1JCTA 3FJ4A 3ANUA 1WCGA 2GVLA 4QR6A 1ZCOA 4D8ZA 3TTOA 3WLPA 2ADAA 3LBCA 3WY1A 3I4EA 1AA1B 1PE1A 3S2LA 2E68A 3MI2A 4ICCX 1IGWA 2HVMA 5HPOA 1WDSA 3MVIA 1XH1A 3M5XA 2JKPA 1F76A 1P48A 4XQ6A 3MKKA 4ACZA 3SRFA 1XI3A 1M68A 3C0JA 4JX4A 2PC8A 2G50A 3R4IA 1FH7A 3WL0A 1MYRA 1KFLA 1KWGA 2RDXA 1E5JA 1US3A 3QY6A 4DLFA 1XQKA 2CFFA 5KETA 3TMLA 4MAZA 5KSWA 3WX7A 4REQA 1RXOB 4B5VA 1LOQA 3NSMA 3AHVA 2NQHA 4C6JA 2PTWA 1K1DA 4ZENA 1Q6RA 3CUJA 4Z1YA 1NFBA 3EOOA 1A0DA 2C18A 1R9XA 3PZTA 3VO0A 5GJMA 1VQTA 1F4AA 1R86A 4PCFA 1H7NA 3BGAA 1VIWA 1JPMA 2Q71A 2ZUTA 4GWEA 1UKTA 1M7JA 1ODZA 1H51A 4V1YA 1TWWA 3GVWA 4EVZA 3MWAA 4I8YA 5CGTA 1ADDA 4FEZA 1V6UA 5D30A 1VBUA 1IYXA 2YL6A 1QR7A 3POCA 4GI6A 1DORA 1FXQA 3OIHA 5G1TA 3SUWA 3WJXA 3UQNA 3AC0A 2OLSA 2WKJA 4KGJA 1CXFA 2PTXA 1GQKA 2UWFA 2FH8A 3NVTA 1E6XM 2QHAA 2J9YA 3DGBA 4OWGA 1WNOA 4OQVA 4Z0JA 1F6YA 1JZ5A 2A3EA 4Z2HA 3BCJA 4Y9NA 3ABOA 3FSUA 3LQLA 3WO8A 2FVLA 2V0TA 3MKCA 1R5YA 3C2EA 1AH3A 1DWJM 3PBWA 2WZTA 3C2FA 3NURA 3OVRA 4AZ5A 1FP9A 2HS8A 3KE0A 2I57A 3WDRA 1OD8A 4PCSA 4BK9A 2WJZA 5J5DA 1IEVA 3P8JA 2PE4A 1FCVA 1Z41A 2VNCA 3AS0A 1L9WA 4C1NB 3LPPA 1RPXA 4KEVA 2X8RA 3ME3A 1Z89A 4QROA 3V0UA 3KOZA 3TYCA 4GUGA 4HHMA 1Q2RA 1R3SA 3O07A 5A1AA 3VX1A 1JPKA 2VX5A 3TNBA 3TQ0A 1HG3A 3FS2A 3NL3A 3RCYA 3KHDA 1EPVA 1UZ1A 3CZJA 1CBGA 3WK3A 4U3AA 4H9YA 1HGYA 3SCPA 4WEVX 4HNLA 1G4SA 4TTUA 1QK2A 4TX6A 2X7WA 2XWEA 4BQ5A 3M4HA 4JTEA 1B2YA 3O6AA 2XVKA 4W8AA 2BHYA 1XGEA 1ZALA 5ABGA 1LCOA 4QLKA 3WMBA 2BASA 1H7RA 1EO5A 1AW1A 4GJ1A 3NDZA 3G0UA 5LZLA 3KOYA 4O0ZA 3N13A 3TJXA 2CNCA 4YL2A 3P7YA 1E55A 2XIOA 4I6KA 2I56A 1WBHA 3DAQA 2MANA 3QFWA 3TAKA 4LEQA 1SZRA 3E2RA 3NCOA 4S3FA 1KGUA 1PZ1A 4W8BA 4IIEA 4DZ5A 3LQGA 1TPEA 2VFGA 2GGEA 1Y5VA 4R53A 4F79A 3WEMA 2XG9A 4DF0A 5AYIA 4UZSA 1UKPA 3SB0A 3AHZA 1VFTA 2OWWA 3EB4A 1C8XA 1QBAA 1ZY9A 1OK6A 3VGGA 1MEIA 3FGCB 3G0SA 4QTGA 2V6AA 3ZJKA 1XINA 4QISA 1IZJA 5HUOA 1NP0A 2GFTA 2X7VA 3KAOA 1JULA 1XLEA 3L2IA 2AKMA 2R94A 2BVWA 2QJJA 4EAMA 2ESCA 1FVPA 3A4JA 4YCPA 3W7JA 3OOQA 3VGEA 4O0KA 4DAFA 2JF7A 5FSEC 3GUWA 3WMCA 3ZLHA 4FI4A 3TWAA 4E8DA 1S2VA 2AMGA 2QUTA 4YVPA 2VC6A 3S6DA 3W7KA 1U5VA 4PMYA 1F05A 3MCMA 1PKMA 4F0KA 3F5JA 3AICA 3VM5A 4UFHA 4NYUA 2WVVA 1NF7A 1IWBA 3CZKA 3EXTA 1N8WA 5DCDA 4KEUA 5I78A 3GTIA 5I09A 3T42A 2YKKA 2FB3A 2P5NA 4XO6A 2C3ZA 4NT0A 2BP1A 4V15A 2DH2A 2D2JA 3MMTA 1GEQA 3BLFA 2EPOA 2XM2A 3ARQA 3N2TA 4KPLA 4O10A 4ML9A 2POTA 3DENA 3RLHA 3PN8A 2I16A 2YA2A 2RDTA 1LOLA 1T40A 4A8NA 4GISA 4CNPA 3UP8A 1UMLA 1O5QA 2YDAA 4KRTA 4ZB2A 2DORA 3GZAA 1NWTA 2PWUA 3EAUA 3HV8A 4EP8C 2A2IA 1K7XA 3ZT7A 3L4ZA 4J40A 4W5UA 3WH7A 1DIKA 4PUMA 4RJEA 3SRHA 2LLEA 5LIXX 5D8WA 4GPNA 3B40A 4KFOA 1FWHC 3F4DA 4DJFD 4FAMA 1S5TA 3UCCA 1SVDA 3CPUA 1WDWA 2WB5A 4H9VA 2Z6IA 3GZ3A 3S5OA 3SM0A 1HKKA 3PTQA 1GKRA 2ZTKA 4CNNA 1V3HA 1G67A 1NWRA 1FWEC 2O55A 4IPLA 4FHAA 1CXIA 1EYWA 1WO2A 3A9BA 4JPGA 3B8IA 3WBYA 4EPKA 5LIYX 1E1EA 1GWJA 3PG9A 2BY3A 2ISSA 3W88A 4URIA 3WLIA 4UXDA 4QEEA 3RUBL 5EBUA 2V2DA 3L0GA 3UWYA 4AIOA 3R1ZA 3B0UX 1TSIA 3W53A 1QXLA 3GHRA 4H6EA 4PZVA 3CPGA 4L6HA 1EJ7L 4OIFA 5EKYA 4HMDA 1BQCA 4JBRA 2WMKA 2VENA 4XAYA 3LHWA 5F7UA 3K46A 1C9WA 2Z7KA 3FDKA 2VCBA 4J3XA 1Q6DA 2CLLA 4DN1A 5BW6A 4DVOA 3WFAA 2FHBA 2A5HA 1G5AA 2QXWA 3WIJA 2ISVA 2PBGA 3ZQ9A 3BO9A 5CZ0A 2J7BA 1PZ3A 5FJRA 2NVCA 3NDOA 1VH7A 2NV9A 1HJVA 4LAZA 4NAEB 3A3WA 1OG0A 1H60A 2GPTA 1E0WA 5A2AA 1IXQA 1VHNA 1GVYA 5AECA 3S9IA 3CWNA 5FL0A 1AD1A 4C6PA 3WD3A 3W9ZA 3CIWA 3H6OA 5PTDA 4G1NA 4BQ3A 4KETA 2E6FA 4O28A 1EJSC 2DSKA 4CD6A 3SZ8A 2WSQA 1BGGA 1SGJA 3EDDA 2PLKA 1UP3A 1K4GA 2NSXA 4XB3A 4XWUA 1JXJA 3E5PA 3TW6A 3WFLA 5A94A 4ZCWA 1VLWA 3UG3A 4RV8A 4PH6A 4OT7A 1A3WA 1W1PA 2V3FA 4HNTA 4NQ1A 5E93A 1OY0A 4KRUA 1GJWA 1Y8BA 4W84A 3M5VA 3GFXA 3O6CA 1JDFA 4P8UA 4Z1BA 3VYLA 3USZA 3LHTA 2YFOA 5EPDA 1W31A 3INPA 1MSSA 3NWRA 3ARWA 4AVNA 1V8EA 3VGDA 3FEMA 3OG3A 1YDOA 3DOPA 3VNYA 4MY1A 3QLDA 3C8NA 1EJRC 1THFD 1XLHA 3PM6A 2O92A 4LXFA 2XIIA 1FWWA 4ALDA 1UR3M 4HYRA 2WSPA 4GY0A 1TB3A 3P84A 1XISA 2NUWA 5D02A 2PDLA 4IIDA 2XIMA 1ZTVA 4O50A 3ZSSA 1HP5A 2UBPC 2C7FA 1PS9A 3PAJA 1D8WA 2WCAA 5DN1A 1KWKA 1UYQA 4Y2WA 4KCWA 2PTZA 5KEZA 4KGLA 3ALGA 3KOWA 5I6SA 3LD5A 3S1VA 5DANA 1J0KA 2G3MA 1NQ6A 3CK5A 4GFIA 4A3RA 3QY8A 3DU0A 4IX0A 1S1PA 3IJDA 1REQA 2GOKA 1OF8A 4BY3A 4A3QA 3C6CA 3EMZA 3G1VA 4AIEA 4JHZA 4QSHA 4P7QA 3TSMA 1EFZA 5I0DA 1OM0A 2G4FA 1JYWA 4K37A 1E0TA 1KBIA 4WY0B 4AWSA 3A4AA 4IMCA 4H9ZA 1YDYA 2ZOXA 1ZPTA 3KLLA 2PWGA 3CT7A 3BV7A 3GX9A 4O11A 1OFQA 1RCXB 1YNPA 3U4FA 3CB3A 3WH8A 2BODX 4V33A 1OT2A 4ORIA 3QW4B 3BLKA 4FALA 2Y5SA 3IS4A 5FF7A 1KXVA 3C0LA 3OZYA 1KGXA 4B3KA 3UZ5A 3DG7A 4AY7A 3B97A 1Q6OA 4JFUA 3E96A 4PMUA 1B5TA 3M0KA 2R1PA 1NEYA 4ZE5A 2ZX9A 5ECUA 3WN6A 3AOFA 5FACA 3TXVA 2IS7A 5BOEA 3TYDA 3EX2A 1UD6A 3AYRA 1FTXA 2YBUA 4UTKA 1RBOB 1DIDA 2ZA1A 4AD5A 3CAQA 5EU9A 4BI5A 2NWRA 3TLLA 4D6EA 2WZIA 2VQUA 2ISWA 3O2LA 3VKAA 3RU8X 2VD8A 2R1MA 4MFEA 3P62A 4IL2A 1ZS2A 4LBRA 3E74A 4N9BA 1CI1A 4LY8A 2J7EA 4GH3A 1Y7VA 2OSWA 1A5LC 4EE9A 3B9EA 4UNIA 4XBJA 5EYWA 4IQDA 3ABZA 2O0TA 2DEPA 3PJWA 5DO8A 1LLWA 4BHYA 4AU0A 1VBHA 3C61A 3T7VA 3ZVHA 4YU1A 2A7PA 4UFLA 1I0DA 1KC7A 2VRKA 3N25A 1A5OC 4MJ4A 3S2MA 3MQTA 1R46A 5A8GA 5A5WA 2D3LA 3E49A 3K4DA 2PD9A 1E4NA 1M7PA 5TNVA 2JKEA 5BXTA 4UTMA 5GPRA 3ZMRA 3CS2A 4MFDA 4QSFA 1RA0A 3Q67A 2WMIA 3GRIA 4X9SA 2E4TA 1ZJAA 3TX9A 2QCNA 3SCSA 1KA9F 1W9DM 2XYLA 2CESA 4HU8A 4W7WA 4UNKA 4TVDA 1KO0A 2QPXA 3R8RA 2ZDSA 3W83A 2PB1A 4AD3A 4AZCA 4JKKA 1MQRA 4PB4A 3SBFA 4DJDD 3YPIA 2DZVA 4D72A 1VFUA 2V81A 2YXGA 4IFRA 3UY8A 3LS9A 1IXPA 1OFBA 3P0XA 1AZ2A 4DJFA 3WUGA 1P4CA 1WYIA 1HL2A 4ORMA 5C9WA 3SSJA 3DFNA 2OQHA 3QV7A 3WLOA 3EWZA 1TVPA 3VIHA 1V93A 2WVUA 3TQVA 3R2GA 4JIPA 3WUFA 1J0HA 1XFCA 1S39A 4A4AA 1A5SA 1ICQA 1NIUA 2DT3A 4F0RA 1DL3A 4D6IA 4K3ZA 1U1UA 4AEEA 4BF5A 1WDRA 4LB4A 3R12A 4BWLA 4JYEA 3A3HA 4TMCA 1UG6A 1HIZA 2PC4A 3OTRA 2PF0A 1XLLA 2A3LA 1J96A 3TWBA 3JW7A 3AZRA 4LAKA 4MYAA 1TPB1 5FI8A 1TFVA 1EUNA 3VC6A 2YCEA 2V8ZA 4D6GA 3VOCA 3BANA 5CCZA 4B9YA 2J74A 2DIJA 1E72M 2EHHA 5D33A 4GIRA 3M46A 3MMUA 1TYGA 3CV1A 4UUIA 3LGDA 1TTQA 3SQLA 3QTPA 4FNQA 2OT1A 1HJSA 1RP9A 1KBBA 1OFDA 1GPWA 2B81A 5CPTA 3T9PA 2J79A 3R79A 2MUCA 5BMWA 5XIMA 1AZ1A 3VDCA 4FA3A 3CZ8A 3I6EA 6CGTA 1DXFA 4J3TA 1MI3A 4JTLA 1YTEA 1W1A1 2BV9A 3JVAA 3LBMA 1KM6A 4A8RA 4L56A 3ATZA 3VMPA 2BGQA 1O1HA 2YA0A 4DUWA 3JZUA 3AWOA 3SO7A 4DUXA 3M41A 1EO7A 1BEUA 4NXSA 4UQCA 3QMSA 3WNMA 1DBTA 1EGZA 5LXEA 3PVFA 3QZAA 2WBGA 5A6SA 2G97A 5EBAA 4Z08A 4GE8A 3RX4A 5C2CA 2QYGA 1JDAA 3S42A 1JPDX 3MWCA 1OG6A 3L4YA 4AY1A 2WCGA 4PMDA 5C9UA 1XYAA 1R3YA 4HMNA 3PBVA 1TV4A 1TPDA 2VDGA 4IG2B 3EOSA 2XPKA 5D2XA 4MKSA 1GVIA 1LJYA 1W17A 2Y7EA 2D23A 4RCXA 2QCLA 2D20A 1M7XA 2E40A 2OZ3A 4D6JA 3NOYA 4ZB5A 2VD9A 5G1YA 1SZNA 3HGJA 1FDYA 3PZOA 1H5VA 1OX4B 5A6LA 1CW2A 4NF7A 5TIMA 5FF3A 3EX6A 2QCDA 3MUAA 4W7VA 3TA9A 1XYZA 4IMAA 3TW7A 2WSKA 5HNTA 4A3UA 2E7FA 5JBDA 3IGXA 1BVZA 2CXGA 4DYJA 4KW2A 1E9ZB 2PA6A 4X60A 3G8RA 3O6DA 3GXTA 3W29A 1AH0A 4E3VA 1JG9A 4AZIA 5F4SA 4JN8A 2IQTA 4Y9MA 2ZVRA 4P8VA 1V3JA 3LZ3A 2BTMA 1S5VA 1G4PA 2GSEA 4UQEA 2ZC8A 1Y65A 4XK2A 1ZLPA 4W86A 3CLMA 2Z29A 2ANUA 1M04A 2FGBA 3CUHA 4MGGA 4JTSA 2GDQA 3U7BA 4XZNX 1E3ZA 1Q6LA 4O18A 2Z25A 4HA1A 3DFYA 3LV5A 3PUGA 1HF6A 1BXCA 1SJBA 2E28A 3HQPA 2BOGX 4E4PA 4UTFA 2VR5A 1C90A 3DFTA 2BVDA 4QJ1A 3MA8A 4I9AA 3PPCA 1R47A 2OQLA 3AXKA 3ZOAA 1N82A 3GKAA 1XIGA 1EQPA 4JNZA 1B3VA 1BD0A 2OX1A 3NQVA 4QDPA 1FA2A 3BMXA 3S4TA 4GK8A 3R10A 3DDMA 4H9TA 1JVNA 4REQB 4GZIA 4Q33A 5FEWA 4MKVA 1UWTA 1BWLA 3S46A 3WLNA 5C5YA 2Y0FA 1DOSA 3QRHA 1ISWA 2WW5A 1TTIA 1RVGA 1V6XA 2VZUA 1Q45A 2OO6A 1AMYA 3TP4A 1XLKA 3I68A 3IIPA 1QMLA 3L0KA 4LT9A 1KV5A 5L6UA 3GG1A 1KCKA 3G18A 4HA3A 5K9DA 1T96A 3EX3A 4JFTA 1XGDA 2NV2A 2DZBA 2ZUWA 3P14A 1E71M 4EF8A 1TV3A 2QUMA 3NQGA 4HA0A 3MPGA 4PN2A 3IIOA 4CNSA 1QUMA 1WUEA 3DYPA 3CH9A 1EB3A 3QGVA 4DZIA 1QASA 3AISA 2VX7A 3W72A 3CMFA 3HMJG 1V4YA 3F4NA 5A8PA 1GVFA 3EEZA 1A5BA 4Q8TA 4IIHA 1I9CB 1SSGA 4FLRA 1RPKA 3A22A 3DI0A 3E2QA 3LTSA 5A6TC 4BJHA 3PWAA 3K5XA 1SO6A 4DYEA 4PMNA 3EWXA 1YLVA 1EXBA 4B4HA 1XLGA 3NDYA 5TD4A 1L6GA 1DJQA 1QHOA 3QSRA 4F0LA 5E0FA 1VJSA 1XBZA 4MJ2A 2JEPA 2VR2A 4XIAA 4RDVA 1DPMA 2X16A 4OBRA 2GDVA 3LK6A 1KV8A 2CLFA 3NM3A 4JDBA 1BVWA 1XIDA 3RG6A 2C1HA 1XLCA 3HJZA 4PTMA 4E8GA 3FLUA 1FH9A 3B0PA 1UBSA 2WLZA 3MHFA 1A53A 4MB4A 4DBDA 3E0WA 3A64A 2FZ8A 4DJDA 3QGAC 1VGAA 4JYFA 4P8XA 4M81A 4YVXA 1H61A 2OJPA 5EFDA 3G22A 1I2RA 3DC8A 1CX9A 2GGHA 3GKFA 1B3XA 4TVUA 4CQDA 3H4GA 1CGUA 1Z3NA 4ATDA 5H8MA 4Z42C 4BI7A 4QG6A 1C8YA 1B3WA 1W1YA 3VIKA 1IF2A 1VFFA 3AZSA 5G1MA 5LNVA 3V4BA 4CNOA 1CEOA 1DE6A 2HROA 4ZOAA 2BMBA 3B8WA 1E6RA 3EYPA 2G95A 1CLKA 2IW0A 2VJXA 2W62A 1V7YA 3LX9A 1KFJA 3UWWA 1KR0A 1PTAA 1F8MA 5H2ZA 1S3HA 2QCGA 3GXMA 3UF9A 1G69A 3HPAA 1GPFA 1B90A 3KM8A 4XAZA 1CDGA 3QXBA 5DMNA 1FWNA 1SM9A 2GUYA 4L4PA 4AXNA 3S2JA 3UZWA 4JFSA 4Q8QA 4JHMA 2G96A 4RLIA 4TX9A 1VLIA 2GK1A 3QR3A 4R7JA 3Q2DA 2V5DA 4HKPA 5D2WA 2IKIA 3N2OA 2Z1BA 3WH5A 2D0FA 3QSTA 4YXGA 1ICSA 3VDGA 4IMGA 3HG3A 3V1HA 1UQZA 3I7QA 5EA9A 1FFRA 3H2OA 4ZOCA 1HL9A 1W37A 5FF0A 1XF0A 4O8RA 1Z48A 2OGYA 1DXIA 3GVGA 3NVDA 4IF2A 1EP2A 2P88A 2QPUA 3CQHA 1QU4A 3ZWTA 3VIJA 1A5KC 1EF2A 3S2CA 2WVVB 3IJQA 3H2AA 5I3IA 1DJIA 2XVNA 4WDXA 1EJUC 3DYOA 3G1HA 1TWDA 3IIZA 4DI8A 3IK2A 3A12A 2WHKA 4Y7EA 4XVEA 2VFIA 5DBUA 2W63A 1M7OA 2V5CA 2WO5A 1UC4A 2QUVA 3N6JA 2Y2WA 3KVLA 4RNFA 5BRQA 4HTBA 4GKLA 1XIEA 3COTA 5HMEA 3KP1A 3WF2A 3WDIA 3IAQA 3TXZA 3AMGA 4OECA 5G2HA 1RD6A 5BOFA 3ZJ6A 3W3OA 3TFXA 3TYUA 1KXHA 4UQAA 3M64A 1FFQA 3U9IA 2PD5A 2GJNA 1NWUA 4ZZ9A 2C19A 3LRLA 1G1YA 2QW5A 2BY0A 4RDZA 1JNEA 3B8TA 4HZMA 1ONRA 3GNRA 4PE8A 1XG3A 2H9AA 3JR2A 2DVTA 4R9XA 5GJNA 4IX2A 4G56A 2J8GA 4P2VA 2DT0A 2BB0A 3GU2A 3S6OA 3LLDA 3BURA 1TG7A 3CH0A 2OYMA 2HNHA 3W74A 4B92A 1FOBA 1Q63A 3SUUA 1XH2A 4TQTA 4ZODA 2HTMA 2A0NA 2ZRVA 4KQNA 3KCLA 5LA0A 3W7IA 3SFWA 3QC3A 4PBGA 3KUMA 5EY5A 4UOQA 4IWWA 1ZCCA 5DXYA 4XKYA 1N2VA 2YDSA 3ITLA 3W38A 3ONBA 1I4NA 1QI3A 4YYCA 4C6LA 4OUIA 2ZXDA 3T2PA 3HV9A 2HV5A 3N04A 3VM7A 1RY8A 4DF2A 3UW6A 4U33A 4ZE4A 4LYKA 3STPA 5I3HA 3XINA 3PUEA 3FSTA 3O63A 1P43A 5CSSA 1NVMA 4CD8A 2ZUUA 1YE4A 4AFYA 2PZ0A 4AY8A 3VKJA 1SPQA 4C5YA 1N8IA 3L23A 4ZR8A 4AYSA 5AC5A 4ASTA 5REQA 3QM3A 2GQ9A 4FF5A 3F2DA 4AWUA 1G4TA 3ARRA 3E2VA 4X61A 6REQA 2ATSA 4AZGA 4L7ZA 3THAA 2Z2UA 4UFJA 3ITXA 3TTQA 5LNRA 3VVGA 3W37A 4I9JA 3TSDA 4DO5A 4R88A 5F2MA 3TU9A 4ML4A 2EEXA 4MDPA 2Y7FA 1W2VA 4Q3MA 3V16A 2ICSA 1BWVA 1A0CA 4BZYA 2ZX6A 4I7UA 4DJEC 1DE5A 4LRTA 5T8GA 2XINA 4LVAA 1DWGM 3BW2A 1NOFA 4RK8A 1TPFA 4DQWA 4NP7A 2HNEA 3CUGA 4QJ5B 4S38A 1S1RA 4WX2A 2PGWA 4G7EA 5EGRA 2DFAA 4HA4A 3PB0A 3EDKA 3VKDA 1JRCA 3KL5A 1FKXA 3WQDA 1JNDA 4JOMA 2ACRA 3WJZA 1ALDA 4E38A 1E1CA 1SJAA 2OXNA 2QGHA 1DYSA 3IJLA 3DBPA 2IXUA 4UWMA 4Z17A 2DZXA 5C9XA 1LRNA 2O4MA 4MY8A 4C6QA 1ECEA 4I9TA 1GVEA 3B4UA 2FHCA 1XS2A 1GZGA 5CGQA 4DZHA 4Q8VA 4KWUA 4AWEA 1ZAHA 4RZ6A 3UERA 1X38A 4HNVA 1DWFM 5FF4A 1O60A 3GTFA 3R0UA 3MB9A 4PB5A 2WJEA 4GGBA 3TN6A 3FEQA 4IP4A 2PDHA 3F4WA 1UR1A 2HDJA 3RMEA 2PRHA 3TR2A 3WF0A 2RFGA 6TIMA 1MVYA 1P0KA 3VE7A 3CC1A 4U10A 1REQB 3IK4A 4W89A 3KP0A 4YIWA 1OADA 1UASA 3W7HA 3W2MA 3USBA 2E0PA 5HJXA 5DMLA 3VZYA 1KNWA 3QW3A 4FNRA 4GLEA 1XFBA 1EEXA 3VIIA 4A3HA 3RYSA 3DN5A 5HQMA 4QQ3A 2I5IA 3LM3A 3KLKA 5K3VA 2ATMA 3DFOA 1AUSL 3H7RA 3IAPA 1GG1A 4AEFA 4IZGA 1SYTA 2J47A 3QHOA 3ITGA 1SJDA 4L9ZA 2FJUB 4JQ3A 1WKFA 1R3VA 1KTBA 3REQA 5EMJA 4U2ZA 1ZP3A 5DQPA 4E8CA 2TPSA 2DT2A 3QQ0A 5FCZA 2CLMA 3RLUA 3DI1A 1RJRA 1DVJA 6ENLA 1O12A 3CV2A 3L0NA 3KVMA 1ESWA 1QI5A 4C6EA 4RE4A 3STEA 1OCQA 3W7DA 1KBJA 3S6TA 1SFJA 2BGNE 2FZ9A 5FL1A 1E6PA 4CEXC 4QJ3B 1KRAC 3IGUA 3BW4A 2XVLA 3E02A 1JPHA 1BGAA 4EPEC 4CNTA 2V63A 1OABA 2YYUA 2HCVA 1R9YA 4XG1A 2Y8VA 1EJXC 2GQ3A 4Q7NA 3ZT5A 4J3WA 2YFNA 5CPSA 5CPLA 4LQ1A 1O4UA 5D37A 3BH4A 2B4GA 1S2CA 1FBAA 2VVSA 4H9UA 2GJXA 4JICA 3E38A 3NEVA 2VX4A 4S3BA 1IEXA 4PUJA 4IPNB 2IKGA 3VGHA 2DSWA 1UD5A 3DX5A 4JTKA 4HMCA 4JKMA 5I07A 2BY2A 3BAKA 4MADA 1EGVA 4A3YA 2OVLA 1A3HA 1VEPA 1ZJBA 5MF5A 2FVMA 5LA2A 3CQ0A 2QJGA 2CCRA 4XD5A 4D9PA 3SURA 2Y1HA 5I7GA 3QMTA 2YL8A 5J5RA 3PB2A 4YTSA 4ATWA 3NL2A 2VFDA 4HPNA 4JX6A 3IWPA 3QPZA 3Q37A 3OYZA 1FWBC 4ADSA 4XZHA 5FEZA 1ONEA 2Y63A 3IIVA 3WJSA 3L65A 3QHNA 3QVQA 3IEBA 1VD6A 3EBVA 4WXZA 4LCSA 4XZ9A 1XYBA 5T91A 1DEDA 4WJEA 1KRCC 1S2WA 1FXPA 3CIVA 1LL7A 3QYQA 1W5PA 1FWIC 1X6UA 4MKNA 5D38A 3AIQA 1XC4A 1UA3A 3KBSA 5LIUX 2X0YA 1TQXA 4AZCB 1X7FA 1ZBKA 2RGMA 3U5YA 2F7FA 2YB4A 2X1IA 2ZA2A 3BJTA 4AXKA 1QVBA 4NZ5A 4CCDA 1K8ZA 4DHGA 2QCCA 4DWSD 1V0LA 3VDAA 1FWFC 1VYPX 3VNKA 2ZIDA 2EPMX 4NXKA 1OINA 1UA7A 4HNUA 5GNZA 1LL4A 1ADOA 4WGHA 3NXLA 2NX3A 3KTXA 3LCWA 3ZVIA 3ZSTA 4I6VA 1E4LA 1LOSA 4QS6A 2PGRA 4GUHA 3W2UA 1Z9AA 2FHFA 2YA1A 1IWPA 2XH7A 3N29A 1VS1A 3GWQA 3N3TA 1X39A 3BE7A 1E6SM 3CHFA 2PLCA 3L2MA 3U8GA 4IPIA 3WJYA 3APTA 4W85A 4WOZA 2WLYA 3BAIA 2BHUA 2EF9A 2OQYA 4ZO9A 3OPSA 2D22A 1W5QA 3CL6A 2O56A 1ENUA 1H0GA 4MJMA 1JZ2A 3LA4A 4ZO7A 3ZXWA 3UEQA 2YOCA 1P0NA 1S2AA 1MUWA 4ENLA 3G8EA 1QK0A 4KBXA 3EWYA 1MXSA 4G7FA 5KTLA 1POJA 1PKLA 4FPSA 4JD4A 1SW3A 4U3CA 4XUYA 3QY7A 5HQEA 4DNMA 4D6DA 1PKNA 2W3ZA 3A5VA 3KHJA 4M0XA 4JR5A 2OG9A 4LUIA 4A05A 1B9ZA 3SY1A 4C6FA 2QF8A 4FR6A 3U7VA 3NQFA 4FNPA 4AD0A 2QVNA 3N9SA 1YXCA 1C93A 1LWIA 3MVTA 3U6WA 3ARTA 4FNSA 3PAOA 4GYFA 1MUMA 1XDJA 3KVJA 3SGGA 1P6CA 4ICNA 3WEOA 3IV8A 2OYKA 4ERGA 5HATA 3ALFA 2TSYA 1TJPA 3D0CA 4A2SA 3B3DA 4ZA0A 3E0IA 2FTYA 4IFKA 1AH4A 3DBNA 2ABBA 1KBLA 4BA0A 1WX0A 4DO7A 4U5KA 3I7SA 4F9JA 2HK0A 2V82A 3K1DA 3ABRA 4PEEA 2Z1KA 1IE7C 1UROA 3II1A 3O16A 3DESA 3PF3A 3BLDA 3MBDA 4DXKA 1UH3A 3SUVA 3KL0A 5F1VA 4N4PA 4FR1A 1TUFA 3L4TA 4CKQA 1HJWA 1RLCL 3L5MA 4Z2JA 1UWUA 4GMEA 3U3HA 2Q8XA 3G0XA 3MKVA 1K7EA 3EDEA 4LEFA 1SO3A 1ZP4A 3EMCA 3NGFA 4KRZA 1UH4A 2CBVA 3C56A 4M6QA 1V6VA 4XAFA 2WKLA 2E5BA 2QCDB 4HNCA 3LERA 4AF0B 3MMDA 4NZCA 3CQIA 4IP5A 4NAFA 5E9AA 2PRMA 1KFEA 4HYVA 1BF2A 1TTPA 3L9CA 5AOUA 2YDRA 1KM2A 3RU6A 4LVFA 4US5D 2C71A 5AKQA 3B03A 2VO5A 4ZOEA 3O6YX 4RKAA 4XUGA 3WNPA 4OU1A 4A29A 2F6KA 1ZBVA 3AZTA 4U2YA 1W8GA 1M41A 2XIQA 5AZ1A 4FSAA 4HNOA 2X05A 1FP8A 4OFCA 1FHUA 3N2MA 4RUBA 4ZVJA 2VHLA 4MWAD 2J6XA 1BRLA 5HPCA 1CENA 4CU8A 2HSAA 1HUVA 1A5AA 4EWND 1H4PA 2H90A 1VEMA 4C6BA 4QHRA 3A3XA 1OBAA 1VIZA 2CZFA 3P82A 1XYFA 3S9YA 3BG5A 1Q5MA 3EB3A 5D04C 2WQDA 1PHQA 4GUFA 4W9TA 4XD6A 4K2SA 3RDKA 3UR5A 4DJED 1R2SA 4C91A 3SN1A 2BG5A 4LS0A 1GW1A 2HWGA 4J27A 1XCFA 5BU6A 4PMZA 1J0JA 1K8YA 5TAOA 4YYFA 1ME8A 1F9CA 3PZUA 4F40A 3KL3A 2PDPA 4J3ZA 4DUOA 1E4IA 1Z69A 4IH3A 1NAL1 3FJ6A 3N6HA 3AO0A 5IBXA 3BQ5A 2VEPA 5U7SA 4Y6GA 1JI1A 1YMYA 2NZLA 3EEGA 4Y8FA 4UFMA 3U48A 3OIXA 1NJJA 1JI2A 1TMQA 3LZ5A 4JFWA 3WBAA 1PIIA 3CYVA 4AHPA 1RP8A 5I3FA 2IUZA 4BQ4A 3QZEA 4KFPA 4O53A 5LSMA 3BWWA 1R87A 3KS5A 3W76A 1JCNA 4LUTB 4TMBA 1VCFA 1PZ0A 4RXGA 1OHLA 3QKZA 4JIRA 2GYIA 3L5AA 5I06A 3AXIA 4D71A 3W2LA 1SU5A 1ZFJA 1D3CA 2OYLA 1W3KA 1NARA 1V08A 1JFXA 4EANA 1DJZA 3UXKA 4HSOA 2QLYA 4MVAA 4Q8NA 3VFCA 2WMGA 1IT7A 1R0MA 1W2PA 1OC6A 2Z1WA 3A4XA 4X22A 4O52A 1GGOA 2CHNA 1QOPA 4IJBA 1C91A 1UHVA 2PDKA 3BAWA 2J62A 3O05A 5F4XA 3CTLA 2WJFA 3BXWA 1FHDA 1B4EA 4GQQA 1OGBA 2POZA 4ATLA 4Z2GA 2YYTA 3HOJA 4W87A 2BS9A 3NPWA 4US6A 2V69A 2PLMA 5KITA 5HBFA 4GNVA 3V3WA 4QGCA 1W3JA 2TODA 1J18A 2G0WA 3BLEA 3UXIA 2WNNA 4C7DA 3RXZA 3TQPA 4LW7A 1XLBA 3POHA 3GG0A 2GSJA 1UC5A 3PWGA 3VMOA 1W9XA 3B05A 1KXTA 1BPLB 2RH9A 1XWYA 1M5WA 2GWNA 1JIBA 3FK4A 4JTTA 4ZBCA 4DWSA 3CYJA 1M65A 3TW9A 1ME7A 1A47A 4H1ZA 3SECA 1I8JA 1EHAA 3BLOA 5HMDA 4Q4OA 4WLCA 3UA4A 3ZWSA 4ADUA 2F61A 1QW9A 3U4AA 3GYEA 2X0SA 4IHCA 3QC0A 3QQWA 3F2CA 1LBMA 3AU2A 2QCHA 3T2QA 4MZYA 1QFEA 2TMDA 5T26A 3TK7A 5D9OA 2C79A 3S47A 1XJBA 1JUKA 3Q94A 1SZGA 2DZUA 2OSYA 2PBOA 4D6HA 3ITVA 1ONWA 2EG8A 3VNJA 4NJHA 3GU9A 3ZLFA 1I0BA 1BLIA 5KZEA 1JQXA 4HPHA 1Q4NX 1HL8A 1KQZA 4XBKA 1EF3A 1Q6EA 1T7LA 3WBEA 2SFPA 4M6UA 3NZRA 2G3IA 2J7DA 5HANA 4ZL1A 3HQ1A 3WQOA 3P2VA 3WLQA 3OBKA 3MUIA 3DHUA 4IFOA 3FOKA 4WDTA 4HVXA 2RDUA 3BUVA 1HX0A 1TMLA 1VCVA 4LV9A 1GVSA 3RM4A 4JTQA 4LBUA 4WKHA 3XISA 4Q4QA 1E56A 3MUY1 3VAVA 4Q4RA 3CHEA 3CUXA 5AC4A 3WQWA 3GS6A 2NV1A 1OSEA 5FJOA 4GO9A 3I6RA 2RJGA 2B7QA 3BLPX 4J28A 2E6DA 3VA8A 3V5CA 1FQ0A 2XFRA 2BDQA 3AMKA 3B8VA 4QP0A 2A21A 1GONA 1EJWC 1NOUA 1T99A 3CWOX 4S3EA 1R38A 1SW7A 1XIBA 3QJAA 1OEPA 3F03K 5FJJA 4AIUA 5F4WA 4IUGA 4UNLA 3ANVA 1HQTA 3P74A 1N55A 4MUZA 2BZNA 3I4KA 4JCLA 1XV8A 1V0KA 3WLJA 1AQHA 1WXYA 3GXFA 1M3UA 1JCYA 3PBGA 2ISDA 5D03A 1VR6A 3SN0A 4YCOA 4DI9A 1DJYA 1XIMA 3HJEA 2X1SA 3LNPA 4MAVA 1UMYA 3QEZA 2XH0A 5E09A 3WD4A 2YXXA 3QR0A 3ITTA 2F38A 4DJFC 1JGMA 1E6ZA 1TCDA 1WPCA 1XKYA 1GOXA 1KTNA 1WBJA 2HPIA 4RZ4A 3VIOA 1Z44A 2W92A 3M6DA 4V2XA 1H63A 3P93A 1AL7A 4Q6JA 2WZMA 1TA3A 3F4CA 4NYYA 5HR7A 2R1LA 3TJLA 2WPBA 4OV4A 4HHHA 3N3MA 2VRJA 3VE9A 1EDQA 5C9RA 2CXEA 3CLWA 4WVXA 1A3XA 4O15A 3C86A 2O9RA 4BWLC 3WL1A 2J13A 3AYSA 3VZZA 3W1LA 1AW5A 5HNNA 4PMOA 1FHLA 4KFNA 4K6AA 1Y5XA 1GCYA 2V5LA 2CZ5A 2VDHA 3W71A 4M29A 4US5A 4C90A 4O16A 1E3XA 1YBQA 3BMVA 4D1JA 3FVMA 4A8LA 3DKJA 3H21A 4L1XA 4WY0F 4EWJA 3HURA 1QWKA 4PSPA 1X97A 4LAUA 2Z6JA 3UJEA 3IACA 3OZOA 1V02A 5DEZA 2Q8ZA 5HK4A 2OLAA 3W25A 3L67A 5M17A 2PDNA 1B30A 4JKLA 4N02A 1ODUA 1MDRA 1LROA 4MWAA 3ZR6A 4IJCA 1S38A 3LCIA 1GVQA 3OBEA 4HQVA 5FSDC 3PZMA 3FXYA 1H1NA 4C65A 3M47A 3WUEA 1YKWA 2B7NA 3R6IA 4AD2A 3BGJA 3LLFA 3EKZA 5AHFA 2FZBA 6REQB 4IUOA 3SJNA 4DJEA 4OVXA 1SQ7A 1OT1A 1FX6A 3W7EA 1X7IA 3RJXA 4K38A 4R33A 4DF1A 2AL1A 5CC7A 4H6KA 2ZUNA 5C2GA 3W2NA 1Y5WA 3O06A 4ZQMA 5BXRA 3E5BA 2NXHA 3VNIA 5KINA 2QR6A 4KCTA 1Q2SA 2CEQA 1UP0A 3KZPA 4QM1A 4UR9A 2PWEA 4QRNA 4PL1A 2ALDA 4IL0A 1A5UA 4JFVA 1Q7ZA 1KRMA 1U83A 2AL2A 3RX2A 4WSKA 1ITUA 1BXBA 1OC5A 3O15A 2VEKA 4ERIA 3OLGA 3UJRA 1OFPA 3SSZA 1VB9A 5D09A 4KMQA 2C13A 3SCWA 4QXIA 3M43A 1S5NA 2NX1A 2ZUSA 2JGQA 2EPHA 3W22A 4GX8A 2XGZA 3UZJA 3KOXA 1VBGA 3SUSA 2WHMA 1FH8A 2VCCA 2FB2A 1DTNA 1NDYA 2PWHA 3HF3A 3HG5A 4FOUA 2OGJA 2VZVA 4L1GA 4HZ6A 5CBIA 3QR1A 2YL5A 3WUBA 2V5KA 3IJ9A 4H8HA 1VKFA 4HSNA 4Z1CA 1QTWA 4L65A 2Z1XA 3STCA 4C7FA 1SFTA 1W9PA 1IV8A 3LOTA 2Z4GA 4XZIA 3KVKA 4HCDA 3HFTA 3RCNA 5EFFA 1JDDA 3PTMA 1XL9A 5I3JA 4S23A 3NTYA 4YLWA 1JDEA 1X8CA 2J4GA 4LAMA 1WZLA 4JN7A 2H3DA 2W91A 3GHSA 1V51A 3MP4A 4N42A 3O1NA 3AROA 4I5RA 3VIGA 3LSBA 3W7CA 3GVQA 4K7VA 4I3GA 3AXHA 4A6GA 3LCGA 2F84A 1S3TC 3GR4A 1RCOB 4DNHA 3K8KA 2DJXA 1H0IA 1JAEA 1CXKA 2NUXA 3UPWA 3MDWA 1EIBA 4DZAA 1QW8A 5IDIA 1G01A 1RHCA 3GNPA 4X2PA 4YHEA 3C2VA 3PZ9A 5GNYA 2JBMA 3ZJ7A 3LU2A 4CQBA 4GH1A 1BYDA 1EP3A 2A79A 3B9DA 1AODA 1HKMA 3BG3A 1O5KA 2W9MA 1OQFA 1Q8JA 3T4CA 5AYYA 5C0QA 3H4WA 5CJNA 1VJZA 4TIMA 2PWVA 1GKQA 3VINA 4EKJA 4WKFA 4DBWA 3F1QA 2DPEA 3EA2A 4L9YA 1A4LA 1LUCB 4MJZA 2PTDA 4F4RA 1O95A 3SCQA 2GQAA 3N2XA 2ZE3A 4QS5A 1JF5A 1VBRA 3NO5A 4HHLA 2WCSA 3H8AA 1LF1A 3EDJA 1Q65A 4LV4A 4XSMA 2D1ZA 2V5JA 5CZTA 3S5ZA 3MI3A 1I2QA 4HBKA 2GJXB 4PGLA 5IDZA 3LHZA 4JN6A 1G9HA 3W87A 4YWSA 2QV4A 3EMQA 2EKGA 2GJLA 4ZSTA 3A6OA 3LG3A 3M0HA 2QS8A 3M0XA 5A95A 5CPQA 1MW0A 1U22A 2A3HA 3GHUA 1FWRA 2PCQA 4QLJA 3UWZA 4C1NA 4FK9A 1R30A 3TIMA 2QUNA 2W79A 4W93A 4L61A 4K1GA 5HQLA 3UWEA 2VC9A 2BXVA 2CKSA 2FJKA 2PUZA 2WV8A 3RFAA 1F3WA 4UTWA 3KRBA 1XW8A 4QAIA 1V6WA 2XH2A 1K9TA 1Q6QA 3V18A 4AD1A 2REQB 4S2BA 1EYEA 2UY5A 4PBFA 2VKZG 3V36A 1T5AA 4GY7A 3T4WA 2Y8KA 3M0YA 3MSRA 1QOXA 1TWSA 3GXNA 1DJNA 4ZTXA 2CC0A 3P5YA 1K6AA 3QKEA 5JUVA 3CMJA 4UCGA 2PPGA 3DHPA 3P3BA 1OYCA 4RDYA 4Q6XA 5LHFA 1AL8A 4Q7BA 3KTCA 3R7MA 4GXWA 1MDLA 5AHEA 3B04A 4DJDC 3W00A 4LPCA 1WDQA 1YPIA 4NZ4A 3GC4A 5AVHA 4J2MA 5CSRA 2WHJA 3KS6A 2J6VA 3GQYA 1ZZMA 5BROA 5LNSA 3VOIA 4LVDA 3KBNA 4R7OA 3OYXA 1ITQA 3SCTA 1HFBA 1I2PA 8XIAA 2AQVA 3WBWA 9CGTA