1JDAA

Maltotetraose-forming exo-amylase
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGQLWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-ALPHA MALTOTETRAHYDROLASE
publication title Crystal structures of a mutant maltotetraose-forming exo-amylase cocrystallized with maltopentaose.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 136
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1997-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jdaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jdaA01
4NX0A 3WNNA 1ITXA 4BS0A 2CERA 5C8BB 3CLWA 3ARPA 2OSYA 3OLIA 3GXIA 1KWGA 4PTXA 4W7UA 3CO4A 1J0HA 1GONA 3ARXA 9CGTA 3RPMA 2XN2A 3AIVA 3SCUA 4MB3A 1C93A 5IHSA 3PZQA 2YLAA 3SUTA 3PZIA 1CXEA 1WP6A 2F7QA 1QI4A 5BRPA 1XH0A 3FXYA 4LYQA 3VGBA 3BCFA 5E6ZA 3WY4A 3ZR6A 1AQMA 2J74A 4UFLA 3IJ7A 4CN1A 2BV9A 1EIBA 1QOXA 2VO5A 1QW8A 4ACZB 4KH2A 1SMAA 5CPQA 1NOWA 1KXHA 1CEOA 2W91A 3WMBA 3A6OA 2JALA 3VINA 3L4ZA 2WPGA 2XN0A 4AISA 1GQJA 1FFRA 1JFHA 5M17A 4V28A 2YDSA 4HU8A 3ZSSA 1HXKA 1HJUA 2QLYA 1K9FA 4PCSA 2J7HA 2YL5A 1EDGA 4AZCA 4UFIA 5I6SA 1MFVA 1PAMA 2J7DA 5A6SA 1B3VA 3WD1A 1M04A 5JUVA 3FHAA 1X6NA 4KMQA 3GTNA 3ARZA 3AHZA 3KL0A 3AIRA 1ESWA 1QNRA 3DX0A 4CCDA 3WEMA 5FL0A 3SCRA 4OKDA 3WF4A 3VIIA 1SFSA 1ZBKA 2J4GA 2VZOA 4WJXA 3NSNA 3ZM8A 3CTTA 3EJUA 3S2CA 2DQXA 1UR8A 2GFTA 4L4OA 4OGZA 3VU2A 2IXVA 2ZUMA 1HJSA 4C7GA 3CUJA 1CLVA 3DX1A 2YOCA 3PTQA 1BGAA 4UQ9A 3AHYA 3MS8A 1UR0A 4Z2GA 1W9DM 3NDZA 1EQPA 3EMQA 1IZKA 2E9LA 1QWNA 3QHNA 2J47A 3VSVA 2FH8A 1OIFA 1WCGA 2EAEA 2GJXB 3SCPA 4HOZA 1P6WA 3A4XA 1XH2A 3UG3A 1BYCA 5JBDA 4FNPA 4UZUA 3VNZA 5I5RA 2YL6A 3RM4A 1PX4A 1RP9A 2J8FA 4AXNA 4HZ7A 2EPKX 3WUBA 5JIPA 1ZS2A 1L8NA 3VM7A 3OGVA 2V5DA 1XRVA 2DSWA 4UR9A 3VGHA 1QBBA 4GO8A 3KLLA 3AHTA 1JZ2A 3WEOA 4ZE5A 3AZSA 3CH9A 2XFRA 1CXLA 3PZVA 3MU7A 1KXQA 1H5VA 5A6JA 4J3UA 2D3LA 1MQQA 1UR1A 2FGZA 4DM2A 5I24A 4P7OA 4Z2HA 1TA3A 1WAWA 4J3TA 1D7FA 1G5AA 1E15A 1UZ4A 4PMQA 1R75A 5A8QA 3ECQA 4BCEA 1JZ3A 2V3GA 1X6LA 3AFBA 3PBGA 4X0NA 1QI2A 3VIMA 2PWGA 1Q6GA 2BHYA 2ZXQA 1UR4A 3T09A 1ZBCA 4GI6A 4QLKA 4PSRA 1NH6A 5A8MA 1ISZA 4X9YA 1H4PA 7A3HA 2CBUA 1CIUA 3AXHA 1QX1A 3ARYA 1W9VA 1DWAM 3S6TA 3N9KA 4JCLA 2WVTA 3WD3A 1TG7A 2VQTA 3HN3A 4M56A 1NWUA 2DDXA 3BVXA 4AZCB 4UOQA 2VX5A 1BG4A 1CLXA 1HXJA 3PZGA 1UA7A 1L0PA 4AMWA 1PBGA 1GOOA 1SR0A 3RJYA 4QLJA 2F18A 1UG6A 4EE9A 3BSHA 3EJSA 4M1RA 5BXRA 1CGYA 4HOWA 4PMVA 1EA9C 4U5KA 2WHJA 1AQ0A 3L4VA 3T2OA 1ZBVA 4NI3A 2WMJA 3CUFA 2C7FA 5CZKA 2CITA 5A6MA 2X2HA 1KXVA 1UKTA 1BVZA 3MV11 6CGTA 1JZ4A 1KCLA 5JIWA 2ALWA 1EH9A 2ZXAA 5TD4A 1XH1A 1HL8A 3L4WA 3RIKA 3D3AA 4AIOA 1E0WA 4LYRA 2A3CA 4ZE4A 1LL7A 2WHMA 1JI2A 4FNTA 2J62A 4MDPA 3RCNA 2D22A 1E40A 5D9OA 4H7VA 4WSKA 1CZ1A 3CV5A 1JXKA 4ZXOA 3OG2A 2WW5A 3WF2A 1JAEA 2VT0A 2DT3A 3CUHA 2FGLA 4DWSD 1DWIM 1V0NA 3MKKA 2CKRA 2OLHA 1G01A 1J0IA 3CZEA 3ARWA 3VGFA 2FHBA 2WWDA 4N42A 1TCMA 2PWFA 2WANA 2E40A 3EYPA 2AAAA 4UQEA 4QP0A 2BY3A 2OYKA 1K6AA 1UWTA 3VIKA 4U3AA 4NXSA 1W1VA 1HL9A 1Q6DA 4Z2IA 2EJ1A 3GXPA 1H2JA 3MMDA 3HG2A 5DEZA 3TP4A 1B31A 2V3FA 1B9ZA 2GVYA 4D6CA 4NRRA 5FIPA 1QBAA 4OOUA 1M53A 1GOWA 1LG1A 4E4PA 5I3DA 5D9NA 4U5IA 3ZJ6A 4C7FA 2XVLA 4AD3A 1QI3A 1FHLA 1W1PA 4W7VA 2Y24A 3MV01 3MSGA 1YQ2A 3LPGA 5HDRA 1QNOA 2ZX8A 5GNZA 1SYTA 1HTYA 4LXFA 4IUGA 2G3MA 4HPGA 3WIJA 3DYMA 3VIHA 5FKYA 1KR1A 3VMPA 1LL4A 1W2PA 1D2KA 5I2UA 1TQWA 3K8KA 1E56A 2VJXA 4W5UA 5EFDA 5EFFA 5E09A 4AEFA 4CVWA 2EPMX 2VVNA 1FP9A 1RPKA 4ATLA 3IANA 3SUSA 3RJXA 5FD0A 4A3YA 4J3WA 4P7QA 3AIBA 8A3HA 2E8YA 3CC1A 4D6EA 1E5JA 1NARA 4BQ4A 3NUKA 1QVBA 1CNVA 1KTCA 1KQZA 1OGSA 4P7RA 3SIMA 3HG5A 2W5FA 4E8CA 1H1NA 1EXPA 1E1EA 4MPKA 5BCAA 2VX6A 5JBFA 2ZUSA 2QPUA 1R8LA 3SCNA 4AMCA 3AS1A 3BSGA 1FH8A 1TQUA 4WLCA 3AIQA 3WDPP 1V6XA 1HT6A 2XWEA 1A47A 1M7XA 4GKLA 1MW1A 1Q6CA 5CLTA 2XTKA 3VD5A 4MB1A 2GUYA 3NCOA 2X2YA 2XFYA 3EMZA 4P8UA 2VRKA 1B3WA 5A95A 3ZO9A 4W85A 4RL3A 2Q8XA 1E1FA 5I0DA 4Z2KA 2FE0A 4H8VA 4F8XA 2RGLA 1TUXA 3OLEA 1QHZA 4UOJA 4Z2JA 1GOMA 3O9NA 2ZE0A 5DFAA 2J8GA 1I1WA 1K9TA 4D6FA 1E0XA 4PUEA 3L4XA 1W32A 2YL9A 1US3A 2D3NA 2WKGA 3CZNA 3AS0A 1B2YA 4Y7EA 1CGWA 1UWQA 2YL8A 2FDMA 3A4WA 1JDDA 5DT5A 5HXMA 4HP5A 1C8XA 4KGLA 2PWDA 2O9RA 1UD4A 3M7SA 1OB0A 3BLKA 2VX7A 1JYXA 4M80A 4JAWA 3EDFA 1JF6A 3S5ZA 4H2CA 4P7LA 1ISWA 1J11A 1J01A 2QPSA 3NSMA 3AI0A 2G41A 1XSKA 5LA0A 1U30A 1GQLA 2OSWA 3T2PA 1H0GA 1BFNA 4QFUA 1C8YA 3BUIA 4AD2A 2BVYA 4QAWA 3A3HA 3EBVA 3BUDA 1E6RA 1GJUA 2VZTA 1HVQA 4TX6A 3TTOA 2XM2A 2Y8KA 1QI5A 2F7PA 5D9PA 3WDJA 3AS2A 2J7GA 1BLIA 3A22A 2W62A 1E4NA 4ZFMA 1UD5A 3H54A 4JHOA 3EDJA 3MO4A 2WC3A 2DIEA 3CIVA 4B9ZA 4MNKA 1BYBA 2W92A 4NF7A 5BRQA 3LXAA 1CYGA 4A4AA 4DM1A 1BAGA 5FCZA 2Y2WA 1H0IA 1XSJA 1MVYA 2XIIA 4ACYA 1S46A 2FH6A 4CN6A 2G3IA 2DH2A 3T08A 1HF6A 4AZBA 2YBUA 3AIWA 3QOKA 1CGTA 4JFSA 1WDPA 1B3ZA 2GJXA 3VILA 1BYDA 1G94A 4UQBA 1ZL1A 2WM0A 1QNPA 4XX6A 1W3HA 4D6JA 1PS3A 5CPSA 1J12A 3U5UA 1WPCA 1BG9A 1WB0A 3I3BA 4DO5A 3W37A 3AYSA 3W24A 1J18A 4MAZA 3IJ9A 5D8ZA 3KWXA 3BVUA 2WCAA 3AXIA 4GI9A 1BYAA 1KB3A 3EDEA 1NOUA 3WY3A 5EMYA 5I79A 4HMDA 4AYSA 3BUQA 3LPFA 5M03A 2WMHA 4MB4A 3WF1A 4UCFA 1E43A 2A3EA 2BVDA 3THCA 3DDFA 4AYGA 1UA3A 4RE4A 1C90A 3K46A 3AXXA 1G9HA 1M03A 1DHKA 2ESCA 4PBGA 1V3IA 3AS3A 2OWCA 4F9JA 3VGDA 6A3HA 1W9PA 1CXIA 2GJRA 1E4IA 5JBEA 4U31A 3EDKA 1MYRA 1UH3A 1Q4NX 1ZU8A 3WL0A 5BXTA 1CTNA 2YDQA 1V6YA 2DPEA 5AYBA 5LYRA 5E1QA 2CHNA 5I77A 1HX0A 3H55A 3IGUA 2XJ7A 1QHOA 3BMVA 2WK2A 1H49A 1OBAA 4WF7A 3ZMRA 5CQ1A 1JXJA 1SMDA 2X2IA 5A6KA 2YA1A 1W91A 4D6DA 1GHRA 1EDTA 4FLSA 5EB8A 1E4MM 2JF7A 2XVKA 2EXOA 3GNOA 4D1IA 3CHEA 4CU6A 5GNYA 2X2JA 2V3EA 3W81A 4AD0A 1V0LA 1V3KA 2ZUVA 3NSXA 1H3GA 3HU7A 3ZT5A 1ITCA 1JYWA 1TE1A 1CBGA 3AHVA 5A8PA 4UFKA 1E3XA 3VIGA 4YN5A 2F1BA 3DC0A 3WFZA 4CVUA 3WDHA 1O7AA 1HJQA 4AZGA 5A69A 2UY4A 3OZOA 2DGAA 5M3WA 3BCDA 1J0KA 1TZ7A 1PEZA 1TQSA 3TTQA 3VIFA 1CGVA 3BGAA 4NZFA 4J3VA 2XWDA 3K4AA 4M29A 4OBRA 1KQYA 1XCWA 4PRWA 3W82A 2JEQA 5A8NA 2OSXA 3UR8A 4AY1A 3VPLA 4TXEA 3CGTA 4OBSA 3HG4A 2CPUA 3SCSA 1V3HA 1R47A 4UQAA 4Q22A 5LA1A 2E9BA 1V02A 5ECUA 1E5NA 4PUDA 2OWXA 3GBEA 4FNUA 2BY1A 5D4YA 3GZAA 2X8RA 2DT2A 5CGMA 1CECA 3N15A 3GH4A 3UG5A 1HKKA 3T2QA 1UR2A 5ABEA 2EPOA 3U7VA 3WD2A 1DWJM 1V6WA 1E55A 3PZNA 3K1DA 4IISA 2VCAA 3MMWA 4NRSA 2BVTA 1JAKA 4JFWA 4URIA 4HZ6A 2J7BA 5KEZA 2VTFA 4FLQA 2DIJA 4KGJA 5A6BA 2WSKA 1VFUA 2CKSA 2VMFA 4CU8A 5IHRA 1QNSA 2BHZA 3BAXA 3B9DA 1HKJA 2Y8VA 2Y4SA 3A21A 3WUFA 3MSDA 1WKYA 2E3ZA 4P8XA 1KXTA 5BROA 3MUIA 3A4AA 4FLRA 3AISA 2VC9A 4UZSA 4R27A 4H41A 1VBRA 1UKPA 3BC9A 2CIPA 2B31A 2JF6A 2ZICA 4DO6A 1B0IA 1VRXA 1R34A 1W9BM 1FP8A 1LF1A 1TR1A 4BQ5A 1VFFA 3W0KA 1WZLA 1UD8A 3AICA 3ZJ7A 1XD1A 3VSTA 3DX4A 2CNCA 2X0HA 3BAIA 4S3JA 3L4UA 1KWKA 3AMDA 3BAJA 2WKLA 1JG9A 3SEPA 3ARRA 3WH6A 5IFPA 1CDGA 1GNXA 2ZXBA 4UNIA 4CCEA 4W87A 3F5JA 1VBUA 1E72M 2ZUNA 3ZIZA 4YPJA 5A94A 2X09A 1E71M 2WMFA 1LJYA 1H11A 2E9MA 1WDQA 2ZUTA 1VEPA 3VSUA 4D71A 3IK2A 3RDKA 3CPUA 4CD5A 4AW7A 3LX9A 4GZJA 4D6HA 2CBIA 4MNLA 2ZUUA 1PZ2A 7TAAA 4H8HA 1C3FA 1BQCA 2BNJA 4OJYA 1JL8A 3HZ3A 3GXNA 3HJEA 1KCKA 1GHSA 4H8UA 3LRKA 2CYGA 2XPKA 2G3JA 4HTYA 3VGEA 1QWUA 4TVDA 3DDGA 1W1YA 4HZ8A 2V3DA 3KE0A 2DT0A 3AQUA 1UH2A 5IDIA 2D0HA 3CUGA 1HJVA 3RM9A 2F61A 1C91A 1V3MA 3AZRA 4W88A 1W3KA 1LQ0A 3K8MA 4UOZA 2CCRA 4WKFA 4CCCA 4CGTA 4XZBA 4Z2LA 4W89A 1TQTA 1GORA 2J7FA 1GJWA 2WMKA 1KBBA 4JIEA 4EK7A 5A6AA 3FHQA 4TVCA 3ZOAA 4P7NA 3AJ7A 2XIBA 5E0FA 4W8BA 2GK1A 5ABGA 3OZPA 3VGGA 4R5EA 2V5CA 3N11A 2E0PA 3OGSA 4TUFA 1HP5A 3POCA 2VNCA 2YDRA 4DUVA 3ARVA 1AQHA 4XZWA 3I3EA 5HPOA 1W2VA 3VDBA 4TTUA 2WLYA 2X1IA 3DX2A 2PI6A 4EANA 3CZLA 1CGXA 5BXPA 2Z1KA 2WC4A 1GW1A 4JKMA 1W9UA 2YA0A 4AZ6A 1GOIA 2XVNA 3GNPA 3W26A 3THDA 1ODUA 2DSVA 2OYLA 2VX4A 1IT0A 4LQ1A 1NM9A 1J9YA 3W27A 4QDMA 1OGBA 3PZOA 2JFEX 3GXTA 3WNKA 3AHXA 3ZJ8A 3K8LA 1FH7A 5EBAA 4DUWA 3L2LA 3FW6A 3N04A 1YHTA 4AZIA 4B3KA 3VTRA 2D0GA 4PTWA 3CZ8A 1IV8A 2WZEA 4ZENA 1WZMA 3OLDA 3WDRA 3H53A 1AVAA 5E6YA 3WQ6A 3TTYA 1R46A 3CHFA 3WQVA 3F4VA 4OZOA 4LYPA 3S5YA 5CSUA 4NZCA 4WK9A 1JZ8A 3OIHA 2JIEA 5CJ5A 4JKKA 1WDSA 1Q6EA 2BS9A 2XUCA 5A2CA 3DHUA 3ARUA 3WH7A 2MANA 3F5LA 7CGTA 4KWUA 3WEZA 5CSYA 2FHCA 4PMXA 1CXKA 4HPHA 1UR9A 4TX8A 3OGRA 3VMOA 5D8WA 1UQZA 1KR0A 5I78A 1FHDA 2J79A 3MUAA 1DP0A 3CZJA 4NXKA 5C70A 4KRUA 1JGIA 4A3HA 3LRMA 5GNXA 3OLGA 4D72A 4CD4A 4W8LA 4CD8A 3BAKA 4IPNB 1JZ7A 3L4TA 1MXDA 1GOKA 2VRJA 1V6VA 1XSIA 4DO4A 1JNDA 1B1YA 1EOKA 1U2YA 1JD9A 1MQPA 2X05A 2VZUA 2WMGA 3VOCA 1UHVA 3A24A 3BLBA 1HIZA 2VR5A 2VURA 4WIWA 1BF2A 1WZAA 4CU7A 1E6XM 3GH5A 3W29A 2WB5A 2W67A 3N1AA 5HBFA 2GDVA 3GXMA 3D52A 4AD5A 1SZNA 3I3DA 2BXYA 1XYFA 3WH9A 1DWHM 3FNDA 1KGUA 3QR3A 2GK1B 1TFVA 3N18A 4ATDA 3D5HA 3U57A 3HMCA 2WAGA 1KGWA 4UTFA 2O92A 1HJWA 2O9OA 5ABFA 3DX3A 3T0AA 1TMQA 1MFUA 2VZVA 4HOXA 2GSJA 3RO8A 1V02E 5C71A 1E0VA 5AC5A 4E2OA 1JFXA 2DSKA 4OIFA 4UQDA 1V0KA 5GQBA 1VEOA 3O6AA 1IZJA 1PIFA 2XG9A 2DEPA 4GZEA 1DEDA 3DECA 3WY1A 3UG4A 2PB1A 4XUYA 1OD0A 1WZKA 3LMYA 5AY7A 2QV4A 2TAAA 1PX8A 1EQCA 1ZB5A 3UETA 3T0DA 3CHDA 2EPNA 4J7RA 2XVGA 4AWEA 1Z32X 1ZJBA 4MDOA 3BAWA 3CZKA 3CMJA 4ZEPA 1R86A 3SUUA 1LL6A 4PTMA 8CGTA 1XD0A 4HA4A 3VVGA 5LA2A 1N82A 1KGXA 3OA5A 1UD2A 4X0VA 1VF8A 1MXGA 1CXHA 3L2MA 1OSEA 4PTVA 4RE2A 1QPKA 4S3KA 2IGTA 4AIUA 1UYQA 1PX3A 2IUZA 1R7OA 3W4RA 3W38A 3AMKA 3W28A 2NT0A 3VMNA 4ATWA 2J78A 3U5YA 2XGIA 3WDIA 2BY0A 4UFMA 4GQRA 3N17A 2XSBA 2PC8A 5BYWA 3CUIA 2J7EA 3WUEA 3TV8A 1K9EA 3NJ3A 2A3BA 4U33A 1OM0A 2VVSA 1JZ6A 3D50A 1NP2A 1B3XA 3GH7A 3VDAA 3OBAA 2G3NA 3OB8A 1CXFA 1R85A 3VO0A 1OGGA 2XFFA 3M46A 1UD3A 2EPLX 4GIAA 3AYRA 4W86A 1MW3A 3D51A 2YFNA 3A5VA 4UQCA 1TVPA 3ZQ9A 2W63A 3WELA 5A8OA 1V08A 3POHA 1UZ1A 4C7DA 1MW2A 3SCWA 1V6UA 3ZR5A 2GJPA 2WHKA 3TTSA 3NYDA 2EEXA 4AD1A 1VJZA 4OOZA 1HNYA 1K9DA 1J10A 4JL2A 2XM1A 4EAMA 5ABFB 2ZUWA 3BUPA 3WY2A 1FA2A 3BH4A 3BAYA 1UH4A 4FMVA 2VRQA 3VD3A 3PZUA 1Y7VA 1GCYA 3FAWA 3QHOA 2NT1A 4J27A 5ABHA 2WBKA 4J3XA 1A3HA 2A3AA 4LGXA 5A1AA 5E9AA 1GVIA 1U33A 2E8ZA 1HKIA 1ODZA 5CPTA 1UKSA 3WUGA 4H04A 5IXEA 3PZTA 2PBOA 1JDCA 4P8VA 4AIEA 3EDDA 3M07A 2HISA 1EO7A 3VM5A 1QNQA 1FOBA 1W3LA 4HMCA 1R7AA 5CXPA 3B9EA 2OW6A 4GINA 1EO5A 1UASA 3VDCA 4LPCA 2AMGA 4ZXLA 3WKZA 3DYPA 3SCVA 3WQ4A 4PMOA 4XV0A 2PWEA 3UESA 4GI8A 3F5KA 2WHLA 1H41A 4JFVA 5A3HA 1FH9A 4GZIA 4U2ZA 4MB5A 4RE3A 1E6NA 4MJ4A 1LWHA 3VUPA 4DWSA 2WCSA 1OINA 4F66A 3WD0A 2EADA 3GBDA 2XHYA 2HVMA 1QHPA 2WC7A 5HPCA 3DYOA 2BY2A 2ZWZA 4B9YA 1VB9A 1O7DC 4W8AA 2JEPA 1E6QM 2CXGA 3N13A 2YKKA 1W9XA 1NP0A 4DWSC 3IJ8A 1WNOA 5M5DA 3G6MA 3GNRA 3AZTA 1EOMA 1JIBA 1WDRA 5HNNA 1NQ6A 3EJPA 2X0YA 1NOFA 3EJTA 1CENA 3ALFA 3DHPA 4PMYA 4TVUA 2QF8A 1CGUA 2YIHA 2QHAA 1FFQA 1UKQA 3WD4A 4YHEA 1NWRA 3SURA 4D6GA 4NSBA 3SUWA 3PZMA 4MADA 1B3YA 4EKJA 5IFTA 4J28A 3VX0A 2D1ZA 3GYCA 4PMNA 5F7UA 2WWCA 1ZBWA 2ZIDA 2D73A 1US2A 3WNMA 3SCTA 2EO7A 4W5ZA 4PCTA 4TOQA 5A2BA 1OWQA 4JZ5A 4Q7NA 1ZJAA 3VNYA 4JL1A 5DT7A 3KZSA 1PIGA 5DO8A 2BHUA 3E1F1 3WH8A 3WMSA 3CHCA 1DWGM 2XSAA 3PZ9A 5KZ6A 1G1YA 3UR7A 1PJ9A 1BTCA 4FLOA 5I23A 1UD6A 3CBWA 1JNEA 4PN2A 1KFWA 1OCQA 3TOPA 3KLKA 1GVYA 2CBJA 3BMWA 1QI0A 1UQYA 3PHAA 2XGBA 2VCCA 3D4YA 1B90A 4V2XA 1OIMA 2J77A 1Q6FA 2CHOA 3SUVA 2D24A 2F8QA 2WZHA 1E4LA 3KEHA 1CWYA 1V0MA 1RP8A 1XCXA 4HA3A 3LXCA 4PYSA 5BXSA 4BQ2A 4D1JA 1D3CA 3A47A 3WF3A 1T0OA 1JD7A 1G0CA 2UY3A 1TQVA 2J7CA 3VIJA 3WMCA 4M24A 4BZYA 2WVVA 4MNMA 3VIPA 1ISVA 4PSPA 1HVXA 4FF5A 1VENA 1EGZA 1JDAA 2JE8A 3WQ5A 4DWSB 4FNQA 2PWHA 2V38A 1TVNA 2WBGA 1BGGA 3MUY1 3WQWA 1E3ZA 3QGVA 3QOMA 1NWTA 4V27A 3ALGA 3PTKA 2O9PA 1GUVA 5AYIA 1UWRA 4DUXA 1UWSA 3SCOA 1GOQA 3BVVA 3BVTA 3ZT6A 4N0RA 3U7BA 3TONA 1ECEA 3WH5A 4AZHA 1KBKA 4BF7A 4PEEA 2ZOXA 4B15A 2F7OA 3WL1A 5E70A 3W6MA 4M8UA 3A23A 4LX4A 1B30A 3VIOA 3PTMA 1E73M 3WNOA 1VAHA 5A2AA 4MTVA 2D0FA 3ZSTA 6TAAA 2WSPA 2NW0A 1GPFA 2F7RA 2OW7A 4GO9A 4HU0A 1X1NA 2UY2A 3LXBA 3VX1A 1JF5A 2OWWA 1TA3B 2FYVA 3WDQA 3TA9A 5A6BD 2ZX5A 3LPOA 3AIUA 1RD6A 1OT1A 1HP4A 4JHZA 1JI1A 2DT1A 4W7WA 2G8ZA 2WLZA 2WMIA 3WBAA 3KL3A 3T0BA 3W25A 4W93A 2BFGA 4K68A 1LLOA 3FY1A 2WYSA 1BHGA 4IM4A 1VIWA 2JIWA 3M6DA 4PMDA 1XGZA 3D4ZA 2VL4A 3WN6A 5HOSA 4CD7A 4QLLA 3APGA 1UWUA 3UERA 3VD4A 3IAQA 3GM8A 1HKMA 3AIEA 4FNRA 3VKKA 1V3LA 1I1XA 1VEMA 3WQ8A 4KRTA 2ZXDA 2CESA 1CPUA 4F9DA 4IPLA 1W1TA 2UY5A 2YLLA 2FHFA 1HN1A 2O9TA 2WXDM 3AROA 3BVWA 4YHGA 3J7HA 3EJRA 3ARSA 2NSXA 1J0ZA 1EDQA 1E6SM 3WENA 4UFHA 2UWFA 4M81A 5FOOA 2F2HA 3SCQA 3WNLA 2WNWA 5A6LA 1DTUA 3BLPX 2W4XA 3MMUA 4AD4A 1C7TA 2VUYA 2WVVB 4JKLA 1HJXA 3WBEA 2D2OA 3LPPA 1XHGA 3O2LA 4GPNA 1WE5A 1GQIA 5D9MA 2XYLA 3RILA 4FNSA 2Z1SA 2OYMA 1VFMA 3W53A 3QHMA 4PMRA 4B3LA 1UUQA 1C92A 2IXUA 1MW0A 4AEEA 1XYZA 2EACA 4ML4A 4WKAA 3MI6A 3WFLA 3MANA 4D6IA 3RMEA 4GXPA 1W3JA 1UWIA 2YFOA 1I75A 4PMZA 3PN8A 3KL5A 2DSZA 1E70M 2YA2A 2DH3A 1J0JA 1NWSA 1DWFM 3ZT7A 2VZSA 3B8SA 2VR4A 3GDBA 4PMUA 4F79A 1JYVA 2J75A 3AOFA 5CLWA 2C0HA 5DF0A 3ARTA 4B16A 5FL1A 2QMKA 2EQDA 5DMYA 4JCMA 2W61A 4JFUA 3N12A 4QCFA 4FK9A 3AMGA 2CETA 2A3HA 3II1A 1OD8A 1VJSA 4JFTA 1VFOA 2G4FA 3GXFA 2E4TA 2F1AA 3MUZ1 3G6LA 4MJ2A 2XVPA 1M01A 4NZJA 2C8NA 1ISYA 1V03A 1GZJA 3VDHA 2D20A 4E8DA 2VQUA 4ACZA 1PPIA 2ZX7A 5GPRA 1F4HA 2CBVA 2WMIB 4WKHA 4MNJA 2D23A 1E6ZA 1GQKA 4BQ3A 3CMGA 1AMYA 4U3CA 3CZSA 1C7SA 2RGMA 2AOSA 1JZ5A 4BA0A 2PF0A 4CN4A 2W66A 1WO2A 4AZ7A 3AMLA 2WZIA 3IAPA 5BWFA 3WF0A 3WNPA 4CUCA 4GQQA 1J0YA 4MAVA 3CZGA 3FN9A 3VD9A 4XB3A 4M82A 1QW9A 4AC1X 4HMEA 3L4YA 1MQRA 4HA1A 1JYNA 2QMJA 1XV8A 2YBTA 4UFJA 2EBNA 2BXZA 5CG0A 2GDUA 1LWJA 2WCGA 1R87A 1LG2A 4WSJA 4U2YA 2WVSA 1PZ3A 2XN1A 2YJQA 3UCQA 3W6LA 1MWOA 3LRLA 2Y5EA 2EABA 4P8WA 3WSUA 2PBGA 3ZJKA 2VOTA 1R33A 3NIYA 1E6PA 2VCBA 1RH9A 3UEQA 5E0CA 4W84A 1UOKA 2CEQA 3K4DA 4CD6A 3RM8A 4J3SA 1EHNA 4AMXA 3FAXA 3HG3A 1KTBA 2VI0A 4L4PA 3B9AA 4OUEA 2WVUA 3GXDA 3EMCA 1EHAA 3VD7A 3BXWA 1E9LA 1H09A 4AZ5A 5CGTA 1XC6A 1OT2A 1O6IA 2DSUA 1ISXA 2ZWYA 3BUBA 1BPLB 1BSIA 2ZX6A 5AC4A 1C8QA 1UKOA 1F4AA 2J25A 1BVNP 1HWWA 3EJQA 3AMCA 4CKQA 4TTGA 2ZX9A 3JUGA 1V3JA 3ARQA 3NDYA 4QCEA
chains in the Genus database with same CATH superfamily
1WFMA 3HRZC 4UR8A 1KWGA 2NQ9A 1GVEA 3BLEA 1J0HA 4KKLC 1F4XH 1N2RA 4IMKA 4HPNA 3VFUA 5IEKB 3UBXG 4DETA 1EJTC 3WIHH 2X3AA 5L0QC 5IMKA 4PGBB 4QG8A 1QW8A 4POZD 5J5EA 3DO7B 5F2IA 4KH2A 5AVHA 5CPQA 2NY4D 5KJRL 2P8LA 1KELL 4FADA 4N8UA 5ERWB 4AISA 2X6BA 4P23A 3VTAA 1TEFA 3EB4A 1JFHA 3H2FA 2IMNA 4NHUA 2J7HA 3U9PH 2WQUA 5I6SA 5CBEB 1Q6OA 2VXNA 1A4JB 1Z5HA 1X6NA 3OSKA 5FA3A 1CLCA 5LIKX 3G1RA 1ZBKA 3L5IA 4KI1A 3EPNA 3G6AA 4PUKA 3V4VL 4N9OB 4A7VA 3O6CA 1UB3A 3DVNB 4AC4A 4PCPA 3DJRA 4I89A 2WXGA 4MTMA 3HRZB 3EMQA 5K69A 3QEGH 4FI8A 2NY1B 4M7LL 5U7SA 5CZXD 4R2GD 2A9DA 4PFMA 2GJXB 1S7XA 4PBFA 4Y90A 3HE7D 3AU0A 3EX6A 5L9FA 4FNPA 4UZUA 5C0CA 3JVGC 2J8FA 2XWTB 5LDSA 3M0LA 3N85L 1KY7A 3PHOB 4JRXB 4BH8B 3DIFB 5I06A 4GO8A 2Q01A 3WEOA 3C2AH 4W4NA 4QGCA 1KXQA 3K6SA 3WU1A 1IM9D 2COQA 1UR1A 2FGZA 4MHBA 4D2JA 1TIMA 1AQDB 1YMMA 3MRKA 4UT6L 2I9LA 3OB0H 4BBWA 1X6LA 3BP5A 4N87A 3PBGA 1OSZA 1CB2A 5AW2B 4X9YA 2IW0A 3GHBH 5INCA 3MOQA 2CLOA 4EAYA 1M41A 3ZVHB 5AC8A 3HN3A 4PJ5E 3MTXA 2P52A 3APFA 2DDXA 4N0YH 1L0PA 4PBVC 4F0MA 2E86A 2ZJSH 3F58L 2ZOKB 1H8SA 5ENWA 2AI0L 3KAAA 3C2OA 1TNNA 2WHJA 4MD4B 1ZBVA 1BFVL 5KSAA 2ACQA 4NI3A 3NJGA 6CGTA 4XWGL 2VL5B 2APVA 3GFYA 3SKJH 2KDGA 5I07A 2J62A 2GFBB 5HDQL 2D22A 3TX9A 5D1ZD 3QCVL 3FYYA 2B7PA 4WIQA 6TIMA 1DANU 2J72A 1NFDF 2DT3A 1CFSA 4X4YB 3EAUA 3OYXA 2PRMA 1ZLWK 1MOEA 4OTXH 2V7NB 3MNVB 4KTYA 4XNDA 2FZBA 1G7MA 3CM4A 2JBMA 3HBQA 4XVJH 1IGFH 1U6AH 4YUEL 1JXFA 4A21A 2F8IA 5IG7A 5DJDA 4WVXA 2IPKA 3TYUA 1ZCCA 3WMLA 1FNEB 3H2AA 1PTDA 4NBYB 2LV4A 1AKJB 4ILSA 3IRDA 1NOLA 2OL3L 4KDTA 2K6WA 1DCEA 1IAOA 1QNOA 1KTJA 3REQA 1MUJB 2BLFA 1N9PA 1MAJA 1ZY9A 2XIMA 1YTKA 3QNZA 2D7OA 2EPMX 3SDAC 1VCFA 1UXSA 3S2LA 1Q6LA 4ZSOB 2R15A 3ALPA 4QRPB 3PFMA 2FZ9A 4F33B 9XIAA 4FNLH 1OAZL 4PWIA 4MVBC 3NSDA 4UTCA 2OR8A 2WKJA 4WV1C 3AREB 2HKFL 3QHZH 3LS9A 3WJLC 2HTMA 1FHGA 1SBSL 1FH8A 1RK0B 1Q6CA 3SGDH 1B3WA 3RKDC 2FO4B 4B9PA 2OKMA 4HT3A 4DP2X 4UBDD 4N68A 3ISRA 1MFBL 4G8IA 4KWVA 5JVLA 1NIUA 1OO2A 4Z7OF 4E9VA 1F3WA 4K8RL 4PGBA 3DO7A 4FQ2L 4DBWA 3KTCA 3B2DC 4FZ8L 5DFWH 3SDAB 1J86A 3TUUA 1YKWA 3K4ZA 2GHZA 1A6AA 3HI5L 2PXYA 1DYSA 3C5XA 3F3HA 4HN8A 5CBEA 1IMHC 5DZAA 5LN8A 7REQB 5IUCA 3AS2A 3NCXA 4ZFMA 1I7ZA 3LCHA 2R1YA 4C56D 3H54A 3C3UA 1A6UH 3HC0B 2B3IA 2YD1A 1U91B 1MNSA 1LDPH 1T4KB 1WKFA 3MA9L 4K2SA 3DVNA 4HNOA 4F8QA 2PODA 3ASOB 4EF8A 4NKDB 3SKOA 3NFSL 2IGFH 3QXDB 4XP4L 4WI4A 5AENA 2GJXA 1QW7A 4YLQT 1E9ZB 1ZL1A 2QGBA 4AEHH 1W3HA 3LB6D 5I76B 2DM2A 3DIFA 2XUWA 1L7TH 3CZUB 3PWPD 5EMYA 1T5WB 5AZ0A 4D0DB 3TZVD 5G55A 2LTQB 5CMAA 4TLTA 4ICWA 3MXVL 5HJLA 5H8PA 3NACL 4GNKB 3AXXA 4NKMB 1IWAA 4ONHA 2WYTA 1KDIA 3MLSH 3D85B 4JTIA 1NEZA 2X88A 5ESQB 4BI7A 1ZU8A 2ISVA 1WJ3A 4QNEA 5E1QA 1NDVA 4FJZA 3IAGC 2ZCHL 1H3PL 5B38B 3CG8A 3SYQA 2Z8SA 3E0IA 4OQTA 3ZVHA 1QHOA 3V6ZB 1YSOA 3C0LA 1H49A 1WT5C 2COVD 5IQ7L 1R5IB 3OR7B 4JJ5A 3C5ZC 2L4OA 2TRYA 1LRTA 4FLSA 4K5NA 4O02L 4YDMA 4MD4A 3RFAA 3FCSB 3VA8A 5EO1B 2J56A 1XB8A 2Y1YA 4UTBL 3E7JA 1DL3A 3H4HA 4D7BA 2EDKA 2OSLA 2VL5A 5A69A 3D39A 5TFSL 4JZNA 1TWWA 3T7VA 1MCKA 4U1SB 5EC1A 3QMRA 4PRWA 4OBRA 4G1EA 3P0YH 3V0GA 2F6XA 4RZKA 4X4YA 1QZ1A 1EC7A 3SCSA 1FLRL 3UPRA 4J2MA 4E3TA 3NZQA 2V7NA 4M62L 4NI6A 4UIMB 5D4YA 3OAUH 2CO7B 3PIQB 4M7KH 4HYWA 4R34A 5ABEA 3WD2A 4KY2A 3IVSA 2PO6C 12E8H 5E6SB 5I0ZA 1JCJA 3QFJD 1DQKA 2KAUC 2J7BA 5GZNA 3V4PB 5IF0B 2VOMA 4BQ9A 4CU8A 2BHZA 3NZHL 3TROA 1AKJA 4RRPG 2G4EA 3TJEL 5I5JA 4HPXA 3FQNB 3GO1H 2F5AH 5DZLA 4NJKA 3T2LA 1KXTA 3GM0A 3REWA 4WZHA 4EWJA 4FQCL 2RQ8A 2VC9A 5JIQA 4GUPA 3BC9A 3ITLA 2MCPL 1YQVL 1VRXA 4XP1L 1U58B 3EPOA 4ZSOA 2Z92B 4QRPA 3FFDB 4YDKL 1OABA 4RNHA 3MCYA 1DSFL 1XXFC 5DZPA 5CSSA 2OLAA 4Z42C 5EU6E 3WGVB 3AMDA 4C6EA 3AREA 2WZ6A 4U1NA 5H8UA 3GMRA 4EP8C 1FNLA 2GOUA 2AHIA 5CP3A 1KC5L 4PYHA 1RK0A 3ULAB 1L9NA 5DRNA 4QKXB 3ZJAA 2W0FB 3L23A 1HNGA 3KS0J 1UXWB 1RXLA 2C9AA 5D4QA 3RZCC 2WCPA 4WX2A 5AAMC 1QWUA 1SXCA 5B7ZA 4PRPD 1T0MB 2P4AB 4PVNA 3AAZB 5C07D 3AQUA 1H63A 4O4YH 4QMEA 4CVXB 1BECA 4M6VA 1R5YA 3PAYA 3IXAB 4IRSA 3S37H 1V3MA 3X14B 5CN1A 4LARL 4DTGH 2I25N 4Z2LA 4W89A 3WD5L 1QSEA 2P8MA 2G50A 4IMCA 3OZPA 5A16B 1GOGA 5EPMB 4TUFA 1SLXA 3CQKA 1YPZA 4I5UA 3B2XA 4DUVA 4E8GA 3K5RA 1UM6H 4N2AA 5JQ9A 2YD9A 2FIKB 4LC6A 2HG5A 4FHKA 4FMKA 1BWWA 1ODUA 2IWEA 4Q9RH 2OYLA 4HIXH 4FXGC 2VXQH 1JTTA 3AT0A 3FW6A 4F7PA 3DI2B 1Q2SA 1TTQA 4NKDA 4GOAA 4L4VE 3WQ6A 4IDJL 3I75B 3QXDA 2XU2A 3WQVA 3N3EA 3GBNL 3WLWD 4WK9A 3WOVA 1PLGL 1JTPA 4WRLA 3GHUA 4RVBA 4U6YB 4I48B 4QJ4B 2BASA 4IPJA 5FYKD 1T5WA 5IHBA 4YDLC 4WY0A 1B4EA 4ZTPH 3BP7B 5GJSH 1KLUB 3L4TA 5J6GB 4FAMA 5C3IA 4PFEA 2V33A 1JNDA 4NKMA 1JPHA 2VR5A 1FWNA 2W67A 3D52A 5FYJE 1U8JA 2DS4A 4A7GA 5IESH 3QXAB 5CZTA 3OXSB 1MQKL 4H20H 4EF3A 2F6UA 5AHMA 3RO8A 5E93A 1SMOA 2X6AA 1V0KA 2ZUXA 3O3DB 3V4UH 4Y9MA 1VEOA 3HPZA 4N7QA 3ZDXE 2BNRA 2EVHA 4NI8A 1Q5MA 3MCOA 1FWHC 3MVIA 1EANA 4EI6A 1T7XA 2Z0IA 1A4KA 4LHQB 5AY7A 3FPYA 5HYJE 4AIZB 4HVXA 1EJRC 3T0DA 5DRCA 4PUJA 1U1UA 3FGCB 4WUKL 4NL1A 1MFCH 1EZLA 1XT5A 2CDGA 1E5BA 1S5VA 2FBJH 3QDGA 1P0EA 3A4FA 1UEYA 4AQ8C 2PSNA 1IEBA 1BGXH 1NGWB 4QI3A 3KCOA 1OALA 1TSIA 2QADD 3G7TA 4XX1E 3O6FC 1CDCA 2IAMD 5FS5A 5FW6A 3C0QA 3UBXA 3GB6A 4UIMA 4IXXA 3LZOA 2CO7A 5IQLA 4I1NB 3N2TA 4NO5A 3JYCA 2A3BA 4YPGB 1DLHB 2A6DB 3RWGA 2BGNE 2DJXA 4PJ5B 3CV6A 5JIIA 5KYUB 1KGYE 5IF0A 3M47A 1TTBA 1EJXC 2YBRB 3WXVL 1M2VB 1D3HA 3ITXA 3U0TB 3CQPA 2BDNH 3GJFH 2Z0UA 2O56A 3NYDA 4LY4A 5IROC 5IGXH 4U6VH 5JMUA 2V17L 4QHPA 3PK7A 3C09C 5A43C 5FYLE 2OQYA 1E2ZA 4GAYB 3FDWA 4I7VA 1IC0A 5IQ9B 5CS7A 2VC2L 2WBKA 5EA0L 3OKNB 1NAML 3N42F 3TN0D 4RAUB 3NQMA 1OE2A 1UM5H 4O0KA 3HURA 4TUKL 3L3HB 3IE4A 3C5SB 3CFTA 4KERA 4OLEA 1EUUA 3DIDA 2OVLA 5FJPA 4LPCA 1QYGL 2WXQA 3SW6A 3RTQC 1TFPA 2X5PA 2O55A 4IGBC 2W0FA 4OCNC 3NXFA 2G2RB 2VDRL 5FA5A 2W27A 3SKMA 2VLME 4MSWA 2EG6A 1AJ2A 2ATPB 3BSMA 2DZAA 4X6FB 2QVHA 1GKQA 4YSAA 2ZYSA 3LQLA 5AWNH 3GPSA 3RYMA 4IOSA 4DWSC 4HKJA 4CVXA 1WV2A 8XIAA 4GSDL 4I0PC 3IXAA 3G08B 5HNNA 1TZ9A 3EJPA 3MRQB 3SY0A 4LUYA 3ROLB 3CPLA 4HUXA 1OF8A 3CU2A 3W7OA 2ISSA 3NFPB 2BSRB 3PB2A 5A16A 4V1DE 5IFTA 4L8SA 3GG1A 3JV6B 1J5TA 1SR9A 1UWGH 1UZ6E 1XGQB 1KN4H 4MZYA 3RRQA 3DG7A 5DO8A 2BHUA 1X7TA 4QTHB 1IC4L 3CHCA 4TQHA 5JLZA 5JPMA 2CIKB 1G1YA 5KBPA 4YTUA 1EDHA 1KFWA 2W88A 3OD3A 2OQJB 1NBYA 5DJ0A 2FUQA 3PHAA 5CKSA 1D5ZB 2K3TA 1ZP3A 3U2SA 2VKZG 3MLRL 3PBWA 3MV7D 4JDEA 4ZX3A 4LKXB 1LT7A 5EPDA 5AG9A 3IFOB 1E4LA 3PJWA 4U7KA 2VABB 2B4CC 4AIXA 2Z0BA 3COTA 4DZAA 4D1JA 1F07A 4JTEA 2UY3A 1RQHA 5DQ9A 3I6RA 4PSPA 2PYFA 4DWSB 1TV4A 4APQB 3THAA 3IT8D 4QXGL 8XIMA 2VW7A 3JWNH 4K3JH 1PG7L 4E0RA 4F0LA 4P2AA 1U3JA 4UIKH 4L6OA 2WQWA 1JCXA 3JSSA 4PMEA 2ZSVA 2ODOA 5A2AA 2IG2L 4M7JL 3PWLB 4JTFA 3QXAA 3QEUB 2PDNA 4XO3A 2OWWA 5FGBA 3OXSA 2RAGA 1W1B1 4ONOA 4OTKA 1CLYL 3AG4B 4PS8A 1RD6A 4QRQB 1LLOA 4K6AA 5C8JB 3LCYA 4GG6F 1VIWA 3GMQB 5EO9A 2HXTA 3ZLHA 2GC4C 2CK0H 2BSBA 3GM8A 1JJUA 4YHIA 1HKMA 1EJUC 1ME9A 1CVSC 3AQXA 3PE9A 4JRYD 2OR7A 1JK8B 5IB5B 1W1TA 1M7IA 2V2TB 3VFSA 1NJ9A 4XAWH 1A6ZB 1XISA 1ZKAA 3VB8A 1HHJA 5HHXH 1DE4B 3SKUD 1QBML 3LV5A 2F2HA 2HLFD 3QJOA 5E2JA 4Z7WE 3IB4A 3HS8A 2Q86A 1OTUD 4GGHA 4Q4SA 4XGZA 3FHEA 3CPGA 2VN5A 1C29A 3ZTNL 1PE1A 3QHMA 5TE6H 3SGDI 2VMEA 4Z3EA 5I66A 1WTLA 4Z76A 5DMJB 4PJ5A 5EU9A 2XQBH 2C9RA 3NDOA 3FFCE 2JB6A 5KYUA 3HE6B 3ZT7A 4MQXD 2DWYA 4UQIM 5DF0A 4POYA 1EC8A 3S35X 3VSQA 3TAKA 3P73A 3MO1B 5D30A 1ZV5A 2R0KL 4PQXA 3NZUA 2F2KA 3STGA 2MFNA 2ATKB 4JTJA 3KXFD 4C58B 3FUKA 3IFPA 4DKEH 4HJGA 2Z00A 2WKOF 2CA4A 2GBVA 1LMIA 1IT9H 4U4BA 3LV3B 4RAUA 1E9IA 2PF0A 2VEIA 2VR7A 1J0YA 2EDDA 5AB2A 3C5SA 3MUXA 1D2PA 4XP9H 1JRBA 2ALRA 4JQIL 1XV8A 5TQ0H 3T44A 5C0FB 5I17B 2QDGA 4V15A 4E41E 4J3OG 1ZVNA 3OO2A 1EPFA 3KOZA 4PBEA 4UMBA 3BQUD 3LRLA 3HS0C 1MRCH 3M0IA 1I1AD 1PJWA 5AECA 3NIYA 2YYTA 5D6CA 1HH6A 4W84A 1R0MA 2XOTA 1U3HA 2ATPA 4L4PA 2DZBA 1G0DA 4FF7A 3LKRB 4XHJC 4BHUA 5F72S 3WNIA 3V16A 3CSFA 4Q9QH 2O6CA 4YXLH 2WV8A 1B57A 3U6RA 1XW8A 2HT4D 2IWKA 4XOAA 3JUGA 5B1KA 4K7FB 2XH4A 3ATDA 2V5TA 1CS6A 3BKML 3MRQA 5C8BB 3ROLA 1ES0B 3GXIA 3MHFA 2G5RA 2XN2A 3BV7A 1JZGA 3C2YA 3VXSD 1FE8H 2CIIA 4PJIF 3PZIA 5HGGS 5EBLB 3BE7A 3UO1H 2X41A 5EU6B 3ZR6A 3SPCA 1I82A 3M0XA 3WK1A 3OMNB 2X70B 5KYNA 2W91A 1FAKT 3KW3A 4X0KB 3B9NA 3N2CA 3BN9D 1UURA 4IGNA 2OQJA 2NY3C 3D2UD 3MSYA 1XLKA 2WWKO 1UGKA 3FUMA 2XQ0A 1JMZA 1QO2A 1AHWA 5CGYC 1BA9A 3HI6L 1PUDA 2VABA 2D8KA 4LQFH 2CW6A 3IJQA 4ZNEE 1QNRA 3WEMA 3WF4A 2VR3A 3QUKB 5BO1L 1OEZW 3H9HB 3QZMA 5D71L 3MFGB 4OGZA 3VU2A 4QHKI 1DTNA 4Z08A 3LGDA 3PTQA 4NQUA 4LEFA 3CL6A 1UR0A 4Z2GA 4AWTA 4L23A 1GTFA 1VGKB 4PJHF 4U3HA 4QYOA 2QSQA 2Q3AA 3WS6C 3SCPA 4HSCX 5T9CE 2JCCF 1TJGL 3M1OA 1MCPL 3UG3A 3X11B 3NQEA 1PX4A 1P7BA 3A9BA 1ZGLB 1CD1B 3IRPX 4RRPA 5EBMA 2VDQH 1TELA 3OQRA 4ZGYA 1LMKA 4LVNC 3Q43A 2BRRL 3AHTA 1NMBH 3EX3A 4ZB0A 2YCEA 3HGRA 1US0A 2J6EH 4K5OA 3U7AA 4GAGL 3IARA 3EUUA 2WP3O 1R17A 5I24A 3KH4A 5A8QA 1YE4A 2C13A 3K2IA 1RK1B 3P4NB 4OT1H 4X0NA 1JGVL 3IU4L 5T1DL 2BHYA 2FWOB 4L4VB 3OVPA 1FWDC 3QBTB 4M5YH 5C8JA 1VH7A 1H4PA 4A55A 2Z2UA 2B7QA 4OZHF 1A0QH 3GMQA 4G8GA 4X6CE 1WFNA 4TSBH 5HJ3A 3X12A 3GKWL 2AAVA 2AJXH 3W7RA 4U1MA 3BVXA 3GSNH 1CCZA 2FB4L 4AMWA 3RJYA 1FVDA 2HCVA 2RDWA 2HBVA 2QCHA 1I3GL 3PAUA 3WJJC 5F7MC 3F7KA 5D2VA 5TJWK 1BVZA 1EWHA 5AW9B 1ZS8B 1GHFH 1CX9A 1IEQA 3U46B 5J13B 1H7PA 4DAIA 3TS8A 4HKBA 2Q3RA 1E5CA 4HUVA 4MKMA 2MEJB 1HHIA 3T77B 3RCNA 4LVNB 1NBQA 4RH4A 4OJAA 1AZUA 3HJZA 4L65A 2DEYX 1KXVC 2NY6B 4YVPA 3ET9F 4ERIA 1PLAA 3HE6A 2AXGB 3VGFA 2PCPA 4N42A 1DUYA 5BUGA 2WANA 4PJGE 3ZDXB 4J9JA 4MFHA 3VIKA 3W7GA 3MO1A 3KYMA 2BIOA 4NWUH 3UWEA 4HN4A 5HYJB 1ZHKB 2ATKA 3NJKA 3JUYA 1LG1A 3DRTA 4GRWE 3ASWA 3RIAK 3GZPA 1MFAH 1FWTA 5BV7C 4N90E 4Y4FD 2WYHA 1OCCB 3REVA 2E5CA 2AK1H 1P5UA 4LU5L 2GDQA 1BX2B 1IE7C 3CHSA 3W11D 3P0VH 4LLVB 3WSQH 1TQWA 1S7TA 4RNIA 3JBG7 4YDNA 3TJPA 2BOEX 4B4HA 1J8RA 2I7GA 4ISVB 1F6YA 3P3SA 1EAOA 4D6EA 4G7EB 4EXQA 3DROB 1E6JH 3BG9A 3N3TA 1T5XB 2D7QA 3ARFD 4LS0A 2ZYHA 4BYHA 3DFNA 4E8CA 4G5AA 3MOBH 5BCAA 1MXSA 1KJVB 3PQYE 4BSJA 5D37A 3Q48A 1BRLB 3FQRB 1Q6QA 3NJJA 3BSGA 1MNUH 4NUMA 5GVJA 3O6DA 5BMFH 3D9AH 1GOHA 1LUCA 4WWKA 3PFRA 4F8XA 1CK0H 1QHZA 3IDIB 4Z2JA 4ZZ9A 1FZMB 4FQJL 4NUJB 5BU6A 4G43B 4P4KC 4B2DD 2FCBA 5E2UH 1Z1WA 3GMMB 1B6DA 4UMGA 5EU6A 3RA7H 3HMXL 5F4SA 4DXVA 4CCZA 5JW4N 5DVLA 1TSRA 4KRPD 3SOBL 2FDBP 4P7LA 2Q0ZX 4JO5A 3FA3A 5HYEA 2G41A 4EOUA 1U8PB 1J9SA 4QFUA 3HN5A 4G6FB 1XIBA 1P4IL 4OV5A 4R4NC 2E6DA 2HBXA 1TWSA 4OVUA 1P7HL 4LH8A 1K72A 4FA6A 2XM2A 2E76C 3DK0A 1CDIA 1UD5A 3S8FB 1PZ1A 4ES8A 2B4GA 2W92A 3W57A 4W70A 3WJZA 4Z7VE 2VDMH 1VGKA 3QOKA 3D3VA 2IKJA 4PV9A 4V1DB 4S1SL 2ABBA 5D7SH 1F11B 5GS0D 1CD1A 5E8PA 2X7WA 4JHVA 3W24A 5L4JA 3E5BA 2IALB 4XXWC 3IJ9A 1SXZA 1V5XA 5G2HA 2AQSA 2VDLL 3R06B 3UZYA 1R0AH 4C1NA 3BZFB 3OHXC 4GIRA 1A4BA 4Y4KD 1C90A 3V4VB 1CFMA 1CU4H 1G9HA 5E95B 2YGVA 4PBGA 2EVJA 4IF2A 2GPZA 2QR6A 1IBGH 1QPRA 3N5AA 4CAGA 2VW6A 3T8QA 3P67A 1MWAB 1MYRA 4B9GA 4L4TA 4GUGA 4LB8A 3PGFH 1V6YA 3TLLA 4Y5VC 4CMHB 1SO5A 1MAML 4N28A 4OLYH 4PRBA 1I1CA 4RSYA 5JQ6H 2W1NA 1OARL 1KENH 1GGBL 1GHRA 1EDTA 1MRFL 1CE6B 1S7RB 1E4MM 5BOOA 3GNOA 1KIQB 5GNYA 4LUSA 4NBXB 3AHVA 5A8PA 2ICWI 2IH8A 4V11A 1GZPA 3V7MA 4QTGA 1A3WA 3VIFA 1CGVA 4YLBA 5EF1A 1DJWA 2GGIA 3GS6A 5D7KE 2Q1EA 5HI4C 4LF3B 3EUDA 2F5BL 4HXAL 3V5HA 3T05A 5TTRA 4ZFOB 4EN2A 3ECBB 3EH4B 1SW3A 3N1GC 3PR2A 4H0HB 3KDPB 3R89A 4L1WA 2E7LA 1ZHKA 4TQEL 3SIKA 4Y5VB 3F7VA 4LOFA 2DIJA 4BFIB 2VC5A 1NBCA 3T6VA 5IHRA 3BAXA 1MY5A 2WJDA 5ESAA 3NXLA 1DJSA 3S37X 4HG4J 4ENLA 1HIMH 4H0LC 1IBYA 4JDYA 2AAMA 1Z44A 3E2HC 4BELD 2AL2A 4TO8A 4JREC 3RWJB 1FG9C 4ANUA 5LWYH 1P5VB 4LNRB 2WHVA 4WCYH 5KSVB 1WC7A 3W0KA 5FF3A 1UD8A 3FFCB 2NNXA 5LXEA 3X1NA 3WH6A 1KJVA 3NG3A 1I1YB 5DS1A 4TU1A 2XZCH 4IIQA 4WFFE 4YHPA 9PCYA 3ZIZA 2F08A 4J1OA 3VSUA 3BPLC 3FT3B 3LEYL 4X9BA 4ASTA 4GZJA 4PRHA 3IDIA 5J1AB 4LALA 3CX5J 4QR6A 1YEGH 1GXEA 4H8UA 1AZCA 3S3SA 3UJRA 4D8ZA 3SM0A 4G43A 2V2DA 4N2MA 5BS0D 3DDGA 3UDWA 2J3SA 5A2FA 1ZVHA 3CUGA 1GWJA 1V05A 2B77A 3P3TA 1RZQA 1F4XL 1TJ1A 4DVRH 4CCCA 1G4TA 4QRBA 5D7LD 1U8HB 4P2QE 1BFOB 2J7FA 1Q65A 1GJWA 1N70A 4LLMB 2WMKA 4YSSA 2C91A 2PPAA 4E41B 2DJ4A 2ITEA 5HTSA 1I9RH 3WIHL 3N11A 1TR7A 3MN8A 1MJJA 1U8PA 3D47A 3HQ1A 1LQBC 3HIJA 1W2VA 3UYRL 4RFOH 5EZLB 3MUGA 1YLVA 1EFZA 2PI6A 2HVNA 1EIXA 1RKRA 2FB3A 3ELAT 4F4RA 1GW1A 3NA9H 2BP5M 5D96C 3MJ7A 5L6YH 4XO7A 3S5SA 1FWFC 3THDA 5KANG 2J55A 2VX4A 3AHXA 3SPHA 5IBXC 4KJQD 4W4QA 2CLIA 3N04A 4A1RA 4P9MH 2NV2A 5T26A 3OJVC 3OLDA 4LC8A 3R8QA 2LFGA 3QIUD 1HQTA 4OT7A 3PBVA 5H37G 4GQBA 5CJ5A 4JBSA 2MCG1 4G9FA 1ZE3C 1F11A 2BB0A 2IALA 4KEVA 4TX8A 3DK2A 3VMOA 3TA3D 2BNUB 5IMLB 1ZTXE 4NXKA 3OLGA 2QCDA 3DHMA 1I7TB 3IJLA 3U1QA 2MQCA 2EE6A 2A74B 4PLKD 2FEJA 5D2TA 3A24A 2AXHA 5AUMB 1RZJH 2L7UA 2NV9A 4ENEC 1XRTA 5BRZE 4CILA 5HGBA 2FJUB 4Z77A 1MWAA 2WB5A 3C6CA 4ZX6A 4U1IB 3HS9A 1N5AB 5T1KA 3DX3A 4P9HH 3B3IA 2OZ3A 5FEPA 1YNTB 1EX1A 2NY2B 3GHBL 2WTRB 2ICEC 3O6AA 4WFHD 3TU6A 3N41B 1R3HB 2FD6L 5JW4R 4N0YL 5EMKA 1N6VA 1PX8A 2X1WL 5H2BB 2OTDA 1E8YA 5B38G 2ZJSL 1XLLA 2XVGA 3O1NA 3CMJA 1R86A 3EYQD 3MROA 5LA2A 4X9HA 1PV8A 4LF3A 3G6JF 2E6AA 4PTVA 3HC3H 2VDKH 2APWA 2R82A 4UDTB 2XNAA 3SKJL 3W4RA 4KV5F 4M1CD 5C0EB 3WDIA 3JW7A 4NQVB 1VD6A 4S3BA 2IJ0C 4X6CB 5GZOC 1QBLH 1X8CA 3SIZA 2VLRE 1MRDH 4Q2ZB 2E59A 3OBAA 3JQOB 1V7ML 3RLGA 3STFA 2FLMA 4A8IA 4IIZA 4TV3A 1UD3A 3DIVA 4BFIA 2YFNA 1P48A 2HDJA 1JXGA 2W63A 2R6OA 2DPKA 4XVJL 1IGFL 1V08A 1U6AL 3FU3A 3KOFA 1RZGB 4GLEA 1Y6MR 3DNKA 3L68A 5EN2A 3MRNB 4OIBA 1ADQH 3B9KD 5ABFB 2ZUWA 5JW5B 1C12B 4GACA 3EOAB 5ICUA 4RDQF 4OIIH 1FIEA 1HYSC 1W0MA 1GTHA 1A3HA 3P1VA 3RHWF 4OFQA 2OCJA 4L1BA 4L9YA 4JO2L 3FYIB 2GIXA 2ZA2A 2Z35A 3QN3A 3ICJA 2RHGA 4A66A 5E8OB 4S1DC 4HAFA 1AIFB 1ZT1B 5CSZA 3VDCA 3WQ4A 1I1YA 1B4JH 2PWEA 3K71B 2IS7A 4RA3A 4MY9A 1DKWA 1RIVH 4X99B 4JFPB 5AW6B 3QHZL 3MUUA 4GRWB 3ZKXC 4OLUL 3VXTA 3E2SA 4EDXA 1LDCA 2FIRT 3WAJA 3LV6A 1O7DC 3IDXH 2Y7FA 4N2LA 1YDNA 5G1TA 4GBXD 1IXPA 4F48A 3UU0A 1X7SA 3N43F 3ALFA 5L0QB 2J1WA 4PMYA 2ACRA 2Y89A 3KHJA 2QF8A 2JKPA 4N2DA 3MX0B 4AK1A 2YUWA 1RI8A 1TF4A 4X5XB 3BUYA 4MADA 2R29H 2CBOA 2P5WD 2H7WA 2D73A 1LP9E 1YNLL 5K4ZA 3PQYB 4P2RA 3WL9A 3WK0A 2GY5A 5J1SC 4ZSTA 4N4QA 5CD3A 5T33H 4NO2B 4LPWA 3CBWA 4PN2A 1MRQA 3ELFA 1GVYA 3NZ1A 3K6NA 1S7VA 3NIDB 3DFQA 5LIYX 5IKCB 1W72H 4R7LA 3K91A 5G1MA 3TIDA 4ICNA 2BG5A 3FTGA 4KUCF 3DBXB 2E56A 4ZS6D 1GVSA 4K94H 5J04A 4O57A 2ZA3A 5B3JE 4BZYA 1KGJA 1ISVA 4LLWA 4FF5A 2PDLA 3UTZB 4JG0H 1ID5I 1FNSH 3T8XA 1YMHB 3GMPA 3GSOB 3O6YX 1E3ZA 3B3DA 2H6PB 1G6RH 4J8RB 5IMLA 1U8KA 4AEHL 4KCVA 3L5HA 2EPHA 2NTFA 4LMQE 4ONFH 4LOUC 2PMZA 2A74A 4KKNA 5JOEA 3NOYA 3NCFB 4I85A 1L7TL 1NANH 1W0VA 5AUMA 3WL1A 2EKSB 3VNJA 4TUUA 1DN0B 2WZ0A 4NN7C 3GNMH 4ZNEA 2OZ4A 2OQHA 2BIPA 2WSPA 2QQNH 4ZB2A 3HEIB 2JQZA 1OF0A 4ALAH 2XH2A 3G3MA 1K7XA 3MLSL 5DLCA 1I9EA 3LPOA 4Z7VB 5FK9A 4LIQH 2CLRA 4XZUB 1ICPA 1KZYA 2UVEA 4CD7A 3NQ6A 1V7YA 2OTPA 1U22A 3GTTA 5EMJA 4Z7UE 3MSRA 4AT6B 5DDHB 5I1DA 4FX8A 2NUTA 4ZMQA 3ZHNA 1QWHA 2QSVA 3GKFA 5I8OH 4DP8X 3AROA 4BCZA 4AXWB 2Q02A 3KYAA 5FHAH 2NSXA 4HX1A 2ZP8A 3WENA 2VSKB 1K6WA 3INPA 2UWFA 4FYSA 4K1WA 3RYSA 4KK6C 1L9OA 1GGTA 3RWDB 4JKLA 1KBPA 1XINA 4LSSH 4RCAA 4ZO6A 3UXAA 4GPNA 2VXSH 1FGVH 1ZHAA 1XDJA 4FNSA 2OYMA 1AOHA 3SGKA 4IS6B 4XVSL 4WQ6A 4WEBH 2CO6A 4KFPA 1M9SA 2EE0A 3P0YL 4NN7B 4JD4A 1DJIA 2BWGA 2Y25A 3UYPB 2DQEH 5CLWA 5K9QG 1P6BA 4M7KL 2NXYD 2IBBA 5IREA 5IT2H 1GOFA 1MNZA 4K71C 5IEKA 4X5PA 2AITA 4M5PA 2ZZ4A 4RMVA 3ERXA 2D20A 4X7TB 5JW5A 1C12A 3MBED 5ERWA 1KB9K 2F5AL 5HVFB 3US0A 2A6JB 2RGMA 5LB1A 3I9GH 4B5NA 5CPNA 4N3UA 1DSWA 4TXVB 4OZIE 3MU3A 3MLTB 1K7FA 1ZAGA 3VD9A 1A4JA 4O53A 5E8OA 2VD9A 5JPNC 2CO1A 1AIFA 4WV1B 1PZDA 5FFGA 4JM4H 3RLSA 5FR3A 4XNZC 3WSUA 2OBGA 3Q37A 3BRFA 2R23B 4PB9L 2VDIA 3AALA 3LD5A 4M61B 4TMPA 3HRZA 4AZ5A 4NUPA 2HSAA 1JGLH 5FI8A 1W3NA 2VC2B 3WG6A 2NR6D 5K7JA 1BSIA 5FO8B 1GGCL 4C6IA 3GJEB 3VG0H 5DD1H 1E7VA 4K71B 2XWTA 4JVWA 4MYAA 1GS8A 1HFUA 3PHOA 4JRXA 4BH8A 5FKPB 4MYPA 3IMRA 2YARA 4PTXA 3DESA 1U2HA 5DN1A 4HTBA 1NBZB 3QS3A 4MZ1A 4ECNA 3IPFA 3HLAB 4X5XA 1LD9B 4GGBA 4FR1A 3S37L 1ZLEA 4KU1A 5LXXA 1AQDA 3EH3B 4ZTEA 4N9CA 5I1AB 4DTGL 2VDRB 1XC4A 3ESMA 3PQYA 2N0KA 1HO4A 3D46A 1WKEA 1IBBA 4XBKA 4NO2A 1GS7A 3IDUA 1UM6L 5IP4A 4HU8A 5IKCA 2YSSB 5DURB 4HIBA 4XNZB 5FC9A 3GW3A 1BEYL 2WLMA 4KJPD 2ZOKA 3GTNA 4Q9RL 1ESWA 4HIXL 2VZOA 2I85A 3A6BL 4RGNE 4NPYB 3A6CH 1UWFA 5AEAA 1IBFA 1NEPA 2F7FA 4GQGA 2Y1ZA 3EG9B 3JVGA 4JG1L 3FSTA 4P2QB 4PUUA 4HEME 3M5VA 2GFBA 3DU0A 3GSOA 3G6DH 2JIXB 1N0XL 1VKFA 1N10A 4OECA 1POJA 2MWCA 1HE8A 2CR0A 3LH9A 5I5RA 3L9EA 3JT2A 5B1BB 1F4WL 3MNVA 5EH1A 3N73A 3PUCA 4FP8H 2EKSA 5TQ2L 3NPZB 1JZ2A 5I8KL 3AZSA 4ZTPL 1CDUA 4ZMLA 3LRGA 5GJSL 3MODH 3BVDB 4XBPB 4W9EC 1GG1A 3MCMA 2DFAA 2EDXA 3OBEA 1MREH 4XVEA 4ZW6A 1RIHL 5CD5D 2ZZ6A 1FNEA 4L6DA 1RLCL 1OC6A 1T1XB 1HE7A 2LU5A 1Q6GA 4AQAB 1E2VA 3C5ZB 3TT3H 1EGVA 3T2NH 3NQCA 4ZMVA 3M0MA 1MUJA 1Z9AA 3EHBD 4FFYA 1DWAM 3NJFA 2X1RA 4NERA 1PWLA 4AT6A 1ME7A 5DDHA 4CNNA 2PR4H 1EUNA 3MJ9H 4Y2DD 3OX8B 5BOEA 1EZWA 1TITA 4AXWA 5BXRA 4F33A 3BSZL 5CLZA 5CP7B 1AK5A 1MUCA 1JGEB 3D1MC 1E7UA 4HK7A 2UXFA 3ULUF 2ZXAA 2QJHA 2QIWA 1NL0H 2OV0A 5BRZB 1E0WA 2A3CA 1JI2A 2FBJL 4IS6A 1P0NA 1TYEB 5D9OA 1BGXL 1TTAA 3FOMB 1Z3GL 1VYSX 1LL1A 1JAEA 2FO4A 3UYPA 2PO6B 2GQHA 4Y16D 2ZKMX 3QEQD 3OVQA 1OLLA 3W2MA 1ZLVK 5IB2B 2V6HA 5JR1H 1NCBH 3PV6B 4JHAH 1KACB 2TRHA 3CN2A 2PDMA 6REQB 2Z31D 4LAQL 3L7RA 5FIPA 1YEFH 1QBAA 2FZDA 1WX0A 3W02A 4X7TA 4K0OA 4R83A 4O4VA 2BDNL 3EGJA 3IF1B 1YECH 3SDAA 1I85C 3BUTA 5IGXL 4JM2D 1HL2A 1DIEA 4NEHB 5FKYA 5KS9E 3VMPA 1W2PA 4F8TA 3O3RA 4MG4A 7REQA 1RMFH 5H37A 2FECI 1GGUA 4WV1A 4ABWA 3OG3A 2WQSA 3WJLA 3I7SA 4OFPA 1UM5L 3FF8A 1K77A 3HC0A 3IXTB 5CN3A 2VLRB 1JNNH 4RBPH 1E5JA 1U91A 5LBSA 4BQ4A 1YEHH 1T4KA 1XS2A 4YSDA 2CKNA 4JO8A 1I45A 2KI6A 5G4MA 3OMZA 3V5DB 1E1EA 3OHMB 3RZCB 4TNFA 2BIHA 3GLEA 3GBML 4OI7A 5CZJA 1EYWA 2IPFA 4N8VB 2UX6A 3MP3A 5I76A 2EE3A 3STCA 3OLEA 4F7EB 3W56A 2IOOA 4D0DA 5AWNL 5B4MD 4E68A 1US3A 5I6KA 4Q9BA 4GIYA 3WBWA 1ACZA 4EF9A 2D03L 4GS7C 5ACZB 1TJIH 4OUOA 3D85A 2O9RA 1JYXA 2EG7A 5ESQA 3S6CA 4JAWA 5KZCD 5DYOB 1J11A 2R8WA 1XSKA 4GJJA 5B38A 1UWGL 2K6ZA 3I2CH 4FXGB 1T99A 3V6ZA 5PCYA 4DAFA 4RGMC 4NZ5A 1T03H 1PU0A 3NQGA 2KS0A 1R5IA 3OR7A 4F8NA 5D7EA 2LABA 3SAZA 1G43A 1KW1A 1E4NA 1THCA 4JHOA 3WLIA 3M5YA 3QH3B 3KWUA 3FCSA 4R8WH 5EO1A 4NPYA 4B9ZA 2CLVB 1IFGA 3U7YH 1TETH 2WXOA 2EDTA 6FABH 4U1SA 4UYQA 2JIXA 1IQDB 5F1OB 5L2KD 3UJIH 1XCFA 1LO4H 3IJ6A 4YDLB 1LP9B 1DIKA 1B4RA 1PS3A 1VADB 4O50A 4YBLC 1WAEA 5KOMC 3PIQA 3MLXH 2RH9A 4PW4A 1KB3A 1MHCB 2XJKA 4HMDA 2XFWA 1D3GA 1D5RA 5F4WA 4ZAKC 3THCA 1OYAA 5F2GA 1Q7QA 4ORMA 3V4PA 4BKTC 1M03A 2AK4D 5I74C 4F9JA 1T1XA 4WNJA 4RGMB 3NO5A 1WT5A 5JBEA 4U31A 4KZCA 3FQNA 1XL9A 1CI5A 4HU4A 1PD1A 4D2NA 2NX9A 3CN0A 3C6SB 3MLWH 3VI2A 3RNQB 4TULL 5BOFA 4PRAB 4IIGA 2WK2A 1T89C 1GQNA 4HC1A 1U58A 2JTYA 1V5JA 1G0XA 2Z92A 5F7EL 2ZNXA 4EBQL 3FFDA 2CK0L 5LGZA 2WLLB 2RDUA 4QO1B 4ZFGL 2HUEA 1C9DA 1TE1A 1E3XA 2F1BA 2NZIA 3UWQA 1RPUA 2UY4A 5BRZA 3O6FB 1CD0A 3MZNA 2AGTA 5HHXL 4YBLB 3ATBA 4KH9A 1ONWA 4GUQA 2QGEA 3VPLA 4MMZC 4QJ1A 1UXWA 2PO6A 4AHQA 3MYZA 1PB0A 4N2KA 5TE6L 3IKCB 3W07A 1KB5H 3QVQA 4L1SA 2YEQA 1VHNA 3KLSA 1T0MA 1DORA 1HKKA 1CLOL 1ASPA 1UR2A 3AAZA 2R56H 5JOFB 3U7VA 1E55A 4DPQA 4Z7UB 2GK2A 1SVBA 3X14A 4L29B 3ZYJA 5DUBB 2CKBB 2HX9A 3FC8A 4DB7A 4KGJA 4BQBA 3C09B 2R0WH 2OJ1A 5TQLA 4H2AA 1G9NL 5EPMA 4XN7A 4MOZA 1QMUA 3W7QA 4FYTA 4G11A 4FX6M 1QLFB 2E09A 2ID5A 4DKEL 4YFDB 2ZNWA 2JF6A 2FIKA 3TC9A 1BD2D 2AVGA 1ASOA 4XO4A 1IT9L 4YL4A 5E00B 3G9VA 1W9BM 3KR3L 4F57H 2AJYL 5C2XA 5KYXB 4UUJB 3M7FB 4DHGA 3R19A 4QE5A 3RTQB 1PSKH 4FFVD 3RCYA 4IGBB 4XP9L 3N2BA 4MMZB 1JG9A 1KLZA 4XX1G 2H2PC 1GNXA 3I75A 1IHIA 3R0DA 3B2MA 1MRCL 3U4BH 5AAMA 1GCFA 1VR6A 2WMFA 1H11A 2F0CA 1EWDA 4QHRA 3PTDA 2QHRL 3G1YA 4DN1A 3LX9A 3TZNA 4KXCA 1JRHL 1OOAA 4I0PB 4U6YA 4I48A 3VI3F 3HJEA 4Q9QL 4MY1A 4YXLL 4CQBA 3BP7A 1KLUA 3V10A 5J6GA 4OZIB 2D0HA 3O9WD 1NANI 4CBPA 1HHHB 4U7MA 5ACZA 2CCRA 3IMBA 2VJ0A 2VR2A 3BT0A 4WKFA 4C6LA 1YY9C 1OFPA 1FE8L 2NX1A 2FFIA 5F6HJ 4JIEA 1EZVY 4EK7A 4QOKD 4TVCA 3ZOAA 2AKRB 2XIBA 3F01A 4MM1A 1AGEB 4AAJA 1RZFL 2YDRA 4JFZH 3HOJA 5HPOA 2PPGA 2CFFA 3C2EA 4LGRB 1LQ2A 2FEEI 1QUMA 4RGNC 3O3DA 1MEXH 1PAZA 3QH3A 1KIRB 3QY8A 2ICCA 2CLVA 4AIZA 4HSHA 1SVCP 4ONVA 4MWAD 3FGCA 4YLCA 1WITA 3UC0H 3S5OA 4PJ7F 3T8MA 5E6YA 1IQDA 5IJVB 2MRYA 4W9CC 2QT3A 3F7PC 4F9LA 1NGWA 4KI5C 2IQDA 3BIKB 1LP9A 2XUCA 5A2CA 4BEIA 4UT9L 4FB7A 3JV5A 1VADA 2ATSA 4NNYB 1W0WB 1NU5A 1VF5C 3VOIA 5I78A 1YX1A 1FHDA 1XR8B 4YPGA 3LNIA 1DBKH 1DLHA 1MI3A 2DYSB 3LRMA 2NQ3A 2A6DA 2P50A 1YJDH 3F2DA 1EOKA 1AOZA 1NMBL 2YBRA 1M2VA 3ALWA 1B5TA 4CU7A 2O6FA 4H26B 3U0TA 2XBTA 3W29A 3KUMA 4LOCA 4RGNB 1G6CA 1KGUA 3B3BA 4F8OA 5H91A 2MNRA 3FB5B 2RMNA 3U57A 3U7WH 5IHUL 4OT1L 1DDHB 3RNQA 2O9OA 4PRAA 4GAYA 2ZOLB 2ZOUA 4M5YL 5IQ9A 3OKNA 5GQBA 1KFEA 3HO8A 3QHTC 3KG5A 1AA1B 4CNTA 3WIFB 1FL3B 2WLLA 1LQSR 2AJXL 2OPCA 3WY1A 4QO1A 3L3HA 4BJHA 5AD0B 4AQ8A 1FNGB 2IMRA 5D1XD 3ONCA 1O0VA 4H9MA 4B5SA 2W81C 4XPFH 1Y6KR 2NY7H 1XD0A 3MV9D 3RX2A 4FX7A 4PJ8D 1OSEA 2G2RA 3PWJB 1GHFL 3GDKA 5DRIA 3FCTB 4X6FA 3IKCA 3N17A 4LLDB 1A66A 1G4EA 3S3PA 1K9EA 1EAJA 4DFIA 4JY5H 3TF4A 3D50A 4TS6A 4Z7QF 2WV3A 4KT2A 3TC3A 1TMHA 3G08A 1DE6A 2G96A 3M46A 4L29A 3P11H 5DUBA 5IROA 2A4CA 3D51A 1EUAA 2QDEA 3IIPA 5IQMA 3VI4F 3BJTA 3NFPA 2BSRA 1R3JB 3IPWA 1MW2A 4NWUL 4XAPA 4YSPA 3MBXH 4WK2B 4J23A 3JV6A 4TTDD 5DCDA 2AF2A 4GNJA 4FERA 4LAUA 1IQ8A 2BDQA 1XGQA 3WY2A 4BZ2H 1OSYA 5D1QC 4QTHA 1MFAL 1EBHA 1XGDA 1QA9B 2CIKA 5E00A 4Z7NE 1A8ZA 4UI2A 2P48B 2VISB 2GI0A 3F2LA 3CDFA 3EBAA 1X98A 4B3ZA 1D5ZA 4X8JB 1EBAA 3WSQL 5H94B 4OR1A 3HS0B 3GYEA 4DI9A 1XX1A 4LKXA 1EO7A 4IGBA 1QNQA 3IFOA 1GY1A 2YN5A 1UA6H 4Q74A 2OW6A 2LU3A 4LY8A 2OO6A 4Z5RB 4FJ6A 2DQJL 4ZL1A 4JQ3A 2WHLA 2MTAA 4U2ZA 1K8XA 4Q6KA 3MOBL 5IHZB 4G7YH 4DWSA 1L6SA 2EUXA 5EC2B 4APQA 4I0PA 4NYYA 4AY7A 3SDYH 2X9ZA 1EHLH 1FWSA 2DQWA 1W3TA 1MNUL 2RCSH 2GSHA 1LLWA 1H7RA 1E6QM 3WK2A 5KS9B 1CK0L 5M7QA 3GNRA 2PTZA 2E5DA 3CUZA 1IX2A 3G5WA 5JZ7C 3DHPA 1SJCA 1LK2B 2CLLA 4TVUA 3FVMA 3GD6A 3IVTA 1MCBA 3PWLA 5I3GA 2HS8A 3GHRA 4AGLA 1B3YA 3QEUA 2N56A 3RA7L 4G5ZL 3BLDA 1EEUA 1MHHB 1EP1A 2NY3B 2EO7A 5CU9A 4J4KA 2HTLD 4D9LH 1K4CB 2ERJC 4QRQA 3RG1C 4L3ED 5IV2B 4HIIB 5M2FX 2LW3A 4AVKA 4FQXD 4WCJA 1WFIA 4NWTH 1YVLA 4JJOA 4LP5A 1J2WA 2FVLA 2X0VA 1OFEA 3ETSA 3L81A 1JK8A 5IB5A 2V2TA 2H6OA 3AT8A 1A6ZA 1ZPLA 3IRCA 2WQRA 5BXSA 1DE4A 2PGEA 4LSTL 1G0CA 4JNYA 4M24A 3BIKA 2PKDA 3C8FA 2L7EA 2JE8A 2B7NA 3QORC 4FNQA 3NIGE 2LT9A 4MA7H 3F7LA 3Q4DA 1VFTA 4L48A 1LOSA 3G1FA 4F80A 2O9PA 3G9AB 4UANA 4YWIA 5D7SL 5GRXG 1GOQA 3BVTA 3ZT6A 5FPIA 3DFOA 1ANUA 4AZHA 4F91B 3W5NA 4PEEA 2ZOXA 2JI3A 5E70A 3BARA 2B7DT 2AQQA 2XXMB 3P30H 4WHTB 2DEXX 1R0AL 2ERJB 5EEXA 1QFPA 1X1NA 1UPMB 5GGVY 2K6YA 4XNXL 3WUWB 1CFNB 1CU4L 1TA3B 1D5BB 1DDHA 5EU7E 1ZVYA 4PJFE 2TSAA 2A83B 4K68A 3PGFL 4JKPH 4KRNA 4MQSB 3RCMA 1OK0A 2J1KA 5DMLA 3LV3A 1LXMA 1FH5H 4OLYL 1DDTA 1FL3A 4NZRL 1RVGA 4A6YH 3IAQA 5MHSD 1TZAA 2VR9A 4D3CH 2R9HC 5ITFB 1VEMA 3WQ8A 1K8ZA 5FJIA 2BSTB 4RXFA 1KENL 3RE0A 4GRSA 3W6YA 4R33A 3HFTA 2ENYA 3PF3A 3PU7A 3OG6B 4W9LC 5C0FA 5I17A 4WI0B 2X1XR 3U36B 4UFHA 2CQVA 1H60A 4AHPA 5GRVL 2W4XA 3PWJA 1W1ZA 1RSYA 3OKMB 1A7QL 1W1IE 4WGWB 2D2OA 2L8AA 5IB1B 5K4XA 1W16A 3FZUD 3FCTA 3LKRA 1RZKH 1QQDB 2OTUB 4MKSA 2UZXB 5CU5A 2C19A 5C0IB 2IXUA 4E5XB 1YXYA 1X1ZA 3BKJL 3LTSA 3ZRSA 4K7FA 4GKSB 1E70M 4BR1A 4PS3A 1ES0A 1XO8A 3DUHA 4LVHC 4BRJA 3KVQA 1NUGA 3QQ0A 5EBLA 1UCTA 3II1A 4JFTA 1NCAH 3MUZ1 5BV7B 3L0NA 1H5YA 5EIIB 3ARBD 2R1LA 1O7DE 3D7PA 1F5ZA 3EOSA 3O0FA 2X70A 3N19B 3R11A 1II4E 3B8UA 4X0KA 1O5XA 5CILL 2VISA 3E6EA 1JBJA 2ON3A 2PRHA 1GZHA 2XI9A 4PC8A 3IJDA 4G82A 3K5XA 5H94A 1UOWA 5DFVD 4NJGA 1J48A 5LWYL 2NUYA 1QO3B 1A65A 5J6SA 4M6OL 3HQPA 4WCYL 5HK4A 3KPMB 4UFJA 1LWJA 3QUKA 3QRGH 1PZ3A 2YJQA 5DVOA 3H9HA 4PJ6A 3EH1A 3DUUB 5IHZA 1TZ8A 3BK0A 3ORWA 3TQVA 2W79A 4NC0B 1GC1H 4AMXA 3BUBA 3CFUA 3ZXWA 4FS9A 3SGEH 4LVHB 3L0KA 3TNNB 3X11A 3IPBA 4FKHA 1ZGLA 2ZX9A 4P4KB 3TWCH 3KLDA 4QHUB 5MF5A 2KQMA 1PL3A 3PC0A 4LB4A 1ZHLB 1YEGL 3QS2A 3HVNA 1LK2A 1GONA 4GG9A 4AEIH 1WP6A 3RLUA 5G4WA 3VGBA 4XXCC 4UFLA 2OZTA 5AW4B 1RK1A 3IJ7A 4DVRL 3P4NA 1IKNC 1EIBA 4LASH 1ZT4B 1K4CA 2FWOA 4L4VA 1IBDA 3A6OA 1I9RL 4R4FH 3NEHA 2WPGA 4LB3A 2EJAA 3CN4A 1L3WA 2BVEA 4LYKA 4G42B 4RFOL 4XNUL 3ZSSA 4C83B 1SEQH 3ATEA 1LP6A 4PJ9D 4UFIA 2OYPA 4BM7A 2EDFA 3GU2A 3VXOB 5L6YL 3SBFA 4GCXA 1PQZB 1FYTE 4OKDA 5T3XD 4MSSA 5K93A 3WS6A 1YADA 1VGEL 3CK5A 3BDXA 3BFWA 3TK7A 1ZS8A 1MG3C 3U46A 4S1FA 3T77A 3F85A 4RW3A 4KC3B 1QWNA 3H8AA 1GAFH 3GDTA 2EAEA 4Q8TA 1JHTB 3R58A 3LUTA 1AXTH 3OHXB 1H3UA 1F8MA 2AXGA 1I0BA 5HD8C 4WHTA 2OXHB 1ME8A 2HRPH 3STPA 3QFEA 5HYJA 4Z2HA 1CFNA 4F58H 1TA3A 1G5AA 1D5BA 4BZ1A 3T8VA 2C3GA 3QI9C 4QS6A 1L0XA 3CO8A 1WHPA 4N2CA 4GI6A 3A4DA 2LR4A 3BEVB 5A8MA 1TE6A 4Z7WB 3HMWH 3SB3A 1N4XL 4M5ZL 3NOEA 1BX2A 3BJFA 4P9HL 4Y89A 4PWGA 3WJJA 4LLVA 4IRJC 4XBEH 1EL3A 2E9GA 2Y72A 4IHCA 1XUZA 4Y6GA 3NZGA 3SO3C 1T5KA 3JWOH 4ISVA 2GWGA 4WI0A 4MMWA 3S42A 4G7EA 3DROA 2XKUA 1T5XA 3CUFA 1KXVA 35C8L 3Q9PA 4QNPF 4MXVE 1JZ4A 1HL8A 1U5VA 2A5UA 1OE3A 1OAKL 3VB9A 5SWSD 3ZZSA 4UV7L 2Y3AA 1QQDA 2WHMA 1BRLA 2OTUA 1WZ1H 3FQRA 3UOAB 2OL3B 3R1GH 1CR9H 4HNCA 3CV5A 4K8RC 3HC3L 3XINA 1YUKB 5EMMA 4AZUA 2WZAA 5IBLD 3OTTA 1B0GB 4AUUA 5D70H 1G01A 2WBJD 3BN3B 1HHKB 1FZMA 4NUJA 2H8XA 4X6DE 5HQLA 2BY3A 1M6OB 2VDPL 3S35L 3PPEA 1MRDL 2DI9A 3T9PA 3GXPA 3GMMA 2DVTA 3ZWTA 1J93A 1DBAH 2Z2BA 3W2KA 3E2HB 4FKKA 3MQTA 4C7FA 4I13B 4JREB 1IM3B 2QGCA 5B1JC 1Z3NA 3LPGA 3QQNA 1MFDH 1HTYA 3Q65A 1ADQL 2CBPA 2PYED 3N0AA 2J66A 3DYMA 3VIHA 1DL7H 4PVLA 1TUPA 3EFFB 2G95A 2ZC1A 3IGLA 1SGJA 3R2GA 4MLIA 1M1BA 1IKOP 5E9NA 1RQBA 2AW2A 3T3PE 2E8YA 4EEEA 3U9PL 2M2DA 4IIDA 4WW1B 3NUKA 1DANT 1I9JH 1AYOA 3BPLB 1R3KB 4OGAD 1B4JL 1RHHB 4V1DA 3OU8A 3SJVE 2UZYB 1NEYA 1MW1A 2DORA 3KPPB 3NJXA 3VD5A 1RERA 4DCQB 5A7BA 2X2YA 4PTDA 3K2KA 3M0ZA 2CXEA 3DMMC 2H0PA 1N0LB 2QJGA 2WO2B 1S9YB 5AOUA 3QEGL 2JCWA 3HKFA 3B0UX 1BZ9B 3CEPA 4Z7NB 3R06A 4EKXA 4KVCH 4UTLA 1YUHB 3BZFA 2OK0H 2OCFD 1E27B 4DF9A 5ID1B 3ECVA 3BISA 3M0JA 3V4VA 3DARA 3C2AL 3P2DA 2ZWSA 1KCVH 2IH9A 1GKPA 5LA0A 3B0YA 5D96B 1U30A 4YVXA 5HHMD 1T6VN 4YTTA 1XP3A 5EU5B 3INUH 1TMLA 3QZ6A 1YO4A 5LNRA 1N55A 3T0CA 1YC8A 3VXOA 2JGQA 5T33L 3SD5A 1CE6A 1S7RA 5D04C 3TIMA 2V37A 4QIUA 3M86A 4HCLA 1KIQA 2VE6B 2YPLD 3MLPA 1W72L 3EXSA 5E5CA 3V0IA 1IZCA 3P69A 5FCZA 2HK0A 3MRPB 4CN6A 5D5MF 4XXWA 2PUZA 1XWVA 4H0IA 4R3SB 2QCNA 4KROC 1CDBA 4RDBA 4JG0L 4ZFQA 1RZIB 1XLMA 3OHXA 3CDZB 1WPCA 1FNSL 2X1PA 4IP5A 1J18A 4ZFOA 3ECBA 1G6RL 1BXAA 2Y2YA 3DXAE 3WTUA 3WY3A 5I79A 4O02B 4K7PY 5EU7C 3LPFA 2WMHA 4MB4A 5EGRA 5JHDE 4OTXL