1PZ3A

Crystal structure of a family 51 (gh51) alpha-l-arabinofuranosidase from geobacillus stearothermophilus t6
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
497
structure length
497
Chain Sequence
KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNEMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-L-arabinofuranosidase
total genus 172
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pz3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pz3A02
3AJ7A 1VBUA 3VM7A 1M01A 3TOPA 3VD3A 3ZSTA 1CTNA 1C92A 3WENA 4ML4A 2FGLA 2EXOA 3BGAA 5CGTA 2WKGA 1ITXA 3HG4A 1QI3A 2J75A 1X6LA 2E40A 2IXUA 1C91A 1B31A 3DECA 4DO6A 2WMFA 3MUZ1 3ALGA 4NF7A 3W27A 1W32A 1F4HA 3AI0A 1EQPA 3UG4A 3VX1A 4K68A 1W91A 4HP5A 2YIHA 1O7DC 1E1FA 4J27A 3VGHA 2Y2WA 4AXNA 5M3WA 1AQMA 3L4XA 1IT0A 2PWHA 4HPHA 2YFNA 3VDBA 4UCFA 4LGXA 1CYGA 2CYGA 5JBDA 3A24A 2XFYA 1EDTA 4AD3A 2F7QA 4CKQA 2DPEA 1VF8A 2D22A 5JIPA 3WQWA 3WMSA 5BXPA 2MANA 3A4AA 1EO5A 1JI2A 2EO7A 3AHVA 3ARZA 4F8XA 3S5YA 1L0PA 4AWEA 2NW0A 4AC1X 4LYPA 3ZJ6A 2WSPA 2XTKA 2WVSA 3CZEA 1HJUA 4HZ7A 3PZUA 2VUYA 2DIJA 5KEZA 4PTWA 4F9JA 5JIWA 4W85A 2CPUA 2W4XA 3SCNA 2WCSA 2IXVA 2A3CA 4OBSA 2D0FA 1UKQA 2WMIB 1WB0A 4AD5A 1OINA 3K1DA 1H1NA 4ACZB 2VZSA 5M17A 1XH2A 1QI2A 2W91A 4DWSC 1OGGA 2A3AA 4HU0A 4NZFA 5DT5A 1FOBA 1Q6FA 3MMDA 4WKAA 4KGLA 3EJPA 2PB1A 4UTFA 1QNOA 1TE1A 1FFRA 3NSNA 3W4RA 2VURA 3CHFA 1HP5A 2J7CA 4MTVA 1CECA 1B9ZA 1M53A 4PSRA 3IAPA 4LX4A 3T2OA 1BAGA 4JFWA 4MB4A 3PZNA 4UQ9A 4PMQA 4UFHA 3BCDA 2GJXB 1Q6EA 1PBGA 4MNLA 4V28A 4XB3A 1V6XA 4U3AA 1WPCA 2GK1A 3PZOA 5D9MA 4MNKA 5ABFA 3PBGA 1GHRA 2VX6A 5ABHA 2A3EA 1LLOA 1ZS2A 4GI6A 3BCFA 3GXMA 3RPMA 5I23A 3WELA 3B9DA 3AMLA 3VNYA 1B0IA 3AICA 2D3LA 3BMWA 1OD8A 1PIFA 3W37A 1ZBVA 1E15A 3VGFA 2WCAA 1EQCA 2JIEA 1OWQA 2DEPA 3QGVA 3AMGA 1AVAA 1CGVA 4JFVA 1X1NA 3DX3A 3FW6A 2F7PA 5CG0A 3W25A 1VJZA 1MQQA 3GXDA 3A5VA 1R7AA 1FHDA 3MSDA 1E70M 3SUVA 1QI5A 4JL2A 3QOMA 5JUVA 5HOSA 1SFSA 3WDHA 1V02E 1W3JA 3I3DA 3AQUA 2Y4SA 1B1YA 3IK2A 2BVDA 1H0IA 4EK7A 1E4LA 2ESCA 3WH7A 3O2LA 3SCRA 3SUTA 4BA0A 4D6HA 1NWRA 1XD1A 5I6SA 2TAAA 3GZAA 5HBFA 3DYPA 2WVVB 2DSKA 3BH4A 1UD4A 2G4FA 1KGXA 2W62A 1DWJM 3N18A 1Z32X 1TFVA 4AD4A 2CBUA 1CDGA 7TAAA 2J7BA 1NM9A 3J7HA 3CMJA 1EIBA 1Q4NX 1WNOA 4E2OA 3ARYA 3F5JA 1D7FA 1DTUA 4CCEA 5EBAA 3M07A 4P8UA 2XM1A 1V03A 3RM8A 5IXEA 4M81A 4PMRA 1MW2A 3ZJ8A 3VIJA 3WL0A 1US2A 1NOUA 4AYSA 1E6XM 2DT3A 2VRJA 3T08A 2OSYA 4FLSA 1XHGA 1J0JA 1U33A 1E5NA 4AZGA 2DSWA 3T0DA 1V0NA 3WUBA 1R86A 4JHZA 3AS3A 4JFUA 5CXPA 4U33A 1TR1A 5A6LA 1B3VA 2DSZA 1Q6CA 3WF2A 2E0PA 2DH3A 3GTNA 1LG1A 3B8SA 4H04A 2X2HA 3B9AA 4XX6A 1OT1A 1FP8A 5JBEA 3CUIA 2VX4A 1UKOA 4EKJA 4GINA 1E0VA 3OLGA 3AIBA 2C0HA 1G9HA 3ZMRA 5C8BB 3KWXA 4X0NA 3WY4A 4AD1A 3WFLA 1ZBWA 3OIHA 1UH3A 3BLKA 1UQZA 1TQWA 4PUDA 1HXJA 4BF7A 1R33A 1JZ8A 3RILA 1GQJA 5E09A 1VIWA 2EADA 2BY1A 2XIIA 5IHRA 2UY3A 3M46A 3L4WA 1IZKA 1BQCA 1TVPA 4GO8A 3WF4A 1V3HA 1V6UA 2YKKA 3WH5A 3VX0A 4AZ7A 4UR9A 1JYVA 1XRVA 3T2PA 5BXTA 4DUXA 1HTYA 2XVGA 3CV5A 3U57A 1JYXA 1XH1A 2QPSA 3VSUA 1W1VA 3WDQA 2V3DA 3LX9A 2GVYA 1E6NA 3LRMA 5AC5A 1U30A 3S6TA 2YL5A 2VI0A 1AQ0A 4N0RA 4WIWA 1RD6A 1E0WA 1EGZA 3PZQA 2WLYA 3O9NA 1LQ0A 2XG9A 1VFMA 3KLLA 5A8QA 1WKYA 3EJRA 1PX4A 1W1YA 3ARRA 3TTYA 1WDPA 1JFXA 4MNMA 2VRQA 5A8OA 5BCAA 3GH7A 4PYSA 1TCMA 4PSPA 1BHGA 4PTMA 2YFOA 3GXPA 3LRKA 2B31A 4AIOA 3W29A 1C7SA 2GFTA 3BUBA 2FH8A 3VM5A 4AZ5A 1GOMA 4JIEA 2OSXA 1JNEA 2WCGA 3WY2A 3A23A 1VAHA 2GJPA 3AOFA 2XWEA 1VEOA 4U2YA 1CGXA 5E0CA 1ZBKA 2X0HA 1TVNA 5IFPA 4P7LA 1B90A 3VIGA 5A69A 4CN6A 1ZBCA 1OT2A 3BVWA 3CTTA 2BY0A 4GPNA 5IFTA 3GYCA 5E0FA 1BG4A 2ZUNA 1CGTA 1EA9C 5LA2A 4C7GA 1PZ2A 4URIA 1VFUA 5I0DA 2WYSA 1V6YA 1XV8A 2X05A 3SCTA 3D50A 3WD1A 1F4AA 2J78A 3W24A 2JF6A 5A6MA 1OD0A 3ZOAA 3WDPP 5IHSA 2CITA 3N12A 2BV9A 1XSJA 4WF7A 2QHAA 1KXHA 2OLHA 4QCFA 1P6WA 2F7OA 1AMYA 3DDGA 5E70A 4EE9A 5C70A 3ARPA 4D6IA 3W28A 3AHXA 1W9DM 2E9MA 3VDCA 5CQ1A 3H53A 1UH2A 3WDRA 1WDQA 1G5AA 2WW5A 2XPKA 2XYLA 3WIJA 3OG2A 4GZJA 1ITCA 1QBAA 3W0KA 3W81A 2EEXA 1OM0A 1XD0A 3W53A 4NSBA 4UOZA 3VD4A 3F4VA 7A3HA 4C7FA 1E43A 4H8UA 5DT7A 3WMCA 1H3GA 1PZ3A 1UZ4A 1YQ2A 1WO2A 2VR4A 1DP0A 3AZSA 3BAIA 2E3ZA 2NT1A 4TX6A 3KZSA 1ISWA 3OBAA 4KH2A 5BRPA 4HTYA 1R7OA 1EHNA 5GNZA 4P8WA 3AS2A 2VVSA 3LXAA 3D5HA 1UD2A 1UWTA 1QHZA 1J0HA 3ARQA 3MMWA 1HVQA 1FFQA 3AYRA 4UQDA 1KWGA 3L4UA 3BMVA 1Y7VA 3N13A 3WEOA 1FH8A 4W8LA 4PN2A 1GORA 2XVPA 4UZUA 4D72A 3VD5A 5LA0A 3BAWA 1JZ3A 3GDBA 1KGUA 4DO4A 3EJQA 4C7DA 1PX8A 3OB8A 4QAWA 1B3WA 2G3NA 2YA0A 1KQYA 3WFZA 4ZE5A 1K9EA 4D6CA 2DGAA 3HJEA 4J3VA 1EDQA 3HG2A 4NI3A 2YDQA 3KL3A 2W61A 1RP8A 4F66A 3L4YA 2VOTA 4UOQA 1JZ4A 3MI6A 4UOJA 1PIGA 4Z2KA 4EANA 2ZUMA 1SR0A 2D0HA 2PWDA 4RL3A 3I3EA 4J3UA 1SZNA 3THCA 2YA2A 4B9ZA 3WUEA 2EPOA 3DHPA 4CU6A 4Q7NA 3CC1A 3EJTA 4CVWA 4D6GA 4Z2LA 2D24A 4DWSA 1XCWA 2VQTA 2AAAA 4J3XA 1GOIA 3PTQA 1E5JA 1N82A 4YPJA 4CD5A 3UG3A 1FH7A 3WNMA 3H54A 1V6WA 1QI4A 2BVTA 1FA2A 1HKIA 4V2XA 4V27A 2JEQA 1BYAA 3VO0A 1TQSA 3BLPX 2WWCA 5I5RA 1XYZA 4U31A 3L4ZA 3BUQA 4DM1A 3A22A 3A6OA 1HXKA 1V02A 2ZWYA 1UD6A 1V3KA 2VCBA 4OZOA 1O6IA 1KXTA 3OZOA 4BS0A 1MWOA 1HKKA 4TTGA 1HF6A 1BLIA 2OYLA 4CUCA 2J8GA 2OW6A 1WZLA 3IGUA 3MV11 1OCQA 1V0LA 3SCPA 4W7VA 4EAMA 5LYRA 2A3HA 3ZJKA 1KCLA 3VSTA 2ZX9A 1ZL1A 2WHMA 2GK1B 4GQRA 5E9AA 2CESA 3BSGA 3RMEA 4OKDA 3W38A 2DT1A 5TD4A 2WVTA 3T0BA 1R47A 4P8VA 2VVNA 1QNSA 3CHCA 3K4DA 5HPCA 4AY1A 3UERA 3BLBA 2VCAA 1BGGA 3L4TA 2WZIA 3CZNA 4HOXA 1ODZA 4XZBA 1JG9A 1JZ5A 1GOQA 1H2JA 2VZTA 2ALWA 3N17A 2PWGA 5AYBA 3KL0A 1TMQA 4W93A 1QHPA 1QNPA 3POHA 2ZX6A 4DWSB 4WSJA 1UR0A 4PUEA 5D4YA 1WZAA 3SUUA 4PCTA 1NOFA 2FHFA 5FOOA 6CGTA 1T0OA 3AIEA 3SCVA 1GHSA 1VFFA 3AS0A 2WM0A 4YN5A 4LPCA 2PC8A 1JD7A 2EABA 1UUQA 4D1JA 3LPFA 3WQ6A 3ARXA 1E6ZA 3KL5A 3SURA 1XSKA 1GONA 4TVDA 3AIVA 3VOCA 3WMBA 5CLWA 3HN3A 1JD9A 3A4WA 4PTXA 3UG5A 1L8NA 1E71M 1R85A 1W3HA 1ZB5A 3WL1A 3TTOA 3NDYA 2EAEA 3PZ9A 3VTRA 3SEPA 1R75A 3VNZA 2PI6A 1UZ1A 4BCEA 4DUWA 3AIUA 3PZIA 2XN2A 4JKKA 3S2CA 2XJ7A 3AFBA 1JIBA 3WNLA 4HU8A 1W9UA 3L2LA 1BYDA 4D6FA 1VENA 1U2YA 5FKYA 8A3HA 5A6AA 3ZT7A 4HOWA 7CGTA 3LPPA 4PMZA 2CNCA 4X9YA 5HNNA 2AOSA 3BAXA 1PS3A 4KGJA 1KTBA 1QVBA 4B9YA 3VIOA 1H0GA 4ZFMA 4F79A 4MAVA 4A4AA 4NZJA 1JDDA 2EQDA 5JBFA 3CUGA 1GOOA 2CBVA 4JZ5A 4WJXA 5ABGA 3KEHA 4S3JA 1V3IA 3JUGA 4J7RA 3PZGA 3VUPA 5GQBA 2VJXA 1DEDA 2J77A 2DSVA 1WP6A 1W9BM 3MKKA 2W66A 2IUZA 1PEZA 1XYFA 3NDZA 5IDIA 4AD2A 4MDPA 1C8XA 1BTCA 3TONA 2YBTA 3TTQA 3BC9A 4M29A 2F1BA 1OGBA 4AZCA 2ZX7A 4LXFA 4L4PA 1G94A 3GXTA 2WKLA 3CUJA 4R27A 3VIPA 2DT2A 1NWTA 1JXJA 3VIIA 4AZIA 3WY1A 1RPKA 3AYSA 4W87A 1VJSA 4W88A 3W6LA 1E40A 1H41A 3VMNA 2RGMA 4YHGA 2FGZA 2GUYA 4P8XA 3WSUA 3F5KA 2WMIA 2QMJA 3DC0A 3GXFA 1G01A 4P7QA 3ARTA 1E4NA 4FNRA 5A6KA 5CLTA 3AIQA 4U5KA 3WNPA 1J12A 2WANA 2D1ZA 3FHQA 3G6MA 4CD7A 4U3CA 2E4TA 2QPUA 2DQXA 1TUXA 3MU7A 2WHKA 1BVZA 3AHYA 3EJSA 2YOCA 2WZEA 1UKPA 1UR1A 4JL1A 3A4XA 1XSIA 4CU7A 3GXNA 2XFFA 1SMAA 3D4YA 5HXMA 3VSVA 1V08A 4F9DA 2PWFA 5E6YA 3T2QA 5FL0A 2D20A 1KBKA 3LMYA 3SCWA 1H5VA 4ATDA 3EDEA 2J4GA 3VGGA 1RH9A 1YHTA 1UQYA 4CCDA 1CXKA 4UQBA 2RGLA 1QI0A 3WD0A 2GJRA 4Q22A 2FHCA 4JHOA 1R8LA 4UQCA 4NX0A 3WUFA 1WDRA 2DSUA 4GIAA 3WF3A 3RJYA 1BSIA 1DWHM 2OWCA 4AZBA 1GOWA 1M04A 3LPGA 4GI9A 2J25A 4PMXA 3CLWA 1JF6A 1TQTA 4GO9A 1EOMA 3D4ZA 2V3EA 4TTUA 4JCLA 1WE5A 2Z1KA 2V5CA 2BFGA 2CBJA 5ECUA 1QNQA 4FNQA 4XV0A 2VZOA 5D9NA 1JFHA 1HN1A 1MW1A 3FY1A 2WHJA 2CKRA 3QHNA 2ZIDA 3UEQA 4KMQA 5EB8A 5D8WA 4OJYA 2Z1SA 2W63A 5DMYA 3BUDA 3OGVA 2Y5EA 1TA3B 5D9OA 4Z2HA 2F2HA 5A6SA 1JGIA 5CPSA 3N11A 4MAZA 2OWXA 4RE3A 4H8VA 3HMCA 4DUVA 4D1IA 1JYWA 2WB5A 1B30A 1LL4A 2J7EA 1LF1A 5BWFA 4PMDA 2X09A 1E4IA 1JDAA 3T09A 1B3YA 1WCGA 3CGTA 1QOXA 1GQKA 2YL6A 5A3HA 1M7XA 2WC3A 1J10A 1BPLB 1CXHA 3DX0A 4FK9A 2JFEX 3CZGA 1W1PA 4GZEA 4N42A 4AZCB 2VC9A 3AHZA 1V3MA 4NRRA 1Q6DA 4CVUA 3SCOA 4J3TA 4OUEA 2ZXBA 1CBGA 1TQUA 3VD7A 1A3HA 3OZPA 3ARWA 2F18A 5GPRA 4NXSA 3N1AA 3BVTA 3GXIA 5A2BA 3PTKA 2Y24A 4QLJA 1UD3A 1CGWA 2XN1A 4OGZA 3ARVA 3RDKA 1X6NA 2OYMA 4DO5A 3WDIA 4XZWA 1W9VA 4FNUA 1XH0A 2DDXA 2HISA 4CCCA 1Q6GA 2WC7A 1JNDA 3NIYA 1NOWA 2HVMA 4WK9A 2XVLA 3WH8A 1GOKA 3AHTA 1NWSA 4BQ5A 4UNIA 3S5ZA 2FH6A 1VRXA 5AY7A 2ZICA 2G8ZA 1H49A 2UY2A 2VX7A 5GNYA 1HIZA 3SCUA 4TX8A 3AMKA 3DDFA 4GXPA 4MADA 1GVIA 3BVVA 3II1A 3GNOA 3BAJA 1HJXA 3ALFA 3O6AA 4W5UA 1G1YA 5HDRA 1NH6A 1VB9A 3NSMA 1LJYA 3CZSA 3HG5A 2C8NA 1GPFA 4UFLA 4FNTA 5A8MA 3AIRA 1GZJA 2ZXAA 3PN8A 2YLAA 1E3XA 1KXVA 3VVGA 1UOKA 2VZUA 2WZHA 3ZR5A 4PBGA 3FAXA 3AZTA 4J3WA 1XCXA 3POCA 4UFKA 2F1AA 1FHLA 1NQ6A 2O9PA 4PTVA 2G3JA 2XN0A 4XUYA 3I3BA 2WPGA 4PMVA 1R87A 1R46A 4ZEPA 2BNJA 2XGBA 3WD2A 5BXRA 3KLKA 4JFTA 2QF8A 4IISA 1E6RA 4UFIA 2UY4A 4YHEA 2YL9A 4HA1A 3K8KA 1KTCA 3RM9A 2WMGA 1B2YA 2X2JA 2J7DA 4MB3A 4AIUA 3N9KA 3T0AA 1HJWA 1DHKA 3RCNA 3A21A 3EMZA 3D52A 1NARA 1LL6A 2YLLA 3EDKA 3ARUA 1EHAA 4W5ZA 2XHYA 2G41A 4W89A 3IJ7A 1UR2A 4H7VA 1WAWA 3GH4A 4TXEA 1HL8A 3AROA 1MXGA 2D3NA 3VPLA 2WSKA 1W9PA 4IPNB 5E6ZA 3TP4A 3B9EA 1NP0A 4M24A 4H8HA 1QW9A 4JCMA 1LWHA 3MS8A 2GDVA 5DF0A 3VINA 4L4OA 2E9BA 3MMUA 4QDMA 2ZUSA 1CZ1A 1QBBA 1CXLA 3VMPA 4B15A 5AC4A 1JI1A 3NCOA 2JE8A 3K8LA 4OOUA 1W3KA 1QWNA 3NJ3A 5LA1A 1EDGA 3WH6A 3EJUA 2BVYA 1UA3A 2QMKA 2Y8VA 1GW1A 1CENA 4PMUA 1E6SM 3WNOA 3SCSA 2V3FA 4LYQA 2FYVA 4B3LA 5KZ6A 4OBRA 1I1WA 1D3CA 2DH2A 2YDRA 4IUGA 1OB0A 3LXBA 3BUIA 2OWWA 1UR4A 3WN6A 4FF5A 3RO8A 2PBOA 2CKSA 4HMCA 1NP2A 5AYIA 4MNJA 4TVCA 4UFMA 2UY5A 3DHUA 2BS9A 4HOZA 3RJXA 1JXKA 4UQAA 3AMCA 3G6LA 2QV4A 3CHEA 4ACYA 1C8QA 3GM8A 4ATWA 1MQRA 2VO5A 1J11A 1CEOA 1MYRA 4JKLA 3AS1A 1OIMA 2XFRA 1MW3A 1MW0A 3IJ8A 1OBAA 2CHNA 4E8DA 1GQLA 2WBGA 1QHOA 3IANA 5FD0A 3SUWA 3MO4A 1GJWA 4H2CA 3A3HA 1W2PA 3EYPA 4W84A 1QNRA 1WDSA 5M5DA 4GZIA 4FLOA 2JALA 1J9YA 3FHAA 4MDOA 2NT0A 3QHOA 4W7WA 3WQ5A 4Z2GA 4NRSA 3SIMA 5A1AA 2BXZA 1VEPA 2G3IA 5I24A 3CZJA 4FNPA 4MJ2A 2FDMA 3BAKA 2VL4A 2WBKA 4HZ8A 4DWSD 3A47A 4W86A 3MUY1 3ZR6A 1OIFA 2WMHA 1FH9A 1MQPA 4AW7A 1KR1A 3N04A 2WHLA 3N15A 1UA7A 5I3DA 1V3JA 1DWGM 4KRUA 4UZSA 3F5LA 3BVUA 3ECQA 2BY3A 3VDHA 3VGDA 5BRQA 1C93A 3LXCA 1UR8A 5GNXA 4GKLA 1HJSA 3WQ8A 1CXIA 2CHOA 1JYNA 3RIKA 4PMNA 3VKKA 5EFFA 4W8BA 2F8QA 3WNNA 5CJ5A 1PX3A 1H09A 1UG6A 3APGA 1C7TA 3VIFA 4BQ2A 1BYCA 4E4PA 3NUKA 1MFVA 4AISA 1AQHA 4AD0A 1WZMA 3U5UA 2YBUA 3WEMA 3MANA 1K6AA 4CU8A 3CZ8A 1W2VA 1JF5A 4W7UA 4QP0A 2J7GA 3THDA 2ZUUA 4PRWA 4E8CA 2J79A 4AZHA 4PCSA 3BUPA 2ZOXA 3HU7A 2AMGA 2WMJA 2VCCA 1J0IA 2D23A 1UWRA 1UYQA 1ISVA 1MXDA 1J0YA 1I75A 4UQEA 2VRKA 3IJ9A 2XGIA 4D6EA 1A47A 3U5YA 4HMDA 1J0ZA 3K4AA 5DFAA 4RE4A 1JZ7A 4D6JA 4FNSA 4KRTA 5EFDA 2DT0A 2D73A 3VIHA 4U5IA 1CWYA 5CSUA 5CPQA 3AZRA 1UKSA 2A3BA 4NXKA 4AMWA 4TVUA 2CXGA 5FCZA 4B3KA 3GNPA 2J74A 5F7UA 1C8YA 3QOKA 2XIBA 6TAAA 1GNXA 4WKHA 4AYGA 1V0MA 1VEMA 2O9OA 3WEZA 3HG3A 3CZKA 3M6DA 4A3YA 5FL1A 3ZSSA 4PMYA 5E1QA 4D71A 4Z2JA 5EMYA 3WH9A 4QFUA 1XGZA 4HMEA 3WKZA 1I1XA 1KGWA 1UWSA 1K9TA 1BVNP 1B3XA 5D8ZA 1ZJBA 1JDCA 2BHZA 2EACA 9CGTA 3DYOA 2XWDA 2GSJA 2PBGA 5CSYA 4ATLA 2GDUA 5A8NA 1WZKA 2WWDA 2WAGA 3TV8A 3ZIZA 4CGTA 3K46A 1QX1A 1HL9A 3PZMA 4DM2A 1LWJA 3VIMA 1CXEA 3L2MA 5BROA 2VZVA 1PJ9A 3VIKA 1ZU8A 3EDDA 3QHMA 3OLIA 1UD8A 1ZJAA 3D51A 4AMXA 3CMGA 1CLXA 3WF1A 3ZQ9A 1CPUA 3KE0A 2W92A 1KQZA 1EH9A 1UWIA 4A3HA 1EXPA 3U7BA 2C7FA 2GJXA 4BZYA 4OIFA 4WLCA 3RM4A 1E4MM 2CEQA 1ESWA 2J7FA 5CPTA 5M03A 3CBWA 2X8RA 2XUCA 1NWUA 1E6QM 1VBRA 2J7HA 1HKMA 2EPMX 1EOKA 1BYBA 1US3A 3DX2A 4FMVA 1O7AA 1BF2A 2W5FA 4HZ6A 3VGEA 4AEEA 1UASA 1UHVA 2ZWZA 3AXIA 2YA1A 2J8FA 3MV01 3LRLA 4WKFA 4AEFA 3DX1A 1HJQA 3PZVA 2WVUA 3EBVA 4UFJA 2PWEA 5I79A 2XVKA 4GI8A 4J3SA 3E1F1 4PMOA 2IGTA 1RP9A 3HZ3A 4M82A 3VMOA 5DO8A 4FLQA 5ABEA 4AIEA 3EDJA 2V5DA 3CO4A 2VX5A 1E3ZA 1ECEA 2NSXA 3ARSA 1HNYA 2FE0A 3OA5A 1KB3A 3CIVA 3UESA 2BHYA 5A2AA 4R5EA 4Y7EA 3VDAA 1ODUA 5A6BD 1JL8A 1BGAA 2ZUVA 3WNKA 1JAEA 3BXWA 3OLEA 4P7NA 3MSGA 3ZT5A 2CETA 1C90A 1ISXA 2XM2A 2BY2A 1M03A 2WK2A 4QLLA 6A3HA 2F61A 4W8AA 1GQIA 4PEEA 4ZE4A 2WVVA 1BG9A 2X0YA 3WD3A 2ZX8A 5A95A 1HVXA 5DEZA 1V6VA 4Z2IA 1CGUA 2E9LA 4CD6A 2V38A 2QLYA 5CZKA 2YDSA 1DWAM 1E55A 1UR9A 2G3MA 2X2IA 4AMCA 1J0KA 3W6MA 5BYWA 2YL8A 1E1EA 1E6PA 1ISZA 1GCYA 2VNCA 2WNWA 5A6BA 2ZUTA 1C3FA 2O9RA 2D0GA 4JFSA 1KBBA 4MPKA 1MFUA 3H55A 1KCKA 1JZ2A 3EMQA 3AMDA 2ZE0A 1J18A 4NZCA 1UKTA 2J47A 3MUAA 3CHDA 1VFOA 3CUHA 3WD4A 2O9TA 5ABFB 1KR0A 2CBIA 4CD8A 1B3ZA 3GNRA 1TZ7A 4MB1A 1W3LA 3WQ4A 4TOQA 3WBEA 2EPNA 4M1RA 4OOZA 4CN1A 2J62A 3SUSA 4U2ZA 2EJ1A 3TA9A 4D6DA 2ZUWA 2CERA 3AXHA 1CNVA 3GH5A 3ZJ7A 2YJQA 1HT6A 1XC6A 3DYMA 2VMFA 1GJUA 3PTMA 3WY3A 3VU2A 3LPOA 2WC4A 1DWFM 2ZX5A 1MVYA 3UR7A 5A6JA 2V3GA 1OGSA 2F7RA 3EDFA 2BHUA 5A94A 4IPLA 2OW7A 5HPOA 1UWQA 2X1IA 2FHBA 1JZ6A 3VILA 1SMDA 2D2OA 2OSWA 2VTFA 5C71A 1EO7A 1D2KA 1IV8A 4WSKA 1HKJA 2XSAA 1QW8A 1UWUA 1JAKA 2BXYA 1E73M 1E0XA 1LL7A 3NYDA 2OYKA 3AISA 2JIWA 4M56A 1OSEA 3BSHA 4X0VA 1ISYA 4KWUA 2VT0A 4QLKA 5BXSA 1HWWA 1DWIM 3CPUA 3MUIA 1PAMA 1LG2A 3CZLA 3WUGA 2XVNA 1V3LA 5I2UA 4GQQA 1PPIA 2CIPA 3ZT6A 2ZXDA 3WF0A 4J28A 4JAWA 4CD4A 4ACZA 4LYRA 4BQ3A 2Q8XA 3FN9A 4BQ4A 4QCEA 1W1TA 1CIUA 2JF7A 3CH9A 2ZXQA 1BFNA 3UR8A 1E9LA 1CGYA 3IAQA 1FP9A 1KWKA 1CLVA 3UCQA 1UH4A 1HP4A 1UD5A 1H11A 4ZENA 3U7VA 3EMCA 3WBAA 2WMKA 4IM4A 3OGRA 3FXYA 5D9PA 4FLRA 3K8MA 2EPLX 3ZO9A 2W67A 1GVYA 1KFWA 8CGTA 2JEPA 2XSBA 1KXQA 1G0CA 2O92A 2DIEA 1GUVA 3D3AA 1HX0A 3W82A 2CCRA 1S46A 4AZ6A 1QPKA 3GBEA 3VD9A 2WXDM 5I78A 4ZXOA 1K9FA 1E72M 1R34A 2E8YA 3NSXA 3PHAA 1H4PA 3BVXA 5FIPA 4MJ4A 4HPGA 1TA3A 2WLZA 3OGSA 4TUFA 4RE2A 3OLDA 3PZTA 4M80A 1E56A 1HJVA 4HA3A 3L4VA 4B16A 5CGMA 4P7RA 1TQVA 2PF0A 3DX4A 1V0KA 3FNDA 1TG7A 2VQUA 3GBDA 3WDJA 3FAWA 5I77A 4M8UA 2X2YA 4CN4A 1J01A 3AXXA 3UETA 3WQVA 5A2CA 4H41A 2EBNA 4P7OA 3TTSA 2E8ZA 4S3KA 1SYTA 1W9XA 3CUFA 5A8PA 4LQ1A 2EPKX 3BAYA 4JKMA 4ZXLA 3SCQA 3ZM8A 2VR5A 4MB5A 3W26A 4HA4A 3M7SA 1IZJA 1CXFA 1QWUA 3QR3A 3VGBA 2Y8KA 3AIWA 1K9DA 2UWFA
chains in the Genus database with same CATH superfamily
2WXQA 1T7WA 3AJ7A 4ODWB 1QUNA 4IRJC 4A2GA 5KZEA 5AYZA 1VBUA 5T91A 3OZKA 1EK3A 1JN6B 4MDRA 3O16A 3HI1B 1GYCA 3WFAA 2FJHA 3ZSTA 2QUVA 5FKAA 1NWOA 4ROQA 5KYXA 4O5LL 3CLFL 4ML4A 4X6FB 2FGLA 1KB5H 3UVIA 5ETUA 5F7FA 2IW0A 1OAXL 4OCWL 4Q6XA 5CGTA 2Y07L 3LZLA 4I0PB 4JW3A 2GJLA 3VFWB 2VFFA 3PUCA 3NPUA 1I6NA 4AIBA 1B0RA 4MSWB 3QJVB 4X6CB 2X4TA 1JHKH 5I73C 3IM1A 2OK0H 5KSBE 4NKOA 1AODA 5G4HC 1Q5MA 3P0VL 3PUGA 4DO6A 1JNNL 1JWMB 3KGTA 4AQEB 3G6AB 3PB0A 5I8EA 4HNOA 4AGOA 1GJPA 3BSZH 4NJKA 4NF7A 4AQLA 3KG5A 2Y69B 3G9VA 3TCTA 5GS1A 3PPHA 2AGJH 2CUAA 2HKAA 3P7YA 3ABSA 3NPSB 4NUWA 1T22B 3W27A 1F4HA 3FUEA 4IIHA 4K3JH 1TO4A 1XF0A 4P2AA 3G8EA 4H83A 2FTYA 3UG4A 5AWNH 3VX1A 4P2OC 3WQGA 5E2WH 3N29A 2YIHA 2XV0A 4DWDA 2F8XC 1KCUH 1RA5A 2O6EA 4J27A 2Z8RA 4HU2A 2ZRVA 3OJMB 5KSAB 1F58L 1FNLA 2DEYX 1A3LL 4LPWA 4ZI8A 1P6BA 2NY0C 2AGTA 3CHQA 3EB2A 3W1NA 2ITFA 3L4XA 3LS4H 4AXNA 1IT0A 2ENSA 3VXOB 2AQSA 4RCXA 3VC6A 4UCFA 1IAIH 2CZDA 5FHAH 3EWUA 3CK0H 2ZAIA 4BIKA 3QGAC 2CYGA 5JBDA 1MLCA 4LKXB 1ZS8B 5KVGH 1KYAA 2NSMA 1J93A 3DH7A 1KFAH 4CKQA 2OX5B 2KZHA 2PD5A 4XIAA 1Z0MA 2LW3A 2D22A 5JIPA 3JWNE 1RZ8A 3NA4A 5HYSA 2QEZA 4JDTL 4GUJA 4H8WC 5HGAB 1EBGA 1NFBA 4QRSA 1N4XL 3P73B 5GSVB 3APMA 3DX9A 4XPFH 2CAKA 1OZMA 3GR4A 3DO4A 4JFEB 2MANA 6REQB 4KFNA 3EIFA 4WI0A 2G0KA 2ICEC 2V2WB 2PP9A 1R5VA 2YBRB 3S5YA 5AENA 4LVOC 1XS2A 5KZCB 2NW0A 4AC1X 1QOKA 1CDIA 3L9CA 4RMRA 4JLRB 3ZJ6A 3GT6A 4TUJB 4IX2A 4LVEA 2WVSA 1EYWA 3QFJD 3DURB 4LLYA 4M5YH 1A4KB 2APWA 3KXFA 1EAQA 3JTTB 1F6FB 1OL0A 3IJYA 4OZHB 3O2DA 2ICCA 3IBEA 1D3GA 3FB8B 4PTWA 4F9JA 1A6VL 5T5FH 4F0KA 1Z44A 3RUGA 4Y16D 4W85A 2X9WA 2OJZH 4ABUA 4WI4A 1ECZA 1J8HA 1XBDA 2AQ1A 4FNLL 2JFCA 2WMIB 3LENA 1RJQA 1WB0A 1AXIB 4EXQA 3CIQA 2YXFA 1FWGC 3ABQA 2ACSA 3K1DA 5D7SL 1H1NA 3WQCA 2FSDA 3U30C 1EJ8A 4ACZB 2VLRE 3NQ8A 2W91A 2IXQB 5HD8D 3SO5A 1QLRB 1OGGA 3QJUB 2AJXL 3QXTA 4XNQB 1FFPB 1G7JB 3ES6A 5IVXE 4J4PC 5JMRA 2ZZ4A 4NZFA 1ZP4A 2WZAA 3DMMB 1Q6FA 1AXSB 1YIXA 3UCRA 5A16A 2V69A 4E4FA 4L1WA 2W94A 4UBDC 4XP6L 1AW5A 1QAWA 3SOBL 3AQYA 1TE1A 3PWLA 1FFRA 3MROB 1J6PA 1F8MA 3S96B 2R14A 3F2BA 3IFOA 3QBUA 2G3ZA 4RZ5A 3CHFA 3DETC 4FP8H 4W9IC 5LWYL 1IT7A 3QXVA 4GFIA 4MTVA 1CECA 1B9ZA 4R9XA 4UV7H 4IQJA 3QUKB 2TRHA 4WUUE 4M3HA 4HTBA 1RLDA 2VXSH 3EKGA 4Y9AA 4LX4A 3VI2A 1BAGA 4NQEA 3GJFK 3L17A 3MGOA 1DQQB 5I09A 3PZNA 4OBTA 2RDXA 4P2QA 2UZXB 3F8UB 4JO1L 4QYOA 5DK2A 5FA4A 4UV7L 1NIBA 1OFRA 1XLGA 3CQJA 4DXVA 2GJXB 3LV3B 3Q1SL 5L8KB 4KKLC 4LL1A 3ECVA 1TYRA 5SWZA 2PDNA 3MDWA 4R83A 4MNLA 3LIZL 1FWJC 2QV5A 1DN0A 3JXAA 3FT3A 2GK1A 4U3AA 5CC5A 1FGNH 2PR4L 1UEYA 4Q3MA 2XQ0A 3HKFA 3NCFB 5HJYA 4ABVA 3ZTDC 4QX4A 2Y7DA 4GYPA 4IIFA 2FT8A 2XTJE 4XBMA 2AK4D 3CUPB 4XMVA 2GW5A 5I30L 4Q9QH 4N3TA 3Q1SH 5ABHA 3EA1A 3B43A 2QV2A 3C6SB 3NABH 3OZ9H 4P3DB 4WI7A 1WBYA 3O4LA 4QXUH 1W15A 2DQCH 3FU0A 3GXMA 2QW5A 2OULB 3UYRH 3RPMA 3IKCB 4PJXA 1MJJB 3FULA 1LP9E 2GJZA 3GKAA 4QEHA 4IWWA 2D3LA 4JDBA 1OD8A 1ZTXH 4JN7A 1P7QA 1JERA 1GG1A 3SJ3A 1CDYA 4CDGC 3UXIA 1E15A 1A1MB 1USZA 5AVVB 3SQBB 4IBWA 1OFEA 4FHAA 1TT6A 4MA3A 1LEIA 1XXXA 2J66A 4L1GA 3L7FB 1Q72L 3PGFL 3E5PA 2VLRB 3KNBB 3R43A 3ORWA 4NJHA 3FU8A 4LSTL 4Q6IB 5EO9B 3G5YB 3BRFA 4O14A 1Y5WA 2LFGA 4B90A 3RX4A 2WLNA 2CU9A 4B41A 5D1XA 1VFTA 1N64L 4KETA 2V33A 2CK0L 1UIPA 4JFFD 1B5TA 1LWIA 2YSSB 2VH5L 4M00A 4PJHB 5AAWA 1X96A 4RZBA 3ME3A 2B8OT 1X1NA 1FORH 3DX3A 1XBXA 3OQEA 4WW2C 5F97E 3L95A 3MJGX 4HZAA 3KFTA 2F7PA 4QRBA 2X0SA 3KPSE 3GJFH 1MWAH 2XN9A 1KEML 2WBJC 3MSPA 4MD5A 4QHMA 3KPSA 4NFBA 4PW4A 1NUDA 4TM9A 4APXB 3ZVVA 3W88A 2GJ6D 3A5VA 1R7AA 3IIOA 4BI5A 2VZ3A 3SDXF 1FHDA 1RQEA 3MSDA 4KRPC 1KEGL 3OVGA 4WUIA 4LS2A 2R8WA 2BNUB 2BZCA 2LV4A 3INPA 1E67A 1KBWA 4ZQMA 6FABL 4JQ1A 4KEZA 1DLHA 3C2OA 4LCVA 1KEMH 4HIJA 1KD0A 1CQYA 4J8RB 3WDHA 1V02E 1W3JA 5SX5K 2RDWA 4LVAA 1IKFH 4OUIA 1KT2B 1VSCA 2V8ZA 4JDYA 4JUSA 4XAWH 3GSRA 5AW8B 5MEQA 1B1YA 4OF0A 1UM4H 4GCAA 3HR6A 3DFTA 3JTSA 1XXFC 5LHFA 3FSTA 1E4WH 4JG0L 4UV4H 4ZPTA 4BZ1H 3PP3H 1MQKL 3MLTB 2A7BA 5D32A 1YMMD 3GS4A 4ZOCA 5D1XD 1NWRA 3BP5B 6PCYA 3JW7A 1XD1A 2TAAA 3DXAA 3DIFA 1U8PA 3HFMH 1I4FB 1MH5B 3MRHA 3GZAA 4LVNB 4AVKA 4PAZA 4RX4D 3KRUA 2HA1A 3S48A 2WVVB 1E6JH 1EGJH 3ULUE 3CUZA 4Y16B 5DS2A 2R0WH 5DZ9A 1S9XB 2WWMC 3MTXA 3MU3A 4YHYC 4L2YA 1Z32X 2DJSA 4JY5H 2EDEA 4LEBA 4XP1H 5CEYB 5JQ6L 2CBUA 1JGLL 2RFXA 5E8OA 1CDGA 2UUDH 3LTYA 4K1WA 4EAYA 4HN4A 1IGMH 1WBJA 1NM9A 3GMLB 4WY0A 3MRDB 3WLPA 1DQLH 3J7HA 1EGJL 4N9EA 3CMJA 5IM7B 1WNOA 3EX1A 3OJGA 3GF8A 3RKDC 3W9DA 2WNNA 3AWGA 1US0A 4LHUB 2EDRA 3QCVL 5FYLL 3W1ZA 3BESR 3LBOA 4KXDA 3N3MA 4L6OA 5DANA 1DTUA 5GGSY 3SPGA 1M2VA 4DVBB 2J8UE 4CCEA 3C9NB 5DD3L 4JTTA 5D96B 5GRVK 1NDVA 2WM1A 5GSRB 1LBLA 2E9GA 1XFPA 4PB0H 3QH3A 4TN9A 4J35A 3RM8A 4CC1A 3ULSB 1EF3A 4AHQA 3PUDA 3WFBH 3EG9B 4JANA 3C2AH 4M81A 5IXEA 4KWVA 5HDLA 1RD5A 4NHVA 4YBQC 4ZTPH 1F5WA 3F62A 1PFCA 1NOUA 5EDSA 1E6XM 2CZEA 5B7FA 3JR2A 3KAOA 3QHTC 5TBOA 4XP9L 4FLSA 3MHZA 1J5OL 2FAUA 1J0JA 4P2OB 5DUJA 5AOMA 3M5VA 1U33A 1ND0B 3UYPA 1E5NA 3PDDA 3CFBB 2AXJA 2J55A 3T0DA 2GITA 1D5ZB 4PGLA 2DQGL 4K3GA 4L3EA 5TGBB 3WUBA 4JHZA 3V5DA 2VEPA 3DOPA 2IADB 5A6LA 1S38A 4XP9H 1CZ8H 1JRBA 4Y7OC 3SKOA 5DURB 1R0AH 3IFOB 1WAUA 5FHBH 4C4KO 3GTNA 3ONCA 4GRWF 4Y1AD 2V5RA 1MI5B 1NOAA 5F1IA 3B0PA 6PTDA 4XAFA 5IFJA 4PJHF 1CCWB 1OT1A 2R2EB 1MUWA 4PWEA 4AZUA 1PS9A 4NZTL 3CUIA 1YNLH 5DURD 3M6YA 5K1VA 1TXKA 4GINA 1E0VA 3KPMA 4PD4K 4HCDA 5IOKA 4XXDB 1N9PA 2RBLA 1R6WA 5FA4B 1IUZA 3BLKA 3AY4A 4MMZA 3VOIA 2QPEB 3U6XS 5B3JE 1IVTA 1HXJA 3U7YH 4L80A 4PUDA 1R33A 4KNQA 3S1WA 4OZFB 1GQJA 3P14A 2YPLB 1QSFB 4OLZL 1I9CB 5EORL 3DIPA 1QNZH 4GVFA 3P8JA 2MHAA 4NHUB 1OX6A 2ADFH 3YPIA 3W0WD 3ZTJG 2UY3A 2XFXB 3WCZA 1BMGA 1L7IL 2CCLA 3REQB 1V3HA 2H3NA 3N1FC 3H4WA 1XHHA 1X44A 4UR9A 1IXQA 4JX5A 2CIIA 1LOSA 1RXLA 5GRJH 5HGHA 1KM6A 1EJWC 4DKEH 3TBWA 1YDPA 2ZG2A 4ACPA 3X11A 3CV5A 4EUPH 4X83A 4C83A 3U57A 4R33A 4KJPD 4R4BB 2K3HA 4C65A 3Q05A 4NL1A 4N0FA 1YDYA 4HWZA 2ZCHL 5D5MA 3RFZB 2HPTA 4AX6A 1MRQA 4IKJA 4YFLF 1TVLA 1HNGA 2VLRA 3KNBA 1EWEA 3IGSA 4OV9A 1TREA 4HC1A 1ED3A 1NSNL 3FRUA 4OZ4B 3LLXA 2JKLA 3GYRA 3STEA 1JV5A 3WUZA 4WIWA 3R19A 3S97C 3R0NA 3TJHC 1E0WA 1TV4A 4PUKA 5JH1A 4IOSA 3BZGA 2GTWB 2PTDA 4FQXB 3PZQA 2WLYA 4XP4L 3KPTA 5K39B 3VXME 3CQHA 4B96A 3BQ5A 4H9ZA 1LQ0A 1EA0A 1Q13A 2VDRL 2GSEA 2IPKB 4MXVF 2XG9A 4DZBA 2RFGA 3CQIA 5ICZA 3KGRA 3LEYH 1QRNE 4FTVD 4MQXD 2I14A 4ZPVA 1KKRA 3HPXA 2H0PA 3O07A 2I5QA 4UUJB 2YPKA 3BPWA 3JYBA 1W1YA 4RA3A 3WIIH 3VXRA 3BD5A 1L7TH 4A7SA 5KYWB 2HNHA 4GRLC 4GE8A 2FIKB 4MNMA 5IG7B 3NA9L 4WI8A 2NY3B 1DBKH 2GYSA 2B15A 4YSPA 1EANA 3RUGF 1ETA1 4HH9A 3OR6B 2CO6A 3QO1A 4URKA 2XGZA 5ISZD 5AW2B 1IEXA 2VCOA 1DQJB 1QWHA 2YFOA 4FQQA 4KU1A 1WFJA 3IFLL 5AYUL 3OVRA 5EA9A 3FQUA 4AIOA 1C7SA 1OM3L 1MEWA 1ONRA 1I1AB 1E90A 4OV5A 1UB3A 1HSAA 4DZAA 1DDHB 5GS2H 3N25A 1LVEA 3O3EB 4LARH 1GIGH 1T96A 4YDZA 3IDMA 3ZDZF 4AKQA 4DP9X 2OSXA 3LS5L 2DWDB 1OPGH 5C08D 3T0EE 1XGTB 3U48A 1BQKA 3A23A 1FVDA 3AOFA 3TLLA 4P4RB 2CDFB 4ONVA 1VESA 2CD0A 3OKNB 3OL2A 3Q2WA 3D2UD 4J8QA 5F2MA 1LK3L 43C9B 3WTYA 1EBHA 4XCFH 3K1KC 4AYID 4WI5A 3CN2A 4WFEE 4EXBA 3SDXA 4K7PH 4QXTA 5DEJA 3MFFA 1LILA 3RITA 5K9CA 2ZOLA 1YTEA 4LLUA 2X88A 1O7DE 1A80A 5IMMA 1SMOA 1WWCA 4EBQL 3VIGA 2HVOA 5HHQA 6TIMA 4C59B 3BVWA 4DJFD 3EJZD 2BY0A 3RVVC 2R4RL 3APNA 1ILSA 4KK6C 5CIPB 1ZLVH 2RHGA 5IFTA 3LKRB 5GRUH 2NXYC 4ACTA 2NX5A 4L3CB 5E0FA 4HWEH 1BG4A 3LQZA 1EA9C 2G5BA 2J20A 4IJ3B 3TBBA 1AQFA 1H6FA 1SDYA 1ZP3A 4QR6A 5HI5C 3K5XA 1AQDA 3QIBA 3SDAD 4PBXA 4X9IA 3VG0H 5KSVA 2IQTA 3HGJA 2WYSA 2HTLC 1U2HA 2XI9A 2QJNA 4ZMWA 3DRTA 1XV8A 1HE8A 4JANB 2J2ZA 3N42B 5EB9A 1TR9A 4QNEA 2O6DA 5ACMA 1WXYA 1LL1A 2D3VA 1QFHA 1UOVA 3D50A 1XDJA 4K8EA 3WD1A 3DK2A 3WJLC 2YGOA 4ZUWA 4UMBA 4P5UA 2HT4D 1NFPA 3ANVA 5IFAL 4C60A 3GUWA 4KKAD 5B7EA 4A2MA 1TPDA 4TIMA 2ISSA 3MO1A 3QLDA 4LCQA 5EUOF 4L0YA 5C07D 1SQ7A 4Z3TA 1S78D 1XSJA 4QRPA 3IS0X 5BMXA 4EVZA 1T5WA 4MLIA 4U6TA 5IK3A 3RTLA 3ALPA 2EXYC 2F7OA 1BF8A 3DDGA 3TA3C 5E70A 1XYBA 5I28A 4YTRA 5HI4D 1NCWL 4B7LA 1KXTB 1NDWA 1TYEB 1RH8A 4HIHA 4I1RA 4AF0A 4QRUA 3PWVA 3HQNA 4PFMA 5DA0B 3UNTA 3V6OE 4E41E 5DMLA 2PCXA 5CQ1A 3AREB 2AJZB 2Q3AA 1LO0H 3BISA 3H53A 1RZKC 2BW5A 4GRMB 5ECVA 5I74C 1VPOH 3O81A 43CAA 1CG9A 4Z7NE 1G5AA 1ZT1A 4OTXH 1XGPA 5AW1B 3SGEH 4L8CA 1S5TA 2QCEA 1U5HA 2XYLA 3EYVB 1CK0H 3P93A 4L1XA 4ZBCA 3OG2A 4EPBC 5JW3H 1SFHA 2BS8A 2M1KA 4Y2LA 5IMKA 3UTQA 1CDUA 4L9ZA 4N2YA 1A4JA 1LO0L 1J86A 1YEWA 3HEIB 1CU4L 4XO5A 4AQ8A 2VN3A 3ZE2B 1IC7H 1CGSL 1XF4B 3O8XA 2Q6ZA 4H9XA 1VR6A 3BUYB 5E23A 4NSBA 4UOZA 4UF7C 7A3HA 1BVLB 1IC4H 4XX1G 4PEKA 4ETQB 5GRVL 2IDCA 3W2JA 3W72A 2EXWC 1TELA 1TTJA 4C4UA 1NCAL 1KC5L 2W9EH 1VRDA 3WMCA 1PZ3A 3KTSA 2P24A 3L5MA 3ZDZB 3U30B 3AZSA 4NCC2 1L0YA 3I9PA 2Y7LA 3U0WH 3RPKA 1LJMA 3EJYD 4TX6A 3KZSA 3OBAA 1V7NH 2IPJA 3VFSA 4U6YA 5BRZE 3KPNA 1KRCC 5MENE 4PS8A 3QCTH 1OQFA 4FXGA 4IQHA 15C8H 2G2NA 4HTYA 4JR5A 3VFCA 3OJ2C 2PTXA 3AS2A 3RGVB 2DY2A 3AQXA 4HWUA 1GTNA 3LXAA 4NZUH 5AC6A 1QHZA 2LLNA 3BQ6A 4DGYH 1N8FA 4WV1C 4XTIA 4R7NB 3MPGA 1F97A 2HKFL 5AOKA 3MYJB 3HZYA 5KS9F 1D6VH 3CFDA 3KYMB 1E2VA 4UQDA 5AOIA 3HBGA 4YQXL 3PCYA 1KWGA 3T1WA 4HIXH 1F2XK 4HJGA 3IVTA 4I3RH 3N13A 4LLMB 1BYNA 1HCVA 3JSSA 3TH4T 3MRFB 3NG3A 2L04A 1FH8A 1Q1PA 3RVVD 4W8LA 3JV4B 4DJFC 1GORA 2BX7A 1AZ1A 4O1AA 4J3ZA 5LA0A 1W31A 4CLMA 3BW9A 3VXRE 4JZJC 1WAAF 3AM8A 4O58H 5B22A 1ZA3A 4M93C 4EVNB 5DXWA 3AJXA 4C7DA 5FSEC 5I3GA 1XRTA 4F2EA 3BFQG 2VDKH 1F13A 1RUQL 3NACH 1FWFC 2XFWA 4JICA 4R88A 2VDOL 4NNCA 3MC5A 2YA0A 1R3LA 2NVDA 4DZHA 2XA8H 4FQXD 1IR1A 5HPMA 2B7PA 2DGAA 3FJTA 2YKLH 2EEDA 4ZMOA 3FT4A 3FIGA 4QG8A 4DPQA 2A6IB 3PP7A 5L9FA 3E3HA 4HPOH 3EGSB 4AWUA 3C8KB 1UURA 1Q8MA 3NZRA 4PBWD 3PJXA 2Q8LA 3A3WA 2YDQA 4IRZH 3QFDA 1BWLA 1FCVA 1ETJA 4MVAA 3LHPL 2A6DA 4Y0GA 2QR6A 2W61A 3AZUA 3VCLB 4EIVA 1QLFA 4KW2A 4DJEC 4UOJA 4O5LH 3ASWA 3NQIA 1UWFA 4HPOL 5C97A 4JS3A 1E4JA 5EC1B 4GS7C 2PWDA 4H8QA 2FD6H 1MCJA 3QULA 5ALCH 2YC1B 2JB6A 3E0WA 2F5AL 3OHMB 4OVUA 1TLMA 5GZNA 2BJMH 4GRLD 4NN5B 3X2QB 1FL6A 1HQ4A 4LCWA 4NQSA 3IJEA 3MTRA 4J3UA 4M6AA 1SZNA 3FB5A 5HHOA 1D9EA 4YK4B 3WUEA 1T66D 2CU0A 3DHPA 1O4UA 2X53A 5H2BA 3GX9A 1JE6A 2XN9D 1CLOH 6XIMA 4NUQA 5BZXA 1NC4D 1B4RA 1G6CA 4IU3A 4B3ZA 5EKYA 4DELA 5I02A 2VJ0A 2B0SL 3CXDL 1XBVA 3M0JA 3HRZC 5JDSA 3P67A 1IVLA 3TV3H 4X6DB 2R23B 3OF6A 3PTQA 1N82A 1Z69A 3DUSB 1ZUAX 3O3AA 3RVWD 1JS4A 2J9XA 3B0YA 5IY5B 3GTHA 1YVLA 2CHWA 2FYMA 3UG3A 2X1XR 1EXGA 1KCUL 1WVZA 3VACA 1RXOB 3UZXA 2QSCH 2V4LA 3FRPB 2HFEB 3PBMA 1QI4A 4HKJA 2BOFX 1Z66A 4QOKB 5E5RB 4NWTH 4O4YH 4QDGA 3WIFB 4V27A 5LSMA 3I74A 3IETA 4LBRA 5LIXX 2H2SC 5J5DA 2AJ3B 3VO0A 5AOZA 2H9GB 5KJRH 2P53A 2WWCA 4K5MA 5D1QE 1TUPA 4JVUA 4U31A 2OEKA 1MCNA 3RB7A 4Z3IA 1IAIL 3ZYIA 1HINL 5CKSA 1KOAA 2VO8A 1LE9A 2BCKA 1D2PA 4XRCA 3UP6A 1EX0A 2MOVA 3BQUD 3UJJL 1S7SB 1BX2B 2Y06L 4ODSH 1PZ5A 1WS8A 5IQOA 1POKA 3T8QA 2AANA 3HPLB 2X87A 1KXTA 3KOYA 3G6DH 5DS8B 4X5PA 4UIKL 1KCSH 1KZQA 1S78C 3PXLA 4GMTH 4OD1L 3VVWA 4C6NA 1IR2A 3H1ZA 4BE6A 3ULUL 1SZGA 3AREA 1LE5A 2XZ7A 2ICSA 4MQTB 5IJVA 1DQMH 3ECWA 3TO4B 5HMDA 1BLIA 4IBLT 3URAA 3CSPA 2OYLA 1C08B 4JFXB 3W7PA 4OD1H 4ATTA 4AHOA 5DK3A 4KVCL 3HW7A 3MX0A 1MCPL 2CZVA 4IMGA 4O57A 1BCIA 3ULUH 2MCPL 1A4JB 1OF6A 4FALA 1XBYA 2ZKHL 2RB8A 3EFFB 1R3IH 2Y5TA 2ZCLH 3FMGH 1V0LA 3V0SA 4L37B 3GW0A 2OQJA 2NWRA 3NQVA 2GABA 1IGWA 5I1DB 5TDPB 5E08L 1KCLA 1UT2A 3MOQA 4DEWA 1MREL 3VSTA 3WEXA 4QJ5B 1ZL1A 4NYUA 4CADB 3SPHA 1AR1C 3ZKNC 3H70A 3F7YA 2CBMA 3MJ7B 3GRIA 1J8SA 1G7HA 3RU8L 5L2KD 3RMEA 3V6BR 2J8UA 3MYZA 3QZWB 4K2UH 1E4KA 5D2NC 1NDGA 3L9RA 5A2LH 1KENH 2FX7H 1W0WA 3PHQA 4BK8A 1QNSA 2P8MA 2OI9B 1K8IB 2XG4B 2A9BA 3GHEL 4QEEA 5HPCA 2LTQC 1VADB 4W4OA 2XSKA 5DJAB 2OI9C 2Z6FA 4K2UL 5D7JA 1D5MB 1F7BA 2VCAA 5F4SA 3ECBB 1Y65A 3EWBX 4AG4L 1Z5YD 3QNZA 1MFEH 3ARFB 3GAYA 3CZNA 4F8LA 3S1XA 5DK0A 3TT3L 3RG6A 3O6KH 3CHRA 2WLIA 4G6KH 1X5LA 3WXWL 4DOHE 2C9SA 2GQHA 4F8PA 5KBKA 1U6AH 2J88A 2VZTA 5F1NA 4AYEC 1NC2D 3N17A 2PWGA 4A8LA 1I3RA 4RDVA 3FH7A 1EEYB 3MRBA 4PJ5E 1TMQA 2C1PB 2PDXA 1ADQL 5JR1L 1EIXA 5B39A 2PC4A 5CPLA 1VGKA 2ZX6A 1QEWB 4WJEA 3UZVB 3VSQA 5L4JA 5EDXA 5F3BA 1SGJA 4PCTA 2ORBH 3IJSB 1O60A 1NOFA 3PUEA 4GHRA 5FOOA 6CGTA 2LLEA 3SCVA 4PJDF 2BVEA 4IS6B 1L9OA 4NN7B 4OQTL 4NKIH 5HI3D 1P5BA 1VFFA 5D04C 1R24A 1FGNL 2FL5B 4R7DB 5MEPB 2WM0A 4XUGA 3TCEA 4CQBA 3GYEA 1NPJA 1R3LB 3BLOA 2A73A 4K0OA 4H13C 2JBMA 3O4OB 2VM9A 3AC0A 3LPFA 3GS0A 4PHZA 3VWKD 4D1JA 2V2XA 4NWUH 3WQ6A 3OZ9L 4FPSA 3SKMA 4MWAA 5U4NA 2QLVB 1NAMB 2O6FA 3B1UA 5FDYA 3PIQA 4FA6A 3C6LA 2G0LA 4JVWA 4QHKJ 2R56H 1MCWM 3QJOA 3TBVB 3VFUA 3WOVA 3SADA 5E4EB 1P53A 2OMYA 3TURA 1RMFL 3NSJA 1E6ZA 3BANA 3CX2A 2JKTM 1SM9A 4H26B 4RETB 1LP6A 4U7SA 1KLGB 1ACYL 4DEPB 1CICD 1GONA 2E7FA 1RI8A 4LNYA 3VOCA 3OHXB 4OT1L 4A8RA 1HILB 1WRFA 1BW8A 1QNVA 1VKXB 5MKGA 3WLSA 2ZUXA 4JHAH 2JB6B 5JU6A 5FYKU 1LOLA 1WIOA 4GLEA 3E8UL 1Q9LA 4MA1C 4NQSB 4ODBD 3RVTD 1E71M 3D18B 3E9TA 1OP4A 3TBYA 1BSLA 2CDGA 1V4YA 3SY8A 4JFPB 2EAEA 4OT1H 3KVDD 3V9CA 1F4WH 5LB1A 4K3HA 4JTAA 4WHCA 4I0KA 2WXJA 1R75A 1RZ7H 3HMXL 3SBFA 1XIMA 2PI6A 2IO5A 4DUWA 1KTJA 3DX7B 3N3TA 1LP9F 1E8XA 1JMXA 3UYIA 4ZS6D 1W9UA 3P8IA 1NCJA 4K9EH 3IV3A 4NI6A 1ICSA 3FBQA 2YGNA 4BCXA 3EOUA 4WTZA 4J5NA 3O6YX 3QR0A 2UUDK 4XI5D 3UGEA 1AZ2A 1IT8A 3A3XA 1A6UH 5AC8A 1G1CA 5FKYA 8A3HA 4K3EH 4MRCA 4OCLC 3S1UA 3BKCL 2F7FA 1I8AA 4PMZA 4APQA 4DNLA 3HN5A 3QDJB 3W5NA 5IRPA 4G8AC 4YIWA 3N34A 3UF9A 2DQMA 1KFEA 5FIEA 3X17A 2NY3C 5KSBA 2HXAA 1QVBA 4GQ0A 2MCAA 4POUB 4Z78B 1E5UI 4F79A 4K3EL 4XB7A 1TV5A 2YXOA 2AVGA 4IPJA 4PJ7E 2EQDA 3CLEL 3CUGA 2R29A 4NQVA 1FNFA 4NCDA 4QYAA 1YE4A 5ABGA 1KG0B 1QATA 3KEHA 4KH9A 2P48B 4WFGD 3WKMH 4YS4A 3SN4A 3GMQB 4PS4L 3MA7A 5I5JA 3W7EA 3RI5K 3JUGA 4GRSA 1F90L 4UU9B 1PF3A 2Z7UA 3PZGA 4X7DC 3D06A 2J77A 1JRHI 1F56A 3F2DA 1WP6A 4HNCA 1FNSH 1S7VA 3W9EB 4F9LA 1WC7A 3S4SG 4ZMYA 4OFCA 2QTEA 3RU8X 3NDZA 3PGDB 5K33A 3L21A 3RXZA 5FM8A 2NUXA 1L2UA 3MHGA 3TNOA 5I0WA 5E5MB 3FU7A 3CHPA 5JQ6H 1RSCA 2YMTA 1BQSA 4KXZI 3SN0A 5KVFH 4Y9MA 3QUXA 2ODIA 5TDNA 2DLFL 2CGRH 1G94A 3LZRA 3GXTA 4YX2L 3WXVH 4AQEA 3MX0B 3ENEA 4WJ5A 3W73A 3C5JA 4LVHB 2EGZA 1E50A 3QG7H 4HUXB 3CFKB 1A6ZA 5KVFL 3THAA 4LRIA 5E4AA 3DRQA 3O05A 2BP0A 1LO2L 5E1GA 4Y4HB 2IS7A 3VMNA 3BP6A 2EVFA 2P26A 2XVBA 4RFOL 4RGMB 4UANA 3OMAB 5D7IB 4PUBH 3QG7L 4PJ8D 3SDDD 1IGYA 5IIEB 4DP4X 2VC2L 4P7QA 2XQYK 4PJEE 1E4NA 2PA6A 1H1ZA 4FNRA 5F7KC 5AVHA 4QSFA 1U8JB 3JUYA 4PJEA 5TQ0H 2CLEA 3IPFA 4RZ6A 4H20H 1SO5A 3GSOA 2WANA 2D1ZA 4FIRA 5BOEA 3V4UL 3FCSA 4CD7A 4S2SA 5INDA 1M1XB 2E4TA 2VC2H 2UYLA 4XN4A 1Y0LB 1PTAA 1XF5A 3CVCA 4I3SH 4JN1L 1YKWA 3LDBB 1A64A 3GI8L 4JJ5B 4U1KB 4V1DA 1EKOA 1UT1A 3AHYA 4X5XA 1D5MA 5H8DA 1S2UA 1U8KB 4GAYB 1DBTA 2LVEA 2F84A 2JQXA 1CZ8L 3KYAA 1GG0A 4YSCA 4ERSL 2XIQA 5KS9A 4JL1A 3H2FA 3HB3B 3P73A 3GXNA 5GSVA 3BP7A 3NAAL 2H6UA 1SJCA 4XBSA 3MCG1 2V8MA 6XIAA 2P10A 4NUJA 3GLZA 2R6OA 4GC3A 1U8MB 1SUJA 2RQEA 1LD9B 3T7VA 1SMAA 1YMHB 1ZE3C 3W7NA 4F9DA 3W87A 4HZLA 3KH4A 5IV2B 2NQ5A 1AQKH 4CSTA 2PW2A 5D33A 1YBQB 1ZV2A 3LMYA 4HYRA 2A4EA 3EZJB 4TQEL 3SCWA 1NKOA 3LMJL 1E9YB 4ATDA 5ABZA 1SPDA 4C6OA 3DV6B 1LLZA 4F2MA 1UQYA 2IPWA 4LCCB 5MHSE 2DWXA 4PBFA 1BGXH 4QRTA 2GJRA 4Q22A 4D2JA 1GGTA 2WB1A 1TEFA 3CUXA 1C5DB 1SF5A 1U8LA 3SD2A 2YK1H 5C2BL 5D7LE 5ESVB 1CFMA 1AH4A 4JY8A 2UVEA 3GD6A 3KYOB 4PJIE 2QQNL 1WDRA 1A22B 2K78A 4RRPA 5GXBB 1U8PB 4GIAA 4LSPL 4M48L 5DJYA 1B3JA 2D7NA 3GW3A 1GYLA 2H0JA 2ATPB 3CIAA 1MCQA 1JPEA 3I4KA 5I66B 1MNUL 4B5ZA 2QCDA 5DMJB 4Y2OB 1X4ZA 4CNIB 2I16A 4L9LC 1R1CA 2J6WA 1M04A 1BOGB 5D7IE 4ZG1A 5DJZB 3BG3A 2ZP0T 4PN6A 4AENB 4FYSA 3V9EA 4LSPH 1EOMA 3D85D 1GYVA 5C0AD 1A4LA 4HPYL 3HVDA 5DC0A 2FMNA 4PE8A 1S7XB 1QTPA 2FJSA 2N56A 4GSDL 1DPMA 1EP2A 1WE5A 2AXWA 5C0RL 3V7PA 3LIUA 3TEWA 4NKCA 4MQ7A 3ULVD 3PL6C 3OIXA 3BD3A 4XV0A 3ATFA 1KGCD 5E8EA 2V37A 2B7DT 2BO0A 2W8CA 3C2SA 2V5SA 3CL7A 2QCFA 2CKRA 3FY1A 1ET8A 4P5TC 3OJDB 1O5PA 3SB3A 1P1MA 4GG8B 2PLMA 4S1FA 4JRXD 4YR6B 3WN5B 5HNTA 1TMCB 2E9JA 3NT0A 5HYEA 3L7EB 4R0LA 2DZUA 2UY7B 4C1LA 2EDDA 2FYYB 2YLKA 2FX8H 3KLDA 4RCAA 5FECA 2HCVA 1JPSH 3CPLA 2R9HC 3II2A 2Y36H 5IQ9B 4E9XA 3ULVF 3AXKA 3OGVA 4GJJA 4JE4B 1AFVH 4Z2HA 2CJUL 2F2HA 4BFFA 1FZOB 2CQVA 5CPSA 5HULA 1H61A 4Z8FH 2XWXA 1H51A 4UT7H 1U8CB 1MAMH 3F6JA 3L3GA 3O3DA 4P3DA 5CGYC 5DZVA 5I6NA 5K3VA 4YVPA 1EHLH 1HW6A 3KLHC 2ZUQC 4XOCA 4NO3B 4P5KA 3NZQA 2CJUH 2PTTB 4LARL 3CMFA 3TIDB 3RL2B 3DV4A 1MG3C 4ORMA 2YZRA 5G5DA 4Q33A 4Q4RA 1LF1A 1VH7A 1BKSA 1SM3H 2X09A 4Z3GA 4Z7OE 5ADPL 1YECH 3HTLX 1PLGH 5I15L 4NQCE 4LP4A 2PCFA 4Y5VA 3W3OA 5HDBE 2ZKWA 3HUJA 4UAOC 3SE3A 2IJ0C 4E42A 5F93C 2A4AA 1G43A 4GBUA 4F2TA 3NGBB 4P4KB 5A3HA 3KBEA 3SY0B 4AGLA 3HAEA 4X9GA 2WC3A 1J10A 1CXHA 2IAMD 4W70A 4GG6E 3OHXC 1DJYA 1LK2B 1EZSA 1JPIA 5FEZA 4Q8TA 3LCWA 1W1PA 3S83A 5TK2A 5LAXA 1DBAL 4YDIL 4HMNA 1MPAL 3E6HA 2VC9A 3BWUF 3SDCD 3PFMA 3NPSC 4CVUA 4WJ5B 2OTUA 2E7DA 3UTSA 2XWJA 1TQUA 1A6WH 1NMCC 3EFOA 4M7LH 5LBGA 1LROA 3G1VA 5CG7A 3VI3F 2Q3OA 3LKNB 5JZ7D 2F18A 4HV8B 3LRGA 4NXSA 2DB8A 3IGLA 3BVTA 3GXIA 4PR5B 4UM9A 4C57C 1M3JA 2ED9A 3P4OA 4A2DA 2GK2A 2A21A 4DKTA 1GGBL 3GKFA 3VG0L 3IMSA 5FJUA 4QLJA 3SIKA 5JPNB 4ZR8A 2OMUA 1TVHA 2XDHA 2YWYA 4G80A 1CGWA 4KX7A 2CJSA 4OGZA 1F6PA 1X6NA 4XO8A 1SSDA 3S2JA 4DO5A 3O45B 3P4NA 4I0PC 5CJQL 3WDIA 4EZMA 1CURA 2ZA3A 3STFA 4FNUA 5FKPA 3VKDA 4PBEA 3E0LA 4WFGE 1MJ7L 1QVOA 2BLEA 5GGVH 2K8MA 3ABZA 1NOWA 2V9UA 3GNNA 2F19H 3TX4A 3VD0A 1E9IA 3S5SA 3MSRA 5AHNA 4XP5H 2Z35A 2CUMA 3N6YA 2P47B 4BHYA 2CLMA 2J6EA 1NWSA 2GTWA 1PCKA 3BEVB 2IPFA 2FT7A 2FH6A 4KROC 5C0BD 1GJIA 4L56A 2QHRL 4ZNCD 1PD1A 5AY7A 1NANI 3QE5A 4F3FB 1JGVL 2F19L 2Q9OA 5FYKL 2FVLA 3DKHA 4MUZA 1Q45A 1VJIA 2QCGA 1TTIA 3G6JE 4K7FA 4LP8A 5E7FA 1ZD6A 2VUKA 3OPSA 4NP4L 3W2MA 3U1SL 1N70A 3ETTA 3PB2A 1JWMA 4RKAA 3WNJA 3ATBA 4GXPA 3D39A 3V7AG 4MADA 3GS7A 5LHEA 1GVIA 1B54A 3ARGC 4G7VH 2PXYB 4DNMA 3AREC 4ZSUA 5FOJA 5IQNA 4NYLA 4AM0Q 4ZB0A 3D85B 5HDBF 4GP5B 2EDXA 4Q2ZB 5C0AB 2R94A 4W5UA 2MNUA 2VLME 4MNQB 3O11B 5H94A 3SE4C 4AT6A 1NH6A 4Y4FB 1HXYA 4NZRH 3UGRA 5DY3A 1YDNA 4K7PX 1DANT 1LJYA 3TA3B 5DVNA 4E5XA 2HDJA 2CCVA 3ZW3A 3FYEB 3K4ZA 1CO1A 3GPEA 3KPLB 4LHUG 4I90A 1CL7I 2VXQL 3DGDA 4MYWB 4QI3A 2I9LA 5F9AC 4X22A 3O0LA 1SVBA 4Q4OA 4N3UA 4AEIL 4LCRA 5CO1A 1P7HL 4KQ4L 5F7EH 1T89C 2C34A 1UOKA 2WZHA 1JGUL 5TF1H 4A21A 4PBGA 4D0CA 1UZDA 3AZTA 4J3WA 4TNFA 4RNIA 3POCA 4EO5A 5AB3A 2F1AA 5MI0B 1FHLA 1EF2A 3HG1B 3VGAC 2O9PA 4IJCA 3ZO0A 2G3JA 2BHFA 5FLUA 1NVMA 1MI5D 1WITA 4M6NL 3FSOA 3HA0A 4AMKH 3QXDA 3W1RA 4ZEPA 3CASA 3OZMA 3E8VA 3D9AL 3EB3A 4GB9A 2XGBA 3PK7A 2JK5B 2CR3A 3FTUA 4ALAH 4UFIA 2APTA 3BKML 2YL9A 4HA1A 3H2MA 1KTCA 3R10A 2I26N 3ALXA 3CT2A 1KYDA 4MB3A 4PRIB 1VFSA 2VLJD 5I1KL 1X5HA 4N9BA 1NFGA 3G3LA 1FVPA 3HZMB 3MV9D 4P4KC 3SO7A 3UG8A 2BZDA 3HJ0A 1TFPA 3T0AA 3MVSA 1OCZB 1A7NH 3T3PE 5B38A 3IIPA 3ULUF 3TJEH 4YL4A 3QGKC 2P5WB 5LGHH 2OZ4H 2ACUA 5AD0B 3KVJA 2FZ3B 1NARA 3B05A 1MDRA 5HJLA 2CC0A 3V0TA 3WBYA 1Z41A 2YLLA 1P0DA 4HHAB 4FZEL 4KPHL 1K7XA 3UTTE 1OAQL 5E2UH 4NAFB 4ZTXA 4FXKA 4ORGB 3N40F 2JKEA 3RTQD 4Q4PA 1UR2A 4HXAH 5BO1H 3B5TA 4I9JA 2PP7A 4H7VA 2VDQL 4NKMA 1TTRA 4GUPA 5EU9A 1VFAB 3GH4A 2XA8L 1PKYA 2PPGA 1T5WB 2YXXA 3LBMA 3UADA 4FQ2H 3DUUA 1MZRA 4PB9L 3KDNA 4MMWA 1KM4A 3S2NA 4HCRL 2EPHA 3VPLA 3ZWTA 1HESA 1MFDL 2JKJA 3MPCA 1Q0EA 2RALA 3TP4A 3B9EA 2WUBL 3KM2A 2CIIB 4HIHB 4M24A 4RLDA 4BINA 4Z7VB 3UPRB 4PGCA 3UXDA 2DZXA 1DVTA 1NJ9B 1EJOL 4GQZA 5FGSA 5LNSA 1G6RL 1HDMB 1W5OA 2BSSB 1RVKA 3NWRA 5IFHL 2JELL 4QDMA 4RZKA 3BDBA 3HUJE 3EYSL 3LQMA 2WWNA 3FTSA 2J6EL 3VMPA 4K8HA 3FQTB 1EJRC 2HX8A 2FD6L 5ALCL 3FS2A 3BAEL 1TZ8A 3ZIMA 4B15A 1JI1A 2PO6B 5I1JH 4KJWC 1QPNA 3NCOA 3MYOA 1XMWA 3RCMA 1BZOA 5HHME 1MNNA 3S37X 3LH8A 1W3KA 3KOZA 3EYSH 3WH6A 3EJUA 1W5NA 5KTEL 3RWIB 3IFPB 4UNVA 3D05A 1QSEE 4FQ1L 4NC0B 1I1FA 1UB5B 3MXWL 1YEDB 3PDOB 1OY0A 3QJFB 4PJ6A 3T8XB 1CENA 4PMUA 2H8ZA 2PTUA 3BURA 4WD0A 5ICZB 2DMCA 5FCSH 3SCSA 4BF5A 1GC1H 4UOW1 1NFDA 2FZ9A 3W74A 1XR9A 3ZPDA 2FYVA 4M7KH 5FA3B 3MV8B 1Y6MR 2FO4A 1FF5A 5JW4R 3S3GA 2CA4A 3VXRB 4LGPB 4O2EB 3TVMC 2JJWA 2H0EA 3HPAA 2Y22A 1OCCB 4U6YB 3CC5A 3ZDXE 5LDUA 4JTDA 4KCVA 5E00B 4XBPB 4G9FB 1UR4A 3WN6A 3NQBA 1WHPA 3OWRA 5IQ7L 4JFED 3S8FB 4HMCA 1BIIA 2BS71 5T3XL 3VWJD 4ZUTB 3SECA 4E9QA 1W17A 3A12A 3LZNA 5AYIA 3VQMA 5CEXB 3CHXA 1R4XA 1QSEB 3SGJC 5KVFE 3WX7A 3WJZA 5HANA 2B9BA 3DHUA 1DO5A 2BS9A 1RK7A 3B5HA 4U49A 4W9CC 4UQAA 4XD5A 1WCQA 1M57B 3OKKB 1LZOA 2QV4A 2GQ8A 2AQ2A 3G6LA 1KF9B 1PBYA 5CEZD 4KI5D 3G5XB 5FF6B 2AABH 1Y18A 3H9SD 3QRLA 1J11A 3FCPA 1BQHB 1HU8A 3EHBB 3THMH 5I00A 3TE9A 5JH2A 1OIMA 2EVGA 3O2VL 3BH8A 3P69A 2OEMA 3R8GA 1E6OH 2X6AA 2NTSP 2A83B 4NOBA 4B7IA 4E41D 3G6DL 1RLCL 4PJHE 1OBAA 5CZVH 4GKNB 2XXCB 2AEWA 5IEKB 3CWNA 4PJHA 3FO0H 4HGWA 5DQJB 4AC2A 4BJHA 2EKSB 1JQVA 1QZ1A 4QXTB 1FTXA 3UBXB 2INFA 5E6IC 1I9RL 1XZ0A 2DJ4A 3QEQD 3TLRA 5KVGE 3BW3A 1NQKA 4JQ2A 5HGAA 3VQLA 4AXWA 3VCCA 5HHQB 2DLHA 3ZE1F 3LKSB 1HXYB 2EINB 2DLGA 2OTPA 4JPKH 3WYRA 3COTA 1P4CA 3MO4A 3C08H 4P46D 5CMAB 4I9MA 4YO0B 2NTFB 5EZIH 1R5VB 3TA3A 4B3VA 4KFPA 1I9RH 2ZKHH 3DJTA 1G0XA 3BIAX 4HJJH 4W68A 1EFXA 1W2PA 1ZSHA 5GGQH 5I16B 1RL1A 1XQ4A 3HE6B 3W7GA 5M5DA 3UOAB 5KSVB 4BFGA 1EC7A 4JPKL 4NRZA 1RKRA 4PRIE 3WSQH 4P59L 3C08L 4YLQT 2ZRZA 2NYYC 4S1DD 3KBSA 4E9LA 3QKZA 3G1AA 3FHAA 1WA2X 5K9KB 4W7WA 4XWOC 5G4OA 4IXHA 5EZOL 4L23A 3EYUL 5IGXH 2X6BA 1MJJA 3H2WA 3JV6B 4Z7VF 4AWTA 1L8PA 2NY5H 4ZO7A 3KBNA 2K7QA 5CF3A 1J8HB 2AZUA 4ZPTB 5A7BA 1VEPA 3PJWA 4DLFA 1PWMA 4V15A 3FEMA 3N6QA 2D7PA 4FNPA 3FS9A 2UZPA 3V5KB 3PWPD 2QJJA 3LCLA 4OV6F 2J6XA 1QUPA 4X0KB 3TZVA 3CXHJ 4JEQA 4NQDA 2BMKB 4PGEA 4Z7AA 3VNKA 4HZ8A 2C3VB 3RHGA 2N1KA 3KLQA 4H6EA 2X4NA 2KH2B 1IAKA 2MFNA 4PYGA 5TE6L 3ZR6A 4MXWL 4JX0A 2G3XA 3HMJG 3G5YA 4PJCF 1MQPA 1MEIA 1EJVC 4CMHB 1EEZB 2X70B 2F38A 5D1XB 4LIQL 1KM2A 2WSRA 2P50A 2RMNA 1XGUA 1PU0A 2WZ6A 1DWGM 4FTVE 1JGEA 2MQ3A 3ISRA 1KTKE 2X4SA 4MS8D 3GI9L 4QJ3B 5HHNA 1FUYA 4HNVA 5IDZA 2PLKA 5CEWA 4YHPB 1OG0A 1SXZA 2G9HB 2HYMA 2ITCA 1JPFA 3C5ZA 3H3BC 1AC6A 1AHWC 1H5BC 4WUKH 2BY3A 3P80A 5IEHA 3VGDA 2CR0A 5E2JA 5F7DB 3IJLA 5BRQA 1ZT1B 1C93A 3TWBA 1BFVH 2CDEA 2E5DA 1WD9A 3LXCA 1CFSB 3RX7A 1C9WA 3TJHD 1RCYA 4MFEA 3FVDA 4Y1SA 4F5CA 3CCHB 4UDTA 3LXUX 3BUYA 1MRFH 1HJSA 3GFXA 2WTOA 4QYOB 1IKNA 3ASOB 1CXIA 3UWUA 1UFUA 2FPTA 1JN6A 3I7SA 3LRSA 4HLZH 3RIKA 4BZ2A 3ZMRA 4ML9A 4W8BA 4Y8FA 5CZXD 2CIKA 2IDUA 4X6EA 4H0GA 3ZKMC 2JK2A 4A22A 4DYEA 1PX3A 1ND0A 1UG6A 3DXAD 4S3FA 1HZYA 2BSCA 4GRWB 1DIOA 4KRMB 3N73A 2C9AA 1SY6A 2GITB 1A3RL 2WNGA 4X7TA 5K9JL 2ZDSA 4PL1A 2EZ0D 5FB8A 2Q5BA 3RG1C 2EXTA 1HH9A 3PV6A 1G87A 3GMNA 3VFTB 1HKLL 2IBZY 5JYLA 4BWLC 3MANA 4NKOB 3WTUA 4ORIA 1K6AA 3CZ8A 4B0MM 1DE5A 1W2VA 3MZTA 4QLWA 3TC6A 3UGVA 3OVUB 1KFCA 4PRWA 2CNYA 1WXJA 1NLBH 2Y5TB 3FTZA 1BBJA 3QPXH 1PY9A 1XR8A 2VDKB 2GSGB 4PCSA 5I9QB 4AZHA 4NVTA 4NNPL 4EAEA 1BXCA 1QWKA 4I48B 3O41A 3HMXH 2WMJA 2Y7GA 2VMEA 2E5CA 1TPXC 3NFSL 5E6UB 2VCCA 3QJFA 4JRYA 4JS7A 4H9MA 3NJJA 4ZOBA 4YVUA 5T1LD 4M3PA 1T6MA 2O5ZL 3P9MB 4MZIA 3VI3A 4PLKC 4AIZB 5DMKB 1ISVA 4QQUA 4F15B 1Z9LA 1I75A 3QZPA 4Z0BL 4CQCA 1K4HA 4F4RA 5JHAA 4KF1A 4G8GB 3B8UA 3GU1A 3H9SB 3OP2A 4YK4C 2GSIA 4K7YA 4IPPA 2ED8A 3BKCH 3CXOA 2NXYD 1FIGH 4NN5C 1J0ZA 2P8MB 1IXNA 3WH9A 2BVPB 2ZP9A 3CFEA 4QE1A 3DGCR 4RE4A 3B8TA 4PA8A 3QFJB 4YHZL 3SJNA 4O19A 2N4IA 1R30A 4JNMA 4NQCB 3Q6GH 4U5IA 5C07E 2CXKA 5CPQA 3R06B 4JPVL 3UIZA 4TVUA 3ECUA 4KHXH 2CPCA 1DLHB 4NIKB 1A5NC 1H9VA 3A9BA 4B3KA 3DX9B 1XIFA 2LU3A 4LAUA 4NPKA 5F7UA 3X14A 2Y7EA 5D1QD 1MO0A 1RK5A 1FZMB 3B97A 3KS6A 4PJCB 2MQCA 3ZQWA 4L8BB 1E2ZA 4GPVA 4PJGF 1TIMA 4LSRL 2LR4A 2DORA 5C6TL 1IFGA 3T65A 2R7EA 4WKHA 3VYLA 4MJ6B 3WLNA 2HCZX 2P5ED 4FOKA 1KCVL 1VEMA 2YAPA 4RAHA 3B7UX 5FUOL 3W22A 1ZPTA 3AADB 3IB4A 4IEFA 1F05A 5C08B 2NOYA 3USZA 1TITA 3CZKA 3M6DA 4JTGA 3ZSSA 1BA9A 1XZ0B 1RJZB 1H6TA 3KPMB 2XZAH 2VELA 3UXLA 2IQ9L 2OXGA 1T2JA 4MCYB 2F5BL 4EPKA 2PU0A 5CD5C 4NHCL 1KB9J 3FDWA 4OM0H 1BM3H 2A73B 2LAGB 2PUQT 3CFMA 3Q01A 2F0CA 2F6UA 3QQ0A 2D31A 3G04A 4QFUA 1FVCA 4MKMA 1MFMA 2D9QB 4KJYB 1KGWA 2RFXB 1E4XI 3D5OF 1HWGB 2B16A 4QRQA 3X12A 1NTHA 1B3XA 3DIDA 3HE6A 1DSFH 2ADJA 2A1YA 5IHZA 4R90L 1K4DA 2QADD 4HUWB 4I3GA 3D3FA 3CQQA 5D1ZC 2GQ3A 4NNBA 1JHLH 1IRAY 2WXKA 1E28B 4QEGA 4ZTEA 5K9KA 4UTWA 4BM7A 4KVPA 4J2MA 1WZKA 1VKXA 1INQA 5F3FA 2WAGA 5HATA 3QSKB 1JHTA 3TV8A 2ED6A 2UXVA 3H4GA 4Y9OA 1CICC 1Q7ZA 2DWDA 1PZSA 3GIZL 4D8PA 3H9SE 3PZMA 3F7KA 4L4VD 3DBSA 2CDGB 2K9UA 35C8L 2ZTKA 2D2JA 1CXEA 4MDIB 5I6OA 1TQBC 1N59B 2VZVA 4HSAC 5AVTB 3S9DB 4C6BA 3TWYA 4PVLA 3QHMA 1W72A 1GY1A 2A74C 3Q58A 5LAPA 5HYJB 1PKNA 3CMGA 4N8VB 1LNUA 4R8WL 1CLXA 4BUQA 3QH2A 1I8LC 1H7PA 3ZQ9A 1NUGA 1YPIA 5ETUB 4G6JH 2W92A 1H5YA 5DS8A 2Y1VA 1A9VA 4A3HA 1Z6JT 2GY7B 2NY2C 2XIMA 4XMPH 2GJXA 4JPSA 4X9HA 4BZYA 2EIDA 1B0RB 2IPKA 1P2CA 3VXRD 4IBZA 1E4MM 4N87A 1I1AD 1FDLH 3N42F 1OEZW 1U3ZA 2Y3AA 3HBQA 4G6JL 3UP1A 4DAGH 4JFXA 3ISYA 4JO5A 3S8GB 3LJ3A 2X8RA 2XUCA 2FWOB 3F5WA 3SN6N 2FRGP 1BXXA 2J7HA 2WQSA 3NVTA 3BG9A 3DN5A 4WO4D 1RCXB 3GGWB 4V2CB 2GUUA 5CBJA 2EDJA 4EXKA 2GTZA 3N1GC 5REQA 3VOJA 1KG0A 4HXBH 3RNKA 1R17A 5CJOL 1O7AA 4HZ6A 4LBSA 1L0QA 3ATDA 3PRZA 2V7NA 4MFDA 1M6UA 3X3FH 3TMQA 5JOFA 2E27L 2QQNH 1ORSA 4TSCH 1UHVA 3NIFF 3PWPE 1HC1A 4M5TA 3BWWA 3FJLA 2YA1A 5DZPA 3SBRA 2F54D 2FPVA 2J8FA 5I3KA 5FHAL 2I07A 4Z1BA 2W0FA 1AGFB 4HXBL 5FSDC 1U3NA 3MV01 3ZHDA 2WKOF 2X6CA 3MVIA 2AJVH 4Q9RH 2PLCA 1NDGB 4FABH 2Y6TE 2EEBA 5I8CA 1ZAIA 4RIRA 3REQA 2QAPA 1EXHA 3QDHA 1A0CA 4P4RA 1HJQA 1SXSA 3CFCL 4PD4J 4F1SA 2PWEA 3MV9A 4LGSB 4B53A 4N2HA 3E1F1 3PWVB 3SQOH 1AR1D 3O6FB 3ZKND 4A63A 4OV4A 3UDWC 4G6AC 4WW2F 4LCIH 3UTOA 2F6KA 5I2IA 1URZA 3F1QA 4LF1A 3L95B 4MA8H 3MJWA 5F88A 2NX5D 4Z7OB 1NY1A 3HHSB 3QIUB 1D5XA 2V5DA 2J43A 5F6HJ 4DK5A 4EUPG 2VX5A 1E3ZA 4XMKH 2NSXA 3HE7A 3O3UN 4XBGB 1HNYA 3OAZH 2FE0A 3SJVB 4J39A 4YE4H 5IBUG 4QM1A 3J07A 4HX1A 1G7UA 4MA8L 1QEWA 5IB4A 3ZZSA 1M68A 1IKNC 1K3IA 3MRIA 2P5EB 2QGEA 1YPZB 2QQKH 4X50A 1GOGA 3UESA 3UWWA 2BHYA 4IIQA 5D9SA 4G8GA 4NASA 3ULAB 1ODUA 3VDAA 3MLUL 4JZNA 1A4KA 2Y7OA 1ELSA 3EWZA 3ICJA 3M5YA 4X4YB 3WQPA 3WNKA 1VFBB 1JAEA 1ODAA 1R19A 3OLEA 4P7NA 3C52A 4AAJA 5D7SH 3GLCA 4OJDH 3SGDI 4KKCC 3D08A 2AMXA 5IBTL 2P4AB 3L0KA 3C5ZC 1INEL 2WK2A 3IDUA 3ASNB 2AJXH 5JW4N 3SKMB 3LV6A 4HQQL 1IQDB 3MKGA 2EZ0C 1CQKA 1MHPH 3MO1B 4HSQA 4ICXA 4FQIL 3VFUB 5KS9B 2ZCGA 3T81A 3HC4L 1F61A 2X0YA 4FR6A 3WD3A 3FTWA 5A95A 4EEEA 3GD1C 3HZKA 4E9TA 2L7QA 1V6VA 1DQJA 3UWVA 1CGUA 2AXGA 4UT6H 3P4LA 5DCCA 5T1KA 3S3BB 2Z91A 1RPUA 1FWRA 1U8MA 5G2HA 1WD8A 1PL9A 1W8EA 5CZKA 4B6ZA 3MCKA 1HSBA 1TEGA 3DDMA 1A14L 4HZLB 3B7YA 1DWAM 1E55A 3O3EA 3KYMA 1XIGA 1I8MA 3RWFA 1O5XA 2PAJA 2G3MA 4ZD3L 5I0XA 4MJID 1S3HA 2X1SA 2PDGA 5BYWA 4R4FH 1M6JA 2R2HB 4RMVA 2YL8A 3FTGA 4LHUA 2OMZA 1RJZA 2FZ8A 1DBAH 4YDIH 2ESVE 1ISZA 5DMIL 1AYRA 4ANKA 3NSFA 32C2A 2HV5A