1PZ3A

Crystal structure of a family 51 (gh51) alpha-l-arabinofuranosidase from geobacillus stearothermophilus t6
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
497
structure length
497
Chain Sequence
KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNEMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-arabinofuranosidase
publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 172
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pz3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pz3A02
2YL5A 3VUPA 4W85A 2BHUA 3HU7A 2BVYA 3AHTA 2UY3A 1US3A 1TVPA 1JD7A 1V6WA 4M80A 3D4ZA 1R8LA 4F9DA 2CETA 1W1TA 1WCGA 2BNJA 2WMIA 3PTKA 3ZIZA 2ZWYA 2YBUA 1UH3A 3H54A 3ZQ9A 3BUPA 1XSJA 2F7RA 1WDSA 2EPLX 3AIRA 3EBVA 3L4WA 4BCEA 4LGXA 4J3TA 3DDFA 2WMGA 4CD8A 1I1XA 1DP0A 3ARWA 1WZMA 1F4HA 1MQPA 4FNQA 3GM8A 4D6HA 2V38A 4J7RA 5BRQA 1WDQA 1CXKA 1TMQA 3NUKA 2CXGA 3CZGA 2FH8A 1X1NA 2Z1SA 1TE1A 1J0KA 2J62A 5LYRA 2PF0A 1W9PA 3WQ4A 4UR9A 1JG9A 1UQYA 7A3HA 3CIVA 3AZRA 3W25A 4LPCA 2PBOA 3AXHA 2AAAA 3S2CA 2YA0A 3K8MA 3S5YA 2CCRA 3WMSA 2YLLA 3WH9A 4OGZA 2HVMA 4JFWA 5ABFA 2A3CA 1K9FA 2WK2A 2EQDA 2VMFA 4FMVA 1LG2A 4NXKA 1QI5A 3WQ5A 2OLHA 2ZXQA 3WENA 3A4AA 3T2QA 1CYGA 3QHOA 4XUYA 1BPLB 1J11A 3VD3A 3L4VA 1V6VA 3WQ8A 2X0YA 3UR7A 1V08A 3CGTA 1KGWA 3L4TA 4BF7A 2BHYA 2V3EA 3NSXA 4BQ4A 4UOQA 4ZFMA 1NH6A 4CUCA 1E6XM 2DT0A 3VDCA 1HJXA 1JI1A 1KTBA 5A8PA 3GXMA 1BAGA 1BYCA 3L2MA 1GORA 1D3CA 2ZUMA 4GZJA 3SEPA 2EEXA 1K9EA 3S6TA 5GQBA 3OLDA 3CUGA 3G6LA 1V6XA 2GDUA 4AZBA 3WNPA 4PMOA 3KZSA 2YOCA 4MB4A 1IT0A 4H8HA 4AIUA 1LG1A 3SCWA 3CHCA 4MPKA 1JDAA 3BAJA 4ZEPA 4AYGA 3CMJA 1E1FA 1NARA 4MADA 4CU6A 1BVNP 3DX4A 2UWFA 1P6WA 3AXIA 1H0GA 1WDRA 3AHVA 4FLRA 5BCAA 2BY1A 3ZMRA 4AIEA 2CITA 1GOKA 4UQEA 4B16A 4TX8A 4PN2A 4HZ8A 1H41A 2O9OA 3A4XA 5A8MA 1YQ2A 4X0NA 5LA2A 1PAMA 3VIKA 2JF6A 1EO5A 3TP4A 1GPFA 1HJQA 4RE3A 2CPUA 1UASA 4PMZA 3WUGA 1ISWA 2XJ7A 1J10A 1O7DC 2C8NA 3U5YA 2RGMA 2ZX8A 5JBFA 1W2VA 2YIHA 4RE2A 3AIUA 2W63A 2X0HA 5A6LA 1CDGA 3K8LA 5DF0A 3VX0A 3VDBA 4DO5A 3E1F1 4JKMA 4W5UA 2FYVA 2Y2WA 4UFJA 3K46A 1OM0A 4RL3A 1E70M 1HN1A 3RJYA 3SUTA 2XFYA 3UEQA 1JFXA 4QLKA 1TZ7A 1DWFM 1HF6A 3EDEA 4PMDA 3A5VA 2WMFA 4IISA 4AD3A 3GXTA 5E6YA 2O9PA 3VPLA 4PBGA 1ZS2A 4DWSB 2PBGA 3KLLA 3AYRA 7TAAA 3K4AA 2WZEA 5C70A 2BS9A 4PTVA 1XH0A 2E4TA 3KL3A 2ZWZA 2O9RA 3OLGA 4ZXOA 1PPIA 2FE0A 2PWDA 2QMKA 1ZB5A 3WY4A 1ZU8A 4F9JA 4FLOA 3ARSA 3AICA 2GFTA 3SUUA 3WF2A 1W3JA 4NI3A 2VJXA 3POCA 2QPSA 4MB1A 4PRWA 2DDXA 1CNVA 2XVLA 3BCFA 3PZTA 5A3HA 3CLWA 1UKSA 3WL0A 5I5RA 1K9TA 3AMLA 3MU7A 5A8OA 1HP5A 5KZ6A 1R87A 2XSAA 3QHMA 1J0ZA 5IHSA 5IXEA 1QHZA 4H8UA 1J0JA 4W7VA 1W3LA 1K6AA 3CUIA 1E3ZA 5M03A 1KXTA 3HJEA 3GYCA 2XPKA 1AQHA 1T0OA 3LRMA 3LXAA 3II1A 3W6MA 5DFAA 4GI9A 3U57A 3BAXA 4OJYA 3WN6A 2QF8A 3WMBA 1Y7VA 5BROA 3TONA 2VT0A 3LX9A 3DHPA 2GSJA 4TUFA 2XN1A 1OIFA 1ZBVA 1Q6EA 4UQAA 1A3HA 4EE9A 1B90A 2A3AA 1B1YA 4PSRA 3GTNA 1XSKA 1CLVA 2PC8A 3GXPA 3D52A 4P7RA 2YDRA 2CBUA 3U7VA 2IUZA 3SIMA 2WBGA 5GPRA 2CERA 4XX6A 1VENA 1E56A 4PSPA 3VIGA 1MWOA 1C92A 4DUXA 2D3LA 1QHPA 2WVTA 3AZSA 3SCRA 1HVXA 4P7LA 2BY2A 2D0FA 3VGHA 1H49A 2OSWA 1GHSA 3UESA 4WJXA 3AIBA 1QI2A 3QOMA 4AD4A 5BWFA 3TTYA 2X2JA 2WW5A 2VRJA 3A47A 2EBNA 4MAZA 3WSUA 1GOWA 4PTWA 2NW0A 3T0BA 4ZXLA 4E2OA 1ZBCA 5AYIA 5A8QA 1W1PA 2OWWA 1MQQA 4CVWA 3S5ZA 1C8XA 4DWSC 4GO8A 3BUBA 4M81A 4PMQA 2BXZA 2EPMX 4M56A 2WCGA 4MJ4A 1CGUA 1QVBA 2ZUTA 1IZKA 3H55A 2ALWA 2UY2A 2C7FA 3BXWA 3SCSA 2YLAA 1G01A 1DWIM 1V3MA 3LRKA 3WFZA 4TVUA 1E1EA 2DT1A 1VF8A 4V28A 1V0NA 2WPGA 2OYMA 2WB5A 3BLBA 2J78A 1B3YA 1E4MM 2D24A 3SUVA 4XB3A 1MW2A 2GJPA 3AS1A 4QFUA 4D6DA 4AWEA 3ARQA 1M01A 1R75A 1R33A 3FW6A 3GXDA 3MMDA 5HDRA 6A3HA 4URIA 3UETA 4JCMA 1GQLA 3AMKA 1MQRA 5A2AA 2ZX5A 1W91A 1HXJA 4W88A 1ECEA 3RM8A 1E6SM 1KB3A 3F4VA 2W62A 1E4LA 1G94A 1E4NA 1RP8A 2VURA 1UR0A 3WBEA 4KRUA 2QMJA 3F5JA 4H41A 1EO7A 4GO9A 2VZTA 2J7CA 1CWYA 3VGFA 1ZBWA 2WMKA 5ABGA 1W3HA 1X6NA 3SCQA 4GINA 3ARXA 4J27A 4CD5A 1ZJBA 1UD8A 5I3DA 2QLYA 5E9AA 5M3WA 1OBAA 4PMVA 2VCBA 1UG6A 4IUGA 1E9LA 4UFKA 3M6DA 4GZEA 1GOMA 2FH6A 1SMDA 1XD1A 1C91A 2D73A 3VGDA 4OUEA 3WMCA 3ECQA 1CGXA 3L2LA 2VZVA 3CZKA 1JXJA 4CGTA 1DWGM 3K8KA 1CTNA 1ZBKA 1H0IA 1W9VA 4AISA 3PTQA 1O7AA 2J7BA 2PWHA 1QW9A 2CYGA 1B2YA 1CGYA 4YN5A 1VFFA 2JF7A 4ACZB 4J3UA 3K1DA 2ZUVA 6TAAA 1J01A 1E0WA 2X05A 1HVQA 3WBAA 1QNPA 1WO2A 4LYPA 4PMNA 4R27A 3N18A 5JBEA 3OGSA 1GONA 3ARPA 4L4OA 3IJ7A 4AZCA 1WP6A 1L8NA 4QAWA 3ZT7A 2E9BA 1SYTA 2V3FA 3WUBA 2CBJA 4IPLA 3DYPA 3W0KA 5E6ZA 4JFVA 1E6RA 1TVNA 3N04A 4D6CA 5CSUA 3ZO9A 1I1WA 1CIUA 2ZICA 3O9NA 3OG2A 3VD9A 3BLPX 1FP9A 1UKPA 2W91A 5A8NA 3G6MA 1MXGA 3VDHA 3RM4A 1ESWA 1JFHA 2J74A 3H53A 5EFFA 1JZ4A 5E70A 3WD3A 4UOZA 3IANA 1V0LA 3LRLA 4WKAA 1E40A 4U31A 3VTRA 1HKMA 1GVIA 4LXFA 2VI0A 1NM9A 4R5EA 2O92A 3AMGA 3I3EA 2E9LA 2VZSA 1OGSA 4BZYA 4JAWA 3WIJA 3VINA 3BUIA 4V27A 4HMDA 2VOTA 1W9BM 3AIQA 1IZJA 1XHGA 3HN3A 3IAQA 4WK9A 3BAKA 1OD8A 3DX1A 2EPOA 4GIAA 5ECUA 2VQTA 3W28A 4F8XA 2YFNA 3VSVA 1PZ3A 1TA3B 1V6YA 4FLSA 3VGGA 1UH2A 3U7BA 3BLKA 4LYQA 2X2IA 3MUY1 2E8ZA 4NF7A 3NSMA 3BH4A 4PCSA 2ZUUA 5AY7A 1PJ9A 1DEDA 1KXHA 3AHXA 3TV8A 1E73M 1E0XA 1BVZA 1LL7A 3QR3A 4NX0A 3M7SA 2W4XA 3N15A 4JFTA 2XYLA 4YPJA 1TQSA 1C90A 1QPKA 3B9DA 1M53A 2E9MA 4U5IA 3FAWA 4PMRA 5I78A 4W87A 4B9YA 5BXRA 2IGTA 4H04A 3UR8A 2W66A 1HJWA 3VIOA 1JNEA 1UWSA 3CHFA 3CUHA 3CUJA 2QPUA 1G1YA 2VC9A 1ZJAA 4DUWA 3EDJA 1OCQA 2F61A 5CQ1A 1QNQA 5CLTA 3WD4A 2XFRA 2JALA 4UFHA 2BHZA 2WVUA 1C3FA 1HJVA 2J7EA 3VM5A 1ODUA 4GI8A 3PN8A 3AS0A 2XM1A 3CBWA 1KQYA 1U30A 2DH2A 4E8CA 1E71M 5IFTA 1R34A 1QWNA 2F8QA 4S3KA 3KEHA 1LL4A 4CCCA 1UR1A 5FL1A 1UD6A 1BHGA 2D20A 1V3JA 5GNXA 4YHEA 1LF1A 4H7VA 2VX4A 3N1AA 1WE5A 1BLIA 2TAAA 1PIGA 1WZKA 2WLZA 3VMOA 4PTXA 2EACA 2Y8KA 4D6GA 1DTUA 4UQCA 3ARZA 4NSBA 4WKFA 2XFFA 3VIFA 4OBRA 3TTOA 3WDHA 1W3KA 2QV4A 1HKJA 2JIWA 3MI6A 2ZUNA 3RJXA 1NQ6A 3ARUA 3ZJ7A 2G41A 4AZIA 5HBFA 1J18A 1G0CA 5I23A 8A3HA 4AEFA 4GKLA 3WNKA 3ZSSA 3DX3A 3FAXA 3BSGA 1KXQA 2CBVA 3T0AA 1W1VA 4W5ZA 3HG4A 4YHGA 3GH5A 2WSPA 1KTCA 4GQQA 1PX3A 2B31A 1B3VA 3LXBA 1EQPA 2W5FA 1KGUA 4JHOA 3WD0A 4OOZA 4CCEA 5DT5A 2V5DA 3TA9A 3T08A 4Z2LA 3PZUA 3AS2A 5A6SA 1ISZA 4OZOA 4MAVA 4M1RA 3L4YA 4PMUA 4HU8A 4AZGA 3PZMA 3KE0A 1VEOA 4W89A 3ZSTA 2D1ZA 3VSUA 1ITCA 3BVUA 3CV5A 3W6LA 4NRRA 4D6JA 1UZ4A 5DT7A 1VEPA 2VZUA 3OA5A 3NDZA 4WLCA 1UWRA 3VD5A 1AQMA 4FLQA 1JDDA 2WMIB 4D6FA 3CUFA 1QOXA 4JIEA 4L4PA 3A21A 1UWUA 3VMPA 4AY1A 2XVKA 2WKLA 4E4PA 3BUDA 3CHEA 4A3YA 4CU8A 5GNYA 1UQZA 3MV01 2ESCA 1MW0A 1XYZA 3B9AA 3VO0A 1G9HA 3IAPA 3VGEA 2G3NA 3AI0A 4MB3A 3DHUA 3ZOAA 1HKKA 2OW6A 2DQXA 1H2JA 5A2BA 5A95A 4X0VA 4MDOA 2WCAA 1V02A 4V2XA 3OB8A 4W8AA 1KR0A 3CH9A 4HA3A 4FNPA 1QI0A 3WDQA 3OBAA 4WF7A 2VR4A 2PWEA 1LWJA 5CPQA 1MFUA 4HPGA 1JZ6A 2J75A 1VBRA 2GJXA 3WDJA 4KGJA 3A22A 3DC0A 3BUQA 4K68A 1VEMA 1HL8A 1FH9A 3ALGA 4XV0A 3AHZA 3JUGA 2GUYA 2ZIDA 4AEEA 2BVDA 1W9DM 1NOUA 1KFWA 1M7XA 1JD9A 2WC7A 2DSZA 3CO4A 3W29A 1KGXA 5LA0A 3LPOA 4CN1A 5ABFB 3VD4A 4ATDA 5E1QA 3VGBA 3FNDA 1GHRA 1BFNA 1H1NA 4FF5A 1ODZA 5C8BB 4QLJA 3ZT6A 3CC1A 3AJ7A 1CXIA 1XH2A 3M46A 5AC4A 2E3ZA 1JZ3A 2GK1A 4P7OA 2ZX9A 4JL1A 4TVDA 3GXIA 1X6LA 1BQCA 3IJ8A 2W61A 2XVPA 4AD0A 2EXOA 5HPOA 1QNSA 3GZAA 2F18A 2CHNA 1HP4A 1E72M 1LQ0A 4JKLA 2D0HA 2J7FA 4CCDA 4H8VA 3D51A 3VD7A 2CNCA 3WH7A 1J12A 2WLYA 3J7HA 4FNTA 1NOWA 1C8YA 2PB1A 2ZUWA 1GOIA 3VMNA 4DM2A 3WY2A 3RIKA 3PZQA 1FH8A 2WZIA 4TTUA 4JKKA 1WZLA 1US2A 2G3MA 3HG3A 3F5KA 2UY5A 1CXLA 2WAGA 2BY3A 3OLIA 1EOKA 3WEZA 5CJ5A 3AROA 3AYSA 4MDPA 1Q6GA 1PBGA 3SCNA 5I79A 2EABA 4MTVA 3VIMA 3NSNA 4WIWA 5BRPA 4NRSA 4WKHA 2WMHA 3WH6A 3VIHA 3W4RA 2D0GA 1FHDA 3WEOA 4N42A 1UOKA 3D50A 4TOQA 1V3KA 4ACZA 4U5KA 1QX1A 3THCA 1C7TA 3HG5A 4ATLA 3MANA 3OIHA 1H5VA 5D8WA 3IJ9A 2XVGA 3MS8A 3FHAA 3WNNA 4UZSA 1XSIA 2CKRA 2FDMA 1R85A 1VBUA 5A6MA 3PHAA 4NXSA 4KRTA 4AIOA 2ZXAA 3FXYA 5A69A 5D9NA 3UCQA 5M5DA 3BMVA 2E8YA 1V0KA 5ABHA 1E15A 3MUZ1 4HMEA 4QDMA 2BFGA 3DX0A 1CZ1A 1NOFA 2YFOA 2YA2A 1B31A 2OSYA 3W24A 2ZXDA 3KL5A 4WSJA 2WYSA 3UG3A 1B3ZA 1Q4NX 1PIFA 4HZ6A 4BQ5A 2YA1A 1SZNA 3VIIA 5CGMA 5E0CA 5IFPA 1EA9C 2X2YA 4F79A 2VR5A 4TX6A 5CGTA 1CLXA 1BTCA 3W53A 4HMCA 1D2KA 3BC9A 4AMCA 1KQZA 1FFQA 4CD4A 1HT6A 3WKZA 1VFUA 3VM7A 1N82A 2CBIA 1KBBA 4Q22A 1TQWA 3ZR6A 4MNMA 4MJ2A 2VCCA 3BAYA 4D1IA 5JUVA 3CHDA 3MUIA 4B3KA 3W38A 1LL6A 3SCPA 4AZ5A 4LQ1A 2PWFA 3VX1A 2WM0A 4BQ2A 2CESA 3DYOA 1UWIA 1EDTA 1JAEA 3VKKA 1EXPA 1WZAA 3LPGA 4QP0A 4FNRA 4OIFA 2D23A 1E6QM 2VO5A 5CZKA 2WWDA 3ALFA 1HL9A 1HXKA 1HTYA 3GNPA 5AYBA 4KGLA 2E40A 3EMQA 5IDIA 2O9TA 1RD6A 1V03A 2PWGA 5FCZA 5AC5A 2WHJA 3WQVA 5BXTA 1H11A 1TQTA 4U2ZA 2WKGA 1B30A 1GOOA 2JEQA 4NZJA 4E8DA 1HKIA 2W92A 1KXVA 3WUFA 1NWUA 3CZNA 3EJSA 1LWHA 3OZPA 3BVXA 2VRKA 1AQ0A 1EQCA 3PTMA 5BXSA 2J25A 2JFEX 3DDGA 3A6OA 4BA0A 4OKDA 2J7HA 1NP2A 3B8SA 5E0FA 4D71A 5JIPA 1U2YA 3MMUA 2PI6A 2QHAA 1E4IA 2UY4A 2WWCA 3AFBA 1OIMA 1CXHA 2VL4A 4PMXA 1K9DA 4EAMA 3EJUA 4UZUA 2DSUA 3VDAA 2XGBA 1U33A 2CIPA 3SUWA 1UR9A 2VTFA 3N13A 1XGZA 1V3HA 1R86A 3SUSA 3GH7A 1HNYA 3W27A 5HOSA 3WDIA 1Q6CA 4AZ6A 4M82A 5I0DA 4A4AA 5I77A 2GVYA 2NT1A 2A3BA 3OGRA 5A6AA 2G8ZA 1RH9A 1FOBA 1XRVA 4W86A 2G3JA 3VOCA 3FN9A 1PX4A 4JHZA 2DIJA 3DECA 1MW1A 4W93A 1KR1A 4LX4A 1CGWA 2V3DA 1TFVA 1EHNA 3BCDA 1D7FA 1UZ1A 1EH9A 1UD5A 2X09A 3EDDA 5A6BA 5EBAA 3AQUA 1CGTA 4HP5A 1B9ZA 3WFLA 1I75A 3PBGA 2WZHA 1WPCA 3K4DA 5BYWA 3WY1A 3VNZA 2HISA 4C7GA 2YL9A 3CMGA 5A6KA 1GUVA 2WHMA 4AD2A 4B9ZA 1J0HA 3BVWA 5I6SA 3ARYA 2CEQA 1KCKA 2VRQA 1JAKA 1E6PA 4Z2KA 1UR4A 4HA4A 4P8XA 4J3XA 1O6IA 1BYAA 5EB8A 1MFVA 1H09A 3WH5A 1G5AA 3A24A 2BV9A 1AVAA 3W82A 1EOMA 3CZ8A 2V5CA 2X8RA 4P7NA 4AZHA 1B3WA 1DWHM 4Z2IA 1JGIA 1TQVA 3WY3A 1GQKA 2VX6A 4AD1A 4U2YA 3T0DA 3VU2A 5KEZA 1FHLA 9CGTA 2A3EA 1OT2A 1JL8A 1XH1A 8CGTA 3KL0A 3WDRA 3WNOA 3CZLA 4HU0A 1JYNA 3I3DA 2Y4SA 1B3XA 3ZJ6A 4Z2JA 1WNOA 1TQUA 4TVCA 1R7OA 4Q7NA 4AW7A 4HZ7A 5HXMA 2EO7A 3POHA 2WANA 1EGZA 1OSEA 2YDSA 2OWXA 3OGVA 1ISYA 2BXYA 3LMYA 3D4YA 4J3SA 3PZNA 4IPNB 7CGTA 4U3AA 3ZT5A 5EFDA 1QHOA 1E6ZA 1Q6FA 1UD4A 2XTKA 2OYLA 4UFLA 2DH3A 2XVNA 4OOUA 1MW3A 2J8FA 4J28A 1RPKA 3EJTA 3BVVA 3IGUA 2F7OA 1BYDA 2J7GA 2W67A 3NDYA 1F4AA 4DWSA 1WB0A 3CZEA 3O2LA 1EIBA 1CXFA 5LA1A 5CPSA 3WH8A 1Q6DA 3O6AA 4AZCB 4NZCA 3MUAA 2WVVB 3NYDA 1VRXA 3UG4A 2X2HA 2WHKA 2RGLA 3THDA 5FIPA 3MSDA 2VVSA 3GXNA 4D72A 3QHNA 3OLEA 3EDFA 1TR1A 1YHTA 1JZ5A 2WC4A 4KH2A 2JIEA 2VZOA 1CXEA 2WBKA 3AHYA 1JYWA 1V0MA 3UERA 5A6BD 4AC1X 3WQ6A 4CU7A 5FKYA 4AXNA 2D2OA 1GJWA 1W2PA 3PZVA 1J0YA 3ZM8A 3RDKA 1ZL1A 3HMCA 1E6NA 5C71A 1C93A 1PZ2A 1W9UA 5D4YA 2IXUA 2DSKA 5D9PA 1QBBA 2J79A 4M8UA 2D3NA 2V3GA 3WNLA 4AMXA 1VJZA 3WL1A 1JI2A 3EMZA 1M04A 3T2OA 4EK7A 2YKKA 3EDKA 3NCOA 1C7SA 1FH7A 2E0PA 5CXPA 2AMGA 3A3HA 1BSIA 2CKSA 5JIWA 4JL2A 1VFMA 1KWKA 2NSXA 1UKOA 4C7FA 2XIIA 1BG9A 1QBAA 1UWTA 3AZTA 3ARVA 3CTTA 4HOZA 5FOOA 5FD0A 1PS3A 1E5NA 5F7UA 1EDQA 4HA1A 3VIPA 3HG2A 1JF6A 2YL6A 2EAEA 5TD4A 1C8QA 4MNKA 1XD0A 1VJSA 1QNOA 2NT0A 2DEPA 3N9KA 1QNRA 1CGVA 1BGAA 1HX0A 4AZ7A 1S46A 4FK9A 1RP9A 4PYSA 2C0HA 1V02E 2IXVA 3LXCA 1R46A 3RPMA 1DWAM 1MVYA 4CN4A 4OBSA 5DMYA 2DPEA 2J8GA 3T2PA 4X9YA 1UUQA 1UR8A 2DIEA 3GXFA 2ZX6A 1LJYA 4TXEA 1W32A 3HZ3A 3EJPA 2ZE0A 5GNZA 5CPTA 3SCUA 1DWJM 3L4ZA 3MSGA 4ML4A 1KCLA 4HOWA 3AOFA 3OZOA 1UR2A 2EPKX 4FNUA 4XZBA 3W81A 2WC3A 4MB5A 3CZSA 4DWSD 4IM4A 3FHQA 4B15A 1UWQA 1EDGA 4KWUA 4ZE5A 2XWDA 3SCOA 3WEMA 3ARRA 1QI4A 1FFRA 5CSYA 1CBGA 4CD7A 1ISXA 3WUEA 3GDBA 1BGGA 4P7QA 3D5HA 3PZ9A 4J3WA 3TTSA 1HJSA 2F1AA 2X1IA 3KLKA 2VX5A 3WF1A 4DO6A 3ZR5A 2VVNA 3TOPA 2FGZA 3KWXA 1J9YA 4BQ3A 1JNDA 4Z2HA 3PZIA 4UQ9A 4AYSA 1HJUA 4PTMA 2DSWA 2FHCA 1VB9A 4KMQA 1NWRA 5D9OA 1BG4A 1MYRA 4W8LA 4P8UA 2Z1KA 3CZJA 5ABEA 4D6IA 3BGAA 3NIYA 4UFIA 5A1AA 3F5LA 4ATWA 2XG9A 1JF5A 1UKTA 3WF0A 2JE8A 1UHVA 1E55A 2CHOA 3EJQA 4S3JA 3RILA 1PEZA 2FGLA 3FY1A 4AMWA 1GVYA 3GBDA 2XM2A 4JCLA 3U5UA 3WF4A 4UFMA 2XIBA 1XCWA 4CN6A 3VVGA 1HWWA 3WNMA 2XN0A 1GQIA 3NJ3A 5D8ZA 1OT1A 2J47A 2WCSA 2VUYA 5DEZA 3AIVA 2BVTA 3VNYA 5JBDA 1UD3A 4U3CA 4CVUA 2F1BA 1KWGA 1PX8A 3EYPA 1B0IA 1SFSA 4GXPA 2G3IA 3BSHA 5D9MA 2J77A 2DGAA 3N11A 2YDQA 4M29A 1GQJA 2FHFA 1CENA 1JXKA 2XSBA 3B9EA 3SCTA 2WXDM 2DT2A 2F2HA 1SMAA 1GW1A 1NWSA 3WQWA 4ACYA 1Z32X 2J4GA 2JEPA 4P8WA 1BF2A 3PZGA 1JYXA 2Y24A 2WSKA 1UA7A 2A3HA 3GNOA 2VQUA 2YL8A 3ZJ8A 3N17A 1GCYA 4XZWA 1L0PA 1JIBA 3WD1A 5BXPA 4A3HA 2J7DA 4D1JA 3MMWA 4EANA 3BVTA 3AS3A 1QI3A 3LPFA 2WNWA 2D22A 3GBEA 4GPNA 1XYFA 4PUDA 1MXDA 1QWUA 1WAWA 2ZX7A 4JFUA 1OWQA 3AXXA 4UOJA 5IHRA 1NP0A 1SR0A 3MO4A 2Q8XA 1OGGA 2GJXB 1CEOA 1V3LA 1DHKA 2EJ1A 4ZENA 2Y5EA 3APGA 3VILA 5M17A 6CGTA 3A4WA 4H2CA 2GDVA 4W7WA 4NZFA 4HPHA 4JFSA 2ZUSA 1CECA 3ARTA 4UCFA 3A23A 1TUXA 4CD6A 1UD2A 3GH4A 1GZJA 4W7UA 1V6UA 1W9XA 4D6EA 5A6JA 2OYKA 1XC6A 1A47A 3BMWA 4GZIA 3CPUA 1OD0A 2VNCA 1VIWA 1E3XA 4J3VA 2WHLA 2EADA 2GK1B 5EMYA 4GI6A 3L4XA 3SCVA 3WF3A 1H3GA 5A94A 2DT3A 4GQRA 1VAHA 4DUVA 3LPPA 4LYRA 4FNSA 1GNXA 3WDPP 4QLLA 1TA3A 3RM9A 3UG5A 4N0RA 4TTGA 3GNRA 5HPCA 1WKYA 2XN2A 1CPUA 3WELA 4PMYA 3QGVA 1ISVA 1OGBA 1LLOA 1JDCA 2XGIA 2F7PA 2OSXA 1QW8A 2WVSA 3WD2A 1H4PA 3MV11 4UQBA 1JYVA 4U33A 5I2UA 4UQDA 2VCAA 3M07A 4DO4A 4MNJA 1UH4A 1XCXA 1GOQA 3RCNA 2YJQA 3L4UA 2MANA 5FL0A 1KBKA 4PEEA 5HNNA 2AOSA 3DYMA 4W8BA 1IV8A 4UNIA 4PCTA 2DSVA 1UKQA 4QCEA 2XHYA 1JZ7A 2F7QA 1AMYA 3RO8A 1TCMA 2ZXBA 4UTFA 5DO8A 3IK2A 2XWEA 3W37A 3BAIA 1R7AA 4M24A 3EMCA 1E43A 1OINA 4ZE4A 1E0VA 1VFOA 1V3IA 3PZOA 3AMCA 3BAWA 3AIEA 4HOXA 1WDPA 3AIWA 1FA2A 5A2CA 2Y8VA 3TTQA 3SURA 1E5JA 4Y7EA 1HIZA 4EKJA 4BS0A 3W26A 2FHBA 1UA3A 4JZ5A 4F66A 3QOKA 5E09A 2BY0A 2GJRA 2VX7A 2WVVA 3EJRA 1R47A 1EHAA 4WSKA 2ZOXA 2G4FA 4W84A 1TG7A 4RE4A 5CLWA 4CKQA 3AISA 5I24A 3MKKA 2XUCA 3ZJKA 1NWTA 1JZ8A 2WMJA 3VIJA 4AD5A 1ITXA 1M03A 3T09A 3RMEA 2EPNA 3D3AA 1W1YA 4PUEA 4DM1A 1OB0A 5CG0A 1GJUA 3AMDA 1XV8A 4P8VA 1FP8A 4QCFA 1J0IA 2OW7A 2YBTA 3N12A 3I3BA 1JZ2A 4C7DA 4B3LA 4MNLA 1UYQA 4Z2GA 4HTYA 2OWCA 3VSTA 1BYBA 3DX2A
chains in the Genus database with same CATH superfamily
2YCKX 2W95A 1MPAH 2J8TA 1P84K 3AHTA 3C6LB 4UTLA 1O9VA 3LOTA 4PG9B 5KYUB 1KACB 1HKWA 3V4PL 2QT6A 2CETA 2NNAA 3UPAA 3UTZB 2FQGA 3R79A 4PLKD 3U6XA 1SW0A 2YBUA 3LA4A 1J5OH 5FEZA 2WMGA 4ZSOE 5H2ZA 3ZQXA 1A3LL 1TZGH 2YBGA 2NQDA 1MQPA 4NNXA 2V38A 4JFXB 5DHYB 3TJLA 1OF8A 2QTEA 2X4OB 1P0EA 3W25A 2Y22A 3RB5A 3S2LA 3MCMA 3Q1SL 5HHQB 1E8WA 1IR2A 1H5BA 3QWRA 3T05A 2NY0C 5D1XA 2R56H 3L65A 1YAIA 1RZMA 2ROXA 3JZ7A 1LRTA 5KJ7E 5JOPE 1YTKA 4XUYA 1EBPA 2H1LM 3BCJA 2Y6SC 5FYKL 1S7TA 1H3PH 1O5PA 4L23A 2B81A 3WKMH 2FYMA 5BZDB 2V3EA 1FLRL 4Z7UA 1NCWH 3S3CB 2OK0L 1INEH 4WFED 3ABMB 2ICWI 3VFWA 2EEXA 4X3ZA 3SQLA 5IM51 4LY4A 3C0LA 4M1CD 3P3RA 5DTFA 1F8TH 1WSST 5C0IB 4JTRA 2W9DH 4GQPH 3VFMB 4L8SA 3S35H 4LBSA 1BWWA 5I71B 4MQ7A 4ADJA 4DVBA 5LNVA 1Q0YL 2BY1A 4D9QE 3ES8A 2JKPA 4AIEA 5I1KH 1GK8A 3JQOB 4YXGA 3KPNA 4LAUA 5B7ZA 4X0NA 4YHLH 4XBEH 4D0BA 4RFNC 4RE3A 4JFYA 1FWIC 2R9RA 4U1MA 3NZ8A 3M9YA 4KJPD 4ICXA 5JNYA 4MJ5B 2VGGA 3AIUA 2TSAA 4UTBH 1NFBA 5EGRA 3QEQB 5AKSA 1OM0A 1E70M 5FW7A 4R7NB 4MMZA 3EDEA 3O2DL 3RL2A 4DKAA 2FO4A 2YD8A 1N59A 2YMOA 4JJ5B 4XMKL 4XWOC 3AYRA 5FF3A 1EJRC 1AR1C 2H9GA 4IRJD 3T07A 4PJ7B 2B2XL 4A2RA 3SUUA 1ZK5A 4X8XA 3T71A 3GU9A 4NG3A 1QSFD 1Y07A 1HP5A 5F7LB 1FN4A 2B5IB 4XTIA 1KXTA 4ZX4A 1S1PA 3GI9H 5AZEL 3VXRD 3FQTB 4F15C 3MLUL 3LQAH 1NLDH 5F96H 4NWUL 4LLUB 2QPXA 5KVMC 1A3HA 1T96A 4GUPA 3WZ0E 1TYGA 4M7SA 1VFSA 2CLVA 2FLMA 3U7VA 1OG0A 2VR7A 2GY7B 4M5PA 4UIMB 5C0NC 3T0VA 3I4KA 2OPJA 4DUXA 2V9UA 2F74B 4LL1A 2R1YB 1EEZB 5E8OB 2A2IA 2D0FA 1K2DA 4PUBH 3FC8A 2MCPL 1RVKA 4XPGL 1QPNA 1MEHA 2UUDH 1XLIA 4MCMA 1UM6H 1HHHA 3ZL1A 4C6QA 1NDMB 4Y4KB 4W9HC 2X4NA 4Z7VF 2TMDA 1X5AA 4WEEA 4GRLB 4S2SB 1QFWH 1UZDA 4DY1A 8PAZA 4BQ8A 3BN9C 1OK0A 4JDBA 4AHOA 1ZT4B 2IWKA 3DGDA 1FHVA 1CFSB 1TPXB 5L2JB 5HJYA 2FSEB 4U4IA 2K3TA 1MFAL 3KHDA 3QYNA 4OD2A 4D6DA 3GG1A 4P2RA 3RZCB 3GKWL 3AABA 3T77B 5ABDE 1PY9A 2XZZA 4G9FE 4OLWH 1J1PH 4PI2A 4JCMA 4JRFA 4CQ9A 3CFJA 3USZA 1KB3A 3QQ0A 5EMMA 5KSAB 5TFSH 3SDCD 4Z8FH 1E4XL 5HDOA 3NCWA 4KRUA 3AY4C 1U8OA 5JMRA 4YFLI 1EBGA 3EOEA 1OBAA 3OYXA 1SBBA 1KCWA 5JR1H 4Z23A 5FO8B 4UQ3B 4JM2A 1ZANH 5FKAB 3ECQA 5D04C 2D2HA 4DBSA 5KJRH 4BHUA 1ZPUA 1H0IA 3QDMB 1QW9A 4ZB0A 1CGYA 4AB4A 1AC0A 4UT9H 4J3UA 4M5SA 4ACZB 1RD5A 2AJVH 5G2NA 4I88A 1HHIA 3LVEA 3S1XA 1DANU 3DI3B 5BJTA 3IU3A 5BWAA 4PP2A 1RK0A 3ZYJA 1J8RA 4G7EA 3CUXA 2KDYA 3X1NA 5FJOA 2DVUA 2CBJA 1WYIA 4QNPE 2C9VA 1GGIH 2ARJB 3EH1A 1WS8A 2PNDA 5DFTA 5L4IA 5CCKL 5CD3A 1QTWA 4WHCA 1ESWA 2VN4A 2EIDA 1NDGA 1SEBB 1GVIA 3JUYA 4LH8A 4EACA 5FUZL 4FX8A 3ATFA 1TRDA 3RRQA 4NILA 1XIWD 5LHEA 3JYCA 1XHGA 2YUWA 2AAMA 2M2DA 2GEQA 4C4UA 4GIAA 1W17A 3WLHA 1II4E 1XUUA 1KFKA 3M45A 1AOHA 3HBQA 4Z0XA 1E0XA 3KPLB 3IF1A 3NCXA 3GWJA 2Z8WC 3QV7A 4M4PA 2UXFA 2CZ5A 3S8WA 4EX4A 5C9ZA 4PMRA 3BGFC 4XMLH 5ES4B 3FTZA 3T0WA 3FOKA 4PJAF 1LEKB 2QPUA 4DLFA 1QBLL 3TJHD 3K6IA 5CLTA 3MLSL 4JPKH 3F5WB 3W2DH 1CLOL 2ZTJA 4AL8C 1IUZA 4V1DE 3K1GA 4S3KA 3ABXA 2DQFB 3SQOH 1V3JA 5GGUA 3ZE2B 2GC7C 2J44A 1HZYA 5E5LA 4ZX5A 4Y16C 3UDWA 3UJRA 4XPTL 3I9PA 1QR4A 1FQ9C 2HJKA 3V0TA 4JDEA 2A6JB 4XSLA 4O2EA 3ARZA 5CEXB 5GGQH 3L9CA 2ZUNA 3CXDH 4OKVA 2XV0A 3QIWC 3HR6A 5CNHA 3FYOA 3DX3A 1GGTA 4S1QH 4PB9L 4Q6IA 3W88A 4TLSA 1F97A 5F1NA 4OF8A 5TJWK 2PU1A 3DUUA 4FX5A 3NCYP 4S0TD 3T08A 2BOCB 2CALA 4QHKJ 1ISZA 2QQNL 4XMXA 3BVUA 4D6JA 3ARGB 2VZUA 3VD5A 4BFBD 4IOFD 4QRNA 1XIBA 5E4OA 4EQ2A 1WFNA 2VGBA 1YMMA 4Z5RB 3M0YA 1HL5A 2I9TA 1FFPB 1MW0A 5DJ0A 2AABH 1HKKA 2WQDA 5DD3L 2P3EA 1MNUL 1YEGH 5AHFA 4FNPA 3NZHH 1YEJH 5ECJE 4L8BA 1DPMA 1KB5L 5G1TA 2N1TE 3DC0A 1HL8A 4RWYH 3FF8A 1PD1A 1QCWA 4Q8BA 1R3HA 3G1RA 3C4UA 2YD0A 1F1DA 1E9OB 3P9MB 3M46A 3ZQWA 1XQLA 4JQAA 3G0SA 4P7OA 4HSNA 2BFVH 2AEWA 3GXIA 4M7LT 3C52A 1XI3A 5AB3A 5C6MA 1AY1L 3DIDA 3DI1A 3APTA 4QAIA 1KRBC 1E72M 3EWDA 3ZDXB 1J12A 1FVPA 3TYZA 3R25A 3R4RA 1F58L 5DDHB 3W1PA 2DP3A 4P99A 2WZIA 4LK4A 1NWOA 3IV3A 2BY3A 3OLIA 1SXAA 3O9WD 3O45B 1VGAA 3VIHA 3MSYA 4WY0B 4N42A 3H6JA 3KVDD 4S1DC 4M5YH 4U5KA 3FT9A 3IJYA 3PAJA 3S47A 3HV9A 4QJ5B 2BNRD 2XACC 4ATLA 4AC2A 4Q97A 1H5VA 5D8WA 5IMOB 4MYPA 4HKZB 1NF0A 4P9HH 3BQ6A 2ATAA 1OM9A 1OD9A 4HIXH 1OIOA 1GW9A 3IUHA 5LXGL 2WO5A 2H0JA 3WNIA 2DD8H 4WGVB 2EEAA 2BZ7A 3P3YA 4NO5A 4QDMA 1E6OL 3EFDH 1YY8B 3XIMA 3JWOL 5F2MA 3BPLB 2WYSA 3EO9H 2GT9A 4G82A 4L65A 3VOIA 2APFA 4HS3A 1XLGA 1EA9C 2E77A 4KERA 2VR5A 3ULVE 3R13A 4FTVB 5C2GA 3C12A 3W53A 2HTKD 3MVIA 4HMCA 2PO6D 4YMZA 3WEAA 3WKZA 1VFUA 1N82A 3BH9A 4L5FH 3I6LD 1TZ8A 4XPAH 2ZTBA 1J8VA 4AZ5A 3C09B 1T4KA 1EDTA 1HFBA 3M86A 1CI1A 4RXGA 4HIBA 3SGEH 2WWDA 5IJCC 2YPLE 2DUXA 1LP6A 4J2QA 4N0UB 2O9TA 4LOCA 1S38A 1KCUH 4YSOA 4TSBL 3PHSA 3WQVA 5C0GA 5JQIB 3TWCH 3P0XA 5C0FB 4MASA 4PP1C 2NCMA 3OZPA 4FYSA 2ALDA 3VYNA 2J7HA 3ILQC 5JIPA 2CUMA 4LHQB 2WO4A 2WWCA 1CXHA 4NKIH 3T4AA 2IKHA 4WW2B 2OJZL 2P5WB 2IPTL 4H2HA 4LCQA 1U8CA 5EF2A 3QUZD 1A5OC 2G95A 1YQVH 2CHRA 4IQHA 2HMID 2JBMA 4NAEA 2K3HA 2OSLB 1UPPA 5F7FA 1L9PA 4G9PA 4I0PC 3IRDA 1HILB 1U0QA 1T4WA 5G4OA 3MWAA 4TPRH 4FEMA 4A6YB 5LG6A 1J8KA 2V4LA 1OAZL 2DW5A 4O5LH 5ITBH 3ZE1F 3HCVB 5G5IA 1WPCA 3K4DA 4WDWA 1S8DA 1H6EA 3O11A 2IGFL 2VRQA 4N6FA 1WG3A 5I0WA 4UMAA 2UZYB 3NNTA 2HT3C 4W9ZA 1BYAA 3EH4B 4B0MB 5EB8A 4CVXB 1S5IL 5F44A 4ES8A 7PTDA 2XV2A 1WWAX 2JIXA 3F12B 5HA7A 4GQBA 3FFDB 3SYAA 2BMKA 4MX7B 1CFMA 5GSRA 3PB0A 3TN0B 4GMSL 3N19B 4MJ6B 5FJTA 1XH1A 3KL0A 3UYPA 1NELA 4HU0A 3ULVL 4Y96A 2Z0BA 3ZJ6A 1KGJA 1TQUA 3T3ME 4AW7A 2ZA3A 2OMZA 2I60L 5JW4M 3CFCH 1HAUA 3FTUA 3KZ8A 2EEFA 1YUKB 1I3UA 4N5UA 5EFDA 3TV3L 4XWGH 4CSSA 6TIMA 1Q9OA 4Y1AE 3GVRA 4ZTOL 4BSVB 1BAFH 2J9XA 3NYDA 6PCYA 1S6NA 3LCLA 2WC4A 1JK8B 1CXEA 1GS6X 3ZKXB 2QS8A 4IQEA 5T1KD 4OLUH 1BZ9A 1BFSA 5HY9A 3KLAB 2R1PA 4WY7H 3EO1A 4KKPA 1C93A 4QKTA 1QSED 4OAWB 3MRCA 3KX6A 4MDJB 1JI2A 3TIDA 1OAYH 4KY2A 2CDEB 3BVDB 4YHNA 2OCCB 2ZZ5A 2X4TB 5ISZD 2X6BA 1XLMA 5GGSY 3NDZE 4G8IA 2XIIA 3CTLA 3NFPA 4WI9A 3SJNA 2ZKHL 3M0KA 1C8QA 4PFHA 4HGXA 2HK0A 2J6WA 3M47A 4UB0H 5B38G 4QTHA 1H7RA 4PYSA 3RPMA 3ALWA 1FWCC 1WRFA 4LVNB 5C86A 1BQHG 1LTXA 4WNQA 1HK6A 2FX7L 4EIGB 3MSGA 4PJ8D 4HOWA 2ATPB 3ANVA 4G2DA 4LSPL 1O6SA 3D0VB 4B15A 3RUGF 1JVKA 5ABAA 4G11A 1QLEH 4WHDA 1TEGA 1ISXA 1RMFL 1SXNA 2F1AA 3CQFA 2VX5A 2HNEA 3MRDB 1MCHA 1QO5A 1IVTA 2UX7A 2X3BA 2REQB 3LB6C 3VA8A 1AIZA 1A6VH 3RIAK 4NQQA 5A1AA 4NO2A 1XIHA 4R3SB 1KEMH 2JE8A 4KV5E 4Y19E 5KBLA 3RWFA 5J9PA 2O56A 1D2OA 2AXFB 3CZFB 1SJCA 4JK0D 3PWPE 3CUPA 4BR1A 3GBDA 4X63A 4G80B 3GLZA 1U8JA 4M9PA 2RA1A 3VXOA 4LOUD 5DHMC 4UILL 4M7TA 1AG6A 4CVUA 2N59A 2HT4C 3BKYH 2VE6A 1BQRA 2XSKA 2G3IA 1MCOH 1ACYH 4S3GA 3STZB 5FF4A 1T5WA 1AFVH 4AZUA 4ACYA 1Z32X 2J4GA 5IB4A 1QLFB 2ALRA 4KQ3L 2YL8A 5JIKA 4UT6H 5F9JA 1ITUA 3LMZA 3ZJ8A 2WJZA 3GXUB 1XBRA 5F7YC 2XZ9A 1QAPA 2J7DA 2Z2BA 3QNZB 3UVIA 2X1PA 4WFFD 2ZF9A 3TPUA 3RY6C 1OGAB 1QWUA 4N1EA 3VXSA 5IOPA 2QUUA 3PWIA 5EA0L 4HLJA 5HHMD 3R12A 4ZENA 2Y5EA 3IDXH 5I17B 5SWQB 2GDVA 2Q0ZX 2DKUA 4UCFA 3VFNB 4NZ4A 1FCCA 4AQEA 1U3HC 1EDHA 1NGWA 3B03A 5JVLA 3FB7A 2P45B 5JYMA 5I73C 4IU2A 3WFEH 4LUTA 4JRLA 2XKNA 4U6XB 4FR1A 4LKCB 3WD5L 3WJMA 1WKYA 2LU7A 4PMYA 4ODHH 3EJZD 2GGIA 1JDCA 4KAQL 3LBCA 3PXLA 4F2MB 2G0WA 1JBJA 1IBGH 2V7HB 2WVSA 1F13A 1H4PA 3V52H 4Q2ZA 4UF7C 3T7VA 2XRAL 3MLXL 3RCNA 4RMSA 1F2XK 4LSRL 3VE0B 3W1AA 2XXGA 1FNGA 2X88A 4D9LL 3EOUA 4Z17A 3GI8L 4H9TA 3SJVB 5D6DC 3SYCA 1BJ1J 3ZJAA 5FIEA 2PP0A 2WLKA 3K13A 2W88A 1VFOA 2VLJA 2EINB 4YXLH 1ZV9A 3BAWA 2MMXA 3CWOX 2WQ8A 4PZVA 1V8HA 4EDXB 1VACA 1E5JA 4KRPC 5GZOD 4M7LH 2FHBA 2W1NA 3QIUA 2OMUA 4IK6A 2HFFA 4RE4A 1WTLA 3G5EA 3LQGA 1OC5A 3C5ZD 4CKQA 5I24A 4APXB 3VNDA 1ECZA 5C2XA 4ZUUA 4NAQA 4CBZA 1MCNA 3IXAA 4I5BA 4IJCA 3T78A 3QV8A 4YR6B 1IBBA 1E8YA 3LNMA 3GS6A 4Z7QF 1BOYA 4WTZG 35C8H 1RZKL 5DZAA 5KOMC 3OPZH 4FNLL 4JY6A 2Z91B 2ZVIA 1WT5A 5I3JA 1W1TA 2JI2A 2QVFB 2BZNA 4RRPA 2PPGA 1F1GA 3T42A 3ESNA 4NNCA 3IWVA 1PE1A 4Z0BH 2QFPA 1JPHA 4HW6A 4NKMB 4GYPA 1G7IA 1JG9A 3TO2A 2NY3D 2PR9A 4ONGH 1J8HE 4FQ2H 2OLSA 3UBXG 4EPBC 5E00B 3MCNA 3RPIB 1ASQA 5AZ2H 3PL6A 3OKLA 2VMFA 3WQ5A 2KH2B 2JNZA 4PJ7E 3WFHA 3V8CA 2H6RA 3FCBA 5DC2A 1HHKB 2C7UB 1BPLB 3GT6A 5AKRA 1QKZL 2WQWA 2J8OA 1T1XB 1O1ZA 3PCYA 4OCXL 3NSXA 5DSCB 2QDGA 4D8LA 5I1EH 4HCIA 4OQTH 4H8PA 4LCCB 3R8RA 1K4CB 3WFBL 4N2GA 1PSKH 1K9EA 1RZJH 2VDHA 5GS1A 5E7BA 1WKDA 2VYOA 3T6WA 3GG8A 1G67A 1OX4B 4WEUD 3W7RA 5FM8A 4LUIA 3C6SB 3B2XA 4LVFA 1K77A 5C0QA 4UUJA 2J20A 2O93L 1H0GA 3W11C 1UA6H 5C09D 4DCQA 3RDTA 2CH8A 2HZGA 2HKFL 1KLFA 2O9OA 2FRGP 1Q1PA 3RTQA 5DMNA 2VSCA 3MQIA 3N44B 3VIKA 5DHVB 4K2SA 2P88A 4Y9GA 1J10A 2AV7B 4MCZA 3U5YA 3B8IA 3V0JA 4HBCL 1T5XB 2FDBP 4YSCA 1AZUA 4UNVA 3MDWA 1XR9A 4OT1H 4W5UA 4PLOB 4UFJA 3IJHA 4RL3A 4LEBA 5HYJD 3KBJA 4Y4FB 4AC4A 5FHAL 3LD8B 1CL7I 5ECGA 5BW7C 1MFMA 1R19A 5DJZB 4EXQA 1KELH 1SM3L 4N1HB 4DPAX 3WN5A 3KLLA 4DJEA 5DK2B 3M5YA 3KL3A 1GZPB 3ZDYB 7TIMA 2P8LA 4M62L 1DCEA 2GFTA 3EA2A 5D5MA 1ILUA 3VYOA 4LSVL 2I5GA 3LZNA 4KDWA 3LN9A 4XR8C 4HC1L 4J1OA 2PDUA 5A8OA 5AAPA 4QI3A 1JNJA 3BPNC 3D33A 1CFTA 4OVXA 2CBOA 5JQ6H 4M6ML 4WDIA 1N5YH 3NT0A 3SBWA 3GYCA 4IIFA 4P2QD 3II1A 3CAWA 1XB8A 2A1WH 5D1ZA 2VERA 1EZVY 3BYTA 4TUFA 3ME0A 1J2BA 1EJWC 2ZXGA 3BEVA 1JUBA 4V33A 3S4SG 3QH2A 2Z7WA 3QDME 1WUNT 5GPRA 1XQKA 4KESA 3FT2B 1VHNA 3Q2DA 3IN0A 3NN8A 2P8MB 4R0LA 4FX6M 4IU3B 2GITB 4K94H 4JO4L 4M48H 3BE1H 1IGJA 3QO1B 1BX2B 2DQWA 2OX4A 4AD4A 3WXWL 4D2NA 2I5QA 4I5XA 4I6KA 1YEIH 4X2RA 1B4JH 5ENWB 3T0BA 4ZAKC 4JTGA 1H63A 3MRBB 4KKRA 2O5XH 1XBXA 4YDIL 2MPAH 3D2UD 4EI5A 4O52A 4DP5X 2HJFB 2BSTA 4RDQF 3UTQA 2QGYA 3VFSB 4F48A 2DJXA 4TVUA 4TVSa 1R3LA 4JS3A 1TV4A 2VC6A 4GQZA 2EDDA 2UZIH 3FW6A 7ODCA 3QDJD 3P77B 3CLMA 1G1OA 3TA3D 1HXJA 3QPQD 3MA7A 4P5MA 1EJ6A 4P06A 4IBYA 5B38B 1E4LA 3NO1A 2GK2A 1R3IH 2XZ7A 2CDFB 5EEUA 1EO7A 1CWYA 2PXYD 4J27A 2XZCH 4RX0A 2QAPA 1EXHA 2J4WL 3QZBA 3MI2A 3MJYA 1IEVA 4RCAA 2JF1A 1PB0A 2OMWA 2R23A 1DWGM 1KENL 3TYDA 3TBYA 3B3IA 1AHMA 3UTTA 1B2YA 3IDIA 2GAZB 4LBEB 6TAAA 1OSZA 5KANI 1D5RA 3LS5L 5D5MF 4J3BA 1QPRA 4MWAB 1W8OA 2PEVA 5JBEA 2GOKA 2VDQB 5MENB 5GS0L 4AZCA 3QFJA 1T2JA 1T6BX 1KC5H 2ENSA 2IBZY 3K2IA 3U36A 3RFZA 3HRPA 3MYPA 3KCJA 2ZICA 1OCBA 1WLHA 3BLPX 4LDCA 2YGPA 1YKWA 4JQVA 1V0LA 3K6OA 3E80A 2WLIB 2R8WA 3CV6A 5IBXA 1RPUA 3ISYA 3QCTL 2CK0H 3VKCA 1K6QH 2R4SL 5BNKA 3MRHA 4PHZA 1LOSA 4WK9A 4IDJL 1SLUA 3BWSA 2IMRA 4UTCA 3W28A 3QM3A 4F8XA 4JREC 2NR6C 2G30A 5CP3H 3VGGA 4DNMA 1AHWC 4RVBA 4F0RA 1CBVL 3GIPA 1P7KB 2G9HB 1GYNA 1FCGA 4DZHA 1DVXA 2FZ3A 3FMGL 5G1MA 5I16B 2YD5A 2FPVA 4Q4PA 4LT7A 5AVNA 4NIYE 3ZMEA 2CO3A 4NQCD 1SMOA 3TJPA 5GZND 3MRKA 4GW1A 1B4RA 1IXPA 4Y5YA 3GUFA 5H4YA 3Q65A 3VAEA 2IF7A 1QDSA 4QHLB 3JWNH 5IB2A 5IFTA 4HF5H 2FL5A 1UWAA 3S3PA 4GG8B 3Q3GB 2VX4A 3VW3L 5KZEA 1EEXA 2PDGA 4H8QA 4PTXA 1A49A 1R24B 4ELMB 4AYMC 1V55B 4TUKL 2UWEA 2DQUH 4UYPA 3N41F 4OBRA 3NCFB 5M95B 3SQMA 3LIZL 4K37A 5IBLD 4PWFA 3P4OA 4JKPH 5DVKA 3VCRA 4ZR8A 3RLHA 5IROA 3RWHA 4QRRD 4MA1C 4YQXH 1FFNA 2EDMA 1KGUA 3NQEA 3GRWA 2G4EA 4LP4A 3GS0A 1MI5D 4Y90A 1VEOA 5I7GA 4AV5A 1F11A 4GKSA 1AS7A 5E6IA 3OBEA 1KPVB 1LT7A 3O3EB 3L6FA 1DVFA 4OFIA 1G7PB 2A6IA 5MHSD 4XI5D 4Y9EA 1A6TB 5BQ7A 4NYLB 3B0VC 1MQKL 2OW6A 3A13A 2FWSA 4XH2B 15C8H 1KTDA 3V0FA 3MRFB 1HO4A 4GSXA 3UC0H 1MFUA 2EDNA 2C5DC 2WMPB 2PDHA 4J4PC 4B7LA 1QXLA 3KVKA 4K68A 3KPRE 4BIKA 3ZR4A 4KKBD 3PJWA 3W29A 1G9NH 5HSFA 1I7UA 1RQBA 5HNTA 4G6KL 4BUHA 2A9AA 1MFBL 3U0WL 2ZWNA 4RISL 2WUCL 4FTVE 3MLZH 3WTYA 2GJ6A 4JFEA 3GUTB 3EHBC 2W0FB 3IE4A 1UWXH 2OV0A 1ZAGA 1ZDQA 3DIPA 5D7KE 4OFCA 4CCDA 4BZ1H 3J7HA 4HJ0C 2HXUA 3BIKB 2VITA 1KLGA 4N0UE 3NQGA 1Q4WA 3KR3L 3B3DA 1XR8A 4C4KT 1A4JB 2XWJA 1US2A 2GVJA 5EO0B 3UBXB 3OOQA 2WAGA 5CEYB 1UB5B 4NS0A 1EOKA 5CJ5A 2NXYD 4U49A 4KDVA 2YWYA 2PFHA 1FH2A 2CU0A 3I02B 1ZD6A 4AVKA 3NFNA 1NGXB 1VDGA 3QZNA 3L0NA 2G5UA 3BQUB 4A35A 1P48A 4WXZA 4ICWA 4IBQA 2F5BH 2XVGA 2GTZB 3I6KA 3M0IA 1T83A 3UBFA 5B21A 3NPWA 2UWEF 4DKFH 3IRCA 1PKNA 1TZOA 2C1PB 1BBJB 1A5UA 4KDTC 3WE6A 2ZOKA 6PTDA 5CAHA 3NIDB 4GP4B 4E6MA 1XG3A 1BWVA 4IMKC 2CMRH 3G8RA 4ONHB 4HLZH 2IXQB 1LNUB 3L5LA 4NN5C 4HUUB 1DEEA 4FIRA 3LV5A 1X5LA 1EUUA 3E0GA 3WL9A 4ALAL 2XTLA 4WW1B 4ACPA 1WVZA 3EYOA 4MYAA 2CO4A 3UMNA 3RL1A 3S88H 4EIUA 3AWEA 1BXAA 2NV2A 4XP5H 5F9WC 2EKSA 3FRUB 2OU4A 3VG0H 1HZKA 3VX1A 4O9HL 1FZMB 3UZEA 1NKOA 2WYZA 4XCCL 4XTRC 3GB6A 4KJQC 3LQZA 3TVMD 2JSFA 4B3ZA 5IDIA 1RD6A 5KVGL 2DQHL 3LCIA 2UVEA 1H11A 1SPDA 1TIWA 3MBWA 2IDTA 4KZDH 1QD0A 1BIIA 1QVOB 4CNIB 5I9QB 1LWHA 2VRKA 3N25A 3ZE0E 5FYJE 1K72A 5B7EA 1NGQH 3F7VB 4LVGA 3NMEA 4OVUA 1VBGA 3EJYC 5DHDA 4U1HB 3VDAA 3BUVA 3CV2A 4YWIA 3JWOC 4HISA 2VTFA 3VXUB 5FGCE 5I66B 1WXJA 1E9IA 3I7RA 1AZ2A 3IUIA 4C6PA 1QEWB 4BFIA 3CX2A 4JHZA 1MW1A 1CGWA 1Y0LB 3MR9A 4PJ6A 2G50A 2NY7L 1J7VR 4O1CA 1ZOXA 2WZHA 1ED3B 2YL9A 3S4SB 2PRMA 3KWSA 1X5ZA 1U8NB 1A0CA 1TJHH 3BVWA 4HS6A 5MI0B 1H0DB 1R5VA 4OE7A 3GUWA 4YCOA 3IS1X 2V2CA 3SKJH 3FSUA 5CSSA 1ICQA 2ARWA 5K4XA 1P1ZB 1I6NA 3TZVC 5F89B 3W82A 4QRUA 4D8ZA 4AZHA 3BL3A 4HPNA 5PTDA 4G8GA 1FCBA 1MCEA 2EXWD 4XAWH 4OWGA 3DJSA 2W27A 3H2NA 1YECL 1XPYA 3LV3B 1LGVA 1G7LA 2YEVB 4ZFFA 3KFTA 2H47C 1FYTA 4KQ4L 1HZLA 5L9DH 2RIKA 3GAYA 3ZTEA 1LD9B 3C2RA 3FYYA 1PL3A 4JEGB 4IGBD 2QKIC 1OANA 2HWZL 5DS8A 4HKPA 3GSXA 1F6PA 5FEBA 3ML9A 2J7GA 2EZ0C 1GVSA 5D4HA 3LBOA 4QJ1A 4YDJA 4MOZA 4A21A 3CLEH 5JPNB 3GNML 5DK0A 2DZAA 2NX1A 3UG4A 4MBOA 4A2FA 4R97B 4MZIA 5K9OB 1PG7H 4NJHA 5ESVB 2GCYA 5FYJL 2VVSA 1LYQA 3RTLA 1KN2H 5HHOB 2P28B 3I9IA 1JYWA 1KBVA 3WLNA 5I76B 4WU5A 4N9OB 4V1XA 2AS5M 5C97A 1ONRA 1KJMA 3ARBD 3UOAB 3T8XA 5I02A 3J07A 3ULVC 1SVCP 1Z3GL 3CSYA 4QOKA 2V0AA 5CXPA 3JV0A 3GMRB 2YCLB 3GHBL 3O0KA 2H6UA 1GC1H 5HD8C 1B0WA 3ABQA 4WV1B 1JXFA 4RK8A 3AREB 3VTMA 4YVNA 3QXDB 5KBDA 1CGSL 3V75A 1R5WA 1QQDB 1AZZC 2JCWA 2JKIS 3KDMA 2P0IA 2Q9OA 2F54A 3BUTA 2QCMA 4FA3A 2H8PB 4OD3L 3UJJH 4MNQD 3PHQA 5FF2A 3BQ5A 1JPMA 4KBPA 4A04A 1YN6A 1P0NA 2NQ5A 5KVFH 5DURD 2P4AB 3L48A 2V5JA 2VXNA 3EKCA 2EDJA 2QZQA 5G55A 2XTJC 3W81A 3URNA 4JX0A 4OSUH 4H9ZA 4HJJL 4ZE5A 2XWDA 3BGMB 3PAYA 3BH8B 2A73A 3RI5F 4IRJB 2C3XA 1RZFL 1U1JA 3LCGA 4J3WA 5KTEL 4AGPA 3LSOA 5JOFA 4PBFA 2XQ0A 1QSFB 4L8DA 3WIHL 1DL7H 2ZZ1A 4KJYA 4NYUA 5U7SA 4R7XA 5E2TH 1NQBA 1U8IA 3D18A 3V9CA 3VDGA 4KKAD 2EILB 1TKWA 1QRNE 4PV1C 1ZVSB 4WSHA 3VXRB 1N68A 2BSSA 5IW6A 1FVEB 4FXGB 3WLBA 2B9BA 3NJ3A 4S10A 5DO2C 1YZZA 2BVOA 1EFQA 1Z42A 3FO9B 3SPCA 4LVHB 3SJVE 4K23H 4NKOB 1OYCA 3WQWA 4C6CA 4XVTH 2ZKWA 2M8XA 4EWJA 1X6UA 2A3HA 1AQFA 3GD1C 5IF0A 1YVLA 3N17A 3KUMA 1COBA 4Z7UF 2NPLX 5U4NA 3QJUB 1XGUB 4M7JH 1E4JA 4KCVA 4X5QA 5BOFA 3K71B 4TQEH 5TH2B 4ZS7L 1DBBH 1UR3M 1MRCL 3ZBMA 3CYVA 2N56A 3ITYA 5AC7A 3UJIH 3RGBA 2XJLA 4QTIH 3CLFL 2I7GA 3QUMA 1OFQA 2DIAA 1RULH 1XC6A 1NBQA 4Y9FA 5BRZD 1TX0A 1CFNB 3A4FA 3F85A 4NHUB 3SO7A 3UG5A 4Z78B 3KLHD 1ORSA 3MGTB 3SDCB 2VP8A 3P3TA 4RWHA 3DH7A 1JZHA 5XIAA 1XEDA 1XGPB 3EBHA 4HJEA 3IDYB 1AL7A 1QNZL 4OJEH 3DURA 4HUXA 2VZ3A 2GQ8A 2OQJB 2BINA 4PMEA 5LBVA 2IG2L 2R2EB 3DYMA 1J2WA 4UV4L 1MXSA 5H2BA 3IJSA 3P30H 4HEPG 4PGCB 3MCLL 1FWJC 1EJ8A 2OPCA 1AGDA 4HUVB 1E65A 5SX5K 1D9KC 3NCJH 3GSNB 2A79A 3I85A 3F64A 4XWUA 4EKJA 2PN5A 1Z3RA 3IETA 3QDGA 4F66A 3SRFA 2VX7A 4ZPTA 3NJHA 3OXSA 4ZS6C 2ERJB 3CS2A 1TG7A 5EOTB 4CNOA 3TDFA 3UWZA 2N01B 3QXAB 3L3IB 4NENB 5KYWB 2IAND 3ZJKA 5FF0A 3NJLA 4WCYL 1MWAB 4DO7A 4XZ9A 3MYJB 1X4XA 1MRAA 1B5TA 2EPNA 4QXTB 4EMZA 4K5OA 1NANI 4MJIE 3HE7D 3NGBC 4GXUM 1J0IA 4UU9B 1XIWB 3GHPA 2YCEA 3T04D 2DMHA 4JKNA 3GF8A 2BG5A 4LGRB 3DVIA 2WXPA 1R3QA 5ABZA 1A7NH 4YK4B 4G70B 4RGOH 5FDWB 1R8LA 4S39A 4K3DH 5FB8A 2A0NA 3ZIZA 2V5TA 1LQSR 4P5SA 5L6UA 4AHPA 1H3VA 4R33A 1QMUA 2WB7A 5E4EC 5HJBA 4H9MA 1YNPA 3ARWA 3GZ3A 4H25A 5DUPH 4MHHI 1F76A 4E2DA 1TMQA 2OZ0A 1JRHL 2Z1SA 4KJWD 4JGNA 1JPGB 1PZSA 4J35A 1B6UA 4XPFL 3U30C 2E3VA 5EU6D 3N3TA 3WQGA 3VFGL 2QULA 4MAUH 3LERA 1QHQA 4NP4H 4M8QA 3KS0J 4XCYB 2YLLA 5DYFA 3WH9A 4OGZA 3ETBJ 4U0QB 3T65A 1FCQA 2A3CA 1T66C 1P43A 2QPDB 3ZDYE 4Z3HA 2C0AA 3GMMA 4JTDA 1ZAJA 4A2SA 2X1OA 3K2UL 2TRHA 4FKEA 3GBMH 1KGWA 4LCVA 5AKVA 3SN6N 4XCNB 3L4TA 4GKNA 2HVJA 3IGHX 6PAZA 4BF7A 3VJ6B 2NY2D 2DT0A 2VC5A 4GUJA 5L6YH 4CADB 7FABH 1H50A 3DIFB 2BB0A 1U8QA 5DMGC 1EX5A 4PMOA 4JM2F 4LGSB 3QQDA 5LCVA 2VLKA 1MFEL 3S37H 3BP7B 5FI8A 3RX3A 1DE6A 5ITFA 1OAUH 3CMJA 3DX4A 3L95A 2X87A 1P6WA 1JVLA 3ASNB 3AXIA 1L7IH 5I6KA 1KBGH 4L3CB 2E6AA 5ACLA 3WSQL 2KZ1B 5ID0A 4PN2A 3IJ6A 1LO3L 3R0KA 5A8MA 3X12B 5L2KA 1KJ2A 1AZ1A 1TWIA 4WVXA 2NUPA 3S35X 2X4RB 1E0UA 3Q01A 1ISWA 2Y5TA 1JRBA 1V27A 1W2VA 3ISIX 3E1F1 1HI6A 2QTVA 1IC4H 5DZPA 5K39B 4GUFA 2YW4A 2PE4A 5B4MC 3M41A 1HUVA 3GMPB 3QWRD 2BNUB 3NEOA 1G6RA 4G6CA 4RAUB 4QXIA 4MNHB 1EX1A 2DI9A 3BZ5A 2ZWZA 3LZFL 5D7JA 3G5ZA 3VE9A 3H9SB 1TVHA 3IVUA 1XLDA 4WHYG 1PZUB 1CDCA 5I5RA 1O6VA 3GSOA 3AMLA 3WMLA 2JJSC 4JNZA 2QDWA 2D8KA 5HI4D 2ADAA 2ZG1A 2C4FT 5M03A 5F7HA 3VNIA 2OQLA 3DC8A 3QRHA 3W6MA 3BO8B 3TF7C 3U9UA 1AH1A 2VXTL 3VH8A 3V5OA 5I71C 3GDMA 1S7UA 4GT7A 3UBHA 2H26B 1XSKA 2FWOB 2EDQA 3GXPA 4K2UH 3LN5B 3ARDA 3LS4L 2WCPA 3O9WB 1F3RB 3T44A 2WYHA 3S96B 3RN6A 3VFLA 1LUCB 4OZ4A 2RACA 4GH3A 4H7CA 5D93C 1MWOA 2WTOA 4N2CA 4HJWA 1FPTL 1C92A 3RKDC 1SN2A 4D0DB 3MDUA 1WAUA 1XIEA 2VSKB 1F1AA 1AIFA 2WVTA 1NCDL 2N7BA 3EPOA 4MWAE 1SJEA 1EYEA 2DZVA 2ZONA 5MENE 2R0LH 2OSWA 3UESA 4W6YB 5L88H 4NIRA 1I31A 2G5WA 1MZRA 4NEHB 3PXHA 1GEQA 4XZNX 1MCFA 2NW0A 4KWVA 3AU0A 1N7KA 3C60B 3TZNA 1MQQA 3WMQA 3DCPA 4Z7WA 3WJJA 3BLEA 3WXVL 5IW1A 3CHPA 1U8HB 3P9LA 5B7YA 1K8ZA 2UY2A 2PDPA 1SW7A 4BEUA 3SCSA 4RGND 4YE4L 5CGBA 2SFPA 2B15A 5EOCJ 4OUIA 4OF7A 3A0OA 1X5MA 3L7FA 5I5MA 1RVFL 4XB3A 3HTWA 3OF6D 4YHKH 4QWWC 3V5KB 4IQLA 2VGFA 5HYSG 4PIRF 1BAWA 3IARA 3UFIA 1MQRA 4GHRA 5A2AA 1JGMA 2SODB 1YSOA 5CP7B 1RP8A 2PP9A 4PB0H 1SJXA 2Z8SA 5HTSA 4UTUA 5HJDA 3ARXA 1ZHLA 1UD8A 1IEIA 3NPVA 4X7SH 4OUEA 1UJPA 4R4FL 1LEIB 4ENEC 2FZBA 3WX7A 4Q8QA 1O7AA 2J7BA 3UWYA 4OZFH 1ZE3C 3SE9H 5AHEA 2P50A 4OZHE 2QSTA 3QQNA 2UZPA 1F8MA 4HUWB 1W72B 1NFIA 3QUZB 4K7VA 1ZS8B 2XTJE 3W5NA 4JDZB 1UMYA 3IJ7A 3E5PA 1L8NA 1Y5VA 4PJDB 3ES6A 3O6LH 3EUDA 4Y4KC 4O02B 4ELME 3US9A 1TVBA 3QWOA 4DXVA 2XFWA 3QW9A 4FL4C 3IPFA 1CIUA 3NPSB 3O9NA 3F2DA 2Y06H 1KFJA 3H12A 1FBIL 3V3WA 3THMH 2VDQL 5I1CL 1MHEB 4IT1A 1HSAA 4G8AC 3LU2A 4YGVA 3KYMA 4MXWH 5CMAB 5FGBA 5T8GA 5CJBA 4JW3A 4Z95L 5E1HB 1MCQA 3CQHA 3EZ8A 4B9CA 1OD8A 2PLJA 4TV3A 5KSAC 5ECUA 3C56A 1T2QL 2JELH 1BWLA 3HRZC 2CUHA 4F58L 3KPTA 1KXHA 1NIUA 4NZ1A 1BBDL 3FLUA 3NAAH 3QCUH 1AO7E 5TDNA 1F8IA 4G6MH 1Q0EA 1XSOA 2PDBA 2ATKA 4GD0A 2HDJA 3B9DA 3TQKA 4W87A 5GS0C 3M5VA 2IGTA 4IP7A 3ZDZB 1LRNA 3EJJX 5E95B 4GI4A 1YX1A 4E41A 2LLNA 2PP3A 2JALA 4UFHA 1DR9A 2A85A 1LL1A 1HKFA 5C7ZA 5G4MA 3SCMA 2BNQD 4KCTA 4RNHA 4ZNCD 1PSCA 3PN8A 5L9FA 1V05A 2EIZA 1KQYA 4N3TA 3BUYB 1RJLB 3WGVB 5E5MB 2CNZA 4LF1A 4FQCH 1WFUA 2DICA 1E0TA 2HX8A 4D6GA 5I1GL 1U22A 2LU5A 3U7YH 4Q89A 4TNVK 1I9JH 4HIHB 1YE6A 1GZQB 1JSYA 1AXIB 1DBMH 2ZRYA 3V0GA 1WWWX 4R84A 1L9RA 1QSEB 2CRMA 1IEBA 5CD5C 4LCWB 2DQDL 3WNKA 3KPSA 1GL4B 3T0AA 1NGZB 4NAJA 4DEPB 4N9EA 3CVDA 4YWGH 5KBKA 1G43A 4GQQA 1VHPA 3MXWH 3LMJL 4ZD3L 2A74C 4I18A 5ISZB 2DL9A 5A6SA 4UMSA 3HUJA 1KA9F 4DP2X 4E9YA 4JN1L 3S37X 3H7VA 4WI0B 1N12A 3HR5B 4N2KA 2WMIB 1BOGA 3CUFA 4L4PA 1W5OA 1UQZA 2MQGA 2ESCA 4LSQH 1KBPA 1OP5K 3B9AA 1J5CA 1ASOA 4ETQB 3D2TA 1GH7A 3ZOAA 4DXKA 5J1AB 1H62A 3ZUCA 4ADIA 3NIDE 1T3FA 2VR4A 2PWEA 3LZQA 3DX7B 2NWSA 3R4IA 3W7PA 3SFKA 2GJXA 4ZDHA 4KGJA 2F6AA 3DGRA 4XV0A 3JUGA 4XAPA 2DZUA 2BVDA 3Q67A 4FALA 1P84J 3UXAA 3KPMB 5LA0A 3IKCB 3CVHB 3OJDB 3A6CL 5E1QA 3FB6B 1FZJA 5EZIL 2X4QA 5DRXA 3EOAA 4JGUA 1YJDL 1R38A 2GK1A 1NAMH 1ETZB 3DFSA 4HWUA 3PDOB 1IT9L 1BLNB 3CQPA 5BOJA 4XRCB 1UJ3A 5DXYA 3UR5A 1RCQA 2GI7A 5SX4I 3Q1EA 2JFCA 4POZC 4DAGH 3HS0A 1E27B 3KVQA 5IT2L 3FEQA 4A38A 3LHYA 3O2VL 3UZQB 2RDXA 1DZBA 4MFEA 3FTGA 2O6EA 3MJMA 3HZMB 5DMKB 1ITQA 4LRIC 2CLRB 3ARGC 3EA1A 2CR0A 4ZMTA 1ONXA 2ITFA 1G4PA 3BSZL 1EXBA 3BWUF 4LLWB 4HHAA 4WUKL 3W39B 1PUDA 3BKMH 1A9EB 1T5AA 2D0GA 1GT8A 3CDFA 4ZK8A 1ZKAA 3ISRA 2BZCA 1BCIA 5AOIA 4ZW3A 3VXUE 3MVSA 1ZEAH 2I14A 4JY4B 3VFRB 3RGTA 3IJ9A 1TVDA 1FGNL 1JERA 4NP9A 1US0A 3NQKA 3EGXA 3D9AL 5D7SH 1BM7A 4E3TA 1Z9PA 2ITCB 2RGSA 4PL2A 1HCYA 4OU1A 3W7QA 3GBNH 3OGCB 2FZ9A 5HHMB 4LLDB 1A5AA 3OX8B 4U28A 2K1MA 3HMXL 2CBMA 1A8JH 2GK0B 1UWFA 4W9KC 4Y2DB 3GHSA 5E0CA 3UW6A 2FT8A 2GPTA 1PWLA 4ZFOB 1KCBA 1BEXA 3V0VA 3T3PF 3NJFA 2RH9A 1QZNA 4G1MA 1J5HA 5D96C 4X50A 1TQWA 4MNMA 3LHPL 4XGZB 3W38A 4TV5A 5AHIA 2WM0A 1TZHB 3DYOA 1C8PA 2F53B 5CZKA 1MVUB 4IRSC 3GRWH 7ENLA 3VG9B 3OIXA 1A4LA 1NUNB 4Z6AT 4KGLA 1BIHA 3EMQA 1P4CA 3HHMA 1FIGL 5GISH 3O3AA 2PWGA 4GBXA 1FG2B 2WHJA 5DC4B 3ULUL 1PYFA 5LBGA 4Q6KA 1FO0A 1OAJA 1FCUA 1XGQB 4E8DA 2W92A 4F2TA 3V9FA 4I8YA 4O1DA 4PRAB 3CZNA 4L9DA 4F40A 2LR4A 3MDJA 1SHXA 4ONFH 1IMHC 3NQCA 1YNKL 1XGZA 5CBJA 5H4ZA 1HNYA 4XPBH 1LO5B 4ZW6A 3M88A 4G3YH 3EZ4A 4JFZH 4HKXB 2NT1A 3OGRA 2PYEA 1FOBA 1XRVA 2IWGA 5CBEB 2AJYH 4NUGH 1AXTH 5D09A 2AKRB 2DIJA 5HHOE 5C6WH 5L7XH 2V3DA 5IMLB 3GZPA 3D5OF 4Q8OA 5EBAA 5AG8A 4IIQA 3PBGA 4LCRA 4XIMA 4AU0A 2WHMA 4AD2A 3U1QA 1CIDA 1J0HA 1Z44A 1FHNA 2XN9A 4IGMA 1JTTA 4LSBA 2VR3A 4FQPA 2EVGA 3GFUA 2GHZA 2YSSA 2Z27A 4JIHA 1A7OH 4EDWH 4HIEA 3O6KH 1MHHA 4QGCA 1H09A 2E7FA 4X4KA 4LMQE 4F0MA 3MUJA 2WQAA 2R9HC 3C09C 3GINA 4L61A 3NL2A 3OAUL 1A7PH 1TQVA 3IDMB 3PJLA 4PUJA 2VX6A 3OKOA 4QY8A 1NMBH 1A8ZA 2OXNA 2BIPA 2D3VA 4FAMA 4NN6B 3WNOA 1JYNA 5AOUA 2XIDA 3UMTA 4UMGA 4XOAA 1RSYA 1TYRA 5IVXB 4CGUB 1FWXA 3KOWA 4K7FA 1A1OB 5I3GA 1ISYA 1T7VA 4TUJA 5K1JA 1F9CA 4AT6B 3QEQE 1KFCA 2BCKB 2NY3B 4RDVA 1G7MB 4XXCA 1E6ZA 4ZCWA 1TENA 4PRNB 4WW2C 4PGBA 3STPA 4ZUSA 5D30A 1OB1A 2A0LC 4URKA 4D9RD 3RMJA 5HYSB 1K6WA 1RURL 1DUZB 1CCZA 5JHDD 3NL5A 3BDBA 4JGDA 2WVVB 2GSHA 4WJKB 1DVSA 1FNLA 1YEKL 1GAFH 3MV8A 4BQ9A 3SAZA 4HBKA 1Q2SA 3N6JA 1J9TA 4TUUA 1Q9WB 2JIEA 1MDRA 4OLXL 4JO8A 1RJZB 1AD0B 4X22A 2QGDA 4AXNA 3F6LA 2BPBA 3PZVA 3ULSB 3CPLA 4P57B 5AYYA 1ZTXH 4KEVA 5IB1B 2G9KA 4EWND 3EYVA 2PURA 5DMLA 2OJPA 3D09A 4V2BA 1UP0A 3EXLA 5SWSD 4HIIA 4DN3H 3FN0H 1IIHA 4PGEA 1C7SA 3PPGA 3U79A 4UTTC 2R83A 2JIXD 1MO0A 3MXVL 4G6AD 3TN0C 3E9TA 4JL2A 3HNTH 3NYZA 1ZT7A 4ECNA 2RDTA 4OLYH 3SB0A 3V9EA 1YNYA 3NOYA 1ZTVA 4XN2A 9XIAA 4GJ1A 4YDNA 3Q2CA 3U4KA 4FK9A 5KN5B 1DWAM 4RMUA 5HYJB 5GRVL 4X9YA 1ZCRA 5C9XA 2IADB 3JXAA 1A2YA 1FQ0A 3AOFA 1UR2A 3FO1A 4NJ9H 2ZYIA 5B39A 3W5MA 2H9AB 4XNQA 1UWQA 2XNAA 2PCPA 5HGGS 1T04A 3G5VA 1CTMA 2Y6ZA 4QEEA 3ZHLA 1KCZA 1TPVA 3FYIB 1QPPA 1B3JA 2YPVA 3W1MA 1HJSA 3WF1A 4I0CC 3ZR5A 1VZHA 3ZKXC 2FYYB 3LTVA 4N2EA 4Z2HA 1EGJH 1HJUA 3HZKB 3R6IA 4YVPA 3TQVA 1HQRA 4OV9A 2V17L 4UNKA 4L4TA 1YEDB 5JW4Q 1TTFA 1I82A 3STLA 1I1YB 1MAML 4P2QB 4JYEA 1GTHA 4XPHL 3W7GA 5D05A 2IEPA 4Y2OB 3WNMA 3BD4A 3AIVA 3W02A 3FQWA 3BG3A 4O51A 2GJJA 3KTSA 3BSHA 1GQJA 3H8NA 2DT2A 1ZHKA 3Q37A 1OPGH 4L3EB 4AVJA 1UA7A 3ZLQC 1OK6A 3SZ6A 1KTKE 3A6BH 4APQA 2C6QA 1L0PA 4ZMOA 4LVNC 5FDYA 4XOCA 1QI3A 2VRAA 1ADQA 3TO4C 1WBZA 2IAAC 1AL8A 2CBPA 3FBQA 1KCSL 2ZCKH 5IHRA 2BH0A 2C4FU 4YZFE 3FB8B 1KPUB 3D2UB 3A4WA 3HBGA 2XG5A 4LRSA 1VYRA 4B4HA 3QC3A 3ZHFA 5FOJA 3L2NA 1ES0A 4OIIL 1E3XA 3QR1A 1CK0L 1UUMA 1XBZA 4JRXA 3VRIB 4O13A 1WA3A 1PY0A 3TA3B 3QJTB 4N0RA 2YC1B 3CMOL 2NY1C 4O4YL 1OGBA 4FLHA 2COQA 4P23A 4JG0L 3FDWA 2PXYB 2IIJA 5F2IA 2PTWA 2CZVA 1VPOL 4UAOB 4X4ME 1I45A 4YBQC 1JXDA 4GQ0A 5CGYC 4PEEA 4NAFB 1P2CB 3P54A 1JCMP 5AZ0A 3V0IA 3HMJG 1S5HB 4XT1C 4QCEA 4OJFL 5SWUA 1XL4A 3GVWA 3UPRB 4FQ1L 1EPXA 3C5JB 3D85A 1OT4A 3B4YA 2H8XA 2E5CA 1P1MA 1PLGH 3ZKSD 3T6CA 4PY7A 5C92A 3ZE2E 2I16A 3B7TA 2GJRA 4O16A 2ZOXA 1THAA 1ZVNA 5CPNA 4MZ3A 2K9UA 4ATTA 4NJJA 3GSNL 3C3NA 1T6VN 4GAYB 5FSEC 5M2FX 5AW8B 4FXKC 5E2JA 1PF3A 3ZK0A 3C8KA 4OTXH 1Y18A 3Q06A 5DYOA 4AD5A 1X8CA 3SKNA 3KOYA 1MAKA 5DVMA 5AD0A 2AI0H 1MSPA 3GD6A 4BH8A 3NZ1A 1NC2D 3P4MA 3QNFA 4YDKH 2FFCA 2AQVA 4N8VA 3SODB 2OXGA 2DYPA 1IZCA 3DX2A 5D9SA 1MWAL 3Q5TA 2KL6A 2MOQA 1D5XA 2WUBL 3OSKA 3E2RA 5E08H 2AQQA 4A2EA 1NMCB 2W79A 2XU2A 2PD9A 3B43A 1EHKB 5T5NF 3H54A 3VD2A 1CFBA 5AUMB 4PJ5A 3R58A 1QUMA 1ET7A 4XAKE 5LQBL 1SOQA 2R1KA 2Q2LA 1WDQA 1U3ZA 1X1NA 3BT2H 2WZ6A 2X1WL 2PF0A 2P7TA 1U92B 1DDHB 1L0QA 2R0ZL 1PW3A 3PFMA 2OEMA 4HALA 2Q3AA 1QOPA 2VLJD 1CB4A 1TQBB 4X4XB 2EQDA 4NXKA 1QI5A 4BFAA 4KZ0A 3VFOA 1MJ8H 5IMKB 4TS6A 2Q20A 3H9SE 3WO3B 2GQAA 3QIUD 3WQCA 3OO2A 3HG1D 4OI8A 4ZFMA 2YMXL 2I69A 1I8LA 1HHJB 1Q6QA 2BRRH 4XNMA 5L4FA 3ZDXE 1S7VA 5DQDH 4MCNA 1MFDL 1S9VB 3MLWH 1KGCD 3IRPX 3P74A 1GGCH 5F8QC 4KQNA 1TJ2A 2VJ8A 4Z76A 3WJSA 4KKLD 3D1MC 1WFJA 1UWGL 1EWDA 1P0BA 2QCGA 1XGRB 1YDVA 3GTXA 1C5BH 2Z1PA 3VWJA 4UTHA 1SUXA 1NBZB 1AZCA 1UVQA 4FLRA 5BCAA 5MERA 3G18A 3NQFA 3THUA 4JNMA 5I1HL 4BK5C 1FNSL 1ACZA 1H41A 3A4XA 3T40A 5G5DA 5AW0B 4TIMA 4OM1L 3HI1A 2CPUA 3PJSB 1E28B 1G0XA 4ZFZA 2R1MA 3SKMB 1CFVH 3AO0A 2XSXA 3SBRA 5MEQA 2R1WA 2W63A 2AJXH 5FAAA 1YTEA 4PRBB 1G9ML 3FZUC 4H6RA 4NPKA 3PUDA 2XFYA 3UEQA 2ADJA 2B77A 4XZHA 4ZO8A 2VKZG 4GW5B 3LEVH 1EAPA 3PL6D 4GSDL 3PG9A 3NQIA 5TQ2H 3MJWA 1ORQB 2O9RA 4GW4A 2FE0A 4HNTA 1TMHA 2Q02A 2PAJA 3WI9A 5HJ3A 1S3TC 1FE8L 4WO4B 3REQA 2WGXA 2JLPA 2Y3AA 2HE5A 1H6UA 4LCCC 2C15A 2J13A 4M7ZB 5KVGE 3I75A 3HPLB 3QHMA 1KG0B 2ZCGA 4Y2WA 2G2NA 1NBVH 5ENLA 4XD4A 1C29A 3QA3A 4RQQA 1W3LA 5G2HA 2VO8A 1TWDA 3GSUB 2OELA 1V7NL 4OJYA 4ZL1A 12E8L 1VQTA 1UZGA 3JTSA 3T8MA 3RU6A 2C9XA 3SN1A 2CBUA 1HIML 5KSUB 1Q85A 2WBGA 4WNJA 3SSJA 3RDTD 4P5TD 1D5ZB 4P2OB 1KZQA 3QIBA 1IM3D 1OQOA 3C2SA 3RTQD 1S7QB 5E24E 5MEOB 3KNBB 1F6AA 1A4BA 2J27A 4GZ7A 3EX3A 2P5WE 5C9JB 4DGYL 2O55A 5I1IL 2PPAA 1Z9SB 3TJ4A 1BRLB 3EYQC 1IKNA 5EZOH 4Y4FC 3QSKB 1G69A 5KITA 3AQZA 3LD8C 3MRMA 1I0DA 2Y7QB 2QSVA 1OADA 1DBKL 1BA9A 4BWLA 1RUML 4FFZL 3L12A 5HDBB 3PFRA 3FQNB 2CW6A 4XBKA 3LCHA 4A2MA 4M56A 3X11A 1NCBL 4DJED 5F3HB 3WEXA 4P9MH 4KO9A 3BXWA 4ROPA 2F5AL 4JM4L 4MY8A 3GNDA 3BVJA 3TT3L 4NQXA 2Y5SA 2GI0A 5JW3L 4HK0B 1MW2A 3F4DA 3MZTA 1ZV5A 2MQCA 3USBA 2HPTA 1GIGL 5PAZA 4JO1L 4YO0B 3UETA 3TT1L 5IB5A 1I8MB 1LE9A 3V16A 1DQXA 1TIUA 5C0BA 5LCVH 5IRPA 4US6A 1HXMA 4NI8A 3DIVA 2HKHH 1RJRA 4A7UA 5ABGA 5IBTL 1RIVH 4TQPA 4CD5A 3TVMB 3ROLA 2XINA 4HK5A 2A6DB 1E9LA 1HWHB 1OAQH 3TEYA 1FWRA 3KW8A 4PWKA 4X7FC 3TYUA 2MTAA 3ZDZE 3ZKMD 2P5EA 3VZYA 3U4FA 3MMEA 4DI9A 3QGKC 3BKJL 4LU5H 5EULV 1VFFA 4U6YA 1D7CA 3K1DA 5CC3A 3OB0H 1IE7C 8XIMA 3QHFH 5E5RB 3N18A 2WWKT 2CCWA 2NDGA 4R4NC 4FFVD 1H8NA 1RBAA 1SYTA 5JORA 1L9OA 1FXPA 4NQSA 2WY3B 3JU2A 1TQCB 3N04A 1OZQA 4YHPA 3OKDA 1AP2A 4QHRA 3QJHA 1W72L 1D6EB 1FP9A 1POKA 3G6JB 3VDHA 4LCWE 1TTQA 2RCSL 1HKMA 4FN0A 2VI0A 2DN7A 1DE4A 3B5GA 5D8JL 4FA7B 4PJFB 2YEZA 4A6YL 3D3VB 5CBAB 3TCLB 4QRBA 4I5RA 1UZHA 2JJUA 5KINA 2YFNA 3PIQB 5B8CA 5ILTH 2FTYA 1MCPH 1VCAA 4L9LC 5IM7A 3FUKA 3NSMA 4PCSA 4FKKA 4QXGL 3LI1A 1BQGA 3B7RL 1I1FB 1WQ5A 3SGGA 1A4KB 4NX0A 3RR4A 4UM8B 4JHAH 3V8OA 3C6EA 3KGTA 2CUAA 2E9MA 2Q3ZA 2XY1A 2W66A 1BVKB 5L0QB 3Q4DA 1E4HA 4GABA 3FU7B 2VC9A 1G7JB 1REIA 4PJCA 3C08L 4QRPA 3K91A 2EG6A 2IDQA 1JZDC 5JZ7D 4M93B 2WD0A