1JDAA

Maltotetraose-forming exo-amylase
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
total genus 136
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jdaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jdaA01
1JXJA 3BLPX 4OOZA 3CHDA 3DC0A 4AW7A 6CGTA 2WLZA 2VVNA 3O2LA 2XM2A 5HPOA 3VMOA 5BROA 4F66A 3HG4A 3IJ7A 5IHRA 1I1WA 3L4XA 1ZBCA 2YA0A 5I6SA 3PHAA 2XIIA 1H1NA 1JL8A 5M17A 3VX1A 3KL5A 4NRSA 1TZ7A 1E4NA 4HZ8A 3OLDA 2JFEX 4ZXLA 4JHZA 3BUDA 4AMXA 3BVXA 4XUYA 4FLOA 1C7TA 4UOZA 2VZUA 3WDPP 1VJZA 2J8FA 2BY1A 1AQHA 2WCGA 4TOQA 4JFSA 2FHCA 1ZS2A 4L4PA 2GDVA 4AZCA 4NRRA 3K46A 1OINA 5EMYA 5FIPA 2J7DA 3OLIA 5BCAA 5GNYA 4Q7NA 1ISZA 1E73M 1R47A 1V3LA 3UG4A 2RGMA 3AICA 1JYVA 4GZEA 3F5KA 2EBNA 3QHNA 4PSPA 2NSXA 3VM7A 1OBAA 5IFPA 2Y2WA 4MNMA 4DUWA 4HMDA 3ARWA 4PEEA 2WK2A 1XCWA 4KGLA 4FNRA 2D0FA 4J7RA 1W9VA 3FAXA 2W91A 1R33A 5DEZA 2F7RA 3EDKA 3ZR6A 5I77A 2BHUA 3FY1A 1WO2A 3VGBA 5JBFA 4UFKA 1QBBA 2DSKA 2WMJA 1XRVA 4GO9A 1FA2A 3SCNA 2J74A 3DYMA 1X6NA 4ZEPA 2ZIDA 1E15A 4DUVA 3VIFA 4Z2LA 4AZIA 4JKKA 3AS2A 1G5AA 2F7OA 3K1DA 1W1PA 2CETA 4FF5A 1KXVA 5I24A 3CZNA 5I5RA 1D7FA 3IANA 5D8ZA 2JIEA 4PTMA 3BUIA 5E6ZA 2D20A 2V3FA 1NWUA 2ZICA 4GI6A 4H8VA 3WY4A 4C7GA 3BAIA 2GVYA 3S2CA 3AIEA 4PMOA 1BYAA 4H7VA 2D1ZA 4FNQA 3MKKA 2YFOA 1GCYA 1F4HA 3GXDA 5BRPA 4BQ4A 3WQWA 4B15A 2VMFA 3SIMA 2W66A 3A6OA 3VUPA 3WH8A 4NXKA 1GOIA 4M8UA 3VD9A 4ZXOA 4GO8A 1ITXA 4W84A 2XHYA 3AYSA 5F7UA 4F8XA 3T2PA 1BQCA 4CKQA 3VSUA 3APGA 4W87A 5A2CA 5E70A 3EYPA 1EXPA 2WKGA 1Q6EA 1EQPA 1GNXA 4UTFA 3OIHA 3ZJ8A 1GORA 3MMUA 4KRUA 1L8NA 1HKJA 2O9OA 4XX6A 4OBRA 2VR5A 5DO8A 3EJTA 5E6YA 2JEQA 4LPCA 1HKMA 2Y8VA 3AMKA 5DFAA 3WIJA 4M80A 2WZEA 4XB3A 1LL4A 3ARVA 3GDBA 1R75A 4W7WA 1OT1A 1QHPA 1CLXA 5C71A 4BCEA 4J3VA 4BS0A 1CBGA 2VRQA 3L4ZA 3UR8A 3VD7A 1ECEA 7A3HA 3T2QA 2G4FA 4W88A 3OG2A 1EOKA 4HOWA 5AC5A 3ARQA 2OLHA 5EBAA 1Q6GA 4AEEA 4DM2A 5A6BA 5EFFA 3CZGA 4Z2KA 3GXMA 1IZKA 4XZBA 1BTCA 4NI3A 4FMVA 1UR2A 5CG0A 2BY3A 5CSYA 2CBUA 3AROA 1QWUA 3GM8A 2YL8A 1UUQA 1XC6A 2XIBA 1TG7A 3BAYA 3GNOA 1NP0A 3FN9A 1V6UA 1US3A 5KZ6A 3WBEA 5E1QA 4HU0A 2EABA 4EE9A 3ARUA 2RGLA 2ZXQA 3O6AA 1ODUA 2CXGA 1TA3B 3CHFA 4WF7A 2UWFA 2D23A 1E6NA 4U3CA 3VGEA 4A4AA 4A3YA 2JALA 4AMWA 3VD5A 4F9DA 4CCDA 1KXHA 3GBEA 4PN2A 4JHOA 4FNSA 2XYLA 4J27A 3WH7A 2ZE0A 3WF3A 3ZSTA 3LXAA 1UD5A 2B31A 2QMJA 1FHLA 1EO5A 4TXEA 3OA5A 4MB1A 3H55A 4AIUA 1UA7A 1JAKA 2FDMA 2CERA 1E0XA 4BZYA 1J11A 1UR0A 1UWRA 4CN1A 2CHNA 1XH0A 5A6JA 4HMEA 1J0HA 3IAPA 3CV5A 3WD3A 2F2HA 3U57A 3BH4A 1EQCA 4NXSA 3N04A 3W27A 5FL1A 4GIAA 1CNVA 4GI9A 3FXYA 1JD9A 4TX8A 1TQWA 3S5ZA 2EACA 2CKRA 3ZO9A 1CGYA 4HMCA 1LJYA 4ATDA 1CGXA 1B3WA 4P7OA 1MYRA 2CKSA 3WDHA 2OYMA 1VEOA 2JIWA 3SUSA 1CLVA 3TTSA 3HMCA 2J8GA 1MQQA 2WZHA 3N12A 1U30A 4AWEA 2BXZA 1EDGA 3GH4A 3NSMA 3B9DA 5AY7A 1MW3A 1QW8A 2YA2A 3WY1A 1CXLA 1GJWA 5E0FA 8CGTA 2WVTA 2UY5A 2WMGA 2D0HA 1HJUA 4UR9A 3SUWA 1LL7A 2WVVA 1UKSA 3DX0A 1BSIA 2WMHA 4MJ4A 3AXIA 1XSKA 1OSEA 2ZUMA 4PBGA 1WDPA 3CPUA 4NSBA 4Q22A 2WVSA 3CUJA 1E3XA 2W61A 1JZ8A 5GQBA 2BHZA 2VR4A 3EJQA 2W5FA 5AC4A 4OBSA 2VZOA 1K9DA 1NARA 4ZFMA 4EANA 1IV8A 1SMAA 3RJYA 3NIYA 1TR1A 4QLKA 1TQTA 1GHSA 1C91A 2XGBA 2AMGA 1ZL1A 3EDJA 4H04A 4UQBA 2EXOA 1A47A 5LA1A 3RM8A 3AHYA 4PMYA 3MUZ1 4TVUA 1CYGA 1W91A 4RE4A 2BVYA 1X1NA 2ZWZA 4AZ5A 2WAGA 3VGGA 2YL6A 2ZOXA 1JDCA 2HISA 2WYSA 3WDIA 1KWKA 3VU2A 3T09A 1VFMA 1E6SM 3SUTA 3ARYA 1TE1A 3DECA 1JZ6A 1LQ0A 5GNZA 4QAWA 2AAAA 1UR8A 5EB8A 4EK7A 1C8YA 2J7FA 5E09A 3VM5A 3F5JA 2X2IA 3BLKA 3AZSA 3W26A 2XWDA 4HZ6A 2D0GA 4JKLA 3WH6A 2IGTA 3SCUA 3WD1A 1ISXA 1RP8A 4E8CA 4RL3A 1KWGA 5D4YA 4V28A 1GUVA 5A8MA 4UOQA 5FD0A 1FP8A 4W8BA 2X2JA 4AD2A 3S6TA 3WMCA 3BUBA 4H8UA 3NYDA 2WM0A 4P8XA 1FFQA 2E9MA 1VIWA 3OGSA 3DX4A 3AIUA 4A3HA 1BG4A 1GONA 1PX3A 4JFUA 2HVMA 3CUGA 2FHBA 5A6SA 4TTGA 3VDAA 1QI4A 4NZCA 1ZB5A 2DPEA 1W1VA 3FHAA 2V5CA 4P8WA 1E5NA 2DH3A 1CENA 1KQYA 3NSNA 4P7NA 2J75A 3WNPA 1JIBA 4KH2A 1UH4A 3WELA 1C90A 3RM4A 1EHAA 2CCRA 2BNJA 5HOSA 1JG9A 3WSUA 4EKJA 5A2BA 2VURA 3BVVA 5D9OA 1E72M 3K8MA 4S3KA 2PWEA 2XSAA 1CWYA 2FGLA 2GJXB 1V03A 2WMKA 2XM1A 3A4WA 5IHSA 1ZJAA 3AHVA 1GQKA 5AYIA 4D6GA 1V02A 3IAQA 2WHJA 1XD1A 2Y24A 2EAEA 4CUCA 1H5VA 3N13A 4QCEA 1FHDA 2VRKA 1B3XA 1OD0A 4U5KA 3A24A 3AHXA 3TTYA 3T0DA 3NCOA 3AMGA 2QLYA 5ABFB 2OSWA 1I1XA 4NF7A 4UFMA 1AVAA 5C70A 4TVDA 1H0GA 3SCWA 4J3TA 2V3GA 5A2AA 1ISWA 2OYLA 4MTVA 5A6KA 1UKPA 3DHUA 3EJUA 4EAMA 1CXIA 1MFVA 2QMKA 5FOOA 4MB3A 2DSUA 5JUVA 4YHGA 3MUAA 1Y7VA 3PZOA 1G94A 2G3NA 1E1FA 4MB5A 1C7SA 3PBGA 3BUPA 2J7CA 1HXJA 2WC3A 3WQVA 4D71A 3WN6A 4TUFA 1TQVA 1BLIA 4PUEA 3CGTA 2X2HA 1XYZA 4MJ2A 2X0YA 1O6IA 1QOXA 2Z1SA 5EFDA 4LX4A 3O9NA 2WVUA 1OWQA 5BXPA 2ZUUA 4X0VA 1V08A 2YL5A 1SR0A 4LYQA 4WIWA 4Y7EA 3H54A 1KCKA 4AZ7A 4UQCA 3WEZA 4L4OA 2VZSA 1QHZA 4QP0A 4E4PA 2D3LA 2E9LA 5E0CA 3LRLA 3BMWA 3G6MA 1V0KA 1H3GA 4P7LA 4AC1X 1JAEA 4CN6A 3I3BA 3JUGA 1J0IA 1W9UA 3A4XA 4KMQA 4HU8A 1FH9A 1R87A 2DH2A 2A3BA 3MS8A 3BAJA 3EDEA 1W2VA 2WZIA 3AOFA 2EJ1A 1W3KA 1DEDA 3ZT5A 3K8LA 1JDDA 3AHTA 3WQ5A 2YJQA 1DWHM 1E6XM 4UFJA 3BC9A 2Z1KA 5BXSA 1GPFA 3WNKA 5FKYA 1BYBA 5BXRA 2WKLA 3AS3A 2WMIA 1OIFA 3RIKA 4PMQA 3VVGA 2XSBA 3D5HA 3VSVA 2OWWA 4Z2JA 4AD4A 5BYWA 3AMLA 4U5IA 2NT1A 1LL6A 2GJRA 1S46A 2DIJA 1U2YA 3OGVA 1XGZA 1Q6DA 3A5VA 4XZWA 1HP5A 1R8LA 4D1IA 2CNCA 1WKYA 1KTBA 4PTWA 3LPGA 4QFUA 3WUEA 1GVIA 2X2YA 1HXKA 4ACZB 1EGZA 1J0KA 2CESA 4OOUA 4BQ3A 3IK2A 4LXFA 4W5ZA 1EH9A 3N15A 3VIJA 3E1F1 3K4AA 3PZTA 4MNLA 2ESCA 4UQEA 3WUBA 1Q4NX 4AXNA 5I23A 1UASA 2XVLA 3ALFA 2J7GA 2BXYA 3RDKA 4PYSA 4YN5A 2D73A 4B3KA 3AJ7A 1MXGA 1QBAA 3DYOA 2WCSA 1GOQA 3PTQA 1AQMA 4S3JA 3QHOA 3WD0A 1KGUA 3UG5A 1K9FA 3VKKA 2OSYA 4ATWA 4AZCB 3L4VA 3LMYA 3QGVA 4NZJA 2WC4A 3WH9A 1CEOA 2FH8A 1V6XA 1UH3A 4HPGA 3SURA 3SCRA 3ZR5A 3MU7A 5D8WA 1JZ5A 4GXPA 4XV0A 1R86A 1FFRA 1RH9A 1VFFA 1BVZA 4PMZA 3CIVA 1BGGA 2ZUNA 4WKHA 3VINA 1GJUA 1E6PA 1ODZA 3KEHA 1FH8A 3UCQA 4ATLA 2VCBA 1XV8A 4LYPA 1CXKA 1HKIA 1HX0A 1K6AA 2E9BA 1E6ZA 4P8UA 4GKLA 1KQZA 2XFFA 1U33A 4HP5A 3NDYA 1EIBA 1NWTA 3T0BA 4FNTA 1IT0A 2YOCA 4HA3A 4ZENA 1IZJA 5CSUA 4GINA 1FP9A 3DDFA 1PJ9A 3GYCA 4AMCA 1GQJA 2VX7A 4AD1A 3WNNA 2WLYA 3BAKA 3TTOA 1HP4A 1WDSA 1AQ0A 3CHCA 1QHOA 2XJ7A 3M6DA 4B16A 1US2A 4GQQA 2XVPA 4DUXA 3AFBA 1OB0A 3IJ8A 4WLCA 3WD2A 4FNUA 2C7FA 2VUYA 3VSTA 1QNRA 2ZUSA 2ZUWA 2CITA 1E4IA 3RMEA 2XWEA 3OLGA 3CZLA 5GNXA 3AS1A 3WEOA 3WMSA 2VO5A 1BG9A 3ZJKA 3MMWA 2YDRA 4HZ7A 4AISA 3ARXA 1CECA 1CTNA 3VGHA 1UR9A 1HWWA 1C92A 1KR0A 4J3SA 1TA3A 1UD6A 4U2YA 2VX4A 3QOMA 4DO4A 5A8PA 1KXTA 4PMVA 2W92A 4DWSA 4IM4A 3BVWA 3HG3A 1W9XA 2GDUA 3EDFA 1BYCA 2XG9A 2CYGA 3PN8A 1O7AA 1M01A 1D2KA 1DWFM 3EMQA 4GZIA 4M81A 1UWUA 4D72A 3CTTA 2W67A 2ZWYA 5HNNA 1JZ7A 1CXHA 1HJVA 2WHLA 3WH5A 2J47A 2EPOA 2G3IA 1ISYA 2WNWA 1CXEA 5CPSA 1ZBVA 2IXVA 5I2UA 1P6WA 2WPGA 4UFIA 5A3HA 3DX2A 4JFVA 3U7BA 5ABFA 1EDTA 1UKTA 2ZX5A 6TAAA 4AZGA 3AS0A 4UOJA 3GXPA 1DP0A 2F8QA 1BF2A 2XVKA 1W32A 4HA4A 3GXFA 2VL4A 2J7EA 3W25A 1QI3A 4PMRA 3SCSA 1ISVA 3TP4A 1JDAA 1UD3A 5E9AA 5BXTA 4Z2GA 1MWOA 3NJ3A 3CUIA 4WK9A 3L4WA 2WW5A 3RILA 3WBAA 1W3LA 4B3LA 4AD5A 1NP2A 2VX6A 3MI6A 3G6LA 4BQ2A 2DQXA 4U3AA 1B1YA 1WZKA 3CH9A 5I3DA 2DSWA 1WCGA 1R7AA 2DSVA 2WANA 2XUCA 4V27A 1LLOA 3U7VA 2VTFA 1KFWA 2DT2A 5A94A 1M7XA 3GH5A 1PIFA 4WSKA 4F9JA 1QWNA 3WMBA 4OKDA 1BHGA 1NOFA 2V38A 3CBWA 2UY3A 4QLJA 1WZMA 3MMDA 1VENA 2GK1A 1EHNA 3VGFA 1YHTA 4GPNA 1CGWA 3GNRA 1H09A 4WKAA 3DHPA 3WNOA 3CC1A 1V3JA 1W1YA 1KB3A 1R34A 4PTVA 3A22A 4W8AA 2OWCA 3WF1A 1E70M 2F1AA 2E4TA 1CGTA 1OGGA 2WWDA 3LXCA 1Z32X 3QOKA 3T08A 2YBTA 1OIMA 3DX1A 5CZKA 3W29A 2FHFA 3SCOA 4KWUA 3KLLA 1JXKA 1UKQA 4AYGA 1LG2A 3W0KA 2F7PA 2JF6A 4DWSC 3WF4A 2FGZA 3BMVA 3ZQ9A 2IXUA 2GUYA 1B9ZA 4UQ9A 1UR1A 4QCFA 1J0JA 3L4UA 1JD7A 4M56A 3AXHA 3B8SA 4X0NA 3VDBA 5CJ5A 4C7FA 4PUDA 5KEZA 1VB9A 1BFNA 1E4LA 5A6AA 4OJYA 5C8BB 3A21A 1EA9C 3F4VA 1H11A 3MANA 3VIOA 2PWGA 2D2OA 3AQUA 2EQDA 1OD8A 2ZX7A 3L2MA 1E55A 5CPQA 1W1TA 5HPCA 1VBUA 1UKOA 1GOMA 5A8QA 4Z2IA 2EPNA 3GH7A 4CD4A 3MSDA 1E43A 1V3MA 4FLSA 1E40A 1WZLA 4CD6A 2WSPA 3HG2A 2O92A 4UQAA 2WC7A 3VPLA 1K9EA 2J4GA 2X0HA 2V3EA 4PCSA 4J3WA 2ZX9A 3WQ6A 2XTKA 2V3DA 3M07A 5A6MA 1DHKA 1G9HA 3ARPA 2NT0A 3WQ8A 1C8XA 3L2LA 1F4AA 4N42A 2UY4A 3UESA 3ZIZA 1E6QM 4CVWA 3D4YA 3CUFA 2ZX8A 4CCEA 1ESWA 1LF1A 3ARRA 2XFYA 3FNDA 4M82A 3ZMRA 4AIEA 2VX5A 1KTCA 1PS3A 2QHAA 1DWAM 1QI2A 5CGTA 1JZ2A 3KL3A 5ECUA 4RE2A 4D6JA 1J9YA 4H41A 1HL8A 1CDGA 1V3IA 1W9PA 5M3WA 1JI2A 4D6EA 5JBDA 1HTYA 4W7VA 1B31A 3HG5A 3BSHA 3WNLA 2E3ZA 1MXDA 2DIEA 3SCTA 4CN4A 3ZJ6A 2ZXBA 4LQ1A 1BYDA 4ZE4A 1HIZA 5HBFA 1TUXA 3L4YA 3I3DA 2QV4A 1JFHA 2PWHA 3VIKA 5I78A 1J0ZA 2DT0A 1OGBA 4URIA 3W24A 1KCLA 1V3HA 3W4RA 1OM0A 1XCXA 1FOBA 3KZSA 3ARTA 2J7HA 3OB8A 1TCMA 4CGTA 3D52A 3BCDA 2O9PA 5A8OA 3SCQA 4YHEA 3LX9A 1E9LA 2ZUTA 2EO7A 2EADA 1VEMA 5FL0A 4JFTA 3LPFA 3RPMA 1W9BM 4BA0A 2WSKA 3T0AA 1Q6CA 2FYVA 3GXNA 3GTNA 3BVUA 2WWCA 3CHEA 3PZVA 1NWRA 4DO5A 2UY2A 1WE5A 1UD4A 1N82A 1HN1A 2PF0A 3BLBA 5ABGA 1QNPA 1NOUA 3VOCA 4W93A 2E40A 4UCFA 5A69A 4AZ6A 1PEZA 1WP6A 3GNPA 5GPRA 5IDIA 2VRJA 3K4DA 2OW7A 4M29A 1R7OA 1B3VA 2BY0A 2NW0A 3FW6A 1JGIA 1XH1A 3KWXA 1V0MA 3W81A 1E71M 3THCA 2DSZA 2XN1A 2XN0A 2JEPA 1LWJA 1JI1A 3OGRA 4MPKA 4CU7A 1GHRA 2CIPA 1CGVA 1WPCA 4U31A 3D51A 1V0LA 3T2OA 3SEPA 3VTRA 5CLTA 1B3YA 1UD8A 4KGJA 1JF5A 3H53A 1OCQA 4MB4A 2X05A 4ACZA 1QX1A 1H2JA 3AIWA 3TTQA 2JE8A 1HVQA 5I0DA 1J12A 3U5UA 4D6CA 2BY2A 4DWSB 3A23A 1VEPA 1QPKA 2W4XA 3MV01 1J0YA 3WENA 2X8RA 2OYKA 4K68A 4OUEA 3MUIA 4AZHA 4UFLA 2ALWA 1PX4A 3MV11 1PPIA 2WHMA 4AD0A 1HJQA 4AD3A 1OT2A 1HKKA 4IUGA 2V5DA 1VFOA 3OBAA 1KGXA 3WY3A 1GOOA 3W82A 2E8ZA 1ZBWA 3VGDA 2YBUA 3OZOA 2VC9A 4H2CA 3BAWA 2PBOA 5HDRA 3CZEA 3QHMA 1UWTA 5I79A 3WFLA 3ZSSA 3VX0A 3EMCA 1BAGA 4HPHA 3WD4A 4QDMA 1UG6A 2GSJA 5IFTA 1PBGA 1V02E 5LYRA 1PZ2A 4WJXA 2XN2A 3W6LA 2DDXA 1E3ZA 2BS9A 4OZOA 1X6LA 1G1YA 4QLLA 3ECQA 3WNMA 2YKKA 4IPNB 2W63A 3VNYA 3W37A 5CQ1A 5JBEA 4ZE5A 2G3JA 2QF8A 1JZ4A 3WL0A 5ABEA 3VILA 1LG1A 3VDHA 4PRWA 1GQLA 1GOWA 3GXIA 1UH2A 3RCNA 2WBGA 2VQTA 5AYBA 2X1IA 3VD4A 1HT6A 3PTKA 4UZSA 3S5YA 3N9KA 2YL9A 2OSXA 1GVYA 3RJXA 5CGMA 3WUGA 1VJSA 4TX6A 4IISA 1PZ3A 3A47A 4CCCA 2PWDA 5A1AA 3SUUA 4D6DA 2O9RA 3CUHA 1GZJA 3ZOAA 3K8KA 3UEQA 3VMPA 4PMXA 3KLKA 4PMDA 3AIRA 2VCAA 1I75A 3TV8A 3ALGA 1JYWA 1E5JA 3W53A 2J79A 1M04A 2J25A 3W6MA 2G41A 4E2OA 2MANA 1UYQA 3TA9A 3AIVA 4MAVA 5LA0A 2YIHA 3UG3A 3FHQA 4HOZA 2EPLX 4W85A 2GK1B 3HZ3A 3AHZA 3AMCA 4LGXA 4NX0A 3M46A 3OLEA 1MW0A 3PZUA 2PB1A 3BXWA 3HJEA 2Y4SA 2YA1A 3J7HA 3ZT7A 1SFSA 1SZNA 1QNSA 3PZIA 1VF8A 1UZ4A 3M7SA 1UWQA 3AISA 4GQRA 5HXMA 4JFWA 3VIMA 4FLRA 1E0VA 4R27A 4JCMA 4UNIA 1GQIA 1HJWA 5JIWA 3WL1A 2OWXA 1WNOA 1TVNA 4MNJA 4CD7A 5CPTA 4AIOA 4M1RA 3II1A 3SCPA 5IXEA 1UHVA 1H41A 4W86A 2WBKA 3VDCA 4CU8A 1LWHA 3TONA 1NM9A 2VT0A 4C7DA 1UA3A 1QI0A 2AOSA 1VFUA 4R5EA 3AMDA 3A4AA 3NUKA 2CBIA 4D1JA 3IGUA 1L0PA 1XSIA 3DYPA 2WMIB 3PTMA 1W3HA 1BGAA 3MUY1 4MADA 3EBVA 2F1BA 5FCZA 2PBGA 2WB5A 1ZJBA 2J78A 1JNDA 3SUVA 3AXXA 4D6HA 2J62A 1W9DM 1R46A 2EEXA 2EPMX 2YDQA 2A3HA 2VJXA 1JFXA 3EJSA 2D22A 4F79A 2E8YA 3POHA 2ZXAA 4E8DA 1HNYA 1CGUA 2DEPA 2VZVA 3ARSA 1QVBA 3UERA 3POCA 3VO0A 3N11A 1B3ZA 4H8HA 4J28A 5BWFA 1W3JA 1ZU8A 3AIQA 1SYTA 4X9YA 3L4TA 4W7UA 7TAAA 1XSJA 2XPKA 3EDDA 3VIPA 3WQ4A 4AY1A 3IJ9A 1QNOA 4BQ5A 2QPSA 7CGTA 1QW9A 2WVVB 3PZGA 3BAXA 2J7BA 1V6YA 3D50A 2VOTA 1JF6A 2G3MA 4JL1A 3DDGA 1CZ1A 2XVGA 1E56A 4JCLA 3TOPA 2WXDM 1E0WA 4IPLA 4DM1A 2YFNA 3WDQA 3DX3A 2XFRA 1TMQA 4B9YA 1CIUA 5M5DA 4FLQA 3VD3A 1G01A 1HL9A 4P8VA 1DWJM 3PZQA 4RE3A 1MW1A 1BVNP 3PZMA 3MO4A 1TFVA 2YDSA 2VI0A 3HN3A 1NH6A 3LXBA 3ARZA 3AIBA 3PZNA 3VIIA 2F61A 1J10A 3QR3A 4PCTA 1T0OA 1KGWA 3THDA 1E4MM 2F7QA 1KBBA 1Q6FA 3WUFA 1O7DC 1R85A 3WFZA 1VAHA 2GFTA 3GXTA 1NOWA 1QNQA 4UFHA 1B2YA 2GJXA 3A3HA 3U5YA 1XH2A 4UQDA 1PIGA 3WDRA 2ZX6A 2QPUA 3AI0A 4HTYA 9CGTA 1JNEA 3BCFA 1B0IA 3WF0A 2DT3A 1CPUA 2CPUA 3FAWA 2DGAA 1M53A 3WKZA 1NQ6A 8A3HA 3WDJA 2BVTA 2OW6A 2C8NA 1JZ3A 4JIEA 1KXQA 1C8QA 1UQZA 1W2PA 4LYRA 1UD2A 2C0HA 1MVYA 2E0PA 4D6IA 1RD6A 1MFUA 1V0NA 4GZJA 2DT1A 3AZTA 1G0CA 5D9PA 4KRTA 2XVNA 3GZAA 4ACYA 3WF2A 4NZFA 1H4PA 1J18A 1MQPA 5BRQA 4CD5A 1HVXA 2PC8A 2Y8KA 1AMYA 2J77A 1GW1A 4B9ZA 1MQRA 2IUZA 4WSJA 1TQSA 1UOKA 1ITCA 4PTXA 1HJSA 2YLLA 3CLWA 4OGZA 2GJPA 5DF0A 1KBKA 3NDZA 2ZUVA 3W38A 3BUQA 4WKFA 2CBJA 5A95A 1ZBKA 4UZUA 2WHKA 4JKMA 1WDRA 3ZM8A 1UR4A 5ABHA 5A6BD 2Y5EA 1V6VA 2F18A 3VNZA 3LRMA 4W5UA 1J01A 1XYFA 2VCCA 3N1AA 1EDQA 2WCAA 4YPJA 1DWIM 4TTUA 1CXFA 4BF7A 3EJPA 4JL2A 2JF7A 4DO6A 3RO8A 1E1EA 4CVUA 1D3CA 4MDPA 1HJXA 1BPLB 2BFGA 2A3AA 4TVCA 1EO7A 2CBVA 4JZ5A 4D6FA 3ZJ7A 3CMGA 4AZBA 3EJRA 4U2ZA 1DWGM 1EOMA 4PSRA 2CHOA 1GOKA 4HOXA 4FNPA 1UQYA 1NWSA 4CU6A 1TQUA 4AEFA 4U33A 1UZ1A 2VQUA 2TAAA 2BVDA 1A3HA 2FE0A 5CXPA 3RM9A 3CZ8A 2G8ZA 3GBDA 3BVTA 3WY2A 1E6RA 1WDQA 4P7RA 1B30A 4V2XA 1KR1A 3WEMA 3AYRA 3D4ZA 2YLAA 3KE0A 3I3EA 3AZRA 3OZPA 1OGSA 1HF6A 5A8NA 4GI8A 2O9TA 5JIPA 3UETA 3N17A 5DMYA 1FH7A 1JYXA 2PWFA 3HU7A 4JAWA 1WB0A 3KL0A 1DTUA 3CO4A 5D9MA 4P7QA 1K9TA 1PAMA 4CD8A 5DT5A 3BGAA 1RP9A 3CMJA 2EPKX 5DT7A 2X09A 3VIHA 3CZJA 2ZXDA 3N18A 2VVSA 1C3FA 2FH6A 4M24A 5LA2A 2A3CA 1SMDA 3B9AA 1VRXA 1YQ2A 1M03A 1V6WA 2XGIA 3NSXA 3PZ9A 3VIGA 3CZSA 1MW2A 5M03A 1PX8A 3MSGA 6A3HA 1TVPA 1B90A 4FK9A 1UWSA 3W28A 3LPPA 4J3XA 3SCVA 4ML4A 4W89A 2W62A 2BHYA 3F5LA 1V3KA 2CEQA 3B9EA 3BSGA 4Z2HA 1WAWA 4PMUA 4N0RA 3EMZA 2D24A 1QI5A 1VBRA 3LPOA 5TD4A 4DWSD 2Q8XA 2D3NA 2VNCA 4PMNA 4MAZA 3CZKA 5A6LA 1RPKA 2BV9A 1H0IA 1H49A 1XHGA 3UR7A 2WMFA 2PI6A 4MNKA 1C93A 5CLWA 1JYNA 1XD0A 5D9NA 3VMNA 4J3UA 2A3EA 4W8LA 3LRKA 3ZT6A 4AYSA 1UWIA 2VZTA 4MDOA 4HA1A 4OIFA 1WZAA 3D3AA
chains in the Genus database with same CATH superfamily
3PABB 3BLPX 4JEGB 4ADTA 1ND0B 3LMJH 2NQHA 2JB6B 4I0PA 3AXMA 3EX6A 3NSFA 2HT3D 1LE9A 3P3BA 4GY1A 4JJ5B 4B91A 2JKEA 4Y5XC 1QU4A 2ABAA 2Q7NA 3THQA 1MDAA 2WO4A 3B37A 1YEYA 5F44A 4KTGA 5BROA 4F66A 2JKJA 4PRPE 1E67A 1SLWA 5BRZB 5H37G 3G9VA 2LU4A 3D07A 4EOWH 1FHUA 3N55A 3IJ7A 1TPUA 5IHRA 3ERPA 3GB7A 1NSNH 3GDLA 3L4XA 1MELA 5JH1A 1OLLA 3NQDA 1WFNA 5TQ2L 3FQTB 3MRFB 3SRHA 4RDWA 3ZKSD 4GBDA 4K71B 3RGVB 1H1NA 4Z7NB 3QEHA 4UMGA 1NA8A 1HK6A 2F6XA 4MFDA 5J5DA 1KJ2H 2NDFA 4HEME 4WFFE 5ITFA 3PWJB 2FVLA 4NNXB 4GUOA 3VX1A 5D05A 2XKSA 3HN5A 4X9GA 2NQLA 4WI9A 3ZDXF 1H7XA 4NRSA 5HGGS 2I7GA 3RITA 3AVEA 4O58L 1ZT4A 3C56A 3SE8H 3R5EA 4JHZA 5TPWL 3SY5A 3DURA 1SMOA 4DNHA 3L7EB 1B4EA 1NCDL 4Q7IA 3MA8A 4E2BA 5F1OB 5AECA 2BNRD 1ETB1 1CI1A 1GG0A 2F8XC 3ITYA 3CDZA 4UOZA 4X0KA 2VZUA 5IGXH 3WDPP 3KWWB 2VDQH 1FRGH 2XRAL 4BE6A 2V2CA 4QNPF 1BXXA 5SV4A 1QYGL 5F7WC 1NSJA 3PPFA 3NNTA 3B7TA 2EEDA 2WCGA 4ONGH 4U6YA 4YXHH 2AJVH 5CJOL 3NOIA 1ZS2A 2WHVA 5AFAA 3B2DC 2MFNA 5I1LB 1BFOB 4GUPB 4UAOB 1FWCC 4ZB5A 2ETWA 4BZ2L 4EN3A 1OAXH 3TSMA 2RJMA 2VFFA 1ROWA 5DHVA 5BCAA 3IJ6A 4JDZB 3MGTA 3G5WA 4Q7NA 2XV0A 1N9PA 3GG1A 3UPAA 2DKUA 1GL4B 1E73M 4MNQD 4WI5A 3QFJE 3UG4A 3DMMA 2DM3A 1FDJA 3KHQA 4HCLA 5H37A 1I9IL 2QQ6A 3WLJA 3AICA 3O07A 1TV4A 1G4RA 4YR6B 4F8LA 2LABA 2ZJSH 1MFCL 1JYVA 1AZBA 3K71B 1EJSC 1NQKA 2PDWA 3T4AA 2OMBA 2XG4B 4OZ4A 2NSXA 2R9HD 5EC2A 3VM7A 2INFA 2CDFA 1A21A 5TQ0H 3P6LA 4M3PA 4KJYB 4L5FL 1Z6JT 4PEEA 3KLHD 4YN3A 3ELAT 2W91A 2DQ6A 1S39A 1W9VA 3P74A 1OJXA 1FWWA 1PD6A 4HCIA 2IQAB 2XIJA 1JTOA 1QSFE 2F7RA 3BZDA 5EU3A 3WTWA 5LKNA 2FLIA 3AG3B 4G42B 4Y4HA 5JZ7C 3RFAA 1K6WA 1YX1A 3MXWL 4NAFA 4NC1C 3FY1A 1WO2A 4M4PA 1RVFH 5IHUH 1T1ZA 5GISH 2C79A 5E6IC 4DP6X 4UFKA 5ETUB 1QBBA 5F3HA 3NAAH 5JW4N 4KKCC 1KNOB 1I7RA 5JORB 1E8WA 1I2QA 2WMJA 4C6OA 3IPEA 1OX5A 4GO9A 1YMHB 5FK9B 1FIGL 4X80H 6FABL 1BXVA 4LSTL 1JR1A 1PCXA 1KD0A 2Y7QA 3ZJAA 3MP3A 4OTKA 3TQPA 4GBXB 2KERA 5G4NA 1K02A 1CYXA 3EXTA 3VIFA 1Q3NA 1A3XA 4MGXA 2MEJB 2X4RA 3R0MA 3T77B 4O1DA 4N8CH 3G5XA 1QZNA 2KMWA 5C2BL 4FF5A 3THUA 2Y8UA 2WWMC 3QIBB 5EF3A 2KPNA 2P5EA 4NO0D 4C54A 1XIMA 3F6JA 4B92A 3KBHE 3AY4A 1D7FA 3ZE2B 4KPHH 3EHBB 3DGBA 2CR3A 1N6QH 2UZXA 3IANA 3P69A 5D8ZA 2HWZL 2JIEA 3H2EA 4O4WA 3BUIA 3W7JA 1PHQA 2HXTA 2NV9A 5DK0B 1I3RA 4B9FA 3ZLFA 1UXWA 4OTXH 4JGUA 1NWUA 3M7WA 1FI8C 3FQXB 2WNQA 5D2NB 1MCNA 4EUPB 2BIQA 3CSFA 4TS6A 4Y9FA 5FA3B 5HY9A 1KT2B 3F64A 4PV8B 5I8KH 1TUFA 4MUPA 3V5DB 4IHBA 2DW7A 2XG5A 4NQCA 4BKSC 2HT2C 4C6LA 4H7VA 3JTSA 1H7WA 3CH0A 1UA6L 3IWPA 2WB7A 1XXFC 4JREC 1F4HA 3AUJA 1B2WL 5FC9A 1MUWA 3KCWA 3ECVA 5HHMD 3BEVA 1QKZL 1YUHB 3M5XA 5JHLH 4FQCH 1M41A 2E67A 5K9KA 2VMFA 3SIMA 5HHPB 5E00A 4LLMB 2PC4A 4UTTC 4R53A 3WLMA 4TSBL 1ITBB 3CXHJ 1XLKA 1EJXC 2IH8A 1LP9B 4HAFA 5F8RC 4NXKA 5J1AB 3WH8A 4M8UA 4ZFOL 3N6JA 4Y19B 4ZXOA 4GO8A 5SWSD 3H2QA 3QZWA 5K93A 4OH2A 3LD8B 1H6TA 4DSYA 3EPMA 4BF5A 2V67A 4X4MA 4B9JA 1NKOA 1BQCA 3VE9A 4GKNB 4CKQA 3FB5A 4PR5B 1MFBH 3QXTA 4NC1E 3M44A 4FR1A 3N9SA 4NASA 2VFGA 2O30A 1C8VA 4UMAA 2Y5QA 4PI0A 4FQJL 5ADOH 4ZOEA 3MBEB 4FKEA 4S1DC 2H45A 1GOGA 3QC6X 2F53B 1EXPA 1H9VA 3H2MA 2D24A 3UZJA 4KI5F 4WHCA 5FS5A 2KS0A 1LWRA 3CM4A 4NILA 4ADJA 4HIXL 5JPNC 4AC2A 1RURL 3RY6A 1Z89A 3OIHA 3W22A 2L8AA 3ZJ8A 3IRCA 5DS8A 1GORA 1KFLA 4RL3A 1QVOB 3MMUA 3KTCA 2GUOB 3T8LA 8RUCA 1FZJA 1YJDL 3Q37A 5D2LF 1DEEA 1XIWA 3C2AL 3PHOB 3MACL 3WXWL 4E9LA 4ETYA 2O9OA 2GT9A 5CKAA 3MVTA 3HMWL 4PUUA 4AY7A 4JFQB 3TWCH 4MDJB 15C8L 1ZEAL 3VD0A 4PB3A 4PJGB 4OVUA 1M3UA 4AAJA 4NSKA 4K37A 3LIUA 3EJTA 4JY5L 5E6YA 3A3WA 1NBVL 1SGKA 4Z1CA 3CV1A 4LPCA 4H5SB 1XDJA 5CCKH 2Y8VA 2O4MA 1N59B 4I8DA 4WI0A 3SR7A 4KUCF 1KTDB 1ZHNB 5DFAA 4ZOAA 4XB3A 3GZKA 1GZQB 4XP9L 2FD6L 4B5WA 5I1IL 1NKRA 3ZTJH 1Q38A 3PL6B 5I3GA 1HHKB 3NCEB 2VW4A 4KY1H 5CSBA 3KBMA 3Q58A 1X7TA 3QGKC 1OX4B 3QCVL 1T4KB 2G4FA 3QDMA 4YHZL 4HNTA 3RU6A 2OXGB 3D30A 3HE6D 4PJEE 2WQWA 3GX9A 6XIMA 1SF5A 5I6PA 2XINA 5AC5A 3EB2A 4JFXB 2AJYL 1Q8JA 2E25A 5EBAA 4WY7L 3KVKA 4JHMA 2XT1B 5EBWB 2W65A 2ED6A 4J6RH 4MNGA 1AR1D 5EZOH 5AUMA 1E9ZB 2HT2D 2EUVA 2XPGB 3GXMA 4BFIB 1TG8A 4X50A 4HG4K 5CC3A 3AQXA 5IJVA 1VLIA 5DRCA 1JJUA 4NI3A 4FMVA 1WSST 4EI5A 3UAFA 3R8BB 4L9XA 2ZCLL 5MEOB 1UR2A 4CDHA 3ORWA 1R3JA 1LLWA 3M9YA 5AB9A 3S9YA 4OFCA 4G6KL 4R7JA 2A74B 3N44B 3R0NA 1XINA 2KPWA 4LAKA 2L04A 2NR6C 4LUSA 1ILUA 2BY3A 4JM4H 2Y1HA 3CHOA 1L0XA 1UB5B 4LLQA 2CBUA 5CSYA 3AROA 3RYSA 3GM8A 1TCRB 4GSDH 3UZ5A 3W85A 4M7LT 1SYSB 5DC4B 5FO8B 4AHOA 3BAYA 3GNOA 1P6CA 4GH7B 4AEOA 4Q4QA 1V6UA 3CIWA 1POJA 4KV5E 4JW3A 3VFPB 1C8PA 3M1ZA 4L8SA 4FEIA 4X6EB 1G6RL 1Q6OA 2A1YA 4QX4A 1TVBA 4WU5A 1F73A 3B8UA 1BM7A 1NM4A 2HG0A 3FN0H 3FPYA 3Q1EA 4N6EA 4EJ1C 1CG9B 3NL5A 4JYEA 3KXFB 3H6AA 2FO1A 1J48A 5AW5B 3CBRA 1B0RA 4HU0A 5B1KA 1M7JA 1ZPLA 4P05A 5EOTA 3SKJL 5AHFA 3WJWA 3V0WL 1GAFL 4GABA 2A74A 2EYSA 4OCSH 5FACA 3H24A 3TO4D 5G4WA 3N41F 2DFAA 1C9WA 4NZUH 3FA5A 1IC5H 4PJXA 1N0XL 4KAQH 3DUGA 1OTUC 2Y1YA 1G7HA 1KLFA 2DAVA 3GLDA 2VM4A 5IIEA 1OHLA 3VGEA 4UB9A 4MCNA 3VD5A 3KBWA 5I74B 4D9LL 4EDXA 4R4ND 2EUXA 4OZIB 1UMLA 3SY0A 2AL2A 3BYTA 1SQ2N 4LGSB 4FI6A 4DLFA 2CHXA 5K9CA 5J1AA 2HPOA 3BPNC 5J12B 3I6KA 2YS4A 3JZUA 4JHOA 1B4JH 4AM0Q 2I5YL 4S3AA 3SJ3A 2YBVA 4Y4KC 3VNMA 1ZSHA 3SECA 1QFOA 4QWWC 3Q67A 2E56A 4LCWD 1BECA 3LVEA 3ELQA 3JYCA 4MQXC 3G6DL 5HHME 2ZE0A 4ZO8A 3U2JA 3CQ0A 3L67A 1Z9AA 3MNZA 4HUXB 4Z7NF 1PYFA 3U48A 3MUGA 2CJUL 3DV6B 1MLBA 1OZQA 1MFEH 2P1FA 5TK2A 3NXLA 2IBZX 1U8HA 3F58H 3PP4H 4M6NL 4XP9H 1RXOB 4MF4A 2QMJA 3LM3A 5KAQF 1DBBH 3K2KA 1VADB 3OZ9L 3OA5A 4WJ5A 5CWSA 4MB1A 5C9RA 4KQ4L 5E2UL 3WIIL 3REWA 1Q9WB 4AK1A 4EAEA 2EUZA 3KAOA 1IAIL 4R7NA 5IQ9A 5LNEA 3SKMA 4F9LC 3CVHB 3U2SB 3B8TA 5DLCA 1Z66A 3L65A 4PJFA 4HWEH 4C1LA 4IBLT 4CN1A 2HE5A 1QSFA 1P7QD 3GU9A 3MNWA 5DHYB 2DZXA 1CE1H 3Q2NA 4XAWH 3IAPA 4JHAL 2ALAA 4JN7A 1JGVL 1WA0X 3O2WL 3LVTA 1GGCL 3N2BA 3WD3A 3INUH 1TIUA 3WJLA 3S88L 3UPCA 1M7IB 1MHHA 3CVBA 1RZJH 3GZOA 4DN3H 3H9SD 3CSYA 3UVIA 2ITDA 1RJYB 1C5BH 1SXAA 3KR3L 1CNVA 1L3WA 3T6WA 4Q4SA 2G97A 4L4JA 2YD7A 5B1AB 5IB5B 4AG4L 1G6VK 3PPCA 2WO3B 1FZOA 1WITA 4C8XA 1Q65A 5GS1A 1US0A 4HMCA 5DJ6A 5HYJD 1S5WA 4NZDA 1U83A 1WYIA 4MSSA 2DL2A 5F3HB 2BNQB 2CKSA 3G1HA 4O2CA 5LKYA 4XMVA 5KSAA 3G3LA 1N55A 3V5FA 3UIZA 2DQMA 2FSEA 1KGIA 4HHWA 4PV1C 2P8PA 3HBPA 4XAKE 2XTJE 1D5RA 3GRWL 3TTSA 1I8KA 1E9IA 2V5TA 2ZE3A 4F0RA 4LRNH 3M1OA 2IPGA 2XFWA 5D7SL 3GH4A 4MMXC 1EBGA 4K3DH 3PRZA 3B9DA 1MDTA 4KHTH 3SDDD 5AY7A 1M7DA 5FWQA 1QW8A 4JPSA 3STPA 2VH5H 1ESOA 4AG0A 4TLTA 4XI5C 4A8RA 3N43F 3F12B 3WY1A 3VXUD 1CXLA 3DO7B 1GYMA 4JFDB 2J4WH 4JAMB 5FW6A 1Z7AA 5FJRA 2XZ7A 4Z17A 5BUPA 4CBZA 1S7SB 3BYYA 5FYLD 3ZE0E 5JHDB 25C8H 1HJUA 5F7AA 2IG2H 2Q2LA 3FRPG 3P5ZA 4S1FA 2HK1A 1VFSA 1E65A 1F3TA 3DX0A 2NWSA 3FSTA 4UTWC 4MJ4A 3D9AH 1XSKA 4B7LA 4LB3A 4UT6L 4A7GF 3GSRB 3PIQB 4GSUA 4H7CA 3CPUA 2PTZA 3HMJG 1QPRA 5C0DB 4Q22A 2ADYA 2R2BB 3D34A 3VYLA 4TUKL 3BZGA 1A8JH 1AGCB 3W9DB 4OFPA 1LTXA 4WW2C 2OB3A 3EJQA 4A8IA 1E4XL 1DJHA 2P80D 3FDWA 4PY8J 1LEKB 1AH4A 1NDVA 3QJQB 5AC4A 4KCWA 5D8JH 2J6WA 3WIHA 4OBSA 3SYAA 1A4JA 1K9DA 4JFDA 5E9DD 3WU1A 1KBVA 2X6MA 1YUHA 4FTVA 4JX0A 4HJ0C 1OFEA 2QADD 4KPLA 4XISA 3FSVA 1PTAA 4UINH 4XE0A 3M1CA 4QOKB 3NIYA 4JN2A 3J07A 4PJFB 4FZ8L 1TQTA 3MRBB 2JKWA 3OZ9H 5D7HA 5DJYA 2FTYA 3NFUA 1P5BA 1LEIA 1C91A 3K6SA 2VYOA 3B0YA 3EDJA 3Q3GA 5JHDA 3FB8B 3GBMH 2G9KA 3C75A 4IGSA 5HPMB 3QFJD 3ZYJA 1RVFL 5IHUL 5CEXA 3RM8A 4KFZC 3DUSA 1AAJA 2B0SH 4JDZA 3F65A 4NFDA 5IROC 3X3GH 2X6CA 4F7TB 4PMYA 4RE4A 3UYPA 2UZXB 1DANT 1NAMH 1N7ML 1O6SA 4R7DB 4XN1A 5LHEA 2JNZA 4PULA 4A2SA 3RGHA 5I1HL 2D69A 2AJSL 2BVPA 3O11B 3NQBA 4HNCA 4PB4A 3QK0A 4K9EL 3ZVIA 3NQEA 1ZVHA 1C5DB 2DWTA 2MTAA 1LDPH 1KWKA 2H8XA 3AUVA 2P52A 3BSZL 3WS6C 1N3NB 5KVGL 1KLUB 2JK5B 1HI6A 3JT0A 1VFMA 5HHMB 1E6SM 4GISA 2IALA 1MFCH 1QFWI 2WV8A 4N5EC 5TPWH 3AREC 1EGVA 1XYCA 2A7RA 1TE1A 1FNFA 3CEPA 3LERA 4Y90A 1SXNA 2YWYA 1MRCL 1SOQA 3DCPA 3QV6A 4QAWA 2AAAA 3P9WB 1JGLL 1ZT4B 3W23A 2AHIA 2J7FA 5E09A 3SD2A 3LXUX 4UT6A 3VM5A 4I77H 5E2VL 3MDJA 3PGCB 2W95A 1FNGB 3ECBB 3QIBC 3UAJA 4IMLB 1UGNA 2YUZA 5KS9A 4X6CE 3I68A 4O02B 2PPCA 4JTDA 2BCKB 2JIXB 2LQRA 4JKLA 5ENWB 2BSSB 2EDFA 3A12A 4JHWL 3P02A 4DGYH 3D6NA 2IGTA 1Q9LB 4O50A 5DZAA 1Q9OA 3SCUA 3B7YA 2X4TB 2ZWNA 4NNPH 4TRPL 3BIKB 2V17H 2ZG3A 3GHBL 4UB0L 3WD1A 4NM8L 1R5WA 1ZA3B 4FQCL 4OFKA 3HR5B 1AO7A 4PP2B 1LK3L 1E4WH 1TOXA 2GGIA 4HS6B 3HAEG 3PQYD 4G7YL 3QJXA 4IGBB 4IRSA 4XN8A 3VFSB 3OJDB 3O6DA 3BI9X 3EB4A 4V28A 4UOQA 5FD0A 4EPDC 2B59B 4G1EA 3ZLGA 3QR1A 5IT2L 2GJJA 5K9OB 4GX8A 4HSOA 3LGGA 4TUOA 5T91A 3ZE1F 4GW5A 3BP5A 4KIRA 3WMCA 5IIEB 4MXWL 3BKJH 4US5D 3EYOB 3H9ZA 4OU1A 3BWAA 1FFQA 2BRRL 4MA8L 1VIWA 1DLFL 2IIJA 3DX4A 3T8XB 3FYOA 5CUSL 2EECA 2Y1ZA 1S3KH 1T22A 4DGVL 3PB2A 5MEQA 2A6JB 4JFFD 3S4SA 4KW2A 1P48A 5GGRA 2X4PA 2I16A 4WTZG 4LHUD 1NJ9A 2NXYD 3NOYA 1VCBC 4XP4H 2Z93B 3GBLA 2WD0A 3UTPD 4JY4A 2CQVA 1V05A 3HNSL 1TVBB 4WU5B 2Z0UA 3P4OB 3X17A 2NY3B 3I6RA 3SQOL 4NT0A 4O1BA 4A35A 3U9PL 1F4YL 2X0WA 1HHKA 1IKFL 3II3A 5TDPA 3WFDH 2IPTL 4IPPA 4KVCH 4YLBA 4X5XB 1V7NL 3LIZH 5D9SA 3L1OL 5F96H 1HE8A 1KFJA 3M0IA 4NRZB 4AG4H 1FL6B 3VXUE 3S5NA 4J2QA 1ULVA 4G6KH 5CM1A 2QGHA 3M6YA 3K74B 1CF1A 2UWEA 5DFVD 3VKJA 3WSQL 2AQQA 4KZDH 3S5LG 2KLTA 2M26A 4LHUB 2P4AB 2FCBA 2ICEA 3ARBD 4MCYB 1AHWA 5FAJA 1L4IA 3X1NA 4OLZH 4LASL 3LB6D 1JIBA 4KH2A 1UJPA 2OMNA 3EYVA 3EYQC 1KBWA 1EHAA 4OFYD 4CBPA 1DVFD 3I50H 5HMFA 3LI1A 4RAVB 4Y8EA 1EPXA 1OK6A 1BZQK 3IMSA 4L9YA 3HUJB 3P0VL 4Z1BA 1JG9A 4EKJA 1F11A 2AC0A 4P0DA 4UUJB 4YHZH 4IOIA 1UZDA 2WN2A 2V8LA 4JIPA 1NCHA 4MCYA 4DP8X 4HWBA 5HI4D 2HTKD 1JPFB 5D1ZD 5DZPA 3QEGL 4I0PD 3LSBA 3PHSA 3X1GA 3QQ9D 2MMXA 4XTIA 3ONBA 3DA0A 2B15A 2WGNB 3HLKA 1IT8A 3O8XB 1FNEA 2HK0A 3PL6A 3DX7B 2NTFB 5ESAA 5JYLA 1MFEL 3DHFA 4LPWA 1PJWA 5HYFA 1R19A 1XLEA 4PJAF 3P61A 3TYFB 4H2HA 2E76C 3S83A 4ZQPA 4Z1DA 1HQRA 4LCSA 2XM1A 1MIEH 3CXFA 2PLMA 3A4WA 3LCGA 1RZKL 2HEJA 5TE7H 3FRUA 2BW4A 3KYAA 5GJSL 1XX1A 1BVKA 4EIZC 5A1AA 2VLRD 2WUBH 4PJGF 3INPA 1TQBC 2SODB 1H7NA 2WHJA 2Y24A 4YS1A 5C9UA 4C6MA 5F1UA 2BOBA 3SADA 1SZEA 5LCVH 4XC1L 1XBZA 5I1GL 5JOFB 1B3XA 1HH6B 2JFCA 4KDTA 3LN3A 4DJDA 4V33A 1MCJA 1Z0NA 2YCIX 4XKYA 3O8XD 5EV7A 3TWYA 4GS7B 2P0OA 1BSLA 3QFGA 1CD0A 3FB6B 2OSWA 1J79A 2VGIA 3G5YA 3HE6B 2C34A 4HJGA 2R8WA 4TVDA 3NIFE 4AWTA 4YGVB 4TSCL 4O19A 2V82A 4BDVA 2PDHA 1ISWA 2OYLA 3MCNA 4MTVA 3P4LA 2AQ2A 3DHUA 1UKPA 3NK3A 2H5UA 4EAMA 1DVYA 4MB3A 35C8H 1TZ8A 1IKNA 3JV4A 1UXWB 5EEWA 1I9JL 2FGWH 4JTQA 2NCEA 3GFUA 2G3NA 4MB5A 1F4XL 3BPLB 4RCAA 1T0PB 3EGXB 5DFWH 1HXJA 4APQA 5BNXD 1RSCA 1FZJB 1UIPA 1WWAX 1TQVA 3MOQA 4RMVA 3BIBX 1A7RL 4PUEA 4UTKA 1NFDE 3WKNA 1GMIA 3KPPA 1QRNE 5C92A 1KYFA 3T78A 3ZVHA 4FL4B 1BFVH 2NNFA 1Y0EA 4FMFA 3L3GB 3TIDB 1CK0H 3TJPA 1XPGA 4UI2A 1QOXA 3ID7A 4Q6IB 4HIQA 2OZ0A 4GG6A 3OMNB 1KG0A 1JNLH 2ATPB 4LSPH 2OMAA 2VGGA 5E00B 1JXGA 2WVUA 3W2DH 1OWQA 3R11A 5BXPA 4PJCB 4IDLA 4H0LC 5FKPA 1V08A 2C4FT 2YL5A 3BEVB 4MNHB 4Y7EA 1KCKA 4AZ7A 2IH9A 1BD2A 2FIKA 4UQCA 4BQ9A 4XBPB 5CSZB 1DQKA 4WVXA 1TDQA 5DCDA 4XWUA 2ZXGA 1YMMA 4XPHL 1XIEA 2LGNA 2J8HA 3CPRA 1AGEA 4E4PA 1R9YA 1A6WL 2X38A 1H5BA 5IB4A 5LO7A 4OV9A 2H3DA 5E8OB 5F7MC 1A8ZA 4N20A 3SSGA 5EMUA 4A21A 4J6RL 2NCMA 4ZMQA 2GUBA 4FXJA 5M94B 3FB7B 4OLUH 3LRLA 5HYJB 2R1MA 3H4HA 1UT1A 3G6MA 3QF0A 2FX7L 3K4ZA 2EIBA 1H3GA 4P7LA 1RK1A 1JAEA 4K94C 4HC1H 1OAQL 4FG6C 3QW4B 3JUGA 3NEXA 1W9UA 4LLDA 1C1EH 4KMQA 5EGRA 1SFJA 1WAAF 2PXYA 1SPQA 2A1WL 3WCYA 4B9KC 1FH9A 1R87A 2QHRL 5FPIA 5ICYA 4OF6A 3U6XS 4YX2H 5IM7B 1R2SA 4A7VA 2CDGA 3ILPA 4I9XA 3BAJA 3MS8A 2Q8LA 4EXAA 2MCPH 2WZIA 3WLRA 1KXVC 5K4ZA 3NSYA 3O3DB 4MKMA 2G60H 4DQOH 1EX0A 4ZTOH 3ZT5A 5IMKB 4PH6A 3VFOB 5F7EH 1RULL 5DJ2A 1AE6H 3IDYB 4X7TB 4ABUA 3O9WC 2YAEA 4NBZB 5DQ9A 5FKPB 3VXUB 1SYVB 2BOEX 3FC8A 5JR1L 3EF4A 1OG0A 4K8GA 1DQVA 2ODHA 3KS0H 3P0GB 1HFUA 2E5DA 1NCBL 4ZTEA 4AEIH 1K3UA 1KNOA 4PB9H 1FWTA 3L3OA 2Y0FA 4R3UA 1U9KA 3Q2VA 4WKXA 4A7QA 3V4VA 5IMOB 3VVGA 5AAMA 1OYCA 1Z42A 2I7SA 5DMJB 2OWWA 4POZC 4IFRA 4XO8A 4U5IA 5H6HA 1A0CA 2DVXA 3QBTB 4NAQA 2R82A 2GWNA 1CUOA 1GSKA 1FWIC 3MO1B 3WN5A 1LL6A 2GJRA 3K2MC 4JRYA 3CWHA 1U3HB 4PRBA 3OGVA 2PYEE 2OSLA 5CSGA 3SE8L 4DNLA 3DROA 4GIRA 1LCOA 3JV4B 3OAYK 3QRFM 1TZZA 2QHLA 4DN4H 1S9VA 3EXSA 3V0VB 2EKJA 4P5TC 3UTSA 1VP5A 2EG8A 2QDEA 2JJTC 4AQ1A 3MV7E 4JRXA 5I07A 2NUTA 2XWXA 4JN8A 4OU3A 3MOBL 3HOGA 2YC1B 5E9DB 5FF2A 2X2YA 4AZ8A 4NQVA 4UWMA 3BISA 1JCKA 2FZNA 2CESA 3B7RL 4BQ3A 4QKTA 1MHCB 3GIVB 3VIJA 3I02B 3ZMEA 4YSPA 4NI6A 2RDUA 3E1F1 4PJAE 4QXGH 3R58A 1YJDC 3FTVA 1B4TA 4I9WD 5DVNA 2CW6A 4YXLH 5IKCA 4MNLA 2OMUB 2R0LH 2GGEA 4N5ED 2WLKA 5LBGA 1GEQA 4KJYA 2A9AA 4ELMB 1X5LA 2ATKB 4UQEA 3HPJA 5HYSG 3VCRA 1KBLA 5I23A 1Z69A 5BRZA 1R3VA 1AQKL 2IWEA 3QFJB 4YHNA 1YEWA 1PG7L 9XIAA 1WTLA 5DRWB 1O95A 4NHCH 1Q1JH 1LM8V 1YEKH 1RCXB 4ABVA 1E90A 1RVGA 1BLNB 4PGCB 4AGQA 4C6DA 3BSZH 3CXDH 4XMPH 1MXGA 1GJPA 3WLLA 1QBAA 1PKNA 4DXKA 1GOQA 2AGJH 4YLCA 3PTQA 2XIQA 2WXQA 1YBQA 2N0MA 3C4UA 5D30A 4Q14A 1HSAB 4XVTH 3W75A 3MUUA 4TLUA 5DXYA 3NABL 5DZVA 2X44D 4XPAH 1K9FA 3ESMA 1S5VA 2NX5D 3HA0A 1DVXA 1PLGL 3VI3F 1J5TA 1YTEA 5CH9A 1T1ZB 3JBG7 3UBXA 3FJLA 1F18A 5D7JB 2WUCH 3LOTA 1W54A 4RNJA 5SX4H 5TE4H 4GNKB 3V55A 1IHIA 4NZJA 1WXJA 4GBXD 2CLVA 5E8NB 5BV7H 4WI3A 4KY2A 4KKZA 4DO7A 4ZAKA 4NJKA 1UH3A 4WK4B 2H6RA 1QRNB 4O1CA 3SURA 3CH1A 4BFKA 2QCNA 2UZIH 3EAKA 4GW4A 1T20A 4KWOA 4CQ9A 1PSKH 3UTTA 4L2YA 1S6NA 3UTZB 4YSRA 3LEXA 4L4TA 3MU7A 5ICZB 4QMEA 4LSUL 1R86A 2LU5A 1A6ZB 2DQGH 5DUPH 1FFRA 2DEXX 2QQKH 2MSPA 3TIEB 3GMPB 3EBGA 4BHUA 4BQCA 3LTYA 2JQAA 2DQFB 2JTYA 4OV5B 2QCMA 2X3BA 4Y5YB 1KN2L 2R1PA 2AJSH 4WKHA 1ROCA 3NACL 2YUXA 4FQQA 2DYRB 1GJUA 4RZ5A 1E6PA 3NFSL 3SDXA 3MFGB 4ATLA 2B2XH 1XV8A 2PA6A 4MXWH 1KTJA 5B1CA 5TDNB 1HX0A 1K6AA 5FW7A 5IMLB 3LSCA 1R3TA 1TZOA 5CZJA 4BK5C 5F1SA 1THCA 2R0ZH 1L9PA 4P5UA 3C52A 3KVLA 3GU1A 1D3GA 1CC3A 1OSPL 1T5XA 1U33A 3G5EA 3IGAA 4JM2A 5H2ZA 1NWTA 4QDGA 1W1A1 2HE8A 4M6MH 5I5IA 2ODOA 1OPGH 5E6RB 2YXOA 3CX5J 4PRNA 1S3RA 5KJ7E 4OCLC 1DVSA 4HGXA 4U1SB 4Y9BA 5TDNA 3BWAB 5AAWA 1IZJA 3HNSH 4P57B 4PGLA 3VABA 1U2HA 1GGOA 1YG9A 1KLYA 4U1KB 4OIAA 3T71A 1TJHL 4F1ZA 3RDKA 3L3JA 2QADC 2OODA 4H9YA 1S7XB 4J40A 3VZYA 4S38A 5AYQA 3CIAA 1MFNA 4F9PC 2I32A 3IGAB 4JM2B 1IGFL 4ZSOE 1C9DA 2PSNA 3QG7L 3MBED 3STZB 5B21A 1OCRB 3Q6GH 5K9JL 1GIGL 2WMPA 1CLZL 1SEBB 1YYMH 1S4IA 1XLCA 3BQVA 3K6DA 4MJ5A 2X4TA 1QSZA 1FDZA 4X8CA 4KXAA 1TELA 5FOBA 3UBFA 2JKLA 1SR9A 3P0WA 4NNAA 2XVPA 1OB0A 2CLPA 3IJ8A 1BJ1H 4O02A 5HDQH 3VW3L 2VITB 4FNUA 2OZ4H 5BW7A 2C7FA 3COOA 1DKWA 3BP6A 3FULA 3LEVL 1H15A 3AB0C 1C12B 4HFUL 1JCLA 1LOSA 1PKMA 1ZTVA 3C8NA 3L3JB 5AOLA 3QORC 5EA0L 4QEGA 4WO4C 4OLXL 1PLAA 3VFVA 1N7MH 4PUMA 5GJNA 4DGYL 2OR2A 2CIKA 4XBKA 1X98A 12E8L 1RIHH 3ATAA 4O51B 2HKHH 4BUHA 1I4NA 3AS1A 2VUNA 3NJLA 4W9ZA 3VRJB 1G4EA 4OCXL 4CAGA 1UC5A 4L5FE 5H94B 1FV1B 2J8TA 4UTLA 4AISA 2QKSA 4AQAA 3FL7A 4FFWD 3A6CL 1CECA 4LSQL 1T99A 3FV9A 4M8QA 2HPIA 2Z1VA 4I6VA 4YSOA 4G8GA 1YLBB 3MTRA 5HDLA 1SXBA 4YIWA 3ULVL 1GYLA 4NFBA 1ZHLA 1KXQE 3QZEA 2ZZUT 3O0LA 2HN7B 4U2YA 4YGAB 3VB8A 2ODIA 1ED3B 4DO4A 1EEXA 1M71A 4RDYA 4K3JH 2FZBA 4JQIL 3NL2A 3RI5K 3VWKD 3EX2A 4KOBA 5IEKA 4JBRA 2WNNA 4G56A 3S9ZA 3I6LD 1BW8A 4ONFL 3M0LA 4IMEA 1RZIB 3D18A 3BVWA 1RERA 3HG3A 3QI9C 1AGDB 5E8PB 1WRFA 1XR8A 1G1OA 1EF2A 4BIKA 4LCCA 2XG9A 3PN8A 1O7AA 1M01A 3B0XA 1WK0A 4AUBA 4M81A 4JLRB 3CTTA 2W67A 2Q76A 3WCZA 1FL5B 4L5FH 3BW9B 4IJRA 2YEVB 3ABGA 2EICA 3UC0L 1IQDB 2AV1B 1T2QH 3OWRA 3TBTB 1BQUA 5MEPB 1TWZA 2EPOA 2N3JA 4U6VH 3FUKA 3PDOA 5FI8A 5CPSA 1ZBVA 5DGRA 1WC7A 4I2XB 2QFPA 1P7TB 5DTFB 1QR7A 5HYJA 5AW2B 3D5OF 2CBOA 1OCBA 4QE1A 1C5CL 1RZGB 4UT9H 4UFIA 2WZTA 3DX2A 3DGDA 4UTCA 4L3EB 3HZMA 4DIAA 4CVXA 5CEZL 4AZGA 2B4CH 3H2CA 4G7EB 3GRGA 3WLKX 1IGYA 4K73A 4Z7VE 3E02A 3LGEA 3IJSA 2FJSA 3SPVB 3HGJA 1FGVH 1IC4H 2QPDB 3E6HB 3O6FD 4PGEB 1WKEA 2KL6A 4N8CL 3KYNA 2BFVL 5JNYA 4X6DF 3TP4A 3ZN6A 1BXCA 1K7FA 3HE7D 1JDAA 1UD3A 2Q09A 5I06A 3MYJA 5GSRB 2X4UA 4YO0B 2INEA 1WHPA 1I4FB 1CO1A 3CUIA 2FYYB 2ITEA 1DBKH 2B20A 5I1CH 4FXLA 1K6QH 3GJEB 4M6AA 4NJHA 3WBAA 5LIYX 1ACCA 5I1KH 4WHBA 1MSSA 5HSFA 2PURA 4GCAA 4EPSA 2DBJA 1NC4D 1G7QA 3FOMA 3G6LA 1HILA 4Q0XL 1ZD6A 2OEKA 3S37L 4AX3A 1X9QA 3FQNB 1PIIA 4J4PA 4RGMC 3AFLA 4PVBA 5IREA 3RN6A 4B0MM 1IXPA 1WCGA 2DSVA 3MXWH 2WXGA 5F7LB 4DN1A 5CP3H 3TNBA 1BQHA 4XD6A 3U7VA 4WCYH 4WNSA 4ZL1A 3DERA 3HQOA 4N2LA 3CSBA 4GRLB 4BDVB 4OZIE 1YA5A 4S2SB 3BQ5A 1BF8A 4WV1C 5AVYB 1FWRA 4IIFA 3RNDA 4GACA 3UNDA 4XWGL 4F9JA 2GI0A 5H35A 3LD5A 3S3CB 1RY8A 3WMBA 4MWAB 3WH5A 2DQGL 2V4LA 3W39B 5E8EB 4WX2A 2GY7B 2FSDA 2I07A 2FDSA 5C0AD 4PS4H 4F58H 1O12A 4NKCA 5IBXC 4PJBF 2WZ0A 1EHNA 2H2PC 1P9MC 3WAJA 3GNRA 3GVQA 4G1NA 4HUNB 1ZT7B 4ZAKC 5FCSH 2ID5A 1J05B 3BICA 2O6CA 2INZA 2DI9A 2J88H 3UJJH 2VC5A 4BYHA 1RIUH 4RIRB 1UENA 3CC1A 1V3JA 1NANI 3E3QE 1SZGA 3CLFL 4J3BA 3DVGB 5JHDD 5HYSA 1R34A 2ENQA 2Z7KA 1XGTA 3TW9A 3WV0A 4GOAA 2VKZG 3R13A 3OTTA 2AJXL 4NIYE 1THFD 4OWGA 1MZYA 2E4TA 1G7JB 4PJ7F 3ZE0F 5KW9H 3DWTA 5CPOA 4AVJA 1CICA 1P4UA 3HQNA 3KBVA 4OVXA 3K6OA 3WUWG 1TO4A 5F1NB 4MYPA 5AZ0A 2LLEA 1IE4A 2V7NB 5C0CA 2FR4B 2WJ5A 1HYSC 4TSAH 4MZ1A 4R33A 4LKXA 1U8CA 3S4SG 3CYJA 5HHQA 3C08L 4M8VA 4I48B 4EBQL 1N6VA 3O6MH 3VTTA 1KM5A 5AWNL 5KVFH 3W0KA 1UGKA 2XDFA 3ZRCC 2JF6A 4OCSL 4ODUA 5GRUL 5K9JH 1BAFL 1JZFA 4Y9PA 3IWVA 3MCKB 5FYLE 1EP3A 5EIIA 2GUYA 3ULVF 3U9IA 4CNUA 1B9ZA 2OJEA 3EH2A 5HVWA 5MP6H 4UQ9A 4AC7C 4QCFA 2W9EL 2X4UB 3E0FA 1MEWA 4KUZL 1ZE3H 4EEEA 2B1HH 2OMVA 3L4UA 4I85A 3X13B 3ZQWA 4IIQA 4PJIA 1OFAA 2R6OA 3PSVA 5DN1A 4HHMA 3H3BC 3L95B 3QUXA 3FU7B 1GZHA 2OLAA 4WY0B 3SDOA 4WTZA 3BLOA 5CMAA 3NQCA 3D85A 3CD4A 1GGIH 1O5PA 1KB5H 4PUDA 4W9JC 2DWEA 1BFNA 2KHAA 5ANMA 2PGEA 2ZZ5A 4J3ZA 5ACZB 4NOFA 4Q6IA 4I5XA 1PZ0A 5HR6A 4W9LC 1NGXB 2AK4E 1ONEA 1LXMA 4NQEA 5FCUH 2DBLL 3PQYA 1H15B 4IRSD 5E4OA 3RWDA 1NJ9B 1P53A 4YAQB 5A3IC 4WR3A 3FUMA 4FXKB 5LGXA 5GGRB 2ZCLH 2D2OA 3QUMA 1XRFA 5L7XH 2Y07H 2CALA 2ZX7A 5HDWA 2OMTA 3TJEH 3LZLA 2NTFA 4OGXH 2G30A 5DCBA 1W1TA 5HPCA 2XN9D 2Y7OA 1W0WB 3V4PL 2ZXWB 4NUJA 4AQEA 3NJFA 4PFHA 4EOWL 3QUYB 1H3XA 3UCDA 2J8UA 1E2ZA 3LOWA 5DR5H 4FLSA 3HG1A 1JV5A 3SGGA 1WZLA 4KO9A 2XWBB 4ZNEA 1E9OB 1AFSA 1FFOA 3C3UA 4FI4A 4CD6A 1YMYA 1A14H 3SPCA 3S34L 3CX2A 2AGJL 1H9DA 1HH6A 1WBZB 3C5ZA 2FB3A 2WC7A 4QRSB 2QCDA 3QNYB 3TA4D 1K9EA 2J4GA 4RPQA 3VPLA 3CQJA 3I6GA 4I9WE 4PCSA 1JUKA 3KVJA 4XX1G 5L2KD 4J3WA 1SEBA 1PBYA 4JFXA 4O58H 1WUEA 1KV8A 3NR0A 5A6MA 1FNSH 3OC8A 4L4MA 3JSSA 3TQVA 1U91B 1LBLA 3CLEL 1TYEB 5IV2B 1T4KA 2AJXH 3HMWH 3NABH 4NX5A 2Q86A 2AJUH 2VDNB 3E6FA 4MD4B 3K0YA 3ARBA 4ZI8A 5GGUB 3SE3A 1S2WA 2UY4A 3H2AA 4ZBCA 1L6SA 4JDBA 1RUAL 3QY7A 4L8DB 1L7TH 3D4YA 3FT2B 5AKSA 3ZDZF 2P8MA 2XQYG 3S7GA 1HUVA 4PY7B 2FZDA 4QNPE 4ZOBA 4OFYA 3ABZA 4ALAL 4MY1A 4UNLA 2K1MA 3ARRA 1LF1A 3HQ1A 2XFYA 3PZIA 3TJLA 1GYWA 4YHLH 5DJXA 4M82A 4AMAA 1RZKC 3NZPA 2VX5A 1KTCA 2P50A 2QHAA 4HZLB 3L3DA 4QRRA 3HB3C 5C0EA 1RAKA 4NT6B 1SEQH 3B5GA 3ESVF 3HRZC 2YK1H 1OFOA 3FT9A 5GRUH 2OYPA 2BNRA 1F6AB 4B97A 1A7NH 3EYSH 2JKSA 2I5QA 2W3ZA 4XD5A 3ZTNL 4F3FB 3NJGA 3WL9A 5B8CC 2GUOA 3THAA 5ITBH 3BRDA 5JBDA 1HZHH 3ZR4A 2NX5B 3JWOH 2BRQA 1JHLL 4KO5A 2E9WA 5HGDB 4GWEA 4XNMA 4RX4A 2J5LC 4N9DA 4NJ9L 2QKIA 1MHCA 3QC5X 3OX8B 3U25A 5HPMA 1B31A 3IJIA 4H25B 3DHDA 3GTVA 1NDTA 2A3TA 4NO2A 3PWGA 4X6CB 3GSVB 4FFWC 4N0FA 1E4KA 2YC1A 4LFHD 1PYWA 4ZO9A 4PHXA 4PQXA 1NCWH 2B9BA 3U0PA 1FPTL 4DVRL 3IACA 3HR5A 1PFOA 1BYDA 5HYJE 4JTIA 4GKNA 2BX7A 1XLDA 2EC9U 1A7PL 4N2HA 4UQIM 5HBFA 1O5RA 5ALBH 2CUAA 1J8HA 2OMTB 4NM8H 4YSCA 3W9EB 5J8LA 3WEXA 2PWHA 4ZMNA 5KYYA 1ZA6A 4DEUA 3LS4L 4QRRE 2C18A 3R6IA 3N40F 1FO0H 7ENLA 1AW1A 5ALCH 2LAAA 3ECUA 2VM8A 3L68A 3APYA 1V79A 4P5KB 1BQRA 4V1YA 1A4CA 4PLJC 3TBBA 1J05A 3NM3A 5FYKU 2HTMA 1A0DA 2W0PA 1ADDA 2NXHA 3W4RA 2VOMA 4A3UA 2K9UA 3ILDA 4PRIB 5JOPD 1W16A 4FMKA 1OM0A 2NW2A 1U1HA 3BOLA 4ZD3H 1MXSA 1U5HA 3RVTC 2TRYA 4CGTA 1LD9A 4OUOA 4Y4HD 3PULA 2WWMD 4NZ3A 5BZZA 3JV6B 3MXVH 4X63A 2O9PA 4DCQB 2APTA 5LGHH 3MC5A 3W1UA 5A8OA 4APQD 3AU6A 1JPDX 4KZ0A 1SY6L 2FAUA 5JMRA 3QUZC 2ZSWB 5KANI 1N8FA 4Z3GA 1E9LA 3GKWH 3OGSA 2ZUTA 4O8RA 2IH1B 2QV5A 2OXHA 4JN1H 3VDGA 4B2DA 4RX0A 3NQ2A 2X89D 3S5OA 5FL0A 1BGXL 1NIUA 4JFTA 1ADWA 3UTSB 1ZA3A 4XVJH 4JY6B 1PKQB 3TCTA 4C83A 4L7ZA 1OARL 4K94L 3W0WE 4EE2A 4YWGH 5C0EB 3QSRA 4PI2A 4ERGA 2FTAA 3G08B 4LS0A 1SPDA 2FYVA 4G6FD 1PCSA 4XN4A 5ENWA 2IPFA 2H0FA 4N1HB 3RWHB 4LUJA 3HZVA 3EWYA 3PZVA 1NLBL 1RUSA 4GKSA 4AM0A 5CN1A 1ZQ5A 4NO0A 1UD4A 4KC3B 5E1IA 5HI5C 3FT1A 1PZ5B 1WQVT 3VXMA 3DFPA 3OKEB 3BLBA 4LSBA 3STEA 5F7DB 2VR7A 1QNPA 3IJYA 2DIKA 3K2UL 4KI5C 1IQWH 4AKOA 1NOUA 3TVMC 1BYNA 1AK5A 3U6RB 1RV8A 2PPGA 2VUOA 4W93A 2E40A 4UCFA 2Y69B 3LNPA 4AZ6A 4AHQA 4L4TE 3IJEB 2R29H 4AGOA 4IU3A 4YBHA 4YDIH 3W9ZA 2XFXB 5E56A 1RUKH 2GBAA 4PCNA 4QF1A 3BVNA 4HHAA 2BY0A 3N85L 4GAYB 3U6XA 4ELME 1A14L 1SZRA 1IEAB 3LMJL 3PJLA 1JZEA 4I7WA 1H7OA 3A5FA 5CS7A 1MCCA 1KIUB 3KWXA 3RX3A 4CVXB 1X5ZA 3SE9L 3W81A 1E71M 2V9DA 4QNWA 3THCA 3EPNA 1T2XA 2Q7AA 2DSZA 1YEJL 2XN0A 3DHMA 4IJ3B 4CC4A 5KSBF 4MHHI 2C3HA 3NQIA 5LBSL 4CU7A 4NPYA 2CIPA 2GOKA 4WFGE 4MPKA 1OTUD 3GUTB 4FOMA 4L3AA 1II4E 2A77H 4PEKA 4V1XA 4K5OA 4ZCWA 4YEFA 2DIAA 4K0OA 2RAGA 3T2OA 2OMXA 1M3IA 2GTQA 3PDGA 1U8NB 4KGJA 3B8DA 3T1GA 3T9PA 1OCQA 3ZYIA 2YPLB 3S97C 2YMXH 2YAPA 4KXCA 4GYFA 5CBAB 5XINA 5CZVH 3MCMA 3AIWA 3OVGA 5DS1A 4XOBA 5EF1A 3P4MB 3GSMA 3GBML 1YMMB 1S5HB 5I0DA 2A83B 2VEFA 3QEQA 2PW1A 2HJFB 1NEZB 1UT2A 4NO3B 3VQLA 3MBDA 3FB6A 4RMUA 4IX2A 2LLLA 2BM3A 5G2WA 5DRNA 2UVFA 1SHSA 1PGRB 1F61A 3H0TA 4ZMLA 3W7KA 1S5IH 4NNPL 4QXTA 4BEQA 2OYKA 4DRSA 3O9WD 4R0LA 1AYOA 1DFXA 5F93C 1M6OA 2FX9L 4K68A 1A5UA 3EG9B 3NIFB 4UM8A 1ELSA 4NQ1A 4QNEA 2V2WB 4OD1L 4AZHA 2C9RA 4JRXD 4PJXF 4UFLA 5BWAA 1A7QL 2A9NH 2NX5E 4K07A 3D0LA 4DH2A 1IEHA 3M1BA 3DKHA 1WAAE 2DKMA 2WY3B 4JVPA 3RIFK 3AWNA 4HYRA 4Q8TA 3W1ZA 4H3DA 3AUWB 4NP9A 1YN7B 1HKKA 1FG2A 4EXBA 5I18H 2XWRA 2EKCA 3PWNB 3GTXA 3SIKA 1VFOA 2PGWA 5AYYA 2HG5B 3WGUB 4GAJL 4IIEA 3VE0A 5DJ2B 1D5ZB 5LG6A 3NA8A 3URBA 2WN3A 1NFDB 2EIKB 1LRNA 3CNYA 4GS7C 1IGYB 1RSYA 4OFDA 4QYOA 5FWRA 5BRZD 3OZOA 4XBGA 1QO5A 3UY8A 3P0VH 2PCXA 5DJZA 3EWCA 3CZEA 3NPVA 4Y16B 1RVKA 4TNVF 1U5VA 3WFLA 4YDNA 4RGMB 4UB0H 3RPKA 3C60B 2BIMA 1R17A 3T2NL 3DKJA 3UDWC 3JW7A 3WD4A 3P54A 3HFFA 4S0TD 3BV4A 4M6PA 4HU4A 1PBGA 2QDVA 1V02E 2Q8BL 1OTSD 1F13A 5LYRA 4QI3A 4FXSA 5JIMA 5JTWA 4F93B 3X12A 4S2CA 3W6LA 3QXWA 4K7PL 2DDXA 1E3ZA 5IJBC 1ZV9A 1NAKL 3ZGHA 3BW9A 1OK4A 1Z9SB 1DANU 1N12A 1X6LA 3KDMA 3NIDB 3EOOA 3P8JA 3EYUL 1XGRB 2G95A 3EOBB 2VYRE 2BRRH 3QO1A 4MA8H 1T1XB 5T1LA 2YKKA 3G5YB 3WNMA 5DJ8A 1EWEA 2NVAA 4IPNB 5JBEA 1UJ3C 4RDQG 2ZA2A 3N85H 1JZ4A 1QBLH 2QF8A 2F54B 4N2EA 1LUCA 3LG3A 2NV2A 2HVKB 3FUDA 4JTAA 3S4TA 4EUPG 1TTAA 3CFTA 4XN2A 1DQUA 2VMCA 3I6EA 2HTKC 3EH1A 1RK7A 2PP9A 3UTTD 2I9TA 4ZG1A 2WTRA 5IQNA 1BFTA 4LEOB 1LO3L 4ACPA 1JCNA 2VWTA 3U9UB 3GXIA 4TNEA 3W3OA 4YYCA 5EU5A 1EJTC 1UH2A 1XYAA 5EMMA 3UWYA 2Z6FA 5F4SA 1AG6A 1TEYA 4N2BA 2X1PA 3E2HB 5CJ8A 2DZUA 5EOQH 1H7PA 1VR6A 7XIMA 3CASA 2W9DL 3PTKA 4D9LH 5FECB 5HHOB 1L6FA 4BK9A 2ZYHA 3TCLA 4LSSH 1O5XA 3MV7D 3E0IA 2DQHL 2Q3XA 3PF2A 2YZ1A 5HHNA 5GIRA 1FCGA 3GUWA 1NC2A 5CGMA 1XS2A 5I3IA 4NB7A 4NKMA 1I8UA 4TX6A 5AAPA 4ANUA 1RPXA 3PS7A 4DZAA 4MJIE 1LQSR 2QTVA 3U7WH 3FOKA 4PJ9B 4XVUC 2OL3L 4HKJB 1ZGLP 2BB0A 3FH7A 1AANA 2FJHA 4HV8B 4MDJA 4PM1A 5DRXA 2Y7EA 3AXLB 2FZ9A 1JPSH 4ZXBD 5CZTA 2CCWA 3RNQB 4M5YH 1E5ZA 5CHNB 1NQBA 5E4EB 1ZS8A 3EJZD 1H6UA 3P11H 2ICEC 1ZVNA 4KJPC 4P9MH 3V0JA 1PZSA 3UEQA 2OEJA 1ACZA 3LA4A 1QRNA 5CBEA 4G6AD 3N42F 1QSED 1M65A 3G2GA 3RURA 1D7BA 4R2GB 5SWZD 2VCAA 2WSYA 1ORSB 3MJ7A 3QCUL 1KLGA 2IWGA 3X1FA 1CTOA 35C8L 4WVRA 1JYWA 4J39A 5K9DA 4KEZA 1OP3K 4LCWA 4AMKL 2MJWA 2GVJA 2DTMH 1J1OH 2OCFD 3U46A 3MBEA 5E6IB 3W6MA 4NNYB 5L7XL 5BUAA 4E2OA 1AS8A 3AC0A 3O6ML 5I1DA 1U42A 4FTDA 2FK9A 2G41A 1NPUA 2VDQL 3L1OH 4NN5C 4NUGL 4Q9QH 2Z92B 4MAVA 3UG3A 2YGPA 1I6NA 3CX5K 1QLEB 4LESA 3V0HA 4KI1A 3KW8A 3MRLA 3BX7C 4XNQB 2BOCB 1R5IA 1EAJA 3SO3B 4U0QB 3B9KD 4UT9A 2R69A 3S2NA 1XBVA 3HPXA 5GGRY 1K3ZA 3F6LA 2ZOLB 3FQRA 3B1TA 2V2WA 1QFUL 3HJEA 1YY9C 5BMFH 2ZRYA 3PG8A 3QH2A 3VFGL 2Y4SA 1IBYA 2HPTA 2ADAA 4JFQA 3GFYA 3J7HA 5IOPB 3W7NA 4D8AA 1SZNA 1BQKA 3JU2A 3TXAA 4EVNA 4JZNB 4W81A 5EOCL 3AISA 1MVUB 1NMCB 1Q9LA 2H9GA 3EXJA 1Z5HA 3V6OA 5FGRA 4R4BA 1KBPA 1KXTB 1F5ZA 1BMGA 1TCRA 3ISRA 4L1LA 4F7PA 5GZNA 3MYPA 3O3EA 4PUBL 3KCJA 4JFEE 1TJPA 2G5BB 4IRJA 4X7DC 2WJ7A 5JXAH 1E0VA 1RLDA 2RJGA 4JCMA 3RNKA 4B53A 4AE1A 4XNUH 3WJMB 2OU4A 4R27A 2EH8H 4Q2ZA 1O1HA 5IUCA 5JIWA 3IBEA 1QWGA 2Z7GA 3WL1A 1T21A 2XSKA 1WNOA 1TVNA 5CPTA 4AIOA 1JCTA 3E74A 4M1RA 2XTSA 3RA7H 5DS2A 4GRSA 3II1A 4IG2A 1CMOA 3UZEA 4J3OH 3ANVA 4DOHB 1LE5B 1H41A 3GIZH 5KSAD 3I65A 4W86A 2ACQA 2WBKA 3V7PA 3DO3A 3TONA 4MAYA 3MLYL 5DJAA 1NM9A 2VT0A 3NZHL 2X70B 4NHVA 3T4WA 1NY1A 1KZYA 2GHZA 2AOSA 4LHUG 4NKQB 4OGQC 3D0VA 2OPJA 1KRCC 1HSBB 2PUZA 4X2PA 2YD0A 3QZLA 5HJYA 2B1HL 3PGCA 3N14A 3GEFA 3P4NB 5D2LE 5DMIL 3USBA 1CFMA 4P07A 1XSIA 5IMOA 3V4VB 4NZ1A 2FO8A 2BVOB 3WE6B 1KV5A 3DIDA 4I1PA 3KD4A 5FCZA 4Z1PA 1TPVA 3HF3A 4S39A 3JVAA 5AOMA 5AVUB 2OP4H 1INDL 4K9JA 2A4EA 2XV2A 4QJ5B 4YHML 3MBFA 3EYSL 1DLHA 3OAYH 2R4RH 1KT2A 1PZ5A 2CMRL 1IVLA 2EEXA 4LP4A 4PV8A 3VXMB 3HI5L 1O60A 1MFMA 2YDQA 1FG9C 4CNNA 3UO1H 2VJXA 3KMDA 1PZCA 1F4XH 5EU3B 3M0KA 3OMAB 2VN5A 3BN9C 3CPLB 5CLXA 3U36A 1QOPA 1KIPA 4NJGA 2PO6B 3NCFB 3M17A 4XXDA 2AQWA 3S8HA 1KGYE 3AWGA 4IK7A 1FDLH 4GRMB 1CGUA 4OB5L 5IROA 3VI4F 2FX7H 43CAB 4S11A 1F6PA 2DEPA 3UVAA 1ADQL 3ARSA 4KI5D 1VQTA 3O2DA 3O6KH 3POCA 3GC4A 2ZT9C 4FABL 2EDWA 2YXVA 3JUZA 1GOXA 1AZVA 2ZKWA 3GEWB 4JDEB 4CEUC 4ZPTB 3MW7A 3UTTE 4UV7H 3ULAB 4W7UA 5JMUA 1UROA 1DZBA 5CC7A 3L5MA 4NPJA 1NGQL 2YZRA 3VIPA 2RFGA 3VE0B 4L9DA 5EF0A 4K39A 3QYQA 2X40A 1VS1A 1MCEA 3GWJA 2AABL 1JSYA 3TA3D 3KRBA 4GQ9H 1T7ZA 3A4DA 1BOGB 4NWUL 4QTIH 5AVVB 1QNOA 1AZCA 4RV8A 4H4IA 1IT9L 4NCC1 5I76A 3W1XA 5FEZA 1HC1A 4M1BA 4J4PD 2FL5B 4YDKL 4YHYB 4L61A 1XIBA 2F9RA 1JF6A 3RVXC 3MVIA 1C08B 2PLJA 4EO5A 1M7PA 2XVGA 4IOSD 1J9SA 3L3OC 4MSWA 1TQXA 3P11L 4ZW5A 1XWYA 3IGFA 2P5WB 4NP7A 2QQKL 3WDQA 4W9IC 3DG7A 4YIQA 4TTDD 3QAZB 2V7HB 1XLFA 4GY4A 2H0JA 2V37A 4B9CA 4I77L 5E2VH 3RU8X 4BWLA 2EYRB 2YAOA 3CIQA 2Y7MA 4HS8H 2R9HC 3OMZA 2L7JA 3VD3A 4AGMA 1G01A 3VRIA 3TH4T 3PZQA 5CG7A 4B5XA 4XBEL 4Z3IA 2P88A 4GQGA 5F8QC 4TTDC 3K71A 3MKVA 4NVTA 1MW1A 1BVNP 3O4LA 4DKFH 2IH1A 3KLQA 4QISA 3A6CH 5DX7A 2FTPA 3QDJD 1PDYA 2QQLL 2BWIA 3MI2A 4UMSA 1CB2A 2EGZA 1HXMB 4JFED 3KS0J 4IQHA 2G2NA 2GBTA 3HO8A 4QDPA 3IETB 3F12A 1GOHA 4U0RB 4MCMA 1IBFA 2OX4A 2RKXA 4GE8A 3ARZA 3TZVA 3PZNA 2BSDA 2W79A 3VIIA 1D5IH 1ZOXA 4QTHB 3QR3A 2CBMA 1F42A 2BVOA 4PCTA 5EU7E 1ZXKA 3KHJA 4ZQKA 2ROXA 2F58L 2P5EE 1U3YA