1PZ3A

Crystal structure of a family 51 (gh51) alpha-l-arabinofuranosidase from geobacillus stearothermophilus t6
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
497
structure length
497
Chain Sequence
KATMIIEKDFKIAEIDKRIYGSFIEHLGRAVYGGIYEPGHPQADENGFRQDVIELVKELQVPIIRYPGGNFVSGYNWEDGVGPKEQRPRRLDLAWKSVETNEIGLNEFMDWAKMVGAEVNMAVNLGTRGIDAARNLVEYCNHPSGSYYSDLRIAHGYKEPHKIKTWCLGNEMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVVCGSSNRNMPTFAEWEATVLDHTYDHVDYISLHQYYGNRDNDTANYLALSLEMDDFIRSVVAIADYVKAKKRSKKTIHLSFDEWNVWYHSNEADKLIEPWTVAPPLLEDIYNFEDALLVGCMLITLMKHADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASVYGRGVALHPVISSPKYDSKDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVLEHDNVKQTNSAQSSPVVPHRNGDAQLSDRKVSATLPKLSWNVIRLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-L-arabinofuranosidase
publication title Crystal structure and snapshots along the reaction pathway of a family 51 alpha-L-arabinofuranosidase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 172
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pz3A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pz3A02
4P7NA 3KL0A 3QHOA 3WBEA 4FNSA 5A8OA 2ZUMA 4GQQA 1UR9A 3RPMA 5E9AA 1SYTA 4AD4A 3D51A 1PX8A 1UWQA 1XHGA 1JF5A 5A69A 4BQ3A 1E4LA 2J7BA 3HG5A 3EDJA 4PSPA 1TA3B 1GHSA 5BROA 3LPFA 1R7AA 1DWGM 2W63A 3OGSA 4NSBA 1CLVA 2YBTA 3WF1A 4FLOA 4Z2IA 1TQVA 4Z2KA 1RH9A 2VURA 1J0KA 3DDFA 3VIGA 4QDMA 1KBBA 1TQUA 1G94A 1R75A 3CZEA 4W93A 3EYPA 7TAAA 2GJXA 3GXTA 5CXPA 3AOFA 3QHMA 4ZFMA 3NSXA 2F1BA 4U5KA 5FCZA 3MMDA 2QPSA 3VGFA 3WNNA 4UTFA 2OWXA 3AQUA 1BGAA 1BTCA 1PBGA 1NOWA 1KBKA 3GXMA 4GO9A 3ALFA 1VFMA 1H49A 4U33A 1ZBVA 3GNPA 3VINA 3W37A 4MAVA 1XSJA 3DX4A 5ABFA 4W7UA 3U57A 3WDQA 1V6XA 3AS3A 4MPKA 3WMSA 2CKSA 2Y8KA 2CBVA 1QBAA 2YOCA 2WHJA 1E6SM 4IM4A 2BNJA 5D8ZA 1XD1A 4QFUA 1IZJA 5HNNA 3RMEA 1T0OA 4NXSA 2DSUA 1KGXA 2Z1SA 1GOWA 1DWHM 3W0KA 1P6WA 5D4YA 3ECQA 1TA3A 4W88A 1G1YA 4C7FA 5LA1A 1ISWA 1OD8A 1XSKA 1GQKA 3TOPA 3BVVA 4PMDA 4YHEA 3WUBA 3VGHA 2XWEA 1K9DA 4Z2GA 1LF1A 3AICA 4HA3A 1NM9A 4JFTA 1HJUA 3MUIA 2VR4A 1NWTA 1WZLA 1PEZA 3KWXA 2E3ZA 4CD5A 5A6KA 4NRSA 2GK1B 3MS8A 2EO7A 1UQYA 2OWCA 2DH3A 2X0HA 3BSGA 3WNOA 4M81A 2GJRA 1UWUA 1NWUA 3VTRA 2Y5EA 3UG3A 4CCCA 4U3CA 4PRWA 2BY1A 4P7QA 5HBFA 1ZB5A 2UY4A 3WH9A 5BRQA 1E56A 3D50A 4JKMA 3WH5A 3BH4A 3B9EA 5BXPA 3BCFA 1OIFA 3L2LA 1ZBWA 4W7WA 2D3NA 4OIFA 3NSNA 2X05A 5A8PA 2Y2WA 1CGYA 2XM2A 1I1XA 3WUEA 1GCYA 1Y7VA 3WNKA 1PJ9A 3OG2A 5HXMA 4XZWA 2VRKA 2BHYA 2WB5A 2Q8XA 2A3AA 3T0BA 4CD8A 1KTCA 2IGTA 3VMNA 5I5RA 2DPEA 2JIEA 2ZUWA 1SFSA 3SUUA 1AQMA 2EPOA 2XGIA 5EBAA 1FH8A 3VMOA 1TQTA 3ARYA 3MKKA 2YJQA 1HKIA 1UKOA 2F61A 3GBEA 1JF6A 3WY1A 3LPPA 2VCBA 4URIA 3CTTA 3MO4A 3CLWA 4GI8A 2WZIA 1M7XA 1BGGA 7CGTA 3WF4A 3CBWA 3ZT7A 1MVYA 4OJYA 3T2PA 2EQDA 3PZQA 4PMZA 1L8NA 3VDHA 4UR9A 3EJRA 2TAAA 4PMUA 1A47A 4W87A 3N12A 4FF5A 1H3GA 2GK1A 4H41A 5FIPA 5A8MA 1KWKA 2XGBA 2FHFA 2ZUNA 3AISA 2J7FA 4J27A 3EJQA 2XFYA 3HJEA 4JKLA 1VEOA 2GDVA 3WDJA 4R27A 3ARTA 4MTVA 3UERA 5I77A 3N04A 2C0HA 4H2CA 1E6QM 3AROA 1QOXA 2CEQA 1FP8A 4U2ZA 3UCQA 1F4AA 2CKRA 4C7GA 2BFGA 3VIPA 2BVDA 3VIIA 4U5IA 1W1YA 1F4HA 4AWEA 4J3SA 1ZS2A 4AYSA 3NDZA 1FOBA 5A8NA 3A5VA 3VSUA 4NF7A 3A4AA 4W8AA 3VDBA 1JZ2A 1XD0A 3BAWA 1VBUA 4U3AA 2QLYA 1ZJAA 2VO5A 4PTWA 1KQZA 2HISA 3DYOA 4KRUA 3UR8A 4D6HA 3WL0A 1J0JA 5FOOA 4H7VA 1CGXA 4PMYA 1W1VA 3K4DA 2ZUTA 4CKQA 1E55A 1I75A 4HMCA 1JNEA 4A3HA 4D71A 2OSXA 5A6BA 4GKLA 3AYRA 2CXGA 1EQCA 5DO8A 5LYRA 2VOTA 4W84A 3CUHA 1CGWA 1QNOA 2BV9A 4GZEA 3WQ6A 3SUVA 4UCFA 2OSYA 2EXOA 3WFZA 3EDFA 3ZO9A 1EA9C 2VL4A 4MDOA 3PZUA 2YDSA 1WDRA 4M29A 1NOUA 1CLXA 4WIWA 3AHTA 5CPQA 1C8XA 4NZFA 1E6PA 1KXQA 1VEMA 2E9LA 4P7LA 1RD6A 4QCFA 3AYSA 1E6ZA 2ZIDA 1HXJA 1IV8A 1E4IA 3CZLA 1WZAA 1UD4A 2Z1KA 4AXNA 1UASA 3OLIA 3MSGA 4F66A 1QHPA 2EABA 2VZOA 3W6MA 5KZ6A 2WYSA 3CUIA 3I3BA 3GXPA 1TE1A 1J0IA 1LWJA 4RE2A 2WXDM 5HOSA 4LYQA 4GINA 3K4AA 1UWIA 2WAGA 2CESA 4AD0A 1IZKA 1A3HA 1HJVA 1CGUA 4WKAA 1BSIA 2V5DA 1BYCA 5C70A 2J77A 2CBIA 3WIJA 2E40A 4MJ4A 4GZIA 5EMYA 3LRLA 2CBJA 1UWRA 1QPKA 2WZHA 3K8LA 3CIVA 1UKTA 3D4YA 3WL1A 3BUPA 3W82A 3VO0A 4TX8A 4D6IA 1NP2A 1BG4A 2CHOA 1Q4NX 3BMWA 1GOIA 4P7OA 3BVTA 1VJZA 2VI0A 1BF2A 5BXSA 1JZ6A 3AZTA 2WHMA 3GZAA 2DT3A 3AMKA 3ZQ9A 3UESA 4HZ7A 3W29A 2ZOXA 1IT0A 1E3XA 4Z2JA 1CDGA 4LX4A 5EFFA 5FD0A 4OOZA 4F79A 4FK9A 1SMDA 4JKKA 3WDRA 2D0FA 2W5FA 1ISVA 4XX6A 3N9KA 4JFVA 3HZ3A 3L4TA 4D72A 3VIFA 3AI0A 3EMQA 3CHFA 2ZXQA 3AIWA 3W25A 1QVBA 5GNYA 4D1IA 2W66A 5BXRA 1QI3A 2RGMA 1CYGA 1UR2A 1E4NA 2GVYA 4GQRA 1E1FA 4MB4A 4D6FA 3WUGA 1GVYA 2WK2A 1PZ3A 3ARVA 2VCAA 4HU0A 3CV5A 2XFFA 3WH7A 5ABHA 4PTXA 1QNSA 3GDBA 2CERA 2Y8VA 4L4PA 4AW7A 4F8XA 2OWWA 3ZIZA 3N18A 3WDPP 4D1JA 3IAPA 3FAXA 2XPKA 1W3KA 2DGAA 2WBKA 1US2A 4ACZB 2V5CA 4ZXLA 2OYLA 4NZCA 3HG3A 3K1DA 1CXFA 2QPUA 4Y7EA 1XH2A 2IXVA 4NI3A 1GZJA 1L0PA 3TTYA 4AZHA 1EHNA 1GQLA 4LYPA 4P8UA 3WD2A 1JFXA 1QHOA 1V02A 2WWDA 3AZRA 5HPOA 1BG9A 5D8WA 2AMGA 3OIHA 5DF0A 1JD7A 5IFPA 1JZ8A 1MYRA 1JZ7A 1M04A 4EANA 2FH8A 2WCAA 4AEFA 3D5HA 2OW6A 4E4PA 3AS0A 2ZWZA 1V6YA 1DWFM 1V3MA 3MU7A 3O2LA 4LXFA 4W85A 1B3XA 3AXHA 4DWSD 3BXWA 2MANA 4HOWA 3LPGA 1CXLA 3SCUA 3M6DA 4D6EA 2VTFA 3ARXA 4AZ7A 1JZ5A 1ZBKA 4LGXA 2WMGA 1ZBCA 1J11A 1B3WA 4PSRA 3WD4A 2G4FA 2VC9A 1LLOA 1G0CA 3AMLA 2BVYA 3VGBA 2F7OA 4WJXA 2GFTA 1GOQA 3BUBA 1Q6EA 2FDMA 4KH2A 5CG0A 3SUSA 1VF8A 1B0IA 4D6DA 2DIJA 4AZCB 2EPMX 2PC8A 5BXTA 2OSWA 1MFVA 2BHUA 2V38A 5CSUA 4OBSA 3GXFA 3AHYA 2IXUA 1EDGA 4JAWA 1XYZA 4LQ1A 1EO5A 4AISA 1VFOA 3ZR6A 4ACZA 1UR0A 5AYBA 3CPUA 4S3JA 1E40A 3UETA 3WFLA 3WEZA 2F7RA 1J01A 4N0RA 3UG5A 3VIHA 1JG9A 4UQEA 1BYAA 3GNRA 2WM0A 1HX0A 4PUDA 3IANA 3AMDA 1TR1A 4CD6A 4TUFA 1HJWA 3DECA 4JCMA 4M1RA 2FGLA 2JIWA 3UEQA 5CLWA 2J8GA 4J3XA 4JL2A 5FL1A 3DX0A 1KTBA 3EDEA 5F7UA 1VJSA 3ZT5A 4J3TA 1V08A 2YL5A 1B31A 1E15A 1EH9A 1OT1A 5I78A 5CZKA 4BCEA 2XIIA 3L4XA 4AYGA 2WWCA 2WVUA 2JE8A 5A2BA 1BQCA 3CUGA 2WC7A 1QX1A 3LRMA 4PMRA 1XSIA 2X0YA 2W67A 6A3HA 2J25A 2V3EA 3OLEA 1GORA 5AC5A 4MNMA 1TCMA 1WDQA 3F5KA 2W62A 1E5JA 1CWYA 3A4WA 1CNVA 1U2YA 5DFAA 2WMHA 3A22A 1BYBA 4AZCA 2J8FA 3B9AA 3AIBA 2D24A 4V27A 4UFHA 2XSBA 2WPGA 2J47A 2DSVA 5GPRA 4ML4A 1J10A 4A4AA 4GI9A 4V28A 1HKKA 3F4VA 2ZWYA 4JL1A 3SCPA 2A3CA 1WCGA 3ALGA 5JIWA 5E6ZA 2F7QA 1KXTA 1H11A 1WAWA 2JF7A 2FHCA 1J9YA 5CLTA 1GJUA 3T09A 2YDRA 2ZXAA 1UD6A 5CGTA 1V6VA 2CYGA 4CU7A 2PBOA 3EBVA 1QI5A 1QBBA 4BZYA 3QGVA 2O9TA 1W9BM 1W1TA 3PBGA 1VENA 3W6LA 2VMFA 3TP4A 1N82A 4TVDA 2AOSA 1OGSA 3NJ3A 2QMJA 3GH4A 1R85A 4HPGA 3KL5A 2F1AA 1RP9A 3ARSA 1E0WA 3A4XA 4IUGA 4AIOA 2X1IA 4WLCA 1R86A 5IHRA 5C71A 1AVAA 2VRJA 2JEPA 2CCRA 3RJYA 5KEZA 4CD4A 3DX1A 1H09A 3A6OA 1VBRA 2B31A 3NCOA 2DT0A 3DX2A 1BVZA 1W1PA 4JHOA 1V02E 3N17A 4U2YA 3MV01 2QMKA 1JDDA 2YKKA 2YFOA 4LPCA 4QAWA 3QHNA 5DMYA 5HDRA 5CGMA 1B3YA 1ZL1A 1HTYA 1HVQA 1UUQA 8A3HA 3S5YA 1UKQA 1KR0A 4W86A 3SCSA 4PUEA 4BA0A 3JUGA 3WELA 3S6TA 3VD9A 1E0XA 1EOKA 2J7HA 1ZJBA 2J78A 1FHDA 3PZTA 2E4TA 1UHVA 5TD4A 4HA1A 5DT7A 4M82A 3GXIA 3LXCA 1PS3A 3M07A 3VGGA 1CXHA 2WLYA 3AIQA 4MB5A 3SCWA 2E0PA 4DM1A 4IISA 5M17A 3VIJA 3I3DA 1PAMA 1NH6A 1B9ZA 5A2CA 3N1AA 1LL6A 4HA4A 3EJPA 4YHGA 3H55A 2CITA 4Q22A 3FN9A 4IPNB 1M01A 1EOMA 5D9MA 1M03A 1MW1A 5LA2A 4C7DA 2EPLX 3WQWA 3KLKA 3WNMA 5A6BD 1JNDA 2A3BA 1JZ3A 2CETA 1UWTA 1CGTA 4HMDA 4UFIA 2PWHA 2G41A 1H41A 4CN6A 3CZJA 1W32A 1E9LA 1JD9A 1W3LA 2PWEA 3VMPA 3VGEA 5GNZA 1UH2A 4B3KA 1KGUA 4FLRA 2OYKA 3NDYA 4CN1A 2DSWA 2JFEX 3A23A 1HT6A 2WMIB 5JBFA 2F18A 1HL9A 3T0DA 3LRKA 2EPKX 2FH6A 1WB0A 1V0LA 4WKHA 1X6NA 1R33A 3BLBA 2O9OA 3SCQA 2D1ZA 1AQHA 3EJUA 1D3CA 2DEPA 3TONA 4PYSA 1C7SA 2VX5A 1OM0A 3PZIA 3AIEA 3ZJ6A 3WD0A 4CU8A 3BSHA 1FH9A 3HG2A 1PIFA 1SMAA 2EJ1A 4MNKA 3WQVA 5E0CA 1MQRA 2ZX6A 3T2OA 1U30A 5I23A 2PB1A 4UFKA 2W61A 4H04A 1W3HA 5M03A 3RJXA 2ZX7A 1VFFA 2JEQA 1JFHA 2CNCA 4PMOA 1V0KA 4CGTA 3PHAA 5ECUA 3WMBA 1GOMA 2YL6A 1GOOA 3GH5A 1HXKA 2WANA 2CPUA 3W53A 4PEEA 4D6GA 2XTKA 4DO4A 1B90A 1MW2A 3EDKA 2VX6A 2VCCA 4EE9A 1S46A 3A3HA 3RM4A 1HP4A 4CD7A 4QP0A 1OWQA 2ZX9A 4PCSA 5LA0A 1BAGA 1LJYA 5IFTA 3DC0A 2FGZA 3B8SA 3U5YA 1JDCA 2BVTA 2XIBA 4GO8A 1OT2A 1HN1A 1JL8A 5I0DA 1JAKA 3POCA 4AEEA 1V3IA 1RP8A 5I79A 1PX3A 2OLHA 2WMIA 3MUY1 5AYIA 1LWHA 3WNLA 1HP5A 4KMQA 3IK2A 2WBGA 1E6XM 3T2QA 1JXKA 4KRTA 3CC1A 3EMCA 1R47A 4IPLA 1QNQA 4B3LA 2XVGA 2XVPA 1QW8A 3IAQA 3VD5A 2VQUA 1GHRA 3L4ZA 4PMQA 1J18A 4TTGA 3OZPA 3F5JA 2VNCA 2DIEA 2WSKA 1TUXA 2VVNA 5A6JA 1VB9A 4UNIA 4UFJA 5E09A 4D6CA 3FY1A 2UWFA 5EFDA 4CVWA 5FKYA 1EDTA 3WF0A 4AIEA 2BXZA 3CHCA 3HU7A 3EJSA 3VX0A 1NWSA 2J7DA 1TMQA 2YA0A 4HTYA 3FAWA 1B3ZA 2XG9A 3FHQA 2OYMA 2JALA 1V3KA 4LYRA 1UQZA 3VGDA 4OBRA 3A21A 3D4ZA 2XN0A 3BVWA 5GQBA 4JFUA 2JF6A 4TX6A 2YL8A 3ZM8A 4ZXOA 4UZUA 6CGTA 3WENA 3QOKA 4JHZA 1FP9A 4L4OA 4BQ2A 3IJ9A 1C90A 3U7BA 3K8MA 1CTNA 3HN3A 1KGWA 4J3WA 2WHLA 4J7RA 3BVXA 6TAAA 1HKMA 1V3JA 4AD3A 1D2KA 1AQ0A 2GJPA 5JBEA 3TTOA 4FMVA 1UKSA 2VRQA 4NXKA 3PZOA 3VKKA 1KFWA 2E9MA 2XHYA 3ZJ8A 5E1QA 3ARUA 5ABEA 1E1EA 1H0IA 1X6LA 4ZEPA 2PF0A 3VIMA 2NSXA 4MNLA 3TV8A 2DH2A 5JBDA 3BGAA 3ARZA 1TQWA 1E3ZA 2WW5A 2OW7A 1NARA 4J3UA 3MI6A 2NW0A 2BS9A 1BPLB 2J7CA 1EIBA 2ZE0A 4AZIA 3H53A 1QWUA 5A94A 1C3FA 4HZ6A 1VIWA 2XM1A 1KB3A 4V2XA 4PMVA 3OA5A 1FFQA 3IGUA 2XUCA 3WBAA 3A24A 5D9NA 3VILA 3VPLA 1VEPA 1E4MM 4FNUA 4WF7A 1ISXA 4DWSB 4BF7A 5I24A 1FH7A 4HOXA 3FHAA 1B2YA 2D73A 1UKPA 3TA9A 2J62A 1YHTA 4AZ5A 3GH7A 2X2JA 4HOZA 1HL8A 1GPFA 4HZ8A 3WKZA 3QR3A 3PZNA 4PTVA 1V6WA 1JDAA 4N42A 2D23A 2QF8A 3MUZ1 2Y4SA 2BY0A 3CMJA 4X0VA 1EDQA 4P8VA 3WF2A 1SR0A 3MSDA 2J75A 3APGA 3WH6A 4F9JA 2UY5A 1CPUA 1MQQA 3WY3A 1Z32X 1BFNA 3EDDA 2VX7A 1VRXA 3L4UA 1KCKA 3T0AA 3AJ7A 4UQCA 1B30A 1GJWA 1Q6DA 1C8YA 4JCLA 3K8KA 2WMJA 4TOQA 3DYMA 4Q7NA 1C8QA 2WCSA 4MAZA 4MB1A 4FNPA 1FHLA 4F9DA 3LXAA 3BAKA 3CZKA 1WDSA 4P8XA 1I1WA 3VDAA 2G3MA 3BUDA 3ZJKA 3VSTA 3SCNA 3OLGA 2C8NA 3ZJ7A 3ZSTA 1CBGA 3A47A 4ZENA 2ZX5A 1QI2A 1LL7A 3CGTA 2DT1A 4UFMA 3OGVA 4CUCA 2WVVB 2YFNA 1UD3A 2XWDA 3VNYA 2QV4A 1E6NA 1OB0A 5BCAA 2EEXA 5JUVA 5EB8A 5DT5A 4H8UA 4DWSA 3BLPX 4M56A 3RIKA 2VVSA 3S5ZA 1DWAM 2YL9A 1DEDA 4UZSA 5BWFA 1JXJA 1KCLA 1US3A 4HP5A 1UR1A 1H4PA 4CCDA 3IJ7A 1W9XA 2XSAA 2VZTA 4QLJA 4NRRA 4MDPA 1QWNA 1TQSA 1B3VA 3WQ8A 3ZMRA 3WY2A 3CZNA 1R7OA 1NQ6A 3WSUA 1R8LA 1KXVA 1MXDA 4HU8A 2BXYA 3O6AA 1UD8A 2G8ZA 1DWIM 2X2YA 2G3NA 2XVKA 3VIKA 2D0GA 2WKLA 4H8HA 4MNJA 4E8CA 3NUKA 2PBGA 1HVXA 4KGJA 1GQJA 1XV8A 1LL4A 4D6JA 1GW1A 1HWWA 3OZOA 3ZR5A 3WD3A 1OINA 1PZ2A 3O9NA 2XJ7A 1R34A 3ZT6A 3PTQA 1V3HA 3M7SA 4TXEA 1JZ4A 3I3EA 2E8ZA 1K6AA 1C7TA 1HF6A 5A2AA 1K9EA 3N11A 1EHAA 1E6RA 1JI1A 3W38A 4OZOA 5CSYA 5ABGA 3H54A 1LG2A 4UQBA 4TVCA 3THCA 4UQAA 3B9DA 2WVVA 2CBUA 3PZMA 4OKDA 4AD1A 1OCQA 4CVUA 1JI2A 3DYPA 4XUYA 3BC9A 1CGVA 3SUTA 1M53A 1XH0A 1FA2A 1UZ4A 1OBAA 1BYDA 4A3YA 1H0GA 1HJXA 1LQ0A 2ZXBA 1V3LA 3BAYA 1KWGA 3MMWA 2C7FA 4ZE4A 5AY7A 3SIMA 3VU2A 5GNXA 3W81A 3L4VA 4FNTA 4KWUA 1WNOA 4KGLA 3W26A 3OB8A 5IDIA 2ZXDA 1QW9A 1OD0A 3G6MA 2XYLA 3AHVA 2AAAA 2PWGA 4W5UA 3WNPA 3T08A 4AZ6A 4EK7A 4ATLA 5JIPA 3NYDA 4TVUA 3VD3A 1XYFA 1TG7A 4DUWA 1TZ7A 5E6YA 4MB3A 4QCEA 2IUZA 1TVPA 1EGZA 2NT1A 3SEPA 3PTMA 1CEOA 1DWJM 1WDPA 3MV11 1XCXA 1VAHA 3FXYA 3CUFA 4GI6A 3RM9A 3WH8A 3VIOA 2WMFA 1WPCA 2FYVA 4JFWA 1W9PA 1KQYA 3CO4A 2X2IA 2RGLA 2D22A 3KL3A 1E72M 4PMXA 2BY3A 5HPCA 3SCVA 4W8BA 3N15A 3WEMA 3AZSA 2V3DA 2WLZA 5A95A 3WUFA 2EBNA 3DHPA 1GQIA 2VQTA 1ISZA 3D3AA 4ATWA 5BRPA 1JYNA 3E1F1 4W89A 4NZJA 3SCTA 2UY3A 3VX1A 2WVSA 4FNQA 4M8UA 1V0MA 3PZ9A 4XV0A 2VX4A 1J0ZA 1TVNA 2J74A 4TTUA 1ISYA 3ZOAA 4X0NA 4AY1A 1CXKA 3OLDA 1TFVA 4K68A 1QI0A 1J0YA 2WC3A 2EPNA 4AD5A 2FE0A 4GPNA 1MW0A 4OUEA 1JGIA 4EAMA 3SCOA 2XFRA 1QI4A 2J7GA 2F7PA 1WE5A 4AZGA 3WD1A 4AIUA 3AHZA 1V0NA 1JIBA 3FNDA 3OBAA 3K46A 1C92A 4AZBA 4PTMA 3F5LA 2DSKA 3D52A 3DDGA 3NIYA 5E0FA 3IJ8A 3S2CA 4YN5A 5AC4A 3CMGA 3J7HA 1G5AA 1CZ1A 1UH4A 4GIAA 5M3WA 1HIZA 2O92A 3OGRA 3G6LA 1E71M 1ECEA 2WNWA 3AXXA 2ALWA 1XC6A 4JZ5A 3AIUA 1K9TA 2ZUUA 4JIEA 1DP0A 5I6SA 4PN2A 1J0HA 3KLLA 2VZSA 4GZJA 1WO2A 3VUPA 1CENA 2W4XA 1X1NA 1D7FA 2V3FA 1Q6FA 2G3IA 1W2PA 2GUYA 1W3JA 2V3GA 3CH9A 5A6AA 4NX0A 3WN6A 1W9DM 2J79A 1PX4A 2BY2A 2VT0A 4HPHA 5CQ1A 1UD5A 1W9VA 2WHKA 1UA3A 5IXEA 3L4WA 1EQPA 3PZVA 4WK9A 3CZ8A 4XZBA 3LX9A 1WZMA 4XB3A 3CHEA 3POHA 5DEZA 1H5VA 1JYWA 3VDCA 2D20A 3MANA 3W28A 4B15A 1ITXA 3II1A 2XN1A 4FLSA 4J28A 4DM2A 1NOFA 2E9BA 3WMCA 1UA7A 3LMYA 4DWSC 4ZE5A 1DTUA 3MUAA 2YBUA 3KZSA 2NT0A 5D9PA 1O7DC 3ARWA 3FW6A 1ITCA 2YA1A 1B1YA 2PWFA 2ZUSA 3AMGA 4RE4A 4PCTA 3BUIA 1YQ2A 1H1NA 4E8DA 3BMVA 5FL0A 3LPOA 3M46A 4MJ2A 1QNPA 5CJ5A 5C8BB 4OOUA 1XCWA 1K9FA 3CUJA 4DO5A 1KXHA 3RO8A 5E70A 1UD2A 2YIHA 4B16A 3BUQA 1UZ1A 1E43A 1JYXA 4Z2HA 3PTKA 1ZU8A 4FNRA 2UY2A 4UOQA 4CN4A 4QLKA 1QNRA 3WQ5A 1HJQA 1UOKA 4U31A 2O9RA 4UOZA 2WZEA 1W2VA 1EXPA 1Q6CA 4BS0A 1OIMA 1XH1A 3DHUA 3TTSA 4AMWA 2W91A 5A8QA 4AD2A 2D2OA 3GTNA 3VNZA 1V6UA 2CIPA 4P8WA 3SUWA 1UWSA 4Z2LA 2ZUVA 3AIVA 5A6LA 1G01A 1CIUA 2O9PA 3VM7A 2GDUA 2WSPA 3EMZA 5I2UA 2DQXA 3GM8A 3BAIA 4CU6A 1G9HA 1NWRA 3KE0A 2WC4A 3RDKA 4EKJA 3THDA 1KR1A 3ARQA 4M80A 4AMCA 4RE3A 3WY4A 3BAJA 1VFUA 3LXBA 2DSZA 3PN8A 5A3HA 2EADA 2WVTA 4DUXA 1R46A 4RL3A 3L2MA 5D9OA 3AXIA 4WSJA 3VD4A 4CCEA 4UQDA 1E0VA 3CHDA 2ZX8A 3GXNA 2BHZA 2ESCA 1E70M 3HG4A 4YPJA 3U5UA 5M5DA 3GBDA 4HMEA 3ARRA 1CXIA 3GYCA 3RILA 4AMXA 3BVUA 2VUYA 2G3JA 1HKJA 1AMYA 4UOJA 3BLKA 4BQ4A 1PIGA 3HMCA 2A3HA 3EJTA 1O6IA 3UR7A 1GVIA 3RM8A 5A6SA 1H2JA 2X8RA 3PZGA 9CGTA 4W5ZA 1BHGA 5CPSA 1WZKA 3ARPA 4WSKA 3KEHA 1CXEA 1MQPA 2YLLA 2HVMA 3U7VA 3CZGA 2WMKA 1W91A 2YA2A 2YDQA 1RPKA 4JFSA 3VSVA 1Q6GA 3MMUA 2DT2A 1ODZA 1HNYA 4P7RA 2PWDA 1UR8A 5CPTA 4MADA 2VZVA 3BCDA 2F2HA 1C93A 1EO7A 1WKYA 4PMNA 2W92A 4QLLA 1MW3A 2FHBA 4DO6A 1JYVA 1UH3A 5I3DA 2VZUA 4GXPA 1DHKA 1R87A 1E5NA 3NSMA 3BAXA 2F8QA 2CHNA 4AC1X 4X9YA 2GSJA 4W7VA 1OSEA 4UFLA 4FLQA 3AFBA 3AHXA 4PBGA 1C91A 2J7EA 1SZNA 2YLAA 3W27A 3AS1A 4OGZA 4B9YA 4M24A 2D0HA 3W4RA 5A1AA 2A3EA 3WDHA 1W9UA 2XN2A 1J12A 2X2HA 1LG1A 1PPIA 1WP6A 3AMCA 1UYQA 3W24A 3WQ4A 3VM5A 4R5EA 1HJSA 1GNXA 1BVNP 4W8LA 2D3LA 1ESWA 1OGBA 5BYWA 3SCRA 4BQ5A 3VOCA 3VVGA 1ODUA 2GJXB 1QHZA 2X09A 1OGGA 2E8YA 1MWOA 3GXDA 1XGZA 2EACA 4H8VA 3CZSA 7A3HA 4DUVA 3RCNA 4ACYA 3AS2A 1U33A 5A6MA 2PI6A 3DX3A 3UG4A 3AIRA 2EAEA 3VD7A 4WKFA 1BLIA 4J3VA 1UG6A 1UR4A 1FFRA 2XVLA 1GONA 5IHSA 2WCGA 2XVNA 8CGTA 1MXGA 1V03A 2VJXA 4ATDA 3SURA 5ABFB 3GNOA 4E2OA 1XRVA 1MFUA 3N13A 3ZSSA 3WF3A 2DDXA 4S3KA 2Y24A 2WKGA 3TTQA 1CECA 2ZICA 3WDIA 2J4GA 1E73M 1GOKA 1GUVA 4B9ZA 2VR5A 4UQ9A 1NP0A 1JAEA 2QHAA 3QOMA 3WEOA 3L4YA 1O7AA
chains in the Genus database with same CATH superfamily
4YHOH 4RFOL 2A7PA 3MBEB 2PZNA 2BXVA 2K78A 3ZPDA 3VWJA 5HI3C 3QFJD 4ZVJA 3EDJA 3EFFB 1A4KA 4PSPA 4AZ8A 1AZRA 1FIGH 4KK6C 3VCLB 1SHXA 4N0UB 3CYVA 43C9A 3F3HA 3WF1A 4C54A 4ODVH 1OAKH 4IQLA 4X5WB 4QEEA 2PPDA 4Y9FA 3ZJAA 1U8CB 1EJSC 1FH2A 1WSST 3AG3B 3BZ4A 4CBZA 4L8SA 1XGQB 4FOMA 4HIHB 3CHRA 4L29B 2AV7B 3C0JA 2PTDA 1NGYB 3T2LA 3JWDL 3M64A 3Q3GA 4GO9A 3VFWB 2WBJB 1MH5B 3W37A 5HHMD 5ABFA 2PWVA 1JGDA 1JPSL 2E9IA 1S3KH 2XKNA 2CKSA 1P7QA 3CSYB 3SDXA 2WBWB 3O2VL 5E2JA 2B4CC 2R2BB 4CA4A 5D8ZA 2IBGA 3BG5A 1D5ZB 5A2FA 4OLVL 3SY0B 2GWGA 2HSAA 1KCBA 4AL8C 5EG6C 4JPIB 1ONEA 1G1YA 1XBDA 4ORIA 4Y9BA 5KBLA 4I87A 3ML9A 3K30A 3CDZB 1KG0B 2VR8A 2BOFX 4FB7A 1YEJH 3G6JF 3CCHA 4U1HA 5EFIA 3GRIA 1T0MA 2GJRA 4L4TE 1CX9A 2QQLH 1EBHA 2O5XH 3W86A 4ZG1A 5K9QI 1AZBA 1JTTA 2LGNA 1RZKL 4HGWB 4PRTA 1Z3NA 5DJCA 1PD1A 1E5CA 3BCFA 1AQKH 2XA8L 1ZBWA 1NDGB 3TCLB 3S35X 1IE7C 3GHTA 3A4DA 1G9NL 1I8MA 4IBYA 1F6PA 3GHBH 1I9CB 3ULUE 3FH8A 4N0YL 2AFNA 3SUUA 3FH7A 5E00A 1AGFA 3UAEA 3VI4E 4LESA 2GFBB 5BO1H 1U91B 4YLBA 4ZO6A 5DHEA 5FHBL 1HIMH 3L95B 5DUJA 1OZTG 5C0JB 4FJ6A 3O11B 4XGZA 3NCXA 3N12A 3S96A 1H3GA 5A8MA 1GYMA 2XGBA 4DIXA 5FGBC 2ZKWA 3E0IA 3S36X 4JOMA 3ARTA 2TRYA 4H2CA 4GY4A 3PPCA 3D47A 1EEUA 2DUAA 4G1MA 2W9LA 2JVUA 3VIIA 2J6XA 2PC4A 5XIAA 1ZS2A 3NURA 3EYVB 1XJBA 3TIEA 5J3HD 5FB8A 5CGYC 4LHUD 3ZE1B 1JK8B 2TMDA 4GYFA 3HIZA 2CXGA 3P9MB 4PS7A 5FHAH 4HKJA 2FJSA 3GNNA 4TUKH 3SUVA 4Q74A 3LZRA 1DUYB 4JFXA 1BVWA 4G6KL 4P3WA 4JAMA 5IKCA 2YZ5A 3DGBA 5CPQA 3DNKA 1QABA 3BARA 2ZIDA 1IV8A 4OBTA 1NFDA 1AG6A 4LO9A 4NGHL 1QHPA 2VMJA 1JN6B 4OLUH 4OJAA 5I75B 2OP4L 4OTXL 5ID0B 4RMTA 2X4NB 5SWZA 4PHXA 4BK9A 2NVDA 2E40A 4PVNA 3BI9X 3DHJA 1TZHB 2FPVA 1MLCA 1NIAA 2GJ6E 4F7PA 4J3OD 4JO4H 2OOFA 1NCNA 5CSRA 4L1SA 4TNFA 3V8OA 4XNUL 4GUGA 5F9OH 4P7OA 4K36A 3LDBB 4ZUTA 1KELL 3I6EA 5D30A 1ZUAX 1JZ6A 2EUXA 4UU9A 1DKWA 2YRPA 2VMDA 4DKAA 2QR0A 3MRDB 3DI1A 5EB9A 4FK9A 1CCWB 1NSNL 4FQCL 2R1KA 4ZTYA 4YZFE 1HQ4B 2OMBA 3UZQA 3HRZB 4JO1L 2E1DA 3AI0A 5AHEA 3RKDD 3T0EE 4BKSC 1ZHBB 5C09E 1HHKA 1E4KA 3D08A 1XMWA 3QKEA 4WO0A 3W07A 4HU0A 3FTSA 3W0WD 3S83A 2Q8BH 4IOFC 4GJTB 1DJXA 3WQGA 1E0OB 3F5WB 5FYKE 5EA9A 3FOLB 5GS0D 4LYPA 3JTSB 2PGFA 2Q3OA 5CNHA 1OHQA 5KSWA 4F93B 4W9LC 4NN6B 2LU7A 3C0LA 3FSAA 2K7QA 2FX9H 2F8OA 2XACC 4JZOB 4NNYA 2ICES 1JCNA 4AZ7A 1ZBKA 3MXWH 2Y0FA 2FZDA 3STCA 1O5PA 3AMLA 4NHCL 3VGBA 4G6JL 3UEZA 3RNKA 2FDMA 4MZ1A 3MOAH 4KY1H 12E8H 3O3RA 2Z1WA 2FB3A 4I3RL 3O4LD 3S4SG 2PC8A 3UTTB 1ZVYA 4OBSA 4XIAA 5BMXA 3GXFA 1N18A 5BW7A 1EEZA 3CHOA 3MV7D 4LQ1A 4K7VA 1EC9A 1W80A 3LIUA 3LZ5A 2W07B 4PQXA 4Z18A 5KTEH 4NFDA 4M6AA 4I5BB 1XIDA 3LKNA 2PP0A 4LKXA 5AECA 4HJWA 1HFUA 3L4CA 4A7TA 4NCDA 4UBDC 1DXEA 3T2NH 3CASA 3UFYA 1OM3H 1A4AA 2JGQA 2F1EA 3C60A 4WDWA 5F7UA 2O6FA 1B31A 4JFYB 4JHAL 2VUOA 4L9LA 3M1ZA 4M3PA 4M6PA 1OAUL 2JE8A 3L9BA 1FNHA 5T1DH 2EDLA 2Y70A 4P9MH 1QR4A 3L3OC 5AC5A 2FEDC 2HDJA 1E6OH 4MNMA 1WDQA 1BLNB 3C5XA 4X8JB 3L5WA 1XICA 1UXWA 4XE0A 2WPGA 2WZPD 1HL2A 4KCVA 3EOOA 2OTWB 2X7VA 4YXHL 4DKEL 3TCTA 5E6ZA 1KXTA 4QQUA 4F5CE 2OFJA 1BKSA 2FHCA 3ZN6A 4OGYL 3T09A 5FAJA 5ENWA 5ANHA 1GZQA 4BZYA 3I02B 2OCFD 3ARGB 1ADSA 4JN8A 3PQYA 4IRJB 2IJ0C 4JKWA 5GGQL 3IIOA 1P1MA 1MCWM 1A6VL 1F6KA 1JWUA 1NOLA 3HOJA 3VXRD 5ADOH 1ZE3H 1XCQB 1AVAA 3FU7A 3T81A 2GGGA 2LVEA 3RJYA 4DGIL 4FG2A 3L16A 2V17L 4L1TA 4KTGA 3T9WA 5FO9B 4Y4FC 4KKLC 2YFOA 4QAWA 4Z9KB 1AD4A 1IAII 4HK6A 1FXPA 3ANYA 1YG9A 5B39G 3LH8A 4U49A 4JFDD 4YSEA 2OJPA 2X89D 4PCFA 3T78A 4FFYA 4PJ9B 2HN7B 1OK8A 3TK7A 5IW3A 3PZTA 1BFOA 3WTUA 5TD4A 3NFNA 2OSLB 2WQXA 1MVUB 2CGYA 3AIQA 3OP2A 4MB5A 3ZVVA 2AJYH 2QQKL 4LEOA 4V1DA 4PJFF 3RU6A 1ILUA 4P5TC 2FIKA 5BOPA 1EQWA 4IMCA 2I1OA 5AOZA 5DVLA 4K5PA 4C7DA 1KLFB 1GGTA 5DFVD 3MA9L 2FEEL 2A3BA 3H0TA 2CETA 3CZFB 5KVFE 4QNWA 2FD6L 4N8CH 4YHZH 4IOIA 1H0DA 4B3KA 2BX5A 4HZAA 2JFEX 3T0DA 4Y1AE 1R5WA 4NKIL 5JA9A 4PL2A 4DNMA 3RNQA 4NZUL 3QMSA 2DI8A 1XIIA 3N2BA 1OAXL 4PBXA 3PWJB 1HL5A 4ZPVA 2F53A 3K6FA 1X5YA 3BISA 1MCPH 4Q4QA 3C2AL 4JQVC 2YXWA 1QSFD 4S1RH 1BQHG 1P2CA 4WAFA 3WFCL 3S4SB 1OSYA 5H2BB 4D6GA 1MFMA 2R94A 2QCEA 4NVTA 3NIFF 4EN2A 4JO3L 5EBMB 3TNNA 1SOQA 1KB9J 3M44A 1OWQA 5DSCA 4F0MA 3CQFA 1ASQA 4JFHD 4LAZA 2PXYB 1I3GH 2PWUA 4HULB 3VTMA 5KW9L 2OLHA 3MUY1 5AYIA 3OR6B 1MDTA 5GJTL 4ZMYA 2I27N 3M9YA 2M83A 2H2SC 1Q2SA 3IDNA 1NINA 4G5DA 3WIHA 3HG1E 1WWAX 4TL4A 1HZKA 5JHLH 2X1SA 2AJXH 3KBVA 4Y19D 5JXAL 2WLLB 3GG0A 1W0VA 3LB6C 1U8PA 5ES4B 3WF0A 4MD0A 3N6HA 3X1BA 3EJSA 5C07A 5T1KB 3T6WA 2VD8A 4AE0A 3VOGA 4AU0A 1DBBL 4I77L 5LNSA 3V6FB 1XGRB 3FCTB 5HANA 1DCLA 4LYRA 2AVGA 3VGDA 1J05B 4HHMA 1R3SA 3GVWA 4PJCA 3N43F 3TYFA 1N3NB 2A7NA 1Z66A 3MMTA 4BGDA 5B38G 4O00A 5DEJA 1S7TA 3GMPB 1L7IL 5C0BE 3RQ3A 1Y6KR 1TE6A 3FN0H 4MMXA 4G59C 5C3TA 1IE5A 3M0IA 3VKKA 4AUYA 4ZBCA 1CLCA 2ZAHA 4QD2E 1L9SA 3VIMA 2C6QA 3KS0J 4QRPE 2OW7A 3L9CA 2BS9A 3DMMA 4NQEE 2HS6A 3DX5A 3H6JA 3WFBH 5ESQB 5GJSL 2FATH 1I1FA 1UIPA 1MFEL 3WBAA 3CVIL 4PBWD 2K9FB 4FNUA 2EC9U 3WGVB 1FH7A 5B39B 5HATA 3RCYA 4HJSA 4WFGE 2HVJB 4LNYA 1EWEA 1ZIBA 3DVGB 4ONFL 4P05A 4N7QA 4BFRA 4N42A 1AD0B 3AG2B 5B4MC 3BEWA 5F2FA 3C5ZC 2PUZA 5H94A 4Y96A 2N0KA 1N4XL 5F89A 2BRRH 4D8PB 2QJJA 3FU8A 4BR1A 2FBOJ 4X5LA 1FQ9C 1C8YA 3RIFK 2XH2A 1EBPA 1E67A 2FJFA 4Q7NA 1ZHLA 2BP0B 2GAZB 4U1LA 1RZFH 3BAKA 3H85A 4KKNA 4NB7A 5KZMA 1I1WA 3QUZD 3DTDA 4FF9A 3NGJA 1FWSA 3OLGA 4DJEC 2VB5A 2HMCA 4KVCH 3I6TA 1NCJA 1DVJA 4M4RB 1SSGA 3GLCA 5ECJE 2QT6A 1OB0A 4JREB 5ABZA 2LT9A 3BAEH 1EJFA 4L8BB 4JJOA 3ITOA 3EYFA 1K3ZA 1DEDA 5ID1B 3LHUA 3MCYA 4NQCE 3RWDB 2CQVA 4XN4A 1WG3A 3X1FA 3HS9A 4MDJA 5FPIA 1PL3A 4IHOA 1CE1L 2NZIA 4PWKA 3JVGA 1BQHB 4QHRA 5JUEL 1ADWA 3G5VB 3GVQA 2ZDSA 3OQEA 5FM5M 1K6AA 1FXQA 1RZGA 4X6CE 3IVTA 1U42A 4POUB 1EHAA 5EC1A 4PRIA 2MQ3A 1GG0A 4M6ML 2ITCA 1W0WA 5C0IB 2H32B 1W31A 1II4E 4HIJB 1CICD 1US0A 4I18C 4AD1A 5G4HC 4X98A 2XDFA 4ZSOB 2EIEA 3BE7A 1OBAA 4LYKA 5AVTB 3MMWA 1ZRUA 1NGPH 4U1MB 3OKOA 3L2IA 3KXFD 1OGAB 5IB4A 1M1SA 2J13A 1DVQA 4MNQE 4EK7A 4FXGC 1AJ7L 3G8RA 2P24B 1AS6A 2Z91A 1KULA 1PWLA 5IREA 3CNKA 2AC0A 3AXMA 1TR7A 4KMTH 2NT1A 4M5PA 1LL1A 3QORA 1KLUA 3W1QA 3TXVA 1T22A 1AXTH 3RM9A 5E95B 4H6KA 2P5WA 1N8OE 4PWEA 4OW6A 2YCLA 4FXFA 1TV5A 3WUFA 2E9WA 3TA3B 4G8GD 4JGMA 3WL9A 5B38B 3PFRA 1QRQA 3L1OH 2YEZB 2DVUA 2VL5B 1BRLB 1TFVA 1I6NA 4Q7IA 3U1QA 3W1MA 1MFBL 4A2HA 1V5JA 1EHLH 5JLZB 1CZ8H 1NOAA 3WD1A 3ZU8A 1JIBA 3KHOA 4Y9OA 3FHEA 1DBJL 3H9HA 3G6AA 1BQUA 4CQAA 5I06A 2F6XA 2PDBA 4JIQA 4Z7OF 3S2CA 5AC4A 3P4NA 4MM1A 1G5AA 4HC1H 3EZ8A 5HI4C 2X5PA 4PS4L 1CFTA 3UX9B 4WFHE 1CFSA 1SZGA 2FSEB 3KTSA 3RIAK 4GBXB 4RFEB 1PSCA 3O6KL 2A73B 3G1XA 2QDWA 2H8ZA 2I60H 4GIYA 3L3GB 4ENEC 1XRFA 1ZALA 3PWVA 2X4OA 3G6DL 2Y1HA 4XB3A 1ONXA 1WAUA 3QNXA 4MJIA 2EC9T 2XI9A 4W9EC 2XN1A 1KGIA 1N12A 2V9UA 5F1SA 5IR1B 5DRCA 2A74A 4ZW8A 1IGYB 1W54A 2J8HA 4GG8A 3KZSA 5CSZB 3RWHB 4Q2ZB 3AMGA 4ES4A 1OF2A 3QAZC 3GMQA 3VRLE 3I6KB 4DTGL 2IXQB 2VDQB 3BUQA 5EEZA 3B2UD 5FEBA 3NVTA 1UR3M 2PDHA 1TVBA 1HJQA 4U31A 5IJCC 5XIMA 3N43B 4BEIA 1LDSA 4M6OH 3PAUA 4EOWH 1DVUA 4BQCA 4Q8MA 3QZOA 5I2UA 2YPKB 1T5XA 3QRLA 5F7BA 2IPKB 3IJSA 5K9DA 2BMKB 2A1YA 2VGFA 5KN5B 3W7KA 1A9EB 4FQXC 2DSZA 1NCAL 5D38A 1OAJA 3VXPB 3CFQA 1GC1C 1ES0A 3E6FA 4UQDA 1NBZB 3ZL4H 4XNMB 1LLZA 5GXBB 2X9WA 3D0CA 2EVGA 5I1HL 2FNWA 1U8OB 3RILA 4AMXA 4JTAA 3I50L 1W37A 1P1ZB 4FR1A 4JMXA 1SGKA 2J72A 3CDCA 4O8AA 4XPTH 4LAQL 1XF2B 1YN7B 5F0JB 5TF1L 1BHGA 2DQDH 1KBWA 5BPPA 4PGDA 4MGGA 4UBPC 4KJYA 3MTXA 3QY8A 3U7VA 4L4JA 4J6RH 4C6LA 4KHXL 1UACH 3DX7B 4H1LH 4XPBH 3VXME 1IGTB 1L6ZA 3QEQE 5LGHL 2C3HA 4GB9A 3LBOA 1FJ1B 4CC0A 4DO6A 3RGVA 4TQEH 3SDDC 2J2ZB 3KYMB 1TV8A 3EOYG 4Y4HA 2VXUL 2EAWA 3HN8A 4G80A 4GKSA 5E4EB 4TRPH 3SQLA 4XNAA 2E5BA 2BNRB 2WV8A 4D9RD 1UWGH 3O3EA 2EPHA 4QHLB 3BZDA 3MRIB 1W9UA 3X3GH 2X1TA 5I5MA 4R5EA 4GQBA 1PLGH 3P80A 5BNXD 3VVGA 1ODUA 3AQXA 2G9HA 3RU8L 4APQD 3PIQB 3QH3B 1FPTL 1WCQA 5PAZA 3ABMB 2ZTJA 1JCLA 5BZWA 1JWSB 5DVOA 2X12A 1H61A 2BVPB 2EICA 5DMLA 1TV4A 2PA6A 4GWEA 1SO6A 2R2EB 4FQ1H 1TLMA 4JKPL 3ZSSA 2Y24A 1CECA 3EX4A 3L9RA 4B9ZA 4NDMB 1ODAA 4JICA 4L3ED 4ZOBA 2ZUMA 3MP5A 3P9LB 4M5YL 5GGUA 3RPMA 1PX8A 2YAPA 1G6RL 4DKFL 5ETUA 1UOWA 4KVPA 2HT2D 1U58A 2CDGA 4F7TB 4HJJH 2IPJA 3OXRB 1J0KA 1R75A 3A3YB 1NF7A 1A5LC 2GJXA 5T33L 2IBZY 3AOFA 3AC0A 3QHMA 2QPSA 4WO4D 4Y16D 4Y5XA 1FGVL 3KDNA 5G2IA 4ZZ9A 1FL5A 2X2GA 5I6XB 1BTCA 3PM6A 1D2PA 4XCYB 3LKOA 1S9VB 2ZCZA 5KMYA 4U33A 4HBCL 1XSJA 1KPRA 1N9PA 1LP9F 3KBFA 3SDCC 4N2DA 2YWYA 4KFZC 1Q9KB 3SE8L 4GXMA 3LI0A 4ZTPL 3ASOB 3ZE0B 2ZYHA 3NG5A 3TJEH 3C87A 2HXUA 3P74A 2OMWA 4PUBL 1ZVSB 4PJDA 5J9PA 1OD8A 3D39E 3VVWA 4HA3A 4MJ5B 1Q13A 2MOVA 5A6KA 3MLYL 1W5NA 2VLRB 4XN5A 1F00I 2X0HA 3HJ0A 4NO3B 3P77B 1L3NA 4UAHA 1NDWA 4IT1A 4AV0A 5F2IA 1IGFL 4UT6L 5A8PA 3HUJE 3IETA 3THMH 3QCVL 4LCCA 3T6QC 5HHQB 4LCVA 1CLOH 2A3AA 2E67A 4DYEA 3VMNA 1W72B 2CKNA 3ZS4A 2DPEA 4MVBD 4UOW1 5HD8D 1FO0H 3UMTA 4N2YA 3SQMA 3QDJB 1J5CA 1E42A 4MQXC 1UGKA 2FL5A 1JERA 3GZQA 2G9KA 4Z0BH 4UR9A 3UPAA 5FM8A 2CDFA 4PMUA 3O41A 1E2VA 2G0WA 5DRXB 4J27A 4NYLB 3BE1H 3HJEA 3C2RA 1WOBA 3V1HA 3RTQB 1J48A 1JK9A 3FO9B 3KH3A 1E6QM 4LSRL 4XHQA 1UM4H 2L0DA 5T3XL 3FT3B 2MNRA 3ESVF 2FX8L 2CKRA 5K9XA 3MLWL 2J56A 4LP8A 3A5VA 5B22A 1TB3A 1N6QL 2C9QA 4MXQC 3NGBC 1ZJAA 1A9VA 4EVNA 5IW1B 2HISA 4MJMA 9PCYA 4DELA 2QQNL 2WIIB 2VDRB 5CMAA 2F84A 3SO5A 1RV6X 2VLJB 4ZX4A 2ZUTA 1QVOB 3UZZA 5A6BA 1YXDA 1EQCA 5J11C 3GYRA 1EP2A 1OP3H 1QU4A 1OCRB 3RL1A 3BTNA 3LM3A 1JCVA 4I9WE 2OMAA 3GRBA 5CH9A 3UXAA 4QEGA 4IL0A 1E28A 1MJJA 4ADUA 4RQQB 2G4EA 3KOZA 1VEMA 4YVPA 1E6ZA 1YO4A 4G6FD 1E4IA 4O0ZA 1U36A 3HA0A 4K3EL 4PMEA 4NKMA 3FPYA 4C60A 2AK4D 4PRHE 4HFWB 5LAXB 2Q2EB 3Q2NA 1XIWA 3WIJA 1D5MA 4PJHA 1FCBA 2R27A 5E2UL 1UWRA 1KDJA 2DQGH 2ZKYA 2DD8L 2XIDA 3T42A 2MNWA 4OFKA 2BS71 3GTFA 5H8MA 3MBDA 1TWIA 3BP7B 5IUCA 3R0KA 4MUPA 1W56A 2R1LA 3EF7A 5I2IB 1R3IL 3LQAC 2TRHA 2Y7EA 4IXHA 1IWBA 3WDRA 3IFOA 3H7LA 3G1RA 3N9KA 1WISA 2FZNA 1XZWA 4U1KB 4Y9AA 4NEHB 2FR4B 2Y89A 3AAZA 4K2UL 3B0PA 5FJRA 4ZUSB 3IBEA 1RERA 5E6ID 4M4PA 4XWOC 5D4HA 1WS7A 3GDBA 4JY8A 4AW7A 1X39A 3RWFA 1QWGA 4U28A 2DGAA 5DHYA 4WK0B 4GH3A 1EHNA 1GQLA 5EZIH 1N8ZA 3VFSB 4WW2C 5AW0B 5D05A 2HFFB 1DFXA 4KI5E 1BX2B 4NI6A 4KWOA 1FBIL 4OVUA 2OMVA 4DP1X 3IYLW 3E2HB 4PJ8B 2Q3AA 1DQUA 3MU7A 1DR9A 5IFAL 1YEYA 3UTSD 3IS4A 2IG2L 3C8DA 4QXUH 2XWTB 3ARXA 4F92B 3V0JA 5D70H 5DZOA 3CU7A 2PCFA 4GC3A 3V5KB 4Q4MA 1OZQA 5MKGB 2R0LL 4H2HA 4HQQL 1G0CA 4PG9A 1T2QH 3LIZH 3EAUA 1LRQA 4WJXA 1VF8A 4UC5A 2J44A 4AZCB 4RBPH 3TR9A 3I9AA 2EPMX 1D5XA 1U0QA 4KROC 2PP8A 1OHLA 4WXYA 4L9DA 1USZA 3BIKA 2IV9A 5F7AA 1DVFC 3FFCE 3NZRA 1CUOA 3D2UB 4JN1L 2ICEA 4OLXH 5F9WB 3VFNA 2OO0A 5CN2A 3I7SA 3DRQB 4UTTA 2NWRA 1WGOA 4DXVA 2J8GA 4ODUB 4ZFGL 3B97A 5LKNA 3D3VA 3ITGA 1VJSA 2IPTL 4NO0B 2YL5A 4LSVL 4JG1L 3GO1H 1KMGA 3EH4B 2YKLH 4XP4L 3C09C 1MUWA 2D7TH 1TX0A 2IOOA 1JMZA 3BUTA 3GAKA 3CT2A 2JCWA 4K3HA 4FS9A 4MF4A 5CFHA 4ZXBC 2V3EA 4E41D 4ZYKA 2NLYA 3TN4A 1N0LB 1PZ5B 2F54A 3LRSB 2ZYRA 1U2YA 1L6XA 1BFTA 3BOVA 3UPMA 4DNHA 3EYUH 2A3CA 5I76A 1CBVH 1I1AD 4GAAA 1WAWA 1CBJA 4F8NA 1MNUL 4GRSA 5L6YH 3SO7A 2CYGA 4ABUA 3B5HA 2X0SA 2MMXA 4L8CB 5CILL 2CM5A 1VENA 4C6FA 4MMZA 2VN4A 2FVKA 4PWHA 2OEMA 2FJGB 4YUEL 3W1ZA 3KL5A 3MBXH 1P6FA 4IIFA 2YAEA 1UM5H 5SX4I 1E9QB 3A6OA 1XINA 3VWKC 3O6MH 4ZSUA 4E9WA 2H1PL 5GRVL 1KT2A 1ZP3A 4IJBA 2XN9D 3P73B 4JNMA 4Q6IA 1F6AB 8A3HA 3S5YA 3NZQA 5C9RA 2HB0A 4BA0A 4NENB 1E0XA 3MUHL 1AGBB 2IH1A 4YNYB 4GNKB 1YEGL 2Q8AH 5I19L 1UHVA 3G08B 4AM0A 3KYOA 4GUQA 2OLAA 2C18A 3QYNA 2GJJA 2H45A 1XLDA 3TPKA 5FF6B 4REQA 3W73A 1L2QA 3EJPA 5EDSA 3IE9A 2I5YH 4G7YH 3BWAA 2CITA 1AC6A 1RZMA 2M1KA 3TBTB 1M01A 4QJ5B 1XRSA 2E6JA 2V2DA 3CXDL 2WCPA 4UFIA 4A7VA 3T71A 1E9LA 4LASL 1FZKA 5DQ9A 3VABA 2DSWA 1U4FA 4KXAA 1WB0A 4YHPA 4G8FB 2CRYA 3TIDA 5C92A 3R8QA 2B1AH 1R33A 1IKNC 4Q8WA 5DO2C 3M86A 2W0UA 2ZZ7A 2EJ1A 4CNOA 5E0CA 3CO8A 3MC0A 3K91A 2RD0A 2UWEE 3FFOA 1RZIB 1KRBC 4RMSA 4WHDA 3M16A 3GH5A 5TH2B 4MNHB 4BRVA 4FTVE 1M4KA 4AL8H 1C16A 4GRLC 4NAFB 1S46A 3I6RA 4IFOA 1ITQA 2HJLB 4DGVH 3BP6B 3R1ZA 3PNZA 1E1CA 3PJNA 4XO5A 5I0DA 2VDPH 5HY9A 4PMFA 1JGMA 1QNVA 5DN1A 5I18L 3H4WA 4KU1A 1G67A 2EE0A 4NRXA 2D3VA 1S5HA 5C8JB 1X5MA 5E56A 4OLZL 4NPYA 4LLWA 1K5WA 5IF0B 3F5JA 2NNXA 3DOSB 3NTYA 2ESVE 1TUXA 1E8WA 1ORSA 4OLYH 1CD8A 2VVNA 1VB9A 2H6OA 4K1GA 5F1UA 3SJVB 1RJLB 4A2EA 2CIIB 1BOYA 1LM1A 5HVHC 1RA0A 3Q2LA 4XKYA 1U1HA 4MWAD 3FAWA 1WFTA 4NZRL 5ITBH 5ANMA 2VXQA 4FZEH 4EEEA 3RP1A 3FYIB 4JFUA 1AFVH 4M5ZL 5IMLB 1FP9A 2JKSA 3P4OA 2W65A 4AT6A 4I3SL 1SZRA 2WWMD 3DX6B 2IOIA 3ME0A 4KEZA 1BD2D 5EU5B 2DEXX 1FC1A 3CSTA 4ZEPA 1KV3A 4IBTA 1J4EA 4HVBA 3MI6A 1BPLB 3VFPB 3IJHA 3MUUA 5AVUB 2BTMA 3H53A 5GVJA 2XM1A 1DQQA 1G7HA 4LRIA 1UXSB 3DBXB 3RB5A 1UZDA 5I24A 5CCKL 1SJHA 2PU0A 4UMGA 5AVSB 3FSUA 1S7XB 3BSZL 3VRIA 4HZ8A 3WKZA 2YRLA 4PTVA 4C90A 2R59A 2YBGA 3TN3A 1SNRA 3ASWA 1VKXA 2F19H 3ZK0A 4Y9MA 2V7HA 2ATKA 5F7KC 1JHTA 1U8MA 4F9JA 1IQDB 1WGVA 1IQWL 5C2UB 4NBYB 2DKSA 1E5BA 4JMNA 2PTUA 3QIWB 4H25B 3TX4A 5F7LB 3BDXA 3EO9H 5FO8A 5HMFA 4MJHA 2YD8A 4JGNA 2A6NA 2OXGB 4LAUA 2DT1A 4G6AD 1OSZA 4M8RA 3VXSB 1C08A 5E8DL 4KCTA 4P3CL 4NQXA 3UY8A 4C55A 1OTUD 4H26A 3JWDH 4S10A 3IRZA 2WWKO 1PTAA 4YHNA 2VZTA 1KKOA 1G7IB 4NRRA 4X61A 4RGNC 3IXTB 2C9UA 1R8LA 1KXVA 2VUNA 1O6TA 3O2VH 2DJXA 2EXYD 3STGA 5IOBA 3HV8A 1GQJA 2CMRL 3QXAA 5G5DA 4QLRA 1XR2A 4AC2A 3GLZA 6TIMA 2H3NA 2EE3A 4Q8TA 1DOSA 1B5TA 2H26A 3VXTA 1RBOB 5DK2A 3V7PA 1BZ8A 1PG7L 3L54A 2Y3NA 5INCA 2APSA 1RZKH 4KJQD 1RR2A 4GFIA 1TJPA 4G72B 4XO9A 2XA8H 5JW4N 3QJVB 2P8CA 2IH3B 1A0DA 1S38A 1EDHA 3IJIA 5IQ7H 2ZXDA 2HXAA 5CJNA 2YUZA 1AJ0A 1IEWA 1TG7A 3TO2B 1HWHB 2JB6A 5GS2D 3HLAB 3O9WD 1IC7L 5HWNA 5AKVA 2FYVA 1OX4A 3QKZA 4FFWC 5AOJA 4PMXA 1G9MC 3O2DA 5BVPL 3GMOA 4ADJA 5A95A 4Q4KA 1XIEA 4ATWA 5K9KB 5I15L 4W89A 3SCTA 4ZMWA 2UY3A 1U92B 3PZ9A 1IUZA 5HNRA 5IGXL 1TEGA 3SSZA 2WQWA 4AY1A 2XFXB 1TEFA 3OLDA 5FM5O 2G2NA 4U0RC 2FE0A 4OUEA 1K8DA 3NQVA 2QKFA 4F7MA 1GY2A 3MRJA 1V0NA 1TSHA 4W4OC 3SDAC 4CDHA 1C92A 2PKDA 4HJ1A 5HP5A 1I3RB 1I60A 4L3CB 1YMHA 4XXCC 3C2EA 1Z44A 2BX7A 2F8VA 4JIEA 1X1OA 3VUPA 3ATAA 4AWJC 2UZXA 2V3GA 1IGJB 4NAQA 1DBML 1WAAF 2BY2A 1W9VA 3FO0L 1GCFA 5AW1B 5IXEA 4NGHH 5EO9A 4PJBA 3URNA 1UQSA 4KX9A 4H7ZA 3ARFB 4NWUL 5C0CE 2OP4H 3VDCA 1P5UC 3NOYA 4OTXH 3QHFL 5ISZD 4I13B 4WTWA 4WI9A 3II1A 1EYWA 4MBOA 4DM2A 1UA7A 2IQAA 2EDRA 3BJLA 3QEHA 4RE4A 4XNUH 4PB9L 1YNTF 1XF5B 1CDUA 2JGYA 3CVCA 4BFIB 1QNPA 3QQ0A 1XCWA 3KS5A 3EOTL 5E51A 2C3VA 2WP3T 2Y72A 3IFNH 4JX5A 2WNQA 3MJ9A 5GS1C 5U7SA 1S5WA 4FQCH 2MOGA 1Q6CA 1W6TA 5L4JA 3WE6A 3NQGA 3U2CA 1AANA 2BIPA 1RIHL 4JX4A 2A3TA 4CQCA 4LCSA 3HHRB 2FAUA 3T6XA 3RLVA 3OZMA 4C4BA 3KPRD 4LHUA 4FULA 4E3TA 3RX7A 4NJGA 6ALDA 2GEEA 2Y7QB 4RDZA 3RDKA 5GZNC 3ARQA 4PJAB 1GVEA 4RE3A 5HGBB 3SZ8A 2EG6A 4QHKJ 2KMWA 1KV7A 1N2VA 4FXKA 1CD0A 1YSOA 4QE1A 3L2MA 3TW6A 4CLMA 1RJCA 3BW2A 2Z35A 1MWAA 5IHUL 1TJHH 3JWDC 5IK3B 3NOIA 2IBZX 1XLMA 5C08D 1LEKB 3I9GL 4H20L 4Q14A 4PI2A 5E9DE 3QQ3B 3SIZA 4MNGA 2Q9OA 3ULVD 2G3JA 1ADQA 1UC6A 2AAVA 1XG4A 1KJ2A 3MDJA 2QCGA 5CEZL 1MFCL 1KB5B 1GA2A 1LMKA 5JIMA 2QQQA 5HI5D 1UGNA 4YL4A 3US0A 4OCXL 4NHCH 4G6JH 1FVCB 3OTRA 4NO2B 4F3FA 1HZHL 2DT2A 1XH3A 3EH1A 2KLSA 2JJSA 2B5IB 4QRUB 2Z2UA 2PYEB 4OZ4B 1UH3A 2F7FA 4C83A 1ADDA 4U1NA 1GG1A 1AO7B 2YZ1A 2W0LA 1RZKC 2VC5A 2B4GA 5CC5A 4Q6KA 2C1PA 3AHXA 1O5DT 4GJIA 4N1CA 1GYAA 1G9NC 4Z7UF 3DUUA 1RZ8B 4RGMC 3G5YA 5KSBE 2D3LA 4EUPH 1JXFA 2PLCA 1SXNA 2HTLC 4R4FH 4XZNX 2RQEA 4ZGYA 4JHAH 3RXZA 3KPSB 4RGNE 3RCNA 2ABAA 8TIMA 4YVVA 3NCJL 1IBHA 1GONA 3D0AA 3W83A 4D8AA 1MF2L 1RI8A 1W2KT 5G55A 4HS3B 1KBJA 3N13A 1EFXB 5CWSA 3CN2A 4MAYB 3BPNB 2JB5L 2NY2C 3EF4A 4Z7AA 3KL0A 2Z7YA 3T4YB 4PGCB 4YXHH 1EFZA 5C0AD 3LV6A 3BWSA 2NQ3A 4DEPB 4C57C 3RRXA 1DQTA 4OGYH 1W1IE 5ICZB 1R3KA 1YMMA 1UA6L 1SF3A 4IBUA 5C6WH 1MQKL 2VLME 3O4LA 3V6BR 2V2HA 4Z2IA 4Y9CA 5GGQH 5KJRH 1XYMA 1A6VH 3GR8A 4CNUA 3MV7A 4GKTA 4PRAB 2OPJA 4KKCD 1JUBA 3WNNA 3B9OA 3R11A 4KX8A 3QZWG 3HS0C 4EN3D 1UZGA 2Z26A 2YQGA 43CAA 5J1TC 4LW7A 1INQA 3VXUE 1H49A 4M43L 1CURA 4LVNB 1JMXA 2YR3A 3B8DA 4OKVB 3U57A 3G6JB 4G42B 3KOWA 4JM2D 1A0CA 3VH8A 3UBXI 1FFTB 3FCGA 4P59L 5D7LD 3TJLA 3G5ZB 2PDWA 1PZ1A 1PZCA 2RCSL 3Q2WA 3BGFC 2EDYA 1XTLA 2YGQA 2ATMA 3AREB 5D55A 3FH5A 2RBLA 1F8TH 4G5AA 1COBA 5JDSA 2QQKH 3KPQA 4LCIH 4DBEA 4AKQA 2X4TA 3TH6A 2YGNA 1CFQA 2WZPA 2G3XA 4I85A 3M7OA 2EIZB 5I26A 4KRPC 1Y0LA 3KYNA 1Y6MR 1EXUA 1TTJA 5D2TA 3EHBB 3PL6B 4O1AA 5D6CB 3GR7A 1K2DB 4H8QA 1OIFA 2YBRB 1SN5A 5M1TA 3NQ8A 3GB6A 4JANB 2Y7SA 2VDKB 1OANA 2GZXA 4PJ6A 1RHHB 4YHMH 1HCFX 4RNFA 1G7UA 1MCKA 5K9QG 4M6UA 3LXUX 3F8UB 4NZUH 3NBNA 1X96A 4YS1A 4PV9B 4FX7A 5C2XA 5F9JA 3W22A 3QULB 4RDWA 3OWRA 4AQ1B 2VYRE 3C2FA 4M00A 3MRGA 1LO5B 1MVYA 2RAMA 3MNWB 4AM0Q 5LWYL 4W87A 3UFIA 3MX0B 3MODH 1FORL 1PF3A 2ZUYA 4JFDA 1VEOA 1Z0MA 1VSCA 1IEBA 4JO3H 1CD1A 4XBJA 3O6LH 2CEQA 2WSQA 1I1CA 3ECBB 3GSUB 5EUKB 3AJXA 4QXIA 4HPNA 3G77A 2PPFA 2CRMA 1KFKA 5GGSY 4KOCA 1HOEA 3RY6C 2Z8WC 1S9WA 3MJ7B 4NNXA 3V5DA 4F9LA 2DW7A 3LHVA 2NR6C 3SSJA 3ZHFA 3GDLA 4JRLA 5BS0D 3H9YA 1NFDF 4YO0B 3GMNB 1K3UA 5AHFA 1YY8A 4HYWA 1OCCB 5CUSL 2Z7KA 2Z0BA 1L9TA 1AKJD 1Z9SA 4IIZA 4WD0A 4LCUA 3PV6B 4YOKA 3W3BA 4B41A 4P3DA 4NZFA 5DUML 1KXQA 2C7UB 3AYSA 3OR7B 1DBBH 4M5TA 3TWYA 4I77H 2DYPD 2VSKB 5IHWA 3QYMA 3UXLA 1NGXB 1FNSH 4DP0X 3LVEA 1WBZB 5CBBA 1T5KA 3R25A 2IQTA 1F8IA 5LXXA 3TH2T 1KOAA 1QSFA 4BH7A 2IBBA 3HKZA 4W1TA 4ZBJA 3WJMB 4NL1A 2J7LA 2D03H 2IADA 4TX8A 4BGLA 4LSBA 3R7MA 2A6LA 2VDQL 1GZHC 4XAZA 3FT4A 5KG9B 1QLRA 4XBEL 1TJRA 3QZWB 4HHAB 1RFDL 4KDTC 3M0KA 3KM8A 3K2IA 2VR2A 4U3XA 2IW0A 1TV7A 3QQ9C 1H3VA 4N2KA 1UJPA 1UR2A 1R3YA 4YWGH 1F76A 2VEFA 1QOQA 3SE3A 1TKKA 3BKMH 5KZCD 2GCYB 3MOQA 2PCQA 5DD5L 2HBVA 1U1UA 4LCYB 4ONFH 1U2HA 2VE6B 5JIIA 5IT2H 4Z7UB 5DMIL 1NEUA 1N4XH 1UZ8A 2QIWA 2QPUA 4AF0B 2YRZA 4TNWK 2IXVA 3KNBB 5JHDD 4WSHA 3WD2A 4YGVA 5F7NC 2OVLA 5DJ2A 1IX2A 3R7RA 4EANA 3BESR 1HHHB 3JU2A 5LNRA 1BZ9A 4JM0A 4E4PA 4DZ8B 1OE1A 2QGCA 1P6CA 4I89A 1L0XA 5F71A 3REWA 3T4CA 2EE6A 4TF4A 3X14B 4M1BA 2H90A 2P3ZA 1S78C 1XSOA 4BFKA 1AP2A 4NILA 1HHGB 4TS6A 5JQ6L 5D7JD 2YLHA 4IGSA 2CR0A 2HFTA 4MA7L 3DFQA 5JPMA 2BODX 4JPVL 4ACZA 3H9SB 1E40A 1MSSA 3ZVHB 1RUPL 1CE1H 3VIHA 4UM8A 4YC2B 1IU1A 4B7LA 2VSCA 3AUWB 4R4BA 3KBMA 1Z42A 3FCSB 3IANA 1UWXH 4CNPA 2A0LC 4J4PD 4XBMA 1X9QA 5C6PB 1NMCC 2YB1A 5CLWA 4HWNA 1KTBA 3UZEA 1GC1H 4A7SA 3OVRA 3TN0B 4M6MH 3X12A 4MMYA 4KK5D 3MCMA 4PMRA 2WTOA 3UO1L 4TXVB 3W9DA 4K39A 4BXVA 1PSKL 4W4QA 1IC5L 5IWLC 5DJ6B 3SBRA 4ODWA 3UTQB 1RZ7L 4F8PA 5F1OB 3NQ2A 2DMHA 3QUZA 5EZPA 3VXNA 1Q1JH 1AJ7H 4ZR8A 1FVDA 2R9HC 2CFFA 1H11A 4HW6A 3DFNA 3CQQA 4PODA 1J9YA 4AQ8C 2OQYA 4K5NA 5IHBA 3N40F 1XG3A 4L5FL 1XW8A 2A7BA 4DX3A 3HB9A 5EMJA 4A7GF 4L8DA 5D1QB 4JIHA 2P5ED 1IBBA 3NJ3A 3UBXG 1Q0XL 5A7EA 1KNOB 3MV8E 4BHYA 1LD9B 5GSRA 5EU6D 5IHRA 3O8XA 5KEZA 2YK1L 3UU0A 3DCPA 5ABTA 1V02E 3CH1A 4MD5B 4PJFB 3LN5B 4P4KC 2QMKA 5MI0C 1J88A 4LPCA 5ERWA 4NRYB 1M3IA 5IIEB 4PD4J 2FLIA 1RUML 2H6RA 1I9JL 4G1MB 4Q7BA 2D7OA 3ARBA 1LLAA 2X10A 4RNIA 4A2FA 1EOKA 3KWSA 5D9SB 5HQEA 4M48H 1TVHB 1Q6QA 1MRCH 1WKDA 3OKDA 2VXTH 2OJZL 4M82A 3V75A 2QCMA 3UW6A 2E7CA 1OHZA 3W76A 4IISA 2AJSH 5JW4R 3S1UA 4EX4A 1N7ML 3N44F 1QCWA 3O6KH 3KXFA 1O6VA 4KKZA 3QJFA 1EOMA 2IO5A 2CLLA 4IH3A 1CLYH 3FCBA 4IMLA 4YIQB 3IDYB 3TYAA 3ABKB 4NKOA 5IKCB 4NQDB 3OAYH 4J39A 3GEWB 1XGEA 4BZ2A 3CWHA 2PW1B 1I45A 2RAGA 4ODBD 1YNQA 3WBYA 1W72L 1J9CT 3DPDA 3IKCA 5FJOA 3NIFB 1UZ6F 1D3CA 3MFFB 1JPMA 3L5XL 1TZIB 1P84J 3PP4L 2O6PA 4ZFOB 4JFQB 3BSHA 4G8GA 4O14A 2N1KA 4CSSA 3FDKA 3BGMA 2ZX6A 5I23A 4MD4B 4RMQA 2OZNA 1ECQA 3D85B 3EXTA 3RJXA 4FFZH 1JDFA 3GSWA 5MENB 3O6DA 4DZIA 1GOMA 5CZSA 1E27A 4M0XA 1A7NH 5L2KE 2ZNXA 2WANA 4PEEA 1EJ7L 1U95B 3FFSA 2CHXA 4YMZA 3QV8A 4A8IA 1T1YA 1HSBA 2PDPA 4GO8A 5SWSA 3Q5YA 3P2TA 3GVGA 2FTAA 1R4XA 3QLDA 3MGOA 4RDVA 4V2BA 1NCAH 3U30C 3P69A 1H5BB 1T4KB 2VKWA 4I2XB 1TQBB 1R47A 1UG9A 1X8CA 2KHAA 3WNJA 4D9QE 5TDPA 5ESAB 1U8NA 3LV3A 2ZZ3A 6XIAA 3UWVA 3YPIA 4PJCF 1F7BA 2WUBL 5A6JA 3C5JA 3S37H 3TEYA 3OKKB 4OUIA 4PBDA 5GGTL 5TE7L 5TF1H 3EOSA 2JBMA 1BVOA 1GTEA 4LTSA 1FWEC 5REQB 1GGYA 1TMQA 3Q6FA 4AUJA 1MIML 1VCAA 5HYQB 5CPLA 3ERPA 4KHXH 3BO8B 5GQBA 1S7QB 4INFA 5D4JA 4XN9A 3HR5A 2YL8A 3AYVA 4WKZA 5LGHH 4D2NA 3V0IA 4O0KA 2R1XA 1A21A 3ILEA 1MUJB 1RK0A 1CTNA 4GYPA 2IGFL 3TQKA 2QVNA 4CMHC 2YD3A 3L7FA 3H24A 5A2IH 2VXUH 5C86A 3FLUA 3WFAA 4X4YB 4S39A 2XTJC 2OAAA 5F2GA 3DFSA 5D93C 2AW2A 4R3SA 1K7FA 3BP4B 1B4JL 1QSVA 4MJ6A 4A22A 1E1EA 1H0IA 1X6LA 3UBXB 2PF0A 2EIMB 5EOQH 3QUXA 4J3UA 3KVJA 2ZYSA 2E6PA 2ICSA 1I7RA 3IUDA 1KFBA 1KIUB 5E5MB 1EERB 3A24A 3S3SA 2QADD 1G4RA 4BF7A 2HQAA 5E4AA 1M05B 3TO4B 4OFQA 4JKPH 1YNLH 5DMKB 4XD4A 5KYXB 4XOEA 4Y2DB 2C14A 3M0XA 1TZZA 3IGXA 1RLBA 3FO1B 1CPUA 1EUAA 3DVFA 3QUMB 2BOBB 5AUMB 1YDOA 3CQKA 1G6RH 2J24A 2OA9A 1IBFA 4G8IB 2NUPA 4DZHA 1UOVA 1F41A 4R26L 5GGRY 5IBLD 3OZ9L 4MAZA 4MB1A 4LOCA 3LXAA 2EIJB 3QBTB 3VDAA 3BUDA 3WO8A 1F4XH 2K4WA 2Q3ZA 4JHWL 4CAGA 3X13A 2X4SB 1AACA 4P23B 3A47A 5T33H 1KCWA 2HKAA 2JSFA 1Q9LB 2J8UF 4CUCA 3OGVA 3VNYA 2QV4A 5IB3A 4YMPA 1E8XA 1TQJA 3C6LC 1KTDB 3MUGB 4DP2X 3IDIB 2PEVA 3M17A 3LQAH 1D9EA 2CO1A 4QLJA 3ZMRA 2JKAA 1GGCH 2X2YA 1NU5A 1YYCA 4APQA 3FVDA 2Y1YA 5IHZB 4RZCB 1HHIA 2XNAA 5MP6L 5JW4M 1LL4A 1B3JA 4X3ZA 3QG6B 3N6YA 3R79A 1U3HD 3VXQA 1BW8A 2FBJH 2VLKB 1XDLA 4XD3A 1SOKA 4AKPA 5K1VA 4BKLB 4L3EA 3K74B 5I74B 3NCYP 1M7UA 3PZMA 4UQ3B 3CL7A 2ENSA 3BC9A 3COTA 3O0KA 1IGFH 3V6ZA 4O57A 2C7FA 3UAAA 3QCVH 3WS3A 2IWEA 4NQ1A 3OB8A 4L48A 4I0PC 3HIJA 4YZWA 4H9UA 2IVFC 2OGJA 2XYLA 2YPLB 1VFSA 4LF1A 3N44B 2NNCA 3OMAB 4WO4A 5B3JE 4ROPA 3EGJA 1CEOA 3R8HA 2YD4A 2DY2A 2GTZB 5DJ0B 1R0AH 3FXYA 3ABSA 2YOAA 1DUZA 1OGPA 1KQYA 2YYUA 1E72M 3PC0A 3DGGA 1FWHC 3U7AA 2F58H 1GQIA 1DJZA 5C0GB 4Z7OB 3LQZB 3E1F1 1D9KD 3T3ME 1BBDH 15C8H 1YEDB 1DN0B 1QEWA 3H6AA 3JWOL 3EYQD 4NJIA 3GRWL 4XV0A 4YLWA 1J0ZA 4JTKA 2FX8H 4N6FA 2EP6A 5MHBA 1F02I 3MLWH 2CO2A 3J2PA 1N6QH 4JO2L 2APXA 1WUNT 5EEUA 2R1PA 4OF6A 1J9QA 2XG5B 2QQNH 2H3DA 1A6WL 3VNLA 1HIZA 1FZMA 1B2WL 2FZ9A 1NBYA 1I8IB 3CFDB 3AIUA 1V8EA 4CGUB 2CO6A 1M68A 2MOQA 1T40A 2W4XA 3GBNL 2Z64C 5AYTA 2ZFAA 4M7SA 3W11D 1FL3B 4FI7A 3TESA 2Y7GA 4NOBA 1VFLA 2VT0A 4MHBA 5D03A 3CHEA 2MNUA 3POHA 2OLDA 1AGDA 3GS6A 2XDHA 4B15A 5E8EA 4KPLA 1FZOB 2NUTA 5FYKU 3VZYA 4F2MA 1JNHB 1MEIA 2AEOA 3TC9A 1BIIA 5FYJL 5E2UH 5HHNA 3CAQA 1ITCA 2Q20A 3BH8A 4PCTA 3TVMA 5CEYB 5IESL 1IYXA 4PYGA 5FL0A 1JUKA 1N2RB 2BP8B 3NIDE 3FQXB 3MHUA 4PP2B 4QPEA 3LCIA 5LHFA 1F86A 4A6GA 4CN4A 2O9RA 4J2QA 3NACL 2EG7A 5CR1A 1FHNA 4K2UH 2BNQA 4UILH 3VNIA 2ETWA 3LMZA 4NQSB 3BAIA 4X7TB 2GK0B 1Q45A 4ZMPA 4EKJA 3SGEH 1OSPL 3REVB 3LZNA 5JDJA 3VOIA 5F7WC 1N0XH 1MI5E 4OIIL 2HRGA 4O1CA 3EPOA 5JORB 1RHCA 1RK7A 4EXBA 3ARRA 2X0WA 3EYSL 2XVBA 1H7OA 3SCMC 1YDYA 1K8IB 3O4OC 5AOMA 1J8HB 2CLOA 3SM0A 3AZUA 3EJTA 4NUWA 2IG2H 5A6SA 2HJFB 3PZGA 2AK4A 2EZ0C 4GVFA 5IUSA 4TMPA 5C0EA 4KFOA 2KERA 5J6HA 4ZW5A 3WTTA 3CZGA 3LKQA 2R0LH 4DPRA 5DQJB 1WWCA 2YDQA 2PDMA 5DHVA 2F5AL 2LW3A 2VMCA 4AEHH 4MYWB 2HE5A 4ACTA 1PCSA 1NKGA 4UTBL 4FCAA 1QRNE 4R7NB 4IJRA 5DWUH 1NEZA 1DLHB 2IDFA 4X9YA 4P5MB 2XXGA 4LKCB 5F44A 3STLA 5E0KA 2RFXA 1QHQA 2XRAL 1D7DA 2V82A 5DI8B 2J8UB 4NJAH 1OVZA 1Q94B 3ITYA 3AMCA 5E6IA 1ESWA 4ZFGH 2HX8A 4FAAB 4K2SA 5KJ4A 4PM1A 2IPTH 4E4UA 4LSVH 4JG1H 2QPFA 4OGAD 3UIZA 1AH4A 1I2PA 1P7TA 1A0QL 4XP4H 4ZQOA 1HZLA 3RBGA 1UR4A 3HZYB 1QSED 1OXYA 4S0TD 5D7IE 3HB3C 1FVEB 5H4ZA 5J1AB 4K8GA 1JF1B 3SURA 1Q8AA 1PLAA 3WF3A 4JFEB 3EFOB 3WDIA 2J4GA 3L3DB 3WLWC 3JZ7A 3UTSA 4C6CA 4C4KT 4EPDC 1FNLA 3GFUA 2C3XA 1XLAA 3JVAA 3TURA 1B3OA 1WIPA 4U1JA 1SLXA 2TYSA 3RVWC 4QTIL 1MNUH 3PLYA 2P42B 4Z76B 1VADB 5CJQL 4OFCA 3Q5OA 4YBLC 1LP9B 5CILH 4XOAA 3LYEA 4Z2KA 1M9SA 1AG0A 1KBGL 3DDFA 1FDYA 3GLDA 4QUOA 7TAAA 4JTFA 4GHRA 2DQCL 4YUEH 2WV3A 1A3RL 2BGQA 2OOGA 1AR1B 3P4MA 4JTEA 5I6LA 3MZ2A 3QUYA 4W9TA 3PPGA 3ML8A 3IXAB 3GXMA 2ZC8A 2Y7MA 4PJDF 2H1PH 3VINA 3T65A 4YDLB 3AS3A 3V36A 4G70B 2H4EA 2X7LB 5EGRA 3LNDA 4NNBA 5HGHB 5HNNA 3RMEA 3E2VA 4YSQA 1TYEB 3KRBA 1YEGH 2BCKB 5I19H 2OX5B 4OI9A 1AH3A 1KM1A 1O75A 4E41A 2VYOA 4N2BA 2VR4A 4F4RA 2W6RA 4ZQRA 1KN2H 1BFVL 4PV1C 4OV5A 3GIVA 2O93L 1UT9A 3WNOA 3APMA 1CB4A 1SO4A 3KBSA 1JSYA 3QO0A 1I1AA 1R3HA 3PAJA 2D3NA 2Y7LA 2Y2WA 3QS2A 4TULL 2DM4A 2J1KA 3UPRB 5JW4Q 3GY1A 4ETQA 4MZIA 5TDNA 2HJKB 4XZWA 2VRKA 4FG6C 2KYIA 1JWMA 4CD8A 2YGVA 3TDFA 4GH7B 3MJYA 4HCRL 3QYQA 1AQMA 3O6FD 4BI6A 3KLAB 3L5JA 3VMOA 1QFWH 2ZBTA 2E6DA 5DVMA 4K55A 3NVQA 1A1MA 3M47A 4PPTA 4ZNEA 3NR0A 4CW1A 3ZMEA 4PJ5E 4WWKD 2OR9L 4QSFA 3WS6A 1BZQK 1KPUA 5I77A 1BXVA 2VDLH 3H42H 1F4AA 1RURL 3IU4L 1FYTD 2O0TA 4UTCA 1W1YA 3EJYC 4HLEA 1ROCA 2OZTA 4QNPE 3MUJA 3VACA 3NEHA 2VEIA 1OF8A 3A4AA 3IWVA 1Q0YL 3VDBA 4BV1A 2PFHA 3HC4L 3ULSB 1A7PL 1KCUL 1GSKA 4DFIA 2V9QA 1KQZA 5I18H 5FOOA 4UM9B 3FVMA 3R94A 4JQIA 5EF0A 3FCPA 4A39A 3N34A 2EYTB 5D09A 5LYRA 4BRJA 2RFGA 5F7DA 1VA9A 4WI2A 2OGYA 4PJHF 4DVRL 1SW0A 1WDRA 4M29A 3AHTA 1WAEA 1R1CA 1TIWA 4NZRH 2R83A 1NIFA 4TKWA 2JI3A 4X6FA 1G6CA 1UD4A 4CQDA 5KZ6A 5KTLA 4M6NL 1TE1A 3FTGB 4NQTA 4JZNA 4M5ZH 1G9MH 4FQQB 1ZT4B 1X7SA 4UNKA 3W5MA 4GQ9L 1JQVA 4HKBA 2AQNA 2J77A 2WQPA 3KMDA 2XJLA 3Q45A 3W2KA 2PYFA 1RALA 3W82A 5C2BL 1KF9B 3CUXA 1Q4NX 8XIAA 4TSAL 4FXTA 3UESA 4R96B 3FRPG 1LK2B 3MBEC 4P2OB 3V4PA 4JDEA 1UWEL 1NY1A 1FAIH 2AQRA 5LHDA 4IU3B 3CHQA 4N6RA 4DGUA 4JFVA 1TPC1 4HIIA 2ED8A 3L7RA 2WJ7A 4PB0H 4I8YA 1QVBA 3PABB 4ZS6C 2PGEA 1DBKL 5CCKH 4HIQA 3RA7L 3BSZH 3RCMA 2H6PA 2OWWA 4GUIA 3GSNB 2AXGB 1WBXA 2V6HA 1FCVA 1T0NB 3QO1A 1MHPL 1F3JA 3SFWA 4GA8A 4P2RB 2JQMA 4PJIA 1XIBA 2PLJA 2WBJC 3EKZA 1HEZB 1DSWA 1JD7A 3VZXA 4M1DH 2PLTA 4AVHA 1NIEA 4O13A 1V3MA 2A77L 4IK6A 1YZZA 2QKIC 2AKRB 3FUKA 4HS8H 4C56D 3RWGA 2IMRA 3U6RB 5JNYA 4LDEB 3GHRA 3P30L 4KQ3H 4K8RL 1LLOA 2FQEA 5E8DH 4EPSA 4JYFA 4N1HB 4KH2A 1ZLUH 4R7OA 4RFOH 4AGQA 1CVRA 4NU7A 4XI5C 2Y6SC 5BO0D 1LOLA 3RE0A 4AY8A 2IXUA 1EDGA 3MGTB 3IMTA 3CN3A 2GUBA 1VFOA 3KGTA 3ZR6A 4NAEB 5CPNA 5IROA 1WC7A 2A6DA 3K2MC 1ZSXA 1ZPTA 4XISA 3QRGL 2Y5TA 3AMDA 4ELMA 4TNVK 1UC4A 3MZNA 3PANA 2X6MA 2JIWA 5HDBF 2J88A 1IL1A 3N4EA 2BS8A 3EZ4A 2OTPA 3QEGL 2AI0L 3AY4C 5FO2A 4V1XA 4PCYA 4X7SL 1SJAA 3L4XA 2WWCA 3T77A 5C0DA 1JPSH 2WHVA 2X0YA 1YYAA 3S1WA 5DBTA 3F5KA 1KIQB 3ILQD 3GQYA 4DKDC 3NPWA 5JXQA 3PAZA 5TQ0L 4OLVH 1SLVA 3FUDA 3UVAA 3S3CB 5DJZA 2HK0A 4A4AA 3F4VA 2YC1A 5F2LA 3SCPA 2DQHL 4JRXB 2HPTA 3RFZA 1YXCA 3CG8A 3HE7D 4FCHA 4E9RA 2GBAA 4OJEH 4S0HA 3B4UA 1QI5A 2FPTA 5KYUB 2GW5A 3PBGA 3B56A 3TP4A 4FL4B 4EPEC 3PDOA 1FFNA 1NGZB 2DWSA 3QFJA 3GH4A 4HPGA 3GSRB 1RP9A 4D0DB 4XBKA 4IOSD 5I15H 4IICA 4OJCA 4M1CC 4P2QE 4JRYE 1G9NH 2INEA 1T1XB 3UWEA 1Q9WB 5IGXH 1MFAL 4N0YH 4K8HA 4IRSD 2G50A 5DMYA 3CMFA 4MHHI 1B3YA 5B1CA 2C1HA 2OEJA 1U1JA 3OHXA 3U7YL 3WIAA 5FHBH 3SAZA 1I7TB 5BRZE 3VD9A 3FRPB 3N0AA 1RK1A 1WXYA 2OI9C 4K7FA