1JDAA

Maltotetraose-forming exo-amylase
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 136
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jdaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jdaA01
4NXSA 5HXMA 1QOXA 2FH8A 1GOIA 4S3KA 1VFFA 1TUXA 4HA4A 2EPMX 4W5ZA 1SMDA 5FCZA 4JFWA 3ZT7A 2J7DA 3A4WA 4J28A 3MSDA 2Y4SA 3DDGA 1V6VA 4ZENA 1JGIA 4FLSA 4WSJA 4J3WA 2X2IA 5AYIA 1ISXA 1H11A 5A6KA 4HU0A 5FOOA 3CBWA 3EMCA 2QPUA 4W88A 3BGAA 1IZKA 3F4VA 3WMCA 1XCWA 1UR2A 4NZFA 2VJXA 3EJPA 1DTUA 3VNYA 1VFUA 1FP8A 3VGBA 5CSYA 3VDBA 5LA2A 5KZ6A 5JIPA 2IUZA 4ZE5A 1H3GA 4ZXLA 3WD0A 4DWSC 3W26A 3MSGA 3GZAA 2FDMA 1JD9A 1W3JA 1NH6A 4YN5A 4FK9A 2A3CA 3NDZA 4LQ1A 2WMGA 1XH0A 1TZ7A 4LGXA 2YL8A 1UA7A 3QHOA 3CZGA 3TOPA 4GI8A 4QLKA 2CYGA 3QOKA 3NYDA 3WIJA 2D0FA 1KBBA 5A6BD 2BV9A 4CD8A 2O92A 2XHYA 1HT6A 1XSKA 1KWKA 4L4PA 4AMXA 2WVTA 1QNRA 5IHSA 5EB8A 5I2UA 2CKRA 3WFLA 3BCDA 2O9TA 1V3IA 2X2JA 1US3A 4PCSA 4RE3A 4MJ4A 4MJ2A 4AIEA 1E70M 1J0IA 1JDCA 5E70A 1E43A 1JFHA 5BROA 4P7NA 4S3JA 2A3EA 2VVNA 1FOBA 2IGTA 1G9HA 1PX4A 2JIWA 1UKQA 5GNYA 2WBGA 1D7FA 1E71M 2J7BA 3OGRA 2YL5A 4UTFA 3BVTA 2D20A 2E9LA 4EAMA 3WY3A 5EMYA 4PN2A 4AMCA 2YBUA 1W9VA 2EPKX 1ZL1A 4YPJA 3VUPA 2WWDA 4MAZA 4MDOA 3WH5A 4AW7A 5LA1A 2J7HA 4FNRA 3WENA 3MV01 1R87A 4ML4A 2YA2A 4TVUA 3BUIA 2PWEA 3T0AA 2QLYA 2OYLA 4BF7A 3VGHA 3GBDA 5FIPA 1UKOA 4P8XA 1ITXA 4W84A 3TP4A 3S2CA 4M24A 1QX1A 2YKKA 4UQCA 5FD0A 3WELA 1J0ZA 3EJSA 3PZOA 3MUY1 3G6LA 2V5CA 4U33A 4B3LA 4AZ5A 3E1F1 2XVPA 3EDEA 3A6OA 2VZVA 1FA2A 1NP0A 3ZJ7A 4Y7EA 2W63A 4FMVA 4UNIA 2DSUA 4J7RA 1ISWA 3WF2A 4CCCA 1CXKA 3BVVA 1B31A 3CHEA 3T2OA 3CGTA 3VDCA 1ESWA 1W9XA 4BZYA 1R75A 1E56A 1E6PA 3DX3A 5M03A 3LPPA 2A3HA 1OSEA 1KQYA 4UOZA 3WF0A 3PZGA 5A95A 3W82A 1FH9A 3OLGA 4CN6A 1OT1A 1E1FA 4D1IA 2ZWYA 1M04A 4UFMA 1EDQA 1UH2A 4JFTA 3AS3A 2OWWA 3AIUA 1HVXA 1CECA 2BY0A 1NP2A 1GJWA 2GJPA 1GHRA 3GNOA 1HIZA 1TG7A 2F1AA 4HMCA 2E8YA 2VQTA 1X6NA 4PMYA 5C71A 5I24A 5KEZA 1UR9A 2X09A 2XSAA 1CPUA 1ISZA 2YDSA 4AZCB 4J27A 4XZWA 2ZWZA 1RP8A 3CH9A 2GSJA 3F5LA 3WDJA 1XD1A 3PN8A 2ZX5A 3QHMA 4MAVA 1FH7A 2D24A 2FHBA 1W3KA 2V3DA 1TFVA 1W9PA 3SUSA 2VZUA 1B90A 4IUGA 2DSKA 4MNLA 5D9NA 3PTKA 2EAEA 3PTQA 3GTNA 1V6YA 4RE4A 3VSUA 2WAGA 4NZJA 2D22A 1CYGA 3WQWA 2VC9A 3DDFA 4Z2JA 3T0BA 3MMUA 1GCYA 3U5YA 4URIA 1PZ2A 2CERA 1NQ6A 1W1VA 2C8NA 3WY2A 3IGUA 4EKJA 1E4MM 2FE0A 2ZOXA 2E3ZA 1MQQA 5F7UA 2DT0A 1KR0A 2JF7A 1HJVA 3CMGA 2E0PA 1E0WA 3APGA 3LPGA 3BAJA 1MXDA 2WMFA 2G8ZA 3I3DA 4IISA 2J77A 2WW5A 3AS1A 5E9AA 3IK2A 1K6AA 4M81A 3WNPA 1R34A 1PIGA 1OIMA 3K8KA 1PX8A 2IXVA 1DWHM 4LYRA 1B3YA 1HL9A 7A3HA 3WD4A 4UOQA 2O9RA 3FXYA 1KXVA 5DF0A 3JUGA 4JCLA 4DO5A 2CEQA 3N9KA 1CXLA 2BHUA 5A1AA 2IXUA 1YHTA 3WBEA 2YL6A 4XV0A 2WC7A 1UASA 3L4TA 5CPTA 1MVYA 3SCPA 3EJRA 6A3HA 4UZSA 3GXFA 4OUEA 1UKSA 3MO4A 4MB5A 2FH6A 4HOXA 4EK7A 4B3KA 5HPCA 4PMNA 3THCA 1K9EA 1GQJA 3CHFA 2XSBA 5FKYA 3W37A 3CUJA 3W53A 4FNSA 1UWTA 2ZXQA 3AIWA 4JKMA 5A2AA 2WBKA 4BCEA 2XN1A 1HJQA 1OBAA 4H04A 1ZB5A 3CZEA 1EA9C 3M07A 1TA3B 3BC9A 2WVSA 4FLQA 1JD7A 5I23A 2WCSA 3BLKA 1KWGA 2WMIB 1OM0A 3W6LA 4AIOA 2JEPA 4P7LA 4V28A 1U33A 4FNTA 1W2PA 3I3EA 3VD4A 4P7RA 4B15A 5A8QA 2VCBA 4CUCA 2ALWA 4BQ5A 3MANA 3VGFA 1CGUA 1PPIA 3CHDA 1TQWA 1DWJM 2PC8A 2Z1KA 5I79A 3OBAA 1CNVA 1JZ2A 3TONA 3VMNA 2W66A 4Q7NA 1D2KA 3HN3A 2WB5A 1JDDA 1K9TA 5TD4A 1OD0A 2VRKA 3LX9A 4J3TA 2C0HA 1QWUA 1E4IA 4AZ6A 1JYVA 2WCGA 3WQ4A 3DC0A 5AY7A 3GM8A 1V3HA 3N11A 4LPCA 1UWSA 1B2YA 1HKMA 1QVBA 1JZ5A 2J7FA 2V3EA 4PYSA 3CC1A 3DX0A 4F9JA 1H41A 2WC4A 4AXNA 1KGUA 2YFNA 1CGYA 2CBUA 4Q22A 3SIMA 2YFOA 1TQSA 2D0HA 1J10A 2F7OA 1VEPA 1XRVA 2X2YA 1V08A 1MFVA 1V0LA 2WC3A 4HA3A 4OKDA 3L4WA 1UD2A 1PZ3A 2AOSA 3NCOA 2HVMA 3FHAA 3HG4A 3CUHA 4TTUA 4W5UA 2F61A 4J3UA 5I77A 3OB8A 2ESCA 4QLJA 3VSTA 1B3WA 4D72A 3ZR6A 1WP6A 4GO9A 5D8WA 3WUGA 1WCGA 3OZOA 4W86A 3KL0A 2ZX8A 4PTXA 1EHAA 4JZ5A 4OZOA 2EACA 3LRLA 3ZQ9A 2D1ZA 3SCQA 4D6IA 3IAPA 1MW3A 2CHNA 1HJUA 5CG0A 3WH9A 1GONA 1DHKA 3WQ8A 3VU2A 2Q8XA 2ZUMA 4HPHA 3CZSA 2XUCA 4GINA 4CD5A 3W0KA 2J7CA 2WHKA 1KQZA 3NSMA 5GPRA 1F4HA 2BY2A 2WM0A 2F8QA 1JFXA 1Z32X 1UWQA 4QAWA 1GORA 1HJXA 1X1NA 3RJYA 3OZPA 1RD6A 4FLRA 5ABHA 5HOSA 4DM1A 3K46A 1B3ZA 1B1YA 3WF1A 1ECEA 1ZBCA 2WCAA 1NWSA 1GPFA 3GBEA 1X6LA 4N0RA 1VRXA 3AMDA 1HL8A 2VVSA 4N42A 1UHVA 3BMWA 2UWFA 4MDPA 4Z2KA 1EOKA 1GOOA 1E6QM 3NSNA 2W92A 4E8DA 2F7PA 3H53A 1QI3A 5I78A 2XIBA 3ARPA 4PBGA 2CESA 3EJUA 1JF5A 4BA0A 1CGWA 2DIJA 3D4ZA 5JIWA 4W85A 4AIUA 4R5EA 3WH8A 1XGZA 2XGBA 5EBAA 5A8MA 3ZIZA 1BF2A 3LMYA 2OW6A 3VIPA 4DWSB 3GXIA 4W89A 1IT0A 2J74A 3HG3A 1GOMA 1J0JA 2PBGA 1QI0A 1B0IA 1LG1A 3PZIA 3WNNA 3WDPP 4AZCA 3BLPX 4ACZB 5GNZA 5A6JA 3UG3A 1R7AA 1TE1A 4M82A 5DFAA 1MW2A 9CGTA 3WUBA 3DYMA 3QGVA 4J3XA 2CPUA 1CGXA 2J78A 1KXTA 3AHYA 2WMJA 1J0KA 1VJZA 1XD0A 3ZJ6A 1OT2A 1DWAM 2YA1A 3UERA 2VTFA 3A5VA 2EQDA 3TTSA 4AC1X 2CNCA 3PTMA 2VZTA 1H0GA 3DYPA 4PMUA 1BYDA 1EXPA 1Q4NX 3VGEA 2XN0A 4AYSA 4X0VA 4PUDA 3M7SA 2VURA 3VDHA 3WD3A 1R7OA 1JXJA 3CZLA 5BXPA 2E9BA 2ZUNA 2F7QA 2J8GA 1J11A 1E0VA 2CXGA 2Y8VA 2WNWA 1UQYA 4UFLA 4F9DA 4CKQA 3ARZA 5CLTA 5I6SA 3N18A 1US2A 3ARTA 2G3NA 4AEEA 1UZ4A 4KGLA 3VD5A 4FNQA 4HZ8A 4D6CA 3W27A 3T09A 2EXOA 2BVTA 2VX5A 5CPSA 2UY2A 3KLLA 1TQTA 4QDMA 2WZEA 4KWUA 4TTGA 4P7OA 3ZT5A 2PI6A 5EFDA 3OGVA 4W8AA 4PUEA 1UR8A 3A23A 2CBVA 4C7FA 4GI6A 2XFFA 4PSPA 1QHOA 1V6WA 3EDDA 2O9OA 4HOWA 5JUVA 1UOKA 4U2YA 2DSVA 2X1IA 3SCNA 4P8WA 4U3AA 2GK1B 3ARYA 4F66A 4JHZA 4MTVA 1ZJAA 2J79A 3W81A 3BVWA 3ZSSA 5BWFA 1JI2A 1WZAA 5AYBA 2G3MA 4AWEA 3UR7A 1PIFA 5CXPA 4UFKA 4M80A 2GJRA 1HXJA 1QHZA 1TA3A 3IAQA 5LA0A 2F2HA 3W38A 2J8FA 3GXTA 4NX0A 5IDIA 2WMIA 2DH2A 4UQ9A 3OLEA 4GQQA 3SCVA 2FGZA 1EDGA 2OYMA 5C70A 3CO4A 1P6WA 1JG9A 1MFUA 3KZSA 5BXSA 1HP4A 1EHNA 1C91A 4WKAA 3AMLA 3GXNA 4TVCA 2F18A 1BYCA 2VX7A 1LJYA 3K4AA 4WLCA 3A22A 2JFEX 4UFHA 1UKTA 3POHA 2CCRA 1TMQA 1H4PA 1UD4A 3N17A 4CVWA 1ZBKA 2V38A 1J9YA 3WH6A 1NARA 3GNPA 1QBBA 3LRKA 1MYRA 1KGXA 1BYBA 3D3AA 1BVNP 3N12A 1XYFA 3K1DA 4OOZA 8CGTA 1NM9A 3WMSA 1CGTA 4CVUA 3H54A 3MUAA 1NOWA 2J62A 3POCA 1E72M 4JCMA 3BSHA 1WDQA 2ZUSA 5A8PA 2YLLA 2BNJA 2J7GA 4UCFA 2WANA 1NOUA 1E3ZA 3O6AA 4E4PA 4J3SA 2BXYA 1K9FA 4AD4A 2XFYA 3A24A 2O9PA 1QNPA 1GNXA 1C8QA 3NJ3A 3SUWA 1VF8A 4PMVA 1XYZA 3KLKA 4DM2A 3BUDA 5JBEA 1DWFM 2W5FA 1BFNA 2YL9A 2BY3A 3DHPA 2XPKA 1VEMA 3CUFA 1H49A 1SR0A 3N15A 2ZX9A 5D9OA 3WNOA 4M56A 1GOWA 3CUGA 4BQ2A 1EIBA 1OIFA 1KCLA 3VTRA 3BSGA 4AD5A 3AIBA 3ZR5A 1J01A 4AD0A 1KTCA 3K8MA 1ODZA 3NDYA 4U5IA 1GZJA 1FH8A 3VIIA 2EBNA 3VPLA 3W28A 4D6DA 1ZU8A 1I75A 3D51A 1CTNA 1JAEA 4ZE4A 2OYKA 3RCNA 4HP5A 1VEOA 2W61A 4QCEA 4GZEA 3SUTA 2WHLA 3BUBA 3D5HA 1E55A 1XHGA 3GDBA 4ZXOA 3AHTA 1FFRA 3BCFA 6TAAA 4OGZA 1CLXA 5IXEA 1JNEA 2OSYA 3LPFA 5BCAA 3RIKA 3IJ9A 2VUYA 4UQAA 1IZJA 5IFPA 3WQVA 1EGZA 3RM4A 3BUQA 5HDRA 2CETA 2WWCA 2DSWA 4U31A 1KXQA 1ZBVA 3OGSA 2D23A 3PZQA 1VENA 5CGMA 2NSXA 1EQPA 2DT3A 3II1A 3CV5A 3DX4A 3GYCA 2YA0A 4KRTA 4A3YA 4PCTA 3N13A 4Z2IA 3CZKA 4A4AA 1WNOA 3FAXA 1J0YA 7TAAA 1C93A 1GQIA 3G6MA 1B9ZA 3WUEA 1JYNA 5E0FA 2DSZA 3EYPA 4B16A 1ZS2A 3K8LA 1LL7A 4H41A 1ITCA 1DWGM 1W1PA 4X9YA 1R47A 3RMEA 3FY1A 3RO8A 1VBUA 2QMKA 4HZ7A 4JKLA 2X0YA 1C90A 1UWUA 4PMOA 3EJQA 4DWSA 1R46A 1UH4A 3D4YA 5HNNA 5JBFA 1QNSA 2WKGA 3SEPA 1Q6CA 4QCFA 4ACZA 4WIWA 5IFTA 3RM8A 1H0IA 2UY3A 4JHOA 1QI5A 1HKJA 1UZ1A 1ODUA 1QI4A 4TXEA 2XYLA 1E6XM 1W9DM 1KBKA 1AMYA 2QV4A 3U7BA 1WZMA 1WB0A 4PSRA 1E6ZA 1E9LA 1U2YA 1TR1A 2OSXA 3WDHA 4AZGA 2XN2A 1M03A 2BVDA 4PMDA 3IJ7A 4H8HA 1OCQA 1VB9A 1XH1A 3KWXA 1HXKA 1BPLB 2ZXDA 3A4AA 3EMZA 3L4XA 3LPOA 3AYSA 1HP5A 3WN6A 4NRRA 4E8CA 1KGWA 2XFRA 1TQUA 2QHAA 3SUUA 4JL1A 1GVIA 1PEZA 1EH9A 3WL1A 3SCRA 1DWIM 3O2LA 1UR0A 2QPSA 2A3BA 5CQ1A 2OW7A 4GZJA 4X0NA 3VGDA 1FFQA 1UD6A 2B31A 5A6LA 1UD5A 1WAWA 3VDAA 2WPGA 2WLYA 4PRWA 4P7QA 3TTYA 2X0HA 4K68A 3AYRA 5A8NA 1CLVA 3WQ5A 3BXWA 1LL6A 3AIEA 3MV11 4LYPA 3CZNA 1WDRA 5CGTA 4GZIA 4AYGA 2GDUA 3GXPA 4M8UA 1V0MA 4PTWA 3LXCA 4D6JA 1HF6A 1UUQA 2V5DA 3WKZA 3CMJA 3FNDA 4YHGA 5EFFA 3ARQA 1V6UA 2AMGA 2JIEA 4WKFA 1NOFA 3A3HA 2EO7A 2VR5A 2YIHA 2PBOA 4JFSA 1BSIA 1WDPA 3BUPA 3GXDA 2C7FA 3VIOA 2VL4A 3MKKA 2DIEA 1UWRA 3ARUA 3ARWA 1JXKA 3FHQA 3PZ9A 3O9NA 3SCSA 2BXZA 4ATLA 3PZUA 3U5UA 4JL2A 2CITA 3WFZA 2PF0A 2F7RA 1CEOA 1WZKA 3ZO9A 3A4XA 2OSWA 5LYRA 3BLBA 1M01A 3F5JA 1C8XA 4WK9A 3WBAA 2WHJA 3MMWA 4ZFMA 3VX0A 2WZIA 1H2JA 4NSBA 3GXMA 1QW8A 1KR1A 1HNYA 2FHFA 1NWTA 1Y7VA 3WL0A 3MUZ1 3OG2A 3CPUA 5ABFB 2PWFA 1LL4A 2XTKA 1UH3A 1PX3A 2J4GA 2EEXA 1XCXA 3L2LA 3RPMA 4BQ3A 4HOZA 2DGAA 4A3HA 4UQEA 5E6YA 5DT7A 1UD3A 4AMWA 1AQMA 4D6HA 2CIPA 2WKLA 3VSVA 1Q6FA 2CBJA 3VM5A 1MXGA 2E4TA 2XIIA 1MW0A 1BTCA 1VFOA 4FNUA 5BRQA 3VIMA 4D6EA 5CSUA 1HJWA 1CDGA 2FHCA 5GNXA 1SZNA 5M17A 3TTQA 2WSPA 3AQUA 4MB1A 3HG5A 3UESA 1WE5A 4ZEPA 1JI1A 1WO2A 5A69A 3ZSTA 1AVAA 2G41A 4IPLA 3ARXA 3M46A 4E2OA 2WZHA 4JFUA 1QNOA 3UR8A 3HU7A 1KXHA 3NIYA 3B9DA 3NUKA 2J47A 3GH5A 4PMZA 5DO8A 3WNMA 2YDQA 1E5JA 1J18A 4W8LA 3DX2A 5M3WA 4U2ZA 2ZXAA 1TVNA 4PMQA 2NT1A 3BAYA 4PTMA 1R33A 1ZBWA 3ECQA 3EMQA 2V3GA 3N04A 4M29A 4WSKA 3SUVA 4MB4A 3VMOA 4MPKA 3VIHA 3WNKA 1CBGA 1XC6A 3HJEA 4D6GA 4HZ6A 4WF7A 3AFBA 1UR4A 1KFWA 2E8ZA 2D3LA 4JFVA 5I5RA 8A3HA 4TX8A 3B9EA 3KEHA 3EDKA 4CD7A 3SCTA 5D8ZA 1VBRA 2W62A 1G01A 5HPOA 2BVYA 5A6AA 1RH9A 1OB0A 1HKKA 1NWUA 3RM9A 3WDQA 5HBFA 4V2XA 1V02E 2DT1A 2J7EA 1XH2A 1EO5A 1UWIA 5DMYA 1E4LA 1OWQA 5A6MA 1LLOA 4RL3A 3T0DA 1Q6GA 1GW1A 2OWXA 2DH3A 5A2BA 1E6SM 1V0NA 4H7VA 4AZHA 2WHMA 1L8NA 2VCCA 2BY1A 4AISA 2VT0A 1E0XA 1LQ0A 3FAWA 1QHPA 1NWRA 2XVGA 2MANA 3D50A 3S6TA 2WVVB 1CXFA 3CZJA 3WF4A 2D3NA 3QHNA 3WH7A 2G4FA 3I3BA 2V3FA 3AJ7A 3ALFA 3QR3A 3WEMA 3AXXA 3ZMRA 4Z2HA 4IPNB 1TQVA 1TCMA 1W2VA 1H5VA 1N82A 1E5NA 3A47A 2JALA 3KL5A 1M53A 1OGSA 4GO8A 3AHXA 3TA9A 2WVUA 3ZJ8A 2ZE0A 1HX0A 1I1WA 1QI2A 1OGBA 3AROA 3WEOA 3IANA 1KCKA 5D9MA 4PMRA 5A6BA 1GUVA 3AZRA 4PTVA 5I3DA 3RJXA 4AZBA 4LXFA 4H2CA 4F79A 1B3VA 1G94A 2Y5EA 1B30A 1V03A 3L2MA 3LXBA 4GI9A 3L4VA 3WQ6A 1A3HA 2RGLA 1E6NA 4EE9A 1E4NA 4DUXA 2WMHA 1VFMA 4BQ4A 1CWYA 1C92A 3VIFA 3RDKA 3UG4A 2GJXB 1Q6EA 3VKKA 5DT5A 2D73A 2E40A 1D3CA 3PZNA 5D9PA 4AD2A 2XVKA 4QP0A 5IHRA 4EANA 4U5KA 2JEQA 2VO5A 2YBTA 2ZIDA 3LRMA 4JAWA 5E1QA 2ZUVA 3MI6A 2RGMA 4KGJA 1VJSA 1R86A 4BS0A 3EDJA 2A3AA 2EPLX 5DEZA 4ACYA 2BHZA 1XV8A 4NZCA 2VQUA 4AD3A 2BFGA 4U3CA 1XSJA 4HMEA 2UY5A 1CZ1A 1E15A 2CHOA 1Q6DA 2WYSA 1PS3A 7CGTA 3HMCA 4W8BA 1G5AA 3DHUA 1AQ0A 3AOFA 2DDXA 1BAGA 2J75A 4KRUA 3KE0A 1BGAA 1WPCA 1EOMA 1I1XA 1BVZA 3K4DA 1PJ9A 2BS9A 2YDRA 5D4YA 2WSKA 4CN4A 3LXAA 1E73M 1JL8A 3VOCA 3WDIA 1GVYA 3HG2A 3AXIA 1V3MA 1XSIA 4PMXA 4CU8A 2VX4A 4KMQA 2VX6A 4AZ7A 4TOQA 3FW6A 1FHDA 3OIHA 3WUFA 4OBRA 1E6RA 1V0KA 4MB3A 4TVDA 4Z2LA 4PEEA 3DECA 3WF3A 5BXTA 1C8YA 4MNJA 3AIRA 4C7GA 2WK2A 4ATWA 2WLZA 3A21A 1ISYA 2HISA 1G0CA 1JIBA 2YLAA 1YQ2A 5A8OA 3AXHA 3AHVA 2X8RA 4FF5A 4CCEA 2AAAA 3BAIA 1BGGA 3CIVA 1C3FA 3AZTA 1O7AA 3WMBA 1UD8A 3W29A 2DT2A 5A6SA 3VGGA 4GIAA 2VNCA 1SYTA 5JBDA 4P8UA 2VMFA 3T2QA 3AICA 2JE8A 3OA5A 1W1TA 2YJQA 4LYQA 2OWCA 2XG9A 2GDVA 1CENA 3ARVA 3MUIA 3WDRA 3CHCA 4L4OA 3T08A 3WD1A 5ECUA 5BYWA 2CBIA 1K9DA 4XUYA 3L4ZA 1F4AA 3BAKA 1VAHA 4CGTA 3AISA 3VIKA 1JYXA 2NT0A 1AQHA 3WD2A 3VINA 5ABFA 1JF6A 2XVNA 3GH7A 1HJSA 4YHEA 5A94A 3ARRA 1JZ3A 1HN1A 2DPEA 3AMCA 2GUYA 1GQLA 3HZ3A 1WZLA 3TV8A 3ZM8A 3VO0A 2EJ1A 1W32A 2G3IA 1T0OA 1JDAA 3BAXA 4FLOA 2QF8A 4IM4A 4Z2GA 3L4UA 3EJTA 1H09A 4H8UA 3WNLA 3SCOA 5FL0A 3PZVA 3VVGA 2D2OA 4WJXA 3T2PA 1HKIA 4XZBA 4DWSD 4GXPA 3SURA 4JIEA 2EABA 2X2HA 1DEDA 1J12A 1EQCA 2PWDA 4UQDA 1C7TA 4CD6A 2UY4A 1BYAA 4OOUA 5E09A 2XGIA 1QPKA 2Y8KA 1ZJBA 3M6DA 4B9ZA 1PAMA 1W9BM 4AEFA 5ABEA 4TX6A 2EADA 1BQCA 1LG2A 4J3VA 3PZTA 3PZMA 1SMAA 3WSUA 3VD7A 3S5ZA 2JF6A 1QNQA 3PBGA 4B9YA 4UR9A 3BVXA 1E1EA 1CXHA 1MW1A 1B3XA 2VZOA 3AIQA 4NRSA 4XX6A 5C8BB 4HA1A 3UG5A 4WKHA 1S46A 1WKYA 1JZ4A 3GNRA 1G1YA 4OJYA 3NSXA 4HU8A 2ZX6A 1V6XA 6CGTA 2GVYA 2XWDA 1L0PA 4W7UA 4HTYA 4CCDA 4F8XA 1JZ8A 2D0GA 1HTYA 4UFIA 3CZ8A 4UOJA 1QW9A 3D52A 3W4RA 2J25A 3BMVA 1BG4A 5GQBA 3AHZA 2PB1A 4D1JA 2E9MA 4V27A 3S5YA 4CN1A 5A2CA 1CIUA 1OD8A 5I0DA 4AZIA 2XM2A 1SFSA 1V3JA 2XVLA 2W67A 3SCUA 1FHLA 3VIJA 2ZXBA 5CLWA 3VD3A 4W7VA 1C7SA 4DO4A 4UQBA 4P8VA 1W91A 1ISVA 1LWJA 1KB3A 3AZSA 2EPOA 1U30A 3CLWA 1UG6A 3OLDA 1UR1A 1CXIA 3J7HA 5A3HA 1V02A 2BHYA 1W3HA 5FL1A 4GQRA 3L4YA 2WVVA 3VD9A 3B8SA 3OLIA 4HMDA 2Y24A 3EBVA 2G3JA 2CKSA 3TTOA 3B9AA 1W1YA 4AY1A 3WEZA 1GQKA 1E40A 3H55A 1GJUA 1EO7A 4W87A 1UYQA 4OIFA 4DUWA 2VRJA 3N1AA 3UEQA 2GK1A 5M5DA 3ZJKA 4C7DA 1W9UA 2Z1SA 3MU7A 3BAWA 1QWNA 1R8LA 4R27A 1VIWA 1UKPA 3F5KA 4H8VA 4MADA 1CGVA 4DUVA 2TAAA 2PWGA 3IJ8A 1JZ7A 5E6ZA 3W24A 2FYVA 3EDFA 4DO6A 3DX1A 4NF7A 1V3KA 3BVUA 4MNKA 2NW0A 3GH4A 4D6FA 4UZUA 1HWWA 1OGGA 5CJ5A 2Y2WA 4RE2A 4XB3A 2DEPA 2GJXA 2ZUWA 4QFUA 3RILA 1GHSA 3SCWA 4CU6A 3VX1A 3CTTA 2VI0A 1UQZA 3MS8A 1LWHA 4NXKA 5CPQA 1W3LA 3W25A 3AS0A 4OBSA 2ZICA 4W93A 3VMPA 1CXEA 1E3XA 2F1BA 5BXRA 4TUFA 2YOCA 4UFJA 1O7DC 3UETA 2VR4A 5BRPA 2FGLA 3WY1A 3MMDA 3ZOAA 1FP9A 1MQRA 1BG9A 2VZSA 3THDA 1MQPA 5AC4A 2XWEA 3AMGA 1QBAA 4CU7A 1JZ6A 1JYWA 1RP9A 3ALGA 1RPKA 1H1NA 1MWOA 3VM7A 1PBGA 2VCAA 3ARSA 2QMJA 3VNZA 4LX4A 1GOQA 1LF1A 2W4XA 4HPGA 3BH4A 4CD4A 1TVPA 3FN9A 3WY4A 3PHAA 5CZKA 3VILA 1UA3A 2EPNA 2WXDM 3KL3A 2OLHA 3AIVA 4GPNA 1M7XA 2VOTA 2PWHA 1JNDA 2DQXA 4AD1A 4W7WA 2X05A 4GKLA 5E0CA 3QOMA 2ZX7A 3AI0A 1R85A 1GOKA 5ABGA 2XJ7A 1DP0A 3AS2A 1BLIA 1J0HA 1EDTA 4MNMA 4QLLA 4JKKA 4NI3A 1V3LA 2XM1A 1KTBA 1BHGA 4ATDA 3DYOA 4KH2A 1JAKA 3W6MA 3VIGA 3UCQA 5AC5A 1O6IA 2WMKA 1WDSA 3AMKA 2ZUTA 2ZUUA 1A47A 4FNPA 3U7VA 1OINA 1HVQA 2VRQA 1IV8A 3CUIA 3ZT6A 2W91A 2GFTA 4D71A 4M1RA 3U57A
chains in the Genus database with same CATH superfamily
2EZ0D 2J1XA 4LALA 3THUA 2ITFA 4WI4A 2ONEA 4L8SB 1TTFA 3OZMA 5I3KA 4S11A 2EG8A 3WL9B 1RK1A 1G4EA 4BFEA 1A14H 3GSWB 1QU4A 4D3CL 2K6WA 3OZKA 4GOAA 2OJPA 3OPZH 4GKNB 3TU9A 3WD0A 4G5AA 1JD9A 3KYKL 2NNAA 2BXVA 3SE3A 4IT1A 2WMGA 5I19H 2C9XA 4LGXA 5HDBF 1BXUA 4L8SC 3NABL 4X80H 5DA4A 5JIHA 4X4KA 4JFDA 3IT8D 1UM6L 4JEGB 2BV9A 3DXAB 1G7LA 1BZ8A 5DUJA 1T22B 3AVEA 1VH7A 3BCDA 1RJYB 3LNDA 4M6VA 1UJ3B 3DFQA 1WFUA 5DHXB 1E70M 3Q2DA 5FKAB 1JFHA 4Z6AT 1G9HA 4Q9QH 3L5IA 1A1OB 2V17H 3FQUA 3BVTA 2OKMA 4EAMA 4ZMXA 4MZIA 2MIZA 1OQXA 3UNTA 1RXLA 1R87A 4IU3B 3IRCA 3T0AA 3QDHA 2XTJE 2PPAA 3D18B 4XT1C 1UKOA 3PUGA 4DOHE 2FBJL 4QDGA 4UQCA 4G6JL 1BXAA 3DHDA 4CCZA 4Y1AA 3MHFA 3S34L 4A05A 2PCPB 4F24A 5CKGA 1G0XA 4HPYL 4ENED 4Y2OA 1HSAA 4YSTA 3UAJC 1GGYA 3JVGA 3RPKA 2NZLA 2YKLH 3RTQA 4NCC2 1OSEA 3SN1A 1KGIA 3SY0B 3ZUCA 3OLGA 4ZO6A 3GNNA 1KCWA 3VCRA 1XEDA 3TBSB 2VFGA 1F61A 1UH2A 2PTUA 1X5XA 1FV1A 1PCXA 3CMOH 1HL5A 2EF9A 2ENPA 2GJPA 5LBGA 5D30A 3CWOX 5HYQA 4NOFA 4LHJB 5ISZE 3H85A 1X6NA 1GGTA 1GS7A 1V8HA 1EZSA 4H19A 1LVEA 2P8MA 4PRAA 5HQLA 3ZGHA 4F37K 1Z2KA 3DX6B 2FTAA 1RP8A 4LEEA 4RNHA 1TJPA 3CFTA 3N1FC 4YWGH 2Y2YA 2JB5L 3T2NH 2FHBA 1TFVA 2BP8B 2R29L 2YGPA 4N9DA 1DKWA 1RPXA 2DSKA 2UZIL 2O61B 1F4YL 5JQ6L 2CLIA 2O5ZL 4MLIA 3RVTC 3VSUA 5I1EH 2Q9OA 3QCTH 4Z2JA 3MMUA 3GC4A 4OGXH 1SFDA 4HIJB 2P1FA 2Q8ZA 2BSSA 1XR8B 4NQVA 5LN8A 4JLRA 4XP1H 1MQQA 3M16A 5JW3L 5F7UA 2DT0A 3EZ4A 2E0PA 3APGA 2X4OB 5D2XA 3M8OL 2CK2A 1DQUA 1UENA 2PCQA 3MJ9A 4HA0A 4LLUB 5C3LD 7A3HA 4LLWA 4UOQA 3KXFA 1O6VA 2P5EA 5IB3B 1CXLA 4C6FA 4ABQA 3ULVD 1P6FA 2AAMA 4FIQA 3VE7A 4HHAB 2HCZX 3WXWL 5E08L 1NFAA 3MO4A 4AM0A 4B3KA 4X42A 4OFVA 3CV2A 2FJSA 43CAB 5FKYA 4PV9A 2J27A 3ZLHA 2J88L 1UWTA 5AC8A 4GYPC 3FUKA 3S3SA 1IKNC 3CYJA 2XN1A 3L13A 2VW4A 1TA3B 4FLQA 2H8PA 3MRIA 1KWGA 1P6CA 4H3DA 3VD1A 2CLPA 3S6DA 5IROD 4AHQA 4G7FA 3GSWA 2AXGB 3W86A 3CHDA 1N55A 3VVWA 4LQFH 4GQBA 3OBAA 3V0TA 3LQMA 4G59C 3DERA 4O16A 4GKNA 4ADGA 1GAFL 3TCTA 1O6SA 3QRFM 3ZTDC 4H1LG 4E9VA 4I2XA 4BWWA 4L8BB 1XBDA 2XKNB 2QKSA 1ZV5A 5C0CD 5EEWA 2NY3C 1IR1A 1H41A 3FSZA 3K7UA 4Q22A 5I28A 3E9UA 3DXAA 2Q3RA 4NN5B 1T22A 3R94A 4XH2B 1A6AB 4HA3A 1GZHA 4XVDA 3D4CA 3QUHA 1UJ3A 3HB3D 1DBKL 2X88A 3MV9E 4UM8B 3HG4A 5FKAA 4U1HB 4ZMOA 1MQ8A 3NZQA 1A1OA 3BJTA 2JCCB 2A1WH 2GAZB 3TO2B 2VXSH 3L3GB 2QQQA 5EG6C 4AGMA 1GONA 3RPDA 5KBPA 3D18A 2AKMA 4R97B 4Y9OA 3GHPA 4P4KC 2J7CA 3PL6D 3G5EA 2V5LA 3WJXA 1SW3A 4NN5C 3N91A 2PCPA 2COQA 4HCRL 1AZZC 4LRNL 1DIOA 2NSOA 3IIPA 4FSAA 5BS0B 3AY2A 1NWSA 1WKDA 4N0RA 1KIRA 3AMDA 2YW3A 2PO6C 4AWJC 3SE9H 3SDCD 2EDNA 2O4EA 2FWSA 4MGXA 1T0MB 3BMWA 4GP4B 2UWFA 3TMLA 4Z2KA 3K2GA 3F7JA 2VR3A 1YE4A 3HB9A 4DAIA 3SDCA 4E8DA 1QI3A 4Z1PA 1PZ5A 4B96A 3BZ4B 2IDSA 2BNRD 2FGWL 3TQPA 3PAZA 3DVNB 3GHSA 4DWSB 4R97C 4HJSA 3JWNH 4X9BA 4KZCA 1J0JA 2PBGA 3HZVA 3WDPP 4BH7B 1FDLH 1XH3B 1B3IA 2N59A 2VDGA 1CD1A 4FXKB 2E09A 1XPGA 4WX2A 4YNYA 4ZGYA 2XIQA 4YS1A 5DJYB 2AQ2A 4HXBH 3MA9H 3QEQB 2JIXA 4XNXL 3UC0L 3WKYA 3WD3A 1R7OA 1WIPA 1S39A 4C6KA 2EIBA 2OZTA 5I6SA 4PD4K 3SFKA 5LXGH 1UZ4A 1TO5A 3RPTA 4XC1L 1US0A 4O4YH 3MSYA 4JM0A 1UCTA 5CPSA 4LLUA 4DP2X 2WGXA 2J66A 1SGJA 2HE5A 3F4DA 1BM3L 3AXKA 4W81A 3GJEA 4XP9L 5IB3A 5E6SB 3K30A 2PSNA 2WUCH 1Y18B 4HHAA 3LH2H 1V6WA 2NV9A 4PJCF 3O4LD 2X1IA 3SDXB 4BQ8A 1JQVA 1X1ZA 43CAA 5ABAA 3KZPA 3SSGA 1BD0A 5I09A 1ZPLA 1ZVNA 3UO1L 1TA3A 2CHWA 1KLFB 2F2HA 2HJLB 4NX0A 4ZBJA 1GYAA 5BNXD 3BVJA 4XAZA 4OUUA 3SBRA 3QKZA 5D7IA 4DNMA 3GXNA 2AXGA 4O9HH 3K4AA 3I4EA 3K0YA 3FKUS 3MZGB 4HPOH 5HVHB 3OAWA 4F5CA 4CVWA 3GINA 5C6MA 2CJUH 1BYBA 2R1XB 3I9IA 5IMMB 4IIDA 2GWGA 1QOPA 1JDFA 4I9WE 4HCFA 3UGXA 4L8BA 2ZONA 2XJLA 2J62A 2GGIA 1JHKH 4OJEH 4GKTA 2DEWX 3OMIB 3VA6A 2BVQA 4G8GD 1A6AA 3S9DB 3QEZA 3SUWA 5L9DH 4H4IA 4G8GA 5JBEA 2DBLL 1SJVA 4EI6A 4UM8A 2BOCB 2BOFX 4JM2F 2ZX9A 4U1HA 2YUXA 4OF3A 4KUCD 4F20A 3I6TA 2VDRL 1MCOL 2FQDA 2IDUA 3T55A 2WUBL 3ITTA 3QQNA 3GTTA 1KFEA 2VITB 3L3GA 3CIAA 4N9GB 4LRIA 3NGBB 3D5HA 4LKCA 5D7SL 1HKLL 3BCFA 2VN7A 5SX5K 1SM3H 2EDTA 4GUPB 3BZ5A 4JM2C 3APMA 5EZLB 2KKQA 3LHWA 5H6HA 1Y0EA 3IJEB 1N10A 2Y72A 5BS0A 3I02B 4MXQC 1T0MA 3LKRB 2JKTM 3FSVA 1GGBH 4YFLI 1ZS2A 2RKXA 1FGVH 4NNXA 5F97E 3BZ4A 1XIMA 3B2VH 4E9LA 1OHLA 3VTMA 3ORWA 2YQ2A 3SGJA 3EJZD 3W7GA 1M3UA 1ICPA 3R4RA 3EWDA 3OL2A 3DVNA 4DWSA 1UH4A 2ZYFA 4PCYA 1EKOA 3PP4L 2EEFA 3OZ9L 3RM8A 4XPGL 4ZR8A 4BH7A 1XH3A 4LSUL 5LBSL 1QI4A 4FXKA 2PTXA 1Q63A 4BJHA 4Y8EA 1WZMA 4INFA 1KFCA 4IGBA 5ICZB 2E7CA 4YJZL 2OSXA 3ISRA 1ASPA 5DJYA 2YSSB 2ORBL 3Q67A 4PMDA 5FAAA 3QEQA 3D30A 4X9GA 2G96A 2EXYD 2F54B 3H2WA 5D1QD 2B8OT 5F7DB 3AGWA 3ARFD 3HI1B 5DN1A 5DK3A 2UZ9A 1YNPA 2AV1B 4ZMGA 5AYQA 5A6LA 4ZK8A 1UD5A 4BZ2L 4Y90A 5D1XD 4TNWK 1CDIA 1WISA 3ME3A 2PWVA 4ZSUA 2LHAA 2RR3A 3RGVC 2WSYA 3SDXA 3B0PA 4I8YA 4YHGA 1TKWB 3EA1A 3CQPA 3UIYA 1NCBH 4LB8A 4BQCA 5AZEH 2WZPA 3FTVA 4HSNA 3GK8H 3T65A 3SQRA 4RNIA 1J2BA 5HHNA 2QQKL 1LILA 2ZBTA 5IFHL 3M1CA 3O9NA 4HEPG 4ATLA 3AM8C 1E27B 4C1NA 5EDSA 3EXSA 3Q1SH 3V2AR 1L6PA 2ZKXA 5AW8B 3QN3A 2BERA 3TV3L 2OMAA 3NP4A 3HN5A 1UH3A 1S5WA 5IMMA 3N40P 4JX4A 3DK0A 1RIUL 5FUZL 4HUNB 2J8TA 3U6WA 4HCGA 1THCA 1AQDA 3IB4A 1HJWA 2FHCA 3TTQA 1XFBA 1WO2A 2JELL 1F1AA 3IMTA 2HTKD 1HL2A 4FFVC 4JFUA 4A2SA 2BOCA 3NUKA 3TBWA 4DFHA 1ICTA 4C65A 2JGYA 4W8LA 5D9SB 1QEWB 4MAUH 2ZXAA 4B5VA 1J05B 5LCVA 2XBDA 1EF2A 3G9AB 3HMWL 1JULA 1CYWA 4HHPA 4L0YA 3VMOA 2BG5A 4N9GA 4WF7A 4I18B 3W72A 2W80C 1KFWA 2WM1A 4YDIH 1TREA 1S7QB 4GUPA 3FVMA 4AGQA 5EZLA 4X8XA 2W79A 4MA1B 1TJMA 2Q8BL 3MLWL 3KAOA 2TSYA 3Q6FB 2G60H 1OP5K 3I02A 4ZQKB 1K70A 1NMAL 2OWXA 3V4PH 4WVRA 5MEOB 4HNTA 2GUUA 2YOAA 3S6TA 3HGSA 4TSBH 3TYFA 1JGEB 3I3BA 3D0VB 3ALFA 1NUDA 3AQYA 4O1BA 4I18C 1QO2A 1MZHA 3OXSB 4GSXA 3T8MA 4YU1A 2V5JA 2FPYA 2PKDA 4PWGA 1D5ZB 3FN0H 2WAQA 1DVUA 3RUGB 3R0UA 3QYQA 4F79A 3SO7A 1WYJA 4WRLA 2GJNA 4PJGE 3SKOB 5ICZA 2N1TE 4Q4SA 2AEQL 3ANVA 4XZMX 5KG9B 1R3KA 2Q01A 4F2FA 4A39A 4FHAA 2F54A 4AWUA 3EH3B 1E67A 1A3RL 3F64A 4XVJL 1QZ1A 1T66D 3VXMD 3HI1A 3PWUB 4Y4KD 4AD3A 1Z7AA 2JI3A 5EPMB 2AV1A 5EEUA 5IBUB 2DVXA 5D4IA 5E5UB 2MTAA 3DHUA 1XGTB 4YDJB 5D37A 4V2CB 1DIKA 2YD5A 4M5ZH 3VOCA 3Q9PA 3AXIA 4PGEB 1OY3B 5T33H 4CU8A 2Y6ZA 3S1VA 3L5JA 1AGDB 3CFJB 3C6LD 1TKWA 2XZAL 5GS1B 3Q65A 4MIMA 1NC2A 1G0CA 4XZUB 4LSBA 4O4VA 1EDYA 2FZ8A 3PNRB 3VFLA 2EUXA 1OADA 5XIMA 4FXGB 1DHPA 3Q9QA 1ET7A 4PFMA 5C0DB 3S9YA 2XTJC 1JUKA 4RGNE 3S8HA 1OP9A 3HF3A 4Y2WA 3ARVA 3CHCA 3SRHA 3V35A 3WTSA 3T08A 4HU4A 1TV7A 5HPMB 3GBNH 3S9IA 3OQ8A 3UTZB 4DP8X 2CLMA 3WNIA 3HE7B 3VIKA 5SWSD 3DGRA 5A94A 4GFTB 3ARRA 4WOZA 3BSMA 4FG6C 2OLDA 3SGUA 3VFWB 3TV8A 1U6AL 2RDUA 3EWUA 1YRRA 5XINA 3I2CL 3MNWA 4I3SL 3L7FB 2NX5D 3K6IA 3B8TA 4OKVB 3FO1A 4JTFA 4BHUA 2E6FA 4JFDE 2PWDA 3DURA 4LCUB 2SFPA 2UY4A 3IJ6A 4L23A 4OOUA 1WBJA 2B59B 1DZ0A 2IAAC 4HDIB 2NXHA 4DGYH 5BV7B 1W9BM 2WKJA 4FQCH 3ZYZA 1W5OA 4O1EA 5MKGA 3VD7A 4JIRA 4GG9A 3PBGA 3HE7C 2B0MA 3H7RA 1NCAL 4F8XA 1NBZB 1A4JB 5T3ZH 4Y5XC 5DJZB 1ZLUK 3GWJA 3N40F 4WZHA 2C3XA 3WXVH 1IKFL 1SOSA 5EWIH 3S1WA 3ZR4A 4L05A 1EV2E 2V9QA 4Y1AE 3FQ2A 4DO4A 3QG6B 2VR7A 5E7BA 5HULA 3OKYA 4G43B 3CLWA 2DZUA 3CXOA 1F58L 4QNPE 3PFUA 4X60A 3STFA 3OLIA 4HMDA 3WUWB 3R13A 6FABH 3D0VA 1X7QB 3EBVA 2P44B 2HFGH 5JORB 3B9AA 2DQHH 4U1MB 4JFPA 1GKPA 2IPUK 3OXSA 2AEWA 1RCOB 3CN4A 4JO3L 4MXWH 1SOKA 1QLEB 3MLYL 4W9LC 4AYMC 1BX2B 2W65B 1FO0B 1QWNA 3B9KC 3RUGA 5T9CE 4TNVK 3L2IA 4NDMB 1A7QL 4J12A 3JZ7A 3IV8A 3Q58A 4XB3A 3AAMA 1J6OA 2WSDA 5I1KL 2XPYA 4JO4L 4NJHA 1A02N 4Q8BA 4CU6A 3F12A 4PGBB 4JAMB 3MS8A 1EJOH 4NXKA 3IGHX 5DT1L 1FVCB 5A2FA 5CEZE 3R4IA 3PWUA 4JD4A 3WY1A 1M9WA 4WZ9A 3M5YA 3WOVA 4JVUA 1XGTA 4YDJA 1TVPA 3VILA 4S3EA 3NQ8A 4PGEA 3TN5A 3GTIA 3KXFE 2J6EH 2P5EE 2OZ4H 3ARDD 5I0VA 3EWYA 1ECQA 4QM1A 1NOLA 3ULUL 4DGIH 2D3JA 4UTAL 1R85A 5EBLB 3AI0A 1DP0A 2IH3A 3CFJA 5T5NG 4NI3A 4TOYL 5GS1A 4AL8C 4GJIA 3E80A 2DZAA 1KEMH 5SV4A 1WAAE 2QGDA 1QDSA 2PEVA 3CUXA 4IKIA 2ZWKA 3OX8B 4C6QA 4BWUA 4FXGA 3GLDA 1NBCA 4AG0A 5E8OA 3L48A 5C0NC 1EPXA 3KP0A 2FUTA 4HIEB 3MP3A 2W91A 4KFPA 1QAWA 4Y9NA 5F1NA 1HZHH 4Z7UF 5I1GL 1EC7A 5FLUA 3M0ZA 2E5CA 4KQ4H 2MFNA 3WFDH 5DEFA 4YXKL 1EP1A 3MLSL 5F7YC 4FLSA 1TEYA 3W9EB 2DZBA 3HE7A 4PB9L 2LVCA 1IZKA 1G1OA 2P53A 1IEVA 1KFAL 1TZ9A 1DEEB 4H2AA 5AD0B 1ONWA 4I2XE 3LN3A 3L7FA 4QKXB 4DKFH 1F13A 2JQAA 3WE6B 3BKML 2Z26A 5SV3A 4LCUA 4GI8A 5GS0H 4W4OC 3DXAE 4QLKA 2BVPB 3X1FA 1G0DA 2EDYA 2IWFA 3MA8A 1QFUL 4CD8A 1PQZA 3L3HB 4JKPH 3VFUB 3GRWL 3LCWA 1L6YA 5GRUH 1EHKB 2WSQA 2A3EA 3ETBJ 3TYBA 5CD5D 4PEKA 3HPAA 4DF0A 2EPKX 3VUPA 1RJLB 4C6MA 2ZXGA 5AKSA 5I71B 1OAZL 2APVA 2VEGA 4X61A 2QLYA 4P8XA 3A9IA 4M24A 3WELA 4R8WH 3PZOA 4G43A 4E68A 1HINH 2X1TA 4JY9A 5D71H 2XVPA 3OVRA 5GSVB 2YSTA 5KANI 3GSOB 4DESA 3UTTA 4DYJA 1I1AD 3WBXA 4MVAA 4BFNA 1FH5L 3WUWA 5JIQA 4UT9H 1W9XA 1VADB 1AS7A 1YXDA 2AI0H 5JORA 2A3HA 1HH9B 3R10A 1Z6KA 3EWXA 5F21B 3FXIC 3O3EB 3WBDA 2JWYA 4OGAD 3N1GC 3ABKB 4ORGB 1XF4A 4MF4A 3O0RH 2V5BA 3IRSA 4HALA 3UBXA 4NDMA 2XSAA 1LK2B 2IPFA 3FDGA 3WD5L 4XZWA 2IO5A 1BXVA 1GHFL 1RVFL 1Z9NA 5AW6B 2PP0A 2GSJA 5BWAA 4XCNB 4YHKH 3U4EB 2F58L 4Y4FB 4PGBA 4JAMA 3GG8A 3C6SA 1IBZA 2GGEA 1FVCA 2GEEA 4GE8A 4H0GA 4ODTH 1CYGA 2HBVA 4PUNA 1MCEA 4X22A 3M4HA 5GRZA 4Q2ZA 1A1MB 4KMTH 3OXRB 4HF5H 1QW7A 4QIUA 4O10A 3V9FA 5AHEA 3I3DA 4FDWA 4GJTB 1QYGL 2WLMA 3WNPA 3LHPL 2R91A 2PAJA 5EBLA 4E5XA 4Z08A 4OCXL 1UUNA 4Y4FC 4JCLA 4K8RH 4DF2A 4WY0F 1FC1A 4UB9A 4Y2DD 3L4TA 4PCKA 3HC0B 4FXLA 5DLMH 2ACRA 1O9ZA 3HGOA 1QWGA 4MKMA 4JRYD 2W8CA 1E1CB 1L9WA 4N8CL 2PLJA 4X98A 1P5UA 4BI6A 2HVJB 3RG1C 4HIEA 4KX8A 3HG1D 4Y8DC 4B90A 2A0LC 1FFTB 2XZQH 2FD6H 4B41A 2VWSA 5A2AA 3WBWA 1EFXB 5D7IE 4XIAA 3W9EA 4AH2A 4V28A 5CSSA 1MRQA 3I9GL 4PJ8B 1H8LA 1AYRA 4F5CE 3VGFA 1CGUA 5D2LF 3SO5A 3WLHA 5AD0A 4WUUD 1ZDQA 4NJAH 4X99B 4NFBA 3U4BH 3ZLQC 4DBSA 1VC4A 2VE6A 3W7NA 2C0HA 4FQQB 1PZ1A 1HQ4B 2ETWA 3AQXA 1KCUL 4FYQA 3T78A 5IBLD 1TZZA 4NZ3A 3Q2CA 3CDCA 4KKCD 5TQ2L 3JW7A 2MQGA 3H4GA 2P88A 3L3HA 2OL3L 3VFUA 4YLCA 2QUUA 1V0LA 4ANXA 4QRNA 2GGGA 2IBZY 1RVKA 4ZRGA 4XMPL 3QI9D 1FKXA 3OB8A 2IMMA 3JR2A 5T3XD 3N44F 2DLTA 2VCOA 3CHRA 4N02A 2GVLA 4YIWA 1NDGA 4D6IA 4A3QA 2QVNA 2V7NA 3W83A 1WXZA 1HJUA 3JRKA 5J56B 3LN9A 1X5YA 1QR1B 3CZSA 4ZDHA 2WAHA 2VDMH 5BS0E 1ZE3C 3QIWD 5GSVA 4NKQB 2OKTA 3I75B 3GSOA 2YPIA 1FWXA 1ZBCA 1E8YA 2YCIX 3TWYA 4GSUA 5CN2A 2X6VA 1VADA 2QKIB 4PIBA 4Y9AA 3NJIA 4AQ8C 1AE6L 4IRSB 4Q6YA 4LNCA 4L1WA 1E6QM 1O7SA 3PWJB 2PNDA 3O3EA 5E2WL 3OODA 3QNYB 5I78A 3VXUD 4E42B 2HYMA 5AFDA 1XINA 1W54A 3KTXA 3D4ZA 5TPWH 1CURA 5AAWC 1BM7A 3MVIA 3R0KA 5BQ7A 3FQWB 1YECH 4ONGL 4KO6A 3BO8B 1V7ML 2ADFL 3EUUA 4ACZB 1A65A 3HRZB 4M6AA 1TE1A 3ISIX 4HK7A 4TSCH 2UY6B 2R83A 1RA5A 3O2DH 2DL9A 3QEQE 2CR6A 2H45A 2E28A 3U25A 3GUTB 3PJUA 1I7RA 4DJDA 1MNUL 1AIFB 2DQTL 4GEJA 4LHQB 4A7QA 4DYKA 4YTSA 2H0FA 1EL3A 4RMQA 3OXRA 2Q5BA 3TXVA 4S1QH 1KENL 4N0YH 3QUMB 1RJQA 2ZF8A 1Q6OA 4I3GA 2OU4A 3PPEA 3N18A 3W1PA 5IQNA 2PDPA 3VD5A 2FEDC 2J5WA 3LTPA 2PDCA 3A9BA 1L9TA 2HX8A 4R7OA 4CQ9A 2VX5A 2WOQA 4NI6A 1P84K 12E8H 1I2QA 4Q8PA 3D87B 4XP5H 1VQTA 3WLOA 5TE6L 2KZ1B 1NC4D 3SDXE 1DANU 4NJGA 3HC0A 2OM5A 4HUVA 1XIJA 3LI0A 4X83A 1IHIA 3IIVA 5KVGL 4E4FA 1E1CA 2YHGA 2HVJA 1EP2A 4JHZA 4JHMA 3BVWA 2GJ6B 4JGUA 2K3TA 5AC7A 5DD0H 4TQIA 4R4FH 1EFXA 4XO9A 3SDAD 5C08A 2RACA 1A7RH 1UM4H 5J04A 1QBML 3DTXA 2QTVA 4PJGB 3KZSA 4PJ8A 2XKUA 4C1KA 4KFMA 1AD4A 3POHA 1SLWA 2DQJL 2HBXA 3US1A 4X99A 3EB2A 1RCXB 4PLNC 4UM9D 2C4XA 2KI6A 5T1KD 5C9WA 2Z34A 4LJ3A 2Z65C 2D2JA 3H54A 1E72M 3FT4A 1ZGLB 1DQDH 3R58A 3LZLA 3N1QC 1K1DA 3QQ1A 3V5OA 1KFLA 5TDPB 1TMHA 3G1SA 3TZVB 4HC1L 3LVTA 3VG9B 3BIKA 4R90L 3NO1A 4TUKH 3ARGD 5L7XL 4KRPB 1DL7H 1VEMA 3CUFA 4YTTA 2N01B 4HSQA 1GOWA 4LCCB 4B95C 3NFNB 1E8XA 3KVKA 4GUGA 2EEBA 3W28A 3D51A 2J43A 2FZMA 2NUPB 2JK5B 5EOCH 4HNOA 3SGKC 2FJUB 1BECA 1E55A 3GDBA 1Q72L 3AHTA 2IQAB 1QR1A 3LPFA 2CUMA 5AW7B 4I8DA 4BKTC 2Y5TA 3O6KH 3RHWF 3Q05A 3SPJA 4KRPC 4O02B 2AK1H 1DVXA 2QKIA 5B3JE 4R4NC 5E9XA 3NZ8B 4LCCC 4IRSA 4ZTOH 3WS6C 5IFJB 5B1BB 2DM4A 1E5ZA 2A83A 1WA3A 2CZNA 4V2BA 2CNYA 4P9HC 2BIOA 2BNQD 2AXHA 4K1WA 4YLQT 2Z4QB 3FQYA 1EO8L 5JBFA 2P26A 3NZGA 3VU1A 3UZYA 1WZ1L 4ACZA 1UC5A 2WJEA 1PFOA 4AE0A 3HRZA 5LNDA 4JHOA 4ONFH 3GWQA 4FKEA 2XYLA 4XBSA 4EI0A 3UJJL 2V9TA 3JT0A 3CHXA 5LBVA 4RGOH 2NZ9C 2ZG1A 2F54E 3GUTA 1K8XA 2BVDA 3C5JA 3SE3C 1AIFA 3EMZA 4KERA 4AJWA 4P5KB 4PJBA 1OX6A 5KYNA 3QUMA 4GNKB 2FWLB 1A0CA 5EEVA 1DJYA 1CB7B 2MNJB 2I9UA 3UJ2A 1QCWA 2AJUL 1REIA 4BV1A 2V69A 4IQHA 5KS9A 2B31A 2IQ0A 1C08B 2BSTA 3D3FA 4WY7L 4WI8A 4Y2OB 2H3BA 5ICYB 4QLRA 1NWOA 5E1GA 3WQ5A 2QQLH 1S7UA 2ENJA 4PYGA 1XFPA 1CDJA 4O53A 5E00B 3N6HA 3EX1A 4MDRA 2BGNE 2VFIA 1YYCA 1RJCA 4ZFZA 3E0GA 2KDYA 4DWDA 3ARQA 4QNPF 2GJ6A 5HY9B 2EO7A 2VXUH 5HYQB 2W1NA 2B7PA 1ZP3A 3GXDA 2VL4A 2FX7H 2QGBA 3HRPA 4NQDD 1BVLB 3UC2A 3QPKA 2BXZA 3AAZA 2QJDA 3NP3A 4HG4K 3ZO9A 4R83A 1KLGA 4AGLA 1SW7A 3JVGC 5B21A 3HV9A 3RTQC 2AEPL 1S1PA 4OGYL 4OCYL 2I9LA 5CIPH 5IOKA 3QWNA 4F37F 4AUUA 4F8TA 3UVIA 4UQEA 1PIIA 4A3HA 5AHLA 1AQMA 3S88L 4YDNA 1XIFA 4JLRB 4JG1H 1S3KH 3PJWA 2IH8A 2R9RA 1F8TL 1EBAA 3TZVA 5AFAA 3OHMB 1F00I 5D7KE 4NENB 4AJ0A 1FCQA 5ETUA 1DYSA 1CI5A 1RBAA 5IB1A 4K15A 3KXFB 2YDQA 1XL6A 1E2VA 2Y36H 1MNNA 3TW9A 4U2ZA 1PB0A 1VGAA 3OF6A 1TVNA 4LCIH 3NFNA 4LFHG 3BAYA 4HSHA 4JDEB 1JCYA 3VOJA 1EXHA 2V3GA 1UZDA 3C52A 2JK5A 3CQFA 4ZMNA 1OV8A 1OAQL 4NNBA 2IQAA 3TJHD 2E8ZA 1WAAF 4G1EB 2H8PB 3NZHL 3MRIB 2ALAA 3ZWSA 4WWPA 5EMUA 5DS1A 1EUAA 4Z3FA 4O02A 1A7PL 2DT1A 4CKVX 4MS8D 2EECA 1OWQA 5FACA 5I00A 3NZ8A 4QKTA 2WHMA 5IFJA 1O6SB 1ZRUA 1OSPL 1TJGH 2G4FA 2Y1AA 1MG2C 5DWPA 4I2XB 1BXNA 1WDDA 5DMLA 1T7VA 1FF5A 1E5NA 2Z4QA 5IJDC 3P54A 4NLAA 1UFGA 3RX4A 3KWUA 3IMBA 3RUGE 2M26A 3IU3B 2PDGA 1NGQL 4G5ZL 3EO1A 3LZFH 3OMAB 3MOAH 1XXFC 2OXGA 4B97A 4YTQA 5BO1H 5IROC 3CHQA 5M95B 1S3TC 3REVB 3RO6A 4FI7A 1FTXA 3VWJD 3ES7A 4P5KA 3HBZA 2HUEA 2OS7A 3NPXA 4Q6JA 1M7UA 1MHPH 3OKDB 1EWDA 1IXQA 3MMTA 2EDEA 1CZ1A 3IDXL 5D2NA 2HLEB 3T4YB 1C08A 4XVTL 1X4XA 1DBAL 3R0MA 3PL6B 1GZHC 2J75A 1UJ3C 4EO5A 5ICYA 1R3RA 1KIRB 2E76C 3KBPA 2GK2A 1M68A 4YBQD 3V0IA 1TYGA 2Y7NA 5E00A 1L7TL 3SDCB 3S36L 3QKEA 2WLLA 4MNJA 1PZ5B 3HI5H 3RFRA 1ISYA 1H51A 1YQ2A 5EH1A 5HY9A 5F7HA 2MCMA 4A68A 2WQSA 5DY2A 4J40A 2VSKB 1GGCL 2BNRB 4B9IA 5DZ9A 3BL3A 3HZVB 1BVLA 1FUYA 3T2QA 4XWGL 3FN3A 1JWUB 1CD1B 4ORZC 4YNYB 2CZDA 1B4JL 2VQ1A 4XUYA 3BAKA 3GNML 4YHZH 4CGTA 5H37A 3SDCC 5G4WA 5I30H 2JIXB 3EF7A 3GW3A 3ESNA 2V82A 2KLTA 5C9UA 3GS4A 3BAXA 2IBZX 4FLOA 1LORA 1YMYA 5D33A 3L7EB 3A6BH 9PCYA 5K9JL 1FNSL 2C9SA 1N8FA 3W1RA 3D6GA 2VN4A 5BZAA 1Z89A 3U3HA 4WK0B 5TF1H 1F76A 4NENA 4DK6A 2YCJA 3V10A 3NPUA 4AEFA 3GJEB 1MZRA 5HVGB 4EPKA 4NRSA 3ORJA 4GUOA 1WITA 4JDEA 1AA1B 5LNRA 2VW6A 4KBXA 1WVZA 4W7UA 3O4LB 4UFIA 1DO5A 3PE9A 2BOGX 3HNVL 4G1EA 2IBBA 5C3TA 2JB6B 1FNAA 3CVIL 3BRDA 2XVLA 3GI9L 4OUUB 1BKHA 5D7IB 2XC8A 1LWJA 1HIMH 5ALCL 5FW6A 3UTTE 2CZEA 5IROA 1V02A 2BHYA 2JKWA 1S2UA 2ZWLT 4OJDH 1DQQB 3OSVA 4Q32A 5FJTA 4XE5B 2J4WL 3PU7A 3CQQA 2HA1A 2VDKB 5JH2A 3B2UD 3UGUA 4DAFA 3CFQA 3HC3L 5AVRB 1OFOA 4DUWA 1TV2A 3UL4A 1VBHA 4HCIA 3IU3A 1TPFA 2BVQB 1ZD6A 5C0CA 1F6AA 2APBA 2OA9A 5K39A 3AT0A 2EUZA 1N5AA 3GPEA 2UYLA 4G8GB 4F0MA 4BF5A 1XMEB 4EI6B 4J1OA 4ZUVA 3FJNA 3Q13A 3LS4H 3GH4A 3REVA 1CICD 4J8QA 1ZJIA 1JNNH 4A7SA 1X38A 4HU3A 1GHSA 2RFXA 1IAMA 4YOKA 1RHCA 3CTTA 3ATYA 1NIDA 3SBFA 4M4RA 4DLMA 1UCWA 1CXEA 4F9PA 2JCCF 4Z5RB 4LKCB 3OKDA 3SADA 2VZSA 4JX5A 2QQNL 3MN8A 1MCKA 1N4XL 3T4YA 1FY6A 1RPKA 1SYSB 3ARSA 2CGRH 1H1NA 2HUHA 1XYMA 3PL6A 5CZVL 5JHAA 3PHAA 4JTEA 2EPNA 3KL3A 3NQ2A 1KACB 1JCKA 4OCMC 5JU6A 4JO8A 4W7WA 2HVOA 1AS6A 3VRIA 1AZ1A 3LLDA 3N85H 4NNXB 4LRIC 5FYLD 5KVFE 1ZY9A 1C8VA 1KRMA 1E90A 1MPAH 3QLDA 3GS0A 3SAZA 1IWAA 1NIBA 3ASWA 5DUPL 1R0AH 2YAMA 2BNRA 1SY6H 2YXMA 1R19A 3MRMB 1XM3A 2YSWA 5KVDL 4MJ4A 2G9KA 4LEXH 1N68A 5CLZA 2Q7YB 4HA4A 5AYTA 1JWUA 4Q8UA 4OQVA 4DF9A 3UR5A 1BQLL 2J7DA 5ACLA 3A4WA 1EP3A 2DLFH 2BK8A 4IGBB 1H11A 3K6SA 1AW1A 3HI6L 3KHQA 3NA9L 3RX2A 3H2OA 3KBWA 3S35L 4JHWH 4HHGA 1DTUA 1VFUA 3GTHA 3SGJC 1GVRA 4UAOB 4AQ1B 2JJVA 3L7EA 2IUZA 4ZE5A 1BOGB 4DWSC 2LLGA 2FDMA 1GYCA 5D1QB 5FUCE 5J6HB 4YGVA 2EE2A 3ARFB 1GZPA 1KM1A 2V6AA 4BZ1L 4FXKC 5D38A 2WXQA 4XWOC 5A6BD 1R2RA 3QARA 5F88A 4IGBC 5JZ7D 5D1XB 3LY0A 5AVTB 4I1NB 4POYA 4RFOL 4NZDA 1QLRB 1CFQA 4XMKH 1W17A 4PCSA 1MQKH 4JNYA 4GVHA 2X6MA 2A74A 1BAWA 4LEFA 2VIRA 5I3HA 3O4LA 2JJWA 3T65B 3G04A 5AW2B 2J7BA 5DD1H 1WAPA 3SDXF 2QGYA 5HHNB 3MQIA 4M6PA 3O45A 5IHUL 2JB6A 1KV5A 2J7HA 4ZO9A 5I8CA 4C1NB 4P49A 1U1JA 3S2CA 5CINL 3QNXB 1J0ZA 1FHNA 2MQCA 5I8KL 4OZHA 3E1F1 2FATL 1DQQA 1F3TA 4KJPD 2YD4A 3GS6A 3SRFA 1BFSA 2QJGA 4I0PD 2H7WA 32C2B 3QZBA 1AQDB 2WNZA 1TRIA 1HHKA 1NP2A 4PBXA 3GKFA 4AL8H 1YEHH 3D85D 2X12A 2ZZUT 3LRSA 4YX2H 2DZEA 4M7KH 1IIKA 1CUOA 3TBWB 5KVEL 3B3BA 2ZWZA 3FU7A 4FP1A 5HVHC 2KZKA 1MY5A 3PN8A 1JRCA 4X6EB 4A2MA 2V3DA 1NIAA 1OX5A 3KLQA 4Z5RA 5HATA 1V6YA 1YPZB 3NJVA 4TVPE 4RZ5A 4PQXA 4LARH 2CLZB 4GUFA 2LU5A 4FQJH 1V7AA 4GW1B 1I1FA 3NL3A 1SYSA 4RNRB 3THMH 1W72H 1OKEA 2VC2L 1QXLA 3PM6A 3M0KA 3STLA 3H3PH 1OIOA 3PUUA 5E9AA 3QMRA 1L9PA 4EOWH 1GYMA 1LCOA 2ZZ2A 4U0QB 4XO6A 1POJA 3TYFB 1UXLA 3R8BB 3PYCA 4XBKA 2WC7A 4PS4L 2VELA 3NGBC 3LNMA 4RV3A 3ILDA 4DKEL 3FQTB 5B3JF 3PREA 1RUQH 1IT7A 1F3DJ 3MRMA 4F7KA 3CHFA 1TETL 2XJKA 2DM7A 5IW1A 4AAJA 3E9TA 1L9MA 2WLJA 1YLVA 2Q7YA 4RRPM 5C08E 3UXLA 4LASH 1I8IB 1KA9F 3NOEA 2VDQB 4YQXL 2GSHA 2R0ZH 2VDNL 1SQ2N 3FFSA 4WWID 3MDUA 4FNTA 2E1DA 1KLZA 2I5GA 1K7FA 1U91B 1RZFH 3V4UL 1R3KB 4P7RA 3H7LA 2NY6D 4RMUA 4OLWH 3F7PC 2E7DA 2L04A 1V54B 4PWEA 3Q5YA 3EAUA 1CD8A 2HT4D 4BF9A 4AQ1A 4ZQCA 1XSOA 2CO2A 1BOGA 4QXWA 5C2UB 3CLFL 3EGSA 5D1QA 5J6HA 3UWEA 1DO6A 4IIZA 4XN8A 5CM1A 1E4IA 1O7DE 1R5WA 3V4BA 3ARFA 1I8UA 4Y4KB 4NM8H 3CU2A 3WFAA 5I03A 1B2YA 1SR9A 5AVWB 1P4IH 3VI4A 1EJ8A 2X44D 4JS3A 1LWIA 1E4WH 5D1XA 3UYPB 1EHXA 3G3LA 4HHWA 2XG5A 1QLRA 3NN8B 1CU4H 2XH4A 5ITBL 2IPTL 4DPPA 1NC2B 5K2ZA 3QWOA 1FORH 4LO9A 3RVWD 5AKRA 4A7GF 2VDPB 4FYSA 4KJYA 3ZHLA 1LBLA 4L56A 3KR3L 3RZCD 1FVDA 1N67A 3E6EA 3LRLA 1MW3A 2AQSA 1DHKA 3WLBB 4KNSA 1OG0A 1HKFA 3GZQA 3QNXA 2ZCZA 4XO3A 5TNVA 2FQFA 2GBVA 3DO7B 2DDQH 3CFCH 4JBSA 1HL8A 4W9HC 2FAUA 3LCLA 2WNKA 5LGZA 2QELA 2W0PA 3MNWB 4PI2A 2PW1B 3PAUA 32C2A 2F7PA 4N8UA 3TZFA 4PCPA 4Y9PA 4TVSa 3FO1B 3PJSB 4YN3A 2NX5B 4W85A 1IQWH 2C9UA 1BLNB 3DURB 4GRWH 2I1OA 4ANUA 1HESA 3FBKA 1Z9LA 4N8VG 2JJSA 2G50A 3S3JA 4JQIH 1MRDL 5MKGB 3ZX1A 2QAFA 2CMRL 3UG3A 2DTML 4L8DA 2EXTA 2ACUA 2DQGH 3QYCA 3HVNA 4X6EA 4PUWA 3AHYA 3KBEA 3QJQB 1IL1A 1Y0LB 3NQBA 3UXAA 4UTWA 2KUTA 2CNCA 1YPZA 2WB7A 4PJBE 3NBNA 2CLZA 3WKML 3ICJA 1FG9C 2IEPA 4LPTA 1IU1A 4XZHA 4M7SA 1N12A 3UJTH 4GW1A 3TSDA 4RNRA 1Z9SA 1BFVH 4WFFD 5KS9E 4CKQA 4U1GB 3DJRA 4AEEA 3GEWB 2XOTA 4GQ9L 2H0JA 1KM2A 3HPLA 4Z0XA 4M1DH 5J06A 3C8KA 5DC2A 4BY3A 1P4CA 1KBJA 3BT2H 2WQDA 5FM5O 4PWHA 4JFPB 3FQTA 2GJ6E 2Z0UA 3SOBH 1HZYA 2ZRXA 3QZEA 4OVXA 1DDHB 2VFDA 3ZSSA 4MA1C 1SEQH 4LF2A 3DX9B 4U1GC 4YHNA 4UFKA 2V0AA 2NY7L 1I8IA 3LEYH 3Q01A 1QOKA 2WQ8A 1H61A 3W38A 3GXTA 5ACZA 4GK8A 2JKIS 3RUGF 1U91A 4EPBC 3GEFA 1QPQA 4Q4OA 3P4NA 4OZFH 3F12B 2F18A 1O12A 3LI1A 5TE4H 4TNVF 3JV0A 1GOFA 3M43A 4R33A 1EVUA 3PP3H 2OJEB 2SEBA 1H5YA 3K1DA 3VXMA 5IVOA 4Y4KA 1WEJH 4NKOB 3W7DA 2OJZH 5C0AD 2NY5L 3OKLB 5DBUA 3UYPA 4ZX6A 3NN8A 1QG3A 4ABVA 1DWFM 3E2HB 2IH3B 4X63A 3DHPA 1A0QH 3Q6GL 2A7PA 4JHVA 3ARDB 4H0LC 4WHCA 5DC4B 5D9OA 4M56A 1R9ZA 3S4SB 3C6LA 3TYUA 4X2PA 4HWEH 1ODZA 3M88A 5E8OB 4BK5A 5F1NB 1BPVA 4IKJA 3WLBA 4DAGH 1XHGA 4ZXOA 1JV2A 1FFRA 4WNSA 5DEFB 4JPSA 1QASA 2WXPA 2X4NB 2X6AA 1XZWA 1IBDA 5DRXA 3KUMA 2QADB 5FHBH 3DO7A 2QDWA 3PZQA 3E2HC 5CGMA 5IGXL 4KRTA 4NIRA 5GS1C 4A3YA 5SWSA 4A66A 4P23D 3OVGA 4QWWC 1TSRA 3CFKB 1I9IL 5F3FA 4Z0JA 2PW1A 1SO4A 4FXGC 4P23A 3ONBA 2P7TA 1S78C 3PJSA 4DPCX 2NX5A 2ZZ6A 1QFWL 3FUNA 1BLNA 4HS6B 1MCHA 1B0RA 3VTAA 3E2RA 4NKMB 1IC7H 4FZEH 3VXOA 2NYYD 3SEPA 1KY7A 1PQZB 2DLGA 2TSAA 1SBSH 1QI5A 4ZS6D 4AK2A 2QADC 1PCSA 1NCIA 1E6ZA 5BW6A 1Y0LA 1A0EA 3WDHA 4NCDA 4OZ4B 2ZP0T 4PGJA 3R19A 3OB0H 4XVUC 2DP3A 1IE7C 4WHYH 4RDBA 1TJ1A 5K9KA 3GMRB 3BSZL 1KB9J 5D2NE 5L8KB 1EH9A 5BV7C 3CB8A 4LVDA 1UR0A 4KX9A 4P2CG 1XX1A 1LLZA 4H8WC 3VA8A 2A79A 1YPXA 4HPXA 2PW2A 3UTTB 5IBTL 2X0HA 4PZVA 4M6NL 4PBVC 2CDEA 1I1AB 2B9AA 3B1UA 2X1SA 2J21A 1MEWA 5F72S 1FE8L 3RB7A 3U0HA 3CIWA 5DLLA 3W5NA 2E47A 5B38B 3FNDA 2WV3A 5CD5C 1DDHA 4FL4B 2FGBA 3I10A 1XF4B 4G71B 5FGRA 1BBJA 3DX9A 3UBXB 1FL5B 1UCBH 1MJJB 1UWRA 3P9LA 5LWYH 2J1KA 2DUZA 1R3IH 5MEPA 2WXRA 2FLRT 1NLDL 4C6NA 4ZL1A 4F80A 3LOWA 3LMZA 4NSBA 4QRBA 3RAJH 3C6SB 3T8QA 1XTMA 1UXSB 4WW2B 3MUZ1 4XQ6A 2OJEA 2FJGA 3IJLA 4FL4C 5GSRB 3L5XH 4OW6A 3D2TA 4Q2ZB 4EMZA 4NKOA 4JZJA 1JZGA 1M65A 1AG6A 4HJUA 3MLZH 4N3TA 3LZPA 3OKLA 5GRJL 2UUDK 4P9HH 4F2EA 4D9LL 3SSJA 3C2RA 2G41A 5BUAA 4TNGA 4E5XB 3RDTD 1H3PL 1EAJA 4WHDA 2EKSA 3ARDA 5DVLA 3ULVE 1Q45A 5C5YA 5CUSL 3S4SA 2E5DA 3RVUC 1MFDH 1DTNA 4A2DA 2EEDA 4Y2DB 4X98B 1P5UB 1A6UL 3N04A 4WSKA 1W16A 3KNBB 4JRYB 2W6RA 1GYLA 5GS2D 1XGYL 1P1MA 1R2TA 5LNUA 2V68A 3CIQA 4DZHA 4RXGA 5I1JL 1DE4B 3B9EA 5HHPB 3EDKA 4H26B 5B1CA 2YLKA 1J88A 1RQBA 3HFYA 4X6CB 2X4NA 4AH2B 4F7TA 4F40A 4JJ5B 3KDNA 4V2XA 1V02E 3KLHD 1Q6GA 4QITA 4LTSA 2DQUH 3CFKA 3CQJA 1OAYH 4AY7A 1EWHA 1OG6A 3QWQB 5FA4A 2D3NA 1YNQA 1P5UC 2VE6B 1RK5A 3IGLA 4X9SA 1Q4WA 4HS6A 2Z2BA 1OWWA 3MREA 1EB3A 5C0CE 1W2VA 2VUOA 1H5VA 2CKBA 2MRYA 2JALA 4NKMA 4IBVA 3PGFH 4G8IB 3R7MA 4WJKB 3WS3B 3QGKC 3IJIA 2C5DC 4LHUD 2EDJA 3AZRA 3SGGA 2IKJA 4L9XA 3P4MA 4W6YB 1QBLL 1BMWA 5EKYA 3U9UA 5EPDA 3D7PA 4N2LA 4OZ4A 4WDXA 2O6DA 4UT6L 1S5HA 1IT9H 3CK0H 1NDGB 4PR5B 1TFHA 4NM4H 2V7NB 3GMRA 3JVFC 4KGJA 3K3QA 5FUCC 4M6ML 4ACYA 4JUTA 1LRQA 1JUFA 4ZDHB 3QISA 4XMLL 1E15A 3SECA 1QO5A 4R7DA 6REQB 3QR0A 4FQXD 4M3KB 3LDVA 3HAEG 1GZGA 4JQ3A 4KKCC 4IIQB 2XWTB 1THAA 2IOIA 2K45A 1VBGA 4JHAH 5C0QA 4FQXA 3QIWB 1E73M 3DXIA 1M3IA 1I1AA 2OB3A 4APXB 2AJSL 3TJPA 1U0QA 3LRHA 4Q14A 4BJLA 2DY2A 5B38A 3WF3A 3TQVA 2I9TA 2R9HC 5I71C 2BNRE 2QCCA 1MF2H 1XG4A 2FZ9A 4U6YB 5BQ7B 1ZP4A 1FL5A 1P0NA 1MJJA 1SVZA 4DTGH 3BGFB 2YJQA 3O3BB 2OR9H 3H7UA 3MR9A 2RGSA 1RUPL 3OJMB 2CBIA 1ZVSA 4Z8FH 4H88L 1U36A 3SBPA 4HHHA 1VAHA 2NNRA 3AISA 1UXSA 4WW2A 4KT2A 1BCIA 3OQEA 3MJ9H 5E5RB 5FV2A 1N7KA 2NX9A 1I7RB 4ML9A 3HZ3A 4BUGA 2R24A 5GSRA 1PL3A 2HNHA 2G3IA 1T04A 3GFYA 5C6TH 4LMQI 2HZGA 4HUUA 3JV6A 2UXFA 3O16A 1B2WL 3WNLA 3GLAA 5EA0H 3VVGA 5CU5A 1YJDC 4RA0C 1C7TA 4NJKA 4ADJA 4FQ2H 2XGIA 1QPKA 3FV9A 3F7YA 1EEPA 4F0HA 2WQUA 5AALA 3S5ZA 4HUVB 1UZGA 1CXHA 5GGSA 3O4LE 1NC4B 4HA1A 4DJDC 4Y2DA 3G5VB 3MJ6A 4Q8MA 2I60L 2GVYA 3KNBA 4JRYA 3ZTEA 3Q8BA 4DERA 2GTWA 4EXAA 3CZ8A 4C1LA 1ZGLP 3HG1A 3NH7L 1DE4A 1BQ5A 2V5SA 2PB1A 5HHPA 4H26A 5FKPA 3UXDA 1IEQA 4L1GA 5C08B 3CFEB 4X6CA 2EDKA 5I0DA 2XM2A 4N1EA 4JJ5A 2IW0A 3C8HA 4OZHE 3DTXB 3SDAB 1ISVA 1KB3A 4QTGA 4UUIA 2ZJSL 4ZQMA 1IGFL 5JHLH 1EZWA 3MO1A 5FL1A 3SHSA 5HQMA 4WUUA 1DBML 2C14A 2PGWA 4JVWA 2R27A 4ZMTA 4NOBA 1ZLVH 4B9FA 4UM9B 35C8L 3FT4B 5C2CA 4LSSL 1EO7A 2O5YL 1RFDL 1UYQA 4G8IA 1TEFA 4JPGA 3WS3A 5J3HD 4MJMA 4G8GE 4C7DA 3MU7A 3G6DH 4P2VA 4C4BA 1ZHBB 3BIKB 1OYCA 4PJ8C 1LOLA 1JZ7A 3OAYK 5E6ZA 2FWOB 3ARGB 4UZUA 2V5MA 3SGZA 1H5BA 1G9MC 3V5CA 4BI5A 2I27N 5AYUH 2VISA 4J5NA 3QI9A 1FPTH 3RX7A 4PR5A 1UBSA 1LWHA 2HLFD 5I0YA 1TPB1 4EF8A 1Q8JA 4M6QA 1O7DC 3OAUL 3JWOC 1LO0H 3MSRA 3MGOA 3PC0A 1BG9A 1DQMH 3WJYA 3KGUA 1W56A 4P2RD 1JZ6A 2X38A 2Y5TB 1ONXA 6REQA 1RZKL 1MWOA 2VCAA 2VR2A 2EDRA 1N9PA 2IQTA 4FOMA 4MKSA 1OARH 2YQBA 4IIQA 2XWTA 3ZRCC 2NCEA 5EU7E 1MEIA 3QIWA 2AK4D 3GFZA 4APXA 2A9BA 4OUOA 1KZQA 5E7FA 4PFEA 2A83B 2XX1A 1CE1H 1EDTA 4JKKA 4MKTA 1OW0A 4S3FA 4F58H 4KO7A 1O6IA 4RCXA 3VXUA 1KFJA 4DPRA 4U6YA 2DQDH 2BNQB 5REQA 5D96B 5F4SA 3A64A 3NGFA 3VTTA 4S3KA 4JX6A 5AOIA 3O3BA 2WTRA 3DDGA 2QKIC 1T83A 5AYIA 2X2IA 4KV5E 2A21A 2YPVH 1ZRQA 4IRSC 2H90A 1JCVA 4CNNA 2KAUC 2Y62A 3C5JB 4YHOH 4PV8B 5EIIB 2FX8L 5D1QE 1LLAA 3B0UX 4PJBB 3QS2A 3G1XA 5CSYA 5LA2A 5BJTA 1TXKA 4IDJL 4WKXA 3VI4E 5KS9B 3HRZC 1J5HA 3CT7A 3QHOA 2BSTB 3PUDA 2XXCB 5ANMB 5D1XE 4MD5B 2BZCA 1SO6A 4KDVA 4OTKA 5KS9F 1S7UB 2WZ6A 5LVEA 3IMUA 4B9KC 5I2UA 5KBKA 5ALBL 1V3IA 3PJXA 1PWLA 2VSCA 1FNLA 1DVQA 4FULA 2AFNA 1NC4A 2CSPA 3GI8H 5F1KC 3G5VA 4ZFZB 2JIWA 1JWSB 1UKQA 5B8CA 1MJ7L 2YB4A 2NW2B 4LNRB 4B5SA 1AY1L 2YBUA 1RJZB 4E8GA 3BYYA 3CFEA 5DD3H 3VRLE 3TX4A 1G7VA 4JZOB 4TVUA 3AAZB 4NQDB 3SDAA 3TP4A 1KLGB 4KZDH 2ON3A 5HDOA 4FP8H 2P0IA 2CRMA 1SFHA 2I9LB 4PJGF 3WF2A 4CCCA 3UZ5A 4H25A 3IMWA 1LDPH 3EH4B 4QBXA 2MPVA 1HOCA 1DUZA 4UM9A 2FSDA 3TVMD 5T1KA 2GJZB 3SGDH 2ZWYA 1FVPA 1QZNA 3KLDA 3F05A 3D09A 2BS71 4FC3E 4NUPA 1X5KA 1ZHBA 2NQZA 5EOTB 2VQTA 5HWJA 3VH8G 5ETUB 1FWRA 2X09A 4FIRA 5IB1B 3GIZH 1CPUA 2FWOA 1EGMA 3DGBA 2ZD0A 3ARGA 2PYED 3F5LA 2ZX5A 3QHZL 5SX5H 1W3KA 1SHWA 1YPZE 4B7LA 2VZUA 2PFHA 4JDBA 4IW4C 1O75A 2XV0A 2E3VA 2HPTA 3T6WA 1KIPA 4YZWA 3NIGE 1NSJA 3U5YA 3TZVC 3WCYA 1EMTL 3VG9C 3F6JA 2AJVL 2IALA 3WY2A 4KH9A 4EKJA 3FCSA 1I1YB 4NFCA 4EX4A 1BXCA 2P24B 3AS1A 2J77A 5HGHB 2OZNA 4UTBA 3N2OA 3WAJA 2IXUA 3U8GA 2PDIA 4TQEL 4R26H 5LHDA 1JGMA 1E6OH 1NAL1 3SCPA 3B1TA 4NP4L 2BNQA 2EZ0C 4QE4A 3BWSA 1ZV2A 3WCZA 1CLOL 2XSBA 1NBVH 4IMLA 2DYRB 3EO1B 4C6OA 4XNAA 3CE1A 2WXMA 2OXGB 2WVSA 3K2MC 3TKFA 4EBQH 2C13A 4CA4A 4DKAA 3TC9A 15C8L 5IF0B 5IVXB 3QYSA 3SDDD 3I3EA 5EZIL 3VD4A 1NLBH 4LESA 1DQLH 2ZCKH 4MJZA 4ZUTB 1F6LL 1CMOA 4PV8A 5EIIA 1TQWA 3SN4A 1DWJM 3P5ZA 3N19B 5BNKA 3VXME 1XUUA 5AVQB 3HMXL 5D2NB 1C1EL 3IJDA 5K1VA 1B4LA 5TQLA 3BDYL 1P9MA 3LIZH 5ANMA 4NUGH 4LB4A 4MD5A 5JQHC 4AG4H 2PYFB 1J10A 3KTCA 2PTYA 5HGGS 3K2UH 1TZOA 4MLSA 1MFVA 3DOSB 4A8RA 2KLSA 1UPPA 1ZKAA 3M7OA 3L4WA 2V8ZA 1ET8A 2WLLB 2NV1A 2NNXA 3HUJA 4RV8A 1JHLH 4BE6A 1JWSA 3B8WA 1Q9OA 2NW2A 4LNRA 3OV6A 4NS0A 4R7JA 1RJZA 4P0DA 5D2NC 1AJZA 4ZW5A 4Q33A 4GBXD 3I6GB 3WH9A 4JZOA 1P1ZB 4O2EA 4NQDA 3HR6A 3EFFA 3IEAA 4QPEA 2YK1H 1MELA 4JGJA 2VQ1B 4KOBA 1JFXA 4ENEC 3O11A 4WDTA 1HJXA 1X1NA 3OZPA 5SWSE 1EERB 2H6PB 3WF1A 5CZRA 3OA3A 4CBPA 2DJMA 4EF3A 5D7JD 1Z5YD 4IP5A 3QCVL 4ZNCD 3UFYA 1CS6A 2GJZA 2NX5E 3S36X 3B05A 1C5DB 5DRIA 2W92A 5LCVH 4B5XA 3CC5A 4YHYB 2ZAGA 4O15A 3S46A 1CGWA 2CGZA 3L81A 1XGZA 1XBRA 5EOTA 3LMYA 1IT0A 1A5CA 3PJLA 3FB6B 1R6VA 4DEPB 1R7AA 2ZAHA 1EJFA 3T6CA 3QJAA 3GQYA 1K5WA 1DDTA 5T1DL 2F53D 1YRKA 3D05A 5EMMA 1KTLB 3ULVF 4RVBA 1Q4NX 2F53A 1YXCA 2OODA 1OTSD 3FYPA 2D2HA 5HJLA 4IOFD 3UTSD 2WINA 2NTSP 3L16A 2A4EA 3DRTB 2E9BA 1WHOA 1TIWA 1J11A 2CXGA 5SX4I 5B22A 1PE1A 1I1YA 2FUQA 2G3NA 4ODHH 1I9JL 3HPFA 2FNBA 2P24A 3W70A 1IGSA 1AZVA 4Z1AA 4JPWL 5HGHA 3ULVC 3F04A 5H94A 2ZVRA 4PWKA 5FYKH 3SDYL 1AXTH 4HLZH 3COTA 1RAMA 3I6SA 4PSPA 2VWEE 3UADA 5JA8B 4WO0A 2J79A 5C0CB 1F6AB 1CI3M 1YZZA 4IRJD 2QUNA 3QZPA 5K39B 1PCKA 3WEXB 1N5AB 2UYLB 2P80D 4YE4L 4ZUVB 2ODHA 2QHRL 3OLEA 4RW3A 3QSTA 5IF0A 1SDAB 5IVXA