3VOIA

Cccel6a catalytic domain complexed with p-nitrophenyl beta-d-cellotrioside
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
360
structure length
360
Chain Sequence
STGNPFEGYDIYLSPYYAEEVEAAAAMIDDPVLKAKALKVKEIPTFIWFDVVRKTPDLGRYLADATAIQQRTGRKQLVQIVVYDLPDRDCAAAASNGEFSLADGGMEKYKDYVDRLASEIRKYPDVRIVAVIEPDSLANMVTNMNVAKCRGAEAAYKEGVIYALRQLSALGVYSYVDAGHAGWLGWNANLAPSARLFAQIYKDAGRSAFIRGLATNVSNYNALSATTRDPVTQGNDNYDELRFINALAPLLRNEGWDAKFIVDQGRSGVQNIRQEWGNWCNVYGAGFGMRPTLNTPSSAIDAIVWIKPGGEADGTSDTSAPRYDTHCGKSDSHKPAPEAGTWFQEYFVNLVKNANPPLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiohydrolase
publication title Comparison of the structural changes in two cellobiohydrolases, CcCel6A and CcCel6C, from Coprinopsis cinerea - a tweezer-like motion in the structure of CcCel6C
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Hydrolase
total genus 138
structure length 360
sequence length 360
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 3voiA00
3VOGA 3VOHA 1OCJA 1UOZA 3RU8X 1QK2A 3ABXA 3A9BA 1OCBA 1UP3A 3A64A 4AU0A 4AVOA 2BOEX 3VOJA 1OC6A 4I5RA 1HGWA 4AX6A 2BOGX 1DYSA 1QK0A 1HGYA 1BVWA 1GZ1A 2BVWA 1OC7A 1UP0A 4A05A 1TMLA 4B4HA 1OC5A 3VOFA 1UP2A 4AVNA 1OCNA 1CB2A 4I5UA 4AX7A 2BODX 1QJWA 3RPTA 3VOIA 2BOFX 4B4FA
chains in the Genus database with same CATH superfamily
4UOJA 1LOQA 5LXXA 2Z1BA 5GNXA 4ZXOA 3W7JA 5HJLA 4PMQA 3O9NA 3E5PA 4WDWA 1NVMA 3DERA 4LVFA 2PRHA 4JFWA 2GVEA 2SFPA 2OZ3A 2D73A 1O4UA 4XZWA 2NX1A 4MAZA 4GIEA 4GQGA 4ZO8A 4E4FA 1M7XA 1NWSA 3LGDA 3IAQA 3S1WA 4FX7A 3ABOA 4KCTA 4NAFB 4CQAA 1KFJA 4HPJA 1N55A 3GIPA 1M3UA 2YIHA 1IXPA 3JUGA 1ZCCA 3QMSA 4DZAA 4QAWA 1JCNA 3MMTA 1P0DA 2NUYA 4LOCA 3A6OA 4BHYA 3DC0A 5DMNA 1MWOA 4UFLA 2PP0A 3QV9A 4IL0A 1F7BA 1PVNA 1TPWA 1E6RA 3P81A 3SY1A 1C9DA 1OGGA 5HMDA 1VKFA 2FDMA 1OWQA 3CYJA 1EEXA 3UCCA 4MPKA 3MT1A 4MVAA 3VIPA 3QQWA 3LCLA 2Y62A 2BOFX 4S3CA 3OJGA 4XZHA 3AMLA 4X9SA 1DJZA 2WZHA 3ENLA 3UZYA 1PO9A 5AC5A 3OPSA 1A0DA 3AALA 3LCFA 4HYRA 3B06A 4JEQA 3BZJA 4QM1A 2ZUUA 3AIUA 2VRKA 4N42A 4TV5A 3THCA 3H7VA 4P7OA 1R86A 2HPMA 1HKJA 1ADOA 5HUOA 2YBTA 3CXOA 5KSWA 1PKNA 3VC5A 1Q2SA 3F5JA 2PODA 2XIQA 1KGUA 3T6CA 1J01A 1B1YA 4REQB 1BHGA 4N9EA 2WYSA 5I5RA 1XQLA 3K4AA 2WPBA 5CLWA 3CLWA 3VIKA 3CJPA 1UP3A 4TUFA 3W7DA 4ZVJA 5F2MA 4GI4A 2YX0A 1P48A 4AB4A 1BG9A 1FHVA 2ODOA 1G5AA 4JTLA 1SW7A 4C5YA 5AHFA 1WZAA 2J47A 2FZBA 2ZA3A 3EXRA 1Z48A 4QRNA 3KAOA 3C6CA 4C7GA 1KNWA 2PI6A 4FNTA 1WZKA 4MM1A 2G4JA 1MNZA 4RXGA 1YDVA 1OFRA 3LYEA 4NNCA 1ITQA 1LUCA 2E5BA 2D2JA 3WQFA 1UOZA 3TYDA 3HGJA 2Q3RA 3PB0A 2CZVA 1UKQA 3W1LA 1SO6A 3NQFA 1RBOB 3KX6A 2PS2A 3A3HA 1QJWA 2NV2A 4WJ8A 3TVAA 1W8GA 3O8AA 4Z08A 2YZRA 3ES8A 2WM0A 3HG3A 3NQEA 4WQ6A 4GI8A 1HJVA 1PZ0A 1NQKA 1XH2A 1AQ0A 2A2IA 4UFIA 3UXAA 1RCQA 3APTA 3PB2A 4RZ4A 2AGKA 1R7AA 1J18A 4AZIA 4QFUA 2ISSA 3Q94A 2P3EA 2D1ZA 3FA3A 5LZLA 3KBVA 2EJAA 4OV9A 3AIWA 3R11A 1KCZA 4X3ZA 3FVMA 2RGMA 4BZYA 4KKXA 3SR7A 4N6FA 5FF7A 1YYAA 4HVXA 1DXEA 3A4WA 1X7FA 3A21A 3AYTA 1ODZA 2HQAA 3L4VA 1JZ8A 1P6CA 3AUJA 3VOFA 1L6FA 1ZHAA 4I9TA 5A2BA 2P1FA 3CIVA 3ZR4A 4BKNA 2ACQA 2ISFA 4D1JA 1IZCA 4LBRA 5GJMA 3LBOA 1R47A 4YMZA 2F6KA 2CW6A 3OBEA 4Q32A 3DH7A 3LZ3A 3HB9A 5M03A 5T8GA 4OV4A 1FP9A 2J6XA 2XGBA 1VLWA 4LY8A 2WC7A 1TX0A 3VKJA 2C16A 2R1NA 3IRSA 4ZSUA 3KS6A 3P5YA 3ISIX 1CCWB 1FCVA 3D47A 2RH9A 1IEXA 1XCFA 2QF8A 3C52A 4JIEA 4PYSA 3LTYA 1E3XA 4EWND 1BWLA 3PJWA 1FH9A 3FK4A 2HE5A 3IJ6A 3VXGA 3M46A 4LVBA 4QNWA 1NOUA 1V3KA 3APGA 4DBUA 3EX1A 3IAPA 3T08A 4W89A 3IRDA 2EG7A 3FJ4A 4TOQA 1J0YA 3P67A 2ZCGA 1BD0A 5TIMA 2INZA 5CLTA 3WUFA 5I3IA 3EDKA 3F2DA 4ML9A 4BF9A 4HYVA 3CUGA 5D9NA 4PMVA 3VIJA 2IKIA 3JVAA 3LXAA 1HJQA 3PPCA 4DUOA 4OVXA 3TH6A 1RALA 4JN8A 2Z1WA 3NOEA 3KOXA 4ZQMA 1VGAA 2A21A 3AHZA 4LS2A 2G3NA 1AD1A 1GOXA 4B5UA 2VD9A 4AX6A 5BOEA 3KTSA 1CLXA 2YBUA 2HMCA 3VIGA 4HU4A 2NQ5A 5AC7A 4PTVA 4FNQA 3W28A 3BGJA 2EAWA 1JPMA 2Y8UA 3ITGA 1F2JA 4ZXLA 2CLPA 1IQ8A 1TJ0A 3QY6A 2VZSA 4JQAA 3CPUA 1JAKA 3V1PA 3TQPA 3EKGA 2WZMA 2WMIA 1R2SA 4GIRA 4GIYA 3CYVA 4B3LA 2YFNA 1EC7A 1F07A 3HOJA 5LKYA 3R0KA 2QV5A 1EGZA 3DFQA 1Q3NA 2JGYA 1WAWA 3N3TA 4F48A 1FFQA 1P0KA 3GHRA 5HMSA 1EOKA 3LZ5A 1VCVA 1JCYA 5FF3A 2O9RA 2WHJA 1HVQA 1VYPX 3LHVA 4IQEA 1BSIA 3LK6A 4YTRA 4XZMX 5D33A 3BGAA 3E49A 4A2RA 5DANA 2NXHA 2W0UA 1CENA 4H7VA 3SSZA 2V8ZA 2HV5A 3MANA 1TR1A 1JULA 1Q5MA 2V2DA 4UOQA 4UOZA 2P3ZA 4E2BA 1EX1A 3OA3A 3VM5A 3UWVA 1MZHA 3PUDA 1XUZA 1TO3A 2WVVA 3P62A 1X1ZA 3KP1A 4FNSA 2GQAA 3ABXA 1QO2A 1JDAA 1NFGA 3CBWA 4GNKB 4V1XA 2RDUA 2OWXA 4YHGA 4I7WA 3OGVA 4X0NA 1V0LA 2DVTA 2PDCA 2PDJA 2Q8ZA 5H8UA 1EJRC 2ZKMX 3RK8A 5DBUA 3NYZA 3QKEA 1W9DM 4GO9A 5AYBA 1RPXA 5F1UA 3VTRA 1MSSA 5JBEA 3LOTA 4LYPA 3AS3A 3GZ3A 1V3IA 3ZYZA 1QI3A 3AAMA 3W7KA 5CSUA 1M7OA 5J5DA 1L8PA 1B3WA 1KCLA 1XUUA 1CDGA 4GY0A 1GKRA 3I3DA 2YPIA 1W1YA 4AIBA 3W7QA 1WDRA 1MRAA 2EG8A 1NDWA 1I45A 2QPSA 2GWNA 1NH6A 5BXSA 2VHLA 2QJHA 2PF8A 4D8LA 1Q6EA 1EX5A 2PDIA 2AKZA 3AMGA 1E51A 2PTDA 2ZE0A 5HQEA 1W9PA 4HU3A 5A5WA 1NTHA 4B5VA 2E8YA 2W67A 3M6YA 2VL4A 3LB0A 3A24A 4NNBA 1TUXA 1AZ1A 1UKTA 3VA8A 2WMHA 1A5LC 3VIFA 3GK0A 1B90A 1X6NA 3LA4A 3UF9A 4UCFA 4NZ4A 5MKGA 2A85A 5EL1A 3AISA 4D72A 4IISA 2DIEA 1XYFA 3KVMA 3PNUA 2CLLA 2PWUA 2C3ZA 5AHNA 1N8IA 3VMOA 3W6YA 4KF1A 1GPFA 3UG4A 3GQYA 4JN6A 4GINA 4Z0SA 2DDXA 3P7YA 2X0SA 2XVPA 2FJKA 4YHEA 1W56A 5I24A 1HZYA 3QH2A 8A3HA 4Q4RA 4MWAA 3IGXA 4HZ8A 4PMJA 5C7VA 1UH4A 1DKWA 1S2AA 4H1ZA 3E12A 3LS9A 3UERA 3OGSA 4N9CA 1XPGA 1TPUA 1A53A 1UWTA 1TMQA 3VK5A 2DSUA 4QP0A 4CUCA 2QUTA 2QGHA 1XFCA 1UZHA 3VCNA 4F66A 3GDBA 3VOJA 3GFXA 3MSRA 1W8SA 5FAGA 1IWPA 3BH4A 2CHRA 2GGGA 3TOYA 3GTHA 2ADAA 2WJZA 3KOYA 3SN0A 4QQ3A 1TKKA 2GWGA 5CZTA 3H23A 4AF0B 4XBSA 3TZFA 1H49A 4QITA 1WKYA 1H4PA 4AAJA 4QJ3B 1JL8A 2UBPC 3CWNA 1Y0EA 3FSUA 1HFBA 1V5XA 1HP4A 1KBIA 3WEMA 3KVKA 2NVDA 1REQA 1YRRA 3OB8A 2WVTA 4LF2A 4BWLA 4PB4A 4YIWA 3WLJA 1FA2A 3MY9A 1QI2A 1Q66A 3QY8A 3PSWA 2A3EA 2C79A 1RK6A 4H6RA 2WMGA 4ILSA 2E0PA 5D2VA 4CCCA 3A4XA 1QWGA 3W84A 5AHIA 3ARRA 3W02A 5BXPA 3DFHA 2WHKA 2PDGA 1GWJA 3KL3A 1RD6A 4YS1A 4J3TA 4EK7A 1K8CA 4P2VA 1IF2A 1PWLA 3M0HA 1V6VA 4LC8A 4HA3A 2WNZA 2VDHA 1K9DA 1X38A 4IGNA 3Q67A 1DJQA 2RDWA 5DRIA 3ZFHA 1UQZA 1WDDA 3WK2A 4ZR8A 3GXPA 2H9AB 1BWKA 1FWFC 2NXIA 3TXVA 3PF3A 4DJED 3V4BA 3MWAA 3BVJA 2RJHA 3AOFA 3E0LA 2PCEA 1Z8AA 9RUBA 3S2JA 4J2MA 1VCFA 1OK4A 3TMQA 5CGQA 2J8FA 4EF8A 2J7DA 1OD0A 3C3NA 3MYPA 3GXDA 3S46A 2JIEA 4PRWA 2CKRA 1EUNA 4LF1A 3HJZA 4GA8A 2OYMA 1H51A 2IKHA 1KM3A 2EBNA 1R9ZA 4DZIA 1T7LA 3WNMA 3EDDA 1XH0A 3FY1A 3W4RA 4IQJA 2BODX 4NZFA 1UC4A 1OF8A 4C6PA 3GHTA 1D3CA 2IPWA 2I9UA 5HR6A 2XFYA 2C0HA 3DN5A 1SYTA 1FWDC 2Q8XA 1IGSA 2OYLA 3WSUA 3F5KA 4M56A 2DP3A 3V18A 2WCAA 1VFSA 3KHDA 2X1TA 1R5YA 3DYOA 4MNLA 1VH7A 5M3WA 1I2OA 3K5XA 1EJUC 4P8XA 4FIQA 4TX6A 1E55A 4MPQA 2HTMA 2OMAA 2V63A 2IPFA 2A3AA 1Q6RA 3WMCA 4JFSA 3OQEA 1EOMA 1K77A 3BQ5A 3TTYA 3TMLA 2C15A 1TB3A 3SGUA 1Z32X 2DVXA 3BLOA 2REQA 3LRLA 2IS7A 3GUWA 3WQ5A 5K9DA 2WZIA 1X8FA 4AW7A 5A69A 4ONVA 1UJQA 4JS3A 3VINA 3U7VA 1MQPA 2Z29A 1EJXC 3L0GA 4PMNA 3VMPA 4DPPA 2PSNA 2ZXDA 4LJ3A 1R30A 1K4GA 4NZ3A 1QPNA 3LCWA 1LBLA 1EWDA 2ZA2A 3MUZ1 1EFZA 3W7CA 4ZB5A 5EFDA 3VGEA 4OZOA 3V16A 1Q6LA 4NIRA 2A7PA 2NV9A 4FLQA 4S39A 5JU6A 3A64A 3AYVA 2VZUA 2J7EA 3OZPA 1LRNA 3MP4A 1A49A 2EXOA 3H2MA 2AL2A 3ECQA 3LI1A 3TR9A 3GHSA 1KBJA 3TKFA 4S2BA 2ZDSA 1K9EA 4HPNA 1CXFA 1FFRA 1V3MA 2NUXA 4L7ZA 4TVCA 5CJ5A 4YYCA 3AIVA 2VX6A 3GXTA 1MUMA 1UKSA 4PMDA 3VABA 3GDMA 4ADUA 3S6DA 4G56A 5JBDA 2X7WA 1GOIA 4AZCB 2NSOA 5JXQA 4PMRA 4U5KA 4BQ4A 4X2RA 2WSQA 3SCWA 2PDPA 1B4EA 1O7AA 3B8TA 3BV7A 3NA8A 3GNOA 2PU0A 3PN8A 3HF3A 4UTKA 1B57A 1AH0A 2HVNA 2YCLB 1YBQA 4H00A 2EF9A 4C90A 3MYOA 3UWQA 4QLLA 2VWTA 3KVJA 1N8WA 2Z4GA 4TTGA 1H7WA 4Y9OA 2CLOA 3ITLA 1K4HA 3VNLA 3WO8A 2OTDA 3LUTA 3SURA 1H50A 4GUGA 3SRFA 4A8LA 1HKIA 4RE0A 4QR6A 4FOJA 3DAQA 3FAXA 3R43A 1HP5A 4Y9AA 1XH1A 1CB7B 4QQUA 4LUIA 5BZAA 1NU5A 4Q8WA 3P6LA 1X6LA 3WF0A 3P5ZA 1NF7A 3W2UA 4MSSA 1V3HA 1E4MM 3GUGA 3GTNA 5CZJA 2XVNA 3MMUA 4AISA 2GDUA 3ABSA 5CPNA 3NCOA 4HQVA 1LWIA 2O4QA 1VC4A 4PN2A 1JRCA 4U28A 3TTQA 2QUMA 4FOKA 3HBLA 1XGEA 1Q8JA 3AU6A 1SGJA 3CLMA 4Q6XA 3V0SA 5I07A 4WY0A 4ACZA 3QOMA 4ECLA 5ABEA 2OKOA 3MU7A 3CZGA 3W7MA 4N02A 4XD5A 3OO2A 2J7GA 1JD9A 2VKZG 2XVGA 4FLRA 4JFTA 3W7HA 4OBSA 5REQB 3OZYA 3W7EA 3SO7A 7REQA 2F2HA 3B9AA 4HOXA 1Q6CA 4JTRA 1BF6A 1JZ2A 3WH8A 2O7QA 1MVYA 3WBWA 3A22A 4UMBA 3USZA 1FDYA 1CGUA 1F61A 3T2PA 1G7VA 4JQ4A 5IDIA 1B4KA 2WBGA 5IHRA 4BCEA 3MI2A 5LGZA 1UD2A 3MZ2A 1BGAA 4UIOA 3GNXA 1GT8A 2X1UA 4FB7A 3PC0A 4GE8A 2JF6A 3Q4DA 3UNDA 1TJPA 1XKYA 2NT0A 2A3CA 3S1XA 1FWTA 3BLLA 2X8RA 1KRMA 1LBMA 1J10A 2VX4A 3L5MA 3EPOA 4MOZA 4CNSA 4XKMA 3HV9A 2QCMA 3MUAA 2GQ3A 2Y70A 4L1WA 4DF2A 4CEUC 3O63A 3AIBA 2CC0A 4CN6A 1DJWA 1XS2A 3BW2A 5HWJA 3QZAA 4JX6A 5KINA 4O50A 4V28A 2B7QA 3LHUA 4B9ZA 1IXQA 3UG3A 5GJPA 4B92A 3C2VA 4C6FA 1EP1A 4YNGA 3R7MA 4CCZA 2PF0A 2ISVA 1NWTA 3L4UA 2AOSA 1ZUAX 1TV4A 3H4WA 1XC4A 4PBFA 1NFPA 4FIRA 2IQ0A 2AKMA 4WF7A 3CT2A 4DBSA 4UNKA 4Y8FA 3TYUA 1EO5A 1JZ3A 1XRSA 2W4XA 3B8DA 3TJIA 1XI3A 1SW0A 4W93A 2V3FA 4JYDA 3GIQA 3PJTA 1QO5A 4WHBA 2OKTA 2PD9A 3T81A 4GZ7A 2VEGA 2P10A 2FDSA 2GJXB 4QDPA 3RCYA 3IJ7A 1XW8A 3DESA 4ATDA 1V6TA 1Q13A 2JE8A 3LGEA 1J96A 1Q6OA 2HJPA 1YTDA 3FHQA 4Z2GA 4L80A 3ITXA 4YLWA 3K13A 3WG6A 1XLLA 3ARSA 3WDPP 4AG0A 2NVAA 3AHXA 3DHFA 1Y5XA 3ALGA 1ISZA 3LV6A 3CPRA 3PY2A 3UPBA 5CEWA 3B04A 4JL2A 4S3DA 3NVDA 1RBAA 1Q6DA 4QGCA 2B81A 1J9YA 3RLUA 5D2WA 1E6SM 2E6DA 1KM1A 1ECEA 1XIBA 4MWAE 1CWYA 4EE9A 4XSMA 1R9YA 3DG3A 5AECA 3SUUA 4XWUA 2Y8VA 4B3KA 3I7QA 5EU9A 1WDQA 2YSWA 3SAZA 4L4PA 3BJTA 3VI2A 5EFFA 1UBPC 1ZBCA 2QCDB 4HNVA 1CGVA 1WV2A 2PZ0A 2BP1A 3LHWA 3W25A 1IT7A 1P1MA 1OABA 2FVMA 3SN4A 1R8LA 1RA0A 2GUBA 4O0QA 4MNKA 4IJBA 3EYPA 3FJLA 4KFPA 4K8HA 3T1GA 4F0RA 1QRQA 4Z2KA 4GGBA 4BQ5A 5DCBA 3U0HA 1PDYA 3CUXA 4DB7A 4W7VA 1NAL1 1T5AA 4UQEA 1J6PA 4PEKA 3AXIA 1NP0A 4I9AA 5ECUA 5EYWA 4D1IA 2DORA 2FH8A 3WBEA 2DIJA 2C14A 2Z6JA 4Q8OA 5CH9A 3RLVA 3AJ7A 5C9ZA 1JIBA 2XWDA 3QGVA 4W5ZA 2ZUMA 3OG2A 4WR3A 3I4KA 3D0CA 2YBVA 5G2IA 1UIPA 4DO5A 4HYWA 2ZUVA 1UHVA 1ZALA 3GWQA 3REQA 4DO6A 2WJDA 3Q58A 1UB3A 2CETA 3GDTA 2WKJA 2Z1SA 3OLDA 3EBVA 2PCQA 1TA3B 4ZFCA 3PPHA 1B31A 3S1UA 5K2ZA 3KZSA 2PBGA 3W1AA 3AI0A 5F2LA 1POJA 4OWGA 2Q8LA 4KH2A 1TMHA 3N2CA 4WZHA 4MTVA 3ZVHB 3L2IA 2J9XA 1TTJA 5FEXA 5CCZA 3ARYA 4CQCA 4CU6A 2RGLA 3CIXA 2XISA 3UW6A 4JEJA 2XGIA 2ZYFA 1MEWA 1W17A 2EPOA 3UXKA 3RM8A 3OIHA 4XKYA 1P6WA 1IYXA 2PWDA 3FGCB 3JS3A 4HMDA 1B3OA 1KBLA 1ICSA 4LALA 3AU2A 4GC4A 3ITOA 2Y1HA 4QTGA 4ERAA 1LF1A 4GACA 3W38A 3F2CA 3FXYA 1R9XA 3RYSA 4KQNA 1ADDA 4R3UA 1RP8A 1XRVA 1FKXA 3AO0A 5CSYA 3D6NA 1OSEA 4O17A 4LYKA 1K6AA 3H4XA 1WDPA 5D2TA 3WQEA 3W1XA 3HM7A 3HMJG 3LM3A 2WJFA 5F2GA 4EXQA 2MNRA 2XVLA 5D2XA 1EGVA 4NYUA 3SB0A 3L4YA 1W3KA 1W3LA 2VGGA 3A5VA 3G1AA 2A3HA 3WD3A 2G37A 4V27A 3TV8A 4ZSTA 1PHWA 4DWSB 4Q4QA 1AL8A 2J13A 1GVOA 4UNIA 4E8DA 2YXOA 2HNEA 4AVOA 3WQ8A 1M65A 4CN1A 3ID7A 1HJSA 4UXDA 5I3HA 1BF2A 4N2YA 5D2YA 3FYOA 1OADA 1MXGA 2CERA 4KW2A 4R7OA 3AFBA 1QPKA 3KOFA 3LEPA 1ME7A 4Y96A 3EKZA 2W63A 3IJQA 1ZPTA 1S2WA 1ZS2A 2VQUA 1VJSA 3H7UA 1FUYA 3ITCA 1QXLA 3NYDA 1EJSC 1XD1A 3ERPA 3M0JA 5C6MA 3G0XA 3DBPA 1S38A 4IMDA 4ORIA 1UR1A 2QT3A 4C6NA 1GOQA 1S5NA 2QCGA 3PZIA 1LG2A 1T0OA 3F1QA 1BVNP 2C7FA 4OECA 3VIMA 3RO6A 3FDGA 4PUNA 3I4EA 3WLMA 3QM3A 2D69A 4FP1A 3STPA 3PP7A 5C9XA 4EXBA 3IEBA 1S2CA 2C0AA 1PZ1A 4E3TA 3RRXA 5D8ZA 2VI0A 3UY7A 1C3FA 4FNRA 3IVSA 4RX0A 1OINA 1H5VA 4GWEA 3OLEA 2HK1A 4EP8C 1J4EA 3PPGA 3A13A 4R9OA 1XD0A 4DNHA 3M41A 4L64A 2IKJA 1DQXA 3N25A 3OW1A 3AROA 1AQFA 2EEXA 1AH4A 3BXWA 3IK4A 4LCRA 4CQ9A 1EUAA 3EB4A 2ZADA 1M03A 4PCTA 1SMAA 1JPIA 2J9ZA 2FIQA 2INEA 1G94A 4HZMA 1KM0A 5HWMA 4KRTA 5DXYA 3UVIA 2Y4SA 3WF1A 1R87A 2I5QA 2QPXA 3WD0A 3RGTA 1FH8A 3PSVA 1XCXA 4UZUA 5G1YA 1DPMA 2XFFA 4MLRA 1K03A 4ZO9A 4WX2A 2HNHA 2VP8A 5D38A 2CZEA 4KEZA 1L8NA 4FXSA 2E68A 1VFFA 3AXKA 4JY9A 3GS6A 3MP3A 5KZDA 4PRTA 5BRBA 4A8IA 3W2JA 1VP5A 3S3GA 3NOYA 3TJXA 4KWSA 1Q7MA 1TWDA 2WJEA 2A1YA 2A5HA 1UZDA 3KBJA 1EIBA 1VFOA 5ABTA 1Q63A 1EDTA 2HCVA 5AC6A 5LNWA 4AD1A 4U3CA 4O16A 2OOFA 2YDQA 2Z7KA 3RILA 1JJKA 4LU0A 1WNOA 1H62A 4IPJA 3LTPA 3W1RA 2ZBTA 3KHJA 4AZGA 1QNVA 4XZNX 4H3DA 4HT3A 1AMKA 4E0CA 3F7JA 3MWCA 3CPGA 4LX4A 3UXDA 2XSXA 4F8XA 4L4LA 4PCFA 1HJUA 2W66A 2HXUA 2OOGA 1HGYA 1OC7A 1QI4A 2OCZA 3WQWA 2VOMA 4AEEA 3H26A 3PTDA 3FFSA 2PRMA 3TCEA 1TPFA 5CC6A 4UQCA 4FR6A 3F4CA 4RV3A 3QYQA 5A6AA 4QX4A 3MKVA 4H8VA 3QHNA 4WY0F 1HN1A 2XN2A 3C0QA 5HK4A 3TC7A 1TUFA 4CD4A 3T2OA 3O6YX 1PB0A 3NXLA 2RJGA 1XBVA 4ZO7A 1H0GA 1I4NA 3CWOX 3EDFA 4D8ZA 1KWGA 1E73M 2O4MA 5C8BB 3WNLA 1BEUA 4AEOA 7CGTA 2W5FA 4RCXA 3ZSTA 2VR5A 1Q6GA 3LDVA 3XISA 2QJIA 4HTYA 1A0CA 1QK2A 3TWBA 1BTMA 4AMAA 1DIOA 4NNAA 1UKOA 4UZSA 4LCQA 1ZZMA 4GYPC 1QMLA 3WK3A 2GGJA 1J0HA 4BI6A 1CGXA 4GYKA 1DORA 3VU2A 4JQ2A 2QNEA 1C8QA 2J9YA 1S3HA 1E4NA 3D46A 3P2VA 2FPTA 1XPYA 3H54A 2Y61A 5ABFB 4U10A 3N18A 2DSZA 3DOPA 4UFHA 1GOKA 3SCTA 3MO4A 2J7CA 1ZFJA 1SO4A 1VBRA 4ZOBA 1K70A 1Q2RA 2CHNA 4C6JA 1FWJC 1E56A 4I6VA 3GYEA 4RR4A 3IIOA 3KM8A 2GFTA 1E6PA 2OXNA 2QZRA 1OG6A 1W54A 1R3VA 1PX3A 2VZOA 1QW8A 4BF7A 5HPOA 4E2VA 1R2TA 1D7KA 4UC5A 4H6QA 2F9RA 2I7GA 3I6EA 3RPTA 1YLVA 1UOKA 1FCUA 3PBMA 1D3GA 1LRTA 3MKKA 3LMZA 1SM9A 1FQ0A 4PRRA 3C4UA 1P0EA 1K8ZA 5LA0A 2XZ7A 1SO5A 3ES7A 4D6EA 5TD4A 5CQ1A 1DBTA 2XFWA 1UWIA 5CPOA 4IP7A 2GUYA 4WD0A 3W9ZA 3N19B 1EP3A 2GVYA 2J27A 3Q45A 3M43A 5C2XA 2HS8A 1QNPA 3JZEA 3OVQA 4Q7NA 3O05A 4DJFA 2J8GA 5GQBA 1B3XA 3OBKA 1C9WA 1EJTC 4RK8A 5LXEA 4IP4A 3URNA 1H7XA 4I90A 1EF3A 1YHTA 4DAIA 1V93A 2PA6A 2PRLA 4C7FA 6REQB 4H9TA 3E38A 4FAMA 3GR4A 4F2BA 3IGHX 2YB4A 1JCTA 1HUVA 1RQHA 3HQ1A 3KOZA 3H2NA 2E1WA 1W31A 3L0KA 3DX5A 1SR9A 3CH0A 2ZRXA 5D37A 5DY3A 2WWDA 5KZEA 1LT7A 3ARVA 4JTIA 4ML4A 1LORA 2E9BA 1UQYA 4ATLA 3Q37A 2G41A 4GJIA 4QJ1A 4EVZA 4Y6GA 1GVEA 1KBKA 3BJFA 1X6UA 2O55A 3QZ6A 4M29A 1SMDA 4IICA 4P61A 3BLEA 3T9PA 1YDNA 5CZSA 1UASA 3W24A 4G7EA 1BKSA 3OYZA 4R27A 1E0VA 3CO4A 3TFXA 1PJ9A 3T42A 3CB3A 1XLKA 2AQWA 4B5NA 3WEZA 1QHPA 1IZJA 1WBHA 4B5TA 1DWAM 2X16A 3WLHA 3P60A 4L9ZA 1KCXA 5BU9A 3PZTA 4U3AA 4HCLA 1KBBA 2CBVA 1MI3A 4MYAA 1EGMA 4BK9A 4H9VA 2C91A 3DGRA 1OQFA 3WLOA 4M6UA 2D3NA 1JYXA 4H9YA 1AK5A 4XAFA 1BYBA 4AIOA 3TTEA 2HWGA 5A6KA 3W7GA 5FJIA 4HNOA 5FSDC 1LLOA 4JY8A 1OFOA 1LL7A 2FVLA 1TPVA 1DJGA 3BSMA 1ZJHA 2CIPA 4LAOA 1KM6A 3EX2A 4GI6A 1N7KA 2VX7A 4IIEA 4S2CA 1EP2A 4LUTB 2QS8A 4Z1DA 3RM4A 3PFMA 2OWCA 5HJXA 4IIFA 1D2KA 5E1QA 4GXWA 1AFSA 3W73A 4FK9A 5D02A 4M5PA 2JKAA 4KERA 4XBKA 4Q7BA 1E1EA 4XG1A 1XCWA 3VDCA 4HNCA 3N1AA 4NP7A 1CXHA 1ZGDA 2FZDA 2VO5A 3SFKA 4MFDA 3URBA 3FEQA 4HHHA 4A2SA 2Z26A 4Y9NA 1NARA 2XIMA 3UZ5A 2FLIA 1K02A 4AVNA 4J2PA 1GQLA 5JUVA 1VLIA 2YXGA 3K2GA 1MEHA 3GNNA 1D3HA 3DI0A 3RLGA 3FX4A 1VBUA 2B31A 3T05A 5G5IA 4MF4A 3HGSA 1ZBVA 5AZ0A 1CT5A 3VGHA 2D23A 5HNUA 1F8MA 4UFKA 2XWEA 3S5ZA 1MW0A 3NQ7A 3JZUA 5BOFA 5IXEA 1HVXA 3VKKA 1M9HA 4NX5A 3NUKA 1KTCA 4AZBA 1B30A 4N6EA 2OEMA 2XGZA 1PPIA 3N4EA 4ZFMA 4DVOA 3L12A 1O5XA 1A5NC 4LVGA 1MW2A 4YPJA 1CXIA 1U1HA 3SUSA 1SFLA 1TWSA 3RAOA 1AVAA 3THDA 2XM2A 3EMCA 4L4OA 2X30A 3QR3A 2V2HA 1YIXA 1ONEA 3CQJA 2CLEA 2P76A 5AOUA 2P5NA 4PUKA 1UR4A 1RY0A 4PMXA 2FGBA 4H2CA 3QRHA 4HN8A 3NNTA 1N2VA 1OFBA 3G6LA 1CNVA 1EH9A 3SDOA 3UJSA 1SFTA 2WNQA 4NT0A 2VM8A 1E1FA 4CEXC 4XAYA 4F79A 4CKQA 1U5VA 3TN4A 3BLPX 5CC5A 4PCPA 4TQTA 4EANA 3PBGA 3CZ8A 4F0LA 5BW6A 3A3WA 3M4HA 3W7NA 4OJYA 4GQBA 2C6QA 4TR9A 1VBJA 4QDWA 2VC7A 4XIAA 1E0TA 4H19A 2IKGA 2W27A 2WHLA 4AC1X 2CYGA 1IEWA 1JGMA 4ORMA 5A6TC 3WQPA 4R53A 2VELA 3RUBL 1L6WA 3DG7A 1F8IA 4IG2B 3FOKA 1TFVA 3S2MA 2XH4A 2UY4A 1I2RA 2R91A 5JBFA 1XKJA 4LUSB 1X96A 3N6JA 1XLBA 1LWHA 4O1AA 1JPKA 2QHAA 4NJJA 2CBJA 3EAUA 4D6IA 4E4UA 3SJNA 3C8FA 1XYZA 2TYSA 4PTNA 5FJUA 4PR4A 1V02A 1LWJA 2DH3A 2CPUA 3W75A 1EJWC 3QW3A 1SFSA 2PC4A 2WW5A 1JZ7A 5B7YA 4W85A 3N6HA 3AIQA 1WA3A 3OODA 4BI7A 1M1BA 1XIDA 3ABQA 1G0CA 4TMBA 3B4YA 4O52A 4N4QA 4ZA0A 4ZGYA 4OUIA 2YCJA 4FXFA 1MQQA 3NPWA 4LVAA 1RV8A 2OO0A 4PODA 4G1NA 4BS0A 1WBJA 3OZMA 1QAPA 2PC8A 4GZJA 5C70A 1ONXA 4WEVX 3P8JA 2BNJA 3U7BA 3SEPA 1GOWA 4GUJA 2BY1A 1T8QA 4YWSA 4NJGA 3IJ9A 5C71A 4NX0A 3GVVA 1PIIA 3WDHA 4CD8A 1LM1A 2GLKA 1E72M 1XIIA 3CZLA 4QLKA 2RHGA 3G18A 4UTTA 4NASA 2WO5A 5I3GA 1SU5A 4B2DA 4KT2A 3NTYA 2PDHA 3B0PA 4WKHA 6XIMA 3R13A 4RNJA 4AZ5A 3BTNA 1G4PA 5DMMA 3LCHA 5K7JA 3NZQA 5M1TA 4HPHA 5H91A 1RR2A 3LLDA 5I78A 1AZ2A 1WXZA 5E0CA 2ACSA 2VEKA 3VIOA 2OX1A 4IGMA 5FI8A 3GBEA 1VB9A 5EBAA 3WH6A 2GQ8A 3DFPA 1I60A 7TIMA 3MSGA 3QJAA 2OGYA 4OU1A 1G9HA 3SCRA 4DZHA 2TSYA 1W37A 5LHEA 4NXKA 4US5D 1CTNA 1MRQA 1XXXA 3JR2A 3NZ1A 7TAAA 2F2KA 4UFJA 4UTWA 3QW4B 1PTGA 1O5KA 3MSDA 4ZQCA 5F2IA 1KR1A 2ZZ7A 1UWUA 1XLEA 3WDIA 2ESCA 3WN6A 4IFKB 3S0CA 1GG0A 5AVHA 3M9YA 1QPQA 1L9WA 2Y5EA 3UR5A 1ME8A 2ACRA 2EPLX 4MMWA 5LIYX 3ZJKA 4QHRA 2VVNA 5EBUA 1OT1A 2ZX9A 2DH2A 3QSRA 3W87A 3OHMB 5AN7A 3T09A 4JPGA 3T55A 3PWGA 3K8MA 3WX7A 1KFLA 4HHLA 3LLFA 4S1FA 4DUWA 1K7FA 3C3UA 4K7VA 1DJHA 3DHDA 2QUNA 3DZ1A 3N73A 3ZT6A 1EJVC 3NQ6A 4DRSA 3W6MA 3T0TA 2E1DA 5DN1A 3VKCA 4UNLA 4W84A 3RMEA 3RX3A 4CD6A 3H2EA 2AL1A 3KEHA 4FI4A 4JTJA 1HJWA 1QFEA 3HN3A 3WF3A 4PCSA 2F8QA 3THUA 4GMEA 4TIMA 4W4QA 1WZLA 2VEMA 3BICA 9XIAA 4W8LA 3MPGA 5DELA 3M0VA 3RJXA 1MEIA 2HPIA 2EPKX 1EZWA 3CHEA 4DXVA 4LUJA 1TSIA 1UPMB 5G1TA 3RN6A 3WUBA 2ANUA 1W1A1 4MDPA 1OYBA 1S5WA 1PWMA 3GC2A 3IIVA 1W9BM 3TC6A 4GVFA 3FV9A 3O1NA 4GH1A 1YPFA 1XRFA 4FXJA 3G77A 2PGEA 5GVJA 1XSIA 2DQXA 1QOQA 3QMTA 3W86A 4ADSA 1X8CA 2C71A 5FACA 2ZICA 5K3VA 1TR9A 1K9FA 4B91A 1FCBA 1V6YA 4HMEA 3THAA 1PKYA 4QAIA 3S2NA 2BVYA 4NXSA 4DWSC 4DPQA 3OVRA 3S5NA 1DEDA 3UWZA 1CI1A 5C5YA 1M01A 3GG8A 3OP2A 4W7UA 3KRUA 1FWCC 4C6LA 1WDWA 3GM8A 3V1HA 2GDVA 1T96A 3K1DA 4ZQPA 1UIOA 4XZBA 3GAYA 4K1WA 3MHGA 2EQDA 1QHOA 4JZ5A 1G6CA 4JHOA 2BHUA 1YE4A 3M47A 1CB2A 1US3A 4ADTA 1DWGM 4JCMA 5F7UA 1TQXA 2ZZ3A 4NHVA 3TNOA 4AMCA 3URAA 1PKMA 3UT0A 2FPYA 4JTTA 1QT1A 4HK6A 4BQ3A 2DIKA 1WDSA 1A4MA 4IOTA 3WF2A 3O6DA 5JH2A 3T7VA 1IWBA 3RFAA 4J1OA 3A5FA 1KQYA 2WC4A 4QEEA 3G8RA 4QG8A 1UMLA 2C18A 2J6VA 3EDEA 2I16A 3T2QA 3W1NA 3PG8A 3F4DA 1E6NA 2POZA 2PBOA 3BAIA 5IOBA 1KKOA 3BMXA 5A2AA 3MVTA 4GXPA 1C91A 3QFEA 1VBGA 3HIJA 3MHUA 3HPFA 3GW3A 1SUXA 4GBDA 4MB4A 2XH7A 1F4HA 1L6YA 2NZLA 4BR1A 3BCFA 1Q7ZA 2W91A 1IR1A 1UWAA 4TVDA 3P3BA 3ITVA 4KEUA 3UESA 5CBBA 1EPVA 4JTDA 4KCVA 3SGGA 2ZUTA 4QSHA 3ZLFA 3RDKA 5IBXA 1F3WA 3OBAA 1I9CB 2G3IA 4AY7A 3H4GA 1ZP3A 3NEVA 2PMQA 4GX9A 1IT0A 1V77A 4CN4A 1UR9A 3KRSA 2J66A 2WMIB 4K2SA 3WNOA 3LN3A 4XD3A 3CHDA 5JVLA 1QPRA 1YNPA 1UR3M 3C0LA 1MXSA 1R2RA 1HL8A 4IIGA 5LA2A 5TNVA 1F73A 3I68A 3NGFA 7ODCA 1IEVA 4JXCA 3TU9A 1GVYA 4YVVA 2XG9A 1W9VA 5J04A 1DYSA 3CZKA 3QEZA 3VC6A 5DXXA 3VFCA 1DWIM 3E02A 3FNDA 3BCJA 1OX6A 3IV8A 1VHNA 3NAVA 4PFMA 2BXYA 4PUMA 2Z7GA 1XIHA 3RCMA 5REQA 4K8EA 2A7NA 4D71A 4DF0A 3OEXA 3EWXA 3N12A 4NAEA 3ZR5A 1SZGA 2QJJA 3GH4A 3PK7A 4ASTA 5HNTA 1RVKA 3RIKA 5HATA 3SGZA 4FLOA 4HD5A 5FCZA 3BMWA 4MIMA 2WVVB 2FHCA 3TW6A 5E6YA 4I5XA 2I57A 5HMFA 2AGTA 1R3TA 1R3SA 3IACA 4E2OA 1TREA 4IM4A 3MDWA 3T0DA 3C86A 4P7QA 1W1ZA 2YDAA 4K37A 4IQDA 3NR0A 2VFEA 3A9BA 4XVEA 1KW1A 1DHKA 2CESA 2DSKA 5C9RA 3H2CA 4HMNA 2J4GA 2V5LA 3VGFA 3U2CA 4JAWA 2D0FA 3STEA 4C6KA 4F0MA 1TJRA 2ON3A 1AA1B 2QEZA 4C6QA 2ZRUA 2DY3A 1RXOB 3HGRA 4JTAA 1FWEC 1E0UA 5AZ1A 2JGQA 1PX4A 1EWEA 1JYWA 1V03A 2ZFAA 5AKQA 3N9KA 1XBYA 5IFPA 2C1HA 1S1RA 3ZXWA 3UGRA 8RUCA 1YMYA 1JYVA 3LNPA 3L7RA 1TVPA 4H2HA 4TX9A 1KO0A 1IEIA 4C6CA 4I8YA 4Y9PA 2PDXA 2YB1A 1QW7A 2DZUA 4RDVA 4XVDA 4AUBA 4FALA 3WQOA 1T99A 4NUWA 1TZ9A 4FX8A 1GJWA 5EB8A 2PPGA 4F9JA 1POKA 4K8GA 2QJMA 3MV11 4HSHA 2Y85A 3W0KA 1D8CA 2YDSA 2B0MA 2E9MA 2PTYA 2HZGA 3WLKX 4KS0A 4AU0A 4KCWA 3WL0A 4NL1A 2FVKA 1PUDA 3PZMA 4DJDC 3ONCA 3XINA 5MKGB 1JQXA 3E96A 1EBGA 4HJWA 2XN0A 2GJXA 1SJDA 2J7BA 3TXZA 5T26A 1Q45A 3ZQ9A 2ZOXA 4O1CA 2Z25A 2VC5A 1UMYA 4JHMA 3O15A 2IXUA 2J8TA 4XD4A 4DXXA 5FESA 1TRIA 1S2VA 4OUEA 4U4MA 3W37A 4MWAB 2H6RA 1FCQA 2X1SA 4K7YA 4JX5A 4P7LA 4WGXA 2VRJA 4DYJA 5LA1A 2GPTA 1YXDA 4S3AA 4JICA 1OCJA 1ZJIA 1VPXA 1W9UA 4QG6A 1G4SA 5CJNA 4ZB0A 2WQDA 3QYSA 2NXGA 1JUEA 4ZTXA 3PG9A 4KGJA 4DEFA 3IUIA 2R82A 3TAOA 4XBJA 2TPSA 3V75A 3USBA 4C60A 1Y7VA 1ZCOA 3MMWA 4NKCA 3P80A 4GZIA 3WLTA 4YXGA 5HOSA 1F6PA 6CGTA 1FRBA 1LCOA 4Z2HA 1Z3NA 4UQDA 5EMLA 4PMZA 2FGZA 3WH7A 2ZXAA 4J3XA 1KKRA 4ZE4A 2Y2WA 3B40A 3FYYA 3LSBA 5XIMA 1IIHA 3S1VA 5BCAA 3I10A 3S2CA 5AYYA 2E5CA 1REQB 1E71M 1XYLA 4G7FA 3VNYA 3W2MA 4G9PA 1LLWA 1W3IA 5AB3A 4HA0A 3OGRA 1H2JA 5C9UA 3G22A 4GNJA 4KWWA 2XSAA 4BQ2A 3DG6A 3K4DA 2I17A 1J2WA 2IQTA 3M6DA 1ITUA 1UZ1A 4K38A 4YN5A 3DECA 4HJFA 3A3XA 4NSBA 1WQ5A 3CIWA 2WM1A 2WZTA 4JDBA 3IIZA 4EPBC 3D3AA 4J4KA 1MFVA 1JAEA 3CH9A 3HO8A 3AHVA 3QR1A 1ITXA 1TV2A 1EHAA 3SCOA 3VOGA 1I2PA 3VD4A 2QQ6A 1OZQA 1W1TA 2KX9A 2X1IA 1YXYA 2CZFA 3ZOAA 3EB2A 2HBVA 2C13A 3KVLA 2ZTKA 5H2ZA 1S5VA 3BWWA 1Z42A 2RUSA 3R0UA 1UD8A 3GXFA 2NX9A 4OBTA 2FFIA 3PZUA 2G50A 2WSRA 5FF0A 5DEZA 3EEZA 2DUAA 4NF7A 4HA4A 1PEZA 5DO8A 4M0XA 5HAOA 4A3QA 2DZTA 1HXJA 1QR7A 2YCKX 2YL6A 3OIXA 4LVDA 4G2DA 1U83A 3W74A 2VNCA 3DI1A 4DO7A 2E4TA 4R34A 2DGAA 2QAFA 1S2UA 2Z2AA 1KTNA 2D2GA 4DXKA 1KB3A 3APYA 3AXHA 4ZQRA 4MHBA 4EAYA 3CV1A 4NJKA 4CD7A 2V81A 1TE1A 4B16A 1DIDA 1EZ2A 2YL9A 4DM1A 2ZZ1A 4L65A 4KGLA 4M19A 2P8CA 1AJ0A 1JRBA 1TTQA 3M0KA 5A3HA 2VRQA 4O14A 2BASA 1HIZA 4GJ1A 3WH9A 3JU2A 4GQ0A 4UMCA 3AXXA 4RUBA 2Y5JA 1WAUA 3LXCA 2E25A 1FDZA 2A6NA 1NOWA 2E28A 3T4CA 4DWSA 3GXNA 4WJXA 5DY2A 4WUIA 4QCEA 2V5CA 4LAZA 1XLGA 1G67A 4MZ1A 4Z2IA 4G6CA 3INPA 2Y7EA 4B4FA 1SSDA 4PULA 4UTHA 2JEPA 4TTUA 4IGHA 2REQB 1OT2A 1B9ZA 1RJPA 5M5DA 4MNJA 3MI3A 1GVFA 1WB0A 2VZVA 3F5LA 3QOKA 3A4AA 3LG3A 3TDFA 1JG9A 2OX4A 1A4LA 4AZ6A 4IPLA 1JDCA 4UQBA 4RE3A 4M1RA 1JNEA 2YXXA 3CV2A 3NPVA 2P8BA 3LV5A 2GOKA 4GBUA 1H41A 4ZL1A 1M53A 5BXRA 2DVUA 2NWSA 4E6MA 1V0KA 2GSEA 1PV8A 5KTLA 4HHMA 1MFUA 2J74A 7ENLA 5TAOA 4MKSA 3QPEA 4YJ5A 4JTCA 3LXBA 4XB3A 1DL3A 4GXMA 4IMCA 4QE4A 5EMMA 3CHFA 3NGJA 4HP5A 2VYOA 4DJEA 3KZPA 4AWTA 3R8GA 1PSCA 2ZUSA 3WLNA 4OQVA 1H09A 2R1LA 3EB3A 3GC4A 2BB0A 4LRSA 4PMYA 3B0UX 4UUIA 1JDDA 4DBWA 2PB1A 1ZRQA 2XTKA 5GNYA 4AY8A 2IPJA 3GRIA 3HU7A 2D0GA 1BSLA 4GCAA 3TYEA 3M07A 4I7VA 1JCMP 4AXKA 4A3YA 2E6FA 4FLSA 1YBQB 1O5QA 4F9DA 4B9YA 2OFJA 2ZZ6A 2EJ1A 1LT8A 4H8NA 4KFOA 2BFGA 1DHPA 2VT0A 3MTWA 3T8LA 5C55A 2XN1A 5BU6A 3ZT5A 2DT3A 2I9EA 2Y7DA 3RHGA 1OX5A 4UMAA 1HJXA 2C8NA 2Y6ZA 1TG7A 3ARTA 3KP0A 2R24A 2GVGA 2HEJA 4JGDA 6XIAA 3AJXA 3WDJA 4FX6M 4ZO6A 2VCBA 2FTWA 3SBFA 2F7FA 4JHZA 1J5TA 3KTCA 8TIMA 2VQTA 1ML1A 5FKYA 4Z1BA 4P8VA 3C2EA 3CNYA 2B7NA 4CNUA 4DX3A 3I7SA 2D2OA 1JDFA 1UC5A 4ERGA 1PHQA 4LQ1A 2VEIA 3TOPA 3T0BA 3TEVA 3MW7A 3BLIA 4ZTYA 1OYAA 4AWEA 2QCCA 3PJXA 4C7DA 3STFA 1D9EA 3WLRA 1H61A 3TLQA 4D8AA 4C1NA 1KXHA 1X97A 2VD8A 4QDMA 4AHPA 2BHYA 4ACZB 2QLYA 2VXNA 5JQ9A 4BEQA 1DOSA 1QVBA 5CBIA 3WYZA 4PB3A 4AVFA 1F6YA 4AD3A 1W3NA 1XYMA 1ECQA 4O4WA 5JH1A 1K1DA 4IMEA 7REQB 3WJSA 1GNXA 3MDUA 1ISWA 3Q2DA 3CL8A 1M41A 1DXIA 3LM7A 4WSKA 1QASA 4O8RA 4LV9A 2D20A 1TWWA 2GGIA 3EOOA 4H9XA 1BFNA 2ZUNA 4IUGA 3P0WA 4O28A 4NY2A 3OZOA 4PL2A 4A3HA 1EPXA 3VNDA 4X9YA 4DO4A 1ZP4A 2R8WA 5IFTA 3NPXA 4GVGA 1RZMA 1PL9A 3WBXA 3BURA 4ZODA 1IZKA 3SUTA 1V6UA 2Z24A 2Z1XA 1NDYA 1V6WA 2PDUA 5KMYA 1ALDA 1OHLA 1S46A 2VCAA 5A8MA 3VDAA 1KFKA 3SN1A 3G24A 1UPPA 4UWMA 3UCQA 5CGMA 3SI9A 4O19A 3G1SA 4RXFA 2PDWA 4PZVA 3U9IA 5B80A 4CQDA 1W1VA 3BQ6A 3ONBA 1KC7A 4ALDA 2NQJA 3N2OA 4OOUA 5CPLA 3N2BA 3VE7A 2HVOA 3SJ3A 1GZJA 3P74A 4PUWA 3OVGA 1XRTA 3W71A 1V3JA 1BRLA 3PWIA 2GVJA 4HK5A 4GY7A 3BAKA 3UZJA 1XQKA 4W7WA 2VGIA 4DJDA 4O15A 1UP2A 4LAUA 3UGVA 1C8XA 4Z2JA 3GNRA 4C6MA 3Q65A 3VKDA 3OA5A 1MW1A 2YDRA 1AMYA 4QXIA 1M7JA 4PL1A 5E09A 2WB5A 3FIGA 5DX7A 2GL5A 4MLJA 2WV8A 3PZGA 1GOMA 2WCGA 1LJYA 3NL6A 1TX2A 3QF0A 1QNRA 3LY0A 3QGAC 4C6BA 1CGYA 3AIRA 2PWEA 4JTSA 3RU6A 2V69A 1LG1A 3UZXA 5T9CE 1R6WA 3BLKA 3C2YA 2X40A 4CGTA 3BO9A 2J7HA 1B0IA 1RQEA 2F6UA 4YL2A 3LHTA 1FWSA 4JIHA 5CPTA 3UPWA 4HGXA 2OO6A 4IPPA 4YWIA 4O1FA 3WD2A 4ATWA 1W1B1 4Z42C 4DWSD 1GONA 5FAJA 4YVPA 4W8BA 3BK0A 3TQ0A 3NPUA 3MB9A 3GU2A 4LBSA 5C2GA 1TELA 1XDJA 1YNQA 2I1OA 1O68A 4ROQA 2Z1KA 3PANA 4KWUA 4A21A 3U2EA 5T91A 3HV8A 2NQ9A 3G1DA 3QC0A 4MJ4A 2V5DA 4RZ5A 2W61A 3L67A 2E77A 2PDNA 3PBVA 4KETA 3W00A 4HPXA 3WUGA 3PTMA 3LERA 3QY7A 3EMZA 2MUCA 2O92A 2WXDM 4XZ9A 5HDRA 4KRUA 1EDGA 1BLIA 2WZEA 2E6YA 2VUNA 1OD8A 1HQTA 4S3KA 3RG6A 5BROA 5I3FA 1UD3A 4M51A 4O8AA 3L66A 1E1CA 5BNKA 3DCPA 4J7RA 5CAHA 1IT8A 1C8YA 3NWRA 3OG3A 2R1KA 1PIFA 4YVXA 1XYAA 4LAKA 5AHLA 4W5UA 3W1TA 3VILA 4DAFA 2NWRA 1FTXA 1MMFA 2ACUA 2CXEA 1PCWA 3WH5A 2V68A 3WNKA 3QMRA 4IH3A 4BEUA 4LUYA 1A3XA 2E3ZA 2ZE3A 5A8NA 4J5NA 5G2WA 3BG3A 2JIWA 1XBZA 2MANA 2BVWA 5HUPA 1C29A 3SCUA 3CUJA 1OJXA 3B3DA 1UA7A 3HA1A 4Y7EA 3L4WA 2WLZA 1AH3A 3ELFA 4C6EA 1DTUA 4LY4A 2QCFA 3F03K 3WD4A 1QWKA 4M80A 5DFAA 1X39A 3QKZA 1KA9F 3WF4A 3XIMA 3REQB 3SRHA 4L6OA 2HBXA 3E3HA 1DWFM 1UD5A 5G4HC 3VKAA 1V79A 2J7FA 4CQ8A 1TWIA 1GW1A 3C8NA 3OQ8A 2VEFA 3EWWA 1IEQA 1W3HA 3RM9A 3SCPA 3V0UA 2HE8A 3E6EA 3RCNA 1TJ2A 1KXQA 4C6OA 3P93A 4O1DA 4POCA 2B7OA 3R1ZA 3AUOA 1XIEA 4I5RA 4JYFA 2NVCA 3ANUA 2JK2A 3GXIA 2WMFA 3MSYA 2QUUA 4IJRA 4ICCX 3U57A 4CCDA 1ISVA 4Z1AA 4XKYB 5HJYA 3N15A 1ZTVA 3FDKA 5K4ZA 2GVLA 4RJEA 5T9BG 2ZX5A 1YE6A 1XISA 3CQKA 1YX1A 1TCDA 3T44A 5D30A 4AD0A 1FBAA 5DF0A 3FEMA 3GW0A 3ZM8A 2AAMA 1W5QA 3P84A 2J88A 2V0TA 5HINA 3IS4A 3PUOA 3W72A 3S47A 2H8ZA 1KM4A 3S2LA 3QFWA 5I2UA 2VZTA 1FWNA 3LTSA 1XV8A 1U1UA 3IPWA 3VYLA 4C6IA 3K30A 3TX9A 1XG3A 5FF2A 2FZ9A 4BJHA 1CGTA 2V5JA 3DXIA 1W6TA 2ISWA 1Y8BA 4NI8A 4HNTA 4UFMA 2Z6IA 3JRKA 4AD2A 4Y90A 2GJPA 4WXYA 2XINA 1MQRA 4IFOA 3SQLA 5LNSA 2DW6A 3BE7A 1HG3A 5FA5A 2JQXA 3NG3A 4UTJA 2GGHA 3VIIA 3S6OA 4NG3A 4RPPA 4C6DA 2ZWZA 1MUWA 2PLKA 4W8AA 3VD5A 5LSMA 4R7WA 1IR2A 1AW1A 3WMSA 1Q4NX 3QV8A 2OQHA 3H2FA 3BOFA 1BYCA 1A0EA 5BRQA 4F2UA 1UUMA 4FMVA 5I77A 4XISA 4Z1YA 2FQIA 4W87A 1B5TA 3EX6A 3W26A 5CG0A 2E8ZA 5KZ6A 3LQGA 1LDCA 3WJZA 1JUBA 1C7TA 1XDLA 1M7PA 5KITA 2FMOA 2XM1A 3W01A 1XSJA 3VNIA 4UTUA 1PAMA 3GE7A 4K39A 3GNDA 1RP9A 5HQMA 5D09A 1WKFA 3K46A 3HFYA 4DJDD 3VCCA 5A6SA 4QG9A 2BS9A 4R7JA 4ZOEA 1EYWA 3MP5A 2NLYA 3HJEA 1QU4A 3M0IA 3UG5A 3WQDA 5K9CA 4QE1A 8XIAA 4GC3A 4Y8EA 3E2VA 1E40A 2YL8A 4LUSA 3TYAA 4L1XA 1JF5A 2CWXA 2CLHA 3B8IA 1TV7A 3N9RA 2V6AA 1XLAA 4S3EA 1PZ2A 1U1JA 1Q7QA 1KCKA 4FR1A 3ZWTA 3H70A 2ATMA 3VDGA 1ICPA 3SQMA 3WUEA 1WOBA 1WXJA 6PTDA 1GZGA 3OU8A 4I9JA 1XBXA 2XZ9A 3AIEA 4MUZA 4HNUA 3H24A 4NZJA 3W2NA 1H60A 4NJHA 3EZ4A 4PSPA 2DQWA 3LU2A 3S9ZA 1CXKA 1QK0A 1YQ2A 1JPDX 2BG5A 2BVTA 1OG0A 2G95A 1V6XA 2O9TA 1R3YA 2IXVA 4H8UA 2YJQA 3HG4A 1KRBC 3GD6A 4EIVA 2BSLA 2PDKA 2O7SA 4PTWA 3CQIA 4J3WA 4L1GA 3UNTA 4CU7A 3TZNA 3PHAA 4M6QA 3VUSA 3N14A 1JXKA 1VAHA 1XX1A 3CAKA 3NDYA 5LIXX 2CHOA 2OSWA 3ZZ1A 2ZRZA 4F4RA 4PBEA 2BGSA 2NW0A 3VZZA 2YYUA 5LYRA 3GTIA 3M7SA 1RJRA 2DZSA 1UG6A 3SADA 4EKJA 1SFJA 4WJEA 3BARA 3L68A 3KCOA 1RPKA 4MWAC 3FCPA 2DT0A 3LSCA 2QDDA 2RFGA 1P6BA 2DU2A 4RZBA 4FZIA 3IVTA 4H7ZA 1F3EA 3W53A 4V15A 3M5YA 3AMDA 1RA5A 4NI3A 3R6IA 2PWGA 1W5MA 1J12A 4FHAA 2Q09A 2P0IA 4B15A 3NXFA 4H9ZA 4WLCA 1ME9A 3WK0A 1JI1A 3VNMA 2W92A 1XIJA 4IIBA 4NU7A 2V2CA 1UA3A 3CK5A 1Z7AA 2PUZA 4PH6A 5CG7A 5DRCA 2CLMA 4XO7A 4LT9A 5XINA 1UWRA 4DI8A 1YPIA 4Q7IA 3PS7A 4F0KA 1A5BA 1ODUA 2VFDA 3TQVA 3NQBA 4BY3A 4XO6A 2YW3A 4MB3A 5A6BD 1JCLA 3DENA 4UTLA 1P7TA 2BY2A 5A2CA 4O1BA 2ISDA 2CU0A 5A1AA 1F05A 1VF8A 2BOEX 3SY5A 5FF4A 1CX9A 3MZNA 1IXOA 3F4NA 4IFKA 4RE4A 1VZWA 3CMJA 3ZMRA 1G1YA 3U5YA 3LGGA 4BWLC 4DI9A 4PC8A 4P7RA 3AZTA 1A5UA 3H53A 1ISYA 2FB3A 2DEPA 3O7UA 1JZ5A 3A23A 5LIWX 3BAWA 4H9MA 1RK5A 1UWSA 4UR8A 1ESWA 4MKNA 5CJMA 1Q6QA 2GK1B 1EYEA 1XFBA 1P5BA 1VR6A 2ATSA 2QIWA 2YYTA 4ZZ9A 3HMCA 5EMKA 3VGBA 3DKLA 4J40A 5HNNA 1HGWA 1R3WA 4FSAA 1E43A 1UUQA 2QVHA 4J28A 3S83A 1TPDA 4WXZA 4GJJA 4MAVA 3FJNA 1TWZA 4PB5A 5E9XA 3KL0A 4RNFA 3LCGA 1GQNA 4FXRA 1UH2A 1W1IE 2VMFA 1GYLA 3M0ZA 1HW6A 4KWVA 3BL3A 5E93A 4JX4A 1Z6KA 3GVRA 4XSLA 3ZJ6A 3TW9A 3QN3A 1VFTA 3GFZA 1H11A 3SCQA 3TYBA 1E9ZB 1VJIA 3TA9A 3A4JA 4AY1A 1PXGA 1ZAHA 1NY1A 3ZT7A 2OZTA 1JFHA 3DHUA 4DQWA 1J0KA 1ELSA 1QOPA 1QW9A 1J11A 2X2YA 4QISA 5CAKA 4WKFA 4D6FA 2WBKA 3G5EA 1E4IA 3DEQA 3DU0A 4KMQA 2DZBA 1CEOA 3P82A 1EC8A 3DBNA 1DV7A 3KWXA 4WSJA 3LPFA 3V5FA 3NQGA 3PVFA 3U2OA 2XU2A 3R12A 1A5SA 2PDBA 3QPYA 4W9TA 2TAAA 3NDZA 1EQCA 1O66A 5E5CA 4CQBA 3KXQA 3MV01 1TVLA 5A8GA 1VHCA 1TTPA 3ARUA 2ONEA 3NL5A 2XH2A 4U31A 1W32A 2RAGA 2BBFA 3L65A 3QTGA 1UH3A 1KFCA 5I3JA 4MG4A 1FHLA 4D6GA 4HCHA 2DZWA 1H1NA 1JD7A 1QI0A 2H3DA 1LZOA 4AFYA 3NEHA 1FWHC 4E5TA 2L5HA 4DYKA 2ZDRA 1FWIC 4A8NA 5I3KA 1F5ZA 3CL6A 4Q8MA 2PEVA 1J8VA 4M7SA 4YTQA 3VDHA 2OZ0A 4GIAA 1QNOA 5DMLA 3WFLA 4M8UA 1ONWA 1B54A 3WJWA 3ANVA 2CBIA 5E9AA 1ZY9A 2YZ5A 4F40A 2E40A 5DMYA 4G8TA 1JEZA 3UJRA 3NJ3A 4U2YA 7PTDA 3UBPC 4PUUA 3NO1A 4G7EB 1QBAA 1SR0A 3PBUA 4S3BA 3SIZA 1IE7C 4EPEC 4DBDA 4GX8A 1KGXA 1MYRA 1DXFA 1OFQA 3CM4A 1RHCA 2XIIA 4LBUA 4IMGA 4J3UA 2CXGA 3E0VA 4D6JA 3SUVA 4AIEA 3KBSA 3S5OA 2DT2A 4HZ7A 5HBFA 2J79A 4LANA 2R9RA 3NQ2A 3EOSA 3UQNA 4QJ4B 5A6LA 1HO1A 1GQJA 3E9AA 1BWVA 4CD5A 1XIFA 3KCJA 5PTDA 4EX4A 4LGXA 3WIJA 4GVHA 4J3ZA 3GDRA 3FXGA 3CQHA 5CBJA 3CB8A 1PYMA 4I7UA 4LRTA 5DBTA 1JZ4A 1LLZA 4AH7A 4L6HA 3H55A 3QLDA 1GCYA 4B5SA 3MCNA 4PE8A 2D24A 2A79A 3WQVA 1L2QA 3TC3A 9CGTA 2J75A 4PGLA 3TP4A 1DTNA 1UROA 1UZ4A 1LQ2A 4JQ3A 1XYCA 3STGA 1UP0A 1V4YA 3GNPA 4R9XA 4JTEA 3PUGA 1ZU8A 1F9CA 1V08A 1RCXB 4GFSA 3UWYA 1NEYA 3ARPA 4D6CA 2D22A 1K7XA 2D3LA 2FTPA 1XF0A 2V82A 4A3UA 1EQPA 1C7SA 4INFA 1ZAIA 1ZBKA 4Y9MA 3PAJA 3R5EA 4LH8A 4YCPA 1OIMA 3AQUA 2BX7A 2UY5A 3BLFA 3W2KA 1KR0A 5A95A 2G96A 3AICA 4NZ1A 3TR2A 1JCJA 3W1MA 2OWWA 1OCBA 2V67A 2G4FA 4I6KA 9XIMA 3LD5A 4H4IA 3R79A 1DWHM 1FXQA 4UR7A 3G1XA 3W2LA 3HFTA 4HOWA 1YDOA 3E5BA 2PDQA 1VEOA 4Z1CA 3B03A 3BOXA 4H41A 1SZRA 4K3ZA 2Z0IA 4HB7A 4M1BA 1KFEA 3WMLA 4P5UA 3SCSA 1B3YA 3CHVA 5KEZA 4HNNA 2BDQA 2A0NA 1E6QM 3NL3A 3DC8A 6TIMA 3GTFA 4YTTA 2D2HA 4GYJA 1G7UA 2GSJA 1NIUA 3FYPA 3WQGA 4A8RA 3PFRA 4FF7A 4NZ5A 4S3FA 4QROA 1VPYA 1BQGA 2AQVA 5JIPA 1KTBA 3CTTA 3E1F1 3WLSA 2QV4A 3STCA 1R3QA 5I09A 1W5OA 3SCVA 1BYDA 1DJXA 5F1VA 2PTXA 2BMBA 4DYEA 4IT1A 1CLKA 4DIAA 4F0SA 1XP3A 3TIMA 2QCEA 2P53A 4MGGA 1TIWA 1R0MA 2OYKA 2QULA 3G0UA 3BJSA 3BLDA 3VNJA 3QPZA 3W27A 5BOOA 3WQCA 3VM7A 2C19A 4O11A 1YEYA 2H8XA 4K1GA 2J62A 2WQPA 1RH9A 1NWRA 3PULA 3RLHA 4JNZA 1OC5A 5FJRA 3W6LA 3VX0A 1J0JA 5FOOA 5AYZA 3EWDA 4NAFA 2V3DA 3UYIA 2OLSA 4OFCA 4KFNA 4PTMA 4GUIA 3A47A 5FJTA 1YXCA 3QQ0A 3G3MA 4K36A 4X61A 2UZ9A 2WK2A 1KV5A 3UP8A 5J5RA 4Q8PA 4GH3A 2RKXA 4HPGA 3WLPA 4JOMA 3EOLA 4MB1A 3KFTA 2ZX6A 3F4VA 4NZCA 1FX6A 2B7PA 4E8CA 1A5MC 4EWJA 2WSYA 3OOQA 2Y7GA 3WNPA 3I3BA 1IHIA 2FH6A 3ABZA 2VGFA 1PKLA 1RJQA 1EIXA 3M5VA 3NQAA 4MZYA 1HKVA 5CSRA 1MZRA 1B3ZA 1VS1A 3SIMA 5I02A 2ZTJA 3GVWA 4AD4A 4MJZA 3ARZA 1UR8A 4HNLA 3HGOA 3L5AA 2VOTA 4E38A 3PZOA 3MHFA 1JCXA 5TF0A 5M17A 4ZBCA 1LROA 3KW3A 1VIZA 3SCNA 5FJJA 1AW2A 2XFRA 4BFAA 1M04A 4RLIA 4MDOA 4REQA 3R0DA 5AYIA 3BAJA 2XSBA 1ZENA 5F4XA 2ZIDA 1XLDA 1W3JA 2CLKA 2V9DA 3AYRA 1TV5A 1F74A 4Q4KA 3IWPA 1JDEA 3M1ZA 4BF5A 1EF2A 1HNYA 2GJNA 5D4YA 3PTKA 1V51A 3WJYA 1GEQA 4JL1A 3VGGA 2YA0A 4Q4PA 4BA0A 4KWOA 3UA4A 3KBWA 3ICJA 3WFAA 3L4XA 1JZ6A 1OY0A 1P0BA 5CPSA 1V7AA 2J78A 5HULA 4MY9A 4NRRA 2A3BA 3HURA 3S4TA 3LNMA 1MDRA 1HL9A 4Q33A 1UR0A 4HA1A 1FOBA 2PP3A 3DKJA 5AHEA 4P7NA 4LNYA 3UWWA 1HO4A 1AQHA 1OX4B 3AZRA 3VVGA 3MVIA 3LPOA 1OGBA 3CUIA 1RQBA 5D04C 4AC7C 3GIYA 4IP5A 1XC6A 1F6KA 3NQ8A 1TZZA 1MO0A 1WX0A 3RX2A 3PM6A 3UZWA 1RLDA 5U4NA 4MKVA 3GR7A 2NSXA 2YGYA 5AVNA 3B0VC 4B5XA 1ZNNA 4OE7A 3TLLA 2PLCA 5AHMA 1ZL1A 4E3VA 4M6VA 1NWUA 3D5HA 3HQOA 1JR1A 4M7TA 4ZOAA 3WBYA 2X0HA 2ABAA 3S5YA 3B0XA 3PTQA 4AYSA 4L9XA 1O60A 2ZC1A 4J27A 4EOUA 2FKPA 3W7IA 1OFEA 3V7PA 4IF2A 4JCLA 1F4AA 4PTDA 4ZQNA 2TODA 2HISA 4URIA 4IQLA 5FIPA 3KWSA 4EPKA 3BANA 2ALDA 3VKBA 1X1OA 4V33A 3AC0A 3MJMA 2IW0A 5EA9A 1T6MA 2WSPA 1BQCA 3AYSA 4R5EA 1FXPA 3M0MA 3AS1A 1E9YB 4DLMA 3CMGA 3PZQA 1ZLPA 3TYCA 2QAPA 1E4LA 3FVDA 1VFMA 4OIFA 4F3HA 1NELA 2A3LA 1RUSA 2JEQA 4GO8A 3T78A 4AX7A 4DHGA 4AZHA 4UTFA 2Y8KA 3GVQA 4ACYA 3QTPA 3NM3A 7XIMA 5BWFA 3UVAA 3GU9A 4US5A 3QC3A 4KPLA 3BPWA 4S3GA 4IGSA 1FP8A 1LTDA 4WCJA 4Z17A 4JQ1A 1KQZA 3T8QA 2OEJA 3II1A 3V3WA 5XIAA 4X2PA 4RE2A 1WUFA 2FJUB 2EPHA 1YDYA 3TN6A 2BY0A 4LPCA 4Q8TA 3NURA 3TONA 4PUJA 2PTZA 3CZJA 3UFYA 4K68A 2XPKA 1MUCA 4UQ9A 1YTEA 1ISXA 3W83A 3W3OA 3B8VA 4H9UA 3V0TA 3C0SA 4JIQA 4TMCA 4C5ZA 1DP0A 3BAXA 4PFHA 7A3HA 3CMFA 2WNNA 1GGOA 1NFBA 1P1XA 4HMCA 5FJPA 3U4AA 5CC3A 3E0IA 1QHZA 1EKOA 4R33A 4A4AA 4D6HA 3T4WA 4W86A 4WGHA 3ZLHA 1P4CA 4WRHA 3QR0A 3M0LA 4R85A 5A6MA 2WVUA 3LHYA 2G97A 2YFOA 3GVGA 4LWWA 3GU1A 1NM9A 1THFD 2YLAA 4TU1A 1OGSA 3ATZA 3VNKA 2V38A 1KFBA 1UD6A 4OT7A 1O5RA 4M82A 1KXVA 3IK2A 3B0YA 5E0FA 4CNPA 1NQ6A 5ABGA 2KZHA 2VVSA 1VBHA 1WO2A 2DSWA 1QUMA 3EWUA 2OELA 1XM3A 3HPAA 2C1GA 2DUZA 3WQ4A 1TVNA 3FSTA 1Q8AA 2JBMA 4GKTA 2HDJA 3H22A 2ZZ5A 5I0DA 3WLQA 3K8KA 2UWFA 1KM2A 4MWAD 3NZRA 3O0KA 3VIHA 5BMXA 1MW3A 1VD6A 3SQSA 3I6RA 2G5WA 5DT5A 5G1MA 3GTXA 4MZ8A 1WXYA 1ZBWA 4LCSA 2EG6A 5IM51 3VDBA 4UCGA 2H3BA 2XVKA 3NZGA 4Q22A 3TAKA 1NOFA 1VYSX 4LB3A 3E2SA 2WVSA 4JTUA 2NLIA 3R2GA 4HIBA 5C54A 1A80A 4E4PA 2ZX7A 2G8ZA 2X42A 1UCWA 2F61A 3IIXA 2HS6A 2CCRA 3EA1A 4M81A 3TE9A 4AWSA 3DDMA 1XLHA 3EWCA 2J77A 3O2LA 5CKSA 4ZB2A 2DT1A 3DGBA 1S2TA 4L9YA 3GG1A 5EMYA 1WCGA 1LP6A 1R85A 2JKPA 2VC9A 3MA8A 4HCDA 3NM1A 3O06A 3E2QA 2A4AA 1HTIA 2X0YA 1J6OA 1PCKA 2R1MA 4NAEB 2W6RA 1XIGA 3F2BA 1O6IA 1HKKA 4J3VA 5FJOA 3TTOA 4F2TA 4J3SA 2XJ7A 4LSBA 2BV9A 3LQLA 1YPXA 3BCDA 3NSXA 3TA6A 1C90A 3SECA 2PFHA 2GZXA 5TQLA 4AIUA 4Z2LA 4DELA 2G3FA 3VOHA 5E0KA 1XJBA 1UKPA 3TCSA 4CVUA 1C92A 2BTMA 4HTBA 1H63A 5HXMA 3UWEA 3LLXA 4IIHA 4O54A 1A3WA 2X2GA 1KRCC 3MMDA 1W9XA 5DQPA 5BRPA 1AJ2A 3C5QA 1JYNA 5EKYA 4UB9A 3W7OA 3M5ZA 3CEPA 3GG0A 3E74A 3BG9A 2WWCA 4GY1A 4XQ6A 4CU8A 1F3XA 3O6CA 1U30A 4XUYA 3TK7A 3AS0A 5BWAA 3N17A 1L0PA 2Y5SA 1VCGA 4ICMA 2OU4A 3HTWA 1OEPA 2QJGA 3FLUA 1U22A 2QCLA 4WDXA 2PLJA 4KBXA 4H04A 4FA3A 1GKPA 4WVXA 4A22A 4Q3MA 5CPQA 2X05A 1NJJA 2OSXA 4HZ6A 1I0BA 3QLLA 1EEPA 5L6UA 3UG8A 4U2ZA 5IDZA 4C1KA 2BWGA 1A3HA 3O0FA 3D3FA 4AF0A 4HBKA 4HN4A 3WDRA 3HG5A 1GVIA 5I00A 3AMCA 2VEPA 4XAZA 1BYAA 4JTGA 4PMUA 1XL9A 5BMWA 2PZNA 4HSOA 3QQ1A 5HMEA 1Y65A 2E67A 2VDGA 4AHOA 3RPMA 1WE5A 2F84A 2I14A 3C2FA 2IMRA 3LCIA 3EXSA 5G4WA 3UCDA 1E9LA 4UR9A 2PDYA 1VIWA 3P61A 4ZEPA 4A05A 1MXDA 1DJNA 2QDEA 1AL7A 2WPGA 4GYPA 1VFUA 2ZX8A 4AD5A 3KDNA 2GJLA 1OIFA 2YA2A 1CLVA 2EKCA 3W1PA 3KS5A 4TVUA 3PPFA 1SJBA 2R1PA 4GRSA 1T40A 4X22A 4FOUA 3KLLA 4IPNB 4GCXA 2CWNA 4P8WA 1RVGA 2A6LA 3M5XA 3HZ3A 2OT1A 4QE5A 2YOCA 3H7RA 5A8PA 3HPSA 4TXEA 2OODA 4LAMA 4LYQA 4DJFC 2POTA 5BYWA 1G01A 1BAGA 3IARA 3MC5A 3NDOA 1MDLA 4WDUA 3T07A 4GABA 3M44A 1UYQA 4A6GA 2B4GA 3PJUA 1GK8A 1XIMA 4FNPA 1XDMA 3DFOA 3TWAA 1K8XA 2OLAA 2XIBA 3QXBA 3RX4A 4HHPA 5HQLA 4MFEA 3WLIA 2DJXA 4JYEA 3SFWA 1U5HA 4OBRA 4H01A 1WKEA 2H9AA 3IV3A 4PSRA 2R6OA 2G3JA 2PGWA 3H8AA 1SVDA 2FMNA 1LUCB 3ITYA 4AEFA 1PTDA 4O0ZA 1W2VA 3K8LA 5HNRA 1K6WA 2BXVA 1EXPA 4JDYA 3GZAA 4G1KA 3W81A 2ZRYA 3M0XA 4ZQOA 4CCEA 2OT0A 1A50A 3JW7A 3B9DA 2YL5A 1US2A 4RW5A 3VCRA 2ABBA 1AW5A 5LNUA 3GSMA 1KM5A 4XX6A 1I8JA 4NYYA 5MHBA 1XGZA 4X60A 4IX2A 4XV0A 3CAWA 3URQA 1MNSA 1CXEA 1CGWA 2YR1A 2G3MA 3THQA 1Z9AA 4AZ7A 2OPJA 3CASA 4IFRA 3TN5A 3S6TA 4MNMA 1V8EA 4EF9A 2PDFA 1QCWA 1F3TA 1CYGA 3K4WA 3LHZA 4KIRA 1RD5A 3WY1A 1S39A 3M16A 2NX3A 4TV6A 1Z41A 4GKLA 2X09A 4LYRA 1VEPA 3ANYA 3VD7A 1UJPA 4DNMA 2QMKA 3PWAA 2GUUA 1KLYA 1H7NA 4L4MA 3AHTA 4HSNA 4LS1A 1XLFA 4LNCA 1W2PA 5D9MA 3C56A 4H83A 3DFSA 4L5ZA 3W82A 4Q4OA 1J93A 1EC9A 4TX8A 4JBRA 1J0ZA 2QPUA 5C0QA 1QNQA 3GR8A 4FF5A 2GDQA 3WNNA 5LNVA 4QLJA 2A7RA 3LRKA 3U8GA 5C2CA 1YKWA 1VYRA 5B7ZA 2E9LA 5JMUA 3ITTA 1ZAJA 1WPCA 1FVPA 4FO4A 5AC4A 1GKQA 3LI0A 4GUHA 1DJIA 4IL2A 3FA5A 2OGJA 3L0NA 1GEHA 4HU0A 1A47A 3VD3A 3G1YA 1SSGA 3MO7A 3YPIA 1T41A 3LENA 2E6AA 1RY8A 3PAOA 5BXTA 1XWYA 2ZZ4A 3B4UA 2QUVA 3BUVA 1VQTA 2Z27A 4Q6JA 5AY7A 3WFZA 3H2AA 2GJRA 3CO8A 1ZSXA 4JN7A 4AZCA 3HPZA 5AYXA 5ECVA 2WCSA 4WDTA 4EPDC 2VENA 3ARQA 3PBYA 3U6WA 5CXPA 3KDOA 4LEQA 1XLIA 3B05A 1FWGC 1EA0A 4QSFA 3V35A 3GH5A 4I3GA 2E09A 2PWFA 5I6SA 3B8UA 2QW5A 3IUHA 4LFYA 1S3TC 1QNSA 2OEKA 2ZVIA 2YCLA 2Y24A 4ERIA 2PAJA 4CNTA 4B90A 4JTQA 4NJIA 5J8LA 1G69A 3VZYA 5EY5A 6ALDA 1CW2A 1KFWA 4HKPA 4WKAA 4RKAA 3G1FA 4NRSA 1GJPA 2ZQ0A 3L23A 5FEZA 1PIGA 3N04A 4JKMA 4GYFA 4LS0A 2V30A 1H7RA 4O1EA 2BOGX 3KTXA 4YU1A 3C0JA 5FSEC 4GUFA 2Q71A 4ES4A 1H7PA 3S9IA 5FL1A 2ZVRA 2GOUA 2WHMA 1DIKA 4GNVA 3EKLA 1QI5A 3MJYA 3NSMA 3M64A 3E0WA 3UR2A 2OLHA 1TZ7A 2FHFA 1B2YA 4QIUA 1I2QA 3ZJ7A 2Z1VA 6ENLA 3MCMA 4O13A 5G4EA 2CFFA 3AXMA 4NVTA 1EBHA 1TV3A 3EWBX 4CNNA 3W23A 1VRXA 4N0RA 2QKFA 3DFYA 3GFYA 3M0YA 4JR5A 1DE6A 1E9IA 1LQ0A 2PE4A 3QZEA 4CVWA 1XYBA 3KBMA 2OQYA 2J25A 3VO0A 4E8GA 2BLEA 4DN1A 4O12A 2DPEA 3PZNA 4LXFA 2FYMA 2BVDA 1QTWA 5DLCA 3VOIA 3POHA 4W88A 3VUPA 3G0SA 4K6AA 1CZ1A 2PDMA 4D2JA 4GGHA 3UY8A 1SZEA 1E6ZA 4GISA 5RUBA 8XIMA 1BGGA 4ICNA 2NV1A 5HR7A 2BXZA 3CUHA 2QJNA 3BG5A 2QXWA 6TAAA 1O1ZA 3CUZA 5GPRA 1I0DA 1KD0A 1R46A 1F76A 4A3RA 4WSHA 3CAQA 2HK0A 4U5IA 3OHIA 3L21A 1E0WA 2P88A 3OVPA 1OBAA 4JKLA 2HSAA 3CL7A 2Q02A 3G1VA 4XD6A 2IPGA 1PZ3A 1VJZA 2DZAA 3QGKC 2Q01A 3U4FA 4C65A 3NL2A 3AZSA 4GHRA 3RU8X 1CECA 3N29A 3PR2A 3QV6A 3SY8A 2O56A 3TW7A 4HK7A 1JPHA 4O0KA 4YYFA 4C1NB 2VURA 3VGDA 3RNDA 4QS6A 2UY3A 3CS2A 5AFDA 2BHZA 3GHUA 5AC8A 1DJYA 2P50A 2CLIA 3UR8A 5KETA 3CV7A 4MYXA 4UTTC 4JTHA 1OZMA 3MS8A 2XUCA 4ZENA 1M5WA 1YW1A 3HQPA 3R4IA 1WYIA 1TRDA 4L56A 1GORA 3EPMA 1JF6A 3UYCA 1RAKA 4LTSA 3ZVIA 5EMJA 1OC6A 3UU0A 3H6OA 2WMJA 1GHSA 1O94A 3QSTA 3O07A 3SM0A 2FTYA 3AWOA 4IXHA 3N13A 3K1GA 3NO5A 3IJIA 1JUKA 1LL6A 1V0MA 3ABRA 4RDWA 1U5JA 3KRBA 3UJFA 4EAMA 3BDKA 1TPEA 1GYNA 2PWVA 1W0MA 3HG2A 4QCFA 3IGSA 1EB3A 3KE0A 3L5LA 4RV8A 3S42A 3GG7A 1V02E 3RR1A 2ASHA 2EPNA 4OGZA 1WKDA 2FZNA 3N11A 4MY8A 3BZGA 1EO7A 1OCQA 4US6A 1YNYA 3SW6A 4UTWC 2W9MA 1WOAA 1FH7A 1PDZA 4GK8A 4OTKA 2WC3A 1BRLB 2CZDA 2GK1A 4DUVA 4UQAA 3MUCA 1Z44A 2NUWA 4H6EA 3CC1A 2JALA 3L2LA 3L9CA 2CZ5A 4KIEA 2AAAA 1BXCA 2CKSA 2DV0A 3PZ9A 4Q8QA 3TSMA 2XDFA 1JQVA 2F6XA 3NSNA 5SWUA 3EA2A 3IUDA 3W7LA 3WMBA 4Q8NA 4U33A 4H7CA 4JNMA 5E6ZA 2Q6ZA 3MBDA 1OVDA 2FB2A 1AQMA 3NO3A 2INFA 2CBUA 5MF5A 2QCDA 3O3RA 2VC6A 2BZNA 2X41A 3WELA 3CAVA 2WSKA 5GNZA 1AJZA 3BV4A 2ZA1A 2QCNA 3LCXA 1DWJM 2Z2UA 3KL5A 4JFVA 5D03A 4DWDA 4GQRA 3FN9A 3U5UA 1EL3A 3ORWA 3SRDA 1OFPA 1BG4A 5DT7A 1M6JA 4PTXA 3RMJA 3TSDA 2DW7A 1IXNA 5L9FA 2HRWA 2KAUC 2QVNA 1IGWA 4Q8UA 3KLKA 3WK1A 4Y2WA 3C2RA 3QVQA 4XTDA 1EHNA 2YCIX 1K9TA 2VCCA 2XH0A 1M68A 4EACA 1GJUA 2OR2A 1DIEA 3RPDA 4XUGA 1VRDA 2O9PA 1W3TA 2EO7A 4WOZA 3CTLA 2FGLA 1N82A 3TQKA 1AG1O 1ZJAA 3ZR6A 4HU8A 1FWRA 1V3LA 1JXJA 4C1LA 2DFAA 3RR4A 3NIYA 1OFDA 3CT7A 4UBPC 5G2HA 2YA1A 3IJLA 1K8YA 4IPIA 1TA3A 4S23A 2X1RA 1QDSA 3W70A 1E1CB 3UPMA 1DQUA 2W79A 3MUXA 1E5JA 2ZRWA 2CITA 4I5UA 2FPVA 2WKGA 3W22A 1IV8A 3L2MA 1QPOA 2JKEA 1NSJA 2YCEA 5CPMA 3NFUA 1SO3A 3ZVHA 2VR4A 3HQNA 1FY6A 3KOWA 4ZCWA 6A3HA 5LHFA 3UXIA 1SQ7A 2VJXA 5U7SA 5ENLA 3BOLA 5CZ0A 1KLZA 4GFIA 2I5IA 2J24A 4ZMGA 1QBBA 3LRMA 3LPGA 3FGCA 3N6QA 5IRPA 4IX0A 4KEVA 5H1WA 4O10A 3DIPA 1GHRA 3EXTA 4PEEA 4DBEA 2EHHA 3CUFA 3GYCA 2D0HA 1JNDA 1UBSA 2VFIA 4X0VA 3WL1A 4O53A 1R3RA 3GAKA 1R7OA 4HOZA 4RDZA 2ZC8A 5HA7A 1OB0A 1ICQA 4YTUA 1JVNA 1AUSL 1E5NA 4OHQA 1A5AA 2BGNE 2Y7FA 1OFAA 2E7FA 4NQ1A 3CQ0A 2PDLA 5EPDA 3C61A 3VE9A 1BKHA 4GG9A 3OLGA 4C91A 4O57A 1ZJBA 1FKWA 4L61A 2QYGA 2V5KA 4Q4MA 4GOAA 3ZIZA 1XR2A 3R94A 5FEPA 1E3ZA 1CPUA 3GH7A 3TJ4A 2QMJA 1HL2A 2OSYA 2F38A 2NQLA 2VUYA 1TV8A 3TJLA 4A35A 4G5DA 3B9EA 4NILA 2HXTA 4IWWA 1N8FA 1ONRA 2ALRA 1W1PA 3LX9A 3B8SA 1AD4A 3QV7A 5FEWA 3EWYA 3U48A 3TSBA 4UTMA 3AWNA 1UWQA 2PWHA 3BW4A 2AL2B 5IBXC 3BSGA 1OK6A 3EWZA 5I06A 3L4ZA 3ZSSA 3R8HA 3QHOA 5GJNA 2V5BA 1V0NA 5JIWA 4Q8VA 3EGJA 4PBGA 4ZOCA 5A94A 1WUEA 3B9OA 3NQMA 4DZ5A 5DCEA 1OYCA 1FWBC 3VZXA 2OB3A 4IMFA 2FZ8A 4OKDA 3NVTA 3W7PA 3PUEA 3FKKA 3MUIA 4RPQA 4RL3A 3VOCA 1LBFA 2WANA 3AMKA 2BGQA 2O9OA 4WK9A 1ZQ5A 2ZXQA 5LIUX 2JFEX 3RXZA 4FS9A 2PP1A 1FHDA 1FHUA 4JD4A 1EJ7L 3POCA 4M24A 1SW3A 3B9NA 1VFLA 3ATYA 1DQWA 2PU1A 4IUOA 1OM0A 1EDQA 4JNYA 3OTRA 2CNCA 2TMDA 3BAYA 4JFUA 5C7HA 3UETA 1O95A 1TJ1A 5FD0A 2FFCA 2VFHA 2Z28A 4IXXA 4XK2A 3OLIA 3UJEA 2PURA 2DZPA 3N2TA 3FS2A 3SSJA 3E0FA 5IHSA 1IIGA 3UJ2A 2PD5A 5DCDA 1PE1A 4FPSA 1FDJA 5M2FX 1NP2A 3MQTA 3NQVA 1UD4A 4PUDA 5TBOA 1GVRA 3IGUA 5D32A 1J5SA 2PGRA 3GY1A 3LBMA 1H1YA 2YKKA 1BVZA 3EOEA 2E5DA 4N4PA 1KWKA 4RNIA 2GYIA 1DE5A 3BMVA 3CU2A 3PNZA 2Y89A 4I8DA 1L6GA 4WY0B 3N4FA 3SRKA 1I6NA 4LC6A 2ZWYA 1HX0A 1U2YA 4B4HA 1VFHA 2LLEA 5H8PA 1H1ZA 3J7HA 3RF9A 3T0AA 1I2NA 5LGXA 2EGZA 3G1RA 3DYMA 1GQIA 5CZKA 2WAGA 3N34A 4DJFD 1BTCA 1GYMA 2PTWA 5CSSA 3CV6A 1S1PA 2VDIA 1JGIA 4AHQA 2QCHA 4PCNA 4JTFA 3WLLA 5HWNA 4H6KA 2Y63A 3EEGA 3I65A 3EA3A 1GG1A 4MY1A 5EGRA 2WNWA 3O6AA 3W29A 3KUMA 1X98A 4ENLA 2V3EA 4YTSA 2WLYA 5I7GA 1GW9A 3DFTA 1I75A 2VWSA 3MUY1 4KEMA 1XHGA 2CEQA 3WJXA 1P0NA 1JFXA 1VENA 5A8QA 3I3EA 1HKMA 3MBFA 3G2GA 2Y88A 1TE6A 3V5CA 3MI6A 5D8WA 3MKCA 4DM2A 3NQDA 3W7RA 3GKFA 2GGEA 2ZUWA