4YTQA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy d-tagatose
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
total genus 118
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4ytqA00
1XIGA 1XLGA 2XISA 4XKMA 5AVNA 1DIEA 2QUMA 3UXIA 3VNLA 4ZB2A 1BXCA 3KCOA 3P14A 3L23A 1XLLA 2Q02A 3M0MA 1MNZA 3C0SA 2I57A 2GUBA 4HHMA 1YX1A 3UA3A 4YTRA 4HGXA 1O1HA 5XIMA 3VNIA 3VYLA 7XIMA 3ITXA 4QDWA 1XLIA 1XLHA 5C9ZA 5B7ZA 4GJIA 6XIAA 3ITYA 3OBEA 1XIIA 4A8RA 4OVXA 1K77A 3ITVA 2X7WA 1XIHA 2QUNA 3UVAA 1S5NA 1XLMA 3AYTA 1XIJA 3DX5A 3KBJA 2NQHA 4QEEA 5B7YA 8XIAA 3C0LA 1XLCA 3NGFA 4HHLA 3CNYA 2I56A 3KBNA 3VNJA 3BANA 3M0XA 1QT1A 3KBMA 4GJJA 1XYAA 1XLFA 2ZVRA 5XIAA 1XISA 1S5MA 1XIFA 1XLKA 3CQHA 3M0LA 4G56A 3BWWA 1A0EA 4QE4A 4ZB0A 3CQKA 5I7GA 4A8LA 3KCJA 4EAYA 4A8NA 4GLEA 5AVHA 1CLKA 2GLKA 3UA4A 3XINA 4QE5A 3ITTA 1XLDA 1DXIA 3QC0A 3C0QA 3KBSA 2ZDSA 3M0VA 2QW5A 1I60A 9XIMA 1XYMA 5TNVA 3ITOA 3N4AA 4LNCA 4QE1A 2XINA 4XSLA 3BZGA 1XIEA 5EMKA 4ZBCA 1XIDA 4W4QA 4YTUA 5EMMA 4E3VA 3XISA 4YTQA 4XISA 1I6NA 1XIBA 2J6VA 1XICA 1XLAA 1XYCA 1A0DA 9XIAA 3VNKA 5FA5A 4Q7IA 3IUDA 3QXBA 4PFHA 3QZAA 2NQJA 1DIDA 2GVEA 3M0HA 1D8WA 3P6LA 8XIMA 2NQ9A 4X61A 1XYLA 3CQJA 3KBVA 1XLEA 2GYIA 1TZ9A 3KBWA 2X7VA 3FVMA 3LMZA 1XLBA 3IUIA 1BXBA 1OADA 4QEHA 1XIMA 3QYSA 4XSMA 4XIMA 1DE5A 3AYVA 3M0YA 3CQIA 3TC3A 2G0WA 3U3HA 2HK0A 1XP3A 3KCLA 3AAMA 4EACA 2XIMA 5H6HA 2G4JA 3CWHA 4HNOA 2HCVA 4K3ZA 3U0HA 2QULA 1XLJA 3BDKA 1QTWA 5EMLA 3JU2A 4US6A 4K1GA 5XINA 4X60A 1MUWA 1XYBA 3UU0A 3XIMA 3KWSA 4DUOA 4YTSA 3KTCA 4A8IA 4J4KA 3DBNA 1QUMA 4DVOA 5J8LA 3ITLA 4PGLA 1XINA 4ZB5A 5B80A 3VNMA 3IUHA 3BZJA 4X63A 4QDPA 4YTTA 5H1WA 3WQOA 2OU4A 3TVAA 1GW9A 4XIAA 3AALA 5EMJA 1DE6A 3GNXA 4KW2A 6XIMA 2HK1A 1A0CA 4GQBA
chains in the Genus database with same CATH superfamily
3SIMA 1YEYA 3ICJA 4NF7A 3BURA 2WC7A 4L65A 1BGGA 1XCFA 2I9UA 3BMWA 3V3WA 2IQTA 4ATWA 3TJLA 4DJDC 2HVNA 4UC5A 1XIHA 3V18A 1ZJIA 3ZLGA 1S5NA 3AYTA 1HIZA 3C0LA 4BWLA 4XO7A 4FEZA 3A9IA 3EOLA 2Y1HA 4HA0A 4GYPA 4DELA 3ABSA 2WB5A 1L6WA 3NOEA 5DO8A 4LVDA 5AZ1A 1I60A 3FJNA 1QDSA 1XFBA 2UY2A 3VMOA 2REQA 1EP1A 5J5DA 3QKZA 3ZR5A 1XIBA 1KFLA 3E6EA 4RR4A 3DENA 4YCOA 1H60A 2YCLB 3FNDA 3H2CA 4X61A 4TX8A 2Z1WA 4LB4A 1FVPA 1WQ5A 2YLLA 3HFTA 3K8KA 2X1TA 3HPSA 4DYKA 2DZUA 4JIPA 4E8GA 3VGBA 3NQFA 3VZYA 3TYDA 1EHAA 1OC5A 1FWSA 1CECA 4WDTA 3LPGA 4DNMA 3QW3A 2V0TA 1TV8A 1KTBA 1EA0A 3KP0A 4P7OA 4X63A 3L4TA 1GW9A 3K4DA 2QIIA 3VIGA 3S6OA 3PF3A 2IPJA 1UH3A 1WPCA 1LM1A 3WF1A 3NDYA 4AAJA 3NJ3A 2XH4A 4GYKA 1VIWA 4HOZA 4RV3A 3BW3A 1K4HA 1QASA 1V93A 3K1GA 4AUBA 1PEZA 4N9CA 4H9MA 3PK7A 2O9PA 1KWGA 2J66A 1SO6A 1VYPX 3CPGA 1MQQA 1BG9A 1AZ2A 1LOLA 3SB0A 2O92A 4LVAA 3LXAA 2SFPA 1L0PA 2DUAA 1QNOA 3E0VA 3M0JA 3MSYA 3RRAA 4YJ5A 1E71M 3TZFA 3A13A 3FSTA 1BGAA 3GB6A 4JNZA 1R47A 2CBVA 3DG6A 3WLPA 1BTCA 3VKKA 2J6XA 3PS7A 1XLAA 2DIEA 5AZ0A 5FOOA 3OHMB 3T6CA 3N18A 1QI5A 1EH9A 4LSBA 4TMCA 3O07A 4QFUA 3GTHA 2VQUA 3GYCA 1ZCOA 3NCOA 5K9XA 1F8MA 3NQMA 4X60A 1XYBA 3TX9A 1L2UA 2HVOA 3IJ6A 1RALA 2OLHA 4FNRA 1FWTA 1X8CA 3EX4A 1ZTVA 2B0MA 3TIMA 4BHYA 4JKMA 1C8YA 1LROA 3IAPA 3G24A 1J0IA 3W1PA 1UD2A 1PZ3A 3LG3A 3B0XA 1KQZA 1OD0A 1YTDA 1KFCA 2X1IA 4LBRA 2VFGA 2XUCA 4MB1A 5CEWA 4XAZA 3OB8A 3L5LA 3R12A 3SUWA 2J7EA 2HS8A 2D0FA 4Q4OA 5FAJA 1WOAA 4EPDC 3T2PA 3OA5A 4WRHA 2ZVRA 4HCLA 4HOXA 4X2RA 2VZTA 2OWWA 4IICA 3DGRA 2VR4A 3ZVHA 5REQA 2ISFA 4X0NA 3MSRA 1XQKA 3UR2A 3UR8A 3I65A 4CU8A 1X6LA 1HVXA 5A6AA 4QG6A 5AYBA 6REQA 3W88A 4LQ1A 5CBBA 3QV9A 1SMDA 2Y85A 4A35A 1H7OA 4ML4A 4D8LA 5E5CA 5FSEC 1QHPA 3LXBA 2WSQA 5U7SA 1BXBA 4QQUA 1H1ZA 4PMUA 4S3GA 1O4UA 1EL3A 3MPGA 1KKRA 2CWXA 4NNBA 3R58A 4WF7A 5CQ1A 1J93A 2FZDA 3LSCA 1X97A 4PMXA 5AECA 2E6DA 3GAKA 1FWWA 3N4FA 3RM8A 2E28A 4G1NA 3B05A 3QV7A 4Z2LA 1UD8A 2QYGA 1LRNA 1R3TA 3T05A 3LNMA 4M6VA 2WVUA 4AH7A 1W32A 5A69A 1V3JA 4ZO7A 2PS2A 1NH6A 1CGYA 3AUJA 4OVXA 1MUCA 2X0SA 3WK1A 2X7WA 4NRSA 1MW3A 1XLMA 2NWSA 1H7NA 4JIRA 4AWSA 5LXXA 1E0VA 4W84A 4CGTA 3H8AA 2E1WA 5DY3A 2H90A 3R2GA 1JCJA 1XH1A 4HNLA 2A3LA 3AS0A 1UQYA 1KTCA 4H8UA 3U4AA 4PUMA 1RA5A 4JHZA 4FR6A 4ZQNA 2HWGA 1XLDA 3N13A 3M1ZA 2G4FA 4IP5A 1M65A 1FCQA 3TR2A 3BG3A 2OMAA 1QPNA 2EG8A 3SSZA 4UQAA 2VGBA 2F6KA 4I8DA 4NXSA 3T2QA 3HIJA 2XU2A 1VBGA 3O06A 1DIDA 4E3TA 1TV5A 3MJYA 2ZXQA 1OGGA 3LMZA 1OADA 3QYSA 3FJ6A 1J2WA 4HNCA 3WQ4A 3LGGA 2Q8ZA 3JR2A 3WLKX 4MNKA 1XH2A 1F4HA 3A3HA 3KOYA 4QSFA 1SVDA 4W86A 4JTKA 2D2HA 2ZWZA 4XIAA 4IX2A 2DT3A 3W7EA 4REQB 3HQPA 4OOZA 3APTA 5AVNA 3B9DA 3ARPA 1FWHC 4JIHA 2RGMA 5I79A 1O1HA 2J78A 4UMCA 4UFHA 3R0DA 1J0KA 3HG4A 5HAOA 2J27A 3TTEA 1K77A 1UR0A 1DIKA 3KL5A 3KDNA 3QHMA 2EPKX 5D05A 3NGFA 1ZALA 4LYQA 3B8VA 3CUGA 3IWPA 2A21A 5FL1A 4WLCA 3CBWA 4A8LA 3EDJA 3Q65A 5I3DA 4GXPA 2TRSA 2WMIB 4ZBCA 1R0MA 4R7JA 1PHWA 1EJXC 1OG0A 3K4AA 2BASA 1RY8A 2JGYA 1KM5A 1H2JA 3CIVA 1KC7A 1JXJA 4ZO8A 1CLXA 3W2LA 1R85A 1HP4A 1NDYA 4HA4A 1YMYA 5JMUA 4A22A 4LX4A 2FGLA 3BW4A 2OXNA 4O17A 1J4EA 3DAQA 1V0MA 5D09A 2PDFA 5HMSA 4EXAA 4QP0A 4AMAA 2WCAA 2VWSA 3MP4A 1KM3A 5EMUA 3U7VA 5C8BB 4DRSA 4JQ4A 1O6IA 2BHZA 1RSCA 1E4NA 1JCNA 1GONA 4R9XA 2DZPA 5CPLA 3HJZA 2DH2A 1D7FA 3ITYA 4NAFB 4HP5A 2XFYA 1MDRA 1GK8A 1UW9A 4FO4A 3AUOA 2BHUA 2XM2A 5CPOA 3F5JA 3HGRA 4LB3A 3WMSA 2AQVA 3E9AA 4AY8A 4LEFA 3KLLA 4XZBA 5I3JA 4GUGA 2EJAA 1G4PA 4B5XA 5M5DA 4H2HA 4Y96A 2YYUA 4IP4A 3T0DA 1V3HA 4IGMA 2OSYA 1HKVA 3DFTA 4K8HA 3PSVA 4AXNA 3T9PA 2ZZ2A 2GDVA 3SURA 1W5QA 5FEPA 1E70M 2XH7A 2X1UA 2ANUA 2OZ3A 5E6YA 1A4MA 4AD1A 4H2CA 2BY3A 1UBSA 4M6UA 4MADA 5DXXA 1EJUC 4IGSA 3KWSA 3LHTA 3LU2A 1W9PA 3FN9A 3E2QA 1R7OA 4F2UA 5L6UA 3O9NA 1CBGA 2ZZ6A 4K7YA 1YKWA 3Q37A 3N14A 4GX8A 4GVIA 3F7JA 3LRLA 1HTIA 1H0GA 2NUXA 1F3WA 5I02A 2QQ6A 2ZADA 3P5ZA 5BROA 5C70A 2WMHA 5A6TC 3GVQA 4DO5A 4ECLA 1VYSX 4YLWA 1TO3A 3L4VA 4B5WA 3QGAC 3QQ1A 3GFXA 3STPA 2FZ9A 4ZE5A 5JIPA 3WQ8A 1P1XA 1SW0A 2WZMA 3V4BA 1HNYA 4DJDA 1PAMA 4M51A 3LLDA 1I0DA 4LBSA 4GZJA 2BLEA 3DEQA 1QRQA 3WJXA 2Y70A 3WDPP 4M0XA 2WMJA 4XZHA 5GVJA 4JTQA 3TNOA 3VCNA 4BK9A 2BY1A 5CZKA 5E1QA 3RF9A 1FP9A 1X1OA 2GPTA 2X0HA 4H04A 5I06A 1OIMA 1XKYA 3M7SA 3WF2A 5F2GA 2QV4A 3HURA 4RDYA 5EMLA 1H5VA 4DXKA 2RDTA 3GHTA 2OFJA 3OZYA 4P5UA 4GINA 6TAAA 5EPDA 4U31A 5IOBA 3UJSA 4H9UA 2FMNA 3PZUA 4ZFMA 3GY1A 5DCEA 1Q6OA 2QUMA 3VM5A 3BLDA 1QU4A 2OCZA 4PCNA 4KRTA 1RA0A 4H9XA 3V1HA 5EY5A 1JYWA 3ERPA 3EWZA 2G95A 3TC6A 4J1OA 3RX2A 2OG9A 1T41A 2DPEA 3T0AA 4W8AA 3ME3A 3NAVA 4GXWA 4NT0A 1V3MA 1B0IA 3A3XA 3M6DA 2X16A 3SCNA 2C71A 3PFRA 4S39A 5HA7A 1T8QA 4QGCA 3WN6A 4DNHA 3ABZA 3K4WA 4LUJA 3EPMA 1YLVA 3KEHA 4E0CA 3EOEA 5AYIA 1JZ8A 1EGZA 4QCEA 1ITXA 1QOPA 3DIPA 2ZWYA 4KQNA 2XH2A 4QBXA 4PMVA 1WX0A 4H7CA 1EEXA 2Q6ZA 4N0RA 4NL1A 4WJEA 4JTRA 1A0DA 5CZTA 5FF3A 1XW8A 1V51A 4FNPA 5LIKX 2H3DA 1XLEA 3TE9A 2I1OA 5G4WA 3MV01 5GNXA 2JKPA 3WBWA 1H7XA 3W2MA 3V5OA 3CIWA 3W6LA 3AJXA 4K38A 3DBNA 3W7LA 2XJ7A 4JQ3A 2E9MA 2V5DA 1QBBA 1TJ1A 3SCWA 3TFCA 3QHOA 3H53A 1L6YA 5HUOA 5KETA 1DWIM 4FLOA 1AODA 1S3TC 4UFKA 3P0WA 4MMWA 1GZJA 4JTGA 1EC8A 2WPGA 2QCDA 1L8PA 4HGXA 2GJPA 4PMDA 1F5ZA 2OT0A 2E6YA 1UP3A 1XF0A 4JYEA 4ZOCA 3C8FA 3DHDA 4UTMA 2CBJA 4FIRA 1UASA 3KOZA 2RHGA 4AIOA 1QNPA 4P7QA 2VGIA 3U7BA 2XM1A 4IIEA 2UY4A 3W74A 1UOZA 4AZIA 5D2YA 4GCXA 2C79A 3XINA 1Z42A 2I5GA 1W91A 3W22A 5I23A 5LXEA 5LA0A 3IIXA 1JZ4A 2PI6A 3BC9A 3ZSTA 2VUNA 3UBPC 3WD3A 5D32A 4GCAA 4KEUA 3V5FA 4LEQA 4DO7A 1UHVA 4HJFA 4RDWA 2L5HA 4H9VA 3VIPA 4LT9A 4GUFA 4ZL1A 1J12A 5E0CA 1PIGA 4Q8NA 1P6WA 2ZFAA 4OQVA 4RK8A 3G0SA 1M1BA 5D2WA 2ZXAA 5BWAA 5DX7A 4O11A 4F9DA 4L61A 4PMQA 5FEXA 1HVQA 5G4HC 1A0CA 3NIYA 3SCRA 3AMKA 5EL1A 3PNUA 4N2YA 5DY2A 3W76A 2ZZ1A 1GYLA 3OIHA 2O56A 2HQAA 3FXGA 1UZ1A 2Y7EA 4MYAA 2E25A 3MDWA 2J47A 4W85A 3KS5A 1XC4A 2QPUA 3MJMA 1QI2A 1XD0A 4NYYA 1LT8A 5M3WA 3W1LA 3EB3A 3MU7A 1OY0A 2PWFA 4ZOBA 7PTDA 3VD3A 3S0CA 1BVNP 1QR7A 4E4PA 1KD0A 1BVZA 1HJWA 2VRKA 4AWEA 2VELA 4PBEA 2E8YA 2A7PA 1XM3A 1FWRA 2GGGA 2OR2A 4M82A 1V4YA 2POTA 1BWKA 2J7HA 3VDCA 4KKXA 3QBUA 3S46A 3R5EA 2BSLA 1AMKA 4GYFA 3EDKA 4ZQPA 2VWTA 2Z26A 3TC3A 3CQIA 3MI2A 1QFEA 4UR8A 5LIYX 4CNPA 4D6CA 2WMGA 3MCMA 1FP8A 2ZA2A 4CQCA 4NAFA 5I2UA 4HU4A 3W1RA 2XDFA 3W9ZA 2PDQA 1SZEA 3LM7A 4ATLA 1UWQA 4QDPA 4QSHA 4JR5A 2JK2A 3RUBL 2DY3A 3BJTA 2WC4A 4LVGA 2ACRA 2CBUA 5A6LA 3TW6A 1Q66A 3KCOA 1ME7A 3KX6A 3LPPA 5F2LA 1OGSA 3G6LA 3NOYA 1QWGA 5CZSA 4J27A 3B8TA 2NXHA 2ZZ4A 2OSWA 2OO6A 2ZX8A 4IGNA 1SZRA 1IR1A 3SN1A 4M3PA 1ZBVA 3N4EA 1TMHA 1NDWA 2CBIA 3UWEA 3N2BA 4DQWA 4MPKA 3ARSA 2XSBA 3TTQA 4GUJA 1PTAA 4F3HA 4QAWA 2PZNA 1E51A 4ZZ9A 3FX4A 5A1AA 3D0CA 1TX0A 4XSLA 4IGHA 1F9CA 1YRRA 1XIDA 5LNWA 2PLCA 3LHYA 2BMBA 3OTRA 4PA8A 1NY1A 1IZKA 2AL1A 1ZLPA 1W3KA 2AKZA 4OUEA 4N6EA 2VC7A 4IUOA 3UPWA 4QEHA 5F1UA 3ALGA 3EPOA 3WENA 2HK0A 4W7VA 2BHYA 5CPNA 3LCXA 3CAWA 1RUSA 1EIXA 3LZ5A 1VPXA 3GNOA 3ITLA 3R43A 2QGYA 4JAWA 2ZRXA 1F73A 1PB0A 4HPNA 3V75A 1YDOA 1KXVA 3PJTA 3WQOA 1NU5A 3NPVA 1E43A 1ZP3A 2F8QA 3MMWA 3T09A 3VI2A 3GTIA 4B5NA 1UR8A 1B2YA 3PZ9A 1PV8A 3D46A 1CPUA 4TOQA 4H9ZA 3THCA 3IJ7A 3MQTA 4MZ1A 4JL1A 4GUHA 1NDZA 3M0MA 1A49A 4MWAA 2FDSA 3QFEA 1Q3NA 2O7QA 3U57A 1CXEA 2QMKA 5AYYA 4TX9A 4XAPA 4ZCWA 3T55A 5BRBA 1XD1A 2HBXA 5REQB 1SFLA 3KBJA 4UFLA 3LM3A 4YHEA 3ZOAA 1KTNA 3GWQA 1YHTA 1LT7A 1MZRA 4RZ4A 3T8QA 2VMFA 4LNYA 4PUNA 1DWJM 4B9ZA 4B2DD 5L9FA 5EKYA 5BCAA 2ISDA 5I00A 1RLDA 1DJXA 5IXEA 3B0UX 3ARZA 3RR1A 1FDYA 2ZUUA 4YVVA 2EPMX 3ZLHA 4H7VA 3K2GA 4C6OA 3SCVA 1CENA 3ZR4A 3SI9A 1F3TA 3EWYA 1XBZA 4WXZA 1HKMA 5I3FA 2ISWA 3SEPA 1E5JA 3LK6A 4GI6A 2PAJA 3MSDA 5LHFA 4EXQA 1DWGM 2RH9A 4XVEA 2NQLA 4IPNB 2WLZA 5XINA 3VDAA 4JYFA 3VOHA 1O5QA 2P53A 3NL6A 3MS8A 1WDWA 3AZTA 1RK6A 2YIHA 2DVXA 3A3WA 2XYLA 2ZYFA 3WG6A 5A6MA 1A5NC 1A5CA 3AALA 1LG2A 2HNHA 2ACUA 2FH8A 3KP1A 4JQ1A 3R11A 4ACZB 3SQMA 1UB3A 1XIGA 3LN3A 4IIGA 4A3RA 4W7WA 3R6IA 1ISZA 1P7TB 2X05A 5KSWA 3R10A 2VHLA 3ZYZA 1GOQA 5HK4A 1Q4NX 4DF1A 3LGEA 2PSNA 3AS1A 3S83A 4C6MA 2XVLA 2BB0A 1QNSA 2YYTA 1TR1A 2WC3A 4XV0A 2WQDA 3SBFA 4JKKA 2I9EA 2PB1A 1EO7A 4FNQA 2DSWA 2ZA3A 2FVKA 2GGHA 2BVDA 4HYWA 4JQ2A 2HTMA 3CMGA 5A8MA 4Y90A 1YDVA 1SPQA 2E5CA 9RUBA 1R2SA 2IW0A 4RZBA 1MXDA 2XGIA 3QMSA 4IG2B 2WNWA 3S6TA 4H6KA 2A0NA 2GGEA 3N73A 4MF4A 4TR9A 4H6QA 1T40A 3VGFA 3D5HA 2ZZ7A 3OVGA 5DT7A 1CGTA 4P61A 4O54A 2TSYA 3PUGA 4UBPC 3TXZA 1W8GA 1CZ1A 3KZSA 3NG3A 4GY1A 3HPAA 3KHDA 1HKIA 2WKJA 1P48A 1VZWA 2OPJA 2YA2A 3FJ4A 3LBOA 5CZ0A 4XZ9A 1KBKA 2PP0A 4FS9A 4DUOA 4KFNA 4R27A 1Q5MA 3C2VA 1J79A 2X40A 2PDHA 2XVNA 3STEA 2YDSA 1EEPA 1VFHA 1DE6A 2P0OA 1G4TA 3CL6A 3ARWA 3ARXA 3PG9A 1P0NA 2VFIA 1V0NA 3WNMA 3DI0A 3NQAA 3P14A 4LY4A 3SADA 3M5ZA 5M2FX 4YTRA 4GQGA 4MDOA 4C6DA 2IMRA 2VTFA 1KLZA 3LB0A 5K7JA 3WD1A 1YDNA 4KT2A 4IMEA 2Z6JA 2YCIX 2JEPA 3TN3A 3B9EA 4BJHA 5HQEA 5CGTA 3W70A 1WXJA 1F4AA 5CCZA 4O1EA 5HANA 3SFKA 4G56A 1IWBA 3S1VA 4CEUC 2WZHA 2DJLA 3N9SA 2PLMA 4O16A 1XQLA 1Z69A 3I7RA 3EKZA 1R46A 6REQB 3VIIA 3KL3A 1YTEA 1FXPA 3OGVA 5HR7A 1O5RA 3EX3A 3JUGA 1U1HA 2HNEA 3WUFA 4LRTA 2WHKA 4XD5A 2YL9A 2E0PA 1ONXA 4KFPA 7TIMA 1U5JA 3NWRA 1GW1A 1I2NA 1Z6KA 4L4OA 2X42A 2WSPA 1H7RA 2IUZA 1W17A 2DV0A 3H55A 3COTA 2YDRA 1XG4A 3MKCA 4NASA 1R86A 3DDMA 3IIPA 1CGWA 5F2IA 3TFXA 5GQBA 3REQA 3UW6A 1KBLA 3UQNA 3WKZA 2DZWA 1UPMB 4KS0A 5BRQA 3IJDA 4C6JA 2YCJA 2CLEA 1G4SA 5G1TA 2C7FA 1VBUA 3T44A 1EYEA 3W2JA 1UOKA 3CV1A 3UPBA 4H6RA 4LWWA 4OV4A 1KXQA 4AZBA 4RPPA 4KWWA 3P2VA 1UKPA 4AIBA 1BWVA 4HVXA 4V27A 3WQ6A 3SCQA 1RY0A 2E9BA 1CXKA 3OVRA 2ZUNA 1TZ7A 1CXFA 1Q7MA 3BAYA 1J10A 1XUZA 1EC9A 2ZRYA 1VLWA 1IXPA 2PDJA 3GG8A 2DFAA 5I7GA 2OQYA 3HG5A 3W1UA 2XG9A 3CC1A 2G3FA 3LI0A 4PMJA 2FLIA 3MUZ1 1ZJAA 1Q7ZA 3RJYA 1ZY9A 2NVDA 9XIAA 4DBDA 4MWAC 1GQKA 2A3CA 3BJSA 1HN1A 3TUUA 1TJPA 4DPQA 1OX4A 1XLJA 2PDWA 4LUIA 4EKJA 1TPVA 1OT2A 1JIBA 2A2IA 3GNDA 5CC5A 3VILA 2ATMA 4XQ6A 1W3IA 3CAKA 3S9YA 4HSNA 2FHFA 2VC6A 3F4VA 1OCBA 1OYCA 3OBAA 3S1UA 2JIEA 3S1GA 5HWMA 1NOUA 3U5UA 1JULA 4CEXC 4RKAA 1OFBA 4B4FA 2E77A 4XUGA 4UTHA 1Q4WA 1OC7A 2GZXA 3UA3A 2E09A 2QDHA 3H4GA 1YBQA 1J0HA 6A3HA 4UFMA 1NARA 2FPYA 1M03A 2YB4A 5C9WA 3C8NA 1HL8A 3VCRA 4GC4A 1SZNA 4ZVJA 1W3TA 2NQHA 2OSXA 1WKEA 2R1NA 3OBKA 4WCJA 1KFEA 1RBAA 3GXTA 3MI6A 1EBGA 1TPH1 3P60A 3G8EA 4TX6A 2YBTA 4PBGA 2F6XA 3EOOA 1US2A 5FJUA 1G67A 1RZMA 5HJLA 5TNVA 5BXTA 4H01A 3CWNA 4LS0A 2Y7DA 5C2GA 5CGQA 1V02A 2GVEA 3EOUA 1NJJA 4ERIA 4WY0A 5H2ZA 5T9CE 1UMYA 2A6NA 3QY6A 2JKAA 3M5VA 1T7LA 2OX1A 1TWSA 4KCUA 2YW4A 2V5JA 2P50A 3K13A 3EDDA 3G0XA 4IIBA 4HPXA 1FWDC 1NSJA 7A3HA 2QCLA 2YPIA 2G3MA 1OINA 2P1FA 4FHAA 1KR0A 2JGQA 4MNLA 2DQXA 4I5UA 1AQHA 4GNKB 4J28A 2E7FA 2Y88A 4AVFA 2E8ZA 3UETA 5M17A 4E6MA 4EE9A 2GUBA 4ZR8A 4CVWA 2DSVA 3N1AA 4HTYA 2QJMA 2G3NA 3E74A 1YQ2A 1GQJA 4XBSA 3HQ1A 1TX2A 1W3JA 3TYEA 3PHAA 1EFZA 3LQGA 4AZ5A 3SY8A 2OGYA 3NUKA 3QFWA 1UWUA 4Z0SA 3VNJA 3WQEA 4AD3A 1E0WA 2Q3RA 5E0FA 2PDKA 3UWUA 3BPWA 1VEOA 1J2BA 2QJNA 1VHCA 4U10A 3WDQA 1TVPA 3SCPA 1GJUA 1TJRA 5E93A 4ZXOA 1BYAA 2GOUA 1Z41A 4LALA 1UBPC 3OVPA 2FHCA 2D23A 4IHCA 3S9IA 1H51A 1GQNA 3QZAA 3S5OA 3ZWSA 3T40A 4YVXA 2QF8A 1CDGA 3ECQA 4XAYA 3ZJKA 3RPDA 3SO7A 2C6QA 4US6A 3WLHA 3MT1A 1WXZA 5HINA 4S3BA 3HMJG 3UERA 1GGOA 3L2IA 4OT7A 1BHGA 4MJZA 1O5XA 2I5IA 4WJ8A 4TTGA 1SO5A 3WDRA 3L9CA 3SUUA 2B4GA 1OIFA 2WJEA 3KE0A 4J2MA 4HNUA 5CG7A 1V8EA 2G97A 4MWAE 4NZJA 2J79A 4RZ6A 4L9XA 2RDWA 4GJIA 4NY2A 1O95A 1QPKA 4DIAA 1RQHA 1JAEA 3UNTA 1MFVA 2WWCA 4UQDA 1IF2A 4L64A 4AVOA 4PC8A 2ZE0A 3VE7A 3C2YA 2VI0A 4KEMA 4DXXA 5HQMA 4JFVA 2JF7A 1UC5A 1C93A 1KRCC 3UR7A 1JI1A 5IBXC 1FY6A 5HQLA 3G2GA 1DHKA 1TSIA 2ZDSA 3NM3A 3QQ0A 2ONEA 4H8VA 2CETA 3DN5A 1W9VA 1LQ0A 4IG2A 1UWSA 3VNKA 5EA9A 4QR6A 1FA2A 2B81A 4L1WA 2WOQA 1EBHA 3W7DA 3AS2A 3CQJA 1ME9A 1NF7A 1AZ1A 3F4WA 3NL3A 3W7RA 3AIQA 4AFYA 4EPEC 2TPSA 3HOJA 2GSEA 4WGXA 2CITA 2FZMA 2R1KA 1L9WA 1JPDX 3II1A 2XIMA 3ONCA 4KIRA 3DU0A 4HNOA 1S2UA 3ARTA 1BRLA 3ZS4A 1KW1A 2TAAA 5D30A 1NP0A 3E0LA 1YTKA 2VL4A 3QR0A 1R8LA 4NQ1A 2PBGA 4G1KA 2QDEA 4C6BA 3L66A 4NYUA 1F8IA 4NZFA 3R1ZA 3ZJ7A 3FCPA 2GJXA 2NX1A 2F2KA 2DIKA 1BXCA 4Z1BA 1PZ0A 1K7XA 2XZ9A 4IFOA 4OECA 2WYSA 1KCXA 2J9YA 2J25A 3ZT7A 1BYCA 4US5D 5DBUA 1EQPA 1E5NA 4ASTA 3GR4A 4KIEA 2OZ0A 4IJBA 4RNJA 3W00A 1ZPTA 3MV11 4PTVA 1VRXA 1H50A 4MZYA 3FK4A 4CKQA 2ALDA 3U4FA 1GVOA 2ICSA 5LIXX 4IMGA 3URBA 3NXFA 3ZSSA 4CCCA 1LL4A 4CQ8A 1EPVA 5BYWA 4YTUA 1P6BA 2CU0A 3V35A 5DXYA 1BQGA 3H24A 4DZAA 4C90A 1QWKA 4DM1A 5EGRA 3S42A 3CMFA 4AQLA 1IXQA 4H4IA 3L0GA 5D2XA 1DV7A 3BLFA 2W27A 4JFWA 5HUPA 3GTNA 2R1PA 4K2SA 3W82A 1M7PA 5DRCA 2HCVA 2QULA 4X2PA 3W7GA 1I45A 5C7HA 2ZA1A 4W9TA 1GVFA 3TK7A 1VC4A 4B91A 1X39A 3LY0A 1AJZA 1SUXA 4GBDA 3CB8A 3VC5A 4OBSA 3B06A 3WO8A 1Q6FA 3GH4A 5IHRA 4DAFA 5FCZA 1B3VA 2VT0A 2J7GA 4BF7A 4PH6A 2Z4GA 2ZRWA 3GNNA 1MXGA 3I7QA 3SUVA 4PTDA 4QJ3B 3H7UA 3MTWA 4QNEA 4V28A 1J5TA 4LF1A 5E09A 1FHVA 3NEVA 1KV8A 5I24A 4CQAA 4JBRA 4FOKA 4Q33A 2WJZA 3WDIA 2WWDA 2X1SA 4F2TA 3FW6A 1YBQB 1KRMA 1JCMP 1XYAA 1TREA 4GK8A 5BNKA 1LJYA 5CPMA 2WNNA 3I4KA 5IDIA 5DMYA 1C29A 5I03A 4PTWA 3PBMA 3OP2A 3TW7A 1YADA 1ELSA 2C13A 1NOWA 3ITOA 3VK5A 3GG7A 5E6ZA 3SCUA 4MDPA 2Z1SA 4QJ4B 2PGRA 1VCGA 3PZGA 3LD5A 3U8GA 2A5HA 3VIMA 1TZ9A 1A5OC 3KVLA 3VPLA 1CXIA 4LJ3A 3FKKA 3WK0A 2VD9A 3BDKA 4BR1A 3W28A 2DSKA 1CCWB 3UZJA 1X38A 2O9OA 1AH0A 1OFAA 1E6QM 1MRQA 1L6SA 2PP3A 4F0RA 1AH4A 5A3HA 2ASHA 4ILSA 1E73M 4WEVX 4C1NA 1D3GA 1UZDA 5IDZA 3EKLA 3GX9A 5D38A 1I75A 4IFRA 4QQ3A 1AVAA 3MHFA 4HK5A 1GZGA 4D6DA 1W1A1 1WDRA 1Q6DA 1BPLB 1UR3M 1RXOB 3UGRA 3NFUA 3CZ8A 2FVMA 3RXZA 4JFUA 5TF0A 3SUSA 2OLSA 1C9WA 1KR1A 1H7WA 4KERA 3UWZA 3AMGA 4IX0A 4RXFA 4G8TA 4AYGA 5G2WA 2G3IA 3W85A 4JTHA 4GQ0A 3H23A 1BG4A 3IVSA 2D3NA 1G7VA 5DBTA 1B9ZA 2VZVA 3IARA 4QIUA 3TJIA 4JFSA 4H3DA 4JXCA 1IEQA 4BQ5A 2IKHA 2Z1XA 4AZ6A 2RUSA 4W7UA 1Q6GA 4E3VA 4LU0A 3AHYA 3G3DA 1AFSA 4PMNA 1MEHA 3S2NA 5HJYA 3L0NA 1M53A 2QAFA 1LRTA 4ORIA 2V9DA 2CZDA 1JF5A 4DWSC 3TMLA 5KZDA 1XIMA 2X1RA 2PWUA 2QDDA 3VE9A 4W5UA 1PWLA 3UNDA 1IQ8A 1PDZA 4HCHA 2NXGA 1BQCA 4MAVA 5CH9A 3B3DA 3MUAA 2XVPA 2ZTKA 2YFOA 4FB7A 3RDKA 5GNZA 1GZ1A 3DOPA 4NU7A 2HXTA 1XLGA 1RAKA 4XKMA 4CN6A 2CLFA 4MTVA 3TYAA 1F05A 3CWOX 1Z48A 4AEOA 5HBFA 3S1XA 1AMYA 2Y5JA 3MY9A 3VZZA 5T8GA 4V1YA 2ZRVA 3O6DA 3L21A 3N34A 1ODUA 1PKMA 3NEHA 4Q8PA 4A8RA 2NQZA 2PP1A 3WUGA 4S3DA 4LCSA 1QW8A 1FWFC 4RNHA 2XFWA 5A6BD 1YNPA 5JBEA 3CQHA 1XIFA 3PBYA 3N29A 4E38A 2V67A 3LQLA 3VD7A 1WBHA 3SRKA 2XVGA 3U48A 4JKLA 1XIEA 1QNRA 1RCOB 3L5MA 4N6FA 1RCXB 3FDGA 3FOKA 4HPJA 4LCQA 1DQUA 3TKFA 1PTGA 2V68A 2RKXA 3H26A 4DBEA 5KINA 4GVHA 3TYBA 4OKDA 4OIFA 3DFHA 1EJWC 3ABRA 2W66A 3A5VA 3MHGA 3H2OA 3UG4A 1TTQA 5CPTA 2AMXA 4R53A 1WUEA 4LH8A 3QM3A 1D3HA 3T08A 3MMUA 4E2BA 1OM0A 3R0UA 3VKJA 2WO5A 4F0MA 3BLEA 1DJYA 4MB4A 4WVXA 2VEIA 1ICPA 1XL9A 2A4AA 3HTWA 1ADOA 4PR4A 1FDZA 3KRUA 2EXOA 3A4JA 4QXIA 3RG6A 2Q09A 1DQXA 4RV8A 5PTDA 3PPFA 3AU2A 4C6KA 5IFTA 3WL1A 2QVNA 4HU8A 3WLTA 1KNWA 2BP1A 2DZAA 3VGHA 3RMEA 4LCRA 1VP5A 1PL9A 1SW3A 4DAIA 4QG8A 1WB0A 2VX4A 3NPXA 2I56A 4FSAA 3GXPA 3EWCA 2OT1A 4FX8A 1W3LA 2YL6A 2Q8XA 1WYIA 1CWYA 3BWWA 1TA3A 1EUAA 4P8XA 2HPMA 8RUCA 3E38A 2FZ8A 3GM8A 3AIBA 3EXTA 1YPIA 4DJEC 4LYKA 3SCOA 4IMFA 1XJBA 4C6LA 3TN5A 2YL5A 2J6VA 2V2DA 4IXXA 4HQVA 3IUDA 3S2CA 3MB9A 3P6LA 3VOFA 1XCWA 1W9DM 1P1MA 5GJNA 4JOMA 1JJKA 1BVWA 3WF0A 3BH4A 2BFGA 3GYEA 4NIRA 4G7FA 4QAIA 1O5KA 3GD6A 3UYIA 1V5XA 3M7WA 1G94A 3Q94A 4UZUA 3AMLA 4AD4A 1IXOA 4H83A 4JIIX 3EYPA 3QJAA 3XIMA 2EKGA 3VOIA 1RBOB 3CU2A 1UP2A 3DFNA 3W73A 1LQ2A 4YTTA 2OU4A 2PLJA 1HUVA 4MOZA 3AROA 1XGZA 3DERA 1XR2A 1YXDA 3GTXA 3OYZA 2EJ1A 5K9DA 5BOEA 4XWUA 4AC1X 1OFDA 2XIBA 1GJPA 1R9ZA 2CERA 3SRFA 3CHFA 4ORMA 2V5LA 2LLEA 1B57A 1JDFA 2CWNA 4PTNA 3VUPA 3TTYA 1AD1A 4PEKA 3TP4A 3OEXA 2KAUC 1M3UA 1B5TA 3DKJA 4D6FA 3VIFA 1UKSA 1UA3A 1FWAC 4S3FA 4P7LA 1ZBCA 2I14A 4Q8MA 5EYWA 4DWDA 5D37A 4B4HA 1EF2A 1K6WA 5ECVA 2PDGA 4WDWA 3H7RA 1A3HA 3MP5A 2CZVA 3CASA 4J3ZA 1LORA 5LSMA 3I6EA 3GDKA 1PVNA 4F0KA 4PRWA 4MSSA 3PZQA 1GG0A 2OWXA 5MKGA 5LNRA 4C6CA 1TR9A 2ZUTA 2XH0A 4U33A 2G0WA 3AAMA 3WLMA 2YGYA 1XDJA 3QR3A 1FH7A 3STGA 2Z0IA 3EA3A 1BYDA 2HVMA 2NT1A 1VLIA 4LUTB 4MY1A 4NG3A 4PUUA 3QTPA 1DOSA 5DANA 2P3ZA 1IEXA 1POJA 3GDTA 4D71A 2R1MA 3QMTA 1ZCCA 3N19B 3QPZA 3NYDA 4J3WA 3W25A 2EPHA 3AC0A 4HMNA 1FCVA 1WAUA 3EDFA 3TZNA 3BLLA 4IM4A 3WBXA 1H61A 4GY7A 3D6NA 3KFTA 3MUXA 4EVZA 2INFA 2V3GA 2GK1B 2BWGA 2YXXA 1ZFJA 3PUDA 1FWEC 3KOXA 1ZUAX 3W83A 3VNZA 1GKPA 2HV5A 5F4WA 1EKOA 3CQ0A 4D8ZA 3WY1A 1QATA 1R30A 4L1XA 1KB3A 2F6UA 4YWIA 3KDOA 5RUBA 2DU2A 3TAOA 1UD4A 3LGDA 3BZGA 5D04C 1VFUA 3W7NA 1SJDA 2NQJA 3MP3A 2DT2A 3UR5A 3GDRA 1OB0A 2A7NA 1J01A 2FB3A 3LHVA 3M0YA 3ALFA 3WNLA 3KCLA 2BNJA 1M6JA 4F48A 3O6YX 5BW6A 4OUIA 3WUEA 4CLMA 4WX2A 3W1AA 1XI3A 3USBA 4O14A 2V5CA 1JAKA 4AHQA 2BTMA 1SFSA 3PZVA 1SR0A 2W6RA 4RX0A 2YL8A 1BKHA 5KZMA 1WZLA 2WMIA 4HSHA 3TSMA 1VENA 3RM4A 1EZWA 2EPNA 2DZXA 3KAOA 3W1MA 4Z2GA 3OGSA 2YB1A 3HQNA 3ID7A 1DJQA 2UBPC 1KRBC 3LPOA 3FHAA 4K6AA 2PWEA 4UTWA 4DZIA 3MO4A 4XZNX 1S5VA 3IS4A 3IJIA 2FGZA 5I07A 4YYFA 2OLAA 4HNTA 2PTZA 4A8NA 5J5RA 3BLOA 2HE8A 3O1NA 4AD2A 1N7KA 5AHNA 7ENLA 3W6YA 1V6TA 1RHCA 5HPOA 3L4UA 5HJXA 4AF0A 5TAOA 1PHQA 4HU3A 1CTNA 4Y9MA 4HPGA 3E5PA 4Q8VA 4FLRA 3B8DA 1LUCB 4PMRA 1E3XA 1PKLA 2YLAA 4ZO6A 4YXGA 2CLOA 4CD4A 2ACQA 4H9YA 3AXMA 3NDOA 5HMEA 5A6JA 3R8GA 2C18A 1F3EA 1W0MA 4Z08A 3RLVA 3TVAA 1M5WA 1M7XA 1NM9A 1ONEA 2FFIA 1H1NA 1JNDA 3S2LA 3DYOA 2O7SA 4GQQA 3H7VA 3URQA 3AYSA 2PBOA 1X1NA 1K1DA 4HHMA 1XSJA 2JQXA 2VFFA 4XTDA 1O68A 2C0HA 4POCA 5F2MA 3O3RA 2V2CA 3SRHA 2IQ0A 3N6JA 4M5PA 5C6MA 3W53A 3AIWA 1OC6A 2ZCGA 3KOWA 2V3DA 1KV5A 1I9CB 4JTFA 4WOQA 2VZUA 4K68A 4D6IA 2MNRA 1UH4A 1BSLA 3EBVA 2KX9A 2OJPA 3IANA 1DXIA 3C0QA 4OJYA 3G1XA 1LBLA 2Z2BA 3FA4A 1JF6A 4GZ7A 2Z25A 1KLYA 4Y9PA 4KEZA 3DHFA 2VX7A 3VGEA 1KFWA 3FAXA 3TWAA 3KBVA 2GYIA 1WAWA 3RGTA 3PFMA 1K70A 1EOMA 3U9IA 2D20A 3FYYA 4W8LA 3PVFA 4F8XA 4MNMA 3EX2A 1XV8A 1BTMA 1JD7A 3IJQA 4KETA 2CCRA 3GDBA 1X98A 1ZSXA 3CZGA 3NO1A 2HPIA 2CXGA 2GSHA 1QO2A 3W7MA 4XTIA 4KW2A 1RD5A 3VX1A 5BMXA 1W2VA 1HJQA 2A79A 3IJLA 4WR3A 4JL2A 4GOAA 2D0HA 2NSOA 4CD5A 2NQ5A 4DZHA 1K8CA 2DZSA 3CL7A 2WLYA 6XIAA 4ENLA 4EF9A 2CKRA 4PUWA 5MHBA 3TQKA 1GHRA 1I2OA 1HKKA 5D9MA 5DT5A 3INPA 1E1CA 1S1PA 5B7YA 1W1TA 4RE4A 3VFLA 4ZENA 4Y9OA 3MDUA 4ERGA 4YNGA 4DJED 2GQ3A 2BGQA 1OCJA 3BV7A 3ITGA 2V38A 1EP2A 4LAKA 4PULA 3B8IA 2Y8VA 4QE4A 3LRMA 3VGGA 1YPXA 1AQFA 3G77A 1SSDA 2C0AA 2IKJA 3PR2A 1JNEA 2HS6A 6PTDA 1QAPA 3PNZA 2OYMA 2PDXA 2CHOA 2YA1A 2PDNA 5G1YA 2WSKA 1TQXA 2VEGA 3F1QA 2H9AA 2VXNA 1FKXA 3CH0A 3GNPA 3IGUA 4H8HA 3W26A 4FI4A 5AHFA 1H63A 4MB3A 2HRWA 1XX1A 3TQVA 1XPYA 4C65A 1MUWA 1OFQA 1AD4A 4E2OA 5LZLA 1K03A 1IGSA 3U2OA 1RP8A 4W88A 5EMJA 3W7OA 1UC4A 6XIMA 3W86A 1AJ2A 4NX0A 4FLQA 1CGUA 3JRKA 1DIEA 2Z1VA 3CB3A 2CW6A 1TV7A 1AW2A 1S2CA 3DECA 3FSUA 1TPWA 4Y9AA 3OG3A 1TUFA 3GE7A 4KEVA 1IXNA 2PDBA 2ZC1A 1V6VA 4HKPA 3EX1A 3VDHA 4C6IA 3VABA 1S3HA 3CT2A 3CYVA 2XSXA 1XRVA 3VCCA 4FNTA 3GXFA 2UY3A 4Q32A 3THDA 2GWNA 3ARYA 3FIGA 3FVDA 1XLFA 1A3WA 3I10A 1VEMA 1RP9A 1IIGA 4JN7A 3QSRA 3CPUA 1AA1B 4ZFCA 4CN4A 3W7JA 1UMLA 1JRBA 3BG9A 3R0KA 3IK4A 3C2RA 4J2PA 1C8XA 1R2RA 4N02A 3TAKA 4EK7A 2ZKMX 3M41A 1W56A 3WLNA 3ZLFA 4HHPA 4B3ZA 1L2QA 4IF2A 1XBYA 3PAJA 1DWAM 1BD0A 5H8UA 1FCBA 3CV2A 2CLPA 4TXEA 4W93A 2YOCA 2INEA 4Z1CA 4F2BA 2XSAA 2ZRUA 4ACYA 4LV9A 2GDQA 3WLQA 3UXKA 1VFFA 3GU9A 1X8FA 1OX6A 5DRIA 1M01A 3T1GA 3P62A 2WPBA 3FEMA 3HN3A 3NQDA 4CCEA 1TE6A 2PC4A 1MNSA 1ZBWA 2BGSA 2VR5A 3FGCB 3L7RA 3CM4A 5HOSA 4QS5A 4DZ5A 3T81A 2AQOA 5C9ZA 3C2EA 1K8XA 4FP1A 5LIWX 2Z1KA 1CX9A 3WH7A 4A3QA 1W5PA 2H6RA 4HN4A 3M0XA 4CNSA 3O6AA 5D9NA 1R87A 3HGSA 2VVNA 1G69A 3OODA 2W79A 2W62A 3CTLA 5F1VA 4OHQA 3RLUA 1TZZA 2WKLA 1GUVA 1UD3A 3A12A 4P8UA 1FWIC 1M7OA 1W1B1 3POHA 4RJEA 4NI3A 2WZTA 1ZGDA 3VM7A 3QGVA 3PC0A 2V6AA 5BZAA 3GBEA 4N4QA 4MUZA 3TJ4A 3M0HA 4MIMA 3G1SA 4NHVA 4C7DA 3NL5A 1T99A 2VRJA 2VEPA 1UD6A 4O50A 4CD7A 1DE5A 1SJCA 3EA1A 5LKYA 2VDIA 5JUVA 5JVLA 1N55A 3N9KA 3W84A 1QPQA 5AC8A 2V30A 3T07A 2YX0A 3BTNA 3PTMA 5ABTA 3PPCA 1QW9A 3PTKA 1RPKA 4KPLA 1Q2RA 1EF3A 1P6CA 5D2TA 5AN7A 1OYAA 1PCKA 4JTAA 3DYPA 5AKQA 2OKOA 4XZIA 4ADUA 4H6EA 2JIWA 1WV2A 3O05A 3B04A 3QV6A 3CZJA 4DF2A 1IWPA 2ADAA 3HBLA 4B5TA 1KM6A 2YCLA 1JDCA 3RYSA 5HATA 1VPYA 4HU0A 4L5ZA 1E4IA 4XKYB 1JL8A 3JVAA 1HGWA 3MYPA 5AB3A 4RZ5A 2YXGA 4HIBA 1JDAA 2QPXA 5EU9A 3ATZA 2VFHA 2YKKA 4YPJA 1F2JA 1A47A 2WMFA 2GOKA 4DUVA 2XGBA 1CLKA 1CLVA 1FX6A 3GU2A 1JUEA 1PE1A 4X3ZA 2PF0A 1WO2A 3IPWA 5EMKA 4YVPA 4BY3A 3TXVA 1FOBA 5HNUA 4UMAA 1Q13A 1T5AA 5F4XA 2BXZA 3WLSA 3RO6A 3N3TA 4GVGA 4ES4A 3NZPA 2QGHA 3WLIA 4S3KA 3W7CA 3G1DA 1OG6A 2GWGA 3E2SA 2Y2WA 4YTSA 5D2VA 1E56A 3B0YA 3RCNA 1N8IA 1NFPA 2VDHA 3RMJA 3LXCA 4NJGA 1IEWA 3OZOA 2OYKA 4EX4A 1R3YA 4GZIA 5A8GA 3THUA 3I3BA 1FCUA 5CKSA 1R5YA 3WK2A 4O0KA 2DUZA 1VKFA 2YBUA 1HT6A 3QY8A 4GH1A 1UZ4A 1MDLA 3V0UA 4JHOA 4RUBA 4A2SA 3R94A 1ZB5A 4JEQA 4D1IA 3KHJA 4PYSA 4N4PA 3B4UA 3WD2A 1V3KA 1P0DA 1IYXA 2VFEA 4A29A 2HDJA 3G18A 3L2MA 1QHOA 1AW5A 1OABA 4GUIA 4Q8WA 3TCEA 1E6NA 1LTDA 3HZ3A 1Z89A 4D8AA 3NQ2A 4HSOA 4BQ2A 1GOOA 2QW5A 4GPNA 1WNOA 2OYLA 1S5TA 1V3LA 4O0QA 4RXGA 4BQ3A 1HL2A 1UR9A 4MZ8A 4AF0B 2V3FA 5HPCA 1R3SA 2ZBTA 4G9PA 4F9JA 1GOMA 2BXVA 3P3BA 1O7AA 2G5WA 1SU5A 1NWSA 2X30A 3HV8A 1JXKA 1GCYA 3FAWA 5LHEA 3TYUA 4EIVA 5ABHA 1ZS2A 4WUIA 1XP3A 4DF0A 1GOXA 3UZZA 4Z2IA 3M0IA 3DFQA 2YR1A 2F84A 3GZ3A 3C52A 3PB0A 2QMJA 2AGKA 3STFA 3EMQA 1N8WA 3E96A 4BZYA 4MKVA 4GIRA 1LZOA 4O13A 5HR6A 5ECUA 3QKEA 4ALDA 1Y7VA 1TMQA 2GQ8A 3A9BA 4WKHA 4HOWA 1OFPA 3NZ1A 3O6CA 4GIAA 1GVIA 1C7SA 1EC7A 2X2YA 1ISYA 5K9CA 3GXDA 4EP8C 3GTFA 2VCBA 1IZCA 2CZEA 2Q71A 1E1CB 1H7PA 4PRRA 2WVVB 3UZ5A 3GUWA 3OU8A 4URIA 4NVTA 1LWJA 3QEZA 4UQEA 2PU1A 5C9UA 3UY8A 2DSZA 2P8BA 1L6GA 4HJWA 1VPQA 3TOPA 5BOOA 2PODA 4I9JA 3EX6A 4Q8OA 1GKRA 1WUFA 4XZMX 3FKRA 2WSRA 4DWSB 5KEZA 4RCXA 5ABGA 3RN6A 2BODX 1HJUA 1TPUA 2G96A 2NV2A 1MQPA 1TIWA 1Q8AA 4U5KA 4LRSA 3BG5A 1H11A 1H62A 2WVSA 5AC4A 1P0BA 1OX5A 1ZJHA 2C16A 2ZICA 1VEPA 5H1WA 4O10A 3GNRA 5DF0A 1V6UA 2FMOA 2QEZA 1AL8A 4OU1A 3WYZA 3PN8A 3UWWA 1K8ZA 2GK1A 3WNKA 1LDCA 4PL2A 4UMBA 3WJYA 3VD9A 1RQEA 4LBUA 3ARQA 2FPVA 2FQIA 2W9MA 5I09A 3RRXA 1UWRA 1OSEA 2G8ZA 1FFQA 4WKAA 3WQGA 8XIAA 5AC6A 3E49A 2BOGX 3PJXA 2PDLA 1TA3B 5XIAA 1LF1A 4Q8QA 5D33A 4I3GA 4AW7A 5D03A 5A95A 1ISXA 4IJRA 1P0KA 3F5LA 3TLQA 2G3JA 1KCLA 3GG0A 1MW1A 3UJ2A 5CZJA 1XGEA 3EXSA 2AGTA 2JKEA 2PWDA 2PTWA 3RR4A 1Y5VA 3AMDA 2QV5A 3EWWA 1FH8A 1QXLA 3BOXA 1H1YA 4A4AA 3BSHA 2TMDA 1EJRC 3UXLA 1E15A 1P43A 1NDVA 4AWUA 4LYPA 4RNIA 2PU0A 3K5XA 1B3YA 4JD4A 4Y2WA 4ZA0A 3EB4A 4BI7A 5HMDA 3G1AA 3IV8A 4LUTA 5KTLA 4GC3A 4A21A 1IWAA 1S46A 2DGAA 1RJQA 2F2HA 1J11A 3QN3A 2XIJA 1FWGC 2F61A 4AHPA 2XTKA 2Z00A 3CAVA 4ZB2A 4JFTA 3L23A 1WDPA 4X9SA 1GYMA 5EFDA 3PZMA 5AHEA 4CQ9A 4GABA 1MXSA 1Z3NA 2NUYA 5DFAA 2V82A 1IHIA 2HJPA 1IEVA 3MCOA 1TTIA 4YMZA 2PMQA 2PD9A 3VFCA 3CNYA 3C6CA 4L4LA 3ZXWA 2OB3A 1F74A 1BXNA 4HTBA 1JR1A 5JBDA 3CZLA 1PO9A 4Z17A 4Q8UA 4B3LA 2V3EA 4GE8A 3D3AA 3GDMA 2GLKA 3PTQA 4QE5A 3DG7A 4JHMA 4N42A 4R7WA 4MM1A 3A64A 3FFSA 4YHGA 4HT3A 4JY9A 5HDRA 4UOZA 1Q7QA 3CHCA 1E6PA 1R2TA 4O52A 2DVTA 4AIEA 2VEKA 1HG3A 4NZ3A 3UG8A 1I1XA 4FXSA 3MANA 1FQ0A 1TWDA 3AO0A 1XYZA 2X8RA 1B90A 2W0UA 2NSXA 1BYBA 3WD4A 5IFPA 5A6BA 4J40A 4D6EA 2GGIA 1H41A 2HXUA 1AW1A 3BSMA 3H70A 1REQA 1VAHA 5G1MA 3BLKA 3LYEA 3WNOA 4NI8A 3QRHA 4KGLA 2WHMA 4B2DA 3M0KA 5G2HA 4B92A 3TONA 1JCTA 1JFXA 1LBMA 4K37A 2Y4SA 1LUCA 4U2YA 3GH7A 3DC8A 3CUIA 1CYGA 3JS3A 1YE6A 1LOSA 3UWYA 4OOUA 3QVQA 3E02A 1ONWA 3EWBX 5DLCA 4NILA 1DJHA 4IL2A 1UZHA 1B3WA 4MYXA 1XLHA 3OIXA 5C7VA 4C1NB 4M19A 3JZEA 1C3FA 2C91A 5LGZA 2C19A 2VM8A 4AMCA 4FNUA 3BLIA 3QOMA 1V6XA 4Q4MA 3KVKA 4ZXLA 4HHLA 5CC6A 1P4CA 4JTLA 5D4YA 4D72A 5AHIA 3DBPA 2TODA 1HP5A 3QLLA 4M24A 5AOUA 3KBSA 1ZRQA 4I7WA 2OX4A 4AX7A 1P0EA 2Q8LA 1OZQA 2E9LA 1V3IA 4KWOA 3ANVA 1F6YA 1E72M 4PN2A 2VVSA 4JNYA 4GO8A 4JICA 3THQA 3UPMA 1EP3A 5A8NA 3E2VA 1IGWA 2UWFA 3QOKA 4JEJA 4M80A 4J3UA 3NVDA 3U3HA 3GSMA 3M64A 4AU0A 4X22A 4WGHA 3RM9A 4MKNA 5DN1A 1WA3A 3EXRA 3V1PA 2FYMA 1KFBA 2JALA 4LC8A 4D2JA 3AZRA 4PTXA 1QK2A 3G1VA 3LBMA 4V15A 3TROA 3WX7A 2ISVA 1EB3A 2V5KA 1UROA 3UYCA 3CT7A 1SR9A 1P7TA 4FPSA 4NJKA 3B9AA 2G41A 3SQSA 1UR2A 3LCFA 1KBIA 5CG0A 3S6DA 2C15A 1A5BA 4Q4QA 2DP3A 4QS6A 4UOJA 5TIMA 3R8HA 3WH9A 3IGSA 1KFKA 5C5YA 2ZUVA 1M7JA 1U5HA 1ZQ5A 2GFTA 5IHSA 3IIZA 3MCNA 3WF4A 4IFKA 1NP2A 2EQDA 1E4LA 3A21A 3UP8A 4TU1A 4WIWA 1TQJA 3PWAA 3QPEA 3EGJA 1TWIA 4XK2A 1JPKA 1J5SA 3AFBA 3LERA 4I7VA 5D02A 2FIQA 4K39A 2Y63A 4RDVA 1S2TA 2FZNA 5M1TA 4LY8A 2Q01A 1U30A 3E0FA 3QC0A 4CQBA 4YWSA 5GJMA 3SCSA 1QNQA 4JIQA 2EBNA 2CEQA 3PJWA 1C7TA 1JUKA 4MG4A 3E3HA 1DVJA 3K8MA 1S2VA 3I3DA 3UD6A 2WQPA 2QJGA 3CJPA 4H00A 3IVUA 1DJZA 3AYRA 1EYWA 3BGGA 4O8RA 3KS6A 1M41A 3TN6A 3RX3A 1DBTA 1CB7B 2XN0A 2QDGA 4ROPA 1XBVA 4V1XA 1TWZA 4AEFA 3P0XA 2I17A 4X9YA 4IH3A 2AAMA 2YDQA 3GW3A 4MGGA 1DHPA 1WKYA 2P8CA 3P8IA 2DSUA 1T6MA 3FJLA 5LYRA 3VKAA 1E40A 4DN1A 3S9ZA 5AYXA 4QROA 3VINA 2GVLA 4GA8A 2O0TA 4BWLC 5BRPA 1NTHA 3GUGA 3LHUA 3RITA 1TPDA 3FS2A 4DPPA 1W5NA 3MWCA 4L4PA 1MSSA 5C2CA 5CC3A 3C2FA 3PULA 4DUXA 3B8WA 3OPSA 2WKGA 3TYZA 3KVMA 1HFBA 4PB5A 1GVRA 3OLIA 4AZGA 3KM8A 5G2IA 4RE0A 1OWQA 3KWXA 3S47A 1MEWA 2AQWA 2PDIA 4KF1A 2FFCA 4EAYA 4ZO9A 3LBCA 4DJDD 1GNXA 2XWEA 4UTTC 2XN1A 4CNUA 4IPPA 3GC5A 3F03K 5BOFA 4UTWC 2Y24A 2BG5A 1QMLA 3MSGA 5D8ZA 3APYA 4MY8A 3VIHA 1JQXA 2NQ9A 4EWJA 3CL8A 4NP7A 3FVMA 4PCPA 1B31A 3M44A 4UTJA 4M29A 5FAGA 4IQJA 3MMDA 2W61A 4S3CA 3LCLA 3AXXA 5CSSA 2C8NA 4NKCA 1OFOA 4IIFA 1RVKA 3KL0A 3DI1A 4GZEA 3CHVA 3H22A 2QPSA 4PUKA 4B3KA 1E6SM 3R13A 3L0KA 4PGLA 1OBAA 1L8NA 3WH8A 2QUVA 4EF8A 5M03A 2IPWA 3H2EA 1VHNA 4QJ5B 3MKKA 4BF9A 1ISWA 1JPMA 1EGVA 3LA4A 4NRRA 3IGXA 3G1RA 3UJFA 4U3AA 4I6VA 4KWVA 4ROQA 3BJFA 3N6QA 5A8QA 5AC7A 4MPQA 4XBJA 1B30A 3G8RA 2J9ZA 1GVEA 3WLOA 1VH7A 5FL0A 3CV6A 3OG2A 2CLHA 3AXHA 4PB3A 1QT1A 1LLZA 1E9ZB 2B31A 4Q7BA 5AHMA 3V7PA 1JDDA 2INZA 5HMFA 1ZAHA 4F66A 3T4WA 4XD6A 3DKLA 2CZFA 2QVHA 3XISA 3LMYA 1EJ7L 3BICA 5TQLA 3QYQA 4H8NA 4AYSA 2OO0A 3DYMA 5CXPA 5T91A 4U4MA 1JD9A 4HK6A 5TBOA 3TOYA 1YYAA 5GPRA 2QCMA 4M1BA 4YCPA 4Z2KA 4PMYA 4K3ZA 4S2BA 5LNSA 2CESA 8A3HA 3Q67A 2O4QA 3BMVA 3FV9A 3H54A 1YPFA 2WZEA 3AHTA 3KXQA 5JU6A 1SZFA 3CXOA 3CHDA 1UJQA 1T0OA 3PWGA 5T26A 5H8MA 3ISIX 2W3ZA 1R3QA 4UR9A 1LBFA 1EPXA 1KM1A 2J7DA 2KZHA 4JCMA 2BVTA 5FSDC 3N2OA 5I77A 2A3AA 3BARA 4PB4A 3BAXA 4US5A 4DO6A 1UWIA 2VOMA 3EB2A 3S5NA 1WZAA 2PCEA 4N9BA 1Y5XA 3RCYA 4I5RA 1TPFA 1Y0EA 4UTLA 4LS1A 3R7MA 4Q6XA 3VUSA 5A6KA 3QV8A 5FJJA 1XISA 4DWSD 3PSWA 4TV5A 3RJXA 2C3ZA 3KCJA 3ZR6A 3EWUA 3LTSA 4Y6GA 4RW5A 9XIMA 3MKVA 3VNDA 4LUSA 1Q6RA 1VJSA 2ABBA 4KRUA 2P3EA 2VDGA 1Q8JA 3BOFA 4RL3A 3TSBA 4HPHA 1W1YA 3RNDA 4GACA 1CNVA 4FF5A 1ZU8A 4GNJA 1XYLA 3GG1A 4P8VA 4W5ZA 1NAL1 3VOCA 4KWUA 3FA5A 4LVFA 1PIIA 4XSMA 1D8CA 3NQVA 3AHZA 1DKWA 1KM0A 4YIWA 3PZNA 3RU6A 3LCGA 1M9HA 4Q4SA 5EBAA 3KTCA 1W6TA 1R3WA 3ENLA 4CVUA 1KKOA 2PWHA 4ZB5A 1G0CA 3NXLA 3W1QA 4KBXA 2J7BA 4Q8TA 3UVIA 2WHJA 2QNEA 4UTTA 3APGA 4U3CA 1E6RA 1SYTA 3UXIA 4JX4A 3CIXA 3A24A 1FDJA 3WJWA 4WY0B 1JDEA 2GJNA 3LZ3A 4M6PA 3QC3A 5EFFA 4AC7C 3JZUA 4NJHA 4UTIA 2VD8A 5CJ5A 3CYJA 4Z1DA 3U2ZA 3HJEA 1DIOA 1GYNA 2DZTA 4MWAD 3BMXA 1FH9A 1HJVA 3KBNA 1NWRA 4NAEB 5FF7A 3A5FA 1XDLA 3AJ7A 4GJJA 2WM1A 3NTYA 4HD5A 1SZGA 3TW9A 2EG7A 3GIPA 2WW5A 3GHSA 3QZEA 5F7UA 3NQ6A 3ZJ8A 2QLYA 1DPMA 4HZ6A 2DUXA 4PUDA 2NVAA 1O1ZA 3P80A 1Y65A 4PE8A 3TLLA 4PFHA 3OO2A 3SCTA 4LANA 2EKCA 2X7VA 2G37A 4H1ZA 4HHHA 3UJEA 4JN8A 2VX6A 1KXHA 2Q3OA 2J62A 2QJIA 1SJBA 2DT1A 3L67A 3LV6A 2PFHA 4TIMA 1S5WA 1T96A 4AHOA 1C8QA 3C3UA 1VGAA 1FRBA 4S3JA 1U1JA 4FR1A 3M0ZA 1A80A 1OX4B 1EJVC 2YDAA 4UQBA 1JYXA 3VD5A 3NVTA 2OOFA 3PBWA 1HO1A 3NQ7A 2D1ZA 4JQAA 4L80A 2D0GA 1JI2A 2POZA 2EGZA 3VYLA 4KCVA 3N25A 4QNWA 2CFFA 5DCBA 4C5ZA 3GH5A 4GD0A 4XD4A 4LVBA 3ORWA 3CUZA 1XIJA 1ZAJA 4DB7A 2FJKA 3RHGA 2JF6A 3V5CA 3MUCA 2PCQA 5HWJA 4ZE4A 2BZNA 1GVQA 2HEJA 3BGAA 3GVGA 3G1YA 3N4AA 1ADSA 4HA1A 5LA2A 1OHLA 3KRZA 1JZ6A 3UFYA 1XYCA 5FJRA 3A23A 5FA5A 3UG3A 4UOQA 4GRSA 3N15A 4HN8A 3O8AA 1OFEA 2DZBA 3HGJA 4IPJA 2G4JA 1V0KA 2DW7A 3W1XA 3ELFA 2V69A 4PUEA 3MHUA 1TV3A 1GEHA 2YCKX 4WK9A 1QOQA 4R7OA 1SJAA 3FLUA 1AUSL 1WP6A 1G01A 3NSMA 2Y5EA 3HGOA 3PWIA 2ATSA 5FF4A 1Q63A 2HK1A 3PPGA 3IIVA 3LCIA 3W6MA 3GDLA 1QVBA 1TPEA 4L9ZA 4EWND 4RW3A 3BOLA 4BI5A 2CYGA 4CQDA 4MFEA 3MC5A 4TVCA 1WKFA 1KCKA 1HJXA 2ABAA 4O1FA 3UGVA 1JZ5A 4D6HA 4L4MA 4KRZA 2R1LA 4U2ZA 2BS9A 5JXQA 1JGIA 1QO5A 2FPTA 2VURA 3DCPA 4QEEA 3HO8A 4ZODA 5LIUX 3RO8A 3SJNA 3T0BA 2XPKA 5G4EA 1ESWA 1E4MM 5A94A 3FHQA 1MFUA 2J7FA 3KW3A 5FI8A 3NNTA 3I68A 1G9HA 3EMZA 2I7GA 1MUMA 1V6YA 5DMNA 2XZ7A 1DTUA 4JCLA 5A8OA 3UY7A 4ZQRA 2XINA 3RIKA 3ES8A 1G7UA 1J0ZA 5EMMA 3UCCA 4Z42C 1PCWA 4BA0A 4MVAA 4NUWA 4N9EA 3EOSA 3U2CA 3KBWA 4FOJA 3MW7A 3NPUA 4QRNA 2XGZA 5CLWA 2DDXA 4I7UA 1W5MA 2GJLA 3RX4A 1AK5A 3U0HA 4PUJA 3WH5A 3S2JA 4XO6A 4B16A 4AY7A 1XFCA 4AB4A 3Q58A 2ZRZA 2ZTJA 1EUNA 3H12A 4FALA 1J96A 4AG0A 3BZJA 1EWDA 4W89A 1OQFA 4LYRA 4E5TA 3RK8A 1OEPA 1Q6CA 4FIQA 4GX9A 4AZ7A 2Z2UA 3NQGA 2NV1A 3M46A 2H8ZA 1S1RA 3PG8A 2QKFA 3DFOA 4JTSA 4PFMA 3VNIA 1KGXA 2VO5A 4OV9A 2E6FA 1CB2A 3I3EA 3UXDA 1K9TA 4U5IA 1Q6EA 3MWAA 3GQYA 4FLSA 1VIZA 4DO4A 3OA3A 3LTPA 2JBMA 4LAZA 1I8JA 2BOFX 2NVCA 4Y8EA 3IJ8A 4JDYA 3FGCA 3TA6A 1QHZA 2BY2A 3TMQA 1XRTA 3WLRA 1QK0A 2YFNA 2FGBA 1TPB1 4I9TA 5I6SA 4CNNA 4LS2A 3EWXA 1IT7A 2ISSA 2PRLA 3L68A 3W27A 4C60A 3GK0A 4JTTA 1PKYA 3AS3A 1GTEA 3GVRA 1XSIA 2EEXA 3QXBA 2YZRA 3F2CA 4FXJA 4XX6A 1DORA 2OZ8A 2DZVA 4O1CA 1H4PA 3P93A 4MUPA 3W87A 1J6OA 2GJXB 5CSUA 4FAMA 1B9BA 3W7IA 2QCGA 2VCAA 3PY2A 4GFIA 4YS1A 1FHLA 2QUTA 4GO9A 2VX5A 3A4WA 2PRHA 2WJDA 3CHEA 1ITQA 1Z32X 4J3XA 4P7RA 3BSGA 4QLLA 5FEZA 5LNUA 2WCSA 2E3ZA 1LOQA 1U83A 1GVYA 3VAVA 2HSAA 1MRAA 3RU8X 3BAWA 1FTXA 3BAJA 3ANUA 5I3HA 3E12A 4QDWA 2OZTA 5CAKA 3NM1A 4LUSB 4XB3A 2HZGA 2PTYA 2DQWA 1CW2A 1KRAC 1HW6A 4BS0A 4GHRA 4ZGYA 4DLFA 3TTSA 3AU6A 4F79A 3BAKA 4PMOA 4JX6A 4J5NA 3LX9A 1S5MA 3QZ6A 1WDDA 3BXWA 3ARUA 4QISA 4WY0F 3RAOA 1A3XA 3ZO9A 3W24A 4E4FA 1TTJA 3A6OA 2VR2A 3LHWA 2VEMA 4QLJA 1X6NA 4P8WA 1LL7A 3WBYA 2ZXDA 3LV5A 4O12A 2WV8A 2D73A 4S1FA 1Q85A 3AIVA 2Y8KA 2PC8A 3NPWA 5FJIA 4FNSA 4MJ2A 4BQ4A 1TWWA 4L6DA 2E5DA 5FKYA 4B5VA 2Y7GA 4LV4A 1OGBA 4JN6A 1W3HA 4IJCA 4UZSA 2NX9A 1VBJA 1V79A 2D2OA 4E8DA 4OBTA 1ZJBA 4UNLA 2PD5A 2P76A 3TQ0A 3NZQA 4QLKA 1IE7C 3CO8A 3S5SA 2AOSA 4XZWA 1J8VA 3B4YA 3GNXA 4BF5A 2J74A 5FF0A 2F7FA 3SY1A 4O1AA 1FFRA 1DXEA 3GRIA 5JIWA 1MW0A 5FESA 3V16A 4Z0JA 2PGEA 4YU1A 3M5XA 4Z1YA 1KGWA 4ZQOA 3BUVA 3QLDA 2DW6A 2ZE3A 1OVDA 4B5SA 3WQPA 2B7OA 2EPLX 3H4WA 3HB9A 2ZUWA 3UG5A 2BVYA 2QS8A 3WBAA 3PBGA 2NT0A 2Y8UA 3KBMA 4UWMA 3WLLA 3DGBA 3P67A 1TRDA 5ENLA 2HE5A 3CQKA 4J35A 3P5YA 3ARVA 2DT0A 2PA6A 2OVLA 2RFGA 2V81A 1OCQA 3PAOA 3OVQA 3S5YA 2FB2A 1F7BA 3PUOA 1X1ZA 5SWUA 4GJ1A 1PTDA 4ZTXA 2VYOA 1WOBA 2GQ9A 4WDUA 3BL3A 3C2OA 3U6WA 1NF0A 4GKLA 2ZOXA 2WM0A 5FJPA 3F2DA 2QIWA 1F3XA 3OLGA 1U22A 2VC9A 4HZ8A 4FZIA 3T0TA 3BO9A 3L4WA 2MANA 1LYXA 4JGDA 4W8BA 4UQCA 3ONBA 2CHNA 6ENLA 2I16A 2ZX6A 3TN4A 2CHRA 4PEEA 1D2KA 7TAAA 3P61A 2PGWA 4JS3A 1O12A 1Y8BA 4JDBA 1TFVA 3W07A 4LAMA 4MJMA 1JZ7A 3LHZA 2RDUA 1E0UA 4A05A 4WSHA 3PBUA 1OFRA 2E67A 4ZTYA 1W9XA 1ICQA 3ANYA 3CK5A 3KRSA 4C6FA 1WCGA 1IEIA 2E6AA 4Q7NA 7ODCA 4AZCB 1DWFM 2A3EA 2D3LA 3A4XA 1XLCA 1V77A 4OWGA 3KOFA 3F4DA 1PZ2A 2UY5A 4I9AA 1KFJA 1PYMA 2ACSA 4I9MA 1D3CA 2Y89A 3VZXA 3EA2A 3A22A 3D47A 1IV8A 4JTDA 3ITTA 1ODZA 3R89A 4TO8A 3SGGA 1KA9F 1ZENA 3U2EA 1KM4A 3HPZA 4UCFA 3GC2A 4L56A 2OWCA 1XPGA 4Q7IA 4ZMGA 3GS6A 1R3RA 4FXRA 4DJFC 1KM2A 3UZWA 4IISA 2RDXA 2PDUA 4QG9A 1H09A 3B0VC 3BVJA 4K36A 1VBHA 4OGZA 5H6HA 4GG9A 5CPSA 4RE2A 4CU6A 3NZRA 2RJHA 2YW3A 3UU0A 1TYGA 3CZKA 3GIYA 2WJFA 5IRPA 3AIEA 1A53A 3B9OA 3K8LA 4CN1A 3F4NA 1XG3A 3VA8A 1FHUA 4UNKA 2JEQA 2VGGA 1BSIA 3BCFA 3GVVA 3SN4A 4O15A 5DMMA 3L4YA 1MO0A 1EX1A 1XLIA 2CKSA 3NYZA 3M47A 2D22A 1XYFA 3OLDA 4CU7A 1V7AA 1XIIA 2VNCA 3NZGA 2XVKA 2WBGA 1JYVA 1SFJA 2J88A 5BXRA 1OZMA 5K4ZA 4C6PA 1IZJA 3DUGA 2PF8A 3HMCA 4JX5A 1BAGA 1J6PA 2B7NA 1IT0A 3FYOA 4R34A 2OEMA 1DL3A 4OTKA 1TV2A 5H8PA 4C1LA 4S38A 3VMPA 2PWVA 1EDQA 2O4MA 4DWSA 3SSJA 8TIMA 2H9AB 3CMJA 1EWEA 5JH2A 4R85A 5CAHA 1DJNA 1I6NA 1BEUA 1V02E 4R5EA 2OKTA 1HKJA 4KWSA 7CGTA 2QCDB 3MO7A 3W23A 2R24A 4RDZA 4EANA 1UKQA 1K9FA 3DHUA 4D9PA 4GIEA 1UCWA 5CBJA 3JU2A 4GH3A 1KCZA 4NJJA 1IR2A 4FA3A 1U1UA 2FH6A 3FY1A 4PBFA 2J7CA 1DJIA 5A2CA 1ECEA 5CJNA 2W4XA 3YPIA 4IMCA 3UESA 2NXIA 1Q2SA 3TDFA 4Y7EA 2MUCA 1MEIA 2BGNE 5ABFB 1EX5A 5K3VA 4G6CA 4DX3A 4D6GA 1LLWA 4KCTA 1MNZA 3C0SA 5A5WA 3FEQA 1HKWA 2Z29A 1Z8AA 3REQB 2V8ZA 3WLJA 1K8YA 3H2FA 3PJUA 1CIUA 3NL2A 1I2QA 3ZZ1A 3W38A 3UVAA 1WE5A 3DX5A 4TVUA 1UA7A 4DYEA 1RBLA 2X41A 3C5QA 3SIZA 3BANA 2QZRA 3DC0A 4EOUA 2PDPA 5C0QA 1V03A 1GOIA 4UFJA 4TUFA 1JCLA 3MVTA 4AXKA 4PODA 1OF8A 2GGJA 2PURA 5FJOA 2VRQA 1Z7AA 5I3KA 3SAZA 3WFAA 4IQDA 2W63A 4JTIA 4OZOA 3NSNA 4LGXA 8XIMA 3E0IA 4C6EA 2W91A 1HGYA 1US0A 3WDJA 3AISA 4UR7A 4JTUA 1W8SA 3AIUA 3L12A 2DVUA 2EF9A 4FXFA 1RK5A 3OW1A 2FKPA 3VNYA 3R79A 4UB9A 1C92A 3RPMA 1EDTA 2H8XA 3BV4A 2VZSA 6TIMA 2EO7A 3M9YA 2HMCA 2VC5A 4GQRA 4PCTA 3WQWA 3EEGA 3QH2A 4E8CA 2Z28A 4MY9A 1XLLA 1K7EA 1GQLA 4MAZA 2E5BA 3TEVA 1E55A 1G1YA 2NZLA 5A2AA 1OCNA 4RE3A 5BMWA 3W2KA 1KQYA 1VFSA 1W9UA 2Z6IA 5KZEA 5DMLA 4WZHA 3NQEA 4C6NA 3N11A 1GOKA 3WIJA 2AAAA 3GKAA 1TRIA 2F38A 4AZHA 1MWOA 1TVLA 3GAYA 1V08A 4OBRA 5MF5A 3PTDA 3UCQA 2B7QA 3QTGA 2TYSA 3ZT5A 1KGUA 3IEBA 3M0VA 3SECA 1B54A 4E4UA 1JVNA 4UFIA 1E6ZA 3B03A 3W02A 2A85A 3P82A 4ZQMA 1Y5WA 3KTXA 2J8GA 5FEWA 5FACA 1G4EA 2J24A 3N9RA 1JCXA 3N3MA 3EAUA 5HXMA 3WUBA 4C5YA 1MW2A 3STCA 3GXIA 3PBVA 2BBFA 2YBVA 4GXMA 2GQAA 1UWTA 2IPGA 4ZQCA 3VC6A 1Q6QA 1JG9A 4HYRA 3GR8A 4B90A 1V6WA 3LUTA 1UJPA 3TV8A 3SN0A 1XWYA 3WNPA 4XBKA 2EG6A 1PDYA 4O28A 3QHNA 1AJ0A 2YA0A 4ERAA 1ALDA 4K8EA 5H91A 1AL7A 4NZ5A 4MJ4A 6ALDA 2IKGA 2ON3A 3OHIA 3LTYA 2OOGA 3CLMA 4DJFA 4HBKA 1NEYA 3O63A 4IWWA 1VJZA 5C55A 3UEQA 3O16A 1VR6A 4I90A 1TCMA 3SGZA 2VP8A 4GGBA 1EJTC 2Z7GA 4R33A 4MB5A 4IPLA 3TYCA 1PJ9A 1PBGA 1XLKA 2FJUB 2V63A 2CC0A 3L4ZA 4ZSTA 2RGLA 1ZL1A 4GI9A 4ZB0A 3VMNA 4JIEA 1A5KC 2ZXBA 1DWHM 4QTGA 1QNVA 4GY0A 1JGMA 2FTPA 1LLOA 1XSKA 4DI9A 3KUMA 3VGDA 1FBAA 2PLKA 4XISA 3UZXA 3CO4A 4M1RA 3W7KA 3T8LA 2CXEA 3HQOA 1EQCA 4B9YA 2UV8G 1K02A 3FDKA 4HZ7A 1A5LC 2NWRA 3L5AA 4UTFA 3F2BA 1G6CA 4XG1A 2XN2A 5I3IA 2A3BA 2C1HA 5DCDA 1ADDA 5AHLA 4JTJA 1PWMA 2BV9A 3NGJA 1PX8A 5HNNA 3C56A 4LFYA 1DP0A 1IT8A 4CNTA 3W0KA 4QM1A 4A3UA 3JW7A 2CLLA 2UZ9A 4YYCA 3GFZA 4GI8A 4H7ZA 1C91A 1NFGA 3GXMA 3K1DA 2XISA 2J77A 3G5EA 3HA1A 4LUYA 1JQVA 3G1HA 2H3BA 1EIBA 3C86A 4MWAB 1JRCA 2ZUSA 1PPIA 2OQHA 2Q02A 1AH3A 2XIIA 5CGMA 1VYRA 1NFBA 1F6KA 3WEOA 3H2MA 4GISA 1DJWA 3ABXA 3HPXA 4NAEA 2B7PA 1PZ1A 4NX5A 5GJPA 3L65A 1XXXA 3N2TA 4J9JA 1Q6LA 3M0LA 1PUDA 4M6QA 3GO2A 2AL2B 4O0ZA 3G3MA 4IMDA 3P81A 2QCEA 3LS9A 3LSBA 3E0WA 1MI3A 1W1IE 3LCWA 3WMLA 5HULA 4QHRA 3GVWA 1D8WA 2GL5A 4ZSUA 1H5YA 2YXOA 2PRMA 4AEEA 3AXIA 4RLIA 4EPBC 2Z2AA 2PDCA 3V36A 1P5BA 3R4IA 1A50A 2A1YA 3LI1A 3H21A 3N2XA 4CD6A 3NR0A 1E6XM 3SRDA 2ODOA 1HF6A 3NQ8A 1LL6A 1SFTA 1VFMA 2Y62A 4WJXA 3POCA 1E1FA 2DORA 1VCFA 2NW0A 5C9XA 2XFRA 3AQUA 1ICSA 3CH9A 1D9EA 1C90A 1A5UA 1J9YA 3O2LA 4AISA 5BU9A 1MYRA 1E0XA 4HMDA 1ZBKA 2WZIA 4TMBA 2CLKA 1TB3A 1UUOA 4ICNA 4HYVA 1JYNA 4PZVA 2QCFA 3A47A 3BE7A 3P8JA 2WNQA 2QJJA 3IIOA 2V2HA 1UWAA 1FHDA 1VFOA 4CUCA 4GKTA 3BK0A 2PTXA 1JZ2A 3GC4A 1W5OA 4QX4A 1YNQA 1E9LA 3GW0A 5E9AA 1RR2A 2R8WA 2QF7A 2WNZA 4IOTA 1EJSC 2FVLA 2A3HA 4DEFA 1WXYA 1DTNA 2VQTA 3DHPA 3BCJA 1CXLA 2FTYA 3AXKA 3LRKA 2IS7A 1B3XA 4L6OA 2ZZ3A 2J8FA 4HNNA 4J3VA 4N9DA 2J9XA 3AIRA 1SM9A 3WNNA 1XUUA 4WXYA 4DM2A 5LNVA 2OELA 1E9IA 1ZZMA 1KO0A 2HBVA 4GWEA 2GVGA 2DEPA 4E2DA 4F4RA 2Y6ZA 5FIPA 3LDVA 3WCZA 3W1TA 3MUIA 4M8UA 3E2RA 3EMCA 1FKWA 4L6HA 2GDUA 1EXPA 3N17A 4FMVA 1OF6A 1O66A 4QJ1A 2HISA 3H6OA 5B7ZA 5I3GA 4FOUA 2VFDA 4AD0A 1HJSA 1WDQA 4REQA 4Q4RA 3WF3A 3RPTA 1F76A 4DYJA 3SM0A 3MMTA 3SW6A 5IM51 3LLXA 3SDOA 1LP6A 5JH1A 4Q4PA 2J75A 1OK6A 4C91A 3W7HA 2NX3A 3P7YA 4GGHA 3G0UA 4UXDA 3KTSA 3SQLA 1YXCA 3SJ3A 3W72A 2DH3A 3M07A 4UQ9A 5FF2A 2R91A 3EWDA 1I1WA 2OQLA 3UWQA 3NO3A 3M4HA 4DUWA 3ZFHA 4FK9A 3RFAA 5AFDA 1QBAA 2EPOA 4J7RA 3D3FA 4MLRA 4ADTA 1BWLA 5AY7A 4G7EA 5C2XA 1X6UA 3WMBA 3VIKA 1B4EA 3LPFA 1EA9C 1LQAA 3WD0A 5B80A 2R82A 3NURA 3VIOA 3DFPA 1TMLA 4MNJA 1FWBC 4WD0A 4FF7A 1W9BM 1N8FA 5D9PA 1O94A 1IIHA 4I8YA 1HQTA 3R8RA 1I2PA 1XRSA 3CUXA 4PTMA 2C1IA 3DG3A 3DH7A 1WDSA 4P7NA 4FX6M 3CEPA 4B15A 3WQ5A 2ZZ5A 4DBSA 1GORA 1L6FA 1Z44A 2CLIA 2X0YA 4O19A 4I5XA 3WFLA 3WQVA 1VFTA 3I6RA 1W1ZA 1JUBA 1K6AA 1TV4A 4ZOAA 4Y8FA 4AD5A 1HL9A 4WQ6A 3VD4A 5MKGB 4M56A 3GLCA 2I5QA 5ABEA 1TPC1 2WSYA 1VFLA 3QSTA 5AVHA 2NV9A 4WHBA 2O55A 3W1NA 5GNYA 2J4GA 3OGRA 4ADSA 3N12A 3WH6A 1DXFA 1ZP4A 1OYBA 3C4UA 5CBIA 1XS2A 4H19A 3VO0A 5IBXA 2BDQA 4BCEA 2PZ0A 4BEUA 2CZ5A 4XKYA 1EZ2A 4BEQA 4PMZA 1VF8A 1TCDA 1WZMA 2EHHA 2VJXA 4NXKA 1PXGA 2A6LA 1W1VA 2WCGA 4K8GA 2IPFA 5HWNA 2ZQ0A 1YE4A 5F4SA 3ZVIA 3QQWA 5BXSA 1VBRA 4UIOA 3PB2A 2AMGA 4GNVA 1TKKA 3PUEA 3G22A 4IPIA 4HB7A 4WKFA 4NZCA 2VCCA 3W7QA 3ITXA 1GKQA 1BKSA 3IRSA 1HXJA 5LGXA 2REQB 4C1KA 1NQ6A 3S3GA 1DQWA 3W2UA 3WJSA 1V0LA 2FHBA 3UF9A 1F6PA 1R6WA 3ABOA 2WHLA 3LLFA 3N6HA 2PTDA 3OJGA 4IUGA 1WKDA 4PCSA 3F4CA 4D1JA 5I78A 1GPFA 1ZHAA 3ZVHB 3QGKC 4GVFA 2ZIDA 4TQTA 1XBXA 4HMEA 4UUIA 3HPFA 4YTQA 5KZ6A 1QI0A 4LC6A 1Q65A 2X2GA 1H0IA 2R14A 1CT5A 5CSRA 2R9RA 7REQB 5DELA 3U5YA 1JZ3A 4O1DA 4V2XA 2Y5SA 2ZX7A 3O15A 1ML1A 2OTDA 2YJQA 4KMQA 3EZ4A 1QUMA 1GQIA 5A6SA 1XGDA 3IUHA 3MYOA 1M04A 1FWCC 1JPIA 3LEPA 4LAUA 3RILA 3WQCA 3V0SA 4O4WA 4IT1A 3HU7A 3O0KA 4S3AA 1GT8A 2PDMA 1RV8A 3MBDA 2WK2A 3OLEA 4ACZA 1W1PA 3OBEA 1R9XA 3VKBA 4A3YA 2DJXA 1Z9AA 3KVJA 2QUNA 5A2BA 3WBEA 3ZWTA 3DESA 1U5VA 1OJXA 2WVVA 1PIFA 1EO5A 2BXYA 1KWKA 4S2CA 2OEKA 4IZGA 3WEMA 4QDMA 2GUYA 1A0EA 1UR4A 4Z2HA 1KXTA 5ABFA 1B1YA 3VU2A 2F9RA 4QITA 5U4NA 2QUUA 2EAWA 4X0VA 3SGUA 1UUMA 3PANA 5BU6A 3KZPA 3AZSA 4W87A 3HFYA 1YW1A 3AMCA 1K4GA 1QI4A 4LAOA 1I2RA 1EHNA 2XHYA 4NZ4A 3MVIA 2G50A 3PM6A 3H4XA 1ZAIA 5BXPA 3KLKA 2AL2A 1VQTA 1UH2A 3BCDA 1XCXA 5K2ZA 4ICCX 4ONVA 5D8WA 1XHGA 3S4TA 1JEZA 1R3VA 3CPRA 1YIXA 3VNLA 3B97A 1ONRA 5DQPA 1UIOA 4DHGA 3GFYA 3VIJA 4L1GA 2QHAA 4WOZA 3W37A 5T9BG 4C7FA 4XVDA 5EMYA 4TVDA 4XZLX 1NOFA 3AHVA 1NIUA 3TWBA 1RJRA 1UKOA 4RPQA 2HROA 4MKSA 4BI6A 4E2VA 4UNIA 1ZNNA 1QOXA 1YDYA 1MMFA 3AWOA 3W75A 4JY8A 3ABQA 1K9EA 3IV3A 3TNBA 3IGHX 4NNAA