1PZ3A

Crystal structure of a family 51 (gh51) alpha-l-arabinofuranosidase from geobacillus stearothermophilus t6
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
497
structure length
497
Chain Sequence
KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNEMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-arabinofuranosidase
publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 172
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pz3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pz3A02
4W8AA 2BY2A 3PZTA 1JDAA 3BC9A 2WWCA 4J28A 4HU8A 3VMOA 1HL8A 2WSPA 3WL1A 3EJTA 2ZUUA 1GCYA 3LXBA 3OLDA 4W86A 1MXDA 3RJYA 1QI3A 1NP2A 2EJ1A 3CC1A 2WANA 4RE4A 3PTQA 5I24A 3II1A 4A4AA 3VNZA 1PX8A 2VR4A 3POHA 2G3MA 2VX5A 1J0YA 4AYGA 3LPGA 2WHJA 1FH9A 2ZUVA 1GZJA 2ZXAA 4FNSA 2WHMA 1HXKA 1F4AA 1L8NA 3EYPA 2PBOA 3FHQA 1KXHA 1WDSA 2Y2WA 1LWHA 2WLZA 3APGA 3RM9A 4AD2A 3WN6A 3MV01 3GBDA 1QI4A 1QNOA 2VZUA 2PWDA 4MB5A 3VM7A 4ACZA 2F7QA 1ZS2A 2YFNA 2WVUA 1JZ5A 1BTCA 1CEOA 2YA0A 5AY7A 4PTXA 5A8QA 2Y4SA 2WM0A 5IHSA 4EK7A 1UWTA 1DTUA 1G1YA 3A3HA 1OD0A 2XUCA 1W2VA 3UR8A 2WC3A 2YL8A 3TTOA 3N12A 4DWSD 3AMGA 5EBAA 1ITXA 4NXKA 3ZJ6A 5JUVA 5A3HA 1DP0A 3U5YA 1H0IA 5CPTA 1E6QM 3VGHA 4XUYA 2D3NA 1LG2A 4H8VA 2PWFA 3VIOA 3GM8A 2OWCA 1HT6A 1LWJA 6CGTA 2NT1A 1WDQA 1G5AA 1HKKA 2E4TA 3ARTA 1U2YA 5A2AA 3VMPA 5GNYA 3ARVA 3WKZA 1UD3A 3ZJ7A 3POCA 2EAEA 4JHZA 3TONA 2Y24A 1C8XA 1QI2A 2WYSA 1EXPA 4D6DA 2C0HA 3LRKA 4URIA 3VIIA 3NUKA 4W7UA 4GPNA 2DT0A 3S5YA 3A5VA 4HA1A 4U31A 1N82A 1UKSA 2WMIB 1PEZA 3WF4A 2G3JA 5BROA 2QHAA 4BA0A 3KL5A 1NWUA 5D9PA 2A3HA 1KBKA 4OZOA 4MDPA 2WHKA 1KXQA 1QOXA 3ZR6A 1P6WA 2DQXA 3AS3A 3FAXA 1E55A 2ZUMA 5IDIA 1E3XA 3I3DA 4WJXA 1PPIA 2XVPA 4D6EA 4AIUA 5HOSA 3W81A 1OSEA 4ZFMA 1UYQA 3ARSA 3CZNA 3D52A 1K9EA 2JEQA 3K4AA 2E9LA 3AMKA 3AS1A 2DDXA 5BRPA 1H0GA 3AXHA 3MUIA 4QCEA 4PYSA 3NDZA 2GJRA 3GNOA 4ZENA 5HNNA 3BMWA 1BG9A 3OA5A 4MAVA 1J9YA 3WUFA 2G4FA 1JZ8A 4C7GA 3WFLA 1TQUA 5A6LA 2VC9A 2D0GA 1PIFA 3CZLA 3G6LA 2V3DA 3TP4A 4CN6A 1US2A 1H5VA 4RL3A 2WC7A 2VX7A 1MWOA 3ZMRA 3M7SA 4XX6A 2OYKA 2JE8A 3A21A 2OSYA 4P7RA 1TQSA 3GH7A 2E0PA 1CXIA 2XGBA 3OGSA 2J77A 3CV5A 4F8XA 2Z1KA 2YBUA 3TTSA 4CU6A 4AZBA 5IHRA 1JI1A 4D72A 1H41A 2ZUWA 3VD7A 4AZ5A 3RM4A 1B9ZA 4LPCA 2X8RA 4JCLA 3JUGA 3WL0A 3WDHA 3QHOA 1UQYA 1MW3A 3W37A 1UR8A 4MNJA 3SCQA 2EACA 1RPKA 3GDBA 3KLLA 2PB1A 2V5DA 5AYBA 4CU7A 4BQ4A 4BQ3A 4FF5A 1TMQA 4OOZA 2RGMA 4N42A 2J7CA 4AWEA 2BHZA 1CXFA 3W53A 1IZKA 4U33A 3SCOA 5M5DA 1GQIA 3EDKA 3H54A 5DO8A 4P8XA 1J11A 1WZLA 1E0VA 4M29A 2JF6A 2WLYA 2XM1A 2GK1B 2DH2A 1E70M 1CENA 1EDQA 4J3SA 1JAKA 2D2OA 3RILA 4Z2LA 3FHAA 4R5EA 2JIWA 2F1BA 4OOUA 3WY3A 1G94A 4CN4A 2MANA 3OLEA 2CEQA 4OJYA 3CH9A 4D1JA 4WSJA 4WSKA 1ZL1A 1K9DA 4D6JA 4OIFA 4U3CA 3VU2A 1NOUA 2CBUA 2X2IA 2J8GA 3RJXA 5BXSA 4HMEA 1X6NA 2J7EA 3MKKA 2E3ZA 4P7NA 2W5FA 3VSVA 3PZQA 2BS9A 5LA1A 5CG0A 3SEPA 2FHCA 1NWTA 4P7LA 2W62A 5LA2A 1KXTA 1UKPA 1E6SM 1UKTA 1QW8A 2C8NA 2F7PA 3D51A 3GH4A 4PMNA 5FD0A 5D9OA 4MNLA 1H1NA 1UD4A 3OLIA 5I77A 3ZO9A 2VZTA 4WF7A 2IXVA 3UCQA 2OW7A 2OLHA 5I5RA 3WEMA 3CHCA 4UFJA 4Z2JA 4TX8A 3DDGA 3GNPA 4A3HA 1V6XA 3AFBA 3A4AA 4FNQA 3BLPX 1V3LA 4TX6A 1SR0A 1V3JA 4AZ7A 1PAMA 2VZVA 1VFUA 3CZJA 2OW6A 1DEDA 3GXMA 3NSMA 3OB8A 3GXNA 1KGWA 5E6ZA 2X0YA 3VDBA 2BHUA 1BGGA 5CPQA 1EDTA 4NZJA 1B3ZA 3PHAA 1O6IA 1ZJAA 3UG4A 4YN5A 4BQ5A 3T09A 2GUYA 4U3AA 1WPCA 3A4WA 3PZUA 4IISA 3F5KA 3CZKA 1VBUA 2DSUA 1ZBVA 2EABA 2YJQA 4Z2HA 5HPCA 4WIWA 2GSJA 3LPFA 3IAQA 3MS8A 1R47A 3W28A 3WBEA 3EJUA 3BLBA 1LF1A 4NZCA 3DX2A 3F5JA 2J74A 1IV8A 3HU7A 1J10A 2WMHA 1E71M 2QPSA 1ZU8A 3IJ8A 3L4VA 1JZ3A 3WNMA 4HA3A 2VVNA 4CCCA 4PMVA 3TTQA 2YLLA 2D0FA 2J4GA 3LXAA 2F18A 2F2HA 4KGLA 1UR4A 1F4HA 1TVPA 4ML4A 1UD6A 3AIWA 1H09A 4MB3A 3OG2A 1OT2A 4GI9A 1UZ4A 1HXJA 1UR2A 4FNUA 2EQDA 5EMYA 5JBEA 3EJPA 4QDMA 2WBGA 4EE9A 4J3WA 2GDUA 1V02E 2UY5A 1CECA 1XRVA 4K68A 4TVDA 3DX4A 2W61A 3WNPA 3L4ZA 1K9FA 4AIEA 3I3BA 5CLWA 1H4PA 3CMGA 2VJXA 1BAGA 1B3WA 2YDRA 1OB0A 2A3AA 2J78A 1KBBA 4UQ9A 4W7VA 2WWDA 1EO7A 4A3YA 2W91A 1XH1A 1UUQA 2CBIA 5DMYA 2E8ZA 1WP6A 3CUJA 3OGVA 3A23A 3RCNA 3FN9A 1BPLB 2FH8A 4GI6A 4LYRA 2UY4A 3THDA 3VD5A 3VGFA 4AXNA 4WKHA 5GNXA 1KR1A 1V3IA 4MB4A 1A47A 5IFPA 1JFHA 4DUXA 3VGDA 1KR0A 4W8LA 4ACYA 3VGGA 4DM2A 2JIEA 3GTNA 1VFFA 4CD8A 1B30A 4F79A 5IFTA 5HDRA 5I2UA 1TR1A 4AY1A 1WDPA 1W3JA 3B9AA 2YOCA 1C90A 2WNWA 3RO8A 4H41A 3AIQA 4GO8A 4PSPA 1SFSA 3AYSA 1UA3A 2XN1A 3CZGA 4GQQA 3EBVA 1ZB5A 4ACZB 3HZ3A 1BYBA 3NYDA 3OZOA 4GINA 3GNRA 1CYGA 2X1IA 4ATDA 3S2CA 4JFWA 2BFGA 4XB3A 3HMCA 4PTVA 4X0VA 1JI2A 1LL6A 3MMDA 1B2YA 1GOOA 1HN1A 4HZ7A 2UY3A 4S3KA 2YL5A 1EH9A 3D5HA 4UFKA 1E6XM 3RM8A 6A3HA 3W4RA 2VNCA 5D9NA 5DF0A 3WD1A 4DO6A 4LXFA 2VX6A 3DYPA 1BHGA 2VQTA 4L4OA 3K8MA 1K6AA 1H2JA 3AMDA 2JFEX 1HF6A 3WEOA 5HPOA 2WHLA 1EO5A 5I6SA 1E5NA 1OD8A 3A4XA 3ARWA 3WH6A 4IM4A 4R27A 3BLKA 3GZAA 4PMZA 3BCFA 4ATLA 4AZIA 5C71A 1FFQA 1HVXA 1GQLA 4WLCA 2NW0A 1Q6FA 1CNVA 2J75A 4UZUA 3FW6A 2OSWA 2A3BA 3WDQA 3SUUA 2HISA 4L4PA 3ZQ9A 3VGBA 4Q7NA 1KB3A 1I75A 1J01A 3CBWA 1XH0A 5E70A 1C91A 3VD9A 2QMKA 1UH2A 4AD0A 2XSBA 1W1YA 3WD4A 1PX4A 3AHVA 2BHYA 1XV8A 2J62A 3SUSA 3AIRA 3L2MA 3MV11 3QOMA 1WKYA 1CGYA 4J3XA 1JYWA 2F61A 3WQ8A 3AMCA 1ISZA 1BLIA 3DECA 4PBGA 1X1NA 3AHXA 2VCAA 5GPRA 4PMXA 5FIPA 3AMLA 2FGZA 3WY2A 3HG2A 1EQCA 2UY2A 1I1WA 4IPNB 1AQMA 1M53A 2XPKA 1XSIA 5A8NA 4PSRA 1DHKA 1V08A 3K1DA 4JFUA 3BSGA 1M7XA 2F1AA 2WBKA 2EEXA 2ZWZA 3WD2A 1QW9A 4LYQA 2EPKX 1I1XA 4QCFA 4CUCA 5I23A 4JAWA 5CZKA 3VNYA 5DEZA 2XVNA 1G9HA 1PS3A 2EPLX 4TUFA 1J0IA 1NOWA 2W66A 4H8HA 3T0BA 1HJSA 2GJPA 1EOKA 7A3HA 1U33A 2E9BA 4GZEA 3ARYA 3BUDA 8A3HA 3WDRA 4QLLA 1EQPA 5D8ZA 5JBDA 1TQVA 3AIUA 5KZ6A 1OGBA 2DH3A 1OBAA 2J47A 3WF0A 3LPOA 4HMDA 2D73A 2YA2A 5I3DA 1HX0A 1H49A 2WMGA 1KWKA 2V38A 3ARZA 3WF1A 1E73M 2E40A 2BV9A 4PUEA 1EOMA 3CZ8A 1UKQA 1KQZA 3SUTA 3WH7A 5BRQA 2WMJA 1HJWA 2WCAA 4U2ZA 4UNIA 4D6GA 2GDVA 1KCLA 1PZ2A 1B31A 3AZSA 4W87A 1J12A 2YDQA 1UR0A 1CXKA 3BXWA 3CUHA 4BF7A 2GJXA 2ZXBA 2G3IA 1PZ3A 3AISA 3BAIA 2XSAA 3IGUA 3F5LA 1Z32X 4FLRA 1E6RA 4HPHA 5FCZA 4NF7A 4QP0A 2G8ZA 3SUVA 2JEPA 2V3FA 3K46A 1AVAA 2J7FA 1LLOA 1WE5A 1SYTA 4CD7A 1TE1A 3HG4A 1GOMA 3AS2A 7TAAA 3L4YA 2W63A 1NARA 2J8FA 3PZVA 2VR5A 2FHBA 4AD1A 2OWXA 4W89A 3NIYA 3LPPA 4B15A 4JL1A 2VURA 3ARRA 1FP9A 1QWNA 5M3WA 5A95A 4NRRA 5CSYA 3KE0A 4YHEA 2A3EA 3VIHA 1ESWA 2CETA 2WXDM 1BVZA 3T2PA 2CBVA 1ISVA 5E0FA 4JCMA 3AHTA 1XC6A 3RMEA 4AYSA 4PTMA 2XHYA 2VTFA 2XWDA 4P8WA 3CO4A 2EPOA 5DT5A 4AC1X 3ALFA 5LA0A 1H3GA 1IZJA 1OM0A 5AYIA 1NQ6A 4BCEA 3CGTA 1W1TA 2CNCA 2YFOA 3KWXA 2DSWA 4E8CA 1GW1A 2WVSA 1KGUA 2VVSA 1FA2A 1JD7A 4JKLA 1M04A 1Q4NX 3W25A 4X9YA 1HJQA 4NSBA 2PC8A 2DSZA 1LJYA 3BSHA 2VO5A 2RGLA 4LX4A 3FXYA 5E1QA 2PWHA 5M03A 3EJRA 1UWRA 1VENA 4B16A 3BH4A 2Z1SA 3PZIA 3WH9A 4BQ2A 3ZR5A 4CVWA 3GH5A 4F66A 1WCGA 1BQCA 4D1IA 5EB8A 3MUZ1 3BVWA 5I79A 1ZBKA 4XV0A 4UFHA 2EADA 2V3GA 4GQRA 3AIEA 2VZOA 4EKJA 4CD6A 4AMXA 3MSGA 2WPGA 4ZEPA 2WAGA 1XSJA 1WNOA 1JYNA 3D3AA 1BVNP 1JZ6A 2F7RA 2OYMA 1C92A 3GYCA 4FMVA 3H55A 3CHEA 3CUGA 3HG5A 2CXGA 1LQ0A 1MQRA 3DYMA 2AMGA 5E09A 4NZFA 2BY1A 4AD5A 5D4YA 1XHGA 4KWUA 1YQ2A 2ZIDA 3T08A 1TA3A 3MI6A 1XD0A 2NT0A 2YL9A 3SCRA 5E9AA 4FNRA 1BYAA 1V0LA 1E0XA 4DUVA 1W3LA 4J3TA 2ZXDA 2XJ7A 4H2CA 2D3LA 3MO4A 3N17A 1NWRA 2QLYA 4PMYA 4WK9A 3ECQA 3BVXA 3UEQA 3ZM8A 4LQ1A 3MUAA 1VJZA 3W6LA 4H04A 1JZ7A 1E0WA 3VUPA 3VX1A 3BAYA 4H7VA 1JF5A 3IK2A 2X2HA 2D1ZA 4XZBA 1MYRA 2CIPA 2DIJA 2WVVA 3AZRA 4UFMA 4ATWA 4IUGA 2BVTA 4UOQA 3ZJ8A 1JZ2A 3VIPA 5HXMA 1E15A 2BVYA 1CGUA 3K4DA 1UKOA 2QMJA 2O9RA 2V5CA 4M82A 4TOQA 4U2YA 1B1YA 2OWWA 1GJUA 3AQUA 1V6VA 1QPKA 4NRSA 3SCUA 1C7SA 3T2QA 1Q6EA 2VI0A 2W92A 2CESA 3CPUA 2E9MA 1R85A 1BSIA 3EJQA 3WH5A 4B3KA 2DPEA 2D23A 3VD4A 1GUVA 3CTTA 1V6WA 3GXIA 3WY1A 1XH2A 3NSXA 1BYDA 4OKDA 3VINA 3AICA 5A69A 1OIFA 3LMYA 2PWEA 1R7AA 3AYRA 4AZGA 3ARQA 3KEHA 1S46A 4AEEA 4C7DA 3AROA 1VBRA 1YHTA 4TXEA 4MNMA 5CGTA 2BY0A 3U57A 3VPLA 1CZ1A 3WEZA 3VSUA 1JNEA 4MDOA 1C8QA 5M17A 4JZ5A 2X05A 4HOWA 2D20A 4PTWA 4DUWA 1FH8A 3WY4A 1GONA 1GJWA 1CXHA 3CMJA 3N11A 3CZEA 1QBAA 4BZYA 4V28A 2YBTA 1E9LA 5A6JA 1JG9A 2ESCA 1RP8A 3CUIA 3ZSTA 4HU0A 1JL8A 1W91A 1E4LA 2A3CA 3HN3A 1C8YA 2ZOXA 3WSUA 4M1RA 4YPJA 3BMVA 1XGZA 4FNTA 3E1F1 5A6BA 3UG3A 2DEPA 2B31A 2CBJA 1VEPA 2CHNA 3IAPA 3EMCA 1A3HA 4PMUA 6TAAA 1ECEA 1HTYA 2X2YA 4PUDA 1L0PA 2WKGA 3N1AA 5CJ5A 1JZ4A 4GI8A 3BUQA 2WC4A 4OUEA 1MXGA 1KFWA 5KEZA 1RH9A 4JFSA 4AW7A 1EGZA 1VF8A 5BXTA 3WNNA 4GIAA 1HJXA 3VIMA 4P8VA 3WDIA 1V3KA 1O7AA 1QNPA 2O9TA 1OCQA 2ZXQA 4AISA 2WZHA 1CDGA 2Y8VA 4AIOA 3N04A 1J0HA 3EMQA 2J79A 2GFTA 1EHNA 2AAAA 1XSKA 3VD3A 1C7TA 3MU7A 1CBGA 4P8UA 3OIHA 1R7OA 2NSXA 2CKRA 1E3ZA 4ZE4A 5CLTA 2D24A 2ZUTA 1DWFM 3PZMA 3OLGA 3WQ6A 1Q6DA 3OBAA 1C93A 4PMQA 2VRJA 1CGXA 1HNYA 7CGTA 1VB9A 4HOZA 4J3UA 1TUXA 3WMSA 5I0DA 4TVCA 1DWIM 2ZWYA 4DWSC 3DDFA 3B8SA 1V3MA 3WD0A 1GOIA 4DM1A 4U5KA 2DGAA 3WUEA 1GPFA 3DX1A 5HBFA 4C7FA 3ZIZA 3W29A 4LGXA 1R86A 3VIJA 2ZE0A 3O2LA 5CPSA 4H8UA 2WK2A 1JDDA 4DWSA 1CLVA 4M81A 3AS0A 1EIBA 1WZMA 3WQVA 2WVTA 3LXCA 4UQCA 4W84A 1QNQA 1UD8A 3WDJA 3EDDA 1WZKA 4UZSA 2E8YA 1V0KA 1UQZA 1KGXA 3GXTA 4M56A 1X6LA 4S3JA 9CGTA 4WKAA 1VEMA 4JFTA 4Y7EA 3WUGA 3SCNA 1GVIA 1XCXA 1JF6A 2O9OA 3QHMA 1E4MM 1VFMA 2X0HA 3BAXA 1EA9C 1WZAA 3CUFA 3WUBA 5A6BD 3AIBA 2FYVA 2WKLA 3ALGA 1UR9A 1MW2A 3BVVA 4MPKA 5EFFA 1JGIA 3VILA 5TD4A 3TTYA 3WNOA 1XYFA 1MQQA 4PMOA 4DO4A 1K9TA 1E6ZA 1GVYA 2VUYA 1B3YA 2Q8XA 1JXJA 2WCSA 1E6PA 2FE0A 2YLAA 3MMUA 3N18A 1E1EA 3BCDA 2FH6A 4RE3A 4HZ8A 3VIKA 4P7QA 2XTKA 3KLKA 4D71A 4PMRA 4QLKA 3THCA 3DC0A 2GJXB 5E6YA 3VTRA 5A94A 2W4XA 5CGMA 1QNSA 3WBAA 4F9JA 1GORA 4GZIA 4W85A 4AZHA 4GKLA 5ABEA 4W5ZA 3MUY1 3SCSA 1GOWA 2ZICA 1E56A 3WNKA 1BG4A 2XFRA 4D6IA 1WDRA 1E5JA 2J7HA 3D4ZA 3W0KA 1E43A 1JYVA 5ABFA 1ZBWA 1VFOA 1V0MA 4JHOA 3CHFA 4Q22A 4CVUA 1UASA 2V3EA 3TA9A 3M6DA 4KRUA 3NJ3A 1R75A 1JDCA 3SCVA 3KL0A 2ZX5A 4NXSA 5FL1A 3VDAA 3A47A 3TOPA 1JD9A 4OBSA 4AD4A 3WIJA 1E4NA 1TQWA 3BUBA 3AZTA 3W26A 2D0HA 1J18A 3N13A 3SCPA 5A1AA 3BUIA 4OGZA 1ZBCA 5A8MA 1AQ0A 4Z2IA 5BXRA 2QPUA 3IJ9A 3UG5A 4AMCA 3AIVA 1W9XA 1UH3A 1UZ1A 2IXUA 3VIFA 3T0DA 4B9YA 1V3HA 3T0AA 1QX1A 4AZCA 2VQUA 1OINA 2OYLA 1QHPA 3UESA 1B0IA 1JNDA 8CGTA 1PIGA 3BAKA 4UQAA 2XVLA 1JFXA 1CGVA 4AD3A 3K8LA 1BYCA 3PZOA 1SMAA 3ZT5A 2XVGA 1UWIA 1LL4A 3VVGA 3ZT6A 3SURA 3W24A 1W32A 3UERA 2VZSA 1HL9A 5FKYA 3WNLA 4X0NA 4W93A 3IANA 4ZE5A 4RE2A 1R34A 3EDEA 2J7BA 4D6FA 3CIVA 4HP5A 3CLWA 1W9DM 3WQ4A 3GXDA 4B3LA 3SIMA 3D4YA 2J7GA 1JXKA 4W7WA 1E40A 1V03A 5FOOA 2TAAA 4EANA 4CCEA 3B9EA 4U5IA 1BGAA 3D50A 4GZJA 1W3KA 3PN8A 1CPUA 4AEFA 1GQKA 2ZUSA 3GXPA 5A6MA 1UOKA 1HKJA 4KMQA 1G01A 3WQWA 1MVYA 1W9UA 3LRLA 1TCMA 3WF3A 3BVTA 3F4VA 1TFVA 1E72M 1TA3B 4JKMA 1KTCA 1KXVA 2G3NA 2VX4A 1CLXA 2EXOA 4D6CA 3VMNA 4UFIA 4D6HA 1Y7VA 3AXXA 3WDPP 2XVKA 1HIZA 1B3VA 2VRKA 1QBBA 1SZNA 3O9NA 1MQPA 3VDCA 1XD1A 3BVUA 1B3XA 4E8DA 1ISWA 3PZGA 5DFAA 2CERA 4E4PA 5ABGA 4UQEA 5BCAA 3AXIA 2PF0A 1QVBA 3CZSA 3MANA 5JIWA 1HP4A 4EAMA 1HJVA 3VSTA 1HVQA 1CGWA 1W2PA 3GXFA 1DWJM 4HTYA 1KWGA 2WVVB 2ALWA 4PCSA 4UOZA 3L4WA 1UD5A 2EPNA 1BF2A 3FNDA 3PTKA 2X2JA 4UQDA 1OIMA 4W88A 2W67A 3DHUA 4CKQA 5BXPA 1ISXA 3QR3A 4TVUA 4GO9A 3MMWA 2ZX6A 3DX0A 1NM9A 1GOQA 1G0CA 2ZUNA 1V0NA 3IJ7A 3K8KA 4FLQA 3WENA 1D3CA 1AQHA 2BXYA 1W9PA 2EO7A 2OSXA 1WB0A 3CHDA 5DT7A 1NH6A 2ZX9A 2WMIA 2XYLA 3AI0A 4JKKA 4CD4A 3TV8A 3PZ9A 4FLSA 4NI3A 2Y5EA 5CQ1A 1OGGA 1HP5A 3W6MA 1VEOA 3W38A 4HPGA 5CXPA 3ARXA 4V27A 2DT1A 1LG1A 3GBEA 4PMDA 2XN2A 5F7UA 2BNJA 1QI0A 3S6TA 5D8WA 2XWEA 3EMZA 5D9MA 3ARPA 3J7HA 1W1PA 4WKFA 4AZ6A 2DSVA 1XYZA 4N0RA 1VAHA 4FK9A 4W8BA 5IXEA 4TTUA 1LL7A 1ITCA 4JL2A 1V6YA 4TTGA 5AC4A 3S5ZA 1ZJBA 3T2OA 5I78A 2ZX7A 1FFRA 3A6OA 2D22A 2J7DA 4CU8A 4UCFA 4YHGA 5JIPA 4ZXLA 1J0JA 3BAJA 1W9VA 4P7OA 4GXPA 3AOFA 2GVYA 3SCWA 5BWFA 1H11A 1Q6CA 2DT2A 1UR1A 1KTBA 1V02A 3I3EA 4MNKA 3DYOA 3EJSA 1J0KA 1HKIA 2XFYA 1AMYA 4M8UA 3HG3A 4AMWA 2HVMA 2WMFA 3WMBA 2CKSA 1DWAM 3B9DA 3VIGA 3WF2A 4NX0A 1UH4A 4QFUA 3FAWA 3VM5A 1J0ZA 2WZIA 2BY3A 1MW0A 3DX3A 4JIEA 3VO0A 3N15A 3WD3A 1TG7A 1UWUA 2VOTA 5A8PA 1CXEA 2JF7A 2CCRA 4MADA 1ODUA 1RP9A 1RD6A 4E2OA 4Z2KA 1QNRA 3SCTA 3LX9A 4CN1A 1E6NA 3QOKA 3ZJKA 3AHYA 1OT1A 4MAZA 3EDJA 4MTVA 1U30A 3M07A 1R8LA 3LRMA 2CYGA 4KRTA 4J27A 5A2CA 1QI5A 1GOKA 2FDMA 4HA4A 5ABHA 1MW1A 2YA1A 1JAEA 1MFUA 4MB1A 4V2XA 3OGRA 1C3FA 3PZNA 2J25A 3A24A 2GK1A 3MSDA 2XFFA 3O6AA 1R87A 2FHFA 2WZEA 5GNZA 2DSKA 3BGAA 2PI6A 2XIBA 3W82A 1CIUA 3L2LA 3U5UA 1EDGA 1E4IA 2WB5A 3PBGA 1OGSA 1OWQA 2CHOA 4FNPA 4KH2A 2IUZA 1FP8A 1TZ7A 1UHVA 4DWSB 1CGTA 2VMFA 2XM2A 1US3A 1PX3A 4F9DA 3VGEA 3DHPA 4CGTA 3BUPA 1NWSA 1WAWA 5A6KA 4DO5A 3ARUA 3ZT7A 1R33A 2Y8KA 2YIHA 5EFDA 3WELA 4LYPA 5A2BA 1W1VA 2XIIA 3WH8A 3AJ7A 4B9ZA 1D7FA 2WCGA 3HJEA 1DWGM 3VOCA 3N9KA 4HMCA 3U7BA 4CCDA 1QHZA 1T0OA 4HZ6A 2IGTA 1FHDA 5BYWA 2QF8A 4UR9A 1KQYA 4OBRA 2WMKA 1ISYA 2JALA 4UQBA 2YDSA 2G41A 4HOXA 1D2KA 1M01A 2DT3A 3L4UA 2XGIA 5C70A 2WW5A 1HWWA 1FHLA 3L4XA 4ZXOA 3A22A 2VT0A 2VCBA 5A6AA 4BS0A 3QHNA 1CXLA 1NP0A 3BAWA 1GHRA 1SMDA 1VIWA 1QHOA 4J7RA 1UA7A 5AC5A 4QAWA 2CITA 2CPUA 1FOBA 5GQBA 1Q6GA 3NSNA 3M46A 5FL0A 3RPMA 3WQ5A 3RIKA 3KZSA 3ZSSA 3L4TA 3WMCA 1W3HA 3PTMA 1BFNA 4PEEA 4KGJA 2UWFA 3FY1A 4CD5A 5LYRA 4MJ2A 4W5UA 3WFZA 2EBNA 5JBFA 4PCTA 2QV4A 1VRXA 3VKKA 2F8QA 3UETA 1CWYA 2FGLA 2O92A 3KL3A 2VCCA 5ABFB 3EDFA 4UTFA 2WSKA 1GQJA 2O9PA 4QLJA 1XCWA 2PBGA 1EHAA 4FLOA 1M03A 1PBGA 1O7DC 4J3VA 2EPMX 2VRQA 4IPLA 3SUWA 1HJUA 1R46A 5C8BB 3VX0A 1B90A 2X09A 5CSUA 5ECUA 1MFVA 2C7FA 3RDKA 3NDYA 3ZOAA 1JYXA 1FH7A 3W27A 4XZWA 1JIBA 1ODZA 5A6SA 1VJSA 2AOSA 4PRWA 3H53A 1UD2A 1KCKA 4M80A 2XN0A 4Z2GA 3UR7A 5A8OA 1UWSA 4JFVA 2ZX8A 4MJ4A 2BXZA 1TVNA 3U7VA 1CTNA 2DIEA 1GHSA 1WO2A 1DWHM 2YKKA 3QGVA 5E0CA 4AZCB 1PJ9A 1GNXA 3AHZA 3G6MA 4UFLA 2PWGA 2VL4A 1QWUA 2YL6A 2XG9A 1W9BM 2F7OA 1V6UA 1NOFA 1HKMA 4PN2A 1UWQA 3NCOA 2BVDA 4UOJA 3VDHA 1E1FA 1TQTA 3OZPA 1UG6A 4M24A 1IT0A
chains in the Genus database with same CATH superfamily
2BY2A 2QTEA 2POZA 5D02A 5DS8B 2WQDA 4BQ6A 3V5FA 1RZIA 3PUUA 4UIKL 3FCSA 3U7YL 1V7YA 3G77A 4XODA 4FA7B 3BTNA 2WANA 1IC5L 1OB1A 4NO3A 3AWOA 1NF0A 1TJIL 3OZYA 2P5PA 4EXBA 5D1XB 2WLZA 2IQAA 3W2JA 3OGCA 3UGUA 2AK4D 4P9HC 3H2MA 3VM7A 5LNDA 2HMCA 5GHWL 5ENWA 1DQDH 5TDOA 3B04A 5B3JE 1JZJA 2AK4E 4TSBL 3DUSB 1QFPA 3GTIA 4GYKA 1A7NL 4Z7IA 1DKWA 2FUTA 1JPTL 1XGQB 8FABB 2CHXA 5C07D 2Q02A 4DIXA 4NAMA 1IM3D 1OL0A 3FOKA 1AGCA 5C07E 2A7PA 1YEIH 3NDYE 3CQ0A 6CGTA 2HK0A 1D9EA 3QUMA 3U6XS 4B9PA 3P3TA 3WLWC 4AVOA 1LEIA 5EMUA 2D3JA 3S8GB 3H4HA 3CIXA 3EXTA 3O0LA 4XD4A 3IS1X 4H0GA 3M43A 2NX5D 2MEJB 3FTUA 5FCUH 4JVPA 1PYMA 2QEJA 1CCZA 2NX5E 2FRGP 2WWKT 1M7UA 3TIEA 4TVPL 3AM8C 3O6FA 1QOXA 3AS3A 3W2DL 4OJDH 3SADA 5CWSB 3X2QB 2UBPC 1NZRA 3C60D 4BK8A 2JEQA 1RZQA 4C56A 3MBFA 1HO1A 3H3KA 3EFFB 3FFCA 4QCEA 3V0VB 3THAA 4FFZA 2FIQA 3WUFA 2PLJA 3LZLA 2DTMH 2D9CA 4H88L 5AW8B 2ZYRA 4IHOB 3BPWA 5FACA 1H5VA 2DJMA 5B3NA 3FSVA 2VE6A 1P4BH 1IT8A 2WXLA 5HDBE 7REQA 3MFFA 2QCDA 4D8AA 1EJ7L 4PGJA 4IPJA 3TROA 2ZCZA 4PJ9B 3EWDA 2DLIA 4XVUD 5LHEA 4N85A 1GH7A 5A7BA 5EORH 2V5DA 1OYBA 5EU5A 3K7UA 4M6NL 4BEUA 5DMKB 1NICA 4IRZA 1LOQA 2FZ3B 4JM0A 5I6NA 2W60A 3WHXA 2N1KA 1PEWA 3QYSA 5HWJA 1T3FA 2A0NA 2O5YH 3RI5K 1JAKA 4OOUA 3STLB 3WY3A 2Y70A 2HJFB 3BFWA 2IQDA 2EUVA 3VVVA 2FX9H 3QIBA 4GG6E 5AVWB 3HIJA 2HWZH 3W9EA 2KHAA 4U3CA 4J1UB 1GMEA 3P3YA 4W9FC 3RGBA 1FVDB 3E02A 2HVBA 4OZ4B 1TTRA 4P7NA 4Z18A 5HDWA 1E9YB 3IARA 1KXTA 1LXMA 4AQ1A 3PUEA 1ONQB 2E9IA 1JV5A 4S2SB 5FIEA 4DYJA 5I1KL 1AJ0A 1OQFA 4HHGA 1ITQA 4LSUH 5SV4A 1AC0A 4LY8A 2OW6A 4KPHL 5E6ZA 4HNLA 1KNOA 2PP3A 3TA4D 3QSRA 1S3TC 1O6IA 1ET8A 3BVDB 4YN5A 3F5KA 2X4OA 2YD1A 2V63A 5KYXB 3T8XB 5IJCC 2R23B 3L7RA 3VXRB 3EJUA 4Y19D 4XBPB 3DHJA 1WZ1H 3HU7A 1W15A 4Y19E 1GGYA 3L4VA 4OLWH 1SUJA 1RXOB 1LP9E 1RK0A 2EH7L 2VFIA 4ERIA 3N40P 4FPSA 3V6FA 4IMCA 1OT2A 4O02A 1PKQB 4LU5H 1S3RA 3BW3A 2EQDA 3F7VB 1SJHB 2IWGA 3DROA 4OAWB 2J3SA 1D6VL 1BOGB 3AGVA 5F7FA 2V17L 1OB0A 4OH2A 2IAMC 1KFBA 1EO7A 3WCYA 2GBAA 2XWTB 3RPBA 5CIPB 3DTXB 3NIFF 4GACA 3LNGA 4M7ZB 2ATKB 4NAFA 3VD5A 1XGTB 1KR1A 4GXMA 4ZMZA 1RALA 1PYWB 3UJTH 2CRIA 1TR1A 1H7PA 2AJZA 4ODWB 5KZDA 3CZGA 3EBVA 4PD4J 1DIOA 4GINA 1G4MA 5EN3A 4NUJB 1UADC 5AC7A 5EOQH 3VE0A 3EFDL 2QCLA 3E8VA 4S3KA 3HS9A 1IKFH 6A3HA 3NYKA 1FL5A 5IY5B 2YK1L 1J05A 1EO5A 3RHGA 4Q4EA 2ADIB 3R0NA 3STZB 4IM4A 9XIAA 1Q13A 1VERA 4HCRH 3O8XC 4G8GA 1RQEA 4Y16C 4G7EB 2GIYA 1AD9B 1I75A 5DXWA 3VD9A 32C2A 4YGVA 2FB3A 4LSSL 5D2LE 4WY7H 1UIOA 4PRHB 5F1NA 5DUPL 3LS4H 4M7LH 4AIZA 4DLFA 4ZD3H 1CGYA 4NGHL 2IG2H 5I0VA 5JOPE 1NGXA 3HNVH 1PKYA 3HE7D 1LWRA 4F0MA 3QI9C 3NXLA 4PFEA 4K15A 1X7QA 3MODH 4HPYH 3SKMB 2DZSA 1D5MB 1TLMA 3WK0A 4MRBA 2NW2A 1I9IL 1SEBB 4DGVH 1DLFL 3FVMA 3ZU8A 3LHAA 4ABVA 2Z64C 2BS8A 3HS0A 5MERB 3ARYA 3ZE2B 2Z31B 3IAGC 1YQVH 1DDHA 1WBHA 3E38A 2XIQA 3DO3A 3KCLA 5IQMA 1TV7A 2NLJA 4PB4A 4HCIA 2V38A 4KEZA 2DAVA 1JHKH 1E73M 4Z7NB 2BV9A 3GY1A 4DZ5A 1BZ9B 4GGHA 1DQJA 3E7JA 2ACUA 1P0SE 3F64A 4U2ZA 2O72A 3PBYA 2QKIC 5EIIA 1B31A 4PGBA 1RU9L 3HUJF 4KWOA 3A3WA 1QASA 2VDNH 1T4KA 4C55A 4ZBCA 1KYOK 2NYKA 2Q7AA 2HE5A 3ZDYF 4HIHA 4DBWA 4H1LG 4LUJA 4F2EA 3WTSA 4XIAA 4YPGB 5GRWA 1BFVH 3T2LA 1SGJA 3ZL4L 3H9HA 4S3CA 4LC6A 3PZVA 2CU9A 1TFPA 3SYQA 3BDXA 2NY7L 1MRCL 4QE1A 4HNTA 2ZNWA 3ARRA 5JXAL 4EPEC 5CSYA 3KE0A 3VA8A 3LHPL 2ZOWA 2PODA 4UT7L 1G67A 1MPAL 3P74A 2NQ5A 2ADFL 4QRRB 4Z3JA 4PTMA 4JDTH 4K71B 4IX0A 3HR6A 3EHBB 1WEJL 3MJ7A 4FXSA 4A22A 4OJEH 2HJKA 3L6FB 4GC3A 3O4LA 4QRUB 5CBAA 3IJEA 1CLKA 4B5SA 3QDJD 3U4BL 4OZIB 1Q4NX 2GAZB 1YXYA 1I2NA 2ICSA 3T0EB 4BELD 4RNIA 3BSHA 5D9SB 3UYRL 3QDJE 3LZ5A 3VB8A 2YRPA 5DDHB 5HANA 1HYSD 3RIFK 3CXHK 1NLBH 1VD6A 3UO1L 3SOBH 3QFJB 2AK1L 4K5LA 3KJ6L 4ZZKA 3BRFA 1XLBA 1LJMA 4EUPH 1RJLA 2Y62A 1YC8A 3E8UL 1NPJA 4R97B 3P8JA 3I6SA 4V1DA 2F7RA 2J6WA 5I18L 1FYTA 3GSNA 1QBLH 2WZPA 2YR1A 4ONFL 1IMHC 2PDXA 5JXED 2PCFA 2NW3B 2XN9B 1R3HB 2OKOA 4BK4A 3E0FA 2QLYA 4PMYA 3BG9A 2WM1A 1ALDA 1WFUA 4X8CA 1P5UC 4POZD 1MNNA 1BQLH 2MSPA 3Q44A 1XLLA 1LE5B 1EEQA 1RVFL 4RK8A 2DQFA 1M3UA 2FBOJ 4NFCA 3VCRA 3K4DA 2QMJA 4NT6A 1B1YA 5EY5A 4BHYA 4Y4HC 1G1KA 1PKMA 2BMBA 2G9KA 2ZAHA 4JBRA 5DJ6B 3SRFA 3UF9A 3LEXA 3IFNH 2UY7A 1I7UA 2CE6A 4RAUA 1SLUA 4PJEA 4JO4H 1KCSL 4JFOB 3ARDC 5EGRA 3HNTH 1N2VA 1TF4A 5DD0H 2G0LA 3CHXA 4KY2A 1Q7MA 1OTSD 1J6OA 5A8GA 2BY0A 1PD0A 3T65B 3OA3A 3ABRA 5J12B 4JZ5A 4PTWA 2CGRH 4X4YA 4H0IA 1IE5A 4AHQA 3Q0HA 2VC7A 4PJIE 4DZBB 1T5KA 3X1NA 4UMSA 1IEVA 3Q1SH 2BIQA 2QHRH 3LZRA 3CUIA 3NQIA 4A8NA 3HZYB 4QG9A 4E0RA 3KPQB 1ASPA 1REQA 3BMVA 3KXFB 5AWNH 4OVUA 4LCQA 1HU8A 1N59B 5F7WC 4L4LA 3W1PA 1QPRA 2A5HA 3F65A 3AUOA 1QRNB 1A3HA 1W1ZA 4AG4H 5DFTA 4Z7VA 3FTSA 1L0PA 4EI5C 1A0DA 4TU1A 3TYGL 2UY6A 1HE8A 5L9FA 4P46D 4KK8C 2XTLA 1VSCA 3D0LB 1V3KA 3LH8A 5GRUL 1ZUAX 1RXLA 1DN0B 1OSPL 4GY4A 3WO4C 3WG6A 2MKWA 4ODUA 1AZRA 1FRGH 3LKQB 2P3EA 2R27A 1Q72H 3CDZB 1TNNA 1YEKL 4YTQA 5DQ9A 3EX4A 1V3MA 3SKNB 1RURL 3RP1A 3UTTB 4Z0XA 5C7ZA 4KOCA 2OMNA 3GF8A 2I14A 5GISL 1FA4A 3FO1A 2RD0A 3EOTL 3CFMA 4ZAKC 3TBBA 4Q8OA 3B8YA 1L8PA 4IQEA 1TSIA 3DFSA 1KYUA 1P7HL 1ZV2A 1JCYA 4PJXB 5ESVA 2XRAH 1AQKL 1OAXL 1N26A 1T6WA 5JHDD 4FS0A 1ZANH 1OZQA 3HCVA 1RLBA 5JHDE 1OAQH 2DV6A 4R96B 1K9TA 1SQ7A 1GVYA 2XHNA 5KSBB 2EUZA 5DYOB 1GJPA 5BXFB 3V7PA 3TCEA 2DI8A 3N14A 4WEBL 4OGYH 2H2PC 4S3FA 1S2UA 1JQXA 1VYRA 5E4IA 4ENED 1SJEB 4OCSL 3DTUB 4LUIA 4WV1B 5HJLA 3VNIA 5FUOH 4LSRL 1YAIA 2OO0A 1UJ3C 3LEYL 2FLBT 1XRFA 1QZ1A 3T81A 1YRKA 1JPGB 2PP9A 1RY0A 2A21A 5FW8A 4AQ8A 1CZ8L 3CFCH 3LKPA 2ZVRA 4ZOAA 2WZ0A 1BP3B 1WC7B 2EEDA 2KT6A 3ME0B 1IEIA 2OLAA 4LMQE 1U3JA 3O11B 5I1GL 3K3QA 1P4LB 3TWAA 1LLAA 2VDOB 3PWUB 1A53A 1FJ1A 2NLIA 5D2NB 8CGTA 3ZTNH 1CGVA 3MUJA 4G3YL 1ITUA 1U22A 2VGIA 3U2CA 1G4EA 4B96A 3SY0A 3H23A 3M5YA 1MVUB 3C0JA 3NP4A 1FO0L 2KDGA 1NDGA 1XF5B 3PPEA 2J7BA 1RD5A 5DJAB 3WQ4A 2XUWA 3QWRA 2K4WA 1JXKA 3IPFA 2ESVD 4Z7UA 5C2BL 1OAUL 1TZGH 4HFUH 2ZPKH 3EA3A 3TF4A 2ESVE 1KRBC 4JY4A 3MV9B 3OZ9H 2WQAA 1KLFB 3D25A 1A4LA 3MBEB 1MCEA 3BE7A 2XWBB 4APQA 4K39A 3GMQA 3FTGA 3S3PA 3GSQB 4PGDB 2EXOA 4D6HA 3AXXA 2XVKA 2BASA 2R0KL 3NQEA 1MAJA 4W9CC 1TJHH 2OOFA 4E8DA 1QLFB 2IOOA 2VAAA 3GDTA 4FMFA 1ZTXH 1QVBA 4DJDD 2NNAA 1NAKL 1T2QH 1XPGA 1T03H 1KCBA 3NG5A 3TBSA 1XF0A 3VKBA 3TC3A 2VL5A 2X3AA 4ERAA 3QRGH 5FW6A 3RQ3A 3O2VH 4S1RL 3B4UA 3WENA 1TPDA 3FT2B 5C0QA 4P5SA 5CD5D 3TO4B 2A2IA 3PZ9A 3OL2A 3ABGA 1MLBB 4X7DC 3WCZA 1PL3A 1LG1A 4C47A 2XX1A 5AOUA 4IMEA 4ILSA 4K36A 4IS6B 4WTXA 4I0CC 5F2GA 4CBPA 1T4WA 4KK9D 3GC5A 4N0RA 3V5OA 3FKRA 4ZUTA 4J39A 1SSDA 3WKMH 2IH8A 5D1XD 1GS8A 2DWSA 3BQUC 4ETYA 3QSTA 5D1XE 4HS8L 1E42A 3H2FA 6PTDA 3W86A 1OK0A 2FD6H 3QW4B 3KS0J 4P7OA 1U8MA 3SCWA 4W9HC 4Z78A 1NVMA 1T6VN 3LSBA 3OOQA 1XCQA 2J56A 4DERA 2IKJA 3HBGA 2NY4D 3LH9A 2Z92B 1OFOA 3MUHL 2CKSA 3VIGA 3VH8A 3HGSA 1AGDA 2PXYC 3SBRA 1PZBA 5I15H 5HQEA 1FFOB 3CCHB 5A8PA 5FEZA 2MPVA 4YLBA 4JNXA 1B6UA 1U2CA 5CSRA 1G87A 5EUOF 4Z2KA 3BESR 3SPVA 1XG4A 1B2WL 2WKOA 3FRPG 1UA6H 5EU7E 2SEBA 1AHKA 3VNLA 4UQ3B 4XAYA 1JVNA 4MD4A 3PZNA 1DLHB 3ZTJG 1MI5E 1FZKB 3D4CA 3V5KB 1XWVA 2NQCA 2XIBA 3LHUA 2X6BA 5HI3C 2VXVL 4U1MB 1J2WA 1OWQA 4KKAD 1TE6A 5C07B 3N2TA 4C83B 3I65A 3HBLA 4BFIB 4JTKA 3AY4C 1KFJA 2ABAA 4G56A 4LLWA 1DWGM 1E5CA 4H2HA 1AJZA 1FDYA 1A7OL 1A0QH 5TGBA 1BJ8A 5CS7A 2IGTA 4RESB 5F9DC 1KQYA 3MDJA 1JRHH 3NPZB 2B2XH 2G41A 2NX5B 2XGIA 1FKWA 3L4XA 1MNZA 4FQXB 1S9VA 5D4JA 2EE6A 2JCCA 2HUEA 3BAWA 2NY2D 7PTDA 2CWNA 4FOUA 2AQOA 4KZCA 1NF7A 2YPIA 3MKCA 1GVOA 3IFOA 2GJZB 3CPLB 1NDWA 3HRZC 3ULVF 4J3OD 3KXQA 1V6TA 3C60B 2YO3A 1SUXA 3E9UA 4Q8UA 2AV7A 2CKBL 4PRIA 3UETA 2O92A 2XZCL 4MA8H 1GQJA 1YYCA 3CD4A 2G0WA 3RDTB 1U92A 4AC2A 1M03A 1KIPA 2LLGA 3BWAA 1LO4H 4H6KA 4M6OL 4IPLA 2X3CA 2FEJA 3S6OA 5HDBB 1CLYL 5H2ZA 2C7FA 3ILPB 3FO2A 4TQ8A 2DEYX 1ODZA 1F13A 4LAMA 1RMFL 3W39B 4DIAA 4CDGC 4PV1C 5PAZA 5C54A 4NLHA 1K4HA 3KWWA 5FA3B 3U7VA 2H6UA 2NUTA 1B6DA 3NH7L 4QWWD 2OZTA 4GBXB 4Z7OF 1V6UA 3CWGA 1FCCA 3HZMB 1IIIA 4BKTC 1YPZE 3OHXA 4REQB 4FKKA 4X7SH 5BW7A 5GGRY 3EYQD 1Q0YH 3EJTA 3CIQA 3WAKA 4AVNA 2O7QA 2KL6A 4PJEF 1NP2A 1HHKB 5EDXA 1CB2A 3TBYA 4Y1AE 2IXQB 4E5XA 2J4WH 2Y7QB 4YE4L 3P82A 4AYGA 3GMMA 4XC1L 1USZA 2OT0A 3MROA 5IROA 1OPGL 2XNAB 3F58L 4GKSB 3CYVA 3HB3C 1BQGA 4CC1A 1LWHA 1QI4A 1XJBA 3RWFB 3S6CA 4GG6B 1VKXB 1M56B 2WVUA 3GRWL 1P7KB 3VXRD 1LT7A 4U1JB 3VXRE 4KZEL 5CO1A 3OTTA 5A3HA 5FEXA 4FZEH 4MHBA 1AW1A 1U8JB 4RNRB 1Q6RA 5F44A 2OCJA 3NRPA 1XF4B 1LWJA 1G5AA 2OL3H 4BZ2L 5A2AA 2MCMA 3WKZA 3VFNA 1SDDB 4FA3A 2WYSA 1A5BA 3SO5A 1UWGH 3Q2VA 4FG2A 5CZXD 1N82A 2FT6A 1WBJA 4LCWB 4DJEC 2D31A 2G3JA 5FA5A 3KL5A 1N70A 2BC4B 2FECI 3DBXB 1NDTA 3ILQC 1Q6LA 1SHSA 4XMKL 3JRKA 2G4FA 1A6UL 3OP2A 4M00A 2BJML 2Y61A 5ISZA 3TP4A 5AOJA 3MP5A 1M1XA 4MLRA 3EX3A 4P3DB 4LCYB 1JNHA 2BS71 3MDUA 3QQXA 4FDWA 5TPWH 4JN7A 2PCPB 4LFHG 5KZCB 4K3EL 4FFYH 1CD8A 3EKZA 2QCCA 2OGYA 4LCRA 2MHAB 1OF2A 1Q9WA 3WDHA 2AJXH 5DQPA 3W37A 3MSYA 4R0LC 3MRBB 1RPKA 4YHYB 3QC5X 2DZWA 1TMQA 2Z2BA 4M51A 4HUMB 1I3GH 1ZT7A 5IRPA 4PJ7A 2H0FA 1BWKA 1EO8L 5DY3A 3P11H 4PRHD 1O4UA 3A67H 5DO8A 1SVZA 3N1QC 4G8EA 4PRHE 3CT2A 3VCLB 5AUMB 2OKTA 3LZ3A 3FHAA 2JIWA 2X53A 2F1BA 1QSFA 4LARH 4RZ6A 2WGNB 2WBJD 1I8LA 4A2EA 4ROPA 2EDWA 3CH9A 4WSJA 5F3HB 5FB8A 2CBUA 3STCA 4ACPA 4MY8A 2JELL 2YD6A 1AH3A 4ADJA 2E3ZA 3ZPDA 2YPKB 1GGCH 3DBPA 1MCHA 5HDLA 5FD0A 1X7FA 2OLHA 4AKQA 4A3RA 4A3HA 5D2LB 4N2YA 5D1ZB 4ZB0A 1S7UB 1R3JB 1AGFB 4JFZH 4GKZB 4Z7UF 3GLDA 3VDBA 1ZLWH 5JIIA 5CPQA 4Z7NE 5LXVA 1JRHI 3STFA 1C8PA 1WPCA 4R7LA 2H32A 3QDHA 3GSMA 5LBSH 3D3VA 4L80A 3F5JA 3VFVB 2Q6WA 3IJ8A 3KRSA 2V6HA 4GJIA 1RPXA 3QY8A 3SJVA 4CCCA 4WHTB 2F2HA 4KXCA 1I8IA 4AOFA 4KHXH 4MB3A 1I60A 2ZZ7A 2NCMA 1X5XA 2X44D 3SY6A 4QRRD 1PQZA 1XH3A 2EP6A 3B6SB 1JNLL 3FX4A 3EHBD 1Q6OA 1EGJH 3RUGE 2OMXB 2Q9OA 3E6FB 1CBVL 3PL6C 4S1QL 4XE5B 1WFTA 4ZMWA 1RR2A 2P8PA 4YVVA 4K7PL 1NCBH 1UQSB 4X4MA 4FCAA 3BFOA 3T0ED 1IXNA 4OZIE 3T0EE 1V3IA 4N87A 2YAQA 3VXPB 3VGDA 1KR0A 2Z1PA 4UIMA 4DVBB 4HK3J 4GA8A 1C90A 4LP5A 3M47A 1TTPA 3VFUB 4N0UE 4WI0B 1GVRA 4QR6A 1XTMA 1HQ4A 5KSVB 2UYLA 4MHHI 1ZWIA 3KPNB 4HS3A 1Z7AA 3M5ZA 4Q4RA 3O15A 2B0SH 1JI2A 1WYIA 2HS6A 1U36A 2FBJH 2YL5A 3NGJA 2C3GA 3D5HA 1E6XM 1BZEA 1SYSB 5I6LA 4J3BA 2XN9D 1TQCB 3T6WA 4GZ7A 2E56A 2XN9E 2PDIA 1MFDL 4OZGB 2B9AA 4P9HH 5KYNA 1WFIA 1I85C 1RHHA 3GC2A 3GZAA 3QZLA 4KQ3L 2ORBH 2GQAA 3LKRB 2H3KA 2J75A 4CQ9A 2BODX 2R1KA 2ADAA 1UZHA 2VCOA 3W70A 2D7MA 2WKOF 1C91A 5HHXH 3IV3A 3BPOB 4NRZB 4HWBL 1SZRA 3INUL 5EO1B 4TNEA 5EKYA 1HH6A 4ELDA 2XV3A 3QEGL 4UTTA 2WINB 1EERB 5C0EB 2OEKA 3O81A 1QNZL 2AQTA 5KBLA 2DIKA 5F21B 1FGVL 4ZOEA 2N0MA 4D9LL 4I1PA 2YZ5A 3RY5A 2YCJA 4LAUA 5T3XL 5DJDB 4QO1B 4L4VA 5K9XA 4R6UA 1NOWA 2VQ4A 2D7NA 2ENPA 3QISA 1ZVNA 2ITDA 4F9LC 5G5DB 4JFFD 3H1ZA 3KXFD 1FC1A 3ALWA 1TQVA 1RERA 2QDGA 2ZOOA 4JFFE 3NURA 3KXFE 4RDBA 4B5XA 2JCCF 3FO0H 2OJZH 1JHTA 2DQIH 2HMIC 5HGHA 3O9WA 4O58L 4O10A 1KG0B 3SUTA 1MLCB 4UT9A 4P23A 3CDCA 3N6QA 4I3SL 3A9IA 2GK0B 1SJAA 1JZGA 2J55A 4U4MA 4JFPB 2XSAA 3G2GA 1ZHBB 4DTGL 3W07A 3RR1A 3L13A 4ANVA 5I1IL 3SY8A 2DQDH 2D2GA 2V3FA 3G6DH 5IHLB 4GUGA 3CFEA 4PJIB 1GTEA 2OMYB 1HHGB 1DQXA 3VUAA 3DIPA 4P4KD 2YQBA 1RIHL 4HC1L 4HU4A 2I32A 5I75B 2VURA 2ZZ2A 1YIXA 5EU4B 4PUJA 3T2PA 1N5AB 4XGZA 5IF0B 3BKYH 4DCQB 2IWEA 3NNTA 4XMWA 3AHTA 5C55A 2A6JB 1TELA 5D32A 1ZK5A 2LABA 4EI0A 4XP9L 2NQHA 1QAWA 4QKXB 5TQ0L 3IXAA 2XC8A 4MLSA 1H8OA 3QUKB 4C1LA 2PYFB 3SDDB 4P46B 4L8DA 5E99L 1EZLA 1BXUA 2IALB 1A5FH 4OCNC 5I1LA 4PJXE 5I30L 2QJHA 4JICA 4LESA 1Z89A 3ARED 3QC3A 5DC0A 5EU3B 3KYKH 1IAIL 3WH9A 3D47A 1FCBA 3S37H 1WCGA 3LHYA 3GW0A 3MUZ1 3MREB 1JWMA 5A2FA 4GQRA 1IGJB 3DZ1A 5E9NA 4HKJA 4JYFA 2F53A 3LIZL 3CFTA 4HYRA 3MZGB 3EJZD 1JZ6A 1UB6B 4MJ6A 3MRLB 1LORA 3HG5A 2CXGA 4EIGB 4F7KA 4RZBA 4KO5A 1IKNA 2WLJA 1JPKA 3B7UX 1Q9KB 4C5YA 3PNWB 4M0XA 5DEFA 2HRWA 3OAUL 4O4VA 1EBGA 3UBPC 2NSQA 2D3VA 2POTA 4PY8J 1EANA 1IGTB 4MJID 4AENB 5D96C 3CDFA 2IH3B 3QPQC 4MJIE 1TYGA 1UKOA 4JQXC 4U6TA 4MWAA 4DOHB 3ELFA 2NMSA 4OFQA 3QEQA 3VFGH 4UMBA 2VDPB 1FHUA 2ZUQC 5I1JH 4B9KC 5D2NE 1HKLL 4OV5B 3NR0A 4LTSA 4JKPL 2VMEA 3BEVA 4JQ2A 2LR4A 1QPNA 3QF0A 4ODXB 2VO8A 3LMYA 2R0LH 4AZGA 4Y5XA 2V2DA 5IWLA 2PYEB 2KZBA 3YPIA 1S7QA 1G9MC 1HKFA 2V5SA 2Y6SD 1DSFL 5A6IA 1OK4A 5E2JA 5IOBA 1E9LA 2WWOA 43CAA 2B3IA 4LCIH 5A6JA 3MCMA 3CFDB 1WFJA 2NXHA 3CL7A 5CSSA 4LDCA 2JQMA 1W91A 3KLHD 4MASA 3QDGB 1JHLH 4HWNA 3TM6A 1FG2A 1HH9B 6TAAA 1DO6A 2UZYA 1GS7A 2V7HA 2UXGA 1WDAA 4NNXA 4FAMA 2P9RA 2X0SA 5IHHA 1YSOA 2X1SA 1CDYA 1VF8A 4KHTL 3C8DA 3FN3A 2H5UA 4JVWA 3BP6A 2O9TA 1QNPA 4PJ7F 4MS8D 3CSGA 1A4KB 2PCXA 4KETA 4FQLL 1DYSA 2H3BA 3L65A 1T96A 3O4OB 5AB3A 4B5EA 2DM7A 2VDRH 1W0VB 1TX2A 2ZCGA 1RIVH 4MQ7B 2P3ZA 1SZGA 3TCLB 1DN2A 4QX4A 3NOEA 3PZMA 2I5YH 1WDWA 3TLLA 4U49A 5DZVA 2H9GA 4E3TA 3EO9L 1DVQA 2H26A 4HJ0C 1XGUB 4UUJB 1AJ2A 2VDLL 3VFPB 5DLML 3TA3B 2WAQA 1P7QA 1R4XA 1R86A 4DWSA 1CLVA 4G9FB 3VXMD 5B4MC 2P24B 4QRAA 3BISA 3O3AB 5IBUB 1KIUB 3LZFH 2E8YA 3VXME 1W6TA 3OAYH 3VD1A 1RZJL 4A04A 2B14A 3H56A 4XC3H 1IEAB 4I2XA 1WZAA 3C4UA 3NQ8A 1W72H 5HQMA 1HWHB 5EEWA 3ALGA 3BVVA 4OJCA 1G6CA 4QRQB 2GSGA 2V67A 4JQIL 2J6EL 2ZRUA 4H7CA 2OODA 3NZQA 1GYNA 1E6PA 2YLAA 1XXFC 1B57A 3EKLA 5CINH 2ZWLT 2E59A 4P7QA 2FQGA 5GZND 1FPTH 3QO1A 5A16B 4RZCB 1I8JA 1QT1A 1Z48A 5I2IB 6XIAA 3BIBX 5A7EA 1EHLH 4YVXA 3WNKA 1JPFA 2ETWA 1JYVA 4WFGD 5ABFA 2BVQA 3CHFA 4FEMA 2VENA 4WFGE 2V3EA 1G1CA 3C2RA 3SCVA 2V82A 4DBDA 4FFWD 1VFTA 1E0UA 3L3OC 3NAVA 5BUPA 3FMGL 1PNCA 1SFHA 2QDWA 1TO5A 1LM8V 2NY4B 5IP4A 4YNYB 3BKML 2EO1A 1MFAL 3VXNB 3RG6A 3T0AA 4HEMA 3QKEA 1X5AA 5EHFA 3BGJA 2PR4H 2WXPA 1AW2A 2WOQA 1JFXA 4S3DA 5G2HA 5KVGL 5I1DA 3FQRA 1EZVX 3ARBD 3TFCA 1X5HA 2NTFA 2Y7FA 3GSVA 2QLVB 1D7CA 4OU3A 1Q85A 2BW4A 2K6WA 4FQXD 4IMLA 3SDCA 3EF7A 4G1KA 1DJNA 2P5EA 1AKJA 5ABZA 1MI5B 4A3QA 4RBPK 3S4SG 3FXGA 2GQ9A 3ROLB 3B9EA 1BBDH 1JWUA 1LTDA 4KRPB 4M3HA 5DCDA 4G6ML 1OE2A 5AG9A 1TENA 2DZXA 3SE8H 3UJJH 4ZXBC 4KKXA 4ICMA 1CLXA 5J8LA 1BKSA 3WDPP 2K7PA 3RVWC 3RDTD 1MQPA 5JMUA 2WNQA 2H47C 1UCTA 2PF0A 3V4BA 4K3ZA 4Z7WA 1X5KA 2M2DA 3L66A 3FU3A 1E9OA 1Q9LA 3VI3B 4G6JH 3PQYA 4NPKA 2CDFB 4NQUA 1POJA 3Q7JA 4POUB 3NCMA 3FB6A 1HIML 2EIDA 1JERA 2L7QA 3TQVA 4BRVA 3FNDA 2X0UA 3SQOL 4HG4K 5BXPA 2CIKB 2ED9A 2X1XR 4TVUA 1NM9A 3C5JA 5KVDH 4GBXD 2NY2B 5EN2A 4XWGH 2I5GA 4HNNA 5LNVA 4DFHA 3R1GH 5K39A 1JVOA 3UG8A 3WUWB 3PAOA 3W6MA 1COBA 4EVZA 3W7DA 1NGQL 3BGFC 4AH2B 3QNXB 2V5JA 1LO5B 1OC7A 3EOSA 5KETA 3QZ6A 2Y85A 1QR1B 4MD5A 4PRBA 2LU3A 4AF0A 4W8BA 4I0KA 5T1KA 4Q8WA 5DSCB 2D22A 5C0RH 4IIDA 4M03A 5CH9A 1TVBB 3OKOB 3QUML 4AIXA 4HXBL 1FV1B 4C6MA 5CZJA 4N9DA 3HC3H 3H2QA 3SPCA 3GHSA 1Z9AA 2NQZA 1IEQA 1YPZB 3GVWA 5GRJH 1ZEAH 5DK2B 5D4HA 4H8PA 1UYWL 2F9RA 3QP3A 1T8XA 2E1DA 1I8AA 4EVNA 3TWCL 3C5SB 4Y1AB 4WCYH 4IIBA 4XN2A 1SU5A 2PTTB 1OTTC 1YY8B 3ZJKA 5K7JA 3T9WA 3BO9A 4AYBA 3Q5OA 4NKIL 5A40E 4I3RL 3RLGA 3TX4A 4LCWD 4Y2NA 4FFZL 4J27A 4IFOA 1FXQA 4XO8A 1MFUA 2EYSB 4LCWE 4W9KC 2WTRA 3HAEB 2KLRA 2WZEA 3W1UA 1NUNB 1D3GA 1A1NA 4PJBE 3O3DB 4JHBA 3TURA 1OGSA 2BOBB 1XO8A 2BNQD 2HN7A 4RIRA 1FP8A 2ISSA 1US3A 2BNQE 4XPAH 5I00A 2P7TB 5IJVA 2QS8A 1R33A 3UAAA 1JGEA 4A6YA 3GHUA 4B9ZA 4I6KA 3T4YA 5TBOA 4MMXC 3PAVA 3LRSB 1Z1WA 4OBRA 4G9DB 3US0A 3FB5B 3Q2WA 1D9KD 1J87A 5KZCD 1M01A 4TO8A 4XXWC 4X8XA 5DO2C 4IRZL 2EUWA 1VBJA 4A2RA 4IU2A 2PTUA 5IESL 1E7VA 2ADGB 2QJGA 1THCA 3T5WA 3ZSSA 4QHUB 4MA3B 4G7VH 1AMXA 3FT4A 2AQRA 1IBBA 4TUJB 4G9PA 5TE7L 4BK9A 1VRXA 4ISVB 5H4YA 1EJVC 5DHXB 2WQWA 4J6RL 2H2SD 1PZ0A 4BFFA 5SWZA 4WKZB 3MRFA 4LAQH 3MN8A 4IRSA 4YXHL 4MMYB 4WGHA 1WBYA 5CUSH 4F7CA 2VFGA 3CUPA 3MR9B 4NL1A 3DEQA 1ZVYA 4Z17A 4BSVB 4C6CA 1TVNA 3O2WH 4IQDA 2RQEA 4NPYA 4OI7A 4PUBL 1ME8A 1U0QA 4AAJA 4UBDC 1J5CA 5JW3H 2O6DA 4G59C 2NZ9C 1NKRA 4XX5A 5DJXA 3N34A 5INCA 3VMOA 4LIQH 2NWRA 1BWVA 3CQKA 1JJUA 5C7HA 3MRIA 2B59A 1RCXB 3IN2A 1E30A 5D1ZD 1P48A 3P73A 1C8VA 5FR3A 2C3WA 5JOPD 2DWXA 4S2CA 2GJ6A 4YR6A 2Y2WA 4XMLH 4KKLC 1EJTC 1QNOA 2GC4C 3R11A 4LASH 5DMGC 1QU4A 2WBJB 2PP8A 1JEZA 2WM0A 4P3CH 1OD0A 1CQYA 1H50A 4O02L 4UU9A 1QUNA 4JZOA 4PBVC 4NQQA 3GZ3A 2C9VA 4K5PA 1OQXA 3LZOA 1NFAA 5CCGE 4KIEA 1MZYA 4Q8NA 1W1B1 4HSNA 4OJFH 1T22A 2CBTA 2PDKA 1QACA 4TQHA 3MZ2A 3MY9A 2O56A 1C8XA 3ARFB 5E5MA 1OOAA 1PL9A 3NUKA 2H45A 4INFA 2EH8H 4NY2A 1JZEA 2ZZ4A 2OMVB 3U6RA 4LLVA 3IDIA 1AH1A 5AVXB 3GSWA 3V4UL 4MCNA 2FPVA 4R90H 4FFVD 5F6HI 4KZDH 3ZR6A 5KBDA 1G69A 1CL7L 2GL5A 1H3PH 1X5IA 3AXHA 4Y4FB 2CH8A 2FJSA 2GJRA 2XWRA 1IIHA 5T1JA 4W4NA 4XBEH 5AOZA 2YXWA 5G4NA 4LVOB 4GNKB 3VQLA 1M68A 3CLMA 2OZ4H 1UM5L 1NQKA 4S0HA 2BSBA 1I1FA 4AFYA 1E9PA 3LKSA 3FU7A 4JHWL 2OMTA 3ABQA 3W23A 4OF0A 2GPTA 3RUGB 4I7VA 3AXLA 3S2JA 3DV4A 4JPKL 4AZBA 4RW5A 2NX1A 3C0LA 3MBXL 3T2NL 4OZFB 3RM4A 1EJOL 1I8MB 4PRAB 4JCLA 1YNQA 2PCYA 2VLJB 4OZGE 4U05A 1FTXA 4ORGB 1LDCA 2XCMC 4UTAA 1FP5A 3ZKMD 2E7BA 3R4RA 2FX8H 4GYBA 1L7TL 3CX5K 4N0UB 1WIPA 2VDQL 4MD0B 1NSNH 3PANA 4YJZL 2XM1A 4FQ1H 1R3IH 4ZQCA 5FUZL 4ZS7H 3HMWL 3TCSA 5EMMA 4AL8C 2X9WA 3SPIA 2D2OA 4HPXA 3HPLA 1NEZB 4WGWB 5J11B 4RZ4A 1VA9A 3FEQA 1FUYA 4MDJA 2C6QA 5M95B 2CZVA 3WS3B 4HIPA 1A6TA 3P60A 1KLGA 1ZXQA 5C3TA 3IMTA 1IEXA 4F0RA 2FHCA 3BKJL 2NUPB 2OTDA 1UKPA 5CJOL 1E6SM 3ZZLA 4A3UA 1YDNA 2PTZA 4ZQPA 3OKLB 3UCDA 3RVUC 5F88A 3WLSA 4ODBD 4Z2JA 1KF9B 2FR4B 4D0BB 1WBXB 2Y2TA 3I6KA 4AZ7A 3QUYA 5D4QA 2QADB 3IFPA 5FYJH 5HPMA 5E8OA 2JTDA 2N01B 4IGBD 4JM4H 4JPWL 1B3JA 1RSCA 4IISA 1R1CA 4AJYV 4Q6KA 2WN2A 1PUDA 3Q67A 3TDFA 2F58H 4PRDB 1MIEH 4U7MA 3WBEA 3NRFA 5ICYA 5DURD 1IXQA 3SSZA 5HQLA 1LBMA 1X5ZA 4NWTH 4YQXL 4LCUA 4M1GH 4IQLA 2CR0A 5BV7C 3B0VC 4TPRH 5DJCA 1RZ8A 4OD1L 3BD4A 5KSAC 1JPHA 4F58H 1Z66A 4JNYA 3EO1A 4JFFB 1I7RB 3DMMA 3EGDB 5L2KA 1MCPL 5EBUA 1SLWA 1K9FA 4G7SB 5CLWA 1H4PA 4QY8A 3U2IA 4X9SA 1SF5A 4BA8A 2IPUG 5ITFB 3W7LA 1WKEA 4Q9RL 5C0DA 3SDDD 5BRZB 3HE6C 4GW5A 3TN0A 3KHQA 1F3DJ 5H1WA 5AW6B 4TQIA 4UM9A 1AD0B 1HAUA 3NQFA 3ULVL 2X7LB 2BW5A 1XF3B 1SVDA 4DM2A 3G1XA 1B30A 4ILDA 1US0A 3GSNL 1SY6A 1WS8A 2O5XH 1W3JA 1TTIA 4CVXB 4H41A 5DMIL 1KIQA 1EVTC 1QVOB 3AYSA 3P0YL 1UA3A 3WLQA 4R7DA 4P4KB 5D7SH 1YE6A 2BFGA 4M5SA 3TNMA 1JCJA 3AWFA 4FP8H 1LL6A 4JIHA 4HK5A 3VWJC 3TEUA 4EN3A 3G5ZA 1XDTT 3PG8A 3WD1A 1N7KA 3ZE1B 1QYGH 3K2IA 5K59F 2WHLA 5I6SA 1EMTL 2P53A 1Q1JL 2CXEA 1VP5A 1M7DA 4XN4A 2BVPA 3UTOA 2NW0A 1XR8B 5J6GB 1I2OA 2A3BA 3H4WA 1K6QL 5DD5H 3AREB 4LOEA 1URLA 1VF5C 2APSA 3P54A 1UH2A 4JEJA 3CC5B 2ATSA 1ZHNB 2GW5A 3AIRA 3MV11 4DOHE 3MRNA 4GX9A 5EEZA 2KERA 4KKCD 1GPOL 5T91A 2OMZB 3NTCH 1MF2L 1B54A 1LL1A 1CICB 1E4XL 1ETZB 2UY2A 1TNMA 2RQ8A 3SFWA 4ODTH 4WU7A 1P6CA 5E51A 2PYED 3QR0A 4KDTC 3NCEB 3N85L 1CE1L 4E9YA 2YD2A 2PYEE 1TV8A 1LO3H 3IXTA 3X1BA 2QV2A 5HI5D 3N1FC 2V9RA 3UP6A 5ERWB 1A22B 4ZMOA 2IKGA 4R4BA 4HJEA 4RUBA 4TNWF 4JAMB 4MJIB 2DWDA 1T80A 2HK1A 3ATAA 1IUZA 3QDGD 2LV4A 4IU3A 5AAMA 2NXZC 4M7KL 1GTFA 4HHWA 3QDGE 5CEYA 5F70A 5C8JA 3KBSA 2O93L 2ARJA 5BMXA 4IKNA 3FT1A 5REQB 3WF1A 3HW7A 2VOMA 2I60L 4ZTOH 2AHIA 1H6TA 3SO7A 3LGDA 3W7JA 1BFSA 5EEYA 1W5QA 4GRLD 2GDVA 1FY6A 4W87A 4KX7A 4U1SA 4J2MA 1RZFL 1PZ3A 1Y8BA 4QF1B 2CDEA 3LS9A 1R2SA 2V30A 1YG9A 1U3HC 3S2LA 4GIPD 2C1PB 2KQNA 1P1MA 1NARA 5F0MB 4A2LA 3PHSA 3WN5B 2OWXA 4W89A 4WEVX 1A6WL 3D48R 3DGBA 1XQLA 2P3YA 4B7IA 4PY7A 2Z1VA 3P8IA 2CBVA 3TA3D 3BH9B 3MOAL 3X13A 5AFAA 1OFQA 1W5MA 4YSQA 4G9FD 1O9VA 1U8IB 2VTFA 4G9FE 5DT5A 1BFOA 2DV0A 1TCRB 1KY7A 4PRTA 5T33L 3IETA 5ALCH 4M61A 3K2MC 3MOBH 1EIXA 4NN7C 4HPNA 1F4YH 1E8YA 4MJHA 3ZTJH 1BPVA 3L7FA 4WZHA 5C5YA 4L05A 2DQCH 4JTAA 1UWRA 3GS4A 4ZTPL 3CWNA 3BJSA 4KKBC 1GEQA 4MKTA 5KOVC 2GJJA 2EDKA 3KEDA 1BQCA 1J4EA 1KTNA 1AQFA 3EWBX 2WJZA 5HGBB 1A9BB 3JV5A 4I77L 1N8ZA 1L9MA 1Y0EA 2MQGA 3ZE0F 3DIFA 3KOYA 3A0OA 3TS8A 2DN7A 1OIOA 2VELA 4WNJA 3TWYA 2CW6A 4RRPG 2VN7A 2QIWA 2GKIA 4KWUA 4MZRA 1NAMB 2HBXA 3VXMB 2YL9A 1BYAA 4N0YH 4NC1E 1BQKA 4J3TA 1EHXA 2ZYHA 4XVTL 3N17A 2W6RA 4JLRA 3B2XA 5D71L 5CILL 4DAGL 1RZKL 3IPWA 2CJUL 2FYYA 3DHDA 3C8KA 3PP4H 1JF5A 2YLHA 3U82B 1MYRA 1SM9A 4L4TA 3PJSA 1S5HA 3QLLA 4GXVH 1R5YA 2DD8H 2HTKC 5JIKA 4ZFGH 3AYVA 4JFHE 4Y5VA 3KZPA 1E15A 1AS7A 4PB0L 3SCUA 4PREA 1TJMA 3P3RA 4J35A 5DVKA 4H0HB 2ZP0T 2D23A 4XHJD 4M3JA 1AJ7L 4NUGL 5BO0D 1XH2A 1Z9OA 3PWLA 3R1ZA 3PWJB 3CJJA 3N42F 5DQDH 3GFZA 3CLFH 3U1SL 3PY9A 2E27L 1YKWA 3JZ7A 2K78A 4Q0XL 1P7TA 4NN5B 1MI5D 4ZMTA 3MGOB 3RFZA 5I3KA 4JTQA 3WEZA 4L6HA 3SQSA 1WTLA 5M17A 1GONA 4KRPD 4XNYH 1YMMB 2PZ0A 3J2PA 2G2NA 3CU2A 4LDLB 3MUXA 3TJXA 2JJWA 2R0ZL 1YRRA 4C59B 4RMQA 4XXCC 4KEUA 2BIMA 3B8TA 1HZHH 3M0YA 5FF4A 2K9UA 2CBJA 5GSRA 3EMCA 4NAEA 2HZHA 1U93B 2BXVA 1FWBC 1BLNA 3OPZH 2X2YA 4X61A 3BUQA 4I8YA 3ARBB 4MNQE 1HJCA 1S9YB 4QJ1A 2EDNA 1GAFH 3VI3E 1A7RL 2XV6B 3CWHA 3VFTB 2XDFA 2IWKA 1OCQA 1V27A 2I9LB 1O66A 2DQUL 1NIUA 2AAAA 3MMTA 3GINA 2FJGB 3OIHA 2NSXA 5DRZA 4QDPA 2A74A 3VI4A 1AZNA 1QBML 1U3ZA 4HH9B 1IE7C 2NUYA 2CZEA 3DPBA 3OVQA 4K3DH 3TASA 1MUJB 4PLKC 1TUXA 4L8SA 5KS9A 1ZHLB 4LPWA 2CDGB 1GOIA 4J23A 3WUEA 4C7FA 2WK2A 5I8CB 2B1AL 3W74A 4ALAC 4ZMQA 3WDJA 4HQVA 5J6HA 4BJLA 9CGTA 3NJLA 3KCPA 3KBWA 2CHDA 4OD3L 2GITA 3SCNA 4TRPH 1NCCL 5TFSH 2PDFA 2GGEA 3ZYJA 5JHBA 4WTZA 2OV0A 3KVPA 5IREA 2DZPA 1FL6A 3B7YA 3VGAB 1XYFA 1EP1A 4I85A 4XBGB 3U4KA 2LQRA 5D6CB 4QAIA 3BCDA 1BIIB 4QBXA 3DO7A 5IG7B 5JW5A 2XTKA 4Y1AD 3DC0A 2GJXB 3LOWA 3MYOA 1JCNA 4GQPH 5FOJA 4GRMA 1W3IA 4OSUL 1J1XL 2CWXA 3NEVA 2KMWA 5BZAA 4W5ZA 4NQTA 4TVPD 1X5MA 5CLZA 3H3BC 4TVPE 3MRMB 1UCBL 3BIKA 1PHQA 3NWRA 4NHVA 1BEUA 1J18A 4XZ4A 2FDSA 2BCKB 3LQAL 4B9IA 4ZI8A 1DXIA 3AIVA 1XL9A 4Z7VF 2UZXA 3FQTB 1V3HA 1TTCA 4NKQB 4JTSA 5EPMA 2EXWC 3HBQA 2XPGA 3PAUA 1YADA 4H9UA 1U58A 2E7LA 4JHAH 1JGDB 1KFLA 2AP2A 3PWNB 2ITEA 2OXHA 1P0EA 3GJEA 5D7JB 4O16A 1FWGC 1UXWB 1JPDX 4KAQL 2X1WL 2ZAIA 4YDJB 4IJBA 4FX5A 4CCEA 5CEZD 4PJBB 1FNAA 5C09A 2VIRA 5CEZE 5KN5B 2ZUSA 4DF1A 4NZTL 3FQ1A 1F4WH 5BZWB 3IMBA 2BNQB 4XRCA 1TETL 4WWPA 4QPEA 4FA8A 4URKA 2CHRA 3VFRA 4JZJB 3UWZA 4YBQD 4QXGH 3D39B 4DI9A 4E4PA 5CSGA 3C0SA 4XPTH 4P57A 3GRGA 4OLXH 4GH3A 4OZHA 5SWQA 4XXDB 4XKYA 3CX2A 2ZUYA 3CVHA 2WBWB 3VG0L 1E4JA 1D9KB 4L3EA 5TQ2L 4UQDA 2ZCHH 4W88A 3DHUA 4CKQA 1BBJA 5JDSA 4NNYB 1WITA 1V0NA 2H8PA 1AAJA 3K8KA 1ED3A 4OECA 3C08L 3E2HB 5DT7A 2O4EA 2VDKH 3WOVA 3MCYA 3PV6A 4JKKA 4CD4A 4XG1A 5GGQH 4M3KB 1P1ZB 2DQJL 3C52A 3HMXH 3GBEA 5E1HB 2J88H 5F7UA 1QTPA 4IMKC 3Q2CA 1W1PA 1MFBH 2CO7A 5I1HL 5T3ZL 2OGJA 4JN8A 4H4NA 1GZGA 3LKNA 3HPJA 1ZJBA 5HVHB 2HPIA 2C9XA 2D9QB 3MRRA 4Q97A 4OFKA 4Y1SA 5GZOA 3BAJA 4BR1A 3IJYA 2XWCA 1P9MC 5B21A 1BEYH 4XAWH 5FDWA 1G9MH 5C0FB 2Q01A 4ICNA 4PZVA 1O60A 5DK3A 3DX3A 3CZFB 1U4FA 4AMKL 2EZ0D 3WBDA 1ODUA 3GMLA 5ACLA 3ARFD 1ZCOA 4YHIA 2EG7A 1P4UA 4JG9A 4M4RB 4Y6GA 3KG5A 3M07A 3VE9A 1NC4A 3I9GL 4YDVB 1MCCA 3HZKB 2WTOA 2PO6B 2GCYB 4LPYA 1TIMA 2GYSA 1MW1A 2VITA 2J25A 5DVMA 3MSDA 1POKA 3OVPA 1AFVL 1EC8A 5EO0B 4N8UA 3PBGA 4Y4FD 3M41A 2GBVA 1SOKA 2LTQC 5HHNA 3LV3B 3C2AH 1CGTA 1BVLB 2J66A 3O6ML 2Y0SA 5K9JH 3RLVA 4QLWA 1TMLA 2Y23A 5C2GA 2J2ZB 2JQAA 1Y18B 2X87A 2WYTA 3FQXB 4PGEA 4M1DL 4PIBA 2W0KA 4HZ6A 2TMDA 2NSOA 1OCRB 4LSVL 3ZHNA 4Y5YB 3P9LB 3R7MA 4DYEA 1SHMA 1NCAL 3Q3GA 1KJVB 5IHUL 4R7OA 4PU2A 4KDWA 2WW5A 1XF2A 3S3CB 3BAEH 1OJXA 3VKDA 5EMLA 3ITCA 2VLJD 3ULSB 3V4PB 5AC5A 3CSBA 4QAWA 1DZ0A 4EOWH 2X12A 1KJ2B 4M6ML 2Z8RA 2VLJE 1I9RL 3IEBA 1KB5A 3L4TA 4NLAA 3F7RA 2AKRB 2A77L 4KJYA 2VR3A 1OM3H 2LE9A 3T3PF 1A4JA 2QV4A 1UXSA 5IUCA 2OFJA 3BIAX 2VCCA 3OKNB 4WUUA 4QLJA 5J1AA 3UZVB 1EHAA 1PBGA 1A5SA 3SYCA 3EOAA 3RDKA 3NCWA 4UTHA 1NPUA 1KC7A 5HYIA 3M7OA 5DJ2B 4LV9A 1CFTA 4OBTA 4PRPA 4MKNA 3DOSA 3MSPA 3UR7A 1UWSA 1DEEB 5E0CA 1PJ9A 4YXKH 2XLLA 3ECWA 4UM8B 1JV2B 4X0KA 2PKDA 3IIVA 5D2WA 1V93A 3OZPA 4GQGA 1YDPB 1I8KB 4W70A 1PAZA 3NVQA 1JDAA 3NPWA 3GSRA 4YK4C 3RG1C 2WSPA 3EYUH 2VYRE 2VSMB 3ARGD 3U7AA 4DFIA 2UXVA 1TXKA 2ROXA 3L0KA 4ZQRA 2QADD 2VR4A 2VX5A 3VI2A 1YEDA 2JJUA 1W54A 2WHMA 3JZEA 4M8RA 2X9ZA 4NRYA 4KK6D 1OANA 2X4SA 3EYPA 2HCZX 1CVSC 2ZCKL 1S78C 5AVQB 4PWEA 2WV3A 4F8LA 3O6LH 1QSZA 4HN8A 4IZGA 3NEEA 1PTGA 1V77A 1R3SA 5ESQB 3ZY7A 1WAUA 1L6YA 3DI2B 1R5VB 4ZMLA 4LSTH 1KKOA 2OX1A 3H9SD 3QCTH 5D1QD 4OGAC 1QP1A 5B7MA 4U1IA 3H9SE 1JPIA 5D1QE 3QYQA 4OM0H 4KVNH 4MNHB 4UMCA 3VMPA 1NDVA 2ITCB 2GABA 4BRJA 2Y24A 3U6WA 5EU6A 4KY1H 3A6BH 4DW2L 3VFSA 3PYCA 2D4DA 4Y9FA 5H37H 3N73A 2FWUA 1Z9SA 1WJ3A 2WMIB 3VI4F 4ODVH 1OLLA 4EN2A 4IGBB 5BRZD 2R1MA 4I18C 4BA0A 4UWMA 1OW0C 2A9MH 3ROOA 4OZOA 4WDWA 2DW7A 1RLWA 1K5NB 5BRZE 4N5UA 5L9DH 2VXQA 2Y5TB 5KS9F 2H9AB 1E9ZB 2R7EB 1QOPA 4ERSH 3TYDA 3MUIA 5DURB 3K6OA 4NENB 5IM7A 2ZOLA 4UCGA 5E5CA 3Q8AA 8RUCA 4C7GA 1CT8A 4P61A 3RRQA 5CHNB 4S3GA 1B4TA 2NY6B 3B3IB 1US2A 4HV8A 3RAJL 4LSQL 2WCPA 5IBLC 1IO4C 1THFD 2JE8A 3A21A 1ZY9A 3KGSA 2H6RA 2H0EA 2DMCA 4MVBD 1MFEH 1SBSH 1DANT 3THMH 5F9OL 1XQ4A 2AL2A 4HQQH 1WWAX 1R5WB 1G6RH 2CAKA 3UC2A 3ZE1E 4HJGA 4IM8A 3WMLA 9RUBA 4CSZA 4BF9A 5IHBA 4CSTA 3KLLA 5IR1A 5IQ7H 1KPVB 1VCVA 1BCIA 4QOKB 1PKOA 4NQDB 5JYMA 5B39G 3REQA 1T83A 4TXVB 1E0OB 2B77A 2D8KA 3FDKA 8XIMA 5IKCA 3RVXC 3IIPA 4UT6H 2BDNL 3B5HA 1G7QA 1GIGL 4YSOA 1LO0L 4PJCA 1ZCCA 2VFDA 3UWWA 3WBWA 3W7NA 1CICD 4GIOA 4PJ5D 1AXIB 2XQBH 4M5PA 3N55A 1ZIBA 4ELKA 4D6JA 4PJ5E 4KTDL 3A4FA 1T7XA 4XZHA 1X6NA 1L3NA 2HLAB 1DE4A 4NQXB 4HWUA 5D6DC 3CEPA 2C8NA 4RX4D 4BGDA 2J6XA 1MY5A 4A2GA 4UT9L 3KCOA 3ZO9A 4BWLA 4KKQA 2ZKHH 4I90A 3AFBA 1JVKA 4IRJC 2H3DA 4NX5A 3CBKB 3B2VL 5FHAL 1CDHA 2VXQL 1CDJA 3U0TB 1MCOH 1VFUA 2NY1C 1NCTA 4UF7C 4TUOA 2GGIA 1KGWA 3EF4A 3HC4L 2EDJA 4J4PD 3QJFB 1NLDH 1AZUA 1QSVA 1ZJAA 2IKIA 3QPXH 2X40A 4B41A 3PGDA 2GFBA 2IDTA 4KV5F 1EEYA 2QSTA 1J8SA 1O6VA 5DX7A 3VNJA 3OC5A 1AMKA 1PFCA 5DHDA 5E6IC 3QJSB 2NV2A 4B90A 2DL2A 4LRNH 1ZA3A 1T5AA 3RZCC 1ZAGA 1D7BA 1HE7A 4OZHF 1IIGA 1F9CA 2HFFB 1MREH 3HFML 2YLLA 4LRSA 1R17A 5IOPA 3IDNB 2BVWA 4HD9A 1G4PA 2R56H 5KTEL 4K2SA 5E00A 5LXGL 1RUAH 3HHMA 2WBGA 1MJ8H 2B08A 4XPBL 3PWAA 5HD8C 2W59A 1EBPA 2M1KA 4O1DA 4AIEA 2E74C 3PE9A 2CBIA 4GRLB 2CLHA 4ZX5A 1F58L 3L3JB 4X6CE 1Z9LA 3B4NA 5F7NC 1R3KA 3EYVB 5LDUA 3CYJA 3OKKA 5FAJA 3SD5A 3QHFH 2HRPH 1XIDA 5FF2A 3UBHA 4GO8A 4F8TA 3CE1A 4CW1B 2XN1A 5CCZA 3L3GB 2DQHH 1EUNA 2JKLA 3T40A 1GVQA 3JWOL 2W0PA 4JPIA 4NAQA 3CLEL 3D8MA 2QPFA 2VC6A 1XB8A 1ZTMA 4HKBA 1QCWA 5D9NA 3BJFA 3HM7A 3IU4H 3HI5L 1P0BA 5DFVD 4XTRD 4DVRL 4L4OA 3DFQA 4AVJA 2C9RA 3A4XA 4IIGA 3I9AA 4XNZC 4ZQOA 1FWWA 4AZIA 4A7GA 4UZGA 1W1A1 1X1ZA 5PCYA 2P50A 1MCKA 2MWCA 3WDQA 2HISA 3SCMA 4RPPA 3ESMA 3UZQB 1CE6B 3VFWB 1MJUL 2BIPA 5IBXC 1XH0A 1C5CL 3GRBA 4EAEA 5TF0A 5C0IA 5E93A 3QOMA 3BUYB 3R06A 1MN4A 3ZVHA 3RWHA 4ZMPA 4P2VA 4N2MA 3MXVL 5HHOD 2QUVA 1JPSL 3G5XA 1FFNB 3AU6A 2VCAA 5HHOE 1HILA 2QGHA 5BNXD 1TQBB 1MEWA 4IPNB 1PG7L 2CCLA 4FXGA 3QJHA 5F7EL 3RHWF 5IOKA 3VRLF 1V08A 4RFEA 1QLRB 2HLFC 1KYFA 4KNSA 4QCFA 1YMMD 4FO4A 2YCIX 3CJPA 3QQ4A 3OMAB 1YMME 2A73B 1EOKA 2XQYA 4RAHA 4PB9H 3BVJA 1R3LA 4MTMA 4G80A 1URZA 4H01A 1FZJA 3L5AA 1X9LA 4YZFE 3ET9F 1FXPA 3DI3B