1JDAA

Maltotetraose-forming exo-amylase
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
total genus 136
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jdaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jdaA01
1R7AA 4MJ4A 1E0VA 6TAAA 3EJRA 3VMPA 4DM1A 3AHXA 1OGGA 4MTVA 1E0XA 1KQZA 3NJ3A 5I24A 4BQ5A 4UOZA 1QNQA 1E5NA 5EFDA 4ACYA 3FN9A 1UWSA 4DUXA 3AMKA 1J01A 3AHZA 2PWEA 3KL0A 2XVNA 1UWTA 4NF7A 4AZ6A 3DX3A 3AYSA 1RP9A 5EMYA 4HPHA 3WNMA 2EEXA 1UQZA 1E4NA 2DQXA 3VIFA 1B3WA 3SCWA 3RIKA 4KRUA 4MPKA 2WSPA 1ISYA 3PBGA 2EADA 3QR3A 4FMVA 3OG2A 1W2VA 2VJXA 2XGBA 2AOSA 2VCCA 1B3ZA 4DO6A 2QMJA 1FP8A 4KMQA 4ATWA 1XC6A 5A8MA 3QOMA 3ZR6A 3VNYA 2WMIB 5DEZA 4J28A 1JYNA 2A3EA 4OJYA 3D4YA 1UHVA 1JI2A 3LXAA 2YFNA 1ECEA 4UFJA 4X0NA 1KGUA 3EDEA 2MANA 1PAMA 3W25A 3AMDA 3ARYA 3TTSA 3KZSA 3BH4A 3O9NA 5EFFA 1KWKA 1XYFA 4J27A 1OGBA 5DF0A 4Z2GA 4IISA 1JZ5A 1J12A 3BVTA 1CGUA 3AHTA 1HJXA 2YA1A 2QHAA 1G01A 2BXZA 1GVIA 4P8VA 2DSKA 3BAJA 3SCPA 3CMGA 3A4AA 1OT2A 3KLKA 2VURA 2CNCA 1KCLA 4V27A 1JYVA 4GZIA 3S2CA 3WUBA 3LX9A 4M80A 1E6ZA 2VX4A 2DDXA 2NT0A 3WEOA 4E8CA 5CXPA 4WIWA 1VB9A 1W9VA 3GYCA 3WD0A 2WLZA 1C7TA 3QHNA 4U5IA 1GOMA 4Z2JA 2VC9A 3CZSA 4CVWA 1MQRA 2V5DA 1V6UA 3WFZA 4W84A 3LRMA 4OBRA 1V03A 4W8BA 3K8LA 3SUTA 3AJ7A 1CYGA 2CBIA 2OLHA 1HXJA 5CPQA 2D0GA 3RJXA 1NARA 1H41A 3MSGA 1XGZA 3F5LA 4NI3A 3NUKA 1WKYA 1UZ4A 1X6NA 2ZUMA 5HNNA 3EDJA 2DSZA 4C7GA 1EQPA 4KH2A 1EH9A 3HG2A 4OGZA 2YJQA 1HP4A 3WDHA 4CCDA 3VGBA 2O9RA 3CZ8A 5AC5A 2OWCA 3ZT5A 1CXKA 2ZUUA 3QHMA 3BUBA 3EYPA 1UKPA 3VX1A 1XH1A 1UKOA 2WPGA 3AHVA 1HP5A 2XFRA 1WB0A 1CLXA 2JALA 5LA0A 3WD3A 3AIRA 3SUWA 3CHDA 1E70M 1UWUA 3CZGA 2RGLA 3MKKA 2OYMA 3OZPA 3KL5A 2J79A 3W24A 1FA2A 3VD4A 4P8XA 1V0MA 4PBGA 3NDYA 3DX0A 4GO9A 2ZXQA 4AZGA 3BLPX 5AC4A 5E0CA 4PTXA 4UQEA 1WO2A 2BVTA 2G4FA 3B8SA 3B9AA 3T09A 3A4WA 4FK9A 5C71A 4CU7A 4IUGA 2ZUWA 5A8PA 2EACA 2D3LA 3BSHA 2VUYA 1ITCA 4GZJA 2IUZA 3FW6A 4M8UA 4AEFA 3B9DA 1QWNA 2Z1KA 4UR9A 4PMOA 4PTWA 1K9EA 1ESWA 4UQAA 5E70A 3IJ9A 1JFXA 4MAVA 1UA3A 1UH2A 2GFTA 1OBAA 3WDIA 1H2JA 2QLYA 1MQPA 5A6AA 4UQCA 3LXBA 2WCSA 1NOUA 3WY2A 3AIEA 2D73A 3BUIA 5AY7A 2G3MA 1QPKA 4C7FA 2WZHA 2JF7A 1TR1A 2JIWA 1H49A 2ZUTA 3UR8A 3WEMA 3LPPA 4CGTA 3EBVA 1VEPA 4HMCA 2VZVA 2XG9A 3VIJA 1W9BM 3GBDA 2XUCA 1PPIA 2BV9A 1TA3B 5M3WA 6A3HA 3WELA 3DHPA 4PTVA 1KFWA 2VX5A 2WANA 1V02A 1X6LA 1V0LA 5LA1A 4PCSA 3CZJA 3DDGA 1QHPA 1UWQA 2VX7A 4TTUA 3TOPA 4UOJA 2PWDA 1V6WA 1LJYA 3TTYA 4QLKA 3LRLA 1B31A 3CPUA 2CXGA 2WKLA 4JKKA 4XV0A 1GPFA 1HVXA 4HOZA 1UYQA 4QDMA 1O6IA 5FL0A 1E43A 4FNRA 3CUHA 1B9ZA 2E9MA 4PSPA 4JAWA 1DP0A 2OSXA 2VZOA 3U57A 1SMDA 4MNJA 5BXTA 2EJ1A 3UETA 3A6OA 2CBJA 3N15A 1CPUA 1K9FA 1A47A 5FIPA 3AMCA 3AIVA 1J0JA 4LPCA 1M53A 8A3HA 2XIIA 4HOXA 4QCFA 3SCQA 2E8YA 2GJXA 3AZTA 3T2PA 4CUCA 3WQVA 3EJQA 2GK1A 4UZUA 1W32A 1ZBCA 2WHMA 4H7VA 1OINA 4AD3A 1PS3A 3D3AA 5D9OA 4AMWA 3GBEA 4PMNA 3CZEA 2ZICA 2VZTA 5KEZA 3ARRA 3OLIA 1CXIA 1W3JA 3NCOA 2QF8A 4ZE4A 1V0KA 1JGIA 4WF7A 3JUGA 1ZJAA 3PZOA 4IM4A 1ISVA 2QPSA 3ARPA 1OB0A 4JFWA 1H5VA 1V02E 3GTNA 4MADA 1JYXA 3GZAA 1DWIM 1R8LA 3PTKA 5A95A 5DMYA 1UR9A 4AD1A 1RD6A 2DGAA 3UR7A 3WQ4A 1Q6GA 3RM4A 5AYBA 1MYRA 3MO4A 4MDOA 4S3JA 3WF3A 4LQ1A 2J7HA 1EQCA 3AZSA 1HKJA 1OD8A 1HF6A 4KGLA 3K46A 4D6GA 1R86A 1WAWA 3BMWA 5BROA 1TVNA 4CU6A 1H4PA 2BS9A 2UY2A 1G0CA 1VEOA 3WMCA 1WP6A 4IPLA 1LLOA 3IAQA 5BYWA 2WLYA 3SCVA 3MV01 2WVUA 1XD1A 3EDDA 1E5JA 1FFQA 4JFSA 1QOXA 1V08A 4MNKA 1VFFA 1BLIA 2WMGA 1WNOA 2CCRA 3N9KA 3T0AA 4DWSD 1R47A 1CXLA 3WDRA 1HX0A 3EJTA 4MB3A 4WKFA 2HISA 1UD8A 3QHOA 1V6VA 2BFGA 4ZE5A 3WH8A 4CN1A 2F7PA 4B16A 3SCRA 1V3JA 4DWSB 1Q6CA 3EDFA 2VCBA 4D6IA 1E4IA 4CD8A 1K6AA 2RGMA 3BLBA 1QNOA 1W91A 2ZOXA 3H55A 4Q7NA 4MB1A 4GI9A 1HNYA 5BXSA 1DWGM 3CIVA 3QOKA 3U5UA 2J47A 2EPKX 1V0NA 1H11A 1NH6A 1BG4A 1TA3A 4RL3A 2AAAA 3AOFA 5LA2A 3WIJA 3D4ZA 4B3LA 2OWWA 2VT0A 1BHGA 2OSWA 3MI6A 4PRWA 4BQ4A 4UNIA 2YL8A 2WMFA 1D2KA 2XN2A 1EOMA 4WLCA 3GXPA 4OIFA 5A94A 3WNLA 2J7FA 3ARUA 4NXKA 3D50A 1W1YA 3IJ7A 2W5FA 3FHQA 2D22A 2J8FA 3WDJA 3AROA 4FNQA 2F1BA 1Q6EA 2E4TA 3MMDA 2ESCA 3VD7A 3L4XA 3BAWA 5CQ1A 2XVLA 4CD5A 5CJ5A 1Y7VA 2FHFA 2X1IA 2XM1A 3WNPA 3ZR5A 3VX0A 3BSGA 3K8KA 2W61A 4Z2HA 1FP9A 4D71A 3PTQA 3OIHA 1BFNA 1E4LA 2GDUA 1JZ2A 3N12A 3VOCA 5EB8A 5HPCA 1OWQA 4PCTA 2F1AA 4PN2A 2V5CA 3AS2A 4XX6A 4AEEA 1NM9A 2Y8KA 4J7RA 1W3KA 4PMVA 1KGXA 4OKDA 3VIKA 3BLKA 1MW0A 1E3XA 2XWDA 3OGRA 1Q6FA 1LQ0A 1JL8A 1PZ3A 3UEQA 2WMKA 5CSYA 4GINA 1NQ6A 5GQBA 3THCA 5IDIA 1MWOA 1DHKA 4JL1A 3W29A 4C7DA 3OLDA 3OB8A 1O7AA 2PF0A 1C92A 3AZRA 1QNRA 1TCMA 3N17A 1WCGA 2GJPA 3BAKA 3IK2A 5ABFA 1R87A 3MUZ1 2XFFA 5A6MA 3AS3A 3WUGA 2DSWA 1V3MA 1B3YA 2GVYA 1PZ2A 3A3HA 2WZIA 3W26A 3CUJA 3MUY1 2PBOA 4AW7A 3ZJ6A 4TX8A 4JL2A 1CZ1A 1BYAA 3EMQA 1GQLA 3CTTA 1BYBA 2E8ZA 3KEHA 2F7QA 1QHZA 1BYCA 2ZXBA 1V6XA 1OSEA 4CN4A 1E1EA 1I75A 1E55A 4Z2KA 3BAXA 2JF6A 5IHRA 5E6ZA 2Y2WA 5JBEA 4DWSC 1XCWA 2OWXA 4LYRA 5A8NA 3A21A 3SCOA 2YBUA 2AMGA 3ZO9A 2WB5A 4R27A 3T0DA 1UD2A 1R75A 4GQQA 2WYSA 2ZXDA 1ZJBA 1QWUA 1M01A 4HMEA 1WZMA 1C8XA 2ZX5A 4YHEA 1H0IA 2UY4A 3VD3A 2JE8A 1GHSA 1MVYA 1AQ0A 1U33A 1VIWA 3VU2A 4XZBA 3I3EA 4P7RA 3UERA 4Y7EA 4FNTA 2J25A 5M17A 3THDA 2E3ZA 1QI3A 1ZB5A 1ISWA 5FKYA 2ZUSA 1AVAA 4M29A 1HKMA 3S5YA 3WQWA 1JDDA 1LG2A 1VEMA 3WQ5A 1JZ6A 1JZ8A 4JHZA 2CEQA 3VSTA 4CD6A 1LL4A 3A4XA 2D3NA 3LPOA 2WMHA 5IXEA 1OGSA 4QP0A 4JFTA 2PI6A 2G3IA 2A3HA 4W5UA 2ZX6A 5HOSA 3KWXA 1XSIA 4HTYA 2F8QA 1CENA 1HJQA 3UG5A 2JEPA 1B90A 5D9MA 1E6PA 3EMCA 1FH7A 2XIBA 2V3GA 2ZWYA 3O2LA 5I77A 4EANA 4AZCB 3IGUA 5CLTA 1ZU8A 4NX0A 1J9YA 1EHAA 3F5KA 4UFKA 5A8QA 2G3NA 1YHTA 2WBGA 3B9EA 4L4PA 3VGGA 4JZ5A 2J75A 1BYDA 3W4RA 3WD2A 3ARWA 4AZ7A 1J0IA 4W89A 2ZX8A 1W9UA 3VSUA 1E4MM 1XYZA 4OOUA 5C70A 3TTOA 1HL9A 2CBUA 1K9TA 4NXSA 2Y8VA 1QBBA 2F7OA 1B3VA 4U2ZA 1RPKA 4D6JA 1KGWA 1JXKA 5I6SA 2FH6A 4V2XA 3K8MA 3NDZA 3BAYA 3WUFA 1JG9A 2BVDA 2NW0A 5GNYA 4AIOA 2CHOA 2F18A 3W53A 4AY1A 1W1VA 3D52A 1KCKA 1HL8A 4AD0A 3WY4A 4K68A 2DT1A 3GH4A 1J0HA 2X0HA 3VO0A 1QNPA 1VBUA 3UCQA 2X2YA 1WPCA 1OCQA 3BCDA 5I23A 4MNLA 3GNOA 3CGTA 1B1YA 3VTRA 3DDFA 3ZMRA 4U2YA 1HJUA 4WKAA 1XH0A 4HPGA 2DT3A 4UQ9A 2VVSA 5CSUA 1QI4A 1E72M 4AIEA 1JNDA 4WSJA 3T2OA 3WD4A 3WMSA 3VSVA 3SCSA 4H41A 1W2PA 2IXUA 3LXCA 4ZXLA 1HJVA 2OW6A 1WDRA 4H8VA 3W82A 1QW8A 3CZNA 2FH8A 1CBGA 2YA2A 3CH9A 3MUAA 4M82A 3BAIA 3ARXA 3J7HA 4UFIA 1CIUA 3PZ9A 2EAEA 4H2CA 2XHYA 2V3DA 2YLLA 2BVYA 2O9TA 3N04A 1CLVA 5A6KA 1C90A 4LYPA 2Y24A 3W28A 3ARQA 4W85A 3HG5A 1XD0A 1NWTA 4W7WA 3AS1A 1GVYA 4ACZA 5I5RA 4PMYA 3H53A 2WKGA 3EJSA 4RE4A 4AXNA 1E6NA 1GONA 1WE5A 3GXIA 4JFUA 3AFBA 3SURA 4AZCA 1HN1A 2CESA 4XUYA 3AISA 2C0HA 3BMVA 4XZWA 3FHAA 2WWCA 4Z2LA 2G8ZA 1E9LA 3VPLA 1TG7A 3GXDA 1KXVA 1EA9C 3VGEA 4U31A 3WL1A 1WZKA 3ZSTA 2ZX7A 1HXKA 4U3CA 1SFSA 1GCYA 1EDTA 2E40A 3ECQA 4UZSA 2XGIA 3LPGA 2W91A 2F7RA 1OD0A 3WUEA 1TQWA 5A2AA 4D6EA 5ABHA 2A3BA 1H3GA 3GH7A 4J3WA 1E71M 2E0PA 1JNEA 3AXIA 1MXDA 3MANA 4W86A 4L4OA 1UR0A 3MMUA 1CGWA 2O92A 1JDAA 1G5AA 4F79A 1WZAA 4WK9A 3VIHA 1E0WA 2PWFA 3BUQA 2BHUA 3WMBA 5EBAA 3RDKA 3OA5A 1C8YA 5CGMA 1GOIA 3K1DA 3NSMA 3AYRA 3MV11 2Z1SA 3PN8A 1D3CA 3ZT6A 2IXVA 3SCNA 3L4WA 2X0YA 4ZXOA 3CBWA 1NWSA 1VRXA 3AS0A 5A3HA 2E9LA 4W93A 2C8NA 2JFEX 4M81A 1QNSA 1ZS2A 3RM8A 2BY3A 1AQMA 1B30A 4PEEA 4UCFA 1J10A 5TD4A 4W7VA 3W6MA 2J74A 4BS0A 3GXNA 5A6LA 2WC3A 4OUEA 4F66A 5IFTA 3WKZA 1LL7A 1JFHA 4JKMA 4GI6A 2PWGA 1CEOA 3POCA 4UTFA 5JBFA 3GDBA 2J7EA 4GI8A 4IPNB 3CC1A 4N42A 4BZYA 5CPSA 1UH4A 1GJWA 1H1NA 3PZIA 4URIA 1JAKA 3PZGA 1UH3A 2OYLA 2WK2A 4LYQA 1H0GA 1JZ7A 4ATDA 2ZE0A 4EE9A 1U2YA 1UOKA 3L4UA 1QX1A 4GKLA 1DWJM 1US3A 1UD6A 4JCMA 4UQDA 4D6FA 1F4HA 2YIHA 1UA7A 3LMYA 1UR2A 2DEPA 1MQQA 3I3BA 3O6AA 3DYPA 2XN0A 4JFVA 1TMQA 5ABGA 3M7SA 6CGTA 3PZTA 4BQ3A 3AIBA 2BXYA 2YDQA 2X2IA 3ZJKA 3K4DA 2C7FA 3KLLA 5DFAA 2IGTA 2J7DA 1BG9A 1JDCA 3M46A 3WQ6A 2UY3A 2WBKA 4JKLA 1XH2A 2XJ7A 1VFUA 2DT0A 4HZ7A 3T0BA 5A6BA 1US2A 5CZKA 4FLRA 4TX6A 3N13A 1LF1A 3WSUA 1R85A 2VOTA 4P7QA 4YPJA 1RP8A 2NT1A 1PX8A 3VGFA 2WVVA 3HG3A 4HU0A 4LGXA 1C7SA 2YOCA 2ZX9A 2V3EA 1KB3A 3CHEA 4W5ZA 3VDBA 2EQDA 2F61A 3ZQ9A 1R7OA 3CO4A 4KGJA 4DO4A 3WBEA 3GNPA 3CMJA 1OIMA 1X1NA 1JAEA 5JUVA 3L2MA 2BY1A 3DX2A 3EJPA 4HP5A 2G41A 1NP2A 1C91A 4AMXA 1GUVA 5ECUA 3ARVA 4TOQA 1QBAA 2J62A 3APGA 1G94A 3AICA 2J7BA 2CETA 1GW1A 5M03A 4DUWA 1IZKA 2GDVA 1UWRA 4BCEA 3WY1A 3MUIA 4FNUA 1E40A 3VMOA 5JBDA 2D0HA 5ABEA 5FD0A 3SUSA 4PMXA 3ZT7A 2NSXA 5A6JA 1SR0A 3NSXA 1HIZA 2GJRA 3F4VA 3RMEA 1N82A 3FXYA 3VMNA 4AZHA 1QI2A 3G6MA 1G1YA 2D0FA 5HBFA 1JXJA 1Z32X 1FH9A 2EO7A 2WVTA 3FAWA 1IZJA 1O7DC 2GSJA 4JIEA 2WVSA 2CYGA 5GNZA 1WDQA 2VTFA 4HA3A 4W7UA 1LWHA 5A1AA 2BHZA 3AIQA 1NWUA 4ZENA 4AYSA 4B9YA 2EPNA 4AD5A 1CGYA 4AZIA 3VIIA 3RJYA 4U3AA 4RE3A 3M6DA 4NZCA 3TV8A 4EAMA 3BVWA 3VINA 1VFMA 1W3HA 2TAAA 2ALWA 5GPRA 4D72A 2CPUA 2VQUA 5C8BB 3AIUA 2XSBA 2W63A 3DECA 1B2YA 4FNPA 2G3JA 3IJ8A 4Q22A 4FLOA 1UD4A 5D8ZA 4HA1A 3BCFA 3AIWA 3VDAA 2WCAA 1W9DM 4J3SA 4PMZA 3KL3A 1I1WA 2J8GA 5I3DA 3WY3A 1QVBA 4ZEPA 1TUXA 1XSKA 1KQYA 3LRKA 2WWDA 5HXMA 1E1FA 4EKJA 2EPOA 2WZEA 4PMUA 1L8NA 3N11A 5FOOA 4P8UA 1SMAA 3L4VA 7CGTA 4XB3A 2VO5A 3BUDA 4QCEA 1KXQA 3L4ZA 1R34A 1OIFA 4AZ5A 1V3LA 3N1AA 2WMJA 2WNWA 3W37A 3POHA 4S3KA 4FF5A 4YN5A 2YLAA 2WVVB 1GZJA 3VM7A 4UFHA 1F4AA 4H8UA 3WBAA 2CHNA 1J11A 3WFLA 3WH6A 3AXHA 3L2LA 3SCTA 5A8OA 3EJUA 3A24A 1FOBA 1CNVA 4H8HA 3N18A 4NSBA 2VX6A 2VNCA 2XM2A 5CPTA 4F8XA 1NWRA 1SYTA 2VR4A 4D6CA 1TQTA 5AYIA 1W1PA 1GJUA 3W81A 3VGDA 2OSYA 4W88A 3G6LA 3ZM8A 2FHBA 1UKTA 2O9PA 1XHGA 4WKHA 1ZBVA 1J0YA 4D6DA 2X2JA 3WN6A 1CGTA 2CIPA 4HMDA 2VRKA 4M24A 3UG3A 1J18A 4PYSA 5FCZA 2F2HA 4OBSA 3WF0A 1LG1A 4AD2A 1KR1A 1XRVA 5M5DA 3ZIZA 2X2HA 5D9NA 3RO8A 3BVXA 5FL1A 2DIJA 4QFUA 1VFOA 4MAZA 1VBRA 3WH9A 1GOOA 1CTNA 1TQSA 2JEQA 4X0VA 3CUFA 3VILA 3TONA 4NZFA 1BSIA 2YFOA 1BAGA 2V3FA 1M03A 3SIMA 5CG0A 3D5HA 1ISZA 2OYKA 4GIAA 3WDPP 1JYWA 3CZLA 4ATLA 1E56A 4HOWA 2DIEA 1GQIA 1UKSA 5D8WA 2WAGA 1K9DA 3A22A 4GQRA 4ML4A 3HG4A 5JIWA 1VJZA 1R46A 4YHGA 3U5YA 2XWEA 2HVMA 4LXFA 4TXEA 4TTGA 3E1F1 1ODZA 3ARZA 4ZFMA 3MS8A 3BVVA 3WEZA 3PZQA 3LPFA 3GNRA 3BVUA 3OLEA 3EDKA 4BA0A 3RILA 4TVDA 2FHCA 3T2QA 1C93A 3VNZA 1PBGA 1FH8A 4CU8A 3DC0A 3GXMA 1BGGA 1DWAM 7A3HA 3A47A 1FFRA 1TZ7A 2D23A 2ZUVA 1QW9A 1DWHM 2W4XA 2XN1A 3OZOA 2VCAA 4W87A 1GOQA 2EPMX 4W8LA 3A23A 1KXTA 3FAXA 2YDRA 4PSRA 5BRQA 4P7OA 2W92A 4J3XA 5KZ6A 4OOZA 4AISA 1CXHA 2FDMA 7TAAA 1MFUA 1VENA 1Q4NX 1UD5A 3PZVA 1EDQA 5F7UA 2VQTA 4AC1X 1KBBA 2A3AA 4PTMA 2FGLA 4M1RA 1JZ3A 1PX3A 3CLWA 1NOWA 1JI1A 3CUGA 9CGTA 3PZUA 3TA9A 1G9HA 2WHKA 1MXGA 2WC7A 2XTKA 2E9BA 2VMFA 3NYDA 2A3CA 3I3DA 3VDHA 2DSVA 1TE1A 1KBKA 4B9ZA 3VIOA 3HN3A 5BWFA 4ACZB 1B0IA 2GJXB 3VDCA 4MDPA 1HWWA 3AMGA 1XV8A 3RPMA 2V38A 4PMQA 4W8AA 3ALGA 3BGAA 4NRRA 4E2OA 2Y4SA 1JD9A 1WZLA 2ZUNA 4CD7A 1Q6DA 4QAWA 2D20A 3T08A 2WSKA 1LL6A 4UFLA 2VI0A 2PB1A 2WM0A 3AXXA 3PZMA 2WMIA 2VVNA 1GNXA 4TVCA 1GOKA 2CKSA 3W27A 3VD9A 3WL0A 3PHAA 1SZNA 1GHRA 1HT6A 4WJXA 2DH3A 4FLQA 3IANA 2JIEA 1MW3A 3WNNA 4DUVA 4BQ2A 3W38A 3CZKA 3SUUA 3GXFA 2EBNA 3HJEA 3DHUA 1H09A 4Z2IA 3VVGA 2ZIDA 4EK7A 3WH7A 2VRJA 3II1A 3H54A 2FE0A 4FLSA 2EPLX 2Q8XA 3OGSA 2VZSA 1JZ4A 5I2UA 4UFMA 3CUIA 1UUQA 1UKQA 5A6BD 4JHOA 3F5JA 2D24A 4NZJA 4H04A 2VR5A 3TP4A 5CLWA 1E73M 1IV8A 1WDPA 4MJ2A 1ISXA 3TTQA 1KTCA 5E6YA 1DWFM 5D9PA 3WENA 1PIFA 3WF4A 4DM2A 3BC9A 1UD3A 3OLGA 3CHFA 1C8QA 4MB4A 5DO8A 5GNXA 4TVUA 4CCCA 4U33A 3ARTA 2ZXAA 2XVPA 1UWIA 1BVZA 1KTBA 1L0PA 3VIGA 4HZ8A 3IAPA 4E8DA 2WCGA 1CGXA 5D4YA 3RM9A 1W1TA 5IHSA 3VKKA 4B3KA 2YL5A 5A6SA 4TUFA 4J3TA 1QHOA 3OGVA 4J3UA 2QPUA 2EXOA 3SEPA 3U7BA 1LWJA 4GO8A 1GOWA 2WHLA 4HZ6A 2YKKA 5HDRA 3RCNA 2QV4A 1V3KA 2YA0A 1NOFA 2WHJA 2FGZA 2W66A 3AI0A 2FYVA 4KWUA 2PC8A 3AMLA 3WF1A 1ODUA 1HJWA 3AHYA 4HU8A 1EO5A 1NP0A 2GK1B 1PJ9A 1UZ1A 5DT7A 3WQ8A 3VIMA 4DO5A 5CGTA 4D1IA 1CXFA 3WH5A 1D7FA 4PUEA 2CKRA 3MMWA 1YQ2A 4GPNA 1TQVA 4GZEA 2CITA 3WNKA 3NIYA 5BCAA 2W62A 4BF7A 1CDGA 4U5KA 2BY2A 5E1QA 1PIGA 2J7CA 1BPLB 1UG6A 3WNOA 1KR0A 4OZOA 1WDSA 3S5ZA 2OW7A 1QI5A 2PBGA 5IFPA 4PUDA 4RE2A 3DX1A 4D1JA 3UG4A 1AQHA 1S46A 4CKQA 2BHYA 3MSDA 3W0KA 1HTYA 2DSUA 3BXWA 1TFVA 5I79A 1E6RA 3VM5A 2O9OA 3K4AA 4P7NA 1E6XM 4AYGA 3WD1A 4PMDA 1UASA 2GUYA 3DYMA 3D51A 4GXPA 2X05A 4DWSA 3PTMA 2WW5A 1EGZA 4A3YA 1XSJA 1IT0A 3U7VA 5BXRA 1CECA 2UY5A 3GM8A 3ARSA 1EO7A 4J3VA 3QGVA 1T0OA 1J0ZA 1BVNP 8CGTA 4V28A 1BQCA 1E6SM 2DH2A 2XVKA 3DYOA 2XYLA 1EIBA 1EDGA 5ABFB 4CN6A 3CV5A 1B3XA 1MW1A 2QMKA 3MU7A 1ZL1A 1TVPA 1P6WA 1M7XA 5I0DA 1BF2A 5E0FA 1JF5A 2XSAA 4LX4A 1XCXA 3WF2A 3HU7A 3VIPA 4R5EA 1GQJA 3SCUA 3ZJ8A 3CHCA 1GQKA 3ALFA 3L4YA 1UR8A 2X8RA 4AD4A 4UQBA 5LYRA 4A4AA 3EMZA 1KWGA 3L4TA 2YL9A 5JIPA 3VUPA 2PWHA 1BTCA 1JF6A 4M56A 5A69A 3HMCA 3ZJ7A 1EHNA 4P7LA 2J4GA 3GXTA 1QI0A 2CERA 4D6HA 5HPOA 4B15A 1KXHA 2WC4A 3KE0A 3M07A 1A3HA 5E9AA 1BGAA 2BY0A 4F9DA 1MW2A 2J78A 2J7GA 5A2BA 1HKKA 4X9YA 1VF8A 1HJSA 4AZBA 1MFVA 4HA4A 4AMCA 3UESA 1TQUA 4N0RA 1W9XA 2D2OA 2WXDM 3S6TA 1DEDA 1VJSA 5E09A 1E6QM 1EOKA 3VGHA 4E4PA 4P8WA 2YDSA 3ZOAA 3SUVA 1HVQA 2EABA 1M04A 5A2CA 3BUPA 1PEZA 2DT2A 1W9PA 1I1XA 2D1ZA 4MB5A 1FHDA 2XVGA 3VD5A 1E15A 4NRSA 2X09A 1ZBWA 3FY1A 3FNDA 4JCLA 3GH5A 4MNMA 4AWEA 1U30A 1CWYA 2BNJA 5BXPA 1E3ZA 1W3LA 1UQYA 2VL4A 4WSKA 3OBAA 3WDQA 1EXPA 4UOQA 1UR4A 1ITXA 1HKIA 1JIBA 2VRQA 1R33A 3W6LA 1GORA 1V6YA 1OT1A 4AIUA 3ZSSA 3DX4A 1V3IA 4CD4A 3AQUA 4KRTA 5DT5A 4A3HA 1UR1A 1CGVA 1FHLA 1DTUA 1PX4A 2YL6A 4CVUA 4FNSA 1JD7A 4QLJA 3HZ3A 2J77A 2DPEA 2W67A 1OM0A 2ZWZA 2Y5EA 5I78A 1V3HA 2VZUA 3A5VA 1ZBKA 2UWFA 2YBTA 1J0KA 2CBVA 2XPKA 1C3FA 1RH9A 3NSNA 1AMYA 4F9JA 4CCEA 2B31A 4QLLA 5BRPA 1CXEA 4PMRA 1VAHA 2XFYA 3PZNA
chains in the Genus database with same CATH superfamily
1TV8A 5KVEE 2NR6C 1ZS8B 5ID1A 3RZCA 4WRHA 4MJ4A 5A2FA 6TAAA 2XZ7A 4FP1A 4EIZC 4EN3C 1HHHA 3VMPA 3D1MC 1D6EA 2HA1A 4ZUUB 4YPGA 4ZPTB 3LTSA 4MTVA 1E0XA 1KYOK 1LHZA 4MAYB 5I24A 3DC8A 3MKCA 3STZB 5AHFA 2OM5A 1OAUL 3W01A 3IWUA 3U9UB 3VI4F 1PFOA 3UVIA 5EFDA 3CHRA 3AG1B 5FYJL 4JNXA 1X5YA 5K9KB 2QCFA 4R7JA 4AY7A 4POYA 2ENJA 4HIHA 4YIQB 4PGBB 4XNBA 3UC2A 1XIMA 3EPNA 2IV9A 3RKPA 4YSPA 3BVNB 3KPRB 4WW2F 3CDGB 4FFTA 3UADA 5EDSA 2DJXA 4UMAA 1F1GA 2APTA 3ULUF 3KL0A 2ACRA 2RJMA 3ZDYF 2XVNA 5IBXA 3MRJB 3Q01A 3FT2B 4JW3A 4NQXA 4JO2L 3UTQB 2DUXA 5FF3A 2NY3C 2V81A 5DANA 3CK0H 3SFWA 4NQUA 2VDPL 1QHQA 2VYRE 4OGAC 3EH2A 1G4PA 4HCGA 3NSFA 1BECA 1DSYA 4MLJA 2R56L 4WWKB 1E4NA 4UTWA 2DQXA 1MEWA 4I5UA 1S6NA 1B3WA 3MLUH 5FM8A 1JBJA 4E2DA 1DUYB 1WBXA 4LSQL 4X5WB 3UXAA 4MPKA 3MREB 1WCQA 2HDJA 2CM6A 3PUEA 1I8UA 3VXSE 4LC8A 4G7RB 3PBGA 4XVDA 2BC4B 2YD3A 3O2VH 2EADA 4NKMB 4K7PL 4XP1H 3QZBA 2CPCA 5EBMA 5GZNC 2QW5A 1EJOL 1NOAA 2G4GA 3OG2A 4PTUA 2HXUA 1RJZA 3K6DA 5DSCA 5D7LD 4H8WL 4I2XB 3BPOC 2ALRA 3BYTA 2Q20A 4IOFD 2AOSA 1YEGL 1NC2B 5K9XA 1SJXA 3LZRA 2VN7A 2B4CC 2OCFD 2YAHA 1ADQH 3NCFB 4YFLF 4ATTA 5JQ6L 2QMJA 3DJSA 5JZ7C 1B3ZA 4DP8X 1HKLH 1FP8A 2YL5A 4WI4A 3THMH 4GBXB 3W9EA 1VD6A 3H6JA 5A8MA 3HRZC 3ZR6A 4UNTA 5DEZA 1DDTA 1SFTA 1ND0A 5D7JD 2EUVA 4OLWL 1NFBA 5D2LF 1JYNA 4XC1L 3VRIB 1IILE 2A3EA 5DHVA 3SD5A 5I6LA 2J5LC 4OJYA 3OXRA 2NY5L 5LNRA 3A64A 3LIZA 5JHLH 1OAJA 1BJ8A 3KD4A 5AZEH 4BFIB 4ZFGL 2YFNA 5EIIA 4FG0A 4L8SA 4PRBA 4X83A 2YPIA 3DVGB 2IALA 3VZXA 1ECEA 2EEBA 2H8XA 4UFJA 3QUZD 5C08D 5IWLA 4YJ5A 1FNFA 1FL5B 3EDEA 2MANA 3T3PF 5HHQB 1VLWA 4XBSA 5DD3L 1S5MA 3C56A 3ARYA 1QOQA 3ABOA 3L0NA 2QUUA 4UAOC 5I19H 4Z7UF 3CDZB 4RZ5A 4Q56A 3T3MF 3LGGA 4A1RA 4Z2GA 1UGKA 1XINA 5F1VA 1QFUL 1JZ5A 2P5WE 1SDYA 4YDLC 4OZIE 3QDAA 1CGUA 3AUVA 1MPAL 1P0SE 2GIMA 5DWUL 3ULSA 4CC4C 5C0CD 2YCLB 1VADA 4S3DA 4S0TD 2OZ3A 2VXVL 3W7OA 4A21A 1G01A 1AL8A 3NQDA 2BRQA 4K3ZA 4NQ1A 4P8VA 3PNWB 1NLDL 1S5IL 2FWOB 2MQCA 1Q8MA 4ZUWA 4KKRA 5KJ4A 2F9RA 3SCPA 2NLJA 5JQ9A 1A14L 1SUHA 2BHFA 3CMGA 1YEFL 4HC1H 3A4AA 4OCRH 1N0LA 1EFXA 3MROA 4YFDB 2QNEA 4ZL1A 1ZENA 6XIAA 2APVA 3O3AA 3Q13A 2NQ9A 2HSIA 5DEGB 4DXXA 2NYYC 2VURA 4RLDA 2EINB 5I1KL 4C57C 2PP7A 1HDMA 5HYEA 3BL3A 3QQ9D 3TMLA 3ZE1F 1JYVA 5ECGA 2MTPA 1IL1A 2FD6H 2GFBA 3LEPA 3VFMA 3S2CA 3WUBA 3ABGA 2BS71 4ABVA 2VLRA 4PRID 3U2SB 3WGVB 4KS0A 1WXYA 4P61A 4W9DC 3QJHA 4E8CA 3P11L 5CXPA 3PAZA 5EMMA 4DN4L 3W6YA 9XIAA 3UU0A 3MJMA 2VDRH 4HZAA 3I02A 2BLFA 1G7QA 4F7MA 5AAMA 3OPZL 4J40A 4EXQA 3VK5A 3PBVA 1XEUA 2WLZA 1LE5B 1NTDA 3IDYB 3OJDA 3CUXA 3PG8A 4L8SC 2V5BA 2YLKA 1ED3A 1WBHA 1VR6A 3TJEH 3IFPB 4KI5E 1RZIA 1YECL 2VCOA 4JZOA 3GIQA 3QPEA 5DMIH 4XZ9A 4Z2JA 2GL5A 5FHBL 1FN4A 4BHUI 3UIZA 2E09A 4JS7A 2C3XA 4HK0B 3H6AA 2V5DA 3BWZA 1U8MB 4P2OC 1R17A 1A02N 3NFPB 3DIFB 2IC2A 4MRCA 4W84A 3NURA 1YECH 3D0LA 5DXWA 2LQRA 2RALA 3HNVH 4GRLD 4KBPA 5F9WC 5B39G 2MMXA 3RA7L 2V2TA 2GSHA 1OM9A 3AJ7A 1DVYA 3FSAA 1IGWA 5I1JH 2I57A 5CPQA 2D0GA 3CSGA 3D85B 1IM9A 4K7PY 4K5OA 4KJPC 1EHKB 2DDQH 4O2EA 5I8CA 1LMKA 3KS6A 3ONCA 2ZSWA 1T0NA 3DFSA 1UQSA 3EJZD 4J2PA 1HZHH 1GKEA 4OJEH 3BZGA 2WJFA 4NI3A 3NZGA 4Z3IA 4FZ8H 4DPPA 4WTXA 4F7PA 3E9TA 3EDJA 1ICPA 3HOGA 2DSZA 2JSFA 3F04A 1YQVL 4TQIA 4G8TA 2DM7A 4LEQA 2Q09A 2O6DA 3QUHA 1AKJD 1S7VA 3QG6A 1VRDA 2QIWA 2INEA 2FX9H 3DN5A 3L9RA 3ESPA 4QRPB 3DUUB 3LQAL 4C6LA 3KDOA 1ECQA 2OZNA 2OMVB 1KLUA 3QHMA 3CU7A 4PEKA 1I3GL 2W38A 4OZFH 3IPWA 1UC5A 3F6IA 4XPFL 4JRYA 3BOVA 4KRLB 1M57B 1TTIA 2PGEA 2BBFA 2XFRA 1FG2A 1MAMH 1TJGH 1RFDH 4NBZB 1UYWL 4ASTA 3IDIA 3RB5A 2VXTL 4H0HB 2C9XA 4DW2L 4IDJL 2FLRT 2HJKB 3QR0A 2ENQA 1E70M 5AN7A 3VKBA 4GSUA 1KTDA 1CI3M 1HFUA 2RGLA 1TJGL 4WJG3 5CJBA 5ICYB 1XKYA 5BNKA 3T7VA 1H51A 4Z3GA 3NCMA 4PJFE 4XKYA 2NX5B 3FNKA 3WTSA 1YEYA 2AGJH 4KRPD 5E5MB 4MZYA 5E1HB 3CWGA 5IM7B 1B4RA 1FA2A 2K7PA 3BWUF 4PJ7B 1V0MA 2G97A 1K72A 1VP5A 1DQDL 4A22A 3PL6C 2ZYSA 3QUYB 3G1RA 4XAYA 3AQXA 3PWJA 2D7PA 4OZ4B 1G7QB 5T1DH 4C6IA 3CDZA 2BVTA 2ZNXA 2DMKA 4HIQA 1MLBB 1MCSA 4UQEA 5CEZD 2F54A 3KPSD 5A3ID 2DUAA 1R3IL 4FK9A 4XE0A 4CU7A 5SWQB 1IGMH 1TLKA 3GNNA 4MZIA 4X6FA 1FV1A 3RVWC 1DBMH 4QRRE 2PRMA 3LY0A 3NL6A 1ME7A 1K7FA 1P4LB 3W76A 1G6CA 3WNIA 4APXA 3LYRA 4HULB 2XA3A 2PYEB 3I6GA 2PYED 2O6FA 4ADIA 3M5XA 3FW6A 4RDYA 1OFPA 1WD8A 3ITTA 1H5BA 4BQ6A 1B2WL 4AEFA 1LNUA 2Y6SC 5HJBA 3WKNA 1FWTA 5E5RB 1AUSL 1XGPB 5I26A 4WKXA 1ESWA 1G9NH 4HX1A 3IVKB 3WS3B 2D4DA 1E7VA 1BYOA 4AQ8A 4MAVA 1QLRB 4R4FH 2XXGA 1B2WH 1J5HA 2X70B 3MW7A 3WFEH 1RV8A 4M1CC 4N0FA 1DBBL 1AK5A 4BFFA 2C3VB 5CCKH 4DPRA 4ZQTA 4U1MB 3MFFA 3S5LA 5LGKA 1FCCA 1FVEA 3QC5X 1H2JA 4ZS7L 1IHIA 4HJFA 4H9TA 1MDRA 5BO1H 4HKXA 4UNKA 4FABL 3O6LH 4KWOA 1EXUB 5CILH 2WMPB 1BQLL 2E86A 1PJWA 2K70A 2D7TL 2Q7YA 4KUZH 1TIUA 4PJ8C 7TIMA 3WY2A 4I5BB 1YEWA 4BH8A 4OECA 4Z17A 5I71B 2D73A 4PRPE 3BUIA 5D4QA 3URBA 2G3MA 4E9LA 4NNXA 4L2LA 2D7TH 4CQ9A 5I16A 3KLAB 3ABRA 4GQ9H 3CEUA 4GVFA 3RX2A 2JF7A 4Z1CA 3L0KA 5HUPA 4H01A 1RUQL 1A3RH 1S9XA 3V4UL 1U8CB 3C3UA 5LNWA 4P23D 1H49A 5G4MA 1DJWA 5JR1L 4CNTA 2YAPA 5HJ3A 3V0WL 1P4LA 3OKOA 5D7KD 1YDPA 4CGTA 5DR5L 3P82A 3PGCA 1VEPA 1N59B 2VZVA 2OLDA 2E27H 3VFOA 1FDYA 3C0QA 2D4FA 4WTWA 2XUCA 2NX9A 1PPIA 4G1KA 3HR5A 3UDWA 2JQXA 4IIQC 4LB8A 2GGGA 4PJGB 4ZCWA 2GY7B 4HIEA 4C6EA 1RPXA 5ENWB 2Y6TE 3WELA 5CKGA 2OJ1A 2J4WL 4Z23A 3OKYA 1SJMA 4YDJB 4PTVA 5EU6A 1X6LA 2ADIA 4ZW7A 1E0UA 5D1XD 3W2NA 2OX5B 3FB7B 1H5BC 3RR4A 3CSYA 3CZJA 4Y2DB 4M1DH 1TCDA 4NKCA 1MWAA 1LMIA 2ICWJ 3DDGA 4GRLB 3TNMA 1VZHA 2DQHH 2A2QT 2C34A 4BJLA 2YQBA 3D2UB 4WEBH 2VX7A 3KVMA 2VLJD 4IGMA 1IJ9A 1H3PL 1N8OE 4JX5A 3QWOA 5EMKA 3LEVL 3JTBA 2IANB 4UOJA 1JCXA 1L2QA 3SGUA 3TTYA 3GMRB 5DVKA 3CSYB 1FWCC 4QPEA 1DQKA 4OV5A 5G5DA 2XPGA 2CXGA 4LL4A 1OTTD 4HOZA 3LZFL 4F7EA 3FQTA 1SJVA 1DJQA 5DJAB 4FNLL 2ODIA 4X9SA 3QJQB 4DP7X 4JY5L 3KPRA 5CPLA 1E43A 4FNRA 2DQTL 2HBXA 1JZJA 3CUHA 2A83B 4PSPA 4WY0A 1DP0A 1S7VB 3QG6B 1NF0A 3ROOA 3ZDWA 5F6IC 1TPWA 2JB5L 1SMDA 4WI3A 2MCG1 1G4TA 1D5BA 3JV6B 5D1ZC 4MNJA 3UETA 4OU3A 2PTTA 3PIQA 4JY5H 4RFNB 2FIQA 3BTNA 4Y9OA 1ZDQA 1A47A 2G5RA 2BTMA 3P0WA 1Z5LB 1O7SA 1JMZA 2R1LA 1QUNB 5FIPA 3T0WA 4PRNB 3H0TA 4X6BA 4Y1AA 2HV5A 2BP5M 1ICTA 2AFNA 4HHHA 3VZYA 1M53A 1YTDA 3CQQA 3QFDA 2X1XR 3VNKA 2PCPA 3GIZH 3R18A 1TTJA 1EF3A 2H90A 2G0WA 2GJXA 3SCQA 4G71B 3FUHA 4ZZFA 2G2NA 3BW9B 4WWID 3SE4C 4E38A 2PLJA 3EB4A 3IPEA 4PP1C 2EIZA 3LAFA 3QY6A 4V1YA 5HMEA 2AK4B 2Z35A 3GAYA 3LCFA 3W39B 4G7EB 5GIRA 1ZBCA 2BX5A 2YD8A 4GAJH 4H7VA 1C08A 3S88L 5FLVA 2B81A 2Y25A 4TVPL 2E6PA 3D3AA 1OTSD 3NFNA 4JR9L 4PJ7A 3WOVA 3RWDA 2AXJA 4JN7A 4R53A 4G7VH 2OP4L 4TSAL 4OJAA 3GRWA 3TO4D 3OLIA 3MRBA 4WK2B 4GP5B 5K59F 2KZHA 3NCYS 4N0FB 4RESB 4Q74A 5KBKA 1LLWA 1DSWA 4OFVA 3V5KB 3JUGA 1PS9A 1IAKA 3G5YB 1OF6A 2IAMD 4TTDC 3ZTJG 3VXOB 5F1IA 3Q2LA 1R0MA 1DVFC 5MHSE 4KDWA 4RNRA 4OLEA 1QR1B 1ISVA 1OB0A 5FV1L 4MCZA 2AJZB 3HE6D 2YXGA 2GIYA 3LHYA 1CR9L 1JYXA 3S4TA 1RK6A 5KJRH 4Y4HA 4E41A 5L6YH 3PTKA 4WQ6A 1R5IA 1KIQA 4BIKA 2PR4H 5GJSH 1EAOA 1G4SA 1RHHA 4KV5E 3MX0A 1DR9A 1B54A 2HG0A 1IIGA 4R85A 2DQUH 2DV6A 1TPDA 2L4OA 1Q6GA 4I3RH 2ZFAA 2ABBA 1F0LA 3PHOB 4FJYA 4C6PA 3TS8A 3TJHC 2Q8BH 4BK9A 4K7YA 2TRHA 5MENE 3MO4A 1E6OL 1TLMA 4S3JA 3BT2L 3AZSA 4R83A 4UDUB 1XVSA 4G3YH 1ZK5A 4MYWB 1AY1H 5KANG 4G1NA 4I3RL 4BKLB 2I24N 2OXGA 4DZIA 1OP5H 4KK9D 4D6GA 4CVXA 3FOMB 1WAWA 3P77B 1KCUH 5JHBA 4JTDA 2XZ9A 5BROA 3OC5A 4EAEA 5AFAA 3EOLA 1JPGA 5GS1B 2OJZH 3EGSA 1IIHA 1TVNA 2XNAB 3M7OA 3IMSA 3HFYA 1L0QA 2BS9A 2OR9H 1H4PA 3D8MA 3QORD 4WW2C 4DF1A 1VEOA 2EYTA 3P11H 1EZ2A 3WMCA 2V2TB 2E25A 3D33A 3IAQA 1AZRA 2ITFA 4U6HB 4UTBH 2Q10A 2NNXA 3CWOX 1QUPA 4G7FA 3SCVA 4E8GA 1JPGB 2AXGB 1FFQA 2B1HL 3NESA 4MMZC 3LH2L 4FQIL 3FO9B 4WIQA 1MO0A 1QOXA 4L8BB 2R23B 3LRSB 3W9DA 2I7SA 3TZVB 4B60A 5LG6A 3LKOA 3SN1A 5MEPA 1ZUAX 4UANA 4MCYA 3N9KA 4MY1A 4YWIA 1I9EA 3IFPA 1I1RA 1M2OA 4RNIA 3ZKND 1CXLA 3K6NA 4HWNA 3BE1H 4XBGB 3GIVA 4LKCA 4PWEA 3UBXA 4LNCA 4WKFA 3EJTA 4NLHA 3CEPA 4M62H 1K8IA 4QF1B 2VXSL 1HYSD 3QHOA 3V0IA 4MZ1A 3RCMA 1JUKA 4JTHA 4XTRC 4PRRA 2BFGA 4XMKL 4NIKB 3NQGA 1G7PA 4N0YL 3US9A 2DBLL 3TPUB 1M7DA 4CN1A 5IJKC 3KDPB 2PP3A 3SCRA 3ARFA 3IRCA 3P4OB 4X5LA 1SSDA 3JS3A 3N4EA 2N7SA 2YO3A 2FO1A 4DWSB 5IROD 3IEAA 4G80B 1EVTC 3TYEA 2RUSA 3PNZA 1D5MB 3EDFA 1JNLH 2ZXEB 1E4IA 1HXYA 3OKEA 4RRPG 3K6SB 1K6AA 3QGKC 2RGMA 5B8CB 2V33A 1KXTB 3NCWA 4TUOB 4N6RA 1J5OH 4YTRA 5C8JB 3FS9A 2DYPB 1K4CA 5EKYA 4N9EA 1T89A 4GRLA 4NVTA 3EB3A 4OCXH 1TETH 1W72A 3S4SB 3WIAA 2BO0A 2VSMB 4MB1A 2B0SH 3GBLA 1JGVH 4UQ2B 5C0AE 2Q3RA 2PAJA 1TYEB 4MA7L 2EIMB 1G7HA 2J8UB 4FOMA 4EMZA 5CGYC 1DWGM 4YZFF 2AJ3A 2IADA 3VKAA 2NUPB 3ITVA 1OPGH 1V0NA 1H11A 1NCNA 3R8BB 1NA8A 3D0CA 5I17A 5DY3A 2BH0A 3KYKL 3ABSA 2RGSA 4D94A 1QJWA 2EJAA 5GS0D 4MDIA 3VA8A 4UM9B 3GB7B 3D4ZA 4BFRA 2X9XA 1K77A 3HO8A 4I5XA 4B3LA 3F3HA 2PCQA 3UTTA 2H6UA 2C5DC 2OSWA 3U2SA 3HCVB 4U1HA 3U0TA 5I8KL 3T0ED 1GG1A 2GC4C 3OG3A 4X8JB 1D2PA 3OZYA 2G5BB 4F4RA 4YDKL 1F90L 4MKSA 3M64A 3B34A 5DC0A 5CSZB 2ZKMX 3ARED 3FXIC 4M3KB 5D9SA 4FQCL 4WU7B 2I5YL 2UWEA 2XN2A 2JQAA 3CPLA 5IGXH 2PDGA 4H88H 5IB5A 5EO9B 3GXPA 5IBTH 2EH8H 1K8YA 1KOAA 4JFYB 3WNLA 2Z7UA 3KR3H 4U1SA 1S7RA 1IEHA 1FWRA 3CO8A 3Q5OA 4V1DA 4GS7B 3ABKB 4L3ED 3WTUA 1MNSA 2J7FA 2V9DA 4L1WA 4H8WC 2BVEA 2HLAA 2ZG3A 1BVKB 2W5FA 5G4EA 3FHQA 3OKDA 3HTWA 4XAWL 4F0RA 2J8FA 2F8XC 1ETA1 2HKHH 2KS0A 2QFPA 4JQVA 3WDJA 3E0LA 4FIRA 1YMHA 3RRQA 1YPFA 4EACA 3AJXA 3VFVA 3UZWA 3MP3A 3T1FB 2ESCA 1CDBA 3PUUA 4YH6A 1N67A 2LR4A 5DUML 3KBSA 4GIRA 3BAWA 5LSMA 3RU6A 5KTLA 3BZFA 4CD5A 4WKZA 4GYFA 4AVKA 3CHPA 3ID7A 2BVOA 4LOEA 2MNUA 4YL2A 1Y7VA 1AI1H 5FYJE 2X1IA 3UR7A 1I7ZA 3SGDI 3W71A 1R3SA 3WNPA 3N34A 3C2RA 3ZR5A 4LC6A 5D2VA 1IKFL 4ZS7H 2V5LA 3HQOA 4K7FA 3BSGA 5E7FA 1IF2A 4PJIB 1GKQA 2PTDA 3K8KA 1SJHA 4KO5A 4YO0A 2W61A 4D71A 1VPOH 5AKQA 2WLNA 1MZHA 1TQCB 2IMRA 3PTQA 5FFGA 1JZ2A 1BFNA 2GDUA 4BGLA 1BJ1H 3RIAF 4AEIL 4AVIA 2GWGA 5EB8A 5TE4L 3DPBA 3GQFA 4K7FB 1JK8A 2ZOOA 3C2OA 2RKXA 2V5CA 4PS7A 4OHQA 4DCQA 1EUAA 1DJSA 4ZFFA 4G9FA 4DESA 3BKYL 1NM9A 2QDVA 2Y8KA 2LGNA 3DBXB 2ZWSA 1TENA 1W3KA 4KCUA 3N85L 4O1BA 4QDWA 2V2XB 3QHZH 1A4JA 5D7LA 2P42B 3WLHA 4UNLA 3GEFA 1E3XA 1T04A 2AEQH 2VL5A 4QR7A 3SSGA 2XG4B 1QZ1A 4FQHB 1CE1L 3RIFF 3S3PA 4MPQA 3UEQA 2WYIA 5GQBA 3BP7B 4GINA 4YHOH 4NZDA 1JSYA 1X5XA 1MWOA 1DHKA 3AY4A 5T5FA 5DMJB 4JL1A 1YEDB 5E6UB 5CM1A 3BESR 1PY0A 2H0FA 2XN9B 3V6FB 4HT1H 4IHBA 3DKHA 3GZOA 1N4XH 2GHZA 5CG7A 1A8JH 4FDWA 2WKJA 4GP8B 2J57A 5GS0C 1QNRA 4NO2A 1VH7A 3AZRA 3DGRA 1NAML 2CKBA 4R9OA 3UZVA 4J8QA 3CFBA 1JGUH 4M1DL 4QROA 3DI3B 4ZR8A 5DQJA 4FI6A 5F89A 2IPJA 1N4XL 3CXFA 4FHAA 2PTVA 5H8UA 2NUWA 2CLKA 3MUZ1 4OZHF 4APQC 3GF8A 2XFFA 4O0KA 3C5JA 5LGZA 3LEVH 3BGMA 3PQYA 3BPWA 5F9DC 3QLDA 3W1QA 5FYLD 4ZQKA 1UMLA 4QCIA 5ICXA 2VR3A 4MJIE 5AW2B 5EEWA 1Q9WA 3GBMH 2IEPA 5BXFA 2WZIA 4FXSA 2NY6C 1KN4H 1KSRA 3E0IA 3WFBH 3WS6C 3MUY1 2PLKA 5TH2B 4AW7A 4TX8A 1JCTA 3DFPA 4ZVJA 4JO5A 2SEBB 1A5FH 1GIGL 1MIML 4E9VA 2WZ0A 1PZBA 1CZ1A 1Q8JA 1QSFB 3OBKA 3OQRA 5EUOB 2F53D 3B2VL 1TJHH 2PRHA 2HQAA 4TLSA 3DKJA 3D09A 4HS8L 4ZFOA 1ZCCA 3KEHA 5EO1B 4IGSA 4WFEE 1J8SA 2ZXBA 2FIKB 2C3WA 1V6XA 1G9MH 3IF1A 3VQMA 2FQEA 1FAIH 1XBVA 2PU1A 4AE1A 2YZRA 1DANU 2YXWA 1ASPA 1L5GA 2BW4A 2QELA 1I75A 5I1IH 2BVPA 3RZCD 1U1JA 4MDRA 1HWGB 4F2EA 1K4CB 4HJ1A 5DK0A 2ZPKH 3WK2A 3BAXA 3LS5L 5HJLA 4YCOA 4K37A 1CD0A 1ROCA 1HH9A 2N56A 5DS8A 2HTLD 3QDJB 4NQSB 3HC3H 1SY6L 1BWLA 4QRRA 1TJIL 2Y2WA 3DV6B 4NUJA 4ZAKB 3SPVA 4E41E 4YXGA 3E6FA 3GU9A 3QE5A 4WHBA 4MVBC 4OD2B 1BD2E 3UFYA 2AMGA 4MQTB 3D25A 3EH1A 4BYHA 5A6TC 1RK1A 5REQA 3V18A 1I9RL 5BZWA 4BSWA 2VN3A 4PRHB 3SE8L 4GAJL 4TV5A 3MCKB 1B3IA 3T4AA 3SGJA 5FSEC 3BZ4A 4FTVB 4HMEA 3UTOA 4UWQB 5EBWA 1MDLA 3BDBA 5IEHA 3WUWB 1C8XA 2ZX5A 4U1GC 4WUUD 3QJUB 3QW3A 4AMKH 2GJJA 2H6OA 2NV1A 3VFTB 1RBLA 4CQDA 3VU2A 1MCOH 5AOZA 4Z18A 2ZCLH 3TBTA 3MRMA 3L5MA 4Y7EA 1S8DA 5FGCB 3UTPE 1S7UA 3PP4L 3R0MA 2QCDB 1T6MA 2J25A 4XTIA 5M17A 1TYJA 1IM9B 4I9WD 4D9LL 4HV8B 2HT4D 4F7CB 5L6YL 2OSLB 4I5RA 1B0RB 4O0ZA 4AK1A 1O6TA 1O9WA 4MSWB 3B43A 2Q7NA 5F71A 2YKLL 1KCWA 2A0LC 2G3XA 4HXBH 1KPUA 5H37H 1LL4A 1RJRA 1UP3A 2VEIA 5M2FX 2HT4C 2Y62A 1AW2A 1JDFA 2NY2B 4JFTA 5KW9H 4N8PA 5ACMA 5EN3A 3A5FA 5C2GA 1HIML 4O11A 4F0MA 3LZ5A 3VFRA 2ZX6A 2Q2LA 5DRZB 2HE8A 3FO1B 3M4HA 2DMHA 2M8XA 3WI9A 3CJJA 5LIWX 1TPFA 4O8AA 1HI6B 3ZVIA 1IAII 4LEXH 2DZAA 3ROOB 3ZMEA 3EXRA 3C60C 4LUSA 3QO0A 4GVIA 4QHRA 3KP0A 2V3GA 2H1LM 4X99A 3P30L 3DUSB 1NEZA 3C9NA 3O2LA 1PDKB 3E6HB 5E99L 2BZNA 3KCOA 1FZKA 3W3OA 5B1KA 1ZU8A 4MXWH 1J9YA 5DJYA 4AZUA 2AKRB 4GISA 3NQVA 5DD6A 4NJKA 2XKNA 4HBCL 2G3NA 5A8QA 1H1YA 3MC5A 3E9AA 1XG3A 4L4PA 3VGGA 1U3HC 4JZ5A 2FB4L 3G5ZA 3O3AB 4J3BA 1MQ8A 3FQXA 1KLGA 2J75A 1M2VA 3BSZA 4FXGA 4G9DB 4PJ5D 3W4RA 3ARWA 4X4XA 3HB9A 4C90A 2Q6ZA 3JWOL 3IVUA 3L5LA 2FUQA 3Q44A 4BK8A 4J4PC 1XI3A 4JGDA 4PLJC 3O4OB 4OCMC 4OT1L 2X0HA 1BDYA 2Q6WB 1XYZA 4OOUA 1HL9A 4Z7VA 3MRFB 4MD4B 4JM4H 5KSAA 3GS0A 2DL9A 4FG6D 3H2QA 3QISA 4NXSA 3DXAE 2Y8VA 1NM4A 3TJXA 1VFAA 1XF5B 5F6HI 3QYSA 3KJ4B 3EG9B 5HI5C 1PLGH 4XMPL 1IQWH 1N6QL 3SY1A 2BK8A 3JVGC 4NZ5A 5J5RA 1UROA 1KJVA 1QG3A 1DEEA 1JXKA 2EC8A 3FT2A 1E5BA 4Z1PA 4D9RD 5I6SA 2FBJH 4A39A 4J2QA 1PF3A 1FQ9C 3R10A 2NY6D 3E2VA 4Y5YB 4DOHE 3REQB 4MJHA 3CDCA 2KC0A 3MB9A 4PRDB 3HI6H 5T3XD 4Z7QF 1GTFA 1GY2A 2F18A 3W53A 4W87A 2EICA 3AB0B 4XBPB 4OZGF 4AY1A 4G9FE 2F7FA 3BARA 5T3ZD 1N0XL 4ANXA 1HL8A 1G1KA 5BPPA 4CQ8A 4AD0A 1EEYB 1OSPL 1TVHB 2DT1A 2C1HA 4GUCA 5DRXA 3MCNA 4I77L 4YLCA 1JNJA 4JZNA 3VO0A 5EYWA 3MUJA 4XNZC 3EOBB 3UCQA 5IJCC 1J1OL 5MENB 1GEQA 2E7CA 1TQCC 4PW9A 3GNOA 4HUXB 2JKJA 4H9ZA 2C9VA 5CZVH 4NO5B 4R97B 3FQUB 3OL2A 4GKNA 4KRZA 1BVKA 2LTQC 3DDFA 4P4KB 2AMUA 1YJDH 1T3FB 2Z27A 3NJMA 3FU5A 1JPKA 3V6ZA 5EC1B 1ZLPA 5CSSA 2OL3H 4UUIA 1ZLSL 1HJUA 5H94B 2P3ZA 5U7SA 1SVBA 1G84A 3ZLQC 1ITUA 4M1BA 5I06A 1A5AA 4IRSD 2A77L 5MKGB 1SOSA 1TZHA 2WQSA 1BM3H 2VVSA 1F8IA 5CSUA 2QCGA 3SQSA 3CFTA 4TL4A 3O8XD 1JNDA 5AHMA 1A4KA 3LNEA 3NGBC 4LAJH 4PRHD 3KRZA 3NL2A 3GUFA 3BXNB 1KNWA 4OBTA 1P6FA 1OAKH 5DD6B 3N6JA 3QEGH 1OPOA 4LCIH 2A77H 4EIUA 3SCSA 3IMVA 4HJUA 5BZDA 1FWGC 4APXB 1R3WA 1S7TB 2L7QA 2CHZA 3TYFA 1II4E 1L9QA 3RYMA 1KBVA 1HL2A 4H8VA 1QW8A 4UINH 3DFNA 3SBWC 3HZVA 4JRLA 5B7MA 3W22A 4KQ3L 2CBMA 1CBGA 4PJ8D 1FDJA 1B9BA 4Y2DC 4L48A 5F4WA 4LCSA 4M82A 3BAIA 4XWGL 4C58B 3W7NA 1IR2A 4UINL 3HRZB 1YY9D 1FG9C 1QVOA 3PHQA 4L1SA 4IIZA 4L1BA 4BQ9A 5B4MC 1NEUA 4MMXC 4JTSA 1ACCA 4PU2A 3WHXA 4BZ1L 4NO0D 3UOAB 1NDTA 4U3HA 1UXSB 4DVBB 1EC8A 4LP4A 4DBEA 3LKOB 5J6GA 5LGXA 5DJCB 4HS6A 3KYAA 1JCKA 1C90A 3SJ3A 3W28A 1SVCP 4NJ9H 5CJQH 1OZUA 4LBAA 5B8CA 3ARQA 2E7MA 1LUCB 4KFNA 3U6RA 3C86A 4O58H 2ANUA 3OJGA 4NJHA 4C6FA 3FRPA 3AS1A 1ZV2A 1DLHB 5DVOA 5TE4H 1GVYA 3MBFA 1CD1A 1J5DA 1N55A 4BDVB 3U0WH 5EA9A 3AG3B 3ZE2F 4GP4B 3P77A 5FM4A 3M16A 1J2WA 3BP6B 3O3RA 2MOGA 1AGDA 3H53A 3ZE0F 1L7TH 4IEFB 4EDXA 5L8KB 1KY7A 3QPQD 3RNKA 1BW8A 5IKCB 1M6JA 1WXZA 2ISWA 4DERA 3KRBA 1PWLA 4MHHI 4AXNA 4YBLC 3QKZA 3AWEA 3Q8CA 4JFDD 5TE6H 4CJ0A 4AZCA 2D03H 4G6AD 4FXTA 1YXCA 2KUTA 4RAUB 1OC5A 4PWGA 3KYOB 3RBSA 4NJJA 2C0HA 4IBVA 2CRZA 3FHAA 3SE4A 1YVLA 5JW3L 1EUNA 5IHLB 2XQBL 3TZVA 1S39A 2WIIA 2E1DA 3OU8A 4FX7A 5KYWB 5AKSA 2X9YA 1LEIB 1PLCA 1WITA 2ZXGA 3P6LA 4NQVA 1E9LA 2ITDB 3CFIC 3K7UA 5E2VL 4X5RA 3HPAA 2EIJB 4ROPA 1HKLL 3GXDA 5BRBA 4FFZH 3B37A 4EIGB 1ELSA 2V5TA 4U31A 1PNCA 5BOOA 2OYPA 1ULVA 1JWMA 3OZ9H 2O4QA 1QT1A 3MHUA 3IGKA 2O55A 1C1EH 5KZDA 4JZOB 2EIBA 1EDTA 2E40A 2DT2A 1COBA 3QZNA 1RZ8B 3SGGA 4HU2A 5ALCH 1HGYA 3WYZA 1G7LA 1TB3A 4D6EA 1DLHA 4JR9H 3O3EB 1XGUB 5L2KB 1BQHA 4KPHH 4WFGE 4Z7OE 1XRSA 4Z7VE 1LBFA 3CPRA 4LAZA 5DK2B 5I3FA 1G9NC 2GGJA 4Q8UA 2QYGA 5EU7E 5C0IB 1JNEA 5C0BB 1WSST 5HVWA 3MANA 3FB6B 3MUHL 3I65A 4L4OA 4W86A 1EZVY 4E6MA 1XGYH 2NY1C 4UTTA 3EFFB 1MEIA 1TPB1 1KV7A 2O92A 3BLIA 1G5AA 5IF0B 4PTNA 1K5NA 2WLJA 3AZUA 2OS7A 1YNLL 3VIHA 1UM5H 4FQJH 4YXLH 3ITLA 1AMXA 5GGQH 3BUQA 5C3IA 2BHUA 4JHBA 2X89D 4NQED 2L7EA 4NQTA 3URQA 4KK6D 1UZ6E 3CL8A 1IBGL 4DTGH 1C8YA 5CGMA 3V4PB 4HZLB 4YS1A 3K1DA 5CPMA 1B5TA 1MUJB 25C8H 3TCTA 3KH4A 3MV11 3SDXF 5CKAA 5I1KH 1S7XA 1U8NB 1D3CA 2CALA 2DM2A 4XPBH 3QPXH 2WJZA 2X5PA 4FFYL 3MV7B 2BRRL 4EUPB 2AEOA 3CBWA 1NWSA 3AS0A 5F9AC 1VRXA 5DYOB 2QZRA 3D47A 5FEXA 3MNWB 2IQAA 3BQ5A 3TLLA 5A3HA 3W39A 2E9LA 5D5MB 4X6EA 1SYSA 4BKTC 1RJPA 4FFYH 4HD5A 1JWSB 5JXAL 1P0NA 1QNSA 1ZLWK 1ZS2A 5J06A 3OPZH 1RAKA 1IGIH 4IX0A 4WI6A 4LSVL 5CAKA 3BP5A 1B30A 5DJCA 4WUUE 4W7VA 5IB1B 1MWAB 2APBA 3TNMB 2X4UB 3LEYL 1TJ1A 3QV7A 4XPGL 2UVEA 1EK3A 1W0VB 3BISA 4U1GB 4F7KA 2J74A 3RGTA 4BS0A 3BQ6A 2NYYD 3QR1A 4QIUA 1HJCA 1K8CA 2FL5A 4Y7OC 1PVNA 4Q4EA 4FAAB 3OJDB 2B7QA 3LCIA 5C09E 2W81C 2WTPA 2OK0H 4GBXA 3W9EB 5T1MA 3R0UA 4IIFA 3F62A 1MXSA 3EOAA 1B88A 4RX0A 3R25A 4P2RA 1RJYA 2LLLA 3UTSA 4DQAA 5EOCL 3VXSD 1CEOA 4YE0A 3SBQA 3TKFA 4FXLA 5JBFA 1VCGA 3H85A 3MA7A 3TBYB 1R9ZA 4WFHD 4NRYA 1CL7I 2IWKA 1RJZB 1RIVL 4BZYA 4N42A 1FIEA 1GJWA 5IQLA 1H1NA 1IAIH 2D7QA 1PZ5B 4N68A 4TTDD 4N0YH 4QXVA 2V67A 5T5FH 3JRKA 4NKOB 2JKIS 4WI0B 2CO7A 5G1TA 2Q9OA 3US0A 3LMJL 3RGVB 1X5KA 3EIFA 4ZUVA 4L56A 3IACA 1JZ7A 5CCZA 4OJCA 3V6OA 2HTMA 5BZZA 4FKEA 2ZE0A 5I8EB 2V37A 4G8GB 1YN7B 4YAQB 1XQLA 3ZK0A 4AT6B 1TE6A 4GKLA 1US3A 1KYFA 4HNUA 4BINA 3O3UN 1ZVYA 4G8GE 4JCMA 4M6NH 1UUSA 5HGAB 4PTTA 4CW1B 1NBVH 3FCBA 4S1SH 3LMYA 2HN7A 2V5YA 5ETUA 3WKQA 1EJWC 2FWLB 4LDLB 4ODWA 1TZOA 1YUKB 2X6UA 3GMPA 1MQQA 5D1XE 4WI2A 4Z78A 3CFMA 2XN0A 4JFVA 4X7EC 5C8JA 2B0SL 3PAVA 2DI7A 4P49A 4PJGA 3M7SA 4EOWH 2FB4H 4JB9L 1Z66A 5HYJB 4AQZA 2BXYA 5ESQB 2AF2A 5I0VA 1CQKA 2VXQL 2X6AA 4YIQA 4C54A 3LYEA 1U8JB 2DM4A 2C7FA 1RAMA 3F58H 3GC2A 3MJGX 3QI9A 3PU7A 4AWJC 4B95C 2WXNA 4YDLB 2BZ7A 5C0RL 1YDOA 3WN5C 2UY3A 1S9XB 3AC0A 4PJDB 4M5TA 2F6AA 4PGEB 5C09B 1O9ZA 4XE5B 4YGVA 4YHMH 5M1TA 5LDUA 1VFUA 3T0BA 3F58L 4HZ7A 2OCCB 1C29A 1PD1A 1U8PB 3DRTA 2NTSP 3T4YA 4FLRA 4IL0A 3QORB 4LRNL 3KBHE 4CADB 4MMWA 1LF1A 4TX6A 2MHAB 1BZEA 3H7LA 4YLWA 5HGDA 5DEFA 5AW1B 4P7QA 1QPPA 3IFLH 3RL1A 2VDNL 3J07A 4BGDA 1FNHA 4UI2A 4DZBB 1RZKL 3HRPA 3VGFA 4F92B 4DKFL 1C7SA 4PCYA 5IHZB 5K33A 3M5YA 5GRJH 5SWZA 1P4UA 2XT1B 1TVBA 2HRPL 5T33H 3JWNE 2Z31C 4R90L 3WL9B 2ICWB 2ESVA 3PF3A 4ZUSA 4ZSOA 3GG0A 4W5ZA 2F74B 5EBUA 3UJEA 1G9NL 2XWJA 3JTSB 4DEPC 2V9TA 3HMJG 2EQDA 4QMEA 2A2IA 1U0QA 2HKHL 4KTGA 2YAFA 4JQIA 2JKXA 2YSTA 1R4XA 3I6TA 3MAWA 3RU8X 1J48A 2WPBA 2HRPH 3CB8A 1HKMA 2XNAA 3ZTEA 1R0AH 3GLEA 1DN2A 3WEAA 3CMJA 3N2JA 4LBSA 3YPIA 2YC1B 1JAEA 3BKMH 3UZJA 3HQ1A 4L5FL 1A5MC 3L2MA 1M7DB 1D8WA 1UWXH 3GMNA 1AD9B 3EJPA 3LG3A 4MNHB 4KPLA 1QLFA 1NP2A 1TUPA 1P7QD 4BK5A 4UILL 5CILL 2PEVA 1EJVC 3ARVA 4U6VH 3IJYB 2BVUA 1QBAA 5G55A 3BG5A 2J13A 3GE7A 3IIVA 2OL3L 2QVTA 4MVAA 3ARFD 2C14A 1TX0A 1YMYA 4QJ3B 1N5AB 2W80C 3NVTA 2IWEA 5HJGA 1X7FA 4DUWA 5KYNA 5M03A 4MWAB 5HI4C 2GDVA 3NCJL 3SW6A 4G9PA 4LEEA 4PJAA 2IF7A 5HY9A 4N2BA 4WUKL 1SGJA 5HDOA 4IOTA 2DFAA 2CRIA 1MREL 2AK4D 4IH3A 5F4XA 4ZG1A 3GY1A 3BPLC 4N5UA 1GYLA 5FD0A 2VGBA 4PMXA 5ABEA 2W27A 4HUCA 4LEFA 4XD3A 2AJUH 1SR0A 2OLSA 4S1QL 1HIZA 3VNMA 5BOEA 1T0MB 3BKYH 1C9SA 2N01B 1KRMA 5D1QB 3IMUA 5IK3B 5BV7L 2R91A 3QDMB 4KQ3H 4DEFA 4JQXC 2QZ5A 4N2DA 3HPJA 4P05A 1O6VA 3QDJA 3ZHDA 3OHXA 5TFSL 4ODBD 5HVHB 1HZYA 2P50A 3G6MA 5F8RC 1JPDX 4O13A 3EBIA 1CT8B 4JPKH 2AQTA 1EIXA 1AC6A 5HBFA 1JXJA 1AFVL 3RWDB 2DYSB 4M1CD 1TYGA 2ZKYA 1A5BA 2QCDA 3ZUNC 3QEHA 3RLUA 1CGSL 1MHCA 4XNMB 3RX4A 2H26B 4HC1L 3P3BA 3Q1EA 2WVTA 3FAWA 3GSRA 5D6CA 2XH4A 2TSBA 1C12B 1F02I 1O7DC 1AP2B 1TTCA 2CO6A 2R1PA 4RPQA 5E8PA 4ZX3A 2K4WA 4YHGA 2Y6SD 1VKXA 4TYUA 2H0PA 5GNZA 1A9EA 4L6HA 1FFNB 1WDQA 2P80A 4M00A 5AENA 1NIBA 2W07A 5JNYB 2GVEA 5AALA 4Y4HB 5A1AA 1EP1A 2BHZA 4HWZB 4AGMA 3ICJA 2ZZ1A 2R29A 2X4QB 4AYSA 4NWTH 5DJDB 4B9YA 3JT0A 2EUXA 1H7NA 2EE3A 1VESA 4K7VA 4FYSA 1AXSA 3RJYA 4RE3A 3BPNC 4Z7WE 1H15B 5JA9A 3M6DA 4AIZA 3MCLL 3E0WA 4NZCA 3TV8A 3B7RL 1HH9B 3BVWA 3DIFA 3UMTA 4HF5L 1TELA 3MFGB 2IVFC 3HPLB 2E9WA 1LE9A 1BZ9B 5GPRA 4NAFA 3SQLA 1QPRA 4OGXL 4BDVA 1GVSA 1R3TA 2VQUA 2V30A 4OLUH 2C6QA 4IK7A 2LTQB 3EH4B 4ODWB 3KEDA 2CJUH 2COQA 1YNQA 1F6FB 4EKXA 3UTZB 3KOZA 4FNPA 1PCKA 3WLWD 3L7FA 4HU4A 2UXVA 2FBRA 3QEQA 5T8GA 1KTKE 3V0HA 1AQDA 1OYCA 3VKCA 4Y16B 4H4IA 3NT0A 2DLFL 4JXCA 3PZ9A 2I25N 3T81A 3WLRA 2P47B 4TNWK 3CSFA 4WJ5B 2NNFA 3GSWA 4DJMA 3B0YA 2B39A 4GGHA 3QFDB 1TJXA 3AIWA 3MRCA 3B5TA 3G04B 4PWIA 5I8OL 4PJCE 2WCAA 3KL3A 4FL4C 1WA1X 2B2XH 5D7LB 1J6PA 1I1WA 3FLUA 1F9CA 3GGWA 4ZEPA 1AS7A 1MCJA 1XSKA 1KQYA 3LRKA 3GS6A 3T5WA 4LVDA 4FCHA 3IIPA 4EKJA 2BERA 1IX2A 1MG2C 2WZEA 4D0BA 5DS1A 4YJZL 5SX5K 5DT1L 4IW4C 4S0SD 5FOOA 3WKYA 3TU6A 4PULA 2A9ML 5KSUA 1O5PA 1D5RA 3L4VA 3N44F 4D7BA 5CZXD 7CGTA 4MJ5B 4N86A 3UPCA 1FWAC 2B7OA 1IIIA 4LLWB 2I9EA 4MY9A 1Q1JH 2AI0L 3GWJA 5I5IA 1OIFA 1S1RA 4MQXD 4MNHA 2R0KL 2EVIA 1V3LA 1F4WH 3HIJA 4GY0A 4JIHA 3I6KB 2POTA 1M42A 3N1AA 2WNWA 1AQKL 5EU9A 4RFEB 3FQWB 2X4OB 4GRLC 1XICA 4FF5A 4RCAA 5IP4A 1I7RA 4U1IA 2P5WD 1AD0A 4YXLL 2WVVB 2Y3NA 5FUCE 1SZEA 1JGDB 3BSMA 2PU0A 1TU2A 1GZJA 1E6OH 5DFVC 4TV3A 1HYRC 1WOBA 1P5BA 1AIFB 1NKOA 4ODHL 2BVWA 4HW6A 3QJFB 4NNAA 3T55A 3FH7A 3H9SE 5DY2A 4AJWA 5CP7B 3TNNB 1JNHB 4FYQA 4IRJB 4P5TD 3TBVB 5LGHL 5EN2A 5TPWH 3BPNB 2MWCA 2XPYA 3RVVC 4XKMA 1ADWA 4Y9AA 4MA1C 4U6XA 4MNQB 3BD3A 5L9DL 2VITA 4M6QA 3AXHA 1ZD6A 1JGMA 2PPAA 4GLRH 4LHJB 3SCTA 1LEKB 1BOYA 1M7UA 2JCCE 3IXAA 4PJ9C 5DRXB 5JXAH 2WNGA 4HX1B 3K71A 2BDNH 5EY5A 5IB2A 3U2JA 3LHWA 3QTGA 1MQKL 4FEMA 4S1RH 5I3DA 2MPVA 4FYTA 3U4BH 3TSBA 1SYTA 1QA9B 1HHKB 3NGBB 2A3LA 5AYIA 1GJUA 3EF4A 3SDCC 4GD0A 1N7ML 1BAFL 1QFOA 3HC4L 5IW1B 1VGAA 1FNGA 4QNPF 3CHQA 4FQ2L 3STZA 5KOVC 4NN5B 2YPVL 5D02A 1X3DA 4YPGB 4ZPTA 1Q38A 3HEIB 5GGSY 5ISZA 5IIEA 3IDMA 3HQPA 4WOQA 1J7VR 1A7QL 1T1ZA 2O9PA 1DV7A 3GSWB 1XSOA 1ZBVA 4WKHA 1G4MA 2P5WB 4N2EA 2X2JA 4WW2A 3MLRL 5D7IA 3WN6A 1UZHA 4P3WA 1KRBC 2CIPA 3BWAB 1CFTA 4K6AA 2DWTA 1RZ7L 4PD4K 3EKCA 2PZNA 1J18A 4ONGH 2HVKA 4PJFB 4J2XA 2F2HA 5DZVA 2HLAB 1G7HB 2J8UA 3LZLA 1YPZF 3F1QA 5CEZH 5E6IB 3RWIB 4EXAA 1QQDB 4Y4FD 4G2DA 4XKYB 1D7DA 5TF1H 3NACH 5ADPH 4FFWD 2Q6WA 2RQEA 4C6MA 1S7RB 3UMNA 1WUEA 1YX1A 4KESA 4L61A 5HYSA 5K3VA 3BVXA 1HAUA 3QUZC 1NFGA 2SODB 3PHSA 1MFAH 2RQ8A 1R6VA 3BP4B 4HLJA 2OMZA 3BRFA 4N87A 2ITDA 2PS2A 1K2DB 4UR7A 1V05A 1AE6L 1GHFH 1L3WA 1VFOA 2GK2A 4MZ3A 4NZTL 4I88A 4XCEB 5IB4B 3PQYD 2OSLA 4YBHA 1MRCH 5CSZA 5DD1L 4KIRA 4LV9A 3S2NA 5B7YA 1GOOA 5EZLB 4YVNA 3SBRA 4O0QA 5D7JC 5D2XA 1IM3B 4X7SH 2JEQA 3AAZB 5C0JA 1SEBA 2IXQB 2QFRA 4OCSH 2PDPA 1ZTXH 2ITCB 3FULA 3DG7A 2NTFB 5AAPA 2R6OA 3R6IA 4X0VA 1MUMA 1NCGA 4TNVF 3HBLA 3VRLF 1XXFC 5DX7A 1M03A 3VE9A 3W0WB 4Z3FA 3LKQB 1XFCA 4FQXD 1ISZA 2YX0A 3AACA 2APFA 3NEHA 2IH3B 3SB3A 1RVFH 3BZ4B 2NUPA 5LIKX 3WDPP 5DJXB 4N9CA 4GY4A 1FO0B 4ZMVA 1L6XA 4LANA 1JYWA 4Y8EA 3CZLA 4NRZB 4IGBA 4D0DA 4XNMA 1NJ9B 1M7JA 3GUGA 4IZGA 2IBBA 1NUNB 2WAGA 3LNHA 1KJ2A 1B4JH 2JKNA 4JO2H 1EZVX 2BIOA 4U1LB 1AXIB 4GG8A 2O5XH 3H9HB 4GIOA 1W5OA 3UJRA 2F8VA 3K6SA 1NGQL 1RZFH 1R46A 5HHOA 3QIBB 4Y2OA 1KN2H 3SO3B 1R6WA 4Q7BA 2P3YA 2HVMA 2VEMA 4YC2B 3NFPA 4UT9A 4HIBA 4LVHC 5FHAL 3ARZA 3FUJA 1ODZA 3PWAA 3B7TA 3WEZA 2NY3D 3L54A 3PZQA 3HBZA 3LPFA 5DJ8A 4WFED 3MJ6A 2ZADA 4QRQA 4PB0L 1I7TA 3TJLA 1QFWH 2NCEA 3EDKA 4IHOB 5D2NA 3WIIL 4BA0A 3S1WA 2LU5A 4BFNA 3B2MA 1LE5A 2DRUA 1AW1A 3T2QA 1P7TA 2Z1XA 4NQCB 4ZMLA 1ACZA 1C93A 5BMFH 1PBGA 4MBOA 1FH8A 4KX7A 3HFFA 3C75A 4DUOA 2ED9A 2HJLB 2UV3A 3M17B 4L3CB 1XFBA 3PP7A 2IBZX 3EYVA 4AM0Q 1BGGA 1F6LL 2A4AA 4NC1E 4IT1A 5CU5A 5BMFL 1BQHG 1VF5C 2R1WA 4EN3D 1DWHM 4MXVE 1ONEA 3IU4L 3ZZQA 3ULUH 4JY4B 1IL1B 2AV1B 4A3QA 1FI8C 5KSAD 1RIHH 5DQPA 3HZYB 5KMYA 2QQQA 4F0LA 1P9MA 1XTMA 4AVHA 2WOBA 2BNRB 4ZFGH 1VHCA 5AZEL 2G5UA 2VDOL 2X4SB 4RMQA 5T1KB 5FYKH 2GSEA 2ZG1A 3NZHH 3TYUA 4K1GA 5I30H 4NJIA 2RH0A 5E51A 5BRQA 3VH8A 4OF0A 2OTUA 1RIHL 4IWWA 4X61A 3JTTA 2V5SA 3TBWA 1AYOA 1OP4A 2W5PA 2W92A 5KZ6A 4HG4K 3PREA 4D0CA 4OZFA 2I14A 3TVMB 3WXWH 5IHZA 1HQRA 3E74A 4QGCA 3QF0A 4NZ4A 1YPZE 2WXHA 1HHGB 3OMZA 4AQ1C 2QSCL 1G0YR 1CLOH 4QOKB 5CUSH 1QFUH 1L6WA 2ZYFA 2AJUL 1EDQA 2JI2A 5F7UA 1D9KA 1PMYA 4X5XA 1KT2A 2FZ9A 2XIMA 2XI9A 4I9XA 3NXLA 4QTIH 1L9NA 5CBBA 3T3MB 5FOBA 2VQTA 4TRPH 1JUEA 3MCYA 1AMKA 4F37F 1BKSA 1DFBH 1DKWA 1AR1C 4RX4D 1KBBA 3DVGA 1S9VB 1OFEA 2VDPB 3A6CL 4JFOA 2VQ4A 1JZ3A 1ZSDA 4LOUD 5FO8A 4ENEC 2CIIA 4YSOA 1UPMB 2CC0A 3GYEA 2E7BA 2FO8A 3FSZA 3A4JA 2XU9A 3ITXA 1INDH 1AFVH 3VH8G 4XVSL 3MWAA 3QIBC 2QJGA 1X97A 2HPTA 4HUWA 5G4NA 1DN0A 1G9HA 1MXGA 2WHKA 2XTKA 2VR6A 5CIPB 2JMRA 2DQEL 4PJXF 4WWKD 3EKZA 1WZ1L 4JKPH 4PGLA 3NM3A 2VMFA 3MCOA 3ZMNA 4L6OA 2PTUA 4O4YH 1I4NA 2OZ0A 2N4IA 3I3DA 5ESQA 4BHUA 4BUHA 2FVMA 1WQ5A 3F4DA 3V75A 3VDHA 1SXCA 3FO0H 1WDAA 1XWYA 2ZE3A 3VI3A 1JXGA 2QUVA 4F40A 1JTTA 3TBVA 4B5ZA 5EWIL 3WN5B 3NJKA 1I1YB 3TLRA 4CVZA 1JHKH 2EDRA 3W7HA 3MWCA 4JEQA 4HJIA 3SB0A 1XV8A 1AGFA 5E6RB 5KAQF 4I90A 3MJYA 4UTBL 4PMQA 1IGCH 1PYMA 1E5UI 2UYLB 3HG0A 2EIZB 5F21B 4R2GB 5F0PB 4HCRA 2VWTA 4NRRA 5KYUA 4E2OA 4J6RH 5FHBH 2Y4SA 3V8CA 2HNEA 4HUVA 3HM7A 3I4KA 5DRWB 4PRBB 4BEIA 4BUGA 4EF3A 4CD7A 3T08A 3TA3D 1FCQA 3PWNA 5TTRA 4HGXA 4C1NB 4R0LB 4IK6A 1FIGL 3MCG1 5EF3A 4UFLA 2PTZA 3BE1L 3P4NA 5DWPA 1AGEB 1PG7L 3B9KA 5DJ6B 2RHGA 3L7EB 1V7NL 1YY8A 4LMQI 1XJBA 2CHDA 2DDQL 2EO9A 3HAEB 1OAZH 1GOKA 1VBHA 4ELME 4CJ1A 2B7NA 3GHPA 4E5XG 3VD9A 3TZFA 2Y1VA 3P73A 3DENA 4EN3B 3PHAA 4ODVH 4TPRL 4HPOL 3GKWL 2PXYA 4FFWC 5K39A 3QPYA 4K39A 4RFOH 4LDOB 5BJTA 1N59A 4XN5A 1U91A 3RU8L 3VFOB 1BKHA 2DORA 1HHJA 2ZP8A 1MW3A 2YUVA 3QEUA 4JTGA 1FNSH 2HLFD 1CICA 2R7EB 3WNNA 4ZMQA 3KXFE 1E4HA 1ZGLA 2F5BL 3CZKA 1ZANH 4NPKA 1E5AA 3FSOA 4P2RE 4WTZG 1Q6LA 3RB7A 4WWOA 5U4NA 1PZDA 3U0HA 3S98A 2ZIDA 3BKCL 4EK7A 1J05B 2C1PB 3KPTA 3SY6A 4EUPG 1LCOA 4WJ5A 3II1A 3UX9B 1IE5A 1ZHBB 2AL2A 1Q7ZA 4G8GD 2C9PA 1UB5A 2PW1B 4L1HA 2NY3B 2VZSA 2MCPH 5MERB 2QAPA 5I2UA 1Q2SA 4KU1A 3NFSL 3V52H 3E0VA 2N3JA 2A1WH 2RAGA 1RA5A 4H8NA 1KEMH 3TH4T 4U7KA 4H3DA 3AUJA 2HVBA 4NNYA 3SPIA 3IRSA 2D24A 5GSRB 3H42L 4H04A 3ATBA 5CD5D 2OU4A 4JIQA 4I87A 3IMRA 5AVVB 2LU4A 4XPGH 2XETA 3TBTB 3TN0C 4AUJA 5IBLC 1XH3B 3NBNA 1GGUA 2QQLL 1WDPA 1UZ6F 4N9OB 4M9PA 5D9PA 1TZAA 3ZE0B 4WU7A 4PI0A 4EX4A 5FO2A 1XDTT 2ERJB 3RTQD 3RVVD 3RNQB 1OTUC 2VHLA 3BN3B 1UD3A 2F8IA 4KQ0A 2QKIC 4YS4A 1F6YA 4MM1A 3C2EA 4NN6C 1MEXH 1K02A 3Q2WA 1XF3B 4RWYL 3CVDA 4TVUA 1O12A 4AHQA 1JPIA 3MLTB 4ELMA 1S2AA 1Z42A 3L1OL 1IKNC 3ARTA 4H5SA 4ZD3H 3Q3GB 1ICQA 3S9IA 2XX0A 5I17B 3QLLA 3M6YA 1GS6X 4LP8A 4US6A 2D7MA 3OW1A 2BJMH 1AP2A 3DOIA 2OMXB 1KFKA 1R3HB 2H0EA 5JA8B 4N0UE 1XHHA 3VXNB 2AQ1A 4DN3H 3TN6A 3ASNB 1QTPA 1Z9LA 2XUWA 5JLZA 5E93A 1F2XK 3VIGA 1X1ZA 3EG9A 4ZJ9A 3SAZA 2PUZA 1N12A 4WI7A 5DJZA 4FERA 4MJID 5IB1A 4XPTL 2NY6B 2CA3A 1UWGL 3MFFB 1A1MA 3S5LB 2WCGA 3NABH 3MPGA 2E6DA 3ETSA 4E8DA 1T2JA