3VOIA

Cccel6a catalytic domain complexed with p-nitrophenyl beta-d-cellotrioside
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
360
structure length
360
Chain Sequence
STGNPFEGYDIYLSPYYAEEVEAAAAMIDDPVLKAKALKVKEIPTFIWFDVVRKTPDLGRYLADATAIQQRTGRKQLVQIVVYDLPDRDCAAAASNGEFSLADGGMEKYKDYVDRLASEIRKYPDVRIVAVIEPDSLANMVTNMNVAKCRGAEAAYKEGVIYALRQLSALGVYSYVDAGHAGWLGWNANLAPSARLFAQIYKDAGRSAFIRGLATNVSNYNALSATTRDPVTQGNDNYDELRFINALAPLLRNEGWDAKFIVDQGRSGVQNIRQEWGNWCNVYGAGFGMRPTLNTPSSAIDAIVWIKPGGEADGTSDTSAPRYDTHCGKSDSHKPAPEAGTWFQEYFVNLVKNANPPLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the structural changes in two cellobiohydrolases, CcCel6A and CcCel6C, from Coprinopsis cinerea - a tweezer-like motion in the structure of CcCel6C
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Hydrolase
molecule keywords Cellobiohydrolase
total genus 138
structure length 360
sequence length 360
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 3voiA00
3A64A 1QK0A 4B4HA 3RPTA 1QJWA 1UP3A 3A9BA 1OC7A 4AX7A 4I5RA 3VOHA 2BOGX 1DYSA 3ABXA 4AVOA 1OCBA 3VOJA 4I5UA 4A05A 2BOFX 2BODX 1OCNA 1TMLA 1QK2A 1CB2A 2BOEX 4B4FA 1UOZA 3VOIA 1UP2A 3RU8X 4AX6A 2BVWA 3VOGA 4AU0A 1OCJA 1HGYA 4AVNA 1OC5A 1UP0A 1HGWA 1OC6A 1GZ1A 3VOFA 1BVWA
chains in the Genus database with same CATH superfamily
3CUXA 1JL8A 1XF0A 2DZVA 1UZ1A 1E6PA 2Q3RA 4ZOAA 2BG5A 1MUMA 4QX4A 5FACA 1DWJM 5HWJA 4DZHA 2VZUA 3NPXA 3GC4A 2R1MA 1TMHA 2JIEA 5J8LA 2XFYA 1DJZA 3LERA 3UU0A 3TTOA 1KFLA 5DXXA 5FIPA 1A47A 4CNSA 4UTIA 3WQDA 2VKZG 4GUGA 4XZHA 3LRLA 3N18A 2PE4A 4B4FA 3M46A 3ICJA 3M41A 4NNAA 1CI1A 3AALA 4PMXA 3WJXA 1WZKA 5FJJA 4C5ZA 2VDIA 1KW1A 1P1MA 1ZSXA 3OBKA 3DN5A 2INZA 5K2ZA 1ONEA 3GHRA 3AOFA 4GJJA 2YCLB 3ERPA 3S5OA 2ABAA 4X9YA 1JDCA 3N6JA 3W76A 2PTZA 2QS8A 3WH9A 2ZADA 1N55A 1Z69A 4GH3A 1MQQA 1S3HA 3QZAA 3UT0A 2HVOA 4MLRA 3URAA 4AWUA 3B9DA 3PANA 1JZ2A 3WLHA 1WZLA 5TQLA 3UWYA 4S3AA 4AH7A 4REQA 4S1FA 4YTQA 2VENA 4CN6A 1JEZA 1GKRA 3M5YA 1IEVA 1ZQ5A 6REQB 3GTHA 4LRSA 3TW6A 3OW1A 1UP3A 4UB9A 4XQ6A 3S2NA 3DHUA 4LFYA 4WDWA 2OSYA 5C54A 5T91A 4IZGA 4D6JA 3FV9A 4KGJA 4REQB 2YL8A 4PBGA 2ZFAA 1TTPA 4LAMA 3TTEA 4Q4SA 4W7UA 2XFRA 3QEZA 6ALDA 4GNVA 4M7SA 4JTGA 3ABXA 1VIWA 5IHSA 2J8FA 3E49A 5FL1A 4GD0A 3C0SA 1HKWA 2PDQA 1Q6QA 4H2CA 2C3ZA 1ICQA 2OVLA 1K7EA 1H0GA 4N0RA 3KRSA 2EO7A 2PD9A 3DFSA 1ZAHA 1FWJC 3MO4A 1J0YA 4J2PA 1YBQB 1M03A 3PUEA 2TYSA 3WQEA 1LTDA 2J62A 1POKA 1AZ2A 1YKWA 1XUZA 1QVBA 3HJEA 5H1WA 3QBUA 3ITGA 1KGXA 1WZMA 2I7GA 1P6BA 1DE6A 2OEMA 2VFGA 3LHUA 4HJWA 4GQBA 1OK4A 1S46A 1EWEA 3W00A 4HJFA 4DHGA 3KBJA 2A7NA 4ZB5A 3QV8A 3H8AA 4Z17A 2RFGA 1YBQA 3TYDA 4B5XA 3PTKA 1PDZA 2VMFA 2D2JA 4BF9A 4C6QA 1OWQA 1PIGA 2JF6A 1DL3A 3PP7A 1UWAA 3E0FA 3TA6A 3MBDA 5CJ5A 3S47A 8XIMA 3K46A 1GWJA 1WDDA 3DFOA 1UOZA 4PR4A 3T09A 1Z9AA 1R46A 4DF2A 3DEQA 4O52A 3GM8A 4YWIA 1LWHA 2AGTA 4WY0F 4XZBA 3FLUA 3RMEA 3I6EA 4HPNA 3PZMA 4PRRA 4WY0B 1RV8A 2GVYA 3LCLA 2F38A 3CASA 1G1YA 2YW4A 2HE5A 2PGRA 2R8WA 5HQMA 2WVUA 3E74A 1SW7A 1YXDA 1UB3A 2PLCA 5IM51 1GJWA 4WY0A 1NSJA 3F2BA 4WLCA 1OF8A 4GYPC 1Z41A 3KEHA 3P82A 1ME9A 2CKRA 5AHLA 4AWEA 3OU8A 3WDPP 1H60A 5XINA 2X40A 2UY4A 4GZIA 3BMXA 4IUOA 2B81A 1NEYA 1XFCA 4KW2A 3ES7A 3QY8A 3H23A 4ZOEA 3WUFA 1DHKA 1VEPA 3IRSA 1K8XA 2FPTA 2C1IA 4YTRA 1M04A 5F4XA 3A9IA 1SSGA 5A8OA 1B9ZA 1VFMA 3D0CA 4JBRA 1PAMA 3QMTA 1JQXA 3MP3A 2PB1A 2XSAA 2QT3A 3AYSA 5KZEA 3UXDA 4OBSA 1VEOA 3Q37A 2JK2A 1GOIA 4CCDA 3JRKA 1RA0A 4GG9A 3GBEA 3BG5A 2J24A 3LXCA 1XSKA 3CM4A 1AW5A 3DKLA 3CO8A 2NUYA 1R7OA 1G6CA 1V7AA 4PUDA 1EZ2A 1D3CA 3PUGA 4Q4RA 1GUVA 2CETA 3EDDA 3SRFA 3GK0A 3KVKA 5JBEA 3U3HA 4MPQA 3EOUA 1A50A 4LUJA 3SZ8A 2WLYA 1U83A 2PC4A 1W5QA 4XWUA 1CENA 3RU8X 5TNVA 4AC7C 4LEQA 3O06A 4DM2A 2VC7A 3S9ZA 1WX0A 6ENLA 4ZO7A 4BKNA 1G69A 4IIDA 3UPWA 4AHOA 2FDMA 2NW0A 2ACSA 4ZZ9A 1TV3A 5I3GA 3VD5A 2DJLA 2EBNA 1HFBA 5G4HC 4C7DA 2FZNA 4MB5A 5FF7A 1QWKA 1X1OA 4EANA 5C2XA 1UMYA 3QQ0A 4ZQMA 3SCWA 3C2YA 1LOQA 4PMVA 2XJ7A 1UUMA 3A3XA 3GH4A 2XU2A 2YCIX 1ZBVA 4PMDA 5I77A 1W6TA 1FTXA 1XIFA 2GFTA 4LC8A 3SSZA 4CGTA 4TMBA 3R8RA 3OZMA 4FNUA 1RD5A 1WXYA 1JZ8A 4NIRA 2QDDA 4MJMA 2F84A 3E3HA 4WD0A 4ICCX 3GG1A 4HU8A 1Z44A 2HPMA 1W2VA 1XJBA 4ORIA 3N11A 4MJZA 2E9LA 1OFQA 4IG2B 1TELA 2BOEX 5HQEA 3GVVA 3CTTA 3EAUA 1CECA 1E55A 4QXIA 2GJXB 3MDUA 5AYBA 3IGSA 4XX6A 1Y5XA 4IX2A 1EPVA 3IANA 1DWIM 3IACA 2HJPA 3VTRA 1IT0A 4HT3A 5ABFA 3MVIA 2HZGA 2P3EA 3VE9A 4JGDA 2NV2A 1R86A 1BKHA 1V6WA 1BRLB 3EWYA 3B4YA 2UY5A 3QTGA 2DJXA 5G1YA 5CSUA 4C6FA 3FIGA 2PTWA 2BTMA 3QMRA 4O10A 3M0XA 3BLOA 1JD9A 4MG4A 2E1DA 4BEUA 4QQUA 3RO6A 2V38A 1XH0A 2PF8A 4PODA 1V93A 2J6XA 4CD7A 1RALA 2V30A 3NZRA 2QJJA 4GH1A 5A2BA 2PU1A 1Q4NX 4JIEA 2Y8VA 3SCVA 4JR5A 4HCDA 1F8IA 1V0LA 3IJ8A 3G77A 3Q65A 1E4MM 3G1HA 4DELA 1X8CA 7CGTA 1UZ4A 1EPXA 3W82A 1TJ0A 3WH6A 1TE1A 1EJSC 3VYLA 1HO1A 4YWSA 2ZZ3A 2QMJA 4UTUA 4C65A 2X0SA 2YYTA 6XIAA 4JTSA 2E09A 2CLEA 4TVCA 3VDGA 2W67A 2WHMA 4KCTA 4YTUA 2V67A 2XTKA 4HMNA 2D20A 4DY1A 3ZJ7A 5A2AA 1GZJA 3QXBA 2Q3OA 2CLMA 1UD5A 4HGXA 1R9ZA 3C61A 2OZ0A 3NDZA 2QHAA 3UERA 4X9SA 5A69A 3REQB 2OEJA 2OLAA 4K8EA 1RPKA 5EPDA 3OIXA 1I0DA 1E43A 1SZEA 4CCCA 3KFTA 1XGDA 4AFYA 5FF3A 3A21A 1EGVA 4L5ZA 1XSJA 3M0YA 1V6TA 3EXTA 3FAXA 1CBGA 4UR9A 3AYRA 5CZSA 3CQ0A 3RDKA 2B7PA 2OO6A 1E6XM 4JICA 4E38A 4OECA 3W7IA 3CZKA 3EX2A 4X0NA 3PWIA 5AHIA 5D2WA 1TRDA 4U10A 1KM0A 2WZEA 2Z00A 1TCMA 1SW3A 1Q6RA 2A3EA 5CSSA 3PR2A 1QOXA 1UHVA 2Z1SA 4P8UA 2W27A 1XBYA 4JDBA 3N2BA 2RJHA 3R13A 4MM1A 3VNZA 2EXOA 1H63A 3H26A 1XL9A 4B92A 3CYVA 1TIMA 3BW2A 1F4HA 4LPCA 3ZM8A 1PJ9A 1HG3A 4Z0SA 3OGVA 1L6GA 2ACRA 4FLOA 3WLTA 4JTDA 3VILA 3MWCA 2RGMA 4GHRA 2PRMA 4JL2A 4HMEA 4V1XA 3C56A 3VIGA 1XIJA 5EU9A 3QQ1A 3KOXA 1AH3A 4X2PA 1DJQA 3TC6A 1B0IA 4BQ3A 2PTDA 1YE6A 4I9AA 3NXFA 4CD5A 2XSBA 1O95A 4DJDD 3LCGA 3PVFA 1UKTA 4PUNA 1UR8A 4WF7A 4ECLA 2PDCA 1WXJA 3MJMA 5FJUA 4IGHA 5GVJA 3HM7A 1P48A 4Y9NA 3MPGA 1T6MA 3I7QA 4EWJA 1H0IA 4L1XA 4AD5A 3A3WA 5A94A 5CPOA 2Z7GA 4KRUA 3HU7A 3VNKA 3VX0A 1SYTA 4MHBA 1XYFA 2D73A 1XSIA 1L6SA 4I8DA 1XGZA 1X1ZA 4DLFA 3TW9A 4K36A 4O0KA 4TTGA 1FH8A 4Q8VA 3KP0A 2BP1A 1HGWA 4PMNA 2G4JA 4DRSA 2DIEA 3QSRA 2TPSA 5KZMA 3JS3A 4NP7A 5FF0A 2VX7A 2F6XA 4FF5A 4XV0A 1B5TA 4WX2A 1RK5A 1EBHA 1ONXA 1N82A 5A6LA 3EB4A 3QQWA 4UTWA 3KCOA 4PEEA 2PS2A 4ATWA 1XFBA 4V27A 3CZJA 4I8YA 5B7YA 4Z2LA 3NQ8A 3L12A 4Q8MA 4V15A 1XM3A 1UWRA 1CLVA 1MQPA 3W0KA 5I02A 1W56A 4WSJA 4ZENA 4D1IA 3K4WA 2YW3A 3E2VA 2DUZA 4W87A 4PFMA 3FNDA 1EZWA 3QOMA 4RJEA 2F61A 3G22A 5CKSA 2VX4A 2Q8XA 2X16A 2ZVRA 5FD0A 1GJPA 5JUVA 4WRHA 3N6HA 3G1SA 5HK4A 1AQ0A 1VENA 3K13A 3KOWA 3TK7A 4E2VA 1V02E 4K2SA 1LP6A 4ENLA 2E5DA 3VNYA 5CBIA 3TAOA 3B97A 4WUIA 4Y9MA 4QS5A 3BVJA 4FHAA 1UWTA 3AMCA 1EF3A 1A3HA 1KFCA 2CZDA 4B91A 1OY0A 1GVQA 1D7FA 2Y89A 1O66A 4QM1A 2V5CA 1K4GA 3AIQA 3LNPA 1JPHA 3UP8A 3B0VC 3D47A 1RCXB 4ZR8A 4I9JA 2YGYA 4PB3A 3WFLA 3T40A 3DI1A 4DJFD 1C8YA 3VABA 4BY3A 3PBGA 1S5VA 1QPOA 1LF1A 3WBEA 3XISA 4G7EA 3IJIA 1SFJA 2PWVA 4H7CA 2QXWA 3IJ6A 5AHEA 4LC6A 1DIKA 3KE0A 3CT2A 4KFOA 3S9YA 3L0NA 4PSPA 2QR6A 1D2KA 3WK1A 3G0XA 2GQAA 1PHQA 1I8JA 1Q65A 1G67A 1EJTC 3NQ2A 5HUOA 1HJUA 4OV4A 4PTXA 1Z6KA 4EKJA 4LH8A 1H49A 3H7RA 3E6EA 3TFXA 1US2A 1H7NA 4Y96A 3AISA 2WM0A 2PDIA 3BGJA 1UQYA 5I00A 5M03A 2GVGA 1VFFA 1QHPA 1UROA 4XBSA 3U5UA 4JD4A 1E73M 4A05A 3R89A 4Z1YA 1ITXA 7REQA 4Z1DA 3AIBA 2Y70A 3U4FA 1VP5A 5DY2A 4HSOA 4LV9A 3WK0A 1ZZMA 1OFOA 5DEZA 1AUSL 4JDYA 5AHMA 4FX6M 3F5KA 2HVNA 5HPOA 1UZHA 3K4AA 1KM4A 1P5BA 4JN7A 4FXSA 4XZIA 2MUCA 5LKYA 3WJYA 2PI6A 1ZHAA 4GISA 4IPIA 4BQ5A 4NG3A 4N4PA 2ZXAA 4WXYA 3NL2A 3VKAA 4Q8UA 3AJ7A 4HQVA 1IGWA 3LXBA 4JQ4A 3UCQA 1FXPA 3CUJA 2V81A 5HMEA 5LIWX 3FFSA 4AD3A 3CWOX 3LA4A 1H61A 4JNZA 1KXTA 3QW3A 3RM8A 4HN8A 2F6UA 1GYLA 1BTMA 3LGEA 2DH3A 4Z0JA 3FYYA 1XLIA 2QCNA 1XV8A 1V6VA 3UWQA 3MV11 1TA3B 1DWAM 3POHA 1UD2A 3KBNA 3UZZA 1ZU8A 1UKSA 3KOYA 3V18A 3A12A 2JBMA 3B04A 3NQCA 4DWSB 3GVWA 1AL8A 1PPIA 4DM1A 2I17A 1K1DA 1O5KA 1DIDA 3AHVA 3PTQA 1K70A 4R27A 1MW0A 3TSDA 3S5YA 3MU7A 3S1WA 3A47A 2VC9A 3MSRA 3DGRA 1LRTA 1FWWA 3A13A 3VD9A 2J7DA 5E6YA 1WBHA 4ADTA 2XG9A 1EL3A 2I14A 4QITA 5REQA 2MNRA 5AYXA 2V9DA 3AWNA 4H4IA 5T9CE 4E2BA 3TQ0A 4DIAA 4HP5A 4KS0A 2IKIA 3QHMA 4UTHA 1OYCA 4DZIA 1LORA 1W9XA 4NZJA 4J40A 5A6SA 1UP2A 4PN2A 2GSHA 1SJCA 1ONRA 3SB0A 3TLQA 3CLMA 2GLKA 4KERA 1WOBA 1VPXA 3BAYA 3PULA 3OZYA 2GQ9A 3NZQA 1U2YA 1GKPA 1VC4A 1XKYA 3FEQA 4OTKA 3KL3A 3W7DA 1YTKA 2DZXA 4UCGA 4NILA 1XIMA 3E0WA 1P0EA 3AU2A 3TU9A 3LBOA 1CW2A 3KRUA 3WQ5A 1PIFA 2WJFA 2IXUA 5JMUA 3CUGA 3UETA 3W87A 1R85A 4S3JA 4B9YA 4FOKA 3ELFA 1FHVA 4C7FA 5BU9A 4E3TA 4TX6A 2XGZA 1S2CA 3UESA 4F0LA 1QNVA 3KBWA 5AB3A 1QNRA 2NV1A 4PBEA 5AC7A 5C9RA 1BG9A 3T2PA 2OB3A 2PDWA 3AXIA 1EOKA 1B3VA 1CLKA 5EFFA 4R53A 1J5SA 4ZEPA 4YYFA 1RVGA 2A7PA 5CC3A 1I6NA 4KH2A 4U4MA 3W38A 3BO9A 4DBSA 3N25A 4RDVA 3PN8A 2W9MA 1O6IA 1JI2A 2Z28A 2YL5A 5SWUA 1P0NA 2GL5A 4C6KA 2INEA 4HMDA 4L6OA 7A3HA 4QDMA 3GDBA 5A1AA 1Q5MA 2P10A 4C6MA 5G1TA 4F9DA 2XIOA 4QNEA 1L0PA 2POTA 4FAMA 4CU6A 4BS0A 3PPFA 4J35A 4GYJA 5CBJA 4OHQA 3U5YA 2PDGA 3W22A 5CPTA 3BAWA 3QZ6A 1GVSA 2GK1A 3EKGA 3BARA 4H8NA 1WO2A 2VEGA 3WF2A 2OODA 3GAYA 3U48A 4EXQA 1RZMA 2J7FA 5K9XA 3O05A 3HG3A 4MNJA 4QNWA 4P2VA 3ABOA 3MKVA 4ZQCA 1DV7A 4MY1A 2GGJA 3S4TA 3ZJ6A 3TN5A 2HCVA 1W1VA 5LA1A 1C29A 2OG9A 1S2AA 4GPNA 1TPDA 1E72M 1KA9F 3K8KA 5EKYA 2TAAA 5M2FX 1YDOA 1KRCC 4ZQOA 3RM4A 3IPWA 1RSCA 2V68A 4JTJA 1Q66A 3ARYA 4X22A 2A7RA 2G96A 3W6MA 3N4FA 4AZ5A 4M1BA 3O63A 4B15A 4O50A 5JVLA 1E6NA 1K8CA 1QPQA 3HV8A 5BOOA 2IQ0A 3NSMA 3VZZA 4U31A 5AYIA 1FDYA 3AI0A 2G4FA 3FKRA 5AVNA 3W2LA 2F8QA 2DSKA 1TQJA 1XPGA 5F2MA 3ABZA 3R25A 3TXZA 2UY3A 2V63A 1WNOA 2XH7A 1RP8A 2O9PA 4IIHA 1E4NA 3HGSA 1V51A 4NJGA 4D71A 1B3YA 4PL2A 3R94A 4P8XA 5GPRA 3W2KA 4LW7A 1HL2A 1L8NA 4US5D 4US5A 3VVGA 2HMCA 4MVAA 3H6OA 1PX8A 3VIFA 3P0WA 2YL6A 1IR1A 1FUYA 6REQA 2WHJA 2YFNA 4PCPA 1V3KA 4DPQA 5I6SA 1VBGA 1RJRA 4O13A 4PBFA 1F8MA 2V3FA 3CIWA 2W92A 2XN2A 3NVDA 1I9CB 2EKGA 3RX3A 1J10A 4R9XA 2VZVA 1DWFM 4ZBCA 4HCLA 1PYFA 3CQIA 2DW6A 2RH9A 3URBA 3P67A 2WNWA 1OIMA 2DVTA 4ICMA 1TZZA 1KGWA 4ADUA 4F9JA 3G1FA 1NDVA 4XZ9A 4FP1A 4K39A 3MKCA 2Q01A 1YE4A 3EDFA 5FAJA 3O6CA 1ZBCA 3GW0A 2G8ZA 3BDKA 2G41A 2NXGA 3ZWSA 3H24A 4R34A 4UBPC 4NXKA 1H1ZA 1VZWA 3I4KA 3WLPA 3QC3A 3DFYA 1DJWA 3N29A 1G7VA 1P0BA 4YJ5A 2GGEA 2YR1A 3TYEA 3CL7A 1WBJA 3LOTA 3OA3A 2BX7A 3DG6A 4E8GA 6TAAA 5HDRA 4K1GA 4D8AA 1A5LC 1UPMB 2XIMA 4QBXA 4AEEA 5CC6A 3VIMA 3GIPA 1F3XA 1I2QA 4FF7A 4E4FA 1J2WA 2OQHA 5FSDC 3UXLA 4G56A 2ZC8A 1A49A 1R3VA 5I3DA 4OFCA 1U33A 1NQKA 2DSVA 2Z1KA 8RUCA 4JKKA 3VDAA 3Q2DA 1O60A 2Z24A 2DZTA 4L65A 1OIFA 4DO6A 2VWTA 4MADA 1OJXA 6XIMA 1JGMA 1GOQA 1D9EA 4H8UA 5EGRA 1JCJA 1MEIA 2VR4A 3KTCA 4NRSA 4CQDA 5HOSA 3M1ZA 2V5JA 4H7VA 3UXIA 3FVDA 1KFWA 1XLDA 1Q6LA 3GXMA 2HE8A 4X60A 4W8BA 1GYMA 2X1SA 3SGUA 1UR1A 1IXNA 2UWFA 5DANA 4RPQA 4GZEA 4HNUA 4UFIA 5FF4A 1GOWA 3LHYA 3VCCA 3ZR5A 3PJUA 3OEXA 4XKYA 3DC0A 3H2AA 4Y7EA 4NJHA 6TIMA 3MUY1 1EX1A 4C91A 5KETA 5E70A 1IZKA 2OYKA 2PGFA 3W7LA 3BWWA 1A53A 1M7PA 1JYXA 1K8YA 3FHQA 2Z29A 5KEZA 2ZBTA 4C6EA 2VEMA 3HF3A 2FVLA 4W7WA 5H8PA 5KZDA 1QI4A 3UNTA 4MLJA 4OV9A 3BQ6A 2A2IA 5CZ0A 3TN4A 4I5UA 5D8ZA 4GACA 3B9AA 4GRSA 3WNMA 3PZTA 3ZWTA 4QJ1A 3ARRA 1VD6A 3IGXA 3BLLA 4Q8QA 1BF2A 2LLEA 4HN4A 3QHNA 2JGQA 1F6YA 1YXCA 2I16A 4AZGA 1V02A 2WJEA 4M7TA 5JU6A 2V2HA 1Q8AA 1AW2A 1NWTA 4X3ZA 4EIVA 5FSEC 1PUDA 4OQVA 1NAL1 5F2LA 1XCFA 3I6RA 1W5OA 2YZRA 3UR2A 3WMCA 3EOEA 1QDSA 9RUBA 3S1UA 2Q8LA 2QQ6A 5G5IA 4HZ6A 1KXQA 2ZE3A 3O8AA 3W74A 3R0UA 4RCXA 3ZT6A 4QG6A 2EJAA 1OGSA 1HJWA 2ABBA 4AMCA 4GZJA 1W9PA 2ZC1A 3ITYA 2D3LA 3EDKA 2O4MA 2ZXBA 5D4YA 2Y8UA 3EDJA 3O16A 4UR8A 3KAOA 1E70M 1QW8A 7PTDA 1IEIA 1MEWA 3BAKA 4P7OA 3GVGA 3W28A 2D2HA 4WGHA 1F74A 1Q3NA 3QJAA 3F2DA 5DY3A 2DZPA 3IVSA 4ZOCA 1C93A 1MO0A 4M5PA 3H55A 1RBAA 1ME8A 5KITA 3QV7A 1XBZA 5M3WA 4EX4A 4LAKA 2IW0A 1G4TA 4IFOA 4JTAA 3GFXA 2Y4SA 4YPJA 3ONCA 4Y9OA 3UR5A 2VVSA 2NSXA 1BKSA 3PG8A 4O4VA 1FH9A 4AVNA 2PFHA 4QJ3B 3E0VA 4XZMX 2J9ZA 4QTGA 2WBKA 3IEBA 3PJXA 3IIZA 5HJLA 3N04A 3F4NA 4W89A 3N2XA 4TXEA 3PF3A 3C8FA 3G5EA 2V5LA 3W1QA 3GQYA 2ISVA 4L6HA 3TKFA 1SZFA 3EX3A 4QFUA 4ZTXA 1LOSA 2FFCA 4DUWA 3Q58A 4S38A 5CSRA 3N2MA 1HJQA 3ALFA 2OGYA 1S1RA 1VJIA 3LUTA 4CCZA 1OCQA 3DBPA 1KM1A 4XIAA 3GIQA 4IQLA 4O1AA 3A4XA 2QW5A 3TQVA 3T8QA 3PZGA 2NQ9A 2OT1A 2A1YA 4Q8TA 1G0CA 4LVDA 3B8WA 1ZUAX 4GMEA 4TU1A 5HNRA 3MKKA 1Q7MA 3WLIA 3L4UA 3XIMA 4OUIA 4ZQRA 2WMJA 2J78A 3TOYA 4LSBA 4LUTB 2OSWA 4HPJA 4P8VA 4JTHA 4H9TA 2FYMA 3SY5A 1DWHM 2OCZA 2V2DA 2JKPA 1LQAA 2PEVA 3B8VA 1KLZA 1NTHA 1JDFA 1EWDA 5BZAA 1ZPTA 2BSLA 1NIUA 3OYXA 3EWZA 4M1RA 4PCFA 2VZOA 1T0OA 4HCHA 3BJFA 5K4ZA 2OLHA 3L0KA 2GJNA 3CLWA 3M0ZA 2E1WA 8CGTA 4B2DD 1KGUA 1SQ7A 1AMKA 3BURA 2XISA 3CHEA 1F5ZA 3CB8A 4YTSA 4WEVX 5EA9A 1VPYA 1LCOA 3VNMA 3B9EA 3ANUA 4JHOA 3CBWA 2DUXA 1GQNA 3GG7A 3P80A 3DKJA 4YNGA 1XRTA 1QJWA 2JQXA 3A4WA 4A21A 3VU2A 1DE5A 3TCSA 5JXQA 5C9UA 4O57A 1E1FA 2CEQA 2GVLA 1C8QA 7ENLA 4GI8A 2GJPA 2QVNA 2ZQ0A 3GXTA 2WCSA 3T0DA 2WVVB 3U2EA 3M0LA 3L0GA 3BJSA 4BK9A 3AYTA 4F48A 3VO0A 3OODA 2WCAA 3OGRA 1JCYA 3CPGA 2WPGA 3TJXA 3R10A 3VMNA 2YDAA 5D2VA 1S5WA 4EK7A 4MWAE 3BOLA 4PUWA 3DYPA 1FVPA 2E77A 3GHSA 3VGGA 3B40A 3E12A 4Q3MA 2HBXA 5LNSA 2WK2A 1GVFA 1V3IA 1W1A1 3TOPA 2JKAA 1BVNP 3ITLA 1CB7B 1JUBA 3NFUA 1C3FA 3W72A 4EWND 3W1RA 1ZL1A 3H4WA 1XYBA 4OVXA 3IIXA 1XLKA 3C6CA 4IFKA 3GYEA 3AZSA 1PDYA 4IIEA 2VEKA 1UIPA 2BXVA 4W85A 4HK6A 4D6IA 4PUJA 1ICPA 1LWJA 4F4RA 2QJMA 3LS9A 2BHUA 2ZDSA 1B30A 3HJZA 2PDKA 1AQMA 3P84A 4E0CA 2VRKA 4U2ZA 3M0HA 4RXFA 1C91A 3THAA 1EP2A 1KFEA 4FNTA 2A6LA 3BV4A 1OYBA 3NVTA 4XAGA 3CUHA 2O92A 3N9SA 3NPUA 3RX4A 5TF0A 3BICA 1TO3A 4IX0A 3WNPA 1A0EA 3WNLA 4O1CA 5C5YA 4PB4A 3VOHA 3CT7A 5IOBA 3NM1A 3P74A 7XIMA 1JRBA 1WCGA 3LHZA 2WXDM 1XYLA 3UPBA 3NSXA 1B3WA 5BXPA 3S2JA 7TAAA 3C5QA 4PUUA 4U28A 2V3EA 4NZ5A 2C14A 3VMPA 3LBCA 4O1BA 3LMZA 1A0DA 3TVAA 1HT6A 4N9EA 1FWAC 4M6UA 3M5VA 1OM0A 3M7WA 3Q67A 4P7RA 1GG0A 3F5JA 1IZCA 5JBDA 1HXJA 1F3TA 3WMBA 4H04A 1T99A 3GRIA 1J01A 3CZGA 2YOCA 4HPXA 5LHFA 2G0WA 1EHNA 1TWZA 3S8HA 3P93A 3RF9A 4JN8A 3S5SA 4AD0A 1T41A 4AUBA 2BZNA 3SM0A 1FWNA 2OLSA 3UVAA 1W3KA 2CHOA 3QGKC 5E09A 3GU2A 3MBFA 4FALA 5H8MA 3VNIA 3ZJ8A 2XWEA 4PMZA 4YVPA 4IG2A 4AWSA 4DNHA 1OFAA 6CGTA 4MNKA 4DWSC 3AJXA 4U2YA 3LHTA 3JU2A 3N15A 5DMNA 1F73A 4MKNA 1P7TB 3WELA 4IL2A 2QDHA 1FWIC 4QLLA 4M8UA 5C9WA 2ZKMX 3BZJA 4OBTA 3QW4B 5M17A 3U9IA 2L5HA 1ONWA 4S3KA 2IXVA 1IEQA 1OINA 4DJDA 5I5RA 3BLDA 4XAFA 5F1VA 1UPPA 2DV0A 3OQEA 3V5CA 1A3XA 3IVTA 4UQEA 2XIQA 1XLHA 2DDXA 3O6YX 4JOMA 1WB0A 4H6KA 1E15A 7ODCA 4O15A 2DT3A 2PDYA 1RJPA 4UC5A 4E2DA 3GNNA 5EL1A 4H9XA 3BAJA 3MP5A 1NOFA 1VPQA 3S2LA 3WD1A 3FSUA 1F6KA 3CH9A 4WOZA 2EKCA 4X0VA 1ISWA 4DBDA 4BWLC 4KKXA 3TQPA 2GQ8A 1M3UA 3VCNA 3M9YA 3UCDA 3HGRA 2F2HA 4DF1A 5FEXA 3B06A 3LV5A 1AZ1A 2OEKA 5HQLA 4N9CA 3W7EA 3SUVA 5BXTA 4NJIA 4HSNA 1CT5A 4BR1A 2W79A 3CGTA 2GWGA 5CJNA 1SZNA 4JQ1A 1SGJA 1SMDA 1V03A 2FFIA 4M0XA 4JTQA 1OK6A 4PYSA 3GHTA 3L4TA 2ZCGA 4W8AA 3MW7A 1VBUA 3VOJA 2PU0A 5LXXA 5BOFA 3BXWA 4FA3A 2FHFA 1MFUA 3KTSA 1W37A 3G6LA 1V6XA 2XN0A 4XD4A 3RRXA 1V6UA 1FHDA 4QJ5B 3NZGA 3CYJA 1PZ1A 1YNQA 4NX0A 2FGLA 5J5RA 4W9TA 3QTPA 3GNOA 3BSMA 3WQ4A 4KIEA 2OX1A 3WH7A 3HA1A 2CITA 4IP4A 5D04C 4Z2KA 2WLZA 1UP0A 4NY2A 1OZMA 1W17A 2DZUA 4GK8A 4W84A 2QJGA 2J47A 1EBGA 3BAXA 3G1AA 2VTFA 1QRQA 2Y2WA 1KCXA 1ZGDA 2H9AA 1UIOA 3W2MA 1JAEA 2VFHA 4TV5A 3NDOA 3EXSA 1E1CA 1EKOA 5ABTA 4XZLX 3RO8A 1LLOA 1JZ3A 3CQKA 1B90A 1OCNA 3H22A 3BLEA 2H9AB 5AC4A 3W24A 5ENLA 4DWSD 1QT1A 4QE4A 3AS2A 3GHUA 5EB8A 4H9MA 1W1YA 3UJEA 2PCQA 4UOZA 2EEXA 5HR7A 2E9MA 2WKLA 3W37A 3UWWA 1RLCL 4BF5A 4NF7A 3MSDA 1OT2A 1A3WA 1GJUA 1XLMA 2OMAA 5M1TA 1A5KC 3C2FA 1I45A 5EY5A 4GIAA 1ADSA 1OX5A 4HK5A 4Q4OA 2NUXA 4KF1A 2BBFA 5BRPA 3T78A 1F2JA 3SIMA 1US3A 2GVJA 4D2JA 3G0UA 1JIBA 1YTEA 3WLMA 3CB3A 3RPTA 3STCA 4NI3A 3KZSA 3UFYA 2XIBA 2ZX9A 1OX4A 1X97A 5F2IA 3OOQA 3G8RA 1VBRA 2BVDA 4GYFA 4C90A 4QDPA 1J0ZA 1GOXA 4WSHA 1FY6A 2FPYA 2IQTA 3D3FA 5HA7A 4JYEA 3CEUA 3CJPA 3IV3A 3FA3A 5E9XA 4B16A 2G5WA 3DECA 1AVAA 5K3VA 5A6JA 3WDHA 3T07A 3GO2A 1PKYA 4WSKA 1RR2A 1OFDA 5DN1A 5F4SA 4IGSA 2Y62A 3V35A 1OQFA 4LNYA 3TE9A 4FOUA 3WY1A 2J6VA 3WD3A 3ZR6A 1PKNA 3BAIA 1VLIA 3FS2A 3GU1A 5EMLA 2WMHA 2ADAA 4CQ8A 3T08A 2HK1A 1C8XA 8A3HA 3V3WA 2PWFA 1ESWA 2A6NA 2RKXA 1QI0A 1RBLA 4LUYA 3QKEA 4LNCA 3MMWA 3OHMB 2E28A 3GVRA 1NWRA 2QCCA 3THUA 3NQBA 1J0JA 4XKYB 4S3FA 1I2NA 1SMAA 3UJ2A 5HUPA 4J28A 2CC0A 3GZ3A 1AH0A 4HU3A 1JFHA 2J27A 1HVQA 1NDWA 1EB3A 3UJFA 1Y0EA 1EDQA 4UMBA 2YB4A 4JYFA 3FW6A 4HYWA 1K77A 2QCGA 1ISXA 5DO8A 4LANA 1OBAA 2AAAA 4A2RA 5E5CA 1F05A 4ZOBA 5AZ1A 5I7GA 2CYGA 2BY2A 1YDVA 4DJED 3LM7A 1IV8A 1TTJA 2E5BA 1N7KA 2OZ8A 4Y6GA 1FWBC 1I2RA 3MYOA 2YFOA 4GVFA 3MUXA 4D6HA 2CLLA 4URIA 4JX6A 3HB9A 5LNRA 1ME7A 4CEXC 2FPVA 4X2RA 1WA3A 2P76A 2OFJA 2OZTA 1BD0A 3VGBA 3NCOA 4O8AA 4BHYA 3BC9A 5LYRA 2E3ZA 2YXGA 3II1A 3K30A 3QY7A 3MJYA 1KCLA 1MYRA 2WSKA 1UD6A 5CPSA 1KV8A 3DYMA 1AQHA 1SVDA 3SCOA 4LVGA 4J3ZA 2Y5EA 1U30A 3V1HA 5CZJA 2PA6A 3HMCA 4DN1A 2VC6A 3BLFA 4BEQA 1U22A 4AIEA 2YDSA 1TJ1A 2PODA 3V0UA 1G5AA 3C0LA 4HA3A 3ZSSA 3PBMA 1UYQA 3OTRA 3B0YA 1O68A 4AZCA 1OC6A 4HU4A 4XBJA 1JPKA 3WK2A 4TO8A 4UCFA 2WVTA 4OGZA 2NV9A 3RUBL 3FJ4A 3LLFA 4O54A 2BDQA 3L4XA 4GVIA 2A79A 3GNPA 3BV7A 3TYCA 2JKEA 2QPXA 3U6WA 1PVNA 3I6TA 1IGSA 2AL1A 3VXGA 2EPKX 3KW3A 1O7AA 2PLJA 3WK3A 1WUFA 4RE2A 4RZBA 2CZ5A 2Y6ZA 2V5KA 4XZNX 4ZE4A 1JZ7A 1BTCA 5LSMA 3IIOA 2WCGA 3NO1A 4HMCA 4W5ZA 4UQ9A 1Q63A 2VL4A 3NAVA 3CL8A 1K8ZA 2Q02A 3SCQA 4N7QA 4GA8A 4ZMGA 2V3DA 1T8QA 5D09A 2WMIB 3STPA 1R3TA 3W71A 2QJIA 3EMQA 3IIVA 1MMFA 1Z8AA 3PBVA 3W2UA 2QDGA 3PAJA 4JNYA 1HL9A 1E1EA 1OABA 3FA5A 4GJIA 4U33A 1CXKA 2G50A 1YTDA 3WQGA 1TVLA 1XS2A 1TVNA 1J9YA 1OEPA 5TBOA 2BGNE 4MFEA 4WR3A 4IXXA 1VYPX 3L2LA 3BW3A 3EXRA 1EH9A 2GYIA 4UR7A 4JFUA 2WMIA 4FXRA 2OKTA 3RCYA 3FHAA 3WNOA 4CNOA 4DBUA 1UWIA 2AQOA 1B4KA 1H09A 4LU0A 3UPMA 2HXUA 3HOJA 5CG7A 3KS5A 3MMDA 1X39A 1JDEA 3O0KA 3H2EA 3CU2A 1GHRA 3L4WA 3SRHA 4UTMA 3ARXA 5BU6A 2OWWA 1VF8A 1D8WA 3W7KA 5XIAA 2FB3A 3LI1A 2X1IA 1VQTA 2HBVA 4YU1A 4DUOA 3BLKA 2WVVA 3MZNA 4AG0A 4EF8A 4IJCA 4GI4A 3LCHA 3TP4A 3VCRA 3QN3A 1GNXA 1GOKA 2UBPC 3UZXA 5I78A 4FEZA 4IOTA 1XISA 4ZODA 2QJNA 3MY9A 1SR0A 5CZTA 2YIHA 3UXAA 2XHYA 5HNTA 2PMQA 4DI9A 3CK5A 2OXNA 3G1YA 3SUSA 3TYUA 4EVZA 3QLDA 5IDZA 1EDGA 4QRNA 1OVDA 4RXGA 1B9BA 1WPCA 2HS8A 1WXZA 2GDQA 2P50A 3AXMA 4ASTA 4F2BA 4L4MA 2OYLA 4GXMA 4Q6JA 1Q45A 1XIDA 4F8XA 4OOUA 2FVKA 5HULA 1VBHA 3WLKX 5HMFA 4CLMA 2ZWZA 1IXQA 4H00A 3HQPA 1LG1A 3LV6A 1HIZA 3WQWA 2G95A 4ZFCA 5I3JA 4J27A 3DXIA 1BGGA 1DJXA 4H2HA 3N3MA 2VWSA 2NX1A 3UR8A 3LGGA 1IXPA 2KX9A 3LYEA 2QYGA 3IJDA 3T55A 1XXXA 4MDOA 4RDZA 1V0KA 3F7JA 1I2OA 4JIRA 3TTSA 3E0IA 3LCFA 1XLBA 3EBVA 3HPAA 5IRPA 2G3FA 5LIYX 2G3IA 5CXPA 3GKAA 3W7GA 4LUIA 1IWPA 5E1QA 1J0HA 3WF3A 2XVPA 5D9NA 4RL3A 1SFLA 5TD4A 4XBKA 4HHMA 3L67A 3OLDA 4YIWA 4UNKA 2PP1A 2DPEA 2HNEA 3JVAA 1GG1A 2TMDA 1GTHA 3W26A 1ZLPA 5CSYA 4PMYA 5HJYA 3WH8A 3BCFA 2PDJA 2XH2A 3QR1A 4MZ1A 3R7MA 2QUNA 3WEMA 1S5MA 1UBSA 2YCJA 5CQ1A 1JXJA 4QAWA 1LUCA 1FFRA 1HNYA 4YVXA 4W86A 2AMGA 4B5TA 3QV6A 4MWAD 4MWAA 3UJSA 1EGZA 1SO5A 2DQXA 1H50A 4LY8A 3NQGA 1HO4A 1IWAA 1A5BA 1XC4A 3TJLA 5G2IA 4LF1A 2TODA 1F07A 2J7CA 4HNNA 4BF7A 5H6HA 1V7YA 4XKMA 4ZL1A 3QSTA 3H54A 3E9AA 2E6DA 4JTIA 4AYSA 4H9VA 5BXRA 2GZXA 4D8LA 1Q6DA 3ZVHB 1XYAA 4JX4A 3G0SA 3VIKA 5FA5A 2QCLA 5G2WA 3WENA 1BGAA 2NX3A 2R82A 3OVRA 4FZIA 1ICSA 3RPDA 4DB7A 1ZB5A 4M6QA 4NSBA 5BWAA 1RAKA 1FX6A 1HKMA 1UR2A 3QY6A 3LPGA 3WO8A 3PNZA 1DKWA 2E7FA 4M56A 4RNFA 2VJXA 3PPGA 3B0PA 5CBBA 1QHZA 1M7JA 1UD4A 3EZ4A 3MUIA 1FWFC 3L2IA 3TUUA 1BHGA 1JCLA 5EMJA 2X1RA 3FSTA 2PWGA 3RIKA 4F3HA 4C1NB 4LX4A 3QKZA 4H01A 4NRRA 4UMCA 1EYEA 8TIMA 1XH1A 3LY0A 2VGIA 4PCNA 1R6WA 1CCWB 4A3UA 2RDTA 1H7PA 3TW7A 3GS6A 4YVVA 4BFAA 2Z1VA 1UA3A 3IRDA 1GQLA 1A80A 3PSWA 4Q8OA 4I6KA 3RPMA 4ERGA 4NNCA 1BF6A 5CAHA 3IV8A 2ZX8A 1E0UA 3DFQA 3RMJA 2FHBA 3MMTA 1MI3A 3IUHA 1KR0A 2PF0A 2WBGA 3FX4A 1HF6A 1V08A 4GWEA 4E2OA 4GABA 4JY9A 4JTUA 2BLEA 1YIXA 4ZFMA 3OYZA 4PTDA 3BH4A 5A6MA 4MB1A 3EWXA 4AXNA 2AKZA 5AYYA 3RITA 4FB7A 1JXKA 4POCA 1G7UA 1OCBA 3T44A 4M51A 3BQ5A 3M0JA 3NO3A 4UZUA 2ZUUA 4Q8NA 3U4AA 3W1UA 4ML4A 1KKOA 3H2OA 3I68A 3IAPA 1SO3A 1XIEA 1C90A 1OC7A 1KBBA 2A5HA 4RW5A 3GSMA 2C19A 4QQ3A 3TX9A 1DJIA 3T0CA 3AFBA 3ZYZA 4RDYA 2OR2A 3L23A 1F4AA 1CGUA 2WHLA 2AL2B 4BI5A 3F4CA 4UTJA 4OKDA 4WKAA 3UG8A 4AIBA 3S1GA 1SU5A 1F7BA 1Y8BA 3ME3A 1JD7A 3C2VA 3V36A 1KR1A 4R9OA 2ZOXA 1K9FA 1CX9A 1ZP4A 1Q6FA 3P8IA 1LT8A 4GIRA 3IJ7A 3HG2A 3AQUA 5J04A 1R8LA 5AZ0A 4CU8A 4G1KA 1A5MC 1PE1A 5EBUA 2PDPA 3BGGA 4I5RA 2ZX6A 4IISA 3USBA 2VXNA 1M65A 5AC6A 2E68A 3TNOA 4OBRA 1W2PA 2VRQA 2R1KA 2VNCA 1JQVA 3CAKA 3PAOA 5A8QA 2ZZ5A 3L2MA 1EJUC 3LLXA 1FHUA 2A0NA 1I0BA 1VYSX 2Z6JA 4AY7A 4ZVJA 2BVWA 2EGZA 1KRMA 3GY1A 1LL7A 4H9UA 3TYAA 1IT8A 3AIEA 2J77A 3AS1A 3U2OA 5L9FA 2RDXA 3FVMA 3VNDA 2OKOA 1FFQA 4CKQA 3C2EA 4IHCA 2YZ5A 5K9CA 2VX5A 3A4JA 5D8WA 5A6KA 5B80A 3KBMA 3TFCA 2NQLA 1JCMP 2CESA 1C8VA 3ARWA 3WQ8A 3WJSA 1NOWA 1Q85A 2WNQA 3N13A 3LCIA 2QV5A 1FCUA 1RBOB 3SIZA 4AZIA 2C8NA 1T5AA 3UQNA 4JIQA 3ARVA 2DUAA 3T4CA 1FKXA 4BI7A 1SW0A 2QV4A 1EO5A 3MWAA 3LU2A 4CU7A 3UG4A 5DF0A 3SEPA 4L9XA 4ZCWA 1GPFA 3SQSA 2Z26A 4CNPA 1DBTA 4JTRA 2GJRA 1XBXA 1LBLA 5CJMA 2UY2A 2ESCA 3GFYA 4O16A 4Q4KA 3FDKA 1HKIA 2V5DA 1IEXA 1DIOA 1LT7A 1W9BM 4JFWA 2R1PA 2CBIA 1X6UA 4TVDA 1TTQA 3DC8A 2PDNA 2OWCA 2PWDA 1WAUA 4DI8A 1PTDA 3QYSA 4MY8A 1UKOA 4YLWA 3A6OA 3HFTA 2CXGA 5LNWA 4UOQA 1TB3A 1BWLA 2R14A 3O1NA 4ML9A 5LNUA 5DCBA 3GB6A 5FCZA 4DQWA 5A8MA 3K1DA 1E0XA 1RCQA 2QKFA 2J74A 1XD1A 1RVKA 3ENLA 2BFGA 3WQ6A 1OADA 4IGMA 1JUEA 1GCYA 4HKPA 4J9JA 3GFZA 1QNSA 3FJLA 1P0KA 4KEUA 1H7OA 4BWLA 1LRQA 2HSAA 4LS2A 1AH4A 3G2GA 3W01A 5BNKA 3P2VA 1PXGA 3VC6A 4LBRA 4LB4A 3VZYA 3OO2A 4QSHA 4GYPA 2HK0A 4FR1A 3DESA 4P5UA 3M0MA 1WDRA 4XSLA 3PUOA 1NFPA 5D2TA 5MHBA 3WD2A 5I3HA 1J12A 2YXOA 4FLQA 2FIQA 4QLJA 2XFWA 4LCRA 1MDLA 3GXFA 3H4GA 4JTEA 1CDGA 2IKGA 5EMYA 3STEA 4JY8A 3BGAA 4S3CA 4GC4A 1XLEA 1UR3M 3TR9A 1A4LA 2X0HA 4PTVA 3CHFA 4XSMA 4XB3A 3N17A 1WAWA 3N73A 1AA1B 2R1NA 1S5NA 3QMSA 4LVAA 1HKJA 3ITVA 3R1ZA 2J13A 4NZ4A 4ZGYA 3S2CA 4DJFC 1OF6A 1EA9C 2ZRYA 3QM3A 4G5DA 1S3TC 4MNLA 3N6QA 4S23A 3ZLGA 1RLDA 2ANUA 3OJGA 3OGSA 1A5UA 2CU0A 4AD2A 5A3HA 3AUJA 5D2YA 1NF7A 3VE7A 3DIPA 4Z1BA 2YA2A 2Q09A 1JPIA 5CGTA 2DSWA 4JPGA 4DAIA 3CHVA 2WQDA 1W3IA 1UKQA 5XIMA 1G9HA 3TYBA 3M4HA 1JZ6A 2XVLA 1U1HA 2J79A 3SN0A 3TNBA 4JQ2A 3A23A 2QZRA 3H21A 2HDJA 4L1GA 2EPMX 2MANA 3MHFA 5A8PA 3B4UA 4B90A 5K7JA 4C1KA 3HPXA 2YA1A 3N14A 4GO8A 2UV8G 5E0FA 3TR2A 3GW3A 4B5SA 3AXKA 3BZGA 2AOSA 2YCLA 3QFWA 2W6RA 3W84A 1ELSA 1W1ZA 2P8BA 1AK5A 4M6PA 1D3GA 4JNMA 1KRBC 5HBFA 3WCZA 1F3EA 4W8LA 1JG9A 1DXFA 3L4YA 4MKSA 3DUGA 3W70A 1EEXA 1TR1A 1JULA 1OHLA 5A8NA 1K6AA 4IH3A 1PCWA 2OQYA 3EEZA 1RD6A 3VNJA 4PUEA 3RLUA 2FZMA 3DCPA 7TIMA 1ZBKA 2CPUA 4MZ8A 2PLKA 3GH5A 4DBEA 4TUFA 4NX5A 2ISDA 2B31A 3IJLA 5LA2A 1Y5VA 3NL3A 4M3PA 3CIVA 3EYPA 2W63A 4L61A 3VDCA 3W4RA 3CL6A 4MDPA 3K8LA 3WH5A 3P14A 1XKJA 1V5XA 4UQBA 2XINA 1E4IA 2FDSA 3WBAA 3UWZA 3H2MA 3NXLA 2EAWA 2FTWA 3HMJG 2IKJA 4RE0A 2WZIA 4CNNA 2ZRWA 4AVOA 1WKEA 4ZSUA 1JDDA 1XI3A 3H7VA 4IM4A 5I23A 1MNZA 4F0MA 3TTQA 4QE1A 3C86A 3S6DA 2Y7DA 4I6VA 5AC8A 3CH0A 1R87A 1A5NC 3EA3A 1T7LA 2VZSA 1Z42A 1MW3A 1XPYA 1DHPA 3GG8A 1BYDA 5AHNA 1EXPA 3UZYA 2Z2UA 3MI2A 3WQCA 4DJEA 1DXEA 4B5WA 3QYQA 1H41A 3U0HA 2G3NA 5BROA 4LEFA 1Z89A 5GNZA 1H51A 2C79A 2HEJA 3QVQA 1WDSA 3GXIA 3ZS4A 3LPOA 2QPUA 1NM9A 2NQ5A 2IPJA 4WXZA 4IMEA 1VR6A 2HISA 1HGYA 1H62A 2GGHA 1CXEA 2V6AA 3WDIA 4GO9A 2QJHA 1XUUA 4JKLA 4FK9A 1BPLB 2Y5JA 3WEOA 3IWPA 2V3GA 3RRAA 3TN3A 6PTDA 4GIYA 1PKMA 4BQ4A 4MTVA 2J75A 2EF9A 1ZALA 2HNHA 3ARUA 4X61A 3GXNA 1XIHA 2RGLA 3P60A 1TPVA 2DZAA 4TR9A 1W3NA 3WLQA 4NZFA 3KX6A 3H4XA 2XN1A 1OFEA 2O56A 4B3LA 2ZUWA 3UEQA 1M68A 3W7QA 3CS2A 4GY7A 2VELA 3NTYA 1PZ3A 4FSAA 3NZ1A 3QF0A 3RJXA 2CZVA 3UG5A 4DO7A 2DVXA 3VD3A 2BS9A 5A6AA 3N1AA 4Z2HA 1YYAA 2ZA1A 2J9XA 1CLXA 1KWKA 1J6OA 4A35A 2BVTA 3NOEA 3MDWA 1MW1A 1SPQA 2IPWA 2NQHA 3G1VA 4KCWA 1HJVA 1GZGA 2ZE0A 3BSGA 3W25A 4IJRA 3ITOA 4E5TA 1N8IA 4GFIA 1ITQA 4R85A 4BCEA 2NVAA 2D69A 3DHFA 4YXGA 1XYMA 2WAGA 2GUYA 1W9UA 2VFEA 5MKGA 2VRJA 3N2OA 3VM7A 1TPWA 1E4LA 3ITCA 3UGVA 3CUFA 1NARA 1UD3A 4U5IA 4K7YA 2WHKA 3DHPA 3LTPA 4MJ4A 1F3WA 2Z6IA 2Z27A 3P7YA 2WZTA 1CXLA 4N9BA 3I7SA 4GI6A 3B05A 1CGVA 3AIRA 3VOFA 1OZQA 4LJ3A 4A8IA 4D9PA 3IJ9A 1XIBA 2C1HA 1B1YA 2YKKA 5IFPA 1XYCA 2VHLA 3H53A 4HZ7A 4AIOA 1PIIA 2PRLA 1TFVA 2Y5SA 1VHNA 1GKQA 4A29A 1J79A 3IAQA 1HTIA 4L80A 3N3TA 4GCAA 4NAFA 1LQ2A 3ABSA 2PUZA 4AZCB 1TPFA 2H3BA 4M81A 2QCFA 1QK0A 4OWGA 3EEGA 5KINA 3AZTA 4DWDA 1NQ6A 3I3EA 1R3RA 3WD4A 1DJGA 3FY1A 3FDGA 3RR1A 2XDFA 3WLRA 4Q22A 3RR4A 1SFTA 3C0JA 3DI0A 2VDHA 4AZ6A 1H1YA 4Q4QA 4XO6A 4MUZA 4PTNA 3T4WA 2RHGA 1BVWA 1KWGA 1W5PA 3W75A 3W85A 3VDBA 4UTKA 1XBVA 2PDMA 3GTIA 1QMLA 1ZJIA 3H2FA 2A85A 3GYCA 5CGQA 2V2CA 4Q32A 1MZRA 2ZA3A 5CPLA 1VYRA 1EX5A 2AL2A 5DBUA 1EIBA 3T8LA 4Z1CA 1O5QA 3NGFA 3R12A 4XUYA 1O4UA 3B8DA 2QVHA 1VEMA 4P61A 5H91A 3SURA 3V4BA 4JXCA 1ISVA 5I09A 4AD1A 3MP4A 1LOLA 3QR0A 4UUIA 4KWVA 4AZBA 3LSCA 4OE7A 3RFAA 3UA3A 4GY0A 5AHFA 1MRQA 3S6TA 4O0QA 4DZ5A 3NO5A 1EHAA 3IS4A 3TWAA 1FWDC 1NOUA 2DSUA 1EJ7L 1NELA 3WLOA 4IWWA 4LS1A 1LRNA 3MYPA 1VFTA 4WGXA 3W1MA 2REQB 1RP9A 4WHBA 1OG0A 4IF2A 1B54A 1UWUA 3QLLA 4D6DA 3N34A 2EJ1A 1YPXA 3AU6A 4WKFA 5G4EA 1GZ1A 3B9OA 4I7WA 1HX0A 4XZWA 5AKQA 2XM1A 2QNEA 3UA4A 1OYAA 2D2OA 4U3AA 3R11A 4A6GA 3SADA 2CXEA 1X7FA 4KMQA 3WF0A 3OG2A 1AQFA 4TV6A 1QCWA 4FNQA 4PMQA 2OQLA 1LUCB 1SR9A 4WOQA 2OTDA 1BQCA 1TPEA 3N2CA 4HNVA 4RNJA 4FNPA 1S2UA 2BOGX 3ISIX 3AAMA 1CXIA 2QIWA 2TSYA 4AXKA 4G7EB 3R2GA 5CH9A 2PRHA 4HNOA 4NYYA 1ZCCA 2D22A 5HINA 1UJQA 3V5OA 3AMGA 2X42A 5FEZA 3WIJA 4MY9A 3L4ZA 5AFDA 4WK9A 1NFGA 1CPUA 3KWSA 4PB5A 3KRZA 1RQEA 4G8TA 4IT1A 4JN6A 4IIBA 3QGAC 1UBPC 3WMSA 2WWCA 2XGIA 2FTPA 4K68A 3UWVA 1RH9A 3GC5A 1KM6A 1KLYA 1FWEC 2E4TA 3GIYA 1Q2RA 1HP5A 2QCDB 4HOXA 1A5CA 1QAPA 2Z1XA 3IVUA 4QE5A 4HSHA 2W91A 3W3OA 1R3QA 1H7RA 2WZMA 2PAJA 1UASA 4CQ9A 1QNOA 3QR3A 2TRSA 3TAKA 1KCZA 3T6CA 4RR4A 5CPQA 4MWAC 3REQA 2O4QA 1E9IA 1EP3A 4IFRA 4A22A 1REQA 2E8YA 3SY8A 3IK4A 3O2LA 5GJPA 1YDYA 3WLSA 1PS9A 3DFTA 7REQB 1YHTA 3NQVA 3W7PA 3AHYA 4WKHA 3N4AA 3NOYA 4NYUA 4OU1A 5C70A 3FGCA 3RK8A 1DVJA 1YEYA 3P8JA 2B0MA 4LYQA 4WIWA 1C7SA 3TMLA 5HR6A 3S3GA 4IIFA 1P6CA 1Q6GA 1K02A 2X7VA 1VIZA 1LL4A 4M80A 4GQGA 1XW8A 3C3UA 3NNTA 3DBNA 1LM1A 5JH2A 2CZFA 4RZ4A 3Q45A 1TWWA 2IKHA 1CYGA 2CERA 1WQ5A 4GY1A 5JH1A 4ATDA 1S5TA 3KLLA 4A3RA 2OJPA 3QV9A 2HPIA 4ZA0A 4R7WA 4B3KA 2ZRVA 1ML1A 1XLFA 3WNKA 1A0CA 3EA2A 3W83A 2D1ZA 2R24A 1GVOA 3QH2A 4PRTA 3SCTA 4RX0A 2R6OA 3HV9A 1XWYA 4O14A 3WQPA 2NVCA 4DWSA 2VFDA 2HWGA 1XH2A 4P7LA 2FTYA 2QUVA 1TQXA 3VUPA 3NQDA 1W3LA 3I4EA 5FJTA 5FJRA 2WSRA 3N2TA 3MI3A 1M5WA 4FLSA 2ZTKA 3PBUA 3E5PA 4JIIX 4NT0A 1WDWA 1GVEA 2CHRA 3KVLA 4CD4A 5C0QA 1CEOA 4JQAA 3RM9A 4AWTA 2D2GA 4N9DA 4QS6A 4NNBA 4PSRA 1QPNA 4C1LA 3SJ3A 3GD6A 2BVYA 5EFDA 4YL2A 3UXKA 2Q6ZA 3SQLA 1H1NA 4PA8A 3BLIA 1QBBA 4QROA 4AHQA 3CEPA 4IUGA 3GXDA 3VKJA 5BRBA 4GKTA 3ZVIA 1X1NA 2FZDA 3E0LA 5T9BG 4F79A 3AYVA 1YNYA 1ZJAA 3NQAA 3ANVA 3MS8A 4Z42C 3RNDA 1PCKA 3LZ3A 2GDUA 1O1HA 3TQKA 2BODX 2WSYA 5DMYA 3EMZA 5EMUA 1R9YA 5F2GA 1V3MA 2WW5A 3NJ3A 3KRBA 2DT2A 3DX5A 1QPRA 3C3NA 3R0KA 3T05A 3KTXA 1K7FA 3G1DA 3TEVA 4TVUA 1GONA 1M41A 2PURA 3BOFA 3CUZA 4AEFA 1FHLA 5DRIA 1R2RA 4MPKA 5LXEA 2FKPA 4ZXLA 5M5DA 3O07A 5CEWA 1IQ8A 1WKYA 4C5YA 1DWGM 3H2NA 4HPGA 1ZAIA 2VD9A 3GAKA 3HN3A 1U1UA 2NX9A 3DU0A 1VJZA 3EGJA 2VGBA 3JZEA 4I5XA 3NGJA 3THQA 2Y61A 5FL0A 1KM2A 4CNTA 3MC5A 4HA0A 2ZUNA 5C2GA 2VOMA 3BL3A 5I24A 3AROA 2F6KA 4K8GA 1MXDA 3N9KA 2DZBA 5LZLA 4A8RA 1BLIA 1FBAA 1EXBA 3A5VA 2WB5A 4WJ8A 4M19A 2V5BA 1UR4A 4MUPA 2CKSA 5A95A 4IPJA 3GH7A 3ALGA 2C71A 4AW7A 3ZLHA 3G1RA 2EG8A 4L64A 4HZ8A 5DRCA 1OD0A 2DGAA 4HIBA 3LPFA 5D38A 3SCSA 4LY4A 1KKRA 3KCLA 1KXVA 3BUVA 4HVXA 3F1QA 3HPFA 2EHHA 4ZQNA 4NZ1A 5DT5A 3UR7A 4NZCA 1FDJA 1J0KA 4UQDA 2XYLA 1K9DA 1VGAA 3U8GA 2WC4A 3BK0A 1PX4A 4PMRA 1J0IA 3APYA 1GOOA 4S2BA 3OLGA 4O19A 1NY1A 3MQTA 3E96A 4O8RA 4JTFA 2F7FA 4AAJA 1B2YA 4HHPA 2O0TA 2P53A 4PCTA 1KTCA 4GCXA 4DEFA 3BSHA 2PDFA 4E6MA 4KT2A 1KO0A 2JALA 3EMCA 3DENA 2EQDA 2PTYA 4EPEC 4GYKA 3M0VA 2CBVA 1JGIA 1TMLA 3GR7A 5C7HA 2I1OA 3LN3A 1AMYA 4Y8EA 1PV8A 2NXHA 1K3UA 1H5VA 2X05A 4MYXA 3LHVA 2B7NA 2DIKA 3LEPA 3UNDA 4DAFA 1OB0A 4Q4PA 2DU2A 3FXYA 1CNVA 4DUVA 3EWDA 4JEJA 4LVBA 3GR8A 2CCRA 4G6CA 4MZYA 3H7UA 2XIJA 4XTDA 5BOEA 1MEHA 1M7XA 1AL7A 1VH7A 4LYKA 3CZ8A 4FX8A 4LUTA 1TUXA 3TZFA 3SJNA 3V16A 4HZMA 3PPHA 2E6YA 2E40A 4QISA 4OT7A 2IUZA 3WUEA 3N19B 4FIRA 3ZR4A 4IICA 4D6CA 5D05A 1KQZA 2QGYA 3O15A 1EP1A 4PGLA 1W5NA 4YN5A 1SJAA 3NQ7A 2C6QA 2OO0A 4WDTA 1IT7A 1PWLA 4JYDA 5I79A 3KOZA 4FXJA 4LYPA 1VFSA 1BYCA 4IQJA 4MGGA 3HGOA 3OQ8A 2OX4A 4I7UA 1JFXA 3DHDA 1BXNA 4DX3A 4LUSA 2HQAA 4O53A 5J5DA 1EQCA 2PDUA 4NU7A 4MB3A 3AMLA 3R0DA 3HGJA 3ABRA 2BMBA 1Q6OA 1XLLA 3BG3A 4M6VA 3S42A 3PZIA 2ZIDA 1IE7C 2DEPA 4GVGA 4J5NA 1QFEA 2PCEA 3U57A 2AKMA 3MI6A 3M6DA 5AN7A 1NJJA 2ISSA 3KBVA 4MOZA 4KCUA 3NQMA 4LCSA 1JYVA 2DVUA 1THFD 2IPGA 3KP1A 4GBDA 5E0CA 3MANA 4GQQA 1W91A 3IGUA 4UTFA 1FWSA 3HBLA 4TX8A 2ATMA 5ABHA 1TKKA 3AS0A 3EWUA 4L1WA 3D5HA 4W93A 3PTDA 4UFHA 1W8SA 1W3HA 3OG3A 3RILA 5AC5A 1Y65A 4MAZA 1EGMA 1GVIA 1QI2A 3STGA 3LG3A 4DO5A 1FWTA 4HK7A 5LHEA 1ODZA 4QIUA 1S1PA 3F4DA 3UJRA 4DZAA 1J5TA 2J88A 1T40A 2R91A 4O4WA 4UNIA 4H8VA 3E2SA 4EAMA 1PKLA 2NWRA 3HURA 3G3DA 1RXOB 4ACYA 1XICA 5FJIA 4Z2GA 4QHRA 2J7BA 1VJSA 3VC5A 2R94A 3EWBX 3WL1A 4F2UA 1NVMA 4NJKA 4IXHA 2HS6A 1I2PA 2PWUA 3S6OA 5ABGA 4OJYA 3L5LA 1UG6A 3POCA 4DXXA 4V28A 2PGEA 2PZ0A 3BJTA 4PH6A 2I56A 4MJ2A 1QPKA 5EMMA 2C16A 5EYWA 3WDRA 3PBYA 1FCVA 3PSVA 3JUGA 3ITXA 2VC5A 3SGGA 1JJKA 2XFFA 4DJDC 4AB4A 4JEQA 4NKCA 1SZRA 3TIMA 1R47A 5CAKA 2WOQA 3V0TA 3LMYA 3W2NA 1L6WA 2WSQA 4IP5A 1JF6A 3AIUA 1C92A 4EXBA 1KQYA 4ATLA 1K9EA 2NT1A 4F0HA 3P62A 3TSMA 4UFLA 1CXHA 4LALA 4EXAA 2Y63A 4PEKA 2E6AA 1SUXA 3PPCA 4ACZB 3W9ZA 9XIAA 1BXCA 4K6AA 1EUNA 5A6BD 1JPMA 1E40A 1XDLA 3VPLA 4UFKA 2F9RA 3LK6A 1LBMA 2WKJA 3F03K 3ABQA 3GDRA 5C71A 2YYUA 3L5AA 1RJQA 1TX0A 3EX4A 3ZQ9A 3O6AA 3UW6A 3F4WA 3DAQA 1BWVA 1TREA 1V79A 1E3XA 3R43A 2P0OA 1L6YA 3MUAA 4MAVA 5F7UA 3HO8A 1C9WA 2JGYA 3HG5A 2Y8KA 1W1B1 2WJZA 3T7VA 3PK7A 2VM8A 2PZNA 3FYOA 1OT1A 1GQKA 2H90A 3O3RA 2JF7A 3NDYA 4H41A 1UH3A 4RE4A 3VOCA 5C9XA 3V5FA 3WMLA 2ZICA 1Z48A 4XK2A 5F4WA 3N9RA 3E38A 2QIIA 2XH4A 4JKMA 1NWUA 3W07A 3M7SA 1JF5A 4HA1A 1TYGA 1EJRC 1ITCA 2Z25A 3M0KA 4H83A 5FJOA 1ENUA 3WYZA 2ISFA 3W7OA 1P1XA 3UY8A 4UTTA 3CWNA 3GBDA 1K7XA 3S9IA 1VB9A 2DFAA 3W2JA 4UWMA 3OBEA 3TA9A 1TX2A 5LIXX 3MCMA 1M7OA 2PP0A 4WDUA 4F2TA 4ES4A 4AX7A 4AF0A 2QUTA 2AQVA 4JCLA 2OPJA 1FQ0A 1A5SA 3PZ9A 2VT0A 4TX9A 3C2RA 1OC5A 1G4EA 4NI8A 2DORA 3GDTA 3KLKA 4GOAA 3BMVA 2PGWA 2C0AA 3G1XA 3RGTA 5C9ZA 1VHCA 2J25A 2I5QA 3P3BA 4L9YA 2VEFA 1JNEA 3APTA 3AO0A 4EOUA 4L56A 4Y9AA 5I2UA 4J1OA 2UZ9A 4JFTA 1YXYA 4A3HA 4XD6A 3LQGA 4ZB0A 3C0QA 2B7OA 3BW4A 3RAOA 4H1ZA 5CLTA 4W7VA 4UZSA 3EOLA 2X0YA 2FGBA 1F9CA 1TWSA 4GQ0A 5HMDA 3UY7A 3MCNA 4MFDA 3DOPA 4GKLA 3VA8A 1PSCA 4J3XA 3UGRA 5AYZA 3TONA 2NUWA 4G9PA 1UWQA 1E9LA 1X8FA 4FOJA 3EX1A 4HYVA 1EJXC 3NWRA 4AEOA 2A21A 4B5NA 1L9WA 5E0KA 3WLJA 4LGXA 2YL9A 4PMJA 2FVMA 2PBOA 3WFZA 3L5MA 3NL5A 3VMOA 5LNVA 4GINA 1W0MA 4MKVA 4HA4A 4KWWA 1JI1A 4XAZA 3KS6A 4IP7A 4S3GA 2FMOA 1XCXA 1SM9A 3KVJA 3P5YA 4FI4A 2GJLA 1DJNA 2VCCA 4M82A 3VKCA 3GTXA 4ZTYA 2X8RA 4W5UA 1XLAA 3IUIA 3ZFHA 1R0MA 2DW7A 4JTTA 2NWSA 3S1VA 1XDMA 3P6LA 1Y7VA 2V0TA 4GI9A 4FNRA 4RNHA 5DT7A 2Y24A 5D9OA 4AF0B 1KBKA 2PWHA 3EOOA 1BRLA 3UZWA 1R3WA 4CUCA 3R5EA 3O9NA 2WKGA 1UUOA 4HTYA 4J3UA 3TH6A 3SR7A 4P7NA 1GQJA 5LIUX 2A3AA 5DBTA 1TV2A 1Q4WA 2OT0A 2GUBA 4QG9A 5ABEA 1DP0A 1NWSA 2IMRA 3LPPA 4ADSA 3OLIA 4KIRA 4MSSA 4HOZA 3SDOA 2O7SA 5T26A 1S2TA 3NURA 5C7VA 4NAEA 3TC7A 3B9NA 4EP8C 1H3GA 3KVMA 5FJPA 3F4VA 5CC5A 3VIHA 1XG3A 2P5NA 4ZSTA 4NL1A 2YPIA 5ECVA 3B03A 2NZLA 1RQHA 4AHPA 1GVRA 2C91A 4HYRA 3ZSTA 4K8HA 1UKPA 4JTCA 1DPMA 5G4WA 1US0A 3W1XA 1L2QA 3W1LA 3S0CA 1F61A 4H9YA 2O7QA 3FAWA 5BXSA 1IIGA 4UXDA 4DXVA 4GX9A 1NP0A 5E6ZA 1HJSA 4MIMA 3R6IA 3L4VA 2ZZ2A 2ZA2A 1QO2A 1W31A 1TWIA 1ZS2A 2R1LA 3A3HA 3SN4A 1QASA 5CLWA 1LDCA 1QR7A 1E3ZA 1V0MA 2FQIA 3LCWA 3SRKA 5TAOA 9XIMA 1OD8A 4DXKA 2J8GA 2ZZ6A 3VINA 1HL8A 5FAGA 4PMOA 4RK8A 1VKFA 1AW1A 5LGXA 1WOAA 1GEHA 4CD8A 4TQTA 5G1MA 4HHLA 4XISA 4EAYA 3JW7A 3O7UA 4KBXA 3FJNA 3H2CA 1TCDA 3KM8A 3OZOA 3BG9A 1CB2A 3IIPA 4C6IA 3K8MA 2WNZA 2VGFA 3S83A 1FWGC 3TV8A 2NLIA 1E71M 3KL5A 1GEQA 2JEQA 1MNSA 2A4AA 1Q7QA 3WJZA 1EDTA 3UD6A 1UOKA 3OIHA 2G37A 2W4XA 4TMCA 1G4PA 3U2CA 3PB2A 1J6PA 4B5VA 5CPNA 1R9XA 2ICSA 1F76A 4CCEA 2GOKA 3FGCB 3VGDA 3PZUA 2WSPA 1NH6A 2Y85A 3M16A 3CV7A 3EWWA 1R5YA 3EX6A 4DJEC 1XRFA 3DFNA 4J3VA 3SGZA 3VGFA 3WKZA 3PBWA 3W1AA 4R5EA 4LXFA 3AICA 1SSDA 5HWNA 3ZMRA 3ONBA 1KD0A 5BMWA 1OFPA 3PM6A 3QPEA 1IZJA 4PTWA 3BCJA 3AHZA 1MXSA 3D6NA 1CGTA 1ISZA 3SFKA 3AMKA 1QATA 1UW9A 2YCKX 2QPSA 2ZVIA 1JCNA 3VM5A 3GX9A 3M47A 1A5OC 1E9ZB 3M6YA 1UD8A 3L65A 3ATZA 3DG3A 2Z1WA 1GPWA 1GHSA 4NAFB 3WBXA 1XHGA 2Y1HA 4DO4A 1EYWA 2VR5A 3GDLA 3L9CA 1FH7A 2B4GA 2D0GA 3SW6A 1PBGA 2YXXA 2EPOA 3KBSA 1TV4A 1MUWA 1TZ7A 4GVHA 4HOWA 3VOGA 1XIIA 4RV3A 3VFLA 4HPHA 1M1BA 2VYOA 3I65A 3DYOA 3KHJA 5DCDA 3E1F1 3UCCA 4IIGA 3NYZA 3N4EA 3WF1A 4RNIA 1AJ0A 1U5VA 4F0KA 1VAHA 3I3BA 1AJ2A 1UC4A 1V8EA 3QPYA 5HANA 1XRSA 2FZBA 3TWBA 5GJMA 3VIOA 5LA0A 4IPPA 3FN9A 3L7RA 2Z2AA 2KAUC 1IEWA 2ZUSA 1Y5WA 3PS7A 4O1DA 4JZ5A 3V7PA 2GSJA 2WWDA 4DUXA 5LGZA 3S46A 3ATYA 4YCPA 3DERA 1J2BA 2WO5A 3WQOA 3T1GA 2J8TA 3LX9A 3USZA 2VGGA 4PZVA 1SJBA 3OHIA 2GGGA 5GJNA 4ROQA 3C2OA 3K1GA 1WE5A 2QAPA 2X09A 2DH2A 3HQOA 4G2DA 4CQCA 2C13A 1L8PA 2BV9A 3LXAA 1WKDA 1FCBA 1JZ4A 3ZO9A 4UQCA 4MB4A 3G6MA 4S3DA 1XG4A 3FJ6A 1GT8A 2RDWA 1E6ZA 1E56A 3NA8A 2XPKA 3WFAA 4LBUA 1X38A 1NDZA 4LWWA 2POZA 3B8IA 3W73A 2VUYA 2QMKA 4NXSA 3TLLA 2RAGA 2XIIA 4S39A 1P6WA 4H9ZA 2OOFA 1ECEA 1NDYA 2XZ9A 4C6BA 1YDNA 1SJDA 2FMNA 2YDRA 1BG4A 2Y7EA 4Q33A 1UMLA 5DQPA 1XQLA 3A4AA 2ATSA 1AD4A 3GR4A 4KEVA 2YLAA 3AC0A 4NAEB 3CPRA 2Q71A 3SI9A 2NQJA 3MHGA 3T0BA 5RUBA 1TPH1 3M5XA 3U7VA 1NFBA 2VX6A 5HJXA 4DBWA 2W62A 3PFMA 1E6RA 1EFZA 4AQLA 2RDUA 1RA5A 1POJA 1YNPA 2WC3A 1TJPA 2YJQA 1I75A 1KXHA 5HNNA 1HKVA 1JDAA 4CN1A 3TJ4A 2OYMA 3ANYA 4AY8A 1PHWA 2PDLA 3SUUA 3TTYA 3NM3A 3SRDA 5IBXC 4NQ1A 4WZHA 4GZ7A 1U5HA 2OSXA 2HVMA 3MZ2A 3W7MA 4U5KA 5G2HA 1N2VA 4HNLA 4CQBA 1GW9A 3VOIA 1TSIA 1ZJHA 1Q6CA 4PRWA 2YCEA 4QP0A 4A3YA 2JEPA 5C55A 3O6DA 3MTWA 2C15A 4JS3A 1C7TA 4PTMA 3S2MA 1RUSA 1OG6A 3E2RA 4O0ZA 1HN1A 3FEMA 1YADA 5DELA 2Z1BA 3VD7A 3W6YA 1XD0A 1OCJA 2XH0A 1Q7ZA 3R79A 2FB2A 3B3DA 2ZTJA 3ARSA 3T42A 3A64A 4ERAA 4B4HA 2QULA 2J66A 2P3ZA 2PDXA 3LHWA 1WUEA 3HQ1A 1VRDA 4HNTA 4Q7NA 4GUHA 2ONEA 2GUUA 1IHIA 4UTWC 1JUKA 4UTLA 3ZT5A 3OZPA 3PB0A 4R7JA 2CBJA 3WJWA 3CWHA 2Z0IA 2FZ8A 2VI0A 3RN6A 4GUJA 3M64A 4LUSB 4RV8A 2DIJA 5MF5A 5IDIA 5DCEA 1UJPA 1CZ1A 4S3BA 4LYRA 2QCEA 2J9YA 1UH2A 4JIPA 1EEPA 4E8CA 4E4PA 3PJWA 4IQDA 3FXGA 1RK6A 5I07A 1JR1A 2ZZ1A 5MKGB 2VZTA 3RXZA 3EA1A 4WVXA 2J7GA 1Z7AA 1HQTA 3F5LA 4ILSA 1R2SA 3T2QA 5K4XA 5D33A 4QSFA 1UZDA 3UG3A 2YBUA 3WD0A 2JE8A 4UFMA 2DT0A 2D24A 2XSXA 3STFA 2O9TA 4UTTC 1YX1A 1R3YA 1E0WA 1UQZA 3LI0A 5EMKA 3MSYA 4JTKA 2ISWA 3RLHA 3CHCA 1TJRA 2BHZA 4GNKB 3UVIA 1PYMA 1TG7A 4E8DA 3EKZA 4DJFA 2V8ZA 2YB1A 3W7RA 2QF7A 1FP9A 2BXZA 3COTA 2X2YA 3BE7A 4N42A 4K38A 4O1FA 1B31A 1B57A 1N8WA 3LNMA 4IMAA 4PUKA 4BQ2A 1DTUA 1LQ0A 3NZPA 5I3KA 3P5ZA 4INFA 3VKBA 1LWIA 2QCMA 5DFAA 1LBFA 4UNLA 1VCFA 2I5IA 4YS1A 1B3XA 2C1GA 1D7KA 5GNXA 2BASA 3AHXA 1H7WA 2WPBA 2FJUB 3W7CA 2VEPA 4GC3A 3LDVA 3WLLA 3OB8A 2PC8A 3F2CA 1O5RA 1DJHA 2OZ3A 2VFIA 5F1UA 3SCRA 3MHUA 4RZ5A 4QEHA 3OA5A 4K7VA 3KZPA 1Z3NA 3H70A 4A3QA 4L4PA 4GUFA 4F66A 3C52A 1XLJA 4KWSA 2H6RA 1D3HA 1T8XA 3GU9A 2H8ZA 2VOTA 1I4NA 1YPIA 4XVEA 1WYIA 2PBGA 3S5ZA 4C60A 1BFNA 3ZLFA 3C4UA 1RY8A 3VIPA 4R3UA 1XCWA 2BB0A 1GTEA 1IF2A 3LTYA 1QOQA 5U4NA 1R30A 3B8TA 4YTTA 4FX7A 1ZAJA 5AVHA 2P8CA 3TCEA 1KFJA 1S2VA 3QC0A 1E9YB 4F0SA 3UYCA 1OSEA 1JRCA 2CFFA 3B0XA 3DDMA 3M0IA 1ADOA 3M43A 5REQB 3RG6A 5PTDA 2REQA 1VFLA 5HATA 3WDJA 4Y2WA 2J7HA 1TE6A 2E9BA 4DYJA 3ZOAA 1MWOA 1MQRA 3ZJKA 3R8HA 2GK1B 2XGBA 1XGEA 1KCKA 4FR6A 4OUEA 4XAPA 3PJTA 2DP3A 5A6BA 1H11A 2ZZ7A 5CG0A 1W1IE 1BAGA 1M53A 4JFVA 3W1TA 3SAZA 1R2TA 2V69A 3TSBA 3VZXA 3MB9A 1WP6A 1H4PA 3MV01 1MXGA 2CWNA 2YA0A 1ISYA 3L21A 4LCQA 1QOPA 3PWGA 2WANA 2CHNA 3XINA 3CAVA 4AYGA 3THDA 4LV4A 4F40A 3MA8A 1B3OA 5A5WA 2FJKA 3ID7A 4ZO9A 3WBWA 3SN1A 3N12A 1WKFA 2WV8A 5D9PA 1EO7A 2WVSA 5H8UA 4LTSA 4FIQA 1RY0A 1KBJA 4HNCA 4AZHA 2W66A 2ALRA 3GLCA 3W86A 3LRMA 4OIFA 3BTNA 4O18A 4AU0A 1XQKA 4QEEA 4C6OA 4YYCA 4KEZA 5FKYA 4IPNB 1EJVC 2HRWA 4MNMA 4KQNA 4KESA 2X1UA 2I5GA 4PCSA 1QI3A 4C7GA 4V2XA 2E8ZA 3IUDA 4IPLA 3VGHA 1FKWA 5CC7A 3GTFA 4UMAA 4XAYA 3LB0A 1IXOA 3WX7A 3H12A 1DQUA 2BXYA 3KWXA 4HD5A 1G94A 3OPSA 4K3ZA 3V0SA 1M9HA 4DVOA 2CIPA 3LLDA 1J93A 3SUWA 5BRQA 1J96A 1VCGA 1VS1A 4WDXA 4XG1A 9CGTA 3PWAA 4V1YA 2WJDA 5AY7A 4KPLA 1HW6A 4C6JA 3GWQA 3S1XA 3ZXWA 4NVTA 3L68A 2A3HA 3WUGA 3NPVA 3QPZA 4V33A 4JAWA 1QK2A 2X30A 1HP4A 1KTNA 1JYNA 3O0FA 5HWMA 2PD5A 1QTWA 2Z7KA 1W32A 2O9RA 4A4AA 4D1JA 3WZ0E 1KRAC 5D02A 1OX6A 3TYZA 3AMDA 4BA0A 2PSNA 4L9ZA 1E5JA 2Y88A 2NT0A 2Q8ZA 2XWDA 1QI5A 3W7HA 3NIYA 2C7FA 4XTIA 5IBXA 3U7BA 4EF9A 4K37A 1XYZA 1PO9A 1HUVA 2GQ3A 3HPZA 2FGZA 1S39A 1SZGA 5IFTA 2HXTA 3BMWA 1MRAA 3PNUA 3W6LA 3CV6A 5E93A 3WDQA 4OOZA 4ZQPA 4US6A 3Q4DA 2NQZA 2WM1A 1DQWA 4KFPA 1K9TA 3URNA 1UWSA 3AXXA 1JZ5A 3A9BA 2CLOA 3W1NA 3AHTA 4B2DA 2PTXA 4ROPA 3CUIA 1JNDA 1JCXA 1TRIA 1UC5A 1LZOA 3D46A 1CTNA 1UUQA 1W3JA 2XVNA 5HMSA 4H6RA 1XLCA 3VDHA 1YPFA 4PMUA 4O11A 3M5ZA 1VFUA 3DFHA 3TZNA 1DIEA 1MZHA 1ZCOA 1PEZA 1X98A 4C1NA 3DZ1A 1U5JA 3BPWA 3KOFA 2RJGA 4GFSA 3EPMA 3M44A 4I90A 3WEZA 4ZB2A 5D32A 4PUMA 1GGOA 1AJZA 1VLWA 2ZUVA 4FMVA 1KB3A 2WMFA 2WNNA 1DOSA 1DQXA 4YHGA 1UA7A 2YX0A 1FP8A 1HZYA 2Y7GA 2Z2BA 4Q4MA 4HHHA 4GGBA 4GIEA 1MUCA 3E2QA 3LZ5A 5KZ6A 2H8XA 2HV5A 2Y7FA 1GYNA 4IL0A 2X7WA 3NR0A 1W8GA 3CMFA 1LLWA 5GNYA 3W81A 1G01A 2KZHA 4TIMA 4A8LA 2BY0A 2D3NA 1VFHA 3NUKA 3VKDA 3K5XA 1LYXA 2NLYA 4GE8A 4QCFA 5H2ZA 1O94A 2X1TA 4IGNA 1FWHC 3LGDA 3LD5A 3ECQA 4XIMA 5T8GA 3QRHA 4C6NA 1HVXA 1UH4A 1W9VA 2GGIA 2RUSA 2Z4GA 4EPKA 1IYXA 4DNMA 4ZO6A 4GUIA 4KRTA 2ZWYA 4JHMA 5FEWA 1QU4A 4IMFA 2I9UA 1CXFA 1V4YA 1K03A 3PZOA 3C8NA 1P4CA 4EE9A 4ERIA 1MSSA 1TZ9A 2WMGA 2VD8A 4XO7A 1GW1A 3GZAA 3W7JA 5CPMA 3TC3A 3ARQA 4YHEA 1J8VA 2GJXA 3UWEA 3RX2A 3G24A 2VP8A 3VAVA 2ZXQA 3AUOA 3J7HA 5I3IA 3LCXA 2ASHA 3SECA 3A24A 2DZWA 4GXPA 4LVFA 5IHRA 4YCOA 3FA4A 4KGLA 2E25A 4KETA 1ADDA 2DT1A 3A22A 4TTUA 1M6JA 1ZFJA 4H6EA 1HJXA 3NSNA 1OFRA 3VKKA 4MYAA 2QEZA 2AQWA 4RUBA 4XD5A 1FRBA 3R4IA 3W7NA 2OWXA 3SQMA 4Y8FA 5JBFA 2QUUA 1WDPA 5A2CA 2CLPA 3RCMA 3PHAA 1TIWA 3UZ5A 1S38A 3INPA 3RLVA 1RQBA 2JIWA 3QHOA 3GDKA 4Z2IA 1QBAA 1SFSA 1TR9A 2IS7A 3V1PA 2I57A 3EDEA 4O17A 4UIOA 4JIHA 1CGXA 2CBUA 5KMYA 4W88A 1IR2A 3LBMA 3VIJA 2VQTA 4WQ6A 4B5UA 4UOJA 1UR0A 1KBIA 3UZJA 4GJ1A 4LAZA 2SFPA 4G1NA 4JX5A 1P43A 1AFSA 1O1ZA 3HQNA 1ZTVA 4LS0A 4RLIA 1EA0A 2G97A 3L66A 4QCEA 4NASA 3TDFA 5C8BB 4I3GA 1MDRA 4J2MA 3RJYA 3VFCA 1VBJA 2EG7A 3I10A 4QG8A 4H8HA 4ICNA 2CLHA 1PTAA 3EWCA 1YW1A 4XD3A 3CQHA 1IWBA 3NG3A 2F2KA 2H3DA 2BGSA 3AS3A 2GWNA 2QCHA 5HAOA 3PZVA 3WN6A 1KV5A 4JL1A 2VR2A 4J4KA 3GG0A 4YMZA 4N4QA 1R7AA 2X2GA 5I0DA 1R3SA 1Q8JA 4L7ZA 3GNXA 4DLMA 3UWUA 2X41A 5DX7A 1O5XA 2PLMA 4DYEA 5B7ZA 4GX8A 4LBSA 3VK5A 4AX6A 2PWEA 3PG9A 4IMGA 2YDQA 3KL0A 4J3WA 5JIWA 4D72A 3GNDA 1FCQA 4IMDA 3BANA 4Q7IA 4ALDA 2VVNA 1R38A 3PY2A 3ARTA 1B3ZA 5KTLA 1BSIA 4J7RA 4Q7BA 3NYDA 2YBTA 3BOXA 1Q2SA 3DFPA 8XIAA 3ZT7A 4GNJA 1RCOB 1EUAA 3TJIA 1B4EA 1TWDA 1PZ2A 3ARPA 3GXPA 4PC8A 3W88A 3P0XA 3GE7A 2E67A 2ZXDA 3PC0A 4W4QA 4FPSA 2VCBA 1EQPA 4WCJA 4CNUA 4Y9PA 3THCA 1CWYA 1I1XA 5DLCA 4C6CA 4AD4A 2CLKA 2O9OA 3ES8A 1BEUA 2HTMA 4IFKB 1K4HA 3CTLA 1A4MA 2DY3A 4AVFA 1TV8A 3T2OA 3T81A 4GGHA 2ALDA 4B3ZA 3MSGA 3EB3A 3FK4A 4R88A 3RYSA 4GBUA 3HTWA 4ONVA 1FWCC 1J18A 5C2CA 1LL6A 3MVTA 1PB0A 4NHVA 3GUGA 4K1WA 1E0VA 3V75A 1EIXA 3DGBA 1J4EA 1KTBA 1DJYA 3YPIA 1XC6A 2XZ7A 3PUDA 1J11A 1H5YA 3NEHA 1Z32X 1WZAA 4PULA 3TMQA 2GVEA 1GORA 2YSWA 4D8ZA 4E4UA 3CZEA 1DTNA 4LAUA 1EC9A 1JVNA 4CVUA 3AIWA 2DSZA 1KBLA 2W61A 1ITUA 5ABFB 4L4LA 2XM2A 1BYBA 1XINA 5JIPA 1OFBA 1W1PA 3W27A 2WZHA 1QXLA 1AD1A 3S5NA 4D6FA 4P8WA 4C6PA 1D8CA 4F0RA 2ZX7A 2DZSA 2W0UA 3FOKA 2QF8A 4JTLA 3ARZA 1F6PA 4ACZA 5BWFA 1X6LA 3KCJA 1JPDX 2CW6A 1V77A 4DF0A 3WBYA 2D0HA 1BVZA 1M01A 3VGEA 3HG4A 3E5BA 4Q8PA 1E0TA 3R58A 4KEMA 4G7FA 1OGBA 3DG7A 4Z1AA 2FHCA 4EPBC 1EOMA 4E3VA 3OLEA 3W53A 4BJHA 3W1PA 3LTSA 2EG6A 3SY1A 3PFRA 3SSJA 3PTMA 3VD4A 2PDHA 4QLKA 1GOMA 4CD6A 2A3CA 4FNSA 4O1EA 4Z08A 2G3MA 2VFFA 4ORMA 3LRKA 3RLGA 1ALDA 3HIJA 3NQEA 4RKAA 3GNRA 2ACQA 3CO4A 2OELA 1LG2A 3W29A 2VEIA 3LQLA 4EPDC 2D0FA 3AXHA 4RW3A 1VCVA 4IJBA 2NXIA 1BXBA 1SO6A 3CPUA 3QOKA 3ZZ1A 5JQ9A 1E1CB 1BSLA 1WV2A 3EKLA 3ZIZA 4UQAA 4U3CA 2Y0FA 5I3FA 1TA3A 4FXFA 2QAFA 2GDVA 6A3HA 2VDGA 1E5NA