4YTQA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy d-tagatose
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 118
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4ytqA00
2I57A 5AVNA 3UA4A 3BZGA 3P6LA 2XISA 4W4QA 4ZBCA 1A0DA 3KTCA 1A0EA 3AAMA 3CQKA 4HGXA 3XISA 4DUOA 4GQBA 1DE5A 2GUBA 3QC0A 3IUHA 4E3VA 3KBVA 4HNOA 1XIEA 3KCOA 4X60A 4EAYA 3M0XA 4XSMA 1DIDA 1XLCA 1XIJA 4US6A 3BZJA 1XLJA 4HHLA 4XISA 4YTQA 2GYIA 5AVHA 3M0MA 3N4AA 2G0WA 3UXIA 3ITVA 9XIMA 1XINA 5EMKA 3UA3A 8XIMA 4QEEA 3DBNA 2GVEA 3M0HA 1O1HA 3L23A 3BDKA 1QTWA 1XIHA 3QYSA 3KBJA 4PFHA 5XINA 4PGLA 1A0CA 1YX1A 4J4KA 4HHMA 3M0VA 3LMZA 1S5MA 3VNLA 6XIAA 3IUIA 3KCJA 4A8NA 1XYCA 1DXIA 3ITYA 1XP3A 5EMLA 2HK1A 2QULA 2ZVRA 2HK0A 4QDWA 2QUNA 1XLAA 4GJIA 4OVXA 3UVAA 4X63A 4YTTA 1QUMA 3CWHA 4XIAA 3M0LA 4A8IA 3VYLA 1BXCA 5J8LA 3KCLA 1XLEA 1XLHA 3BANA 3NGFA 1XLGA 2NQHA 4XIMA 3UU0A 1XIFA 9XIAA 5XIMA 1I6NA 1QT1A 1MNZA 3AALA 2X7WA 3AYVA 3CQIA 4G56A 4QEHA 1XLLA 1XIIA 2Q02A 5EMJA 5B7ZA 3TVAA 3ITXA 4QDPA 3CQHA 1XIBA 4LNCA 3BWWA 1XLFA 3XIMA 5H1WA 3M0YA 1CLKA 3C0QA 4YTSA 3KBWA 2XINA 3VNIA 1XYLA 1XLDA 3ITLA 5FA5A 3CNYA 1XIGA 5B80A 1GW9A 2NQJA 4X61A 3VNJA 4YTUA 1XLKA 4K3ZA 3ITTA 3FVMA 5I7GA 3KBNA 3GNXA 1XICA 1XYAA 2I56A 4KW2A 4ZB0A 3KWSA 3AYTA 2J6VA 3ITOA 4QE1A 3U3HA 4XKMA 3VNMA 4QE5A 3TC3A 2QUMA 5H6HA 3P14A 3CQJA 2HCVA 2X7VA 1XLBA 1XISA 1OADA 3U0HA 1XYBA 3KBMA 3QXBA 5TNVA 5B7YA 5XIAA 3JU2A 2ZDSA 4GJJA 1XIDA 2XIMA 4A8RA 1XLIA 3WQOA 3IUDA 2QW5A 5EMMA 2NQ9A 1DIEA 8XIAA 1DE6A 3C0SA 1XIMA 1MUWA 4ZB5A 4Q7IA 4YTRA 3C0LA 6XIMA 4K1GA 1XLMA 4QE4A 1I60A 7XIMA 1D8WA 1BXBA 3QZAA 3VNKA 1XYMA 3DX5A 2GLKA 4EACA 4ZB2A 4GLEA 4DVOA 1S5NA 1K77A 3KBSA 3XINA 1TZ9A 2G4JA 4XSLA 4A8LA 5C9ZA 3OBEA 2OU4A
chains in the Genus database with same CATH superfamily
3R6IA 2G4FA 2X0HA 4NNCA 2G8ZA 4DUOA 1DE5A 4JY9A 3T7VA 2NUWA 3RM8A 4GHRA 4J40A 4EX4A 1DWGM 1EZWA 4QQ3A 2G0WA 1J6PA 3TWBA 3K4AA 2VWTA 1A49A 3O05A 4AEFA 1FWBC 3BO9A 1U83A 3A4XA 8CGTA 2GUYA 2JGQA 3FIGA 3WIJA 3I10A 5A6LA 1EA9C 3GX9A 1TTQA 1EIBA 3LHTA 1OFAA 4D8ZA 3BCJA 1OHLA 4DUXA 4BI7A 1VBJA 1PIGA 3CU2A 2Q8ZA 3G0SA 4BCEA 2J66A 1OIMA 3LPPA 1GORA 4FIQA 2EPHA 3HQNA 2A85A 4WKAA 3A23A 3CQJA 4GUFA 2QJGA 1TB3A 4S3FA 3U0HA 3EOUA 2OZ8A 4AVOA 3ARTA 4Y9MA 3WX7A 3N12A 5I23A 2QIWA 1BVZA 3IJIA 1ISZA 4P8WA 1KKRA 2GOKA 4AD1A 2DUXA 5L6UA 1DWAM 1O7AA 1HNYA 4CCEA 1MW3A 3DKJA 3A12A 1CLXA 4C7GA 3O06A 1QW7A 1WV2A 3P6LA 3E02A 4DJFD 1E1EA 4R7WA 1ISXA 2PMQA 4P7QA 3F5KA 1XFCA 4KWOA 5DN1A 4HHLA 3H26A 3QMRA 1AQ0A 3U4AA 1E51A 3MU7A 4PEKA 4C1NB 2QS8A 1J0IA 4IQEA 3ZJ7A 3UCDA 3S42A 3WNOA 3UYIA 1FX6A 3TCSA 3LLFA 3GAKA 1DXFA 2VZVA 3NPXA 1TWIA 3T8LA 3PTDA 4ERIA 3NQBA 4P5UA 4QCFA 4U3CA 1LM1A 4JX5A 4JTQA 3LQGA 1ZBKA 3EDEA 2QLYA 3W23A 3LHVA 4V33A 3HQOA 5T9BG 1UWAA 1I4NA 1MSSA 2BVYA 4IH3A 3VFCA 4QE5A 3UXKA 2Z29A 5AHMA 4PEEA 4P61A 2OELA 4REQA 1PTGA 1YNQA 4IZGA 4TVUA 2ZWZA 3FNDA 1DIEA 3RXZA 4IICA 1WP6A 2WLZA 5C9WA 3ZT7A 4HBKA 4URIA 4ALDA 3GFXA 3QKZA 3TH6A 1TZ9A 3EB2A 2UV8G 4ACZA 3OTRA 1POKA 1W8GA 2O7QA 5JBDA 2RJGA 1IEWA 4FLRA 5IBXA 3LZ3A 2IQDA 1XV8A 3VDBA 2QCNA 3TXVA 4EPDC 3AYRA 4JFVA 1C92A 5HMFA 4RZ4A 3TUUA 4ZO6A 3HTWA 1W3IA 3L9CA 3TN3A 1TIWA 2WMIA 3E0IA 1ME8A 1GYNA 3W2LA 1SFLA 2DT2A 5EMYA 1V7YA 3VOIA 1D7KA 5TQLA 1TCDA 2ODOA 1G94A 4GUHA 3ITTA 3ES7A 4Q8TA 1JIBA 4OV9A 1O5XA 1AQHA 3L68A 4LPCA 3NO5A 3SQMA 3AHVA 4XB3A 5G2HA 3OGSA 3H53A 3R89A 4OBSA 1MW0A 3P60A 4EP8C 2HJPA 5D30A 4BJHA 2CWXA 2PDKA 4QJ1A 2J7CA 4FA3A 1B57A 3W1UA 3UGVA 3VOCA 2WCGA 2OQLA 4CNUA 3HPSA 3MHGA 4ZOAA 3LPFA 4L5ZA 2PAJA 2DVTA 4AY7A 2PEVA 3U5YA 1S5TA 1TREA 2QVNA 4Z1BA 3L4WA 3L67A 1WNOA 1KFLA 3GIYA 1KXQA 1O5KA 3WKZA 3UJRA 1VHNA 1Z7AA 1XPGA 1JCNA 2CNCA 4PCSA 4AZCB 3H4XA 2YCEA 3CTTA 1VZWA 2OJPA 2ZE0A 2XVLA 5ECVA 3GR7A 3WF1A 1KM0A 4CEUC 3FEQA 3FHAA 4ZQNA 4FLOA 1XDMA 1JCTA 4QJ3B 5BXRA 5DRCA 2NQJA 1ADDA 5KITA 3NM1A 1Q63A 4FAMA 3FK4A 4NYUA 4B5VA 3VD3A 1CTNA 3KP0A 2GJPA 4M1BA 3EOOA 3WBAA 5A6JA 1VJSA 3I4KA 4DNHA 1WB0A 2QCDB 3GW3A 5CC6A 2OFJA 4H7ZA 4ZZ9A 4LSBA 1SYTA 5K9DA 1Y5WA 5CPTA 4KIEA 1L6SA 2VI0A 3FJLA 3OJGA 4QSHA 2NX3A 1ZP3A 4JHZA 3C2VA 4CKQA 2VC5A 5M17A 4ATLA 3MTWA 3FVDA 2ZUNA 4DY1A 2YGYA 1XHGA 1QWGA 4BA0A 1A5AA 2AAAA 4YPJA 5I3GA 4BS0A 1PIIA 3GC4A 1JDAA 4UR8A 5AHEA 1SR0A 1XINA 4BK9A 5TBOA 1DV7A 4GH3A 2GVEA 4JTLA 3UG5A 1TVNA 1GOWA 4PBFA 1UD3A 3V3WA 5FEWA 2XWEA 4R33A 6TIMA 1ZUAX 2PWEA 3FYOA 3VZXA 1L2QA 1J6OA 1QHPA 1UR8A 5HXMA 3NL5A 2FHFA 4M6VA 1K9DA 4IIFA 3TOYA 3CZ8A 2DZPA 3ZZ1A 2WMHA 4LB3A 4UZSA 3ANYA 5F4SA 3BAKA 3D47A 3MB9A 1V3IA 1P0BA 1X38A 3EEZA 4N9BA 2CKRA 3UZYA 2YDSA 4DF1A 4WZHA 3W6YA 3HB9A 1UB3A 3R8RA 4JGDA 1YDYA 3VCNA 2ZXDA 4E0CA 1T6MA 3S2NA 3UZXA 1DHPA 2E28A 3B0VC 1FTXA 4MB3A 3W4RA 2DW7A 3BGGA 2WNNA 3NJ3A 2EG7A 2PWUA 3OYZA 3EX2A 1OBAA 4Q4OA 4EXBA 3SFWA 1U1HA 1OGGA 1JDFA 2J9XA 2AL2B 2Z1XA 1UZ4A 1TWSA 2ZVIA 4DJDA 3FYPA 2C79A 1WBJA 2DY3A 1UYQA 4PE8A 2EAWA 3OHIA 3FSUA 4JYDA 2FH6A 1NP2A 3KTCA 1HL2A 5TF0A 1QI5A 4RNHA 1FCQA 3TTOA 4DWSB 1GVOA 4I8DA 1K9TA 4XSMA 4IIDA 3R10A 1YTKA 5CSSA 5ABHA 4JIHA 2EEXA 4L7ZA 1NM9A 4PCTA 1D3HA 2PC4A 1L0PA 3S1VA 2VZTA 1UWSA 3Q45A 3AXKA 3UBPC 2QR6A 3MA8A 3W88A 1DWIM 1KRBC 2H9AA 2V9DA 1QI3A 4Y9AA 3WENA 5CLTA 3NSXA 3AYVA 1LUCB 2FDMA 2RFGA 4MJ4A 2HVOA 3SAZA 1O5QA 1QPQA 1JG9A 4AYSA 3WD2A 1V93A 3PZVA 1DJWA 3HU7A 4RE4A 2BOEX 1NELA 3URQA 1RAKA 1OG6A 2RAGA 1IEVA 4HZ8A 5GJMA 3SUUA 2C15A 2G3IA 2QHAA 2J27A 4FI4A 4QJ4B 1XISA 3H2OA 1KTCA 2J7EA 3ZQ9A 3AIUA 4LTSA 1E6ZA 1DE6A 2FH8A 3S1XA 1LG2A 1V3MA 2Z2UA 3N4FA 2YIHA 4AC1X 4G2DA 4LUJA 1SZRA 3C86A 4FLSA 2WNQA 4KCUA 1N8IA 2BHYA 2D69A 2XISA 5DBUA 3NPWA 4S3DA 2CZDA 1FA2A 3EWWA 4GABA 2O92A 2B0MA 1KFEA 1MRAA 5G1TA 5HWJA 4ADUA 1V02E 5EMKA 4FOUA 2F61A 2DZSA 2C0AA 3ARUA 1LTDA 3VIIA 1B4EA 4AMAA 2AMXA 1XUUA 1D7FA 1EKOA 2DQXA 3U2CA 4KCTA 3MI3A 3QF0A 3VKDA 2YCJA 3RF9A 9XIAA 4V27A 3DFSA 4AAJA 3W1XA 1YXYA 4LYQA 4GYPA 3HBLA 3WK1A 5D9NA 3RU8X 3QGVA 1ONEA 3QGAC 1SZGA 1UQYA 1EXPA 4WOZA 4WHBA 4Q32A 4YTUA 3UZZA 1V6TA 4HZ6A 2BB0A 1RHCA 2NUYA 3SN4A 1ZNNA 3C2YA 1US3A 1CXFA 1GQLA 1E5JA 4UQBA 2PGRA 3LUTA 3W29A 3AZRA 4WXZA 1TMQA 4ZOBA 3ARZA 3B8DA 3LBCA 3EEGA 3W24A 1Y0EA 1YTEA 1W9UA 1TSIA 1XH2A 5HDRA 2FFCA 2G96A 2IMRA 2RDXA 3S1UA 1JD7A 3HFYA 3MSDA 3DX5A 2GUUA 1HP5A 3S2CA 3IANA 1TV8A 3UXDA 4S3KA 1TVPA 2OX1A 3STEA 4W4QA 2Q6ZA 1FKWA 2GVYA 3N18A 2CWNA 3P3BA 4YCPA 4A21A 1VBUA 2ZWYA 1MEIA 5A1AA 1PVNA 3N4AA 4JTHA 4ZQMA 5LIYX 3ITVA 4MPKA 3W87A 4GRSA 4CNPA 3M0HA 1XBYA 4O1BA 3R11A 3H4WA 4NAFB 1C7SA 1GCYA 1H61A 1JJKA 1E4MM 4HSHA 4KEVA 1QUMA 5GNYA 1BRLB 3DHUA 1VBRA 1V77A 4HCLA 3CUXA 2ALDA 3BLPX 4DJFA 3PWIA 5BYWA 2FGBA 1HJSA 2DSZA 3NQDA 1XIIA 1WZAA 2OGYA 5E0FA 3MP3A 2I14A 1CW2A 3UWVA 2C71A 3B97A 3VKBA 1R86A 3S2MA 3V35A 1FWAC 1NDWA 2CBJA 3ERPA 3CV1A 4GZIA 3HPAA 2I56A 4FXJA 4AF0B 1UZHA 4H9ZA 3NPVA 4CQDA 4LY8A 3M43A 3CZJA 3L12A 3QV9A 1XL9A 5HUOA 1UR0A 4ZA0A 1TJ2A 2D3NA 4ADSA 4E8DA 4TX8A 3CC1A 2NT0A 5D05A 2PP0A 3IVUA 1ZBCA 3EKLA 3FSTA 4GPNA 1QDSA 4B2DA 3EX4A 3T0BA 3OG3A 4Q8WA 4H2CA 5CEWA 3W1MA 1DPMA 2ASHA 2E4TA 4HNVA 2YXOA 1R9XA 2VNCA 4Z1CA 1W1PA 4HCDA 2D22A 2V82A 1KCXA 2C6QA 4A3RA 1EOKA 2WC3A 4HNUA 1B4KA 4L6HA 2DSKA 2HNEA 5G4HC 3TYZA 3I65A 3VNDA 3M0VA 1IWBA 3UF9A 3CXOA 4XBSA 1PX8A 4CUCA 1FY6A 4KWVA 3MI6A 1H5VA 3PC0A 4O16A 2QEZA 4Z2JA 2Y5EA 5C5YA 1YRRA 3QTGA 3NGFA 3WQEA 1PEZA 1LLOA 5CZ0A 4LC6A 1TELA 2GL5A 3CPUA 2E9BA 3GDLA 4NP7A 3WUBA 4WJ8A 3W6MA 3SSZA 2GGEA 5D9OA 4K38A 5DXYA 3LXCA 4HA0A 4LC8A 4K6AA 2DH3A 3N6JA 4HP5A 4JTUA 3UESA 4IQLA 2DZXA 3E3HA 1H3GA 2ZDRA 3TFXA 3CM4A 4GZ7A 3T40A 4POCA 2I17A 4GACA 4IL0A 5HK4A 4UTJA 5AZ1A 4XZWA 4NG3A 4HT3A 3WLMA 2FMOA 4GLEA 1RP8A 2OU4A 4EPKA 1AZ1A 1B54A 3UR7A 1U5VA 2WK2A 4AIEA 4HOZA 1ISYA 5A8MA 1CXHA 1VH7A 3BJFA 3GAYA 4Q7NA 5HATA 1XYZA 2JEPA 5DELA 1LORA 3BAJA 1TR9A 1TPC1 5C9RA 3GVRA 4GYFA 3ZLHA 3AMCA 1JL8A 3A22A 1SZNA 3UFYA 1SW3A 4LCQA 3K8MA 1PTDA 1MFUA 3Q37A 3G24A 3B8WA 4X63A 2EBNA 4JFUA 1NAL1 2W4XA 2QCGA 1XKJA 5I02A 2GVLA 3ZSTA 1UP3A 2PZ0A 4GINA 4JTRA 5D9MA 1IIHA 3G1RA 4OECA 3ITXA 3W7NA 4UNKA 5I3IA 3BWWA 4UOZA 4JOMA 4QFUA 3FX4A 1PKLA 4QM1A 1TJPA 2ZX5A 3DEQA 4LYKA 1FWSA 2IS7A 3MJMA 3LRKA 4MOZA 4PBGA 7TIMA 4U2ZA 1FWGC 1GGOA 4CD7A 2W3ZA 2V3DA 2VUYA 1SMDA 2WJFA 3DYOA 5LZLA 4JIEA 2C1HA 2YPIA 4DB7A 3I6RA 1ZAIA 3B05A 5EBAA 4ML4A 4K1GA 5E09A 4YWIA 4HNLA 3UWUA 1SPQA 4RDYA 3AO0A 2ONEA 3KDOA 1IEIA 4AXKA 3TK7A 3BLEA 3NEVA 1UQZA 3SBFA 5JIWA 4GG9A 2PDGA 3ZIZA 3CIVA 2P76A 3ME3A 1H2JA 1XRFA 4QAIA 4E4FA 5CBIA 3PUGA 1I1WA 2WJEA 4OUIA 3WJWA 5JXQA 3HPZA 4L65A 1UHVA 1OD8A 4E3TA 1B90A 1QASA 3ZR6A 2Y24A 4GVGA 4WR3A 2ICSA 3ZO9A 4N9CA 4AUBA 5HMSA 1E1CB 2YL5A 1MZHA 4NZ1A 1M7OA 3L2IA 4GBUA 4Q3MA 3ABZA 3OIXA 1XLFA 3EDKA 2DFAA 3YPIA 2XH0A 2PF0A 1U5JA 1JFHA 1M7PA 3NYDA 3VNJA 2ZXAA 4P8XA 3SCNA 4M19A 4DLMA 2O9TA 3WQVA 4IMAA 3MV11 1SO4A 2G50A 5A8GA 1OF8A 4BI5A 3T55A 2WVTA 2BFGA 1KFCA 3OEXA 1C9WA 2E6YA 3CEUA 3OLIA 3AIVA 3B03A 4LALA 3FN9A 4F79A 2ZUVA 4AX7A 2B7NA 3M7SA 1EGMA 4I5RA 1OZQA 2PUZA 4C6JA 3H2CA 5BRBA 3W86A 2QAPA 2AMGA 2GWNA 3KX6A 1A0EA 1RPXA 4JTKA 2O4MA 3CUFA 3VTRA 4AQLA 4GQBA 2TMDA 2V2DA 2VX7A 3TMLA 3KBVA 3NVDA 4O53A 5D33A 4GUIA 4MNKA 1XM3A 1AMKA 2VX6A 3MUIA 3N13A 3SEPA 3S1WA 1LLZA 2XFRA 4ML9A 3V7PA 1FWJC 2NQZA 1KFKA 4YXGA 2VR2A 3NZQA 3PTQA 1DXIA 1EUAA 2IKJA 5HMEA 2VDIA 3RLUA 1KV8A 2V3FA 5GJNA 4KETA 1VRDA 4G56A 1WAWA 3LCHA 4R7OA 1LQ2A 2FPTA 3W7OA 1REQA 3UPMA 4CNOA 4W8LA 3AU2A 2OGJA 4U5KA 4UQAA 4HNTA 1K9EA 2DZTA 2C1GA 2I5GA 2NQ5A 2A3CA 5JBFA 1XICA 2PDQA 1EYEA 1M01A 4NZJA 1HT6A 4NL1A 3DUGA 2ZIDA 2GJXB 3CWNA 3W7RA 2PZNA 2OPJA 3CHVA 3DFPA 3WK0A 2CXEA 3GB6A 3KXQA 1AH0A 2BLEA 2NQLA 1GPFA 1EDTA 3IEBA 4KRZA 4HHPA 3QPEA 1U1UA 2NQ9A 4CQBA 4JQ4A 2A3HA 4HIBA 2YW3A 4JN7A 3RIKA 3GUWA 1RY0A 4NYYA 1DORA 1QW9A 4DJEC 4DBUA 2Y0FA 2GPTA 1YBQA 3BSMA 4Q22A 2H6RA 1V0NA 4E2OA 1RQBA 3W7LA 3TNOA 1UC5A 3KOZA 4Q4QA 2GDVA 5CAHA 5CCZA 1OCJA 4AHQA 2OWXA 5I3HA 4NI8A 4HYWA 3OLEA 4LUTA 6ENLA 3W02A 4LWWA 3NM3A 1RK6A 3T4WA 4U10A 2D24A 2OVLA 4JYFA 3KRBA 1DYSA 4HN4A 3EWBX 1BYAA 1S1RA 1ZJIA 4B5WA 1M03A 4CCCA 3QW3A 4ZOEA 3MP5A 1S39A 4C1KA 4KEMA 2BASA 1A5LC 2DU2A 4M56A 1C7TA 3HO8A 2VDHA 2YOCA 3H4GA 1IZCA 1MWOA 3RM4A 5AYBA 3IAPA 3KL0A 1W9VA 1UZ1A 1LJYA 1W3JA 1ZRQA 4L64A 5B80A 4N2YA 1V3KA 3BG3A 2E8YA 4EE9A 3NIYA 5C7VA 5E9AA 4GY7A 3KOFA 1O68A 2VMFA 3KE0A 2BDQA 4M6QA 4ACZB 4P7OA 3KW3A 2V5KA 1XLIA 4IG2A 4F0RA 3LTSA 2YCLA 4LNYA 3V1HA 4TX6A 1GZGA 3CZLA 1X6UA 3ZR4A 5DF0A 3SRKA 1EOMA 5EPDA 3PJXA 1TMHA 3T9PA 4MY9A 1IV8A 5DCDA 3TSMA 2WMIB 1ZGDA 2O56A 3AOFA 5LYRA 1R38A 4KWUA 1GVIA 1DWJM 2SFPA 5FF3A 4BF5A 2PDNA 2VC6A 4XZBA 2OSYA 5IXEA 3BDKA 4IWWA 4C6DA 2FKPA 3D5HA 1ECQA 1CDGA 3GVGA 2CESA 4P7LA 4H1ZA 4NAEA 4PUUA 2HK1A 4I3GA 3GBEA 4IFKA 5IHSA 2JF6A 1JUBA 1F6PA 3V16A 1UASA 4QQUA 2YW4A 4TO8A 2VOTA 5I3KA 5HJLA 4CQ8A 3S2JA 8RUCA 5LXEA 4WUIA 1H49A 2UY3A 2Q3RA 4LAMA 3HFTA 4R9OA 1LBLA 3VZYA 2ISWA 4PCPA 4A3YA 5CC7A 4Z2KA 3EA3A 1J10A 4MADA 3PPCA 4Y7EA 1UD8A 3STFA 3QRHA 2R94A 4INFA 3AS1A 2WW5A 3MVTA 3TLQA 1U22A 1EP2A 3NQAA 2A79A 2OZ0A 2VD9A 3RJXA 4GIYA 1PE1A 4KWWA 4JX6A 2FPYA 1EEXA 4KEZA 2ZOXA 3HJZA 3P0WA 3S6TA 4I7VA 3W2KA 1IZKA 3B0XA 2IPFA 6XIMA 3N6HA 2PDJA 3NOEA 3FKKA 1GWJA 3DFHA 3PPFA 3MSRA 1V6WA 2O4QA 3WH6A 1BTMA 1EDGA 1GZJA 3D0CA 4JTTA 2QDEA 2J7DA 4D6HA 3UWWA 3W7MA 2FZBA 1EUNA 2AQVA 3WNMA 3IUHA 2X05A 3VIGA 1C9DA 4FXSA 3MKKA 4Y9OA 1TV3A 2B31A 3NQ6A 4I6VA 2YX0A 1TRIA 1S3HA 4AVNA 1SFTA 1FCUA 3EX1A 1QTWA 1MEHA 2J7FA 1H7PA 3L4ZA 1EJ7L 3PTKA 4MLRA 2WVVA 4UFKA 2VENA 1DEDA 3WDRA 1W17A 4L4PA 3SJ3A 3W82A 4KEUA 1KB3A 1UMYA 3PNZA 1XLHA 1RCOB 2FTPA 2DUZA 3PANA 3WD0A 3PAOA 3KLLA 1B3OA 2ISSA 4PTMA 4OTKA 1IE7C 3HMJG 1FHUA 1SFSA 3OG2A 4QDMA 4HOXA 1EQPA 2A21A 3CYJA 2ZE3A 2JEQA 1ADSA 4PMNA 5DCBA 2FYMA 1C8YA 4H6EA 2QJHA 1WDPA 3SCRA 3OB8A 4RNFA 4GXPA 3ZWTA 4BWLA 1UD5A 2XVKA 4V1YA 1QW8A 2POTA 2IPGA 1CECA 3VIMA 2C19A 1PSCA 4MY8A 5JU6A 5EMMA 7ODCA 3GHRA 3VVGA 4MB1A 3QV8A 4CQCA 3IK4A 3XINA 4CEXC 3TAOA 1NFPA 3GTHA 5DMNA 3WDJA 5LA0A 1NWRA 1UKSA 4NILA 4ATDA 3KRSA 1B0IA 1W3HA 1ZU8A 1G7VA 3TYCA 2OLHA 4TX9A 2QXWA 5AECA 4PUKA 1C8XA 4AMCA 3U2EA 3CASA 4IISA 2OZ3A 4QRNA 3O6AA 1E0UA 3O07A 1Y7VA 3LHUA 4ZO9A 2GSEA 4N6FA 3EMCA 5DT5A 4US5A 3C2RA 2Y7DA 4IMDA 1L6GA 3QSTA 3I7QA 5BOOA 3BSHA 2OWCA 5FL0A 3WLPA 1KR1A 1ZL1A 1X39A 5DBTA 3CIWA 3HG2A 3XIMA 1D3CA 5H1WA 1THFD 2WHLA 3C2OA 3GXIA 1R6WA 3VXGA 3ITLA 4Y9NA 4NJIA 1O95A 4GX8A 9RUBA 1PL9A 3USBA 3CAVA 2VVNA 4S3BA 3BQ6A 3AYTA 3E5PA 2PTWA 3GG1A 4U33A 3M0IA 2HCVA 4JNZA 5FACA 3Q2DA 3TROA 2ISDA 3LI0A 1VS1A 4ZL1A 2DEPA 3E2SA 4JQ3A 4FF7A 4GVFA 3TP4A 1HO4A 2OQHA 4XG1A 1KD0A 4HPHA 1E0XA 5BWAA 2VC7A 4RX0A 3M0KA 1QOPA 3WBWA 2C3ZA 3SO7A 4IX2A 3GTXA 1KW1A 2XH7A 1B3XA 3DXIA 2VRQA 5A8NA 3WFLA 2I57A 3OVRA 4C6OA 4AWEA 2CZEA 1M7JA 5FEXA 1W3NA 3UERA 4KQNA 4M29A 3T78A 3U48A 2H9AB 3V5OA 3UY8A 3DBNA 3VIPA 1A3XA 3AHZA 1UD6A 3WJSA 3W00A 1DJGA 1LDCA 2WSRA 4MAVA 4F2BA 3LQLA 2EJ1A 3LM7A 4NY2A 2O55A 1Q5MA 1V0MA 3AMLA 1RH9A 5C7HA 5FKYA 2D1ZA 4ZODA 3LX9A 4RPQA 4HVXA 4I9JA 1MNZA 4OT7A 1XXXA 1XX1A 4L4LA 1HGYA 3EGJA 2HTMA 3BG9A 2BODX 5A8QA 2IW0A 2Y61A 2PLKA 3UWZA 5KSWA 4P7NA 1E40A 1EBHA 2J47A 3U7BA 3HGSA 3PSVA 3TYBA 2XIJA 3B8UA 1QRQA 2O9PA 2A3LA 5I06A 1TPWA 4Z2LA 4XZLX 4HK7A 1FH9A 1RQHA 1X1ZA 3GBDA 1JPIA 3IACA 5D2VA 4DEFA 1JF5A 1H62A 1Z6KA 2Q3OA 3UXLA 1W9BM 4HU4A 4UBPC 1GJUA 1Z32X 1S5NA 1EO7A 1CXLA 1UIOA 4LYRA 4C6MA 3TYDA 3QHOA 1ZS2A 2C16A 3OZMA 5GNZA 2X41A 3WL0A 3EMQA 4GGBA 3CV2A 3QMSA 4BR1A 4YTQA 5AVHA 5DX7A 1M5WA 2DV0A 1N82A 3H2AA 1SZEA 2V2HA 5HINA 2JBMA 2PTZA 4PRTA 4LU0A 4NZ3A 4F40A 4JTDA 1KTBA 3RX2A 3AWOA 2I16A 1X1NA 3LB0A 3SUSA 3MYPA 2VZUA 4W5ZA 2VEKA 1G0CA 2J7BA 3ZSSA 4MDOA 5BROA 1NQKA 3RLHA 3GTFA 3PZ9A 4OBTA 3VUPA 4NT0A 4LRSA 3BAYA 4LV9A 3VMNA 4BF7A 3B8SA 1C29A 2F6XA 4AZIA 1TPVA 1VR6A 3UVIA 1S2WA 1J96A 2Q8LA 1R46A 4D6IA 4PCNA 3VMPA 3WJXA 3BJSA 4S2BA 1BSLA 3CBWA 3P82A 3GU1A 2WHKA 2CXGA 3E0FA 1FWEC 2OG9A 4UTWA 1BEUA 4LCRA 2Z27A 3QFWA 4FR6A 2RH9A 1QO5A 4TOQA 4LAUA 4PUDA 4CQ9A 2ATSA 1JZ5A 1XS2A 4KFNA 3L7RA 1KWKA 2QUUA 4J7RA 1G7UA 1OVDA 3O7UA 5I78A 1ZBWA 1XIJA 2WHJA 4J3VA 3L0NA 3UA3A 2G37A 1RJQA 1DJZA 2OO6A 3PFRA 3ABQA 4J3ZA 1S1PA 2FJKA 3ONCA 4B5XA 2VYOA 3PPHA 5AHNA 3S5ZA 1R9YA 2DPEA 1IWAA 1W3LA 5M3WA 3H6OA 3EDDA 5IFPA 1I6NA 2ANUA 1VJIA 4PMDA 1NVMA 1W91A 4LV4A 4P7RA 1BF6A 3AUOA 3M16A 2GK1B 1IYXA 1X8FA 2X1TA 3AICA 4MG4A 2Y5SA 1CX9A 3ATZA 3IJ7A 4Z2HA 1H7WA 3PVFA 1U1JA 4HNNA 1B2YA 3BSGA 2J74A 2FZ8A 3CT7A 4MWAC 2EPMX 3P67A 4GFSA 4U28A 3NO3A 3BK0A 1UBSA 4JQ1A 5LA1A 4DYKA 4FNUA 5FCZA 1EDQA 3UJEA 4JQAA 1F9CA 1EYWA 5A2CA 4E4PA 3CJPA 1Y5VA 3BGAA 4JTJA 3GY1A 2VGBA 4IL2A 1VCGA 3H8AA 1P43A 1SFJA 3QLDA 2YYTA 3OA3A 1Q13A 3GM8A 2D3LA 5D8WA 3PNUA 3VOFA 1UIPA 3QMTA 5T8GA 4S3CA 3C56A 1LWJA 3HPFA 1SW0A 3IGUA 3T0AA 3RYSA 2A3AA 3NL6A 4ZSUA 1RP9A 1LOLA 1QJWA 2QIIA 5TAOA 3W1LA 2E77A 2O7SA 1RZMA 3VM7A 1XD0A 1FDJA 2VFGA 2ZRYA 1OK4A 4QEHA 2HV5A 1LZOA 1BPLB 3ARYA 2NX9A 2WMGA 2PCQA 1W5OA 3SECA 1PDZA 2OEJA 4FLQA 4Q6JA 4XKYA 3SY8A 1V0KA 1K70A 5LNRA 3T0DA 3FAXA 1ISVA 2QMJA 5LXXA 1FWRA 1H09A 5LA2A 3TJIA 1SMAA 1TUFA 4DZAA 2B4GA 1OFRA 3IIZA 4HU0A 4NQ1A 3WNKA 2XM2A 3EA1A 2XN2A 6REQA 1XIMA 3BLFA 4S39A 4YYFA 1WZKA 5DCEA 2YA2A 3N2BA 1GYMA 5KEZA 3UR5A 4XUGA 3W0KA 2ZA1A 3V5FA 1VFFA 2WV8A 2O9RA 4NHVA 1W9PA 1E4NA 3W38A 2UY5A 2CBUA 2DT0A 4QLJA 1S2CA 2YZ5A 4CVUA 1WXJA 4YS1A 3VKJA 3AYSA 3EKZA 5I07A 1EP1A 5D03A 3CWHA 3R7MA 5FJJA 1AW5A 1UOKA 4Y6GA 3HGRA 1OFBA 1WZLA 1EFZA 1BXNA 2YFOA 4ADTA 1PXGA 1SU5A 2ZUSA 2YBVA 3VA8A 2W66A 4G1NA 3VNIA 1Q6GA 3MI2A 2XIBA 4NRSA 4PMZA 2ZX7A 3KLKA 2EXOA 2DVXA 3KBNA 1JYNA 1QBAA 2PD5A 1BKHA 4WCJA 2OKTA 1QHZA 3GNNA 5IFTA 3SCTA 4J35A 4J2PA 4GIEA 2NV1A 2A2IA 3UWYA 4L1XA 3T2PA 1O94A 2Q8XA 3ARPA 3CZGA 4RCXA 4JR5A 3GVQA 5CLWA 1OFOA 4GC3A 1BQGA 4Q7IA 3HJEA 1XRVA 1PCKA 2OR2A 1YE4A 1I60A 3R8GA 3APTA 4KMQA 1VAHA 4BY3A 4B91A 5D4YA 4PMOA 3Q65A 3M0ZA 3NEHA 5G4EA 3GH7A 2P3EA 2G3NA 2XYLA 3QVQA 1HJVA 4H9MA 2WSKA 5EBUA 4QP0A 5CZTA 2DQWA 5AOUA 3UJ2A 4B90A 3SCWA 4KRUA 2B7OA 2YZRA 1TCMA 4D6JA 3R12A 4OHQA 1TTJA 2E5BA 2B81A 2ZICA 2CC0A 3I3DA 1NIUA 4G7EA 5HNTA 4ICCX 1VRXA 2A6NA 2INZA 4WGHA 5AC6A 4B3ZA 3M6DA 1OX5A 4PN2A 3OOQA 4PSPA 4WKHA 4PTVA 5A94A 1GG0A 5I09A 1ODZA 1KM1A 3THAA 3K8KA 2INEA 2HROA 2ATMA 2Z2BA 1QOQA 3SJNA 3RU6A 4IQJA 2C7FA 3P5YA 4RXFA 1Q6CA 2FZMA 3MDUA 3G6LA 1WKDA 3KVLA 3S6DA 4CU6A 1WDQA 1OSEA 4TV5A 4C5YA 2JKPA 3AZSA 4HOWA 4ATWA 6TAAA 5AYIA 1Q4WA 1T96A 1UMLA 1UBPC 4F0MA 1F3XA 4O1AA 5TIMA 1AFSA 2E6DA 1MVYA 3U9IA 3I7SA 1R3TA 1PX3A 3F4DA 2E6FA 4Q8MA 2V69A 1GVRA 4O10A 4ZENA 1PBGA 4WSKA 1J0KA 1A5SA 3VDAA 2WB5A 2A7PA 1RQEA 3OVQA 5E70A 4MKSA 3EDJA 4P8UA 5GNXA 2GYIA 3M0MA 3BLOA 1JZ6A 2UWFA 2I5QA 1RD5A 1REQB 4K7VA 4IFRA 3H7UA 2Z24A 3AXMA 1S38A 4UR7A 1IHIA 2V3EA 3B8TA 2GJNA 1SJDA 1NDZA 2YKKA 2CZ5A 3CB3A 5BU9A 3ARRA 4WEVX 5I2UA 2NQHA 3CUZA 3FJ4A 1UROA 1F6KA 1R9ZA 2XUCA 1CEOA 2VCCA 4J3XA 3FDKA 3RPTA 2OZTA 1U33A 4GQ0A 4LUSB 3G0XA 2VC9A 1W1A1 3C3NA 3CWOX 1SO3A 4W85A 4IGSA 3A4WA 4BEQA 1WUEA 3GHSA 4QE1A 2XG9A 3FW6A 1KM5A 3TIMA 3SADA 2VEMA 4W93A 1E70M 3NDZA 1GOKA 1KFBA 1XYBA 2VQUA 2DDXA 1OFEA 3B9NA 2ZQ0A 4N7QA 5CGQA 6ALDA 2NX1A 2WPBA 4QX4A 4C60A 2G3MA 1TE1A 2YDRA 1Q66A 1JCLA 1FP9A 4C7DA 2NWRA 3MCMA 3GKAA 3N9RA 4MWAA 3TYEA 3BJTA 1UH3A 4LUTB 2PSNA 3SCUA 3RPMA 1GKQA 2PFHA 2Y70A 3JRKA 4ROQA 3GO2A 3OZYA 4GJ1A 3WNNA 2NT1A 1K9FA 3VAVA 1CLVA 3ES8A 5I24A 4B9ZA 4LT9A 4RNJA 2WPGA 3DCPA 4LF1A 1JDDA 1LL7A 1EC8A 2VFHA 4XUYA 1TA3A 2GGGA 1E4LA 1AA1B 4Q4PA 3LI1A 3RCYA 2PWVA 1R3QA 3F7JA 1TV4A 4R3UA 3MKCA 3LSBA 2Z1KA 3TZFA 2YYUA 1DQUA 3EYPA 2PGEA 1HKKA 2ABBA 4PA8A 3H22A 3HIJA 3TEVA 1SQ7A 4HTYA 3OVGA 3VD4A 1B9ZA 3K4WA 1OT2A 3WQFA 2ZZ7A 3PZMA 4LUYA 3SN1A 4KIRA 4IHCA 2PTYA 5F4XA 3URBA 1E6SM 1RCXB 4H7CA 4LRTA 3V0UA 4JIPA 1GEQA 1NP0A 2BWGA 2QDDA 4B3KA 2OX4A 3CQ0A 1ZALA 2NXIA 1GZ1A 2A3BA 3WLTA 4PB5A 2WKLA 1CCWB 1VFLA 4GISA 2QV5A 4XZMX 2FJUB 1I2OA 3M64A 4J2MA 3RUBL 4AHPA 4MF4A 4IPIA 2BVDA 1RALA 4HCHA 4ZCWA 1JGMA 3MSYA 3CHEA 4UOQA 4ZQPA 1UWRA 2Y1HA 3UXIA 4U31A 3SCVA 3CHDA 4ROPA 2CITA 1XGZA 1XI3A 2JK2A 2P1FA 1QOXA 4QGCA 2ZRWA 2VGFA 3AS0A 3HG4A 3UCCA 1QMLA 4V1XA 1E56A 4Z0JA 4WDUA 3USZA 3TSBA 3KWXA 3CV7A 1AODA 2XTKA 2Q71A 1K8YA 3K2GA 4J3SA 1ME9A 2YL8A 3PBUA 5JIPA 3MMUA 2JF7A 1T7LA 3O6YX 3L5MA 2VHLA 2L5HA 3C0QA 3VIJA 2WNWA 1FWDC 4A05A 1G4TA 1K7XA 4DPQA 2FZDA 3KZPA 3IIPA 2HXUA 3VCCA 4V15A 3I3EA 5IBXC 4JHMA 1CWYA 4YU1A 3BL3A 1NJJA 2Y8KA 4UTLA 7ENLA 3LBMA 4UMAA 1MW1A 1TRDA 4Y8FA 3TJLA 2VELA 4KGLA 4OE7A 2CLKA 3BG5A 1BG4A 4E2VA 3I7RA 4Z2IA 2FB2A 3CT2A 1OC6A 1JZ2A 2PP1A 3UT0A 3NSMA 2VFDA 4ZGYA 3R0KA 1CGVA 3GZAA 1SJAA 1RA0A 1L8PA 4X60A 4F66A 1VENA 4XD4A 4X0VA 3AHTA 4R88A 2WLYA 2P3ZA 1J18A 4HA4A 3DG6A 3E74A 5CC5A 5IOBA 3LM3A 1EJSC 2XJ7A 5JMUA 4DWSD 3U8GA 3VABA 2XVNA 4GCXA 3PR2A 3PJUA 2F2HA 1EZ2A 2Z1BA 1YXCA 3BCDA 4XO6A 5FAGA 3STCA 4MB5A 1V3JA 3QQ0A 3BANA 4FX6M 5LGZA 2R82A 1YPIA 3DN5A 4KFOA 3G8EA 4U3AA 3GNRA 3TVAA 1Z8AA 1T8XA 5AHFA 3L2MA 3TTYA 4GQRA 4TU1A 7PTDA 4CNNA 4NU7A 3TMQA 3EPNA 4O57A 1QATA 3O8AA 3UCQA 3MP4A 4UTTA 3HQ1A 3HOJA 4G5DA 1J01A 1X97A 1KKOA 4DF0A 3RN6A 2E1WA 4JX4A 4MSSA 1ZAJA 4GKLA 2DT1A 3JU2A 3CAQA 3N25A 2C1IA 4NZ4A 4JQ2A 3CPRA 3DI1A 3GNPA 3LHYA 1DJQA 3GIQA 3MANA 4Q7BA 1RUSA 1EB3A 1HUVA 3E0LA 1P0KA 3ECQA 5J5RA 3ARXA 4JTEA 3OP2A 1ALDA 3AAMA 3BMXA 3BUVA 2GUBA 3NQEA 4ZXLA 3GC5A 4FSAA 3T2OA 1BG9A 2P88A 1UA3A 3LLXA 1H1ZA 4JTIA 2Y88A 2WBGA 2TAAA 2X1UA 4KESA 2CLHA 4MMWA 4PMYA 4CNSA 3KOWA 1WDWA 2HVMA 4OVXA 4Y90A 2X0SA 1FXPA 1T0OA 3M0LA 3WH9A 1JPHA 3LTYA 3DYPA 2X7WA 4QNWA 4F4RA 4YCOA 1XJBA 4QDPA 4YTSA 2BY1A 1GOQA 1XYLA 2X30A 4K37A 3SURA 3GNOA 5CJNA 1UR1A 3LBOA 1DVJA 1HXJA 3GKFA 4XAFA 3KS6A 1QNSA 5HR6A 4IQDA 4UR9A 2BXVA 4PULA 2ZDSA 3TLLA 5BXPA 3PZQA 3PTMA 2BV9A 4DZIA 3GUGA 2UZ9A 3VI2A 4O0KA 1MEWA 3A3HA 2PDBA 4UB9A 4DBEA 3WQ5A 4JFWA 2R6OA 1W3TA 2A7RA 2GLKA 4O4WA 1L6FA 4TUFA 4DAIA 1H41A 3OHMB 4AYGA 1BD0A 2D0FA 4AC7C 2QJIA 3W7DA 1OG0A 1QI4A 3OZPA 2E67A 5FF0A 3G5EA 1WDDA 5HR7A 3CLMA 4DXVA 4EOUA 3AXHA 1TO3A 1RLDA 3W27A 4HPJA 3N34A 1XYCA 1W5QA 4WX2A 3QOKA 4EF8A 1HKVA 5G2WA 2G41A 1F4HA 4UTHA 1G69A 3G1HA 5HMDA 3QSRA 2GZXA 1RSCA 2Q02A 3GVVA 2DGAA 1FFRA 3ANVA 1QI0A 4AIBA 3NQ8A 5FEZA 3P2VA 3SY1A 5K7JA 4DJDC 3W22A 1C90A 2BG5A 4UNIA 1KBJA 3CUIA 4FALA 1NF0A 4OZOA 4ZE5A 1RJRA 3PBYA 5U7SA 1K7FA 4OV4A 1TYGA 1R2RA 2VX4A 2W9MA 3GS6A 2EQDA 4UFIA 3IPWA 1V03A 3DYMA 1R3VA 1KGWA 4J9JA 1FWHC 1GQNA 4KCWA 3QZAA 3LS9A 3MUCA 2V68A 1VFOA 1PO9A 1ZCCA 3G2GA 4F3HA 3VFLA 3OPSA 2C14A 4JICA 5AC7A 3UA4A 3PUOA 2OTDA 4XAZA 3WLOA 4HA3A 1OEPA 4LS1A 4ORIA 4IFOA 1Q7ZA 2P0IA 2D2JA 1NQ6A 2VJXA 1LOQA 2AL1A 3MMDA 4IUGA 1R2SA 4H83A 3PZUA 4PC8A 3G22A 2EG6A 1V3HA 5CPMA 4MB4A 4LS2A 3TNBA 3GRIA 5HOSA 3WBEA 4X9SA 3W74A 3G18A 5IDIA 1X7IA 1A80A 1UA7A 3WBXA 1JI2A 4ES4A 3L5AA 3UU0A 5BXTA 4NZCA 2XFYA 4M82A 2BGSA 1Q2SA 3NPUA 4OWGA 1SUXA 3PY2A 1A4LA 3ICJA 2LLEA 3JUGA 3T05A 3REQA 4D9PA 3TW7A 1WKEA 1R30A 4LVDA 4R7JA 2NXGA 3W71A 1YHTA 3V1PA 3KWSA 4XZ9A 2PRHA 4JDBA 1XSKA 3DKLA 4Q8NA 3P7YA 2QCEA 4EXAA 4AVFA 1GQJA 1LF1A 3W2UA 1N8FA 2YXXA 5EGRA 4KPLA 1UWTA 1GK8A 4C91A 2J79A 3MO4A 1XQLA 3CHFA 2ZADA 3S83A 4L9XA 2VT0A 1OYAA 3N17A 1J4EA 5U4NA 3KEHA 3S1GA 3CB8A 3GSMA 1TPDA 1EF3A 4LOCA 4W7WA 2E5DA 5IM51 4GYPC 3NURA 5JH2A 3OQEA 4O13A 1AZ2A 3ZT6A 1GHSA 4KS0A 4H6RA 1SR9A 4LEQA 2NV9A 1XFBA 2BHUA 1A47A 5KZEA 4AG0A 4FNSA 3R0DA 3OBAA 2I7GA 1G67A 3LMZA 1P6CA 4JCLA 3NZRA 2QCLA 4GIAA 1F05A 1K4HA 1FWFC 5LKYA 4RDVA 4AZHA 1LBMA 1WA3A 1OQFA 3KCLA 2HVNA 1WAUA 1XGDA 3RILA 1QO2A 3B8IA 4UFHA 3TW6A 1W1ZA 1HZYA 4NJJA 1HIZA 4GFIA 3LCXA 4XK2A 3C61A 3Q94A 1PKMA 3H23A 1KCKA 1S5WA 3VILA 3W7GA 4MWAE 3MVIA 3DC0A 1K8XA 3GQYA 4FF5A 2OODA 4ZEPA 3ZVIA 2POZA 2X2YA 4AZCA 2Z0IA 3THQA 2PRLA 4HPNA 2YDAA 1G01A 3DZ1A 1YKWA 3NQFA 3N11A 2OEMA 1J0JA 2GDQA 2G3JA 4DJFC 3OBEA 5FIPA 5AYXA 3UD6A 1PZ3A 1S46A 3PBVA 2W61A 1E9YB 3PB0A 2TYSA 3H55A 5AZ0A 4AY1A 1G4EA 3VINA 4CN1A 5F2IA 1XCFA 3GW0A 3O2LA 1NWTA 3DBPA 1KBIA 2J25A 3WNPA 4RDZA 1UKPA 3KHDA 1YX1A 4LYPA 1UWUA 4L6OA 4H01A 2QCDA 3CH9A 3BOLA 3QV7A 3LCIA 1WCGA 3EWCA 1Z89A 1ITCA 4GE8A 3A13A 1HKWA 3ZJKA 4WSJA 1H63A 1SO6A 2J77A 2RKXA 2VQTA 3MZ2A 4Z0SA 2CPUA 1I0DA 1C91A 4H9VA 3QH2A 1VYSX 1WDRA 1XLDA 4AZ6A 2CLEA 2VD8A 3CO8A 4B5TA 1PUDA 1EJTC 4IPPA 3BAXA 3P8IA 2ADAA 2YL6A 4IOTA 2VEFA 1LRNA 5HWNA 1Z48A 4DLFA 3WQ4A 3WG6A 1YMYA 2NZLA 1CPUA 2G5WA 4RV3A 1YADA 2WOQA 2BY0A 5HQLA 3EOLA 3OQ8A 3L4YA 3TR9A 2Y7GA 2IPJA 2ZZ3A 3ZLFA 2VXNA 1ZAHA 3N9KA 3WLQA 4FXFA 3URAA 3FA5A 4UFMA 4XBJA 3N2XA 3HN3A 3FKRA 2PDUA 3CK5A 3RCNA 3B4UA 4QS5A 4ERGA 2F8QA 3WEZA 1VYPX 2PDXA 2NV2A 3AMGA 2Y7FA 3TC6A 2VR4A 4GOAA 4D2JA 3IS4A 3QOMA 3VX0A 3ZR5A 4W89A 2O9OA 3J7HA 4XAGA 2QNEA 2IXVA 1VIWA 3GVWA 1KFJA 4QROA 4EKJA 4N42A 4LANA 1WKYA 2CLFA 4Z08A 1Y65A 1GVYA 4YMZA 1TG7A 2AL2A 5HANA 4M80A 4M81A 1FXQA 2X42A 2VTFA 5FF2A 4EANA 2PS2A 4H8UA 4OIFA 4RZ5A 4BQ2A 4PTWA 2XINA 3H2FA 5HPCA 1ZZMA 3FGCA 1UOZA 4JTGA 3LY0A 1PIFA 2NVAA 3TSDA 3M5XA 4UTMA 5BMXA 5I77A 1QFEA 4GXMA 4K2SA 4EAMA 1UH2A 1DWFM 1PZ0A 3PG9A 4XWUA 2HMCA 2Z2AA 1W37A 1VGAA 1Z9AA 4L4MA 3W1PA 5HNUA 4M1RA 3EWUA 4JIRA 3LTPA 2VX5A 2VM8A 4L61A 2IXUA 3IV3A 1E6RA 4AWSA 1AD4A 4LVGA 4WQ6A 5I79A 2ACQA 3QEZA 5F7UA 1EWEA 2ABAA 3GFYA 1OC5A 3CHCA 3HG5A 4I5UA 3SGZA 3GHUA 2JIEA 3AIBA 4DI9A 4PUJA 4NUWA 1JPKA 3MZNA 3NVTA 1KTNA 4HK6A 3SN0A 3S3GA 3WLNA 2I9EA 3BURA 3BW4A 3DFNA 4MHBA 4KCVA 1OF6A 3T09A 4R9XA 1KGXA 1BF2A 1GJPA 4JXCA 1DTUA 1F8IA 1XGEA 4H9XA 3DHDA 4F0SA 4IPNB 4OJYA 3IVTA 4HA1A 5CQ1A 3TFCA 2WZEA 1FVPA 5AY7A 1TPUA 3O0FA 2QQ6A 4ZSTA 3PUDA 4OQVA 1BWLA 3HG3A 1QNQA 3W70A 1QT1A 4MFEA 4WDTA 3W26A 1DJYA 1XWYA 3NQGA 4FEZA 1CXKA 2EPNA 1O60A 4RE3A 2Z6IA 2JKAA 3NQVA 3W1TA 1W1B1 1Z42A 4ICMA 1WQ5A 4GUJA 3QLLA 2BX7A 3G1DA 3IVSA 4EWJA 4WK9A 2WZHA 3W7HA 1JRCA 4GNVA 3U57A 1TTIA 4CD5A 1RVKA 1J93A 1E3ZA 1L9WA 1JYVA 3KBMA 1R3SA 1HL9A 3W3OA 4C6PA 4F9DA 3BE7A 4IF2A 4YL2A 1C3FA 3RRAA 1OX4A 1NWUA 3PG8A 1GNXA 4YTRA 2DZUA 1BXBA 1NSJA 2X2GA 4PMVA 3ZJ6A 5KZDA 3C3UA 3LNPA 2PGFA 4DRSA 4DIAA 3EPMA 1IGWA 3WSUA 4WY0B 2DZBA 1DOSA 3QY8A 2J8FA 4ZO7A 4QLLA 5BOFA 3LXBA 4RKAA 3DAQA 3N15A 5FI8A 4PRRA 5CXPA 5CPOA 3R5EA 5XINA 4AISA 2GJLA 1E71M 5EMLA 3QBUA 5A6SA 2ZX8A 4GJIA 4K8EA 1VQTA 4C7FA 2HXTA 3FA3A 4GI9A 3V5CA 2XZ7A 1JD9A 5LIWX 4XIMA 4S2CA 2HPIA 1QNVA 3M7WA 5CPLA 2EPLX 3UW6A 5JVLA 2ALRA 4RDWA 2YA1A 4DNMA 2ZA2A 3M47A 4CGTA 1IF2A 2YCKX 2VL4A 3U7VA 3HGOA 3C4UA 1B5TA 3Q58A 4MWAB 3O63A 1W2PA 2Y63A 1HGWA 3BV7A 3SGGA 1K3UA 1Q85A 1OFPA 3GH5A 4NIRA 4NAFA 2IPWA 3T0CA 2QV4A 2Z7KA 4IIGA 4DHGA 4MUPA 1Z69A 3EWXA 1BRLA 2J7GA 2XHYA 4QE4A 1AMYA 3VNYA 3FJ6A 3I68A 4HU8A 4UWMA 2VFIA 3FLUA 3LDVA 3VOGA 1XH0A 2YLLA 3IIVA 4OGZA 2V5LA 4HN8A 3P62A 2JFEX 1OCQA 4Z1DA 2R24A 1AW1A 4LXFA 2JE8A 3BMVA 2ZCGA 4DO4A 4W9TA 4HZ7A 3DFOA 4AF0A 1L2UA 3LHWA 4N4QA 4E5TA 1JFXA 4I7WA 3EX6A 1EL3A 1I2NA 1B31A 2PBGA 4HHMA 3MYOA 4FXRA 4J3WA 5D2YA 5M1TA 3NR0A 1JAKA 1EBGA 3QR1A 4AIUA 3IARA 4TVDA 1QR7A 3SZ8A 4XD6A 1RD6A 3EBVA 2RHGA 2CLMA 2HZGA 4O19A 1TX0A 5EB8A 3S46A 2VZOA 2WKGA 1H51A 3ANUA 4TVCA 4LNCA 1K7EA 3NWRA 1LLWA 3K30A 1NFBA 4RJEA 1GW1A 1KQYA 4O14A 4PMJA 4CVWA 2EKCA 2VCBA 3WLRA 4IGMA 3WMSA 1DBTA 2MNRA 1GOIA 2BS9A 3KZSA 1P6BA 4O8AA 3A3XA 3ZM8A 3RNDA 1VD6A 2WYSA 3QTPA 2BMBA 3QGKC 3RLVA 1LG1A 1I0BA 3DECA 3RFAA 4GNKB 3HV8A 3O6DA 2DW6A 4IP4A 2TODA 2E8ZA 4ACYA 1M9HA 1OT1A 1VPYA 3XISA 3EPOA 4NASA 5C71A 3C2EA 3DH7A 2PBOA 1M6JA 2VRKA 3LNMA 1OABA 1S3TC 3DIPA 4K1WA 1KM4A 3GU9A 5ABGA 6XIAA 2GOUA 5CZJA 2ZRVA 5I5RA 2ZZ5A 4ZMGA 4GVIA 1H7XA 3AS3A 4KH2A 3TOPA 3WEOA 1GQKA 4M3PA 1Q4NX 4JTAA 2A6LA 1BFNA 2MANA 4AD0A 4G8TA 1PDYA 3CGTA 3ELFA 4O1EA 2WHMA 3M07A 2WQPA 2P8CA 3MHFA 3S0CA 1T40A 3DU0A 3BV4A 3WNLA 1JQXA 1YYAA 2Z25A 1YEYA 4GZJA 4IMCA 3I6TA 1DP0A 2Q01A 4JEQA 1YPFA 3M46A 4E2BA 3RX4A 3RCMA 3B04A 5K9CA 2YCIX 1FHDA 5C70A 3GTIA 7REQA 4DWDA 4DZHA 1D9EA 3VD9A 5EU9A 2W67A 2XN0A 1YDOA 4C6FA 1UP0A 2YXGA 1J2WA 4YNGA 1NDVA 2ACUA 2J9ZA 2E1DA 1G9HA 3QC0A 5D9PA 5CZKA 4DI8A 2WZIA 3UZ5A 1B9BA 4US6A 4QITA 5E0KA 4IUOA 1W1IE 3UETA 1R85A 2OYMA 4PMQA 1ZLPA 1X98A 4XX6A 3SUVA 5L9FA 3OLGA 2OXNA 3WQGA 4EVZA 3BW3A 1XLAA 3GDRA 3FCPA 3UVAA 4YTTA 1JNEA 1QK0A 1EPXA 1G1YA 2PDPA 4C6BA 1PWMA 1XIFA 3GXMA 3CQIA 3F5JA 2BOFX 3GWQA 4UQCA 3NOYA 5AFDA 1E6XM 2YB4A 2YJQA 2DP3A 2AGKA 4GYJA 2FVLA 3G8RA 1B3YA 1TIMA 4UFLA 1AUSL 1JCYA 3ZYZA 2DSUA 2BNJA 3LU2A 1BTCA 3MBFA 3N1AA 1P7TA 1VBHA 5DMYA 1IEXA 1WXZA 1V8EA 1RR2A 5ABFA 1XRSA 1XYFA 5FJOA 4F2TA 3BH4A 4U2YA 1E9ZB 1Q6FA 2QDHA 1U30A 3PBMA 5GVJA 3ZS4A 1IT0A 1JUEA 5HJXA 1E1CA 2P5NA 1E9LA 4MAZA 5AVNA 3BZGA 4HGXA 3B0UX 3B4YA 3UG3A 5EA9A 3LGGA 1JCMP 3SI9A 3U5UA 3WLHA 3NUKA 2CLOA 4HJWA 3EXRA 2EO7A 4V2XA 4K68A 3RRXA 2QCHA 1FCBA 4QEEA 5AB3A 1IQ8A 3IIOA 2NSOA 4JTCA 1RLCL 5BMWA 3S6OA 5CAKA 2X40A 1IXQA 1R0MA 5D8ZA 5K3VA 2CBIA 2ZYFA 3CUHA 4BWLC 4WVXA 1WDSA 5BWFA 3WO8A 3EA2A 2OQYA 4LW7A 1JPMA 2WXDM 1TV5A 3WJZA 3NXLA 1LOSA 1PYMA 5DLCA 3SR7A 4UC5A 4XBKA 2D2GA 1YBQB 3W53A 3EB4A 3L65A 5FA5A 2Y5JA 4UTIA 4HNCA 4M5PA 3C6CA 2PTDA 2Z1WA 1KC7A 4DELA 1NDYA 1L8NA 3LERA 3PZIA 1EA0A 3O1NA 2OT1A 1UWQA 5JQ9A 1BQCA 1MXDA 4UIOA 2VFFA 4NVTA 3IUDA 3W9ZA 4R53A 4J27A 3C0SA 1AJZA 1SO5A 3RO8A 2QZRA 1T99A 2VWSA 5CGTA 1YPXA 1JYXA 5CBJA 1WX0A 1XYMA 3RMEA 4YVXA 4O0ZA 1E72M 1Q6QA 1FWWA 5C9ZA 2WKJA 1KV5A 1PV8A 1KR0A 3G1YA 3UYCA 3NTYA 1MXGA 4N9DA 4QTGA 1L6YA 3AJXA 3HURA 3M0XA 1QPOA 2VP8A 2YDQA 1JGIA 3TAKA 3QM3A 3L0GA 2GJXA 3BLLA 4LS0A 3LPGA 1F74A 4JTFA 1A4MA 4S1FA 4L9YA 3VIKA 1EEPA 1TWWA 4PGLA 4AY8A 3NZGA 1HW6A 1TE6A 3WN6A 1H1NA 4Z42C 1PHWA 3F03K 1OCBA 1JDCA 3RLGA 2OMAA 3WQ6A 3RR1A 1KM3A 4RNIA 5EMJA 1BGAA 4X0NA 4JZ5A 1OYCA 2XGBA 1XIBA 1J0HA 1IGSA 4AZ7A 3WDIA 3VZZA 3VMOA 4H19A 1QBBA 4PUWA 3TZNA 1SW7A 5PTDA 4Y2WA 1SM9A 3IGXA 4UFJA 3ABXA 5A3HA 3FVMA 3ABRA 3LCWA 2WJZA 1QVBA 2DH2A 3ORWA 4D6EA 1OADA 1PYFA 4B2DD 1Q3NA 3VOHA 2XIMA 4JPGA 4W7VA 4E8CA 1H11A 1V08A 3W01A 1MUWA 5CG7A 3AIWA 5LIXX 4GD0A 5A8PA 1SJBA 2CERA 1D8WA 4Q8QA 3VGFA 3DC8A 2V8ZA 4WSHA 2QPXA 1XG3A 1K77A 1DKWA 5FJRA 3JR2A 5I03A 3HZ3A 3FJNA 4CNTA 2RGMA 4EK7A 3W7CA 3EZ4A 4Z1YA 2NW0A 1W1TA 4XAPA 4LAZA 1KNWA 2GVJA 3WUEA 3N6QA 2PDLA 4UTKA 3VD5A 3O0KA 4KRTA 1WYIA 1ONWA 2VRJA 3B9EA 5JUVA 2DJLA 4REQB 3P81A 3WF4A 3REQB 2FGLA 2WCSA 1XDJA 2XM1A 4OOUA 2J6XA 1MZRA 1EHAA 2ZTKA 2ZX6A 1UZDA 3F4VA 5DT7A 3O15A 3RJYA 4DO7A 4F48A 1IR2A 2FMNA 2OOGA 1T41A 4A29A 1MNSA 3B0PA 3OU8A 1GVEA 4Q33A 3BPWA 2I5IA 2AQWA 5HQEA 3VKCA 2X0YA 3WQWA 3SQLA 4X61A 3W1AA 1B3ZA 1VP5A 3KOYA 3B40A 2A0NA 4PFMA 3U6WA 1DIOA 1ZCOA 3AHYA 3A47A 2XDFA 1CNVA 3WH8A 3VD7A 5KZMA 4A3UA 3SQSA 4PUNA 4MFDA 5HULA 1TX2A 5XIAA 3DDMA 1VCFA 3WBYA 2W63A 1R2TA 1FRBA 2FPVA 2PGWA 2QGYA 4W8AA 4GCAA 2OSWA 1P4CA 2RUSA 2VKZG 4WGXA 4I9AA 3W7PA 1X8CA 4KF1A 1RBOB 4P8VA 3WQDA 1FH8A 4RPPA 1CT5A 2D20A 4K8HA 3N73A 1QPNA 1A5NC 2WM1A 4S3GA 1IXOA 3BC9A 1JF6A 2PODA 2QPSA 3GHTA 1OK6A 1BHGA 2WZMA 3TX9A 4TTGA 3AU6A 1Q8AA 1WE5A 3MV01 5FESA 1OD0A 2Z26A 4LVFA 4C6IA 3N2MA 3IJ9A 2WWCA 3UNDA 4A2SA 3V18A 1VCVA 2BGQA 3UZJA 3NSNA 1BYCA 1RA5A 4K7YA 5XIMA 2V30A 5LNUA 4L1GA 2ZRZA 4UTWC 1EX5A 1JVNA 1NOUA 5AC4A 1ZJHA 4GA8A 2WZTA 4IMFA 1G6CA 1LWHA 4UTUA 3BARA 2HDJA 5G4WA 6PTDA 2QJJA 3L66A 1C8QA 3APGA 4FNPA 2PDMA 1ADOA 1XR2A 4H6QA 1GW9A 3AMDA 1H0IA 4DN1A 1JQVA 4CN6A 1FH7A 2J6VA 3GFZA 5D32A 5H6HA 4S38A 3RGTA 2X09A 3JVAA 1BLIA 1AH3A 2NVCA 1K8CA 3GU2A 4GJJA 5K2ZA 1FWNA 4JD4A 4A8RA 2QGHA 1GTHA 3TYUA 5T91A 1Q45A 4PSRA 7XIMA 2Y2WA 2QCMA 4O1FA 2R1NA 3CTLA 3KOXA 3PUEA 2G4JA 1VJZA 4RXGA 4ZBCA 2BBFA 1A0DA 1LCOA 3WLIA 5AN7A 1JULA 4GO8A 1Q65A 5REQA 5DEZA 3G6MA 8A3HA 3TC7A 4JFTA 3PAJA 1PB0A 2A3EA 1MQQA 2D73A 4GI6A 3DFTA 1TJRA 4WDWA 1A5MC 3TWAA 1KCLA 1ZTVA 1A50A 5IHRA 1IWPA 4IXHA 1M65A 3MHUA 2FZ9A 4HU3A 4H9TA 1VC4A 1FQ0A 2TSYA 5C9UA 4D1JA 1E73M 3MUAA 3TQVA 5DRIA 1KA9F 3AWNA 3THCA 5BW6A 4O12A 3C8FA 3VPLA 5FJIA 1NOWA 1JZ8A 2WVSA 3LK6A 4NX0A 3TV8A 4DZ5A 1ZQ5A 3WK3A 1NY1A 1R7OA 1F4AA 1ZJAA 5I6SA 3APYA 5K4XA 4M7TA 4YN5A 3IV8A 3AQUA 1HN1A 3P14A 2PA6A 2OT0A 4KWSA 3DENA 5LNVA 3CMFA 1EPVA 3COTA 1H1YA 2PCEA 1V6VA 1S5VA 1FDZA 4AWUA 1VPQA 3THDA 1A5BA 3V36A 2VGGA 5LNSA 3RMJA 3A4AA 3TTEA 4M0XA 1UPPA 1HJQA 1DTNA 1UD2A 5A6BD 2AAMA 1V7AA 3KS5A 1O12A 1JZ3A 3QR3A 2P0OA 5M03A 1TJ1A 3NFUA 1DIDA 1EJUC 4PMRA 4DBWA 4QG6A 4AH7A 3S4TA 4DQWA 4D6FA 3W1NA 2D0GA 1HVQA 5HQMA 4O50A 2H8XA 1VFSA 3TW9A 2VEGA 1XP3A 2AQOA 2ZVRA 3EWZA 3MKVA 2W79A 1G4SA 3VDGA 3FGCB 1GYLA 4YHEA 1T5AA 2DZVA 4IIHA 3OZOA 4QAWA 4L4OA 4IT1A 3LPOA 3CQHA 1VKFA 1IR1A 5IRPA 3KBWA 5D37A 1FCVA 3Q67A 3QZ6A 2PLJA 3LG3A 3P80A 3CS2A 1VHCA 1UCWA 3GNDA 3VC6A 2Y4SA 1XYAA 4M7SA 1P6WA 4ZB0A 3ITOA 1OCNA 8TIMA 3ZT5A 3T6CA 4W7UA 1FP8A 3WDQA 1V51A 3NCOA 5CPNA 2PE4A 5BRQA 5I00A 4H8NA 4UZUA 1RY8A 2DVUA 1SJCA 3URNA 1KCZA 1DJIA 3SY5A 4IJBA 3PB2A 4CD4A 4LBUA 3P5ZA 1I2PA 3SW6A 3UG4A 3GD6A 2X1SA 2FB3A 3AIRA 1F8MA 3LEPA 4DYEA 5A6MA 5M5DA 1TJ0A 3ABOA 4I6KA 3E2RA 3B0YA 2NLIA 3ZWSA 3D3FA 2CLLA 1SSGA 3SUTA 4Q4SA 1TPEA 3CV6A 2HSAA 5G2IA 4QS6A 3W84A 4E38A 4ZFCA 2PPGA 3L23A 4UTFA 3BGJA 1QAPA 2CFFA 3NA8A 1N8WA 4I7UA 3WD1A 1VFTA 3WDPP 4Q8PA 3SDOA 2YL9A 3KRZA 5CBBA 3LMYA 4ZOCA 1R7AA 3T0TA 2ISVA 4ZTYA 3KHJA 4OKDA 5SWUA 3MW7A 4BEUA 4F2UA 1KBLA 2PTXA 2ZC1A 1EGZA 5HBFA 3LSCA 4GO9A 3LRMA 1FBAA 3CIXA 4I8YA 3BICA 1WOBA 5CZSA 4PBEA 3WLJA 4NJKA 2G95A 4L9ZA 3STGA 1OX4B 4H4IA 1TQXA 1W9XA 2NSXA 1CGXA 4XD3A 4L56A 1JEZA 3MDWA 4F9JA 3VNMA 4MNJA 4JTSA 4R34A 1UR3M 2X7VA 1QU4A 3ZLGA 4Z1AA 4CQAA 1GONA 3TYAA 1EP3A 4FZIA 4YWSA 4D8AA 3IGHX 1A5CA 4PTNA 2VCAA 1NWSA 4DBDA 4K36A 3WD3A 5C2GA 2O0TA 2INFA 3CL6A 4JIIX 5MHBA 3L21A 5FF7A 3QPZA 1GOMA 2X8RA 2YR1A 5FD0A 1PPIA 3BW2A 4B5SA 4JDYA 3FHQA 1TV2A 2EJAA 4XO7A 1R47A 2H3DA 3GYEA 1GOOA 3VM5A 4O52A 2R8WA 1RVGA 7A3HA 1FHLA 4ZVJA 3DHPA 3QC3A 3SRDA 1A0CA 3TCEA 1UR2A 3HA1A 4MVAA 4JIQA 5F2MA 3STPA 1OYBA 1F76A 4EF9A 2QUNA 1JAEA 3QY7A 3O3RA 5A5WA 1J8VA 3WFAA 4WLCA 1KRMA 1VIZA 2ZZ2A 1A5KC 2HE5A 1PTAA 2HWGA 4HPGA 2A1YA 3IJDA 1FWCC 3TTQA 2E0PA 2BSLA 4HD5A 1H7NA 3D3AA 3M9YA 2FGZA 1NARA 4KGJA 3IRSA 4M8UA 3JS3A 3A6OA 1TPH1 4B4HA 1BKSA 3A3WA 1P1MA 2FVMA 3BVJA 4GWEA 4MKNA 1YLVA 2YBTA 4NXKA 3HGJA 3V0SA 1W5PA 4IM4A 3E96A 2C13A 4C6QA 2E68A 2A5HA 4E4UA 4WRHA 3H70A 3DFYA 5AHIA 2R1PA 1LL4A 1ELSA 1PZ1A 2GQ3A 1W31A 3MMTA 5C9XA 1GG1A 4IGNA 3VE7A 3OIHA 1OWQA 5ABEA 3AZTA 1POJA 4FP1A 2XFFA 1TWDA 3A5FA 1JPDX 5D02A 3T2QA 2GK1A 1X6LA 5E6ZA 4YHGA 3TQPA 3NZPA 3RM9A 1GJWA 3PN8A 4I9TA 1XC6A 5FF4A 4M6PA 4LCSA 5K4ZA 2HPMA 1KGUA 4PMUA 3EDFA 1JYWA 3BLDA 1UR4A 2ACSA 4D72A 1J12A 4J4KA 4F0LA 2QCFA 3NDOA 1S2VA 3ARVA 2VEIA 4LQ1A 1QHOA 4WF7A 4Z17A 3W2MA 4JS3A 2Z6JA 1J0YA 3ABSA 4S3EA 4QG8A 1K02A 2CHNA 3VCRA 3R0UA 1AVAA 3NO1A 3SCSA 3I3BA 1ZPTA 5TD4A 3EWYA 3ALFA 1CLKA 1EHNA 2YB1A 3M0JA 1IT7A 1Q6RA 2ZZ4A 2Z1SA 2E6AA 4O18A 1TKKA 3VU2A 1B3VA 1K03A 3BLIA 3POCA 5DMMA 4DM2A 4M51A 4AW7A 3WDHA 3TC3A 4N02A 4LVBA 1B30A 2YBUA 3WUGA 1P5BA 3CYVA 3MY9A 4QISA 5D38A 4L6DA 5C54A 5GPRA 4MYAA 3AXIA 1HFBA 1S2TA 4LVAA 4C1LA 3WZ0E 3KDNA 3M44A 4GI8A 1GKPA 1R3WA 3FDGA 4W8BA 1OX6A 2RDTA 1SGJA 2PU1A 2OYLA 1JCXA 3PP7A 1E55A 2CZFA 3L4XA 4KFPA 1PHQA 4JL2A 2V3GA 2NUXA 2YLAA 1XLCA 3AIQA 4ORMA 5CGMA 1XLJA 1VB9A 3N19B 9XIMA 4LAOA 1LWIA 3E9AA 4O17A 1KM2A 1FWIC 2PC8A 1EH9A 3N2OA 4US5D 3PPGA 5A6AA 2PRMA 2R1MA 4XV0A 2DIEA 2QVHA 3CLWA 2VUNA 2CEQA 4CLMA 3VIFA 3VGDA 5FEPA 1RBAA 1TPB1 3E2VA 2ZKMX 3B3DA 2PP3A 2VR5A 3VX1A 2EKGA 3W6LA 2X1IA 3KVJA 3PK7A 1V0LA 2D2OA 3W07A 4G6CA 3E1F1 4HK5A 3ZXWA 2CIPA 1NEYA 4BQ5A 7REQB 2GDUA 3WF3A 4E8GA 1C93A 2DZWA 3CUGA 1HO1A 1ONXA 4X3ZA 4NNAA 4RV8A 3OYXA 5AC8A 3U2OA 1Y5XA 2W27A 5G5IA 4EXQA 3GE7A 3UWEA 3LOTA 2ZBTA 3H21A 3CZEA 1XIDA 1E9IA 3QQWA 1Q6DA 1NTHA 1XQKA 2XGZA 4JKLA 5G1YA 1LROA 2QYGA 1O4UA 3L4VA 3M5ZA 4UMCA 4D71A 1MXSA 1AQFA 1Q6EA 2BXZA 1DIKA 3KM8A 1OINA 4R85A 4RL3A 3PZGA 4XZNX 4S3AA 4DJED 4KT2A 1B3WA 2V0TA 5KETA 1J11A 4OOZA 3BZJA 4LAKA 1Q7QA 3CAWA 3ZJ8A 3AMKA 2XIOA 4MM1A 2IKHA 5LHEA 2HE8A 1IXNA 3LLDA 1MUMA 1TWZA 2QJNA 1H7RA 1FKXA 4G7FA 1VPXA 4X22A 1UKOA 2KZHA 2X1RA 3THUA 2CLIA 3NNTA 1F2JA 4LBSA 2W92A 4WJXA 4FMVA 1H7OA 1E0TA 3TN5A 4IX0A 5EY5A 1XCXA 4GQQA 4MNMA 5I3FA 2QUTA 3EXTA 4NXSA 5CC3A 5HA7A 3T44A 2ZUUA 1P7TB 4QR6A 3M0YA 1XBVA 2HS6A 1I45A 3N3MA 4W88A 1PCWA 3DFQA 5ABFB 3DESA 5AYYA 1A5UA 3LYEA 4O28A 2REQA 5I0DA 1OFDA 3KRUA 4G9PA 3D6NA 3AI0A 1XRTA 2ZZ1A 1XSJA 3N4EA 1R5YA 3C5QA 2BZNA 2XVGA 3WMLA 1Q6LA 5F2GA 5CSUA 3S9ZA 5J04A 4J3UA 3E49A 2J7HA 5EL1A 3C0LA 1XC4A 3WLKX 4MKVA 3N2CA 1UWIA 3H7RA 1J2BA 1CYGA 4YVVA 4BKNA 3LGDA 1AK5A 1CENA 1UJPA 5FSEC 3L0KA 4HB7A 4Y8EA 4UNLA 4XQ6A 1MI3A 4NNBA 3CQKA 4H3DA 3GR4A 2W6RA 2ZRUA 1EJRC 3GR8A 2FIQA 1XSIA 3MMWA 2FZNA 3N14A 4CN4A 1QCWA 3OO2A 3F2DA 3TQ0A 1TTPA 3N29A 4LFYA 5F2LA 1IXPA 4HMDA 2KAUC 4UTTC 3VNLA 1AJ0A 4QXIA 1ZHAA 3H24A 1P1XA 1EC9A 4NJGA 5A6BA 3DGRA 2X16A 1I1XA 3HPXA 4CD8A 3P0XA 4CU8A 1M1BA 1K4GA 1GHRA 3ITCA 2YA0A 4WXYA 3N3TA 2CKSA 3L5LA 4A35A 4PB4A 3OLDA 2DSWA 2ZTJA 3W7JA 3WQ8A 1ZB5A 5JBEA 4IMGA 4I5XA 3NDYA 3NQ2A 2G97A 1F5ZA 1TUXA 3S5OA 3UP8A 2HS8A 2GQ8A 2PWGA 4LUIA 5AHLA 4FB7A 1EC7A 1W8SA 1EWDA 4DM1A 4FR1A 5DQPA 3SM0A 4OUEA 5FAJA 3WH5A 3NQCA 3LV6A 1M3UA 1D3GA 1Q6OA 1R87A 4GGHA 1A53A 5T26A 3LXAA 3E2QA 1ZY9A 4FNRA 4PB3A 4B4FA 3GXDA 5DFAA 4LUSA 4E3VA 3BCFA 1XIEA 1W56A 3GXPA 1P0DA 1ONRA 1PS9A 1IIGA 2IQ0A 5KZ6A 3WY1A 4JNMA 1EF2A 1YW1A 2AGTA 4ZE4A 1HJWA 3PHAA 5GQBA 1HP4A 1CXEA 4PUEA 3LCLA 3UJSA 1BXCA 3KP1A 4TTUA 3N2TA 1A5OC 1U5HA 3AXXA 3M5VA 1K6WA 4OBRA 3F4NA 4A4AA 3HF3A 1P0NA 3LN3A 1JNDA 1CGUA 5DXXA 3UG8A 2VFEA 3MCOA 1O6IA 3PJWA 4AEOA 3R25A 5F1UA 2PI6A 1TZZA 2R14A 3QJAA 3ISIX 4RW3A 1IEQA 2V63A 4NRRA 3LZ5A 1I8JA 2XIIA 3UY7A 3LRLA 4O0QA 2V5CA 1MMFA 2BY2A 3W7IA 1WBHA 1AJ2A 2QAFA 3O6CA 3LD5A 2PDIA 3TN6A 3QY6A 3VGHA 4BHYA 2ON3A 1H5YA 2PU0A 1GEHA 4WJEA 2ZUWA 2Z7GA 1E0VA 4S3JA 4NF7A 3FFSA 2XWDA 5D2TA 1YDVA 3AHXA 3TONA 2ZFAA 4PH6A 3PJTA 3UR2A 4XSLA 2ZUTA 2V38A 4BF9A 3IK2A 1H60A 2W62A 1O5RA 4J3TA 4GXWA 3CPGA 2ZRXA 2E40A 5HNNA 4MDPA 3W2JA 4IIBA 4EAYA 4CU7A 4DX3A 4FNTA 4XISA 5J5DA 4ZTXA 4C65A 2V5BA 1JI1A 1VEOA 4QCEA 1XG4A 1US2A 3UXAA 3P8JA 4I9MA 4HMCA 2C91A 2H90A 4IG2B 2YCLB 1UPMB 1FUYA 2PWFA 5D04C 3ZOAA 2WBKA 4FOJA 2GFTA 2Q09A 4ZO8A 3V75A 3WD4A 1OC7A 3VK5A 3A24A 2J24A 1BYBA 4XVDA 3M1ZA 2RGLA 2R91A 3F2CA 2J78A 1B1YA 2NWSA 5FJTA 1XW8A 3MUY1 1NU5A 1ME7A 3TJ4A 3B9DA 1W1VA 4Q4KA 3K4DA 3SB0A 5TNVA 3R4IA 4Q8VA 4H9YA 4NAEB 1F07A 4IFKB 1E6PA 1M7XA 4EPBC 2QJMA 4DO5A 3UPBA 3EOSA 1TZ7A 4HJFA 1V4YA 3MSGA 4M6UA 3GXTA 1PAMA 4EACA 2DUAA 2HISA 3MUXA 1A3HA 3KVKA 1F3WA 4FK9A 5E1QA 1EIXA 2EHHA 1FWTA 2YFNA 1JR1A 2F84A 2OCZA 5C2CA 2GSHA 3A64A 3PULA 3KCOA 2ZA3A 4UCFA 1DJXA 4LBRA 3A21A 4ECLA 1YE6A 1U2YA 4KBXA 1YDNA 1CGYA 3VNZA 2RJHA 1DHKA 1QXLA 1SZFA 3T42A 4P2VA 5E5CA 1R3RA 1E6NA 3ZFHA 5HUPA 1JCJA 3KCJA 4A8NA 4DUWA 3W1QA 4QNEA 1WO2A 4RZBA 1ISWA 3HQPA 4XIAA 1AW2A 1W5MA 1EJXC 2J75A 1AG1O 4HYRA 4EIVA 1LL6A 2XU2A 3POHA 3KL3A 3GG0A 1I2QA 5LIUX 1JZ7A 3DERA 3EWDA 3GH4A 3G77A 3GXFA 2OLSA 3ZVHA 1LT7A 2R9RA 4R27A 4RE2A 2Y89A 4W84A 3TKFA 2VOMA 3G3DA 3VE9A 1OB0A 4ZQRA 1ZSXA 4MIMA 3UGRA 4Q8UA 1UW9A 4DPPA 5E93A 1AL7A 3SGUA 4MLJA 5HNRA 4C6NA 3F4CA 4RUBA 1I75A 3WJYA 1A3WA 2WVVB 3T1GA 1XCWA 5REQB 2W91A 4HSOA 4JN6A 3VDHA 5I3JA 3B9OA 5C0QA 4ZQOA 4MZ8A 5G1MA 7TAAA 1TMLA 4MTVA 1TPFA 5E9XA 1W5NA 4W87A 3B8VA 3G3MA 5BU6A 3NL3A 3QQ1A 4RZ6A 4R5EA 1J5SA 2OLAA 3P93A 4XTIA 1HL8A 4V28A 4B92A 2XH2A 4PFHA 2GQAA 1RBLA 5H8UA 5DO8A 1O1ZA 1S5MA 2E9LA 4TMBA 1GTEA 1KBBA 4C6LA 4BQ3A 4NZ5A 2V67A 4H8HA 5A95A 1RCQA 3OGVA 3RG6A 3NZ1A 1UG6A 2CHOA 2PDCA 1E15A 5MKGA 1QNRA 5A69A 1ECEA 2I1OA 2WSQA 1JXJA 4FO4A 1UD4A 3EB3A 5CSYA 2ACRA 3DOPA 4UQDA 1OGBA 3FAWA 3W7KA 4AWTA 3PZTA 3W76A 4IP7A 4UCGA 3W2NA 1PKYA 2Y85A 3VUSA 3FXGA 1W9DM 3NQMA 5FJPA 2Z1VA 3OA5A 5I3DA 1HKMA 1CB7B 1MDLA 3MWCA 2PB1A 2OWWA 1M53A 1BVNP 2E5CA 4MJ2A 1RPKA 2PURA 1E43A 1KM6A 1OGSA 2WAGA 1XLMA 3BMWA 4J5NA 4DO6A 1R8LA 2IUZA 3BXWA 2EPKX 4LF2A 1PZ2A 3RDKA 4C6EA 3RPDA 3BLKA 3IAQA 3QV6A 3NQ7A 3S47A 3D46A 4WDXA 1N2VA 2FVKA 3E12A 1YQ2A 1AD1A 4AZ5A 4H2HA 1E4IA 3W75A 5RUBA 4LY4A 3IJ6A 4QIUA 1ZFJA 3MCNA 2PF8A 5E0CA 2VURA 3TE9A 1ICSA 1H4PA 2XN1A 3VDCA 4QBXA 1KWGA 1G4PA 4TQTA 1SVDA 4DJEA 1DXEA 2DZAA 4JKMA 3GZ3A 3W25A 2WVUA 2Y8UA 5B7ZA 3LV5A 1XKYA 4EWND 1HVXA 2B7PA 1Z44A 3QN3A 1J5TA 4F0HA 2RDUA 5CJMA 3T07A 4X9YA 1AQMA 3A9BA 1NH6A 1V79A 1OM0A 3R43A 3C2FA 2E7FA 4M24A 3H7VA 3U3HA 2Z00A 2J9YA 3VGGA 3O16A 3SRFA 2BXYA 1MQPA 3ARSA 3DG7A 1EGVA 3LHZA 4I90A 1UP2A 1UUMA 4MWAD 3TN4A 1G5AA 2P53A 1BAGA 1XBXA 4IMEA 4HMEA 2GGHA 2QW5A 4AX6A 1XH1A 4IP5A 2PD9A 4O8RA 1YTDA 3S9IA 1TR1A 3B9AA 3WYZA 2XZ9A 4WOQA 1ODUA 3OW1A 2OB3A 3IJQA 1GOXA 2CCRA 2F7FA 5CG0A 3FV9A 4J1OA 3T8QA 3QPYA 3G1SA 4Q4RA 3UWQA 4A3HA 2NVDA 1MUCA 3LCGA 1IT8A 1GPWA 4FNQA 1W1YA 2XSBA 4DWSC 1KXHA 8XIMA 5FL1A 3WQCA 5A2BA 1XIHA 4JYEA 3GG8A 3GC2A 3QFEA 5HAOA 2NLYA 4C6KA 4ZXOA 1AH4A 5J8LA 1XLGA 2PDFA 2V2CA 5BRPA 4Y9PA 4GYKA 1WZMA 3R58A 1QPKA 3QHMA 4C1NA 3W7QA 1XUZA 1ITQA 4B3LA 3O9NA 5BNKA 4CCDA 2ESCA 2WANA 3AROA 4D1IA 2XGIA 5DANA 5ECUA 1KBKA 1Q8JA 2Y8VA 4C5ZA 2XSAA 3VIOA 4GUGA 4O54A 4O15A 4PODA 4F0KA 2QUMA 3I4EA 2WMFA 3CAKA 3GDKA 1PJ9A 3GDBA 2P10A 1F73A 2YSWA 4D8LA 5LSMA 2Z4GA 5CH9A 4DBSA 2R1LA 1Y8BA 1HKIA 2PWDA 1KRCC 4YIWA 3AISA 3VIHA 4RW5A 3OVPA 4D6GA 3G1XA 1LQ0A 4GY0A 3MUZ1 1OIFA 4DVOA 1CGTA 4Q8OA 4A8LA 1K1DA 1T8QA 4YJ5A 4AD5A 2WCAA 2WMKA 3MWAA 4GZEA 4UUIA 4AU0A 4JHOA 1VEPA 4D6CA 5T9CE 4RR4A 5H2ZA 3TR2A 1MDRA 5AKQA 2J88A 3L4TA 3VKKA 3S2LA 3GDTA 3KAOA 2W0UA 1DWHM 2ZX9A 4HTBA 2FQIA 4YVPA 3F5LA 4AD4A 1UUQA 1F3EA 4N9EA 4AEEA 4XTDA 1OFQA 1MQRA 2WJDA 1W2VA 1UH4A 3QKEA 4Q4MA 4NSBA 3WMBA 4N0RA 4WD0A 3FS2A 1VLIA 3OBKA 4Z2GA 4AZGA 3CMJA 5ENLA 6CGTA 3SCOA 1RK5A 1XIGA 4K3ZA 7CGTA 4PL2A 4KKXA 1OZMA 4PYSA 1GUVA 4GK8A 3R94A 5A6TC 5EFFA 4AB4A 5HPOA 4AFYA 4TR9A 3QR0A 3GDMA 4O4VA 1V6UA 1EO5A 4GH1A 4B9YA 3A9IA 2HRWA 4DXKA 3W7EA 4JBRA 3GIPA 3K1DA 2WQDA 4CD6A 3INPA 3FY1A 3RO6A 1QNOA 4MZYA 1O66A 2QKFA 3WCZA 5BZAA 3MO7A 5KTLA 4TMCA 3CO4A 2GGJA 3FA4A 4J28A 1YNPA 3SCPA 4NJHA 4MJZA 4D6DA 3W37A 3ARQA 5LGXA 1Q2RA 4CCZA 1X7FA 4HYVA 4QHRA 3A5VA 4XZHA 2QF7A 5D09A 3ATYA 2Y6ZA 1N55A 2WC4A 3TDFA 3GG7A 4GKTA 2DIJA 4QDWA 3TA6A 1HJUA 2OO0A 4IPJA 3M6YA 4C90A 4PCFA 3H2EA 3IJ8A 3MJYA 2EG8A 1CIUA 2VZSA 2QCCA 5BCAA 4IPLA 3C52A 3RITA 3PS7A 4MPQA 3R8HA 2F9RA 4RK8A 3QHNA 1KRAC 4AD3A 1VFHA 2QUVA 3TJXA 3TU9A 1MYRA 3NAVA 1GVSA 5CPQA 3UEQA 2P8BA 2IKIA 2J62A 2HBVA 4MNLA 3MBDA 1RJPA 2UY2A 2E25A 1ZP4A 3HV9A 1BWKA 2IQTA 3F2BA 1I2RA 1I9CB 4UXDA 2GWGA 4ZB5A 1TFVA 9CGTA 1LRTA 2J8GA 3S9YA 3FEMA 3W81A 3NG3A 4QLKA 3SUWA 5A8OA 1BSIA 3LGEA 1N7KA 3ONBA 5BOEA 1E0WA 1CGWA 1DJNA