1PZ3A

Crystal structure of a family 51 (gh51) alpha-l-arabinofuranosidase from geobacillus stearothermophilus t6
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
497
structure length
497
Chain Sequence
KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNEMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Alpha-L-arabinofuranosidase
total genus 172
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pz3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pz3A02
3VD7A 3S6TA 3VIMA 2NT1A 1V3JA 4AZIA 4AEFA 1CGTA 1E56A 1Q6GA 5CPSA 3EDJA 1BHGA 1RH9A 1PEZA 4YHEA 3F4VA 1CDGA 3OGVA 4A3HA 2ALWA 1GPFA 2BHYA 1XH0A 2BNJA 1UHVA 1X1NA 1JF5A 1HTYA 4DWSA 4V27A 3NJ3A 3DX3A 2BV9A 1XGZA 3WH9A 2VX4A 5HDRA 4UZUA 5AYBA 5A94A 1PZ2A 4MDPA 1OGSA 5ECUA 1EDGA 4KMQA 1S46A 2VX7A 4C7DA 1DTUA 1XD1A 3SCVA 4AZ7A 3WEZA 4PMVA 4DWSD 2EPMX 1NH6A 6TAAA 4CU8A 5I2UA 4U5KA 1QW8A 1UKPA 4UTFA 3O2LA 3BVTA 3LRLA 3WNMA 1CWYA 3L4VA 5D9MA 3W24A 3WQ5A 3VGHA 3L2MA 2YBTA 1GQIA 2DT2A 3VINA 4GZEA 5AYIA 2DSZA 3BAYA 3MUZ1 4E4PA 3VDAA 1SYTA 2WCSA 3WF3A 1DEDA 4EANA 4DUXA 1UWRA 3SCOA 3VOCA 4NXSA 2CHOA 4D6EA 1E4LA 5HOSA 3D5HA 1QHZA 1BG4A 2ZX9A 4OZOA 5AC5A 3GZAA 2XJ7A 5ABEA 1UH2A 3VU2A 2EPLX 1H11A 4Z2JA 1HJWA 1MQQA 1W1YA 2EAEA 4OKDA 1UASA 2VQTA 4CKQA 1XRVA 1VF8A 3CZNA 5E1QA 1VEMA 4GQRA 2WMJA 2YBUA 4B15A 1JYWA 2CPUA 3PTMA 3WENA 2ZWZA 3L4YA 4EE9A 4AD4A 1RP9A 4Z2IA 5A6KA 1MVYA 5IXEA 4J3UA 3MMUA 4U3CA 1OCQA 1GHRA 2YLAA 4PSPA 4AZ6A 2XTKA 1G9HA 3TTSA 1KTCA 2VNCA 3ARTA 4XB3A 5I79A 4BA0A 3SCTA 4GI6A 1J01A 3LPOA 4TX8A 1PAMA 2JEQA 1BLIA 2QMJA 3K46A 1LWHA 1QBBA 3I3EA 4NX0A 4TXEA 4URIA 1GQJA 2XM2A 3WF4A 1BPLB 4AXNA 2V3DA 3H53A 4MNLA 4X0NA 1GOKA 1ZJBA 5BCAA 3WFZA 4U2YA 2XFRA 4F9JA 4UQDA 1PIFA 3AROA 2WZEA 3ZSSA 4D6GA 4JZ5A 1VAHA 2VCCA 3UETA 2DSVA 3CZEA 4BZYA 3BLKA 3BMWA 3IGUA 1E43A 2VZSA 1WCGA 1R47A 1IT0A 1TA3B 1CGXA 1E1FA 3WL0A 1VBRA 2F8QA 3HZ3A 1OM0A 1KFWA 1V0LA 1US3A 1WE5A 4FNPA 2GSJA 1CYGA 3DDFA 3IAQA 1GORA 2G4FA 2YJQA 1F4AA 1JYVA 1UH4A 2QF8A 1JZ8A 1FP9A 4H04A 4GINA 2WHJA 3AJ7A 1WDQA 2E9BA 3AI0A 2YFNA 1E5JA 2O9OA 1W3LA 3MU7A 4BS0A 2DGAA 2VURA 4ACYA 1JYXA 4JFWA 4UCFA 2D3NA 3VGEA 4LX4A 3N13A 1UYQA 1MW1A 3SURA 1TVPA 1UR0A 1JDDA 3BUBA 1SFSA 1C8QA 4UQEA 2V3GA 1E6ZA 2EBNA 1HJUA 1FH8A 1PX8A 1V6XA 2J25A 1LJYA 4AZGA 3ZR6A 5CPQA 5M03A 3OLEA 1ODUA 5FCZA 3L4WA 1XSJA 1Q6EA 4TVUA 2XN2A 3BSHA 3ZQ9A 2Y4SA 2HISA 4JCLA 5AC4A 5BXTA 4BQ5A 3WF0A 5IDIA 2WLYA 4ATWA 3BUQA 2Y8KA 4DWSB 4EAMA 4AMCA 1HXKA 4RE3A 4R27A 3BAJA 5EBAA 3AIBA 2J77A 2YA2A 3SUTA 4J7RA 4ZFMA 4P8UA 1TQUA 1HX0A 2FHBA 4ACZB 2D20A 2AOSA 1UKQA 5GNYA 4U31A 2GFTA 3II1A 1QOXA 1EHAA 2Y5EA 3BUIA 2WCAA 3LXAA 4CGTA 3B8SA 2CBUA 3T0BA 4NRSA 3VMPA 1W2VA 2IXVA 1ISVA 3AIWA 3HG5A 1MQRA 4FLQA 1HJXA 5CSUA 3THDA 1CLXA 5FL1A 2ZXQA 2J8GA 2XUCA 3PZ9A 5JIPA 1VB9A 3L4TA 3ZJ8A 1JXJA 1WZLA 3WNKA 4JHOA 4F66A 3VD4A 2WHMA 1B30A 5HPCA 3H55A 2O9TA 1V3KA 1R87A 3ARUA 3K4AA 4GZIA 1GQKA 3VIPA 3CZGA 1OSEA 4CVUA 1BAGA 2XIIA 3A21A 1PX4A 1PS3A 3KZSA 1LL7A 1R33A 4EKJA 2YL6A 5CQ1A 3BAWA 3GBEA 3AHTA 4H7VA 5IFPA 3SCRA 4UQAA 1PX3A 4OOZA 3AMKA 4P7LA 1J0ZA 1HN1A 1EQCA 1GJWA 4PUDA 4B3KA 3ZT6A 1KQZA 1BG9A 4YN5A 1QNRA 2WZIA 1B3VA 3BSGA 3VSVA 3F5KA 2W61A 3DC0A 5FKYA 4H8UA 4ZENA 5CJ5A 1M03A 3WN6A 1WZMA 2A3HA 2WHLA 8CGTA 2WMGA 2DQXA 1M53A 4W93A 1QI4A 1LF1A 1VFOA 4JCMA 3K1DA 3BVXA 3AZSA 3ZR5A 4V28A 3U57A 4UFLA 1M01A 4ZXOA 3BH4A 5IHRA 4AD1A 4FLOA 2YDRA 4WK9A 1RD6A 2J47A 2FH6A 3GH4A 4GPNA 2WCGA 1CXEA 1J11A 2WXDM 2CBVA 4PMZA 2XWEA 2GJRA 5AY7A 1CZ1A 1K9FA 1NOUA 2CNCA 1HVQA 5A8OA 2JE8A 1LWJA 1MXDA 4BQ3A 2WW5A 1C3FA 4LYQA 1QVBA 1FA2A 1FH7A 2WC3A 2VT0A 1QNOA 3VDCA 1OT1A 2X2JA 2X2IA 4KGLA 4W5UA 5E70A 2VR5A 3DDGA 1L0PA 4PMDA 4FLRA 4Q22A 5EMYA 1CGUA 4CD8A 3VD9A 2YA0A 4FNRA 2W67A 1FFQA 3VIHA 2VVNA 1E5NA 3BVUA 2EEXA 1B3YA 4UQ9A 3CHFA 5C8BB 4TTUA 4ZXLA 3EDDA 3WNNA 1V6UA 3T0AA 5A6BA 1V0KA 3WH7A 4GQQA 2WKLA 2VC9A 4CN4A 4W86A 2VZUA 2VCAA 3FY1A 3AHXA 1JZ7A 2F7OA 1W9UA 1CXIA 3FXYA 3VMNA 3WH5A 4Z2HA 1M7XA 2WVUA 5IHSA 3CHDA 1W9VA 4TOQA 4AC1X 4CCDA 1G0CA 5BRPA 2PWHA 2WMIB 5JIWA 1KTBA 1VENA 4KWUA 4MTVA 4DUVA 1H4PA 3MV01 1UWTA 2OYKA 4PTMA 2UY2A 3VGFA 1CBGA 4LYPA 1HL8A 1ZBWA 3EJPA 2DH2A 2YL9A 2E8ZA 1GJUA 1GW1A 4ATLA 4AD0A 2XVNA 3A4XA 5FIPA 2ZUWA 3SUSA 1E6NA 5A2AA 3ARQA 1LL6A 1MW2A 1E6PA 4KRTA 4M29A 3AXHA 3F5JA 3A4AA 4UOJA 1EDTA 1DWHM 4CD4A 3WBAA 5D9NA 4DM2A 2NSXA 1IZKA 1B3XA 3W29A 1V3HA 2ZUUA 4AZCA 4W87A 3ARSA 3GH5A 1HT6A 2ZUSA 3WEOA 3WD1A 1ISYA 4AIUA 5A2BA 1QI3A 3RCNA 3MANA 1JL8A 3OZPA 2JFEX 1QX1A 1TVNA 1R75A 2TAAA 5BXRA 4W8BA 2BY0A 2WZHA 3MMWA 5CSYA 2QHAA 3L4XA 1VFMA 5FL0A 3EJTA 4TVCA 3U5UA 4HA4A 4E2OA 3IJ7A 4MNJA 2D3LA 1UR2A 1QBAA 3WD4A 1VFUA 2W92A 2VL4A 4XUYA 3GDBA 3TV8A 4MDOA 3MUIA 3WQ8A 3AIVA 4AD3A 3AQUA 4GIAA 2ZOXA 1TE1A 2G3JA 4KH2A 4ZE4A 1E6SM 1J0IA 1E3ZA 3OA5A 3PBGA 4WSKA 4CD5A 5BRQA 2UY5A 5C71A 1DWFM 1F4HA 2RGMA 2BY1A 1GOWA 2J7BA 1E6RA 3KLKA 4F79A 5BXPA 1EQPA 5EFDA 1NQ6A 1BYAA 1E6QM 3HG4A 3UG3A 1UZ4A 2JIEA 1V3LA 5D4YA 3FAWA 1ITCA 4HMCA 4WF7A 3AOFA 3K4DA 5HNNA 4AW7A 2XPKA 3WY4A 2WMFA 5F7UA 4HU8A 1C91A 3WEMA 4ZE5A 1QNQA 2Y2WA 2G8ZA 3GXPA 3CGTA 3AIUA 2E8YA 3GXTA 4P7OA 4HZ6A 3QHMA 3S2CA 3CBWA 4WIWA 4IISA 2BY2A 1I1XA 1OD0A 1UQYA 1BYCA 3SCSA 5E6ZA 3EMZA 5A6JA 3QOKA 4IPNB 3FHQA 2EPNA 3ARXA 1UR4A 1AQHA 4FLSA 4EK7A 4AD5A 3HU7A 1JZ6A 1AMYA 1W32A 2WKGA 2PBOA 1V0NA 4JKKA 2YOCA 3FN9A 3EMCA 3UERA 1EHNA 1NOFA 3I3BA 3SIMA 2D2OA 1VRXA 2J62A 3BAIA 4J28A 3OB8A 1PZ3A 4CCEA 3CZKA 3WH6A 3BUDA 3S5ZA 4W5ZA 4PCTA 1D7FA 3RIKA 1UOKA 4OUEA 1WDRA 3PTKA 2CKSA 4HMDA 3PZGA 1O6IA 3WSUA 3ZJ7A 4GI8A 1TQWA 3FNDA 3OG2A 3CUIA 2J7EA 1OT2A 2PB1A 5M17A 3UR7A 2WMHA 3ZOAA 4M80A 1ZJAA 1GOMA 3A22A 4X0VA 4QDMA 2WHKA 4DWSC 3O6AA 5GQBA 1W9XA 2A3BA 1G1YA 3AMLA 2D0GA 4TTGA 2D73A 1R8LA 1CECA 1XH2A 3AS0A 3OZOA 3LXBA 4AZHA 2ZUNA 1GUVA 4D6FA 4XZWA 2X0HA 3IJ9A 4Z2LA 5A6MA 1JFXA 3ZT5A 1W3HA 1A47A 1XYFA 3WQ4A 4UOZA 3TOPA 3GNOA 4CUCA 3N04A 2QLYA 2J7DA 3VPLA 4WLCA 4C7FA 1JGIA 3ZO9A 2JF7A 3VGGA 3AIQA 2Z1KA 1UA3A 1H1NA 1FFRA 3EDEA 3NSMA 2FHCA 5JBFA 4AEEA 3WDPP 5C70A 2BHUA 4Q7NA 1JNDA 1G01A 2YKKA 2EXOA 1WNOA 4MJ4A 1JF6A 3N9KA 3PZQA 1XHGA 5I24A 1ZL1A 2WC4A 3EBVA 5A69A 4HA3A 1QI2A 3PZMA 2PF0A 1JZ4A 1UKSA 4PTVA 4PMQA 4WKAA 4B3LA 5LA1A 1GNXA 4PMXA 1HJVA 4MAVA 2OWCA 1E55A 4E8CA 3PZOA 4J3WA 1UWQA 4UFKA 1HWWA 2VMFA 4PMYA 2BHZA 3CZ8A 3AS1A 1ECEA 3I3DA 2UWFA 1DWGM 3MUY1 3K8LA 4HZ8A 3IANA 4NXKA 2GDUA 3WMSA 3W4RA 2WSKA 2DPEA 2IGTA 4A4AA 4E8DA 1NWRA 2W63A 3SUWA 3CHCA 4C7GA 5CGTA 4MB1A 2YL8A 4MAZA 1R86A 3CZLA 1DWIM 3WUFA 1QI5A 3EJRA 1XH1A 1SMDA 2ZWYA 4OGZA 4AY1A 5A6SA 1KGWA 1ZS2A 4RE2A 2G3MA 2JIWA 4U3AA 3L4ZA 4U5IA 1ZBVA 1GHSA 2VRKA 3PZIA 1KXHA 4AZ5A 3W6MA 4QCEA 1DP0A 4QCFA 2QPSA 2YDSA 4LGXA 4V2XA 2GK1B 1FOBA 3MSGA 3W6LA 3H54A 1MW3A 2CXGA 4D1IA 5JUVA 2OSXA 3CUGA 4XV0A 5A8MA 2J74A 2YL5A 5CLWA 2VZOA 3GBDA 5E6YA 1V3IA 2J8FA 4BF7A 1I75A 2ZX5A 1QWUA 1DWAM 4MPKA 3ZM8A 1E73M 4B9YA 5BROA 1JG9A 1GVIA 3TP4A 2VJXA 2WVSA 1HF6A 1MQPA 1HP4A 2F7PA 4CU7A 3F5LA 4PEEA 2ZICA 1U2YA 2X1IA 3UESA 4Y7EA 2DSKA 3EYPA 3AS3A 4H41A 3W0KA 1CXHA 1LLOA 3LPGA 2YIHA 2J7CA 4WJXA 3SCQA 1GQLA 1RP8A 3BC9A 3CPUA 1FHLA 1CNVA 1M04A 3MMDA 3IK2A 3CHEA 2A3CA 1QHPA 1NP0A 1CENA 1FP8A 3MSDA 3ARRA 2XVLA 2A3EA 3AFBA 5I5RA 2WBGA 1E4NA 3RPMA 1B2YA 1EA9C 4W8AA 1EGZA 3AYSA 2F1AA 2OW6A 1MXGA 4UFMA 1ZB5A 2FGZA 1JXKA 4HP5A 4D6HA 2YDQA 4ACZA 4M56A 3FHAA 4B16A 1V03A 1ISXA 4AWEA 3WD0A 1KWKA 3J7HA 1WZAA 1UUQA 2V5CA 4HOXA 5A8QA 2W91A 4DO5A 2XIBA 1OIFA 1XC6A 1NM9A 4NI3A 5A2CA 4JFTA 3W28A 1TQSA 3AISA 3RM9A 3KE0A 2AAAA 4FMVA 2VOTA 4CN1A 1CLVA 3WQWA 4F9DA 3N15A 4W7WA 3BCFA 1TQTA 1UWUA 1U33A 2IUZA 1BTCA 1EDQA 1BQCA 1JFHA 3A23A 4WKHA 5ABFB 3L2LA 1HIZA 2XN0A 2VX5A 5TD4A 4H8HA 3WELA 1HJSA 5ABFA 3ARZA 4CD6A 4MNMA 1BSIA 4PTXA 3ZJKA 2XWDA 3RMEA 3A47A 4JAWA 4FK9A 2WM0A 2J4GA 3POCA 1UR1A 3ARPA 2WVVA 3T09A 1K9DA 1UD3A 1R46A 4MB4A 1UKOA 3VIIA 3ZT7A 3QHOA 4W85A 2FH8A 1E40A 1G94A 2XHYA 1EO7A 2EPOA 4UZSA 1PIGA 3CUJA 3LRMA 3BLPX 1CGYA 1UG6A 5CXPA 2MANA 1CEOA 2D22A 1T0OA 2D1ZA 1X6LA 3GYCA 4M8UA 1E4IA 1JI1A 3TA9A 3A3HA 5D8WA 5DFAA 3RJXA 1UD4A 1VJSA 2PI6A 3NDYA 4PBGA 1KGUA 3AHVA 4W8LA 4HPGA 3ARVA 3CV5A 6A3HA 1K9EA 2PWEA 3EJUA 1W9BM 1HKIA 3A5VA 1XCWA 1JD7A 3RDKA 4FNUA 4TVDA 2C0HA 1LQ0A 1HKKA 2BFGA 4HMEA 1L8NA 4UR9A 3K8MA 1PJ9A 2C7FA 2E9MA 2EABA 5E9AA 1ISWA 2VO5A 2EADA 5D8ZA 2BY3A 4QAWA 1P6WA 3PZUA 5M5DA 2ZUMA 2CETA 5A1AA 4J3VA 3AMDA 1UD6A 4JFSA 3EJSA 5DO8A 5IFTA 2BVTA 1NWUA 2XSAA 1SMAA 3GXFA 1GONA 3AMCA 5JBEA 2VTFA 3VM7A 2EPKX 2XSBA 3T0DA 1UWSA 5E0CA 2W62A 2WB5A 3W81A 1W1TA 3HG3A 2XGIA 5LA0A 1JZ2A 4P8XA 4CVWA 3A4WA 2WVVB 4F8XA 1BVZA 4L4PA 4TX6A 3NSNA 4ZEPA 2OWXA 3WDRA 1LL4A 4UFJA 3LPPA 2GJXA 2W66A 1VEPA 1V02E 3D50A 4YPJA 3B9EA 4M82A 1D3CA 5CG0A 2XG9A 2ZXDA 4UOQA 3WKZA 3GNPA 4P8WA 3TTQA 2VUYA 1EOKA 3RM8A 3W26A 3VIGA 3KL5A 3VNYA 1XCXA 4PCSA 1B90A 4QLLA 3WNPA 1H41A 1W1VA 2VX6A 2F7RA 4OBRA 5GPRA 1W9PA 4LPCA 4N42A 1E71M 3AZTA 4OIFA 3VGBA 1C93A 1QW9A 4GO8A 3CMGA 5D9PA 3AHZA 3QR3A 2VI0A 1TCMA 2CEQA 3WY2A 2FYVA 1TQVA 4YHGA 1BGAA 3VSUA 3KL3A 4CU6A 3SUUA 1G5AA 3W38A 1HKMA 3T2OA 1UA7A 4D72A 1HL9A 1Q4NX 4GI9A 1N82A 2X2YA 1C7TA 3IAPA 1K6AA 3U5YA 2X09A 1KBKA 1JI2A 3ZJ6A 2D24A 2PWGA 4PMNA 1J9YA 2J78A 3SCUA 2F61A 3KEHA 3MKKA 3DX1A 1KGXA 1CIUA 2WSPA 2DT3A 3AIEA 3LXCA 3U7BA 3HJEA 2DEPA 4AYSA 1H0GA 2Y24A 3EDFA 4W84A 3BLBA 2WK2A 3SCPA 3S5YA 2XM1A 1UKTA 3W82A 1OIMA 4OBSA 4XZBA 4GO9A 3MUAA 4AZCB 1KB3A 3LPFA 3M6DA 1XYZA 1H2JA 1UWIA 2ESCA 4CCCA 5DT7A 2WYSA 1U30A 3BVVA 3PTQA 3VIKA 3VSTA 1JD9A 4DO6A 3APGA 1W2PA 3SEPA 3VILA 1J0KA 1NWSA 3N1AA 1V3MA 1FHDA 1HVXA 3LRKA 1QI0A 5CPTA 4WSJA 4PMOA 1A3HA 4HU0A 3GTNA 3N17A 3DHPA 4PSRA 4H2CA 2BXYA 1E0WA 3WDHA 3WIJA 4AISA 4PUEA 1J0YA 1W91A 3VX1A 3N12A 2VQUA 2E3ZA 5CGMA 2B31A 1V02A 3MV11 5I77A 2OLHA 2QV4A 3VUPA 5FD0A 3NUKA 2QMKA 3WMBA 2D0HA 4UFIA 2X0YA 1W3JA 4R5EA 1QHOA 3B9DA 3U7VA 3WUGA 2BS9A 5BXSA 4M81A 4LYRA 3WNOA 3AS2A 1JAEA 1C92A 2FGLA 3HG2A 4P7RA 1SZNA 1BYDA 1KQYA 3ECQA 5EFFA 2X8RA 4IUGA 3WL1A 3GXNA 4HOWA 1LG2A 3CO4A 1NOWA 5HBFA 5I0DA 4K68A 4J27A 1TUXA 1NP2A 3LX9A 1SR0A 4FNQA 1C8XA 1BF2A 4LQ1A 5BWFA 1ESWA 1J18A 1XSIA 4J3XA 3UEQA 4MB3A 3K8KA 2ZX6A 3VIOA 1OBAA 3UG4A 1V08A 1MW0A 3WQ6A 3BAXA 3VGDA 1TG7A 4S3JA 2PWDA 3W27A 1R34A 2J7FA 1R7OA 1R7AA 2WBKA 3WFLA 1CXLA 4AMWA 1GVYA 1QWNA 1Z32X 4HTYA 1KXVA 4QLJA 3SCNA 1KCKA 3UG5A 2G3IA 1BGGA 4L4OA 2WWCA 1KXQA 2EJ1A 2RGLA 2V3FA 1OWQA 1ITXA 3HMCA 2OSWA 3AXIA 2GJPA 1TZ7A 1B3WA 2W5FA 3AIRA 4HA1A 3MO4A 2VZVA 4W7UA 5GNZA 2D23A 2PWFA 1O7DC 5I78A 5LA2A 3L4UA 3CLWA 2PBGA 3AXXA 2OSYA 3AZRA 5ABGA 1EOMA 3POHA 4JFUA 1FH9A 1TFVA 1NARA 7CGTA 1J0HA 1JNEA 3ZIZA 1Y7VA 5ABHA 5DF0A 3TONA 3DYPA 1AQMA 2CITA 4PYSA 4B9ZA 1E3XA 3RO8A 3DECA 2GUYA 1IV8A 1Q6DA 3CH9A 4A3YA 3W53A 1VBUA 2V3EA 1QNPA 1J10A 1I1WA 1V6WA 3VNZA 4P7NA 2NT0A 1Q6CA 1W9DM 1YHTA 5BYWA 1E9LA 1VEOA 4U33A 4IPLA 1BFNA 2G41A 1WB0A 3CZJA 2DSWA 2CYGA 2WNWA 4W7VA 4GXPA 3FAXA 2YA1A 1JYNA 2OYMA 2EACA 2ZIDA 1H09A 3D51A 2OWWA 3BCDA 3VIFA 1V0MA 3THCA 2DIJA 1KCLA 3VMOA 4AZBA 1CXKA 1E6XM 5HPOA 4NRRA 3WUEA 5A6AA 4KRUA 3UCQA 4M24A 3N18A 3WDQA 3CMJA 2HVMA 4UNIA 1KBBA 3ZSTA 4MADA 3VTRA 1RPKA 3OLGA 3G6LA 1JAKA 4P8VA 1ISZA 3ALGA 1KR1A 3BAKA 5D9OA 4AYGA 1YQ2A 2OW7A 4D6IA 4MB5A 1H49A 1UR8A 2O92A 3HN3A 3WF1A 1H3GA 2E9LA 1WO2A 1VJZA 5LYRA 1PBGA 3OGSA 2BXZA 4IM4A 1C8YA 1UZ1A 1WDPA 3EMQA 2DIEA 3WUBA 3WD2A 1VFFA 4J3SA 5DMYA 2ZE0A 4U2ZA 2FHFA 1OGGA 3VKKA 2WMIA 1QPKA 5E0FA 3AYRA 4JKMA 3OLDA 1HKJA 3D3AA 4UQBA 1V6VA 1VIWA 1H5VA 1EIBA 3GXIA 2ZUVA 1NWTA 2E40A 1B0IA 4JIEA 2CERA 3RJYA 2GK1A 2J79A 4MNKA 4CD7A 4JL2A 4TUFA 1UR9A 2DSUA 3E1F1 2XYLA 2PC8A 4P7QA 1E4MM 2J7GA 2F7QA 3T2QA 1J0JA 1KR0A 3BXWA 4RE4A 2XVPA 3NCOA 1EXPA 1B1YA 2CHNA 3FW6A 1JZ5A 4PMRA 4DM1A 2WANA 3WY3A 3DX0A 2ZXBA 1GCYA 3PZNA 3VM5A 3WQVA 1HNYA 5A6BD 3BVWA 5E09A 4LXFA 4DO4A 1LG1A 1HJQA 8A3HA 4W88A 9CGTA 1TMQA 4Z2GA 2V38A 2DT0A 1B3ZA 4S3KA 2WLZA 3TTOA 3W25A 4NSBA 4D71A 2BVYA 3GH7A 4H8VA 2YLLA 4FNSA 2J75A 2EQDA 4QFUA 2UY3A 5I23A 3G6MA 1MFUA 1EH9A 5I6SA 4OJYA 2CIPA 3M7SA 2O9RA 4GKLA 1MFVA 3VD3A 1OINA 3PZVA 2VCBA 5M3WA 5EB8A 3GXDA 2CCRA 3WNLA 6CGTA 3N11A 3KL0A 1GOIA 3A24A 4QP0A 1KXTA 2C8NA 2UY4A 1OD8A 1CGWA 5I3DA 3WMCA 4HZ7A 1PPIA 3ARYA 2WMKA 2JEPA 5A8PA 3PZTA 3T08A 4PRWA 3WD3A 2VVSA 1XSKA 3ZMRA 1GOOA 2WC7A 3GNRA 1C7SA 3M07A 2A3AA 1UH3A 2ZX7A 1CPUA 1E72M 2Q8XA 3EDKA 3W37A 3LMYA 2VZTA 1CXFA 4HOZA 1QNSA 4NZJA 1E70M 2JALA 1K9TA 1WKYA 2X2HA 3SCWA 4NZCA 1D2KA 3DYMA 3GXMA 4JL1A 3M46A 1WAWA 1B9ZA 1WZKA 2QPUA 1TR1A 2V5DA 2WPGA 4AIEA 2XFYA 3VD5A 2FDMA 4MJ2A 2WWDA 3BMVA 3D4YA 5A6LA 4BCEA 4UQCA 4X9YA 4PN2A 1Q6FA 5KZ6A 3BGAA 4PTWA 2O9PA 1DHKA 2E0PA 4Z2KA 2CBIA 5CLTA 1XV8A 3WDJA 4D6DA 3WY1A 2OYLA 2W4XA 4CN6A 4ATDA 4D6JA 4NZFA 1EO5A 3PHAA 4XX6A 5HXMA 5KEZA 4JFVA 2AMGA 1O7AA 4GZJA 2ZX8A 2BVDA 1BYBA 2J7HA 3VVGA 1WDSA 4D6CA 5A8NA 2VRQA 3OIHA 2ZUTA 1KWGA 1X6NA 2CBJA 3DYOA 1B31A 2WAGA 2GJXB 1WPCA 1W3KA 1E0XA 3D52A 2GDVA 4ML4A 1OB0A 1C90A 1JDAA 3MI6A 3GM8A 3SUVA 3WF2A 3A6OA 3CUFA 3DX4A 5CZKA 3PN8A 2VR4A 1GOQA 4FNTA 1MYRA 3EJQA 1GZJA 2JF6A 3CZSA 2CKRA 1H0IA 3BUPA 3CUHA 3RM4A 1UD8A 1TA3A 3NDZA 1E0VA 4OOUA 1E15A 4PMUA 1CGVA 3NIYA 2XN1A 3KLLA 1W1PA 2DT1A 3WDIA 3VO0A 3CTTA 4AD2A 3QHNA 3VDHA 2Z1SA 4KGJA 2X05A 2F1BA 2Y8VA 4JHZA 4HPHA 2XGBA 1ZBCA 1ODZA 4W89A 3QGVA 1CTNA 3QOMA 5GNXA 1ZU8A 4RL3A 4BQ2A 2YFOA 3MS8A 4NF7A 4DUWA 1UD2A 2XFFA 1E1EA 2NW0A 3B9AA 2ZXAA 7TAAA 2GVYA 3UR8A 1V6YA 2DH3A 1JIBA 1XD0A 3ALFA 1HXJA 3VDBA 2XVKA 3TTYA 4WKFA 4BQ4A 2CESA 4FF5A 3D4ZA 2DDXA 2G3NA 1MWOA 1J12A 3CC1A 4N0RA 5FOOA 1UQZA 3DX2A 3NSXA 4AIOA 7A3HA 3NYDA 2D0FA 1JZ3A 5DT5A 3WH8A 2EO7A 1R85A 1ZBKA 3O9NA 1US2A 3AHYA 4UFHA 2F18A 2FE0A 4JKLA 3VIJA 3AICA 2E4TA 2IXUA 5JBDA 3OLIA 3KWXA 1OGBA 1IZJA 3VX0A 3IJ8A 1UD5A 3DHUA 3OGRA 1DWJM 1AQ0A 1HP5A 4J3TA 4AMXA 1WP6A 5A3HA 3CIVA 3ARWA 5DEZA 4M1RA 4QLKA 3WBEA 1AVAA 3OBAA 5A95A 3T2PA 1JDCA 3AMGA 2WVTA 2VRJA 2F2HA 3RILA 2XVGA 3JUGA 4D1JA 1BVNP
chains in the Genus database with same CATH superfamily
1V93A 5JHLH 2XFXB 1IAMA 3FN0L 2R23A 7FABH 5IJDC 1PNCA 2AV7A 5JLZA 1B9BA 4Q8NA 3VIMA 2AABL 3LKSB 2WXRA 4U1IA 4FG4A 4YSSA 1E56A 4PLKD 2FGWL 3FB8A 3EDJA 4X98B 1VZGA 4GYKA 2L7EA 4JRXD 2BC4B 4YHEA 3UC2A 1DQDH 1T4KA 3JV4A 3SKOA 4AGMA 3NURA 4IPPA 1ACYL 4XO6A 3OGVA 3V4VB 4MKMA 3FT2B 3FT0A 2BHYA 1T66C 4ZW7A 4E9QA 1SJAA 3UC0L 4Z7VA 1MEIA 2JKRM 5E7FA 4J3OD 2GG1A 3KD4A 1Y6MR 1JF5A 4TLTA 3RGHA 5HD8C 4N9EA 4HN8A 4BJLA 1JBJA 4NQCD 1G9MC 2UY7A 1SF3A 3ILPA 4JG1L 4QRUA 5C0AB 4MDJA 5DXWA 2JTYA 3SQRA 1G0YR 2PF6A 3PBMA 3WH9A 2R7EB 2H0EA 4G70B 2FAUA 1U1UA 1KTRL 2VX4A 1E6JL 1YEEL 2P1YA 4UZUA 2OGJA 2QQKH 3P30H 4WQOA 2X1QA 1PZ2A 2J9XA 5A94A 4FXSA 3ARGD 5ECUA 3SBRA 4KCWA 1H3TA 4OGYL 2PYED 4KDTA 1UURA 3L3IA 3ERXA 1XUUA 4B90A 2VX7A 4Q7IA 1DTUA 4KRNA 3UF9A 1MCJA 3GG7A 4Q6YA 2UY7B 3ILPB 4FFVC 2R56L 4JEGB 4KQNA 1IT9H 4AZ7A 2FBOJ 3T8VA 3WEZA 1HH6B 3C6SA 4YTUA 4P99A 4P4KA 3MRQA 5CCZA 1W0VB 3MRJB 1I8AA 3MU3A 3LKNB 4Y8FA 5I2UA 1AY1L 1M7IA 1QW8A 4LNYA 4UTFA 3BVDB 1NAMA 5ID1B 2W9EH 3O2LA 5AKTA 1RKRA 1VZWA 1KIPB 2UZYB 3WNMA 4J2XA 4YSCA 3G5VA 3KPRD 5E1IA 1XR9B 3VGHA 1RURL 3NCEB 2HFGL 4G6JH 4L0PB 4HJEA 3CH8A 4LDOB 4Q6JA 4N8VG 3AAZB 1I3GL 1Y5XA 3MKCA 3D06A 5AYIA 1B4RA 3QO1A 3ZDWA 1XIIA 1VGEH 3MUZ1 1UADC 2OXHA 2P48B 1T04A 1MCOL 1SYTA 3FYPA 3ZYIA 4QKTA 3JTBA 1ZVYA 1FZMA 3DUUB 4D9QD 4QXWA 1FZKA 4UNTA 1UWRA 4GUPB 2UYLB 3VOCA 2WUCL 4HF5H 3QZ6A 2X6CA 3HI6L 1YECL 4UT9A 2VEFA 2E47A 3HJZA 3M0IA 4D6EA 1U8QA 3VCRA 2E5BA 3D5HA 2O4EA 4DGYL 1WQVT 2ZX9A 3IIXA 3KNBB 1WX0A 4DRSA 1XF2A 4HIJB 3MCKA 1TZ9A 5AW8B 5ABEA 4JE4B 4E5XA 3L68A 4IPJA 4N2NA 3WFEL 2K6WA 4G9FA 4WTZG 1XLBA 1M42A 4YLQT 2F8VA 1C5BL 5ACZB 4JQ3A 2B7DT 3CQFA 4YHOL 5EULV 3QJRB 1B0GA 1MQQA 4LUYA 4TUUA 3P81A 4PHZA 2W94A 5LBSH 4BBWA 1UASA 5EO9B 1UVQB 1DBBH 3FUMA 4X4KA 2Q8AL 4M0XA 2VDRB 2PW1B 4IMLA 4Q8TA 1EV2E 3AT0A 5JHDE 1A9EA 3NOYA 1DLHB 1ZHBB 4O51B 1NUFA 2NXYD 2B9BA 1V4YA 3AQZA 2G9HB 5D55A 4DP8X 5I8KH 4XZMX 3GK8L 4W9ZA 5FYJD 2DQUH 1WXYA 5E0QA 2CPUA 3MYJB 5AVTB 1JYWA 3TBBA 2HT3D 1O7DE 2HVKB 2AXHA 3L5WB 4XVJH 4KY1L 4GYJA 2XWJB 1GC1C 3WEBA 2O6DA 1EIXA 5IKCB 4Z76B 1H6FA 3WS6C 3L4YA 4KFNA 1FG9C 2D7MA 4JDZB 2VDPB 1RP9A 2IMNA 3OJMB 2Q8ZA 2EYRB 3ZDXB 5IXEA 4J3UA 1MFMA 2BCKA 1MAKA 5IIEA 4O28A 3VXOA 3KPQA 3PREA 1MNUL 1HFUA 1GHRA 2RH0A 1QJWA 3QIWC 3RRQA 1NCBL 4G9PA 3MRKB 5D1ZD 3NQBA 4EEEA 2VNCA 3HHSB 3KGTA 5EIIB 3ARTA 3WL9A 5K39B 1IEBB 5A7EA 1LP6A 2Y63A 5I79A 1ZHLB 2A0LD 1Z0NA 3DPDA 3OC8A 4P9HC 3UPRB 2WKOF 3T0WA 3DRQB 2BWIA 4J3OF 4I9TA 1Z3RA 4L9YA 4LAOA 4JFED 1WAEA 1TPUA 3D3VA 1PLGH 5T5NF 3U2JA 4Y4HD 1S2VA 4GH1A 1QP1A 2YAHA 3NG3A 1FHNA 2QHRH 3CK0H 3TEUA 1GS6X 3MJ9A 1UJ3B 4LEXH 1HL2A 2BOFX 3QMTA 1GCFA 3B2MA 1QFUH 5FKAB 3SO3B 3RCYA 1TIUA 3O45A 5IW6B 1RPQA 3LI1A 4FCHA 4URIA 2VFHA 1BBDH 2ED7A 4K73A 4MYAA 4IRSC 4A37A 3SB0A 3TWBA 3NQMA 1DVSA 2UZXA 3TBSA 1GOKA 3ESUF 3U1PA 5CILH 4JQVC 1UGKA 1KFKA 3AG1B 1EWHA 3BVNB 3LN4B 4L9LB 3AM8C 2BCKB 1PQZA 5C0AE 1Z41A 3RUGB 2I69A 2XFRA 3TO4C 1MFDL 3QT2A 1GGCH 4XCNB 4ZQCA 1UENA 3LHPL 2C7UB 4MMZB 2V17L 2EDLA 3O4OB 1TPFA 4WXYA 5DY2A 3VDGA 1LD9B 1NIFA 3WQDA 4PJFB 2ROXA 3DXAA 2XTLA 2DSVA 1E4XL 1NFPA 3IGUA 3ES7A 4XKYB 1BTMA 4TTDC 4KVCL 2ZADA 5DZJA 1G9ML 2LTQB 5CEZH 1IT0A 2Z4QA 4FEZA 3FFCA 3NH7L 1AL8A 5KTEH 1SSDA 3VE7A 4WDXA 2R1LA 3RJQB 1S9KC 5IRPA 3RWDA 3WLWD 1VBRA 3HZVA 3VI2A 5K59E 5JW3L 3RY6C 4KKLC 2COQA 1YE6A 1NCIA 2X4OA 5C6PB 1MHEB 3CWGA 4OIIL 4FNPA 2X7LA 1OAKH 3DDFA 3AU1A 1C5DB 1CI3M 1GORA 1GZPB 2YJQA 3LMJH 4GSXA 1QOKA 4N2EA 4PG9A 1JNNL 1SFJA 4MNGE 1UH4A 5JIDA 5HNUA 2YSWA 1PZ5B 1FP9A 4H04A 4XBSA 2YK1L 1OFRA 3QV8A 1IEQA 4GINA 1L0YA 1R24B 4HUXB 2WHJA 3TYUA 4IMDA 4HXBL 3RWEA 3FH7A 1WDQA 3DX5A 4K7VA 1FN4B 2E9BA 2YFNA 3AI0A 3FQYA 3L7EB 4MJ5A 5CEWA 4MLJA 2K1MA 2OQJA 1G6RL 3CV7A 2WAQA 4RMTA 4BRVA 4K7PX 1RY7B 1D2PA 3UYIA 4HJ0C 1CL7L 4OCWL 4BS0A 4JG1H 4HZLA 4QAMB 5C0RL 1LT8A 2V4LA 3DSFL 3E6HB 3CZFA 4FQLH 4F9LC 4ACYA 4AVHA 3XIMA 1ZHKA 2ZWLT 4HV8B 3ZL4L 2A2IA 6ALDA 4YLCA 5DRNB 5HYJA 5KVEH 1KXQE 3FYOA 1ETB1 1FXPA 4X5PA 4MNQD 1N3NB 4R7XA 2WXHA 1ORSA 2CK2A 2EXYC 3FPYA 4QXTB 3SE3A 1UYQA 4YCPA 1BD0A 1ACXA 1MW1A 5BW6A 3F7RA 3AO0A 4RDVA 2CQVA 2EG6A 4UMBA 1H8LA 1NGPH 2BNUA 2KZHA 5AB0A 4G80A 4HJWA 4DBSA 3OSKA 4WKZA 3GMOA 4GRWF 3GSRA 4PTNA 3IUIA 4UQEA 2DLTA 2V3GA 1ENUA 2QQ6A 1HJUA 3D34A 5AVUB 4C57C 1D7BA 1FH8A 1V6XA 2VOMA 3B9KD 3MPCA 3OJDA 3PR2A 4MXWH 4LCWE 4EIBA 1E8ZA 5BRZA 4PJAA 4UAOC 1WVZA 2OL3A 4FQJL 4DWHA 1QATA 2NDGA 1J96A 4ZSOE 3GDCA 3WSQH 2I56A 5K3VA 2EIDA 1ODUA 1CICA 3VNIA 1E7UA 2H32B 5FCZA 1Q6EA 3ABKB 4C55A 1I1AB 5DJ2B 4EOWL 3L3KA 3EWZA 2Y5QA 1T20B 5DFVC 2BVWA 1P9MC 3NA8A 2PP8A 4BQ5A 4HWBL 5CBJA 5DHXB 4DH2A 2JF1A 1JRBA 1R6WA 3BUQA 5XINA 2Y8KA 1NCHA 5CEZE 5H37G 1NFIB 2EHHA 2ZFAA 3S47A 1HXKA 2YUWA 5KBLA 4EPKA 4WWID 3WXVL 4POZD 4G7EA 4Z3HA 5IJCC 4M7LT 3BJ91 3HE7A 3AIBA 3WSQL 3QUZC 3CWOX 1W1IE 3HF3A 1HHIA 4QF1B 4ZFFA 4L56A 3RFAA 2HT2C 5EFIB 4BFOA 4F27A 4J7RA 3ULVD 1KELH 5FO9B 2EDXA 2YGPA 2BC4A 3VRJA 3BQUD 5HHQB 3FGCB 4H2HA 4ZFMA 1TQUA 1UROA 1YEKL 3O3AA 2V2HA 1A5MC 1G6VK 1CW2A 2OSLB 4KTDH 2WBJC 1UKQA 3BKYH 2W0PA 4ZUUA 1AANA 2QADB 3BZGA 1HEZA 4QRRE 2GFTA 3BIAX 4KZ0A 4NGHH 3SGJC 4AMKH 4G8EA 1U3HA 4LARH 3UTSD 2OZ0A 3FB7B 4EQ3A 2QGYA 1HE8A 3TZVC 2ISFA 3H9HB 3B8SA 1NLDH 3GHUA 4H20L 3T0BA 1O6SB 3CAFA 4Z7WE 1OCWH 5K59F 5BVJB 3VXRD 3VMPA 1NEUA 5HMDA 3LNGA 4F7EB 1KFCA 4GUCA 1F3JA 1TZ8A 4YXKH 4XZUB 4QBXA 4PJ8C 1NFDA 3AIWA 5KJ4A 3KRBA 5SWZD 2VGIA 5EH1A 5C08B 1I9EA 5JPNA 5L2KD 4ICXA 4ZXBD 5EB9A 5GZOD 2KKQA 1O5DT 3UPRA 3D0VA 4XCYA 1U8CA 1WWWX 3N42B 3ZE2E 1AUSL 1OP5K 1F3XA 4F57H 1XQ4A 2YYUA 4QNEA 1ZHKB 4L29B 4DOHE 4HU3A 4HK5A 4LOUC 4ZSTA 4IKKA 2CU0A 3GC5A 2DJSA 5TQ2L 5FO7A 3W11D 1JEZA 2XUCA 1W16A 5JIPA 3PZ9A 4BKNA 1VB9A 1BRLA 4QRPB 3ZJ8A 7PTDA 4YHLL 3WNKA 4GXFA 4XH2A 1J05A 4UM9D 1RIVH 2IBBA 5DJYA 1B30A 1EEPA 1EZWA 1F8MA 3FF7A 1OARH 3TN0D 4IJCA 3H55A 3U46A 2GPTA 2PWVA 3LRHA 3TFKD 5FAJA 3KVQA 4OGQC 5JW4Q 2HWZH 2JJUA 1V3KA 1OFBA 1T1WA 1V51A 3L1OL 4LASH 1GQKA 4GZIA 4FE9A 1BGXL 1OSEA 2AC0A 1OZTG 1JZFA 4P8XA 2GUUA 3VQ2C 1GG1A 2IOMA 5E2WL 3ABXA 3DERA 2C9SA 4RRPM 4E9WA 3ZTDC 1A4MA 4S0HA 3IACA 2A4AA 1U91A 1NGXB 3KDPB 1S3KH 2VLRD 1R5IB 3TNMA 3ZYZA 3L3GB 3VH8G 5K9QG 4JHWL 3B0XA 1E9ZB 2ADIB 2P80D 1TB3A 4GRWE 3U9UB 4NM8H 2JV6A 1TZGH 43CAA 1Z89A 1TFPA 1F8TH 4N25A 1OE3A 1YEFL 4QGCA 4LSBA 3MNWA 4O2FB 4CBPA 3SPIA 3QZBA 3U1QA 3TZVB 1Q6RA 2ZE3A 4GFIA 4RNIA 3UTOA 3PBYA 2XWTA 3T0XA 1FFOA 3B8TA 4DJFC 3KPNA 4PBXA 4MG4A 3PUOA 1HN1A 4FZIA 1G67A 3N44B 1PKQB 3ZLHA 1GJWA 2FZMA 1WDDA 2LVEA 1HHHA 2DTML 1IFRA 2X0VA 4JDEA 5INCB 2Y06H 2F5AL 1CDJA 1KV7A 1QEWB 1J88A 1XGUB 3BSGA 1ZEAL 3PUCA 3DC0A 4LFHD 4H8UA 4TNWK 3V5HA 4GRMB 4AQEA 5CJ5A 1NCTA 1AD0A 3L7RA 3P3BA 3ZWTA 5C55A 1P48A 1JK8A 2Y3NA 3ARBA 2BODX 4UXDA 2ZKMX 4W93A 5EN2A 4JN8A 5IM7B 4BSWA 4Y5VB 1RFDH 1G7LA 4WK0B 3DI0A 2NLIA 3CFJA 4D7PA 1YNLL 1ZT1A 4ODHL 4WW2F 4ZAKC 3O8AA 2XA3A 3MRHB 4C6PA 5F89B 1UFUA 2L4OA 4KMTH 3D9AL 5EMLA 1F1GA 4PCYA 1LE5A 4IGHA 3KPMB 4AUJA 3AZSA 3D3VB 5IUCA 3OG3A 4AB4A 2VN7A 4PVMA 2F5AH 5ELIA 5IMOA 2GFBB 3T2LA 3CVHL 1MIML 4GEJA 2VFFA 4XTDA 4NRZA 1NFBA 3U2IA 3PHQA 3JWNE 1Z5LB 3M1BB 1NKGA 1M01A 1EJOL 1OK8A 5IHRA 1ILSA 2YDRA 4O2CA 4N0YH 1V5XA 3G04B 1RSFA 1QR1A 3LOTA 5IOPB 2JKWA 3O3UN 1KG0B 5EEWA 3SO5A 5D32A 1FHVA 1B4LA 1MWAH 2OZ4L 1HJBC 1P6CA 2WLLA 4OT1L 4KTGA 2CBVA 2OFJA 2D4FA 3A12A 1CZ1A 1K9FA 1NOUA 2C1GA 4KRPD 4YL9A 1FL3B 2QZRA 3EWDA 4DF0A 4NUGL 4GC4A 4FFYA 2Y6SD 2RDWA 3MVTA 1LWJA 4A8NA 3WIIH 4PV8B 3HMXA 4LYQA 2IWFA 2PCQA 2X7WA 5C0AA 2VDKL 1BQHG 5A5WA 4PW4A 1B4KA 3M5XA 5E9XA 1XH3A 3FO1A 4Y5XB 4JMXA 1EUTA 1K8XA 3RPDA 1QNOA 4XVUD 1EFQA 3R1GH 4X6DB 4ZMTA 5I1CL 1Z5YD 4U4BA 1XPYA 2OQHA 3R79A 2YGYA 4YWSA 3PJSB 2VR5A 2Y23A 1R5WA 2CDGA 3CK5A 2YQGA 3DDGA 1CBVH 4N2YA 1EO8H 2MRYA 3RTLA 3UAJD 2IPKB 1HYSC 3V0SA 1L0PA 2EE0A 5TE7L 4FLRA 2G2NA 2O56A 2FUQA 2OX1A 1H7XA 2DUXA 3PXJA 4CC1A 4LSRH 4JQ2A 3EWCA 1Z8AA 1TTFA 1CGUA 4K8RD 2YAFA 4HWEL 4E5XB 3LQZA 3OX8A 1Z3GL 3SDXF 1A6TA 4GQ9H 2W67A 4I3SL 1WXJA 3SKNA 2VVNA 2ITCA 3N9GH 5B8CB 1AR1D 3DNKA 1JGLH 3R8BB 3DJSA 1TWIA 2XH7A 4YVVA 3IJHB 4ELKA 3PFMA 3F7YA 3UJJH 1MCEA 1DQJA 1R0AH 4FP1A 4PBEA 1CLYL 3TO2A 4YHMH 3MRCA 1E3FA 4ZA0A 4LDEB 4YDVA 1R3IL 2G30A 3RA7H 1RERA 5IJBC 3WNNA 1V6UA 3PWPA 5I6NA 3WH7A 4PJCF 4L1DA 3EIFA 4PJAF 3U1SH 1IGCH 4GIEA 3FT1A 2AKRB 4ODSL 5FF6A 4W86A 4F4RA 2CO3A 2FECI 2VZUA 4MNQA 4OLWH 3RIAF 4Z0XB 1JZ7A 3F62A 5EC1A 1YSOA 1WAPA 3EXTA 4S2CA 2J2ZB 3QORB 3QXDB 1GEQA 4PP1C 4HCFA 4WNQA 2VEKA 5DFVD 1OP9A 3E02A 2IQAA 3VNDA 1FWGC 4AL8C 3FXYA 2RR3A 4GQBA 4TYUA 2ESVE 3HAEB 3EWXA 4JKPH 5C07A 4ZFOL 1HO1A 3RLHA 1HEJC 1W9VA 1DVXA 3TW9A 2XKUA 4X5RA 3OQ8A 4OLVH 4UIOA 2WMIB 1ZSDA 3LJ3A 4G7RB 1KTBA 1QSVA 4FFWC 4TRPL 3T0TA 1MY5A 4NN5B 4URKA 5H35A 4YHPB 1ZSDB 3F1QA 2NZIA 4ODSH 4OLWL 1BWLA 1UWTA 2E28A 4HUCA 5L7XH 4PI0A 4PTMA 3R7QA 3MCNA 2I17A 2N4IA 5DD6A 4ZB5A 5D96B 2CLMA 1ZBWA 4LEFA 3HQNA 5FO8B 1DL7H 4OCLC 1FCQA 2PR4L 5C0NC 5I0ZA 2YL9A 3HIJA 1NMAH 4KETA 1N8IA 5L2JB 1NCAH 1ZXQA 1W0WA 3MRFA 2BWDA 5F6IC 2CXKA 1AGEB 4W9DC 3A4XA 5FIPA 3G6JA 1LWIA 4IJRA 4JY9A 4UTTC 1U5VA 3ZKXC 2HVBA 1H3WM 1KLFA 5A2AA 3OKDB 4NBYB 1CQKA 3OXRB 2R9HD 1MW2A 3AXHA 4GQPH 1JPTL 2AW2A 3KW8A 1DQJB 1E5CA 2TODA 1E9OB 3BIBX 4W70A 4UOJA 1EDTA 3LDVA 4JTRA 4CD4A 4B60A 4IRSA 1A3QA 2ZDRA 5B8CA 4WI3A 2QV5A 4GVFA 3GSXA 4QLRA 3LM7A 1HDMB 4MVAA 5D9NA 1IZKA 2EKGA 4HCDA 1P4BH 3ARGB 5DHVH 2R0LL 1AYRA 1V3HA 1HH9A 2ZUUA 4BQ8A 4W87A 3GH5A 3MOQA 1UB5B 2CPCA 3WEOA 3R0UA 3GSUA 3UGUA 1TX2A 1OQOA 1A6AB 2G5RA 4UT7L 3N34A 5HYIA 4M6OL 3RDTD 3O3DA 2R23B 4PW9A 3NESA 4FTVA 2BMKB 5ICYA 1YY8B 3QNFA 5JIHA 1JL8A 1XF4B 2GHWB 3L9EA 4FYSA 3ESVF 5T1LD 3OZPA 1QX1A 2XPYA 2P5WD 4IMEA 2NY4D 1TVNA 3BT0A 4CJ1A 1OVZA 5DD0L 1R75A 4I7VA 4WEVX 2TAAA 3MQTA 3VZXA 4Y4FD 4I5XA 3QJSB 4PJ8B 5BXRA 5BZXA 4M5YL 2H6PB 2BY0A 1CDCA 3MMWA 1GGIH 1WFMA 3NCYP 3H2EA 2QHAA 4K37A 4JQ4A 2PDYA 3J07A 4Z7NF 3PSWA 1D9EA 1U8JA 5JH2A 4TVCA 3U5UA 5BUGA 4UTBL 5GJTH 3IJ7A 3WKPA 1AKJA 3CPGA 4HS8L 4AIZB 3NPZB 5F9JA 2V68A 1YPIA 2EH7H 4KY2A 3T55A 1X5LA 2WCPA 1YNTA 4QR7A 2W92A 3QEUB 4YMPA 1M41A 2PYEE 4I18C 3IGLA 1WZ1H 3JSSA 4DZ5A 3GDBA 5F2MA 5ABTA 5D5MA 1NJ9A 1PDKA 1K8CA 5GIRA 5AHLA 5EA9A 3DETD 5DD0H 2J13A 3TCXA 2E25A 3WQ8A 4IS6B 5I16A 1RULL 1LLWA 5JUEL 4K1GA 5KS9B 3TCLA 3K1GA 2GFBA 5FUCE 4ZW6A 3IDNA 3WQEA 3C2EA 2B5IC 2VEIA 4A3QA 2V5YA 3WN5A 3BCJA 3OP2A 2VD9A 4KNQA 5D33A 3MX0B 4IIDA 1L6YA 4G1EB 3MGOA 4P9HH 1QK0A 1TUFA 1K4CA 3CUXA 3G0XA 1HYRC 1KRAC 1WBXA 4FYQA 5AYXA 1UXSA 5F2FA 4BCZA 4K3DL 4C90A 3OA5A 1F6FB 3PBGA 2DOCA 4BY3A 5EBMA 4OFVA 3GZKA 3DX8A 3KOWA 5JW4M 1QABA 3TN0A 3PWJB 4NHCL 5C71A 3TF7C 1MCCA 3DJ9A 4LCUB 1AZ1A 3HFTA 2YQ3A 3H6JA 3KJ6H 4J8RB 4JGJA 4PRPD 4R33A 4PRRA 5ACLA 2J7BA 3NQVA 3IJHA 3KCPB 5ISZE 1N6QL 1E6RA 1S7SA 4OT1H 4N2MA 4HH9A 1EQPA 4MD0B 1ZGDA 5EFDA 1RZIB 4JFZH 1BYAA 3HG4A 2JIEA 1V3LA 4NQUA 3H9SB 2VXTL 4MHHG 3L81A 4WF7A 1LZOA 4QS6A 1V5JA 3X3GL 3NR0A 2ESVB 4I5BA 3WY4A 2XZAL 4LUSA 3MLTA 5F7UA 1HGYA 2AEWA 4XNQA 4M8QA 4HU8A 4R5XA 5EEXA 3B06A 1VFAB 3LHYA 4HNTA 4XP4H 2I9LA 3VKJA 4WK2B 2WD0A 3MFFB 1CVSC 3S1WA 1S1PA 4LLUA 2PTYA 3T8QA 4Z3IA 2G8ZA 2WWMD 1S7WB 4GAGH 3AAMA 1Q0YL 2CLLA 5I1JH 5ENWA 2Z24A 5LBSL 1E9QA 4ZO7A 5DA0B 3Q5TA 1B4JH 5GHWL 3UCCA 2FJGA 3GXTA 4MZ8A 4I0PA 4ZFZB 5C0CD 1YPXA 4ENLA 1FL3A 1M57B 1OPOA 2QGCA 5E8NA 3OHXB 1A14H 1T1WB 3GMNA 4PS7A 1C16B 1OJXA 3L9RA 2V6AA 3CBWA 4RR4A 2BY2A 3FQNB 1OD0A 1UQYA 4ZUVA 1D9KA 3DC8A 3MCYA 4WSHA 4IPNB 3FHQA 3M8OH 4QI3A 2NOYA 1OK0A 3QA3B 2GY7B 4DIXA 5AB3A 3PWNA 2YO3A 3GZOA 4FLSA 2JKJA 5DEJA 3N6JA 1EJTC 3LLFA 4LSUH 4OUUB 3NO3A 4ADTA 3OC5A 5F9JB 5GRJH 4X7TB 1KM1A 1E5ZA 2G75A 4E9XA 3H3KA 5JHAA 3GDLA 1W37A 3AY2A 1DQLL 1NLDL 5DC2A 5ABZA 3H4HA 3GYEA 4S1SH 3CDYA 5FWQA 2XZ9A 3SY5A 2XKNA 3NQGA 3QUYA 2E56A 3P4OA 3KWVA 3DX7A 4N24A 1EZVX 1BQUA 2WQAA 5BRZE 3UERA 5JO5A 2XRAL 4XI5C 3RX5A 1KLGA 2B1AH 1KTJA 2YEZA 2CZEA 1QSZA 2Y3AA 2FO1A 1EJ7L 3M8OL 3IGHX 4FN0A 2D2OA 2F19H 3TN6A 4AWUA 4PBVC 3DKHA 4DP0X 1ZA3B 5EIIG 3TS8A 1KCVH 1NAKL 3OKNB 1U3HB 4PB0H 4Z78A 3O6FC 3WUWB 4W5ZA 4DNMA 5DI8B 3WLQA 1BZ9B 1CQYA 3QZEA 1BDYA 1GG0A 3B1UA 3VXPB 1MLBA 1ITUA 2YBVA 3AC0A 5LGJA 1LK3L 4HD9A 2X3CA 3AUOA 3V0HA 5I30L 3FK3A 3GNML 5LDSA 1WDRA 3NIGB 2ISVA 3BT2L 4L1WA 4M6NH 4XAPA 3WSUA 4W6XB 3CHVA 3ZJ7A 3KYMB 1TQWA 5F9OH 4WHTA 4B91A 4ORZC 1T7WA 4HPJA 3FU8A 3OG2A 1MHPH 2VW7A 2MCG1 1BA9A 3QY6A 4JFEA 2BSCA 4NN6C 3CUIA 2J7EA 4UTIA 5FACA 1MFBL 3QHZH 1KGIA 2WXIA 2G3XA 3LEVH 3ULUL 1NC4B 3PM6A 3U2EA 2IFFL 2EDNA 1HHKA 3BYTA 4WVXA 1HQ4B 4O53A 3QUMB 1ROCA 1KLFB 4LSQL 3UR7A 5JH1A 3TEVA 4RZCA 4NP9A 5HHMD 3SGZA 4Y1AE 2WXJA 3JVGC 3ZE1F 1QT1A 3WS3B 5KN5B 4KVCH 4HIIA 5BU6A 4BELD 1KIRB 5CUSL 4O0QA 4HOMA 3QFDA 3SCMD 3ZOAA 5DU7A 4PUUA 3DVNB 3SPVA 5C07D 1FWAC 5B1JA 4IGBC 5FGSA 2E5EA 3B43A 3EO1A 3ORJA 1XBRA 3JVAA 4X0VA 4LPTA 2LVCA 4QDMA 4N8CL 1HEHC 4PTTB 5DD6B 2DQWA 3SY6A 2P8PB 2AQNA 1TFHA 2H3DA 4D9PA 1AW1A 4YBQC 5C0CB 1NDTA 4WI6A 3W9EA 2Y7QB 4LF2A 4G7YH 3TN4A 3BEVB 3DGCR 4KRZA 3AMLA 1MRDH 4H8WH 3L95B 3OZKA 1FVPA 2H9AB 2YC1B 4EP8C 2C4XA 5CUSH 1QMLA 4MUPA 3DU0A 1N0XH 2X1XR 4NQEB 1KTLA 2VLME 4BQBA 3AS0A 3OZOA 4AQ1B 3VXTA 3R43A 1FVDB 4YTQA 1XL6A 3BW4A 2YR3A 1FYHB 2A83A 2ZUNA 3DFOA 4RDWA 4B4HA 1TQBB 5CGYD 5AW5B 1KJ2A 5IHZA 1GUVA 4D6FA 2XINA 2MCPL 4PJDB 4Z2LA 1EF3A 3FCBA 3CXDH 5EUOF 2FFCA 4ORIA 4PUNA 2AEOA 4WFGD 4NEHB 4FD0A 3QBTB 4GD0A 4M9PA 4OFPA 4L4VB 5J13B 1HQRA 2B08A 2QLYA 2Y9RT 3HNTH 4GSDH 1A4KA 1FG2B 3NWRA 4C7FA 1QSFE 2Y1HA 3PGFH 4GXUN 2Z31B 5FGBC 3ZO9A 1D9KC 3MUGA 2JF7A 3GMRB 4IDJH 1UA3A 1XGQA 1OAYH 1IIKA 1QFWI 2ILLA 1XGYH 1B6UA 4GO6B 3FSZA 7PAZA 1KBLA 1FFRA 1BPVA 5AVNA 4N0UA 1XIDA 4ZO8A 4PJ8D 2HBXA 3QRFM 3EOAB 2WB7A 5HR7A 3QIWD 1J48A 3VNMA 4AGQA 1WNOA 5LCVH 3TCTA 3UAAA 1ZL1A 4OJCA 2BHFA 1YNTF 3BOVA 4OIAA 5TE6L 1UPMB 3E0IA 3G8RA 4AHOA 3WFBH 4YVNA 5F6HJ 3WAJA 3P84A 3S96B 5GZNC 1QI2A 4GA8A 4HA3A 2AK4E 4Y4KA 1UKSA 3HE7B 4MJIE 4WUUD 4E9RA 3GNNA 4X2PA 5IB1B 2VDOL 3W7OA 2ZUYA 4MA8H 4AGLA 4Q97A 1W17A 1U8IB 5F1IB 4AIBA 3LCHA 4XXDB 5CCKL 1X96A 2PDIA 4WDTA 3QM3A 1J1OL 4LPYA 1U8IA 5F1IA 4R7WA 1HJVA 3WG7B 2WM1A 3MO1A 4QNPF 1TPXC 1MZZA 1P4UA 5DJAB 3QE5A 2HMIC 3OMNB 4E8CA 1DXEA 1JGUL 1LD9A 2GJ6D 1LE9A 2F53E 4J3WA 1JULA 4I18A 4H6KA 2OLSA 4JJHA 4S3FA 3C8KB 4EX4A 2BHZA 3DX6B 1YO4A 3B5HA 2FD6L 5TK4A 3AS1A 4EN3A 1EAPA 2WBXA 2F54D 3EJCA 3HB3C 3I3DA 1ECEA 1X1OA 2ESVD 4JG9A 4LOVA 4L9LA 1HC1A 3FZUC 4XX1E 3WMPA 4C58B 5BRZB 2VDOH 3QG6A 1SXZA 1Z3GH 4HZ8A 5T1LA 1ZXKA 1CF8H 3HS0C 3SD2A 1YXYA 3FJNA 4Y2OB 4N0FA 3PUDA 3H4FA 2OPJA 3RL1A 2ZXEB 2Z25A 5IROC 2J66A 2ICEB 3W1MA 3HC4H 3ZU8A 4A4AA 3MV8D 4QIRA 4XO4A 1CFQA 4MD4B 4JTTA 3SUWA 5D1XE 4HK3N 2DMGA 5C6TL 2FCBA 3ALWA 2MNUA 4C7GA 3E9UA 2O5XL 5EPDA 4F33A 2YD7A 4NGHL 4AMKL 1H7PA 4MAZA 2FD6H 3QF0A 3CZLA 3LDBB 4A6YH 3SOBH 1R3LB 4YHNB 3FIGA 5D5ME 3CUZA 2XYBA 1HE7A 3NSFA 1U6AL 3C6CA 3ITOA 4B4FA 1U8PB 1SMDA 2IPUG 1IF2A 4BE5A 1QEXA 3EBIA 2ZRWA 2IAMC 4AY1A 4RCXA 5A6SA 4NFDA 1RJLA 2HSIA 3S4TA 3MRNA 1FVDA 3S88L 1KM6A 3QQWA 3W9ZA 3L9CA 2J71A 2QF7A 3DFHA 2FWSA 1CURA 2D31B 2ATPB 3B3DA 3PZIA 2P3YA 3B6SA 1I8UA 4LAQH 1D5ZB 1Z9PA 2C9QA 1IJ9A 1F61A 2AKMA 4JS3A 4LNRB 5C0BD 4QCEA 4Y1AB 4ASTA 1FCCA 1N9PA 2QPSA 2Z31D 2YDSA 4GVHA 1FOBA 5GRVL 3WU1A 1A5AA 2C3VA 4RQQB 1MW3A 3GJFH 3V4UH 1HSAB 4UDTB 4D1IA 1PZBA 1N5AA 4Z7WA 1O4UA 3CUGA 5AB9A 2A9MH 1KB9J 4XV0A 4JQIA 3IPWA 3SN0A 4IJBA 2G9HA 2J74A 4QYOA 4EKXA 3MJ9L 2A21A 4LCYB 1C5DA 5CLWA 4KUCF 4PJGB 3V0EA 1LVEA 2F19L 2OTUA 3BFWA 3SPHA 3FJ6A 3KDNA 2BVEA 3CJPA 1I75A 3U0PA 2BP0B 2JKSA 2VSMB 3IVUA 3OR6A 1LTXA 4MPKA 1B0GB 4KEUA 4L9ZA 3WJWA 3JUZA 1RMFH 3N43B 1S5NA 1SHWA 1O1ZA 3QUMA 1F58L 1KXVC 2OMTB 2BNQD 2HRPH 3QJHA 1DDHB 3BPLB 2AGJL 4O02B 5HHNA 1S3KL 4ZODA 1RCXB 1WYIA 1ADSA 1HZHH 1JTTA 4NYUA 1MCSA 4QM1A 1H0DA 2ZICA 3BT2H 4NNYB 1P5UB 3VFGL 3UESA 2YBRB 2GSIB 3MJ9H 3P77B 4Y7EA 4PJBB 2IWKA 3AS3A 1TQJA 4ERAA 2IQDA 3QEGH 4IBVA 2YXWA 4I77L 3N4AA 4HK3J 4FS9A 5HDOA 5JXAL 1VFTA 1XIEA 2CA4A 3G24A 3TW7A 3EXJA 5E4EB 4DW2H 2PLKA 1SJVA 1SY6H 1RP8A 3MRNB 2EH8L 1Y1DA 2FB4L 4JN2B 4XAKE 5TDOA 5BZDA 1KCSL 3ZDZE 1UCTA 4ZCWA 3A13A 1MAJA 2YCLA 5T1KD 4XCFL 3A9BA 4LTSA 1J1XH 4XMKL 3SDDA 1L8PA 3UTPE 3PAZA 3QSKB 3FB6A 4JO3L 1FP8A 4Z77A 3N2OA 4MFEA 2OULB 2DFAA 1F56A 4IGSA 2BZDA 5JO5B 4M61A 4NC1C 5D6CB 1A5FH 5SWSE 1A6WL 1INDL 5F6IB 3PP3H 3AFBA 3UJTH 2ZBTA 4PZVA 4O16A 3P3SA 3QAZC 5T1MB 2RDUA 3RURA 4ADSA 3TLLA 1EGZA 4KNUA 4UTBH 2BZCA 4U1LA 4HS8H 1PSCA 1FSKB 1IEAB 2OO0A 5IQMA 3QPXL 1GPWA 4LUJA 2HSAA 4X7TA 1L4IA 1JXKA 4GY1A 3KJ4B 2MQ3A 2ZYFA 2WNKA 3INUL 4IH3A 2NNAB 3CH1B 1KN4H 4OLZH 2DMCA 2VCOA 1IAKB 4PG2C 5FLUA 5HJBA 1U83A 2B4CC 3H3PH 3E5BA 4Y6GA 3VKBA 3MNVB 3UDWC 4C6MA 3AJXA 1C5CH 4G7FA 4OM1L 4ZSOA 3C8HA 4B16A 2A0LC 2J7LA 3LBMA 1YKWA 3NCJH 4B2DA 1PVHA 3TBCA 1VBJA 4AWEA 5JVLA 2N3JA 2MCPH 2YPKA 4F91B 1K8ZA 1NEZB 2PDNA 5EEUA 4AX7A 5HQMA 4JHAL 2QPEB 4UINL 5E6SB 3L9BA 4ZUWA 3GIPA 4QIUA 2V5CA 4DAGL 3MV7B 2Z92B 1NA8A 5D38A 2YZ8A 2ZKWA 2YD6A 2BZ7A 5A8QA 2W91A 1OF2A 3B2XA 3PDDA 4G1NA 1ZDQA 3HZKB 3P73B 3GI8L 4I2XB 1ZJIA 5AKQA 4LLUB 4ZFGL 5DK3A 3V4VA 3AISA 4PJEA 3EJJX 3GRWL 4C4KT 1MRCL 3S2LA 1KCRH 1QLRA 3C5JA 4KQ3L 4JQ1A 3W1XA 4UTWC 5AZEH 1LGVA 3MRLB 2AAAA 1N0LB 2ZZ5A 4W6WB 4J5NA 3FEQA 4FMVA 2P8LB 3L0NA 4LZKA 4N1CA 3VA6A 2VOTA 3EOBB 4L1GA 4JRFA 4XP9L 2Q02A 2KERA 5I3GA 2UXFA 5F97E 1DJNA 1O95A 1MCHA 3APCA 2HVJB 5CBEA 5IB2A 1TPB1 2UBPC 4OVXA 4J3ZA 3D07A 1B0RA 3LEXA 4ZYKB 2GUOA 5LAPA 3PTDA 1JHKH 2NNCA 5ABFB 2UZIL 5K93A 3L2LA 3ITXA 4D6GA 3QAZB 3NCMA 2W61A 2ZC8A 3MRBA 4CD6A 4KO5A 4KDWA 1Q1PA 4HC1H 2XN9B 4DJFD 3BGFC 5CD3A 2CZDA 4O57A 3OM3B 5DFWH 3S2NA 2H8XA 4HPOL 1OCOB 2XWDA 4TQ8A 4PGDA 2FQDA 2HTLC 1Q0YH 3A47A 3KLDA 3TT1H 4GAYB 4JAWA 3P40A 5FSDC 1FLRL 5CHNA 2J4GA 2VDMH 5JIQA 2ODIA 3ABSA 3WG6A 3VXQB 3CC5A 4S3GA 2BX7A 3E6HA 9XIMA 3LH2H 3DVGA 3QIBB 1UKOA 1A5LC 5EU6A 2OMUA 1S5TA 1FFPB 3GGWB 4Y2LA 1E40A 3OR7A 4BFEA 2A74A 5I71C 5CG7A 2JKTM 5GXBB 2MPAL 5BQ7B 1GOGA 4WI0A 3VNJA 2APXA 1IBBA 1W1A1 2PE4A 1RPXA 1FCUA 3N91A 2CGRH 4ANKA 1RLCL 3UVAA 3UYOD 1MI5A 1CGYA 4BI6A 3JZEA 3SDOA 3ULAB 5TE4L 5CD5C 3EGJA 1S9VA 2WYZA 4ODTL 2JB6A 1BX2A 5ITBH 1DQLH 5A40E 4M93C 5LNVA 3L5XL 3BZFA 2BMBA 4K38A 1SHMA 4ZZ9A 2MANA 1E0TA 1CEOA 1XKJA 2D22A 5IVXE 4YDMA 3OVQA 1SNRA 3LM3A 1E4IA 2NVDA 2P3ZA 3HE7C 3TA9A 2WXMA 3STBA 5DFAA 3QRLA 4MY1A 1HOCA 2ITDA 1P2CA 3X2QB 3ZHNA 3RWHB 5C0BB 4AEOA 4PCPA 3IU3A 1JGEB 2KZBA 2NX5D 3L1FA 4Z7VB 2UWEE 5D7SH 3V2AR 4F2ME 1NCNA 3BWUF 5TE4H 3TMLA 2QGDA 5J5RA 2F54A 3EYVA 1MCPH 4TV3A 3BLDA 2V2TB 1UWYA 3W1TA 4F3FA 2C1PB 2WLKA 3RE0A 3V6FA 3PPCA 2PLJA 3FMGH 3V4UL 2XUWA 4KVPA 2XTSA 3T81A 4WFEE 3BDYH 5IG7B 5BS0B 3W56A 4IK6A 1YX1A 3K6IA 1UW9A 4FNUA 2TRSA 3RDKA 3FYIB 2C0HA 3TV3L 5D7LA 1KYDA 1CB4A 1OE1A 4KROB 2ZRYA 1I8JA 4WRHA 3QK0A 1DJGA 1HKKA 3C3UA 2EDMA 2BFGA 3OMAB 3PGCB 3MBDA 4Z0BL 2C1OB 3K8MA 4G72B 1V7ML 2EKSB 3QNZA 4U1MB 2C7FA 3B9OA 1MUJB 4MS8D 4DAIA 3IMWA 3EWBX 5EPMA 5E9AA 1H5YA 3DGBA 1N4XL 3RZCD 5KINA 3FCSA 2MFNA 2OCJA 3LDBC 1OAXH 1M9WA 2BGSA 5EBWA 3QPZA 5GZOA 1TYEB 3UGEA 4TVSa 3PGDB 5FJUA 1D5IL 4JFSA 3UZJA 3O8XB 3EYSL 2FATH 3C5SA 4M7LL 1PUDA 1VYPX 1NWUA 2UX7A 1KEMH 3GXFA 4R5VA 3HLAA 2FMNA 2QCLA 2DUAA 3AMCA 3KPQB 4KXAA 1LLZA 3HS0B 3S5LA 3VM7A 1V79A 3WHE0 5IQ7L 1UWSA 1U2CA 4L1BA 3BE7A 3O4LD 4G7YL 3MYOA 4NWTH 5JQ6L 2EH8H 1KENH 2XACC 1T80A 1F4YL 4NQQA 3LH8A 5DK2B 3W81A 1W1TA 5DEGB 1K70A 1VS1A 2GKIA 3F04A 3S3SA 2E6FA 3MYPA 3W1AA 5LA0A 1OGTB 1JZ2A 3DBSA 3BJFA 4HSNA 3H42L 1DUZB 4ZS7H 1GAFL 5JTWA 1EP2A 1AGBA 2NY0C 2J8UB 4M7KL 1RJYB 4JPVL 4UV4H 3CN4A 4YLBA 3HPLA 2XQYK 1BVZA 3CX2A 4F8XA 2QEZA 4OZIE 3U0WH 3ZY7A 4OD2A 3SBWC 1RQ5A 3FCUB 4CKVX 3ITLA 4GOSA 1V02E 4TSAL 4QG8A 1QBLL 1I82A 3DO4A 4TUOA 1UJQA 2FJKA 1S7VA 4JPIA 1I7TA 1D3CA 4GRWH 4U4IA 5CG0A 4AGPA 4YAQA 4L8CA 4AYBA 2ZXDA 3WFHA 5LSMA 2VDMB 3MBXL 2DN7A 4N6FA 4G8IA 4XMLH 3KUMA 4PODA 1KJMB 3ILQC 2VUYA 4N3UA 4TQPA 1O5RA 5IB2B 4GVIA 1NY1A 4JANA 2FWLB 4WIQA 5INDA 3LNMA 4XAZA 3C6LD 1JNJA 4K3HA 4J6RL 2YGVA 5AVQB 4BUQA 3CSBA 5HPMA 1C9WA 2ZPKH 1BVLB 3TVAA 4JTDA 2PS2A 3WIHH 1CR9L 2OS7A 4GUFA 3UAJA 1SUJA 2QVKA 3SJNA 2CALA 4QLLA 3WNPA 2BS8A 1W1VA 3N2TA 3RLSA 1FBAA 4XO5A 1MI5E 3KLAA 5B3NA 1W9PA 1Q72L 1AO7B 1UXSB 2YWYA 4XNBA 3V4PH 3CYJA 3VB9A 5REQB 1M2OA 4BI7A 2DQMA 2E9IA 4OIFA 3VGBA 4QNWA 5T91A 1HAWA 4GO8A 3CMGA 3E6FA 2IPTL 5CCKH 2B14A 3FTVA 4XNDA 5D9PA 2NY2B 3STZA 2VI0A 2DDQH 2PUQT 4PV8A 4LSPH 2GGIA 5D05A 4DGVL 4PJHB 2EDWA 3LSOB 1BGAA 1JWMB 5IBTH 3KL3A 3ZZ1A 3THQA 2YPKB 4MZ3A 1OCJA 3C60D 4I9WE 2YMTA 3VXNB 2LFEA 3T2OA 5I1JL 3W38A 3CO8A 2P5ED 2M1KA 1H6EA 5U4NA 3MA7B 4YK4C 4GI9A 1W6LA 1N82A 2X2YA 1T5KA 3D85D 5DQJA 4Q8QA 5GIRB 3IAPA 3NOIA 4OM0L 3GTVA 4LL9A 2IMMA 4DVBA 4CBZA 2NNAA 3CH1A 3H1ZA 1XCQB 2PWGA 2QKIA 4Y19A 3MA8A 1SPDA 3N50A 4PMNA 4UC5A 1L6GA 4NP4H 3HN8A 2F61A 2DDQL 5GS0D 5FI8A 1E9IA 3KEHA 3GDTA 5LVEA 4XB7A 1MH5A 5ICZA 4IBQA 5CJMA 1HILB 1XYCA 4GWEA 1KGXA 5GRUL 1XLDA 4PB4A 3F12A 2WSPA 5BOJA 1F2JA 3LTSA 4B6ZA 3LMZA 4L4TB 5LQBH 2IDCA 5TIMA 3P2TA 5IHUL 4GRSA 4DXXA 4AQ8A 1FH5H 5T5NG 3RGVC 4ZRGA 1YEDB 1EEXA 4ODWA 3F7PC 3DG6A 1BBJA 1KC5L 2WXKA 5CP3A 5EZOH 3T65B 3L7FA 4Y2DB 4LVBA 2NNXA 1HI6A 2XM1A 4LK4A 3NAAL 5M94B 3D2UA 1UKTA 4G8GE 5D7IE 2Y6ZA 3L3HA 2PCXA 4PP1D 4H4NA 5IG7A 3C60A 4OBSA 3NJKA 5L2KE 2YW3A 4GO9A 4AZCB 4XNXL 4NZ8A 3RRAA 1HHHB 4KKCC 2BVOB 3KR3H 1SFTA 4QTIH 3DI3B 3M6DA 1JZIA 4PJXB 4PV1C 1XXXA 3LN5A 3T9WA 5EWIL 4GW1A 4E41A 3D18A 4CCCA 3S8HA 2YBRA 2MH4A 4PUBH 1OFPA 3VOGA 1U30A 4Z3JA 5DS8B 4DK3A 3G1RA 4B3VA 1K8DB 4IX2A 2CKBA 2APSA 1VADB 1W2PA 1DUYB 1UP0A 4OZ4B 3KYOA 5EU7E 1WEJH 4YUEL 4AE0A 1TT6A 3N1AA 3OR6B 1AGEA 1V3MA 2EYTA 2Q86A 1QI0A 2WZAA 4UF7C 4PR5A 3MNMA 5D7SL 4HHWA 1Q94B 5DGRA 3ZE0E 4LQFL 3H2WA 2X42A 2WJZA 3DMMA 4LSQH 4HU0A 4LCYA 5T1DH 1I1FA 3PBWA 4M00A 3CTLA 1BXBA 3MJ6A 1A7NH 3NQDA 3DZ1A 4RBPK 3NIFE 2C14A 4LSVL 4D8PB 2DVUA 5B1KA 1ES0B 2J72A 1M6JA 4DJFA 3GJFB 3RU8L 3TC6A 4AISA 4R9HA 1ZANL 2H3XC 4FADA 1NSNH 1ZE3H 2QJJA 1ADDA 5F6HI 3VX1A 3TEWA 2Y5JA 2OMUB 2DI9A 1I2NA 3GG0A 1PYWA 2VQUA 5JHLA 4YXLL 4Q14A 4DERA 3F85A 2D31A 4CQ9A 4DJEA 4PJ6A 4XMPL 3E0LA 4IRJD 5HVHC 4NRYA 3MV11 5IVZB 5C0QA 3N1QC 1NCCH 2HZHA 5TDPA 4O5LH 2WTOA 1KOAA 3NN8B 5JORA 2JK5A 2D0HA 2FDBP 1F7BA 1U8CB 3W5MA 2Z27A 4RDZA 1H8NA 4R5EA 2AQSA 3B9DA 5LDUA 1XL9A 4RSVA 5BXSA 4QG6A 5DRIA 5DJXB 3QCVH 4KFMA 3WNOA 4Q0XL 1NFDB 1SVZA 3TJLA 4FQ1H 4OUIA 1TJMA 3IMSA 5E94B 4XN9A 3K2UH 1L7IL 1L9QA 2N1TE 3T8LA 3ZHLA 2DEWX 1Z9SA 2FGWH 5CBEB 3TC7A 3ECQA 3BOXA 4HALA 4KOCA 3RVWD 5EFFA 3UZVB 4IUGA 1EYWA 3GXNA 3CM4A 3CN2A 1CX9A 4L3ED 3CO4A 4E0RA 4NZ1A 1A21A 4QHMB 3UP6A 3KZPA 1KLUA 1Q8MA 4X4YA 2RD0A 4XPHL 2LFGA 5I0DA 4HN4A 3NACL 4XPTH 4K68A 4XO3A 4UV4L 2ENJA 3KHQA 2NUWA 2PLCA 5AHEA 4XSMA 5IHLB 2IAMD 3NJNA 1C8XA 1LOSA 4HAFA 3CLFL 4LQ1A 2J4WH 4Y9NA 1J18A 3VTMA 1ZLSL 4JHAH 4ICMA 4KPHH 1ZS8A 4K7YA 4PBFA 4J3XA 5MKGA 5GGSB 4NAEB 4RW5A 1TTJA 1N67A 1IUZA 1ZVNA 3TVMB 2W81C 1S8DA 4AZUA 1WOBA 3N2MA 4UNVA 4MB3A 3UR5A 4DBUA 3EGXA 3K8KA 1TO4A 4W9JC 1TSRA 1PG7X 3LZ3A 4MASA 2DQEH 3T77A 3DGDA 3GI8H 3UG4A 1V08A 1DANT 3FV9A 3P60A 4PYGA 3WQ6A 2GC7C 3BAXA 3VGDA 1TG7A 2DJ4A 3GTIA 2ZKHL 3AQDA 1W1B1 1ZTXH 2QSTA 3V9CA 1B3IA 2FB2A 1R34A 2J7FA 4J6RH 1QLEB 2V33A 5AOZA 1CICB 1R7AA 4M7ZC 1UUMA 3TZNA 2R0KL 2IIJA 3CLEH 1CXLA 5DSCA 2YPLA 1GVYA 2OKTA 2H2PC 4DP6X 2HK0A 4AG4H 1AGDA 1K77A 3NBNA 4J12A 4P4RB 2OEKA 2VP8A 2PAJA 2CKNA 3UG5A 1SMOA 3MBEA 3T0VA 1A1MA 1R3SA 2DW6A 3QHFH 4XB8A 1SXBA 3GMRA 3CAKA 2GK0B 1KXQA 4Q4KA 1KB5A 5GS1B 4GUJA 5D7IA 4PRHB 2RGLA 4L64A 2FTYA 4NQCB 2H26A 4F2EA 1OWQA 4WKZB 4PB9H 1R5VA 4E9VA 2A6KB 2B3RA 4JRYB 3NFPB 1NDMB 3SCMB 1SR9A 1ZQ5A 2VL5B 4Y1SA 4QHRA 4RUBA 4UB0H 3BZDA 5FCSH 2QGHA 4IICA 2DBLL 3CLEL 3MRPA 1BLNB 5J3HD 2A6LA 3AIRA 4WI8A 3HMXL 4D9RE 3G5EA 3M17B 3MOAH 4L0ZA 2GQ9A 3LGDA 3MO4A 3MZTA 5G4HC 3PABB 2D23A 1AQDB 4KKNA 5GNZA 4FSAA 2PWFA 3CYVA 5H4ZA 1O7DC 4HIBA 1P4IL 5LA2A 1O5QA 3TSMA 5LUMA 3MRDA 3E0WA 1TIMA 4OW6A 2PDFA 1Y0LB 2UUDK 3IDGA 4PAZA 4NDMB 2PBGA 1A5NC 3CMOH 1IQ8A 5L6YH 3I02B 1KV3A 3IDXH 5CFAA 1FP5A 2VLKB 3W1RA 4IXHA 4IIHA 1FNGB 4NZRH 3FU3A 3IJDA 4HUXA 1OCNA 4Y2DC 3MOAL 3N2XA 4G8FB 3QIBC 5F4XA 2QDDA 1ZIBA 4OAWA 2EO1A 3FC8A 3K3QA 1RVFL 2VQ1B 1PIIA 2VXNA 3MDWA 4PLOB 5I6LA 2J43A 2WBWB 1NCWL 2V0TA 4C6NA 4E3VA 1E6OH 1AQMA 3VFUB 4B9JA 1TMHA 1MHEA 4AUYA 4QQUA 5J7CC 4KDTC 2A9ML 2HP4A 4URTB 3EYOA 4Y9BA 3VFUA 3CHRA 1TETH 3RO8A 4OZFB 3LBCA 1TVBB 4PJBF 1Q6DA 2OB3A 3IDMA 3GAKA 4QJ5B 4ROPA 5DCDA 1J10A 4XCCH 2VKZG 5I6OA 3E2QA 4D0DB 4LALA 2R2CA 3IVKA 4P7NA 1JPFB 4HHPA 2NT0A 4MAYC 1Q6CA 1UUSA 2FJHA 1IKOP 4AYFB 4ZFOA 4U33A 3N43F 4XMWA 4YNYA 3FOLA 2IMRA 4WW2B 4IPLA 1NCWH 2XT1B 3FMGL 2H1PL 4MA7L 2CDEB 3CIQA 3BDYL 2AZAA 5DJYB 2BSDA 4GMSH 4WUUB 4EPEC 4X0KA 3PJLA 4W81A 2DQGL 1YEGL 2ZIDA 2A9AA 4JDVA 3D51A 2YCIX 2Y1YA 3HVNA 1F45A 1AMKA 5KSAD 4Y9MA 4FP8H 2PA6A 3X12A 1W8OA 4PP2A 5C0IA 4RFNB 2XJLA 5E08L 1V0MA 4XCYB 3CAVA 4P0DA 3WMQA 3PAJA 4ZX5A 4PGBB 1T6WA 2AQVA 1EMTH 1KCLA 2XA8L 1N64L 3L3OC 1BZOA 1PAZA 1CXKA 3U0HA 1A8JH 3Q1SL 1WGOA 1I31A 5F0MB 5T1DL 3WUEA 3GNXA 2JKNA 2W38A 1A3ZA 1T1XB 3S36H 8TIMA 3WDQA 3D46A 4ZDHB 3DJRA 3IDJB 4KITB 4AV4A 1K6QL 1PBYA 5KUKA 2PDJA 2CO6A 3O0LA 2EXWD 2E7FA 4NKDA 3G0UA 5GZOC 3LV3A 4FALA 2ICEA 1ZHLA 3VTRA 2QGBA 1XL4A 2F6AA 3OLGA 4JFXB 1JAKA 1ISZA 2BNRB 2OT1A 4P8VA 4UBPC 3LN3A 3TW6A 1FHGA 5I1DB 2Z1WA 1HCYA 1YQ2A 1UXLA 2K3HA 3UJTL 4H19A 3FZUD 4IBYA 1H49A 2AABH 2PO6B 3PWNB 2A4EA 1N64H 2XA8H 2IG2H 3A67L 4O4YL 4E42A 4INFA 4V1DE 3ZZSA 2VYOA 3OKYA 2Z8RA 2A7RA 3UWUA 2ZOKB 2TMDA 5FUZL 1VJZA 4QRSB 3CNKA 5JDSB 1PBGA 1M71B 3MNDA 4CEUC 3LKPA 4FA7B 1OZUA 3OKMB 1S5VA 5ESAB 4IM4A 5DJAA 1I4NA 4BQCA 1IM3A 3JV5A 1NPNA 4WZ9A 2AJUL 1C5CL 2R0ZL 2YPLE 1X7QB 1CTMA 1SN2A 3O2VH 4FQQA 3S3PA 5EC2B 3ZE2F 1JDFA 2BVPA 1MG3C 1TYRA 5ICUA 1GKEA 3ZRFC 1XYAA 4U2ZA 1I9RH 2G9KA 3VC5A 4Y4KB 4PWEA 2C9PA 3D25A 3KPOB 4OSUL 2Q1EA 4HDIA 2GAZA 5I1AB 2IH1A 5E2UH 2VSCA 5JIIA 3AYRA 3O0RH 1FWIC 3HHRB 3SGKA 2XTJC 3HW7A 4JRYE 4P04A 3RX9A 1FWNA 3UJRA 1RZ7L 1VGKB 2JGQA 2HH0H 2ZUVA 3UZZA 4RMRA 2HRHA 3S5LG 5LG1A 3TBVB 4XMXA 3RJYA 2Y36H 5HJLA 1NM4A 2W88A 1FWEC 1S5HB 4TUFA 1O75A 3BSZA 4FHBD 1XIWB 2AV1A 4XO8A 1VP5A 4B9KC 5D37A 3QR0A 4O4VA 2DQFA 1DSWA 5DJ0A 1ZRUA 2C3HA 5HI3D 4QNPE 1YDVA 1ONXA 5E99H 4DPCX 4GG6A 3A6CH 4YE4H 3NEXA 5CGQA 2G97A 1IILE 3OGCB 1EF2A 5C2UB 5HHXH 5L4JA 3BXWA 2CRYA 4IF2A 3RLVA 3APTA 5G55A 1EXPA 2CHNA 3P69A 2Q0ZX 3MGOB 3H70A 3CU1A 3P4NB 1G7PB 4WCYL 4JB9H 1KTLB 2EKJA 4I0PC 4LRIC 4HEPA 3MCMA 3TT1L 1HNYA 2WZ6A 4K55A 3WQVA 3EJYD 1LG1A 2VDML 3WKQA 2QYGA 3G5WA 8A3HA 1SO3A 2YW4A 2Q76A 3PNZA 1ZY9A 3VGAB 3BEVA 3QEQD 1CLOH 1N7MH 1TMQA 1P84K 3A6CL 4S1QL 1BEUA 1S3HA 1TYGA 2DT0A 2IVFC 4MA3B 1WFOA 3IIPA 5D1QD 2WLZA 4OI8A 1L6SA 4NSBA 4D71A 2BVYA 4WDIB 3P9LA 2W8CA 1ZMYA 2YLLA 2QKIC 4O8AA 3ONCA 2VN6A 4JFOB 4H9VA 3JXAA 4UB0L 4A2HA 4JIIX 1AXTL 4Q9RH 4XXCC 2V2WA 1ZHNA 3HGSA