1JDAA

Maltotetraose-forming exo-amylase
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
source organism Pseudomonas stutzeri
total genus 136
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jdaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jdaA01
2VUYA 3ZJKA 4F8XA 4PTXA 2ZXBA 3SCOA 2GJRA 2DT0A 3AMGA 5JIPA 5D9NA 1E6NA 2YDQA 2EPOA 3GH5A 4TVDA 1CENA 4OBSA 2V5DA 3N04A 2YA0A 2VCAA 3LPGA 2WBGA 2BHZA 1CEOA 3UR7A 1CLXA 1E6SM 1QI0A 3SCRA 3VD5A 3IJ7A 3L2MA 3GXDA 2W5FA 3U5YA 5HNNA 3T08A 4NXKA 1OGSA 4DWSB 4CN6A 3IJ8A 2XVLA 2A3HA 3THDA 2WB5A 5BRPA 3UG5A 1EO5A 3M6DA 5LYRA 5ECUA 1TUXA 1TG7A 1VEOA 1TVNA 4F66A 5DO8A 2WVSA 1V3LA 1E6PA 3UR8A 4P8VA 2D0FA 1E6XM 1K9DA 1U2YA 2XVNA 2EAEA 1WAWA 3DHPA 4J28A 4UFHA 4FK9A 3THCA 2VX6A 4UZUA 3MUY1 2VCBA 1X1NA 3W29A 1VRXA 1YHTA 3WD1A 1DWGM 4HMCA 3VDAA 1V6XA 1NWRA 4QDMA 1US2A 4QFUA 1JYXA 1C8XA 1D7FA 3VD9A 1EA9C 2X2IA 3AFBA 2YBTA 4WSJA 2W62A 3I3EA 1FOBA 1TCMA 2ZUWA 5EB8A 5EFFA 3PZVA 1TE1A 2QLYA 2GFTA 3DX2A 4H7VA 1IZJA 1V0NA 2VJXA 1V6YA 4PMQA 4UQCA 3W26A 5DT7A 2MANA 1HT6A 4JFUA 3VNYA 3GDBA 4FLRA 3WKZA 4PCSA 4MPKA 3VIOA 2JFEX 5A6BA 1E0VA 2DH2A 4DWSD 3AIVA 4N0RA 7CGTA 1CLVA 4LYRA 2CBIA 1KXHA 4J3SA 1XH2A 4FNRA 2J7EA 4M80A 2VZUA 4PTVA 2XYLA 3WH6A 4F9JA 4W7VA 3KL5A 4AMXA 4JHZA 5HBFA 2VX5A 2YL5A 5DFAA 4GI6A 3AIBA 2WLYA 3IGUA 3WF2A 3EJSA 1ISWA 3WDIA 5CGMA 1E1EA 4XUYA 2XPKA 4PCTA 4GZEA 2W67A 4B15A 3ZOAA 3BVVA 3VGGA 3CLWA 4V2XA 3OLGA 4YHGA 3SCSA 1GORA 4KRUA 1ISVA 3AIQA 1FFRA 1GCYA 1WNOA 3LMYA 4DO4A 2PF0A 5M03A 1UKOA 1GNXA 4TVUA 4BA0A 3A24A 1BHGA 3CUJA 4OUEA 3VILA 2VL4A 3BUBA 2XSBA 1GJWA 2BHUA 2W4XA 2Y8VA 2IUZA 5A94A 2D3NA 3WF4A 3ZQ9A 4GQRA 2WMFA 1MW0A 4UQEA 1EDGA 5EBAA 3RDKA 1JAKA 1QHZA 4AD1A 4W87A 1Q6GA 1GOMA 2DEPA 1J11A 6CGTA 1JYVA 3VDHA 4HZ6A 3CHCA 2WHKA 3LRMA 1H49A 3HU7A 1QI2A 1V0LA 3GZAA 2Y5EA 2J7CA 2X0YA 5HOSA 3WNNA 4F9DA 3WF3A 3EMZA 4P7QA 2BXYA 1Q6EA 3VSTA 2JE8A 1RP9A 4FNSA 1KXTA 3AXXA 3VD7A 4MAZA 4D6GA 3WELA 4JL2A 1JI2A 3DDGA 1JL8A 3LPPA 5E1QA 2PWHA 3BGAA 4D6CA 2A3CA 2FHCA 4DUWA 3IK2A 3WY2A 3AXIA 3PZNA 3N15A 2UY2A 3LX9A 3WSUA 1XH1A 3H55A 3AMDA 2IGTA 4XV0A 2EABA 3PTKA 2OWCA 3RILA 1FH8A 1WZLA 1X6NA 1C8QA 2E9MA 4UOJA 4NSBA 3OZOA 2NSXA 3EJQA 5A6BD 1B90A 5CZKA 1V6WA 3CMGA 4AMCA 2XM2A 4FNUA 4W84A 1LL7A 2PB1A 1SFSA 2F8QA 4WKFA 2WVVA 3ARXA 1F4HA 2V3FA 4UNIA 3A47A 3G6MA 1XSJA 1PX8A 2E40A 1MXGA 3CV5A 2QMJA 1UD8A 3MKKA 1JDDA 4CD7A 2FE0A 1SMAA 1GHSA 3AYSA 1LG2A 1B3XA 5JUVA 1MXDA 1ZBKA 4ZFMA 3SEPA 3VD3A 2CBVA 4AIOA 3EYPA 3VIMA 1PPIA 5KEZA 3D50A 4C7DA 3BC9A 4PMZA 2J7GA 1OT1A 2WHLA 2D1ZA 1BG9A 3MI6A 2GDUA 3WQWA 4HOZA 2VI0A 2BV9A 3PTQA 4WK9A 3H54A 2IXUA 1XSIA 2BFGA 1HJQA 3WDRA 2WVVB 4W93A 4W8AA 1VFFA 2PWFA 2BVYA 3UEQA 1KCKA 4QLKA 4PBGA 3O2LA 4OJYA 1CWYA 4KRTA 3DC0A 2XUCA 5CPSA 2DT2A 3VVGA 1HWWA 2CPUA 3D4YA 3UG3A 2YA2A 4AXNA 1OD8A 3L4YA 2BY1A 3QR3A 1OCQA 2F7PA 2VZOA 3U7BA 2X05A 4FF5A 3ZO9A 3VINA 1HJVA 5DF0A 4OIFA 3SCWA 4EK7A 1ZJBA 2PI6A 2DSUA 2J62A 4QCEA 2OW7A 1H3GA 2J7BA 4HU0A 2E4TA 4D6FA 2YFNA 3ECQA 2W66A 1GOQA 2O92A 4R27A 3WQVA 4URIA 1QNRA 1UQZA 2WMJA 1Q6CA 5KZ6A 1QNPA 4HA4A 4PUEA 1QNOA 4L4OA 1R34A 4LPCA 1KR0A 1QVBA 1Q6FA 3EDFA 1BLIA 1VAHA 3DX4A 3OZPA 1EHNA 2CYGA 4AZCA 3DYOA 3KL0A 3WBAA 2BHYA 1CDGA 3BLPX 3ALFA 4RE3A 3AHTA 2NT0A 3BVTA 1JYNA 1JAEA 3MSGA 3FW6A 4EE9A 5BCAA 2FH8A 4MNMA 1VFMA 1KQZA 1C91A 3FHQA 4L4PA 3B9EA 5TD4A 4ATLA 1VBRA 5A1AA 1DTUA 4M24A 4BQ3A 1MW2A 3S2CA 1MWOA 3PHAA 1CXHA 3WUBA 4AZ5A 5I78A 1CYGA 1E56A 2F1AA 3OA5A 2ESCA 3AJ7A 4CN1A 2A3EA 2ZX5A 4WJXA 2F2HA 5ABEA 1ZL1A 4AZCB 2YL6A 1ECEA 1CGTA 1JYWA 1GOIA 4F79A 2XN0A 2E9LA 1KGUA 4OOUA 3L4ZA 1OB0A 3CO4A 1LWJA 2ZXQA 1JF5A 2V3EA 1FP9A 2CITA 3BLKA 1AVAA 1L8NA 2EPLX 4BQ4A 5FKYA 3EJPA 1W9PA 1W1TA 1R7OA 6A3HA 4PTWA 1V3KA 4JL1A 5HDRA 1WO2A 1TMQA 3NSXA 1OWQA 3W38A 3HJEA 2XGIA 5A95A 3L4XA 4MB3A 1PBGA 1R75A 3PBGA 1MQPA 5C70A 3VSVA 2ZUSA 4UFJA 1E5JA 3AS2A 4HOXA 1GUVA 3WNPA 3GTNA 3WL1A 1B1YA 1CPUA 3TONA 3VOCA 3VGBA 2WHMA 1NM9A 2VCCA 1H0GA 1LJYA 1OBAA 2ZE0A 4KGJA 2PWGA 4KMQA 2WBKA 3AIEA 4UFLA 5CXPA 3VIJA 4GO8A 4ZE4A 2ZWYA 3O9NA 1BGGA 5LA0A 3M46A 3RM4A 3BCFA 3ZT5A 1ZS2A 3VGDA 3SCTA 1JD7A 2DT1A 1NWSA 3DHUA 3WQ5A 4H8UA 2ZIDA 3TTSA 1UWRA 2IXVA 3D51A 1JF6A 4HZ7A 1GONA 4FNPA 3S6TA 1JZ4A 3LPFA 5I79A 4BS0A 1EHAA 4B16A 3SCNA 1W3JA 5M5DA 1QOXA 1VIWA 1EOKA 1QX1A 1QWNA 1DP0A 2EBNA 1PZ2A 1J0HA 1CNVA 5BWFA 1XD0A 3NCOA 1WDSA 3GXNA 4J7RA 1MFVA 3RJYA 3F5JA 2C0HA 2J78A 4MJ4A 4AIEA 3I3DA 1R86A 3WD4A 2OYMA 4Z2JA 1MQQA 5EFDA 4HPGA 4QLLA 1W3HA 3EDJA 1PX3A 3O6AA 2E0PA 2E3ZA 2O9PA 3BAWA 1NOWA 2V38A 2PBGA 3VGHA 4QLJA 4YN5A 4UZSA 1ESWA 3AHZA 4ML4A 1I1WA 2G41A 4A4AA 3BAJA 1KXVA 4H8HA 5E6ZA 1EDTA 5IFPA 2WCGA 4NX0A 3SUUA 4H8VA 3A3HA 3M7SA 3W6LA 4AZ7A 1IV8A 3JUGA 4PMOA 2XGBA 2E8YA 5A8OA 4ZXLA 5E0CA 4BQ5A 1VEPA 3CZNA 3AMKA 1ODUA 3AIUA 4OKDA 3EMCA 3HZ3A 4NRRA 1JZ8A 1WZAA 1GQJA 1EQPA 3CZGA 3AMCA 5ABFA 1XYZA 1UD2A 2BXZA 1ISXA 1UWQA 3OLEA 1UA7A 5GNZA 1VENA 2J8GA 3HMCA 1JDAA 4CVUA 4UQ9A 3BSGA 5GNXA 1XRVA 1KBBA 4AZGA 2VRJA 4AYSA 4C7GA 2YLAA 4X0VA 3BMVA 3WDHA 3FAWA 4V27A 3DX0A 2O9RA 4IISA 1P6WA 3L4WA 1ISYA 4AD3A 3PTMA 3VDBA 4P8UA 1E6QM 4HPHA 1SZNA 1LL4A 5A8QA 5GNYA 4H04A 3BUIA 4E4PA 1GVIA 1CGXA 3IJ9A 3A4WA 5A3HA 3OG2A 3WF1A 1GW1A 1H1NA 3N11A 1ISZA 5ABFB 3VGFA 1BFNA 2FGZA 1WDPA 3PZQA 3BCDA 1N82A 1UWTA 1W3KA 2WZEA 3OGVA 1W2VA 1OIFA 1W9BM 3BVXA 4FNQA 1UWUA 4PSRA 3AS3A 3TOPA 3KE0A 1BQCA 1HP4A 5FIPA 3BVUA 4Z2IA 4B9ZA 1MFUA 1E15A 3ZJ8A 4AIUA 1B0IA 1V3HA 1DEDA 3SUSA 2J74A 2WAGA 2C7FA 3VX1A 3VUPA 1UUQA 3WFLA 1W9XA 3PN8A 1TQTA 2JALA 2WCAA 5JBFA 4Z2HA 1EH9A 5D4YA 4KH2A 2VZVA 1R85A 4CD5A 2DSZA 4QAWA 2ZX6A 4UR9A 1K9EA 3A21A 2VVSA 3WIJA 3CGTA 3OB8A 1DWFM 1DWJM 3FXYA 1HVQA 3VM7A 2WKGA 1V6UA 3VIPA 1PIGA 3T0DA 3TP4A 4AZ6A 1KTBA 2WMGA 7A3HA 4AYGA 1HJXA 1V02A 3AROA 3D3AA 3WDPP 4ZXOA 2Y2WA 2ALWA 3NDYA 3VNZA 5CLWA 4Q22A 2ZX9A 2A3AA 3A5VA 1GVYA 2UY3A 3B8SA 4RE4A 3E1F1 2ZOXA 4W7UA 4JIEA 3VSUA 3VD4A 4MDPA 3UCQA 4B9YA 1M53A 2F61A 3RCNA 3WQ8A 4IPNB 2D22A 2WPGA 5BXSA 3POHA 2XFYA 1WPCA 3T09A 1UOKA 5D9OA 1EO7A 5M17A 3WL0A 1R33A 4Z2GA 2XN2A 2O9OA 4QCFA 3UETA 4U3AA 1VFOA 4D6JA 3B9DA 3QOMA 1BYAA 4NRSA 3VPLA 5CPTA 3MS8A 4D71A 1TQVA 1F4AA 1NQ6A 3RPMA 1KWGA 1E6RA 4M82A 3CTTA 3T0AA 1A47A 1HL8A 2J47A 4MNKA 1AQ0A 2JIWA 1J0KA 1PS3A 1M01A 4UOZA 3EDEA 1NP2A 2J7HA 3MV01 3MV11 3T2PA 1J0IA 1H11A 4RE2A 4CGTA 4LYQA 3WY3A 1HN1A 3BUDA 3ZJ7A 4TUFA 1HF6A 5CLTA 3B9AA 1EOMA 1OSEA 1KXQA 1J0ZA 3BUPA 4TX6A 2OYKA 2VRKA 3WENA 1WB0A 1OGGA 1VFUA 5JBEA 3WD3A 1HKKA 3SCQA 1ZB5A 1PZ3A 4OBRA 3GYCA 3F4VA 5FL0A 5A6KA 3N13A 4W85A 2X2JA 2XTKA 2XM1A 5I3DA 1OD0A 3W81A 4MB1A 1GOKA 2Z1KA 1UYQA 1O7AA 1QWUA 1XSKA 5A69A 5BXRA 3N9KA 2G3MA 1LL6A 3NDZA 3K46A 4IM4A 2J7DA 4QP0A 4E2OA 2EADA 4EAMA 3WF0A 1XH0A 3CHEA 1UG6A 1CTNA 1M03A 4IUGA 3WH5A 1UZ4A 4J3VA 1UKPA 4GPNA 4MDOA 5A8NA 1GQIA 2BS9A 1OM0A 1H0IA 3SCUA 3LPOA 3ARTA 3AS1A 1QI3A 3SUTA 4GQQA 3EMQA 4AW7A 2ZUNA 2G3NA 2ZUTA 1E6ZA 2E9BA 2D20A 2PC8A 2X0HA 1E5NA 1JZ2A 1V3JA 1LG1A 5CQ1A 3AHXA 2XFRA 2ZUVA 1TQSA 5I6SA 5DMYA 4YHEA 3BH4A 1T0OA 4CCDA 4AZIA 4FLOA 5BXPA 2XVKA 3EJTA 1QW8A 1KQYA 3CZLA 3KWXA 1E1FA 3ALGA 2DT3A 4GZIA 2OWWA 3NIYA 1PX4A 3LRLA 4W88A 1H41A 2OWXA 3VX0A 2WYSA 4PMUA 1US3A 2WMKA 3MMDA 2DDXA 2OSYA 2GJPA 1O6IA 2CHOA 3PZ9A 1G94A 3BAXA 3WNLA 3F5KA 3W24A 3UERA 4AMWA 1UWSA 3DYMA 4ACZA 1GHRA 2Y8KA 1E73M 3MUAA 1ITCA 3GNRA 2VC9A 3CUIA 1JNDA 4NZCA 2VRQA 4GO9A 2XIIA 3WQ6A 1BSIA 1UZ1A 4PUDA 2XN1A 3CIVA 2GDVA 4DUXA 1EIBA 1BVZA 1NOFA 1C7TA 3D5HA 1HTYA 1QHPA 4EKJA 1WDRA 1HP5A 1V6VA 3IAPA 5F7UA 3DDFA 3N17A 1JFHA 3KEHA 3AHVA 3GH4A 4JHOA 3RM8A 1OINA 3VU2A 4GZJA 1KGWA 2WVUA 1ZBVA 3S5ZA 2PWEA 8A3HA 3LXAA 4JFTA 1GQKA 3AYRA 4ACZB 1D2KA 4HA3A 4IPLA 2HISA 3HN3A 1HIZA 3ZM8A 1U30A 2CETA 4WF7A 1XCXA 3NSNA 2CCRA 1G0CA 4U2ZA 4HMDA 1BGAA 4D1JA 3OIHA 1VB9A 3CC1A 5CGTA 2OYLA 1O7DC 4XB3A 3H53A 3DX1A 4V28A 5IHRA 4AY1A 3CUGA 3VMOA 4MB5A 3ZR6A 2JEQA 1CXFA 4A3HA 3AICA 5AC5A 1R8LA 3IAQA 4M81A 1CGYA 2HVMA 4UFMA 4Z2KA 3HG4A 3CMJA 3T2QA 3L4VA 2WANA 2YBUA 3PZUA 1V3MA 4LQ1A 1V3IA 3KLKA 4C7FA 1G9HA 4A3YA 4MTVA 4M1RA 1D3CA 5HXMA 1KGXA 2BY3A 2F18A 3GXPA 3N18A 1C93A 2ZWZA 2CEQA 4UQDA 1B3WA 2CIPA 3EDDA 1E70M 4WLCA 4TXEA 1RP8A 2PBOA 1BYBA 4CD8A 5E9AA 5FOOA 3BLBA 3CZ8A 4CU7A 3N12A 4OZOA 1UWIA 1HJUA 1XCWA 4U3CA 1UKTA 3GXMA 3W0KA 3BUQA 2WK2A 4BQ2A 3NYDA 3BXWA 1UD5A 5BROA 4X0NA 2WC7A 5D8WA 1KWKA 2X2HA 2EPKX 1R7AA 4Q7NA 1TR1A 3CZSA 5CPQA 2D2OA 3QHOA 3U57A 3RO8A 4HP5A 3S5YA 4HMEA 3ARUA 3WD2A 4P7NA 3VIHA 4HU8A 3LXCA 2BNJA 2J4GA 4D72A 1KR1A 2TAAA 1K9FA 2GK1A 4AISA 3VKKA 2C8NA 1MW1A 4JFSA 4OGZA 5GQBA 3AS0A 4D6DA 1UKSA 1V0KA 1BF2A 3AZTA 1Q6DA 2BY0A 1C90A 5A6AA 3ZSSA 4J3XA 5C71A 4M8UA 1GJUA 4CCCA 1BAGA 1R47A 1H5VA 1OGBA 2CESA 3VIGA 4RL3A 3NSMA 5I5RA 3WFZA 2A3BA 2X8RA 5A2AA 1FH9A 1BYCA 3HG2A 4ZE5A 2XWDA 5FD0A 1VJSA 2F7OA 2DH3A 1VF8A 1QW9A 5JBDA 3A4XA 3ARYA 4Z2LA 3WD0A 5LA2A 2ZUMA 1B9ZA 5E09A 1UR9A 1UR0A 2GK1B 4CUCA 1E55A 1UH2A 2FGLA 4M56A 1FA2A 4BF7A 1W1PA 4NZFA 4CD6A 2QPSA 1JNEA 3D4ZA 1XD1A 4HTYA 2Z1SA 2WKLA 2RGLA 1UD6A 1NOUA 5ABGA 4J3UA 3W4RA 1W32A 4XX6A 1MYRA 3BSHA 4JCMA 2W92A 4P8WA 3SUVA 5A6JA 3A22A 7TAAA 5EMYA 2NT1A 1JXJA 2RGMA 2WWDA 1GQLA 1X6LA 1QI4A 4W86A 3VDCA 1CIUA 2BVDA 2VZTA 2GVYA 3LXBA 4EANA 3SIMA 3VM5A 1W3LA 2NW0A 1FHDA 1ITXA 4FMVA 5CSYA 3AIRA 2WC3A 4AD5A 2F7RA 2G3JA 3AMLA 5A2CA 5GPRA 1JZ7A 4X9YA 1W9UA 3GBDA 4GINA 3GXTA 4PMYA 3MUIA 1BG4A 3U5UA 2WCSA 4D6EA 2G3IA 3ZIZA 1TA3A 5DEZA 3A6OA 4LX4A 4JKKA 1QNQA 1HJWA 3TTQA 5LA1A 1OT2A 2VMFA 4K68A 1IZKA 2QMKA 3VGEA 4PYSA 1RPKA 1YQ2A 4MNLA 1MQRA 3GBEA 3WNOA 3WEOA 3RM9A 4W5UA 2CXGA 1HVXA 1QI5A 3SCVA 4TTUA 2ZX8A 3GNPA 3CZKA 2WC4A 1W9VA 2YL8A 5E6YA 3FAXA 3K8MA 5DT5A 1M04A 1AQHA 1LQ0A 1UR2A 1VJZA 1UD4A 2QV4A 2VR5A 5IFTA 2EXOA 1ZJAA 2J7FA 1UA3A 1H09A 3ZJ6A 2B31A 1NP0A 1EDQA 3WEMA 2FDMA 4WKAA 4J3WA 3L2LA 1TA3B 1C8YA 1ZU8A 2YIHA 1MVYA 1TFVA 2E8ZA 1TQUA 2WZIA 4ATDA 5CSUA 1E4IA 5D9PA 4AD4A 1CGVA 2VT0A 4BZYA 2XVGA 4MJ2A 4CN4A 1E4LA 1DHKA 1VBUA 3ZT6A 5M3WA 4PMVA 4ZENA 1CECA 8CGTA 1UHVA 2ZUUA 1W1YA 1EQCA 2J79A 2DGAA 5I23A 5IDIA 1E4MM 2BY2A 1WCGA 3W27A 3ARQA 4P7LA 1JDCA 2AMGA 2OW6A 1B31A 1SMDA 4HZ8A 3W82A 5BYWA 3KL3A 1H2JA 1E43A 1FP8A 2F7QA 3CPUA 1E0WA 1VEMA 1I1XA 1KBKA 1FHLA 2DIJA 3BAYA 1EGZA 3BAKA 4D6HA 3WUEA 4CU8A 4DO6A 4J27A 1XC6A 4KWUA 3FY1A 4AWEA 2J8FA 4TOQA 2VX7A 4GIAA 2EO7A 3OLDA 3ARZA 1CXLA 3GXIA 2XFFA 3PZTA 2QHAA 4AD2A 3HG3A 3DYPA 2YA1A 2VQTA 1ODZA 4E8DA 3CHDA 4PMRA 1OIMA 3GNOA 3VMPA 1CXEA 3D52A 4E8CA 4ZEPA 2EPNA 3WH9A 3GXFA 5ABHA 3TA9A 4GI8A 4YPJA 5HPOA 4GI9A 4HA1A 4GKLA 4BCEA 2DSVA 4S3JA 2VURA 2WM0A 3CZJA 3WMBA 2WSKA 4FLQA 2VR4A 3WMCA 1NWUA 4UQAA 3ARVA 1HKMA 1TZ7A 3K8KA 1UQYA 1W1VA 3QOKA 1XYFA 2XIBA 2OLHA 3MANA 3RJXA 1CGWA 2OSXA 5A2BA 3WN6A 3WDJA 1AMYA 2O9TA 1J0JA 5E70A 1AQMA 3OGSA 1CGUA 4UQBA 1Y7VA 1E9LA 1UR8A 3FHAA 2WW5A 2W61A 3CHFA 1C7SA 1JG9A 1B2YA 2ZX7A 4PMXA 1XV8A 4CKQA 4U33A 4JKLA 4JZ5A 2YL9A 2DIEA 1IT0A 3W6MA 1HKIA 1CXKA 5A6LA 4XZWA 1G01A 3MSDA 2WWCA 2YDRA 4WIWA 3GH7A 2CNCA 4WSKA 3WBEA 1GPFA 2XWEA 4N42A 5AYBA 1H4PA 5FL1A 1E72M 4CU6A 1LF1A 4KGLA 3WEZA 3I3BA 4UFKA 4AEFA 1GZJA 1HXJA 4CD4A 3U7VA 3ZSTA 1KFWA 3OGRA 1KB3A 4U5IA 5AYIA 3SUWA 4W8BA 4UOQA 2XJ7A 1C92A 2V3DA 3T2OA 3W28A 1Q4NX 3WNMA 1G5AA 2YLLA 2GUYA 1TVPA 4ATWA 2V3GA 2AOSA 1TQWA 1UH4A 2AAAA 3MUZ1 1WE5A 4P7OA 5CG0A 3CUHA 4PRWA 1M7XA 2ZXAA 3BAIA 3ZT7A 4AEEA 1B3YA 1XGZA 3KZSA 4DWSC 4PMDA 2CKRA 2D3LA 4FNTA 3WMSA 2DSWA 3FN9A 5BXTA 1UKQA 4UTFA 1JI1A 1PAMA 2YJQA 2Y4SA 3A4AA 3W53A 4MAVA 1BTCA 4HOWA 1WP6A 5CJ5A 2D0HA 5FCZA 3TTOA 1B30A 3K1DA 4WKHA 3DECA 1S46A 3ARWA 2V5CA 1V03A 3POCA 3II1A 1QBAA 3J7HA 2EEXA 3LRKA 1FFQA 1E4NA 2W63A 2WMIA 3AI0A 5AC4A 3TV8A 1HX0A 5C8BB 3UESA 3ZMRA 2Q8XA 2XSAA 3L4UA 2WVTA 2X1IA 3NUKA 2WSPA 3CUFA 5A8PA 1HXKA 3WDQA 3EBVA 4JFVA 1PEZA 3VIFA 3QGVA 1ZBCA 1G1YA 2D0GA 1RH9A 4DM2A 3QHMA 1JIBA 4JCLA 2ZXDA 4UFIA 1EXPA 2X2YA 4D6IA 4UCFA 1WDQA 2YKKA 4MNJA 2D24A 1JGIA 1DWHM 4JKMA 5D8ZA 3AISA 3AQUA 2J25A 4B3KA 2G4FA 3G6LA 4D1IA 4XZBA 3M07A 3WNKA 1R87A 4JFWA 2VVNA 4AZHA 2WMIB 6TAAA 2VNCA 4PMNA 2X09A 4JAWA 1CZ1A 2XHYA 1UR1A 2D73A 1JFXA 3N1AA 2VZSA 5A6SA 1L0PA 5IXEA 3K4AA 4J3TA 4NI3A 3EJRA 2WMHA 1UD3A 1V08A 2OSWA 1HJSA 1ZBWA 1WZMA 1E40A 1J12A 4PEEA 2VX4A 2YOCA 1J0YA 3WH7A 4W7WA 2J75A 1R46A 2FH6A 3ZR5A 3HG5A 3MMUA 1QPKA 1JD9A 1J18A 1WKYA 1PIFA 5E0FA 5HPCA 4U31A 2JF6A 4TTGA 1XHGA 1Z32X 3WY4A 1CBGA 4ACYA 1C3FA 3CH9A 3AZRA 4U5KA 2UY5A 3PZGA 2ZICA 1WZKA 3VTRA 2YFOA 2QF8A 3ARSA 3RMEA 2DSKA 3AZSA 5I2UA 2EJ1A 2G8ZA 1V0MA 4U2YA 1GOWA 3VIKA 4PTMA 3BVWA 1DWIM 1I75A 3W37A 5D9MA 1K9TA 1BVNP 4NF7A 3PZOA 2BVTA 1MW3A 2D23A 2GSJA 1J9YA 1UR4A 4DUVA 5JIWA 2UWFA 1B3VA 2FYVA 1E71M 1QNSA 2CBUA 4PN2A 1NARA 3WUFA 3WQ4A 1QHOA 2VQUA 1K6AA 4OOZA 2VOTA 4MB4A 2CHNA 2XVPA 3WH8A 3UG4A 3MU7A 4H41A 2WNWA 1W9DM 1GOOA 1JZ3A 3OBAA 9CGTA 1FH7A 2UY4A 1SR0A 1CXIA 3DX3A 4CCEA 1LLOA 3KLLA 4CVWA 4P7RA 2DQXA 3AHYA 1B3ZA 1RD6A 3SURA 3EJUA 3F5LA 5IHSA 3W25A 5AY7A 3PZMA 4DM1A 4NZJA 4B3LA 3ARPA 3VIIA 1E3ZA 4FLSA 2WXDM 4AC1X 2EQDA 5A8MA 1SYTA 2CBJA 2VTFA 1V02E 2YDSA 2GJXA 3GM8A 4TVCA 1HL9A 1JXKA 4R5EA 4LGXA 4DO5A 1W2PA 4GXPA 4LYPA 4P8XA 3CBWA 1UASA 2CERA 1QBBA 1U33A 2F1BA 3WUGA 4NXSA 3TTYA 3IANA 4MADA 1JZ5A 3ARRA 2Y24A 4PSPA 2J77A 3MMWA 1NH6A 3AXHA 3VO0A 2FHBA 1J10A 4LXFA 4AZBA 4S3KA 3RIKA 1JZ6A 3K4DA 1J01A 4AD0A 2WZHA 4TX8A 2QPUA 3EDKA 4M29A 1DWAM 4W5ZA 5I24A 2JIEA 2WHJA 2FHFA 3FNDA 3L4TA 5I0DA 2JEPA 3BMWA 2EACA 3QHNA 3K8LA 3A23A 2CKSA 5I77A 2W91A 2GJXB 1UH3A 1E3XA 1NWTA 2PWDA 1KCLA 3MO4A 2WLZA 3VMNA 3WY1A 3AIWA 1KTCA 4H2CA 3APGA 2VO5A 2DPEA 1BYDA 3AOFA 1W91A 5BRQA 5A6MA 3PZIA 3CZEA 4DWSA 1PJ9A 4W89A 1BPLB 4W8LA 1LWHA 1HKJA 2EPMX 3OLIA 2JF7A 4Y7EA 1HNYA 3NJ3A 1A3HA 1E0XA 3T0BA 2XG9A 3SCPA
chains in the Genus database with same CATH superfamily
4Z7OB 4MG4A 3LKPB 1B3OA 3MCLL 5CC3A 2IANB 3SJVD 3MMEA 3TX9A 4DLFA 4NP7A 3LPGA 3KS0H 3QWOA 3SDCB 1ZHBA 4HIEA 3UADA 4V1DA 4ZT1A 5HJ3A 2Z2UA 2EYRB 5HI4C 2WBXA 1IR2A 3MOQA 3M9YA 2F8VA 2NLJA 4O51B 3VKDA 1MLCA 3H9SD 4LPVA 2YD9A 2OZ4L 3PGDB 4WY7L 3QAZC 3D05A 2XVNA 3B9KB 12E8L 2R1PA 4B6ZA 3W29A 1KCZA 5C54A 2HRPL 4PJIB 2OMBA 3FFCD 3EZ8A 1PLBA 3QZAA 2R4RH 3T6VA 5KVDE 2VLLA 2ED6A 4CW1A 4RGNE 4A8LA 2DZTA 3IGLA 3ISWA 3EOUA 1C16B 3PJWA 2QVHA 4LPTA 3T4AB 4F8TA 4X22A 2YZ8A 3A4JA 5C6TH 3B0XA 1IC4H 4CQDA 3KCPB 2FR4B 2NXYD 4O4WA 1JPSL 1AA1B 1RHHB 5EPDA 3GFXA 3PFRA 2PMQA 4AH7A 1OP9A 1NFDB 5F1NB 2YR1A 3MCMA 5CILL 5AVZB 1S78C 4W7VA 4JHZA 3MSRA 4JO3H 4U6XB 3VNLA 5F7DA 5L0QC 3WF2A 2VDOH 4X8XA 1ISWA 1ZPTA 5D7SL 3WLPA 5CBAB 5F1KC 5E9DD 2VHLA 3RURA 4W9KC 4V2XA 3M17A 5BOJA 2ZOKA 4V1DD 4N4QA 5T3ZD 3TO2A 3LMYA 3WJMA 3EYOA 3CUJA 2X89A 1CBVH 3VILA 1I1FB 1EAQA 1PAZA 1FNEB 4HU2A 3W3OA 4OCWH 4I87A 1EDGA 5EU6E 1UEYA 3CPLB 2AGJL 1F8TL 3VNDA 1E27A 2AV1A 3VDHA 1RK1A 5BOOA 2E9IA 5AOMA 3V4PH 4OCXH 3GUWA 4FSAA 4F9DA 2ONEA 3MJ8A 4E2BA 3RFAA 4UV4H 3AXXA 4ZSOE 5DMIH 3TK7A 3LPPA 2QXWA 1EAPB 5LNEA 1T5XA 1QG3A 3OODA 2ICEA 3FULA 3T40A 2VXVL 2DD8H 1FH8A 1OAYH 1NC2A 2BDNH 2HRLA 3G6AA 5TQ2L 3S9DB 3OZOA 4FGMA 4PJFB 1CIDA 3NFNB 5FF7A 2IBZY 3G6DL 5D55A 2G0LA 3BT2L 1O75A 4WKFA 2WNZA 1OEZW 4B9FA 5AWNL 1I8KB 2QTVA 3RNDA 3AU6A 1XSJA 2BCKA 43C9A 1WIUA 2Z8RA 5F7EL 3R6IA 1SEQH 4CD7A 3MGOA 3O41B 1VD6A 3HR5A 1MXDA 3APFA 4Z7UB 4K07A 5E5MA 2X6BA 4UTAH 1KTLB 4N9DA 1OAQH 4EIBA 4KOCA 3S35X 4CJ1A 3C61A 3U2SA 5GRWA 5E1IA 3CIXA 4HYTB 4OJYA 1CWYA 4KRTA 1M41A 4AXNA 2ZRYA 4OV5B 4HYRA 5DEJA 3HZMB 2F7PA 1C08A 1XLMA 3B5HA 3A0OA 4GA8A 2ITCB 1BAWA 4N9GA 4KI5C 2VR8A 1OW0A 2HH0L 1GOQA 4QHNB 3P61A 1QNRA 2WMJA 2YW3A 4DJDA 1BBDH 4S38A 3WCZA 4MXWH 2RDUA 1O6SA 3LKQB 1S5TA 4XZNX 5JMUA 3VRIB 1JCMP 2PYFA 2ZZ5A 3LN4A 2Y0SA 1CC3A 2CYGA 1NC2D 2ZSWB 4NDMB 3WTUA 1VFBA 5I16A 4EAEA 2NPLX 1H6FA 3TL5A 5AZ2H 5BCAA 2PYEA 3NAAL 2BOGX 1Q63A 4L4PA 4JN1H 4L9ZA 1WWWX 3BUTA 3TF4A 3ATAA 4MRBA 4HXBH 4RMUA 1J8VA 4FZEH 3KWWA 3WUBA 3U30C 1A7NH 4XC1H 1BEYH 3UU0A 3IETA 1EBAA 3F4DA 4WJXA 3BJTA 2G2NA 4CBPA 4XBSA 2YL6A 3MC5A 1PZ0A 2R29A 4NQEA 1RBOB 1O5RA 3ZIMA 2C9UA 4LOEA 2HN7B 4G7QB 4EPKA 4Z7NE 3GMQA 2F2KA 3WLNA 5L0QB 2IKIA 1KG0B 2Z91A 4P5TA 6A3HA 5HDRA 3MV9E 3O2VH 2IF7A 1QUPA 5CCJA 1KIPA 1F5WA 1XF3B 1S5IH 5IBLC 5EUKB 4P2RA 5LZLA 5E1GA 3DFTA 4PBFA 2DQGH 3FQUA 2IG2L 4LZKA 4W6XB 1TX2A 4QRUB 3G6JA 1ADQH 4IG2B 2EUWA 3KXFA 2EIZA 3SCTA 4JO5A 1TQBC 2IH8A 1FC2D 4KRPD 3DHUA 4DJDD 4AWTA 3L1FA 4FNPA 4HK5A 3TIMA 3CQ0A 3UFIA 2FTWA 2RDWA 5HHQB 1QX1A 5C0EA 1FWHC 5CC7A 1KIQB 2BVPB 3CDGB 2FGWL 1EPXA 4NFCA 4O4VA 2PYED 4KH9A 5IM7B 4EIVA 5TFSL 1PTZA 5EUOB 3ILQD 1B6DA 4O14A 1IKFL 4HPGA 3WTYA 3MPGA 3K6FA 5IQ9A 4WI4A 4TV3A 4PJGF 4X6EB 5BOPA 2GUUA 1LO2H 1XX9C 3TDFA 3MP4A 3M8OH 3M7SA 3TZNA 4NQED 4ZXLA 3X3FL 1P0EA 1JHTA 1WA3A 2G4GA 2B59A 3TNNB 2AXGA 1UD2A 4P5TD 4LGRB 3QC5X 3KUMA 4HLZG 4JTCA 2WKOF 4KQ3L 2WOQA 1UA7A 3SO3C 1UM6H 2WPBA 5GNZA 3P9LB 1RCYA 4UQ9A 1DTNA 2VXSH 1UUMA 1J5TA 4P2RD 5I76A 4PRPB 2AFNA 5L6YH 2N01B 1NCNA 4IISA 3PTMA 3KWUA 3BQ5A 4H4IA 4U7KA 1CFQB 1E6QM 1J1XL 5GNYA 4NZ4A 4E4PA 4OQTH 2OMWB 4Y1AE 1JNLH 4ICXA 5AVRB 3P69A 3QARA 3KXFD 1TEGA 3WLMA 3FO2B 4DPRA 2Y36H 1OE3A 1H5YA 4X0KB 3MHZA 3IUHA 3IJYA 4KNSA 4KUCD 4X3ZA 1E15A 3MBEA 2OXHB 3ESMA 4WU5B 4ANVA 1ZUAX 2W6RA 3KOYA 4PGLA 3OU8A 5D4YA 1OTUD 4CGUB 4UUJA 3RB7A 2ISSA 3OAUL 3TH4T 1BP3B 2DSZA 4RAVB 3OG3A 1LT8A 4NAEA 1MREL 2Z7UA 2B4CL 4NRXA 5IUCA 1GG1A 3G0UA 4OIBA 1NMBH 3SB0A 4PB4A 5DQJB 2YXFA 1RURH 4PJXA 1DBMH 2JELL 1GVYA 3EGDB 4C57C 5F3BA 3H22A 4AM0Q 4JIEA 3QDAA 3JWNE 4IMDA 2AV7B 5J5RA 3U30B 4XH2A 5TIMA 5D9OA 3W7RA 1KCUH 1KB5H 1R3SA 3U9UB 5KN5B 3T1GA 5TDPA 4Z7QB 3RNKA 5T9BG 1E4WH 4TTDD 5IQMA 4UAHA 5JUEH 3U0PA 3DJ9A 3MS8A 3DFQA 2NZIA 1AHMA 2JJWA 1JVOA 4LEEA 3BZEB 1A47A 3TYCA 1MUJA 2NQLA 4PW4A 4DJFC 1DVFD 4PGDB 2R4SL 3DXAB 4Q3MA 3BUDA 4TUFA 5ALBL 4I6KA 3HEIB 4NPYB 3APCA 1OSEA 1H5BA 3GUGA 1EEYA 3GMLA 4PVLA 2ABBA 4QRSB 1RIHH 4PGBB 2B1AL 3F4VA 3MBED 4OLZH 5A6KA 5CO1A 3PABA 1G7QB 5AOUA 1UYQA 1QWUA 1TQBB 4L4VA 1O9WA 5BZAA 1QOPA 1KPVA 1SQMA 2OJ1A 1MFAL 2DMBA 2C9VA 4PS7A 1BFVL 5AZEH 3H3BC 4MDOA 3QO0A 1GQIA 3NEEA 4ADTA 3WE6A 1GY2A 3AS1A 2SEBB 3RX4A 4J4PA 4OUUB 4G6KH 3U2CA 2VDOB 1KTNA 4YJZL 2LABA 3HMWH 2HLAB 3PJSA 2ZUVA 3WCYA 1PSKL 4ZFOA 3L9CA 4ZFFA 5TE6L 3BP5A 3MRRB 1R3LB 2C3VB 5D1ZC 1FYTE 1QLEH 1MJUH 1US3A 4C54A 5AW2B 1SBSL 1WSST 3O2DA 4UZGA 4WI0A 1MCOH 5DHYA 4P4RA 2J3SA 4UV4L 5GRXG 3T4YB 2VCOA 5EC1B 1TV5A 1JPGB 3KPNB 3H12A 1Q9WA 1AJ0A 3WKNA 4NZCA 5JIIA 1W8SA 3V4PB 4HVXA 2BVOB 4B41A 2ADFL 1KT2A 4E9TA 4BFRA 4JDEB 1OAYL 4M9PA 4MQ7B 4E36A 3GB6A 1ITQA 3MFGB 1G6VK 4M61B 4OCYH 4W68A 1QOQA 4TKWA 4Q8OA 4XP4H 1F0LA 1MI5B 3BK0A 4L4VD 2WZ6A 5I03A 2XISA 2YQBA 2QV5A 1T0NA 2EDJA 4NN6B 4F7TA 1S9WB 6REQB 2BM3A 5C0BE 5AC5A 2YPKB 3W7OA 3CVHH 3KVPA 1CGYA 3HA1A 1T2XA 2VKZG 4GK8A 3WJZA 2VM9A 3D5OF 4J4PD 4LRTA 7XIMA 1H6TA 4WWKD 4DJMA 2XXFA 3NZPA 4L6HA 3PAZA 3ATDA 3L67A 1YE4A 4K2SA 4HPOH 4MSWB 1M2OA 3UD6A 3I4EA 2OEJA 5DMKA 4OZOA 5LG6A 3D25A 1XCTB 3EHBD 4F7CA 4B2DA 4PLKC 5FIEA 4UTKA 1G67A 3MPCA 3CD4A 3SECA 3SBWC 1K5NB 4HV8A 3WFHA 1TTQA 4Y19A 3L9BA 3PQYB 1FRGL 2WXLA 4P99A 2NR6A 2GITB 3CX2A 1MCPH 1BBDL 4OV9A 4JFSA 3MOBL 3S2MA 1BVLA 1FL5A 3GPEA 4AIZA 1N4XH 1WGOA 1OLLA 3SQMA 1EC9A 4XTRC 5LN8A 1S3KL 2VFFA 3MRFA 2F7OA 1VF8A 5SWZB 5JHDA 4G71B 2BVQA 1FWNA 1B9ZA 3RR4A 4L4LA 4M56A 2UBPC 2BNRE 3NJMA 2YPVL 1OAUL 4UNUA 3SE9L 2FATL 1G9NH 1N0XH 2QKIC 1UMYA 2QS8A 3QCVL 2GVYA 5EBWB 2D03H 5J13B 3ME3A 4WTZA 4NY2A 2QAFA 1PWLA 2Z65C 1S5IL 1MI3A 5T3ZL 4RMQA 2BSTA 3QUHA 3UTZA 2EDLA 2W27A 3GSRA 4NQXA 4WHCA 2DQGL 1G7UA 4B2DD 1IZKA 1OYAA 2Q09A 3BN9C 3EGJA 1ETB1 4K38A 3TTEA 4G3YL 3BPNC 1W9VA 5D1ZB 3LS9A 2NR6D 4XXDA 2R23B 3PPGA 1G7MB 2E6FA 1NP0A 5ES4B 3P14A 2CLEA 3L2LA 4XE5B 3VXOA 3I02B 5ABAA 2ARWA 4LMQI 2XVGA 4LCUA 1AKJA 1VBUA 3V4VL 2ADAA 1OC6A 1QSFB 1C1EH 2CDFA 4AF0A 2EXTA 4IJ3C 4JN2B 4JO2H 5JHDD 1GHFH 5B22A 1Z9OA 3KPSA 3VQ1C 2R69H 1A53A 4QHKI 1YVLA 4U1HB 4EOWL 1TTAA 1KBKA 2ZOLA 3IFLL 5K1JA 1W31A 4WGKA 2PCPA 3RITA 5C08E 2YW4A 2QHAA 1OZMA 1OZUA 3KPRB 3KLQA 3HAEG 2KX9A 1J5OL 4KROB 1Q9OA 3O3EA 4MGXA 3VFTB 3LTYA 2WSKA 1CICC 1GS6X 2TSYA 1W5OA 3PNUA 1CGWA 1FH5H 1AMYA 5HJBA 4A6YA 3DX6A 4U1JB 1B2YA 4F33A 2PA6A 1JNLL 4MOZA 5DN1A 3DSNB 3MRPB 4WUUE 1CLCA 1M7UA 4EMZA 2YCEA 1C12B 4F80A 2A3TA 2IDFA 4JQXC 3WEZA 5ANMB 2DEYX 4NZTH 5MEQB 4QNPF 3I6SA 2F5BH 2OJEA 4GUFA 2BVUA 3QR2A 1KB3A 1FFPA 4DYEA 3W28A 4LTSA 1Q4NX 1TVPA 3TJPA 3C6SA 2ZA1A 1KIUA 1AKJD 2ICWB 2X1SA 1B3YA 3PHSA 1IO4C 4W9DC 1KBJA 3A4AA 3KPSD 4AQLA 3H7RA 1J1PH 2DLEA 1CZ8L 2DKUA 2FFCA 2XTLA 1P6CA 3POCA 2X4UA 3K6IA 4JHBA 2Z6JA 3R10A 2W63A 5AC4A 4PJ8A 3AC0A 4LV9A 1JUKA 3L4UA 3A67L 3NUKA 2QUNA 4LB4A 3LKOB 5EIIB 4QG9A 3HKFA 1SYVB 4ODTH 1DQML 1NFPA 1URZA 3EXTA 4Q4SA 4YE0A 4D6IA 5I8KH 2NUXA 2YD8A 2PDBA 4MNJA 1SJXA 4GG9A 3ZWTA 4KX7A 3NL6A 4OCRL 3M07A 4AY8A 3ALXA 4PLJC 4C4UA 4G8GB 2ZG3A 1LXMA 1CZ1A 2MQ3A 1L0PA 5E03A 1JF1A 5FYJH 1EP2A 3ZHDA 4IKNA 4BZ2H 2EDMA 2CLZA 3KWTA 4KY1L 3PJLA 1HE7A 3O3DA 1S9YA 4W7WA 3V18A 3GDTA 3GS0A 1ESOA 5D1QC 3N40P 1I9RH 3ZVIA 3UEZA 4X4YB 3LJ3A 3HW7A 4NIRA 3BPNB 1E3FA 3O11B 4OZFG 2VDLH 4TUKL 5DS1A 3V36A 4NI8A 2AJ3A 1U3HB 2BNUA 5CBEA 3W7PA 1BVNP 3PPHA 3JXAA 5CLYA 5C6MA 1J9YA 3BZFB 2AABH 3NGFA 1ZT7A 3LN3A 4P57A 3CXHJ 3RU8L 1G9NC 1XGPB 5TDOA 4D9QD 2WNWA 4XT1C 4IJ3B 1OIOA 4L1SA 3MYPA 1JZJA 1M1XB 4PJ8D 4JQIA 4UUIA 4UIMB 4Q0XL 35C8H 5FF3A 4OB5H 4HPYL 1E3ZA 4FLSA 4I9JA 5E51A 4JO4L 3HCVB 1OAJA 3R2GA 3V0AC 4TVCA 1J5IA 4J5NA 2ATPB 4HUCA 1R3RA 1IQWH 1NJJA 4YXHH 4TMBA 2ZKWA 1HYSC 2FHBA 1KTRL 4LXFA 4S1QL 1QLEB 4S3KA 3NCJH 3TEXA 4GG6B 1CICB 3SDXB 3RUGA 4YJ5A 3LKPA 4L1LA 5I0DA 3LNEA 2WP3T 2JEPA 4HNCA 4ZMOA 2IANA 4LALA 5TPWH 4PA8A 4B5SA 1KCLA 1PTGA 3TWCH 2DZSA 1KTCA 3SDCA 2GSHA 3VYPA 2X9WA 4F1ZA 1JK8A 8PAZA 1QR7A 2ODIA 1Y1DA 5CSSA 4WXYA 2EYRA 1WH0A 2JF7A 2GWGA 3FUHA 3TN4A 4O51A 5BUPA 4Q7BA 4K7PL 2OLAA 5I02A 3CT2A 5JIMA 4RZ5A 2Y0FA 2ZKMX 5J12C 3SPJA 4ZFZA 2YA0A 3UTSB 3BCJA 4PJIA 3T08A 3U0WH 2G2PA 2OZ4A 2PABA 1ZPUA 2QEJA 4CMHC 3CVHB 1HHGB 2JWYA 1P6BA 3W1MA 4BH8A 4U49A 2D0FA 1K9DA 5CJQH 5FYLE 3E0IA 1NKRA 4PPTA 4S1SL 3TAKA 2WXKA 3WO4C 3OJVC 1PZSA 4R3SA 1AANA 2BZDA 3KCPA 3ANYA 1MCPL 2FR4A 1T66C 4Y9MA 3CLMA 1YPIA 1KYFA 3QPYA 4LCQA 3MDJA 1RHHA 3S34L 1M7IB 1QEWA 1N4XL 5DC2A 2W62A 1NFDA 5F1NA 4LBAA 1CE6B 5HHMB 3NQKA 1K7XA 3S2AA 1TCRB 1PLAA 2GFTA 2IAND 2OODA 4MPQA 2UX7A 1VH7A 5DT7A 1HT6A 4GT0A 4MA7L 4KY2A 1YG9A 3SDCD 4AFYA 3WKZA 5FYKL 4NNYB 5HANA 5XINA 2G5RA 3AIVA 2I07B 1A4BA 4KTEH 1G7PB 4IRZL 3KOFA 5D1QB 1QOKA 3D3VE 1FNEA 1SYSA 2TRHA 5JXEC 3CPLA 2Z8SA 5DFAA 4RDBA 2PCYA 5K9JL 4QXTA 4LT7A 3BVVA 4AQZA 4YR6B 3FKKA 1JGLH 2WY3B 2EH8H 4AEIL 2B20A 4OUEA 4MAYC 3EGXB 3JW7A 2XQYA 5AL0A 5JMOC 1EAPA 3WS3B 5LNWA 4MMZC 1UR3M 1JAKA 1Q0EA 4W87A 4EDWL 2WNXA 5GGQL 4MUPA 5CKSA 4XD5A 1KCWA 1FCGA 1PG7H 4AKPA 1OCCB 2Y63A 3CSFA 4HIPA 2VW4A 2VLRB 4C1NB 1KCXA 2WJFA 2FBJL 3GZPA 3B8UA 1MNUL 3VD7A 3FYYA 5IBTL 1I8KA 2DYRB 4OLVH 4P23A 5IEKB 1SN5A 2ZTBA 3N15A 1X97A 3IRZA 3H55A 3MCKB 4GRMB 3AY4A 4NYLB 3COTA 4J8RB 1JCYA 3DV6B 1XL9A 3TE9A 1N8IA 2NVCA 5G4WA 1BMGA 2B81A 3HC2A 2R69L 5H2ZA 1KKOA 3ZZQA 3P3RA 3H7LA 2YD0A 1XRSA 1KTLA 4AMCA 1AGFB 4L3FA 3U1QA 3Q1SH 3USBA 1PGRB 3CUPB 4HCGA 1K7EA 3HZKB 3LUTA 4YOKA 3CV5A 4YX2L 1XGUB 1XCFA 1RJPA 4OV5A 3RU8X 1QNZL 4P05A 1ZSHA 3AYSA 3DTXA 5BQ7A 1ORQB 3HZMA 3OJGA 3LHPH 3TN0B 4AIOA 4W9LC 4BHUI 1PPIA 3HPLB 2BP3A 5C0RH 2ITCA 5FK9B 1ZTXH 4Q2ZB 4KCWA 4JX6A 2VSMB 2HTMA 1JNHB 4MTMA 3ULVH 5EEUA 5IHBA 1BEXA 4QHNA 5ACLA 2V9DA 2DUAA 1TO4A 2BFGA 2AVFA 1FH5L 1ACYH 1KEMH 2WLIA 3VFCA 2R39A 3B8TA 4DJEC 5B7MA 2YZRA 3VVGA 3VRIA 3W71A 1F41A 1QQDB 4CMHB 3SRKA 2PPAA 2ZSWA 1KCBA 4NDMA 4QTFA 3FEQA 1MHCB 5MP6H 3RLVA 5GJSL 2LR4A 3BWSA 4KDVA 3VFGL 4Y16A 4HNTA 3URQA 5T8GA 2WJEA 4P2VA 4Z6AT 5C1MB 4TSCL 4P23D 2CHDA 1UIOA 2QW5A 1IBFA 2J57A 3IJSB 1K3IA 5HDBB 1NINA 4LSBA 3OZPA 4CJ0A 3DYOA 5ETUB 5C0IB 3H6OA 2AMXA 4XBGA 4RE3A 3LYRA 1MCBA 4L8DB 3RIFK 3VQMA 1PS9A 3PWPB 4XO4A 3HVNA 5TD4A 1KG0A 5IVXE 3IDIB 1V7NH 5IBUB 1XF3A 5HI4D 1BVNT 2ERJC 2ESCA 3D1MC 2F2HA 4AZCB 4NQQA 4XSLA 4JHMA 1GOIA 2P5NA 2ESVB 3TURA 2XN0A 3ZLGA 4ODTL 1T7VA 1EEXA 2EXSA 4QRUA 1AVAA 4IG2A 1GZHC 1A7QL 5KSAC 1J05B 2EDYA 3HNSL 2Y70A 3LCWA 4WOZA 2F6XA 4IBVA 2WTRA 1Q1JL 3R89A 2XLLA 4MWAC 1VBGA 3R58A 5A95A 3H8NA 3MGAA 4LARL 2XU9A 1J1OH 4OZGB 5EZOH 1YIXA 4MAYB 1PB0A 4PR4A 3WNPA 3WL1A 1QW7A 4BZ2L 2OMYB 3ZL2A 5HHQA 4XAYA 3TA3C 1KIQA 2BVPA 1I3UA 3CDGA 3I9IA 1JZHA 3KGTA 4JGMA 1VGKB 5IM7A 2OX5B 4WW1B 5EUOA 4L1GA 5C7VA 4L7ZA 3C2SA 2Z2AA 3VGDA 4RPPA 1BQ5A 2IPWA 4S39A 3WJXA 4E6MA 2XPZA 4ZOBA 2DMCA 2PMZA 3JTSB 3QE5A 4YHMH 2EIDA 2CO7B 3NOIA 1K4DB 2VDLL 2WQVA 4BKNA 4X6EA 3EEZA 1NWOA 5F9OL 3IIOA 3W39B 3LCHA 4NAFB 1EVTC 5DU7A 3UZWA 3LCYA 3LNDA 5F2LA 1S78D 2ENYA 1CVSC 3ABZA 1AIFB 4L4TE 1F74A 2VDLB 3TNNA 4B9GA 1AS7A 5EFDA 4U28A 3MXWL 4QE5A 4HPXA 3UBPC 3P9LA 4BQBA 4M3PA 4XWOC 1HI6B 4L64A 3BGGA 4H8VA 3S3DB 7FABH 2P8MB 5IGXH 3W02A 4X4ME 3JUGA 3EOYG 1CFQA 1Z7JA 4PJHA 5A8OA 2AJVH 4UTBH 3CZNA 4AK1A 5FJTA 3UL4A 4Y5XC 3FO2A 1BXXA 2ZYIA 1LK3H 1I9IH 3RIAK 4I85A 3IIVA 3H3KA 3B04A 4X0KA 2H9GB 4ODSL 1BLNA 1O5XA 4TPRH 4K0OA 4M48L 1XIGA 5EDSA 1F3RB 4WU5A 3VNKA 4I5BB 4GBXC 3CAQA 3LTPA 4GY0A 3WYZA 2ZCKL 2O5NA 4PGJA 5AW1B 5EORL 1FGVH 1RJZB 1XIDA 1EJTC 1UPMB 5L4IA 4RAVA 1W0VB 4IIGA 1EQWA 1TPXB 1X5MA 1W3KA 1YEIL 5CJXC 3SPVB 5DFVC 3BYTA 5HK4A 3SJNA 5FIPA 4EIUA 4KRZA 2FL5B 4HC1L 1I85A 3PUDA 3MR9B 1KM1A 1N7KA 2C3GA 3GSOB 2HXUA 3VNIA 2AV7A 2R14A 2A1WL 1YAZA 2YD4A 4HB7A 3U9UA 2C71A 4PM1A 5KN5A 4R4NC 2RR3A 5E5RB 4CQ9A 2WMGA 3R11A 3T8XB 2ADJA 1HJXA 5BZWA 3OEXA 1M56B 1OQOA 2LU4A 4KRLB 5H94B 3ULVC 3CXOA 4PRPD 5GGRY 5CLWA 1NA8A 3BZEA 5C5YA 3SYQA 2UYLB 2QJDA 1UOWA 2YMXL 4PGDA 3JWNG 4O2FB 3WQ8A 2D22A 2WPGA 2ERJB 2UUDK 4NPYA 3EJCA 2WW8A 1KIRB 1HNGA 4H0IA 4Y9OA 3G1AA 4QRSA 3P4NB 1G7QA 1EAJA 1PHWA 2ACRA 1P7KB 3VAVA 2R9HC 4MWAB 1PS3A 1OTTC 3BWUC 4PC8A 3T6WA 3WY3A 3V5CA 3PWVB 3MI3A 1J0ZA 2H8PB 2SEBA 2Y3AA 4F48A 1HKKA 4PMJA 2ZRZA 4OUUA 3GKWL 4FZ8L 2X2JA 1OX4B 4ZJ9A 1YMHB 2HLAA 3SQBB 4UR8A 1ANUA 2A2QT 2NY0C 2ZAIA 4X99A 2AQSA 4ZL1A 1MSPA 3MRRA 3WF0A 1I1YB 1R3LA 1NKOA 4TLKA 4AKOA 3OKOB 1J8RA 2DL9A 2IPTH 3MBDA 3EOSA 1MCSA 3RHWK 2NYYC 5A43C 5AD0A 5EC1A 1UADC 3FT9A 2YBRB 3LB6C 3EA1A 5JQIB 1NJ9B 4DEPC 1P4BL 4NIYE 1YEDB 2BVOA 1GG0A 3AITA 3GS7A 3CAVA 4DZIA 5BXPA 4ICNA 5IBLD 1T2QH 4MQ7A 3ALGA 5DS2A 4PMUA 1FWEC 4QQ3A 4KERA 5GS0L 3EA2A 5BRBA 3SI9A 4HTBA 1INEL 4FXJA 3MHGA 4M61A 1WFJA 3LCLA 3AACA 4NWUH 2KC0A 1XC4A 4OLUH 2HNEA 4WOQA 1GHRA 2UX6A 3DG3A 1NBVH 1MI5A 3IMTA 1SGJA 5AYUL 3LEXB 2JCWA 3WQ6A 3G04A 2J1WA 1UZ1A 4PUDA 2B77A 4NO2A 3U48A 1HTYA 3LV3B 1L9OA 1RCQA 1S9WA 6REQA 3CFDB 2YPKA 4AYEC 3PGFL 3FCGA 5KSUB 4QITA 4WNSA 3MY9A 4YYFA 3N2OA 1NGQH 1Y8BA 1KN4H 3MWAA 5A2JH 3EFDL 3ONCA 1OQFA 3QT2A 4HOMA 5L8JB 3FUFA 1UOVA 2EF9A 4ENLA 4MSWA 3KYMA 1MJ7L 4AY1A 4H0HB 1DVXA 1SFLA 2WYTA 1CK0H 3RDTB 1CXFA 1XCTA 3LHPL 3AREB 2ZE3A 2EINB 1OM9A 2HVMA 1QCWA 4ELMB 4WHYG 3KLAA 4XMKH 3L4VA 2DTSA 3PQYA 1U8NB 3KLKA 2GITA 2OKOA 3TW6A 3DO7B 3PY9A 5CPOA 3N18A 1LQBC 4WLCA 1TVDA 3DC8A 3P4OA 4CD8A 4H26B 4N4YB 3QFWA 2HT2C 4H20H 1UKTA 2ZWLT 3V0JA 3C87A 5T8IA 3BKJH 4AGLA 4J3OG 2XTJB 3L4CA 4A38A 4QOKB 3RPDA 5CPQA 3KBNA 4K71C 4CQCA 3TX4A 3EPMA 2BNJA 1MI5D 3SE4C 1MJ8H 3AS0A 1V0KA 4S1RH 1WBJA 3GRIA 4LJ3A 3XIMA 4DBEA 1DO5A 3K5XA 1FORH 1T6VN 3O05A 3VXUB 1JCXA 4YHKH 5I5RA 5DJXB 1RA0A 3QIUC 5CR1A 1S2EA 2WTOA 3E6HB 2G3FA 4ZYKA 3W1NA 5JBDA 3WXWL 3C4UA 4IRJC 2JCCB 5EBWA 3FCTB 1KGCE 4G9DB 2YPVA 4G6JH 4Q8UA 4HHLA 4CUCA 1MCWM 3FFDA 1JWSB 2QUUA 4JQ1A 3MBXH 1JNEA 2MSPA 1XD1A 4GBDA 3DO3A 1L8PA 3SADA 4JUSA 2UZIH 2DYPB 1B9KA 4IGSA 5KWYC 2X1QA 2F54E 5EH1A 3KYNB 5E9DA 3A22A 1S4IA 1P1ZB 3PQYD 2VZTA 2KI6A 2EIKB 1NCWH 1W3LA 2R23A 4FMVA 1JDFA 3P0YL 2NZLA 4Q8NA 1FFTB 1V5XA 1G7MA 2CALA 2FB2A 1SZGA 3U5UA 1YNPA 5HY9A 2XBTA 5DEZA 3MDWA 1OARH 3I02A 4KJWD 2NLIA 3MKVA 4WTWA 3N41B 4JZNA 2QJNA 4DJFD 1QSFA 3VI4B 4DZAA 4KMLB 4JN2A 5E6SB 2WC4A 2QSCH 3QPZA 3GW0A 1M04A 4U1HA 2XC8A 1LQ0A 1CF8H 4YHML 5AOLA 1OM3L 2KT6A 2P5EB 1O9VA 3V4VA 5D6DC 4ATDA 1W17A 3O6LL 2XKSA 1DVYA 3AT9A 5D71L 1TRIA 4RX0A 4CN4A 3KPRA 3NQVA 4TV6A 4KO5A 2WQDA 4PBWD 2EEDA 1FCCA 4HQVA 3BVJA 5EBUA 4HCRL 2J8UB 1RL1A 2YAPA 1ZEAL 4KRMB 2HP4A 4D9LH 2J8FA 4H01A 3UWEA 4O9HL 2W0FB 4K3DL 4W9FC 4U1JA 4C65A 5C3IA 4E3TA 4ENEC 3B0YA 3DSNA 2BIPA 2L7EA 2FX7L 3MRPA 2P0IA 5HWJA 5D1ZD 2HWZL 3VNMA 5JPMC 1C12A 2BSRB 1K4HA 1KA9F 4NQUA 2TSBA 5ANMA 5MEQA 5E2JA 3SE3A 2DW6A 4DAIA 3S4SG 2O9TA 5LQBH 2UWEF 4EZLA 3HI6H 3GINA 3E5BA 4RRPM 2ICWA 1FGVL 1QSFD 3E8VA 1DSFL 5E2WL 4CNOA 3SOBH 3GH7A 2Z7GA 4F2MA 3ABGA 1EJ8A 4JDVB 1CLZL 2EYTB 3ZX1A 4J6IA 4DKEL 4Y9NA 5I2IB 1WZ1H 2OBGA 1OPGL 2IMNA 4ISVB 3NVQA 1VFLA 1Y18B 4JW3A 3WNMA 4EZJA 2NDGA 3MP5A 1QP1A 3QJUB 3G7TA 4MSSA 4KO7A 4RDZA 3IKCB 1S3TC 1TG8A 3KPRD 1RZFH 5EIIA 4XKYB 5IVZB 4F3HA 3WK3A 2JIXB 1AR1C 3K81A 4KROD 1D5RA 2XWRA 1EPFA 2YAMA 1N8WA 2FLRT 1VJIA 4AUUA 2JB6B 4HOWA 1ITUA 1N64L 5GSRB 1VFAB 3TTOA 1B30A 3K1DA 3DECA 3QIUB 1IYXA 4WW2C 4NQSB 5ANHA 2BMKB 4IOIB 3LVTA 4OGXH 2UXGA 4GLRI 3P6LA 1B4JL 1FWIC 3K13A 4TV5A 2BRQA 3QG7H 4BQ9A 4PG2C 1TELA 4GXFA 1TFPA 3ORWA 1QEXA 1MCIA 5DRNB 4HSQA 2DM4A 2XH7A 1YBQB 4ZMVA 4X4YA 2YD1A 1BYOA 3N9SA 1PJWA 3O11A 2ZTJA 1QKZL 4MA3B 1BDYA 4QQUA 1E4JA 2OULB 1JFXA 1U3HA 1LK2B 4WJ5B 3K4AA 5I7GA 2PWVA 4IW4C 2E6QA 2X4OA 3BZFA 3Q5TA 3QAZB 3R1GL 2YOCA 1ASPA 5BS0E 1XGPA 2FPVA 1QPKA 1JD9A 4LANA 1JFQL 4XTRD 3TJIA 3J8F7 3Q01A 1NCIA 3MJMA 4FI7A 5KVEL 2VYRE 4FLHA 1UZDA 5DA0B 3MZGB 4UIMA 2W0UA 4P2YA 2KZHA 3OAZH 5D9MA 3PZOA 1MW3A 5JIWA 2INEA 1B4LA 3HCVA 4ODVL 5T9CE 5KTLA 5CSZB 4PBEA 2VOTA 1SLUA 4H25B 5KVGE 4M6QA 2P5PA 4O52A 1M3UA 4XPAH 5DJ2B 5DFWH 1E7VA 4HBQA 2JK5B 4F4RA 4GG6A 2AJYH 2IQ9L 3HC4H 5E6RB 1A4JB 1U9KA 3CV2A 3MBWB 5DJAB 4DAGL 4A6GA 1AJ7H 3PWUB 1RZ7H 5EZPA 2ICSA 2Y7DA 1KJ3L 4B9PA 2Y24A 1NH6A 5DD1L 3S42A 2BFVL 3K4DA 2IDTA 3QF0A 2WB1A 1U3HD 1EA0A 4W5ZA 5I24A 4OCNC 2JIEA 2NX3A 4AENB 5EEXA 1Z0MA 3HTWA 1W5QA 1J4EA 5DRZB 2E09A 4I77H 3AALA 4YNGA 4A22A 3UTSA 5KYXB 1YEFL 4H9XA 2V5BA 5JA9A 2DPEA 4FL4C 2A5UA 4L23A 1AGEB 4I90A 2G5BB 3M44A 1U5JA 3CVHA 4ENZA 1HHGA 3FB8B 1R5VB 1RIUH 1PO9A 2RFXB 3ZJKA 3DETD 3EG9B 2ZXBA 4B95C 3K2KA 2QPDB 3GH5A 1XYMA 3G2GA 1KC5L 1XR9B 1AR1B 4UM9B 4GRLC 2AAVA 2G60H 2INZA 2A6LA 4F9PC 3OVRA 3UG5A 5DD5L 5K59E 1CICD 1M7IA 4YFLI 1VHNA 4WW2B 1COBA 2CBPA 1CE6A 4JFHD 3ESNA 4N24A 2D4FA 1ZS8B 2J2ZB 3THUA 2QZ5A 1NCHA 1IEIA 1BA9A 5JNYB 4XN5A 3MRBA 1VRXA 3IGFA 3EJYD 4NNYA 2XQ0A 1AO7E 2PPGA 1MFMA 1MJ8L 1D7FA 1G7PA 2EDFA 2IOIA 2H26B 5D1QA 2ZXCA 3MO7A 3PPSA 2WWOA 1DVFA 1BOYA 3U2OA 4DN4H 3CC5A 4KO6A 1VPQA 4XMLH 1TE1A 5KZMA 1V6YA 4XVTH 2R2BB 2ACUA 3UTSD 1NUGA 4YR6A 4IRZA 1J6OA 4C4KT 2X41A 4JO1H 3D9AH 1F3DH 4RV8A 4OU1A 1DN0B 4F9LA 3KCWA 3QGKC 4PTVA 3WS3A 4F9JA 5A7EA 5DRWB 3GVVA 4F0MA 4HWNA 4EZKA 2W67A 3TT3H 3V6FB 4HN8A 1RVFH 5EN2B 3RVTC 2HVJB 3SCSA 3JBG7 4KEUA 4DT2A 3OQ3B 4LC8A 5M03A 4ZW6A 1O95A 4MNHB 3VVWA 2P88A 4PLNC 1VCBC 3TBYB 2PLMA 5IEKA 1OARL 5HHMD 3RDKA 3MCKA 4AD1A 4GRMA 3OTTA 4NYLA 5D6CB 1BD2E 1XGDA 2R4RL 4J8RA 2PDCA 3DV6A 3NIFE 3FU0A 4GSRA 4HSCX 5L7XH 1DQJB 5FEPA 1EJOH 1XFPA 1B88A 2WLNA 3DI0A 3OZLA 2YAOA 4NP4H 4PBDA 5D1QD 4D6CA 1SJEB 3IK2A 2Q1EA 3CUPA 5FYKD 1TPC1 3HZKA 4PGZA 3BW2A 3WSUA 2R69A 3BIKB 1XGUA 3M0VA 4IT1A 2IPKB 5C6TL 1IC4L 1ORQA 1POKA 2QJMA 1MVUB 3TN0A 2ISWA 1QZ1A 1KD0A 3HPLA 4Q2ZA 4XO6A 2XV2A 1JNHA 1MHEB 3WG7B 4OM1H 3ULUE 1WS8A 4QEHA 3ZDWA 1GZQA 4GRWF 4JO3L 3O15A 5HJDA 4DP1X 3DUSB 3ALPA 2VDOL 3MKKA 1F1GA 2COQA 1SQ7A 3GNXA 1GHSA 4ALDA 5JW5B 4WEEA 1MHCA 1CFVH 2EKSB 4NQ1A 2VLRD 1LOQA 1CBVL 2WHLA 2GDUA 1IAKB 2QJIA 4WWKA 4DEUA 4M5ZH 5B7ZA 4ZSUA 3L08A 3WUWB 1CCZA 1R38A 4OCWL 3ATYA 5ITFB 3PPCA 3P3SA 1Z9AA 3EYVB 4GRLB 3IS1X 2R94A 2DMHA 2VZ3A 1QWKA 1I8LC 5DVKA 1HAUA 3V4PL 3FTYA 4OCXL 4W9ZA 4YTUA 5ETUA 4NO5A 1OT4A 5C0IA 3WLWC 1JMXA 1BJ8A 5DF0A 4FQCH 4L8DA 4NZ3A 5DMIL 3IIXA 4OE7A 1UCWA 2YQGA 3EX4A 4NC1C 5ID0B 2BP1A 1FI8C 2EUXA 4K3EH 3SKNB 3IDIA 3SO3B 1J8HE 4WDTA 2DD8L 2BDNL 2TYSA 5J56B 3RVWC 2I27N 3E2RA 1EHNA 3CZFB 4AZCA 4OQVA 2VABB 2ESVA 3BLPX 3TN0D 2PURA 3LD5A 2PW1B 4JN7A 2V30A 2CLVB 2V7NB 2KMWA 4JANB 4GNVA 2ZOUA 5GISH 1VSCA 4PY7B 2ZP8A 1HL5A 3ITYA 1J05A 5AC8A 3UVIA 3WHE1 2DJ4A 4KWSA 1VBRA 1CYWA 4BQ3A 1SEQL 2QQQA 3GKAA 1MW2A 2JXMA 1NICA 4MJHA 3GTVA 4OVVA 4AQAA 3ID7A 1U42A 4OZGA 4QHUB 2YSWA 4PJCF 2ZX5A 4OFVA 1ZL1A 1SM9A 3T9PA 2OMYA 3IPBA 4OZHB 2YXMA 3UDWA 4UTAL 1X7TA 4ZOCA 3G22A 3CWNA 1OAQL 1VGKA 3P0GB 4WW1A 4HK3N 4UWQB 1A7BA 5SWUA 4F37F 2EPHA 3QDJB 4PTWA 5IBXA 1NWPA 3I9PA 4BZ2A 2G0KA 3GC4A 3KYAA 4HJWA 3JTSA 3D06A 5IB1B 1N2RB 1L6GA 2CO7A 2DZBA 3PBGA 1MQPA 4PJ5E 2CIIA 5C70A 3W39A 2X4SB 3FA3A 3T0TA 2QT3A 5AAWA 3GTFA 1AIFA 2C3XA 3UAEA 3GTXA 2APWA 4Q6XA 5B3JF 2DAVA 2Y2YA 4MXWL 5AKTA 2ZCHH 1NWSA 3W7CA 1XZWA 4HNNA 3P2VA 4JY8A 5IFJB 1HI6A 1W3JA 5M5DA 1EOKA 5AZ2L 2P8MA 2ESVD 3ORJA 3UZYA 5JXED 4J7RA 4JN1L 4AVOA 1A14H 4KCTA 2C0HA 4JCWA 5I06A 4HXBL 4I89A 2HBVA 1DJGA 1OQXA 5LVEA 4Y9BA 4LRNH 4FZEL 1A7NL 4XC1L 1BEYL 5F4WA 3PFMA 2PBGA 2H9GA 4DZ8A 3THQA 2G41A 4A4AA 4Z1BA 4MAYD 3S3SA 5MERB 4WCJA 4I5BA 4HGMA 2XGBA 3VA2C 4RVBA 3M7OA 4CADA 1WZAA 2VYOA 1FLRH 3O2VL 1W0VA 4OUIA 5FYJD 3P9WB 2C3HA 3SPVA 3BP6B 3EFOA 4NRYB 1UB5B 3HQOA 4LBSA 5FGBC 1XRVA 2VRJA 3QISA 4X0VA 2OPCA 2FL5A 4LSSH 5I3GA 3FU5A 3FCBA 4Z7WA 3MR9A 4ZZ9A 4AD3A 1GYLA 4HKZA 1KRMA 5I8OH 1ADQL 3GSOA 4H04A 3F2LA 3A3WA 2DLFH 2YSSB 3H2WA 4G7VH 1M6UA 4HC1A 3UGRA 3MLSH 4DBDA 1BKHA 3K5SA 3T8MA 3PSWA 3BVNB 3G5YB 4X4XB 1XDTT 5H94A 1B0IA 1KJVA 4XAKD 1DBTA 2ZOOA 4CBZA 1YYMH 2UYLA 3CDYA 4FHKA 4PE8A 4O2FA 2H6PB 4F2FA 2F6AA 4B4HA 3UJSA 2G60L 1KIRA 3W9ZA 5E6UB 1AD9B 1LO2L 4NJHA 3IMVA 3M8OL 4IK7A 1SN2A 2HPOA 2A3AA 3WKPA 4MWAA 4MQXC 4HZLA 3VD4A 2OMNA 1UOZA 3PWVA 4ROQA 3HMJG 1UM6L 2RTTA 2H8PA 2O9OA 4F2EA 2VXSL 1V8EA 3DENA 3TT1H 3ZMEA 3FQRB 5L6YL 3RG1C 5I0WA 1KWGA 1HL8A 4OQTL 3EWUA 1F3JA 2Z64C 1W72H 3QRLA 1HN1A 2Y36L 3OKOA 2GBAA 3EA3A 4JO1L 3D9AL 5GRZA 3FT3B 4A66A 1G4RA 1X5FA 2YBRA 1KO0A 3RXZA 1U1UA 1XHHA 1XTLA 2B3IA 2K0RA 4XZ4A 5EU9A 3L9EA 3FJ4A 2CE6A 1K77A 5IQ7H 1JUBA 2XPGB 3TJXA 2B3RA 3PPFA 4J3VA 4GPNA 1JZIA 3TT3L 3QW3A 1XXDC 3SCUA 4LEFA 1NMBL 3JWDH 4OZIF 3H0TA 4AW7A 5F0PB 3W5MA 1RURL 5DD6B 1OCBA 1DBML 3RCYA 3HG1E 3S36H 3JZYA 4DPBX 3QEUB 3PU7A 3B4UA 4ZMTA 4FNLH 1X4ZA 4MWAD 4ABWA 4FLOA 3EJTA 1KCUL 3LV3A 4X6DE 1KB5L 3N2JA 2QL1A 1W6TA 3CFDA 2OWWA 5FHBH 4H6KA 4XPHH 2QKIB 1LL1A 1E4WL 5JUEL 1KLUA 4K15A 1YUHB 4K23H 2HEJA 2Y8KA 3QZBA 1KB5B 3TV3H 4AW4A 1G1OA 3GIVB 4CNIB 5CJXA 3CIVA 2J1YA 1WAEA 1QFEA 3D5HA 3GJFH 3D4CA 2MQ0A 4MJZA 3WJSA 3RDTA 2XZ7A 3U0TB 3AREA 5FEXA 1ZWIB 3VH8B 1IGIH 5GJNA 4ELMA 1RIHL 4OLZL 1S3RA 1KPRB 2LTQC 3RR1A 4ZOEA 1G69A 4TNGA 8A3HA 4XVUC 3K4ZA 1XB6A 2ZVIA 5I1AB 1D2KA 3LRGA 1U8NA 4FULA 2HISA 3MQIA 3OIHA 1XDLA 5AZEL 3MYOA 4D7PA 4XWOD 4H26A 1VR6A 3L2IA 3ZR6A 4TOYH 3E02A 1CFVL 4M81A 4G6KL 2PDIA 3GMMB 3HG4A 5MEOB 2PDXA 2BVWA 3B0PA 4S1DD 3CIWA 2NWRA 4QOKA 3HMWL 3OKEB 4Q56A 2DV6A 2NV9A 1DQIA 1D3CA 3PHQB 4NN5C 3RF9A 5GS0D 3VTTA 4TXEA 3RWCB 1BYBA 1QLEL 1MJUL 3FL7A 1MCOL 3WO3B 1QK2A 3RZWA 1CI1A 1HDMB 4N2LA 4OT1H 5DJXA 4LVNC 5CPLA 3E6HA 4Z3EA 1FTXA 1P7TB 1T89A 2ODOA 4G9DA 1KR1A 3UXKA 1E8ZA 1WRFA 1WDAA 1JWSA 3VRLE 4F7KA 3R06B 2BWQA 5DFVD 4B0MM 3NG5A 5DLLA 1C90A 4IBYA 1AS8A 3GC5A 2DYPA 1FKWA 3RDTD 2V6AA 3ARED 3VXQB 4OCYL 4OFQA 3HFYA 3N19B 4AIBA 3RG6A 3EADA 4XP4L 4KX8A 1YDYA 3JYCA 1E90A 5E09A 2GK1B 4S23A 5KVMC 3VFWB 1TXKA 3F04A 1FNFA 3D4ZA 1Y1UA 3PGDA 1LT7A 2RGLA 2WOBA 3CVHL 3B9KA 2LLEA 4WEMB 5D96C 4LDCA 4ZX3A 3LZFH 4XX6A 1ECYA 3NPUA 5AHMA 3SUVA 1R5WB 2HJFB 4TQPA 4IYKA 2XTJD 2WWDA 4XN1A 4M7ZC 4AEOA 2VMDA 4QOKD 2BS71 3GMOB 4EANA 2P49B 3ZWSA 5D4IA 4HPOL 4M6NH 5G1YA 4MCYB 2OS7A 3O8XC 2Z28A 4WDUA 2P5EA 1C16A 3QXUA 2GC4C 4FI6A 4OI7A 3QJAA 2J6EH 3T4AA 1PLCA 3KH4A 5HYJE 3TF7C 3VXUD 1IMHC 1AYRA 3SKJH 2XICA 2F5AH 3L1GA 3QUXC 4HD9A 1DBKH 5DD3H 5GGSY 1A0EA 5AVVB 1BIIB 2RUSA 2VR5A 1MNSA 2J8UA 2J7FA 1H09A 3ABOA 3Q2WA 3N42B 2V5RA 4LLUB 4U6XA 1NL0H 2DYPD 4OF7A 5B21A 2WZIA 4NKOB 3LCIA 3AG2B 2W0FA 4YXLH 1GVSA 5CBAA 3MNWB 4HCRA 3LZPA 1H62A 3IFNH 4PRIB 5IDIA 3MACH 1G1CA 3L3OC 3P0WA 2BSRA 1I1FA 1I1XA 4M93C 3JWDC 2FPTA 1A80A 3O4LB 4UTBA 2LTQB 3WUEA 4J27A 1G4PA 2HZGA 4TNVF 3B9KD 3LB6D 1G9NL 1NDMB 1N0XL 4IIZA 1Q9LB 5CAKA 3MLZH 2YA1A 2XRAH 3R4DA 1NLDH 1OIMA 3U3HA 2G2RB 4BM7A 1J48A 2D03L 1S1PA 3HGJA 3CZJA 1JPST 1U3ZA 2VR4A 4OECA 2EYTA 2P5ED 4PH6A 5E2UH 1AZZC 3ZHKA 5I2IA 1PLGH 3FN3A 1Y18A 1ZAJA 3SE4A 1SPQA 3QZ6A 1M9HA 3IKCA 4D8AA 2JJSC 4XKYA 5IVZA 5FYKU 2YL9A 2VDQH 2JIXA 4ERAA 4PJFA 3NFNA 3E0VA 4H0LC 4G7VL 4DGVH 2JB6A 2UZYB 3RHGA 5GSRA 1VFAA 2GYIA 3I3BA 4U3XA 1DLHB 3QIUA 5J9PB 1EDYA 4NQSA 3U7VA 4JTSA 2BMKA 1CL7I 3QV6A 1EJ6A 1XRFA 3EKCA 3O41A 1YYML 5K1VA 5XIMA 5EOTB 1C1EL 1J9SA 4FYTA 3DOSB 1UH4A 4JO2L 5DLCA 4Z7UA 5B39G 1GHFL 2BC4B 4HA0A 2TRYA 1CTOA 3P82A 4AT6B 3GC3A 4AC4A 1YBQA 1G7LB 1F97A 3II1A 5A6TC 4PJ7E 3PYCA 3LSOB 2IADB 5L4JA 2H3BA 2RAMA 4L1XA 3CS2A 4MA3A 1QTSA 4Z1DA 1TV7A 1I9EA 1CN4A 4ANXA 1LK2A 2WVTA 4WJ5A 3ZE2E 5I3JA 4UB0H 1HXKA 4JDZB 3EBVA 1XFBA 4FMFA 3VIFA 3NZSA 5F7FA 4DGWC 5D96B 4GIRA 5J12B 3TJHC 3I6KB 4BE6A 2PWUA 3O81A 2PPEA 4NBYB 5KZDA 4YSAA 1LMIA 2CGYA 2AW2A 4K1GA 4M7ZB 3BPCB 3LKQA 1ZIBA 5E5LA 2CRIA 3NL2A 3WAJA 4Q32A 5FO2A 3QNZB 3O8XB 4FXLA 2JIXD 1ZV2A 5I15H 2WQRA 3KPOB 3D2UB 4ICWA 4NZTL 2E7DA 3WO4B 2F5BL 2R59A 4NT0A 3MA8A 1SOXA 1K8XA 2WYIA 4H25A 1J18A 5J6GB 3QIUD 4EIGB 1CBGA 4ZQRA 4U5KA 5DJ2A 2UY5A 3FOKA 3PFUA 2JK5A 1L6YA 1NOLA 1JZDC 3MV7B 3BVWA 3QFGA 2J9ZA 3IMSA 1S9XB 5J11C 6FABH 3V2AR 1A4JA 4J3BA 4PJBE 2HN7A 1J1PL 3MBWA 1B3VA 5DJAA 5IQOA 5FLUA 1L4IA 3PWUA 2A6JB 4K7PX 2BODX 2Z7ZA 5I9QC 4QRPB 2YXOA 3OBAA 1NIDA 3ULSB 2R1YB 3E9UA 5EUKA 4XTIA 5JW4M 3SSJA 3AHYA 4M93B 5D5MF 3VOJA 2VDMH 3PZMA 3DOPA 2JBMA 3VIIA 1SYTA 5I8KL 1YA5A 1V02E 3LMZA 3IS4A 4I5RA 1WS7A 3L1EA 2CERA 4Q8MA 1AGEA 3KDMB 2G5BA 5GXBB 1IC7H 5FYJL 3FB8A 4O18A 1R5VA 2X4TB 4YDLC 2PTVA 1ZZMA 2RFXA 4X6BB 3EG9A 1XGQB 4MMZB 4AH2B 1X5XA 2GJXB 1D9EA 1I9RL 4WUKH 1WITA 1DVZA 3GJFB 5BMXA 5AENA 4Y2WA 1ZAGA 1D2OA 3HA0A 4LOUC 3RCMA 2FWSA 1WTGT 3HFMH 3UGUA 3VG0H 3KOZA 3W7DA 4M51A 4E41E 2AABL 1WYJA 4WW2A 1S9KC 1R5YA 4WY0B 1ZS8A 3LPWA 3Q67A 2J2ZA 3K1KC 5JNYA 1FN4B 5FESA 4G8AC 2BHZA 4GFXA 4ENED 4PUBH 3LGEA 3AUJA 2VQ4A 2XVLA 2WB5A 4K5MA 1OSZB 35C8L 4PRPA 3M6DA 5FYJU 4OB5L 2H26A 4DPAX 4QE4A 4HUMB 4M1GH 3ZTJH 3BIBX 4DVOA 1BJMA 4RMVA 2H9AB 4C6BA 2OMWA 3UR8A 1G43A 1OANA 1AW5A 1IQWL 3NCXA 4YXHL 2C5DC 3LLXA 2Z31C 4XUGA 2W07B 2CNZA 2FNBA 1US2A 3NCJL 3CDCA 4M5SA 1A66A 3W1LA 2OXHA 4HIBA 5HSFA 4DY1A 2FX9H 2YBTA 5CN1A 4RIRB 4BFNA 5TPWL 1TCMA 4TMPA 4X4ZA 4AKQA 1WUEA 3BYYA 3L68A 2ZRXA 4HSHA 2ED8A 4TS6A 3TWCL 4WFED 5DRWA 2D3JA 2H2PC 4S0TD 4QR7A 3P73B 4FKKA 1V27A 4O5LH 4GJ1A 1YC8A 3V6FA 1A9BB 4FLRA 5EN2A 1AR1D 4UM9D 2NY5H 2DH2A 2P47B 5DQJA 4MNHA 3EGDA 4GWEA 3TBYA 5IIEB 4ZFQA 3KL5A 5CGMA 1XTMA 5D6CA 5DCBA 3U0WL 4B15A 2WXPA 1T41A 1DXEA 5XIAA 4YO0B 4BI6A 2PF0A 4BA0A 2G9KA 2VL4A 3WSQH 1XBXA 3VE7A 2VXQH 1SJEA 5CJQL 2V2XB 3OKNB 2WMFA 4UQEA 4AJWA 2OSLB 1XXFC 3DXAA 1OABA 3NTCH 4HUKB 4HCHA 2X0SA 5KYUB 3BEVB 4PJAE 1MVUA 1SLVA 2Y5EA 2X0YA 4M03A 3F6IA 3OKYA 4PGBA 3EMZA 4KI5D 4R84A 3HPZA 1P0DA 2JE8A 3CCHB 1MHEA 2ID5A 5KSAB 3W85A 4DLMA 4NHVA 1CDYA 1JL8A 4C90A 2X4QB 2PWHA 3LLFA 3DUSA 3PZNA 4YHLH 2KLRA 2CZNA 4YXLL 2BW4A 3L12A 3PTKA 1HWHB 2K7QA 1F1AA 5JW5A 2EDBA 3SFKA 1AG0A 3CXFA 3TA3B 4HAGA 1A7PH 4N8CH 2EKSA 4HZMA 4KTEL 4FYQA 1CT5A 1NAMH 1PDKB 2K4AA 2J5WA 3ZXAC 1IAKA 4W84A 2IMRA 7ODCA 3WUWA 1W6LA 3Q65A 4GRLA 1W1ZA 4G8TA 5CEWA 1UT2A 2C3VA 4FAAB 2PZ0A 4TUUA 1JGLL 4PIBA 4EN3C 1RK0B 1B3XA 1QRNE 1RY0A 2EH8L 2NUTB 4A2SA 2Y5JA 3T4YA 2QV2A 4PMZA 1P5UC 1QFWI 1JPGA 3KPNA 5CSRA 3V4PA 1HJQA 1AZNA 3SKNA 2YGOA 4PBGA 1UWEH 3DXAD 4JDEA 4AG0A 2IDQA 3W7KA 4OU3A 1OGAB 2KBGA 1PG7L 5D02A 4K36A 3QR3A 3FLUA 2VABA 4X9BA 5D72H 2PW1A 2R8WA 2CLVA 4EK7A 2V7NA 3KWVA 2XV6B 3QQ4B 4PY7A 2E4TA 2JTYA 1ZT1B 2WAQA 3C5XA 4OLVL 4Y5XB 4HUUB 2Z31B 2VDQB 2VN7A 2E7MA 4RNIA 4QHUA 1HGWA 3NM3A 2KZKA 1E9OB 2RHEA 3TC9A 4GBXB 4OZHA 4EPSA 3ALFA 1DKWA 2BZ7A 4IF2A 2VN6A 3MSPA 3T6CA 3Q1SL 4QRQB 4OGAC 3T3PF 4C8XA 3SQSA 3QDJA 2J9XA 4GRLD 3VAEA 4UTAA 1N2RA 3DUHA 2OXNA 1E56A 5A6IA 4JREC 3L5JA 2X4SA 3RY5A 5C0RL 1ZTXL 4ZW8A 5MHSD 1Z89A 3TMQA 4ODHH 1K5NA 1S5VA 1FP9A 3X17A 3ULVL 4LHUB 1JSYA 3A9IA 2WM1A 5LGKA 2PRMA 3VFUB 1ACYL 1KEML 1W1TA 5C2CA 4GX9A 4NU7A 2FUTA 3FTWA 4AX3A 2JKIS 4K9EH 4OLWH 3W38A 2NZ9C 3E0FA 1PBGA 2P28B 2BZCA 1R75A 3JRKA 1QFWM 5IFJA 3ZE0B 5MP6L 1AH3A 4HOXA 3OMIB 4HJGB 1CPUA 1D6EB 1IXNA 1YLVA 1NFIB 3VGBA 4DJFA 4LASH 4O02H 3RGVC 1UVQB 3AIEA 4UFLA 5SWZA 3VIJA 4RMWA