1PZ3A

Crystal structure of a family 51 (gh51) alpha-l-arabinofuranosidase from geobacillus stearothermophilus t6
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
497
structure length
497
Chain Sequence
b'KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNEMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-arabinofuranosidase
publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 172
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pz3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pz3A02
4MB3A 4IPLA 3WFLA 4CD5A 2FHCA 5GNYA 1UD3A 3VD5A 2XIBA 3PZTA 2J8FA 3VNZA 2WZEA 5CSYA 3MMDA 3WBEA 1PPIA 4PEEA 1R8LA 5JIPA 3VGGA 1C92A 1WPCA 3WEZA 1G5AA 2YJQA 1AQHA 2A3CA 3W0KA 1B3VA 3OB8A 4RL3A 2PI6A 3ARQA 1ZS2A 1UA7A 3MSDA 1BYAA 2EXOA 3PZQA 4BQ2A 2WVSA 2EPMX 1E9LA 1KQZA 3KE0A 2XVNA 3K4DA 1CXHA 5D9MA 3NSXA 2PWDA 5HPCA 2BXZA 3LX9A 4AZCA 3VGEA 2E4TA 3ZOAA 3WUBA 2HVMA 3WEOA 4D1JA 3PTMA 3CZNA 3D52A 2WW5A 4PMVA 3FAXA 3LPFA 3BH4A 2IGTA 3E1F1 1CXFA 1PS3A 5A6LA 4HZ6A 5I0DA 2XVGA 2G3IA 1XD0A 1EXPA 1H5VA 4PCSA 1UWSA 3A24A 3AIBA 1HJUA 3N13A 5I24A 2VRJA 4W7WA 2FGLA 3VO0A 1J01A 3DYMA 5ABFA 4WK9A 2JIWA 1CXIA 2YFNA 1KFWA 1ODZA 1EDGA 3HG2A 4PN2A 1E3ZA 4KRUA 1KXVA 2IXUA 1JAKA 5DEZA 1UG6A 4CD6A 4MADA 3K4AA 3W53A 5CZKA 1E1EA 3WN6A 3VDAA 4CN4A 3PTQA 2JFEX 5I6SA 3WMCA 3LPGA 1ZB5A 3GXDA 3CUHA 3ARXA 5BCAA 4TVUA 2GK1B 1PZ3A 1BGGA 1ZU8A 3NYDA 4YHEA 1R75A 3MUZ1 3VM5A 3PN8A 4QAWA 1GHSA 2DIEA 3MV01 3WQ6A 3WH7A 3CZGA 5CPQA 1HJXA 2VUYA 1DEDA 4UFMA 1J11A 1GONA 4D6EA 1BVZA 1JF6A 1CPUA 2VQTA 3DDFA 1E72M 2VC9A 2ZOXA 1QI0A 2WYSA 4F9DA 2BHYA 2J7HA 1TUXA 2X2JA 4OOUA 4WKHA 3U7BA 2X2IA 4ACZA 3PZOA 3T0BA 2WLYA 2W63A 2QMJA 1JNEA 1SZNA 3ZR6A 3TTOA 3WF0A 3GH7A 1Q6GA 3K8LA 1TVPA 1VJSA 1E40A 4D72A 4A4AA 1QX1A 5FCZA 1MW1A 1M01A 2VR5A 3CPUA 1PIGA 3T0DA 2VQUA 4WKAA 2DH2A 1XCXA 2WZIA 1OGSA 8A3HA 1KBBA 1NWUA 3LPOA 2WC3A 1XH1A 1BG9A 4B16A 1V3HA 3ARSA 3AHVA 4DO5A 4UOQA 4J3SA 3BAWA 2ZUNA 4EANA 1X6NA 4URIA 5A6MA 1MYRA 3SEPA 3CHEA 4N0RA 3EDJA 3F5JA 3QHNA 5LA2A 3AFBA 4NSBA 3LMYA 2AOSA 4AZCB 3BSHA 5A2BA 1FH9A 1TMQA 1HL8A 1WDRA 1SYTA 1F4HA 4DM1A 3WY1A 2D0HA 2F7QA 2V5CA 2G3MA 1BYCA 2DDXA 4W86A 1J18A 3AMCA 3VSUA 3SIMA 1TZ7A 1IV8A 5A95A 3CMJA 1JI1A 1GQIA 2FHBA 4GI6A 2X8RA 1LL4A 2XFRA 2VI0A 5D9NA 3T0AA 2FE0A 4NXSA 2HISA 4UTFA 3AZTA 2ZXAA 1VBRA 2WK2A 3VKKA 1E6RA 1AQMA 2JALA 5E0FA 4DO6A 3AMGA 1S46A 1DWHM 5A6KA 4V28A 2UY4A 3HU7A 2XWEA 3HG5A 2E8ZA 4TTUA 3TV8A 1V02E 1JYNA 4PMNA 2BV9A 2J7GA 4GI8A 1JZ6A 2XN2A 1VEOA 1U33A 4YN5A 3WDPP 3SUWA 2EO7A 1H0GA 5BXTA 5BYWA 5GPRA 2B31A 2Y5EA 2ZE0A 1MW2A 2XGBA 3VIJA 2WVTA 3RDKA 2OWXA 3AXHA 4U2ZA 1WKYA 2YIHA 1B90A 2VRKA 4NF7A 3HG3A 1XSJA 2GSJA 1HKJA 4BQ5A 4TXEA 1Q6DA 3BUBA 3T2OA 1TA3A 4ML4A 2E0PA 1VFFA 2VOTA 3GNPA 3FAWA 4PMQA 2DSKA 3L4TA 4WSKA 1TQUA 3RJXA 4AY1A 4Z2GA 3WDIA 1DWJM 1EHNA 4PMDA 1W9BM 3FY1A 1JNDA 4KGJA 4M80A 1EOKA 1VFOA 2F7OA 3UERA 1TQSA 3WD0A 4ATDA 1V03A 1QI2A 4FLSA 1JZ8A 2O9TA 2RGMA 3PZVA 2VZTA 1GPFA 2E40A 1B1YA 3AHXA 3ALGA 3KL3A 3EJQA 1UZ1A 2C7FA 5AC4A 2VX5A 2VURA 3A3HA 1Q4NX 1LQ0A 4FF5A 1UH4A 1NQ6A 2JIEA 4P7LA 5CPSA 2YBTA 3VINA 2J7CA 1ZBWA 4Q22A 4EKJA 3WUGA 3SUUA 5IDIA 3OLGA 3A4XA 1KTBA 3ARTA 1O7AA 4S3JA 3ZJ8A 1WAWA 1MXDA 4Y7EA 3AXXA 3D50A 1SFSA 3RJYA 3WF1A 2DSZA 5EBAA 1Q6CA 4GQQA 1M53A 1B3YA 3BAXA 3F5LA 1SMDA 3SUSA 1K9EA 4PUEA 1X6LA 3TTSA 4UFHA 1ECEA 1HXKA 1OB0A 1KXTA 1NWRA 4A3HA 5A8QA 4JCMA 4HZ7A 4CU6A 1AMYA 1XV8A 4LXFA 3QGVA 3OBAA 1WCGA 3AS1A 2A3EA 3IAPA 3OGRA 4UQAA 3MUAA 3MANA 3VIOA 3FNDA 2VCAA 2WCAA 1V6WA 3ARVA 1V6YA 4QCEA 1J0HA 2QV4A 3ZQ9A 2ZXDA 1V3IA 4OIFA 4LYRA 4CCDA 3ZJ7A 4CCEA 3D4YA 1DWIM 2BY3A 1PZ2A 1EDQA 3DECA 1I1XA 1Q6EA 2XM1A 1HL9A 4JFWA 3AIVA 4JHOA 3FHQA 3AMLA 5AYIA 1V0KA 3CBWA 3M07A 1UKTA 5I2UA 2XVKA 3QHOA 4GPNA 3WNPA 2QLYA 2XYLA 3POHA 3S5ZA 3AIWA 3ECQA 2W66A 4JKLA 4D6FA 4E2OA 3WNNA 2E8YA 4UQ9A 4JKKA 3I3EA 1GOIA 4JHZA 4CN1A 4C7GA 3IANA 3VMNA 4TVCA 1V0LA 2BVTA 5BXRA 1QHPA 3WDRA 3ZJKA 3VD7A 1RP9A 3WEMA 1CXLA 3VD3A 1E6XM 1D7FA 1L0PA 1HXJA 5LA1A 1LWHA 5IHSA 3W24A 4DO4A 1NOUA 1GHRA 3S6TA 5IHRA 5FL0A 2VZVA 3VPLA 4HP5A 4FMVA 5CJ5A 5DT7A 2J78A 3GYCA 4FNTA 2QHAA 3TONA 1GOMA 4JKMA 2D0GA 1HKKA 5A6AA 4P7OA 1K9DA 1LWJA 3T2QA 4P8XA 4QCFA 2EAEA 4TUFA 1CEOA 2YDQA 1GORA 1NP0A 1KR1A 1GOKA 2WVVA 3KLLA 2EPOA 4HA3A 1CXEA 5FD0A 1R33A 4PMYA 2AAAA 1KGWA 5I79A 2GJXA 4W88A 3GBEA 2VRQA 3D5HA 3OA5A 3DYOA 3QOKA 3VMOA 3EYPA 1ITCA 2CKRA 2WWCA 1GQJA 2V3EA 4CCCA 1GVYA 3PBGA 4DWSA 1CLVA 1EOMA 4FNPA 1R85A 3AMKA 5A8PA 3W27A 2WMJA 1E71M 1VF8A 3N11A 4UZSA 3GXTA 5BXPA 1W9VA 4A3YA 3AZSA 2F7PA 2W92A 3EMQA 5KEZA 7TAAA 2BY2A 5FKYA 1XC6A 2WMHA 2CBUA 3CC1A 4BQ4A 1XYFA 1J0IA 3N1AA 3VTRA 4HOWA 5HNNA 1HT6A 2WPGA 3OLIA 1O7DC 4BA0A 4W84A 3DDGA 3WQWA 3N9KA 2ZX9A 3DX2A 1PJ9A 3N04A 2VTFA 3RILA 4UOJA 1TFVA 2J7DA 2DT0A 4PUDA 4U33A 1TR1A 1RD6A 3RCNA 3AIRA 4LPCA 3W81A 3OZOA 5A8NA 2CHOA 4TX8A 3WH5A 2BS9A 1UKPA 2X2YA 2YL8A 1H4PA 4WJXA 2ALWA 3ZIZA 3FW6A 3RPMA 1CZ1A 1FOBA 2YOCA 2BHZA 1JGIA 3IAQA 1P6WA 2WHJA 4N42A 1BSIA 1I1WA 1AVAA 1XSIA 3T2PA 3VX0A 2WKLA 3L4YA 2AMGA 1R47A 4H8VA 3CZEA 1DWGM 2FGZA 4XV0A 4HMCA 3LRMA 1V6UA 5DF0A 3BCDA 1E1FA 1GUVA 2VO5A 1YHTA 2J7EA 1EQCA 3EJTA 5CG0A 1OCQA 2O9PA 3CUIA 1MW0A 5E1QA 2Z1SA 1WE5A 1V0MA 3MMUA 4AZHA 2DEPA 1PAMA 3WKZA 4OKDA 4MJ2A 2VNCA 2XM2A 3VDBA 3BMVA 3VGDA 2C8NA 1E6PA 1WB0A 4XB3A 2QMKA 1LL6A 1SMAA 1UH3A 1XSKA 3B9DA 3CMGA 3W82A 1D3CA 5A3HA 4GINA 2W5FA 2D22A 3AIEA 4DWSD 2G8ZA 4HPGA 3PZMA 3WF2A 2D3LA 1UD4A 5GNXA 3J7HA 3CZSA 1J9YA 2BY0A 2CCRA 7A3HA 1A3HA 3AROA 3MU7A 4HA1A 1HTYA 3HMCA 3AQUA 4J3UA 3AHYA 1ITXA 5CGMA 1UR1A 1HJVA 4ZENA 1W2PA 3BVTA 2OSWA 4AYSA 3KL5A 3F5KA 2J79A 1G1YA 3SCPA 3AS3A 7CGTA 4AD3A 2Z1KA 1US3A 4HPHA 3VDHA 1VEPA 2WC7A 1B30A 4M81A 2UY3A 1KWKA 4UQBA 4Q7NA 2XN1A 3NSNA 3BC9A 3DHUA 1TQWA 1I75A 2CERA 1KGUA 1PBGA 4R5EA 3FXYA 5BRQA 1JIBA 4AIOA 1PX8A 1R34A 4U3CA 3CUFA 3A23A 3BVUA 4QP0A 1E6QM 3LXCA 5A6SA 1JYWA 2BXYA 2EADA 3GZAA 2WM0A 2FHFA 2PBGA 2VR4A 2XVPA 5HOSA 1QWNA 3CHCA 3VDCA 3WQVA 2WHLA 4IUGA 1JYVA 3W6MA 2D20A 2GJPA 1R7AA 3EBVA 1OIFA 4HMEA 2DPEA 3HN3A 3EDDA 2ZUUA 3W25A 3UG3A 1NWSA 1FH7A 4P7RA 1JL8A 3ARYA 2EPKX 4U3AA 1KXQA 4UNIA 1UWRA 3ZO9A 4AZIA 1OINA 4J7RA 3A21A 4ZE5A 3SCSA 2JE8A 3WL0A 3AIQA 3PZUA 4W87A 3GXMA 1QPKA 2XTKA 2JEPA 1HWWA 3BUPA 2OSXA 3MUIA 2IUZA 3SURA 4NI3A 3WY3A 5KZ6A 1V08A 1HVXA 4IM4A 1PIFA 3GNOA 3ARZA 4MAVA 3TTYA 4CD4A 1HVQA 4WIWA 5D8WA 4HTYA 3ZT6A 2XJ7A 4UQCA 4GXPA 1E4NA 4AW7A 1FH8A 4CD7A 2EACA 5AC5A 5BRPA 3A47A 2GUYA 4NRRA 5FIPA 4JFUA 3EMZA 4UQEA 1KQYA 1JFXA 1WO2A 4JAWA 1CYGA 4CKQA 1QW9A 4E8DA 3WMSA 4UFKA 3F4VA 4RE2A 3WH9A 3EDFA 2D24A 3KEHA 2PC8A 3VILA 4E4PA 3OGSA 1XH2A 3G6MA 1W9PA 3KL0A 4BQ3A 3WDJA 1XYZA 3WH6A 4J3XA 1W91A 3SCNA 3BGAA 4NZCA 5BROA 1UKOA 4UCFA 3OG2A 4GO8A 1E4IA 3VUPA 1FHLA 4NZJA 1JZ3A 2ZUTA 3ARUA 1WZAA 1G01A 2VX7A 4MJ4A 3LRLA 2ZUMA 4JFSA 4H7VA 5CSUA 4F9JA 4D6JA 2XSBA 3AIUA 1CIUA 2PWEA 5ABFB 1UKQA 3EDEA 1B9ZA 1BGAA 4QFUA 4ZEPA 3M7SA 4HU8A 5EB8A 4OZOA 3WNOA 3PZGA 4AD4A 1QNRA 3D51A 3EJSA 2E9MA 3BAIA 4X9YA 5DO8A 1EIBA 1ISWA 3K1DA 5I3DA 2QPUA 1MQPA 4W89A 1XH0A 2XN0A 5DFAA 4AMCA 1V3MA 4CUCA 2UY2A 1TQTA 1HN1A 2D2OA 3TA9A 4H41A 2E9LA 3PZNA 5ABHA 3IK2A 3U5YA 3VIMA 2V38A 1ISYA 4QLKA 3GXFA 2J77A 2V3GA 3D4ZA 1QI4A 5ABEA 1EDTA 1JDAA 4EAMA 2WSPA 1W1PA 2YLAA 1JDDA 2PBOA 2F18A 3AOFA 3T09A 1J0YA 1QNOA 2VVSA 3CH9A 1QBAA 3BXWA 1J0ZA 1EH9A 3W6LA 3WQ5A 4JL1A 4ACZB 3SCOA 3W38A 3BVXA 5HPOA 1HKIA 5CQ1A 2ZXQA 1U2YA 2YA0A 3MS8A 4AYGA 4PTVA 3CV5A 2DGAA 1EO7A 4MDPA 3WDQA 5I23A 1CWYA 1UQZA 1GJUA 2MANA 3NDYA 3W26A 3PZ9A 2WMIA 3WD1A 1MVYA 1W1VA 1XCWA 2ZWZA 4DUVA 1MQRA 3ZJ6A 1TG7A 1E70M 1NOFA 2D0FA 3BCFA 4J3WA 1WDPA 4P7QA 1UYQA 1JYXA 1BHGA 5E09A 2EPLX 3QOMA 1HJSA 1BLIA 1VFUA 3A4WA 2WMKA 2GFTA 1DTUA 2VZOA 4PCTA 5TD4A 6TAAA 2X09A 3NSMA 5D8ZA 1H0IA 3RO8A 1E5JA 3POCA 4OGZA 1CLXA 1GJWA 1CDGA 5GNZA 1H41A 4BCEA 1OBAA 1E0WA 1SR0A 1UWQA 4X0NA 4MB5A 2YLLA 2WZHA 1W3KA 4DM2A 4Z2LA 4LGXA 4PTMA 1ZJBA 2J75A 2UY5A 3EMCA 3G6LA 1E15A 3SCUA 4M56A 3JUGA 2BY1A 1UA3A 1NP2A 2WANA 1CGYA 3CHDA 3SUVA 1EQPA 3NIYA 4B3KA 5I77A 1BYDA 3TP4A 3BAJA 8CGTA 1HP5A 4PMXA 3VNYA 2CKSA 4M1RA 3VIGA 4PMOA 1KWGA 4KRTA 1E4LA 5HXMA 2OSYA 2VT0A 2J7BA 4W8LA 4W7VA 1UD6A 4MNKA 3THDA 2CBIA 1B31A 1C91A 1VBUA 4JIEA 3M46A 2GDUA 1JD7A 1UZ4A 1BAGA 2W62A 3RM9A 4WLCA 2CNCA 1ISVA 1CTNA 1UOKA 4BS0A 4Z2HA 1W3JA 1T0OA 2OWCA 1TA3B 3MSGA 1KR0A 3FN9A 4H04A 2NT0A 2VL4A 2VZSA 1E6NA 5M3WA 4AZ7A 2F7RA 1W9UA 1M04A 3H55A 4FNUA 1V3LA 1QHOA 2Q8XA 4QLLA 2ESCA 1WZKA 2W91A 4HZ8A 4ACYA 2FH8A 3OLEA 4W8AA 3AZRA 3DHPA 1E5NA 1BF2A 2O9RA 1UR8A 5AY7A 5BWFA 1OSEA 2OYKA 1QNQA 5ABGA 3GNRA 5IFPA 3HG4A 1OGBA 1E6SM 2DT3A 4AZ5A 4MB1A 3WUEA 3W29A 2JEQA 3RM4A 3VSVA 1MW3A 1CECA 5HDRA 4XUYA 4HA4A 2ZXBA 2WSKA 1EA9C 2F8QA 3QR3A 2DH3A 3WF4A 1BVNP 2F61A 1DWAM 3SCRA 3BUDA 3S2CA 3DX4A 1HIZA 1H1NA 4OOZA 3WELA 1M03A 5JBDA 3W28A 1W1YA 2V3FA 1HJQA 3GM8A 1WDQA 2WHKA 3HZ3A 3GTNA 1R46A 5JIWA 2WKGA 2F1BA 1WZMA 1U30A 4AZBA 3WFZA 2WBGA 4UQDA 2WXDM 2WMFA 1MFVA 3DYPA 4CVWA 3LPPA 1RH9A 5C70A 3S5YA 4CU7A 1PX4A 1ZL1A 1UD2A 2V3DA 1JFHA 2OW7A 3EJRA 3ZT5A 2X0HA 3VX1A 1NH6A 5A69A 2Y2WA 3M6DA 3WMBA 4J27A 1VEMA 1L8NA 3H53A 4MB4A 4GZEA 3WH8A 4HU0A 4PMRA 4AISA 2WAGA 3BLKA 1JDCA 4JFVA 1CGXA 4LQ1A 5JBEA 3AI0A 3T08A 1QWUA 2J7FA 2GK1A 2FH6A 1GNXA 2UWFA 1XHGA 1QNPA 2C0HA 3CHFA 5M5DA 1WZLA 2WMGA 5C8BB 1E0VA 3NCOA 1WP6A 5A6BD 4W93A 4V27A 1UWUA 2XSAA 1K9TA 1V02A 2CEQA 3CUGA 1BQCA 5GQBA 1G0CA 1H11A 4HOXA 1V0NA 2XGIA 1BG4A 4PSPA 2XG9A 4UFIA 2WC4A 3WENA 4AIUA 1K9FA 4X0VA 1FFQA 1OM0A 3WD2A 1C8YA 4IISA 2BHUA 3VMPA 2XFYA 2PWHA 4AEEA 4J3TA 1B3ZA 4H2CA 5M17A 3AXIA 1TE1A 1UR4A 1ZBKA 5E70A 3N12A 1V3JA 2CPUA 3VGFA 1V3KA 3DX0A 2Y8KA 4OUEA 4R27A 1HKMA 1JXKA 1HNYA 2EPNA 1IZJA 3CIVA 3UETA 4KH2A 3KLKA 1R7OA 3K8MA 3A22A 5E9AA 3PZIA 1H2JA 1JZ4A 3A6OA 4P8WA 4S3KA 4GKLA 4PBGA 2WVVB 1OD8A 2EEXA 3GH4A 1DWFM 4P8UA 2OYLA 2GJXB 1E4MM 2VX4A 1KCKA 2NSXA 1BTCA 4XX6A 4AIEA 3L2MA 1W3LA 2DSVA 1ZBCA 3ARWA 5JUVA 1ISZA 1JZ2A 2WBKA 5EMYA 3UR8A 1W32A 2O92A 2D73A 1CNVA 1LJYA 2EABA 4DWSB 4YPJA 4KGLA 3UR7A 2X0YA 1E3XA 2A3AA 3IJ8A 3BVWA 1EO5A 4V2XA 1GOOA 4D6DA 4LYPA 4NRSA 2D23A 2VZUA 5EFFA 2YFOA 1VFMA 3RIKA 1FA2A 4PTXA 3WQ4A 4C7FA 1JAEA 1JD9A 1HX0A 2XWDA 3BLPX 1E56A 4F79A 3VGBA 3MV11 1R87A 2VCCA 4GI9A 4D1IA 5IFTA 1W3HA 5AYBA 5E6YA 4AD0A 4H8UA 4Z2KA 1AQ0A 3AHTA 3VU2A 3WBAA 2CBJA 4NX0A 3SCVA 1J12A 4KWUA 3O6AA 4NXKA 4PRWA 2CYGA 1A47A 4Z2IA 4U5KA 3B8SA 1YQ2A 1OWQA 2CETA 3OGVA 1LL7A 1E43A 4ATLA 4DUWA 5A1AA 3ZMRA 2DSWA 1CXKA 2J25A 3L4ZA 3AISA 1XD1A 2W67A 3RMEA 5A8MA 2YDRA 1W1TA 4J3VA 1B3WA 3SCQA 2ZWYA 5CLTA 3WD3A 3FHAA 2E3ZA 5LA0A 4OJYA 1EHAA 1UR9A 5EFDA 3H54A 2VJXA 3AS0A 1W2VA 4MDOA 1Y7VA 1ZBVA 4AEFA 3MO4A 5I78A 2CESA 4FLOA 4CN6A 1MFUA 3N17A 4B15A 4HMDA 2Y8VA 3U7VA 2XIIA 3VGHA 1UASA 5IXEA 2F2HA 1C7TA 4GIAA 4TX6A 5A2AA 2G3JA 5A94A 3DC0A 3O2LA 4LX4A 4W85A 2NW0A 2CHNA 2ZICA 1BYBA 5CGTA 1UUQA 1RPKA 3BUQA 3LXBA 1K6AA 5FL1A 1FP9A 5FOOA 2OLHA 4P8VA 2CXGA 1UQYA 3CZLA 4AXNA 2ZX8A 4DUXA 1UD5A 1D2KA 1QHZA 4RE3A 4W5UA 1TVNA 2E9BA 1ISXA 4AMWA 2WVUA 3VIKA 2F1AA 2XHYA 3KZSA 4M82A 1UWIA 3LRKA 2DSUA 5LYRA 3WUFA 1C7SA 1N82A 1JXJA 4GO9A 2V5DA 4J28A 1VAHA 1FFRA 1X1NA 2QF8A 2OYMA 3LXAA 1UHVA 3B9EA 4L4PA 1ESWA 4AMXA 2VCBA 4TOQA 1KGXA 4BF7A 2G4FA 2GVYA 1E73M 1MQQA 4B3LA 2G41A 3WF3A 1R86A 4OBSA 4FLQA 4JCLA 3WNKA 1FP8A 4OBRA 2YA1A 1JZ5A 2D3NA 3GH5A 4MAZA 3N18A 3OZPA 3VOCA 4JFTA 1VRXA 2BFGA 3GBDA 1TQVA 1JI2A 4W7UA 5M03A 3W4RA 4M29A 2VMFA 3RM8A 2EBNA 4U2YA 3NJ3A 4W5ZA 1C90A 3II1A 2WB5A 1PX3A 4FK9A 6CGTA 3CUJA 3QHMA 1CENA 4YHGA 3K46A 2WCSA 9CGTA 1VJZA 5CXPA 5DMYA 4QDMA 1LLOA 3AMDA 2OW6A 4DWSC 4FNRA 3ZM8A 1Z32X 2W61A 4HOZA 2ZX7A 2RGLA 1HP4A 2BVYA 3BLBA 2WCGA 1E6ZA 4PSRA 5JBFA 1QVBA 2XVLA 2WHMA 1KBKA 5DT5A 1MWOA 2J74A 1VENA 4D6GA 3WSUA 3NDZA 1CGWA 4UZUA 3IGUA 1CGVA 2IXVA 3VIIA 3WDHA 4U5IA 3APGA 3PTKA 4UOZA 3ARPA 3L4VA 1ODUA 1J0KA 4P7NA 2EJ1A 3EJUA 1IZKA 2DIJA 3ZR5A 4WKFA 2ZX6A 5ECUA 3SUTA 4AD5A 1BPLB 3MMWA 1QW8A 1LG1A 1NM9A 3D3AA 4E8CA 6A3HA 1UD8A 2A3BA 1M7XA 1HJWA 3U5UA 1C93A 2X1IA 1LG2A 2BNJA 1UR0A 4AD1A 2WLZA 3CLWA 1GVIA 2X05A 1LF1A 1FHDA 3UG5A 5D9OA 1V6XA 4D6HA 1NOWA 4MNLA 1O6IA 4FNSA 1DHKA 1E0XA 3AICA 1B2YA 3WL1A 4WF7A 5E6ZA 4EK7A 4TTGA 5C71A 1QNSA 4MNMA 1E55A 2PWFA 2EQDA 2FDMA 2GJRA 1UR2A 1KTCA 3TOPA 4ZE4A 1JF5A 5BXSA 3CTTA 3WD4A 4GZIA 4CU8A 1UH2A 4CD8A 4GZJA 4QLJA 5A8OA 4CGTA 3A4AA 1MXGA 4ZFMA 1KCLA 1J10A 3UESA 5A2CA 3CZKA 4B9ZA 4PYSA 4BZYA 3AYRA 1C8XA 1EGZA 1H49A 3VSTA 3EDKA 1B0IA 2QPSA 2ZUVA 4W8BA 3GDBA 4D71A 4PMZA 3THCA 3BMWA 2W4XA 1QI3A 5I5RA 1C3FA 4AC1X 4U31A 3L2LA 2JF7A 3WNLA 4B9YA 3ARRA 2J4GA 1W9DM 4AD2A 3ZT7A 1XRVA 4TVDA 3W37A 4JZ5A 4UFJA 1GQKA 1GOWA 5A6BA 3VD9A 1OIMA 4ZXOA 3WY2A 4JL2A 1JZ7A 5CPTA 5E0CA 3EJPA 2G3NA 3CZ8A 4RE4A 3MUY1 2DQXA 4ATWA 4M8UA 2ZUWA 3AJ7A 3ZSSA 5F7UA 1G9HA 3BSGA 3VIFA 4D6CA 3I3DA 1GZJA 4PMUA 5HBFA 4PTWA 1XGZA 4K68A 4WSJA 2YL6A 4MPKA 3SCTA 2YL5A 4EE9A 2ZX5A 3ZSTA 1NWTA 3L4UA 4FNQA 1PEZA 2XPKA 1JG9A 1GQLA 1W9XA 1QBBA 1H09A 3CGTA 3BAYA 2WWDA 2YBUA 4LYQA 2PB1A 1B3XA 4KMQA 3A5VA 1OD0A 2VX6A 3VVGA 2YKKA 2WMIB 2YL9A 2J8GA 4M24A 2DT2A 3TTQA 4CVUA 3CZJA 2YDSA 1OT2A 3IJ9A 3AS2A 3CO4A 2JF6A 2O9OA 4AZGA 3SCWA 1CGUA 3BUIA 1US2A 3WQ8A 1OT1A 3AYSA 3MI6A 1CGTA 4UFLA 1OGGA 3VM7A 1C8QA 3L4WA 1VIWA 1UKSA 2TAAA 4UR9A 2ZIDA 4AZ6A 3VD4A 2CITA 4IPNB 4XZBA 2NT1A 3WIJA 4C7DA 2XUCA 4MTVA 3KWXA 1CBGA 3BVVA 2CIPA 1HF6A 1WDSA 3GXNA 1G94A 1H3GA 1J0JA 2CBVA 2D1ZA 5D9PA 2XFFA 2VVNA 1VB9A 3UG4A 1QOXA 2A3HA 1GOQA 3UCQA 5D4YA 3IJ7A 1NARA 3L4XA 4XZWA 3MKKA 4F8XA 4Z2JA 1F4AA 4L4OA 2WNWA 2FYVA 3DX3A 3U57A 2Y24A 2PWGA 3DX1A 2PF0A 1GW1A 3ALFA 2BVDA 2GDVA 3WNMA 1DP0A 3B9AA 1TCMA 3K8KA 3I3BA 2YA2A 4MNJA 2X2HA 3GXIA 1KXHA 2ZUSA 2J47A 4GQRA 5CLWA 3O9NA 1GCYA 3VIHA 3HJEA 4FLRA 4D6IA 1BFNA 3AHZA 3VIPA 2OWWA 2Y4SA 2J62A 4ZXLA 1ZJAA 3OLDA 5A6JA 3WY4A 1QI5A 4H8HA 3BAKA 1UWTA 1WNOA 1V6VA 1Q6FA 3UEQA 4F66A 3GXPA 4NZFA 3N15A 1IT0A 1KB3A 4AWEA 3OIHA 3PHAA 1RP8A 3NUKA 2DT1A
chains in the Genus database with same CATH superfamily
1U1JA 2XZCL 3UAFA 3P14A 3NDYE 3JT2A 1P6CA 4LSSL 2J8FA 3APTA 3TN0C 4Q6XA 3MJ9L 1BRLA 5KJ4A 5JIPA 5CSBA 1DVJA 1U8NA 1THCA 3PG2A 4JM2A 5DXWA 3TC3A 2JLLA 5DLCA 4QQUA 35C8L 3ROOA 1JFQL 5F97E 3V7PA 3KGTA 2EPMX 3ZVHA 3NSXA 3MRMA 2XZAL 1OGTB 1DFBL 3R1GH 2Z31B 4OUIA 3WUBA 4XN7A 3VE0B 1REQB 5F2LA 1CXFA 4QYOA 4WDXA 4GUHA 1YNKH 4W7WA 2X2UA 3QBTB 4IJBA 1FDJA 1ODZA 3H9SB 2AV7B 5JW4R 1RUSA 3P7YA 3CN2A 4EWND 4URTB 2PXYC 4RRPA 2R9RA 3W2NA 1ZEAL 5EN2B 4MOZA 4LK4A 5F3FA 1BGGA 3UQNA 1YUKB 1F4XH 2FD6H 2UVEA 5F96H 2GOUA 5IB2B 3NP4A 1DEDA 4A05A 3OJDA 1EBHA 1BBJA 2HX8A 1JK8A 3O6FD 2NXZB 4X7SH 2NY3D 3MHFA 1IC5H 2J7HA 3PB0A 2ZUYA 2C18A 3GMLB 2HN7B 3C2FA 5TQ0H 3ZR6A 1B4RA 2I57A 4P2AA 1X97A 3GH7A 1TVPA 3BKYL 5D03A 1BCIA 3OSKA 3U9IA 4XO8A 4YDKH 5FLUA 3T0DA 3O8XC 2DH2A 3V4VH 2JSFA 3P2VA 5JHLA 5CO1A 4YWIA 3AHVA 1D3GA 2JWYA 2VIRA 3E2HB 4JTHA 1F41A 2FX8H 4OFVA 4YTUA 3AFBA 4WK2B 3MRQA 1FH9A 3UXLA 2NLYA 4I4WB 2D0HA 3GRWH 2YSWA 1FUYA 3S3BB 3QKEA 3LB0A 3CFBB 1TT6A 3RUGA 2AMUA 2WK2A 2ZXAA 4C91A 2R8SL 3NFSL 1NSJA 3FCPA 1ITQA 1DSYA 2GGIA 5D7IA 4L8SB 4IJRA 1GZHA 2IO5A 4YUEH 5CCJA 5BYWA 3VIJA 4V1DD 4XP6H 2I07B 2IDTA 3TLQA 4NJIA 2NQ5A 3X14B 3NRFA 3GSMA 5CBAA 3HGJA 1US0A 1AZUA 1M4KA 4LLYA 4RDYA 4LCYB 3FNKA 2UX7A 2ZQKA 3RX9A 3VAVA 3QZ6A 4N5EC 5D1XC 1K02A 3UERA 1GJPA 2CGRL 3ZKQD 2V17L 3GSWB 4QRPA 2E40A 1NIEA 5AYZA 5AC4A 1GG0A 2VURA 4ML9A 4ZTXA 4GRWH 3KH3A 4AI7A 5EC2A 1RU9L 3FSUA 2WNQA 2WYZA 1WIOA 1G67A 4XPTL 1YPZF 2X41A 1WGOA 1KTLB 1OGAD 1HZHH 4XD6A 4L3CB 4NZRH 3PSWA 4G6ML 2NY5L 3DROB 3B05A 4GQQA 1RUKH 4JTKA 3NGBC 2Z2UA 3M0VA 5J06A 3U30B 1UUMA 1KM2A 4LLWB 3PLYA 5D2NC 4WJ5A 5IM7B 3FRUA 5C54A 3MC0A 2ZXDA 1OP5K 4X6BB 1Q72L 4UB0L 1OCWH 2FIRT 3QFJA 5I2UA 2YD2A 1AQKH 5J6HB 4XWOC 4HC1H 4MNQD 5BZZA 4D6FA 3DIDA 1F8TL 3PJSB 1JF1B 2E75C 4PRNB 4XMPH 3T44A 4O18A 4OF6A 1FNHA 3VOFA 5EF0A 3QXWA 3S6TA 4B92A 3EO1A 5CZXC 4JFDA 3CM4A 3A12A 3IRCA 1A8ZA 4TUFA 1VLXA 4JIQA 1CEOA 4IP4A 1X5FA 1QUNA 1QTSA 3CG8A 1UVQB 4XZLX 1R33A 1XL9A 5B1JC 3RY6A 1JDEA 2IAMB 5AAMC 3D5HA 1AO7D 5E08H 5ESVA 4PGCA 1GQJA 3MJ9A 4NRYA 3HFTA 4KXZI 1QSZA 4X6DF 1RVKA 1OF8A 4KUCD 4MLIA 5BXPA 1JZGA 4R7NB 4ORGB 4A2SA 3W9DA 2ICEB 1VFTA 4KF1A 4OD3L 5CZRA 2I17A 3FFCA 4HOWA 1BF5A 1K6WA 1F6AB 5IEHA 2W59A 4F40A 1X5JA 4U33A 5CLXA 2Y22A 2BDQA 3FOKA 3DNKA 2C9UA 3L6FB 4TYUA 3WOVA 2EXWD 1DOSA 2PYEB 4WW1A 3W3OA 3KVMA 3EXLA 4QWWC 4UT9H 4G6AD 1CT8A 4U10A 3VA6A 1LMIA 3B06A 4OLUH 1DWGM 5FLVA 4KESA 4TNVF 1T4WA 1G7LA 3U83A 3W7JA 2XWZA 3OQ8A 1Y07A 2W9DL 1ZHLA 4ETYA 1ZPLA 4NT0A 5MI0C 2Q7NA 1MW0A 5E1QA 4OV4A 3TO4C 1AY1H 3SGJA 4PRDB 3S3GA 4MD0B 2K4WA 1MPAL 2XM2A 5K33A 3ARDD 4MA1B 3GDMA 3DX7B 4AV0A 1D5ZA 4I9WE 5GJTH 1R9YA 2G8ZA 2BRRL 4TL5A 4L8CB 4QBXA 2WLLA 3HLAB 2V0AA 3SQOH 2DQWA 1B9KA 3MU7A 1BQHA 5EBLA 5HANA 2EIBA 4OF3A 5I73C 4WTWA 4DP0X 4J1UB 4ZD3H 4AYSA 1R2TA 3C0LA 5DVMA 3AS3A 1NMBH 4QSHA 2AV1A 3HFYA 2V2XB 5GRYA 1DJQA 2IV9A 4ZS7H 3C61A 3VNKA 2HJKA 4HZLA 4H19A 1FG2A 2GQ8A 2VWTA 3LXCA 1USQA 3O0RH 1V5JA 1Z66A 4E42B 4GT0A 5IOPB 1NFPA 4HU3A 2Z3FA 3P3TA 3OR6A 3W25A 2I60H 3RB7A 4FQPA 4ERIA 4PUJA 1KXQA 3CUZA 5E5CA 3VFVA 1O5RA 2VDRL 2OSXA 1M7IA 2QGHA 3PC0A 1U95A 4JTQA 3SB3A 3ATZA 1PIFA 3H4XA 1R1CA 2XTSA 1SEBA 4FIQA 4AW7A 1U8NB 3HTLX 4JFUA 3QNZA 3LHZA 4L1XA 3G6JF 5DC9B 5I1HL 3EDFA 3FBQA 1OXYA 5D2XA 3OGSA 3OAYK 5ALCL 1CE1L 2P5WB 3WDJA 3TBBA 3MRMB 2ZKHL 4ENEC 3WH6A 1I1YA 3WJJC 3C0SA 4GRMA 4UUJA 4CJ0A 5MENE 4C59B 1ZCCA 4WGWB 1JZ3A 4OM0H 3UABA 2FPTA 1EEYA 1G01A 4JGUA 3AIUA 1EEPA 5L2KB 5EB8A 4JN2A 4NI6A 3RLGA 3GVGA 2QPUA 4D8OA 1CL7L 1GC1H 1HN1A 4TUJA 1OTSC 1A25A 4H41A 4RZCA 1EZ2A 3VIMA 2V38A 2LFEA 4YBLC 3NACH 2OGYA 1VZIA 3OJDB 1BBJB 1T21A 4DEFA 4KUZH 1YYLL 4HPXA 3GIYA 5FGSA 3B56A 5TGBA 3NEEA 4XPFL 2BSEA 1X38A 1OARH 1MUMA 1G4TA 2GUBA 4PRPA 3CHVA 3FX4A 3OAZK 5C8JA 1E7UA 3S3CB 3RFAA 2PDCA 5GGRY 4OE7A 2D0FA 5DSCA 2RMNA 3I2CH 2VKWA 1BHGA 4MDIA 4FPSA 1MWAH 2PSNA 1X8CA 4KFMA 3QWRA 2F54E 3VNJA 5TD4A 3MRQB 2XTJB 4PVMA 5E9DA 3OKYA 3FTWA 1NICA 3DJRA 1EEUA 4MB5A 2GUOA 4BI6A 4S3FA 3RUGB 1CMOA 5F7HA 1ZJBA 5CGYC 2Y1VA 1ZV5A 3TS8A 3I02A 4X83A 4IF2A 2QJMA 5AW5B 1PG7L 1K8YA 5EBUA 4H01A 3QH3B 1ORQA 5D7IB 5CU9A 5FGCE 1E4LA 5H91A 5AW9B 3THDA 2XQBL 3BWZA 1VBUA 1MRAA 1UZ4A 2XQYA 4NENB 4AGMA 3RM9A 3B8UA 1UWXH 2KKQA 5CBAB 3D18B 3GFZA 4LLYB 3ENLA 3LK6A 1KR0A 1E6NA 4HH9A 3DJ9A 5CD3A 2A9NH 2V5RA 3BUYB 5K9JL 3ZTNL 2AI0H 5BO1L 1EBGA 1QHOA 3QHZL 4MWAE 4JG0L 2E9JA 3MRJA 2YD3A 4JW3A 1MDTA 3MLXH 4QRPB 3DHPA 2WQXA 3ZDYB 4GAJL 2YEVB 1KF9B 4AZ5A 5EC2B 3ARGA 2X4QA 4RGMB 4PBVC 1MW3A 3MX0A 1CECA 4ZMVA 1SU5A 3O6KH 1ICQA 3LQZB 1A6WL 5IFHL 3KCLA 5DFVD 4Y4HC 4NT6B 3TYAA 2V3FA 1MDAA 1X4XA 4GXUN 5C3IA 4HHWA 1QT1A 2JCWA 4Y1SA 5CSRA 4ZK8A 1KTKE 4WJ5B 3FRUB 5HVHB 1PX4A 3GUTA 3EJRA 1MLBA 1U4FA 2C7UA 4ZSUA 3LKSA 3RVUD 3SYPA 2RALA 4P46A 1VPQA 3HQ1A 4WNJA 1YSOA 4AFYA 1TVLA 3SE3A 2G5BB 3EH3B 1FBAA 3QY7A 4WW2F 2CEQA 3D2UA 3S3JA 2QUMA 5L7XL 5CJ8A 4UFIA 3E0FA 2E46A 4Q4KA 1IAOA 1C8YA 1I7ZA 5IQ7L 4Z17A 3EO1B 2ADAA 4PMEA 4JFDB 4HCRH 1X7TA 4S2SB 1QUNB 1BBDH 3I6RA 3BXNA 2EKSA 1YY9D 3N2OA 5JW4Q 4U1IA 4K9JA 3BGJA 4DGVL 3HRZA 4AIEA 3HE7A 1K8IA 2F68X 5ESVB 1ZBCA 1JZ2A 4PGCB 2CW6A 1EFXD 1IEAA 4EVZA 3B2XA 2OCFD 2DEYX 4JQVA 3IJ8A 1HW6A 3S8HA 5C0CE 5G1YA 2WWNA 1NGQH 3W9DB 3QFDB 2VZUA 3WQ4A 2XINA 3RWDA 4D1IA 2XRAL 4P59L 4PB0L 3ILPB 4Z2KA 4KPHL 3VU2A 1U8IA 2BS71 4AQ1A 4BK8A 3OZLA 2CLEA 4HALA 3QMRA 1ZLVH 2ON3A 3UGUA 2I32A 2M8XA 3FHEA 1NDTA 1FI8C 3NTCH 3UXFA 5KJRH 2Y3NA 3OGVA 2J9ZA 4A2DA 5K9QI 4WW1B 3OEXA 4GKZA 3SRFA 2MNUA 4HX1A 3KDMA 3CFIC 4JB9H 1CT8B 5CLTA 1HQRA 4PJGA 5EFDA 3H54A 3MCOA 1X7FA 1G7LB 1BAFL 3OC8A 4XMXA 4DF0A 4A6GA 2Q8AH 4TX6A 4R4FL 3LEPA 4U7MA 3FK3A 1FP9A 1KACB 5LIXX 4RZ5A 3IWUA 1D5ZB 3ESOA 2EC9T 3WAJA 4JY8A 2WLLB 4M82A 3AG1B 1AW2A 1CYXA 3DHJA 2O4MA 1I53A 1FFRA 5A2IH 1BQHB 1UHVA 1HL5A 4AMXA 5FV1L 4N25A 4ODVH 3U25A 3FA5A 2VEMA 3ERXA 2GFBA 5CILH 2AV1B 3EOAA 1JZ5A 4LGRB 4EI5A 3QIBA 3SADA 3VD2A 4IBSA 1Z41A 3BUTA 4NM4L 3HBZA 1K7FA 5IT2H 2HJKB 4HZLB 1FG2B 1BWLA 3QCVL 3L3JA 1A7QL 2UZYA 1L9SA 4L48A 2IALA 4U4BA 1JPDX 2OW6A 2G75B 3OR6B 3JT0A 2DEXX 3CNYA 4IBVA 3D85D 2BSSB 2X6UA 3VFVB 3TN5A 1L6XA 2EDTA 4TUKL 4AY7A 5D8JL 4HZAA 5J5EA 1XF3A 5I1GH 1X5GA 4GQ9L 1M7IB 5D2LB 1U95B 5INDB 5A2JH 2J9XA 5L9DH 3ARPA 3TBYB 2VCOA 1LBMA 4XP4L 1SEBB 5EF3A 3V0SA 3SUTA 1OAZH 1OTUC 4HAKA 1UR3M 4UXDA 1NAKH 3JWNE 3IUHA 5C7XL 3BGFB 2X05A 4DTGL 1YNQA 2R9HC 1SFTA 2Z1WA 2FJKA 5HI5C 1WFNA 3AICA 4GRMB 4UUJB 4EK7A 4XAWH 1RQHA 4WY0A 1W3IA 4CC4A 1KTCA 4XBGA 4N8PA 1EEYB 3H85A 4EAYA 3CQKA 3QC6X 4AHOA 3EH2A 3EH5B 3S2NA 1I9JL 5EBGA 3FLUA 5AW7B 3ZLQC 4JN2B 1EUNA 2Y7FA 4NNXA 3APYA 5KN5B 1A0CA 1NGZB 4JRYA 4AD2A 3MXVL 4RZCB 2V8ZA 4EBQH 1ONXA 4F7KA 1Q9LA 2EE3A 3T3ME 1T21B 1WV2A 1N0XH 1C1EL 2FT7A 1NFDA 1FTXA 1XLLA 4HK0A 1LNUA 4FMFA 3BDYL 5TGBB 3MYZA 4N2HA 3ASWA 3VIFA 3QKZA 4L9XA 3VZXA 4HQVA 4DJEA 1KIPA 2IQ0A 1NAMH 2AS5M 1UIPA 3PWAA 5C8JB 2FT6A 4HIEA 3MKCA 4IX2A 4KMQA 4L56A 2HVNA 2EVGA 4ZI8A 2JELL 5F0PB 4HEPG 4FZEL 4Z3TA 3LV6A 3TTQA 2AEQL 2X12A 4JRFA 3J07A 5AC8A 4FX7A 4MDIB 2LV4A 1MAJA 2FK9A 4N2KA 4QOKA 3W1RA 5K2ZA 3S3DB 1XCTB 4RW5A 1SFHA 3ULUC 1AW1A 5E9DB 4ODTL 3W7LA 3UTSB 3FO1A 2GUOB 4D0BA 5LGKA 2JB5H 4XPBL 3TC6A 3TH2T 2E68A 2VFFA 3RMJA 5AW3B 4Q14A 3FS2A 1W8EA 2HLFD 3I02B 2NXHA 2AXWA 3TQPA 3ZYOA 3I3BA 1ZSXA 1ORQB 2XG5B 1GCYA 2WZTA 4TU1A 1BVKB 4D6IA 4JKPL 3AHZA 1ZJAA 1P7QA 1TREA 5DHVA 2VLKD 4X42A 1TCRB 1WNOA 4FNLH 4Q97A 4N9BA 3V0GA 4AY0A 3R8GA 1HTIA 4YO0A 2ISWA 4HH9B 3DIVA 3H12A 1SW7A 4U6TA 2DQIH 3QZEA 1EDHA 3WBEA 2QJNA 4FI4A 3MRJB 1WPCA 3MJMA 2MTPA 1A3RL 5DD3L 3QZWG 1B3VA 1A4AA 1WSST 4XP1L 5IW6A 3ZGHA 1F05A 3PZQA 4UIOA 2PPAA 3WTUA 1MF2L 3ARGB 2X4QB 4UTIA 4PHZA 3K4DA 4ZW7A 3MX0B 5CPNA 2GJ6A 2OS7A 4E0RA 3MN8A 1TYRA 3RRAA 5D7SL 1FWWA 2BXZA 1DBKL 2OMBA 3TF4A 3R8BB 4Y4KD 2HMCA 2CHRA 3FAXA 2F6AA 3N55A 3BH4A 1PS3A 3F7KA 3R25A 5LGYA 1E4XI 3EJZD 4EUPA 3V5FA 1IJNA 4OUUA 1CXIA 3HI6H 3HG2A 1EZUA 3GUTB 4O14A 3F8UB 1MLBB 4BR1A 2KHAA 2C7UB 3PTQA 1QYGL 5FFGA 3CUHA 2R0WH 3MY9A 4P46B 3GPEA 2J8TA 3LCGA 1YO4A 2SFPA 2XKSA 2ROYA 1C9SA 4UFMA 4HNLA 3D2UB 5JOPD 4OCWH 4UTJA 4BF9A 2D7OA 1IAOB 3X3FH 4F9DA 4CBZA 1I7ZB 4GMTL 4DF2A 1FIGH 2ADGA 4OM1H 5JPMB 3U7BA 4GG6E 4ONOA 2QMJA 1JNEA 3D09A 1GTNA 2POZA 3K8LA 3K4WA 5DCBA 4G9FE 2VR5A 2VDRB 8A3HA 3BXNB 2Z0IA 2EKSB 3OTTA 2Y7GA 4WFFE 1P9MA 1TTAA 3W1UA 3K2UL 1A50A 3KM2A 3HRZB 3HE7B 1K8IB 2DP3A 3SEPA 2I9UA 1QSFD 4MCZA 1LOSA 4GRWF 3M0XA 3QHNA 1IEAB 1S7XB 2H0PA 4F5CE 1S9VA 4H7CA 3NZHL 2VI0A 3T0AA 5A43C 3RWDB 5FOJA 4UTFA 1XH3A 3PR2A 3P67A 1VBHA 3CLMA 4EKXA 5K1JA 1U8IB 4KZEH 4XNUH 1W1A1 2N0MA 2ZSVA 4GI8A 3HS8A 4BHYA 1P0NA 2GEQA 3OAUL 3STGA 5HHME 1TV3A 2FLBT 4HX1B 3KDMB 1XSJA 5CEYA 3GRBA 1HQRB 4NJGA 4PJGB 5DD0L 3TYUA 5BOJA 2YGNA 4KBXA 1L6ZA 4AW4A 4IRJD 1GYVA 3WDIA 4XZMX 4JPVL 4KUCF 4GYBA 3WD0A 4M7KL 1RZJC 3FO0H 2RGMA 4HXAH 2BBFA 3T6XA 1P5UA 7TIMA 1I1RA 1Z69A 2C1OA 1A4KA 4Y9EA 2L7JA 3RU8X 5DCEA 4P7LA 2WKOA 1I3RA 2NRDA 2UV3A 3GNNA 4NNAA 1EJTC 4Q22A 3QK0A 3SUUA 1IXNA 3UXAA 1XIGA 3AXXA 4DF9A 1XLGA 2W65A 1U3NA 1AFVH 2HFGL 1S9WA 2QAPA 1GHFL 2VB5A 2O5ZH 4I18A 2GFBB 3MKGA 1A7NL 2VD8A 3EOAB 3PG8A 4EI5B 5KMYA 3QIBB 4HNTA 3OGRA 1YEHL 3ZKXB 4J3ZA 4NO0A 5FECA 1J5SA 3IFLL 1TZ8A 1MMFA 1XQKA 2GGEA 3JWNC 3L3JB 4G7FA 4LT9A 1V0KA 1FNLA 4RISL 2UZYB 4AVOA 2IALB 4KCTA 1XS2A 1HNFA 5KYWA 2QADD 3F4WA 2W66A 4PIRF 4F0SA 5LQBL 1HNGA 4TVCA 2BVTA 1V0LA 1KEGL 2YGOA 3W2LA 1XF3B 1QSED 4AX7A 3DI2B 4W4OC 5CWSA 1DPMA 3SSGA 2VLJE 2D2GA 3QUXA 1GKOA 3NPUA 2OEJA 3FU5A 1EPVA 1V51A 3VKBA 4KROB 1ZT1B 4LNRA 1M42A 4MXWH 3GEFA 1F90L 1GSMA 3ZN6A 4WUKL 4K3DH 3GNDA 1LO5A 2FO4A 4HHAA 2DQDH 2BSTA 2R94A 4UC5A 4ZBCA 1ZP3A 2EUZA 1LDPL 2MOVA 3AMKA 4J40A 4WY0B 1E71M 1GZGA 4REQB 4AQLA 3MNVA 3IJHA 3H4GA 3MBDA 3QIUC 3ROLA 4KI5E 1U3JA 1ASQA 5EOCJ 4MKVA 1W8SA 1TEYA 4Y1AD 1OFAA 1TFVA 3FO9A 2QDEA 3AIRA 1M71B 3BZFA 5KVEH 2VL5A 3VG9B 3QV7A 3OZOA 2YXGA 3BIAX 4FP8L 4TX8A 3MR9B 4NNXB 1N6QH 5CH9A 1SDYA 1VIZA 2DQHL 1F6LL 2Z8VC 4WHTA 2UY7A 4FG6C 3CDZA 4JRYB 4YSOA 1Q9LB 2L7EA 4KQ3H 3K5SA 4FR6A 3TTEA 4OZGA 4AYBA 3N2TA 4ZAKA 3W3BA 4XMWA 4KRMB 1KIPB 3LDBC 3WKQA 1WV7T 1WE5A 3S96A 4XE5B 3OB0K 3MMUA 4AZHA 2BXVA 4HIEB 4ZB0A 2NX3A 2ZF9A 2Y63A 4PUBL 4IQEA 4HK5A 5KW9H 4P23B 1U2CA 3UF9A 4FYTA 4QJ5B 3WF2A 1OKEA 2HRPL 4QG6A 1V55B 3CH1A 2WO3B 5EIIA 4QOKB 4HBCL 1JXDA 3GQYA 3AQUA 1GVSA 4ZENA 2JGQA 3IXTB 1Z2KA 3FO1B 4PW9A 4A2FA 4EN2A 1B4LA 3U0PB 4ZO9A 4POZC 4J4PA 1XG3A 5CFAA 3V5CA 4P9HC 1TQWA 1F9CA 1FO0L 3VB9A 3S83A 5T1MA 4BWUA 5F9AC 2WM0A 1KLFA 2FHFA 1JYVA 1WWCA 4GMSH 4X5LA 5BVPH 3EDDA 3NJNA 1P7QB 5DHVB 2FVKA 2KQNA 3W39A 4W9JC 1ETZA 4TVPL 2D3JA 4E3VA 3V0UA 2JE8A 3WL0A 4H1LG 1TQCC 4PLJD 1AI1H 2XTKA 4Q7BA 4YO0B 3TF7C 5ACZA 3S9ZA 3T0VA 1GGBH 2VLRE 4IM4A 6ALDA 4GYPC 2EACA 3A47A 3RBSA 3VE9A 4MY9A 4N90E 4A04A 1JCJA 4B0MB 4L18A 4FCAA 2ITFA 5IW6B 3F4VA 4W4NA 5CEZE 3KEHA 1E3FA 3DMMA 4K3HA 3OPUA 2JK2A 2PLTA 4Y2OA 3QSRA 1BD0A 1XRFA 3DRQA 4ZFCA 2PDKA 2OLSA 4WI4A 4XMKL 2MOGA 1E6JL 3TH3T 3MZTA 4KK6C 4H7VA 1H1YA 5J3HD 4HWNA 5F9WC 4EUPB 2NY0B 4OUUB 4QGYA 1AJZA 3LKRA 3M7SA 4HU8A 2ZT9C 2I7GA 4OZOA 1A0DA 5PTDA 1FFOB 4JIPA 3EJSA 3S8WA 5F88A 3O3DA 4D7BA 3T2NL 1E51A 3HBGA 2HZGA 4WO0A 3PZNA 1IM3D 3IDXH 5C0NC 2VXVH 3X2QB 4F15C 4NQDB 2OM5A 1EDTA 4RA3A 3ULVL 5IMMA 3FTGA 1OK4A 2E6FA 1R3KA 3C6CA 4GG8B 4U28A 5LNDA 3CH9A 2ADGB 3YPIA 3P80A 3WQ5A 4MCYA 3ZKMC 1GT8A 4NIRA 4C56B 3QLDA 5HHVH 2YA0A 4PTVA 4BE5A 2J2ZA 3WDQA 2CD0A 4GXWA 4PJHF 5SX4H 2MIZA 3W7MA 5F7WC 4BM7A 3PNZA 5GS1C 3N43F 1E70M 3PL6A 4XWGL 1ELSA 2DIKA 4FN0A 1OQXA 3FVDA 3GD6A 4MCZB 2Y9RT 1K1DA 1MDLA 4K7FA 1Q66A 3M0IA 1IWAA 2MCG1 4K36A 1THFD 3O3AA 1BM3L 4XTRD 4BCEA 1UWQA 1S9VB 3GTTA 2WYIA 3WIIH 3BKJH 1OZMA 2N56A 1HK6A 2UY5A 4KXCA 2R4RL 3L3HA 3AU1B 4DYKA 4YE4L 1A5FL 3MRKA 4E9WA 3SUVA 1MZZA 2ZSVB 2UVFA 2PDHA 4DQOH 4QRBA 4IBYA 1PMYA 2RA1A 3WTTA 1T7ZA 2Y5QA 1OAJA 4Q8PA 3IBEA 4AL8H 1NEZA 1ISVA 1CTNA 3BWAB 1UOKA 4OR1A 3QYNA 4NLHA 1ZLUH 4EXKA 4IIGA 2HTLD 5JDJA 2ESVD 4O19A 1U8LB 4GD0A 4MASA 1QVOA 3PAVA 4LEXL 2JIXA 2P8CA 5D55A 4OZIF 4A39A 1D6VL 3BN9D 4OIAA 1P5UB 1HGYA 2CJTA 5EU7E 2NMSA 4ZS6D 1A4KB 4DKTA 4KERA 3FQRA 1YLVA 1WGVA 3W29A 3RM4A 3QFGA 4BH8A 1I3RB 5C9RA 2NXYC 2YRBA 4WDIB 3H2WA 4D9LL 3BKML 3HW7A 4P48A 1MFEH 2W65B 1S9WB 2NYYC 4WHYH 4GABA 4LVGA 2WBGA 1XWVA 4I18B 1LLAA 4OH2A 1ZQ5A 4KJWC 3JSSA 5IB3A 4A55A 4NO0B 1RAKA 1JGMA 5FECB 4IGMA 3JWDH 3ZWSA 2Q3AA 3V0WL 2OK0H 1ETJA 3KPMA 4XGZA 3F1QA 1SYSB 4YHPA 2NUTA 4XMTA 3C2YA 5T3XL 5KYWB 3P30L 1H11A 3QORD 2XG9A 2NY1C 1FO0A 2Z91A 4OGXL 2PZNA 1MDRA 1YIXA 3LZ3A 3S35L 3LZ5A 2BG5A 2FQFA 2FEJA 1U1HA 3I85A 1TE1A 3DUGA 1UFGA 4ZX5A 2A9CA 1FDZA 3KLHC 3IV3A 3QUXB 5FYKH 5AZUA 5HJ3A 1IB5A 3LV3B 3TBCA 1ESOA 4JDYA 5TBOA 5EUOA 4LNRB 4KETA 3HO8A 4P8UA 2WXNA 5I8EA 4GAGH 3H0TA 4YBQC 5FF6A 3IFNL 4XBMA 2NSXA 4YOKA 1D9KC 3R4RA 4FQIL 2R56H 1LO5B 2FO4B 3P0VL 4HHAB 4XMLL 2BSTB 2HH0H 4YPJA 5T26A 1GOOA 2RD0A 3MNVB 5EFFA 3IJHB 2V2TB 3RIKA 3AT8A 5F3BA 3NQ2A 3ROLB 4NZUL 2XWDA 1M6OB 2CCLA 3R06A 5KZMA 3KYKH 5IFTA 3LNHA 3FFSA 4AZ8A 1RZ8A 4XC3H 3RDTA 2GEEA 5KINA 4NX0A 3Q37A 5JMUA 2P80A 3FO9B 1IT9H 4IGNA 4JO4H 7PAZA 2OSLA 3BZFB 3C2SA 1EFZA 2VL5B 3AFLA 3ES7A 3UBXG 4WHTB 3B8SA 2UY7B 4DGUA 3IGKA 1X9UA 3HG1D 3CDZB 3IMWA 1PLGH 4LUYA 1CXKA 3BWWA 4XC1H 2HT3D 2Y7NA 3KBJA 4OZGB 4MDOA 3M47A 2LLGA 4ZAKB 1Z9SA 3N17A 2XIIA 2ALRA 4ADUA 3TWCL 4TO8A 1IWBA 1TYGA 2G3JA 3X13A 3S96B 2VZ1A 1HKFA 2ZICA 5HYIA 2C79A 2DTML 2CXGA 4GK8A 1UM4H 4Z3HA 2YYUA 2R1PA 2B14A 4FTVB 4GUJA 3HZVB 1UWIA 4X5PA 3E0WA 3P8IA 1RBAA 1JJUA 5BZWA 3O06A 3CH1B 4G7YL 4G8EA 5EIIB 3FC8A 3T1FA 5KBDA 4ZB5A 1PKMA 4KTDL 3CAWA 3QB7C 1NVMA 2E6YA 3CQ0A 3KVQA 2Y89A 2R24A 4MZ3A 1W8OA 1SUXA 4GE8A 4UMBA 4OBRA 3RE0A 2IANA 2PWUA 1JI2A 4W7UA 1KJMA 3MJYA 3U9UA 3V6OC 4MZ1A 1TLKA 4R3UA 1Q6QA 5T1MB 3PPSA 1GKEA 1KLFB 4KFOA 4BHUI 3RDJA 3RVTD 4ONHB 1VESA 2V5KA 4XPAL 5HSFA 3IKKA 2WAQA 1FWSA 3IDNB 1IC4L 2WCGA 1ETZB 1IGML 2EILB 4YHMH 4Z9KB 3HC3H 3SKJL 5ACZB 1A66A 2D4DA 4N8CH 3IIPA 2V2WA 2CKNA 2VXUL 5PCYA 4WEEA 2BZ7A 1NM9A 3UJ2A 1HJWA 1RIVH 5FHBH 3P2TA 5DHYA 4YHOL 4JXCA 3DMMB 1SQ7A 5F21B 4Y2OB 1J1OL 4UMSA 2D3VA 4GP5B 3LA4A 1OABA 3TBTA 4TTGA 2B4GA 3DRQB 3G5VA 1AANA 3A6CH 3SDYH 2MHAA 3QM3A 3NAVA 1GXEA 4B9KC 4JO8A 1FCCA 5DURB 3LKRB 1JGDA 2ZAIA 5IRPA 1KCLA 4MQ7A 5A2CA 3VA2C 2VN3A 4Z1DA 3TIEA 5KZCB 3UZYA 1EYEA 3O3DB 2VUNA 1B0IA 3T4YB 2OAAA 5IW3A 5EYWA 1XB6A 1CDUA 3BMWA 1QLFA 4LVEA 4IMKC 2YGPA 3ZUCA 2XH7A 4RAVA 3CFUA 4JGNA 3FQ2A 3UAJA 1RIUH 3VB8A 2RDUA 3L0NA 2DQXA 1OAUH 5IMMB 3FTGB 1OE3A 2TODA 4IBUA 1R3KB 4YVPA 5HBFA 4MCYB 3V8CA 1XVSA 1XGZA 4K68A 4JR5A 5HHOE 4QHRA 2VEGA 2F53B 2J2ZB 3NK4A 2G0LA 3DCPA 3N1FC 4PJXA 2YKKA 5EL1A 2KUTA 4PP2A 3VFUA 5DGRA 2W80C 1AIFA 5AOJA 3PL6B 4WTXA 2DBJA 4S1QL 4B60A 4ELKA 3NA9L 1LUCA 1F5WA 3R13A 5JYMA 3U82B 1QUPA 4BIKA 2PCXA 3T9PA 5ANME 1VIWA 4K7FB 5FW8A 2DM3A 1BFVL 4APQA 1AGDB 3O3AB 4AVNA 3F58H 3WEXA 1Y5XA 3JVGA 3EX4A 3V16A 4AGQA 1G94A 4Q33A 1KLGA 2OQJA 3CPGA 4J2MA 2FUTA 3UG4A 3WFCH 3IJ7A 4ICWA 3L3HB 3MRKB 4WV1C 1DDHA 3OYXA 4JHAH 3TV3L 2GDVA 5EO9A 2YBRA 1FN4A 4LARL 4MNJA 3OVRA 1YQVH 3S3PA 3MP3A 3OLDA 1SZGA 2AQ3A 5EF2A 3F7JA 4QHLA 1SFLA 1NEZB 4PBEA 3SJVA 3GXPA 1RURH 4BD4A 4DN4L 4Q4PA 3LGEA 5CC7A 6ENLA 4FZ8H 1UD3A 4L3EB 2WZEA 1EZLA 2OELA 3S5SA 2JIXB 5LHFA 1PLAA 1T66D 5I0VA 4ODBD 5E6IA 3NWRA 1D7DA 1BYAA 2IWGA 3PFRA 2PDUA 3FQRB 4X5WA 2CLKA 3EZ4A 4P99A 4C6OA 2BSCA 3T3PB 4BH8B 4OB5H 3VWJA 3USZA 3P74A 4HPNA 5DA0B 1LO3L 3W7HA 2WZPA 3E1F1 2FVLA 2ZDSA 5CBEA 3GBML 2FR4A 4JUSA 1ZJIA 3FUMA 4PGLA 1WOAA 1UJ3C 1IKNC 4WFHD 1GTEA 2IKGA 4PN2A 4FFYH 1VA9A 5IB3B 1BM7A 3IGXA 3S1VA 2WQWA 2VDNL 4UDTA 3WLQA 4MFEA 3OC5A 2APTA 1S2AA 4F2MA 4XGZB 4Y9AA 3MDWA 4PS3A 4YHPB 2NUTB 5E4IA 4B41A 3AY4A 5D7KD 3CT2A 2WO2B 3QEQE 1LTXA 1GONA 1FO0B 1KY6A 4I3SH 3U0TA 3QO1A 1QTWA 3ZHFA 5IBXC 1FCGA 4N0FA 2ID5A 4OGYH 1EHLL 3UPBA 3V0JA 1ZTXE 3IFPA 1E40A 5HJ3B 3GPSA 1BRLB 2HFFA 5K1NA 5FUOH 2AC0A 2OQYA 4JM2B 1JNLH 1BG9A 4FALA 1TMCB 5I8EB 5IHUL 4B16A 3H0TB 5FF6B 2H5UA 3ROOB 3ONCA 2ZUNA 3B9OA 2AQRA 3K2GA 1DIEA 1MYRA 1J8HD 3QEUA 3ZVHB 1QTPA 3NIGF 4M00A 4DP6X 2D03H 1MO0A 1WWBX 1UWFA 4Z23A 1X4YA 3GSUA 4GCXA 1SYTA 1FWBC 1Z0NA 3NQ8A 3K2MC 2NY2D 4QYOB 3PFUA 1WKEA 1EYWA 1L9OA 5DGQA 5C07A 3R06B 3J2PA 3C5ZC 5D7LD 4XCYA 5DQJA 3N5AA 3KH4A 3VKKA 4AZ8B 5I5MA 1RZ8B 3FT2A 3RDTB 3LNFA 4WRLA 3NEOA 3HU7A 4XOBA 1V02E 2J7GA 3ESPA 1KGIA 3A3WA 3N19B 5AVYB 3GIQA 1N68A 1H0GA 1HU8A 1RZFH 5I74B 1U5JA 1EBPA 4LSPH 2DV6A 4IL0A 2QKFA 1KULA 1QFWL 4MXQC 4NZTH 4K8RH 4XAKD 3TJHD 5GJSH 1JK8B 2KMWA 5DX7A 4GH1A 3FUDA 3O4LE 4WSKA 4AY1A 1MRDL 1Z9SB 4HGKC 2EIMB 3SJNA 3DZ1A 2IPGA 3WJWA 3X13B 5F7LB 3PHOA 1SDAB 4M62L 3LKNA 3L0GA 2WB1A 3NJFA 1AQDA 5IQNA 1UZ1A 3ITLA 3SBWA 1I8AA 2JIEA 3G5WA 1GKRA 3FTVA 4GUGA 3VINA 1NDWA 5EZIL 1E2VA 4G8EB 3ARTA 2VIRB 3T1FB 1MXDA 2C9RA 3UPMA 4CDGC 3QHFH 1EJ8A 1GCFA 2GK2A 3WF1A 2EDHA 3TO2A 4DAFA 1ZWIA 4RFOL 2PDGA 3SUSA 5GIRA 2CJ3A 4LVAA 2HE8A 3OBAA 3HUJE 2A3EA 1KIQA 1KYDA 1TJIH 2IANB 2JJWA 3MANA 5E2UL 2C1HA 1NBYA 4R3SA 3GZKA 1S9KC 2WCAA 3OHXA 2WMPA 4MZ8A 2Y6ZA 5T1KA 1OC7A 1Q3NA 3EIFA 3U9UB 3H9YA 3C87A 4Y9CA 4R7JA 3AC0A 3SKNA 4HJTA 4Z95H 2MCAA 1T2JA 2IH1A 4I1NB 2NR6D 3B8DA 4C65A 1NPJA 4NUMA 3WNPA 1SN0A 2IOOA 5F1IA 1XBRA 1E9OA 5BMWA 3LERA 3ZJKA 2PDWA 3RFRA 2Y6TE 3P2DA 3ES6A 1UACH 5EEZA 2ED6A 3BP5A 2IBGA 1J5HA 4ZMGA 4AGOA 1QBML 1ASPA 2D0GA 4XNYL 4B9FA 5B8CA 5IREA 1R9XA 5KBNC 3KLLA 3C3UA 5KG9A 4AQ8C 1S1PA 1J9TA 1H1ZA 2Z6FA 2VAAA 3QMTA 1HEZA 2C1GA 3OPSA 1OF6A 4GX8A 3PNRB 2Q8BL 2ILLA 2XJKA 1F6KA 3TBTB 5AAWA 3RTQA 1OX5A 3H2EA 3G5VB 3U7YH 3AZSA 5DYFA 4LVNC 3N73A 2FATH 4U6YA 2ZG1A 3MHUA 2MHAB 3NOEA 1Q7QA 4LGPB 4QXIA 1KZYA 4KEVA 4EI6A 4JZJC 1FH5L 2QGCA 1JGDB 3NL3A 3N9KA 4PC8A 3DX2A 4MQ7B 4FQXD 4PWKA 2FBJH 4K94C 4GC4A 3TIEB 3O41A 4LPCA 1S5NA 5A8NA 3B8TA 2N59A 4HPYL 3WH5A 1QLFB 1AS7A 2PC4A 3RPMA 5C1MB 1SBSL 1EZSA 3QFJB 2ACRA 4HUVA 1JGIA 1P6WA 3PDOA 4N42A 3TZVA 5FCUL 4FFZA 4MNGA 3QQ9D 1RK5A 2DBLL 5DF0A 4GJIA 5B38G 3QWNA 1YHTA 4AKOA 2K8QA 1RV8A 3KRUA 5CG0A 3TT1H 1PTGA 5AYYA 5FGBC 1T1YA 1QATA 3D39A 4M6VA 1DXEA 4ALAL 3CSPA 4FXRA 4NPJA 1NMCB 4PJXB 3LN4A 1RKRA 4K3GA 3VFUB 4LBUA 4LJ3A 4IRSD 2RTTA 1AIFB 4R2GD 1E50A 1LUCB 3UWQA 2VOMA 3WLKX 43CAA 4B0MM 1XUZA 3TXVA 3NP3A 2CDGA 4NRYB 1I0DA 3GTIA 1L9WA 4V1XA 1ZK5A 3WEXB 2B8OT 3KCWA 3ETBJ 3Q06A 4I0CC 3KWSA 4GSRA 2VD9A 1U83A 4ZQOA 3G0XA 1KLGB 2OQJB 2FYMA 3VOIA 1JRHH 4UOW1 4EXPX 3FFCB 4QHNA 3RRXA 1DJHA 5IEHB 1DKWA 4MGGA 2OQHA 1DDHB 3HG0A 4IXXA 3Q9QA 3MREA 2YBRB 1FN4B 1UADC 1FVEA 2Q6WA 3W6MA 8XIAA 1FNSL 3EBVA 4WIQA 3ESNA 4CBPA 2HT4C 3SODB 3HR6A 4DKFH 1U9KA 2JJTC 2ZG2A 4QHLB 4QTHA 1QFUH 2CUIA 2QV2A 3SJVB 1XFCA 3QG7L 3LLXA 4WUIA 3IGSA 4PEKA 1QPKA 1FKWA 3IIZA 4NI3A 4RZBA 1A9VA 1ZHLB 4LFHD 1HVQA 4WIWA 1ZLPA 1PSKL 5ITBH 1KW1A 1QHQA 3QAQA 5E6IB 3EWUA 2WXIA 2RHGA 4KDTA 2JKRM 2OULB 2V69A 3N6YA 4X5WB 4YEFA 3VWJB 5JPNC 5CPLA 3UZXA 2FX7H 4LU0A 1O7SA 3VFNA 2Y07L 2CJUL 1G1OA 4LSDA 5EBLB 2ZUTA 1MNZA 5SWQA 3TN3A 3BK0A 5CBEB 2FR4B 1CIUA 4ERAA 4B2DA 4QFUA 5AECA 4ZEPA 5IROC 2XA3A 4ETQA 2ZCLH 4DJFA 1OPGL 4UDTB 5TQ2H 3CK0H 5LWYH 4X3ZA 4ZB2A 2X1OA 4F2MB 4MUZA 1TQTA 3UX9B 1UBPC 2X1UA 1MI5A 4QITA 5TK4A 4YR6A 3IK2A 1WAPA 4TMCA 3L21A 5T3ZE 1UA6H 3GXFA 3DGRA 1NBVL 3KPPA 3VQ2C 4ZR8A 4IU3A 5IMKA 3QRFM 2ZYFA 4HS8H 2PBOA 2F18A 4BSVA 3U0TB 5HK4A 3QO1B 3J27A 3HA0A 1AOZA 2NNRA 3O2WL 3SCOA 3W38A 2QQLL 2ZXQA 3GNXA 2DDQH 2YKLH 3ITCA 2UY6A 4YDJA 2HFFB 1S7RA 3BFQG 3NQKA 2ZWZA 3QNZB 2EYTA 3WXVL 1UEMA 4D8AA 3GLDA 1E8YA 1MFBL 1DQDL 3IN2A 3T8VA 3AQYA 3QEUB 4X4XA 3DXAA 1X8FA 1MCSA 1L0XA 2GJJA 1I1YB 3FJ6A 2H8XA 3GSUB 4INFA 2Z4GA 5K4XA 4RMUA 5C07B 4XCYB 5DQJB 2J75A 4IGHA 3FT2B 1FGVH 1VJIA 2R1KA 4PJ8A 1O5XA 1B2WH 3QDGD 3OQEA 5HXMA 2WM1A 3MRCA 4JQ4A 3GLZA 4TUJB 1TRDA 4GWEA 3BP7A 5KAQF 3CIXA 3MRPA 5T1LA 1QOQA 4BWLA 4QE5A 1W3JA 3WHE1 4ZTPL 2OWCA 4KKNA 5GRUH 1RD5A 3FN9A 2FNBA 4AIXA 4NAJA 1IFHH 1PNCA 4NO5A 4QI3A 1T5AA 3IGHX 1W9UA 1PFOA 4WSGA 4YVXA 3CMOH 2ESCA 1YEFL 2HLEB 3PHOB 4PRPB 3LKNB 4GUQA 2Y7MA 5JW4M 4FFWC 3S5NA 1U91A 3MDJA 3SQRA 2A9BA 4GUCA 4WNSA 3MV9D 2A4CA 3APCA 2WSKA 3QR3A 1RQ5A 5DSCB 2YO3A 1NCAH 3IMTA 3DX4A 3DO3A 3KBSA 1W1YA 1KV7A 1UWEL 4KO7A 3TO2B 1RZQA 1ZWIB 4NC1E 1MZYA 2OYPA 5IW1A 5GIRB 3CQHA 4X2PA 1F58L 2C4XA 2OMAA 4FOMA 4HYVA 1KIQB 1X5KA 1NBYB 4R3SB 2DQTH 3DIFA 3OHXB 1EEQA 2WMPB 5BNXD 4MWAC 4PJ7E 5T1KB 1KV8A 1YYMH 1C8VA 4OSUH 3RX2A 5KSUA 3C09B 1OFBA 4HWUA 1UCWA 2VKXA 2C0HA 2IH1B 1Q38A 4HSOA 2XSAA 4X6DA 4ACTA 4DP1X 3LN3A 3LD8C 3VXQA 4EIBA 3H2OA 3Q8EA 4BWTA 5C3TA 3P5YA 5F1IB 1E9OB 2JF1A 2VR7A 4E41E 4LEQA 3DO7A 2KL6A 4O58L 4R97B 2FGWL 1T8QA 4OFKA 1TKKA 2LU3A 3ES6B 4FLHA 1CFMA 1V3JA 1PAZA 5C9XA 3BP5B 5CD3B 1E1CA 1WUFA 4O2FA 3MBEC 5B8CB 4DPCX 1G7IA 5I8OH 3PZIA 4S3EA 1W0YT 4QRNA 2P5ED 5AHMA 2CLHA 2I5YH 4PU2A 2VX4A 2VAAB 5BRZA 1HEZB 3ME3A 2XDFA 1FRBA 1BTCA 3CAFA 4JHWH 4L4VE 2IIJA 1XLIA 3NQDA 1V7MH 1YNPA 3RTQB 2DQEH 1H6EA 5F8RC 4DBSA 4PV1C 4U6YB 1J5OL 1QZNA 4Y16C 4GMEA 4D3CL 5D6DC 3RP1A 2VN7A 3JWNG 2BVUA 4EI6B 4AUJA 4H8UA 5GGSA 2X88A 3LI0A 3SOTA 1KM6A 1J12A 4N9OB 5FHAH 5DS2A 1RJYA 4WK4B 4AM0A 1OG0A 4A8LA 1GVQA 2IDUA 3LKSB 4Z2IA 4HXBH 1OWQA 3UTPE 1TPUA 5I07A 3PDOB 3TZVB 5ISZD 5CCKL 1PBYA 2VDNB 4YBHA 1FDYA 3LRSA 4OLYH 4MNGB 3PS6A 2ED9A 3S4SA 5GZOD 1F76A 4OD2A 4XVJH 2QGDA 4HPJA 1UASA 4I77H 4GYFA 2WNKA 2F58L 3EYSH 3D39B 1OHLA 3O2LA 3SQSA 4LX4A 4OBTA 4PL1A 5CUSL 5TQLA 4WJEA 1PD1A 5JR1H 1EIXA 2OZ0A 5JXEA 2ZX8A 3CLEH 2EEBA 4O11A 5LXGH 1U1UA 2PLJA 3GMOA 3AUOA 2XHYA 1IAKA 4U1IB 3B37A 1JXJA 4RDQF 5SX4I 1YEJL 4XMVA 3RU8H 2CDGB 1C16A 4U1HA 4WR3A 2G4FA 3EWXA 4WO4A 4Z1PA 3UC0H 1XYCA 5F72S 5ALBH 4OJFH 1BJ1H 3VXME 1AOHA 3UDWC 3GH5A 1T7VA 2YQ2A 4DIXA 4JFTA 4QHNB 1YE4A 1SVBA 5KYUA 5XINA 5CN3A 4H20L 1P7KA 4GSXA 2BVPA 1DQVA 5ENWA 4AQ1B 2RCSH 4W5ZA 4X5RA 3MREB 3BE1H 1FVEB 2Q6WB 4BXVA 3E0VA 3S37H 2WCSA 1QOKA 4YWGL 3KPSA 2YMXL 4DGYH 3ZM8A 4JFFA 1JP5A 3B7RL 2ZX7A 1E4KC 2EH7H 4GKZB 5LKYA 2BX5A 5TF1H 4OIIL 4DZHA 1ZPUA 4ABQA 1H7WA 4JZOA 1TJHL 2K7QA 3RHWK 1GEHA 1Z5YD 3IGUA 3WDHA 2YRZA 4U5IA 1DQLL 4UOZA 1UB5A 2ZWNA 5AZEL 3C6LC 1IZKA 5E8OA 3BYTA 3ZR5A 3LG3A 1PCSA 1SO3A 3ABQA 4AE0A 1ZTVA 4B9JA 3HE6A 1NLDH 4JO1L 5B39G 5J8LA 4I1RA 1CJYA 2P26A 1WBZA 1H7PA 3QZBA 3EHBC 4H8WC 1E55A 1VGEH 1X5LA 2POTA 3VFNB 4ACPA 5SWQB 4J8RA 3HS0A 3DPBA 3D69A 5EMJA 2QLVB 3B40A 4CD8A 4FX8A 1EQWA 5EKYA 5A8OA 4RAHA 3S37X 2IPTH 4C6IA 4ETQB 4UMCA 3EAKA 1SQ2N 4DJDA 3ZE2F 2Z25A 5D1QE 4PYSA 4PJIF 4DVRH 2Z35A 4LAKA 3O1NA 2A9AA 2VMEA 1MI5B 2JF7A 2DQFA 3STEA 4YR6B 3ARRA 4K6AA 2EG6A 5EC1A 4JL2A 2F7FA 1GIGH 1KN2H 4IU3B 3VDGA 1UJTA 5IMKB 3C60A 1I3GH 4R4BA 4U6VH 1CLOL 2DLEA 3WCYA 2R83A 1DBBL 4DBDA 2ZFAA 5A3ID 1B5TA 4KI1A 1BF8A 4X80L 2ALDA 3W11D 4KHTH 4YSTA 1B54A 1SLXA 3MT1A 4OCNC 3T0EA 3CGTA 2UY6B 4YDJB 1ASOA 1S7RB 2VX6A 2AITA 4M24A 2EYTB 5IBUG 1JCLA 4JEJA 4HKPA 1KCBA 3UO1L 1I9IH 2C9VA 4NRXA 3M0KA 5JZ7C 4DWHA 3LSCA 3GKWH 3DXAB 4BELD 3TYZA 4UR9A 1YC8A 4ZUTA 3VD4A 1JCTA 4XZBA 2NT1A 3AU2A 1CWVA 4AHPA 1W31A 4LVDA 2VSDA 2APWA 4YIQA 5IBTL 2DZUA 4XBGB 3U2IA 1OFDA 3SGEI 3CQPA 3NM3A 4RGND 2D1ZA 1F61A 4G7EA 2HZHA 4Z2JA 1B6UA 3NIDE 3QA3A 4DGIL 1DP0A 2YA2A 3RVVC 4OCXL 2J47A 3VIHA 3VZYA 3GBNL 3MRCB 3BPLC 3V4PH 3EYQC 2OWWA 2X38A 2PD5A 5D4IA 4PG2A 4FQHA 4RV3A 3MRPB 1SXNA 3MXWH 5T1LB 1Y6NR 3BLFA 2F5AH 4AWEA 2PN5A 1RP8A 4E68A 2ISSA 4ZOEA 4ACYA 1NFDB 4G7VL 2Q86A 3G0UA 4HK0B 1LNUB 4CD5A 4NO5B 2DM7A 1S2UA 3PZTA 1QEWA 1XX9C 4S10A 2GAZA 1TO3A 1MCBA 4LHQB 1ZZMA 1KFLA 3T4CA 1XFPA 3N34A 4L4LA 5H94A 4ZOCA 1X5YA 4TQEL 4I5UA 3FGCA 4LOUC 2DOCA 4FXFA 2ERJB 5TAOA 2V5SA 2HVMA 4JN1H 3MRDA 5HDBB 5F1OB 4M9PA 1EX1A 3K0YA 2NTFA 5IW1B 3G6DL 4EX4A 2JIWA 5CNHA 1KFWA 3OR7A 3TVMC 5HMSA 4D0BB 3Q6FA 2AK1L 5EEWA 5DEZA 4CD6A 3W53A 3NCMA 4B3EA 3DIFB 2XICA 1DO5A 3N4AA 1IGJA 5KSUB 5SWSA 3ZDXF 2AJVH 1BD2A 1W54A 2J8UF 2BNQA 3FXIC 4YHEA 2AGJL 1AXTL 3MGOA 4M4PA 3QUZA 4W9ZA 2WSYA 1I1AD 2GSGA 5TFSH 2F74A 5JQ6H 1S5IL 4LSQH 4YCPA 3AWGA 3D7PA 2GY5A 4DUOA 3ZE1B 1XIWC 5BV7H 4CC0A 3DO7B 3NABH 4RRPM 1L6WA 1RR2A 2ACUA 4WKHA 1IL1A 1AK5A 3T0BA 2WLYA 2W63A 4BRVA 5DT1H 1SZNA 4U4IA 1AZCA 5T33H 1WICA 4O2FB 4YH6A 4IQLA 4D72A 4PGJA 5F1SA 5LDSA 1G7IB 4LEOA 4MJJA 1M01A 2V5BA 4LAJH 4OF0A 3EFDH 4XX1E 5BRZB 1J6PA 2UXTA 1XGYH 5D1ZA 1ZVYA 3SPHA 2GJ6B 4YFLI 4Y9NA 4E0RB 3F5JA 4KQ4H 4QTGA 3H7RA 1BQLL 3V0HA 1B4JL 3CH0A 1TJGH 3SIMA 3QQ1A 1CLCA 3RX5A 5I16A 2JALA 2NZIA 2PO6D 2QCDA 4M6ML 3HNSH 2V82A 1RJYB 1P7HL 2MRYA 2BNRD 3TV8A 4AM0B 3IPEA 4L0YA 2BV9A 3GVRA 2XN2A 4PRRA 1JEZA 2X44D 1UM5L 1EA0A 2PRHA 3AXHA 2V9DA 2WXFA 4N9GA 5I9QC 3LRSB 3CU7A 2VQ4A 1Q6DA 3BUBA 4N68A 3T2OA 2E0PA 1VFFA 4H6KA 3ZGIA 4JNMA 3S4SB 3WQPA 3RJXA 1Q63A 3OVUB 4LLUA 4OD2B 2NUXA 2OPCA 3RY4A 4KHXL 4Y19E 1UPPA 1KEML 3FL7A 3PZVA 1IM9A 3APMA 4UINH 4FXTA 5I1KH 4LCQA 2XZZA 4KJYA 3BUVA 4YU1A 3FQNA 4H00A 4YHYC 4PRHE 4LP4A 3GMOB 1IAKB 3AO0A 4O4YL 3WKYA 3WBDA 1IMHC 2FEDD 1SFSA 1A0QL 2FECI 1C16B 4U1HB 5IBLC 4FKHA 1MAML 3QULA 4P9HH 4WO4B 5HDOA 4ADTA 1YEIL 4JCMA 1AMYA 3INUL 1V7NL 1K03A 3TLLA 1IQ8A 2QS8A 3RIFK 1XH3B 5KYUB 3DERA 1ECQA 1MHEA 1P7KB 5JHDA 2BVPB 4KRZA 1XLAA 5ENWB 3EWBX 4A7QA 5EU6A 3B2VH 3ARFA 3KPSB 3M07A 4X9SA 4W9IC 2VSMB 2QLYA 2XYLA 3TJ4A 4JFFB 4X4MA 1XTMA 3IEAA 3JZEA 1D5RA 1PZCA 3C8DA 4CN1A 1POKA 2GT9A 1KJVA 4JZOB 2GC4C 5CEYB 1A65A 1E6XM 3LHPL 3QYQA 5ICUA 4OD1H 1RCQA 5DT7A 1TPXB 2QHAA 2FGBA 3TONA 2D2JA 4M03A 1LWJA 3RLVA 1ILUA 1CD8A 1GORA 2VGLM 2AAAA 1WFIA 2B16A 3HE6B 1QR7A 2J5LB 3P73A 2C1OB 3EJYC 1IVTA 2UWEE 5GZND 1HSAA 2GQAA 2Z1BA 5FYLH 1WBZB 2CZDA 1TELA 3GXTA 2HFTA 2VDQL 2EO1A 3HS0B 3DPBB 2ED7A 4CEUC 1EJOH 3D69B 4DF1A 5J8OA 3VTRA 3RL2A 1GPOL 3B7YA 4OCRL 3DOPA 4OQVA 3OLIA 4JEQA 3DDGA 2B4CL 3VC6A 2VTFA 4PY8J 4X61A 1JV5A 2X10A 3HHMA 3VK5A 1HWGB 2FRGP 5JMRA 2Z35B 3CCHA 4HD9A 3X12A 4AEIH 2YZ5A 2DQFB 2JLPA 1FOBA 4H8PA 5KVFE 5EC1B 5DBTA 3IEBA 3CFCL 3N0PB 4M93C 3LHWA 3DJZA 4IGBD 3MLVH 2XIJA 3C60B 4R4BB 2YQGA 3GW0A 5FF3A 1A6UH 2O9PA 5CWSB 4KI5C 5CKGA 2DMCA 3LYRA 1EKOA 1IRAY 2G5RA 3BKCH 3T0EB 3RLSA 3NSJA 5C2CA 5AVTB 3ZKNC 1O6TA 1SMAA 1UH3A 1D3CA 1MJ8H 3G3MA 2ZZ4A 1MCNA 4XP9H 4UBDC 5DC0A 2BY0A 3MUCA 3SGEH 1A9BA 2ZVRA 4QY8A 4ZUTB 2A9DA 4J3UA 1ITXA 1E4HA 1HJVA 3E0IA 3GB7A 2CRMA 5I71C 4JK0D 2ZPKH 3KL5A 3GVQA 2YD4A 1EAOA 4YIQB 4PV8A 3HCVA 1B0WA 1VEPA 4KWWA 4HBKA 2KZBA 2YN5A 3JRKA 4Z7QF 4PBFA 3DHUA 4PJCF 4XZIA 4G7EB 2CERA 5CKSA 5DMJB 4E36A 5FYKD 4M1DL 3RX3A 3QA3B 2IF7A 5A6SA 2J6XA 5FW6A 3SPJA 2D20A 3QPXL 2NUWA 1FV1A 4LVOC 3E8UL 4OKVA 3N50A 5AB1A 2BSLA 3AUVA 7ODCA 3MO1A 4FQHB 3MCYA 3CN1A 4UNIA 3UJEA 4ISVA 3PZUA 4AIBA 3QJRB 3GXMA 2CU0A 1CE6A 2Q86B 3GLEA 4XVEA 5I1CL 2G3XA 4YZWA 1KYOK 1ZNNA 2GAZB 4H1LH 3RGVC 2GI7A 4S3BA 2PNDA 4NGHH 1ML1A 1DJIA 2CM6A 4JM4L 1WJ3A 5H94B 2OJEA 3FGCB 1N6VA 4FXKC 4XCCH 3UJJH 4NZCA 5BROA 3L7FA 3MRDB 4C6DA 3G1DA 5AHFA 2OZ4H 4Q9QL 5I0ZA 4G43A 3VWKC 3TUUA 1OGAA 3ARUA 3WFEL 4O0QA 2NTFB 3BTNA 3NQGA 4FI7A 3OR7B 3UJSA