3VOIA

Cccel6a catalytic domain complexed with p-nitrophenyl beta-d-cellotrioside
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
360
structure length
360
Chain Sequence
STGNPFEGYDIYLSPYYAEEVEAAAAMIDDPVLKAKALKVKEIPTFIWFDVVRKTPDLGRYLADATAIQQRTGRKQLVQIVVYDLPDRDCAAAASNGEFSLADGGMEKYKDYVDRLASEIRKYPDVRIVAVIEPDSLANMVTNMNVAKCRGAEAAYKEGVIYALRQLSALGVYSYVDAGHAGWLGWNANLAPSARLFAQIYKDAGRSAFIRGLATNVSNYNALSATTRDPVTQGNDNYDELRFINALAPLLRNEGWDAKFIVDQGRSGVQNIRQEWGNWCNVYGAGFGMRPTLNTPSSAIDAIVWIKPGGEADGTSDTSAPRYDTHCGKSDSHKPAPEAGTWFQEYFVNLVKNANPPLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cellobiohydrolase
publication title Comparison of the structural changes in two cellobiohydrolases, CcCel6A and CcCel6C, from Coprinopsis cinerea - a tweezer-like motion in the structure of CcCel6C
pubmed doi rcsb
source organism Coprinopsis cinerea
total genus 138
structure length 360
sequence length 360
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 3voiA00
2BVWA 2BOGX 1OCJA 1UP0A 3VOIA 4AU0A 3A9BA 1HGYA 4B4HA 2BODX 1GZ1A 2BOFX 4AVOA 3RU8X 4AX6A 1BVWA 4A05A 4B4FA 1OC5A 1OC6A 3VOJA 3VOFA 1DYSA 3A64A 1OCNA 1QK2A 1OCBA 1CB2A 4AX7A 4AVNA 1HGWA 1TMLA 1UP2A 1UP3A 3RPTA 1OC7A 1QJWA 1UOZA 1QK0A 4I5UA 3ABXA 3VOGA 2BOEX 4I5RA 3VOHA
chains in the Genus database with same CATH superfamily
3P7YA 3TOYA 3SCUA 2PWGA 4U5KA 3WLOA 3S6OA 4NIRA 5HBFA 2EO7A 3K30A 3F5LA 3BQ6A 2CLMA 2Y7DA 4BKNA 3C0LA 3MYPA 2R1MA 3TTOA 3KL3A 1IXQA 4ZA0A 3EWBX 3NQAA 2WC3A 3QV9A 3VOHA 1HO1A 3BOLA 3S2LA 3PZOA 2EG6A 4IUOA 2ALRA 2QCDB 4YVXA 2R14A 4P2VA 2WMGA 3MCOA 2AL1A 3WL0A 1BVNP 3TP4A 5A6BA 4FX6M 1JYXA 2BVYA 3VKBA 3P8IA 4ILSA 5G2WA 1IXPA 5D02A 2W62A 3QY8A 2HVNA 2BG5A 5EA9A 3NVTA 1J4EA 4B4HA 5BZAA 1KB3A 3BMVA 1E9IA 5AFDA 1TPDA 3A4AA 5IDZA 3T2QA 2J9YA 1ZZMA 4WSJA 3W7NA 1A5AA 1UKQA 1F8IA 3URAA 2J4GA 2QCGA 4GUJA 2QIWA 5EFDA 1HKKA 4XIAA 3BG9A 1TJRA 3B9EA 3W85A 4NJIA 3TAKA 4NI8A 2G3MA 4FIQA 5CPQA 3URQA 4YTSA 3S2CA 4ZODA 3NL2A 4E8DA 4F48A 4LSBA 3P14A 4ZSTA 1E5NA 3EWWA 4MAZA 4QQUA 1R3VA 3UJ2A 1OT2A 1YQ2A 3UZXA 3S1XA 3MVIA 4JL1A 3RU8X 4HCDA 2VQTA 3RNDA 3N34A 5HK4A 1FWWA 1MDLA 2PDPA 2RHGA 3AJ7A 3NFUA 2OOGA 4M1BA 3TYZA 4YPJA 3NO3A 4NF7A 3N15A 1QFEA 5A8GA 3T6CA 4N0RA 2Y5JA 2X09A 2Y6ZA 4WHBA 4CUCA 4PBEA 4PL2A 5EMMA 3VVGA 2AGTA 4AD4A 4TX6A 3GXMA 3S5YA 2R1NA 4ZB5A 3TX9A 2PEVA 1JPMA 4E8GA 3T05A 4JD4A 2GDVA 4KH2A 4E4PA 1S2CA 4LAZA 1ITCA 3UPBA 3PY2A 4D6DA 2HK1A 3KZPA 3BJSA 3SY1A 4ZTYA 1DHKA 3M0MA 2Z2BA 3H2MA 4MZYA 4GBUA 1QXLA 2QF8A 3BZJA 2B7QA 2W61A 3FJ6A 4FS9A 4ALDA 1O5KA 3VC6A 4XZWA 4AXNA 1HGYA 4GC4A 2X7WA 3V7PA 4E38A 4RE3A 4LYQA 3G2GA 1QK2A 1Y0EA 1EQPA 1VAHA 2J6VA 4CCEA 1DIOA 3WJXA 1XLMA 4UTTA 2A3CA 2I57A 3EB2A 2YA1A 3M0IA 3W7LA 1G4PA 4UFJA 4FNTA 4HQVA 4IG2B 1UQYA 1R7AA 4X0VA 2NQHA 3LBCA 4YWSA 1F3WA 4DJFA 2ZE3A 3TXVA 4U28A 3EKLA 2XIIA 1IGSA 3HMCA 3DFNA 3CGTA 3CQ0A 3U0HA 2XIJA 3EDJA 1UP0A 2ZUMA 1KM2A 3VOCA 4GLEA 1XJBA 4DUOA 2B4GA 4I90A 4LS2A 4S3EA 2ZOXA 2OEMA 2J75A 3IGSA 3T42A 5IBXA 4MM1A 3KRZA 3VIMA 3VAVA 2G97A 2GJRA 1WKEA 3LOTA 2CLFA 4S1FA 3N6JA 5JH2A 4J3XA 3MHGA 4GFIA 4J3SA 4ZEPA 4US5A 4HMCA 3TUUA 1K7FA 4YIWA 3EA3A 4KF1A 1RK6A 1OINA 1HG3A 5BW6A 5EYWA 3WLSA 3T07A 4M19A 4H1ZA 3UNDA 3NOEA 3BAIA 2XFRA 4AD5A 1OF6A 5EBUA 3SQLA 5AYYA 3LSCA 3QZAA 1YIXA 3OBEA 1PYFA 3C2OA 1XHGA 1YBQA 2PRHA 1I2OA 1YDYA 3B8UA 5HDRA 4PRRA 3QMTA 2ZC1A 2TSYA 1ZALA 3HV9A 5LNSA 4RZBA 3PZUA 1C9DA 3MDUA 2FGZA 4J3VA 3ABOA 1Z41A 3KTSA 3VNKA 1EL3A 3H4XA 1JCNA 3VOIA 1R38A 4TXEA 2YXGA 3MT1A 3SW6A 1A4LA 1FH7A 2X30A 1DWFM 3QVQA 1E4NA 1VFTA 4EPKA 1HP4A 4I9JA 3I3EA 2H90A 4MAVA 5A8QA 1R0MA 3M0VA 5FEWA 1H63A 2ISSA 2RJHA 1WCGA 3CQKA 2OX1A 4Y9MA 3TKFA 3WLJA 1LTDA 3OVQA 4IXHA 3USBA 2F61A 1FX6A 2AQVA 1ZAHA 1HXJA 3GB6A 1SVDA 3ARUA 1V3JA 3LXCA 4A3QA 1WBJA 3MMWA 6XIAA 5DX7A 5CC5A 3N6HA 1YXYA 3W7EA 1N8FA 4GQQA 1T99A 2ZX5A 4M81A 4DZAA 4DZHA 3B9AA 1DQUA 4YNGA 2X0YA 4GOAA 1GJUA 4FXSA 3VNDA 4NASA 3WO8A 2I9EA 2FHCA 4HTYA 5AOUA 2UBPC 1XH1A 4XZNX 3U4FA 3NVDA 4I9MA 4RNFA 4ZQPA 3I7SA 5GJPA 2POZA 1XD1A 1EQCA 3IAQA 1JF5A 4B3ZA 3SFKA 5M5DA 1VS1A 2EPMX 4QLLA 3HU7A 1M41A 3F4VA 1KXQA 2FVKA 2BHUA 1UCWA 3LLXA 4FZIA 4H6RA 3PG9A 1K6AA 2XTKA 5EMKA 1XCFA 3TW7A 1C9WA 2PDXA 4HSOA 1J0KA 1PSCA 3C0SA 2FIQA 3OA3A 3B8DA 1DJNA 1VBRA 1V6UA 1Q7QA 1H0GA 2CCRA 4HZMA 2ZE0A 1XYMA 3UXLA 1XSIA 3UCCA 3WH5A 5GNZA 4QG8A 1A3WA 3GG0A 3A4WA 4JXCA 5FF7A 3LZ5A 2VC7A 3MA8A 4DM2A 2Y4SA 1AFSA 1EIXA 3PFRA 5CXPA 5D9NA 4EXBA 3SY8A 3CJPA 3CBWA 1I1XA 3INPA 1US2A 5LA2A 1K8ZA 3PF3A 4UMCA 2WBGA 2YCJA 2V63A 2PFHA 3PZQA 1JYNA 4LCQA 3ZM8A 4AVNA 2HK0A 4I7WA 1QWKA 2LLEA 3BV7A 3JVAA 1KQYA 3UYCA 2BXZA 1M03A 2OQHA 1I0BA 2YLAA 2VOTA 4IJCA 1JDAA 1QTWA 3BURA 4QS6A 1IT8A 3E2RA 3NO1A 4NNCA 3QGAC 2PP3A 2J66A 4QJ5B 4N9CA 1F3XA 4XUYA 5IHRA 2FZNA 1EJRC 4TX9A 2VD8A 1JDEA 5C7VA 3QTPA 3SUWA 3MVTA 1AW1A 1LCOA 1NDYA 3VNZA 2RAGA 3B06A 1TKKA 4Z0JA 3B9DA 4AISA 2XIQA 2Y5EA 3CIXA 3CV6A 4M80A 2HISA 3OGRA 2J25A 1UC5A 1CIUA 2GLKA 3QQ0A 2WCAA 2V8ZA 1F61A 1RBAA 4A8RA 1QI5A 3SCRA 3VNYA 2QDEA 4MB3A 1XYBA 4YCOA 3AYRA 4RE0A 3L21A 3FXGA 3COTA 2F38A 3GIPA 3HJEA 4PH6A 1TCMA 4PL1A 3KBJA 2J9ZA 1WDSA 4L7ZA 1SO5A 4JKKA 4FP1A 1JZ8A 4XO6A 3W83A 1ZL1A 2OWXA 2ZXQA 3OZOA 1A5LC 5C5YA 2WMFA 1V77A 3PC0A 2GUUA 3GDRA 2Z2UA 1PIIA 2JGYA 4BY3A 2Y85A 1WP6A 2V68A 1GOQA 3STCA 3URBA 5D2TA 2ONEA 4XZIA 4UQAA 3QZ6A 2DGAA 1AH3A 4KCUA 5A6AA 4BI6A 1E72M 4GD0A 4OWGA 4TX8A 4C6OA 2PBOA 3LB0A 3ECQA 5CZ0A 3QV7A 4DPPA 3WQPA 1GT8A 1FWAC 2VZUA 4WKAA 3WNKA 5C9XA 1S5WA 2PMQA 5I03A 3E0WA 3S5ZA 4DI8A 3EPOA 2YBVA 1GWJA 1VBGA 5H1WA 2BVWA 3ZT6A 4PTWA 4QSHA 4JHZA 4LT9A 2EGZA 1AVAA 1MWOA 4O54A 2IQDA 5JQ9A 1LQAA 3VC5A 2C19A 5A3HA 4QNWA 2G0WA 2QLYA 4KMQA 3UNTA 2DQWA 3N2MA 4ACZB 2XSAA 5GNXA 4UFHA 3SSJA 2WSYA 1I8JA 4WK9A 1YMYA 1XC6A 3LCWA 4CEXC 4Q8PA 3GH4A 5EPDA 3K4WA 3TV8A 4ZO9A 3LM3A 4OT7A 1EDTA 4O16A 3EOOA 4PMVA 4P7OA 1S38A 3PZ9A 4W9TA 4JPGA 2XN2A 1TREA 4JTKA 4FNUA 3L2LA 2A4AA 1V02E 3TC6A 4UQBA 4PC8A 1KFCA 5A2CA 5ABEA 3S5SA 4IGSA 3PBGA 3DFHA 5IOBA 1UWTA 4HZ6A 2X2GA 1KCZA 3PNUA 2OZ0A 3G6LA 3TU9A 3MCNA 4LB4A 3LXBA 2HNHA 3AYTA 1Q6QA 3W00A 4J40A 1VB9A 1KFKA 3A24A 2R1PA 4GH1A 5FJIA 2QZRA 3C4UA 3RM8A 3RX4A 2WMHA 3CIVA 3FY1A 1DWAM 5T9BG 2ZX7A 4P7QA 1MQRA 1AJZA 4F9DA 2GJNA 3UF9A 1LLZA 1R86A 4XG1A 2XN0A 3DKJA 4J3UA 2ZZ3A 4JTDA 1RHCA 4MLRA 1W31A 2ZFAA 4H7VA 4CNPA 2NQJA 1U30A 5ABFB 4PUKA 2J7DA 4M6QA 2ZX9A 4TQTA 1XR2A 3QKZA 4GYFA 5C70A 2UV8G 2GSEA 1RA0A 1M5WA 3NWRA 1VJZA 3BAYA 4TVDA 5BRBA 3BO9A 3S83A 2E9BA 3H8AA 1I2RA 4IFRA 3IIPA 5HUPA 4OU1A 1W3NA 1LF1A 4ZMGA 2TODA 3M47A 4CNOA 4JNYA 1H49A 5EY5A 1CENA 1JCYA 2I5IA 3EDKA 3SDOA 3BQ5A 4Q6XA 2OTDA 1TUXA 3HGSA 3V0SA 1V5XA 3AMCA 4Q8MA 1PDZA 3RJYA 1A3XA 2D2OA 3SN1A 1ITUA 4WSHA 5TIMA 1ICSA 5D4YA 4M24A 2VEMA 3WLPA 2FDSA 3C3NA 1ADSA 1IXOA 4WCJA 4DUVA 3IV3A 3W38A 3QW4B 1WPCA 1H7PA 1J6PA 3URNA 3GE7A 4AX7A 3LZ3A 4JDYA 3LX9A 3IJIA 3SI9A 3LRKA 5JUVA 3TQ0A 4Y8FA 1OFQA 1W3TA 3IUDA 5ABHA 1S5TA 2ISDA 3IEBA 3RGTA 2V3FA 1EX1A 2QPXA 3VKAA 5JXQA 3LBOA 1XIEA 1N82A 4NAEA 3WY1A 3MSDA 4IGNA 3CEUA 4HU8A 3JRKA 4ORMA 3VABA 3R0KA 5EGRA 1L6SA 2YA0A 3Q2DA 3T1GA 4ZL1A 1E1EA 4U33A 1U5VA 4WKHA 4NXKA 1OFDA 4XAPA 6CGTA 2ICSA 3HJZA 1SJBA 2W9MA 3T4CA 4E3TA 1VRDA 3BJTA 3B8TA 2Q8XA 4AY1A 5E5CA 5PTDA 3UY7A 1JNDA 1W0MA 4JNZA 2OYLA 3VX0A 1OG6A 4W84A 4H19A 4C5YA 3CV1A 2OU4A 4LUTA 2Y62A 1TMLA 1L2QA 5HMDA 3U5UA 4NJHA 4YYCA 3I7QA 1ZJBA 2EBNA 5FI8A 3VCCA 1H5YA 3P62A 3M5XA 4GHRA 4HTBA 4RDYA 4O50A 4PUUA 4ZOCA 1AD1A 2BVTA 4GX9A 2WNQA 5AVHA 4LUSB 1F74A 2J7EA 1PHWA 3BGJA 1RPXA 2XWEA 5AHIA 1C3FA 4B90A 4HU4A 1JUBA 1NIUA 2Z1XA 3OG2A 2YCIX 1CXHA 1XXXA 3A4JA 1JGIA 1GQNA 4C1NA 2P0IA 3SUVA 2QJGA 5HUOA 3VM7A 5DT7A 2DIEA 4U2ZA 4AVFA 5GNYA 2FFIA 1Z9AA 2OZ3A 4PTVA 1HUVA 2O9TA 3KTXA 4QCFA 3F4DA 5A6TC 3W1MA 3BW4A 2HE8A 3C8FA 1FA2A 2PWHA 4PEEA 3HPAA 4DZIA 1WAUA 2G5WA 3UA4A 4DJED 1MVYA 4YTTA 4S3JA 1UA3A 4MADA 1LG1A 4RUBA 3OTRA 3RN6A 3C0JA 5CC6A 5C9RA 3P93A 3M41A 1Q8AA 5MKGB 1ZS2A 1PKLA 3UWZA 1MMFA 2DH3A 4OZOA 1KRCC 1W1B1 4WJ8A 3HMJG 3IANA 2Q6ZA 1BPLB 1LL7A 3G0SA 3LBMA 1NFPA 4Q7BA 2QJMA 1FKXA 1R9XA 3IGXA 4M7TA 4UFKA 4H6EA 3ZXWA 3EMZA 3WQEA 3HQPA 3I10A 3GRIA 4OBRA 4XBJA 3DZ1A 2J77A 1TTQA 2BY3A 1T96A 4XZLX 4LPCA 3DYMA 3AS1A 3OO2A 1L2UA 3WNOA 3C2YA 3FXYA 1KFEA 3AAMA 1XRVA 3HO8A 4HNUA 1Z3NA 1GHRA 1EP3A 3T08A 1ZNNA 2C6QA 3BW3A 2XZ7A 2IKIA 3CZKA 3RMJA 1X8CA 1R85A 2F7FA 4C1LA 4E2BA 1X8FA 5C55A 3WD3A 1W1A1 1J96A 3EX6A 2INEA 5BU9A 1JR1A 3THDA 1XIBA 3CHEA 1JD7A 2BGQA 5E6ZA 2J74A 3M64A 1KFJA 4NL1A 4DO4A 3IIZA 1UIOA 3R2GA 2OFJA 1ISVA 1K7EA 2D0GA 4GO8A 2GWGA 3N17A 1M53A 1V0MA 3VFCA 2CZVA 3GHTA 4OBTA 2R1KA 4C6BA 3U3HA 4JEQA 4GQRA 4MNLA 1TSIA 4AMAA 1MZHA 3CTTA 3H2OA 1XQLA 5TAOA 3FIGA 3GD6A 3VD5A 4GUIA 2I9UA 1QDSA 1W2VA 1TYGA 2QT3A 1NOUA 4R88A 1ISXA 2A3HA 3O05A 4E4FA 1HKIA 5DCBA 8XIMA 2FVMA 3IV8A 3CZ8A 4MWAE 1MW3A 4A4AA 5I3JA 4QQ3A 3ABRA 3QY6A 5IFTA 1V3HA 2ALDA 5B80A 2QUVA 4PMJA 5C8BB 3ZZ1A 1X38A 1T6MA 3HPZA 4G7FA 3CH9A 2QCMA 4OHQA 4UNLA 2E8YA 1H1NA 3AHTA 3QC0A 3OVPA 3RLHA 3LHWA 1UMYA 5LNVA 3PZVA 2GGIA 4ZQNA 1SM9A 3UG4A 4ZQRA 1EP1A 4PUWA 1EGMA 4ASTA 3RX3A 2I5GA 4Q4OA 3TOPA 1BFNA 2C79A 4JTLA 1DWJM 2V82A 2NT0A 4NZ1A 4QM1A 1ZJIA 3CAWA 2TRSA 3CHCA 4BQ4A 3ZT7A 2DH2A 3TDFA 3P74A 2I16A 4GNJA 3FKKA 4QCEA 2RUSA 1W1PA 3WDRA 1P0DA 1KR1A 1SZEA 1YTEA 3DBPA 1CLVA 3MI6A 1FWIC 3PR2A 4RZ5A 5E70A 3PBVA 4P8UA 2QJNA 1UP2A 4H00A 4PZVA 4K1GA 3K2GA 1KR0A 2GQ3A 4QE1A 1PX8A 2REQB 3WH6A 2HS6A 3WUFA 3G1RA 2P8CA 2OSWA 3ZR5A 4GG9A 2QF7A 2V81A 3O7UA 4KPLA 4EX4A 4DF1A 1BXNA 3H2NA 2RDTA 3GXIA 3TIMA 1XPYA 5FJUA 4GXMA 4GABA 1JI1A 1JIBA 4N4PA 3QM3A 4AZ5A 1WUEA 5DMMA 3N11A 2HEJA 4O28A 1CYGA 3N19B 3O6YX 1R47A 5AHMA 1B4KA 1DJXA 2YCEA 1K8CA 3PUOA 5CPSA 3UZJA 3L4TA 1R6WA 1GVOA 3BOXA 6ENLA 3KUMA 3NZRA 2E09A 4XKYB 1KFWA 2PWFA 1OGBA 4HHPA 4CN4A 2ADAA 3PZGA 2X2YA 1C8VA 2ZQ0A 3WK2A 3MQTA 3ZJ7A 2WSQA 4ERGA 3C2EA 4J2PA 4V28A 1U83A 3V5FA 3BLPX 4RL3A 3G1VA 2KX9A 1UD6A 3DHPA 1VYPX 2YDQA 1F73A 3VDGA 4Q4QA 3SCQA 2V5JA 3P5YA 4JS3A 1AJ0A 1OX4B 3QV8A 4NAFB 1XI3A 2NLIA 4XSLA 2Z29A 4YVPA 3W7OA 4R9XA 4KFOA 1TPH1 5KZEA 2NQZA 3NPVA 1OWQA 4RZ4A 1EA0A 1Q6GA 2NXGA 4DXKA 2XU2A 4KCWA 3W2JA 1HKVA 2IUZA 4NRRA 1KRAC 2FZDA 2PURA 1YHTA 4MMWA 3BPWA 3TA9A 2PDUA 2PC8A 5CBJA 2JF6A 4WUIA 3JS3A 3QF0A 2VZVA 1MQPA 1W5QA 2QXWA 3BMXA 1FCBA 3PSVA 2V6AA 2R6OA 2BLEA 1A5MC 1E1CB 3MUZ1 4JY9A 4B5VA 4D1IA 4MHBA 3NAVA 2ANUA 4L4LA 1W37A 2WANA 3WD4A 3TLLA 4UNIA 1M1BA 3MPGA 3N29A 3FKRA 4S3KA 4LFYA 5A6JA 4DJDD 3ZYZA 4BWLC 4JYEA 3MV01 1NM9A 5DEZA 3U48A 1XLJA 4O12A 3WF2A 7XIMA 2F6XA 3THCA 2NW0A 3RLGA 4LS1A 3DYOA 3CHFA 3RYSA 3NURA 4N4QA 3QHOA 1MFUA 4KWUA 3VIIA 4YYFA 3QZEA 2VC5A 3VMNA 3OJGA 5REQB 4UTHA 4FNRA 5DY2A 2C91A 2D0HA 4K39A 3NSMA 3NDOA 4IPNB 2D23A 2EHHA 4GO9A 4OQVA 2WMIA 3DXIA 1Q65A 4LU0A 2CETA 4HMNA 2NWRA 2PTYA 3F5KA 4FEZA 4PMRA 4H04A 4E5TA 2FPVA 1XLAA 3ITVA 4DHGA 3M5ZA 2HBXA 5CCZA 1ZBCA 3A22A 2HMCA 2Z27A 3PANA 4A21A 4WSKA 4H2CA 2A3AA 2G96A 2CFFA 3O0FA 2PWUA 3UBPC 3L0KA 4KESA 4AZ6A 4AIUA 3VE9A 4DUXA 4AW7A 4G5DA 3FCPA 4JDBA 5F4XA 1X97A 1BG9A 1JYVA 1GOMA 3LCHA 1Q7MA 5HINA 3UETA 3SY5A 2FKPA 3LGGA 3QLDA 1CNVA 4AD3A 1XIIA 2QCDA 3O63A 3OLGA 3QRHA 3FA5A 4UZSA 2Y1HA 3WLTA 1AW2A 2NV2A 1X98A 1ZSXA 2QCHA 3TK7A 3O6CA 3EA1A 3KOZA 1E9LA 4B5XA 1THFD 3CK5A 3K46A 1DQWA 3GUWA 4I8DA 3TNOA 1I60A 4HK6A 1XLLA 3VIGA 3R12A 2PE4A 1GW9A 1CX9A 1FOBA 1TCDA 2VTFA 2QJJA 1O1HA 4DYJA 3SRFA 3TN3A 1GPWA 1RK5A 3BARA 3S2NA 1H7OA 4IMGA 4X9SA 1UD8A 1LT8A 4NNAA 3ZWTA 4AC1X 2C0HA 3BMWA 1SMAA 2YR1A 4ATLA 4CD4A 4DWSD 2HS8A 3TWBA 4EANA 2VQUA 4MG4A 4QEHA 4BF5A 4AD1A 2ZTJA 1PZ1A 2BY1A 3E2VA 1R87A 4UOZA 3UZ5A 2CZEA 1KM5A 1NARA 2O4MA 3HPSA 1KKRA 3N3MA 1EWEA 2XPKA 3WQFA 3V0UA 2A7PA 1W17A 1M3UA 3UR8A 1CGYA 3GW0A 4KEVA 2FJUB 2Z26A 3QGKC 2PDWA 3W7GA 3VD9A 1WKYA 3N2OA 3GDBA 3W73A 3PBUA 1YTDA 3ARXA 5CH9A 4AIOA 5C9UA 3S1UA 4QDWA 3N2CA 3VTRA 1HT6A 4FSAA 3WH9A 2FDMA 3HFYA 3NZ1A 2CXEA 3Q94A 4H9XA 3PPHA 1ZBWA 3IPWA 3MP4A 5MHBA 4L65A 2Q3OA 3FJNA 1ESWA 2OYKA 2WHMA 2JKAA 3U2CA 1OX6A 4PMXA 1GGOA 3MDWA 3SRDA 3L66A 2W79A 1TRIA 1REQB 1W3LA 3H53A 2J27A 1T0OA 1SFLA 5LGXA 4IMCA 1XKYA 3AWNA 2ZVRA 3QJAA 3BICA 3JUGA 4OKDA 4B5SA 4WOZA 1XDMA 2WOQA 3L4ZA 3W7HA 3K1GA 3MO4A 1Q6DA 2J62A 3NQFA 4F2UA 4ZTXA 1T7LA 1XUZA 2Y24A 3LRLA 2PA6A 5C9ZA 3ABSA 4KGJA 1BTMA 1LDCA 1RAKA 4Q32A 1OFOA 4GK8A 2E3ZA 1XM3A 4IG2A 4NG3A 4XD3A 9CGTA 3NJ3A 1FTXA 4XZBA 3K4DA 5FF2A 1DJZA 4FF7A 1EHAA 2V67A 4LUIA 4WXYA 4GGBA 1J11A 4G2DA 4JTEA 1P6WA 1KBKA 5JIPA 1K4GA 4LRTA 4RW3A 1UIPA 1XLIA 2W6RA 3N9RA 1QHPA 4UNKA 4JQAA 5IFPA 4GIEA 3DYPA 3HN3A 2OB3A 1P0KA 3TYCA 1J2WA 1IEIA 2BXVA 1FWDC 5E1QA 3XIMA 1FXQA 1YPFA 4Z2HA 3VZZA 1NH6A 4WY0F 3U7VA 4NP7A 3HZ3A 1PVNA 4O19A 2MUCA 1GVIA 3WDPP 4F0HA 2Z0IA 3NL5A 7ENLA 2EKCA 2D24A 3LNMA 5A1AA 1RA5A 4M6VA 4JAWA 2GJXB 3UT0A 1QHOA 1LUCB 4E2OA 4UQ9A 1PXGA 4YS1A 1TMHA 1X1ZA 3U57A 1RD6A 2ZZ1A 3FDKA 3LD5A 2XFYA 1TA3B 1HX0A 3ARRA 1HL2A 4MZ8A 4OOZA 4MWAD 1VGAA 4ADSA 4X60A 1GKPA 4REQB 1KWKA 1FHVA 4IP4A 1T8QA 4W8LA 2C7FA 3IAPA 3AYVA 3RF9A 2V2HA 2WZMA 1AW5A 4PN2A 3TLQA 3M4HA 2J8GA 2VGIA 1PPIA 1GOXA 5E9AA 1UUMA 1W5MA 1JCJA 1DJWA 1WNOA 2ZRXA 3AYSA 3IUIA 2V5BA 4J5NA 1UJPA 1XG4A 3GR8A 1YDNA 3JU2A 3CU2A 4BCEA 3V36A 1H61A 3ITLA 4XUGA 2W63A 1YW1A 1XLGA 1XIGA 4GVGA 4KETA 3SGGA 3TTYA 4Z1AA 3N2XA 3GU9A 1DJYA 1VENA 3GZ3A 4LAKA 3GR7A 2QUMA 4LV9A 4DY1A 4LTSA 5CPTA 1J9YA 1MQQA 3Q67A 1HIZA 4EPBC 4H6QA 2VX7A 4URIA 2B0MA 5A2BA 2PGRA 2GQAA 5B7YA 4FX8A 3B04A 3WD1A 1RR2A 3P8JA 3W02A 1OCBA 4MKVA 3OEXA 5A6BD 3VUPA 1TIMA 1VRXA 2ISFA 3AIUA 4UFLA 3BCDA 1UZ1A 4S3CA 2PSNA 1UPMB 1CXEA 2VURA 2AAAA 4FAMA 4OUEA 1FWBC 1ISWA 2JKEA 1OG0A 4LVAA 5LIXX 5HR6A 3OVGA 4XKMA 3RK8A 5D2XA 1Z48A 3VUSA 2PDKA 4GXPA 3TMLA 4P5UA 4NQ1A 4M6UA 1H1YA 3W7RA 1RUSA 3W1AA 3GVQA 5MF5A 1TJ1A 1JQXA 3PTMA 2EJAA 2PLKA 4GQ0A 4RDZA 5C9WA 3OBKA 1WXJA 1I2PA 4PTDA 3ARWA 5CLWA 1DJHA 1S1PA 2VVSA 4PMNA 4A2SA 2QMJA 3CYVA 3OLDA 1K4HA 2ZA3A 2VRJA 3A5FA 1GYNA 3NDYA 4F3HA 4NKCA 3UGVA 4J27A 3B4YA 4JTGA 1IQ8A 1UKTA 4HPXA 4EKJA 3W75A 2TPSA 4UTMA 1CLXA 3AIWA 2O7SA 1AQMA 3F4CA 2EF9A 1V0NA 2B81A 2VT0A 1R3SA 1S46A 2WVVB 2H8XA 3BG5A 1VFHA 4GH3A 1E1FA 1R3QA 1B9BA 2ZTKA 2ATMA 2XVPA 1A53A 1K9FA 4H01A 4MF4A 3QV6A 4XZMX 3VGFA 2OWWA 3PAJA 4DXVA 1RJPA 4Q8VA 1VEOA 4IIDA 4NYUA 5I02A 3AS0A 4WGHA 4HK5A 3OODA 2QUNA 4O1DA 2NVDA 2VRKA 3EX2A 1Q8JA 3Q37A 4Z17A 1XYFA 2OO6A 1X96A 3FAWA 3CM4A 1T5AA 3W72A 1H7RA 3CUHA 3EGJA 4L61A 3T2PA 3C6CA 4LBUA 1S2AA 3N2TA 2YL6A 3VDHA 3ERPA 4FB7A 4Z2GA 4XZ9A 1O5RA 2ABAA 3SRHA 1RCQA 1KNWA 2GJLA 1IE7C 3QPZA 3TTEA 1SFJA 4EVZA 4OTKA 1E9ZB 2XM1A 4GC3A 4E4UA 2E5DA 1LBFA 4JCLA 3IVSA 9XIMA 2YCLB 4HCLA 3R8HA 1V51A 4D6HA 1XX1A 3E96A 3R58A 3RR1A 2WAGA 5F4SA 1POKA 5C54A 5XIAA 1AZ2A 2ZUWA 1TQJA 3NQEA 4AHPA 4DWSB 3UPWA 3RM4A 4P7LA 1DBTA 1E0WA 3KLKA 4V2XA 1ICQA 2XWDA 4DJFD 3TN6A 3KBWA 1AUSL 2NSXA 2FTPA 2XG9A 1KLYA 3A6OA 3HGRA 2J47A 4C6PA 1G4EA 1SJCA 1FWRA 3MU7A 1E3ZA 4PUDA 4UTWA 1MNZA 1C7TA 1PZ0A 3MUY1 3SRKA 2OPJA 1UR9A 4XAZA 4R53A 4A22A 1X6NA 4PULA 1QUMA 3OZYA 1UWAA 3PHAA 5CJ5A 5GJNA 3KXQA 1DJIA 4LCSA 5FD0A 3S9IA 1H3GA 5HQMA 4CN6A 1FCUA 2IPGA 3G22A 4UFIA 1MEWA 3BAXA 4US5D 1W91A 4G1NA 3ARPA 1V6TA 2BX7A 3G8EA 4KWWA 3CAVA 4DVOA 1FCVA 4F8XA 1JULA 5HQLA 5HJYA 2QCLA 2E7FA 2VGFA 3WQDA 2CYGA 1SO6A 4AH7A 3UYIA 3F5JA 1AD4A 5CJMA 2NUXA 2EXOA 4A2RA 3MWAA 3HV8A 2ZZ7A 4L5ZA 4DIAA 4ACZA 2HCVA 4GMEA 3BK0A 2YSWA 2AQWA 2YFOA 4UOJA 1J01A 1XISA 1XYLA 1VD6A 1V8EA 3VZYA 2FZ8A 3IRDA 1GQKA 3R0DA 4CNNA 4PCNA 4NVTA 4OFCA 5FF0A 1PX4A 3Q58A 4H7CA 4F79A 2FH6A 4IP7A 2X41A 3SM0A 1VJSA 3OYXA 1KBLA 4N2YA 4PBFA 3XISA 2Y70A 3W27A 4RK8A 3B9NA 1BWKA 1KTCA 3M9YA 1K02A 4Y9PA 1YXDA 4W89A 1R3WA 3QW3A 3ITOA 3DU0A 5G4HC 3UU0A 4H3DA 1XS2A 4QEEA 3LI0A 4E0CA 1UWQA 3WMSA 4XB3A 1Q6OA 4Y2WA 5U7SA 2HBVA 3M6YA 2ZZ2A 1RVGA 3EDFA 4M56A 4PMUA 3BGAA 1JCXA 3NZGA 3UXDA 3I7RA 3EKGA 1N55A 1N7KA 4NRSA 1GTHA 1GNXA 4X2RA 3D47A 2BODX 2QDGA 3PZMA 1E4IA 1LOQA 4UBPC 5KINA 1O66A 4Q4PA 3KDOA 2PD9A 3M0JA 7CGTA 1MXGA 3RIKA 4C1KA 3WQWA 3MW7A 1TX2A 2WNNA 1V02A 4R7JA 1BQGA 4UMBA 1JDDA 3W6YA 1DL3A 1PDYA 4YTRA 4NHVA 4TV5A 3BOFA 2FGBA 3FYYA 1BYBA 3HURA 1OZMA 4US6A 2VXNA 1PHQA 2VNCA 3VKJA 3USZA 5C71A 3UZYA 2EPLX 4YVVA 4GVFA 3KVJA 4WY0A 3VE7A 5G1TA 3KVKA 4A8IA 3OP2A 4HN8A 1ZU8A 5DO8A 1BKSA 2ZRYA 3P5ZA 3ZO9A 3A9IA 1KXTA 5H2ZA 2D22A 3THAA 3B0YA 3A3WA 3DEQA 1H1ZA 3SGUA 3CYJA 1WV2A 4XO7A 3WLIA 4RW5A 4FALA 2OSYA 1NWTA 4JTFA 4DBUA 1TV8A 5FJOA 1XUUA 1SYTA 3CWHA 3W1QA 2EAWA 3N13A 2PCEA 3ZLFA 2XFFA 1HZYA 4CQ8A 1B54A 4H9UA 1E56A 2BMBA 3UFYA 2PDNA 3SADA 2XH7A 4GI4A 3MB9A 2YA2A 3W2NA 1JPDX 5BXTA 2YBUA 1H4PA 4FHAA 1GOOA 1ONXA 3KWSA 4OV4A 2AKZA 1KBJA 3NPWA 4MYXA 1PYMA 3B0PA 3D3AA 4ZGYA 3GNPA 3BAWA 1QK0A 2DZTA 4GYPC 4QHRA 2VR5A 3WQ6A 2PP0A 2F2HA 3UWEA 3CV7A 1G5AA 2Y8VA 4IQLA 4CQ9A 2O9PA 3W7MA 2HZGA 3LV5A 4BWLA 1XDJA 2H3BA 4JY8A 2CC0A 3N12A 3NQ6A 4DPQA 5LXXA 1SFSA 4W7WA 4FOUA 2P76A 4MDPA 3CL7A 2ZDRA 1D7KA 2WWDA 3D3FA 5CKSA 5IM51 4KEZA 3WD0A 2QDDA 1OQFA 3S6DA 1MSSA 2VYOA 1JPIA 3IJ7A 2YLLA 4RDWA 3ZR4A 4F0SA 1DXFA 2IQ0A 1SO4A 1W3KA 3ANYA 1V0LA 2C3ZA 1JJKA 1W8GA 2OELA 4IMFA 1VKFA 1EKOA 3H70A 3WCZA 4H6KA 5D09A 3AIVA 1Q6RA 1N8WA 4LUSA 3PPGA 2WQDA 1QNVA 1QPKA 1J0YA 4MUZA 4ATDA 4I5UA 1Y8BA 3S6TA 4C90A 3KBMA 4DLMA 1E6ZA 2ZRUA 3WBYA 2IQTA 2VDIA 2FB2A 3NSNA 2CLPA 1NAL1 3B3DA 4GVIA 1OIMA 1FWFC 1V6WA 1JPKA 1R7OA 1BKHA 4JFVA 1JDCA 3REQB 2DVTA 4C6IA 2VR2A 2VKZG 1Q2SA 3EWZA 1DORA 2V3DA 3KOFA 2VDHA 4V27A 3AXKA 2NT1A 4ZQOA 3W26A 1CGXA 3MKKA 4G56A 4XQ6A 2NV9A 3OLEA 1VLIA 2JKPA 1YE6A 4H41A 4QAIA 4LALA 5MKGA 3L5AA 4FK9A 3T0TA 1R3TA 1GZ1A 4GINA 4GIAA 4PRWA 3BJFA 2G8ZA 2XGBA 1E51A 1KXHA 2C18A 4D9PA 5I3IA 1NTHA 1UP3A 1TTJA 3BLLA 3HG4A 2Z00A 3POCA 1WYIA 2R8WA 3BCFA 1M6JA 1J0JA 4RZ6A 1MO0A 1G6CA 3AFBA 3BAKA 3MV11 1JYWA 1W9BM 1TTPA 5A94A 2GK1B 1TTIA 1NQ6A 3GWQA 4C6LA 4EPDC 2YB1A 5I78A 3NQVA 1VPQA 3N4EA 3O06A 1JZ6A 3QPEA 5JH1A 2NSOA 3H2CA 2G3NA 2GWNA 1W9UA 1SSDA 3STEA 1F3EA 3W0KA 3W7KA 1A80A 4WLCA 4ZXOA 5HWMA 3VIJA 5AC6A 1WQ5A 1OY0A 5BMWA 2PODA 4GCAA 1VFFA 4QX4A 3PUEA 2D2GA 3W1LA 4ZQCA 3APTA 4PR4A 3WJZA 1TPWA 4GKLA 3AUOA 1EXPA 1B57A 2FTYA 1QI0A 5D05A 1N8IA 5ABGA 1G69A 1WAWA 1ML1A 2OVLA 3NPXA 2CNCA 4CVWA 2OGJA 2VFIA 4EIVA 4UC5A 2OLSA 1D2KA 5CAKA 1EDGA 1LROA 3ONCA 2BVDA 3ZR6A 3GNNA 4QJ1A 2D73A 1XGEA 3TFCA 1VF8A 1W32A 2GPTA 1E0TA 5DY3A 1UMLA 3UWYA 2VJXA 4AY7A 1TZZA 1XG3A 5E9XA 4YCPA 3CT7A 3GO2A 4Y9OA 3UWQA 2Z6JA 4JQ3A 4C6CA 4EWND 1RZMA 3NQBA 5CBIA 3I4EA 1YBQB 4Y8EA 3SUTA 2X40A 5CGQA 3LTSA 1XSJA 1FWGC 1F07A 4MB5A 4LWWA 3WLLA 4LH8A 1XSKA 3H2FA 3LLDA 1OSEA 2FPYA 4ICNA 3BLIA 2QCFA 3QKEA 2EJ1A 2PUZA 3C52A 3PZNA 1LOSA 1GONA 2X0SA 4I5XA 1P6CA 3TROA 1MYRA 5ABTA 4J1OA 1JZ5A 3ITGA 1XBZA 1CXIA 3CZLA 2PDYA 2QMKA 3ONBA 4JGDA 3GVWA 2FHFA 2FMOA 5A8PA 5HPCA 3RX2A 1NFBA 3MMUA 4IMAA 2BY2A 1LT7A 3E02A 4O1FA 4XK2A 4NSBA 5G5IA 3LPGA 3SCPA 3UXIA 4O0ZA 3WNMA 1XW8A 5EMUA 2VEFA 1OADA 3KEHA 1EH9A 4JHOA 3LENA 4AHQA 2P5NA 3KWXA 1UZ4A 3E2SA 1FWSA 2CZFA 3HG2A 4GJ1A 3BZGA 4MJ2A 3AJXA 3MWCA 3JZUA 3WG6A 3LMZA 3MKCA 4JTSA 4RPQA 4J7RA 3B4UA 3W1TA 2YXXA 5T91A 3AXHA 3W7DA 1L0PA 1FRBA 4H9ZA 1HFBA 4F0LA 4W88A 4DNMA 3PULA 3MBFA 1FFQA 3N14A 2TAAA 3PAOA 1UBPC 2NUWA 2HSAA 4BF9A 4B2DA 1ZFJA 4GKTA 3PTKA 2BS9A 1CBGA 2QYGA 4HT3A 3TH6A 2O56A 4KW2A 4IH3A 4O14A 3S5OA 5F2IA 1X7IA 5HAOA 3U8GA 4UQEA 4C7GA 2E67A 2VFDA 4GIRA 2DZAA 4GISA 4UR9A 1PZ2A 1XINA 3NL3A 5DELA 2PZ0A 4ZOAA 8CGTA 3O9NA 4AZBA 1OT1A 1TFVA 4DUWA 5AHLA 4HKPA 8A3HA 1JZ3A 1GORA 3D0CA 4AZHA 2VOMA 1DE6A 5FACA 1A5NC 4XKYA 2WM1A 3GTFA 4PRTA 4JX4A 3FV9A 1QI3A 3WIJA 3UD6A 1LLOA 3VPLA 3EWUA 1U1HA 4XV0A 4Z0SA 2A3BA 2DZPA 2OQLA 4Q8QA 1ZHAA 2V38A 2ZYFA 2PLJA 4BA0A 3SCSA 4DAFA 3FAXA 1P48A 4H9YA 3GXNA 4NZ5A 3S3GA 1BF2A 5EMJA 3KL0A 5DLCA 2WMKA 1V93A 4NJKA 4IUGA 4XD5A 1KD0A 1CB7B 1HVQA 4GJIA 4F66A 3N4FA 4B16A 3BH4A 4YLWA 1XCXA 3II1A 3J7HA 1UUOA 1P43A 1R46A 2V3EA 1Q6FA 1RBLA 4CCZA 4CU7A 3SZ8A 1VFSA 4B91A 1P5BA 1F8MA 3S42A 3VMOA 6A3HA 2WQPA 5CSSA 1AL7A 2UY2A 3R94A 4MNKA 2UWFA 1EBHA 1QPQA 3FHAA 4RV8A 3AHYA 1WO2A 3MUXA 1K9DA 2HDJA 3GVVA 3G0UA 3VCNA 3BTNA 3H2AA 1YTKA 4HSNA 1C93A 3M7SA 1SW0A 4JX5A 2CLOA 4R34A 1M7JA 1Z8AA 5D32A 1XDLA 3LHVA 3APYA 2YCKX 2GVEA 2VELA 4IHCA 3VGEA 3MTWA 1SUXA 3DOPA 1DHPA 5LKYA 4BQ2A 1GJPA 5KETA 4GYJA 1WZMA 4Q22A 4AU0A 2A0NA 3U7BA 2PC4A 1WDDA 3FSTA 2OWCA 3WDHA 5HNUA 1C7SA 3AHZA 1CW2A 3OG3A 2W66A 3RRAA 2OX4A 3OQEA 4HA4A 1MW0A 4ZVJA 3DDMA 4LAMA 2XVLA 5AHNA 2A21A 2WZHA 1NF0A 5F7UA 1JDFA 3H2EA 1TO3A 3OB8A 1HL9A 5FF4A 3LTPA 3OU8A 1TPEA 4RDVA 3L65A 4HU0A 1HL8A 3TTQA 1DWIM 1VHCA 3A12A 3I4KA 2FTWA 1CDGA 5FEZA 3UXAA 1E71M 4JN8A 2RKXA 4U5IA 3IRSA 2FZ9A 5F1UA 3CUIA 3EB3A 2PDFA 4O8RA 4AZ7A 4C60A 3UCQA 1UJQA 5T26A 3UG8A 4HPHA 3R4IA 2FFCA 3MP3A 2D1ZA 2GYIA 1KGXA 3ZQ9A 4PSRA 2E77A 3PWAA 2CXGA 3MJYA 2PRMA 2WV8A 1UD5A 5CZJA 4MJZA 3RJXA 3TSMA 3CASA 3H54A 3AS2A 3GYEA 1KCKA 1A0DA 3IVTA 1Y5XA 3GTNA 3QBUA 1L6GA 4H9TA 1LQ0A 3AMGA 4RV3A 1R2RA 5LHFA 5LIKX 3G1XA 4Y96A 4R85A 4LOCA 4KFNA 1B5TA 3IACA 3EOSA 4IICA 3UESA 4HOXA 2J7HA 2DIKA 5LA0A 3ARTA 3LK6A 2GGJA 3WF0A 4RNHA 1VBUA 1EJ7L 4NJGA 4J3TA 3KL5A 4NZJA 5JBDA 1JFHA 3LHZA 2UY5A 1BLIA 4AG0A 5LIUX 2PS2A 2B7OA 3NGFA 3SEPA 2C15A 1NF7A 2PF8A 3VDCA 4D1JA 3WLKX 4PMOA 5EU9A 3AXXA 1OD8A 3AC0A 5I0DA 4HYWA 3EXTA 5LYRA 1KBIA 3UERA 4M5PA 2QPUA 3W7JA 1W5PA 4K36A 4XSMA 1GJWA 5AC5A 2GUYA 3VKDA 1VQTA 2PZNA 1D8CA 3AU2A 1MZRA 3OHMB 3IARA 1R8LA 3RO8A 4DRSA 3GK0A 4IGHA 2H9AA 1MUWA 1JUKA 3CMJA 1CGVA 1QU4A 4TVCA 1S2VA 1KCXA 2YYTA 3ARZA 1OF8A 2PRLA 4DJFC 1EYEA 5EL1A 3NQMA 1OCQA 1KXVA 1ZLPA 1H7XA 1VC4A 4M82A 1E43A 1MRQA 2G4JA 4UR7A 3DFOA 4AYGA 3S9ZA 2QGYA 4IMEA 4C7FA 2FZMA 4ZO8A 1ZQ5A 4WVXA 2NV1A 4QDPA 5A69A 4ZCWA 1X1OA 2VP8A 5A95A 2I14A 3NM1A 2F84A 4R3UA 4CQAA 3FOKA 2I56A 3TC7A 1D3CA 4NYYA 4MB1A 3ARSA 3NSXA 2BOFX 2W27A 4G8TA 3GU2A 3EDEA 1A50A 5FF3A 4A3YA 1YNPA 4F2BA 1W1IE 1REQA 3VDBA 4QBXA 4JTJA 9XIAA 3VKCA 3W22A 1SMDA 2E9LA 1X1NA 4ADUA 3N4AA 5K9CA 2WJFA 3A9BA 2D2HA 1ECQA 2BB0A 3GBEA 4FIRA 1Q13A 1M7OA 1S1RA 2CESA 1B2YA 3SSZA 3P2VA 2AAMA 2GJPA 4XVEA 5D37A 2WCSA 3C8NA 2XJ7A 3E0IA 3UR2A 4C6NA 2A3LA 2C1IA 3DKLA 4U2YA 4RCXA 4FF5A 4AF0B 4FXFA 5HJLA 1C29A 1TIWA 2VDGA 1YADA 4GUGA 1L6FA 4B4FA 4QFUA 4GNKB 4BK9A 4L4PA 3FN9A 4ZSUA 4ZB0A 1DE5A 1VCFA 2QPSA 4FLQA 3CUZA 2Q02A 1I75A 2IW0A 1CWYA 4NU7A 3SO7A 4UIOA 2DSZA 3KOYA 1HVXA 3E5BA 4W8AA 2E6DA 4CCDA 3CL8A 3LA4A 4QJ3B 4K8HA 4PA8A 5BOOA 5DBTA 4GGHA 2I17A 2CERA 4GE8A 5I3GA 1IWPA 2HQAA 3S5NA 1HKJA 3ZOAA 4CNSA 1XF0A 5D8WA 2O7QA 2PP1A 1G4SA 4ZOEA 2BBFA 2A6NA 4HNVA 5KSWA 4F2TA 4TMCA 2WHKA 4LUTB 1UKOA 2V69A 2DSUA 3QYSA 4D6JA 4JFUA 4LW7A 3W3OA 2NZLA 2INZA 4QLKA 1W3IA 3FK4A 4HP5A 4K1WA 3WMBA 4GRSA 4S39A 3S9YA 1A0CA 1W3JA 2YL8A 1DV7A 1GZJA 4S2CA 1LRQA 1LUCA 4UXDA 2CLEA 2DZVA 4LRSA 4FX7A 1OGSA 4LYPA 1GCYA 1QI2A 2HV5A 5AC7A 3UWVA 3GSMA 3PJWA 4JIEA 1AZ1A 1P7TA 3SBFA 3QPYA 1HKWA 4C1NB 1S2UA 1V4YA 4QE4A 1FHLA 5CG0A 3NIYA 3VK5A 3EYPA 4LEFA 4K2SA 5CZTA 3OVRA 3IWPA 4OOUA 2XM2A 3H7RA 5A8NA 1K1DA 5C7HA 5C0QA 3RAOA 2HTMA 2X42A 3I6TA 3FEQA 3STPA 3GW3A 4KWSA 1PX3A 4GYPA 3ZWSA 1DVJA 1JEZA 4M8UA 2ODOA 1NFGA 4QLJA 1EX5A 5E0FA 2E25A 2E5BA 2FVLA 2Y7EA 2DT0A 3KOXA 1EA9C 4PB5A 3V5CA 3KHJA 3LCGA 3M5VA 5CZKA 1TV2A 3SN4A 4CD5A 3OYZA 2WC7A 3GHRA 4LAUA 2YXOA 1JNEA 2DY3A 4RE2A 4BZYA 1IGWA 3UWWA 3FSUA 3CT2A 2OCZA 5G2IA 3QMRA 1BG4A 3LS9A 4KIEA 2PD5A 1LWHA 4ERIA 5CC3A 4BI7A 5T9CE 4MIMA 4AY8A 1OYCA 1QNRA 1QBAA 4AQLA 4JN6A 1YNQA 4AWTA 1S39A 4YJ5A 3NCOA 3CV2A 1EUAA 3ZSTA 2E28A 2W92A 3K13A 3QEZA 4M7SA 2O55A 2PTDA 4KGLA 3VIPA 1AMKA 2PWDA 3PUGA 2X1RA 3A3HA 2GZXA 2A5HA 3V0TA 4D8ZA 2VCCA 4JTTA 4LB3A 3UPMA 4R7OA 4CVUA 4WR3A 1OABA 3O1NA 4MNJA 1A5KC 4IL0A 1Q45A 2BGNE 2PDJA 4GPNA 3C2FA 1HN1A 3VU2A 3ORWA 2ZUUA 2INFA 4H8HA 3CMGA 4I6VA 3V18A 3TMQA 2DW7A 3BUVA 2E40A 1IR1A 3H4WA 4K8GA 1ZGDA 4W7VA 3WBAA 5A8OA 5FAGA 5K9XA 5I24A 2F8QA 4AAJA 4XIMA 1L8NA 3NGJA 3TYDA 3M0KA 4MPQA 4QJ4B 4ES4A 3DFTA 6TAAA 1FDZA 2W91A 4ORIA 1B9ZA 1EJXC 2R24A 4B5WA 1O68A 1Q85A 3OZMA 4WX2A 1OYAA 1CPUA 4HVXA 4AD2A 3PVFA 1JAEA 1FWTA 2Z7GA 1EBGA 5ECUA 2J78A 2Q01A 1OVDA 3IJ9A 4I9TA 4DBSA 1DTUA 4BI5A 1XLEA 1O1ZA 1ZP4A 2GOUA 3LTYA 3QLLA 2QVHA 1XBXA 2BWGA 4XZHA 1G94A 2O92A 1YEYA 2C0AA 1AODA 2QIIA 1TB3A 4D6CA 4X63A 1EZ2A 2OEJA 3L5LA 3DUGA 3CUJA 3DC8A 1NELA 3EEZA 3TWAA 2OJPA 3WENA 3RMEA 2DUXA 1GOKA 3HGJA 3MY9A 3KRSA 1J0IA 1FP8A 1JQVA 3T8LA 1XIHA 3SUUA 3AXIA 1CECA 1HJSA 3GR4A 1TQXA 4ZOBA 1DXEA 3S47A 1RXOB 4C6QA 3LYEA 5I00A 4GZJA 2W0UA 3L67A 2W3ZA 1XYAA 1DYSA 1CCWB 1BTCA 1OK4A 2QDHA 3KS5A 1OFEA 2YCLA 4Y90A 3R79A 1NVMA 2DV0A 3FS2A 4W86A 5FSEC 1PCWA 3TTSA 4QNEA 1UWSA 1ZY9A 3HGOA 5C6MA 2GDUA 1HKMA 4UFMA 1ZCCA 2YW3A 3WLNA 4JEJA 4X0NA 3L5MA 3T2OA 3W7IA 3QY7A 2YDRA 1KGUA 4FLSA 2J88A 1WA3A 3VGDA 1BWLA 3E49A 1I0DA 1L9WA 3L4XA 3OBAA 4U10A 3WH8A 1VFMA 1UD3A 8XIAA 2PDBA 4IJBA 1B0IA 1SR9A 3TFXA 4HA0A 4KEMA 2AL2A 2EPKX 1X6UA 1Y65A 1GQLA 1Z7AA 4YXGA 2P8BA 2VUYA 1OC7A 2QQ6A 5BOEA 3PPCA 2GVYA 3QGVA 4ACYA 1X6LA 3EKZA 3M44A 2NQ5A 4FI4A 3IK4A 4L6DA 3AMLA 1F7BA 3NOYA 4MDOA 2Y61A 3DN5A 2XSXA 1GEHA 3C2RA 4PFHA 4HGXA 4HNOA 2PTZA 4G9PA 3ARQA 1PIFA 1UR3M 2QAPA 2CLKA 1X39A 2DVUA 3E38A 1DEDA 1W9VA 3MYOA 1XL9A 4HHMA 5J04A 5M3WA 1TV3A 1UHVA 1Q6EA 3W84A 1H09A 4IIEA 3LLFA 3R5EA 4NT0A 4GI8A 1ELSA 4A8LA 1TX0A 1WDRA 3MHUA 1ZP3A 2VRQA 3WNPA 4IPJA 4IT1A 1SU5A 4A6GA 4C7DA 3W1NA 4OVXA 4HPNA 2DSWA 4DO5A 4YHEA 3D46A 1FQ0A 1FBAA 3ALFA 1YXCA 5AHFA 4Y6GA 3FFSA 4OBSA 2OZ8A 3QH2A 3CAKA 2VEIA 3LG3A 1XBVA 4CQDA 1XFBA 4RNJA 2D20A 3FA3A 4S23A 2VM8A 1V6XA 5AVNA 2YW4A 3EXRA 1DIDA 4OE7A 1JZ4A 3LDVA 5F2MA 4IMDA 3TEVA 1MW2A 4AWEA 5CPMA 3TCSA 3L23A 4O0KA 1KTBA 4FNPA 1R5YA 3V4BA 4ZR8A 2ZADA 2RGMA 3MMTA 1GVEA 3O15A 1OB0A 3DI0A 4EAMA 2YYUA 1V3MA 4KKXA 1V79A 1RVKA 5BROA 4ONVA 3EX1A 4H8VA 4B15A 4WXZA 3QFEA 3W53A 4GI6A 1OC6A 1ZTVA 3AOFA 4RX0A 2CLIA 5FL1A 1CB2A 1BYCA 3CO8A 4NNBA 2Q8LA 3EBVA 2ASHA 5C2GA 1E0UA 1ITXA 4GUHA 3VNJA 3VFLA 1XLCA 1C8XA 1QT1A 4XTDA 5GJMA 3NM3A 3PSWA 1FXPA 3W29A 1L6WA 2Z25A 4O52A 1FCQA 3KW3A 2OR2A 2OMAA 3R7MA 4U4MA 2IS7A 1LOLA 3GFZA 1FWHC 3LCLA 3M7WA 3KAOA 3EOUA 2W4XA 1MRAA 4GXWA 2Q71A 4AX6A 1IV8A 3OLIA 4QSFA 2QS8A 1IHIA 2I5QA 4YN5A 1PUDA 4R27A 1LWJA 3WDQA 2WKJA 3H7VA 4GCXA 2WLYA 1Q4NX 2ZICA 1J2BA 2WMIB 5A5WA 3IS4A 4JTIA 3W88A 3AXMA 3E74A 4ATWA 5CSYA 3CIWA 4UCGA 5BNKA 4L6OA 1MXSA 3ABXA 4UB9A 4HJWA 5KITA 1JFXA 5BWAA 3I68A 4MKSA 3KX6A 3WEOA 3BG3A 1GVRA 4EK7A 4IIBA 5FJRA 5DN1A 3QMSA 3WF3A 3LERA 1JCLA 1JXJA 3IJ8A 1UG6A 3VMPA 1RBOB 1UWIA 4CEUC 3T0DA 1QR7A 4LV4A 3MBDA 1K9TA 2FPTA 1EOMA 1EJTC 3N9KA 2PGFA 4Q4SA 4V1XA 2A79A 3C5QA 4TUFA 1AH4A 5JBEA 5AYXA 1FWCC 4Q8UA 1WZKA 3TYUA 1ODZA 1GVSA 2IXVA 3R0UA 2CW6A 4BFAA 4D6IA 4INFA 3OGVA 4JKLA 4AWSA 6PTDA 2J13A 3SIZA 2V0TA 1XYCA 4HA1A 3VX1A 3EA2A 3FDGA 3FYOA 2CIPA 2OSXA 4NY2A 2DSVA 1IXNA 5I3FA 3L4VA 3TYBA 5LIWX 1E40A 3WD2A 3NUKA 3NZQA 2CU0A 5G1YA 3WFLA 1CLKA 1PZ3A 3ATZA 4O1AA 2F6KA 3IJQA 3IK2A 2J7BA 5KZ6A 1WB0A 3HB9A 2BGSA 3NXFA 2VCAA 5HA7A 3ZVIA 1OK6A 1DXIA 5I3KA 2AOSA 4UZUA 5AKQA 3FNDA 3SURA 2ZX8A 1ALDA 3G3MA 3REQA 1IZKA 3HA1A 1FWEC 3FVMA 3P67A 5CC7A 1EGZA 2DUZA 3S8HA 3H7UA 3L7RA 2WO5A 5DCEA 1IR2A 3M0ZA 3RILA 1F05A 1XPGA 3F2CA 1W54A 3GVRA 2OLAA 3STGA 1XRTA 1O7AA 3G1FA 1WE5A 4W4QA 1FP9A 5E0KA 4OGZA 4L9ZA 2HPMA 4F0RA 2VR4A 2J6XA 2B7PA 3W6MA 4N9BA 2A7RA 4IPPA 3AISA 5DF0A 1PV8A 3K5XA 1FHDA 2CZDA 3NXLA 1Y5VA 4O1EA 3TR9A 1HGWA 2BFGA 3C0QA 1O60A 2JEQA 1ZJHA 1E4MM 1J6OA 2CBUA 2BDQA 4LEQA 1FDYA 3GAKA 3MUIA 4BQ3A 3P60A 3ZJ6A 3ITYA 1G01A 2X1SA 4QTGA 2KAUC 3LHTA 1UOKA 5HWNA 4PCPA 5CG7A 1MEIA 2E6YA 2GK1A 1S2WA 4W7UA 1B1YA 1LL6A 3GIQA 3BL3A 4Z42C 5KZMA 4J3ZA 4FMVA 2QEZA 5IDIA 1VJIA 4IXXA 1VIWA 2NX1A 1QCWA 3HQNA 4B9ZA 3NL6A 1IT0A 1M65A 3VKKA 2E4TA 1ADDA 1I6NA 1PTAA 3NPUA 3UR7A 5I79A 4PYSA 2GUBA 1TPUA 3KCJA 4Z2LA 4NZ4A 1HTIA 3W7CA 3AZSA 4Q4MA 4A3RA 3GIYA 2VZTA 3L4UA 3LCFA 1S5VA 3EX3A 2WZTA 4HYRA 1BXBA 5DRIA 5AZ1A 1G7UA 5I5RA 1IEWA 4O53A 4NX0A 3PBYA 1QW9A 4JQ2A 5HWJA 4H2HA 3E5PA 1UD4A 3KM8A 4QG6A 5HMSA 2QJHA 3LI1A 4HMDA 5BXSA 2NQLA 3MCMA 3DHUA 4B5NA 2WBKA 3SCVA 3VGGA 3DI1A 2GGHA 3DBNA 3UR5A 5RUBA 4UTIA 3UA3A 3AROA 3U9IA 3SECA 3H22A 4IQDA 4PUEA 2GFTA 4D6GA 3LU2A 2CITA 3N6QA 4IX2A 4JQ1A 4WZHA 3GH7A 4Z1BA 1Q2RA 1F2JA 1ITQA 3RRXA 1C92A 3OIXA 1VEPA 3ITCA 1I45A 5FOOA 2HVMA 3L0GA 1ZAIA 2CLLA 3DHDA 2QGHA 2JGQA 2PLCA 5SWUA 3I6EA 5GPRA 2XFWA 4N02A 3V5OA 3RLUA 1PWLA 3LUTA 3R8RA 4EOUA 1DKWA 4D8AA 3GG8A 1J18A 1XIMA 2PB1A 5GQBA 4KBXA 1W1TA 1NOWA 1XV8A 2Z6IA 4GFSA 2OQYA 2PGWA 3C56A 2VEPA 3W23A 5D2WA 1E9YB 1O12A 4JFTA 1JCMP 1RV8A 3KS6A 4ENLA 1JF6A 2X1IA 1XLDA 4O0QA 4UTKA 1V7AA 4PB4A 3OPSA 4QITA 3NQ8A 4ZQMA 1XLKA 3H12A 1UR8A 5D9PA 4A35A 4H8NA 4QROA 1RALA 1P1XA 3AIEA 3A3XA 1TUFA 2QV4A 3WF1A 3GKFA 1POJA 2MANA 1PKNA 1LRTA 1E6SM 4PCTA 2AKMA 2PDHA 1OIFA 4BJHA 4S3AA 3LHUA 2ZX6A 1Z42A 4B92A 1QPRA 4UR8A 2SFPA 4AZIA 3AUJA 2XH4A 4WJEA 4XX6A 5AB3A 3K4AA 4WQ6A 4QR6A 3EZ4A 4L1WA 3RM9A 3BAJA 3TW9A 3W81A 1XYZA 3BC9A 2OGYA 4TTGA 1E6PA 3KRBA 3VCRA 4U31A 4XBKA 1DWGM 4Q4RA 2IXUA 2C71A 3CC1A 1SFTA 3BLKA 3UW6A 4PMZA 4G7EB 1KV5A 1JAKA 1TVLA 2XZ9A 3QN3A 3DG6A 2WCGA 1R9ZA 1HJQA 2BP1A 2P3EA 3GDMA 1A5BA 1A5UA 3GY1A 2F2KA 2JF7A 4UCFA 4IWWA 5KZDA 1PWMA 4A8NA 4O1BA 3M07A 4LXFA 3T40A 1FUYA 2Z2AA 3A4XA 3LPOA 4DN1A 4FR6A 2DVXA 2ACUA 3DG7A 1V3LA 1AQFA 2NWSA 4KRTA 5J5DA 5K9DA 4I3GA 4C6KA 1UW9A 3TYAA 4HB7A 1VHNA 1A5SA 3TA6A 3BGGA 3VZXA 3DG3A 6REQB 3B8SA 4GI9A 1UR0A 4RXGA 1ME7A 3BDKA 1KCLA 5LIYX 1QOQA 4IFOA 3A47A 3MP5A 3CB8A 7PTDA 3VIKA 3MO7A 3KBSA 3CUFA 3WN6A 3CQHA 4JIRA 4AD0A 1AQ0A 1UA7A 2EQDA 4DNHA 1UR1A 1CT5A 3R6IA 3W25A 4YMZA 2OLHA 3HOJA 2P53A 1BYDA 3LMYA 5HANA 1MXDA 1RP9A 4N42A 4HHLA 1XH0A 3WH7A 4JTHA 4ERAA 2E6FA 2E8ZA 3CPRA 1AG1O 1P4CA 1MEHA 1OCJA 3W4RA 2NQ9A 2WPGA 3EPNA 2XVNA 1LM1A 1E6QM 2F9RA 5K2ZA 4PTMA 4N9EA 2ACQA 3CH0A 5M03A 3LQGA 4K3ZA 3IIXA 2JBMA 2NXHA 3W71A 1L6YA 3VNMA 1EHNA 4AXKA 4FLRA 4PMQA 4DAIA 3CQJA 2A6LA 3T0CA 2GVLA 3RCNA 4DX3A 1RCXB 1BAGA 4TTUA 4RXFA 5H8UA 3VGHA 2QCEA 4K8EA 5TF0A 4OUIA 5DMLA 4MVAA 2PPGA 1H5VA 4Z1CA 3KVLA 3ENLA 1LP6A 2X7VA 4EXQA 3P3BA 4JZ5A 1BVWA 1TR1A 2CKSA 3BXWA 1QPNA 2B7NA 1H62A 3O8AA 5E93A 2OXNA 5DFAA 2R91A 2BOEX 3RCYA 1HP5A 4OECA 4J4KA 1AQHA 4EE9A 5D38A 4JYFA 1R2SA 2DUAA 2E0PA 3KLLA 2ZWZA 1XRFA 4AYSA 2WWCA 3RXZA 3FGCB 1Q63A 3BANA 1EO7A 5HPOA 4IFKB 3QHNA 2ACRA 4ML4A 1IZCA 1TR9A 1RP8A 3UJRA 1E73M 4LANA 3WBEA 2QV5A 3GKAA 3B8WA 7REQB 3QQ1A 3NTYA 2V5CA 3PWGA 2XSBA 4DWDA 3M5YA 1B30A 2E1DA 3TW6A 3G8RA 2DZSA 1W1YA 4N9DA 2CBIA 4IPLA 1B3YA 2EPHA 4W8BA 1OBAA 4AFYA 1GYMA 2QCNA 3CHVA 4NJJA 4QISA 3EEGA 4LGXA 2V3GA 2WM0A 3KCLA 3GHUA 5CJNA 1WXZA 1LG2A 5FIPA 3HM7A 3F03K 3WDIA 1ZCOA 1ZRQA 3CEPA 2ZXBA 4DLFA 4AIBA 2E68A 2G41A 2QHAA 1NSJA 2YGYA 5EFFA 3QR3A 1JVNA 3QYQA 1RY8A 1H0IA 3RO6A 2D3NA 1D7FA 1V3IA 4OIFA 4KCVA 1KM3A 3POHA 5BYWA 1G9HA 3M16A 4NZFA 1P1MA 1QW7A 1KLZA 3GQYA 5DT5A 4CU8A 2NVCA 2Q09A 2IPWA 4P8VA 3AO0A 4V33A 4HPJA 4E3VA 3W2UA 1WBHA 1UC4A 3ANVA 2WVUA 3BSGA 4JIHA 5BMXA 3GNXA 4MGGA 3L4WA 2UZ9A 2JFEX 4E8CA 2ZDSA 4O11A 4JIQA 4JTAA 1E15A 5FSDC 1BWVA 3TNBA 3G1AA 1BRLB 4MKNA 1LORA 1F4HA 4AZCB 4LY4A 2Z24A 3NQ7A 3C2VA 2DORA 4B2DD 2W67A 3CWOX 1FH9A 4GZIA 1ONRA 3AS3A 1NQKA 2ZVIA 4CU6A 3ICJA 5A6SA 4GUFA 1GEQA 4MTVA 4L6HA 1O5XA 3RU6A 1VBJA 1EF3A 3M1ZA 2GVGA 1TPB1 3P80A 1EJVC 1YRRA 1CXKA 4V15A 3VO0A 4M51A 2CBVA 4LNCA 3NG3A 3WK0A 1SPQA 2DP3A 2PBGA 4GBDA 4WY0B 1UD2A 4AWUA 2DT2A 1PTDA 4LUJA 3HBLA 3B97A 1ISZA 1KRMA 2WXDM 2Y5SA 3SQMA 1AH0A 3FHQA 2PU1A 3GYCA 2OYMA 4IIGA 3TONA 4P8XA 2NVAA 2AMGA 4N6EA 1SZFA 1QI4A 1F3TA 4H7ZA 5ECVA 4JFWA 4A29A 4QE5A 1JGMA 7A3HA 2NXIA 4JHMA 3G1HA 1SSGA 2VENA 1HJXA 2O9RA 4CQBA 3IJ6A 2ZUVA 3JR2A 4GQBA 4PGLA 2VO5A 1U33A 3VNLA 2YZRA 4O4VA 1U5HA 3WUEA 1EF2A 1O95A 4AF0A 3SIMA 2QUTA 4ZFCA 1GVFA 4OV9A 3L12A 4QP0A 3WNNA 2G3FA 4HSHA 3S46A 1UASA 1WOAA 4ZE5A 3HIJA 1MI3A 1EC8A 2BHYA 4L56A 4GWEA 2ABBA 6TIMA 1MUMA 3QTGA 2VUNA 1M7PA 5J8LA 4NI3A 3S1VA 2RFGA 1D8WA 4TR9A 1BYAA 3GNRA 5AECA 1GQIA 1D9EA 4R33A 1BVZA 3GXPA 3FJ4A 5JU6A 3G77A 1CEOA 2H8ZA 1W1VA 1LBMA 1VP5A 3ZMRA 2A3EA 2PDQA 3U2ZA 1BQCA 1GHSA 4ADTA 1M9HA 4MYAA 1IZJA 4AC7C 1L8PA 4N6FA 2ZXDA 3PJTA 3HF3A 1P0EA 3RR4A 3WJYA 4WIWA 3GDKA 3WK3A 4IGMA 3I3BA 2RGLA 4ZO6A 1QW8A 3PZIA 5L6UA 4AZGA 1TJ0A 3QQWA 4W85A 1PE1A 1BSLA 2WHLA 4IP5A 1AK5A 3IVUA 1VYRA 4E6MA 1DTNA 3E3HA 3UVIA 4Y9AA 1G4TA 3W7PA 4LF1A 1YDOA 4C6EA 5D04C 4Q7IA 4HZ7A 3BV4A 4DJEC 1QO2A 1HO4A 1NEYA 2D0FA 4L1GA 4IX0A 1TVNA 3AMDA 2XYLA 2E9MA 1WDPA 5BCAA 2POTA 1JZ7A 3S2JA 1E4LA 1QWGA 1A5CA 5HNRA 3M0LA 1R9YA 3TZFA 3G6MA 2X16A 5E6YA 2JALA 1JRBA 2YIHA 5EKYA 1B3OA 5AC4A 1U1UA 2C1GA 5F2GA 1XC4A 3KFTA 1RJRA 5BWFA 3LN3A 4KERA 3UEQA 4DBEA 3HG5A 3ITXA 3FVDA 3EXSA 4EF8A 1N2VA 1PS9A 3L68A 2XINA 4AUBA 4Z1YA 1YPIA 1QATA 4BQ5A 4HOWA 1P0BA 1C8QA 3NEVA 3GAYA 2EEXA 2H6RA 3M43A 3M46A 5LNRA 2GDQA 2O4QA 3MMDA 1E0VA 3CZJA 4CNTA 2BHZA 4DI9A 3F1QA 1YKWA 3M0HA 1RJQA 2YDAA 3MC5A 2FHBA 1HJUA 4I7UA 4M3PA 2QUUA 4GZ7A 4QXIA 1XBYA 5HULA 4Q7NA 1XIDA 3MZNA 2IKHA 4YL2A 2BOGX 2XN1A 4DF2A 1GZGA 2OG9A 4KCTA 1PKMA 4ZXLA 3E0VA 2OODA 5I07A 1TELA 1BXCA 3APGA 4WF7A 2XGZA 2GL5A 4GY7A 5KEZA 1I2NA 4L4OA 3KRUA 1H11A 4HNNA 4C6JA 1OJXA 3W86A 3H6OA 1S5NA 2Y63A 2ACSA 3BSMA 2A7NA 3VGBA 4GX8A 4EF9A 5K4XA 3HQOA 3F7JA 1XIFA 1IEXA 4ICCX 1WXYA 3R25A 4HBKA 1K3UA 3THUA 3QR0A 2GQ8A 4LVFA 4H4IA 1W9DM 4LQ1A 5LSMA 2XVKA 2WVSA 4X2PA 1UZHA 1JG9A 4WEVX 1PTGA 1V6YA 2UY4A 3BE7A 2Y2WA 2DZWA 1VFUA 2OO0A 3S1WA 4JCMA 1KWGA 3GG7A 4ZE4A 4MY9A 3P61A 4M1RA 3P81A 4Q33A 2V9DA 1OFRA 3QSRA 3LPFA 3V16A 4O18A 3DAQA 1MFVA 1KM0A 3GDTA 1HW6A 4J28A 1LJYA 1ISYA 3GVGA 5I23A 5CEWA 4UTLA 2DU2A 5I77A 1V08A 5GVJA 2NX3A 4JTRA 3OHIA 3W74A 3MHFA 1UR2A 2HXTA 4Q3MA 5EBAA 2DDXA 3K8LA 4LVDA 3GH5A 3CZGA 3EWYA 3P6LA 3CLMA 4XVDA 2ZRWA 1GTEA 5AN7A 1R2TA 1OYBA 1EUNA 1I1WA 3CZEA 4IQJA 2ZZ5A 4TV6A 1PIGA 1OD0A 4O17A 1K8YA 3THQA 3HFTA 4UTWC 3KBVA 3WLHA 3TCEA 1SJDA 4XTIA 4CQCA 2HRWA 1GVYA 3BCJA 1TJPA 1VH7A 3LV6A 3OZPA 2YB4A 5FKYA 4HNTA 1RLDA 3UJEA 1W56A 1B31A 1O94A 3TVAA 3WJSA 3GBDA 1TRDA 4X61A 2Y0FA 2O0TA 3EWDA 4M0XA 2XDFA 1RQBA 4DO7A 4V1YA 4B9YA 1J5SA 4M29A 2OT1A 2O9OA 4ZZ9A 1H7NA 3L4YA 3MUAA 2Y7GA 1I2QA 3B05A 2DT3A 4GY1A 5ABFA 3N73A 1KA9F 2UY3A 3F2BA 4GZEA 4AVOA 4S3GA 3T44A 1V0KA 3GUGA 2CLHA 4XWUA 2PI6A 2VVNA 2DZBA 1WKFA 3NQGA 2WNZA 3H24A 5I09A 1TV4A 1FWJC 3GC5A 4MNMA 2YZ5A 4IZGA 4MWAB 1UPPA 3S0CA 1UYQA 5A6LA 3ZVHB 2GGEA 1EXBA 3AIQA 2C14A 3ARYA 3K8KA 4Z2JA 4KS0A 4EP8C 4O8AA 3DFYA 2BNJA 1F76A 3QXBA 5AY7A 3T9PA 4CCCA 2NUYA 2Z7KA 3B0UX 4S3DA 2PDLA 1JXKA 3QC3A 2DPEA 3VM5A 1NJJA 3ZFHA 4O57A 1T40A 1TWWA 4FXJA 1HQTA 1K70A 3VIOA 2YDSA 4RJEA 2VI0A 4PODA 5H91A 1BHGA 2P3ZA 2ZBTA 3RLVA 3HTWA 3HQ1A 3F2DA 3WYZA 2V30A 2E5CA 3KHDA 3TQKA 5I3DA 4JICA 1RCOB 2YJQA 3G18A 5DCDA 1PL9A 1U22A 2HROA 1A49A 2F6UA 4ROPA 3TYEA 1NP0A 3W6LA 2VZOA 1Q7ZA 2JQXA 1VCGA 1KM6A 4IIFA 4KWOA 4PEKA 2J9XA 1AA1B 1KM4A 4ROQA 1RSCA 5D8ZA 1JI2A 5HQEA 1TV7A 1G7VA 3TC3A 3W7QA 1DP0A 3T7VA 3ARVA 1WDQA 3OGSA 4P7NA 5H8PA 4WDTA 5K4ZA 1LRNA 4G6CA 3KBNA 2EPNA 2VFHA 4JFSA 3JZEA 3U6WA 5HMFA 1V3KA 3P0XA 3VDAA 3GXDA 4GQGA 4PCSA 3EMCA 4TMBA 3WQ8A 3V1PA 3WEMA 4QG9A 3NQDA 3FYPA 4BF7A 1VBHA 2CEQA 1U5JA 3NO5A 3QHMA 3CUXA 5IXEA 2NLYA 3EMQA 3P84A 5FA5A 2YL5A 4PB3A 4DJDC 4PUNA 2DQXA 4MJMA 1NDWA 5AHEA 1JZ2A 4JR5A 3UGRA 1XWYA 1A4MA 1Y5WA 1JD9A 4KFPA 5D2VA 6ALDA 1GQJA 4GIYA 5DRCA 3NZPA 1X7FA 2ZUTA 1ADOA 4HHHA 4RNIA 4B5UA 4LF2A 2PAJA 4XISA 1OFAA 3UZWA 1AMYA 2BV9A 2VGBA 2Z1SA 4IQEA 2BASA 1O4UA 2JIEA 3EAUA 4JL2A 4LX4A 1GOWA 3A13A 1FH8A 4RKAA 4LNYA 3OOQA 3RUBL 3WUGA 1ME8A 4IF2A 3CPUA 3KVMA 1LL4A 4JQ4A 5TNVA 3W76A 2Y8UA 3GXTA 4IOTA 1SZNA 3E6EA 1VIZA 4MSSA 1KGWA 1BGGA 2XH2A 1OFPA 2YPIA 1TG7A 1TMQA 3EDDA 3O07A 5HOSA 3BSHA 3UVAA 3TAOA 2RJGA 4AHOA 2DEPA 2ZKMX 3BWWA 4B5TA 3V75A 3EOEA 4M6PA 1UROA 2JE8A 1OFBA 4WGXA 5EMLA 2HJPA 4KIRA 3R89A 3GXFA 5KTLA 1O6IA 3CB3A 4YWIA 2J7FA 4DF0A 3ID7A 1KRBC 1TWDA 1IYXA 1EC7A 1C91A 4RPPA 4J2MA 1EEPA 1E5JA 2I1OA 4FR1A 1J79A 3E2QA 1H60A 5E09A 5M17A 2GVJA 4FNSA 4J3WA 2QCCA 1OCNA 1ZENA 2RDXA 5DANA 2HPIA 1AL8A 5CBBA 2CZ5A 3KE0A 3VOGA 3ES8A 2HXUA 1U2YA 2Q8ZA 1TPFA 3BLEA 2FH8A 1KFLA 1F4AA 1EYWA 3NEHA 1CGTA 3E0LA 3W01A 1NDVA 4L9XA 2QULA 1OEPA 5G4EA 4JKMA 1E6XM 5DXYA 1P6BA 1SZRA 3CHDA 3MANA 4MB4A 4DWSC 3FA4A 3R11A 3T4WA 5HATA 4POCA 5C2XA 4KWVA 4CGTA 3M0XA 2ZA2A 4IM4A 4QRNA 1Q66A 4WRHA 3ABZA 1VPXA 4C6FA 1DWHM 2XVGA 3R13A 5BOFA 4H8UA 1US0A 4KRZA 1A3HA 1PB0A 3LHYA 3TQVA 4HZ8A 3KCOA 2FYMA 2PLMA 3AI0A 1S3TC 1XRSA 4JOMA 2A2IA 3B03A 4BR1A 4TOQA 2GOKA 1SO3A 2FJKA 1LWIA 3E9AA 2OZTA 5FCZA 5CPLA 1FDJA 1VZWA 3HG3A 3VILA 4J9JA 2ZZ6A 4R9OA 4LYKA 1J0ZA 4FNQA 4UUIA 3GNOA 5D9MA 2IMRA 1SR0A 4PMDA 3IGUA 5HR7A 4S38A 3ABQA 4LUYA 4Q8WA 1Q4WA 1KQZA 3ZLGA 4MUPA 1CTNA 2VGGA 3SCWA 1BGAA 3GTHA 2H9AB 3PS7A 4XD6A 1S3HA 4FXRA 4LY8A 1A5OC 4MPKA 4GACA 4UOQA 3R43A 1E0XA 4L1XA 1GOIA 4U3AA 2NX9A 2Z4GA 3IJLA 3GTXA 1JCTA 2Z1WA 2EKGA 5CAHA 3TXZA 4LCRA 3ZSSA 3PB0A 3UWUA 5L9FA 2RH9A 2CBJA 2WZEA 2G95A 3WSUA 1GVQA 4DBDA 3STFA 3WNLA 1GG0A 1WUFA 4PTNA 4KT2A 3NYZA 4NX5A 1VR6A 1HNYA 4MZ1A 2R82A 1ZAJA 5D2YA 1DPMA 1Q5MA 4QGCA 4W93A 1F6YA 4AEOA 4LC8A 1PEZA 2REQA 5C2CA 1QVBA 3PP7A 2P10A 4D8LA 4D6FA 1V7YA 1S5MA 4TU1A 4TIMA 1J0HA 3N04A 5D33A 1TWIA 2PCQA 4UQDA 2DIJA 1ICPA 3T09A 3B40A 3IIVA 4HIBA 2X0HA 1RQHA 4OJYA 5D9OA 1UKSA 3K1DA 1EB3A 1NP2A 4BS0A 1NWRA 1XLBA 3CNYA 3VIFA 1IIGA 1MDRA 1B4EA 4HJFA 1BF6A 3GTIA 5CQ1A 3VD3A 3ELFA 1ZB5A 2ZUNA 2V5LA 3AU6A 2QVNA 3SR7A 2WSPA 4HCHA 2WK2A 1W9PA 4CNUA 1K8XA 4B3KA 5KMYA 1GG1A 4EAYA 1K9EA 4EPEC 4L80A 4W5UA 3QFWA 1CZ1A 3W07A 1V03A 1OZQA 5BRPA 1G0CA 1KKOA 3PJUA 1J12A 3VYLA 3VOJA 4E2VA 4DBWA 3VNIA 1IWBA 1IF2A 5LNUA 3YPIA 3EOLA 5HNNA 4FPSA 1UUQA 3VD4A 1S2TA 3W1RA 2JEPA 2FQIA 2G4FA 4JX6A 5M2FX 4XAFA 2VFGA 2C1HA 1LBLA 3IGHX 2JK2A 3F4NA 4DYKA 1W6TA 5G4WA 1TPVA 3DESA 4ZO7A 4Z1DA 4XD4A 2V2CA 2ZXAA 4MWAC 3N3TA 5AYIA 4YHGA 1EZWA 1UWRA 2WZIA 3GU1A 3A23A 2ZZ4A 1OX4A 1QNSA 2CKRA 1YPXA 4NAFA 5I3HA 4MFEA 2WPBA 2VEGA 4LBSA 1QAPA 4WD0A 4D6EA 4QAWA 2J7CA 4MY1A 4QS5A 1O5QA 2BTMA 4P8WA 5I06A 1VFLA 5CGTA 1LLWA 3T81A 1PCKA 1Z6KA 3WBWA 3DFSA 1GPFA 3XINA 3A5VA 4UQCA 3RFAA 1EPVA 3DFPA 3PNZA 1W5NA 2PWEA 1QOXA 3E0FA 5CLTA 5TD4A 1M7XA 3T8QA 4PE8A 1QO5A 1RD5A 4FOJA 2ZRVA 1E1CA 3SCNA 2OOFA 4W87A 4DB7A 1P7TB 1KFBA 3LSBA 5CPNA 5JBFA 5LGZA 3WMCA 1I4NA 5F4WA 3FEMA 3GFYA 3WLRA 5B7ZA 3IUHA 4HN4A 4N7QA 3LM7A 1UBSA 4IISA 3G0XA 4ML9A 4PFMA 4P7RA 5FEXA 4F40A 2YOCA 2CWXA 1H50A 4JN7A 3U2OA 3M0YA 1CXFA 4ICMA 1IIHA 1EJSC 1QBBA 2R1LA 1C8YA 3GLCA 1K7XA 3DGRA 4EACA 1QJWA 3NA8A 3WKZA 4P61A 2Q3RA 2X1UA 3W24A 3TSBA 1KBBA 3DIPA 3AHXA 4O1CA 5DQPA 1H7WA 2PDGA 4S3FA 5REQA 5FEPA 3OW1A 4BEQA 3W1PA 3VINA 2WJDA 3PPFA 1XICA 3NQ2A 2Y89A 5HXMA 4RR4A 3SCOA 4ZFMA 2WJZA 3B8VA 2OT0A 5IHSA 1OC5A 1M68A 3A64A 4DJEA 1XQKA 5TQLA 1H41A 3ZT5A 5DBUA 2VWTA 3SFWA 1IEQA 3CO4A 4TVUA 4D71A 4PCFA 3BLFA 4GYKA 4CN1A 1US3A 4IPIA 2VFFA 4PUJA 2PDMA 2DSKA 4X3ZA 3KP0A 5HJXA 4DZ5A 1EWDA 3V35A 2XISA 3SCTA 1F5ZA 3GM8A 3NYDA 1ZBVA 1FFRA 5TBOA 3VD7A 2J8TA 3CL6A 5AYZA 2E1WA 2D69A 1YYAA 1XCWA 3QSTA 2ZIDA 4UWMA 2R9RA 3WFZA 4G7EA 2VCBA 3ANUA 3L9CA 2WMJA 5CSUA 5U4NA 2RDUA 2I7GA 4CD6A 3EX4A 5FESA 1HJWA 3SUSA 3RHGA 4YU1A 1NOFA 3G1SA 5F2LA 1QASA 2G3IA 3RPTA 3WDJA 1ME9A 1BSIA 4DYEA 1Q6LA 4YTUA 1JPHA 2ISVA 3V1HA 2VWSA 3H21A 1K03A 1FWNA 1W2PA 1QMLA 2VMFA 2Z1KA 1Q6CA 3U2EA 3PTQA 3JW7A 3S1GA 4ZENA 3ZJ8A 3DGBA 2BSLA 3G24A 2W5FA 4A3HA 3W2MA 3IIOA 3BLDA 3QR1A 4I8YA 4UTTC 7ODCA 6REQA 5I7GA 2PTXA 3WQOA 3ZS4A 2VX6A 1UH4A 1WZLA 2YKKA 3RCMA 4LS0A 1RY0A 3B8IA 3UY8A 4JBRA 1YDVA 2J79A 4X9YA 4X22A 3LNPA 5FAJA 3C61A 1MW1A 1EC9A 2X1TA 3PN8A 1CXLA 4U3CA 2WVTA 4ZB2A 1EOKA 1AJ2A 3VOFA 3M6DA 3L2MA 3LY0A 2QAFA 5LZLA 1H51A 1XLHA 1OM0A 2VZSA 3UG5A 3N25A 5M1TA 1UQZA 1NY1A 3OIHA 4ZBCA 3CTLA 4L9YA 4R5EA 3NNTA 3PG8A 4CLMA 1TZ7A 3TE9A 1RH9A 3PJXA 4LVGA 5IBXC 2WNWA 3H23A 3LQLA 3G5EA 4Q8OA 5AYBA 3VA8A 1KC7A 1UOZA 1YNYA 2HNEA 4DELA 3TJXA 5AC8A 3WQ5A 3MJMA 4EWJA 4WOQA 3E12A 4MOZA 3CWNA 1K6WA 1GKRA 4WDXA 3SJ3A 1XP3A 1DJQA 3DC0A 2PTWA 2EPOA 5A6KA 1UKPA 5K7JA 1Y7VA 1VYSX 3UCDA 3AZTA 4LBRA 5IRPA 3EB4A 4AIEA 4Z2KA 2HE5A 4A05A 2AL2B 5FJJA 4AMCA 1XIJA 3PK7A 1DOSA 1KM1A 1GKQA 3FJLA 1T41A 1M01A 1EJWC 6XIMA 2XUCA 2AGKA 3GDLA 2EG7A 3B9OA 3NDZA 4PSPA 3W1XA 1JUEA 3ES7A 2IPFA 3GZAA 3UP8A 2WSKA 3CAQA 4K68A 3TJ4A 4HK7A 3FGCA 4CD8A 4NAEB 3VXGA 2P0OA 1KV8A 3O16A 4R7WA 4NZ3A 2VFEA 1W8SA 2DJLA 4IFKA 4CD7A 5A2AA 1XKJA 1TJ2A 2YBTA 1E6RA 3D6NA 1W9XA 4H83A 5JVLA 2D2JA 3T0AA 2WJEA 4JYDA 7REQA 2PGEA 4KQNA 1NWSA 5LA1A 1OGGA 1VLWA 2AMXA 2ZC8A 4LYRA 3PUDA 3EWXA 4Y7EA 1J5TA 2JIWA 1J93A 4HMEA 3W2LA 1PBGA 4KRUA 1W5OA 1Q3NA 1FKWA 1KW1A 3DHFA 3LPPA 4L4MA 1ZPTA 3LCXA 4CKQA 3Q45A 4Y9NA 3WQVA 3FX4A 2AQOA 1QNQA 2MNRA 4ECLA 2XIBA 1RQEA 3O6AA 4LJ3A 4E2DA 3AQUA 3GC2A 4RE4A 3W28A 3A21A 3BVJA 4GNVA 2GJXA 1PO9A 3ZIZA 3W70A 1SW3A 2WSRA 3SQSA 3IJDA 4JTUA 1QPOA 1WDWA 3WJWA 4NUWA 1XGZA 5CSRA 4HPGA 1QHZA 1VFOA 3MS8A 3NQCA 1ZJAA 3O0KA 3R1ZA 1TA3A 4HNLA 3G1DA 2VHLA 5LNWA 3MZ2A 2CWNA 1ODUA 2QJIA 4REQA 1QNOA 1OX5A 2DW6A 4DEFA 3AALA 4NILA 4LAOA 2HWGA 4GA8A 1B3ZA 2EG8A 4AB4A 3WQCA 3T78A 2CHRA 2GSHA 2QR6A 3LRMA 4O10A 3GC4A 1UH3A 4K6AA 3R8GA 2A85A 3CS2A 3ATYA 3SGZA 4MY8A 4MLJA 5EB8A 5BXRA 4UTUA 3DECA 1BRLA 4AZCA 4F0MA 1HF6A 1K77A 1OHLA 2FLIA 1ONWA 2FGLA 4D2JA 2XHYA 1SJAA 1B3XA 3SAZA 1DQXA 2WYSA 3DX5A 3FW6A 2PDIA 5I6SA 1E70M