1JDAA

Maltotetraose-forming exo-amylase
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
b'DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
molecule tags Hydrolase
source organism Pseudomonas stutzeri
publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
total genus 136
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jdaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jdaA01
3ZSSA 3GDBA 4HZ8A 4F8XA 2G3MA 2YL9A 1KXTA 1M04A 3GXDA 1SFSA 1EDQA 2BHUA 1ZJAA 2PB1A 4NRSA 4D6HA 1CEOA 3W6MA 5A8OA 2JF7A 1BHGA 3AHTA 3BVUA 1BSIA 3B8SA 1TVNA 1TMQA 4PCSA 1X6LA 1V0KA 3ZJ8A 2ZUWA 2ZIDA 1KWGA 4FLOA 3JUGA 3SEPA 4A3HA 1Q6EA 3WY1A 3OG2A 3GXTA 3SUWA 4PCTA 1L0PA 1H4PA 4CCCA 3BLPX 2V3GA 1QWNA 3ECQA 3WMCA 4CU6A 4PYSA 4JCLA 2O92A 3ZM8A 4OKDA 1E5JA 2GSJA 3G6MA 1ZL1A 3A23A 2YOCA 3VIHA 4PMUA 1C92A 3UG5A 2WMIB 5HOSA 4RL3A 4P8WA 3EBVA 1E0WA 3IAPA 2E9BA 4HA3A 3GXFA 5EB8A 1SR0A 3D52A 5BROA 1HL8A 2EJ1A 2PWFA 3BAYA 4H8HA 3EYPA 4MNLA 4GI6A 4AD3A 2FHCA 1F4HA 2ZUSA 1HIZA 4EK7A 4W84A 1W91A 1GORA 3PHAA 1BG4A 1OGGA 1FFQA 4TXEA 4IUGA 4AZGA 8A3HA 2BFGA 2XM1A 4WJXA 2F7OA 1QNSA 1E15A 3F4VA 4S3KA 2GK1B 5I2UA 3BMVA 3N13A 4FLQA 2VZVA 1WZAA 4D6FA 4ACZB 4EANA 3TOPA 2BY1A 1MFUA 4UZSA 1QVBA 2J7CA 3VD4A 1HJVA 2CKSA 3NYDA 4F9JA 4J7RA 2W4XA 1V02E 3VNYA 3SCTA 1CECA 3UR8A 1QBAA 3PZTA 4PUDA 3B9DA 2XVGA 4AIUA 1J0YA 5FL1A 2J7FA 1T0OA 1K9FA 3WNMA 1A3HA 2DEPA 3AZSA 1WP6A 4OBSA 2VCBA 1VJSA 2YA2A 3BSGA 5A2CA 4TX6A 1RD6A 1GQJA 3CHCA 1XC6A 3D3AA 4Q7NA 1UD2A 1A47A 1J01A 1FHDA 3SCQA 3N1AA 3DHPA 5FKYA 1C7SA 3ZJ6A 3VSTA 2XVPA 2ZXDA 3GXPA 2YIHA 1CXLA 3AMGA 3LRKA 3CIVA 4W8LA 1FP9A 2VVSA 4AZ5A 1P6WA 2WAGA 3HMCA 3LPOA 5CG0A 1PAMA 3BVTA 3AS0A 1LL4A 4CKQA 2VZTA 3WDRA 4UFKA 2CYGA 1IZJA 1SMDA 2J78A 1D3CA 2X1IA 4M56A 2QPSA 3B9AA 3D51A 4JIEA 2OSWA 1V08A 4OUEA 1UKPA 1VRXA 3G6LA 4MAVA 1XRVA 3AMCA 3L4WA 3VGDA 1ZS2A 3GH7A 4HU0A 3A22A 2VQUA 5IFPA 2OW6A 2W61A 5BXTA 4IM4A 5I78A 1E0VA 3BUIA 5A8MA 4CUCA 2X2HA 1WO2A 1WE5A 3L4UA 4PMDA 3UG4A 3WL0A 2FGZA 3W29A 1LL6A 4U3AA 3WNKA 4TVCA 1YHTA 3MO4A 1R47A 3MKKA 3WH9A 2D0HA 1JFXA 2PWGA 4BZYA 1XSKA 4MB1A 3TP4A 2UY3A 4GQQA 4HA1A 5I3DA 4NI3A 1GOQA 1I1XA 5C8BB 1EHNA 3BGAA 2VL4A 1JGIA 4J27A 1EDTA 2EPOA 1ECEA 2PBOA 3EDFA 1EO5A 3DHUA 3S2CA 2GFTA 3BXWA 4P7OA 3CZJA 3D4YA 3BUBA 4RE3A 3O6AA 4UQAA 5CXPA 1XHGA 2C0HA 1E40A 4W7WA 2GDUA 1B3ZA 4M24A 1NP0A 4B3KA 4BQ2A 1N82A 3KL0A 1PX4A 1SZNA 1VENA 5M03A 4FNTA 3AS1A 2V38A 4W7UA 5I0DA 1JNDA 4EE9A 4CD6A 4GZJA 4D6JA 2F7QA 1JZ6A 3VMPA 5BXSA 5A6JA 3OGRA 3ZMRA 2VJXA 4W93A 1BYBA 1HKIA 5EFDA 3WN6A 3PZMA 1E4IA 1HJQA 1OWQA 2ZUVA 2J47A 2J4GA 4CN1A 1FH9A 3U57A 2WZIA 3KEHA 3AS2A 2ZWYA 1DTUA 1HVQA 4P7RA 4QCEA 4DO5A 4Z2LA 1D2KA 3LPFA 3RO8A 3AJ7A 1JL8A 1Z32X 1E6RA 1W1YA 4AEEA 3LX9A 3BC9A 5A6SA 1X1NA 2UWFA 4MJ2A 2X05A 1TUXA 4OOZA 2DPEA 1NWTA 5BWFA 3WMBA 3N04A 4AZ6A 1WPCA 3DX3A 4XZWA 2YA0A 3VSVA 1JZ7A 1JD7A 3PZNA 3FHQA 2XN0A 4PMXA 3TTQA 4LX4A 4J28A 2ZUUA 1SYTA 4KGLA 4NRRA 1KXQA 2DT2A 1QPKA 4AMXA 4NXSA 3AOFA 2WLYA 4XUYA 3WDIA 2V3FA 5E9AA 4AD0A 1HXKA 4AD1A 1JZ5A 3CZKA 1DWHM 1WZKA 4CU8A 4UOJA 4YHEA 1B3VA 2ALWA 2WVUA 3WNOA 4WF7A 4JHZA 1C7TA 1CGTA 2VUYA 2VURA 1UD5A 3BUQA 1R87A 4P7NA 5HDRA 2VC9A 3L4VA 4UNIA 1B90A 1LG2A 4GO8A 3BUPA 4E2OA 3PBGA 2ZXAA 1WCGA 3K8MA 3W37A 1FP8A 1C3FA 2WW5A 1R8LA 1MVYA 1TE1A 4QLLA 2C8NA 2A3EA 3BUDA 1HNYA 3EJRA 2BVYA 3RMEA 2XGBA 1LG1A 1MW2A 4DUWA 3AROA 3AISA 5ABHA 2VX4A 2PBGA 3T0DA 2CERA 2CBIA 1PZ3A 2J8FA 2XHYA 2J62A 3KZSA 3SCUA 1ZBWA 2Y5EA 1MQQA 1LWJA 3EJQA 4HU8A 2WHMA 4WSKA 2OWWA 2ZXQA 1E1EA 1R86A 1CIUA 3F5LA 1B3WA 1OT2A 5A6KA 2EPMX 3VD5A 1EOKA 4P7LA 2EBNA 2WZEA 4D6CA 1O6IA 1KCKA 4W86A 1WZLA 3ARZA 4OBRA 1UKQA 2Y4SA 3EJPA 4OIFA 3A3HA 4PTXA 4B9ZA 1V3HA 2XJ7A 3PZUA 4TVUA 4DO6A 1GJUA 1HX0A 3WQ6A 1W1VA 1W9PA 4C7DA 2W63A 4PSRA 5DO8A 1DWJM 4MB4A 4H8UA 5ABEA 1QWUA 2X2IA 4JFUA 4GI9A 2PC8A 2Y24A 2D2OA 3EJSA 1JDAA 4FK9A 3HN3A 5M5DA 4GZEA 2WMJA 1GZJA 3ARWA 4TTUA 1UH3A 3THDA 5CLTA 1KXVA 1DWFM 1C90A 3WF3A 3AHVA 4KRTA 3GNPA 1ZBVA 2J7DA 1V6YA 1PJ9A 5I5RA 2E9MA 2WC7A 2OWCA 2IGTA 3DYOA 3MUY1 4M81A 5CGMA 3RDKA 1BVNP 2GK1A 4NSBA 1JD9A 3DX1A 3WQ4A 1R33A 2V3EA 1H11A 2JALA 1E6SM 2VX7A 3SCNA 1CWYA 2C7FA 1UR1A 2QPUA 5FD0A 2WHKA 2ZX6A 1VFFA 1XD1A 1KR1A 4D71A 4PMYA 3CTTA 1KQZA 3DC0A 3W6LA 1KQYA 2WXDM 1KR0A 2DT0A 3PZ9A 1JFHA 1O7DC 1C8YA 2OYMA 3UR7A 1XV8A 1ZBCA 2VTFA 1UD8A 3S5YA 1GOKA 2WMHA 2ZUNA 2DIEA 5JIWA 1I1WA 4YN5A 1V3MA 1TQUA 2XIBA 4MDOA 3VTRA 3UCQA 1W9BM 3L4XA 2QV4A 4FF5A 3U7VA 3K46A 1PIGA 2NT1A 1U33A 3SUUA 2WLZA 3PZGA 2XUCA 3PZOA 1G5AA 1V3KA 2YFNA 1GCYA 4CN6A 3VINA 1JYNA 2VR4A 4EAMA 3SUTA 2F18A 3H55A 3VGHA 4Z2IA 5CSUA 2CBVA 5HNNA 1JZ3A 5EMYA 2EPLX 1CDGA 1UH2A 1W3JA 2XWDA 4WKFA 2YLAA 4NZJA 4PMVA 4QDMA 1QW8A 3KL3A 1PEZA 1QX1A 5I6SA 2RGLA 1JI1A 1GHRA 2UY2A 1XH1A 1E4MM 3MV11 3BAJA 3KLKA 5HXMA 1QNRA 1TZ7A 3BAIA 4JAWA 1EHAA 2W91A 5GNZA 1NP2A 2XFFA 4AMCA 1E3XA 1BVZA 3ARSA 5JUVA 1OIFA 3AHZA 1Q6FA 4H8VA 1R7AA 4R27A 2ESCA 1AVAA 5E6ZA 2CITA 2WVTA 1E71M 1CXFA 1HJWA 2JIWA 3VM7A 3T08A 1UD4A 1W9VA 5GNYA 2YDQA 3S6TA 2OWXA 4JKKA 4U2YA 4WKHA 2BY2A 4AISA 2D1ZA 1TQSA 1CYGA 3CUFA 4LXFA 2V3DA 2DSVA 3PTMA 4NZCA 5CJ5A 2WMFA 1UG6A 3BCDA 1BPLB 3TONA 3WQVA 4TOQA 2BVTA 4IPNB 3O2LA 1W2PA 1B31A 3CH9A 2E9LA 5FL0A 4AD2A 4ACZA 1UR2A 1HN1A 4JKMA 3ZT6A 3GBEA 2QLYA 3OA5A 3DECA 3T0AA 1B30A 3VKKA 4JL2A 3OLGA 2XG9A 4HZ6A 5CLWA 2WM0A 5TD4A 4HOWA 3WFLA 2HVMA 1QI4A 5BYWA 1B2YA 3FAWA 3OBAA 4ZXOA 1VBUA 5CPQA 1H41A 2NW0A 2WHJA 2ZE0A 1WB0A 4FNQA 4IPLA 4P8XA 2X0YA 1UWUA 4JFSA 3CMGA 1XH0A 2W62A 4GO9A 1HF6A 5AC4A 4URIA 3MUZ1 5GNXA 1KBBA 1GNXA 4F66A 4W89A 1GVIA 5GQBA 1EH9A 4MPKA 3K4DA 4MJ4A 2O9RA 1UWIA 5E1QA 3WMSA 3AIEA 1OT1A 2XIIA 1JXKA 2ZX9A 3CUIA 4B15A 4B16A 3N15A 4JKLA 1TG7A 2BY3A 1VFUA 2WCGA 4KGJA 1BG9A 1MWOA 1KCLA 2VRQA 4JFTA 3HG3A 4AW7A 2YL6A 3PZIA 4FNUA 3WQWA 3BLBA 2UY4A 5A95A 4UQDA 1EGZA 3GZAA 1H09A 3WD0A 2J25A 4P8VA 5JBEA 1H5VA 1KGUA 1U2YA 3AMDA 2IUZA 3AZTA 2AAAA 3AXHA 5ABGA 1HVXA 5A8PA 3WDHA 3ZOAA 2WHLA 3VIJA 3OLEA 2NSXA 5EFFA 3SCSA 3VIPA 2CEQA 2A3HA 3W27A 2D23A 1J11A 1TA3B 3WDPP 3ZIZA 2VOTA 1CTNA 4A4AA 2ZUMA 2WMKA 3BVXA 4JL1A 2UY5A 2E0PA 3CZNA 4D72A 3K1DA 4QCFA 1V3JA 1V6XA 2VCCA 3QR3A 4WKAA 3LRMA 3T09A 4FLRA 4U3CA 3CV5A 4MADA 2VVNA 3CZEA 3CHEA 2G3NA 1W9XA 5A94A 1UASA 3AIBA 1RP8A 1VEOA 1K9TA 3MV01 4QLJA 5BXPA 5DMYA 1DWIM 1V02A 3BVWA 4MNMA 2GUYA 3HG5A 3DX2A 3IJ9A 4ZFMA 4Z2HA 1OD0A 1US3A 2BHYA 3CZLA 4UCFA 1CZ1A 3QOMA 2VNCA 2ZICA 1GW1A 4HA4A 2DSZA 1E72M 4GKLA 1XD0A 3BAWA 4WLCA 4PBGA 3W25A 4ATLA 4UFLA 4ZE5A 2HISA 3VU2A 3AIWA 1QHZA 4BQ5A 5BRPA 3CBWA 4HMEA 3CUJA 2AOSA 1MXGA 4NXKA 3UEQA 4CD8A 3HG4A 3K4AA 3NSMA 2WKLA 1MFVA 4W7VA 4AZCA 4U2ZA 1TQVA 3MMWA 3VUPA 3ARQA 4X0VA 1FA2A 1E5NA 3WIJA 1W9UA 2EADA 1CGXA 3AIQA 4UTFA 2CBUA 3W24A 2D20A 1TQTA 3UG3A 4HPHA 2PWHA 1QBBA 4DWSA 4Q22A 1HTYA 3WNPA 3KLLA 1GOWA 1HKKA 2J7EA 3WD4A 2BVDA 3RCNA 2W67A 1VEPA 2XM2A 1UQZA 1VEMA 1MW3A 3ARYA 3ALFA 4AZ7A 3A24A 2IXVA 1E3ZA 1UR0A 1G0CA 1E1FA 4HPGA 2WZHA 1UWTA 1RP9A 3WH7A 1CGUA 3T2QA 4D6IA 3VPLA 1G94A 3SUVA 3F5JA 1TVPA 3A4WA 4DM1A 4BA0A 2VQTA 1Q4NX 1NOFA 3M6DA 3LRLA 1B3YA 1BQCA 4R5EA 3A4XA 4LGXA 1JDCA 3M7SA 3MANA 5A2BA 1FHLA 4PMQA 2YL8A 4J3VA 4J3UA 2WWDA 3OGSA 2O9PA 1UD3A 2YFOA 2XFRA 1J0ZA 1UWQA 3KL5A 3EDDA 4UR9A 3BAXA 3HZ3A 4GPNA 3PZQA 1LLOA 2WVVB 3VVGA 3CGTA 4K68A 4M80A 4FNPA 4NZFA 5E0CA 1EIBA 5D8WA 5I24A 3MU7A 4QFUA 3CHFA 2EEXA 1CXIA 3ARUA 4AD5A 2WANA 4CCEA 4KRUA 1XGZA 1JNEA 3D5HA 4LYPA 5D9PA 1EQPA 1KB3A 1UR9A 2WC4A 3MSGA 3KWXA 1PBGA 3WUGA 5IFTA 3EMCA 2OYLA 3EDJA 4J3SA 4D1JA 3VOCA 2XVLA 3N12A 1E56A 3W4RA 4PTWA 1UH4A 3VNZA 1U30A 4KWUA 3N9KA 2G8ZA 1VAHA 1VJZA 1G9HA 3CMJA 5A6LA 1DEDA 4PTMA 4U5KA 3T2OA 3RJXA 4HMCA 3L2LA 1ITXA 1XSIA 1QNOA 3QHNA 2D24A 4YPJA 1R34A 2D73A 4QAWA 1OCQA 5D9MA 4MAZA 3ZR5A 1UUQA 2CETA 2YDSA 1BF2A 2FHBA 2DT1A 2YDRA 3W82A 3VX1A 3F5KA 4XZBA 4QP0A 4PSPA 3CPUA 4CVWA 3RPMA 1JZ2A 3SCPA 3AI0A 3VDAA 1AMYA 1OBAA 2FYVA 3DX0A 2GJXB 3FW6A 3WY2A 4MTVA 4XX6A 3VMOA 2FGLA 3FY1A 1H1NA 4Z2JA 3W38A 1LL7A 3RILA 3L4TA 4F79A 1QI5A 4U5IA 2G4FA 1IT0A 4CD4A 1WDQA 1XCXA 1OD8A 2Z1KA 1VBRA 2DH2A 5AY7A 5C70A 3RM4A 1M53A 1VFMA 1E6PA 4UQ9A 3GXNA 4AIOA 1M01A 2VX6A 3WF4A 4J3WA 5HPOA 5DT7A 3BCFA 5A6MA 1QNPA 2DSWA 2WMIA 1TQWA 5ABFB 1LJYA 5CGTA 1MW0A 6CGTA 1JI2A 4X0NA 4JZ5A 4OZOA 2A3AA 3WF1A 1KGXA 3VDCA 1R46A 3CO4A 2WWCA 1PPIA 1WNOA 3NIYA 4AY1A 5DF0A 1OINA 3WH5A 4PTVA 3IAQA 1DHKA 4B3LA 1JZ8A 4ZXLA 1W2VA 4PMNA 1H0GA 1K9DA 2XSAA 2F1AA 3WDJA 1CGYA 4OOUA 2ZUTA 2WVVA 4HOXA 4ATWA 5LA0A 4MDPA 3TTYA 2AMGA 2GJXA 2CNCA 4FLSA 3N17A 1CXKA 5KEZA 1KGWA 4CGTA 1NOWA 4Z2GA 5D8ZA 3W81A 2F7RA 3OB8A 1Q6DA 1E9LA 1Q6GA 3ZSTA 3L4ZA 3POHA 2ZX5A 3WEOA 3NCOA 1E43A 2D3NA 3FN9A 2Y8KA 3IJ7A 3WDQA 3RJYA 5A3HA 1WDSA 2J7GA 3WQ5A 1BTCA 3AQUA 1O7AA 2WK2A 2JE8A 2A3BA 4UQBA 3AIUA 4AYSA 3GBDA 3MI6A 2BV9A 1JXJA 2EQDA 3ARRA 4UOZA 2D0GA 1MQPA 3W28A 5JBFA 4ML4A 4CVUA 1OIMA 1WZMA 3AFBA 4ZEPA 4LYQA 3T0BA 2VR5A 3UETA 1V6VA 3UERA 3EMZA 5E70A 1FH7A 2QHAA 2BY0A 1ISZA 3VDHA 2EPNA 2JF6A 4V27A 1HKJA 1H3GA 4V28A 1QI0A 1JF6A 4LQ1A 3ZO9A 3S5ZA 3OLIA 2VI0A 2OSYA 1E6XM 3WUFA 3W26A 2BXYA 1PX3A 4HOZA 2DT3A 4CN4A 3EJTA 4M29A 1GVYA 2XN1A 2J7BA 2ZOXA 1V0NA 1OGSA 3FXYA 1US2A 1W3KA 4UOQA 4PMRA 1W32A 2J74A 1VFOA 1J9YA 3PTQA 3TTOA 1TFVA 3M46A 2WSPA 2F8QA 1TCMA 3AMKA 2DH3A 1E6NA 2GJPA 3CUGA 5FCZA 3W0KA 3A4AA 4DO4A 1UA3A 4D6DA 4W85A 1L8NA 4NF7A 1C8XA 3POCA 2VT0A 6A3HA 1KXHA 2J8GA 2JEQA 2VX5A 2WNWA 1PIFA 1VIWA 1V3LA 4EKJA 1CENA 2E40A 1QHPA 3W53A 1J18A 1PZ2A 1CGVA 3MUIA 4DM2A 4WK9A 2FH6A 4AEFA 5I79A 1ODUA 1QW9A 5IDIA 1WDRA 2O9OA 3WH6A 1B1YA 3LXBA 1GQLA 1UWRA 1KBKA 1H49A 2E4TA 3CHDA 4JFVA 4AMWA 1JF5A 3M07A 1ZBKA 4UFMA 4HMDA 3DDGA 2XTKA 1K9EA 2D3LA 1CBGA 3WD2A 3BH4A 3AHYA 3K8KA 1D7FA 3VIOA 2E3ZA 5A2AA 5E0FA 3AYSA 1JAKA 4BS0A 3THCA 4AZCB 1MYRA 5BXRA 3WD3A 2XYLA 1CXEA 3H54A 3LXAA 2IXUA 3ARPA 3VILA 1I75A 3PTKA 1UKSA 1NWRA 7TAAA 5IXEA 1GOMA 2O9TA 1XCWA 1UHVA 3A47A 3WFZA 1GOIA 1NQ6A 3RM9A 4Z2KA 1UZ4A 2Y8VA 2QF8A 4GXPA 4RE2A 2JIEA 1EOMA 2ZWZA 1NM9A 3WUEA 5EBAA 4ZE4A 5HPCA 4H41A 3RM8A 4TTGA 1BLIA 3WSUA 3VSUA 1IV8A 3GXMA 3OIHA 1JYXA 2WYSA 4C7GA 1ISVA 4DUXA 3SCVA 3NSXA 5BRQA 2CXGA 4JFWA 2VZOA 1F4AA 1NH6A 1J0HA 1V6UA 3VIIA 1NWUA 4JCMA 2WMGA 1ZJBA 5F7UA 3VO0A 4WSJA 2CCRA 3J7HA 1EXPA 4PRWA 5JIPA 1HWWA 1C93A 1CXHA 1W3HA 5HBFA 1HXJA 1IZKA 3FNDA 2XVNA 3A21A 1CLVA 1XH2A 3BSHA 1AQHA 2X8RA 5E6YA 3BVVA 4ATDA 1C91A 3U7BA 4BCEA 3CZGA 1R7OA 1E4NA 3BAKA 2NT0A 1V6WA 3QOKA 1W1PA 1CGWA 2CKRA 1JG9A 5JBDA 2A3CA 4J3XA 3VGBA 3VIKA 5D9OA 2F1BA 3ARTA 1BYCA 4MNJA 3A5VA 1ODZA 1GONA 2CESA 1GHSA 3CZSA 1WAWA 1XSJA 2FE0A 2GVYA 1BYDA 4KMQA 1DP0A 5A6BD 1BGGA 1HKMA 2F61A 4GZIA 4P7QA 4PN2A 3WNNA 1UA7A 4E8DA 5LA1A 2GDVA 2YA1A 1RH9A 4PUEA 2OLHA 4D6GA 3WENA 3GH4A 3FAXA 6TAAA 1GJWA 4M1RA 2Y2WA 2YL5A 4TX8A 3HG2A 1B3XA 3II1A 1H0IA 3SCWA 3CUHA 1Y7VA 1ESWA 2ZX8A 5DFAA 1ZB5A 3HU7A 1JYWA 2G41A 4L4OA 1KTBA 3NSNA 1E70M 1R85A 3MMDA 5LYRA 5E09A 4YHGA 4CD5A 4LPCA 1GOOA 3I3DA 4CU7A 1EO7A 4XV0A 3VD7A 1J10A 1HJSA 4E4PA 4BF7A 4N0RA 2EACA 1V03A 1QNQA 1E6ZA 2DGAA 2RGMA 2VO5A 1UYQA 3SURA 4ACYA 2Z1SA 1UR4A 3K8LA 1V0MA 3WD1A 1W1TA 5KZ6A 3GH5A 2FH8A 1JIBA 3ZT7A 3TA9A 4FMVA 3GXIA 2DIJA 3WY3A 3CC1A 3HJEA 3ZJ7A 2YBTA 3AXIA 3AYRA 1KTCA 4XB3A 2XFYA 4GQRA 3WELA 4C7FA 1CLXA 1WKYA 3LXCA 2XPKA 1EQCA 1G1YA 1TA3A 2XN2A 1BYAA 3VDBA 2JEPA 5AYBA 3DYMA 1NARA 2TAAA 1EDGA 4B9YA 4TVDA 3VD9A 4JHOA 2BXZA 5FOOA 2XGIA 3FHAA 1UKTA 3KE0A 1QOXA 1J0IA 4U33A 1KWKA 2B31A 4AXNA 2FHFA 1ZU8A 3CZ8A 1JYVA 9CGTA 1ISYA 2VRKA 5GPRA 1JDDA 2VMFA 3GM8A 4H04A 4ZENA 4M8UA 4J3TA 1S46A 2ZX7A 3WY4A 4UFIA 3WKZA 2WC3A 1HJXA 2WVSA 2WB5A 2PWDA 5CQ1A 1AQ0A 4OJYA 3ZR6A 1E55A 1LF1A 3DDFA 3OZPA 1Q6CA 4AZBA 3WNLA 5I77A 3SCOA 1HJUA 3AMLA 3MMUA 1UZ1A 4HP5A 2WCAA 3BLKA 1QI2A 2E8YA 3I3BA 1YQ2A 5FIPA 3OGVA 4W88A 3DX4A 5BCAA 4CCDA 1EA9C 2XVKA 3E1F1 4P8UA 3AXXA 4AZIA 1CNVA 4QLKA 2DDXA 4W5UA 3EDEA 3QHMA 1J0JA 5A6BA 3ARXA 4MB3A 2J7HA 1ITCA 1NOUA 2JFEX 1XYFA 3U5YA 4MB5A 4OGZA 3ARVA 2G3JA 4DUVA 3AIVA 2CHNA 5C71A 2GJRA 2V5CA 3VIMA 3TV8A 5I23A 3CLWA 1GUVA 3AICA 1HP4A 2X0HA 3AZRA 1H2JA 3QHOA 4W8BA 3OLDA 1PX8A 4PEEA 4W87A 1E4LA 3ZT5A 3MUAA 4PMZA 2EAEA 4DWSB 3VIFA 1K6AA 1VF8A 2EPKX 5A69A 2CIPA 4N42A 1XYZA 2VCAA 3UESA 1MW1A 3WEMA 3WF2A 4UFHA 5IHSA 1E0XA 4Y7EA 3WEZA 5CPTA 1JAEA 1C8QA 3NDZA 3VM5A 1UD6A 2X2YA 3APGA 5M3WA 1LWHA 1J0KA 1VB9A 5CZKA 4KH2A 5D4YA 3VGFA 4V2XA 1DWGM 1UKOA 2PF0A 8CGTA 5AC5A 4E8CA 5IHRA 5CPSA 3PZVA 4BQ4A 1OSEA 3D50A 3EDKA 4H2CA 3SCRA 1FH8A 3VIGA 2YBUA 3VGEA 4FNRA 2MANA 2QMJA 2CPUA 2VRJA 3ALGA 3WF0A 1NWSA 4AIEA 1ISXA 1DWAM 2OSXA 1WDPA 3U5UA 4UFJA 2E8ZA 2VZSA 4IISA 1OM0A 4H7VA 2X2JA 1BFNA 4FNSA 1HP5A 1HL9A 3VMNA 1UQYA 4U31A 2VZUA 3AIRA 2X09A 4AYGA 4UZUA 1UOKA 3H53A 3TTSA 1UWSA 3VGGA 3NJ3A 3NUKA 3BMWA 5A8QA 1E73M 2OW7A 4L4PA 3WBEA 3VX0A 5DEZA 1LQ0A 3N18A 3AS3A 2CBJA 2J79A 4RE4A 3IANA 4TUFA 2WBKA 3WQ8A 1ISWA 3LPPA 4AWEA 4UQEA 1B9ZA 5A6AA 1GQKA 2YKKA 1BAGA 3SIMA 4D1IA 3GNRA 3A6OA 4PMOA 3WUBA 2G3IA 5CSYA 3WL1A 4BQ3A 1G01A 1J12A 1M03A 2BHZA 2WBGA 3N11A 3LMYA 1RPKA 1QHOA 3QGVA 3WBAA 1QI3A 1SMAA 2WPGA 2YLLA 2F7PA 2DSKA 1W3LA 3GNOA 3L2MA 3IGUA 3EJUA 4HTYA 1CPUA 5DT5A 2OYKA 3ZQ9A 3O9NA 4AC1X 4S3JA 3T2PA 1OB0A 2D0FA 4GIAA 1MQRA 1JZ4A 2EABA 2CHOA 2J75A 2W92A 5A1AA 5LA2A 5AYIA 4CD7A 3PN8A 1AQMA 2PI6A 7A3HA 2YJQA 3B9EA 2EXOA 1X6NA 2J77A 1V0LA 2XSBA 4D6EA 3NDYA 4AZHA 2WKGA 1M7XA 1V3IA 3MS8A 2ZXBA 3ZJKA 4AD4A 4LYRA 2PWEA 1FFRA 4A3YA 2QMKA 4M82A 3L4YA 1UR8A 2WSKA 5ABFA 5ECUA 2W66A 1B0IA 1E6QM 1OGBA 3LPGA 3SUSA 4GI8A 4W8AA 5D9NA 3I3EA 1TR1A 1MXDA 2V5DA 2BS9A 3D4ZA 3IK2A 4GINA 2D22A 2FDMA 2DSUA 1W9DM 3RIKA 1BGAA 3DYPA 4X9YA 2DQXA 3IJ8A 1FOBA 4MNKA 3VD3A 2WCSA 3OZOA 4DWSC 4WIWA 4W5ZA 3EMQA 2F2HA 2BNJA 4F9DA 1PS3A 5M17A 4DWSD 1GPFA 5A8NA 7CGTA 2EO7A 4NX0A 1KFWA 3WH8A 2Q8XA 2XWEA 3GTNA 2W5FA 3AHXA 1GQIA 3GYCA 3MSDA 1R75A 4HZ7A 1HT6A 4UQCA
chains in the Genus database with same CATH superfamily
3A6BL 1AS7A 3NCXA 4GYJA 4DJFD 1QSED 2NTFB 3F84A 4IGBD 4Y2DB 5H6HA 4TNEA 3JWOH 2EPHA 1PLCA 3WO3B 4IK6A 2E74C 5L88H 1RJLB 1JK9A 1F41A 3B43A 2PTUA 5EEVA 1GKEA 4R5XA 5CZTA 1I1AB 1WBZB 4HVBA 5DC9B 3W3BA 4ZNEE 2A1WH 3VW3L 4A2LA 5SWQB 4RDVA 4U3SA 1EP2A 1KTJA 3C08L 4QXUH 3QORC 5C2GA 4MMZC 5L6UA 5A8OA 3NTCH 3AHTA 3ZVIA 5BRBA 4R2GC 3IEAA 4L64A 5FJIA 1TVNA 4A29A 4NWTH 3QUKB 1NFDB 4ILDA 1V0KA 2X16A 3ZJ8A 3WLPA 4HJFA 2ZUWA 4L9LC 1PLGL 2UWEA 2YD9A 4EXKA 4ECNA 4FLOA 3SEPA 3KDOA 4FQXA 4NNCA 4A3HA 3MCNA 2VC2L 1TZOA 1CF1A 1UFGA 2FIKA 4Z78B 3UXIA 1SHSA 4GW5B 1HSBA 1W15A 2I25N 3VXSA 1SW0A 2HT4C 4GAGL 1EBGA 3STPA 1Z2KA 1P2CB 3SUWA 1C5CL 2VM9A 3T0XA 2R9HC 2B7NA 4FADA 1RPQA 1FO0L 4BK9A 2DQ6A 2APWA 1NFDA 3PAUA 3NOIA 3P2VA 1P7QB 3ECQA 2E68A 3QYQA 3ZKMD 3WK3A 3DTUB 1TJIL 3QARA 5HGAB 2QFRA 2I1OA 4TQTA 3H26A 2WXRA 2NLJA 3GBMH 3TKFA 4E9VA 3QTPA 3GHPA 3V4BA 3OKKA 4BR1A 3T0TA 4KDTA 5AZUA 3UTSB 1ZA3A 1XGYL 2AJSH 4JOMA 1GEHA 1GGIH 1SVCP 3D0VA 3CJJA 1I0DA 3UO1H 4ADUA 2YOCA 2JVUA 3Q1EA 5ILTL 3BAEH 3HR5B 3HOGA 1PKLA 1C92A 3VIHA 4LCWA 3KOZA 4DKFH 3MTXA 7TAAA 5JMRA 3NRQA 4MDJB 3QPXH 1J8HD 1AA1B 1ZHKB 3GXFA 1ORSB 3OVGA 2LFEA 5KANG 1SF5A 1X5JA 1B4TA 3D52A 1SR0A 1QVOB 3QI9A 1L9SA 1ICSA 1U95A 1MNUL 1VD6A 5EY5A 1BVOA 2PWFA 3L17A 1WUFA 3IRCA 3C6LA 2XDHA 4NNXA 3PG8A 4JY5H 1NBZA 3NJXA 4G59C 2XZZA 5HMSA 5H37A 2ODOA 5DZOA 4TQEL 1WTLA 3U4BL 5C9ZA 1MFNA 3VFPB 3PPSA 1BG4A 2C1PA 2ITCB 2GITB 4JE0A 1OGGA 1FGVH 4IUGA 4TXEA 4GO6B 2HS8A 5C8BB 2KH2B 3CVIL 5JHAA 2D8KA 3PSVA 5I1AA 3BKCH 2D9QB 3FSVA 2F7OA 3QQ9C 3E6FA 5EEWA 2QHRL 3FJNA 3CFKB 3UZZA 2F68X 3P9LA 2GK1B 2OR2A 3D18A 4FLQA 1EEZB 4D9PA 4GI4A 2WNKA 4D6FA 2DWEB 4U1HA 3BPLB 4KK8D 3PAOA 3N0AA 4RNRA 2Q3RA 4U49A 2DYPB 4UZSA 2PF6A 4MUZA 5EIIB 4M6UA 2G96A 4J3OD 3QWQB 4EF8A 3FUJA 4EN3D 4F9JA 1XLEA 3QDGA 4L1TA 3WAKA 3KZPA 1JXGA 5GJNA 1NJ9B 4P3CH 5F7AA 3UTTE 1V02E 2DV0A 2W4XA 4ES9A 3BLEA 1KNWA 2APSA 2PW1A 2Y06L 4ETQB 4UMSA 2LVCA 5J6GB 1GS6X 4UAOC 5DDHA 1Q6RA 2J7FA 1KFEA 1U3HC 1OFAA 3CXHK 5FL1A 5F8RC 2K6ZA 2NY4C 3V4UH 3WNMA 3CV1A 1WP6A 4NO0A 2V5SA 2QAPA 3HA0A 2VCBA 2B0MA 1E28A 1NAMH 3ES6B 2J44A 3BSGA 4F7TB 1KRBC 2BM3A 3V6ZA 4S0TD 1AFSA 5D30A 4P2OC 3TS8A 5H37G 3CHCA 1OTTC 4IPPA 4GY7A 1BJ1H 3FU6A 4E6MA 1HEHC 1G6VK 1GOFA 4J4PA 4Q6IB 2J9XA 3RIAK 3RGTA 2LFGA 1TZIA 1XLCA 2RMNA 1J01A 3RKDC 4EAEA 1CWVA 2YD0A 3FH5A 3II3A 4P0DA 4UINL 4XMZA 2INZA 3EX3A 3USZA 3ZHDA 4BELD 4Q9CA 2XV0A 2LU7A 5E9DA 1FHDA 3SCQA 1ZT4A 3GHEH 3CQ0A 4OQTL 4D8OA 3N1AA 4Y8DC 5AHLA 1N6UA 9RUBA 1BCIA 5EDSA 3DHPA 3N40F 4PJXA 1H51A 1A6AB 1U5VA 3RI5F 4NO0B 1VHNA 5GGQH 1S8DA 3DX8B 3G6DH 2ZBTA 2DQTH 1KLUA 2ZXDA 4HCRA 3QXAB 1KV3A 3NZ1A 4HHHA 3TYAA 2YIHA 4J3OH 4M9PA 3NO1A 3NG5A 1XAUA 5EZLB 3N6JA 1ONRA 4PVLA 5ADOL 1WBXA 1NMCB 1TTCA 4WI5A 3QKZA 4AZ5A 1SDAB 3FA3A 4RFEB 4X6DB 3HMCA 2X6MA 1WITA 5E5RB 1BQHG 4LCWE 2O56A 3CUXA 3K91A 4QRPA 4F15B 4DKEH 5IB2B 4LOUC 1E4WL 2PUQT 2VZTA 3FQNB 3EG9B 4R8WL 4TN9A 3W2DH 4BFKA 1J4EA 3L23A 1RSYA 2CYGA 4QCIA 3LNEA 3NDYE 1FA4A 3WQ5A 4GAFB 1IZJA 1SMDA 1L0QA 1D3CA 1X4YA 3GB7B 4LLAA 4PJFB 2J78A 3CTLA 2VW6A 3ZZ1A 3NRPA 2QBWA 3RPIB 5T33H 2E7BA 2X1IA 2ED9A 5HQEA 3MV8A 4QGTA 3RY6A 3D51A 3UIYA 1TQCC 3KFTA 3H23A 3K72A 1KZYA 5I1KL 3F83A 1TG8A 5CHNA 4I2XE 4PBXA 1XBVA 5B1BB 3KVQA 4QAIA 5CGYC 4FQXD 1UKPA 3RNKB 2CO6A 3QFEA 4KESA 4ICWA 4GHRA 5AVVB 3UMNA 2K8QA 2PP9A 1UQSA 4M61B 1ZS2A 2ZXEB 2XNAB 5F7EL 2R94A 1R5WB 4NPYB 1IE4A 4UV7L 4Y5XA 4Q9RL 3C6LB 3ABOA 3AY4C 5A7EA 4RPPA 1XGUA 4RGMB 1NBQA 1SXZA 3M17A 2ESVA 5FCSH 2NY7L 1CGSH 2Q8BH 3U46A 4APQC 1L8PA 4F9LA 1SYVA 5BXTA 3L2NA 4UUJA 4Q6IC 3HNSH 3LN5A 5C3LD 2CRYA 3ILQC 3BUIA 2TMDA 1TENA 5DJYA 4MAYD 1CIDA 3HPLA 3OQRA 5IHUH 3SGGA 2X2HA 2X4RB 4DJEC 4I88A 2RHGA 5C0CD 2O72A 3OKKB 1O5QA 4KY1H 2X6AA 2YRZA 3MJMA 3KYNA 3RVTC 2J1XA 4B4HA 2VDGA 3O0KA 3GSVA 4PRPA 4ZNEA 1ME9A 3R4IA 1TEYA 1I1AD 1R47A 2A6KB 2R91A 4MY1A 4A8LA 1XIWA 3HC3L 3ITLA 3QDJA 3MGTA 4G8GB 4UAOB 5KS9A 1Y65A 3O9WB 5DEJA 4IIEA 1UGNA 2YGPA 3H3PL 5D1XE 1KPRB 3EYSH 4JY5L 3P11H 4K5PA 2GTQA 4N8VG 5AL8A 1ZXKA 3W1MA 4U1GC 4BZYA 1S7WB 3EPNA 1KTKE 1XSKA 3TVMD 1YN7A 3IVTA 2RH9A 4K3EL 4AQ1A 1IL1B 1GYWA 1I82A 1ML0A 3B34A 4ODTL 4NI3A 2XZ7A 3N19B 5G1TA 4BQ6A 1CVSC 1PKMA 1SUHA 3QZMA 4ZG1A 3LY6A 2AXWA 4GXUM 1EHNA 3P3SA 5FGCE 1AR1B 1W0VA 3O41B 1E65A 3TMQA 3BGFC 4J27A 1MF2H 4AUUA 3AW5A 1CB7B 5DFTA 1EDTA 1LK2B 2MTAA 2JKSA 5DEGA 5DLLA 2X0SA 1TTFA 3QHFH 4GKZA 3EXSA 4IDLA 2PBOA 5EZOL 1YEYA 1PY0A 2HLAA 4L8SC 4H1ZA 3BXWA 4P7OA 1L5GB 3I9GH 3O81A 4HJIA 4WNSA 1MNZA 2PTZA 2YRBA 1CBVL 3M0XA 2O26U 4JR9H 3QQ3B 2CGRH 5HJ3A 2Z1XA 2Y07H 4O0QA 4UQAA 4KI5D 3FK4A 1XHGA 3RL1B 3W00A 2GW5A 4WGXA 4EAYA 2V6AA 5CD3B 3SRHA 5JIIA 5DA0B 1QTPA 2XQYG 1B3ZA 4S1FA 1J2BA 4LMQI 4B3KA 3LZFH 1D3HA 9XIAA 3BEVA 1YNPA 4LP5A 4RMSA 5I76A 3KL0A 3UH8A 1PX4A 5CJQH 2XWJA 1QBML 4PJGF 1C1EL 2IDQA 4TQ8A 2NTFA 1NAKL 1ETZA 4HIIA 4KMTH 3COTA 4TYUA 5M03A 3BMXA 1MZZA 2XZQL 3GWJA 2EG6A 4CQCA 1UWEL 2FK9A 2YWZA 4IIHA 2GY7B 4MA1B 3CHXA 3BZEA 2Y25A 2I60H 4XP5L 5K1JA 5C0DB 4U7MA 4EE9A 1WYIA 3DC8A 4GZJA 1AC0A 5E8EB 1PTAA 5K59E 3ES6A 5IOBA 3QQ1A 3H8NA 1D6VL 3GKWL 5BWAA 4DP4X 2JKIS 4XODA 3UP1A 3FVDA 1AFVH 5FM5O 2UWEB 3U1SL 4LCUA 2A1WL 5ADOH 3ZMRA 1QSEB 4GBDA 3S5NA 5TK2A 5DDHB 4EF3A 5AC8A 1HKIA 5EFDA 2EKSA 1W8SA 5FJJA 2OULB 4XBGB 3WN6A 3PZMA 4M7ZB 5L88L 3BURA 2ZUVA 4GUPA 3BWWA 3KNBB 2AV7B 1MFMA 1XCFA 1NANI 4LLVA 2BB0A 2DORA 2OA9A 3MVSA 5GJSH 4G11A 2BWGA 2QDHA 3WFBH 3KEHA 2ZWYA 5KS9F 2OLSA 4QCEA 4Z5RA 1IC5L 2K3HA 3QRLA 2ZJSL 4XP9H 4L3CB 1XIGA 5AW8B 3RO8A 2WINB 3Q67A 3WFAA 2AMXA 3NDZE 3PABB 1CBJA 1S7UB 1RJYB 4ZMLA 2WJZA 3MACH 3W87A 3HMXH 1HFUA 1Z32X 1ZHLA 2GTWA 4DWDA 1DOSA 2BW5A 2PCPA 3K2MC 2PLJA 2XTJD 4AEEA 3QORB 4G6KH 1LOLA 3CV6A 3V16A 1ZLDA 3BC9A 4NI6A 1D6EA 4QLRA 1XH3A 4MJ2A 2X05A 1RI8A 1BD0A 4HAKA 1TUXA 2F6UA 2QJIA 3QRHA 1OTUC 2IAMA 1NWTA 3QSTA 2Z92A 2IADB 3WMBA 4KKLD 1MJJB 4Y2OA 5JPMC 2ZCHL 4MJZA 6XIAA 3DX3A 5DHYA 2E9JA 3B3IB 1S5TA 2XSXA 4HHPA 1NGPH 2Z0BA 5JQIB 3PZNA 3KG5A 1YO4A 1XF3A 3FHQA 4HETA 1DJGA 3UYOD 5BPPA 1OADA 3TTQA 3WLWC 1JHLH 3CFDA 4Y4KD 4J28A 2OMYA 3NIDF 1EYEA 1P6CA 1TJPA 2Z7GA 2OO6A 1XGRA 5AHMA 2IALB 1T1XB 3QC0A 1FNLA 2BIOA 5DD0L 3LCWA 4FIQA 4GYPA 4AMXA 4WZ9A 4YNYB 4YXLH 3LKOB 4NXSA 4AQAB 1M6OA 5L0QC 1NAL1 2J71A 1TF4A 2WLYA 3HI6L 3NJGA 3QXDA 1KOAA 1QZNA 3B9KA 2V3FA 1C8VA 4MRBA 4P04A 3BARA 1R3SA 3CNYA 4AKOA 4AD1A 3BKML 4BIKA 3MRFA 4POYA 3TIEA 3B5HA 1JZ5A 4JG1H 4XMPL 4DBWA 1BFTA 4ZXBA 3LYEA 5FAJA 1G9NL 4HBCH 4M8QB 1WZKA 2DZEA 5DQ9A 4OGYL 3I6GA 1JPTL 1WICA 3OJDB 5ENWA 2BVPB 3V9EA 2WUBH 2NR6C 4ONOA 2PDBA 1B3VA 3N3MA 3VCNA 3OTRA 2WVUA 1Q9OB 3QJZA 4N2CA 3NM3A 4PS4L 1JFQH 3PHOB 4NN6B 1OD9A 2GAZB 4XVSH 2NY5L 3S34L 4A38A 5I16B 3G1XA 4NJKA 4MSSA 1EUUA 3FO9A 3NEOA 1A0DA 2VEKA 1TV4A 1H9VA 2VURA 4MYWB 3TO2B 4QRRB 1T40A 3TIEB 4QJ1A 2IWKA 3W7RA 2O6EA 1Q63A 1R87A 1F07A 5BNKA 3ATFA 4LVNC 3V0IA 4XAZA 1FNAA 1W0YT 1TTPA 4US5D 3MXVH 2VC9A 3QULB 4RE0A 1A49A 4H20H 2XWJB 4JFHE 1HH9A 4TUKH 4UT9L 1IE5A 1VPXA 1IM3D 4GO8A 3KYAA 4KAQH 2QVIA 2P5ED 2ZCKL 1USQA 1RY8A 4IMGA 1TJGL 2HVBA 2ZXAA 1WCGA 5BMXA 2YPKB 3H9SB 2Y88A 1DJNA 1VFHA 1U58B 4A6YB 3O0RH 1TE1A 5LUMA 1BX2A 3TJ4A 4JZNA 3WKNA 2A3EA 1KYOK 1F8MA 4AX3A 5G2WA 5EPDA 5K69A 5KOVC 3M5XA 5I66B 5AOMA 4US6A 3FBKA 1MW2A 5BW6A 1A5FH 1GR7A 5DRWA 5A40E 3ANVA 5D2NC 1KTLA 3MRCB 4KWVA 1H1YA 3LSOA 5DX7A 2PBGA 3LQAL 1HOCA 4CJ0A 1CC3A 2CBIA 5KETA 2BVOB 4A3RA 1JEZA 2R6OA 4HK0A 1U8KA 4L3ED 4FG4A 1F76A 1G1KA 1H3PH 4CC1A 3LH2H 5AVWB 4KKZA 2ZKMX 4XNQB 3SCUA 1WXZA 4LGPB 2Y5EA 4WWKC 5KZDA 3RCMA 1DJHA 1ED3A 1LWJA 3LD8C 2OQYA 2VLLB 2YD3A 3EJQA 3MBEB 3Q8EA 5ABZA 3QDHA 1NIDA 3RZCA 3LQZA 4O9HH 1E1EA 1UZ6E 5AW5B 2B9BA 4B16A 5GJSL 4L8CB 3F5LA 1NQKA 3DX7B 3KVDD 2R69L 5CZRA 2CO3A 4F3FA 1XCTB 2C9AA 1AQKL 4YSAA 3T2NH 4Y16A 5CBIA 4E5XB 1UOVA 4JRYE 4WUUA 4XP9L 5EV7A 3GPSA 4PREB 4C1KA 1GC1L 4TSCH 5JQ6L 2WSYA 4P7LA 2BZ7A 5F2GA 12E8H 3VFOB 1UXWA 2D69A 1MPAH 4OV5A 1KCKA 4W86A 4HEPA 4HIXL 1ORQB 1W1ZA 4B3VA 3TBWB 2WGNB 3ITXA 1KFAL 3HS8A 3MUUA 3DU0A 4Y4KC 1WFJA 1ZVNA 4KHTL 2J1YA 3E3QC 1V3HA 4F58H 3R89A 3THAA 4FQQA 4P4KC 5BOJA 4Z8FL 1VFSA 3UZXA 5D9MA 4N9EA 3VWJD 3WJWA 4DO6A 3LHTA 3DJRA 2Y1ZA 4ZDHB 4K8HA 2FQDA 1YPFA 1GJUA 3H9HB 3WQ6A 3G1FA 5EH1A 4NQCB 3KWTA 1W9PA 3FO1A 1CFSB 2XNAA 4LVNB 2OTUA 3DA0A 1QDSA 3BKJL 4XBEL 3W0WD 3RB7A 4K3DH 4ZK8A 5DUPH 2ALRA 1K4DA 3MCOA 4HWZB 3W9DB 3MP4A 2ROYA 5HVGB 2FSEA 3CAVA 2CRZA 2B0SL 5DMKA 5XINA 1SJEA 5ABEA 1JRHI 2MQ3A 5TK4A 5DXYA 5AVSB 4H1LH 1BYOA 4JFUA 2Y24A 5DJ0B 3KBPA 3MNVA 3UBXI 4DERA 4JQAA 1JDAA 4P46B 4IJCA 4FK9A 3EADA 3LEVH 3TE9A 1J8KA 2EIEA 1WA3A 2VDRB 3C5ZA 3T07A 1RLWA 4KRPB 4GZEA 3ULVF 1F6LL 4JFQB 2VLKD 4W6YB 5DEFA 2WMJA 5IM7B 5ACMA 5DEGB 1GZJA 4W9HC 1B0GA 5D7JB 3PJTA 5EU6A 5H35A 4H83A 3ARWA 1W72L 2PP8A 4O5LL 5G4HC 1KXVA 3M0VA 1QAPA 4HLZH 1C90A 3WF3A 2PYEE 5HDBE 4JTLA 3FYPA 1W56A 4IKIA 2O5NA 4YGAB 3UTZA 3GNPA 4B6ZA 3UA4A 1VQTA 2D03H 4UIMB 4RNRB 4IPIA 4C60A 2WXHA 1U8OB 2WC7A 4RAVB 3GGWB 2IGTA 3BSZH 1E3FA 3DYOA 4X8JB 3CH0A 1RUQH 5IM51 2YPLE 5D96B 1EXHA 4NSBA 3ZKMC 1GGBH 3CQHA 4NVTA 1ET8A 5B1CA 3WQ4A 1R33A 4X99A 5AHFA 5DHMC 2V3EA 5AW1B 1H11A 3NQ6A 2OSLB 3HZVB 1K8ZA 2GBTA 5FB8B 4IH3A 2IPFA 1DQJB 5G4WA 3SCNA 3KS0J 3REQA 4DI9A 4U1MA 2EEFA 4MA7L 4QF1A 2FZ3B 5AC7A 4MVBD 2C7FA 3AG1B 3GRWH 4ONFL 3SYAA 1M6JA 3GDRA 3FH8A 3TSBA 5DVNA 3QN3A 1QKZL 1XD1A 1CO1A 35C8L 1TUFA 4JHAL 5DJ2B 1KTDB 1KR1A 2C1IA 4WWKD 3CTTA 1Z5LB 2B20A 1A7PH 2VXTL 3GI8H 4KRLB 4Y1SA 4CA4A 2E6QA 2E1DA 4P2QB 1MG2C 4K7PL 4XBPB 3TA3D 1C8YA 3ONCA 5HMDA 4PRHE 3ZXAC 3S35X 1S2WA 5L2KB 4OE7A 3CV2A 3VI4A 3UJJL 4F0LA 3S5YA 3Q5YA 3KBJA 2XG5A 1Q94A 1GOKA 4LDCA 5MERA 2DIEA 2MUCA 1ZANH 1IU1A 2FZ3A 2CWRA 5CJQL 4BCXA 2XIBA 3IDXH 3WIHL 3VTRA 4RGNE 5FXCH 3QH3A 4WFED 1XB8A 3L4XA 3MYJB 4BHUI 4FF5A 4G7EA 2ATPB 2J8HA 4PV1C 4N5UA 4TUUA 1II4E 4XZLX 3TR9A 1PIGA 1U33A 4I0CC 4IBTA 4LCVA 1ZGLM 3SJVB 2OX1A 3WQPA 3WE1A 2WLZA 3PZGA 2AL2B 2ACRA 3BG3A 1A1MA 3UTTA 4NWUH 1LNUB 1AE6L 4MCNA 2CLEA 2XUCA 4EPKA 2WINA 2FQGA 1RUKL 2F54D 4PRID 5I28A 1DIOA 4M7TA 2V2XB 6PTDA 5LNEA 1JYNA 3VINA 5LIXX 2VN5A 4GS7B 3S9IA 2FVLA 5K9XA 2VR4A 2FLBT 2Z8SA 4QJ3B 3VFUB 2EIZB 3U3HA 2X4PB 1CD1A 2F18A 1HK6A 4Z2IA 1T3FB 4LAQL 1T41A 4YSCA 3FUKA 1CL7H 1FJ1A 2DQJH 2GCYB 1IXNA 3HJZA 3KWWA 4KXBA 1WC7A 3VFPA 4TMBA 4YPGA 5JIQA 3L3IA 3W7CA 4DBDA 1UH2A 1QO5A 1QFWH 5D7LB 5AEAA 1E51A 1W3JA 2NNRA 2XWDA 2ZYRA 1S3HA 4AGNA 1R38A 2POTA 4PMVA 1PLAA 1QW8A 3KL3A 1TZGH 3WJLC 2APBA 1LLAA 3LNGA 3QHFL 4WW2C 3ZQWA 3VI2A 1OF6A 1ZS8B 4JQIA 4L1BA 1FLTX 3RVUC 2EGZA 4NFBA 3WJMA 2JQXA 2GJNA 5I26A 2C7UB 3ME0A 3MODH 3W9EB 4Z76A 2BJMH 1IIKA 3QW9A 4GXVL 3NJIA 3RUGE 3ZDYB 1PXGA 4KQNA 4AHPA 3L3OC 3ZRFC 1R5IA 4BINA 4IMKC 1T1YA 1FDLH 3HR5A 5EO9A 4FAAB 3PWPD 1Q6FA 4H8VA 2R29H 2WJ5A 1EIXA 1NELA 3MV9A 1PZSA 2R23A 4Y4FD 1KPUB 4Q4RA 3WJLA 1E4XL 2R56H 3BN9D 3NCBB 5CBAB 1M7UA 1I3VA 2IG2H 3WL9A 2IMRA 2QKIA 3ABKB 5HDQH 2LU4A 3VWKA 1O4UA 2JIWA 3HA1A 3WJMB 1PTZA 1W9VA 3CFDB 3T3ME 4YEFA 1JZDC 5DYOA 2XKUA 4QRPD 5CCHE 1DQUA 3W2MA 1JPGB 2CLRA 2IDCA 4HLZG 1A5FL 1MRQA 4WGKA 3U46B 5IHWA 1B4LA 1M1SA 5FYKL 4BFFA 4M5YL 1F90L 2D1ZA 2NY6C 2XX0A 3ILEA 4LXFA 4U1GB 1FO0B 1NFDE 1J1XH 5B4MD 5F9JB 3I65A 2HG5B 2XN9A 3PTMA 2A83A 4NZ1A 4IJ3C 2E59A 1EPXA 5LHDA 2A5UA 2XIDA 1A9EB 5A2LH 1LEKA 3RLGA 4G8IA 2VEIA 3NSFA 3TBYA 1IBGL 4I5BB 1WIUA 5C86A 2HK1A 2GKIA 3WQVA 4QYOA 4TOQA 4FTVA 3NABL 2F15A 3MLRH 4W5UA 4H1LG 2Y7QB 5FYKH 2HXUA 2WNXA 3FTGA 4UQ3B 4HCFA 2Y7OA 3C61A 3SIKA 1DBMH 4MF4A 5HJLA 1AGBB 3TBTA 2R1KA 1IM9B 1HZHL 1S5HB 2FJGA 3ILPA 3ZT6A 4G7YL 4XB7A 2RFGA 4XTRD 3QIWD 3TXAA 1FY6A 5T1MB 3T0AA 1EFXB 3VXPA 2NVAA 1GC1C 3N40P 2AQSA 4QYOB 2OJZH 3MGAA 2EXTA 1GOXA 1RXOB 1P48A 2ZXGA 4G8IB 4IMLB 1R24A 2MHAA 1MELA 4CILA 2OMAA 2ZAIA 4HIXH 1N0XH 3WFLA 4IDJL 2PTWA 3KH4A 3TH6A 5GS2D 2P5EE 1BFSA 5DEFB 3LDBB 3B8YA 2BOBA 1XIWD 4FTVB 1EFXD 5HD8C 3W5MA 1QR7A 3W74A 5IUSA 4TQHA 3TU9A 2EDKA 3CQQA 2VWEC 4LQFL 4M6PA 4O54A 1U42A 4ZXOA 1WEJL 1XLIA 1VBUA 1F3DH 3NVDA 2XI9A 3ZMNA 4AVIA 2Q8AL 1ONXA 2EZ0D 2IAND 2OL3A 5F6HJ 5JNYB 2B3RA 1ETA1 1RUMH 2ROXA 3ECWA 1WF5A 3Q8FA 3E0IA 2CO6B 4B9PA 4Q4PA 2IAMC 3HGSA 3K1KC 3K71A 2V67A 4D7BA 4A7GF 4GXMA 1GVQA 1NY1A 4KKCC 1GVFA 2QUNA 3MUZ1 1A3LH 5GNXA 2ICCA 2NXHA 1KBBA 1OE2A 1QSFD 4W89A 1SEBA 2IQAB 1AJ2A 1K8IA 2VSDA 4FQIL 3AM8A 4MJ4A 4WI6A 4MPKA 3P2TA 1PSCA 4Z7VF 2HRWA 2YK1L 4AKPA 5C55A 3WMSA 2JJWA 5SWSB 4KTDL 1FFNB 1BYPA 2VLKB 4WJ5A 1A5UA 2MH4A 1XYCA 2R1WB 3NACL 3EGDA 2FNBA 3R06A 1THFD 3C2YA 1IKOP 3GMLA 3FBQA 4OD2B 3OPUA 4OFYA 3V9FA 3N15A 5F2MA 3W71A 4B15A 4GBXA 2FZNA 3FFDA 4LPXA 2OMBA 5F6IB 4FI6A 3DDMA 4OV5B 4JRYD 3WLMA 5I6XB 1VFUA 1CLOH 1YQVL 4OU1A 3QFJA 2HT3C 1CCWB 1QYGL 4MMYB 1IWBA 2ICES 3DUSA 3MRGA 3PXHA 3F6IA 4Y7OC 2NZ1A 3GSNA 4JZJC 3TA3B 3AB0B 3WE6A 2GGJA 5CN3A 2PGEA 3MTRA 2ZKWA 2YZ5A 3QNFA 1YN6A 4XMLL 1IEVA 1NCDH 3QEUB 3WUWG 3R58A 4LRSA 4E5TA 4ZFGL 5A95A 4RDBA 4UQDA 4HV8B 3MSYA 4GUIA 4ZGYA 1DORA 4HJ0C 1F4YL 4YHPA 2FX9H 4X9FA 4EN3C 1H09A 3OHXC 1UXSB 2B2XL 3HVDA 4FYSA 2QDDA 1SW3A 2J25A 1EZVX 2MOGA 3A6BH 2PR4H 4LO9A 2DWDA 1M05B 4CNIA 5IQ9B 1H5VA 4TU1A 4PCPA 1JPKA 1ADQH 3A6CH 3B3IA 4FZ8H 4DSYA 2QPXA 1XRSA 3CHVA 2V5KA 1SJEB 4WRHA 2R1YB 1R3WA 5B38B 2BOFX 4LB3A 2AAAA 2PPFA 3QFDB 2E27L 1D2OA 4AXWB 2NY4D 2YC1A 3T0EB 3AXHA 2VAJA 1NCCL 3NYKA 3BEWB 1FLRH 2XV3A 2PF8A 5ABGA 4ONGL 2G75B 1XPYA 4ZAKD 1KIPB 1HKVA 1HVXA 1V77A 2P8CA 3H4GA 3EOBA 4YGVB 4EN3A 1A1OA 3NQAA 3VUSA 4JQ2A 2WHLA 4GBUA 3OLEA 2NSXA 1KULA 4KXZI 1XYMA 4KWSA 2HJKB 4YK4B 4Y5YA 1J11A 4DKTA 4L6HA 4WFFD 1TA3B 4ZB2A 4O1AA 3X12A 3ZIZA 1I8LC 2JK2A 4JDTH 1EVUA 3LU2A 5IQ9A 4DEPB 3Q58A 3T6CA 2E7LC 1A7NL 4WFEE 1OYBA 1TTIA 3RKDD 4KIRA 2G9HA 5FYKD 2W9EL 4XVTH 3R1ZA 1EEQA 1IWAA 3R8GA 3MRPA 2N4IA 4OZGE 1V3JA 4KXDA 1RAKA 1XP3A 4J2PA 4U1HB 4KK5D 2ODHA 2VCCA 2IOMA 3QR3A 3QWNA 1DXFA 4QXVA 3UBXB 1HCZA 3ARBC 4U3CA 1NANH 2IV8A 3LEVL 4JKPH 4YO0B 5D1ZA 2GYIA 3CZEA 1XC4A 2BH0A 3CHEA 3GKAA 3QK0A 1XBZA 4I9MA 1W9XA 2OQJB 5AVZB 2QJNA 4X8XA 5E0QA 4RAVA 3KPRD 1RP8A 1PFOA 1TPXB 4HKZA 1BDYA 4KX7A 3CT2A 4P2QD 5BXPA 3HMWH 4WHYH 3BW9A 5AQ0A 1DWIM 1V02A 2DQGL 4MNMA 2GUYA 4C1LA 4E4UA 5IZ7A 2VC7A 2YMXL 4KU1A 3ZKND 2I5YH 3HFML 1INDH 4MCZA 4O2EB 4B5ZA 1US3A 5GZOA 2QUUA 2AKZA 4ICXA 4ICNA 3CWOX 3SKNB 1P1MA 1R3LB 2VDLH 2QVFB 3C5SB 3O4OB 1GW1A 1KV5A 3W11C 2Y5JA 4G9DA 3S1GA 1E72M 1R3RA 4GKLA 1T2JA 3M8OL 3BAWA 5GJTH 5BZWA 1LDSA 2SEBA 1U91B 4P57B 4UTHA 1NEZB 1YEHL 3QDMD 4L9DA 3H70A 1KFAH 2H45A 3UY7A 2HISA 1UJPA 2PZ0A 4DPAX 3AIWA 4I0PB 1GHFH 1QHZA 2NWSA 1HXYB 4F7EB 3PNZA 1RJRA 3IFLH 4EDWL 2ED7A 2HJLA 2VIRA 2AOSA 2XY2A 2DL9A 4O02L 3SCMD 4PUNA 3MCMA 2CLIA 5FSDC 4O02H 2A77L 5E2WL 1ROWA 1ES0A 3L9YA 3UEQA 5EA0L 2RQEA 3K4AA 2J5WA 1ZZMA 2WKLA 4WOQA 3U1PA 2CO7A 3UYIA 4W7VA 2X1TA 3PXJA 1DZ0A 3QUYD 4L9LB 2JIXB 4AZCA 4DPPA 2ZZUT 2FQIA 3EYOB 3MMWA 5FJRA 4CC0A 1FZKB 5GRZA 4LV9A 4TV5A 1Q2SA 1MCIA 1SVBA 3N55A 3R4DA 3MI2A 4F7MB 4PEKA 3WO8A 3BQVA 1MFDL 3K2IA 3NIFE 2OU4A 2FBJL 4DP8X 4YQXL 3HUJF 4DWHA 3RBSA 4A2SA 3QIBB 3W24A 1FVCB 2VMJA 1KB9K 1VF5C 2G95A 2YO3A 5JPNC 3SODB 4HPHA 2PWHA 1PU0A 5FYJH 2CIIA 5IGXL 1T80A 4R0LB 3FC8A 4ZQKB 3SCMB 1OOAA 1XRFA 3GK0A 3KM8A 3NIDB 3CLMA 1ID2A 3P81A 2VAAA 1AH4A 1XX1A 2HEJA 3MRFB 4YEEA 4HU3A 5AC5A 3D25B 3WNPA 4G5AA 3WXWL 2EH7L 3W7KA 5H8MA 3GD1C 4W70A 1VEPA 2X3AA 1AZUA 1VEMA 4HIPA 4N2DA 5DQ9B 4XNDA 4XMTA 1UQZA 1HZYA 4HPNA 2X4UA 4AZ7A 2IXVA 2GWNA 1E3ZA 1T04B 3OZKA 2WBJC 4WO4A 4AYEC 5H8DA 2PABA 2SODB 3DV4A 4YDIL 3GSNH 4UYPA 3UTQA 1VFTA 3EZ4A 1RIVL 3CVCA 4OFYD 1NPUA 4YZFE 1G94A 1WZ1H 3SUVA 1F11A 2YEVB 2Z6JA 1V51A 3F5JA 5I1DB 1M9WA 4IBYA 4N2GA 1TVPA 2ZRWA 3HG1D 4XBJA 3A4WA 4MMWA 1KN2H 4BA0A 1FO0A 1QNZL 2VQTA 4R4BA 3VG0L 2B5IB 2E6YA 3U0PA 3I6RA 1AGFB 1F42A 1WQVT 2E56A 4NX5A 2EDFA 4G7RB 4TQPA 3M5VA 1P4LA 5C0IA 1JPGA 3G04A 1B3YA 1XX9C 3KXFE 2ATAA 5TE6L 5DC2A 3CH1B 1BZ8A 3VWKB 3A6CL 1RQEA 3LS9A 1N4XL 5DSCB 3MVIA 5KJ7E 3TGXA 4PMQA 2YL8A 2FUQA 3HC3H 4J3VA 3G2GA 3S1WA 4PB0L 3PAJA 4J3UA 5C6TL 3OGSA 4HC1L 5GS1A 3APYA 4CNIB 1LK3H 2E27H 1M6UA 3WFEH 4H8QA 5AW3B 1SY6H 4B0MB 3BZGA 4GT7A 1OANA 5DZNA 1MRCH 2FX8H 1Q9LA 3EDDA 2Y72A 4XGZB 2LR4A 3N43F 5H2BA 4UR9A 1LUCB 4JO2H 3M0KA 3UCDA 5TPWL 1TETH 1IIIA 2AJYL 3VVGA 2HVKA 3N85L 4M80A 4X8JA 4NM4H 4NZFA 2QULA 3T77A 3NWRA 1CLYL 4ZMQA 1LWIA 3CWHA 5D8WA 3AC0A 1U8IB 3C2AL 3WN5A 4B9JA 1VFBA 2EP6A 4LU5L 1QUNA 3NZUA 5XIAA 4HNTA 2O4EA 1CXIA 1JGEA 3SKNA 5CCJA 5J57B 5G1MA 2W5PA 4CCEA 4NUJB 2YUVA 3FU8A 4ES8A 5HVWA 5ISZD 1JNEA 2VEMA 3GSMA 5CH9A 1V6TA 3B2MA 4XTIA 5D9PA 4PUJA 3UYCA 1CE6A 2O5ZH 1UR9A 3ZDXE 4RZ5A 4G71B 1G9ML 4NU7A 3SY0B 1WYJA 1R3VA 3TPUB 5LKYA 4PB5A 3MWAA 5HY9B 5KSAD 4Z7AA 1J5OH 3F4NA 3CD4A 1YQVH 1YDNA 3ZUNC 3WCZA 2CCWA 1UACL 2VH5L 2Y0SA 4J3SA 4MMZA 4F0SA 4K0OA 5E99H 4YXKL 4LC8A 4DGVL 1E5ZA 1IGTA 2DIAA 2EYTB 3CFBA 3DRTB 1GYAA 4GNVA 5AN7A 2EE9A 4OLWL 1E56A 5CS7A 1QFOA 1U41A 5TNVA 4PJAE 2X4OB 1W2KT 4NILA 3AT0A 4W9DC 1GZPB 4OM1H 3MX0A 4JTFA 4PTWA 1UH4A 4RISH 3VNZA 4DPCX 3OO2A 4BUGA 3KLHD 4KFOA 1RQ5A 1TCRB 1OFEA 1BGXL 4CMHC 2UZ9A 1T1XA 4NJJA 2CHWA 3EF4A 4AK1A 1I8AA 3PREA 4OJFL 1HL4A 3AT8A 1VAHA 2R56L 3SQOL 1HGWA 1LP9B 2FFIA 5DQJB 4GAYB 2P1FA 2IFGA 3FT4A 3O1NA 1BEYH 1K5WA 3MNMA 1I9JH 4LEQA 2F5AH 3VCLB 1MNUH 5D1QB 4PTMA 5D2TA 5I6OA 1RXLA 1Y1UA 2WZPD 3LKSB 3U1QA 3BIAX 1ITXA 5E51A 3RITA 1ZHNB 5GRUH 2VDRH 1EB3A 2NZ9D 1VGAA 1FI8C 1U3YA 5K39B 4N20A 5HHOB 1N6QL 5DRIA 4Y16D 1OCQA 2WNNA 1D9EA 3P77B 5T8IA 4QSFA 4IS6B 2NNCA 3IPEA 3QIUB 2YDSA 3LS5L 1BF2A 4Q89A 2FHBA 2CO4A 2WXNA 1D5XB 3NH7H 4G8EB 3QNXB 1PYWB 2FEDD 4OLUH 4DY1A 1JOIA 2JCWA 3DSFH 4IOSD 1D6VH 1D5ZB 2FEJA 1JFQL 1XGTA 3F5KA 1VCAA 4QNEA 4XZBA 3UYPA 5T91A 2GCYA 5CLXA 4H26A 4ZX6A 1EHLL 4PSPA 4LCWD 2ZADA 1FL6B 4NWUL 4F3FB 2Z31C 3N42F 4GMSL 4NAMA 2JI2A 4ZJ9A 4D9QE 3L5JA 2Y36L 4KPHH 3VDAA 3KOWA 3VE7A 2VFFA 4OTXH 1SJBA 1AMYA 1OBAA 3OR6A 4DGWC 4LLVB 1ZIBA 3IPFA 3WY2A 3QNXA 1IO4C 5HHVH 3UBXG 3LCLA 1W0WA 3MRJB 4ZX5A 4DOHB 3BW3A 4WK4B 2FGLA 3FY1A 1H1NA 1JPEA 1SJDA 2XH0A 3UJSA 1KLUB 2LVEA 4NCC2 2W88A 3UGVA 3NESA 2G4FA 1IT0A 3O3UN 4CD4A 1XCXA 2R69A 3BUTA 1XGEA 4NM8L 4TUJB 2R1XB 2E5CA 2V5BA 1OW0A 1VBRA 3WG6A 2L8AA 2MKWA 2M83A 4RK8A 3QUZD 3RM4A 4HKXA 3GNDA 1UM5L 2HN7A 2IBZX 2DIKA 2YCLA 4IHCA 3QJXA 4MG4A 3L12A 1KBGL 3GBLA 1M01A 4DIXA 4JM2D 4ACZB 1NVMA 3OZMA 3F7LA 1ME8A 2QKIB 5T3XD 1JGUH 1ZXQA 1YUKB 3N4FA 4RWHA 3HC4H 3RNKA 1QNPA 4JGDA 2YZRA 2AERT 4LKXA 4NKIL 4NJHA 4YHYB 3S0CA 3CSFA 5ABFB 3DPBA 3O8XC 5TE7L 1LZOA 4XH2A 1MW0A 3F5WB 2ISVA 1R5WA 2VUNA 3L21A 6CGTA 2B4GA 3FU7B 5FF0A 3E9UA 3GNMH 3MV8B 2YYTA 1HYSD 2EE6A 5ESQA 4X2RA 5D38A 3WF1A 4QTFA 5CHNB 1LP9F 5GGSA 1JUFA 1NCIA 2ADIB 3MBFA 4HCDA 1R46A 3Q2NA 3BFQG 1T0NA 1KXVC 4QX4A 2AJVH 4LCYB 3QJHB 4MJIA 4LUSA 2WWCA 1PPIA 1WIPA 4MFHA 2Z00A 1IM3A 4TL4A 2P8MA 5DF0A 4DGIL 3BOVA 1KO0A 4O14A 3EH5B 4K5MA 1JVNA 2BSDA 3PHOA 5I16A 3ZE0E 3MUXA 4NFDA 2I07A 2M1KA 1JZ8A 2GC4C 4YHYC 3DZ1A 3PL6A 4PMNA 2FZMA 4ES4A 1K9DA 3OJGA 2BVUA 2XXGA 3I6GB 2XSAA 5IVNA 3FCTB 4FP8L 4JUSA 3WDJA 4RXGA 5F3HB 3WYRA 4L4LA 3MRMB 2WVVA 1FNEA 5IJVA 4UNUA 4IP5A 1YN7B 4PWFA 5F7LB 3BIBX 1QBLH 5FF7A 1LUCA 5FJTA 3PWPB 2X28A 4ATWA 4F80A 1QP1A 3QEZA 1T3FA 3CM4A 1KLFB 2BDNH 3WXWH 3N9GH 4ZOAA 4Z95H 2CNCA 1KPRA 2B14A 4PJXB 5JW5B 5GS1B 1AQFA 1CQYA 1TZIB 4R84A 3AJXA 3VKAA 5D6CB 3APDA 1CXKA 1WBZA 5SX4I 4PBEA 4IGBC 4KBXA 3NFPB 4EOUA 5D8ZA 4KDWA 3Q9QA 3R5EA 2NX5A 3HLAA 5FF3A 1Q6DA 3V0TA 1YEFL 3QXWA 1NIBA 2P3YA 5DFVD 4JQ4A 2DM4A 3OR7B 3POHA 3UVIA 5JQ9A 3O3AA 3VG9C 5FYLH 1AKJB 1RL1A 3WEOA 3F7RA 4ERSH 4JNXA 3WFHA 1XIIA 1YMMD 2D3NA 5D6DA 5D1XD 5E9XA 4FS9A 2XG5B 2Y8KA 2Z31D 3W5NA 2ZAHA 5A3HA 3RJYA 3U30C 4QOKE 3LK6A 2CDFB 1QWGA 2A77H 1CICB 2CJSA 1FFOB 5CSZA 3ULUC 1BTCA 2ON3A 4UTJA 3TSMA 5E6IC 5MENE 2DJLA 2A3BA 3JWNE 3PABA 2GSEA 5EF1A 4IBVA 4UQBA 3DBSA 3V0VB 1OLLA 4AQZA 2CXKA 2ZCGA 3EJZC 3AIUA 3O6LH 5AUMB 2QYGA 4QRSB 3UTSE 1S2TA 1GVOA 1XIHA 5F2IA 4ACPA 1KW1A 2CGZA 1JXJA 3ARRA 1WT5A 1SJMA 1TWZA 3RZWA 1J1PH 5BQDA 2WQVA 5TDPB 1OSPH 2H0FA 2ZA1A 4RV8A 7XIMA 4PREA 12E8L 3W28A 3BSZL 1A4LA 3SKJH 4CVUA 4A2DA 3NOYA 4ML4A 3P30L 5TBOA 4BWLC 1XR2A 4X99B 2VDOB 5HGAA 3NQKA 3P54A 3LKRB 2X4SB 4XNXH 5SX4H 2Q6WA 1A5LC 1LBMA 1OFBA 3LNPA 4NJGA 2X89D 3RPIA 2TYSA 3W02A 4NNYA 1J8HB 1V6VA 1A6WL 2GJ6E 3OVPA 1OLZA 3EMZA 3BQUD 1H6TA 3OJVC 1YN6B 4NDMB 2PE4A 4GCAA 2BY0A 4KZDL 1QR1A 3HPFA 2DLFH 3NEHA 2A6DB 1DVSA 1T7LA 1HKJA 2KPNA 1H3GA 4U6VH 3F6JA 3OPZH 1IGJA 4NKDB 1RALA 3DJTA 5D1ZC 3OKMB 4F2MB 1QI0A 2XQYK 1TQXA 4JD4A 3OLIA 3RIFF 1QTWA 2OSYA 4G1KA 1E8WA 2DEXX 1YPZE 4ZTYA 3W26A 1L6PA 2WN3A 1ML1A 3ZTNH 2BXYA 4YXHH 2I14A 2DIBA 1QQDA 2YCEA 4S1SH 2F8OA 5IQ7H 4HIEA 3EJTA 3NPSC 4JDZA 5C0AD 2OZ4H 2ZOXA 4YCPA 2ICEB 4X5XB 4QIRA 2QADC 3IUHA 3QO0B 4GOAA 2CKBH 3Q2WA 1AXIB 4O4YL 1BZDA 5D2LF 3RTLA 4F57H 1US2A 3ECVA 1IEXA 1SO4A 4QG9A 5K9KB 3MNVB 4UOQA 1NCTA 3BKJH 1OSZA 4XBEH 4NZUL 2HX9A 2J74A 3GG0A 1RKRA 1VFOA 5HULA 1M7PA 1TFVA 3T6WA 3QC6X 3FXYA 2WSPA 4DVBB 2FR4B 1IF2A 1BP3B 1FV1A 1IBHA 4L9ZA 1TCMA 3CVDA 3LBMA 3AMKA 2DH3A 3PWGA 1FWCC 4JDZB 3BG9A 5DMLA 1E6NA 4XOBA 1GPOH 2GJPA 5FCZA 1WXJA 5AOUA 4XIAA 5LGHH 2VFGA 4Q74A 3MXWH 1NCCH 1NA8A 2DMGA 3ZZLA 3M43A 3BXNB 4W85A 4FFVD 4L1LA 3AO0A 3MUJA 2YXFA 3CXFA 1XR8A 1C8XA 3SE4C 4GVIA 3GZ3A 4O2FB 2HX8A 5EOTB 3LA4A 4ETQA 6A3HA 1I1FB 1KXHA 4HKZB 3U4BH 5C7HA 1MPAL 2XU2A 1NJ9A 1XL4A 2PYFA 3IUIA 2JJVA 4APQD 4C6DA 4FXKA 3KBVA 3LOTA 1V7NL 1FVEA 1PIFA 2EIDA 1CDYA 1NWOA 4J3BA 5C9UA 3LTYA 3GINA 3GSWA 2YQ2A 3IMSA 5J56B 1WH0A 1EHLH 5CP7A 5F89A 4RKAA 4UUIA 3W53A 3MUIA 3SDYH 4WK9A 4BRJA 3V5KB 5ITFA 2ZZ3A 1QW9A 5I79A 4N4QA 5JMUA 4LVOB 4MXWL 3N1MC 5D1ZB 2J1WA 2QSTA 3IS0X 4OVUA 3YPIA 3HKFA 4ZO7A 4ZMZA 2UVEA 4N9BA 1KCSL 4H88L 5JPMA 1O7DE 1U8JB 3I84A 2YGOA 2R15A 1YDPA 1GQLA 1QT1A 3FB7B 4PTTA 5DUJA 1UWRA 3PC0A 4JX6A 1ND0A 2HPOA 3MQTA 5F1IA 3VFTB 1XIMA 1RCYA 3MKGA 3ENLA 4ZSOA 2XXMB 3DMMC 5IROC 4WD0A 5I1AB 1NGQH 3O4LE 1IAIH 1XLMA 4UFMA 5GIRB 2R1PA 2BOLA 1K9EA 3PBVA 2DMBA 3P77A 1N5YL 4W81A 3EXTA 1VADB 3RY4A 3ARGB 3ELQA 3MA9L 5HGBB 4BKSC 1CI5A 3V4VH 3L8QA 1NAML 1ECYA 3K8KA 5E99L 2WNGA 4YXKH 2E3ZA 2ADFL 5F9JA 2PW2B 1LVEA 4RRPA 1VIZA 1O5RA 1ZVSA 2EIKB 2GGHA 1JK8A 1EBPA 4YTQA 2ZP0T 4KVPA 4Q4EA 4JFDE 4AZCB 3BP5B 1MYRA 1IT7A 2AGJH 2A6JA 2Z35A 4GYFA 1ZHNA 2WQPA 4H8WH 2XYLA 2B77A 4RGOL 3F04A 5DGRA 2E67A 4F2EA 3IRDA 3OWRA 4NBZB 3XINA 4DEFA 2AVFA 4LS2A 3VILA 1F02I 1I75A 2NY3B 1RK1B 4N90D 5IB1A 1NEYA 1NWRA 5HYQB 2OMTA 4MAUL 1X98A 3H9SA 1WAAA 3I6KA 4LASL 1GOMA 3VG9B 3HI1A 1BKHA 2FTWA 1J9RA 3FQNA 5DRXA 4E2BA 4HUNB 4FI4A 3A47A 3V0AC 1SLVA 5EA0H 3WFZA 1LO2L 3FB6B 1AL7A 1ET5A 4K7VA 1UB6A 4QHKI 4DP0X 3HZYA 1AFVL 3U1SH 1Y07A 3VW3H 2KERA 2Y8VA 4K3HA 2YUWA 2CSPA 2X4UB 4LOCA 2ZE3A 4IGBB 1UFUA 3GSOA 3B8DA 1L0XA 3FS9A 4MMYA 3ATZA 1FGVL 4JFHD 1AD0A 1N2RB 2ZWZA 4AQOA 3HQ1A 3LI1A 4A2RA 1QJWA 4Q6XA 2ZZ4A 4NM4L 4JTIA 1G84A 1ZLSH 4MUPA 1A6AA 4TTGA 2HUHA 1F97A 2X44D 3BJSA 3S3PA 4X7FC 3EWWA 4ZQCA 2YOAA 4PS4H 4Z17A 4UTKA 2OV0A 4RSYA 4I1PA 2V5TA 5K1NA 3B7UX 3KJ4B 2I9TA 2RKXA 4DUXA 4PTDA 1Q9KB 1UBSA 3PSWA 1WJ3A 2A9MH 2HRPH 1E50A 3SCVA 2NQJA 4M4RB 2CXGA 1DQLH 1OP5K 2CMRH 2ASHA 3VDGA 1FHNA 1FRGH 2F19L 5EC1A 5GSVB 2Y07L 4NNAA 4WGHA 4FFVC 2C34A 2YD1A 5FW7A 4E9XA 2H3DA 3OPSA 4G9FB 4LHQB 3DPBB 1KY7A 1DVXA 3R8RA 3VIIA 3VYLA 3CHPA 5ESVA 4N9DA 4PJFF 5EEUA 2WZ0A 2BRRL 3LV6A 2VDMB 5HD8D 3M1BA 3ARBB 3Q0HA 3J7HA 4GZ7A 2ZCHH 1HWWA 3QYNA 4ZTEA 5EZOH 1CXHA 1KIPA 5CMAB 4CAGA 1W3HA 5DCEA 2XQBL 4M1CD 4H8PA 3LHUA 4JQ3A 3W1PA 5HBFA 1XINA 4JHBA 4KDTC 4NRXA 1TTGA 5HHXL 1CBVH 1B54A 1ZCRA 5J1AA 5FIEA 4MZRA 1A1OB 2E47A 2XA8L 3BSHA 4P4RB 1HIMH 4ZUUA 3L1EA 4ZDHA 3RDJA 2X8RA 5T8GA 3T4CA 3VAVA 1L9WA 1DBAL 1HINL 2QPFA 4N25A 2E5EA 5F96L 1R7OA 3QJQB 3A9BA 3PP7A 4OT1L 5E2UL 4KROC 2FWUA 3GBNL 1E0OB 4HPOL 2MSPA 3ARBA 3C5XA 1A5SA 4FQCH 1EZLA 1VKFA 1MREL 1A4BA 1UBPC 4OZIA 4TNWK 5C0AA 1Q65A 3MLWH 1I3GL 1JNJA 4BHYA 4ZMAT 2A3CA 2DQUH 5DJ2A 3H3PH 4ZBJA 3GFZA 3HFYA 4U6HB 1F3JB 2J27A 1J1PL 3CAQA 5AOZA 3R7RA 3ZHNA 4ABUA 3VIKA 3WQCA 3ARTA 3WX7A 4JTRA 3VXMD 2WB7A 3IS4A 5D5MF 3EPOA 1QATA 2GHWB 4JANA 1ZSXA 2ANUA 3SQMA 3V35A 1GONA 3QEHB 4NPKA 2CESA 3IK4A 3W2UA 5D1QD 3WIHA 4KC3B 4OZFG 1FNEB 4PRTA 2DWTA 1IC5H 3SGEH 2ETWA 3UFYA 5DUMH 4Q8WA 5EUOE 4AKQA 4Z1CA 4NSKA 4X4XA 5AFAA 4UMAA 2BP8A 3MLYH 2WO5A 2HT3D 2YMOA 1TZHA 2BSSB 4BFNA 5G2IA 2NW3B 3CFIC 4NZDA 1DP0A 5KVEH 1POJA 1BGGA 1HKMA 2F61A 3TC7A 4AIBA 4YC2C 4R7LA 4U3XA 5C0DA 4LV4A 5CSZB 4D8LA 5EIIG 3U2JA 1EBAA 2BVOA 2D4DA 4R4FH 3B7YA 5KSBE 3LHPH 5AL0A 1TV8A 5LA1A 3QUGA 3LKSA 5KJRH 3GUTB 4P3DB 1QPNA 4PRPD 3JV6A 1XBRA 3VQ2C 2ZYFA 3S37L 1S9WB 4OZ4A 4BJHA 5KSAB 2E7DA 4D6GA 2GPZA 1SJVA 1Q13A 3GH4A 1PV8A 3X13B 3HI1B 4JFDB 4CNTA 3VD1A 4OJAA 5HI3C 4GJJA 3HG2A 3ARGC 1B3XA 1YXCA 2OO0A 1JWSB 4A66A 1H0IA 3G5YB 4MRCA 2MNUA 4GY4A 5E56A 1ONWA 4YLWA 3DUUB 3T0CA 3DI3B 1C1EH 5C2BH 4HYRA 2ZX8A 1ZB5A 1RR2A 2OZTA 3U4AA 3HU7A 1GIGL 1YBQB 3LNFA 4Y89A 2YMTA 1OWWA 4OT1H 5ANMB 5AYUL 5HVFB 1RBLA 3MOAL 2CLZB 1KGYE 2YZ8A 1I2OA 5MHSE 5CILL 4XO6A 3MMDA 2X70B 3KBFA 3QSRA 1KRMA 3OKYA 2X9WA 4CD5A 1GOOA 5C07B 4WWID 4CU7A 3PB0A 3IDUA 4XXCA 1XUUA 1DFXA 5L7XH 5JXAH 3QXVA 4JRXD 4C6QA 3MJ8B 2Z6IA 3V7AE 4U7SA 3SN6N 1P1VA 1BXAA 2QGHA 1YNKL 5K59F 2YAMA 1V03A 3G1SA 3GSNB 2VO5A 3T3PF 1E6ZA 3FRPG 4JMXA 3RHWF 1UYQA 3SURA 4ACYA 2PDQA 3WU1A 3A4JA 3K8LA 1J9TA 1TMHA 1IC7H 1V0MA 1MF2L 2M2DA 2FH8A 4HJTA 1RZIB 4HUXA 4J1UB 4L3EE 1T5AA 3EYSL 3KXFA 5AW0B 1KFLA 3FVMA 1BXUA 1AYOA 2DIJA 1NCWH 4ANWA 3N2CA 5D04C 3UR5A 3CK0H 1MCQA 4Y88A 5G4OA 3HJEA 4Y19D 2QR0B 3PJNA 5LGJA 1RULL 3ZJ7A 2JCCA 1Z89A 3DESA 2VLJB 3DRQB 2DLTA 4LHUA 1RIHL 3AXLB 3KWVA 4QHNB 3N1QC 4R7WA 1LBLA 3WELA 2GQ3A 2IDUA 1I53A 4GUCA 3BDKA 1M6OB 3LXCA 3S4SB 1OSYA 2CDGB 4GT0A 4I48A 1B4KA 1A9EA 1LEKB 4EUPB 2EKSB 1WDAA 1IGML 4TNVK 1P7TA 3ROOB 3HGOA 2WBWB 5C7XH 2JQMA 4NNXB 5LIKX 4LSPH 2EDYA 2J3SA 4L37A 4Z7UE 1BYAA 5EN2A 2FVKA 4FYQA 3ITVA 2BIMA 2VLJE 5C0IB 1I8JA 1LRTA 4JEQA 4XPTH 3LQGA 2LE9A 4IQDA 3UAAA 4ZTPL 1CB2A 1K8CA 4K7YA 3G5XA 1OCRB 4JHOA 2WQ8A 3OAZH 4PJDE 4E9WA 4J3OG 3AU1B 2BXZA 1NCUA 4Y5YB 1MCNA 4G5ZL 3KE0A 3OV6A 2IVFC 2YC1B 3C9NA 3D6GA 1O6SB 3ECUA 3LEXB 4ICMA 3FT0A 1IXOA 1CGSL 4A35A 3KX6A 2BLFA 3KTSA 3PPGA 2CHDA 4YWGL 2FHFA 1ITQA 4JIQA 3ZLHA 4YHOL 5DD3H 3MHZA 1Q1JL 5GPRA 1JDDA 3HFFA 3CAFA 1Z44A 5E24E 2OODA 2QSQA 4H04A 1WAAF 2MHAB 4RGOH 3H6AA 5F9DC 2OMZB 1V7YA 1J1OH 1F3XA 2EIMB 2ZRUA 4UFIA 2Z28A 3HZVA 5L9DL 4FFTA 3HIJA 2HFGL 1Z3GH 5E6RB 1NAMA 3PULA 1QMLA 3FXGA 1AQ0A 1DPMA 1EJWC 4ZS7H 3K1GA 3JZEA 3N34A 4FXLA 3IJEA 1KLFA 3QPQD 4DF9A 4P2RE 5IRPA 4H9YA 2RJMA 3HPSA 5CKSA 3K80A 3DDFA 3SPIA 1U8LA 3DJSA 4ZNCD 3PWPA 4G80A 1DQVA 4PJ9C 3P0VL 4PRNB 1UA6L 3VH8G 1SZEA 2BMKA 5TF1H 1XISA 2OX5B 4A05A 3WNLA 4I0PD 1CE6B 3T0ED 1XDLA 2X3BA 4I9TA 1NIFA 3CXDH 2F8IA 4PS8A 4AMKL 1HHJA 3K2KA 5FO7B 2GDQA 4OUUA 2OP4L 1H6EA 3NK3A