4YTQA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy d-tagatose
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
294
structure length
294
Chain Sequence
b'MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
molecule tags Isomerase
source organism Pseudomonas cichorii
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
total genus 118
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4ytqA00
1XYCA 1GW9A 1QTWA 1TZ9A 1XLLA 5EMMA 3XIMA 4YTRA 2OU4A 3XISA 4X63A 4X60A 1BXBA 3UVAA 3ITXA 1BXCA 3GNXA 4QDPA 2G0WA 3BZJA 4J4KA 3AAMA 3BDKA 3KBVA 3LMZA 5XINA 3CWHA 4LNCA 4QE1A 3KTCA 3BANA 3OBEA 2QUNA 3C0LA 1XIEA 1XICA 3JU2A 3CNYA 4HNOA 2XINA 4XSMA 3BZGA 3CQIA 4HGXA 1XLCA 3QYSA 4X61A 1I6NA 1XLEA 3QZAA 5EMJA 5EMLA 3M0VA 5AVHA 3CQJA 1XLGA 4GQBA 2NQ9A 1DE6A 2HCVA 5B7YA 1XIIA 4G56A 6XIMA 1XYBA 3KCJA 3VNLA 3AYVA 3VNJA 1K77A 3TC3A 3KBMA 4DVOA 2XIMA 1O1HA 2J6VA 3KCOA 2GYIA 3KCLA 3AALA 2GVEA 1A0CA 1XLHA 5B7ZA 1XIGA 4ZB5A 5AVNA 1XLBA 1QT1A 4W4QA 5XIMA 5H1WA 3AYTA 1A0EA 4DUOA 2ZDSA 2I56A 3WQOA 4PGLA 4A8IA 2ZVRA 2GUBA 3C0SA 3ITVA 4K1GA 1XISA 4A8RA 3M0YA 4K3ZA 3UA4A 3DBNA 2QULA 1XLFA 3TVAA 1XIJA 1I60A 4YTUA 4YTTA 1XIBA 2X7WA 2HK1A 4QEHA 4HHMA 3UU0A 3U3HA 1A0DA 2XISA 4GLEA 3UXIA 3M0MA 3KBWA 1XLAA 1XIHA 3M0XA 2QW5A 1XLKA 3NGFA 3VNMA 1S5NA 1DIEA 1XYMA 5H6HA 4QEEA 5XIAA 3P6LA 2QUMA 8XIAA 2Q02A 3IUHA 1XLIA 5EMKA 1XYLA 1XIFA 4OVXA 5B80A 3CQHA 4Q7IA 5TNVA 4HHLA 1MUWA 5FA5A 3M0HA 4XISA 4KW2A 2HK0A 3P14A 3QXBA 2GLKA 4A8NA 7XIMA 1XINA 1XLDA 5J8LA 3ITYA 4QDWA 4XIAA 3KWSA 2NQHA 3VNIA 4ZBCA 3IUIA 2NQJA 1XP3A 3L23A 3N4AA 4EAYA 1XIDA 4XSLA 3CQKA 8XIMA 4XKMA 4A8LA 3ITTA 1MNZA 4GJJA 1S5MA 4QE5A 1XLMA 2X7VA 3M0LA 4PFHA 4QE4A 2I57A 4XIMA 3UA3A 3U0HA 3VNKA 3FVMA 3IUDA 6XIAA 9XIAA 1QUMA 4ZB0A 1XYAA 4GJIA 4US6A 5I7GA 3QC0A 2G4JA 3KBNA 9XIMA 4ZB2A 5C9ZA 3ITLA 3BWWA 1D8WA 4EACA 1DIDA 4E3VA 1DXIA 3DX5A 3C0QA 3KBSA 1XIMA 3ITOA 4YTSA 1XLJA 4YTQA 1CLKA 3VYLA 1DE5A 3KBJA 3XINA 1YX1A 1OADA
chains in the Genus database with same CATH superfamily
4GPNA 4JQ3A 2DT0A 2EG7A 4YXGA 3L68A 1XV8A 3FAWA 4FOJA 5HBFA 3EDFA 4HQVA 2VURA 2ZA1A 1XCXA 5G2HA 3CUZA 5I77A 2VVSA 4Y7EA 2Q8ZA 1JQXA 5F2GA 2ABAA 4XSMA 4BA0A 4UFIA 2QPXA 1EJUC 2POTA 3ICJA 1OBAA 3AYRA 3B0UX 3MP5A 1I4NA 1YNYA 2C1HA 4Q8PA 4OUIA 2DDXA 3IVTA 3L7RA 3PS7A 3QY7A 3WUEA 4Q7BA 3WH5A 1X6NA 1A5BA 3NPWA 1X97A 1XISA 2FHBA 1OGGA 4MAZA 3CIWA 2YCKX 1V3MA 5ECVA 2J7GA 1YPFA 3LGEA 4Z1CA 1X38A 5GJMA 3UZ5A 1SYTA 3T42A 3N2XA 2BOGX 4OT7A 2ALDA 1QVBA 1M65A 5G1YA 4PH6A 4QDWA 4LUTB 3SM0A 1KBLA 5FEZA 2QJIA 1R3RA 3PM6A 4M3PA 2V5DA 2PGWA 3CHCA 3D47A 4EXQA 4Y90A 2YR1A 5I07A 2OG9A 3LCXA 3DENA 3HPXA 3UNDA 5C2CA 3AHTA 3FY1A 4P2VA 4F2UA 4AD0A 4OFCA 5C7VA 5CPQA 1HG3A 3B4UA 1WKEA 1KCKA 3G0UA 2O0TA 2XWEA 5DCEA 3M0JA 5LIUX 2WZIA 1AW5A 2FKPA 3FGCB 1PVNA 3NZPA 2GSJA 4JZ5A 4GACA 3KBVA 1IQ8A 3H7RA 2D23A 3QLDA 2CZ5A 4QG9A 1B9BA 5MKGB 4UQEA 1G4SA 1GKRA 4UTTC 2PUZA 3S4TA 3NQGA 4RNFA 1Q6GA 3L66A 5MF5A 4XAPA 5E9AA 2ZX9A 4W89A 3W1MA 3BICA 2PBGA 3CTLA 4Y96A 4J3WA 3WF0A 3HF3A 4IG2B 3E5BA 3GIYA 4H7ZA 4F9JA 4ZMGA 4G7FA 4KPLA 1F4AA 3WQDA 2HK1A 2YPIA 2F9RA 1QNVA 1UWTA 4UMCA 3VFLA 4UTKA 1UC4A 4NAFA 4RDZA 3MHFA 4IFOA 4EWND 2PU1A 5EBUA 3NQVA 3CQHA 3EOEA 4EWJA 3TSBA 3QY8A 5IHRA 5A69A 3NQEA 4JS3A 3LMYA 2H8XA 4IWWA 3OO2A 1XR2A 3AJXA 5D03A 2XPKA 1CWYA 1ZENA 2XIIA 3DI1A 2PTZA 4ZO7A 2CXGA 1XC6A 1JDEA 2YZRA 3PNUA 1D8WA 2VM8A 1JPHA 4YTSA 4X9YA 2XN2A 3W02A 2A3HA 2WHMA 5FOOA 4R85A 2CBIA 3L2MA 3CT7A 3PZIA 2PWFA 3O6CA 4N9BA 2WPGA 1QW7A 3R8RA 3ABRA 4WLCA 3GR4A 2VDIA 1Q13A 3WNNA 3BG9A 1XBXA 1TA3B 4M6VA 4I9AA 2EKGA 1VJIA 3T0BA 1XIIA 5FIPA 4PFMA 4DPQA 1VHNA 1H51A 1TJ2A 5DBUA 2C15A 4W4QA 4QG6A 4DNMA 4C6LA 3N11A 1F05A 3PJXA 1DIOA 3PZQA 4NT0A 3UA4A 5LZLA 4KS0A 4GINA 1V3JA 2Y2WA 3DFTA 2EXOA 1KFWA 3EX2A 4HHPA 2VWSA 1KXVA 1KRMA 4S38A 1WOBA 1NVMA 4ADTA 2Y5JA 1KM0A 3TLQA 1EF3A 2FH8A 2G5WA 3ARRA 4EIVA 4DF1A 4PFHA 3VIMA 2OZTA 1WCGA 3WX7A 5LHEA 1RUSA 3AMGA 2JEPA 4TMCA 4S3DA 3CYVA 1EPXA 3LPOA 2A85A 4NYUA 5DRIA 3TYBA 2A3LA 3GG8A 1HL2A 3U7VA 3ZYZA 2B7PA 1JXKA 1OADA 1XYCA 2UY5A 3FAXA 1EDQA 2BHZA 2WLZA 2C3ZA 3SQMA 3VIOA 4M81A 1XFBA 3REQA 5E0FA 2B0MA 1WZAA 3B8IA 2XIOA 4GG9A 4EX4A 3L9CA 3OIXA 2VHLA 4JIRA 1F3WA 3GNRA 3MUXA 4H01A 2ZZ6A 4N6EA 3QC3A 3WH6A 4C6OA 3UCQA 4W9TA 5I3IA 4Q32A 2VP8A 3VNJA 1XRTA 3IIOA 3S9ZA 1BQGA 4H04A 2QCCA 2ZX5A 4W7WA 3M07A 4MJ2A 4B3LA 2RHGA 2J79A 2BHYA 1XYZA 1PWMA 3VOCA 2FZ8A 4XO6A 4M7SA 4IICA 3EX3A 4AZ6A 1JUEA 3EB2A 2EKCA 1VBGA 3UG5A 4GYFA 4HP5A 5C0QA 3RRXA 4MUZA 4C60A 2OKOA 4GYPA 2IPWA 2VUNA 1KFKA 3M6YA 1VCVA 4C6DA 2P3ZA 1LWJA 3LZ3A 3JW7A 4ATWA 2E09A 6A3HA 3CB3A 3WQEA 2EQDA 3S42A 4H19A 3OBAA 3CM4A 3BLPX 4J3ZA 4GO8A 3ATZA 5A8MA 5EFDA 2A2IA 1UWRA 4PCTA 1SO5A 1TYGA 3WCZA 3UCCA 1UR2A 1J4EA 3AMDA 2PWDA 3FNDA 1BKSA 1EH9A 4ATDA 3ARWA 1TR9A 1I2RA 2WC3A 4PB3A 3FS2A 2OPJA 1H7NA 3K8LA 3QV7A 2V2CA 1M7OA 4C6NA 2RDXA 2FLIA 1UWAA 2ZX7A 2YDQA 1XD0A 4L56A 1C90A 4GQBA 4ZTYA 1MEHA 4PBEA 2QUUA 2VQUA 3Q2DA 3ONCA 3GM8A 3ECQA 4XZIA 5EMYA 3UY8A 3WLQA 3AALA 3W74A 1V03A 3CH9A 3EMQA 3LU2A 5E0CA 2A0NA 4PL1A 3G1VA 1E4IA 3W7KA 1J5TA 4J3VA 2PSNA 1DIKA 2P3EA 3HN3A 3SRKA 4MY9A 3W7LA 1JR1A 5BW6A 3OZOA 2G3IA 4FIRA 5G4WA 3A9IA 2Y7DA 1KLYA 5CAKA 2VFIA 1FWGC 4MGGA 1GKQA 3VGDA 2V3EA 3WF1A 1TTQA 1E6QM 3EYPA 4QE4A 3U0HA 4OBRA 4YNGA 3CQ0A 1POJA 3BCJA 1DQXA 3BK0A 4TQTA 2XGIA 2OOFA 5K9XA 2HS6A 4YN5A 3GUWA 3MPGA 1R3SA 4YCPA 1JULA 3CB8A 1PBGA 4JYEA 4UTFA 3GFZA 3R8GA 2D2GA 4PEEA 4WUIA 2ZIDA 4G9PA 1UH3A 5LIYX 3P8IA 1WDWA 4NILA 3S5ZA 5A1AA 4GRSA 1QNSA 3POHA 3MI6A 1XH0A 3AISA 3F4WA 3KX6A 1GYLA 3F4VA 3NG3A 4HOXA 2UBPC 4HMCA 1YTDA 4D71A 3HV9A 3WEMA 5FJOA 2TSYA 2GDVA 3H2AA 3VZXA 3WDHA 1Q6CA 4PUJA 2VR4A 4QCFA 3UG4A 5LA2A 4L80A 3TMLA 2J75A 4LC8A 3STGA 5DF0A 2FDMA 3ZWTA 3E96A 4M82A 4IL0A 3QEZA 3DBPA 3P8JA 8XIAA 3PAOA 2ZX6A 5HMEA 3WQ6A 3U2EA 1SZNA 1FXPA 1A5SA 1W5NA 1QBBA 6CGTA 3WO8A 1SO6A 2VFFA 3BGAA 5ENLA 3IACA 4MJMA 1FCUA 2RKXA 3H24A 3SGUA 1YDYA 2C8NA 3ENLA 1L6SA 4UZSA 6XIAA 4HTBA 3G1YA 4MMWA 3LI1A 4KF1A 5IDIA 2OCZA 4NZFA 3IVUA 3W7NA 5JBFA 4KCUA 3KOYA 3LBCA 2WB5A 3E0IA 1GHSA 3QSTA 4PB4A 4UTUA 1H7PA 2P5NA 4MNKA 4AZGA 4JHMA 3HFYA 3QW4B 4XV0A 3VXGA 5IFPA 1C3FA 1XUUA 3RRAA 3MKKA 2E3ZA 3N3MA 5JBDA 4QLLA 1XS2A 5E6YA 3IV3A 2QCNA 3KCJA 1WXZA 1H0GA 2GVEA 3P5YA 4S23A 4JNYA 3UWUA 2YW3A 1I45A 4H6QA 1EX5A 1KO0A 4LV4A 2QJJA 4OGZA 3M44A 3GZAA 2D24A 1JCNA 4ZOBA 3MMUA 4C6QA 2DZVA 1EGVA 3KWXA 5I3JA 3MBFA 3NQ7A 4PULA 2V6AA 1JCJA 2PDCA 4GIEA 2GVLA 2C6QA 1XYFA 2WSKA 4ZBCA 4WDWA 1ICPA 1PS9A 4Y6GA 3NYDA 2PBOA 1AW1A 2RGMA 4QAIA 2Z25A 2YLLA 4XIMA 2I57A 3FYOA 2C79A 4JBRA 3DHFA 3EOUA 4UR9A 3G3MA 4C6MA 1GPWA 4JX4A 1XDJA 1KR1A 4Y8FA 4MWAC 2OGJA 2JKEA 2Q3RA 2Z1WA 4LVAA 1DYSA 2ODOA 1FWHC 1ESWA 1G69A 2PCQA 1SGJA 1H11A 4N02A 4REQB 1GW9A 3L67A 4MTVA 1ALDA 4W93A 3E6EA 1DWFM 1E1CA 2OVLA 2OB3A 1CGVA 4LYPA 4HJFA 4WVXA 3C0JA 1VFOA 2CLMA 3QYSA 1JXJA 4L5ZA 4EOUA 1AFSA 4QS5A 4DQWA 2YFOA 1QI2A 1RK6A 4U3CA 5FJPA 1Z89A 3GR8A 3KVLA 5DQPA 2YXXA 3GC2A 2QXWA 3MBDA 4AISA 1LYXA 4W85A 2XVGA 4L9YA 4HK6A 4PGLA 4ERGA 4ZR8A 6TAAA 4L4PA 3GVRA 4RE0A 2DUXA 3PUDA 1IE7C 3JS3A 4PBFA 3G6MA 1O66A 1EEPA 2CPUA 2NT1A 3OG2A 4ONVA 3THCA 3LGDA 4HHLA 3AHYA 4LS1A 2QT3A 3LQLA 5EGRA 3L4VA 2RDWA 3F2BA 2WMGA 1RPKA 1IYXA 3BXWA 3MZNA 1P6CA 3L23A 5H8PA 4QSHA 2WZEA 8CGTA 5BZAA 2QCEA 2WBKA 1PTDA 2F6KA 1FQ0A 4Q4PA 4E8DA 4V28A 1GEHA 1H3GA 4UFLA 4LF1A 1HO1A 1QW9A 4KWVA 3H2MA 5CSSA 2QDHA 4JEQA 3ID7A 3IJDA 2E9MA 1DBTA 1A3HA 1ADOA 3WBEA 4XBSA 4KGJA 4M7TA 3K1DA 5E1QA 4DY1A 3EKGA 4AMCA 3MHGA 2Y8UA 1YIXA 4ZO9A 1GORA 2EGZA 4JTIA 3BJTA 1NELA 2X1RA 1XSKA 4B16A 4ZOCA 5TQLA 3MSGA 2XGBA 3QMTA 2BTMA 2W4XA 2V69A 3CGTA 4B92A 4D6GA 5ECUA 3ARZA 1TMQA 2J6XA 4JTJA 3ELFA 1JZ2A 1OT2A 1PWLA 2F6XA 1ZQ5A 1K7XA 1MSSA 1J11A 3RIKA 3PC0A 1GYMA 2OYMA 1PYFA 4MZYA 4B2DA 5GJNA 1VFMA 1THFD 3L2IA 3W7QA 3D3FA 4MLRA 3UG3A 1BD0A 5J5DA 2PDNA 4Z2GA 1I75A 3UF9A 3K4DA 4AW7A 4MB5A 2H8ZA 3PBWA 2A7NA 4HNLA 1UWUA 5M1TA 1K4HA 5BCAA 1PJ9A 3M6DA 5LNWA 3I4KA 2EO7A 2UV8G 1CX9A 3WK0A 3TAKA 2INFA 3B8TA 5FKYA 2IKIA 2OELA 4L4OA 4QRNA 1EQPA 2IXVA 3CZKA 2FFIA 3TW7A 2PC4A 1R85A 3KTCA 3OBEA 3WK1A 3TA6A 3S1GA 2NXIA 4LRTA 3URAA 5EMJA 3T08A 1OINA 1T5AA 1RALA 4M6PA 1KQZA 3O3RA 4W88A 5A8GA 3SBFA 3TQKA 3OHMB 2OZ0A 2C1GA 1JVNA 2PDPA 4HIBA 5HXMA 1TB3A 4IJBA 1YDVA 5ABFA 1W1TA 1BF2A 3BPWA 3O6DA 1FHVA 3A5FA 4FNPA 2QCDB 2VZVA 3DFQA 1QXLA 2P76A 2PI6A 4F0HA 3PWGA 4NNAA 3URNA 4JIEA 1XYLA 3NO3A 2Z2AA 5BWFA 2GK1B 4UOZA 4IXXA 4M29A 1SSGA 4AEFA 3A23A 7XIMA 3GG0A 3LM7A 3CH0A 3W70A 4I5UA 3WDIA 1UR1A 2DUZA 4LBSA 4HOWA 3W82A 3AWNA 1G4PA 4AIBA 3I6RA 3UGVA 4CQAA 1DJQA 1EJRC 4S3KA 3VTRA 4A21A 4CN4A 2RFGA 3ZJKA 3WBAA 1E73M 3C6CA 3IVSA 4D1IA 2G97A 2QGHA 3BL3A 2A7PA 2E68A 4X60A 3MJMA 1GVRA 4JD4A 1D9EA 3NO1A 1TWSA 3GBDA 2ZZ7A 4YVXA 3HZ3A 3U48A 3SR7A 2Q3OA 1KBBA 4AQLA 1ISVA 3KDOA 2Y1HA 1G6CA 3VE9A 3DDMA 2FVMA 1VPXA 1BFNA 1J0ZA 3ARYA 2PEVA 3WJYA 1GT8A 2WLYA 3DKLA 3G5EA 3THDA 2C91A 3H4GA 4BCEA 5AC8A 2ZRWA 2X1TA 2OEMA 1CZ1A 2EJAA 1EGZA 3EA2A 1GNXA 1RP8A 2JE8A 4JIQA 3KOFA 5D9PA 2FGLA 1RY0A 3OP2A 4KRTA 3WK3A 1F7BA 3C2FA 3SO7A 5I5RA 2OWXA 3IPWA 3F03K 5D2YA 4QBXA 4GVFA 1R2TA 1QFEA 2HEJA 3GH7A 3WELA 3CPUA 5A2BA 1SFJA 3A4AA 2W3ZA 1OF8A 3UR7A 3T09A 4LOCA 3AO0A 4EVZA 3AIEA 1HKIA 1V6UA 2XFYA 3R25A 1YXCA 3WMLA 4U28A 3PBGA 3W7RA 1NDVA 4EACA 4K39A 4GUGA 1IXOA 2MNRA 4XKYA 1V3HA 2Y5EA 1M6JA 4BZYA 2XH2A 3OLDA 1MQQA 4MM1A 3SFWA 1QNQA 2PZNA 2ZE3A 3E74A 2I7GA 4AY1A 2VZTA 3E38A 4KWWA 1ITUA 3GTHA 1DV7A 3LMZA 5CPOA 1CGTA 1GKPA 3WD4A 1XG3A 3WENA 5L9FA 2E1WA 4LUIA 4OKDA 4WJEA 2C13A 2DSWA 1VENA 3ARUA 1XKYA 4XZMX 1PIFA 1UD4A 3EOOA 5C5YA 1UKSA 1PPIA 2ZVIA 1NWUA 3W3OA 4AIUA 4DIAA 1TJPA 4EK7A 3SUSA 2RGLA 3MWCA 3ZLFA 4GYKA 1WOAA 1JPDX 1UOZA 3N17A 2WV8A 3AHVA 4KEMA 5JIPA 1VLIA 4P7QA 2GZXA 3N9RA 4DXKA 5GVJA 1KTCA 4H2HA 4FP1A 1XW8A 3MV11 5A6TC 1OFOA 2FZNA 1B3YA 3GNDA 1UKOA 1TPUA 3F4CA 4ZSTA 3GNPA 4QIUA 1HJXA 3BGGA 1R7OA 4Q33A 3FA4A 3NYZA 4ADSA 1GQKA 3OG3A 1V79A 1KW1A 1V02A 3FX4A 4PSRA 4C6PA 4DHGA 1VQTA 3P60A 4UTWC 1ZAHA 1GJWA 4FALA 2X09A 2BG5A 1YX1A 1S2AA 1EDTA 1TVNA 5DANA 3U7BA 1I0DA 2I16A 2X0HA 1KWGA 3TX9A 1OCBA 1ZZMA 3TZFA 4GISA 4DF0A 2QMJA 3Q4DA 3G2GA 3NEVA 2DH3A 3CQIA 3PPHA 2J77A 1ONRA 2Z1SA 1GOQA 1A5AA 1UR9A 1GOXA 1VGAA 1DJWA 4LS2A 4LSBA 4YMZA 4DJDA 4WDUA 3UQNA 1V3IA 2Z6JA 3NDYA 4Q4SA 3W85A 3R10A 3C56A 1Y5VA 5E6ZA 3TTEA 1SJCA 2DQWA 2JIEA 1Q7QA 5C6MA 2DZTA 1DWJM 2V2HA 3FSTA 1Z7AA 3A12A 1RCOB 1TV2A 4UNIA 3P5ZA 3QTGA 5D2VA 3KL0A 4RK8A 3OOQA 4HYRA 4MOZA 4RKAA 3E02A 4MKNA 5CJMA 1MDLA 1X8FA 4S1FA 3EXRA 1OFAA 2YLAA 3NFUA 3DKJA 3EGJA 4RZBA 1EJ7L 3PK7A 3W4RA 3GKFA 4AWEA 3UXAA 2IUZA 3T2QA 4D6CA 3TFXA 2WHKA 1JZ5A 2VC7A 5HANA 4L6DA 2IKHA 3BSHA 1W56A 4JR5A 2PDHA 5BMWA 4QJ1A 1E56A 2QJMA 4XZBA 2B7NA 2E9LA 3RGTA 4WGXA 2HROA 3UYIA 5CZSA 3TV8A 5D8WA 1PL9A 1WDSA 2F8QA 2E6DA 4HMNA 2OR2A 1KV8A 2PZ0A 1V6YA 4LBRA 4S39A 3WSUA 1EC8A 1KM3A 1TWDA 5CG7A 4AHOA 1UG6A 4YIWA 1A5MC 1AK5A 4CNTA 1WUFA 1XYBA 3H6OA 4GGHA 5KZDA 1UZ4A 2VWTA 2GYIA 4RDYA 3LPGA 2PGRA 2ATMA 2AGTA 3T4WA 1JYXA 4TTUA 4JTHA 4O0QA 1LRTA 1WKDA 3DBNA 3CXOA 5JBEA 4XWUA 4MJ4A 5I06A 4A6GA 3M41A 4GD0A 1QO2A 3P2VA 3VMNA 3G18A 4HT3A 3WY1A 5FF0A 1M5WA 3A3WA 3CHDA 3QHNA 5JU6A 2YL8A 4I6VA 3B4YA 2OJPA 3S2NA 3MSYA 3R58A 1S2UA 3P74A 1QOPA 4LAOA 3PWAA 2NQHA 2NV1A 1UP2A 1TV4A 2OYKA 5D37A 3W6MA 3CQKA 4JTQA 3FA3A 4YWIA 4A05A 4BEUA 1FH8A 4FOKA 2G95A 2Y70A 3VDHA 1XYAA 2V3GA 2ZE0A 4PN2A 3QQWA 3B8WA 4MY8A 4GZJA 4QHRA 4QJ3B 1US0A 4GIYA 1TUXA 2GJRA 4F2BA 5HJYA 3WBYA 1GVEA 3PZVA 2BY1A 3T7VA 2A5HA 5T9CE 1YE6A 2WQPA 2WMHA 3TQPA 5AC4A 3VVGA 1YMYA 4EPDC 4MSSA 1JRCA 1JYNA 4JDYA 1F74A 2J9XA 2CYGA 3GE7A 3QMRA 2P8CA 3PAJA 1VBJA 5HNUA 4QR6A 4AZ5A 3E2VA 4BWLA 2I56A 3GYEA 2ACQA 2DVUA 3GD6A 2PD9A 3U2OA 3IK4A 2J7FA 3PJUA 2HSAA 2DVXA 1B2YA 1CDGA 2J4GA 4DBSA 3SEPA 1MEWA 5HDRA 3VGHA 4CQDA 2W9MA 1ISYA 5DEZA 4PUDA 3T0AA 2OLSA 4QAWA 1UH4A 1SW7A 4JEJA 4S3EA 4MB3A 3P3BA 3P7YA 2R6OA 2PGEA 2BXVA 1OFQA 4XKMA 3P84A 3G6LA 4KRUA 3VD5A 3UA3A 5I03A 3E5PA 4H7VA 5KMYA 1HN1A 3TN5A 4FX8A 3GXDA 1QWKA 3VIJA 4RW3A 4W84A 2VL4A 3SN0A 4L9XA 3A64A 1XC4A 2J8FA 1MQPA 5F2IA 2A3BA 3GH4A 3ZT6A 4W8LA 4GUIA 5E09A 4C1NB 2QPUA 1SFLA 1TX2A 1Q6QA 4I9MA 3WLPA 2QAFA 3IAPA 4XK2A 2F2HA 1PXGA 4XD4A 4ZOAA 1OHLA 1NWSA 4AXNA 1OC5A 3EOSA 1BYDA 2W63A 5AC7A 5JIWA 1E9LA 3GKAA 4L6OA 5I23A 3V1HA 3QTPA 3URQA 2E8ZA 1E5NA 5XIMA 1H4PA 3WLIA 2X40A 2QDEA 4MYXA 3VOFA 2A3EA 2Y5SA 4JFUA 4AY8A 5C9RA 4HCHA 4Y9AA 1B4EA 3B06A 4ZFCA 3QGKC 2J24A 1P5BA 3SCOA 7TIMA 2E6AA 4MFDA 4UWMA 3GXNA 3UVIA 4EKJA 2C0HA 1ZL1A 4B5SA 3ITGA 2PAJA 2XG9A 3Q94A 3TXVA 4S2CA 3L5MA 2WJZA 4X0VA 2VCAA 4A8NA 4Z2IA 3TQVA 2HNHA 3CTTA 4H4IA 2PDYA 4R27A 1V7AA 4GUHA 4RPPA 2DY3A 3STEA 1UR0A 3W38A 4D1JA 3C8NA 1BG9A 4LRSA 2HVOA 1EF2A 3GDRA 3G24A 5AHNA 7ODCA 3WLSA 4TVUA 3PUGA 3BSGA 4F0MA 4LW7A 4UNKA 1JUBA 5E9XA 1R2SA 2BZNA 1QI5A 3W2UA 3UWWA 2OU4A 1NARA 4QDPA 1CXLA 4ZO6A 1UHVA 1EX1A 4Z0SA 2YB1A 3BDKA 1B57A 5CQ1A 2BFGA 2GQ8A 2D2JA 4DLFA 1W32A 5RUBA 1KTNA 1P0BA 5A8QA 1W1PA 4YVPA 1C7SA 1W6TA 1ZPTA 3AYVA 1TWWA 3CHVA 4JHZA 3S2JA 2HBXA 3BG5A 3KRZA 2VGGA 2I5QA 5H1WA 4LY4A 2RJGA 4B4HA 1H1NA 3DERA 1UWSA 3GG7A 3RPMA 1HW6A 1V3KA 1BVWA 1ZCCA 2IKJA 2CZVA 1OYBA 2BOEX 1Q85A 1XYMA 3C2OA 3S6DA 4I3GA 2DU2A 2L5HA 3E2QA 4H6KA 1KR0A 3PZOA 3N6QA 2HPIA 3K8MA 3TTOA 3UJ2A 3R0KA 2E6YA 1RAKA 3BW2A 3VAVA 5JH2A 1WV2A 2IPJA 4PR4A 1YKWA 2J7BA 4XZ9A 1OB0A 2BVWA 3KBNA 9XIMA 2CLHA 4V1XA 4OUEA 1JJKA 5CZTA 3MMWA 4A3RA 5K7JA 1F2JA 1IEVA 2DW7A 1LBLA 2D22A 4D8ZA 2YDSA 3NQAA 1WZLA 4NUWA 1GGOA 2OZ3A 3W7CA 2UY2A 1BXCA 2O92A 3NZQA 4WCJA 3AAMA 3CWOX 5AC6A 2QUNA 3GXFA 4WD0A 2CC0A 3FEQA 4WKHA 4F0KA 1NY1A 2FJKA 5M2FX 1YPXA 3N15A 4R7JA 3IANA 5AYXA 4UC5A 1MW1A 4O11A 1LCOA 2WMIB 3R6IA 1BRLA 5AFDA 4ZGYA 1EB3A 4IIDA 1Q2RA 3QGAC 3MUY1 4PE8A 1VH7A 2E9BA 3DFYA 2GUBA 4K37A 3M0YA 4K3ZA 3GXIA 3VIIA 4F0SA 1OX5A 2X7WA 3LY0A 4IUGA 3U3HA 1XHGA 1B54A 3WNLA 4AZ7A 1UP0A 5IM51 3LZ5A 3RK8A 2QUTA 1OG6A 4K8EA 1D2KA 3CO8A 5CLWA 1FOBA 3T2OA 1PTGA 4L1GA 4BF9A 2QDDA 4O14A 3GU2A 1U33A 1Q6RA 3BG3A 1R0MA 3R0DA 4N9CA 3TTSA 1SFSA 5F4SA 3GYCA 4AIOA 3FW6A 2CNCA 1KXTA 1KRAC 1OZQA 3WBXA 1T99A 4D6IA 3SRFA 2XM2A 4KQNA 4XQ6A 1N8FA 1TUFA 3NQCA 3VK5A 3WJZA 1KD0A 4OIFA 1LZOA 1REQA 3W00A 4Q8QA 1TPH1 5LNRA 1Z9AA 3SURA 3VKAA 5JH1A 5FF4A 3B97A 4J4KA 4JICA 1K9TA 4PMQA 1OWQA 1JYWA 4S2BA 4LYQA 4AIEA 4WOZA 1KBJA 2NX9A 3WEOA 2G41A 1OD8A 1R87A 3V0TA 1IWPA 5F4XA 4QQUA 1Z48A 3S9YA 5AVNA 2OZ8A 4E2OA 1XBYA 4DWSC 4I7UA 1WE5A 1ME9A 1UPMB 1Q8AA 1Q8JA 4H7CA 1QOXA 3O7UA 1C92A 1F3XA 1EIXA 1CXKA 3W87A 4LANA 1SW3A 2KZHA 2J74A 1LL4A 4HB7A 1RBAA 3RJXA 1DJHA 3S8HA 3KFTA 4CD8A 3OB8A 1G1YA 3ITTA 1ME7A 4K38A 3FFSA 2J7HA 3WQCA 4O54A 4LCQA 3DHPA 3M7SA 4JGDA 5CG0A 3S47A 3UT0A 2GVGA 5AYBA 4JNZA 4OBSA 3GHSA 1EKOA 2X1IA 5GNZA 4H41A 2PDIA 2YCIX 4GOAA 3I6EA 4O1AA 3BAKA 3K30A 1VIZA 3P81A 2O9PA 3RLVA 2X0SA 5DN1A 1X39A 4QGCA 1I2PA 2ZADA 5A6AA 1UD5A 4ZQPA 1XLGA 3GK0A 3D6NA 1H7WA 3R13A 3VU2A 2WVUA 1PTAA 1FWIC 1SSDA 5D8ZA 3WJXA 1W5PA 5EB8A 3S5SA 3PZNA 1FRBA 4LFYA 3WMCA 1BHGA 1BQCA 3BC9A 3QLLA 1TV5A 4PMYA 2DQXA 5A94A 3N29A 5DY3A 1VLWA 4WJ8A 1DTUA 4KEVA 3NQFA 2F6UA 1LTDA 3QV8A 1RLDA 3L4ZA 3BLFA 1A50A 3UW6A 2WJDA 1PDZA 3CC1A 1M01A 3P62A 2Z26A 3FVDA 1PIIA 1WDQA 3O63A 4A4AA 6ALDA 3FXGA 3SJNA 5T8GA 5FJRA 1A3XA 1MDRA 2F2KA 1AJZA 1XH2A 1UOKA 3VNKA 1J6PA 1JPMA 5F2LA 4Z1BA 2ACRA 3HM7A 3NQDA 4RJEA 3MKVA 2ON3A 2Z6IA 5GQBA 1FWNA 1UMYA 4IQJA 2GOKA 4BS0A 3XINA 2HVNA 4GKLA 5FF2A 5DLCA 1QTWA 2NVCA 1QPKA 4C1LA 4NX5A 1QMLA 3T78A 3GHTA 4LV9A 3ZSTA 3SAZA 2CHRA 2ACUA 2Z27A 2W67A 4JY9A 1O6IA 3NPVA 3QQ1A 2NX3A 4I8YA 2FZBA 4RPQA 5CXPA 3EMZA 4WDTA 4WZHA 3NM3A 4QJ5B 2O4QA 1LQAA 2D0HA 1X8CA 1OFEA 3BAWA 5DCDA 3A9BA 5LGZA 4JDBA 1JDFA 4HHMA 3STFA 1IXNA 2J62A 1NIUA 5I24A 4XTDA 3W1XA 5GNYA 1E1EA 1OFDA 2HS8A 4PMZA 4XISA 2OSXA 3CS2A 4O8RA 1B9ZA 3N18A 1W9VA 2JGQA 3IUIA 1L2UA 4H9TA 1RSCA 5KTLA 5AC5A 3L4UA 2OQLA 4N9DA 2ZWZA 3B0PA 1A4LA 4W8BA 3IUDA 1EO7A 3ITLA 1FTXA 3CV6A 2YA0A 1A53A 3ZWSA 4D9PA 3GDTA 4DBDA 1AL8A 4KCVA 1JCLA 4U5IA 1JAEA 1AVAA 4UFMA 5EYWA 3M16A 5IBXC 1IEQA 2CKRA 5CAHA 3OTRA 1JPIA 1AMYA 1P6WA 4WK9A 4G7EB 1F07A 1Q63A 2H3BA 2ALRA 1ZB5A 1C8XA 5BXPA 4AD2A 3W83A 1FDJA 3E0LA 4FO4A 1JAKA 4WY0A 1YDOA 3SW6A 1AQMA 4AFYA 1K77A 1MXGA 3RJYA 1XPYA 2BY3A 1FWFC 5FEXA 1XLHA 2PP0A 1RR2A 2JQXA 4L1WA 1ZNNA 2WVTA 1A5KC 1Q6LA 3TSMA 1E0WA 4DJED 2YW4A 3GTFA 1KRCC 3NURA 4IPPA 5H2ZA 1WDPA 4O16A 3S6TA 4DZ5A 1P1XA 1DJYA 5EKYA 2R91A 2QCHA 3I4EA 4DO6A 2XWDA 3DG6A 4QFUA 1JI2A 4ZO8A 4BWLC 2NXHA 1GTEA 1BXNA 3HPAA 3A21A 4I9JA 1H63A 2V67A 2WYSA 3HV8A 3PSWA 1W9BM 1IEXA 1TWIA 4NI8A 4LVGA 4E4PA 2EJ1A 1IR2A 4AEEA 3IJ8A 3VIKA 4MB4A 4QNEA 1BPLB 5TF0A 1HNYA 2P50A 3PJWA 4QITA 4RUBA 3V35A 3C2VA 3U4FA 1I2NA 1LLWA 2CU0A 3W1NA 4R3UA 4A3UA 4QJ4B 4JX6A 4ROQA 1YADA 1XCFA 3AWOA 5HQLA 3G77A 1MZHA 4GIAA 1O68A 3MCNA 3CUJA 3XISA 4AEOA 3ANUA 1NOWA 4B5NA 3C86A 4KESA 2BP1A 4IGHA 2WWDA 4KGLA 3ATYA 3EB3A 2OO6A 3R4IA 3PB2A 3QY6A 3IV8A 2FYMA 3CLWA 1OZMA 4O17A 2CLEA 3WFLA 2PDMA 4W5ZA 2A1YA 1MXSA 5EBAA 1H7RA 4XD6A 3GB6A 3QQ0A 1P0KA 1TMHA 1R3VA 4CNOA 1F6KA 1OIFA 3EEGA 1Z69A 1XLBA 3T8QA 5DELA 1EHNA 4HZ7A 3EMCA 3LV5A 4FR6A 4MWAD 3VPLA 3EWCA 3W1AA 3CMJA 5A95A 3C4UA 3FCPA 1OX6A 1TPEA 1YQ2A 3FA5A 1ZY9A 4Q8MA 2AL2B 2FVKA 4NAEA 3LENA 1DIEA 5HOSA 5CJNA 9CGTA 9RUBA 2FH6A 4Q7IA 1DJNA 3KP1A 1DPMA 1F6PA 4JIPA 1YLVA 5DT7A 5IBXA 3UYCA 1OG0A 3COTA 5C8BB 1B90A 5A6JA 3WF3A 2PURA 4GQGA 4O1BA 1HIZA 2NLIA 1QAPA 3ARPA 1M7XA 1UZHA 4B9YA 2YXGA 3W28A 3TJIA 3KTSA 4I5RA 2QEZA 2VELA 3SB0A 4AVNA 1F76A 1T0OA 3GSMA 3N13A 2PWVA 2QJGA 4JFSA 2CWXA 3GHRA 4FK9A 3KRUA 4Z08A 3NNTA 3BZJA 4IPIA 3IJQA 2WK2A 3W7GA 3ZVIA 1VFUA 2XVKA 3UPBA 1KWKA 2ACSA 5DFAA 3GW3A 3UY7A 4CQ8A 1GG1A 3W7PA 2P0OA 1QRQA 2B7OA 4G2DA 3PWIA 3T0CA 4HMEA 2FZ9A 4Y9PA 4IL2A 3TP4A 1NF0A 3G1AA 5DXYA 3P80A 3VZYA 4AMAA 1L2QA 3HPSA 1VPQA 5BOFA 3EDKA 4AD3A 3B9NA 2CHOA 4GC4A 3VCRA 2ZXBA 4FLQA 3FSUA 1NQKA 1E3ZA 1P7TB 3VDBA 3UERA 1CI1A 4UB9A 1V3LA 1W3LA 3M0XA 4QROA 5HR7A 2CERA 4L65A 1J2WA 2QQ6A 2O7SA 3WD1A 4JAWA 1W17A 3KS5A 2AMXA 4H9VA 4K7VA 1W9PA 2VQTA 4YYFA 4HNUA 1J0JA 2WCGA 1L6YA 2Z2UA 3S1WA 8A3HA 2WNNA 5I7GA 1UR4A 1GUVA 4NJKA 1Z41A 3LHTA 2I14A 3NZGA 1NOUA 3IJ9A 3WD0A 2FTYA 5K4XA 5FF3A 5EMUA 3DUGA 4DPPA 2AQWA 1FHLA 4C6FA 1F3EA 4J3SA 3MVTA 1S3HA 3ANYA 4JQAA 5I79A 3ARQA 2E6FA 3P61A 1RJQA 3TYEA 2G3JA 1CGUA 2XH4A 3D0CA 4JTSA 3CLMA 3MUIA 2TMDA 4U10A 1TO3A 1ONXA 3R2GA 4H9XA 2VZSA 2VDHA 5HAOA 3TONA 3SCWA 3TQ0A 4ZB5A 2CWNA 3C52A 3ZLHA 1FWCC 3LLFA 4DBWA 4JTCA 3MY9A 3TTYA 2CLKA 1XQLA 3FJNA 5KINA 1V0LA 4KFNA 2YCLA 3UNTA 3DECA 3HB9A 4YTTA 4YTUA 3VNZA 3DGBA 4KCTA 4U4MA 4H83A 5D05A 1JCYA 3RCMA 1V5XA 4OU1A 3VKKA 1ENUA 3V75A 3SRHA 3KAOA 5J04A 3S5YA 3U9IA 3SUVA 2X8RA 2O56A 3OQEA 2NX1A 1LROA 2VVNA 2HXUA 1MFUA 3VZZA 4FNRA 2NUYA 4A8LA 5AYZA 3BLIA 1MW3A 1S5VA 1OVDA 3EDDA 4K36A 4GI6A 1OC7A 3W71A 3W1RA 3BWWA 2VC6A 2WCSA 1DXIA 4Z1YA 3KBSA 5M5DA 1T8QA 1CLKA 1ZP3A 4IF2A 2D1ZA 3DAQA 1QU4A 4D72A 1CEOA 4M19A 3M5ZA 2V5BA 4UOQA 3S6OA 2Z2BA 2MUCA 2VRJA 4QE1A 4X2RA 2V3DA 3W07A 4WR3A 2OT0A 3JU2A 4AWUA 1RPXA 1DXEA 4X61A 2BXYA 2H3DA 4WKAA 1NDZA 1GPFA 2QF8A 3FDGA 3HJEA 3RUBL 1BVZA 4MDPA 4Z42C 3BV4A 2HPMA 4F66A 3OVGA 3W2LA 2A6LA 3LRLA 2WJFA 1XX1A 1JUKA 2ZVRA 3TXZA 1CPUA 1S2CA 3ABQA 5FD0A 5LNUA 2CXEA 1JCXA 3URBA 1FCVA 1XIBA 3LHYA 1U2YA 3I6TA 4BQ4A 4TX9A 3R7MA 1LRNA 2XHYA 3VFCA 2OWWA 3IAQA 3M0HA 4H8VA 3SUUA 2DZBA 2V82A 4J3TA 1SUXA 1K4GA 4O4VA 1UKTA 3VINA 4O28A 1WAWA 2ZC1A 3NZ1A 1HUVA 5CKSA 1EUAA 1W3NA 3VO0A 3SCRA 1M53A 2VEGA 3HQNA 4OHQA 1D8CA 3DH7A 2GPTA 4J3XA 4ZOEA 3GDBA 4W87A 3B8DA 1B3WA 1FWJC 4F48A 4NL1A 2NQZA 4O57A 5C71A 2DV0A 3LCLA 3WFAA 2DPEA 2O55A 4XB3A 7ENLA 1HVXA 3BTNA 4NNCA 3CT2A 2YX0A 3F1QA 4BJHA 3O07A 5LIWX 1JZ8A 1LBFA 2PRMA 1LF1A 1U5JA 1RZMA 2WO5A 1S2WA 2CLIA 3MYPA 1G94A 1YNPA 1FWTA 2JEQA 3PG9A 2E5DA 2NVDA 1W91A 2J8GA 1O5XA 1F8MA 3WUFA 3LHUA 1FY6A 3SY1A 1TJ1A 1JZ7A 5DY2A 2NSXA 4JNMA 4JKMA 1CBGA 1NDWA 3O6YX 5B7ZA 1O94A 1MFVA 3IJLA 5JXQA 1KCZA 3SUTA 1ECEA 3BOFA 3V5OA 4D6DA 5CGMA 3GTNA 1RQEA 3SIZA 1RJRA 1TIMA 2H6RA 3C61A 3VC6A 4C7FA 5IRPA 4TUFA 3F5JA 3APYA 2WKGA 4N2YA 5GNXA 4MWAE 1W3KA 3GXTA 4BQ2A 1Y65A 4MKVA 4O19A 2FDSA 1NEYA 4IMFA 3T81A 2QPSA 4PCPA 1P6BA 4Z1DA 1SQ7A 3UWZA 1CTNA 3QV9A 3G8EA 3ZJ8A 2O7QA 4XSLA 3L21A 2WHJA 5K4ZA 2CHNA 2WPBA 2NVAA 2V2DA 3W7JA 1SZGA 1HKWA 3TAOA 4FLSA 1TCDA 1WAUA 4S3CA 1KFBA 3TLLA 2CITA 1A5UA 4HCLA 4JY8A 3H54A 3BLEA 3NA8A 3RO8A 4H00A 5CZJA 2XSBA 1V6XA 4IOTA 3POCA 3AQUA 1KGXA 2JBMA 1Z6KA 1H49A 3PUOA 1B3VA 3OODA 1T7LA 4J28A 4M56A 1E4LA 2C71A 1GOOA 4IP5A 3NOYA 4WEVX 4JTKA 4J2MA 4YVVA 1PHWA 1ML1A 4IZGA 1HVQA 3SN1A 3E0WA 2GQ3A 3IIXA 4Q8OA 5G5IA 1AZ2A 1K6WA 2EG8A 1VFHA 3CL8A 4MNLA 3QFWA 2R1PA 4RX0A 3WD2A 3WBWA 3AC0A 3BLOA 3N19B 2WMIA 4PUEA 1JDCA 1VFLA 4PCFA 1TV3A 3Q58A 4IIGA 1WP6A 4EAMA 4NNBA 3WG6A 4ZL1A 3TMQA 4OVXA 3KRBA 3E3HA 5DXXA 1T41A 1JQVA 2B81A 3YPIA 1F4HA 4EXBA 3RFAA 2ZRYA 3H53A 4EXAA 2ZUWA 1B31A 1EEXA 1T8XA 4AZCB 3KDNA 4C5ZA 4A3HA 4C65A 1LL6A 2E25A 3FVMA 5BRPA 4C6EA 1IWBA 4US6A 2DORA 5D30A 4GVGA 4LB3A 4L4MA 2AQOA 1FP9A 3ARSA 2VENA 1SJAA 4YCOA 1X96A 2CZDA 2PMQA 3W2KA 3TROA 2G0WA 1RH9A 1ZJIA 2X2YA 1TTIA 4WIWA 3DOPA 3GC5A 5GJPA 4PCSA 1V6VA 3T6CA 3T2PA 5CPTA 4KBXA 1LJYA 4URIA 4GCAA 1SO3A 4H9YA 3NJ3A 3S1UA 4PMDA 2VX7A 3CAKA 4CQCA 1EBGA 4JTAA 4IMAA 1NF7A 1L6GA 1KM2A 2ZZ4A 1V8EA 3VIFA 4LYKA 4PB5A 1ZSXA 4H8UA 2GJXA 1Q7ZA 2JFEX 5LYRA 4A8IA 1LQ2A 1IZJA 1NAL1 3VABA 1J0YA 4RV3A 3UWEA 2JIWA 3OBKA 2NV2A 1E6SM 3IK2A 4M5PA 5BOEA 1MVYA 3CEUA 3K4WA 5C2XA 1RLCL 4BF7A 1E70M 4PRRA 3TK7A 5J8LA 3H4XA 2OLHA 2V5JA 1TPDA 3A24A 3JUGA 1A49A 1OT1A 3AS2A 1QK2A 3VGFA 3SCVA 4ZB0A 4O12A 3E0FA 3AUJA 1KBKA 4GXPA 4Q4QA 1HZYA 3T9PA 4E3VA 4HBKA 3AHXA 5FJIA 3KBJA 4FPSA 1YXYA 1FWBC 2Y0FA 2WSRA 3H2OA 4XBKA 3A5VA 3O6AA 1Q7MA 1MUCA 1TV7A 3QPZA 4ERIA 3LRMA 3AI0A 3LERA 1UWIA 2I17A 3QOKA 4REQA 2C14A 4HPJA 3CZEA 4NQ1A 2VFGA 4NJGA 4QSFA 3IGSA 2ZRUA 2GJLA 3NSMA 3MUZ1 4HSNA 5DO8A 1KFLA 3G1HA 2NQ5A 4FOUA 2DZAA 2O9TA 3HPFA 3AU2A 3ZJ7A 3TYUA 4GA8A 3ZMRA 1E0XA 3HG3A 2GL5A 2G3NA 2XJ7A 4IX0A 3DC0A 4KWUA 2HNEA 4YHEA 1AUSL 3TKFA 3PHAA 4WX2A 3UZJA 3IWPA 4GBDA 1J96A 3WK2A 4MFEA 1ZP4A 1TPVA 1JFHA 3FV9A 5PTDA 1AJ0A 3KLKA 3B9OA 3N4AA 1XIDA 2CFFA 4AZBA 4DX3A 3QZEA 3MO7A 3R5EA 2Z1VA 2ZUTA 2RH9A 3TDFA 3VGBA 1E15A 1W54A 4YL2A 1XDMA 3AXKA 3TUUA 5DCBA 1WNOA 1AG1O 4C90A 4ZEPA 2GDUA 3U2CA 4E6MA 1JYVA 2X41A 3CWNA 5I3FA 3TEVA 5KSWA 2P10A 4LB4A 2NWRA 2FB2A 4CQBA 8RUCA 2QVNA 1KGWA 3N2TA 1X98A 3OA5A 1SR0A 5DMLA 3NIYA 3L0NA 3PBUA 5C9XA 1BSLA 3L4WA 4U2ZA 3MZ2A 3GDLA 1JFXA 4KIRA 4BQ5A 1TPB1 4DVOA 4I7VA 2E67A 1EO5A 4NX0A 2G8ZA 2BOFX 2QKFA 2NW0A 1XD1A 4TVDA 3NEHA 2A4AA 4CNPA 3P82A 1XIJA 1P4CA 5FAGA 5HNNA 5HPCA 3EOLA 5FEPA 1JCTA 4F0LA 4WF7A 3VNYA 2TPSA 2OXNA 3JRKA 4HPNA 3O05A 3EXSA 3WNOA 1ZBCA 1XGDA 3B8SA 3WF2A 5I6SA 2PLKA 3TN3A 1ZS2A 3P67A 1IWAA 4DAIA 5H91A 2WQDA 3DGRA 1A5OC 4RNJA 5D38A 1PKNA 3QZ6A 4BI7A 5I00A 4PCNA 3APTA 1KM6A 5AECA 1JCMP 4DZAA 1HKKA 2VZOA 3WLKX 5D02A 5FSDC 3CL6A 2GQAA 5C9WA 4RZ4A 2B7QA 4UTLA 3T4CA 4CEUC 3BO9A 3NL5A 1ITCA 3QR1A 4HOZA 2PLMA 3H2CA 1C93A 5LGXA 1UA3A 2W79A 3SQSA 3HTWA 4HYWA 5I3HA 3UBPC 2D2HA 1ISZA 3BGJA 3ZR5A 3II1A 2HJPA 1XLCA 3MUAA 1XLEA 4R88A 4BK9A 1JDAA 2GUYA 2OEKA 1GOIA 1M7JA 1E6PA 4K2SA 2ZZ3A 4FNQA 4NSBA 2IQTA 1BEUA 2A21A 2VT0A 3KOZA 1P0EA 7A3HA 2PWGA 4WKFA 1QCWA 4NYYA 4LUTA 4RZ5A 4GWEA 5HR6A 1GOKA 1V02E 3TR2A 3W88A 4IGSA 2Z1KA 1NJJA 4AVOA 4DM2A 3LS9A 2PD5A 1Y7VA 5BRQA 4RE4A 1DWIM 1MUWA 1TTPA 4AWTA 1GOWA 2BGNE 3PP7A 3GVVA 4AC1X 1J18A 3V4BA 3OVQA 2BSLA 3M0KA 2J25A 2PWEA 1H41A 4ICNA 4P8VA 4TX6A 2YSWA 2ADAA 4ROPA 4J5NA 3W81A 4XVDA 1BKHA 3BW3A 3LPPA 3P0WA 2PC8A 1ZAIA 5K3VA 4CLMA 3PF3A 1EJWC 1TJ0A 2WCAA 4GYPC 5M17A 1LWIA 2V5KA 3OVRA 3RG6A 4PC8A 3TYZA 5F1UA 1J9YA 3PG8A 1U5VA 4NXKA 1Q6DA 4LH8A 4LALA 2VZUA 3V5FA 2ZUMA 5AN7A 4PL2A 2CKSA 1CNVA 2VC9A 1U22A 1UYQA 3PFRA 2GJXB 1JG9A 3WDPP 2XM1A 3ZFHA 5AVHA 1E0VA 1FDYA 4NJIA 3N3TA 1KB3A 1IF2A 3QR0A 3MVIA 2Y7FA 1QHPA 2HBVA 4X2PA 4UTTA 4ZQMA 4GNJA 1W8SA 1GJUA 2ZDSA 1IEWA 2XSAA 3GY1A 4JQ1A 1ZHAA 2QCMA 2DZUA 1X6UA 3WDRA 3VNMA 4PMRA 4AU0A 1GZJA 4PTVA 4CD5A 3ZQ9A 3HMJG 4FMVA 1VF8A 4JKLA 2W6RA 3A6OA 5BXRA 2QCGA 1QK0A 4IQDA 4OV4A 3I3BA 1TVLA 2PP3A 1C9WA 4GFIA 3HGRA 1K3UA 4UQBA 5KITA 7PTDA 2G4FA 2YYUA 5CC5A 5HQMA 2GOUA 1SW0A 2Q09A 2GSHA 3I65A 4JFWA 5CLTA 4JIHA 3T0DA 4M24A 4IIHA 3UJEA 3PTQA 3BLKA 1GOMA 3FN9A 3LCWA 4E2DA 1VRXA 2DP3A 3UR5A 1KM4A 3BCDA 1X6LA 2DFAA 1ADSA 1W1VA 2V30A 4H8HA 3I7SA 3CHEA 1QPRA 3VD4A 2CLOA 5ABEA 1CGYA 1TPWA 3G8RA 5EA9A 4LXFA 2GVYA 3V1PA 3V5CA 5CPSA 3N9KA 1K70A 3TE9A 4Y9NA 1KTBA 1IV8A 1VIWA 3BZGA 4FF5A 1UC5A 3ZIZA 4CD6A 1S38A 1HT6A 1J8VA 3FKKA 1KA9F 4JN7A 3W2JA 5CSUA 5U7SA 1L6FA 1BVNP 3EDEA 1IXPA 3A13A 2R24A 1ZBKA 2Z1XA 3NVDA 1XM3A 3NCOA 4B3KA 3D5HA 2P1FA 1PAMA 4MNJA 3I68A 5AZ1A 2FIQA 3RCNA 2P53A 4L9ZA 3NSXA 3MWAA 1VRDA 1BRLB 3BCFA 1S1PA 4FNUA 1RVKA 4KCWA 2Z1BA 4K68A 2QW5A 4L1XA 1TZZA 3DYOA 4HU0A 3NQBA 3TOYA 1Q4NX 4HJWA 3P14A 2Y63A 1B3ZA 3UJFA 4GO9A 3KP0A 1J0HA 4JYFA 2NQJA 3GFXA 4GK8A 3REQB 8XIMA 2GQ9A 3OU8A 3BJFA 3ANVA 5HQEA 4XAFA 1XLMA 4UCGA 1W2VA 1QUMA 3KL5A 2NLYA 1DHPA 2ISSA 3WQVA 2PRLA 1ICSA 3VGEA 2QS8A 2GVJA 3W24A 5HMDA 3RPDA 3U8GA 4J27A 3ALFA 1R2RA 4JYDA 4OZOA 4FLOA 3DG3A 3UWYA 1FBAA 4ZQNA 1F73A 4J40A 4JL2A 2NWSA 3ARXA 4BI6A 1KQYA 4O1CA 2B4GA 3RM8A 3WUGA 3WQWA 1G0CA 5C9UA 1MW2A 2YDAA 3GG1A 3RNDA 4NZ3A 3WUBA 4K6AA 2DSZA 1M68A 1NFPA 3Q37A 2E8YA 2X16A 3PTDA 4CNNA 5LXXA 3QH2A 4ZQRA 1UZ1A 4F79A 3UCDA 1H62A 4FSAA 1XLFA 3QHMA 4RDWA 1I60A 1MW0A 4R5EA 3WLMA 1VYPX 1GW1A 4YYCA 3KBWA 1XLKA 1AH3A 3H21A 4LAUA 3PZ9A 4GZEA 2WSQA 3IJ6A 5C7HA 4MNMA 4G6CA 1OM0A 3QV6A 5EFFA 4LEFA 3V18A 4DWSA 3B8UA 3AS3A 4TR9A 4IHCA 2XVLA 2YXOA 1PZ3A 3F7JA 1UUMA 1MNZA 4UR7A 1R3WA 1O5KA 4JCMA 5DMMA 1CCWB 3USZA 5FSEC 2X2GA 3FLUA 4KT2A 3HO8A 1EDGA 3OLIA 2YA1A 1S39A 2NV9A 1AMKA 2V81A 3THAA 3LOTA 3LHWA 5A8PA 3GUGA 1C9DA 5BNKA 4MJZA 3UD6A 4MWAA 4V15A 3KXQA 2J7DA 4A3QA 4M0XA 4O1FA 1A80A 5G4HC 5IDZA 3F4DA 4ZFMA 4CU8A 3W37A 3VMOA 3FJ6A 4Q4MA 3LDVA 1AJ2A 3QRHA 3SSJA 1ECQA 1C8YA 1E1CB 2HXTA 4QTGA 4DYJA 2ASHA 4NVTA 4B15A 4AUBA 3ZVHA 3VKCA 5GPRA 2E7FA 3DCPA 1RVGA 3OIHA 2X1UA 3K2GA 3FYPA 4FX6M 1NFGA 2ONEA 4TO8A 4A3YA 2QJNA 5IXEA 1K7EA 2E5CA 1QHZA 3EWBX 5CBJA 4OE7A 3UGRA 1B4KA 4I5XA 2D2OA 3LNMA 4TMBA 3B9DA 3UWVA 1TWZA 3QR3A 4FHAA 5B80A 3Q65A 2QAPA 1LDCA 5REQA 2PDJA 3WN6A 3MHUA 2HK0A 1F3TA 1O1ZA 2GGGA 1DJGA 3QXBA 2D3NA 2DIJA 1J93A 4AD1A 2DJXA 2GDQA 1HQTA 1BG4A 4CNSA 2YCLB 2AL1A 2PF0A 1SZRA 3MTWA 2WZMA 3NOEA 4LJ3A 1E5JA 1U1UA 1XXXA 3W7MA 2BGSA 1K9EA 1E4MM 1P43A 1ZAJA 2VMFA 2DZXA 4YTQA 3QBUA 4RXGA 2E40A 4UQAA 4E4UA 4X63A 3KE0A 1IHIA 1J2BA 1ZJBA 2VEPA 4N6FA 2KX9A 4AXKA 1HO4A 2X42A 5AHLA 3T07A 1SMDA 5BOOA 4JFVA 2AAMA 4GI8A 4GQRA 1T6MA 1E55A 4GI4A 3U5YA 1DP0A 1W5QA 4AD5A 3Q67A 2C18A 3TC7A 4OTKA 4GVHA 1IGSA 3ITCA 3MYOA 4KIEA 1KXHA 4I8DA 1H2JA 2D73A 2OEJA 1CB7B 4QEHA 4O13A 3ZR4A 3AOFA 4LUSA 2QZRA 2JKAA 4DAFA 4NZJA 4ATLA 4CD7A 1VD6A 2CESA 2I1OA 5K9DA 3DZ1A 4O0KA 6TIMA 3O2LA 4KFOA 3VIGA 3N2BA 4UUIA 2GGJA 3IGHX 3O8AA 3QGVA 3KZPA 4L6HA 1OIMA 4LVFA 3C3NA 3VE7A 1X7IA 2IKGA 1S1RA 4MZ1A 1R86A 4A22A 4IGMA 4MB1A 3BJSA 3SCPA 5JUVA 5M3WA 2V38A 1PKLA 2GK1A 4ZTXA 3AZSA 4FS9A 1XL9A 3NL6A 1DJZA 2FB3A 2Y89A 3VD7A 3HGOA 2ZICA 3OW1A 4F40A 1K02A 3RM4A 1DHKA 2VI0A 1W3TA 1WZKA 4GMEA 4GQQA 3ZR6A 1RCQA 3W01A 3L5AA 1QI4A 2JF7A 1WB0A 2WXDM 4HGXA 2VTFA 3JZUA 1K7FA 3MP3A 2BVTA 3ME3A 3SCSA 4OWGA 3GZ3A 3LYEA 2QYGA 1OCQA 4PMOA 3MUCA 1SM9A 1RXOB 3CIXA 3PR2A 1UJQA 1DWAM 3WLOA 1PX8A 2FVLA 5IHSA 4IMCA 2WJEA 3MO4A 3EWWA 3GFYA 3IIZA 5HNRA 2W61A 4RNIA 3WL0A 4ES4A 4GNKB 3WFZA 3B8VA 2OSYA 1HKVA 5AHFA 2AAAA 1UR8A 2J9ZA 1UD3A 1Q65A 2FZDA 2G96A 3M0ZA 4E4FA 4LNYA 3RU6A 1RBLA 1XP3A 2P0IA 5M03A 2YCJA 1TMLA 3MW7A 3VDAA 7CGTA 4HMDA 4OECA 1WDDA 3KHJA 2ZA2A 4JXCA 1E6RA 4JL1A 2ZBTA 4J9JA 4DYKA 1ZFJA 2WNQA 3LHVA 4HNNA 1E0UA 3E0VA 3AHZA 3ES7A 1M03A 3G1SA 3RM9A 1CXIA 1GVSA 3NAVA 4FXSA 4LQ1A 1MRQA 1XGEA 4XUYA 1HF6A 3WF4A 1WQ5A 4MVAA 2OO0A 3C5QA 1TX0A 1UD8A 3CMGA 4FXRA 1UUQA 5FEWA 4Q6JA 1N82A 3LSBA 2ZUSA 4P8UA 4Q7NA 3RN6A 2HTMA 1N8WA 2O4MA 2JF6A 2XFWA 3C8FA 1QO5A 4PMXA 3WLRA 1O1HA 2X1SA 5FJUA 1A0CA 4AVFA 3EBVA 3O1NA 1LBMA 2ZUNA 3CPRA 2REQA 1QDSA 4PSPA 1ADDA 1BWLA 2WSPA 1NH6A 1XH1A 4K1GA 1QNRA 5IFTA 5C55A 3THQA 3NUKA 1ZCOA 1J10A 3JR2A 4WGHA 2WVVA 3MB9A 4DUWA 3DI0A 5A2CA 1NP2A 2V3FA 2F7FA 3O16A 3MI2A 3NPXA 1GHRA 5G2WA 1ODUA 1VFSA 3CK5A 4MF4A 4HU4A 2WMKA 1QBAA 2X30A 2WANA 4V33A 5FI8A 4GH3A 5LKYA 4DWSD 2GFTA 4O52A 4E2VA 3UR8A 2BLEA 4GQ0A 9XIAA 2EPKX 1OJXA 3WMBA 4L64A 4BFAA 2VFEA 3L4XA 3UZZA 4IGNA 4ZQOA 4YJ5A 2QVHA 4AX6A 2G3FA 3DIPA 3IEBA 1B30A 3VKBA 3HGSA 4XZLX 3CUFA 1JNDA 2Q8XA 1TR1A 1CLXA 4B5VA 4ENLA 2HMCA 2J66A 2ZRXA 4WHBA 3U2ZA 5I09A 2FZMA 4JTUA 3HIJA 1E71M 4WSHA 1KLZA 1E6ZA 1K9FA 1KFJA 3EDJA 2C1IA 2J78A 1OEPA 1I2QA 3BMVA 1R7AA 4JIIX 4JCLA 1NTHA 2W62A 3PBYA 1AQFA 3EA1A 2PA6A 3O06A 3VKDA 4FNTA 2CETA 5HWMA 3S2CA 1XWYA 4QEEA 2FMNA 3OYXA 5BROA 4IG2A 3OQ8A 1RP9A 3GTXA 1TRIA 5A8OA 3TW6A 5MHBA 4ZZ9A 1WA3A 4FIQA 3RHGA 1YW1A 4PRWA 3BE7A 3TCEA 3VOGA 2ANUA 1H1YA 4PTMA 1UIPA 3ZLGA 4LAMA 3ABZA 3VI2A 1AD1A 3VC5A 3SADA 2OYLA 1AL7A 3UWQA 1UR3M 2E77A 4UTMA 1BSIA 5E70A 4NZ1A 4KWSA 6REQA 2XH0A 4MYAA 1TZ7A 3XIMA 3EWYA 1LOSA 2GWGA 4XAGA 3LQGA 1FHUA 1BXBA 3FOKA 3BARA 3D46A 1A5NC 2XIJA 3UEQA 1FWRA 1GTHA 2ZRZA 4J3UA 3BAXA 3D3AA 4JFTA 5BXTA 2PGFA 3KRSA 4QCEA 1QOQA 4K1WA 4Z2JA 4B90A 4B4FA 3KCOA 3B40A 4N7QA 4UTIA 1JF6A 1DJXA 2QCLA 1GCYA 1VBUA 4XD3A 7TAAA 4K8GA 3N34A 1XRSA 1K8CA 4DI8A 3BQ6A 2IQ0A 4TOQA 5D9OA 1LL7A 5A8NA 4JTTA 1H5VA 3M43A 3TFCA 1J12A 1L9WA 3HQOA 1RHCA 2GLKA 1UQYA 2V63A 4RE2A 3CAVA 3P93A 2VRKA 3BLDA 3CUHA 5D2WA 2HQAA 2OOGA 4B9ZA 1A4MA 1FP8A 5A6SA 1P1MA 2PP1A 8TIMA 2XTKA 3RX3A 1S3TC 3GXPA 4OJYA 1GZGA 1R6WA 3RMJA 3QC0A 5C9ZA 1MRAA 5C70A 4R53A 1F61A 2QV5A 1MNSA 1LUCB 1AW2A 1BTCA 4PUUA 5REQB 3WLHA 3CPGA 4QM1A 4OQVA 3UXKA 1XIMA 1TPFA 2AGKA 1OFPA 2IQDA 3QOMA 4MG4A 1OGBA 5I3KA 1AQHA 4C6IA 3GDMA 1QW8A 4ECLA 1FUYA 5AYYA 2F38A 3V7PA 3WJSA 2QGYA 2E28A 3WQPA 3N73A 2ZX8A 1BYBA 3T55A 4PMJA 2SFPA 3AMCA 3AIUA 4LYRA 1I6NA 3N4FA 1QPNA 3CQJA 2I9EA 3M47A 3WLTA 5G1TA 4LS0A 4BY3A 3VNLA 3LCFA 4S3JA 1SU5A 2VYOA 3QMSA 2J13A 4DXXA 5A6LA 2OQHA 2ZUVA 1SO4A 5LIKX 1DWHM 1U83A 1YHTA 1G67A 4P8XA 4C91A 4O50A 4ZE5A 3HFTA 4NP7A 5I3DA 3PZMA 4JTEA 1FXQA 3W53A 2PODA 3W1TA 1CT5A 1CXFA 2Z00A 1BF6A 2VX6A 3MT1A 1A0DA 1PKYA 2YBVA 3FHAA 2PTDA 4PTDA 4AWSA 3VKJA 1ELSA 3P6LA 1KV5A 1AZ1A 2ZXQA 4RW5A 3WH9A 4PMNA 3S5NA 5LXEA 3O15A 3ZS4A 3NO5A 2DJLA 4AAJA 1ZU8A 2R1KA 2EPNA 1VFTA 2WWCA 1FWEC 1MYRA 4AF0A 4QE5A 3TJLA 3TN4A 2ISWA 3SUWA 1VBRA 2E4TA 1Y5WA 4M1BA 3LEPA 3M46A 5HK4A 1GYNA 4OOZA 1POKA 1XBVA 1UZDA 1PZ0A 3AXMA 3AIRA 2DVTA 3TWAA 1OX4A 3GNXA 2YDRA 2HV5A 4FAMA 2J27A 1ZUAX 1BGAA 2XDFA 3LTYA 3QPYA 2Y8VA 4HNOA 4KFPA 3TOPA 2VO5A 4DJFC 3ZOAA 3KEHA 4QLKA 1E9YB 4UTJA 1Q6EA 4EPKA 5D33A 1PKMA 3QVQA 2BVYA 3KS6A 3EPOA 4PYSA 1GQNA 4B2DD 1CW2A 4CCZA 4TTGA 1D7FA 2QR6A 3IUHA 3A4XA 2QF7A 3N04A 3S1XA 3RXZA 2RDUA 1VEOA 3CAWA 4AHPA 1X1NA 5CCZA 3LNPA 5T26A 1FKXA 4TVCA 1UMLA 3QJAA 1L8PA 5FL1A 3AIVA 1OCJA 1EYEA 2R94A 3M5VA 2C19A 3OJGA 5EY5A 4UQ9A 2ZUUA 3NVTA 3TR9A 5KZ6A 3SRDA 5FCZA 1OABA 1VJSA 3M64A 3S2LA 2KAUC 2R1NA 2ISDA 3W1QA 1GEQA 2Y8KA 2R8WA 5I02A 1J6OA 3WLJA 2XYLA 1DORA 1TIWA 3WH7A 3OLEA 4O15A 1UBSA 4NASA 3AFBA 2ABBA 4CEXC 1IT0A 5I2UA 4PA8A 4UXDA 3HMCA 1A3WA 1W1ZA 1D3GA 1K6AA 4HN8A 2J6VA 2YBUA 4DYEA 4UFKA 1UBPC 2OWCA 1IZCA 4IJRA 1QJWA 3IRSA 3STPA 5A6BA 3LI0A 2YCEA 4PTXA 2XZ9A 4ICCX 6ENLA 4MDOA 2V8ZA 3HG2A 1TV8A 2QUVA 1ODZA 1EWDA 4Q8TA 4DO5A 4GIRA 3HU7A 3M1ZA 3FXYA 4HA3A 1RY8A 4H6EA 1D7KA 2C7FA 4FA3A 1CLVA 1UW9A 2PDXA 2WVVB 3AJ7A 3BV7A 4HK7A 4UNLA 2QIIA 1S2VA 1UKPA 4GXMA 2OKTA 1L0PA 1EOMA 2DGAA 2I9UA 3WDQA 4AZCA 1PB0A 2XGZA 2Y6ZA 3L4TA 4Y9MA 3WNMA 1B1YA 4D8LA 3DEQA 1GQIA 1HJWA 1R46A 1KC7A 1DXFA 4MADA 4JOMA 3S9IA 1U1JA 3AS1A 2NZLA 1ZLPA 1XIEA 1A5CA 3OZPA 4R9OA 1JD9A 1XICA 3GH5A 1REQB 3HPZA 1UA7A 1R8LA 1WPCA 3VDCA 2YZ5A 3M0VA 2IS7A 4NAFB 2ZZ5A 3L0GA 2BX7A 4GC3A 1S5WA 3JZEA 1MEIA 4GKTA 3UESA 3CMFA 1A47A 1JEZA 3LX9A 1XIGA 4CN1A 4EANA 3EKLA 1O5QA 3RR1A 2TRSA 4RR4A 2R14A 3W25A 1EP1A 2RUSA 3ARTA 3OPSA 2J8TA 5DX7A 4C6CA 5LNSA 2WMJA 4LAZA 4BHYA 1KKRA 3T05A 1RQBA 2DZWA 1KRBC 3UZYA 1XIHA 3CZ8A 3ABXA 1UKQA 3LBOA 1OD0A 1OF6A 1S46A 4IPLA 4UFJA 2H9AB 4LEQA 3MC5A 3CO4A 2HDJA 1W1IE 5I0DA 4WRHA 1D3HA 4DUVA 4JN8A 2IPFA 2PRHA 3AMLA 4S3FA 3WNKA 3K46A 4UBPC 3ABOA 2WAGA 4BQ3A 5AHIA 4FB7A 1V51A 3QN3A 2YFNA 4IFKA 4MAVA 1IR1A 2VEKA 2J9YA 3CV1A 3WQGA 1TA3A 3I10A 3DHUA 4U33A 1J5SA 3E12A 3FDKA 3WH8A 4ICMA 1DE5A 3M5YA 3B05A 3MA8A 1FHDA 1VYSX 2BXZA 4UFHA 1MI3A 4JHOA 3A47A 4IFKB 2DH2A 4ALDA 7REQB 3PANA 5A6BD 1KNWA 1RA0A 2XN1A 1XF0A 3QZAA 2ZWYA 5A3HA 4ACYA 3LGGA 4HNVA 1MUMA 1R30A 1WUEA 4JX5A 2ZYFA 5H8MA 2W91A 4HZMA 1W8GA 1FFRA 4XBJA 5HULA 4DJEC 4DUXA 3NQMA 3W0KA 4P7RA 1JZ6A 4G5DA 1HX0A 3G22A 2JKPA 3L2LA 3G1FA 2EPLX 3M4HA 3RLGA 1KGUA 3IIPA 4ZXOA 4KERA 3MKCA 1TREA 3WMSA 1E3XA 3W9ZA 1HGYA 1LUCA 2GSEA 1C91A 2Z7KA 4P61A 3G0SA 4ZXLA 4XG1A 2CEQA 4R7OA 4I7WA 2HZGA 4G7EA 2O9OA 4Q8WA 3W72A 4LGXA 2G4JA 4Y9OA 2DZPA 2QLYA 3AXIA 3WQ8A 5TBOA 3PPGA 5KEZA 3RYSA 4M1RA 1J0IA 3GO2A 4ADUA 2FMOA 1SZEA 4LF2A 4LT9A 4CNUA 1GVOA 4GUJA 5JVLA 3UFYA 1ICQA 2WBGA 6REQB 5C54A 3H23A 4LTSA 2D3LA 1R9XA 1Z42A 1W1A1 4LPCA 5CBIA 3RMEA 6XIMA 4AG0A 5AY7A 2Z4GA 3BMWA 3LD5A 1PZ1A 2O9RA 1GWJA 1BGGA 3ZZ1A 1C8VA 1TCMA 2BWGA 5HMSA 3MQTA 4FF7A 1CB2A 1EUNA 1EA0A 5CH9A 4GX8A 3BOLA 1J0KA 4DWDA 1UASA 4ZA0A 1YTKA 4Y2WA 5TNVA 3OYZA 1Y5XA 1JI1A 1HFBA 1RD6A 3KVMA 5ABFB 2E5BA 4H9UA 2V5LA 2PS2A 5EU9A 3DN5A 5CEWA 5HWNA 2XU2A 1QASA 2R82A 3S0CA 2AKZA 2EPMX 5FL0A 1DQWA 4MY1A 1B0IA 2BHUA 1UP3A 2XH7A 4CU6A 1FWDC 2I5GA 4GCXA 1XSJA 2QHAA 3WZ0E 4US5D 1Z32X 1BAGA 2DW6A 3UVAA 4HU8A 3ITXA 1QPOA 1FKWA 4R7WA 1DL3A 2ZA3A 1ISXA 2EPHA 2VRQA 3W1PA 1OCNA 3TN6A 4GI9A 5A2AA 1B3OA 3AUOA 4IQLA 4EE9A 1O95A 1YBQB 2NQ9A 1G4TA 2OQYA 2NUWA 2A3AA 1YYAA 4HSOA 3EXTA 3CUXA 1GQLA 3S1VA 4PRTA 2YL6A 5HWJA 1ITQA 1QT1A 5EPDA 4O0ZA 3WD3A 4NJJA 3AYTA 1A0EA 4GVIA 1F8IA 3G1RA 2PDFA 2QJHA 4ASTA 3H2FA 1OY0A 4FEZA 3SCQA 1LQ0A 5JMUA 3N9SA 1Y0EA 4GLEA 1PUDA 5HUOA 2J7CA 1EPVA 1UJPA 4FXJA 3UJRA 2YYTA 3EX6A 3E2RA 2FTWA 2QCDA 5FAJA 3RF9A 3PZUA 1W2PA 2PDQA 3ZXWA 3KM8A 4XTIA 1R3TA 4EF9A 3NGJA 3M0LA 3EPNA 3DC8A 2NQLA 1LP6A 3L5LA 2NUXA 3GVQA 4YWSA 4I6KA 1ZTVA 4JTLA 1DQUA 3APGA 5CSYA 3DYMA 3R43A 1S5TA 4QDMA 3RLUA 2OX1A 3W76A 1N7KA 3KZSA 3EZ4A 4QQ3A 1JF5A 2BODX 4WY0F 4NHVA 3S83A 2WC7A 3FJ4A 3CUGA 3W7IA 1YEYA 1XDLA 3IGUA 5KZEA 1OFRA 2V9DA 1HJSA 3MSDA 1FWAC 4CUCA 4MIMA 3SQLA 4CCEA 3VCCA 4C5YA 5LSMA 4XZHA 1OX4B 3CV7A 1DJIA 1FX6A 5LA0A 3B03A 4EF8A 4UIOA 3VNDA 3SIMA 4R34A 3N2CA 1LT8A 4LUYA 2INZA 6PTDA 1P48A 2WKJA 4L4LA 2R9RA 4DBUA 2YJQA 1JIBA 2EEXA 4IXHA 4XUGA 2CW6A 2BY2A 4DBEA 4NIRA 2VR5A 4IISA 2XISA 2PFHA 1H5YA 3A22A 2Q02A 3BAJA 4B91A 1XIFA 3PULA 4MHBA 3G1XA 4H1ZA 4GZIA 1TE6A 1QPQA 5D4YA 5TIMA 1W5OA 2VUYA 3EWDA 2E1DA 1HTIA 4DLMA 3AS0A 4LVDA 2AL2A 4NAEB 4UMAA 5DBTA 2VGBA 4UQCA 2X05A 1FFQA 2ZQ0A 1C8QA 3L0KA 3PZGA 1WO2A 3LXBA 4FNSA 1IT7A 4LWWA 3DX5A 1XLJA 4JQ2A 5CBBA 1YE4A 4N4QA 1IZKA 4AYSA 2Y88A 3TNBA 4B5WA 1JNEA 5T9BG 2PE4A 1EWEA 5DMNA 5LA1A 3CAQA 2BVDA 3GRIA 4IIFA 3CIVA 1W9XA 4HHHA 1IT8A 3CL7A 1RCXB 2Y4SA 2EHHA 3UETA 3WQOA 1PHQA 1XPGA 2F84A 4J2PA 2FGZA 3TVAA 5HA7A 4FR1A 2YA2A 3GX9A 4DI9A 3UU0A 1H09A 2QUMA 1LM1A 1V6WA 4WSKA 4P7NA 3MCMA 2PB1A 2PDKA 3I7RA 1LOQA 2XUCA 2NXGA 5AYIA 1ZALA 3TA9A 3TZNA 2PDLA 1PO9A 2VXNA 7REQA 4RE3A 3MV01 2Z29A 1H61A 2Q01A 4RXFA 1KXQA 4O10A 3TW9A 1E1FA 3V0UA 1PSCA 3HA1A 3C0QA 1MO0A 5J5RA 3VYLA 1LOLA 3GC4A 1WDRA 1XKJA 5AHMA 1SPQA 3OEXA 1XRVA 4S3BA 4H2CA 1B3XA 2UWFA 2YL9A 1K8ZA 4ML9A 4DN1A 1UD2A 4DXVA 4E3TA 2XN0A 1KCXA 4Q8VA 2DT2A 5T91A 4JN6A 3BSMA 5BXSA 4IIBA 3T40A 3C3UA 1VR6A 3QKZA 3NM1A 4G1NA 1O7AA 2W5FA 4NRSA 3MMDA 3NR0A 5EL1A 4RNHA 3H8AA 2VKZG 4GJ1A 4HKPA 2UY3A 2VEMA 1Q6OA 2VEFA 1CXHA 1WXJA 3GIQA 3PBVA 1XCWA 4GX9A 4N42A 1UPPA 3OHIA 3GBEA 1JPKA 1ZBVA 5G2IA 2YKKA 3VIPA 5XIAA 1G7UA 5D9NA 2VR2A 3NQ2A 2WKLA 3VOIA 1VJZA 4CU7A 3RCYA 1HJVA 3QSRA 3UXLA 3B0VC 4WXYA 3UP8A 2PDBA 4WDXA 1BTMA 4ZQCA 1NOFA 1MMFA 3ABSA 3LG3A 1AD4A 1LLOA 1BYCA 3ERPA 3MDUA 1C29A 3G1DA 1SFTA 1G5AA 5FJTA 3R1ZA 1NDYA 1FA2A 2FPYA 4ML4A 1ONWA 1DOSA 4KKXA 2DUAA 2XFFA 1M7PA 3BH4A 5A6MA 1EC9A 3VM7A 2C16A 1FDZA 2AOSA 4DJDC 4Z2LA 2D20A 4GXWA 3GU1A 4FI4A 4C6JA 5LNVA 1EHAA 1HL9A 3MJYA 4D2JA 5A6KA 2Y7GA 4YPJA 4J7RA 4D6JA 2D69A 1EQCA 3PFMA 4WSJA 3LUTA 2AKMA 1BWVA 3BURA 4NZCA 4QX4A 2XIQA 4PMVA 3CUIA 4ZENA 4UTWA 4E8CA 3PN8A 3PTKA 3WJWA 1PX4A 3ONBA 4KEZA 4H9ZA 4RLIA 4H8NA 4D6EA 1XLAA 3ZVHB 1S5NA 2VC5A 2QIWA 3B9EA 4E5TA 2VCBA 5EMKA 2V0TA 3CZGA 3BMXA 3UPWA 3T0TA 4NF7A 5IOBA 2UZ9A 3LRKA 3F2CA 3QFEA 4I9TA 1FCQA 1E9ZB 3IJIA 2PCEA 3KWSA 4GY1A 2PF8A 5CZKA 4V27A 1YXDA 3N1AA 1XUZA 1H7OA 2RJHA 2BMBA 3IS4A 3TH6A 2WNWA 3FYYA 1BWKA 4YU1A 4P7LA 2GJNA 3WLLA 2WNZA 1AQ0A 3TSDA 1OYAA 2ISVA 3UR2A 3K4AA 1AH4A 1EFZA 1LORA 4B5XA 1Z3NA 2J47A 4A35A 1XLLA 3WQ5A 1XQKA 1WZMA 4DJEA 4D6HA 3MP4A 1HJQA 2RAGA 5DRCA 2FGBA 5FACA 2J7EA 3CNYA 3MU7A 3ISIX 3OLGA 4C7GA 3ZJ6A 2HCVA 5CC7A 1VYRA 2ZRVA 1W5MA 1NWRA 3UG8A 2TAAA 4IMDA 1PX3A 3BVJA 2WM1A 3GWQA 1VB9A 4HA0A 3VX1A 4MWAB 1VEPA 1V0MA 1F6YA 2ZTJA 3EKZA 3RILA 3KHDA 3PVFA 4YHGA 5F2MA 3LHZA 3PZTA 2G50A 5HNTA 1I0BA 3O9NA 3UZXA 5G4EA 2XIBA 4DO4A 1U1HA 1VFFA 3I3DA 3SI9A 5JQ9A 4MUPA 3S2MA 3RAOA 4F2TA 1V4YA 2W27A 3AIWA 5F7UA 4QNWA 1KKOA 1X7FA 4AC7C 1XSIA 3KLLA 3B04A 1EOKA 3LCIA 1QHOA 3ORWA 1OSEA 2GJPA 3H4WA 1K1DA 4HVXA 4K8HA 2PDUA 4PODA 2GGHA 4IIEA 1OK4A 4ORMA 3SCUA 4AZIA 3LCGA 4IFRA 3BUVA 3S3GA 3W22A 2FPVA 4G1KA 3H26A 1UCWA 1SJBA 3GLCA 1FWSA 4NI3A 5HINA 3HQ1A 4OOUA 1PV8A 4A2RA 3TJXA 1EIBA 3W7DA 2OMAA 1GONA 3BANA 4GGBA 4RZ6A 4ZCWA 4NZ5A 2XINA 1R3QA 2BBFA 5FF7A 3AU6A 1EA9C 2BY0A 4IMGA 4IPNB 1MWOA 3AZTA 3AXHA 2P88A 1MXDA 3TC3A 5BWAA 3NZRA 3L4YA 5AHEA 5BU6A 4KEUA 3QM3A 4F0RA 4JTRA 1Q4WA 3TWBA 3C0SA 4M6UA 1K8XA 3IARA 1GVIA 4JTDA 4B5UA 4AYGA 4TV5A 5DT5A 3KTXA 4G8TA 3UXIA 3NGFA 4MLJA 1JGIA 1KFCA 3V36A 5CZ0A 2VFHA 2ZFAA 3IGXA 3K13A 4LUJA 2ZCGA 2Z24A 4DZHA 1BLIA 3H7VA 2YB4A 3VOHA 1W1YA 3KOWA 1NP0A 4HTYA 4UQDA 3MCOA 3NL3A 2FHCA 1EBHA 2WSYA 4Q6XA 3GAYA 3RITA 1GVQA 3W1LA 4QISA 3U4AA 2AQVA 4M8UA 4DJFD 5BU9A 3GQYA 4NG3A 4ZB2A 4M6QA 3WNPA 1H50A 2ZC8A 3FEMA 4KH2A 1EJTC 3EB4A 4TU1A 3ITOA 5TD4A 3O0KA 4AX7A 4DJDD 3TIMA 4LBUA 2G37A 2UY4A 3R79A 2WOQA 4OV9A 2XSXA 3NSNA 1V0KA 3VA8A 4LCSA 1EZ2A 1NFBA 3PTMA 3W1UA 1XJBA 3EX1A 1P7TA 2FFCA 4X0NA 1J01A 2CLFA 4CKQA 3KBMA 1ZJAA 4CVUA 2ATSA 3USBA 5SWUA 1PZ2A 3E49A 2BB0A 4RDVA 3MMTA 1PDYA 3R94A 4B5TA 4U5KA 5MKGA 5K2ZA 3SFKA 2QULA 4GY0A 2OT1A 3DG7A 3PBMA 3EX4A 4W5UA 3LLXA 3PPFA 1VEMA 3HOJA 1H7XA 4UCFA 3Q45A 1PIGA 1QATA 1HL8A 4DZIA 3AZRA 4NY2A 3KVJA 1K8YA 1RV8A 1W3HA 1G01A 2VD8A 4RL3A 2CBJA 4J1OA 1XINA 1E6XM 5I3GA 1O60A 5D2TA 3L12A 5HMFA 4R33A 1CXEA 5ABTA 2HRWA 1NM9A 3U5UA 2PLCA 4WOQA 1VCGA 3H7UA 3N2MA 3LV6A 4PZVA 1EGMA 1X1OA 2Z28A 4QXIA 3TCSA 3DFNA 4POCA 2EAWA 4UTHA 3V3WA 1FH7A 1P0DA 4JTFA 1YTEA 4HNTA 1NWTA 4FXFA 4EP8C 1Y8BA 2YOCA 3MSRA 4GE8A 4C7DA 2DSUA 4AD4A 2QDGA 1VZWA 2DT3A 5BMXA 2VEIA 3N14A 1MZRA 1U5HA 2CLLA 2FPTA 3RDKA 3AICA 5AB3A 4HZ6A 2EPOA 3U57A 3N6JA 4HA4A 3WLNA 2WZTA 3LSCA 5F4WA 4K7YA 1US3A 3F2DA 3MI3A 3V0SA 1UROA 3SCNA 4HCDA 1R47A 2VOMA 4W86A 3W27A 3W2MA 1EP2A 3B0YA 4XVEA 4AH7A 3W84A 1HJUA 1QI3A 1DKWA 3NDZA 4CVWA 4O4WA 2WZHA 1W9UA 5D2XA 1YNQA 2VGFA 3R0UA 4JTGA 3GTIA 4IP4A 4H9MA 2VFDA 3J7HA 2YL5A 4KW2A 4Q22A 2HVMA 3KL3A 2BASA 3SCTA 4C1NA 2VOTA 4RCXA 4ILSA 1UWQA 2A6NA 3NDOA 4XZNX 1E4NA 4INFA 3A4WA 2FQIA 4Y8EA 4XD5A 1PE1A 3CJPA 3CZLA 2X0YA 2H9AA 3GNNA 1K9DA 3FK4A 3W7HA 3F5LA 3RX2A 1NSJA 5EMMA 3GW0A 3K8KA 1RD5A 2VGIA 4US5A 3LN3A 2PDGA 1JZ3A 2BV9A 3TYDA 3CWHA 1RQHA 4HPHA 3K5XA 3TTQA 1WX0A 1VC4A 4W7UA 3U6WA 3H2EA 1DTNA 1GG0A 1Q2SA 1EYWA 1LT7A 3WQFA 3KW3A 1E9IA 4CD4A 1SVDA 2RDTA 5HJLA 4DELA 1JRBA 1FVPA 3QKEA 3OZYA 4PUMA 3SZ8A 4Q8NA 1UD6A 3CEPA 4QG8A 2VD9A 3OZMA 4TIMA 3ITVA 4FLRA 5E93A 1BYAA 1CYGA 3QW3A 1Q6FA 4LVBA 3HG5A 3N4EA 1AODA 3ITYA 1GVYA 1YRRA 1A5LC 1V77A 3HURA 2P8BA 4AHQA 4PBGA 1V7YA 4IH3A 1XFCA 3AIBA 2B31A 5F1VA 2GGEA 3LCHA 1P0NA 2ICSA 4NKCA 1UUOA 2PTXA 4NZ4A 4U3AA 3STCA 4W7VA 1M04A 3EWZA 1GQJA 4F9DA 1DIDA 2G3MA 5D32A 3G3DA 3AIQA 3HBLA 1TKKA 4LY8A 5CC6A 3KVKA 1US2A 1VKFA 3JVAA 3E2SA 2WVSA 4Q8UA 1WKYA 4ACZB 2BS9A 3W75A 3W6LA 2DT1A 1W3IA 1IIHA 1O5RA 3FKRA 4HN4A 3QF0A 3K1GA 5EMLA 3CHFA 3GS6A 1UB3A 1AA1B 1W37A 3EWXA 4G56A 3LPFA 2W66A 1Z44A 4ZVJA 3R11A 3SJ3A 1EXPA 1OQFA 3RR4A 3VD9A 5CJ5A 3N25A 3W86A 4E2BA 1GJPA 4DJFA 2CIPA 2I5IA 5D9MA 1ZRQA 4DB7A 1Q3NA 2AMGA 4A8RA