4YTQA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy d-tagatose
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
294
structure length
294
Chain Sequence
b'MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 118
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4ytqA00
3VNLA 2HK1A 2GYIA 4ZB5A 1K77A 2XIMA 3KBWA 4XKMA 3UXIA 4QE5A 4K1GA 2NQHA 3KBSA 4YTQA 1QTWA 1XLBA 3M0MA 3P14A 4US6A 4A8LA 4XSMA 4QE4A 2HCVA 2QUNA 3FVMA 4XIMA 3UVAA 1DE6A 3KCLA 4LNCA 9XIAA 5FA5A 1XLIA 3UU0A 1CLKA 1BXCA 3AYTA 5AVHA 3IUIA 3VNMA 3NGFA 9XIMA 3U3HA 1XLFA 3VNIA 3GNXA 1OADA 1XIFA 3P6LA 3AALA 2ZDSA 1O1HA 4K3ZA 2X7WA 5EMKA 5TNVA 4HNOA 1XP3A 3KBVA 4PGLA 4ZB2A 1XLHA 2G4JA 4EACA 6XIAA 5XIAA 3CWHA 3CQJA 3QC0A 5H6HA 1XLDA 3M0LA 1A0EA 1MUWA 3M0HA 2GUBA 3CQHA 3IUDA 3ITLA 3XISA 3QXBA 1QT1A 2X7VA 3BDKA 4QEHA 5J8LA 1S5NA 1XYBA 4Q7IA 3ITVA 1XIGA 2I57A 3KCOA 2GLKA 8XIAA 3DBNA 4DUOA 1XIMA 1DIEA 3QYSA 3AAMA 4GLEA 4YTTA 1A0DA 3TC3A 3UA4A 1XLKA 3KWSA 3C0LA 4GQBA 5XINA 3IUHA 1XIDA 4HGXA 3VNKA 1XLEA 3BWWA 3OBEA 3AYVA 4EAYA 4QE1A 4YTUA 3CQIA 5I7GA 4DVOA 5EMJA 4A8NA 2HK0A 1XIHA 5B7ZA 5C9ZA 1XYMA 4YTRA 4GJJA 1TZ9A 7XIMA 2G0WA 3BZGA 4PFHA 3ITTA 3TVAA 2ZVRA 4E3VA 3WQOA 2GVEA 1GW9A 2OU4A 3VNJA 5B80A 1D8WA 4XSLA 1QUMA 4QEEA 2QW5A 4HHMA 3ITYA 2XISA 1XIJA 3KBNA 1XINA 1XYAA 2Q02A 3N4AA 3KBMA 1XLLA 1XLMA 4QDPA 4ZBCA 4W4QA 4X61A 1XISA 1XIIA 1DXIA 1MNZA 3XIMA 8XIMA 3VYLA 1I60A 1XYLA 4QDWA 4XIAA 4GJIA 4X63A 1A0CA 1DE5A 4X60A 3U0HA 1I6NA 3DX5A 3M0VA 3LMZA 2I56A 3QZAA 5EMLA 1BXBA 1XLCA 3KCJA 2QULA 3JU2A 4J4KA 5AVNA 3C0QA 1XLGA 1DIDA 3ITXA 3M0YA 5H1WA 1XYCA 1XLAA 2QUMA 4G56A 2J6VA 3XINA 4A8IA 2XINA 4HHLA 3KTCA 3ITOA 3M0XA 4OVXA 4XISA 1XIEA 6XIMA 1YX1A 1XICA 4KW2A 3CNYA 2NQJA 1XIBA 3BZJA 5B7YA 3C0SA 5EMMA 4ZB0A 3CQKA 3UA3A 1S5MA 3KBJA 1XLJA 3L23A 2NQ9A 5XIMA 4A8RA 3BANA 4YTSA
chains in the Genus database with same CATH superfamily
1EF3A 4E4FA 2YFOA 2PLKA 1J93A 1M01A 3NSXA 4WR3A 3SEPA 1NWRA 5BMXA 3W01A 2IKGA 1K9EA 3PPHA 2GQ8A 1A47A 2RDTA 1TTQA 3C3UA 1BF2A 4DNHA 1DQXA 4QLJA 1IGSA 1UBSA 4IJRA 3KOXA 1R85A 2Z26A 2DZXA 4ADSA 1XYBA 5CPMA 4LCRA 2RJGA 3SUWA 3GM8A 3AAMA 3QSRA 4LY8A 1BQCA 3GG1A 4NF7A 1JD9A 4F0HA 4Z2LA 2PGEA 3LV6A 4ORMA 3AHZA 4PYSA 1FCUA 2Q8LA 1CWYA 4DPQA 3SRKA 3GHUA 4U31A 4ZO8A 2GVGA 3GFXA 1I75A 1QHOA 4Y9MA 1Z9AA 3BC9A 3FA4A 4Q4PA 3RIKA 4TV5A 3CAKA 2GL5A 4FPSA 3MCMA 1XISA 3H6OA 3VD4A 3SW6A 1LWHA 4QGCA 3CS2A 1Z8AA 2RDUA 3KCJA 2DZBA 3UCCA 1LWJA 1W3HA 1FWHC 3VKCA 3WG6A 3FYPA 1U1UA 2EG8A 3TTYA 1BVZA 4ZVJA 1ELSA 3CQKA 3HG5A 4OBSA 1G7UA 1R0MA 1HTIA 3CZJA 3EKLA 4FNTA 3IIOA 1JYNA 1NF7A 2WKLA 1MSSA 5GJPA 4HPNA 4GI6A 3R43A 3GIQA 4WQ6A 1XH1A 1FX6A 3W2NA 1HGYA 4J40A 5HNNA 1KFJA 1LLZA 1KKRA 3GXPA 2VZVA 4NUWA 1HJUA 4YLWA 2BOEX 3BICA 1OZQA 4XV0A 5BXPA 1O7AA 1X97A 4FO4A 1DJNA 3KCOA 4LALA 2J74A 5CEWA 2WWCA 3QQ1A 5ABEA 4O8AA 3W75A 3SCVA 4DZIA 3KEHA 3TWAA 1RLDA 3RRAA 4I9MA 2HNHA 2WK2A 1VIZA 3S5YA 3ZZ1A 4IQJA 1E15A 1ONXA 3BLIA 3HGJA 4PL2A 2YA1A 3E96A 5HXMA 2XFRA 5U4NA 1U5JA 4HPGA 2POTA 1DJYA 4HU0A 3R10A 3EB3A 3QV8A 1LL7A 3ATZA 3H2MA 3W7LA 4JNMA 4IP4A 3ZT7A 1C8QA 2Q01A 4PUUA 2WMFA 4UFHA 1MYRA 1UIPA 3WL0A 2GWGA 1I2RA 1MQQA 5ABGA 3FSUA 4BEQA 4ZGYA 3WH8A 3B0XA 3M5XA 2FHBA 1XLJA 4HSOA 1J9YA 3NZQA 3PF3A 3AMLA 4UUIA 1BFNA 2YB4A 4CU7A 3CEPA 4C65A 5IFTA 2QCLA 3WMBA 4UQAA 5DX7A 2CXGA 2HCVA 2QUNA 3UESA 3QTPA 2Q3OA 4HKPA 4Q8WA 4BI6A 4AD5A 4UZUA 3O8AA 4F48A 3APGA 4O13A 1B3ZA 4NG3A 3KAOA 1QI5A 4UTLA 4O1AA 3GHTA 5KSWA 2E4TA 2W63A 1W3LA 4MNKA 2GOKA 5K2ZA 4MHBA 1VCGA 2IXVA 4ACZA 4KWUA 4DI9A 2ESCA 1V6YA 4H7VA 4A2SA 1V8EA 3KE0A 3CB3A 1D3HA 3VOGA 1OCBA 2NWSA 5I3HA 2VR5A 1Y5XA 4HMCA 4QIUA 3QPZA 5A3HA 1QASA 4AY7A 3M7SA 5IBXC 3FKKA 1XGDA 3QMSA 4UTMA 4Q33A 3U7BA 3N34A 1QDSA 1XIIA 3ICJA 2E68A 5L6UA 2EAWA 1KWGA 3ES8A 3IVUA 4O28A 2EJ1A 2VX4A 3M0YA 1AH4A 2F6XA 3FDGA 3MUIA 2PLMA 3WMSA 3G0SA 4DYKA 2QMJA 1LRNA 1UR3M 1S3TC 3VC6A 1OC5A 2QPXA 1EX1A 4NI8A 4AX6A 5DRCA 1OVDA 3UJFA 1VHCA 1TV2A 2ZA1A 4DI8A 4AIEA 3BPWA 1GCYA 4EXQA 2O7QA 1NSJA 3C61A 2GJXB 1JFXA 1QI0A 2RGMA 2VRQA 4F2UA 1GZJA 4LYPA 4W89A 1VLWA 1C93A 4O8RA 1SR9A 4A3HA 1IV8A 5RUBA 2G3JA 4NILA 5D04C 1DV7A 1R86A 2FFIA 4HMDA 2G97A 3UYCA 2UY2A 3GYCA 1XBZA 3BE7A 3UJSA 2JKAA 3VNYA 2YKKA 4P61A 3GHRA 3ITGA 5FEPA 3EX6A 1O68A 1F07A 3I3EA 3SUVA 1UP2A 1T96A 3DHPA 4WGHA 2P88A 4KCTA 2VZTA 1A3XA 4AWEA 1CGVA 4JNZA 3IAQA 1SFJA 3MMWA 3I65A 4IJBA 5DRIA 3STGA 5DCBA 4GY0A 1SW0A 5AHEA 1P1MA 5EA9A 2XH2A 4I7UA 3QTGA 4AZHA 1L2UA 5I78A 2PDFA 1M6JA 2J8TA 1BTCA 1EJ7L 1ZP3A 3LBMA 3HV8A 3ARRA 5HAOA 2HVMA 3PWIA 4FMVA 3ZO9A 1XKYA 3P3BA 3M0XA 2D0GA 3H12A 1XQLA 3M07A 4ZTYA 1J96A 4B92A 4GUIA 3IVTA 3PB2A 4O1EA 2GJPA 2XIMA 1LOQA 4AH7A 4ZEPA 2PGFA 4FXFA 4KH2A 4R53A 3WYZA 3K2GA 3KBSA 1JDDA 3EWYA 3TA9A 4OTKA 2NVCA 2XYLA 3TUUA 3PZUA 3WNMA 2MANA 4DJDC 4HYVA 5A6MA 2F2HA 3VNMA 3R8RA 5D9MA 4ZOBA 3ZLGA 2E8ZA 5G2IA 2NV1A 2X7WA 3AUOA 1E6ZA 4DJFA 4EPDC 2Y7EA 5KZMA 1TV8A 4V28A 1XYZA 1XLHA 2VMFA 2OQHA 3S47A 4XB3A 1OM0A 4WD0A 1THFD 4JTQA 3OGVA 2Y7GA 1S3HA 1R87A 4Q7IA 3MSYA 3NR0A 2BY0A 3N6JA 1OX4A 4IP5A 1H5VA 4QLKA 3SIMA 3KOYA 5BXRA 3PZNA 1VB9A 3IAPA 1PIGA 3RMEA 2NXIA 1FWFC 4LEQA 4L1XA 3KL0A 4UWMA 3SY5A 2CZDA 1B31A 1FWBC 1PAMA 2ZRWA 1HL9A 4N2YA 4IPJA 1OY0A 3PS7A 2PWEA 1P6BA 2F6UA 2CLIA 1TUFA 2CNCA 4G5DA 1FH9A 5H1WA 3PPCA 3UPWA 4IFKA 2FH8A 4PTDA 3VX0A 1E6RA 4UTWC 1Q8JA 2W3ZA 4IHCA 4Q6JA 3VOIA 3SSJA 4UQBA 3ZVIA 1WV2A 4FLSA 3TDFA 2WQDA 1DJHA 1XC4A 2Y62A 2QJHA 3BOLA 1BG4A 4K1GA 3WQFA 1XC6A 3VVGA 5KINA 4ASTA 3HPSA 1TCMA 2E9LA 4Y7EA 3YPIA 3MDWA 1XG4A 4UTTC 4O53A 1G4PA 3SSZA 1E5JA 1IXQA 4ZXLA 2ZX6A 2PTZA 1QK0A 2XTKA 1F2JA 1EF2A 1TMQA 1KM0A 5HATA 4GBDA 3G1VA 3E1F1 4AX7A 3GTNA 4UR8A 3USZA 2OSWA 4PUNA 1DWIM 5HMSA 3BWWA 5D30A 3RX4A 2J9YA 3W71A 2DP3A 1BWLA 4GXWA 3B0YA 3T78A 4DLFA 4B15A 4H9XA 4XBSA 1RA5A 3WQOA 1K03A 2YCLB 1BLIA 2QCHA 5MHBA 2A21A 2QDHA 5I09A 4PE8A 4D6DA 4WIWA 1ZAIA 4FNUA 1U30A 4AY8A 4XTIA 4GUGA 4YNGA 3P80A 2HNEA 5D05A 1GZGA 3AHXA 4NP7A 3R13A 1OQFA 3FJNA 4LUYA 2CZ5A 2DZPA 4PRWA 4TIMA 2NVDA 4Q8UA 5HPCA 4MWAC 3EX4A 2GVYA 2GGJA 3T7VA 5CH9A 3ANYA 3MO7A 4MJZA 2DIEA 4PMUA 3W7KA 2PLJA 3PUOA 4C1NB 1HKWA 3K8KA 3QM3A 1FXQA 1RP9A 4HZMA 3IIXA 3OQ8A 1P1XA 2JGQA 3MUY1 1TMLA 3MP5A 5DELA 1WUFA 3LM3A 1WZAA 1HVQA 5AFDA 1TPWA 4RE0A 4ERIA 1I2OA 1MEHA 1IT7A 2TPSA 3G5EA 2NX1A 4E38A 1BKHA 3AQUA 4Q4KA 1T99A 1Z3NA 3I3BA 5KTLA 3IUHA 3P8IA 3L0GA 3SCOA 3BLKA 4S3DA 4YTUA 1F7BA 5GJNA 1UMYA 4B5SA 1E72M 4JTFA 2J7EA 3NL6A 1ZQ5A 3GFZA 1QUMA 1UKOA 2XM1A 3E74A 3CASA 1A50A 2X09A 1Z44A 4KIRA 1XSKA 3IRDA 1AD4A 4D72A 4CNOA 3BUVA 2JIEA 4IUGA 3UNTA 1KFEA 3LTYA 1MDRA 5AECA 2ZYFA 3A5FA 4CUCA 1XIEA 4RV3A 5FAJA 4HZ8A 4ZODA 5CZSA 1S5MA 3GXFA 5MKGA 4IICA 1DXFA 1F3XA 2NQHA 1XLBA 3VIIA 1XX1A 1TWZA 2G95A 5BOEA 3P8JA 3H7UA 3K5XA 4R33A 2Y7FA 2RHGA 3WLHA 1FDJA 2D0HA 2AL2A 3UU0A 4CQ8A 1BXCA 1US0A 3AXKA 4G1KA 3SY1A 4TUFA 1H1ZA 4LV4A 5TNVA 4NKCA 1P7TA 4GIRA 4ZE5A 2R82A 2ZRXA 4PMNA 4Q4SA 2XDFA 3APYA 1WKYA 1P5BA 4DXXA 3PUDA 3PTQA 3LB0A 1S2CA 3R89A 2BGNE 1IHIA 3RUBL 1EP2A 1CGUA 3NO1A 3WFLA 4M51A 3VNKA 3V3WA 2Y2WA 4LRTA 4DJED 4NXSA 2HVOA 3H22A 5A94A 3ZVHA 3ARSA 5K9CA 4JY9A 3S1UA 3ARYA 1WB0A 3NCOA 3LK6A 1GOOA 2W6RA 2BLEA 5DFAA 3PPGA 3QZEA 4JIQA 4GJIA 1DE5A 4NZ3A 4PUEA 3BLPX 2VUNA 3FV9A 4V1XA 3MZ2A 3XINA 2QLYA 4B5UA 1RJPA 4YCPA 1V4YA 1XCFA 2E6DA 1M53A 3SN1A 3WZ0E 1OK6A 3LNPA 4LCQA 3UETA 3WF4A 2AAAA 4L6DA 4UNKA 4KEUA 2VEKA 4IPLA 4RE3A 4KF1A 3M64A 4KPLA 4BQ5A 1TSIA 3NL3A 2PDIA 1X6LA 3STEA 1B3OA 3N6HA 5FOOA 2PDLA 3VGEA 4HD5A 4L65A 5LNRA 3BJTA 3H2NA 3RLHA 3VCCA 3L9CA 3G1FA 4IF2A 1FFRA 1MRQA 4GNJA 1R2SA 1WUEA 3P0XA 1A53A 1ZLPA 3FJLA 4QS5A 4DF2A 5FACA 2P50A 2C16A 4GY1A 1UR4A 3CMFA 3U9IA 3G8RA 3SECA 2DQWA 2QCEA 2GFTA 2GVEA 1T41A 1EHNA 1V93A 2A1YA 3TIMA 3BVJA 2Z2UA 3V0UA 3QBUA 4IT1A 2XH0A 3RU8X 2VD9A 3U8GA 1AQFA 1M9HA 3CIVA 3QHOA 4J3VA 5C7HA 2A7RA 2QULA 1KRCC 2CLMA 1K9FA 3GNOA 1ECEA 3LA4A 1WXZA 2X41A 4QFUA 1BYAA 1F9CA 1SQ7A 2VURA 4KWWA 2R6OA 4LOCA 3NURA 3E0IA 2YXOA 3M41A 1TVNA 3F4VA 3CC1A 1LT7A 3BLEA 1P6WA 3W2UA 3IUIA 3AS3A 1XLFA 4FP1A 2FFCA 3QPEA 4C6PA 3WH9A 4Q22A 2P0IA 3TROA 2PS2A 4JTCA 1SSGA 2OELA 2YLLA 3C0JA 1TA3B 3WELA 1EOMA 1QT1A 2BVDA 4GX8A 3DBNA 3NSMA 1TV7A 3APTA 3U48A 3JW7A 1QPNA 4YJ5A 3ZWTA 2V63A 2D23A 4XZBA 3W02A 1EBGA 2Z0IA 1DKWA 2ALRA 2PWDA 4F0KA 4YTRA 2E6YA 4EWJA 1RQEA 3VE7A 3TQPA 3W2MA 4C7DA 1X6NA 5E70A 4F4RA 1AJ0A 1EXBA 4RCXA 3PZTA 3FNDA 3P67A 1H09A 2PU0A 5JH2A 2BVWA 2QQ6A 2VEGA 1QOXA 4H7CA 4FR6A 1JCXA 1DP0A 2J9ZA 1IIGA 1LCOA 4C6EA 1BWKA 4H8VA 3T40A 3QHMA 4FR1A 1WBHA 2JKEA 3U57A 3BTNA 2X1RA 4S39A 4EOUA 3WQGA 1QR7A 1UBPC 4OIFA 3CH0A 4C7FA 3FVDA 1EJWC 1XPYA 1QK2A 4JTGA 3G3DA 1UWIA 3LHWA 1FWCC 1HVXA 3DC8A 2QYGA 3GDRA 4LUSA 1W1A1 4XAZA 3TJLA 1QRQA 5LIYX 3T0DA 3W28A 3CWHA 3R94A 3WQ6A 3B97A 3MHFA 1J6OA 3IJQA 4ROQA 1KM6A 3HG2A 3ORWA 1MEIA 3CLWA 1QWGA 5HANA 4BQ2A 3DYOA 5E0FA 1N55A 2FQIA 3NL5A 3H8AA 1YKWA 4GQBA 2ZDRA 1BTMA 1GQLA 1TB3A 3HPZA 2P0OA 1FWNA 2ZUSA 3MVTA 1PX3A 3GXTA 5I0DA 5C9ZA 3G1RA 4QCFA 1DL3A 2XN2A 1QU4A 4HPJA 1TJ0A 2OZ3A 2OEJA 2G3IA 1UWAA 3FLUA 2C6QA 1KCLA 4JCMA 1ZAJA 1RK6A 4X63A 3NEHA 1SZFA 3V0TA 1M5WA 1KXVA 4OV9A 4A8IA 4OFCA 4GUFA 2V38A 4AF0A 3EAUA 4AVOA 2YDSA 4S3AA 1IWPA 4L1GA 4ORIA 1ITCA 4QITA 4JHOA 1AW1A 3VU2A 3CZEA 2FGBA 3KP0A 1Q3NA 4GA8A 4NJIA 2EPHA 3WLJA 1KR1A 1Q6DA 4WUIA 2QUVA 4WY0B 2CETA 5LNWA 3DFNA 4WVXA 4QLLA 4ICNA 2QV5A 3GFYA 4GYKA 2FB2A 1TUXA 1TFVA 2PAJA 2XH4A 4W7VA 4P7LA 3UEQA 3CQ0A 4REQA 1W1VA 2YLAA 1FHDA 5HDRA 4DUXA 3AHVA 4N42A 3CAVA 3WDHA 2ZZ5A 3EDKA 3L4XA 2HS8A 1IEVA 2VFEA 4ERGA 4MFDA 1TZZA 3WDRA 5HOSA 4LAOA 2HZGA 5D03A 3WLTA 2V5KA 3PZMA 4AIBA 3BGJA 3TN6A 3Q65A 2O92A 3WEOA 1RVKA 3DFSA 1LTDA 1EL3A 3NO3A 4Y8FA 4A21A 2YDRA 3W0KA 1NM9A 1WE5A 2QCDB 1Q13A 3ITYA 1ZU8A 2BB0A 1ZP4A 3B8SA 3MB9A 3VUSA 2YCKX 3OLDA 4Z2GA 4KCVA 1UB3A 1TYGA 1Q7ZA 2DIKA 1UD3A 1KFBA 4UB9A 2J7GA 3KWXA 4UFKA 1VJIA 3Q45A 1PHQA 1I8JA 3IS4A 1TPUA 3CPUA 3MMDA 2I14A 4BS0A 9CGTA 1UZHA 3TNBA 3WBEA 3BSMA 1OFAA 3CL7A 3AIVA 2CZEA 3O63A 2QEZA 2UZ9A 2XU2A 4HVXA 2GSEA 1GOQA 3TONA 4C5ZA 1W2VA 1Q65A 4LYRA 2XVNA 4YVXA 3FVMA 2AKZA 2PU1A 1KO0A 2WSKA 1A5OC 1ZFJA 3UJEA 1E6QM 4A29A 4E0CA 3WENA 3R58A 3GWQA 3VGGA 3UD6A 3K30A 4GKTA 2PDGA 1KM3A 3WH7A 1XV8A 3EWDA 3AIQA 2QCFA 3THUA 3PB0A 3AXMA 1UR0A 3DFTA 3AYSA 4Q4OA 1UJQA 2E1DA 4G8TA 3BAWA 3SGUA 3S46A 1FKWA 2Z6JA 3E2VA 3IJ7A 5HBFA 1XBYA 3AXIA 7REQA 2QPUA 1MXDA 4I9TA 1YDNA 4L64A 3NOEA 1MW2A 1RR2A 4YL2A 1VH7A 4IX0A 3BGAA 4JDYA 4QNEA 5A6BA 2DDXA 2BZNA 1E40A 4AD2A 1SW3A 3UP8A 3LS9A 4ERAA 4FS9A 4CNPA 1E9YB 3LCLA 2BMBA 3M5ZA 3AIUA 3QQWA 2OEMA 1OYCA 5F4SA 1ZTVA 2WLYA 1XIBA 4G7EB 4K7YA 3IK2A 2WBGA 2I1OA 3TCSA 2GQ9A 1UWTA 1ZUAX 2B4GA 4HJWA 4DQWA 3T1GA 4MF4A 3URQA 3ALFA 1QTWA 1UKQA 1QVBA 2PURA 1LP6A 3GQYA 4DZHA 4MKSA 1O4UA 5H91A 4IH3A 3QRHA 5DXXA 3JS3A 3LPFA 3D3AA 4TVUA 1BVWA 1LLOA 2X1UA 4L4OA 4XWUA 1C90A 2CBUA 4YVPA 2O9TA 1TRIA 2XZ7A 5HWMA 2ZX7A 1JCMP 3B06A 3ERPA 3COTA 4C6CA 4L6HA 1BRLB 4DUOA 3BOXA 1FWRA 5D4YA 5I07A 2DVXA 1HF6A 4PULA 3RPDA 1GOXA 3BL3A 3AIRA 4XBJA 2ZVRA 4UCFA 3VNJA 4C6OA 5FEXA 4M24A 2X2GA 5J5RA 3PVFA 4W87A 4LSBA 4ZO6A 2DJLA 4K2SA 4HA4A 2CLFA 4C6BA 1XLMA 1IXOA 3MBDA 4JFUA 1MNZA 4QG9A 1NU5A 4QP0A 1ICPA 1SFSA 3HU7A 1UD6A 4PSRA 1JNDA 2VX5A 3II1A 1WAUA 2E0PA 3L5LA 3R6IA 1CIUA 3N12A 5K9DA 3FN9A 3GNDA 5JBFA 4MPKA 1R7OA 2CLKA 1Y5VA 1V0LA 3PBUA 4DELA 3M6DA 1PBGA 4GY7A 3ZLHA 1V0NA 2A3EA 1JZ7A 1KA9F 3ATYA 3HV9A 2PEVA 1JF5A 4FOUA 3C2RA 3VOCA 2Q3RA 1RBOB 1RA0A 1YXDA 1ISZA 4AUBA 3MVIA 3P2VA 3EWWA 3SQMA 3KRZA 1MUWA 3LU2A 4UC5A 3C8NA 4PMJA 2YYTA 3L0KA 1JYXA 4LF2A 3VAVA 1ZBVA 1R7AA 2I5IA 4JTIA 3UWZA 4O0QA 4XZNX 4JQ4A 4Q4RA 1DWGM 3S2NA 4LVFA 4S3CA 4ZCWA 3UWVA 4HHHA 1IEWA 3BQ5A 1W1B1 2EF9A 1E4MM 4U33A 3WUFA 1E1CB 2ZVIA 4RNHA 1JUEA 3MHGA 2OLHA 1E4IA 2ICSA 2VC6A 1WDWA 2D2OA 3B4YA 1J0IA 1F73A 5ABHA 4MUPA 4F2TA 3WLSA 3DKLA 3N4FA 1E71M 3UA3A 2B81A 1JPIA 1JRCA 2J8GA 1T8XA 1W1ZA 3GW0A 2A7PA 4GXPA 3MQTA 1LROA 1NP2A 4FOJA 1SVDA 1VZWA 1TX2A 3V5OA 3N15A 3TP4A 1KFLA 1BYBA 2CERA 3TSDA 5C54A 2DPEA 1V6TA 1AJ2A 1V6UA 2IKHA 4QQ3A 2WMIB 4AZGA 5EPDA 5E93A 3W6YA 3EDFA 2I9UA 2ATSA 4NQ1A 1OIFA 3UWEA 1GGOA 2EGZA 1M7XA 3M0LA 3AZRA 1WKDA 2W66A 1PB0A 5TAOA 3GK0A 4E4PA 4Y6GA 1FBAA 4NX0A 3PPFA 5FIPA 5A2CA 1RPKA 4QISA 4I3GA 3A21A 1M3UA 3CV2A 4DB7A 2CXEA 5FJUA 4GJJA 3F2CA 3BZGA 5TQLA 2Z27A 3QR3A 3GVVA 4XZWA 1GHRA 2VC7A 4ZQMA 1U33A 3ZMRA 1CI1A 2A6LA 4QSHA 3PANA 4WKHA 3CT7A 3CBWA 3OVRA 4DX3A 3TOPA 1CXHA 1EJXC 3M0VA 3MHUA 5CPQA 3EOEA 2WHLA 1KM4A 3JU2A 2UBPC 1WXYA 3FHQA 2PWGA 1G4TA 1R46A 2R14A 4HHLA 4N6FA 3WK2A 5D2YA 3BJSA 1NOWA 1H7XA 4ZO7A 3VNLA 2VCAA 4MKVA 3Q37A 3V36A 3QV6A 1DWJM 2J9XA 4B90A 4D2JA 3D0CA 5DF0A 3MO4A 1EWEA 3NGFA 2JE8A 5LA2A 3U3HA 1KR0A 1NAL1 4E4UA 3BW2A 3WK0A 4HQVA 2QV4A 2R1PA 1TPVA 2BG5A 3RCYA 1POJA 3MYPA 3UWUA 1SUXA 5I24A 1EPVA 3IJ6A 3BDKA 3F4CA 3SCNA 1RVGA 3CXOA 2OQLA 3MUXA 4HOXA 3S9ZA 3NYDA 1MMFA 2OZTA 2Y4SA 3T42A 4IIBA 3CWNA 5HNRA 4LEFA 5I79A 1VBJA 2G50A 3DC0A 5IXEA 1CBGA 2Q6ZA 1TPB1 4FI4A 1XXXA 2H90A 3VUPA 3GC4A 4OUIA 3DOPA 3FFSA 3UERA 3W7JA 1U1HA 3PNUA 1RCXB 4TMCA 3QR0A 2YA2A 3ZYZA 3M46A 5TF0A 3UT0A 3EWCA 2ZX9A 1I60A 2DH2A 3ZT6A 5MF5A 4PCPA 1X7IA 2ZX8A 3VGBA 2CLLA 2QUUA 1TR1A 1HJVA 4N02A 5H8PA 2Z00A 4GZ7A 1V6VA 3LGDA 2V5LA 4K36A 4PB5A 3WDPP 3AXXA 1UW9A 2DW6A 4PN2A 5ABFB 1KXHA 2JKPA 3TEVA 4FIQA 4FXJA 2A5HA 1K1DA 4CD4A 3MU7A 3LPOA 4M1RA 2VELA 3RN6A 3TA6A 4DJEA 1BXNA 1VC4A 4IQEA 1G1YA 1LBLA 8CGTA 1OADA 3S1VA 2G8ZA 2Z28A 2VP8A 3W3OA 3LCXA 1TX0A 3NQBA 4MM1A 3CHDA 7PTDA 2FPTA 1JI1A 3W27A 2J7BA 1YYAA 3ARVA 4PCTA 4WJXA 1W9DM 1IF2A 3DKJA 3T0BA 3FS2A 4LBUA 4TX9A 3SUSA 1Y5WA 2F61A 1K9TA 3FAXA 4PMYA 4HK7A 2CPUA 1ICQA 2QW5A 2PZ0A 4QG8A 4JQAA 2XN1A 4CD5A 4NX5A 3ZS4A 3I7SA 3UPBA 1CCWB 3TN4A 1GVIA 3AICA 6ENLA 1NDZA 3M4HA 2I17A 4KGJA 3OJGA 3UJRA 1PWLA 3HURA 1H51A 1H62A 4IWWA 5PTDA 5F1VA 2V6AA 1WDQA 3MA8A 3P60A 3WLNA 4FLOA 1V3KA 4A8LA 4DJDA 4XSMA 2YYUA 1G0CA 3QPYA 1WOAA 1GVYA 3VIOA 4A22A 1DQWA 3SJNA 1LQ0A 3GNXA 4H1ZA 3URBA 1AFSA 3PR2A 2XFYA 3ME3A 3T6CA 2R1KA 3ISIX 3O2LA 3M0JA 3PUGA 3TFXA 4A6GA 1DTNA 1YTDA 5LIUX 1QAPA 1QWKA 4G1NA 3LV5A 2E6FA 3GTIA 3XISA 4OT7A 3ZFHA 2EPMX 4UOQA 4QJ3B 4JX6A 5D2TA 2VKZG 4WOQA 2BP1A 2Y61A 3DYMA 3E49A 5LA0A 3ITTA 2GPTA 3H2OA 4GYPC 4FXSA 1XF0A 1NP0A 2J7HA 5DCEA 3TV8A 5LNSA 4XSLA 1OF6A 3S5SA 3E2SA 3OU8A 2OGJA 3M0IA 4ACZB 1J5SA 1XYAA 1FWJC 1B2YA 5EU9A 2MUCA 4YVVA 3MMTA 3CZKA 4CCDA 1LOSA 1QATA 2HPIA 2VI0A 1TJ2A 3S2MA 3CYVA 1Q7MA 4UTHA 1W9BM 3FA3A 4O1BA 1PZ0A 4P7NA 5E9AA 1TIWA 1UD8A 3R0DA 2YCIX 4NT0A 2J77A 3LGEA 3GZ3A 5CPNA 3SGZA 1TRDA 2VFHA 4A8RA 4GZIA 4Q32A 4AD4A 4QS6A 1W3KA 3NSNA 1JQXA 3N19B 1EYEA 4I9AA 3EXRA 1KCXA 4H9VA 4DLMA 2OR2A 1QNRA 2YCJA 4QE4A 2ZQ0A 1JAKA 5CGMA 3KCLA 3QYQA 4LNCA 3I68A 4HCDA 2H3DA 4LPCA 5A95A 3ONBA 4Q4QA 4CVUA 2DH3A 4B4HA 3MUCA 1UCWA 3L4WA 4LU0A 2C71A 3OIHA 5C0QA 4D8ZA 4LJ3A 3TR2A 1YADA 2A0NA 2HSAA 3B8DA 3QGAC 4I90A 3QGVA 8XIAA 5DT5A 2WMHA 3CV7A 1H0IA 4HGXA 4X0NA 3FYOA 4U2ZA 4JEJA 5D2XA 3VKBA 3R0UA 5B7ZA 1BAGA 3QMRA 4DPPA 5CBBA 3NAVA 2BY2A 3V5CA 3T8QA 4LTSA 3JVAA 5AOUA 3DG6A 1V02A 3IGUA 2JF6A 1B4KA 3WMLA 2QJIA 2Y6ZA 1UR8A 1PCWA 2XISA 3QZ6A 6REQA 2V82A 2DIJA 3SM0A 5IDIA 4FK9A 4HSHA 1WYIA 4YPJA 1REQA 1RJRA 4RPPA 3W6LA 1XYCA 3WF3A 1QPOA 1M7PA 4L4LA 4DBWA 3A6OA 4RJEA 2WOQA 1EHAA 3SI9A 5L9FA 2PZNA 1RH9A 3TYUA 5C55A 4FZIA 4HNTA 4C5YA 2B7PA 2J79A 3WD1A 4ONVA 1OIMA 3FEMA 2VC9A 3HBLA 3SRHA 1JUBA 4H6QA 2QF7A 4H9YA 5LSMA 1A5SA 1S1PA 1NDVA 5FKYA 5H8UA 1SYTA 2VFIA 2ZUWA 4OZOA 5KITA 1OC7A 3H2AA 1TQJA 3R5EA 3DXIA 1KBBA 3R8HA 3EX1A 4IISA 2G41A 4XBKA 2F38A 3TJXA 6TIMA 1TCDA 1JI2A 1EDTA 4Q8QA 1DJIA 3A22A 4GG9A 4HU3A 1U5HA 2YR1A 1WAWA 5EYWA 1G4SA 3O05A 3BQ6A 3QH2A 4GZEA 4J2PA 2PSNA 1HZYA 3O6CA 1UMLA 2A2IA 1KGWA 3VTRA 1K4GA 2FHFA 4GGBA 2HRWA 3GYEA 3EMQA 1KV5A 3T0CA 3T0TA 3HGSA 3ZJKA 4IMFA 4EPEC 1UUMA 4KRUA 1DXIA 1HKKA 4K38A 3C5QA 4F0RA 2MNRA 1IXNA 3CV6A 3K46A 1OFPA 4OGZA 3VPLA 4J4KA 4PMOA 3FX4A 4MWAD 2WVVA 3WY1A 1AQMA 4X22A 5CKSA 4NAFA 4KW2A 4H6RA 1KBLA 3C0SA 2X1TA 5I3JA 4U5IA 1CXFA 4I7WA 4V27A 4WSKA 4AZ5A 1RBAA 4PEKA 2BNJA 1N7KA 3TNOA 2TYSA 1QMLA 4DRSA 3AIEA 4C7GA 3LDVA 2VM8A 3CUXA 2QT3A 4XO6A 1HUVA 3FOKA 2W62A 4M6UA 1W8GA 1CGTA 1OZMA 3CUJA 2EXOA 3A24A 2C3ZA 2VEMA 5I00A 3B4UA 3VNDA 2CWNA 4J3SA 1ALDA 1C9WA 1YXCA 1UHVA 5I02A 4UNIA 2D3NA 2AGKA 1GYNA 4UTUA 4R9XA 4ADUA 3ARTA 3Q67A 2CLHA 1I0DA 2J47A 2NQLA 3NPXA 4CNUA 4AB4A 5BRBA 3TYCA 3TN3A 1AQ0A 1XYMA 3F1QA 4QXIA 1GORA 4PFHA 3QKEA 3V16A 1VF8A 1ZJBA 2XUCA 2B31A 1HL8A 3CHCA 3EDJA 4W8LA 4E6MA 2ZOXA 4IG2B 3O06A 4Y90A 4C6LA 4HIBA 1DIOA 4M0XA 3VX1A 3WN6A 3PAJA 2PDXA 5CC6A 4IIHA 4NRRA 3S4TA 1OWQA 1V79A 3HQ1A 3LCIA 3W7GA 1O1ZA 4GO8A 4RPQA 5CLTA 4GOAA 2RGLA 1OCQA 1E5NA 5T8GA 3AHYA 5GNXA 2GSHA 3PM6A 4NJKA 4KEZA 3G1AA 4LH8A 3WDJA 2NXHA 3IV3A 3BJFA 3MCOA 1NJJA 4JTHA 3VIHA 2ANUA 4JN7A 5IFPA 5CLWA 1DVJA 3KS5A 1PE1A 1QO2A 3MCNA 1QHPA 1Z32X 3W7IA 1KCZA 4Y9OA 2Z6IA 3PC0A 1A5AA 5C5YA 5BROA 3FJ4A 1DHPA 4OUEA 1XWYA 4Z2KA 3W83A 3CPGA 1UR9A 4P7RA 1FY6A 1D7KA 1I2NA 2ABAA 3B8TA 4QM1A 3AU6A 4LUIA 2CCRA 4GC4A 1AVAA 1EQPA 2YX0A 3GDMA 1DWHM 4V1YA 3DHDA 4L9YA 4GVGA 1YW1A 2VEPA 4PB3A 1P0EA 3KBNA 1ONEA 5AYXA 4I9JA 4DWDA 5C9XA 4JFVA 1GHSA 1G7VA 4LXFA 1BG9A 3WF0A 2AQVA 3MP4A 5C7VA 2GVJA 3LTPA 2PDCA 4NYYA 3WUBA 4ZB0A 3GVQA 2VR2A 4JOMA 1EGMA 3ALGA 5AYBA 5HJXA 3I3DA 4GIYA 1R3VA 3GC5A 3UGRA 2QMKA 1SR0A 3KXQA 2VGFA 2UY5A 3D46A 4WJEA 2J7DA 1JCYA 1TWDA 2WHJA 3L4ZA 4CD6A 1MW0A 1NOFA 3FGCB 5CAKA 2I5QA 2NZLA 2EG6A 4AC1X 5MKGB 1MQRA 1DWAM 3RK8A 3BG9A 4GPNA 1BQGA 3GC2A 3K1GA 3N17A 1ITQA 2ZBTA 2PUZA 1IT0A 4CN1A 1OK4A 4JTDA 2RUSA 4JHMA 5CSUA 3UXLA 3MDUA 4PMDA 1KTNA 2XWEA 2VDGA 5CPTA 3TLLA 4ZENA 3NM1A 3SR7A 2QIIA 4GCXA 1E1EA 3GIPA 2E5BA 3N9SA 4NHVA 1IQ8A 2NVAA 2WHMA 3AU2A 1L9WA 1FDZA 3WLQA 2HQAA 3BMWA 3DDMA 2HTMA 5HNTA 1Q6EA 1F5ZA 1OFBA 4QCEA 2WV8A 4RL3A 1XLGA 3C6CA 1TPEA 2RJHA 2PTWA 4W88A 4ENLA 1E0TA 2W27A 4PFMA 3SCTA 3BMVA 5EMMA 3HB9A 4G7FA 2CHRA 3WFZA 7ENLA 3GO2A 4LAKA 5K4XA 3DFQA 2W5FA 1DTUA 2QKFA 1LBFA 1E0XA 3WEMA 2YIHA 5ENLA 2A3CA 1YXYA 1TZ7A 3UVAA 4HPHA 4IOTA 2GJXA 2E1WA 2O55A 2IQDA 1VIWA 3ZM8A 1JCTA 5CQ1A 1TQXA 3KLLA 3LPGA 4EACA 5CC5A 3PTKA 4Q7NA 3HIJA 1W31A 3N2CA 4JCLA 2QDGA 1TV5A 3UXAA 2V5CA 1FWSA 4JHZA 1QPKA 2A85A 5DBTA 2R91A 5AZ1A 1TJRA 3A64A 3PBWA 5DO8A 3WLKX 1V6WA 2WSRA 1CXIA 1UH4A 3AMGA 1OFEA 3KZPA 2VR4A 5FJTA 2PC4A 1XI3A 5A6SA 2WZIA 3LQLA 5D38A 3I4EA 1JZ4A 1W9XA 1VGAA 3VYLA 3MKKA 3MT1A 3IIPA 4M6QA 3W7QA 2CHOA 1R8LA 4F79A 5FJOA 5AVNA 4KT2A 3UWQA 1ENUA 2QCGA 1P0DA 4IIDA 2C0HA 2VQTA 3W07A 4AVNA 2NLIA 3KZSA 1J2WA 1CT5A 1D3CA 1CB7B 4GQRA 1V6XA 2GDUA 4GIAA 5D9NA 5IHRA 4O52A 2X42A 3T07A 3T09A 3C52A 2BXVA 3M0MA 2J25A 1AL7A 3DGBA 1E73M 1OX6A 3MWAA 4LFYA 4Q8NA 3RGTA 1HKMA 5BXSA 1R3RA 1XG3A 3WDIA 1MW1A 2YZ5A 1PX4A 2BODX 3B9AA 3OZPA 2HISA 5CG7A 2PODA 3LX9A 3C2EA 1V0MA 4UFLA 5KZEA 1QI4A 4GNKB 4BF9A 3TYAA 5E0KA 2BSLA 3HOJA 2DU2A 3RX3A 2DGAA 2ZA3A 2XG9A 1J0KA 5E0CA 3CUGA 1EGZA 1BKSA 3PWGA 3RG6A 1DXEA 5CSYA 2BS9A 4CEUC 4C6NA 4KMQA 2YFNA 3PZ9A 3B0PA 4XAFA 1AW5A 4LBRA 2REQB 5GNYA 1XGZA 1XLAA 4CNSA 1Y8BA 3RNDA 2VYOA 3NOYA 3RRXA 3WLRA 5B7YA 4OOZA 3BSGA 3N3TA 4JQ3A 1EA0A 3WLMA 1SJAA 1XDJA 1CGWA 3TLQA 2JBMA 1P0KA 1VJSA 3LM7A 3N6QA 2H3BA 4BF7A 2XIOA 4US6A 3IJ8A 3ZR4A 1E6SM 1BVNP 3UNDA 2VNCA 3PZQA 4K6AA 2XPKA 2UWFA 3C8FA 4KS0A 1SO6A 3V35A 7TIMA 1GKPA 1E56A 1ZPTA 3THCA 3W70A 1TPDA 4ROPA 2BBFA 1RAKA 1EPXA 4JIIX 3QOMA 4Q8TA 1NOUA 2OSXA 3VIJA 2VL4A 4P8WA 4AZCB 2F8QA 5DXYA 4NL1A 5AYYA 5JVLA 1H3GA 2ZX5A 1SJBA 3P74A 1JCLA 3NDOA 3T8LA 1U2YA 2D3LA 1EIXA 4DVOA 1GVQA 4V15A 2WM1A 5LYRA 2WC7A 4WSJA 3K1DA 5A8PA 2AMXA 1T40A 3CTTA 1FH7A 1NWTA 4KBXA 4ADTA 4KRZA 3UFYA 1TWWA 2HPMA 5HMDA 2AKMA 3EWBX 3EA2A 5LXXA 4W4QA 3VIKA 2Z24A 3WNPA 1XRFA 2VRKA 3IJIA 1FWIC 3UZZA 3V75A 3CAQA 3CHEA 4FX6M 5A6JA 4O57A 4J35A 3KL5A 1R3SA 3ZSTA 1J12A 4NXKA 3HPFA 5A5WA 3KDOA 4LRSA 4IIFA 4JS3A 2YB1A 3VIGA 1ZCCA 4IGHA 4H04A 4EF9A 1M04A 1TELA 3DECA 4H2HA 4IGNA 3E0FA 2J8FA 3TOYA 1JR1A 3GBDA 6TAAA 2CLOA 3IWPA 2QJNA 4MB5A 1ZSXA 2FTYA 2ZC8A 2FZ8A 3KOFA 5BRQA 1OFOA 2J6XA 2W61A 1NIUA 1J5TA 1J2BA 2WNQA 3P62A 4US5D 4K1WA 1HN1A 4D1IA 2ZE0A 3LCGA 3O0KA 5EBUA 4C6JA 4B9ZA 4OWGA 1I45A 4B5VA 3SURA 4F8XA 4IIEA 1V3JA 3SCSA 4ZFMA 3GX9A 1MI3A 5DQPA 4B91A 2NUYA 4ZZ9A 1YRRA 3N9KA 1SSDA 1MXGA 2GWNA 1QNOA 1VP5A 2F9RA 3RYSA 3TR9A 3R0KA 3NVDA 3TTEA 2YDQA 2CBJA 1YHTA 3U7VA 2PF8A 3PTMA 1YPIA 8TIMA 3WMCA 4JPGA 3MUAA 5CPLA 5HMFA 3VO0A 3W6MA 1HKJA 1GG0A 2CEQA 3I6TA 2CZFA 5A6LA 3SDOA 2Z25A 3I6EA 2HK1A 2AL1A 3GNRA 4LC8A 1WZMA 3S5OA 4YTQA 3G1XA 3WIJA 4YIWA 3W53A 1QFEA 2QCMA 3F2DA 3VD3A 1R3WA 1EKOA 2TSYA 4X9SA 4F0SA 1RALA 1JL8A 3NUKA 2C14A 1KBJA 3KW3A 3FSTA 4GJ1A 3E38A 1UH2A 2GGEA 1FOBA 1TVPA 2HXUA 5D33A 1US3A 2F2KA 2G5WA 2WZMA 2DORA 3TYZA 3OZMA 3EGJA 1CTNA 4O4WA 4UQEA 1T6MA 1TE1A 3OBKA 1D9EA 1YE4A 4PB4A 1WKEA 3TWBA 1B90A 3M47A 4GWEA 1PIIA 4BQ4A 1X38A 3GG7A 3RF9A 2EG7A 2AGTA 1W54A 1TPFA 5A8NA 2OG9A 1E9LA 4D6FA 3OA3A 1B3WA 4Z2JA 2CLEA 2R9RA 5HR6A 2CU0A 3IK4A 1GVSA 1RY8A 5CZJA 4EXBA 1FP9A 4XZMX 3QY7A 3BO9A 1YDYA 2PPGA 3C2VA 1Z42A 3D47A 3WQ4A 1B0IA 1PHWA 3V0SA 4CEXC 2JALA 4X0VA 2Z29A 5G4EA 1HX0A 4QX4A 4XZHA 2W91A 4CD7A 1LQ2A 2C0AA 4AEOA 4DM1A 5BNKA 1NDWA 2JK2A 3R4IA 3S1XA 2PWFA 2YL5A 3O9NA 1Q45A 3B8VA 3EWXA 2ADAA 1A3HA 3B8IA 2DVTA 1PKNA 4Q3MA 1PJ9A 1GZ1A 3KOWA 1R2RA 3KBVA 4FB7A 1QOPA 3PNZA 1ZB5A 5H6HA 1FXPA 4AWUA 3BG5A 1W8SA 3ECQA 5GQBA 4FNQA 1DYSA 1SJDA 3IUDA 4JTKA 3N13A 4S1FA 1ZCOA 4PR4A 3NQ7A 5DBUA 5FSDC 1HT6A 1IE7C 3CO4A 4S3GA 2QGHA 1UG6A 2NT1A 3PWAA 3RPTA 4ZXOA 3HQNA 1KTBA 2WVUA 4MPQA 3LHTA 3B9EA 4TV6A 1DJXA 3W7DA 2WCGA 3KTSA 4DWSB 2Z7GA 3A4JA 2PTYA 3PUEA 1JPMA 1GW9A 1NVMA 3RJYA 4FF5A 3I10A 3AUJA 1G69A 3RO8A 5A8QA 4W7UA 3E2QA 3KHDA 2ISWA 4MY9A 3VFLA 5JIWA 4KRTA 1BXBA 2HDJA 3CPRA 3CUHA 3W24A 3E2RA 3ZR6A 1VFMA 4OOUA 1Q7QA 3BXWA 4LC6A 2B7NA 3H54A 1ITXA 4W93A 2UY3A 3SN0A 2FPVA 2XIQA 4DJEC 1K7XA 1NELA 2XGZA 3AC0A 2PB1A 3U2EA 3L23A 4IPNB 3AMKA 1H60A 2YCEA 3U2OA 3A9IA 2VZOA 4HK6A 1UC4A 5C2GA 1C9DA 1S39A 1EZ2A 5TIMA 2QJGA 2E5DA 2IQ0A 1NDYA 4MY1A 4DAIA 1ZGDA 4CCCA 1XUZA 2Y8VA 3LXBA 3TAOA 1Q6GA 4S23A 5EMKA 1GOIA 1XP3A 1UP3A 5IDZA 2XVGA 4HCLA 3H26A 3O6DA 3GDKA 1XLDA 1PUDA 2DZVA 5I03A 1TA3A 5JXQA 1J0YA 4NJJA 4XD3A 1A5KC 3W7PA 3UA4A 4O50A 3K4DA 1BHGA 2AOSA 5GJMA 1F8MA 1KXQA 3BSHA 2PGWA 3F4DA 3TAKA 3A4AA 2O0TA 3PJUA 3VKDA 4Z42C 4P7OA 1T7LA 1Q66A 3CZ8A 4RW3A 1WXJA 6CGTA 1MVYA 1T5AA 5C9WA 2E77A 3W1TA 3O6AA 2WPGA 4O16A 5GNZA 3T0AA 3LQGA 5AN7A 1A0CA 3T4CA 2WMGA 1W0MA 3TK7A 4ES4A 2FJKA 2J6VA 4PMZA 2FHCA 4DXKA 1EC7A 2QS8A 1MEWA 1EDQA 3PY2A 3QQ0A 3W82A 2J62A 4BI5A 2BHYA 4W84A 1PTDA 2VENA 1OGGA 5HQEA 5M2FX 3LENA 3P93A 1EX5A 1JZ8A 3VMNA 4IFRA 4J3WA 4H9TA 4AMCA 2D73A 1VAHA 3CM4A 4M8UA 3OG2A 3IVSA 3Q4DA 1TG7A 3AYTA 2CW6A 2KX9A 4AVFA 2FZ9A 3D6NA 3VMOA 1EC9A 2PWUA 3L68A 3V7PA 4GBUA 3S83A 4LBSA 1W5MA 1CZ1A 3B9OA 3H4XA 5AHIA 4YWIA 3CQHA 1M41A 3ITLA 3H70A 1PTGA 3GNNA 1K4HA 2Y70A 4IGMA 4UMBA 3A23A 3TYEA 4H19A 1XFCA 1W9UA 3NWRA 3TTQA 1K7EA 2A3AA 3WH6A 5CJNA 2H9AB 4MJ2A 1O60A 3WK1A 2ZWYA 3CZGA 1E9IA 3EYPA 1PEZA 3DU0A 2VX6A 2WKGA 1PXGA 3QLDA 4CD8A 3O16A 4AZBA 4LAZA 3G8EA 4ATDA 3P84A 2VTFA 1I2QA 3NEVA 4XIAA 4YU1A 4Z0SA 3P81A 4O14A 5REQB 1AUSL 2DZAA 3C0QA 1NARA 2QUMA 2YGYA 4LS0A 4RZ6A 4GHRA 4YN5A 3GXIA 4DJFD 1XICA 2GK1B 1SW7A 2VOTA 1O95A 4JTEA 3W88A 4HK5A 1GQIA 4GFIA 3RR4A 4GYFA 1H7NA 3RLUA 4M82A 3VABA 4MKNA 3N2TA 3TQ0A 2V2DA 1P6CA 4NZ5A 1I4NA 3VOFA 1S46A 4LUJA 3RR1A 4BK9A 2PP3A 4NY2A 3T4WA 5CJ5A 4XZ9A 5F4WA 2P3ZA 6A3HA 4A4AA 1O94A 2EKCA 1JULA 4EWND 4HJFA 3W7RA 3S5NA 1A49A 1HP4A 1O66A 4ZB2A 3URNA 3OODA 4B5WA 1PKMA 2C1HA 3EDEA 1B9BA 4KWSA 4QEHA 2P53A 3NZPA 3E0LA 1WZKA 3HO8A 2A3LA 4DXVA 3RHGA 3U5YA 2VQUA 2ZUTA 4EVZA 3TFCA 3WH5A 4GYPA 4QDMA 3S1GA 2XSXA 3LD5A 2QCDA 4DYEA 4HHMA 1UKPA 3CTLA 4ZQCA 3MSGA 1QNPA 4Q8MA 4GUHA 1NTHA 3E3HA 4LVGA 3XIMA 4L80A 4A35A 2GJLA 2IUZA 2NV9A 1WA3A 3OLEA 5CGQA 1KXTA 3L2IA 1ME7A 1DIKA 2QPSA 2H8ZA 5BOFA 2VT0A 4ML4A 3BLOA 3QMTA 2NLYA 4HNCA 1ZBCA 4OBTA 3SUTA 4R85A 1TWSA 4U4MA 1DJZA 3K8MA 4B5TA 5D9OA 3HG4A 3TX9A 2ONEA 5BWFA 2OPJA 2DJXA 3FIGA 3VM7A 2E09A 1SGJA 2P3EA 5HR7A 3FY1A 3UF9A 1SO4A 1XDLA 5C6MA 4Z1AA 3LERA 1EXPA 3WCZA 2XVPA 3GR8A 4C1KA 4JX5A 3EDDA 3VXGA 4TTUA 4QG6A 2FYMA 1W17A 3EPOA 3F5KA 2DVUA 2J66A 3WEZA 4V33A 2BASA 3DCPA 3NXLA 2EHHA 2QAFA 4UNLA 5LNVA 1A0EA 1XUUA 5AC7A 4LF1A 5G4WA 1J11A 1SMAA 5BRPA 4PCSA 4C1LA 2XN0A 2QCNA 4K8HA 4D71A 1ZNNA 1Q6RA 3VOJA 1AD1A 4EE9A 1JDAA 2P1FA 4TQTA 1RHCA 2XVKA 3VDCA 4KFOA 5E6YA 3R7MA 1AW2A 1WOBA 1VEPA 1XRSA 3ARQA 2YPIA 4C6QA 1OGSA 4GI8A 4WHBA 1G94A 1UA7A 4MB4A 4QROA 4K8GA 3N3MA 1OFQA 1WPCA 4B16A 1KGXA 2ON3A 4M6PA 3AJ7A 2BY1A 4YYFA 3NZRA 1JFHA 1LT8A 4LWWA 4BEUA 2H6RA 3T81A 7CGTA 4W7WA 4G7EA 3W1RA 4WDUA 1FHUA 4S2CA 4ZQRA 1N8IA 1V08A 3KBWA 4JYFA 5JUVA 4M3PA 3I4KA 3REQB 2F6KA 4J5NA 3SCRA 3DERA 4XIMA 1SU5A 1VFTA 3VCNA 2E5CA 1UASA 3WL1A 4B2DA 3LTSA 4YHEA 2VFDA 2VCCA 1QI2A 1OD0A 4BWLA 3GXMA 1XH0A 1RSCA 3WK3A 1IEQA 4R7WA 2O56A 2GUBA 4AFYA 1PVNA 3RJXA 4HA3A 4I8YA 4HSNA 1UPMB 3KWSA 1XH2A 3RLGA 3EMCA 1YLVA 4JKKA 1GQJA 3POCA 1Q4WA 4ZTXA 2G0WA 1LG2A 3VZZA 1F6YA 2O9PA 1K9DA 3AOFA 1LUCB 3VZXA 1E0VA 3CWOX 3A3XA 1X1NA 1WX0A 3IARA 3DFYA 1FHVA 3ARWA 3EEGA 2VDHA 3UZYA 4B3KA 3BCFA 4WCJA 4GH1A 1EYWA 4NI3A 1XLCA 3NQ2A 1UQZA 3S1WA 4WGXA 2GJRA 3ITXA 4GFSA 4QBXA 3VMPA 2DSKA 4NVTA 2R1LA 4O11A 4PRTA 4QAWA 3TN5A 4J3TA 1Q4NX 4GZJA 3UCQA 2F7FA 4POCA 3OOQA 1TTIA 1LJYA 4FLRA 1DBTA 3O6YX 5F2LA 3NZGA 3KVLA 1I2PA 5FF7A 1UC5A 3SQLA 1EEXA 3CAWA 2J75A 4TVDA 3DFOA 1J0JA 3FXGA 3GR7A 4A3QA 1W1PA 3VDHA 1JRBA 1HJSA 4ZMGA 1HIZA 4D6CA 2QVNA 3L21A 3BARA 1VEOA 4B3LA 1JZ2A 3LSBA 2DEPA 3WNOA 3WQCA 3MUZ1 5FJJA 3CMGA 4DY1A 3TSBA 3W86A 2OOGA 3BAKA 3L2MA 2Q09A 3T05A 4GLEA 2VOMA 3KRBA 3SGGA 2IQTA 1XM3A 5I7GA 3VE9A 3ZJ7A 1UWQA 3AROA 4AYGA 1AH0A 1QHZA 1FTXA 1FCVA 2C18A 1OF8A 4DM2A 4UOJA 5AB3A 5D8ZA 1I9CB 3A9BA 3M1ZA 2DUXA 5EFFA 3VNZA 1J01A 2VJXA 5M17A 2WZEA 4AG0A 1GKRA 3AHTA 4KIEA 2X0YA 2VGGA 1Q63A 4AISA 3RX2A 3MI6A 3GAYA 3WF1A 3GVWA 1E1CA 3LMZA 5HUPA 2ISSA 4L6OA 3CUIA 2VVNA 3C3NA 4WXZA 3WDQA 1E51A 4IJCA 1E43A 4R7JA 5CPSA 4P5UA 1FWEC 2I5GA 3IANA 1KBIA 1GTHA 5ECVA 1IR2A 1YEYA 3NQMA 4PTWA 1PDYA 3OG3A 4JFWA 5FF3A 1CB2A 3OVPA 3SUUA 3R25A 2PDJA 3G22A 3CIWA 1P43A 2BHZA 5FA5A 4MWAB 3SAZA 3VOHA 2WMIA 4HMNA 3UZ5A 5CG0A 4P7QA 4NJGA 4D8LA 3K4WA 4D6EA 2FLIA 4Y9PA 2HS6A 1UUQA 4F2BA 4RNFA 5LIKX 2YBUA 3VD9A 1N8WA 1ODUA 4AMAA 3OEXA 2BV9A 1KM1A 4WDXA 5F4XA 4AZ6A 4Z0JA 3GU1A 3ITVA 3TSMA 5HWJA 1SZRA 2YSWA 4UTJA 4UXDA 1EJVC 5JU6A 3LLDA 1VENA 4E2VA 4PMRA 3CJPA 3HGRA 4B9YA 4U2YA 3L5MA 4Y96A 4L9XA 3TYBA 5FL0A 4HT3A 2OT0A 3G77A 5FCZA 2HBXA 3GUGA 1MDLA 1CENA 4JQ2A 5M3WA 1JIBA 1YTKA 3F5LA 1WBJA 2CESA 4ATWA 3CMJA 1L6YA 1GPWA 1JD7A 1NFPA 1PTAA 4O10A 4R3UA 1ECQA 1B3YA 3EXSA 1Q5MA 4H01A 4D9PA 1XRVA 2NQ9A 4US5A 3BAXA 1I1WA 3V1HA 2DUAA 3QGKC 2G3NA 2WYSA 2OO0A 2OWXA 2INEA 1QBBA 4NAFB 1IZJA 1QW9A 3ABRA 4DHGA 1YMYA 3MI2A 4DBUA 5FAGA 2ODOA 5LKYA 3UWWA 2FPYA 3SCWA 3W26A 1ISYA 2OKOA 2Z1KA 1MNSA 3GBEA 1B3XA 4RW5A 2ZZ2A 1XSJA 4PTNA 3NQFA 2NX3A 2PFHA 3LLXA 3GRIA 3VGHA 5XINA 5LXEA 2D0FA 2C79A 3ARZA 3FA5A 4D6HA 3QVQA 3BLFA 3MI3A 5D8WA 1BYCA 1G9HA 4CCEA 1ZALA 1IGWA 1MUMA 1QNSA 5D2VA 3H55A 1EOKA 2GUUA 2AAMA 3UPMA 3N04A 2GQ3A 3UVIA 2PRLA 1GQNA 5D37A 4JTTA 2VWTA 5F2IA 3VD5A 3UZWA 3S42A 2PDKA 3A4XA 2O4QA 1HGWA 1C7TA 1G67A 3OPSA 1VD6A 1H41A 4BA0A 3QFWA 5DN1A 3B3DA 4FNRA 2OGYA 2ZXQA 3TQVA 3MJYA 4XKYB 4OVXA 2PDQA 3GDTA 2OZ0A 1EJSC 5G1YA 5ABFA 4S3KA 2IPFA 1B30A 3DH7A 2PA6A 4N9CA 3GKAA 1FWWA 2FZDA 3AZSA 2EPKX 3SO7A 4MVAA 1S2VA 4NZ4A 2BXYA 5I3KA 2PP1A 1BF6A 3CLMA 3TJIA 3MV01 4TXEA 4HTYA 1YBQA 1FDYA 3R8GA 1EA9C 3ARPA 4UMCA 1VFHA 4BFAA 2CITA 2IMRA 1KLZA 3W25A 4K3ZA 4AXNA 4JTUA 1FCBA 4H3DA 3HA1A 4ZO9A 2OMAA 1UR1A 1E4NA 2XHYA 4CCZA 1H49A 1PX8A 3U6WA 3LRKA 1S5TA 3K4AA 3WBWA 4P8UA 3G24A 1XGEA 2VX7A 3CU2A 2OLSA 2QF8A 3P5ZA 3CUZA 4H41A 3LBCA 1XSIA 4UR7A 2PRHA 2HMCA 3DG3A 4YCOA 2E25A 1SMDA 1M1BA 3W7MA 4GVIA 4HTBA 5FF0A 1QPQA 4Z1BA 3NFUA 3QFEA 2CIPA 1I6NA 4DO6A 3B40A 1EC8A 3JR2A 5HQLA 4RDVA 5J04A 4HU4A 4AYSA 4MIMA 4O17A 2A79A 3ARXA 2BGQA 2PP0A 1V3IA 1JAEA 3GTFA 4TR9A 4HBKA 1J4EA 4FALA 1ZL1A 4BCEA 3LOTA 2ZFAA 3KBJA 2OX1A 3MMUA 2XFWA 5C2XA 4C91A 3TMQA 1V02E 1UD4A 4MSSA 4WJ8A 4XAGA 4UTKA 2VCBA 1F74A 4GD0A 3OTRA 2OOFA 1UD5A 3HPAA 1OABA 1LRQA 1VKFA 4TO8A 4XAYA 2F84A 4RDYA 1ZJAA 2B7OA 5AVHA 3HJZA 2HEJA 3H4GA 4MNMA 4GNVA 3N2MA 1OBAA 3Q58A 4WZHA 3CT2A 1CW2A 1Q2SA 4MWAE 3H7RA 3O3RA 1BGAA 5LA1A 3OGRA 3B03A 3W29A 2Z4GA 3W00A 1GKQA 2VO5A 4H4IA 4H9ZA 1YPXA 3MY9A 4IL2A 1LBMA 1PIFA 3V1PA 2WZTA 2ZUMA 3E0WA 3W81A 4GQ0A 4O0KA 3G6MA 1PKYA 4FSAA 1SM9A 1JGIA 2I7GA 4UR9A 1VRXA 1D8WA 3GTXA 5G5IA 1AMKA 4UFJA 3PJTA 1VPYA 1WDDA 2EPLX 3O07A 2OO6A 1S2TA 3PFRA 2Y85A 5AYIA 3DI1A 4FIRA 5IOBA 2FGZA 3WQWA 2V2CA 2PBGA 4OKDA 3IGXA 5DMMA 3WD2A 1YX1A 3A12A 5DY3A 3WLOA 5A6KA 2ZICA 4IFOA 2VGBA 1HO4A 3MBFA 1F05A 4W86A 4IM4A 4AEFA 3UR2A 3PG8A 3GAKA 1L2QA 4AU0A 1H11A 2IKIA 4ATLA 4MNJA 3WBXA 4A3RA 3C2YA 3QKZA 4AZ7A 4ZOEA 1BGGA 1JCJA 4HNLA 4LYKA 4Z2HA 3SCQA 3P6LA 2ZRUA 3C4UA 1X1OA 5AYZA 4S38A 4F0LA 4WF7A 4PC8A 2OCZA 5G1TA 3W1LA 1F8IA 4CNTA 4FXRA 5A6BD 1LL6A 1UJPA 4ZR8A 1XIGA 3EOSA 1W3IA 3BG3A 3QY6A 3AIWA 4JDBA 1FCQA 4UBPC 3AYVA 4GIEA 3O1NA 3DEQA 1H2JA 5T9BG 3SJ3A 4FX8A 3W84A 3PAOA 3ZJ6A 3PBYA 2NQZA 1YTEA 4LGXA 2QZRA 3AMDA 1L8PA 2X1SA 2ZUVA 3D5HA 4J27A 5EY5A 3MJMA 5C70A 1O5XA 1S2UA 2Q8XA 2NSOA 4Y9AA 3P0WA 4DIAA 3OZYA 1R2TA 1W6TA 4M6VA 2D20A 4GINA 2JEPA 4MZ8A 1D7FA 2CBIA 1ONWA 4DBSA 3F4WA 3NG3A 3SCUA 1IWBA 2BXZA 3WD3A 3ZXWA 3LXAA 4DWSD 3SRDA 3RDKA 5A2AA 3M9YA 3V18A 2VXNA 2QR6A 3LEPA 3LLFA 1DOSA 2FJUB 3PBVA 4LUTB 4IX2A 4W85A 3W38A 2WVSA 4M7SA 1V7AA 3Q2DA 2OYKA 1H4PA 3KOZA 4ZOCA 5CBIA 1I1XA 1J79A 4JFTA 1U83A 2PD9A 4DYJA 1EJRC 1P48A 1E3XA 4GI4A 5KEZA 4D6IA 3CQJA 1UWUA 4IMEA 3RCMA 2CYGA 3LXCA 3LYEA 2J4GA 3QW3A 2E6AA 2YW3A 3TMLA 2Y24A 1ZRQA 3J7HA 3OGSA 2CFFA 1XLEA 1XFBA 3TH6A 3TC6A 3NGJA 1XDMA 3EPNA 1VPQA 3KFTA 1BSIA 5BU6A 2YW4A 1R5YA 3PJWA 4ZA0A 1FWTA 1KB3A 3N9RA 3DHUA 1VJZA 3STCA 1WNOA 2FVLA 2A6NA 2CWXA 4ZE4A 2V81A 1S38A 5A1AA 5LHEA 3BURA 1UWRA 1H50A 4HN4A 3WQ8A 1J0HA 1FUYA 3TE9A 1Z89A 3DFHA 4MJMA 3GLCA 2DSZA 1GVRA 4J1OA 4JGDA 3NZ1A 4DF1A 5FL1A 1F3WA 2OWCA 3DN5A 1XKJA 4KFPA 2X30A 3RFAA 1WQ5A 5F2MA 4H83A 1DJGA 1JXKA 5JIPA 3RM4A 1YIXA 4EANA 3EWUA 2CBVA 3TU9A 1TPC1 3WBAA 4WEVX 9XIAA 5I23A 3OHIA 2PTDA 1LDCA 3OBAA 3AALA 3S9IA 3M43A 3VA8A 4KWOA 4D6GA 4I8DA 4N7QA 1MZHA 1GOMA 3S6TA 3AXHA 3H21A 3CIXA 3GXDA 4J28A 3R79A 5FESA 3WJZA 1FHLA 1VHNA 4PBGA 3RITA 1H1NA 1A0DA 4M81A 1KGUA 4EAYA 1HP5A 1EP1A 5EMJA 4AWSA 3KHJA 1XIHA 4EK7A 3PBGA 3GG0A 2Q8ZA 2H8XA 4HOWA 4NAEA 1EWDA 2HV5A 1AZ1A 4JN8A 1K8ZA 1LZOA 1U5VA 4UTIA 1KV8A 2OZ8A 3PN8A 3KBMA 1XLLA 4QDPA 8XIMA 2ISDA 4HA0A 4IG2A 3IEBA 4X60A 4XVDA 4NNAA 5K4ZA 1OCJA 2WLZA 4MZ1A 2YXGA 1CGYA 4JFSA 1PWMA 3BW4A 4KWVA 4JXCA 4WRHA 5I3GA 4ZB5A 2VZUA 4IUOA 3EX3A 4GXMA 1XW8A 1F61A 4JX4A 3P14A 4AWTA 2XGIA 4Z1YA 4EPKA 1JPKA 1V3MA 3HF3A 4PEEA 5IHSA 3VNIA 1HO1A 3MYOA 1OGBA 4S3FA 3H53A 4HNOA 1JNEA 1FFQA 4QJ5B 1GONA 4E2BA 1SJCA 4IGSA 4S3EA 1OX5A 3IACA 2IW0A 3N2XA 4CU8A 5FD0A 1PYFA 2ISVA 4W8AA 2BVYA 4I5UA 1W2PA 1Q2RA 5EMYA 3SFKA 1XLKA 1AODA 1OSEA 2IPWA 4K68A 1GEHA 1JYVA 1YNPA 1R9YA 2VDIA 5LIXX 4XAPA 2ZADA 1L8NA 1A5CA 1KRBC 1TR9A 3L4TA 2ACQA 5I3DA 4E5TA 4L4PA 4H6KA 1S5VA 3L4UA 5E9XA 4UFMA 3LPPA 4U5KA 4C6MA 1UOKA 3EX2A 2JGYA 1ITUA 1OCNA 1C29A 4FX7A 4LT9A 2PD5A 5HMEA 2WO5A 2V9DA 3QOKA 3UR8A 4JL2A 1H7WA 3PHAA 3PSVA 3L65A 3GY1A 1XHGA 2IKJA 2VRJA 4LS1A 3UJ2A 4RKAA 3ABZA 4KETA 5BWAA 3FGCA 2FVKA 4ZQNA 2Y5EA 1PCKA 3H23A 1W3JA 2J78A 4PRRA 3WLPA 1ESWA 1E6PA 1YE6A 2YZRA 1DHKA 4JIRA 3NQ8A 2J13A 1EO5A 4O0ZA 4WOZA 2X7VA 2QDDA 3CUFA 4AW7A 4IQDA 5HA7A 4K7VA 1VFLA 3GH5A 3GD6A 1MUCA 2RH9A 1A5LC 3BV4A 3SB0A 2A3HA 1HFBA 2NW0A 1E6XM 2R24A 3D3FA 4JYDA 5JQ9A 2EPOA 5A69A 4IPIA 2YJQA 1R38A 1MW3A 1UD2A 4UQ9A 1EDGA 1UKSA 3NQGA 5H8MA 2P8BA 4OJYA 4GCAA 4MAVA 3R2GA 4UFIA 4FAMA 1IXPA 2PDHA 4MADA 1Y65A 4ICMA 3W1PA 1VCFA 4HMEA 1J8VA 4WX2A 1CXEA 5BMWA 4YTSA 4P8XA 4JICA 2WM0A 3HQPA 1B3VA 1MXSA 3UG5A 1UZDA 5IRPA 1TMHA 4FEZA 3BOFA 1K02A 1VFFA 2FMNA 3E0VA 4G2DA 3CB8A 2TODA 2Y5SA 3W37A 1X1ZA 4UMAA 2V67A 1D2KA 2BVTA 2ZZ4A 3IRSA 4DUVA 1J18A 2Z1XA 3L2LA 2VVSA 2PTXA 3ONCA 4FHAA 2XGBA 4WKFA 3CZLA 3VINA 3GIYA 3UCDA 2ZWZA 3QN3A 4QTGA 3PZGA 1HQTA 4GKLA 1A80A 5E1QA 1KQZA 1ADSA 4CGTA 1EUAA 2R94A 1ZY9A 3EMZA 4DNMA 3H2EA 4LY4A 2QCCA 2WJFA 3S2LA 1XBVA 3QHNA 1W3TA 4LB3A 4E8DA 3TXZA 1EJTC 5G1MA 4WSHA 2P8CA 1LLWA 4DJDD 2WMJA 3W1AA 2I56A 4RLIA 1OB0A 2FKPA 3SFWA 4G56A 3LG3A 4AC7C 3SQSA 1FWGC 2V5JA 3ZLFA 3BZJA 1CXKA 1HL2A 4J2MA 1CYGA 2WKJA 1F6KA 4HP5A 1SPQA 1HJWA 3V5FA 2VZSA 3UXIA 2J24A 4M29A 5M5DA 2V3GA 1HJQA 1H63A 7ODCA 5HWNA 3AIBA 1FWDC 4FF7A 3WJSA 2JF7A 3WJYA 1CXLA 5CSSA 1P4CA 4UOZA 3LHUA 4YXGA 1E9ZB 2EEXA 3KP1A 1XR2A 3TCEA 3M0HA 4JTJA 1UZ4A 1OC6A 2X40A 2EKGA 3TC3A 3I7QA 5KETA 2YBVA 4Q4MA 2WNNA 5M03A 5LZLA 2V0TA 4UZSA 1VYPX 3N2OA 3DI0A 3K13A 4ZQPA 1NEYA 3OA5A 2WHKA 4K8EA 3MP3A 2AMGA 1VLIA 1CEOA 5BW6A 2GGIA 1AQHA 4MYXA 1JUKA 1ME9A 5A8OA 2ZKMX 4GGHA 2FDSA 3NM3A 2DY3A 2REQA 1M7OA 3GDBA 2DZUA 2PDBA 4OECA 2A7NA 3CNYA 2PE4A 3M16A 2DW7A 5DY2A 4GQQA 2BFGA 1VRDA 4MZYA 3CL6A 1Q85A 4N4PA 3KVJA 4BWLC 5C9RA 1B1YA 4L5ZA 2WNWA 1KM5A 1QBAA 4CN6A 3UBPC 3AJXA 3M5VA 5F1UA 1DE6A 1CECA 2PLCA 4WLCA 2C15A 4QAIA 1CLKA 4N9BA 2ZZ3A 9XIMA 2SFPA 1RY0A 2QDEA 1D8CA 3GUWA 1N82A 1HXJA 1RUSA 2KAUC 1H7RA 3VKKA 4QJ4B 4AZCA 1N2VA 5AKQA 3ENLA 1OX4B 1DIEA 4PBFA 3NIYA 3N2BA 3O7UA 1XIDA 2JIWA 4RDWA 4RZ5A 3B0UX 4A8NA 1BEUA 3B04A 2X1IA 1TZ9A 7XIMA 4W9TA 3OVGA 3N18A 2OWWA 3FCPA 1CNVA 1I0BA 4UCGA 5ECUA 3U4FA 4IIGA 1XINA 2WSYA 4NZJA 4S2BA 3LUTA 3ZSSA 1R6WA 2ISFA 1W37A 3NPWA 4WKAA 1V5XA 3A3WA 4MFEA 3U2ZA 3IIZA 1UIOA 1WDPA 2WW5A 4TTGA 4PUJA 4IFKB 5BU9A 1ZAHA 3WD4A 1MRAA 1FRBA 3KVKA 1FQ0A 1Q6QA 2W4XA 1LWIA 3NQAA 2G4FA 3TTOA 1OINA 3JZEA 4NIRA 1Q6FA 1GG1A 4LQ1A 3G2GA 4HHPA 3STFA 2ACUA 5FSEC 1RQHA 3W7OA 7A3HA 3LHVA 2AQWA 4JY8A 5CAHA 3HM7A 5C2CA 2TAAA 4RV8A 1OHLA 1R47A 4A05A 3MANA 4M1BA 2XM2A 2ZRZA 3KTXA 3P5YA 2C1IA 3WQDA 1ZHAA 2V3FA 1VR6A 3OO2A 4OQVA 4JZ5A 3W76A 1DQUA 4AHPA 4ZQOA 4DN1A 4AHOA 2V68A 4HZ6A 4F9JA 1H7PA 3VGFA 4BHYA 1FWAC 1UA3A 4URIA 3QYSA 5AY7A 1UWSA 3NQEA 2DFAA 3A13A 1XPGA 4HYWA 3PJXA 1GVEA 5C9UA 1BD0A 2NV2A 2V69A 1OG6A 2L5HA 2OLAA 2PDWA 3T08A 4JAWA 4E3VA 4AZIA 4HU8A 2WBKA 4QEEA 5EB8A 5I3IA 1W32A 4B4FA 4KCWA 3QJAA 3THQA 4MB3A 1CPUA 4LB4A 2KZHA 3IPWA 2QHAA 4M7TA 1PO9A 1M65A 1RXOB 3W73A 1TTJA 4DAFA 4Z1DA 3OB8A 1EO7A 1AG1O 3UW6A 4D8AA 2YL6A 2V8ZA 5CPOA 2J7CA 1W5OA 4YWSA 2Z2AA 5CCZA 1GW1A 3UR7A 3SN4A 1TJ1A 2WMKA 1G01A 5CJMA 3DYPA 5CSRA 1QPRA 5GVJA 1MFUA 1H0GA 3DZ1A 1OG0A 6PTDA 1NQ6A 1KRMA 2XIJA 1E4LA 5CZ0A 3GZAA 3UZXA 1IR1A 4CN4A 1GNXA 2W67A 3MV11 1N8FA 4GO9A 4L1WA 2WPBA 4GACA 4QR6A 2DT2A 4KKXA 4MYAA 1YDOA 2R8WA 4Z1CA 2OB3A 4PMXA 3WD0A 2C1GA 3WQVA 4AHQA 3FK4A 1G6CA 4GQGA 4E3TA 3F4NA 1GUVA 2GGHA 2G96A 3IJDA 1LQAA 4O15A 3TVAA 1JQVA 1IEXA 4JN6A 4I7VA 1POKA 4CQAA 1KLYA 4FLQA 1JDCA 3ES7A 2PBOA 3PG9A 4Y9NA 3A5VA 3EPMA 2E3ZA 3DX5A 5LGXA 2WNZA 2GQAA 1EJUC 4XUYA 4Q8VA 3GH4A 1WKFA 1DIDA 2RDWA 2E7FA 3F2BA 1ISXA 4O4VA 3EKZA 3ARUA 2PGRA 3BAIA 1OFDA 1GTEA 4LV9A 2G37A 2GZXA 3GVGA 1Z41A 4KFNA 4F40A 5FJRA 3W22A 5FJIA 1GJUA 2ZZ6A 3EWZA 4P2VA 5G2WA 1HKVA 2DV0A 3MSRA 4NRSA 1TWIA 4IL0A 1IIHA 3JUGA 2XIIA 2AL2B 1Q6LA 2CC0A 3S3GA 2Q71A 1IEIA 2HJPA 3E5PA 3AFBA 2FZNA 3N29A 3HPXA 1P7TB 1C91A 4ZSTA 5DANA 4TVCA 3QC0A 3QEZA 4X2RA 2G3MA 3A3HA 2GDQA 1GOWA 1S5NA 2XWDA 4MNLA 4XG1A 5CGTA 1PDZA 3CGTA 3MPGA 3VM5A 3TXVA 2Y1HA 1LL4A 3S2JA 4BZYA 2J7FA 4ACYA 4PSPA 4N4QA 1V51A 2NXGA 4AIOA 1EZWA 3GS6A 4I5RA 3ZVHB 2ZIDA 4DWSA 5BCAA 2PCEA 3LZ5A 3OQEA 3G18A 2XZ9A 3PTDA 1VQTA 2G3FA 4PA8A 3PSWA 2OQYA 1FKXA 2VEIA 1HW6A 1KWKA 3HZ3A 1H5YA 3VIFA 2FZMA 3QZAA 2HE5A 3NNTA 1X8CA 1XJBA 3LCFA 2Z2BA 1KTCA 4PBEA 1V0KA 1QO5A 4R7OA 5M1TA 3UG3A 4RXFA 3W4RA 3P7YA 2O7SA 5CC3A 3IV8A 3ZT5A 1E70M 2FGLA 1EBHA 2CKSA 2D2GA 1DPMA 1TJPA 3RXZA 3BANA 3S5ZA 1JCNA 4DF0A 2NX9A 1VEMA 1K77A 3SADA 1Q6CA 4L4MA 1CLXA 4AD3A 4IQLA 1ICSA 5AHMA 2AQOA 1GJWA 4CU6A 2BOFX 4CVWA 1QXLA 1WDRA 1WCGA 2E28A 2FDMA 4ZSUA 4F9DA 1B57A 1EP3A 5AHLA 4BR1A 5LGZA 2FMOA 3HQOA 4M5PA 3M7WA 3CHFA 2V5DA 4JTSA 1RZMA 3H7VA 1VFOA 1AH3A 2GSJA 1WDSA 2GVLA 2HWGA 2WWDA 1US2A 3OBEA 4JTAA 4H8NA 4X9YA 3SZ8A 4MOZA 2OYLA 1XBXA 2XSAA 2XSBA 4CQDA 1E1FA 2W0UA 2Y7DA 3W7HA 2BOGX 3ANVA 3ANUA 3NVTA 4MAZA 1R9ZA 3GXNA 3GH7A 1JJKA 2V2HA 4CKQA 1B54A 3RPMA 4FNPA 4GE8A 3KS6A 4H6EA 2XINA 4Z2IA 1JVNA 2XIBA 3W85A 3FJ6A 1IWAA 2O9RA 1JZ5A 1A4LA 2PI6A 3B8WA 1EUNA 2B7QA 1PKLA 2OEKA 3EBVA 4QQUA 4XUGA 3SIZA 4KEVA 2XJ7A 1QW7A 3WNKA 5H2ZA 3AS0A 1V77A 4XVEA 4O12A 4O54A 3L67A 3VIPA 4L56A 3DBPA 5CXPA 3WQ5A 2D22A 4NZFA 3N1AA 4JBRA 4CQBA 2IXUA 5JH1A 4PZVA 2HBVA 3ELFA 1A3WA 1EGVA 2W9MA 3L4VA 3S2CA 3RM9A 3NJ3A 2XH7A 3LRMA 4GVFA 1G5AA 2WVTA 3NYZA 4YYCA 3CEUA 3OZOA 4IPPA 1HNYA 3G1HA 2ZUNA 5K7JA 5AC4A 1XRTA 4XD5A 1GEQA 1PYMA 1YPFA 2I57A 3IJ9A 3LNMA 1TV4A 4J3UA 5A6AA 3L0NA 4EXAA 3RU6A 3THAA 1PZ3A 3NQ6A 4JIEA 4NNBA 3CQIA 2VC5A 3HFTA 5AC8A 3WLLA 4O1DA 1FP8A 4LCSA 2E67A 3WO8A 2H9AA 3E9AA 3W23A 3MC5A 4RE2A 1W1IE 2ZXAA 3FW6A 4B5XA 5DMNA 3SCPA 1VBHA 1JXJA 2DSVA 4PUKA 4CQCA 2D2JA 4NASA 5REQA 5HQMA 5FF2A 3KL3A 4KQNA 1ZZMA 4G9PA 1NFGA 1XS2A 1W5QA 3TTSA 3VK5A 3KTCA 4K37A 4MJ4A 3RLVA 3ZIZA 4JTRA 1F4AA 3MSDA 2GK1A 4RZ4A 1Q6OA 4R5EA 3GTHA 2CKRA 1UQYA 3KRSA 3OVQA 1RCQA 3EOUA 3E6EA 3FEQA 5T26A 1LORA 3LHYA 2R1NA 1PZ2A 2W92A 1OJXA 3ABOA 1FA2A 4DBDA 1JGMA 2P76A 2EPNA 5SWUA 1SO5A 5FEZA 2QIWA 3VFCA 4UTFA 4NNCA 4HNNA 3HN3A 2ZRYA 4KCUA 1DWFM 4LANA 4LVAA 4LUSB 3BV7A 2IS7A 2WC3A 5AZ0A 1RQBA 1KNWA 4U3AA 3WKZA 1W5PA 3SRFA 5CZKA 3E5BA 4CNNA 2YCLA 5DMLA 4MLJA 1JPHA 3UGVA 3MZNA 1O5QA 4QSFA 3VDGA 1VYRA 3BK0A 5DLCA 4C60A 4QHRA 4BY3A 3G0UA 1KC7A 3LY0A 1T8QA 2POZA 1LG1A 3GSMA 2GJNA 2VFFA 3U4AA 5FF4A 1KFWA 3BH4A 4H8UA 2Y63A 3N4AA 1UR2A 2W79A 2GOUA 4QDWA 3TW7A 1VFSA 1A5MC 3B8UA 5DMYA 1IZCA 5C71A 5HULA 2RDXA 1YNYA 3LBOA 3MS8A 4AF0B 4C1NA 5IBXA 3LRLA 1LM1A 6ALDA 4R88A 4ECLA 4GX9A 4X3ZA 4GUJA 1H1YA 3S0CA 2HE8A 3SY8A 3AO0A 2Y8KA 1VBGA 4W8BA 3AWNA 3QLLA 3T55A 5DEZA 1FH8A 1CDGA 4DO4A 4BI7A 1GWJA 5EKYA 4R34A 1TE6A 4IMAA 3C86A 4AIUA 4DO7A 1V03A 4EP8C 1XD0A 3URAA 1TKKA 1C8YA 3HMCA 4DJFC 4ILSA 2WJZA 4REQB 3R11A 2EQDA 3ABXA 5AC5A 1GOKA 2C7FA 1SO3A 4EKJA 1YBQB 2PC8A 3TC7A 1IYXA 1E0WA 3MKVA 4JKMA 4PTMA 4GH3A 4YMZA 4Z08A 4W5UA 4JEQA 4NZ1A 4Y8EA 4NYUA 2X05A 2GGGA 4GRSA 1QNQA 4JL1A 1LRTA 2ALDA 1NH6A 2E8YA 4LW7A 2BX7A 1TREA 1GYMA 4F66A 3AS1A 3RMJA 4PCNA 4ZL1A 1PL9A 4PMVA 3IIVA 5C8BB 1X39A 3EB4A 1SFTA 3IJLA 2DSWA 2A3BA 1VBUA 3JZUA 1GVFA 3OHMB 4LAMA 3T44A 1XCXA 2VUYA 1W91A 5TD4A 4UIOA 3EA1A 3W1MA 2C8NA 5FI8A 4H8HA 5I6SA 3UY7A 1V3HA 5I5RA 1VYSX 2GYIA 1L6WA 4C6KA 3W87A 4M80A 3FKRA 3GDLA 1QCWA 4IP7A 3SBFA 3U5UA 3REQA 1UP0A 1K7FA 2BY3A 3FDKA 2EBNA 3A4WA 1K70A 3WF2A 9RUBA 3VILA 1Z7AA 1SFLA 1XIFA 1E55A 4HNUA 3CYJA 4Q8OA 4EX4A 1O12A 3B9DA 4KESA 4D6JA 1NWUA 1JPDX 4X2PA 3L4YA 4EF8A 2PWHA 3VZYA 2QVHA 2WXDM 3GVRA 3ITCA 2WSQA 2Y8UA 3N14A 1VBRA 3KUMA 3MKCA 3KRUA 1KCKA 1F3EA 1L6GA 3VD7A 3PZIA 4H2CA 1S1RA 5AHFA 1KKOA 7REQB 3UR5A 3M0KA 1J0ZA 8RUCA 1DJWA 4J7RA 1ML1A 5E6ZA 1LUCA 3S6DA 1X7FA 3QW4B 1KM2A 1AMYA 1H61A 4J3ZA 4X61A 3LHZA 2VD8A 1NFBA 4Z17A 1OFRA 3WQPA 2BHUA 2WSPA 4HZ7A 2ATMA 3QY8A 3WNNA 2OYMA 3M0ZA 3NPVA 1UKTA 3DHFA 1A4MA 4OHQA 1ZBKA 4AAJA 3M5YA 3ZOAA 3W1NA 5XIMA 2WZHA 5CBJA 2YL8A 4LX4A 3MWCA 1ZJHA 1DJQA 1SZGA 4A3UA 4HNVA 4IZGA 1S2WA 4P8VA 1W5NA 1X96A 2DZTA 4GISA 1JF6A 5DCDA 2E9BA 2FIQA 1YDVA 4OU1A 3R1ZA 4IMCA 4UTWA 2E40A 1R3YA 3IGHX 4ICCX 4HB7A 1OYBA 3RCNA 1TPH1 3Q94A 4V2XA 4N6EA 1O1HA 3UWYA 1QOQA 2JFEX 2G4JA 3PBMA 2V3DA 5A8GA 4N9DA 1PZ1A 5E5CA 3S9YA 4IMGA 2JQXA 4IXHA 5HUOA 4YHGA 1Y0EA 3CH9A 2GLKA 4LVDA 4YTTA 4XZLX 1AJZA 2IPJA 4UTTA 3ZWSA 1AZ2A 5D02A 3EXTA 3UG8A 3WLIA 5LHFA 4JYEA 5D32A 2Y88A 4A3YA 5F7UA 2HROA 5B80A 2ACSA 1GPFA 1TIMA 4LAUA 3VI2A 3BLDA 1IT8A 3EOLA 4RDZA 2J27A 1EH9A 2PCQA 3GR4A 2E9MA 2V3EA 3V4BA 3NQCA 3BAJA 1RBLA 3BMXA 3EOOA 1CGXA 3HJEA 3T2PA 2VFGA 3L5AA 3DG7A 3LI1A 4J9JA 2C19A 1SZEA 1WP6A 5HJYA 2OSYA 5A6TC 1TVLA 1GK8A 3G6LA 2DQXA 2OJPA 2B0MA 1JDFA 5BXTA 3I6RA 4C6IA 3FYYA 5EBAA 4KEMA 4XX6A 2ZE3A 4MY8A 3NO5A 2PDMA 3INPA 1E6NA 5G4HC 3VGDA 3VKJA 5EMUA 4L61A 4MWAA 1X8FA 4N9EA 2XFFA 5A8MA 1EQCA 4DBEA 2ZZ7A 3AWOA 3UXDA 4TOQA 1H7OA 4AD1A 5XIAA 2DT1A 3GKFA 3WFAA 3BLLA 3CO8A 3QXBA 2A4AA 3ZR5A 1M03A 5J8LA 1J6PA 3RM8A 5LIWX 2FVMA 3OW1A 4I6KA 3BGGA 4UQDA 4ALDA 4A2RA 1XIMA 3ZQ9A 2YBTA 1A5NC