3W2UA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-193
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-193
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2uA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2uA01
1SW7A 4U28A 3BK0A 1M5WA 2A6LA 5EPDA 4NX5A 1QPNA 4UFKA 1OG0A 1SO5A 4DBDA 1MEIA 4AVFA 1F05A 1XXXA 1WBHA 3NXFA 1Q6RA 2DZSA 3NL2A 3F03K 5K2ZA 1OHLA 2CZEA 1KFCA 2ZRUA 1FY6A 2Y7GA 4XTIA 4H6KA 3QMRA 4M7SA 5I3FA 4LV4A 4PTNA 5LNWA 5DBUA 3HG2A 1QFEA 3UD6A 4E0CA 1VLWA 1J4EA 4N9BA 2CWNA 4XBKA 4QNWA 3HGJA 4WY0A 4LTSA 1U5JA 3C2FA 1M7OA 4X2RA 3W6YA 5T26A 3PBWA 2Y89A 1F2JA 3LXBA 2P1FA 3EKLA 4K6AA 3N14A 1RVGA 1SFLA 3W83A 3KRSA 2P0OA 4UTWC 5KSWA 1ICQA 4JTKA 3WJWA 3OEXA 3LB0A 2QCHA 2CZFA 3C56A 2QAPA 1GG0A 3I68A 3W1PA 1FUYA 1MO0A 5FI8A 3EX2A 7TIMA 3PSVA 1KFEA 3IGXA 2QCFA 3B4UA 4CQAA 1EUNA 1O4UA 2NXIA 1JUEA 1P4CA 1QCWA 3M16A 4HNNA 1SZFA 4ONVA 3SR7A 4JDYA 1OF8A 1H51A 3UWWA 4A3UA 2ZTKA 2E5CA 3LCFA 2NUYA 2QCDB 4O15A 3RFAA 1WA3A 1ZAHA 3ABSA 1G4EA 3AO0A 5HWNA 3C2RA 2ZDRA 3LHZA 4FIQA 2Y61A 4HHPA 1XUZA 2WJZA 1H60A 1RZMA 2H8ZA 3CEPA 3LCLA 1PS9A 2DZXA 3GVGA 2X2GA 2YFOA 4TO8A 2H3BA 3TFCA 2QCNA 1R30A 3IIZA 5E1QA 4EWND 1VPXA 1WQ5A 3W86A 1EUAA 4X3ZA 3FKKA 2E6AA 4JTHA 1DL3A 1W1ZA 2ATSA 3NQDA 1TPEA 1TYGA 3TC6A 3TMQA 1TPUA 5SWUA 4GXMA 3RU6A 1X7FA 5DCEA 5AOUA 3T55A 4TMBA 1B4EA 1K7XA 4IPJA 3NEVA 3LTPA 3SECA 5EA9A 4GUFA 3R2GA 1YXDA 1VYRA 4ADTA 3W7QA 4A21A 4O0ZA 1VLIA 3NQ8A 4N02A 4EVZA 1W0MA 4O54A 1EA0A 4XZ9A 1RQHA 3G3DA 1SO3A 2H8XA 3DI0A 5AHNA 1N8FA 5FESA 2E09A 5F4XA 3NL3A 5LHFA 5CSSA 3P82A 2JK2A 1IXPA 1BEUA 4UR7A 2I14A 1JQVA 1X1ZA 1TTPA 2G96A 4QAIA 1DOSA 3P81A 3TQVA 5D05A 3PUEA 1H7PA 3DFPA 3C61A 1A5BA 2X1TA 4J9JA 4K7VA 3NQGA 3PY2A 4Z0JA 1GOXA 3CWOX 1G7UA 3G1HA 1ML1A 1EP2A 2E77A 2RFGA 4FNPA 2B7PA 4RJEA 3KAOA 1F76A 5BW6A 1MZHA 2Y62A 4CNNA 2YFNA 5LZLA 3CIXA 1UUOA 5CPLA 1XFBA 4ZQMA 2FQIA 3IEBA 1RV8A 4JDBA 3DGRA 3L65A 1KM3A 4DF1A 3IIVA 1W5NA 4YCPA 3S8HA 1ZNNA 3W72A 1OFRA 5CSRA 3SI9A 1OF6A 3NQMA 1I2NA 2ZZ2A 2A21A 1VZWA 3LCIA 2PE4A 4YLWA 1QWGA 4KWWA 3M7WA 3TA6A 1QNVA 4A2RA 1H62A 3CTLA 3W7KA 1O95A 3W73A 3A21A 1H7OA 4N6FA 3Q2DA 1W3TA 1Z41A 2NX9A 3RLUA 3HGSA 1NSJA 2ZRVA 2EHHA 3UY7A 4DO5A 3MP5A 4JR5A 1OVDA 5K7JA 6TIMA 3ABOA 3W85A 3CIWA 5CPNA 1FWTA 3TR2A 2CLOA 4CQ9A 3PG9A 3CQ0A 1L9WA 3FOKA 3GNDA 1IXQA 3A5VA 1KTNA 4FNTA 4DQWA 2O7QA 3PAJA 1MEWA 4K8EA 5D02A 4GC4A 2NV1A 4E2BA 5U4NA 3HG3A 5L9FA 1G67A 4Z1AA 3MHFA 4UMAA 3NZ1A 5F2MA 4QQ3A 4W9TA 1IIHA 4CNOA 1UCWA 3BVJA 3LV6A 2CZ5A 5I3GA 4UTJA 4GUJA 1XCFA 4FEZA 2DP3A 1GZGA 3NPXA 4U4MA 1ZAIA 4FNRA 1A5SA 2NXHA 4RXGA 1LTDA 4LUIA 1WDWA 4LVFA 3LCGA 4LW7A 2NX1A 5AFDA 3LERA 2JGQA 3E0IA 3W1QA 3F4NA 1RPXA 3S0CA 3W23A 1KA9F 4O50A 3EX4A 4AHOA 4MY9A 1LRNA 4OWGA 1X6UA 5AHFA 1PCKA 3S5OA 1EP1A 2TSYA 1KBIA 2OMAA 3W9ZA 5G4WA 4Y9AA 4YWIA 2Y63A 1OFPA 1V7YA 4MOZA 1GQNA 1C29A 2HMCA 3O1NA 3BPWA 2NUWA 4QSHA 4QJ1A 4Q32A 4UTWA 5D2VA 5DLCA 3W87A 4LT9A 1GEQA 1OK6A 1Y0EA 3FYPA 4G1KA 4O28A 1R2SA 3OVPA 1AW2A 4KFPA 3BLEA 2AQWA 3AJXA 2VFFA 3LI1A 4R33A 4FB7A 5D30A 3IGSA 3L5AA 1OFOA 3MHUA 1TPB1 4ZQOA 3L2IA 4LS1A 4PL1A 4AH7A 2JGYA 2Q3OA 1TIMA 4AF0B 5HUPA 3B04A 1EWDA 2WNQA 1PL9A 1ICPA 2QUTA 3M5YA 4QM1A 3IVUA 5A8GA 3P8IA 3EXRA 4XUGA 3LHYA 3A24A 3KX6A 3MI2A 3B05A 1ZFJA 1WAUA 2EGZA 2ZA1A 2NXGA 3GX9A 4FHAA 1F73A 1VH7A 2NZLA 3GK0A 3S6DA 4UMCA 4O18A 1H1YA 3RK8A 1THFD 1FCVA 3JS3A 5D09A 1ZAJA 2WOQA 2ABAA 1AL8A 2GQ8A 1TTJA 3P61A 3W22A 5KZEA 2YDAA 3PUOA 4HSOA 1ONRA 5J5RA 1JCJA 3W7JA 1PE1A 2V0TA 4Z0SA 4O52A 4WOZA 3H53A 3W1TA 1LP6A 3IVTA 2OT1A 2QUVA 1VYSX 1ZCOA 3H54A 2YX0A 3MBFA 2ZZ5A 4WXZA 3BLFA 1H7XA 1QAPA 3PBUA 3FJ6A 3VFLA 3W7NA 5CG7A 3N9SA 3KHJA 1UBSA 3W1LA 3O16A 3TQKA 2B7NA 1W5OA 1ALDA 2WNZA 3QSRA 4Z1CA 5HR6A 4LS0A 3NOEA 5HR7A 2Q8ZA 1DHPA 3BW3A 1MXSA 2ZZ3A 3PF3A 5C5YA 4WJEA 1YLVA 1IXOA 5HULA 3GXTA 3HGRA 4A22A 5LGZA 2Y6ZA 3G0UA 4X22A 3STEA 1LYXA 2Q8LA 1T8XA 4IGHA 4QIUA 4NU7A 3VKJA 4X9SA 3KFTA 3B8DA 3LM7A 4OHQA 4UIOA 4JTLA 3G1FA 5DXXA 1TCDA 1BKSA 2CLKA 5H2ZA 1VR6A 1GVSA 4JY8A 2Y85A 3QPYA 3N19B 2VFHA 3WK3A 1O5XA 3OHIA 3LOTA 1TV5A 3PR2A 2B4GA 1SR9A 3CWNA 4AHQA 3NQAA 1I2QA 2H90A 3P60A 2QUUA 5BRBA 2QF7A 4PA8A 1LLZA 1VHNA 2PRLA 3OIXA 1B57A 2VENA 5EKYA 2V2DA 1TQJA 3I65A 3A23A 1YADA 1EPXA 2ISVA 4E38A 1AK5A 4KFNA 4TX9A 5LKYA 1G4PA 5LSMA 1XBYA 1KM0A 2V5BA 1SUXA 3N9RA 1BTMA 1NVMA 5DN1A 3TKFA 3ZWTA 4P61A 3QEZA 4XKYB 5F1UA 2EF9A 2VXNA 3MMTA 1JVNA 1A53A 2VELA 3HOJA 1I4NA 4O13A 2DZTA 3RNDA 1A5CA 2GQAA 5I3KA 4JNMA 1O94A 3NO5A 3GDRA 6ALDA 1LRTA 1LOQA 2JKAA 3P62A 1OFEA 4AXKA 4CCEA 3HJZA 4UTMA 4ORIA 1OX6A 1A5AA 1EIXA 1JULA 3GYEA 4JX4A 3R13A 1O60A 3HG5A 3SZ8A 3GAKA 4BR1A 2ATMA 1G7VA 5C6MA 1FQ0A 3VE9A 4JTTA 3UWVA 3G0XA 2H3DA 4OU1A 4PH6A 2Y70A 4MPQA 3BLIA 4MKNA 3TC7A 3P67A 3GIYA 5FEZA 1GYLA 2EKCA 3TDFA 3TJLA 3NQFA 2E68A 3W07A 1LORA 2C18A 4JTJA 1MEHA 3CB8A 3GDKA 1FXQA 3NL6A 3MYOA 3ABQA 3TSDA 2J9XA 3TMLA 1HL2A 2X30A 2ZBTA 1IIGA 4ADUA 2TYSA 3LDVA 5CGQA 2EAWA 5D03A 2CFFA 2GVGA 1RD5A 5U7SA 4NUWA 1W5QA 3DH7A 3W2NA 5KTLA 3BARA 4WOQA 3P74A 5IBXC 4JICA 5K3VA 1IGSA 2QJGA 3KVKA 1GTEA 2NLIA 3SGUA 3WJYA 3DFOA 4IXHA 3HG4A 3ABRA 2DZWA 4H4IA 3STGA 1M7PA 2YYUA 5AYZA 3E9AA 2V81A 3TSBA 1C9DA 1J2WA 4AEOA 3W1UA 4RK8A 3LLDA 5D33A 3CT7A 1DQXA 2WO5A 3QZEA 4HN4A 5HNRA 3NZRA 1JRCA 1TO3A 2ZCGA 4M5PA 3ATYA 3C6CA 5GVJA 1W3NA 2PRMA 2ZZ6A 4Y8FA 2QDHA 3Q37A 3BW2A 4R34A 4K37A 1JCXA 4O53A 2QCDA 4RZ6A 1ZJIA 4UNLA 1TPWA 4OV9A 1YXYA 2R14A 4JTEA 2AGKA 4OBTA 2Y88A 1VJIA 1F6PA 3HIJA 1TRIA 3OG3A 4L4MA 5G2WA 1YYAA 2H6RA 3L21A 1W37A 1ADOA 1TREA 3IIOA 1YTEA 2TPSA 5DY3A 3M5VA 2YR1A 3PM6A 3TXVA 1LROA 1M6JA 1LBFA 4LS2A 4NNCA 4K7YA 3BGGA 4IPIA 4MIMA 2E5DA 4GRSA 3W2LA 2Z0IA 3RF9A 3GR8A 3FEMA 2YCEA 5EL1A 3LX9A 5FEWA 3DFQA 4GBUA 3NQCA 4AWUA 5DY2A 3G1DA 3PUDA 4Z1BA 4JEQA 4YMZA 1ZY9A 1F5ZA 1B3OA 4O1CA 3QH2A 2DZUA 3PULA 1YTDA 4N2YA 1WYIA 2ZQ0A 3W74A 2DJXA 2GVJA 1GJPA 2B0MA 2RDUA 4H3DA 2I9EA 4CCCA 2A7NA 2NUXA 1G4SA 1XL9A 5TIMA 1F6KA 5TQLA 2R91A 5G1TA 3PVFA 2VEMA 3DU0A 3L5LA 4LU0A 1XC4A 3C8FA 3A5FA 3PB2A 3MP4A 3HQ1A 4YL2A 3GDTA 3K30A 1KM4A 1WX0A 3MUXA 2RHGA 4O17A 3VI2A 2R8WA 2GQ9A 1KFKA 3W1XA 4S1FA 2ZRYA 4O19A 1L6SA 3TK7A 1SZNA 2A7RA 3LRLA 3SW6A 3E96A 3Q94A 1ICSA 2CLLA 3G1AA 3TXZA 3ZWSA 1HG3A 1RQEA 4LVDA 5AC8A 1GVRA 3F1QA 3W7CA 1N55A 5HMSA 2FPTA 5F4WA 1JJKA 2J27A 2QCLA 1G4TA 4JYDA 4JX5A 2WQPA 4O16A 3MJYA 1R2TA 4FX6M 4UTTC 5AHIA 2DZPA 3LV5A 1EWEA 5FF7A 3P8JA 3M41A 2WSRA 2YGYA 1UASA 2C3ZA 3H55A 4P2VA 4XWUA 1AG1O 4GUIA 3HPSA 4A29A 3TU9A 3HBLA 2C14A 4AWSA 3O07A 3FIGA 4MJZA 2Y7EA 3P5YA 3DHFA 2ZZ7A 1VCVA 3G8EA 5EY5A 3UNDA 3THQA 5IM51 3GDLA 4IXXA 4ZMGA 1A50A 3TSMA 4JYFA 1XBZA 3W7HA 4O57A 4CCDA 1BWKA 1KV5A 1K7FA 3VE7A 2RH9A 5A5WA 1V5XA 4UUIA 1TPC1 3QMSA 3FLUA 4WX2A 3WFAA 3LXAA 4RX0A 4WY0F 4S2CA 2GJNA 3NQEA 1KFJA 1I2OA 2W79A 1H7WA 3BO9A 1GT8A 3NAVA 1ZENA 1CX9A 5EYWA 1YTKA 3E49A 1D3GA 2FIQA 4WUIA 5HQEA 4DXVA 2YSWA 5HINA 1KM6A 1OJXA 1FDJA 4NT0A 3S9YA 1AW1A 3UYCA 3EWXA 3USBA 4I9AA 5G1YA 3MW7A 1Q6LA 4FX8A 1GYNA 4OQVA 3S5ZA 2VKZG 3QC3A 1T96A 3EXSA 4WXYA 1I2RA 3C2OA 4K39A 1DVJA 1HO1A 5CZ0A 3W76A 1RQBA 1VGAA 3IV3A 4KFOA 4IX2A 3B0PA 3C2EA 2DZVA 2G97A 5AHMA 1TPH1 1GVQA 1UUMA 4UCGA 5ABTA 4LY8A 2ALDA 2OCZA 5KMYA 3GKAA 1W5PA 1YXCA 3NG3A 2X1SA 3UPBA 1FXPA 3UWQA 4GWEA 4RR4A 1L6YA 4LC6A 1LDCA 4JGDA 3L0GA 1WBJA 4HNTA 5D2YA 1I8JA 4Z08A 1H7RA 3S1WA 4RLIA 2GOUA 4NJKA 4LC8A 1F74A 5K9XA 1VS1A 3SY5A 4QITA 4JS3A 3S1VA 1GVFA 3NQ7A 4LNYA 4TMCA 1TJPA 3FS2A 3DENA 3RMJA 1B4KA 1GTHA 3UPWA 4XTDA 1TTIA 1TV7A 3L66A 2DJLA 1Q6OA 2JBMA 4AF0A 4JX6A 4ZQNA 1P0KA 3G1SA 3UQNA 3T7VA 5G2HA 4EIVA 3QW3A 4LVGA 3EWZA 4LWWA 1K8YA 3N73A 1LOLA 3PC0A 3T44A 3TROA 3LGEA 4Y90A 3S5YA 1KFLA 3TCEA 3DFSA 1EP3A 5I3JA 1OYCA 2V30A 2GPTA 1WXJA 3LBCA 1YPFA 2XFWA 1ME8A 1SFJA 3KRZA 1KFBA 3W1RA 4NQ1A 1T0OA 1KBJA 3TFXA 1XBVA 1CW2A 2Z6IA 4HNVA 4IWWA 4FXRA 3CM4A 3IRDA 4GE8A 4L4LA 1FCUA 4MZ8A 1OFBA 1OK4A 4HSNA 4NZFA 3W1MA 3W3OA 3BG3A 3P84A 2F84A 3QJAA 1OFDA 1S5VA 5F1VA 5FF3A 3QMTA 1PV8A 3P5ZA 3CLMA 5DBTA 4EOUA 4GFSA 3G8RA 3PS7A 3B0VC 3MI3A 3DKJA 2V5LA 2W6RA 3G22A 3MI6A 1NAL1 4NJIA 4GUGA 1OYAA 3M5XA 1F7BA 2CLMA 3THAA 4MLRA 1WOBA 3KVLA 1KM5A 3BV4A 1S3HA 4DO4A 3B06A 1J5TA 1KW1A 5LNSA 1X1OA 4UXDA 4UTUA 1L2UA 4BFAA 4EF9A 2F7FA 3GAYA 3WJSA 1SPQA 2ZTJA 4JTUA 4PEKA 1FDZA 3G24A 1CI1A 1FX6A 1ZALA 3WK1A 3A9IA 2B7OA 1YDNA 4DELA 3MO7A 3HGOA 4FX7A 3EX6A 5AC6A 4O4WA 4GUHA 2A0NA 3G1YA 4YCOA 4NJGA 4DPQA 3N34A 1YDOA 1FDYA 1JCYA 2ABBA 3QF0A 2V82A 5FEXA 3DAQA 3BG5A 3SFKA 3W7LA 2ZRZA 5BOOA 1XM3A 2V8ZA 1Q6QA 3NPWA 4O0KA 5EMUA 1LLWA 2Z1BA 4UTIA 4NX0A 4DBEA 1PCWA 1OX5A 2OT0A 3UY8A 4ALDA 1TRDA 5TBOA 5C54A 2YZRA 4NJJA 1TSIA 4FNUA 3PG8A 2CLIA 4MZ1A 3M44A 3EX1A 4BI5A 5FEPA 4MYAA 3WJXA 1B9BA 3MWAA 4CLMA 1KLYA 4LOCA 3B03A 5LHEA 4MVAA 4HKPA 5G4EA 2YYTA 1OYBA 2YW3A 2VFIA 4UC5A 2E6DA 1W5MA 1GG1A 4LVBA 1HO4A 1TJRA 3GB6A 3M43A 4XKYA 3L5MA 2X1UA 1OX4B 3W7RA 2BWGA 3P7YA 4JTSA 4PL2A 3JRKA 3EWBX 3O6DA 2KZHA 1DV7A 1TTQA 2TMDA 2V9DA 4K8HA 3TH6A 5I3HA 1NEYA 3W71A 3NDOA 1OABA 5D04C 4JIQA 3W75A 3TAKA 4BWLC 4EF8A 3N2XA 1Z42A 4M7TA 1GWJA 1SZGA 1VYPX 5E0KA 4BI7A 3R89A 5AC7A 3UXDA 2BTMA 2HS8A 2BLEA 4RCXA 2ZYFA 3UXAA 3BW4A 3CU2A 3QQ1A 1QPQA 2ZZ4A 1H50A 2ZFAA 4RKAA 3R8RA 2QCEA 2Q3RA 3G1VA 2W0UA 1NF0A 1HTIA 3M6YA 3N2MA 3QYQA 4RZ5A 4UFMA 5DCBA 1OFAA 2X1RA 5AN7A 4WY0B 2Z2UA 5FF4A 2ZA3A 3NPUA 2HS6A 1QDSA 2Y7DA 3C52A 4LUJA 2DU2A 2HTMA 3SSJA 1DJNA 2A4AA 3SGZA 1X8FA 4MLJA 3TW6A 3U2OA 3T78A 4OGZA 3LHUA 2PCQA 1TB3A 4K38A 1EEPA 3M47A 3FFSA 3ZFHA 1QMLA 4C1LA 3LCWA 1FBAA 2J24A 5KZDA 2WPBA 3W7PA 4TIMA 5HJLA 3PB0A 4UFIA 3W88A 3E02A 3IVSA 1R47A 2VC6A 2VOMA 4JTGA 3L9CA 3HPZA 3LLFA 3HPXA 1S5WA 1XUUA 2XN0A 5F2GA 4MFEA 1H7NA 4JY9A 1LZOA 1IF2A 1KTBA 1E51A 3L67A 5K4XA 2ZZ1A 1QPRA 1W54A 1ZHAA 2ZA2A 3W2MA 2VEIA 3G18A 1IXNA 1FCQA 5MHBA 1JUKA 4UTLA 3IIXA 3EWWA 4CQ8A 2NWSA 3W1NA 1O5KA 4NZJA 3VCRA 1FWNA 2QEZA 1TPVA 4N6EA 2CLFA 2A2IA 3NM1A 1KTCA 4I7VA 2FPYA 1LRQA 4M6PA 1TQXA 3LRMA 2Z6JA 4Q4KA 4R7JA 1Z48A 4O14A 2JKPA 1FWWA 5KITA 2IQTA 4LRSA 1SO4A 3EWYA 2NWRA 2B7QA 4JTFA 2C1HA 3B0UX 3ZS4A 5CZTA 1DQWA 1HFBA 2J9YA 3OVQA 4N4QA 2PURA 4O1DA 3WK2A 4JN6A 1FWRA 1WOAA 3W7IA 4OV4A 1H1ZA 3NQVA 4POCA 2JKEA 5AYYA 3UZ5A 1RR2A 3HO8A 5LNVA 5H91A 3PWAA 2FB3A 4CNPA 3W2UA 4MFDA 3NPVA 4MY8A 2YPIA 2QCGA 3A22A 4IX0A 2RDTA 4MY1A 2NX3A 3FKRA 3UWZA 4ZQRA 1SSDA 3O15A 5K4ZA 4HT3A 5KZMA 1ME9A 1AMKA 3E12A 1TPDA 2QCMA 1VCGA 1P5BA 2YW4A 2XN2A 4IJBA 4A2SA 5AHEA 2QDGA 2A5HA 5F2LA 5FF2A 3GLCA 5D37A 1KM1A 2FB2A 3KOFA 5D2TA 4N9DA 4PCFA 1PVNA 1D9EA 1HUVA 1VHCA 4JYEA 2OZ0A 3SJ3A 1QOQA 2FFCA 1XBXA 3QQ0A 2CLEA 3O63A 5F4SA 3G3MA 1L6WA 4N9EA 2FJKA 1SU5A 4LRTA 3S1XA 3T40A 3W84A 3DKLA 2J9ZA 3DXIA 2WSYA 3NL5A 3MP3A 3LTYA 4ORMA 3L0NA 2DORA 1VCFA 2CLHA 4PC8A 3NYZA 5DELA 2CU0A 4UR8A 3MBDA 3W7GA 4IQLA 2C0AA 4S2BA 1SW0A 1K03A 3GDMA 2C19A 4JTIA 2A7PA 3LHWA 3NVTA 4JIPA 4FF7A 2LLEA 4D2JA 1TMHA 5HWMA 2RDWA 3NQ2A 2I1OA 1JCLA 3QRHA 5G5IA 3LRKA 2BSLA 4YXGA 2V2CA 4FNSA 3STCA 2R94A 4JXCA 4FXSA 1PIIA 3QSTA 1KLZA 4O10A 4O12A 3ELFA 5BMWA 3EKZA 2FDSA 2VFGA 1JQXA 3TJXA 1R46A 3TW7A 4O11A 3DI1A 3TIMA 1K02A 2BX7A 3VNDA 4Q33A 3M0ZA 4LV9A 5CZJA 4N9CA 2QR6A 1MSSA 1DKWA 1XI3A 3QM3A 2WV8A 1K8ZA 3I7SA 1XDMA 4K36A 5DXYA 1TPFA 2CZDA 4NXKA 1G6CA 3NQ6A 3ATZA 5CZSA 5K9DA 1I2PA 1AW5A 4ICNA 4FIRA 4IMCA 5J5DA 4N4PA 5LGXA 2C15A 2UV8G 1DJQA 3NA8A 3R12A 1SW3A 4KWVA 1PHWA 4UFLA 1S5TA 4BWLA 1W56A 4NJHA 1SQ7A 3GKFA 3TV8A 4R53A 4LVAA 3C0JA 2C6QA 5C55A 1QO5A 3U8GA 4BF9A 4OE7A 5D2XA 4FO4A 1GPWA 3QFEA 1YPIA 2Y7FA 2VEKA 3D0CA 4ADSA 1K8XA 4B5NA 4HPJA 2G95A 4O4VA 5E93A 2BZNA 4XQ6A 1AL7A 4ML9A 2D73A 3TUUA 5D38A 3I7RA 3NNTA 3CPRA 1QPOA 5I3IA 4DF0A 3KXQA 4HPXA 1EB3A 3I7QA 4WQ6A 2CW6A 3PSWA 1LBLA 3W2JA 3O6YX 2NV2A 1OFQA 3W1AA 2QJHA 1XKYA 3LTSA 3P80A 3EWUA 5IBXA 3I6RA 1K7EA 3OBKA 3C4UA 2OX1A 4UFJA 4NXSA 4BK9A 3TX9A 1VRDA 2TRSA 5LNUA 3CC1A 3W7MA 4PODA 3S1UA 3GR7A 1LCOA 3WK0A 5DCDA 1TV8A 3L0KA 2QCCA 4AAJA 4HNUA 4BI6A 3O05A 3HF3A 3MYPA 3BG9A 1JCNA 3S42A 1SSGA 2QKFA 4M19A 4MYXA 1JR1A 1I45A 3F4WA 5FF0A 1KM2A 5BNKA 1H61A 1JRBA 3NR0A 5LNRA 4ZQCA 4HIBA 2A85A 4I7UA 3V1PA 2E1DA 1H63A 3KVMA 4KKXA 3ANYA 1SO6A 1ME7A 2E6FA 1W8SA 3UWUA 4MZYA 1FWSA 4Z1DA 1YDVA 1VQTA 2O7SA 4NNAA 2E6YA 4GNJA 3EXTA 4RV8A 4IOTA 4O8RA 4AHPA 4ZZ9A 5AB3A 3IGUA 3TQ0A 1N7KA 4IUOA 2GVLA 3M9YA 1VC4A 2G5WA 1C8VA 1Q3NA 1UJPA 3M1ZA 3HMJG 3LCHA 4IMDA 3DZ1A 4IMGA 2VFDA 3C2VA 3KRUA 3GNNA 4QNEA 1D3HA 4RXFA 1WV2A 5F2IA 5D32A 2P10A 3OA3A 5CPMA 3TAOA 3CEUA 4AB4A 3FA5A 3W2KA 2QAFA 3L68A 4NNBA 2EPHA 2J6XA 1G69A 4ZVJA 4PFMA 3N3MA 2WNNA 2E5BA 1R2RA 1SZEA 2VFEA 5L6UA 3FYOA 3Q58A 4UFHA 4WD0A 4MUZA 3QPZA 2VEPA 3G0SA 3G1XA 1GVOA 2A6NA 4AWTA 3DFTA 2FLIA 1UB3A 2PC4A 3DHDA 3LI0A 4UTKA 1KV8A 2ISSA 2WKJA 1P0NA 3GXNA 3S5NA 2FTPA 5AYXA 3LHVA 1LM1A 1Q45A 3EX3A 4M6VA 4DO6A 3NM3A 3W70A 4MJMA 4ZL1A 3STFA 1FCBA 4UTHA 1P1XA 2XN1A 2RKXA 5EBUA 3W7EA 3O06A 3WJZA 3O8AA 3M5ZA 4M6QA 2V2HA 2ZRXA 5HWJA 4NVTA 1QO2A 1QR7A 3INPA 4TR9A 4Y6GA 4O1BA 3LCXA 4E2DA 2AAMA 3W7OA 2OJPA 1JUBA 1LOSA 4WZHA 3CHVA 1NFBA 3TNOA 1JCMP 3GXPA 4OT7A 2J88A 2YXGA 4UTTA 1T99A 3HB9A 5KINA 3EEGA 1BWLA 3LBMA 5CPOA 1Z44A 5CKSA 3TE9A 4DF2A 2GJLA 1NF7A 2FPVA 1DORA 3MHGA 2PRHA 3KVJA 3UZJA 3C3NA 2QJIA 4XBSA 2C16A 3RLVA 3ZR4A 3YPIA 2GUUA 5K9CA 5D2WA 4O1AA 3OVRA 3GZ3A 3NGJA 3W7DA 5C2XA 3R5EA 4Y96A 4IMEA 1PHQA 3FJLA 3LHTA 2X16A 3QW4B 4GJ1A 4ZQPA 1K3UA 3EB2A 3V75A 5BMXA 3T4CA 1EX5A 4QISA 5HUOA 1U83A 3BGJA 4DPPA 1QOPA 4RZ4A 1XDLA 2ISWA 2C13A 1OX4A 2BXVA 2ZRWA 3DFNA 2WSQA 3PBYA 1LBMA 4I7WA 3IIPA 3U6WA 3DBPA 4IMFA 2HSAA 1W3IA 3SIZA 3PBVA 8TIMA 4AMAA 4UMBA 3O6CA 2A1YA 4C1KA 4UNKA 4TU1A 4DEFA 5G2IA 1W31A 5AHLA 1H5YA 4FNQA 1DBTA 3UWYA 3JR2A 4JD4A 3LXCA
chains in the Genus database with same CATH superfamily
2EBNA 1SW7A 1XF0A 5EPDA 4NX5A 3FK4A 1YDYA 3N4AA 1SO5A 3UJFA 4UQAA 4AZ7A 1F05A 1QPKA 1AJZA 1WBHA 3OBAA 4XK2A 1VFHA 4HQVA 4G2DA 1KFCA 3E0LA 1VB9A 3GW0A 3N2CA 5DBUA 2BY0A 5ENLA 3SCNA 1QFEA 1OM0A 2ZXBA 3WFLA 1VLWA 3UFYA 2CWNA 5A95A 2J6VA 2OFJA 2PDQA 1JCTA 4X2RA 4B5WA 1QW8A 3W6YA 3MZNA 1XIBA 3AHXA 7ENLA 1UR3M 2P1FA 4JL1A 3N14A 3T2OA 4PBGA 4HU4A 3VYLA 1XWYA 4JIRA 4V28A 4UTWC 2C8NA 1DWIM 4JKKA 3MANA 4JTKA 1IEWA 1XPYA 4CGTA 1GG0A 1XYCA 1MO0A 1AZ1A 7TIMA 1UKQA 2BS9A 4JFUA 4HGXA 3B0XA 3B4UA 2W9MA 4GG9A 2V3DA 1P4CA 3B9DA 1XCWA 2OWXA 4HNNA 1DJGA 4TX8A 2ZTKA 1E6QM 2NUYA 3RFAA 1WA3A 2VX4A 2YCLA 3ABSA 1JAEA 5HWNA 1DIDA 1YX1A 1VAHA 3F5LA 1EQPA 2DVTA 4W7VA 3LCLA 2DZXA 2YFOA 1LUCA 3PJWA 2H3BA 4H9TA 3TFCA 9CGTA 2QCNA 1R30A 3PZVA 1VPXA 4RE3A 4CD4A 1GW1A 1US0A 1VEPA 3AIRA 4GXMA 4MPKA 3UJ2A 1EHNA 4W87A 1X7FA 3MUCA 4DYJA 1KCXA 5T9CE 1AVAA 1VYRA 1RAKA 3PZOA 4ADTA 2E4TA 5CC3A 5DT7A 1VLIA 3RCNA 4G7EB 2IPWA 1TV4A 1W0MA 4O54A 1EA0A 1R3VA 4ERGA 6PTDA 2H8XA 3LK6A 2ACUA 3GE7A 1YMYA 5AYBA 3H12A 5AHNA 3WY1A 1N8FA 3K5XA 1HJVA 5JH1A 3LQGA 2HBVA 3CUGA 2G96A 3B8UA 3R0UA 2GUYA 2W62A 3ANUA 3OGRA 2XIIA 3TWBA 3CHFA 5D05A 3PUEA 1H7PA 2OYLA 3C61A 4NAEA 4K7VA 3NQGA 4CKQA 3GFZA 4DJDA 2HROA 3CWOX 1XLIA 3N3TA 3SCWA 1J6OA 1DIKA 2VZUA 3IWPA 2B7PA 2D2OA 3A4WA 3KAOA 4R27A 1F76A 5BW6A 1H49A 2YFNA 2D22A 2ZWYA 3MUZ1 4AIBA 1XJBA 4HPNA 2FQIA 1RV8A 1IV8A 4JDBA 1BG4A 1QBAA 1FOBA 3DGRA 1ELSA 5HOSA 3UZYA 2DW7A 4DF1A 1W5NA 2Q8XA 1ZNNA 3W72A 5CSRA 2XIJA 2HDJA 1I2NA 3NQMA 3QGAC 1GOWA 3F5JA 2PE4A 3U57A 1A5NC 4LSBA 1M53A 2VCBA 4O0QA 3T0BA 3W73A 3IJIA 3MV11 3UZXA 1W3TA 2NX9A 3WF0A 4R3UA 4JIIX 2ZRVA 2ANUA 2PBOA 2FYMA 4JR5A 3NCOA 2NQLA 4DLMA 3ABOA 3W85A 3CIWA 3H2CA 3PG9A 1L9WA 4WK9A 3A3XA 4KBXA 3VNMA 1GORA 2GZXA 2XFYA 1A3XA 4OUEA 1N8IA 4GC4A 3SCRA 3HG3A 5REQB 2CKRA 3AZTA 1BXBA 1XSJA 3NZ1A 4QQ3A 3HM7A 1C7SA 1E4IA 5XIAA 3PP7A 1UCWA 3GXMA 3AHYA 5I3GA 1MWOA 1WKYA 4FEZA 2DP3A 1GZGA 5E9AA 4C6NA 1K4GA 1A5SA 2NXHA 2WM1A 4RXGA 4GGHA 5I24A 2X0HA 5DANA 1QK2A 3F5KA 3VXGA 3WQ8A 1WDWA 3FDGA 2QUNA 4XO6A 3F4NA 1RPXA 4J27A 4CNUA 1KA9F 2AL2B 2NT1A 5LXXA 3S5OA 2TSYA 2C71A 3R0KA 2QPSA 4YWIA 3WMSA 3W24A 1V7YA 2DSZA 4W85A 2XSXA 1C29A 3O1NA 3BPWA 1OCQA 4ATLA 4Q32A 4UTWA 5D2VA 3SCVA 3W87A 1GEQA 1OK6A 2VVNA 3FYPA 3R25A 2J7DA 1XLBA 1LWHA 4KFPA 3BLEA 3OB8A 2F6KA 4FB7A 3IGSA 4LUYA 3R11A 4HMEA 3MHUA 4ZQOA 3ARQA 3L2IA 3AS1A 1EF3A 2Q3OA 4HMNA 2FVMA 3WLLA 1PTAA 2GGEA 5HUPA 1MVYA 1UKOA 5BU6A 3AHTA 5A8GA 3MWCA 3ZJ6A 4Z2GA 3EXRA 4XUGA 1W9PA 4XZBA 3LYEA 3TW9A 5DQPA 1EA9C 1V77A 4DWSB 2XVGA 3NSNA 1J0JA 3VDBA 1I0BA 4OVXA 1M9HA 4UMCA 1DPMA 4JTAA 1Q6DA 4D6FA 1T5AA 1JFXA 5EBAA 3JS3A 2UY2A 4I5UA 4ZODA 5KZEA 1ONRA 2VCCA 1JCJA 3W7JA 2BFGA 1OGSA 4WOZA 5A3HA 3IVTA 2QUVA 2YX0A 1QWKA 4QLLA 3UVAA 2J7EA 3RLHA 2GK1A 1EKOA 3N9SA 3W1LA 3VDAA 4RNHA 3TQKA 3CT2A 3P93A 4ROPA 1ALDA 2FZMA 3M6DA 3ZSTA 3BDKA 1IEIA 1WDDA 3WQ5A 4B9ZA 4GI6A 3PFRA 4N7QA 1DHPA 1MXSA 5C7HA 1Q4WA 3MCOA 3PF3A 1IXOA 2QW5A 1WDQA 4A22A 5LGZA 1E3ZA 1UZDA 3G0UA 5FJTA 4RDWA 1UR0A 3N4FA 4NU7A 3FHAA 3KFTA 1HKJA 4GYFA 4B16A 3WLNA 4W5ZA 3OQEA 1TCDA 1E4LA 1BKSA 4US5D 3L4XA 1TA3B 3GG1A 2ZVRA 4GZJA 5I07A 1O5XA 3RPDA 3LOTA 3G6MA 5ECVA 2PEVA 1L8NA 3AIVA 2B4GA 4EANA 4AHQA 2OWWA 4CVUA 4QCFA 2CBVA 1I2QA 4C6JA 2ESCA 3GNXA 4LFYA 3I4KA 1LLZA 1VHNA 1JL8A 3OIXA 5A6MA 4QLKA 3L4TA 2V2DA 2O56A 2XG9A 3KM8A 1E73M 4JAWA 4E38A 4TX9A 2FKPA 4Q8UA 3N9RA 2E28A 5DN1A 1HKIA 4OKDA 1E0UA 3MMTA 3UETA 2EPLX 3QTPA 4H7VA 1I4NA 2GJXA 4O13A 3JZEA 4UBPC 4XVEA 4NASA 2DQXA 4GFIA 1KB3A 1XRFA 1W3LA 2BG5A 2ZUUA 4KGJA 6ALDA 2JKAA 4U2YA 1OFEA 8CGTA 4CEUC 3HMCA 3C8NA 3Q4DA 1JULA 4KEUA 3QV8A 1O60A 3HG5A 4IGNA 3GAKA 4L9YA 5C6MA 3PTMA 3G0XA 1V6YA 4LEQA 4MKNA 1UWRA 3M0KA 3GIYA 4D6IA 5FEZA 1GYLA 2XIMA 3TDFA 3TJLA 3VAVA 1O12A 1KXTA 3HQOA 4IPLA 3A4JA 1GK8A 2WSPA 2QIWA 1XH2A 1JDEA 3S9ZA 3AROA 5BROA 4JOMA 5A94A 3TYDA 3KBVA 4J7RA 4YYCA 3VGEA 2CFFA 1OCJA 1CXHA 4BF7A 1RD5A 4NUWA 5KTLA 1UKPA 4NSBA 1RVKA 4G7FA 1VEMA 4FLQA 4PBEA 2Y1HA 3AXHA 1GCYA 3DFOA 3MCMA 4I8YA 3VNZA 3V18A 3VOHA 1BGGA 5D9PA 1OZMA 1Z3NA 4HVXA 1M7PA 3U5YA 1Z89A 5BXSA 2DT1A 4I3GA 1J8VA 3RG6A 4YTTA 4EK7A 4RK8A 3LLDA 1IEVA 4JQ2A 2E9BA 1RBAA 4HN4A 4PMYA 5LIUX 2DDXA 3UJSA 4UB9A 3ATYA 2ZZ6A 2HE8A 1YQ2A 1JZ5A 3BW2A 5TAOA 4FZIA 1NOWA 1JCXA 1WUFA 1WZAA 1DIOA 4UQDA 4GYPC 4OV9A 2R14A 1F3TA 1V0KA 2VX7A 1KBKA 4JTEA 1E43A 4B5UA 1TWIA 2GSEA 2Y88A 4OBTA 1VJIA 3PPGA 2EG6A 4PTXA 3AWOA 3EA3A 3L21A 3ARPA 3OLGA 3N29A 4AQLA 1TREA 2UY4A 4YIWA 1UQZA 3PM6A 2BOEX 5CJMA 1ZUAX 5CGTA 5GJNA 1F61A 4L1WA 4MIMA 4W7WA 1OGGA 1UMLA 4IGMA 3ARRA 3SCUA 1B30A 4NRRA 3DFQA 4AWUA 1HJXA 3LNMA 1VRXA 4G7EA 4JBRA 1ZY9A 1F5ZA 3VD3A 3ES7A 3T09A 3DG3A 4Q8NA 2ZICA 3H2MA 2XFRA 1QHOA 3SFWA 4N2YA 3WQWA 1GJPA 4XX6A 2I9EA 4Y2WA 2NUXA 4RV3A 4HPGA 5TQLA 2XGZA 5G1TA 3L2MA 3PVFA 3DU0A 2CCRA 3KL3A 4YWSA 4GZEA 1TV2A 3GDTA 3K30A 1KM4A 1WX0A 3QFWA 1KCLA 3ITYA 4O17A 1FVPA 1KFKA 1PBGA 2VI0A 3KP0A 3LRLA 2CLLA 3G1AA 3ZWSA 1HG3A 2DEPA 1H11A 1E0TA 4GY7A 4XZWA 2JEPA 2FPTA 5F4WA 1TELA 1UBPC 4QE5A 4O16A 3MJYA 4FX6M 5AHIA 3WMLA 3P8JA 2G50A 1UD6A 2WSRA 5E70A 1Q85A 2VZSA 4W5UA 3H55A 1XIMA 4P2VA 2HVMA 3DDMA 3DG6A 1TIWA 3PZNA 4GUIA 4L80A 3TTEA 3VU2A 3LENA 3WL0A 3DHFA 1VCVA 4DBSA 3ARSA 4GGBA 1OIMA 3WLHA 4UOQA 4DUVA 1A50A 3TSMA 1CGYA 2G3NA 3W7HA 1S2UA 4XZLX 3AZRA 2RH9A 5A5WA 1V5XA 4UUIA 2VHLA 3QMSA 5LA2A 3WFAA 3LXAA 4RX0A 4GI9A 2BVTA 1W1B1 4S2CA 5EMJA 3NQEA 2CBUA 3H7UA 3GSMA 2IKHA 4RDVA 5REQA 1NM9A 4WUIA 1J10A 3S2NA 4F0LA 1KM6A 3DCPA 3EGJA 1B90A 3ZLGA 1W2VA 1EFZA 4PUKA 4OQVA 1OC5A 3S5ZA 5A6TC 3QC3A 3UG4A 3H26A 1I2RA 1DVJA 5CZ0A 1C91A 4P8XA 3SSZA 3F2BA 5LXEA 1QI0A 2E9LA 1EL3A 4MNMA 4OIFA 3CS2A 2ALDA 1LJYA 4F0RA 5KMYA 2QPUA 2UBPC 1FXPA 4RR4A 1LDCA 4JGDA 1U33A 4KW2A 4NY2A 3NO1A 3WENA 2YL6A 4Z08A 3RPMA 4TVDA 3LLXA 4B3LA 5JVLA 4NJKA 1A5LC 3VNLA 4FXJA 3EOOA 3S1VA 2J75A 3W01A 4IIGA 3CPGA 3FS2A 4ACZB 1GTHA 5I2UA 1TV7A 1W9BM 5FJPA 1QASA 1P0KA 3JZUA 4HB7A 1CGTA 1KKOA 3CLWA 3QW3A 3BSGA 3EWZA 4LWWA 1K8YA 3N73A 5CPSA 3T44A 3TROA 4Y90A 1KFLA 3DFSA 3BMWA 5A8OA 3RX3A 3VD4A 2V30A 3LZ3A 3KLLA 4RNJA 1Q8AA 3U7VA 3WMCA 2NT0A 1X1NA 3FHQA 1FH7A 1SFJA 1KFBA 2CKSA 5RUBA 1KBJA 2RGLA 1XBVA 1ZZMA 3V3WA 1CW2A 1KWGA 4IWWA 3CM4A 2R1LA 3IRDA 3EPMA 1VPQA 4J2PA 4NZFA 5F1VA 5FF3A 5KEZA 4GIYA 4EOUA 1CNVA 1T8QA 4DJEC 2W6RA 1TCMA 3M5XA 2CLMA 3THAA 2Z1XA 1WOBA 1KM5A 1UR2A 3BV4A 3N1AA 3B06A 2ZOXA 1PKYA 1X1OA 3BCFA 3AMLA 4UTUA 3TLLA 3WJSA 1SPQA 4PEKA 3ZVHB 3HU7A 1CI1A 1B5TA 4D1IA 3A9IA 1PKMA 2WVVB 4GNKB 3MO7A 3HGOA 3GG7A 4O4WA 4YCOA 3AU2A 4DPQA 2PDFA 1FDYA 4M0XA 3U2CA 3PZQA 3QF0A 1TA3A 3BG5A 3SFKA 5A8MA 2ZRZA 1D2KA 4XZHA 4DM2A 3NPWA 2OYMA 4O0KA 3QV7A 4H00A 2J8GA 2C91A 2YA1A 4ALDA 5C54A 4AIOA 1ZJHA 3EOUA 3ITXA 3NYDA 3ARZA 5CGMA 4DXXA 2GQ3A 4W89A 3MWAA 4GYJA 4DBUA 3CO8A 3VC5A 2V68A 5BYWA 1XS2A 4PTVA 1GG1A 2BHYA 3LUTA 1EGZA 1MFUA 3GVRA 4YHEA 2GDQA 1OX4B 1KXQA 3W7RA 2OG9A 2BWGA 4V2XA 1GQKA 3CMJA 2EG8A 4QGCA 4Q22A 1FRBA 3EWBX 2G3MA 1JXJA 3CL6A 2TMDA 1B3WA 2YDQA 5DMNA 3W71A 3NDOA 3W75A 1Z42A 1SZGA 1VYPX 4BI7A 1ODUA 1K9TA 1S2VA 3CU2A 5AY7A 1K6AA 4ICCX 4RKAA 3R8RA 2WSKA 3G1VA 2QDEA 3N2MA 3QYQA 5I3DA 3R58A 3TYEA 2Y4SA 1OEPA 4U5KA 5AN7A 4JQ4A 1LWJA 4WY0B 5FF4A 4NAFB 5T9BG 2HS6A 1QDSA 2DU2A 2A4AA 3FNDA 1PX8A 3SQMA 1X8FA 3TW6A 3U2OA 4W8BA 3OVGA 2RAGA 1E0VA 4OGZA 1Q7ZA 2PCQA 1BF2A 1TB3A 5EB8A 5FKYA 5CSUA 3A9BA 1QMLA 3LCWA 3PZIA 3W81A 3S2MA 1WDPA 2WPBA 4RW3A 1XGDA 3NWRA 4KPLA 3W88A 1ZGDA 3T8LA 2VC6A 1FHVA 4FI4A 4JNZA 4HD5A 4I5RA 3AS0A 1D8WA 3HPXA 1TVNA 1XUUA 2XN0A 3FYYA 1UPPA 4MFEA 1H7NA 1RHCA 4AEEA 4H8HA 1HVXA 1E51A 5I02A 2ZZ1A 1W54A 4NF7A 2PBGA 1JUKA 2VOTA 3IJ6A 2FGBA 2WW5A 2HVNA 5GPRA 3PAOA 1FWNA 3AIQA 1TPVA 4N6EA 4L65A 2A2IA 4KESA 3NM1A 1KTCA 1BRLA 1LRQA 3LRMA 3NSXA 1XIIA 2D1ZA 2Z6JA 4S3AA 1P1MA 1Z48A 2CPUA 5JBFA 1FFQA 4I6KA 4O14A 9RUBA 2PAJA 5A2BA 3SEPA 2IQTA 2XM2A 1SO4A 1A3HA 3VMOA 1HFBA 2J9YA 1M7JA 2J66A 4N4QA 4BQ3A 4JN6A 4A3QA 1WDSA 3K8KA 4LUTB 1MXDA 3NQVA 4POCA 4ZTYA 3RILA 1LF1A 1JYXA 1RR2A 3GU2A 1EYWA 1ITXA 2VD9A 4MY8A 2YPIA 4DJEA 2X1IA 3A22A 2V5KA 4DZHA 1RP9A 1R6WA 3UWZA 1IT8A 3M4HA 4GO9A 3RDKA 1NARA 1KRMA 1ME9A 3K4WA 2QCMA 4HMCA 1P5BA 1XRVA 4OFCA 3VD9A 2A5HA 5FF2A 2YL5A 5DMMA 1PVNA 1HUVA 2D0FA 3SJ3A 3TN5A 3E0FA 5HANA 3O63A 3AUJA 1SU5A 4W84A 3S1XA 4L4OA 4UOJA 5I7GA 3W84A 4HHHA 1C90A 2J9ZA 3H70A 4PMUA 4U10A 4JTRA 1P48A 1MW2A 3NYZA 1IEQA 4UR8A 1L6GA 1Q2SA 1SW0A 2ZUMA 4K1GA 2A7PA 4QJ3B 1B3XA 4FF7A 1TMHA 5HWMA 2RDWA 3LRKA 3A3HA 1XYZA 2V2CA 3DC8A 3EZ4A 3T0CA 4AZ6A 4JXCA 1KLZA 4O12A 3ID7A 3SUSA 3F4VA 3ONBA 1YNPA 4EKJA 2BX7A 3VNDA 2FGLA 1MSSA 2FGZA 1XG4A 1B0IA 1K8ZA 1XDMA 2Q01A 4NXKA 2E40A 1I2PA 4QLJA 4ICNA 1O6IA 2VCAA 4FIRA 4IMCA 4N4PA 4V15A 3QZAA 3H7RA 5BRPA 4V1XA 2IPJA 4MB3A 3R12A 1AQHA 4NJHA 1HXJA 3M0YA 1SQ7A 3TV8A 4LVAA 5C55A 3U8GA 2D3NA 2PDIA 2BNJA 4JCLA 1T40A 4OE7A 1Z7AA 1PKNA 4LALA 4A8LA 3URBA 1YPIA 2VEKA 3D0CA 4QJ5B 3WUGA 3IJLA 3VCNA 2G95A 4A3HA 2ADAA 2BZNA 1DJXA 3PJTA 1AL7A 5D38A 2GJRA 3I7QA 2OTDA 3O6YX 2O55A 3QY6A 3S46A 4KH2A 1FKXA 3PNZA 4WKFA 4C6BA 3U48A 1K7EA 1TMQA 1V79A 1AA1B 3OZMA 4PMZA 2OX1A 1GOKA 2P3ZA 1BYAA 2TRSA 5HAOA 2DY3A 3WK0A 4IUGA 3A6OA 1TZZA 3O05A 3WX7A 1ISXA 3VPLA 2CXGA 2QKFA 3CZJA 1JR1A 1L8PA 1I45A 5FF0A 3UCQA 5BNKA 1CCWB 4JHOA 5BCAA 1VFMA 4HIBA 4GIEA 4I7UA 1O66A 4DJDD 2GSHA 3A4XA 1SGJA 3GHRA 2C79A 2E1DA 1IZJA 1QNPA 3VIFA 3NUKA 4B2DA 1XSKA 1JYNA 1OC7A 1BFNA 1UWSA 3OTRA 4PUNA 1VQTA 2YOCA 3N11A 4D8ZA 3H4GA 2FZ8A 2FDMA 1DJZA 3ARUA 3TQ0A 1XDJA 4HK7A 2G5WA 4GNVA 4C6OA 1DWAM 4EP8C 1UJPA 3HMJG 4HCDA 3QC0A 3D3FA 4D71A 4QNEA 3AISA 4RXFA 2GVEA 4HZ7A 5D32A 2P10A 3OA3A 5FJOA 2QQ6A 1VBHA 3CEUA 2X05A 3ZXWA 1R0MA 2NVAA 3M0XA 2WZTA 1EBGA 3L68A 3GVWA 3N3MA 4J3VA 2OEKA 1RK5A 3QQWA 3Q58A 2PDLA 4WD0A 5CQ1A 1E0WA 5IDIA 2PD5A 1E70M 1XSIA 1UB3A 1OY0A 3DHDA 2ISSA 3QYSA 1OQFA 1NDVA 2FTPA 4P7OA 1WXYA 1Q45A 1H09A 4AXNA 1E15A 2WANA 3AXIA 3ZVHA 1P1XA 2XN1A 3GC4A 2C0HA 3PJXA 1NP2A 2WVVA 4WKAA 3MMUA 1D7KA 1NIUA 3LCXA 1IWBA 2IXVA 1JUBA 1RJQA 4HYVA 3ORWA 2NW0A 1T99A 4MG4A 1MZRA 2V5CA 3LBMA 5CPOA 4LYQA 1XIDA 1VEOA 2FPVA 2ZC1A 4W4QA 5DF0A 2TODA 1EC8A 2PRHA 3NDYA 4CD8A 3BOLA 3B9AA 5CEWA 2PDMA 3PK7A 3C3NA 4XD4A 4O1AA 3GZ3A 3NGJA 3V0TA 5I6SA 2JFEX 4IMEA 1JDAA 1GVYA 1PWLA 1KCKA 3RPTA 2E8YA 4S23A 3RM8A 2HNHA 3LHTA 4GJ1A 4ZQPA 1R3RA 2FZDA 5A6SA 3V75A 5BMXA 4B92A 3T4CA 1YEYA 2L5HA 1AJ2A 5HUOA 4Y7EA 1EGMA 2XYLA 5XIMA 1OX4A 3H24A 1ZPTA 8TIMA 3PBVA 4AMAA 3APGA 3RYSA 1PYFA 1W31A 5JXQA 2PTYA 1E40A 3BK0A 3EDFA 3WYZA 1QPNA 4UFKA 1OG0A 1R3SA 1RD6A 1MEIA 5I03A 1XXXA 2PF8A 2DZSA 3OYZA 3LBOA 4WVXA 5B7ZA 2DPEA 5K2ZA 4H7ZA 4QBXA 5JIWA 2ZRUA 2WBKA 1EOMA 4D72A 4H6KA 3QMRA 4K3ZA 1Z8AA 4M24A 4LV4A 1KRBC 4EXQA 4PTNA 1IWPA 4ZEPA 1F8IA 1JPIA 3UD6A 1AQMA 4N9BA 4XBKA 3U3HA 3HGJA 4WY0A 4NAFA 1U5JA 1P6WA 5G1MA 4JEJA 2WLYA 3PBWA 2Y89A 4L1XA 1V3LA 3GFXA 3LXBA 1HVQA 2J77A 1FKWA 4F40A 4K6AA 3D5HA 1Y5WA 2ZX5A 1RVGA 1M41A 2G0WA 2P0OA 1ICQA 2ZXQA 3GHTA 3WJWA 3LB0A 1BTCA 2QAPA 1N2VA 2ZXAA 1R5YA 4XSLA 3I68A 2JALA 5FI8A 2R82A 3EX2A 3L4WA 1KFEA 2QCFA 1O4UA 5T91A 2BOFX 5DRIA 3RRXA 3M16A 4UQEA 3SR7A 2ACQA 2E5CA 3B9NA 1EPVA 1ZAHA 4BJHA 1FWDC 1G4EA 2C1IA 2Y61A 4HHPA 1QW9A 1AQFA 3THQA 3CEPA 1XRSA 1LT7A 1KXVA 5FJIA 4PUMA 1EUAA 4Q8TA 1W1ZA 4DBWA 3WLIA 3IACA 1PPIA 1TPEA 3TC6A 3TMQA 1TPUA 1GHRA 3RU6A 3T55A 3ITGA 4TMBA 3F2DA 2YCIX 4LUTA 1RALA 3R2GA 3W7QA 5HQLA 4NZCA 4N02A 4GINA 4NZ5A 3BICA 4W88A 4J1OA 2E0PA 3S4TA 5F4XA 1U1UA 3NL3A 5LHFA 4HA4A 3P82A 1UC5A 2JK2A 3CAKA 1LWIA 3VIPA 2BHZA 1TTPA 4QAIA 2ONEA 3WL1A 4WSKA 3P81A 1W8GA 3TQVA 3FN9A 3CK5A 3C2YA 1Q6CA 2X1TA 2E67A 3OHMB 1GOXA 3G1HA 1GQLA 1E0XA 1RCOB 1EP2A 2E77A 4CN1A 3EOLA 3BURA 1E9YB 3GO2A 4RJEA 4CD5A 4AYGA 4J28A 1F3WA 4CNNA 5LZLA 1TE6A 4QE4A 2PLJA 3STPA 3L23A 3E1F1 1QUMA 3Q65A 2F8QA 3B8IA 4YCPA 2V3GA 1TJ0A 3S8HA 4M1BA 2R1PA 1DJIA 1O7AA 4ZE4A 4D1JA 4E4UA 2A21A 2A3LA 4YLWA 2XHYA 4PSRA 1QWGA 1DIEA 4KWWA 2YZ5A 1QNVA 1H62A 4WDWA 4P8VA 3PWGA 4L64A 4Y9MA 4N6FA 4MSSA 1QNRA 4FOUA 3HGSA 4HHMA 4BKNA 1UPMB 5K7JA 1OINA 1DXIA 2DIJA 5FOOA 3VIHA 4OZOA 5CPNA 3P6LA 3CQ0A 1TX0A 3W02A 1HP4A 2PSNA 3U7BA 2W67A 1KTNA 4J4KA 4QSFA 3W53A 2O7QA 3LZ5A 3I6TA 1HJUA 2VRQA 3K1DA 4K8EA 4E2BA 4UNIA 5L9FA 1XC6A 2ACRA 3VOGA 1RP8A 1TKKA 5F2MA 1R87A 4W9TA 1IIHA 4JKMA 1EEXA 1UH4A 3QR3A 3LV6A 2CZ5A 2R24A 4UTJA 3UP8A 4GUJA 1KQZA 3TCSA 4ECLA 4JNYA 4FK9A 4LVFA 4QR6A 4IIHA 3LERA 3OOQA 4QS6A 3W1QA 4HA1A 3DHUA 3AXMA 3S0CA 4YPJA 3EX4A 4AHOA 4MY9A 1BQCA 4OWGA 5HMDA 1E4MM 3ZLHA 4C91A 4ILSA 3GVVA 4WEVX 3NDZA 3N2OA 2R1NA 1KBIA 2OMAA 4F9JA 5G4WA 3BC9A 1OFPA 1SMDA 3VD7A 4MOZA 1A47A 1F8MA 1GQNA 2P8BA 1PX4A 2JF6A 4QSHA 3WNNA 5DLCA 1QVBA 1HJWA 1VFLA 2PGRA 4G1KA 1NH6A 4O28A 2PCEA 1R2SA 3OVPA 1VIWA 3KOXA 2Q71A 5TD4A 3THDA 3QPEA 2BY2A 5IHRA 3XINA 1HJSA 5E0FA 3W37A 2ZWZA 3VOJA 3L5AA 2QJMA 3ABXA 1OFOA 1S2CA 2REQB 2ZXDA 2JGYA 1WKEA 4AF0B 3B04A 3AYVA 2PWFA 1NU5A 3M5YA 1PTGA 1HX0A 1TG7A 1IT0A 2JIWA 3P8IA 2X40A 3EB3A 1VBGA 3A24A 3GZAA 3KBMA 3B05A 4JZ5A 4F3HA 3TOPA 1WAUA 1OIFA 1F73A 3ES8A 3LPGA 4W86A 4JIEA 2NZLA 2PGWA 4O18A 1A5MC 3CMGA 3RK8A 1FCVA 5D09A 4LCSA 1E6XM 2ABAA 1AL8A 2GQ8A 1TTJA 1W2PA 5H8MA 4HSOA 1UD8A 3AHVA 2V0TA 3LY0A 4Z0SA 5JMUA 4O52A 3QXBA 3S2CA 1HL8A 1U5VA 1JDFA 3AU6A 1VYSX 4M81A 2ZZ5A 3BLFA 4IIFA 1ADDA 3FJ6A 3BCJA 3W7NA 4D6HA 4GIRA 1CDGA 3T2PA 2OGJA 5J04A 4Z1CA 1BXCA 1UOZA 3HURA 2QGHA 3HA1A 4MB5A 2INFA 2FHBA 2Y6ZA 4M51A 2VR4A 1LYXA 1Q7MA 3JU2A 1BD0A 4QIUA 1J96A 1JI2A 3VKJA 4Q8MA 4X9SA 2BGQA 2VUYA 1R3QA 3E2VA 2D69A 4OHQA 3NEHA 4UIOA 2VC7A 1E71M 3CUHA 4C6FA 1ZBWA 2CLKA 2XIOA 1GVSA 2Y85A 3QPYA 3SRDA 2MANA 3SUUA 1SR9A 4C5ZA 2HISA 4ZR8A 2H90A 2PLCA 2WMIA 5BRBA 4R5EA 3VDCA 4PA8A 4GJIA 2PRLA 2XGBA 3CQIA 2VENA 5EKYA 4GI8A 2VDIA 2XJ7A 2DZBA 4CCZA 1X6NA 3APTA 4Q4MA 1AK5A 2J13A 4KMQA 5LSMA 3CUFA 1BTMA 7CGTA 4V33A 3TKFA 3ZWTA 3QEZA 3V36A 3JVAA 1WKDA 1JVNA 2JQXA 3W26A 1VD6A 1JPMA 3HOJA 2OOGA 3VKCA 3RNDA 1A5CA 1O94A 1ZP4A 1NQ6A 3QOKA 3QKZA 3NZGA 3P62A 3QHNA 3VX0A 3WDJA 2B31A 1S1PA 2XIQA 4JX4A 1RY0A 3FV9A 4BR1A 1FQ0A 2J79A 4OU1A 1FWJC 3O6AA 1CZ1A 3GG0A 1IYXA 1P43A 4DWSD 3BLIA 3GTNA 1B9ZA 2E68A 2A3CA 1J2BA 5A2AA 2D23A 1LORA 4GQGA 2C18A 1US3A 1YBQB 1MEHA 4JTJA 3N13A 3MYOA 3ABQA 3DYMA 2WKLA 3TSDA 4AD1A 1IIGA 4ADUA 2TYSA 1FFRA 2DSWA 1PUDA 2F2KA 4B5SA 3CAWA 2INZA 3MSYA 2D0HA 5U7SA 1CWYA 3DH7A 4C7GA 4WOQA 3P74A 5IBXC 4JICA 2QJGA 1G0CA 3KVKA 4XAPA 3HG4A 2VT0A 4QDMA 4ROQA 2VEGA 3E9AA 2V81A 3DYPA 1J2WA 3TJIA 5FIPA 3KBSA 4GQBA 3DFHA 4AUBA 2JE8A 5D33A 1DQXA 3QZEA 4EPDC 3LQLA 1JRCA 4P7LA 4M5PA 3C6CA 1W3NA 3UVIA 4I6VA 2PDBA 2IUZA 1C9WA 1NFGA 3Q37A 3IGHX 4L9XA 1J6PA 4H9UA 3KL0A 3HPFA 1XYAA 4KWOA 4IPNB 4O53A 4RZ6A 3R4IA 2G3JA 4B9YA 3WLMA 1YXYA 4H9YA 1F6PA 3HIJA 3OG3A 4MJ4A 3CUXA 1YYAA 2H6RA 2VWTA 2Q02A 3PN8A 1UZ1A 3MVIA 2XDFA 1W37A 3IIOA 3GIQA 4PRTA 3PPCA 3M5VA 1FP8A 3TXVA 3F4CA 3WDPP 1LBFA 4DM1A 3PBGA 4NNCA 4HA3A 3WQVA 1J0KA 5B7YA 2ZUNA 3IJ8A 3W2LA 2Z0IA 2POTA 3GR8A 2YCEA 4H9ZA 3NQCA 1EJXC 1A49A 3EA2A 3EWCA 3G1DA 5FL1A 4Z1BA 4JTQA 3WD4A 4GC3A 1EDTA 4O1CA 2VQUA 3KBJA 2J74A 1YTDA 1OCNA 4Y9PA 1WYIA 3W74A 1EXPA 3RU8X 2DT2A 1VFFA 1EJRC 5TIMA 1IHIA 2IXUA 1J0HA 4EXBA 3UG3A 3G77A 3PB2A 3HQ1A 3E2RA 1A5UA 1DJWA 4E5TA 4E3VA 3QVQA 1V3MA 4PMXA 3MUXA 2RHGA 3VI2A 4ATDA 2ZRYA 2YB1A 3DEQA 2WKGA 3E96A 3Q94A 2PDCA 5AC8A 1QK0A 4H8VA 4RPPA 3SY8A 3W7CA 2J27A 4JX5A 2WQPA 4GD0A 4UTTC 3WELA 2IMRA 4ZFMA 4IP7A 2QZRA 1PWMA 1UD2A 4WKHA 4A8RA 3WEZA 3PUGA 4S3EA 4UQBA 1U1HA 5M1TA 1AG1O 2W4XA 3HBLA 4R7OA 3FIGA 2Y7EA 1MXGA 2ZZ7A 3N15A 4UCFA 2HWGA 2OODA 1UWQA 4JYFA 1Q66A 4CCDA 1KV5A 1K7FA 4AZ5A 3REQB 2CWXA 1TPC1 3GVQA 5CBIA 5HXMA 4U3AA 1GT8A 5EYWA 4Z17A 1ZBVA 4NL1A 3MCNA 2I5IA 4QEHA 4DXVA 3WUBA 3M46A 2NSXA 8RUCA 4NT0A 5DO8A 3FX4A 3ANVA 4WSHA 1SFTA 3USBA 3B8VA 1XFCA 3E74A 4O8AA 5HMEA 2Y0FA 2VKZG 1T96A 3EXSA 4WXYA 3LN3A 4X0VA 4PMNA 1DYSA 2Z28A 3W76A 5FJRA 4WDTA 1YHTA 3C2EA 5AHMA 4B3KA 3WD1A 4XBJA 4HN8A 5AVNA 5HQMA 5ABTA 7TAAA 2CZVA 1Q6GA 3RHGA 3VZYA 2FFIA 1W5PA 1YXCA 5CPTA 3UPBA 1CGUA 4PCNA 1JFHA 3CL7A 1LT8A 1A0EA 1L6YA 4DY1A 1UJQA 2XZ9A 1CEOA 1OB0A 1AJ0A 2HJPA 2XZ7A 4HNTA 5C9XA 3V16A 1H7RA 1MW0A 3S1WA 4RLIA 4HBKA 2VP8A 3DBNA 2NQJA 2Z1SA 5CC7A 2J7BA 4OOUA 3UCDA 3VNKA 3UNTA 3NQ7A 4LNYA 3VOIA 2REQA 2OU4A 4TUFA 4TMCA 3DENA 3UPWA 1B4KA 3SGGA 2DJLA 2JBMA 4AF0A 1G94A 1X6LA 3T7VA 3MT1A 1S2TA 5G2HA 4UZUA 2UZ9A 4Q4QA 2PP0A 3D47A 1LOLA 3PC0A 3RX2A 4S3BA 4PUEA 3TCEA 5I3JA 3N2BA 5AZ0A 1X7IA 4DYKA 1WXJA 2X42A 3VZZA 3LBCA 1YPFA 3UW6A 2NQ9A 3SJNA 3GWQA 1H0IA 1KO0A 3KRZA 3W1RA 4NQ1A 1XISA 3TFXA 5HNUA 4HNVA 4HYWA 4LAKA 3KWXA 4GE8A 5EMLA 3VNYA 4HSNA 4LJ3A 3BG3A 1NTHA 2F84A 1HGYA 3QMTA 4PTMA 3FA3A 3M0VA 4GFSA 1MUWA 3B0VC 3S6TA 3MI3A 1UWUA 4M3PA 1X38A 2V5LA 3R7MA 4CN4A 1NAL1 2Z7KA 4Z2KA 1Y5XA 4TTUA 1J93A 3O9NA 2DZAA 2ALRA 4MLRA 3CHDA 3KVLA 4GHRA 1DE5A 3IS4A 1J5TA 1EH9A 2PU1A 1L2UA 4BFAA 1KGWA 2F7FA 1W3HA 3LSBA 1XYMA 3JUGA 3CL8A 3G24A 4IT1A 4FR6A 2X0SA 3WK1A 2CBIA 4F0HA 3G1YA 4NJGA 3KZSA 3MS8A 4BF5A 3N34A 5C9ZA 4ML4A 1YW1A 4CN6A 4DJDC 4C7FA 3EPOA 4GCXA 3W7LA 3NURA 2V3FA 4HZ6A 1H2JA 2G4FA 2Z1BA 4UTIA 4DBEA 1OX5A 2IKIA 4KCTA 3U0HA 4RE0A 1V8EA 1TSIA 3PG8A 1XH1A 5I09A 3WH7A 4XZMX 3G5EA 3M44A 4JHZA 4BI5A 4AIUA 3ZMRA 3WJXA 4AZHA 4CLMA 4M6UA 4LOCA 4XUYA 5LHEA 3FSTA 4MVAA 2W66A 4HKPA 2OSXA 1UD3A 4C6PA 2YYTA 4Q8WA 4E2OA 4UC5A 2E6DA 2PWDA 2ZUSA 2PDKA 4WHBA 1W5MA 4F79A 4NHVA 4LVBA 2XSBA 3GB6A 1FHDA 3W0KA 3HPAA 2DIKA 2PF0A 2X1UA 4PMQA 5TNVA 4KCUA 1XD0A 1O1ZA 2PMQA 4PL2A 2KZHA 4F0KA 1TTQA 3VD5A 4K8HA 2BHUA 1MW3A 3ZR6A 3CIVA 3TH6A 5D04C 4B2DD 5AKQA 4JIQA 1H0GA 3T9PA 1GVIA 1GWJA 5E0KA 4MKVA 1ZRQA 4PE8A 3R89A 3UXDA 2BTMA 5CSYA 2ZYFA 4Y9NA 3VVGA 1QPQA 4J5NA 1H50A 2FMOA 2ZFAA 2Q3RA 1XLDA 4KEVA 2YXOA 4RZ5A 4GK8A 4UFMA 1NOFA 1OFAA 2QJJA 1YBQA 1DJHA 1MQQA 5AECA 2X1RA 3MDWA 4REQB 4JIHA 2ZA3A 5LIYX 1GNXA 2I16A 2G3FA 3BLLA 3C52A 1DJNA 4EAYA 3SGZA 4AVNA 1RA0A 2ODOA 2J7GA 3MTWA 1ISVA 1M03A 3T78A 2Y8VA 1NWSA 3S6OA 4Z2LA 5DT5A 3ZFHA 1TFVA 1PZ3A 1FBAA 4E8DA 2VYOA 3POHA 4RDYA 3FSUA 3W7PA 1D8CA 4ZO8A 5JIPA 3RITA 3IVSA 2BDQA 4PCSA 1R47A 5LA0A 3H2OA 1QXLA 4W93A 4JTGA 1GOMA 4RNIA 1AODA 3IJDA 4L6OA 2DT0A 5F2GA 1LZOA 1IF2A 3BAIA 3J7HA 5K4XA 4XAGA 2WJFA 3WQ4A 1FCQA 4TV5A 3CB3A 5MHBA 2YLAA 2WC4A 4EWJA 1QRQA 3EWWA 2ZX7A 3GBEA 4IM4A 3UG5A 4TX6A 2IPFA 5D4YA 3W1NA 3KCJA 1SFSA 5A1AA 2FVLA 1ITQA 2QEZA 2VNCA 3OA5A 1JPKA 4I7VA 1R8LA 2FPYA 4A3RA 4Q4KA 1DJYA 2OB3A 2JKPA 4AW7A 5KITA 3GHUA 3LSCA 2POZA 2QVNA 3EWYA 3B0UX 4HTYA 2P0IA 3KW3A 2HZGA 1KXHA 3FVMA 1V7AA 3GIPA 1WOAA 4RZBA 3WG6A 5AYYA 2D24A 2Z4GA 1V6XA 2FB3A 4CNPA 3L4YA 5IHSA 3SCTA 4IX0A 1Q8JA 2RDTA 4MY1A 5ABHA 3C86A 4YTRA 3O15A 1TPDA 4ENLA 3EMQA 2YW4A 3E5PA 1DP0A 4Q4SA 1VJZA 4HU8A 1FWCC 4IFKB 3GLCA 5EU9A 1LL6A 5D2TA 4N9DA 4Q3MA 1PXGA 1US2A 4FAMA 1D9EA 2OZ0A 1EGVA 3EAUA 3WH9A 2CLEA 2VC5A 3G3MA 4JQAA 4N9EA 2O4MA 1FWFC 3DKLA 3VKBA 3DXIA 2WSYA 3KEHA 1WE5A 3O3RA 3THCA 4H6RA 1VCFA 5DELA 3MBDA 4WRHA 2PTWA 2VX6A 2C0AA 5BOFA 1IQ8A 4AX7A 2WCGA 2E7FA 3GDBA 4XG1A 4FLOA 4QCEA 2DT3A 2LLEA 4D2JA 1QBBA 3NQ2A 5G5IA 4CQDA 4FNSA 4LBSA 1R85A 3STCA 3ZJKA 2PTDA 1PIIA 3TN3A 4J3UA 4IHCA 3TTSA 1W1TA 3CYJA 2Z2BA 3ELFA 5BMWA 4PRWA 1UA3A 2BY3A 3DI1A 3QGKC 4P7QA 4LV9A 5CZJA 3VM5A 4N9CA 4C6MA 1XI3A 2WV8A 4AZGA 2NVCA 3I7SA 3R1ZA 4QROA 2XH0A 5DXYA 5K9DA 2VO5A 4LNCA 3UG8A 3CQHA 1JNEA 3REQA 3SY1A 1DXFA 3WF1A 1TV3A 4UFLA 3UWEA 1K8CA 3BJFA 1KKRA 3CQJA 1OADA 3OLIA 3CH9A 4LAUA 2Z27A 4IGSA 4FO4A 3T0TA 2DUZA 3N9KA 4HP5A 2Y7FA 1MNZA 5I79A 4OUIA 1K8XA 2P50A 1RJPA 4O4VA 4ML9A 2D73A 3TUUA 2I9UA 3NOYA 3QLLA 2Y24A 3CPRA 1J12A 3M0LA 1EB3A 3OP2A 5B80A 1LBLA 5CLTA 3RCYA 4H9MA 1XKYA 3EWUA 3I6RA 4PB4A 3V5FA 3WLJA 3OBKA 2GSJA 3QLDA 2ICSA 4NXSA 4BK9A 4LXFA 1VRDA 3V35A 3ZLFA 2PC8A 4LB3A 3S1UA 1Y5VA 2WXDM 1KBLA 1LCOA 1U5HA 4D6GA 5DCDA 3RIKA 2CC0A 3AQUA 4AAJA 3GXIA 4HNUA 3MYPA 1FTXA 1BVWA 3TQPA 1QTWA 3BG9A 3C0QA 1JCNA 4M19A 4F2UA 1I9CB 4DJFA 1KM2A 4F9DA 1JRBA 1GJUA 5LNRA 4B5VA 1CXFA 2A85A 3V1PA 2X2YA 2D20A 1SO6A 3UR2A 1ME7A 1KC7A 4O1FA 2PP1A 4Z1DA 1MRQA 4GABA 4WR3A 1YDVA 1KRCC 3CAVA 2WMHA 3OLEA 4O8RA 5AB3A 1B3ZA 3HQNA 3RX4A 1IGWA 3IGUA 3ZVIA 1N7KA 1H1NA 2D0GA 4IUOA 2DH3A 2CEQA 1VC4A 2QJNA 1QU4A 2FH6A 3LCHA 1AH4A 3DZ1A 2PDPA 5ABFB 3IPWA 3KRUA 3OZPA 1HJQA 3LGGA 5JUVA 4TOQA 3WSUA 4Q6JA 3TAOA 1E6PA 4MWAB 4AB4A 3FA5A 3W2KA 4NNBA 4Z2JA 4NILA 4ZVJA 4PFMA 2Y2WA 2E5BA 1RA5A 2AOSA 2R1KA 5C9UA 5L6UA 5HPOA 2VUNA 3KRBA 4G5DA 2VEPA 3G0SA 3DFTA 2PC4A 3LI0A 4UTKA 3TYBA 1HKMA 1P0NA 2WK2A 2PP3A 3N25A 3D46A 3WNLA 4C65A 1LM1A 3U9IA 2CNCA 4V27A 5C9WA 3EX3A 3IRSA 4M6VA 3U4AA 2HBXA 4MJMA 1A4MA 3W27A 4Z1YA 2RKXA 1CXLA 2BASA 5G4HC 3KUMA 3QR0A 1RPKA 6CGTA 5JBDA 4RPQA 4TR9A 2BBFA 4E2DA 1JZ7A 5HNTA 9XIMA 1FWIC 4WZHA 3CHVA 1JCMP 1GW9A 5KINA 3HB9A 3BJSA 3VABA 3WUFA 1BWLA 3ALFA 1Z44A 3QOMA 1TWSA 1NF7A 3M0MA 4IP4A 3BWWA 1XCXA 1P0BA 3KVJA 3CO4A 4I90A 2QJIA 2C16A 3LU2A 3M0IA 3YPIA 2GUUA 5K9CA 3OVRA 1NDWA 3W7DA 1XV8A 1PHQA 4L61A 3SO7A 1E55A 2F9RA 1LQ0A 2QUMA 3P3BA 3S2JA 3NVDA 5FAJA 2PLMA 1U83A 2DVXA 4CUCA 1QOPA 1AMYA 4RZ4A 2NLYA 2BXVA 3ABZA 2PGFA 1LBMA 3UU0A 2HSAA 1IZKA 3QHMA 2PU0A 5CCZA 1W3IA 4UMBA 3O6CA 4C1KA 4TU1A 4E4FA 2D2JA 5AHLA 3B9EA 4U33A 4M8UA 4JL2A 4HHLA 2VWSA 3NPUA 4U28A 3HTWA 1O5RA 3NXFA 4C7DA 1Q6RA 3F03K 1S39A 2BGNE 1E6RA 1FY6A 2Y7GA 3ITTA 4M7SA 4FS9A 5LNWA 1FA2A 4KEMA 1WAWA 3HG2A 4P5UA 1OSEA 5A6BA 4NI8A 3XIMA 4E0CA 3IANA 4QNWA 5IDZA 4REQA 5J8LA 4LTSA 3VDGA 3BAJA 1M7OA 1BWVA 3V1HA 4MNJA 3DECA 4H9XA 4Q8VA 1TUXA 1QI3A 1C8YA 1C92A 4DZIA 1M7XA 1QI4A 4FF5A 3EKLA 5I0DA 3W83A 2WHLA 4Q4OA 2WM0A 3OEXA 3C56A 3FW6A 3UZWA 1YPXA 3VIJA 3W1PA 1PO9A 1FUYA 3PPFA 3PSVA 3Q45A 3IGXA 3LPOA 4CQAA 2BVWA 2G3IA 3L7RA 2NXIA 1JUEA 1VJSA 2EJAA 1QCWA 2V67A 4ONVA 3OO2A 2O92A 4O1EA 5T8GA 1CECA 3LCFA 2QCDB 1KWKA 4O15A 3OG2A 5D8ZA 1UWAA 3R0DA 5H8UA 4GQQA 3BCDA 2ZDRA 1V08A 4QQUA 4ZGYA 3LHZA 4FIQA 4DNMA 2DV0A 1GHSA 4D9PA 1H60A 1RZMA 3E3HA 2X2GA 4TO8A 1SJAA 1R9ZA 3VUPA 1T7LA 4EWND 1WQ5A 4ZCWA 3KTSA 4DWSC 4X3ZA 1P7TB 4JTHA 1A80A 1DL3A 2ATSA 4HMDA 4AMCA 1TYGA 1JYVA 1F3EA 2VX5A 3OODA 3F7JA 4B3ZA 5AOUA 1NJJA 4S3KA 1B4EA 1K7XA 1H5VA 2Z00A 3NEVA 3SECA 4GUFA 1YXDA 4H7CA 3GUGA 3DUGA 2XVLA 1UW9A 1BHGA 3NQ8A 1ITUA 4BEQA 4MWAE 4XZ9A 3G3DA 4QRNA 1SO3A 3DI0A 3AICA 3V0SA 2WNWA 1G01A 4NZ4A 1ENUA 1XH0A 1WZKA 4Y8EA 3TYZA 3BOFA 1GONA 1JQVA 1X1ZA 1CGVA 3H22A 1DOSA 1JDDA 1EJ7L 4F2BA 1PIGA 1RLDA 2WYSA 4LAOA 2ACSA 1QATA 2WHJA 1EX1A 3UZZA 1WKFA 3K46A 4J9JA 4DUOA 3PY2A 3IAPA 4ZA0A 1EHAA 4INFA 1ECEA 2PDUA 1G7UA 3P0XA 4FA3A 1Y65A 1ML1A 1HP5A 4FNPA 4LCQA 4LANA 1L2QA 2Y62A 1YIXA 1I1XA 2VC9A 2CHNA 5CPLA 2BMBA 3HZ3A 3A47A 3GG8A 4GCAA 4XSMA 4HK5A 3L65A 1KGXA 3FA4A 2BVDA 3VDHA 1KM3A 1Q6FA 1TMLA 4LCRA 3ITLA 3GR4A 4HNCA 1MQPA 3MSGA 3LCIA 3SIMA 2VMFA 3M7WA 4ZE5A 1POJA 3WLRA 4A2RA 2HK0A 3A21A 4YTSA 4JFWA 3CGTA 1C7TA 3Q2DA 3C3UA 4ZXLA 3RLUA 1NFPA 1NSJA 2W91A 4G56A 3URQA 4WJ8A 3MP5A 2V69A 2V6AA 4C6EA 4L6DA 2A79A 4PUDA 1FWTA 2KAUC 2CLOA 3TR2A 4CQ9A 4YVVA 3FOKA 2NQHA 3OJGA 1IXQA 2C1GA 3VGHA 3A5VA 1KGUA 2FZ9A 3RMEA 1GGOA 4FNTA 4P7RA 3PAJA 1MEWA 1TUFA 5LIXX 2NV1A 5U4NA 1ZS2A 3GTXA 4Z1AA 3MHFA 4UMAA 1EZ2A 1XLMA 3H6OA 2WVTA 3PNUA 4FP1A 4AWEA 3SB0A 4PYSA 3BVJA 4L1GA 1BVZA 1XCFA 3UJRA 1PZ1A 3NPXA 4U4MA 1ZAIA 4FNRA 1WZLA 4HU0A 4P7NA 3IUHA 3RM9A 4ERIA 4LUIA 4IG2B 4M82A 3LCGA 4LW7A 5AFDA 2JGQA 3E0IA 4QG8A 3FVDA 3W23A 3ZT6A 4ZENA 4JFTA 3SURA 1LRNA 2GGHA 4BQ5A 2P76A 1X6UA 2B81A 5AHFA 3FY1A 4B5XA 1PCKA 1EP1A 3MPGA 4H6QA 3C0SA 3W9ZA 3DGBA 3THUA 4Y9AA 3AIBA 5DMYA 2AGTA 1A4LA 4YHGA 2AL2A 3TR9A 3KP1A 1CGWA 3Q67A 4XD5A 2RGMA 4LT9A 3WDHA 1ADSA 5F7UA 3LD5A 3MUY1 1XD1A 2AQWA 2YCJA 2VFFA 5H1WA 2HPIA 2PPGA 5D30A 2Z24A 2YA0A 3PPHA 2PWGA 4ICMA 1XLJA 4PL1A 2F61A 4KWSA 4L56A 2WJEA 4XVDA 1EWDA 1PL9A 4G1NA 2GGJA 1GKQA 3BZGA 3IVUA 1MMFA 2J8TA 3T1GA 1UR4A 2QMKA 3MI2A 5FL0A 2YA2A 3MKVA 3CV1A 5M5DA 2EGZA 2ZA1A 3GY1A 3GX9A 4FHAA 3VTRA 3LGDA 4HK6A 2SFPA 2VDGA 4DWSA 2W27A 3HV9A 1THFD 1TWWA 1WZMA 3N17A 2YDAA 3AHZA 3RM4A 4J2MA 5J5RA 4JD4A 1W32A 1PE1A 1X96A 5ABFA 3H53A 3W1TA 2WMFA 1UD4A 1ZCOA 1R38A 4PFHA 3MBFA 3UERA 4IQJA 4MWAA 3USZA 2E1WA 3S5SA 3VFLA 1UBSA 3O16A 1UR1A 5CBJA 2ZC8A 3UCCA 4TQTA 3KBWA 5HR6A 4IP5A 1TJ2A 3EDEA 1D7FA 4ACYA 1GVEA 2GL5A 2Q8ZA 4NZ3A 5A6KA 3R94A 4HOZA 5C5YA 3TEVA 4WJEA 1W91A 5EFFA 3WDIA 4ZBCA 3GXTA 2PZ0A 3LA4A 2EEXA 3BMXA 4X22A 3PTQA 3STEA 3M64A 4QX4A 5HPCA 4Q6XA 1V3HA 4IGHA 3MA8A 4P8UA 3B8DA 1NWUA 3BLKA 3G1FA 5DXXA 1UMYA 2WHMA 4DVOA 5H2ZA 4P8WA 4JY8A 4B90A 3N19B 1OD0A 7XIMA 3OZOA 1LG2A 3WK3A 3AOFA 3OHIA 4HU3A 1TV5A 3PR2A 1BSLA 1R86A 2TAAA 1RXOB 3NQAA 1I6NA 3TJ4A 4DN1A 2QUUA 2QF7A 4R9OA 2OGYA 1B57A 4E2VA 3CTTA 1TQJA 3I65A 3OZYA 1UD5A 1YADA 2ISVA 4KFNA 2HRWA 5LKYA 4UZSA 1KM0A 5FCZA 1AZ2A 2IQ0A 4LYKA 1RSCA 4P61A 4PCPA 4XKYB 4Q4PA 2VXNA 2IKJA 1P0DA 4GH1A 1A53A 2VELA 3B4YA 3VCCA 2CHOA 1GEHA 1JD7A 3LG3A 2J62A 5M2FX 2V5JA 2GQAA 3CH0A 5IXEA 3NO5A 2ZUWA 3GDRA 2WPGA 1LRTA 4CNTA 4HJFA 4CQBA 4EE9A 4AXKA 3HJZA 1EZWA 4BHYA 3KZPA 4ORIA 1OX6A 4GBDA 1SJBA 3ZR5A 3SZ8A 3CHCA 2YDRA 1G7VA 3VE9A 2MUCA 4JTTA 2H3DA 4PH6A 3WD3A 3WBAA 2Y70A 3TC7A 1PKLA 3P67A 2WBGA 2YJQA 3TZNA 3MC5A 2W63A 3EDKA 4QDWA 3L12A 3NQFA 5ABGA 3R8GA 4WGXA 3UEQA 4HJWA 3W6MA 2W5FA 1G9HA 2OLSA 3CB8A 2IQDA 3NL6A 4A05A 1XIHA 3BAYA 4PMVA 4WDXA 3TMLA 3URNA 2ZBTA 1BAGA 3LDVA 4KRTA 2FHFA 4PCTA 5CGQA 1OGBA 2EAWA 3LPPA 5D03A 2GVGA 1KNWA 1UP3A 5CJNA 4GKTA 3W25A 1W5QA 3BARA 3OU8A 3SUTA 5K3VA 3VKAA 1SR0A 1IGSA 1GTEA 2NLIA 3IAQA 1V03A 2AQVA 3RGTA 1EJSC 2DZWA 3AI0A 2IW0A 1CB7B 5GNZA 5AYZA 1W3KA 3W1UA 2WO5A 3E5BA 4H2HA 3NZRA 2PDGA 1TO3A 4MKSA 5GVJA 2PRMA 1BVNP 4Y8FA 4FMVA 3UPMA 2QDHA 4YYFA 1J0YA 4R34A 2GYIA 3CYVA 1F4AA 2MNRA 2QCDA 4UNLA 4HOWA 2Z26A 5A8QA 1JNDA 1SVDA 4FALA 1UOKA 2I17A 1IT7A 2NSOA 1ESWA 3TYAA 4IL2A 2TPSA 8XIAA 4B4FA 2YR1A 3GH4A 2PTXA 1P7TA 1LROA 1AD1A 2ZKMX 3S83A 1GKPA 3QN3A 2X09A 4LS2A 4QXIA 1JZ8A 3BGGA 4IPIA 1PYMA 4GRSA 3RF9A 3K4AA 3LX9A 1FHLA 1VPYA 1FWBC 5FEWA 4HPHA 4C1NB 2ZX6A 3VIIA 4JEQA 4YMZA 1B3OA 3BAXA 5BZAA 2OO6A 2X8RA 2CETA 2DZUA 3WD2A 3PULA 2GVJA 4H3DA 2OEMA 3G2GA 1MQRA 1G4SA 3RXZA 1ECQA 1CLVA 2CYGA 2VEMA 1RCXB 3L5LA 1XC4A 2OXNA 3NTYA 5DEZA 3A5FA 4MJ2A 1NDYA 2Z1VA 5PTDA 4WJXA 3HFTA 2GQ9A 2OPJA 3WBXA 1GKRA 4S1FA 4GH3A 1SZNA 3KTCA 5CAKA 1ICSA 3IUDA 3IARA 3CQKA 1Z6KA 4QJ4B 1N55A 5HMSA 3WDRA 1JJKA 2QCLA 4AISA 5A6JA 1R2TA 5D9NA 1NDZA 3SQSA 3CXOA 2DZPA 3UXKA 3LV5A 1EWEA 4Z42C 3VNJA 2BVYA 3WQFA 4YVXA 3LPFA 2O9PA 3WZ0E 2YGYA 1HIZA 1BYDA 2C3ZA 3WQCA 3HPSA 4AY1A 2C14A 2PDXA 3TWAA 4AWSA 3WMBA 3UXLA 3O07A 4MJZA 3P5YA 2E8ZA 4ZO9A 1GOOA 1POKA 1UH2A 5HJXA 4PMDA 5EY5A 3U2EA 3UNDA 2OLHA 5JBEA 4URIA 3WCZA 5IM51 1V51A 4IXXA 2Y5JA 4D8LA 3PANA 1XBZA 1CIUA 4O57A 4KERA 4S38A 1JIBA 3VE7A 3E38A 4AD5A 2W92A 3VIGA 3AFBA 3FLUA 1V6UA 3VGGA 4WY0F 5I06A 1XLKA 1KFJA 1OC6A 1CB2A 2W79A 4LBRA