1JDAA

Maltotetraose-forming exo-amylase
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
total genus 136
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jdaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jdaA01
2IXUA 1CENA 4F79A 1AQMA 3BUIA 2G3IA 4AD2A 3ARZA 1VEPA 1XGZA 4M24A 3ZT5A 3A22A 1MQPA 4J3SA 5E09A 4AZ5A 3HJEA 5A6KA 5EFFA 1XD1A 1J0KA 3NSXA 4JFVA 2YL8A 1W2VA 1GQJA 4W84A 4CCCA 1HJXA 2DH2A 2XSAA 1YHTA 1I75A 2D22A 1PS3A 3W4RA 2W91A 1GOKA 2ZX7A 3L4UA 2X2YA 1LLOA 4GI9A 1E4NA 3F5LA 4PSPA 2WCAA 4JKMA 3HG5A 3TONA 1HJWA 4RE4A 1TR1A 4WIWA 5BXRA 1HJUA 4MNJA 1XCWA 3MUY1 3GBDA 3A5VA 4YN5A 1NOFA 4Y7EA 3I3BA 4J3VA 1GVYA 3K4DA 2GSJA 1BAGA 3WDIA 1R87A 5CSUA 1RD6A 3SUWA 1WO2A 1B9ZA 3UG5A 3VUPA 4UTFA 3AHVA 2BXYA 3DHUA 1UH2A 1W9PA 4WKAA 4AZ7A 3VGDA 2UY3A 4S3JA 5LA0A 2YBUA 3W26A 2PWGA 3CGTA 4P8XA 1D7FA 3WD3A 5DT7A 1UWTA 1KGXA 1UOKA 3BLKA 4B9ZA 1QOXA 4WJXA 1WKYA 5CZKA 2QLYA 4MPKA 1CGVA 3UCQA 3DYPA 2TAAA 2D23A 3ARYA 1W9BM 1KQYA 1QBAA 4KWUA 1HX0A 3PZOA 2CNCA 1EQCA 2WW5A 2WKLA 2XJ7A 5EMYA 3VSUA 3WEOA 4ATDA 4MAVA 3BC9A 4KRUA 5IFTA 1KBKA 4FMVA 2XVLA 4TXEA 4BF7A 4WKFA 2EEXA 1SZNA 2VURA 1WDSA 2G3JA 3DDFA 2PBGA 2D2OA 3WD2A 2GJRA 3D52A 2DT2A 2FE0A 1ISWA 5A8QA 3FAWA 4UCFA 3VMPA 2MANA 4LXFA 2FHFA 2WXDM 2NT0A 4P7RA 3DX3A 1CGUA 4PMXA 3M07A 3B9EA 4ACZB 1G9HA 3EJSA 1UQYA 3N12A 4QFUA 4YPJA 1P6WA 3F5KA 2F8QA 5D8ZA 3VIMA 1AQ0A 3PZ9A 1QHOA 1HVXA 1JF5A 2QV4A 4CCDA 3IANA 3MANA 3WIJA 2EJ1A 3GXIA 3S2CA 3DX0A 3OG2A 2ZIDA 2ZX6A 1UD4A 4MB4A 2J7FA 1IZJA 4UQAA 3VNYA 1DWHM 3JUGA 1V02A 3PTKA 2BY3A 3VX1A 5E0CA 1UR2A 4HZ6A 4L4PA 4E8DA 2X1IA 2VVSA 2E8YA 4YHGA 4TUFA 1PX3A 3ARVA 1R86A 5A8OA 3VSTA 1BYCA 1GONA 3VD9A 2YDSA 3KL0A 1VBRA 1BG4A 3B9DA 3QHMA 2VUYA 1QWNA 1CECA 3FNDA 5FD0A 2J75A 4MJ2A 2DT3A 4UZSA 1V0MA 4BA0A 5A8NA 3HG2A 2VZOA 3O2LA 4UQBA 3WF2A 4Z2JA 1UZ1A 3AIEA 1DHKA 3M46A 4CD7A 1TQVA 4J7RA 1ISVA 2J77A 2BVDA 3VIHA 4DO4A 4BQ5A 2WZIA 1E72M 3VGBA 2OLHA 3MI6A 2NSXA 3VMNA 1XSJA 3WL1A 1QW8A 4F9JA 3ZMRA 3D50A 4TTUA 3IJ8A 1CXKA 2XVGA 3EDKA 1V3KA 4H7VA 2J7EA 3L4TA 2A3BA 4DM2A 1JYXA 1X6LA 1K9EA 2WK2A 5CPTA 5FOOA 1MQQA 2WHJA 3RILA 1QWUA 1JG9A 2JEQA 4UFMA 1UQZA 2YA0A 4HP5A 2W67A 1GOMA 3ARPA 1UKOA 2EAEA 3LX9A 1W1TA 3AS0A 2EPMX 1QX1A 1OCQA 3A3HA 1S46A 1KQZA 4QLJA 2WBGA 2CPUA 2ZX9A 1OB0A 4CD6A 4V2XA 2A3EA 1BF2A 1PEZA 4QLKA 2V3EA 1EOMA 4F9DA 2EPLX 5DEZA 3L4VA 1UH3A 3AMKA 1WZAA 1X6NA 1B30A 1BFNA 1ZBCA 4D6CA 1BTCA 5E70A 4D1JA 5A1AA 7CGTA 4GO9A 2O9OA 1FP9A 2UY2A 2ZUVA 3WQ5A 1V3IA 5A6MA 5CLWA 4CVUA 3KLKA 2D73A 4PMUA 3LPFA 4HOZA 5D8WA 5CXPA 5AY7A 3S6TA 1ESWA 2HVMA 1CLVA 2C8NA 3MMUA 1J0YA 4U3CA 4ZXOA 1E6RA 4IISA 3WEZA 3W0KA 2FHCA 4CU7A 5ABGA 1KXQA 3WH8A 3CUIA 1ITXA 3KL3A 1PJ9A 1KR0A 5HXMA 2DSWA 3A47A 4ZXLA 4GINA 4HOXA 1B90A 4PSRA 2XIIA 1QI5A 3CMJA 3IJ9A 2J7BA 1TG7A 1MW1A 1J0HA 1BVNP 1C8QA 1QW9A 4AD1A 1H2JA 3D51A 1C8YA 1ZJAA 3WUFA 1WAWA 1W91A 5I23A 3K8KA 1K9FA 3CZGA 7A3HA 2FGZA 2RGLA 2CETA 2YLAA 1E15A 1VAHA 2WMGA 1TQSA 2ZOXA 1Q4NX 2Y24A 5A8MA 3NYDA 4N42A 4UR9A 4CUCA 1JZ7A 2OW6A 3KE0A 2BNJA 4UQEA 1AQHA 1NP2A 1SYTA 1KCLA 3AMDA 3PZMA 4QCEA 4AIUA 5IHSA 2FDMA 3LRKA 3LXCA 4F66A 1JDAA 1XH2A 1EGZA 4ACZA 2CIPA 3TV8A 1V3LA 2ZXBA 3WF3A 3BH4A 1UD8A 1G1YA 3VGFA 3QR3A 1DWFM 4JAWA 2V5CA 3W37A 3AIQA 4WK9A 3W27A 4W86A 4ZENA 3WQ6A 4H8UA 1GVIA 1OBAA 1UWQA 3I3DA 1KBBA 4R27A 2DIJA 3N15A 1US2A 5IHRA 3THDA 2VMFA 2WHLA 2GDUA 1U30A 1KGWA 2ESCA 1KWKA 1A47A 4V28A 1B3ZA 4U31A 4A3HA 3BAXA 3VU2A 1V6YA 3PZQA 3FHQA 4NXSA 3WDPP 4W93A 3T2PA 1CZ1A 2XN0A 3SUUA 1WP6A 5HNNA 1V0KA 6TAAA 4ZFMA 3IGUA 4UOZA 1JFXA 3FN9A 1V3JA 4E4PA 2CEQA 3ZR6A 4CU8A 1UR9A 3WL0A 3W82A 1E6PA 3W6MA 3SCSA 2WYSA 2A3CA 2JIWA 5D9OA 4DWSB 1DEDA 4CN6A 1HT6A 4NRSA 2F1BA 1BQCA 3WBEA 5CPQA 4JFSA 3RM9A 3K8LA 2FYVA 2ZUTA 1SR0A 4JFWA 4P7QA 4PTXA 5DF0A 3CLWA 1UD5A 2J7CA 4AYGA 1R7OA 2VTFA 2X0YA 4BQ2A 1DWIM 4W89A 1JFHA 4XUYA 2GK1A 2XGIA 1HKIA 4JIEA 3WDHA 3B9AA 3WDQA 3M7SA 5FL1A 2WLYA 3WF4A 1H3GA 5BRQA 2VVNA 1E43A 1CNVA 1NARA 1GHSA 3WQWA 4AY1A 2BXZA 3H54A 4CU6A 2WNWA 1QNPA 1VFUA 3VNZA 2BS9A 4OUEA 2DSKA 2XWDA 5M03A 1XHGA 3S5ZA 1TMQA 2XVPA 4H41A 4FNUA 4AIEA 4D6GA 2OW7A 4WF7A 1UKSA 2YA2A 3RJYA 5A2BA 4ATWA 1ISXA 5JBDA 1R7AA 3EMCA 5I79A 3FW6A 1E3ZA 3BAJA 2O9RA 3BLBA 1JD9A 3PZUA 3T2QA 3W28A 2DEPA 3WDJA 2GJPA 4UFHA 4PBGA 4EK7A 2FHBA 3VD4A 5D9PA 2EPKX 3AIWA 1RP8A 4Q7NA 5IXEA 1BLIA 1MWOA 1UWUA 5HDRA 3NCOA 1KR1A 4W7UA 2E4TA 3HZ3A 3GNPA 1VFFA 1HNYA 1DWAM 2GFTA 4DWSD 3WD4A 2VT0A 1RP9A 1U33A 2EABA 1JNDA 3T0AA 1ZS2A 4IPLA 3ZJ6A 1TA3B 4CD5A 3UESA 2O9PA 1EHNA 3W6LA 1GPFA 3GXMA 2QHAA 2ZX8A 2VR4A 3SCUA 4J28A 1Q6EA 2J7GA 4QLLA 4PUDA 3QHOA 1E73M 2B31A 1HJQA 1OIMA 3AZTA 4CD8A 1Z32X 2JIEA 2UY4A 4PMRA 3LRLA 1W3LA 4GZJA 4AZBA 2FGLA 2FH8A 4AMXA 3VGEA 4MAZA 2YL9A 2EPOA 4NF7A 3WQ8A 4CD4A 4JKLA 3UERA 2IUZA 3AXIA 4TVDA 3T2OA 2ZXQA 4XZBA 3PZNA 4JHZA 3A24A 1XYZA 5EBAA 1PPIA 3WF0A 5A2CA 3ALGA 2BY2A 4B16A 2W92A 2WSKA 3F4VA 4PTVA 2DQXA 2J8FA 1KCKA 1CXHA 1UKPA 3T0BA 4AD0A 1O6IA 1KTBA 3PZVA 3BUDA 4W85A 2IGTA 3ZOAA 3IAPA 4WKHA 3PZGA 4QDMA 1G01A 3AHYA 1LL6A 2D0HA 1EH9A 3RIKA 5HOSA 4P8VA 4UQDA 5A6BA 2AMGA 1E6NA 3WH7A 1IZKA 1BYAA 3IK2A 2D20A 3ZR5A 3SCRA 3HN3A 2VO5A 5DT5A 4HA4A 3BGAA 4NRRA 1QI4A 3VIOA 3CZSA 4LQ1A 2WSPA 4MJ4A 1GJWA 6CGTA 4FNQA 4Z2HA 3N17A 3KLLA 3BVWA 1GUVA 2JE8A 2WBKA 4UQ9A 3POCA 1NM9A 2DDXA 1V6VA 4ACYA 2W61A 3BSHA 1V0LA 4NZFA 4QAWA 4HU0A 3MSGA 1C8XA 2PWHA 3WNMA 1OGSA 3U7VA 1ISZA 3WNLA 1UD6A 3SURA 3VIFA 4JKKA 1G5AA 4BQ3A 1D3CA 1Q6FA 4AC1X 4HZ8A 4IM4A 1GOWA 1JF6A 1QNSA 3WF1A 1E3XA 3SEPA 3MV11 2QPUA 1M04A 3WY1A 1CBGA 1E70M 4RE2A 2D3NA 1NWSA 2XSBA 1E0VA 1ECEA 3A23A 2EQDA 3RPMA 1E1EA 3QHNA 3AOFA 4H8HA 5ECUA 1ZU8A 4AZIA 4W5ZA 1E5JA 3MS8A 4X0VA 1CDGA 4J3WA 3ZJ7A 3RJXA 1CEOA 1XYFA 3MU7A 1UR0A 3HG4A 5BXPA 1HWWA 2J7DA 1B1YA 2BFGA 4HTYA 5E9AA 4FNTA 5BRPA 2E3ZA 4D6IA 2A3AA 3WUGA 3RO8A 4E2OA 2VNCA 1HP5A 3W29A 3ZJ8A 4RL3A 1LQ0A 2UY5A 1BPLB 4D1IA 2W5FA 1XH0A 4M1RA 1MVYA 1JYWA 4PMOA 5I0DA 1UWRA 2XPKA 4A3YA 4CKQA 1RH9A 4KGJA 2WMJA 2QPSA 4Z2KA 4NZCA 1R34A 1HIZA 2XUCA 3AIUA 1K9TA 4M29A 2PC8A 3FY1A 1W9VA 1MYRA 4H2CA 1GZJA 2FH6A 5A6AA 4PMQA 4UNIA 1M53A 4TX6A 1AMYA 3WH9A 1E5NA 5FCZA 3BAKA 3GM8A 1T0OA 2F7OA 3OLEA 3FHAA 4Z2LA 1A3HA 2WM0A 1H09A 1C93A 2Y2WA 4JL1A 2EACA 3OIHA 1PZ2A 3L4YA 3WNNA 1TUXA 3L2MA 2J4GA 3ARTA 4GI6A 1J12A 4FLRA 2WANA 2XVKA 2W63A 5M3WA 1GCYA 1FH9A 4JCLA 5A69A 3L4WA 1JZ5A 5I77A 1W3KA 3CO4A 1BYDA 3T09A 3AMLA 2EXOA 2VRKA 1UA3A 2WLZA 3CZKA 3PTQA 2CHNA 1WZKA 1V6WA 3K1DA 2E0PA 5A94A 3N9KA 2PWEA 3NJ3A 1MFUA 3A4WA 3AROA 1CPUA 2XWEA 3I3EA 3DX2A 3AIVA 1ISYA 2ZUMA 4RE3A 4GXPA 1XH1A 2F18A 4UFLA 3GXDA 4U33A 2UWFA 1WDRA 4MTVA 2ALWA 2CKRA 4B9YA 2J8GA 3PZIA 2RGMA 4DUWA 1E1FA 5IFPA 5GNZA 2W4XA 1E71M 2OWXA 2X09A 1O7DC 2G41A 3BUPA 4OOUA 4M8UA 1HVQA 2OWCA 4GQRA 3TTYA 5KEZA 4UOJA 5E0FA 4PTWA 3UG3A 2JF6A 3AYRA 1VFMA 3WD0A 3D4ZA 2WWCA 3VM7A 2DSVA 2XM2A 1KTCA 4LYRA 1JZ2A 2EO7A 3CH9A 4TX8A 3VD7A 3WQ4A 3PN8A 1ZJBA 3CZNA 3D4YA 1OGBA 1U2YA 1PZ3A 2XG9A 4XB3A 4PRWA 2YBTA 1NWRA 1WDQA 4B3KA 3CHFA 4ZE4A 2E9LA 1CYGA 1TQUA 3IJ7A 2YFOA 1EXPA 3AICA 2DPEA 1R46A 1W32A 3OA5A 2WC7A 1WCGA 2E8ZA 2OYKA 2E9MA 4CN4A 3WH5A 4HA1A 5JBFA 1QNOA 2F1AA 4LYPA 4FNRA 3SCOA 3A4XA 5A8PA 2GVYA 3VINA 3L4XA 1SMAA 1ZB5A 3LPOA 4JFUA 2CBIA 3LXBA 3OZPA 3VD5A 4MB5A 2VX5A 1WB0A 2X2HA 1NWUA 1HKMA 5LYRA 3MKKA 2VZUA 2DH3A 2OSYA 4HZ7A 2O92A 2GK1B 2E40A 4DWSC 4DO6A 1TVPA 3MUZ1 3O6AA 4CN1A 1BYBA 3POHA 4JZ5A 3TTOA 2VJXA 1V6XA 2YL6A 4FF5A 1WDPA 4EANA 1J9YA 2WMFA 2WHMA 3VOCA 2ZWYA 3ZSSA 1EQPA 3WUBA 1QVBA 5A95A 1FFQA 1OD0A 1G0CA 1CXIA 2WCGA 1B0IA 3BUQA 3QGVA 1JDDA 1TVNA 3SUTA 1E55A 1D2KA 4WLCA 1LWJA 2XIBA 2PB1A 5A6JA 5AC4A 2CESA 1EHAA 2VZTA 5CPSA 3S5YA 2WVVB 1V03A 3M6DA 1OGGA 4AMCA 3ARWA 3KWXA 1CXLA 3EJQA 4DUVA 3EMQA 2Z1KA 3VIJA 2X2JA 1GNXA 2CYGA 4BZYA 3NIYA 3KEHA 4A4AA 3N11A 1Q6GA 2G8ZA 1W1VA 3CMGA 4IPNB 1R85A 3K4AA 3GH5A 2BY1A 1WZMA 1MXDA 1ZBVA 1FP8A 3WNPA 1E6SM 2BY0A 3II1A 1OT1A 2C0HA 1UWSA 4F8XA 1LF1A 4GO8A 3SCPA 3WQVA 1E0WA 2Q8XA 2BHUA 1FOBA 5IDIA 1FA2A 4UFIA 3CTTA 4ML4A 1QPKA 3GNOA 3VIGA 7TAAA 1SMDA 1NH6A 1JZ4A 2VR5A 3GYCA 3A21A 3CZJA 1UYQA 1CGTA 3LPPA 4AZ6A 1H4PA 3WUEA 3EJRA 3WFZA 3WELA 1GOQA 4LPCA 4PUEA 4U3AA 3WMBA 4D6EA 1HN1A 2ZICA 2JEPA 3AIRA 1NP0A 5I3DA 2CBUA 2AOSA 3B8SA 4MDPA 5ABHA 1C91A 5BCAA 1CWYA 1CXEA 3CZEA 3CIVA 1LG2A 3APGA 3G6LA 5ABFA 1E4MM 5A2AA 1J0JA 3G6MA 2VOTA 1R47A 3KZSA 4OIFA 4UQCA 1HJVA 4V27A 3TA9A 5BXSA 4UFKA 1WZLA 1XV8A 1OD8A 4JL2A 2D3LA 1JL8A 4OBSA 4AWEA 4B15A 3ARSA 1MW3A 4D71A 2G4FA 3ARUA 1JNEA 3CUHA 1NQ6A 1OT2A 2J7HA 3SUSA 1E40A 3GZAA 3LRMA 1CXFA 2VX7A 1ZL1A 4FK9A 4PMNA 4P8UA 4B3LA 4DWSA 3EMZA 1FH7A 2CBJA 4M56A 5ABFB 2XFRA 5JUVA 1JYVA 1L0PA 2CBVA 4D72A 2IXVA 1JAEA 1PIGA 4GIAA 2YIHA 5CGTA 1HXKA 4W8BA 1JDCA 5GQBA 2X2IA 1GQLA 1H1NA 1R75A 2XTKA 1TQTA 1FH8A 2V3GA 1CTNA 2X05A 4PMZA 1SFSA 2GJXB 2WMKA 2AAAA 1EDTA 5D9NA 5D9MA 1ODUA 1XSKA 3CZ8A 1CGXA 1UKTA 3KL5A 3LXAA 5DMYA 3AMCA 1FHDA 2WHKA 4MNMA 3OBAA 1NWTA 4W7VA 1PBGA 2CHOA 1CGWA 3ARQA 1HL8A 2D24A 1V3HA 2DT1A 3VGGA 1E4LA 2OSXA 3UG4A 3VO0A 5JIPA 5CSYA 4M82A 1UD2A 5FL0A 2J78A 4J3XA 4W7WA 3OGSA 4PN2A 1MW2A 4HMEA 4HMDA 1BSIA 3PZTA 2YDRA 4IUGA 2ZXDA 3GXTA 3SUVA 1V3MA 4W8LA 1GJUA 2CXGA 2GJXA 3TTQA 3AYSA 3EDJA 4AIOA 1UZ4A 5HBFA 3F5JA 3AHTA 3QOKA 3L2LA 4NX0A 5FIPA 3PTMA 3H55A 3GH4A 5AYIA 4D6FA 1TFVA 4PCTA 3WEMA 3PBGA 2DIEA 4JCMA 4AD3A 3VD3A 2VCBA 1J18A 3OGRA 4J3UA 3ARXA 5GNYA 2VQTA 4AD5A 1XRVA 3BXWA 3BVUA 1FHLA 1ITCA 3GXPA 2D1ZA 5KZ6A 1C90A 3GH7A 3OLGA 1VJZA 4LYQA 3VDBA 3GTNA 5CGMA 2VQUA 2BVYA 3W24A 1KGUA 1E6ZA 3WMSA 1VF8A 3RCNA 2J47A 3AS3A 2V5DA 4PMYA 1GQKA 4K68A 4QCFA 4UFJA 4Z2IA 2WC3A 4XV0A 5A6SA 1VEOA 5I6SA 3AS2A 4MNLA 3SCVA 3T0DA 3MV01 3ZSTA 4WSKA 2OYMA 1QHZA 1UR8A 3VM5A 1K9DA 3WBAA 3MUAA 3PHAA 2QMKA 3ZM8A 1NOWA 4GZIA 3EDFA 4H04A 1MQRA 1XD0A 1VRXA 5BYWA 2NT1A 4DM1A 1EO7A 3ZIZA 4OGZA 1QI0A 3BAYA 1OINA 4HPHA 2WVSA 5GNXA 3DX4A 2WPGA 1UHVA 3BVTA 4P7NA 5DO8A 4JFTA 1JXKA 4JHOA 1HTYA 1XCXA 2HISA 1DWGM 2X0HA 1V0NA 1W9DM 1V08A 3CPUA 4HOWA 3UR8A 2WCSA 1QI2A 1DTUA 1GORA 1JD7A 1EOKA 2VZVA 2YKKA 3ZT6A 1JZ6A 2BHZA 1M01A 3BMWA 2QMJA 2BHYA 2YDQA 4HMCA 2GDVA 4J27A 2YA1A 5BXTA 3UEQA 3VIKA 3WDRA 1HL9A 4KH2A 3TP4A 2WVUA 5A3HA 1GHRA 2CCRA 2XYLA 4NXKA 2VCAA 3AQUA 2W62A 3WKZA 3WFLA 4KGLA 5FKYA 1FFRA 4AEEA 4C7FA 4FLOA 2WB5A 3VVGA 4N0RA 2ZXAA 3NDZA 3HMCA 4OOZA 4E8CA 2YOCA 3AI0A 5LA1A 3EDEA 3SCNA 1C7TA 4M80A 2ZUWA 4PTMA 1W3JA 4OJYA 1KFWA 3THCA 1X1NA 3ARRA 3CUFA 3AHXA 2F2HA 3CUJA 4W88A 1ZBWA 2PBOA 1WNOA 4UOQA 2VZSA 9CGTA 1PX8A 3WN6A 4W8AA 1E6XM 3A4AA 1H49A 1BGGA 4ATLA 3A6OA 1QBBA 1CLXA 1RPKA 3GXFA 1E4IA 2XFYA 3W81A 1TCMA 1HKKA 1HP4A 1HXJA 2XHYA 4Z2GA 1VIWA 4AW7A 1GOOA 3VPLA 8CGTA 1JIBA 3NSNA 3DDGA 2J74A 2WMHA 1ODZA 6A3HA 2WWDA 1E9LA 2ZUUA 4M81A 3WH6A 4TVUA 3RM8A 2CITA 4S3KA 1IT0A 3OB8A 5TD4A 4X9YA 1TQWA 4AEFA 3VGHA 2VCCA 3VILA 1HKJA 3OZOA 1KB3A 1N82A 5M17A 2DSZA 1J01A 2DSUA 4AZCB 3WY2A 5DFAA 1Q6DA 5C8BB 2CERA 5I24A 1UG6A 2WVTA 2VI0A 4AD4A 1KXVA 1NOUA 2W66A 1UD3A 1J0IA 3W38A 2WZHA 3U5YA 4QP0A 1G94A 3CHEA 2V3FA 1PIFA 4AISA 1CIUA 3CHDA 4FNSA 3DYOA 3O9NA 4MNKA 2V38A 3T08A 1W9XA 2PWFA 1UASA 2C7FA 3AJ7A 3HG3A 3TTSA 3L4ZA 4W87A 1UUQA 2VRQA 2OYLA 2A3HA 3ZJKA 4EKJA 2BV9A 3WNOA 3UETA 2F7RA 4PYSA 1WE5A 4CCEA 5C70A 1GQIA 2Z1SA 1K6AA 2WVVA 2XFFA 3AHZA 2XM1A 3MUIA 3AXXA 1LJYA 4DO5A 1W1YA 3ECQA 2O9TA 3BAIA 1TA3A 3AIBA 3DC0A 1GOIA 3VX0A 4TOQA 4GZEA 1BVZA 4XZWA 1JZ8A 3CBWA 1LL4A 4YHEA 2Y4SA 5BROA 3MSDA 1J0ZA 2GUYA 1E6QM 3AS1A 3UR7A 4P7LA 4BQ4A 5E6ZA 4P8WA 3GDBA 4FNPA 4BS0A 3K8MA 4AZCA 2D0GA 2PF0A 1PX4A 1OSEA 5ABEA 3ZO9A 1BHGA 1UH4A 1H11A 3K46A 3EJPA 5HPCA 4H8VA 4OZOA 3WMCA 4AZGA 3BCDA 4GKLA 4AXNA 3CHCA 2OSWA 3D5HA 2EPNA 1XC6A 1YQ2A 5AC5A 3HU7A 1BGAA 4NSBA 2YJQA 1H41A 3OLIA 3U7BA 4FLSA 4GQQA 1Q6CA 2XVNA 1QHPA 5F7UA 1VEMA 2OWWA 4HU8A 5EB8A 4ZE5A 3QOMA 1LG1A 1AVAA 3BUBA 1KXTA 4XX6A 2J79A 1J11A 2XN2A 2Y8KA 3BCFA 4BCEA 3NSMA 4LGXA 3BAWA 3VTRA 3U5UA 3VIIA 2JFEX 1VBUA 4PEEA 1KWGA 1MXGA 3E1F1 3AZSA 2NW0A 1C3FA 4OBRA 2J25A 1JZ3A 1R33A 5E1QA 3N13A 4C7GA 1F4AA 3AFBA 1J10A 1EIBA 1US3A 3GNRA 2Y8VA 3DX1A 3CV5A 4EE9A 5GPRA 4GI8A 4TVCA 4HA3A 1DP0A 4KRTA 1F4HA 1EO5A 2F7QA 5BWFA 2WKGA 3WY4A 1UA7A 1B3VA 2J62A 1V6UA 2PI6A 1VFOA 4HPGA 1WPCA 1EDQA 1CGYA 2F61A 3GBEA 3TOPA 3AISA 4PMDA 2DT0A 4PCSA 5JBEA 3EYPA 1W3HA 3RDKA 4C7DA 3CC1A 2VC9A 3WY3A 1W1PA 1JAKA 4P7OA 4LX4A 3WSUA 4WSJA 1L8NA 3DHPA 1IV8A 3ZT7A 5AYBA 1B3XA 4GPNA 4CVWA 2YFNA 1MFVA 1TE1A 3WENA 4URIA 3VDAA 3VDCA 1H5VA 1JI2A 2EBNA 3WD1A 5CG0A 2PWDA 2V3DA 4CGTA 4U2YA 1OIFA 1C92A 8A3HA 1C7SA 3GXNA 1UWIA 4MB3A 2CKSA 1DWJM 2WZEA 1V02E 3ZQ9A 2EADA 1KXHA 1QNRA 4AZHA 4MADA 3FAXA 2ZUNA 1O7AA 2VX4A 4OKDA 4UZUA 1HF6A 4X0NA 1OM0A 1LWHA 4TTGA 3RMEA 1W2PA 3FXYA 4ZEPA 3EBVA 1GW1A 4U2ZA 1VJSA 2F7PA 3VMOA 2X8RA 5LA2A 3VIPA 3IAQA 1E56A 5I5RA 1B3YA 4MB1A 3BVXA 3BMVA 2WMIB 3H53A 1OWQA 3VSVA 1BG9A 1B31A 4U5IA 1I1WA 2JALA 5A6BD 3ALFA 1LL7A 2ZWZA 1JGIA 5JIWA 3BLPX 1JI1A 2ZUSA 2JF7A 2VRJA 4L4OA 3U57A 1ZBKA 1EDGA 1VENA 4D6DA 2DGAA 3LMYA 2YLLA 3DECA 5I2UA 5M5DA 1B3WA 4KMQA 1E0XA 1PAMA 3W25A 4D6HA 3SCQA 4EAMA 3N04A 3SIMA 2WC4A 1MW0A 1UKQA 3MO4A 5D4YA 3N18A 4DUXA 2BVTA 3EDDA 2VL4A 5CJ5A 1TZ7A 3N1AA 3OGVA 1UR4A 5EFDA 1B2YA 1QNQA 5HPOA 2YL5A 3W53A 2G3MA 1H0GA 3AXHA 1R8LA 2Y5EA 3NDYA 1W9UA 3AMGA 5C71A 4U5KA 3CZLA 1M03A 1UR1A 2XGBA 3MMWA 2WAGA 3SCWA 3NUKA 2D0FA 2G3NA 1JXJA 3MMDA 1HJSA 3DYMA 3VKKA 3AZRA 5E6YA 1QI3A 5A6LA 5CQ1A 5I78A 5CLTA 3WNKA 3D3AA 1I1XA 3EJTA 4FLQA 3CUGA 4NZJA 3J7HA 2VX6A 1H0IA 3VDHA 4PMVA 4NI3A 1Y7VA 3BVVA 2QF8A 3EJUA 1XSIA 4W5UA 4MDOA 1VB9A 1EA9C 4AYSA 3OLDA 4D6JA 2E9BA 2XN1A 1JYNA 2ZE0A 4AMWA 3SCTA 4R5EA 3BSGA 2ZX5A 1M7XA 4J3TA 3RM4A 2WMIA 3LPGA 4Q22A
chains in the Genus database with same CATH superfamily
2FX8H 4F7EB 4OZFA 5E1IA 4N6FA 1KELL 4E6MA 2HLAB 4UV7H 1AQMA 5F7LB 3OQ8A 3NSCA 3PIQA 1XGZA 1X39A 1DVFB 3HMXA 4QHUA 1IGFH 1D5MA 3ZT5A 4BINA 1FFOA 3L3KB 2NW3A 3W1ZA 4EDWH 3C60A 1DHPA 3O3EA 3G1DA 3MRBA 1XLDA 4XVSH 3OKKB 4WW2F 2EKSB 3GF8A 4HD9A 1NDGB 3KBHE 2O55A 3GSQA 2WHVA 2EO9A 4LOVA 2KERA 3V0HA 4EN2A 3DFYA 3N42B 1XGYL 3DOPA 2BJML 3W5NA 4I9TA 3NSXA 5DJ0A 3F12B 3HS0C 5GGTA 2R1XA 1KCZA 1NDWA 4UNTA 1W2VA 3KTXA 3W76A 4L8BB 5FYJU 3UXKA 1HJXA 5C07E 5H4ZA 2VDKB 2VDHA 2BSCA 4X6DB 2I9LA 5DR5H 2V5JA 3PWAA 4LHUB 3TBWA 4ZI8A 4GFXA 5DHMC 3GI8L 1DE6A 3IVUA 1I75A 2IOOA 1TKWB 2D22A 2W79A 1F2QA 2YBVA 5CN2A 2HLEB 1EAPB 2W91A 2ZX7A 1GOKA 3GNXA 2ZONA 2X2YA 1LLOA 3JZUA 1RZPA 3F5LA 1UM5L 4PSPA 5B39G 1F3RB 2KZHA 4MUZA 4R3SB 2HEJA 4H6QA 3KRBA 4JVWA 4XUGA 1U92A 3AQZA 4LSSH 4PRPE 1OAKL 2Y07H 3EJZD 1X9RA 4GNKB 2BVOB 1TR1A 3RG6A 5H2BA 4WUKH 2ZPKH 3T77B 1JGUL 4YHLL 2Z6JA 1PFOA 2QCDB 3M9YA 3W22A 3MA9H 3C60B 2EEFA 5FAGA 1BD2D 1GVYA 5L9DL 1KF9B 4CMHC 5EBWB 1K8XA 4X5QA 1PDYA 2GSJA 1LOQA 4ZVJA 1R87A 3FJTA 3HC4L 4QF1A 4TQPA 5CD3A 4NKIL 4PWJA 3TH4T 1BQHB 2VXQA 3MBEA 4TNWK 4RFNC 4Z7QF 1SHXA 4HS3A 5IBTL 3MNVB 2J44A 5I8OH 4NNBA 2XZCL 2QKFA 2BOBA 4Z7NF 1U8HB 1UH2A 1XIWC 2AJXH 3PGFH 5DJ0B 5GGRA 4WKAA 1HL2A 4FAMA 4F5CA 3WQOA 4IXHA 3WLNA 5LQBH 4AZ7A 4NQEA 3HE6D 2ODIA 2UY3A 1XB6A 4YFLI 3UXLA 2NWSA 1FV1A 1AGCB 5LA0A 4ORGA 2GSGA 4Q9QL 2YBUA 3FYIB 2PWGA 4V1DE 4PODA 2F6AA 4L1TA 4Z08A 5I19L 4MNQD 2ZSWB 1TX0A 2QNEA 2OULB 4U0QB 2P4AB 4PJHE 3L13A 2MOVA 4PRHE 4DJEC 1AH1A 2WZ5A 1FZJA 3IRPX 1FJ1B 4R4FL 5DXWA 1OV8A 2QQKL 2UY7B 3BLKA 4N1CA 43C9B 4B9ZA 3Q37A 1F02I 1UB5A 3LM3A 4YC2B 2FX9H 3ULUC 3QFJE 1GAFH 3SSZA 1UT9A 1NCWH 3HZKA 5ESAA 4M4RB 2EINB 4FXKC 5F89A 4C6LA 3TIDB 4PRTA 3H1ZA 3UCQA 3LSOA 2UY6B 3RZCC 1N3NB 3BZ4B 5FHAH 3WJMB 5REQA 1NINA 4UUJA 4Z9KB 1A7OH 4HJGA 3STZA 4ES9A 4JFDB 4OAWA 2VEMA 5C09E 1QBAA 3WQGA 2Y36L 4U1LA 5T1DH 1HX0A 2AKMA 1F3EA 2ZUQB 4HJTA 2AK1H 5F97E 3MRGB 5TDOA 2HH0L 1KEGH 1EQCA 4XN8A 2WW5A 3UWQA 1KC7A 1U93B 1GGCH 3BT2L 2X7WA 1Z3GL 4KITB 2XJ7A 3BG5A 4NS0A 4ATDA 1ZIBA 1VADA 4GUPA 3BQ6A 1IR1A 3IFPA 5F6IB 2VKZG 4KRUA 1KBKA 5IFTA 2GSHA 2ZCKH 5D1QE 1IARB 3KXFA 3GJFA 1AL8A 2OBGA 3ARFD 4BF7A 5E8PB 3P0YH 3UROR 3GMRB 1GYNA 4L0ZA 4KY1H 1SZNA 3TBCA 3CHVA 2F38A 2G3XA 1PZBA 1WDSA 2VN7A 1IIGA 4KXCA 3SBFA 1ZBKA 3Q8FA 2F8OA 4GYFA 4RR4A 4BUQA 1KUMA 2G2RA 4LSQH 5EEYA 3TLRA 1E1CB 1ZWIA 4Q56A 1HO4A 4I1PA 3HAEH 3OAWA 1G4RA 4D0DA 3N1MC 1ACZA 2UX7A 4A2HA 4FQCH 1G9MH 3DJZA 4G6ML 5DD1L 4UCFA 2FAUA 4MDJA 4K94H 4P9HL 1H60A 5T1LD 3BPOC 3IS4A 4KJQC 1TOXA 2Z0UA 2ZAHA 2GDQA 4QAMB 4A8NA 1ADQH 1TWZA 4Q4KA 4Q8MA 2QSCH 4XWOD 4ADUA 1T7YA 2IADB 1E30A 2AQ2A 1WSST 3O45A 4ZW7A 1YJDC 5EZPA 2WZPA 1HO1A 1EFZA 1RSFA 4M3HA 3S0PA 3JWOC 3C8NA 3M07A 3O41A 4JPVL 4XPFH 4ZZKA 4IBUA 2IQTA 3PJTA 5HNRA 2FZ8A 3BSZL 3NESA 1Z5HA 5HDBE 4YPJA 1P6WA 2CRYA 3K74B 4GMSL 4J3BA 3F5KA 5D8ZA 3EOAB 5E5LA 2V9TA 5IB3B 2XC8A 4YE0A 3QC5X 3RWEA 2GTZA 3NCYS 3UJIH 5C0CE 1RJZB 1K8IB 3HC0A 1K8YA 2PCXA 2Q8AH 4KFPA 3LZRA 1PKOA 2WINB 3NXFA 1XMEB 3IANA 4K8GA 3XINA 4NKQB 3NQMA 4NZ4A 3IYLW 4E9XA 3HRPA 4Z5RB 4NQCE 4YHOL 5IM51 3VFNA 2V5MA 4QJ3B 1TTIA 1VF5C 5GGRY 2O5NA 1TV3A 3MRCA 4UOW1 2BK8A 4LSRL 2J7FA 1B54A 1IZJA 5IQMA 3DK2A 2GQHA 4UQAA 3ARBD 3PWJA 1OAQH 4OD3H 5BOZG 4IJRA 1LEKB 2BY3A 5DJ6A 1EFQA 3V6ZB 3QQ9D 2YPVL 2FL5A 3QC6X 2G96A 1VLXA 3V6FA 4NHCL 1ADSA 4HPJA 1E27B 4HZ6A 4L4PA 2LTQB 4Q8QA 4E8DA 2Z1BA 3EO9H 2X1IA 4XZMX 2VUOA 5K9JL 4BRVA 2A21A 5K7JA 3SDYL 3V4VA 5I5MA 5HR6A 4YDVA 5FUCE 1HJBC 3UY8A 2FEDC 3QA3A 4BFJA 1BYCA 1N26A 5FJRA 2PP8A 5C0DB 3VD9A 1GONA 4YU1A 3NIGF 2I7SA 1M2VA 3DIDA 2NXZB 1P0EA 4J23A 3B9DA 5JPMB 5DMLA 3RU8L 3F6JA 1QWNA 1A9BA 3T4AC 4WEUD 4PD4J 4F2FA 4Q6KA 1XP3A 4QRTA 4A7GF 1RJLA 1A6VH 3LM7A 1OX6A 3CHPA 3HV9A 3MMTA 4E9VA 5I06A 4BA0A 4IL0A 3O2LA 1I9RH 4Z2JA 1MCEA 1UZ1A 4O10A 1KACB 2DQTL 4XN7A 1E1CA 4FL4B 1CMOA 2GTZB 4F7PB 3D87B 2ESVA 1ISVA 5KSWA 1OSZB 2BVDA 3QI9B 3Q6FA 4X5XB 4FN0A 5D7JA 5FV2A 2WZIA 1MNSA 3VZZA 4BQ5A 4ABVA 2VDNL 2V6HA 3CUPA 3L3JB 2I24N 3MI6A 5F9OH 2QIWA 4HHPA 3VMNA 1ZK9A 1MF2H 1KFBA 1QW8A 5AL8A 1IKFL 1OL0A 1SJDA 4NJJA 4F9JA 5KVMC 3RTQC 3ZMRA 1IO4C 1RUPH 3D50A 1EHKB 2YZ1A 2RBLA 3L4CA 2DJ4A 5IK3A 3QN3A 3DCPA 1LRTA 2CO1A 1C9DA 5IJKC 4WI0B 5GGTH 2YMOA 2A3BA 4DM2A 3VVWA 1X6LA 3Q2NA 2QADB 2CHWA 1PL3A 4OZHF 2PDYA 3UC0L 2PYEA 3R4IA 1MLCA 3EZ8A 3ZQWA 4CSPA 3NACL 1JPEA 3G77A 2XH4A 4AHPA 3U4BH 1QWUA 3CHRA 3QQNA 5IVZB 2JEQA 2A6NA 4UFMA 3TQ0A 2WO3B 4FXTA 3NRFA 4LYKA 4P4KB 3UXDA 2W67A 2NDGA 3B8TA 2WJ5A 1E4XI 1TZHA 4J2QA 1UKOA 5CKSA 4FCAA 4QRPB 3PDDA 4GKZB 2Z64C 5J04A 4IRSD 1AXTH 2EPMX 2VM9A 3JQOB 5MERB 3QM3A 4R7DA 3C87A 3UTTB 1TTPA 3WIIL 3W7JA 3BVDB 4HPYL 5CJXC 2CA4A 3ZE1F 3DO7B 2XQ0A 3RWHA 3CM4A 1HXMB 3W56A 3B1TA 2VITA 2DVXA 4Y4FD 2FGWH 3QUYC 4CQCA 3L1GA 4JG9A 3O4OB 4ZAKD 5ANME 1VJIA 4V2XA 4ZMQA 2R59A 3MLVH 1EZ2A 2ZC1A 4ORIA 2X4RB 1SLVA 2V3EA 4GQPH 1FGNH 5BOJA 1W1ZA 3GWQA 2HQAA 2UUDH 5GGRB 4YXHH 1ECZA 5F7AA 3LKOB 1BA9A 4OGXH 4X5PA 3PP4L 1Y18A 1X6NA 2P8PA 1BQHA 1SJVA 3MBEB 4HJFA 5D38A 5DELA 3DXAA 4UV7L 1GVSA 5I18H 1MEIA 2K3HA 3PSWA 1UB5B 3KOXA 2UY7A 43C9A 2CLKA 4ODHH 3ZKMC 3UPCA 2B5IC 2EXTA 1D6EA 1ZCCA 2XZAH 3PPEA 1RPXA 1IR2A 5BVJB 3WLIA 3R19A 2ZUVA 3G5XB 3TEXA 1V3IA 3SY8A 1R3HA 5F1NB 1C8PA 3WQ5A 4JZOA 2GSGB 4Z7UF 2O4QA 2QPXA 5F4SA 4NAMA 2NXYD 3QZ6A 5LN8A 1JHKH 1EKOA 3GYEA 3BZDA 4U1IB 4HOZA 2HAZA 2IMNA 3QG6A 4N8CH 1OIOA 5JYMA 1MI5E 3IU3B 2FFIA 3ZDZB 1K7XA 1CZ8L 1JS4A 2EDEA 5EIIA 5D8WA 5CXPA 1MDTA 4JFFB 4ONFL 3LHPL 1BTMA 4E9QA 4LVDA 4U6XA 3PNZA 1Q2RA 3B05A 3WKML 4GLRH 1TTJA 2BOEX 4S2CA 4O52A 1K1DA 3H2AA 2C8NA 3MMUA 4HIBA 4PJFF 4LP5A 4FALA 4M5SA 4EMZA 3L7RA 3S4SB 4M7ZC 4HWZA 4IISA 3MCNA 3WEZA 1Y0EA 1BREA 2W5PA 3W0KA 3DGRA 2CHXA 3Q6GL 4CU7A 3VG9B 1ITUA 4M6UA 4QOKA 3T9PA 1A3ZA 1QFWI 2E27H 4TL4A 5HGHA 1S5IH 4X9BA 5KVDL 1QSEE 3W3BA 4D9QE 2R29A 4CMHB 1UZ6F 2EC9T 4IJCA 2H32B 4I77L 3GEWB 2X1OA 1JCLA 4A2LA 5DQDH 5HXMA 2C1HA 2DSWA 2V63A 3L66A 3QGAC 1FNGA 1I8LC 4AEHL 4PJGF 2NY5L 2FEJA 5B3SB 1B90A 1WK0A 4JDZB 1AOZA 2XIIA 1F6PA 2CZVA 3I50H 3OA3A 4I3RL 3IJ9A 4LIQE 3MTRA 3S48A 5L2KE 1DCEA 3M0VA 2NY4C 1PZDA 4G9DA 3WX7A 1Z69A 1QNZH 3FL7A 4AQ1A 4EXBA 1C8QA 4MMZC 1QW9A 4U1HB 4AD1A 3RVVC 2V5LA 4LJ3A 2MEJB 3KVQA 3QPKA 1TT6A 1U2CA 4ZFOB 3WCZA 3TBWB 2EYTB 5EH1A 2J5LC 3C5SB 4F2ME 3W24A 2PDFA 4U6XB 4JBRA 2BIIA 1Q90A 4M3PA 4TNVF 4X8JB 2R1XB 2OFJA 4KKCC 3ZMNA 2XZ7A 3HRZC 4DQOL 2B3RA 3ORWA 5I23A 2QAPA 1V7NH 3GNMH 1RUPL 2Z31B 3K8KA 1BXXA 3EOBB 4PJEA 3UTPD 5G2IA 2VLKB 3CZGA 2WWMC 1CE6A 1TUFA 4JICA 4Y9OA 4Z3GA 3NABL 8FABA 2XBZA 1HYSC 2E6YA 4G7QB 3W85A 1ZHAA 2CETA 4JPWL 3CV2A 1VAHA 2VLKE 5L6YH 5C2CA 1VESA 3D0CA 1Q4NX 4R4FH 5C0JB 4ONGH 3NYDA 4G6JH 4IU2B 3PHOB 3OB0H 5T5NG 1T04A 5C0GB 5DRIA 3MW7A 4IP7A 4PRBB 4ALAC 4U0RC 5ESVA 4XN4A 4K37A 1KLGA 3N5AA 2OW6A 3KE0A 4IIQA 1AQFA 1CW2A 1FWSA 2BNJA 2AEQH 1AI1L 5AZEL 4DKTA 2OT0A 1OHLA 4V1XA 1I4FB 1YEWA 4XCYB 4ASTA 4F7MA 3OZ9L 5FYJL 2HX8A 2O1AA 1KCLA 1K72A 4AIUA 1IT9H 1BZ9A 4QT5B 4XRCA 3RA7H 3W23A 3OB0K 2G75A 1A4LA 2GITA 3B3IB 3L7FA 1P1XA 5CAKA 1XH2A 3PXLA 1YEGH 2Z92B 3K1KC 3MCLL 3QZBA 4MNHB 3T8MA 4ANVA 1YEIL 4ACZA 1PLGH 1M7OA 3WTTA 2CIPA 1NIDA 3OR6A 1R3JB 1V3LA 4B7IA 2NW2B 4FYTA 1AJZA 3BH4A 3PY9A 3PNRB 1UD8A 5I1IL 3EWBX 4J3OH 3VGFA 4B53A 4NX5A 1XW8A 2R2HA 1TWIA 3QQ9C 3EB3A 3DFSA 5DI8A 3FJ4A 2ZCGA 5F4WA 3U6RA 3MKGA 3I7QA 3SE3C 2CE6A 1CFQA 5ENWA 2YYTA 4Y88A 3AIQA 4OLZH 1EZLA 4DP2X 5J1SC 1FNHA 1ZE3C 4WK9A 3W27A 1MCOH 3O4LB 4MQ7B 4JM2D 4H8UA 5KVEE 1EBGA 4RISL 2OMNA 3Q2DA 3SZKC 4HYRA 1OBAA 2R39A 2BINA 3RFZA 3RWDA 3G08A 3GC2A 2LFEA 4PBVC 3UTTE 3MB9A 4LKCA 5DLCA 4U3SA 2EVGA 2JCCF 1KBBA 5BU6A 3F83A 5EOCJ 1CLYH 4I0PB 2NX5B 1FC2D 1YMME 3OZMA 4PV9B 4EJ1C 1L6FA 2WHLA 4LLVA 4TKWA 4FP8L 4MA7H 3ZKNC 4DHLA 4OQTH 1PKNA 1KGWA 3EGDA 3IMVA 2C13A 4Q7DA 2ESCA 2BB0A 3ZIYA 1S78D 5F7DA 3RGBA 2YAMA 3LHUA 2OOFA 4Y6GA 1FNSL 1KB5B 2XQYK 4HF5L 3ABSA 4PB4A 2QSTA 3KPSB 4N2YA 2O61A 5K9QI 3S34L 3MO1B 4UANA 5EUOF 3Q6FB 4X5XA 3T2PA 1SXSA 4OV5B 5DSCB 1JCJA 2OJZH 1Q7QA 2EYSB 2K78A 4ZFMA 5EO0B 2IMMA 1PWLA 5JHDA 2I32A 4DHGA 3DV6A 3A6BL 4E4PA 4LGSB 3T9WA 2BBFA 1B0RA 4OZFH 1UR9A 3WL0A 3QZWB 2F6UA 3GMOA 1E6PA 1NKRA 3QO1A 3S35L 1G7MB 2XG4B 3QXDA 3EOTH 4I77H 3FQ1A 4OUIA 3SADA 3HZYA 2AJYH 3CCHA 4QOKD 4MWAD 1GOFA 4PV8B 3IFOA 1M56B 3FT2A 4EUPH 4CN6A 1O60A 1RZGA 1GGBL 3O3RA 4M19A 3TC9A 4CW1A 4XD4A 1G9NC 2M26A 2WLHA 3ULUF 1QSFD 3ZE0F 5FOOA 2X9ZA 1G7QB 4X80H 4XR8C 5SX4I 3NBNA 1A5MC 4Z95H 4JFSA 5SX5K 3H8AA 3K8LA 5DJYB 1CFMA 3IJLA 3IV3A 2D2HA 1HHKB 3H9SE 5C2GA 3STLB 4QQUA 4KF1A 4AWJC 2ZQ0A 4X42A 4JFWA 1SR0A 3QR0A 2J7CA 1QASA 2ICWI 4AM0Q 5KSAA 4JQVA 5CJOH 5AB0A 2OMWB 2R9RA 3TN4A 2G9KA 3QUGA 4BQ2A 3KYNA 3ZX1A 4W89A 3E12A 3QDMA 1EHXA 3FU3A 2XGIA 5HVGB 3O4LD 3LS4H 4JIEA 2HJLB 2BSSB 3WDHA 5HHPB 3WDQA 3M7SA 1FZKB 3CZFA 1RJZA 4HJJL 4AE0A 1P4IH 2OR7A 5IW6A 1H3GA 1EPFA 3CASA 1CNVA 4IGMA 3USBA 2IH9A 3BEWB 5KSAD 4AVHA 1A7QL 5I0WA 3PNUA 3GMLA 4QGCA 4YAQB 2Q76B 3HVNA 3FHEA 1ETA1 3HZMA 3URQA 1Q3NA 1SO6A 3A12A 5C1MB 1QBML 3JT2A 3T8XA 3LGGA 2GGIA 2X40A 2FR4A 2HLFC 1OAZH 4N6RA 3SW6A 4BKLA 1W2KT 4QNEA 2QADC 3FUEA 4DN3L 5GS0C 4BUHA 3HE6C 3W7KA 4B91A 1ZHKB 2C9XA 1TETH 1TMQA 3P0GB 1KB9J 3KXFD 4FNUA 3H2EA 4CNOA 5CG7A 3CAVA 3HGRA 1P5VA 1Z9SB 2HFGH 3CDYA 3PE9A 3RX7A 1EPXA 4WF7A 3O6CA 1TU2A 1MHCB 1Q0EA 4Y7MA 3B06A 4X6EA 1ISXA 2HSIA 4H01A 1KZQA 2Z29A 2C9PA 1JGLL 4XE0A 4JR9H 1UUNA 4Y7OC 4GYPC 3V7AG 2O9RA 2VC7A 3B43A 4YDNA 5H1WA 3LJ3A 2PABA 3BEVA 2H26B 2QR0A 1T89A 4B9JA 3Q05A 1A3RL 1T80A 2YC1A 3IGLA 4H1LG 5K9OA 4EK7A 2WBJA 3KWUA 5D9PA 4A3QA 5AHEA 1KBVA 5BVPL 2PXYC 2DOCA 4PW4A 5I73C 3BLEA 1UCBL 1RLWA 5CEYA 1GYAA 1TMHA 3AIWA 4MXWH 3SE8H 4BKTC 2E5DA 2FGWL 3DETD 1MFDL 4YIQB 5EFIB 3EPMA 3DURA 1SJHA 3IDUA 3RKPA 4WV1C 3BWSA 4FHBD 4KKCD 1LLAA 5E7BA 3SE9H 3K71A 1GVRA 3GVVA 2E67A 3AO0A 4H6KA 3ESUF 3ISRA 5HHMB 2DDQL 4W7UA 3MRQA 2NY2D 3VFWB 3KHDA 3HZ3A 3OQRA 3VKBA 3SGUA 1HNYA 2YARA 3MLWH 1D8CA 4O19A 4PRID 4GG9A 4UMSA 1EJOH 3ILEA 3PAUA 3TF7C 5DLMH 3OSKA 5C0CB 4GS7B 4NUJB 3TIDA 4Z3TA 1LYXA 2A77L 1RP9A 2B5IB 1U33A 3KM1A 2GBVA 5IJVA 2ISSA 2EABA 3H4XA 4PR4A 3RU6A 3SB0A 3CFDA 3ZJ6A 4PGEB 3C6LB 3FQ4A 4AGPA 1SFHA 4MIMA 1DLHB 1H9VA 3QW4B 1EC9A 1H9DA 4YHKH 5TE6H 3BD4A 4Q4IA 1JGEA 3EGJA 2GBTA 2J6XA 2NQZA 1KNOB 4A63A 4XTRC 1GPFA 3ARED 4N4QA 4FJ6A 4LLMB 5BO1L 1Q6EA 5H35A 3JU2A 3TH6A 5EC1B 3H7UA 3HURA 3SGKA 1LP9F 4F2BA 3R7MA 2QPEB 1HJQA 1OIMA 2NX5E 5BOEA 1Q8MA 4Q7IA 3S37X 1S2VA 2E6FA 3LV6A 1Z32X 4L4LA 4WVXA 3VXQB 1F61A 2QCMA 4ZUTA 4PMRA 3A4FA 1AS7A 1XL4A 1QTWA 3P5YA 2CG9X 1EZUA 3VG9C 2FGLA 3EOSA 4GLRI 1BQLL 1T20B 4G6KH 4NERA 4RFOH 4UWQB 2OT1A 1ZANH 3KYKH 2G95A 4XBGB 4BFGA 2OGJA 3R58A 3VGEA 1OAXL 2YCEA 4O12A 2CNZA 1T7LA 4TOYL 3DOSB 3CFNA 4DPCX 2YC1B 2BPBA 3MKCA 4CD4A 2XRAH 1N9PA 3OKNA 3J27A 2IUZA 2PXYA 2X4SB 1TZIB 4QRBA 4LCRA 3T2OA 2ZXQA 5MENE 1AD4A 5KSVB 1BFOB 5K1NA 3INUH 3PZNA 1EPVA 5CPMA 2XG5B 1RUAL 1PPIA 1BQRA 4B16A 1R6WA 1G4EA 5DJZB 5A2FA 4JKWA 1NMCC 2EH8L 2NNAB 4M5ZL 4GHRA 3O6FC 4PTVA 5C0EB 2XN9E 4P9ML 3VFGL 2J8FA 1KCKA 4N5EC 3D9AL 5FYKE 1UKPA 3UYRH 3EBIA 3T0BA 4F7CB 2JJTA 1O6IA 5D96B 3LBOA 4AD0A 4BFOA 4X6DA 4HUVB 5ITBL 4AHQA 4PLJC 2POZA 1DQJA 2IGTA 3IWUA 1SLWA 3IAPA 4R7NB 4NZDA 1QBMH 4KK8C 3ZOAA 1J8VA 3CU2A 3PZGA 4WKHA 3TVMD 3H6AA 3BP5A 3DX7A 5CINL 4DTGH 3RL1A 4F15C 3VOFA 2L7EA 2W38A 3EHBB 4MYWB 1GZPB 4KY2A 4OVUA 4BZ1L 5IESL 1EJUC 1AODA 5IVOA 1Q6QA 1Y65A 1ENUA 3ATZA 3M0MA 3MO7A 5HOSA 4QLRA 3RLGA 2VN5A 4K7PL 3FUJA 4HWBA 5IB4B 5MEQB 1WWWX 4P8VA 3VKCA 1O6SB 2AMGA 4LLUA 5EOTA 3WG7B 3CG8A 2DUXA 1E5UI 2PLCA 3D2UB 4EBQL 4P5RA 2WXQA 4G82A 1BXCA 3VI4A 1WIUA 2OGYA 3CIXA 1DQML 2TSBA 3WFDH 1NGPL 1BMWA 3ZR5A 5AHMA 3NO1A 3L9RA 4E3VA 2YXFA 1FKWA 1ZLWK 1QFOA 4IM8A 2O6FA 4HIHB 3CFEA 2N3JA 5C97A 3LHYA 4YBLC 5DT5A 3GU2A 3W1QA 2ITDA 4AIZB 1NFDE 4P5TB 5I0ZA 5KJRL 2E7LA 2HJKA 1LQSR 1UWEH 2AXWA 2V0AA 4WY7H 2GTWB 3ZRCC 1A4JA 1GJWA 4MD5A 2XFXA 6CGTA 2OMBA 2X1UA 5D2VA 2A73B 2C9VA 3KLLA 3GZ3A 3SKMB 5C0BE 2L4OA 3K0WA 4JFPB 1OP3H 1L9QA 2XWTB 5DD5L 2O72A 3LZQA 3P11H 4WJKB 2QGYA 1NF7A 3V4VL 3GMOB 2ATKA 4QHMA 4ADTA 4XO5A 4YTUA 4HU0A 4RVBA 4HCRA 1TTFA 4WENB 3MSGA 1QLFB 3RVUD 1TQCC 3LH9A 5CGYC 3MHFA 1WKDA 5D09A 3WUWB 3WNLA 1X9QA 4RISH 1ZTXH 2I9TB 1U8KA 2A74A 2WLIB 4I0PC 5A16B 1FWCC 4DJEA 3PUDA 3QY7A 3UMTA 3RYMA 3DUUA 4TX9A 4BQ3A 2IQ9L 4N24A 2OK0L 3QEQB 1IIIA 1QOKA 4B7LA 4HZ8A 1GOWA 1MEXH 4Q8VA 3ITYA 4XI5D 3REVA 2MOGA 4MD4B 3MRPA 3Q5TA 2NY3D 3MROB 5JIQA 3WF1A 4DZAA 1AOHA 1E3XA 4NQCD 4N9DA 2CR0A 2QPUA 5CCHE 4OQTL 1M04A 1G1KA 1S3KH 4R88A 3FS2A 4A22A 3UADA 3QFWA 4JN1L 4MCZA 1CFVL 1ZKAA 4GFSA 3EYFA 3O6LL 3A23A 4I13B 4EQ3A 2J27A 3IV8A 3GSVA 4XO7A 1I3RB 2CRZA 4H20L 2O5YH 3AOFA 3OZLA 1M05A 4AYFB 4H8HA 5ECUA 5C07D 4RNIA 3ARBC 1A14L 4G8EA 3EKLA 4WK0B 4KCTA 2XKNB 1SNRA 2MSPA 1DEEA 2NSMA 3CXDH 4JKNA 3LYEA 4P5MA 4PJBB 4G56A 4LAMA 4X0VA 1LL1A 4BK4A 2WXGA 3R8BB 1D7DA 5EPDA 5I8KH 3ISYA 1EJSC 2X3AA 4R97C 4IICA 4JRYB 3WO8A 2G2NA 5BMWA 1LWRA 2HXAA 4KROB 4PJGA 4KDTA 3TNNB 5LQBL 1OCRB 2YD9A 4Y9CA 5FM4A 5HI5D 1DDHB 4WWNA 5FF6A 4PJIA 2QCFA 5ALCH 1G7VA 3AU2A 1R3WA 2NY2B 3HO8A 3RITA 4M6NH 2C7UA 4GKNB 4WWKA 5BRPA 1GWJA 2E3ZA 4D6IA 5FC9A 5LNUA 3QEHB 3QEGL 4ZA0A 3WUGA 4XN1A 5EKYA 3KP1A 1HP5A 1S7UA 5E2VL 4M00A 4AVKA 2Q1EA 5C0CD 1RUAH 3ZRSA 4FQLL 4DETA 1FXQA 3UF9A 1V8EA 4MMZB 1BPLB 1H5BB 4D1IA 1A4JB 3D3VE 4R7VA 2QQKH 1XH0A 2W5FA 1QKZL 2EILB 4NC2B 4JFHD 2CGZA 3DK0A 1YEEL 1CICC 3V6BR 4I5BA 4MZRA 2ZOWA 3IF1B 4OB5L 1A7PH 3N44F 4AZ8B 2F8IA 4Q58C 1U8JA 5I0DA 5E2JA 1M68A 3FB8A 4PJBE 3AUWB 4CKQA 5A2IH 4PH6A 1CUOA 1ONXA 4JFZH 5E5RB 4GQ0A 3CK0H 3P9LA 1LROA 3SE6A 2HS6A 3WJXA 4F0HA 3D4CA 3MGTA 2GWNA 4Q2ZB 4S3GA 1MRFH 4JDVB 1K5WA 1R34A 4LF3B 2BOGX 1NGYA 2XVBA 4OFYA 4AKQA 1HIZA 3O9WA 2XUCA 1A7QH 2ZKXA 2XTJB 3IEAA 5EC2A 3BH9B 4NT0A 1WQVT 3P3SA 5GGVH 1IB5A 3GO1L 4NN7B 3FY1A 4OFKA 2ICEC 1TJ0A 4XMUA 2NY3B 4HUUB 1GZJA 1UWGL 2JCWA 4NQCB 4G42A 2IANE 4MXVE 1RUQH 1M53A 3ZZLA 3B4UA 4AG4H 4DNHA 4AEIL 1QXLA 3CB3A 2LFGA 2CK2A 5FCZA 4AL8C 3IIZA 4FHKA 3AYSA 1MFNA 2GGHA 4E8GA 2VGBA 1IIHA 2YEQA 4Z2LA 2R4RL 1H09A 2CA3A 1R9YA 4JJOA 1Q6OA 4QHNB 3SDDB 2XNAA 1TFPA 1R5WB 3Q7JA 4MNGB 4ZG1A 4MHBA 3MNZA 3OAYH 3L4YA 4JQXA 2J4GA 4AUYA 3L2MA 3B8WA 1A5FL 4GI6A 3UWVA 3SIKA 3BAEH 1I53A 3G6AA 4PIRF 4PLOB 1OGAE 2AQTA 3T2NH 4PHXA 1RZIA 1SSDA 3AY2A 3FRPG 1QU4A 4DJDD 1G9NL 3DGCR 1BQSA 2X70A 3FBKA 3P61A 2XWJB 4OI9A 2PXYB 5HDQH 5T3XH 1F6LL 3ZDYB 2NLYA 1JCXA 1L6PA 4HWBH 3AZUA 3VXRE 1OAYL 2WANA 3FU5A 4UM9D 4LF2A 5M3WA 4JREC 1GCYA 1FH9A 2AW2A 2GT9B 3VB8A 4XMPH 1C5CH 5EU5A 2YXXA 4EO5A 2WTPA 1A0DA 3L4WA 1JZ5A 4TV5A 1EFXD 1V79A 4P57B 4LVGA 1BZOA 1FDZA 5HVHC 3IDMA 1J5HA 1KBPA 3CO4A 2BSEA 5C0AA 5JXAH 3T09A 3KAOA 2DY2A 1LYQA 4F3FA 2EXOA 2P26A 4JFED 1ORQA 1CJYA 1WUZA 4YWGH 2AJZB 3BP6B 1UACH 3FLUA 3BUVA 2Y89A 4CNPA 3KR3L 3N55A 2AV7B 5HD8D 3E2RA 2FT8A 4I8DA 5I16A 4LH8A 3CZKA 3HAEA 2Y36H 3FSUA 4XX1G 4OFCA 5EC2B 1UUSA 2KQMA 3L5XH 1ZOXA 3R89A 3NFPB 3IDNB 3MLRH 4H8WL 4BWWA 1ZHLA 1YY9C 5IB2A 5JXEA 4WU5B 5CSSA 4O02B 4XP1L 2JJUA 4JDVA 3G1RA 3K1DA 4YMZA 2PDBA 3RUBL 1Z66A 1XDMA 5A94A 5F3FA 2FJFA 4U05A 3QCVH 3JWDL 4YE4H 3NJ3A 4JTKA 2WUBH 3N41B 3NA9H 4XD6A 3PREA 1XXFC 3A4WA 4QX4A 3P0YL 2ZG2A 2M83A 4POZD 4BF5A 1VLWA 1KXVC 3HN8A 1VYRA 4P59H 4IMEA 5SV3A 4GBXB 3B0XA 3OVQA 1OPGL 4RRPG 2ZUMA 1RMFL 3HC3L 3IXAA 2VKXA 2K7QA 3WO4B 1CT5A 4ZQMA 4LCWD 5D6CA 2X4RA 2VEIA 3V18A 3GIZH 4QCIA 1T6MA 3GXDA 3PV7A 1Q0XH 4AH2B 4YFEA 2OO6A 3PPSA 2UWFA 4G3YL 5CC5A 1WDRA 4XMZA 2X4TB 4DP9X 3MFGB 3IU4H 1Y07A 1MUWA 3W2NA 1KCUH 2ALWA 3LU2A 1NJ9B 3K0YA 3RVTC 2CKRA 2ZDSA 1H8NA 2ADJA 1XBYA 2NTSP 4YX2H 4Z3HA 2J8GA 1XF3A 3QJVB 4AMAA 2RUSA 2JQMA 4WHTB 2R69H 4P4KD 4ZW8A 2CRIA 4HT1L 3WTUA 5C6MA 4EX4A 1MF2L 2WKOF 2IAND 1E71M 2GL5A 5K9OB 3O1NA 2DQCH 3TDFA 3LY0A 4PCNA 3V4PH 3RVTD 4R8WH 2P42B 4E2BA 3IDYC 4GQ9H 4LGRB 4U49A 5BQ7A 2J3SA 3D1MC 2G41A 3HC4H 1MDAA 4HK7A 5IDZA 4M8UA 5AVWB 4JY4B 4RWYH 5BNXD 5L0QC 4J1UA 1IGCL 1RZIB 1CS6A 5EZLB 2CJUH 5TK4A 3TTYA 2FTYA 3MI3A 3QVAA 2BIQA 4OJFL 4P5MB 2P5PA 2WXKA 4ZFOL 4PTWA 4G8GE 1BMZA 4X7DC 4L61A 3KRUA 4N9BA 3LRSA 2WWCA 2VJ0A 4XXDA 4F93B 1FHUA 2GPTA 5EOQH 4PRNA 3HG1E 5H8UA 3VD7A 4K5PA 3PN8A 4EVNB 3JWOL 1G7HB 1KELH 1N4XL 3CZNA 4HKXB 4IFKA 3MBWB 1S9KC 1TEGA 3B37A 3QZPA 4GGHA 4I2XB 3TSMA 2YMXH 3MNMA 4PRWA 1TNMA 1U8IA 2FEDD 5SWSE 5IHZB 2QZRA 2IAMA 5AWNL 4ZGYA 1S78C 3EO9L 3TSBA 2CO7A 4I2XE 3BH8B 4I5XA 5ENLA 4ZE4A 5HPMB 4R3UA 1FCGA 3LEVH 3RRQA 2DWEA 1L9RA 1TQUA 1BAFH 3VFSA 3IJ7A 4JG0L 4NUPA 4AIBA 4Q4OA 2LABA 2NSOA 3LKRA 1LEGA 4PRAB 4AX7A 4S3BA 3IPBA 1WCGA 2EC9U 2ZOLB 1T0PB 1S3RA 5C0IB 2VLJE 4PJAE 2E9MA 1U91A 2YD8A 4OZGF 4DOHB 3WH5A 4FQIH 2MCMA 2ILLA 1QFHA 1G9EA 2C9RA 4G8GB 2C19A 3NJLA 4MKSA 3W1NA 3TZVC 5AVUB 5HNUA 1O6TA 3THUA 4GSDH 3QUXA 4TN9A 3T6CA 1DBBL 1V8HA 3KPRE 5D5MA 3OU8A 2GVYA 3L4XA 3GLCA 2JELL 1E2WA 4MJ5B 1WXZA 3G9AB 4IJTA 5FCUH 1ZB5A 5DRWA 1DBJH 1V55B 3LPOA 4JFUA 1LORA 3KPOA 2ZRXA 2EP6A 2GVGA 2ZF8A 1I2NA 4XKYA 2XH2A 1XJBA 4PULA 4WFGD 4FTVB 4PVMA 4WW2B 1H5BA 2J56A 5CJXA 3VC6A 3ABRA 4B60A 4XAYA 2J2ZA 3NJJA 5F9DC 3BPLC 3VRIB 3ARDB 2DWDB 2DH3A 4JCWA 5L4IA 5HHOB 4IUOA 3MRCB 5A6TC 3MYJA 1TQCB 4HCRL 2Q6WA 3SCMD 2GK1B 1IAKA 2E40A 4DWSC 1TVPA 1FVCB 4TO8A 3MUZ1 4QRAA 1A1NB 2DTMH 3VWJC 4CN1A 4R90L 3MJ8B 1WKEA 3O6AA 3CL8A 4CGUB 2NXHA 2AQPA 3B97A 3A13A 1K8IA 3HC0B 5J12C 2D4FA 5ECGA 2VR6A 4KKNA 5BZWA 4ZTOL 4FF5A 1BG1A 3QIUA 4X9IA 1ONWA 1HCZA 4NVTA 1XI3A 3VOCA 4JTGA 3ZSSA 3QCVL 2XETA 4YZFF 5I9QB 3BESR 4K94C 5BPPA 3SKJH 1M57B 1MCBA 1T66D 1OD0A 2OKOA 2YSTA 3VU1A 3N6JA 3RK8A 3QMTA 3HMXL 3SYOA 2CLEA 1TVBB 2WCGA 2QEJA 1JDDA 4MJ6B 3UP1A 5JHDD 3ZO0A 3QKZA 3TJHC 4F7CA 4D94A 3WFCH 3SUTA 3JYCA 1FP5A 3QHOA 1F8TH 1D2KA 2E4FA 3T1GA 4EZKA 4WLCA 3HBLA 4WFFE 4GPVA 1U95A 1BWVA 2ORBH 5FSEC 1MI5D 1J9CT 1S5TA 5LUMA 2PB1A 1PY4A 5T9BG 3QWQB 5AHIA 2J6WA 1EHAA 2X9WA 4NQXA 4NWUL 1KFKA 2VXSH 3S5YA 2VC5A 2QQLH 5AKTA 3B7YA 2J72A 1CI1A 4HK3N 4AMCA 1RU9H 1A6UH 4R26L 4FFZA 1JNNL 1ZEAL 3EJQA 5F7MC 1I8AA 4P2AA 5SWSD 3ZY7A 2OZ0A 1GNXA 1AZRA 3B7SA 3GKAA 1VFSA 2CYGA 5BXRA 3T40A 4B90A 3S1WA 3ES6A 3FK4A 5M94B 1CWVA 1XINA 2G8ZA 4NQTA 1AHMA 1W1VA 1R3JA 3DJ9A 3PTDA 4RDYA 2OODA 3GH5A 1Z0NA 2JF1A 3CSTA 4JFPA 4S0TD 3M17A 2ZYHA 3CVHL 3QZMA 3TXAA 1NMCB 5CPNA 1MXDA 3GSMA 2PU1A 2GITB 3L65A 1E6SM 1JHKL 4HJGB 4FTVD 3LBCA 3EYOA 3GI9H 3GUFA 1XR9A 4QGYA 1PE1A 1VGEH 2W60B 3DUUB 1TTCA 5JPMC 2VW6A 4MAUL 5GRXG 5AKQA 1YY8B 3EBHA 3CVCA 1UWSA 4JTQA 4PJ9A 1N8FA 5DQPA 2Q20A 2ZP9A 3CFEB 2ICEA 2ZKWA 4HC1A 4KXZI 4M1CD 3UFIA 1S2TA 2H8PB 3OGOE 4AQLA 2R9HD 1CIDA 4UB9A 3SCPA 4HEPG 1G0XA 1N6VA 2Y5TB 1M7DA 1P53A 2Q3XA 1BOGA 3AC0A 5HDBB 2J88A 4L65A 4UFIA 3U8GA 3ALPA 3GHBH 1YLVA 5CAYB 3GNOA 5MHBA 2Y6SC 1GW9A 2G5RA 1IKFH 1CB4A 2GJLA 1EMTL 2JKXA 5DMKA 3UABA 2NY3C 4JQ3A 3R94A 2N01B 2VR5A 2NQLA 2CWRA 4OGYH 3GYCA 4YHZH 1PTAA 3CZJA 3EBGA 1UYQA 1CGTA 4UBDC 1RZ8A 4JO1L 4JRXB 5B8CC 2BODX 1S5VA 3LPPA 1YMMB 4X7EC 4Y2OA 4YUEH 4O17A 2ODOA 1HZHH 1TCDA 3RY6A 3WUEA 3EJRA 4TPRH 5E8OA 2VH5H 3AXKA 4DPQA 3WELA 2NY0D 2WAHA 3MNVA 4JFXA 5B3JF 1QR1B 1GOQA 2V81A 3H9HB 3WBWA 4M48H 4UTWC 5CBAB 2JKTM 4KFOA 4E42A 4M6AA 4D6EA 2ZICA 1D5RA 3QNXB 4TUJA 5E9DE 4FERA 3B8SA 5T1MA 2V0TA 2C1OB 2VFHA 4RZCA 5F1VA 3W3OA 4PJ9D 4DZBB 3F4DA 3K72A 4ZMAT 1C91A 3NPXA 4G5DA 1CXEA 5ABHA 1X7SA 3D08A 4KVCH 3APGA 3CIVA 3BUYA 2DMBA 4PJDE 4WU7A 3G5ZB 1F1DA 2Z4GA 2MIZA 1E2ZA 4WUUA 4JDZA 3WUZA 2F8XC 1OFBA 3TC6A 4WSGA 4ZUWB 2QCDA 1KCRL 3N43F 3NH7L 5DQJA 1W8OA 4PVNA 1RQBA 2YXWA 1Z1WA 4N0FA 1DN2A 3CVHA 5F71A 1EB3A 4NHCH 3UWEA 3NDYE 4QOKB 2Z91B 4UQCA 4WJ5B 1PMYA 2JV6A 5HVHB 1KY6A 1X5XA 5LGJB 2HZGA 3DOSA 4HB7A 4LBSA 2WY3B 4OLYL 3X1BA 2C26A 1WZLA 2A6DB 4ABQA 3FDGA 3IJ6A 2ENQA 4GRWE 4XBGA 1Z5LB 3LA4A 4YLCA 1YAIA 4HKXA 1FLRH 3EXJA 1FLTX 2J8TA 2ITCA 3I6TA 3RO6A 5IHLB 1UVQB 3ARSA 4M6OH 3IGXA 1OTUD 3GI8H 5ISZD 2DZVA 3EO1A 1SU5A 1MW3A 3MDWA 3P4LA 4D71A 3BWUC 3ARUA 4MS8C 1MJ8L 1SFTA 4W4OC 4WO0A 1QRNA 1J5SA 1NQ6A 2J7HA 4JK0D 3SUSA 2Y8UA 4P3DA 3GZAA 3HEIB 1SJAA 3SAZA 3UR5A 1MG3C 2ZNWA 3F1QA 5AZ1A 2EIBA 1CXFA 4UINL 1N6UA 4FK9A 3S35X 3KDPB 2C16A 2JMRA 4HIQA 4HJ1A 4PMNA 1X4ZA 4HU2A 1VCBC 3QARA 4J1UB 4LUSA 1A25A 5C7ZA 5TQ2L 3PBYA 3EMZA 3DBSA 5IFHH 1A3QA 3Q4DA 2PDIA 3QDJD 5BQ7B 5I3FA 3EYPA 4LRIC 1FH7A 2R2BB 3FU7A 4IGBA 4BM7A 5GZOC 4XQ6A 1XYBA 4JTAA 2QUMA 1L0PA 5BO0D 1QRND 4NO0B 4DGIL 4D72A 1Q9OB 2EDOA 2V5YA 3F01A 1IJNA 3PQYD 1C08A 1JAEA 4PD4K 4U1JB 3BLLA 1LO5A 2W0KA 5IR1B 3M41A 1XPYA 1R24A 1G7JA 1A6UL 3LNEA 1H1NA 1JQVA 1TJIL 1L9TA 1J9SA 2XTKA 2YBRA 2AGTA 1IEAA 4UR8A 2AP2A 1TQTA 3CFJB 4LASL 1U21A 3CBKB 4U7KA 4O4YL 3U30B 3WSQH 4BQ8A 2BIPA 1RSCA 3T7VA 2Y7OA 4K8RC 2WPBA 1QSVA 1KCXA 3DROB 4QRPD 2HXTA 1GKRA 1KA9F 3UA4A 1CG9A 1TZZA 3QS3A 2QQQA 4HLEA 1EDTA 5D9NA 2BZDA 5I1HH 3L3OA 4MZ1A 1Q7MA 3JS3A 2VITB 3N73A 4M7ZB 2F74B 5D9MA 1KOAA 1ODUA 5IOPA 5J57B 3B2VH 4YIQA 5EFIA 5FDWA 3CZ8A 5CEZD 1Q5MA 1X44A 4Y5YC 5BMFH 1RZFH 4XIMA 2WUCH 4G83A 3BIAX 2DBJA 4IKJA 2WV3A 2FBJL 4QRPA 4XPHL 3OBAA 4PGEA 1A66A 4IMAA 4W7VA 3RMJA 3LKNB 4IMLA 3DGDA 4O02A 2A0LD 3ARQA 1HL8A 5FV1L 3ULVD 3BK0A 1ZHLB 2MOQA 3S8WA 4GJ1A 4LSUL 5KUKA 1E4LA 2Q9OA 2NLJB 2W9DH 2EDWA 3KPNB 1VFBB 2WZAA 4I0KA 3NG3A 4RXGA 3QUMA 4N1HB 4C4KT 1MIML 4PJDF 1JPKA 2JKAA 2X16A 1B4RA 3KDMB 1NDYA 2LVCA 3GGWA 3N0PB 4J3XA 5EF0A 5FGCB 3BP6A 3L5WB 4I48B 4DOHE 5LG6A 3OGSA 3A67H 5GS0L 2J5LB 2XTJC 1E8YA 2P45B 5HYSA 1YNKH 3PABB 3M88A 3PXJA 3PZTA 2R94A 1XBXA 3NQKA 1OCOB 4GKOA 3UCRA 4JO1H 1UWFA 1Z7JA 4P57A 3OKEA 4S1QH 4M62L 5IG7B 4LVFA 3R8RA 3SR7A 3LHTA 2WBJB 2BHFA 3GXTA 5LGHH 3LDBB 2L0DA 3C6LD 2CJ3A 1FRGL 1LMIA 2L04A 1UXLA 4PW9A 2YPLE 5ADPH 4WFHD 2CXGA 3U2JA 4JNZA 4R33A 1T7VA 1NQKA 3GK0A 1P48A 4OCXL 3U7YL 4WY0B 3NMEA 1PB0A 1YADA 3ANYA 4IP5A 4LF1A 4JBSA 3F5JA 4FQIL 2DQHL 5J6SA 1F4XL 2AQSA 1BX2B 3RB7A 5ES4B 3T65B 1AZ2A 1EJXC 2QCLA 3LLFA 2PYED 3PTMA 1T2QL 3WKNA 3GH4A 5DXXA 4K94L 3N2BA 3SDAD 1M2VB 3WJSA 4JREB 1PAZA 4Z42C 12E8L 4V1DA 3LKSA 4KTEL 1VDGA 2E7LC 2CPCA 1EX0A 3STLA 4UC5A 4AVNA 2DIEA 2P10A 5MF5A 4PRHA 3BPLB 3H8NA 1T3FA 5DUMH 1WBJA 2IDUA 4JCMA 1MIEL 4EP8C 4LCYB 3PNWA 3WXWH 3VG0L 5I8EB 5I71B 1O5DT 2PRMA 1EUTA 1OAKH 2MH4A 1FLRL 3RTQA 3OGRA 1QLEH 3OKMA 1RZGB 4JG5A 5IEKB 2EUZA 3B0VC 3BXWA 2R24A 2DI7A 3T8QA 1E4XL 3LV3B 2CU9A 2JK5B 3BVUA 3V5FA 4BI6A 1MJ8H 4L5FE 2R0LL 3QXDB 4S23A 4RMQA 2Q86A 5FW6A 4R2GB 4GT0A 2J9YA 3GXPA 2D1ZA 2LLGA 4PUWA 3GH7A 3TM6A 1X8FA 5T1KD 3DIFA 3GKZA 5CBEA 4WFED 3GLAA 1YC7A 5EO0A 1O5XA 3H22A 3RVUC 1TPXB 4EKXA 3P2TA 4BI7A 1HWGB 4WTWA 5T5FL 2WXIA 4LYQA 4UIMB 5KS9F 3UA3A 4G80A 3UEZA 2RAMA 3LYRA 1X1ZA 3GTNA 4AZ8A 1YTDA 4N1EA 2VQUA 2BVYA 2E1DA 2Z31A 1G7QA 4S1SH 4ZFFA 1OZQA 3VXOB 3WS3B 3GDCA 3P8JA 1E6ZA 2P49B 1H5YA 2DWXA 2FJSA 5SWZE 2Q8BH 1J05A 1FHNA 3IFOB 4HG4J 3WO4C 1SY6A 4YHML 1OFPA 5GRZA 2D31B 3KWVA 4PJFA 4R9XA 3AS3A 5HGDA 3LNGA 4BGLA 3W9ZA 4LVNC 1OFQA 2DWSA 5KW9H 2DZPA 3Q8BA 4NKOA 5DC9B 5DVOA 2K6ZA 2FIRT 1TZ8A 1X4YA 4NUQA 1MZYA 1SLXA 4TQTA 5EU3B 1JMZA 1U8QB 2B59A 2C1PA 3LI1A 2UV3A 2PDNA 5EZIH 1HKLH 5I6SA 4I9WD 4GABA 5B1AB 3S2NA 3PHSA 4AY7A 4QYOB 5JW5B 3RL2B 3L1OH 4MNLA 1JK9B 3U0TB 4RMSA 2Z93B 3NOEA 2OTUB 4NAQA 3EEZA 4KNUA 1ZJHA 2OMXA 2UWEB 5FGSA 1I3GL 1JZDC 4JQ2A 3MZGB 2IFFL 4YR6B 3VM5A 3QCTH 2BX7A 4HZLB 2OR2A 4GUPB 4NBXB 1YNLL 4IKKA 3IGAB 1F3TA 1O9ZA 5DHEA 1G0YR 5DHVH 1CDBA 3EDFA 3V10A 4H04A 5BYWA 3OBKA 4JGUA 3UL4A 3NO5A 4G7FA 3P4OB 3H12A 3ONCA 5IB5B 4MLJA 3ZIZA 2EXYD 3RYSA 3DO3A 2HTLC 3MRPB 4HLJA 2YAQA 5DMGD 5D7SL 4XRCB 1ZAGA 2FPVA 5K9XA 4IOFD 5FKAB 5HMDA 2QVNA 3FQNB 4GBUA 1A8JH 4K8RD 3W11C 1FWDC 4ZQRA 7FABH 4B3VA 4U6YA 3SCMC 3LH2L 4C1NB 3BVJA 1A21A 4HJJH 5F1NA 3V1PA 1ME8A 4E3TA 1GY2A 5D9SB 3B7TA 1M9HA 1YYCA 1QLFA 4NCC1 4GXUN 2VLMD 2HISA 5DI8B 2J24A 3NIDF 2X0HA 1B9BA 1W9DM 3CPUA 4ODSL 2E3VA 5CCGE 1ZA3B 3M0HA 3GDMA 3KM8A 1G4TA 5B1KA 2WP3T 3GJFH 4G6FD 3S1VA 3SN4A 3CSBA 3KPRB 4MA7L 4XVUD 1JD7A 2CJTA 3BPNC 2FDBP 3HFFA 4ODXB 3QGKC 4QNWA 1P7QB 1FH5H 1RK0A 1JZ6A 4Z7VB 1XGPB 5IMMB 4E4UA 2BHZA 3IE4A 1I7TA 4FOUA 3ET9F 4ETYA 3A64A 4JO4H 4WI8A 3INUL 4UYQA 3U0PA 2XWBB 3HPLB 2P5WA 1L9MA 3GMPA 4W9IC 4Y19E 2NRDA 5ECVA 4OZHA 2BOBB 1IAOA 1YG9A 4J27A 3L3HB 3MLPA 4OCMC 1N64L 4JY6A 4D2NA 5IT2L 4ENEC 3SD2A 4MS8D 4OF3A 3QQ1A 2DQDH 1CF8H 2DBLL 4NN5B 5DT1L 3P4OA 3FZUD 2ESVE 3QBTB 4URTB 5HHOE 3GD6A 4N85A 3E9UA 1DBMH 3O8XC 2WQDA 4KH2A 3V7PA 3UTZA 2WVUA 1LO0L 4J6RL 1NEZA 1ETB1 2FX8L 5I6XB 1X97A 4ZQKB 1CLOL 2Z3FA 1S9VA 5B7YA 5T3ZL 5TPWH 4US6A 4S10A 2CO2A 1WICA 2FRGP 3REWB 5BS0B 5AVHA 3WFLA 3WKZA 4V1YA 3MXWH 2Z7WA 3ZHLA 2A6KB 1URIA 2XDHA 5E5UB 2I26N 4AEEA 3GR4A 5IB4A 1QYGL 4HGKC 2BNRA 4YSOA 3VWJB 1YEIH 4LU5L 3EOBA 1I1AC 4XZHA 1X5GA 2FZ9A 3VVGA 1OANA 2ZXAA 2A4AA 5DS8B 3F7KA 3PG2A 1N2RA 1U8QA 2YOCA 3GKFA 3WTXA 3CFCH 1SJCA 3AI0A 3L68A 3RU8X 5LA1A 2NV1A 1GPOH 1F6YA 2I57A 2WQ8A 2K7PA 3ZUNC 4M80A 2QCGA 4GUFA 3UXAA 4HC1H 2Z0IA 4OJYA 3RGHA 1AXIB 2M2DA 5I8KL 2M8XA 1QFWH 1S5HA 2YAPA 4LHUA 2EG6A 4KT2A 2JJWA 4WWOA 3RNQB 5MP6L 1I1RA 4FX8A 4QE5A 1K77A 1TJXA 2NNAA 4LPXA 1CU4H 1IWBA 1ZBWA 2YR1A 3NQVA 4KZCA 9CGTA 2VZSA 2ZT9C 2ZXGA 1E5YA 4GW4A 3S96A 3WN6A 4W8AA 3ROOB 2ID5A 3GM0A 3A4AA 4R5TA 3T3ME 4DCQB 2GJ6E 1XCTA 3BFQG 1QW7A 2EIMB 3T0TA 2VDLL 3GK8H 4F7TB 3ITXA 4H40A 2VDRL 5HGHB 3ZTCC 3HQPA 3MNWB 2XFYA 2J1YA 1T66C 1MWAL 3VXMA 2YRBA 3P3BA 4GX9A 3LRHA 4C5YA 4DEFA 1IC0A 5JXQA 4AYBA 1KENH 1KIQB 4KX9A 1GOOA 3VPLA 1AYRA 4TQEL 2AANA 1JIBA 3BWUF 3OTTA 1FO0B 3KX6A 1ID2A 1GYWA 2GJ6D 2OMZB 3FT3B 2PZNA 2GIXA 2HN7A 3FBQA 1U8LB 4BBWA 2CDGA 1IHIA 2FECI 2WMHA 4R7WA 3UZQA 4A8RA 4DP5X 6A3HA 5LXXA 3L3HA 4Z78B 4K3DH 3TWCH 5FO7B 3WH6A 1ZTXE 2EIDA 1FCVA 3RM8A 1W72H 2DMKA 3BW9A 3GMMA 4S3KA 1EGJH 5DCCA 1XQLA 2PP7A 1UBPC 5HI4D 5L4MA 5AUMA 1RK0B 2CBMA 1JWUA 4X9YA 4Y5XA 2F58H 1RZ7H 4E9LA 1RK1B 3KWWA 2NYYC 4TLKA 4H3DA 3IDXH 3ME0B 2IDFA 1KB3A 3TEWA 3DO7A 2Y7QB 3NZQA 5M17A 4G1MA 2DSZA 3B2MA 4GACA 3FXGA 4NPYA 3TU9A 4TPRL 3WY2A 4YDIL 4Y16B 4ANXA 4G6JL 3O3AB 4JX4A 4Q8TA 4DVOA 3IJSB 2DIKA 4JFDD 5DEGA 2WVTA 2SEBA 3LERA 1THCA 4PRIB 2HMID 1B6UA 4JFYA 2ZDRA 5F7NC 4W4OA 1E9PB 1IBGH 3MA7A 2D3VA 1J0IA 4K23L 5I1AB 3W38A 3E74A 3S83A 3U5YA 3PV6B 4QP0A 2NXIA 3L0GA 4OD2A 3CHEA 3LTPA 1M9SA 3FH8A 3WNIA 3SJVD 3PR2A 4QOKE 5DLML 1DO6A 3O41B 4LLAA 5D96C 1XGDA 3NO3A 5JHLL 1PIFA 2D4DA 1ZGLM 1AGEA 5DJCB 3DURB 3O9NA 1B4JL 2GK2A 3UH8A 3VNJA 4Z6AT 4HWBL 4JPGA 4LLDB 2VDLB 2XPYA 1DBAL 2BRRH 1XDJA 3L4ZA 1RY7B 1NDTA 2ADIA 2OX5A 3RDTD 1VCGA 2OYLA 1KT2A 2UWEA 5CJBA 1TTGA 5JMRA 3ATAA 5LWYL 4N2NA 4XP6L 4TTDD 4EXKA 2BV9A 2P3ZA 3QV8A 4EF3A 4B5EA 1JRCA 1TIMA 1E4HA 1JK9A 3U0TA 2XXFA 4YYCA 1ML0A 1SOKA 2Y06L 5DD6A 3UAJC 5C70A 4PBXA 2RJGA 2C3VB 2I60L 2Z1SA 4PUUA 3A0OA 3G1YA 3RUGA 3TYGL 1QRKA 1A7NL 3AXXA 1GS6X 2B1AL 3UGUA 4DO5A 4LO9A 4ACTA 5C92A 3EG9A 3HI5L 3PAYA 3C0SA 2H41A 3QORA 3OG4B 4KJWC 1EA0A 1M65A