3U5YA

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
501
structure length
470
Chain Sequence
b'DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Raucaffricine-O-beta-D-glucosidase
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 174
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u5yA00
3AS2A 3GXIA 3OZOA 2J7BA 2VRQA 3W38A 1DWJM 2ZUSA 3ARSA 3NYDA 1PZ3A 4PYSA 3NDZA 4IUGA 3WH6A 4QLLA 4P8WA 5CQ1A 1OD8A 5D8WA 1M53A 1KFWA 2BY2A 3I3BA 1Z32X 4WLCA 2EEXA 4U2YA 3FAXA 4GXPA 3CBWA 1CPUA 2E9LA 1UWIA 1MW3A 3AZSA 1B90A 4JCMA 1JYXA 4Z2HA 1HNYA 1JDCA 1U2YA 4W8AA 1DWFM 1W9XA 3FAWA 4M1RA 5JIPA 3IAQA 1V6WA 2WPGA 1F4AA 2EJ1A 4EE9A 1YHTA 1E6PA 3MUIA 4ACZB 3ARUA 1QVBA 3SUVA 3ZOAA 3CHEA 1ISYA 4R27A 4D6IA 5A6BA 1W32A 2XFRA 3N11A 4D1JA 3TTOA 4AZ7A 2X0HA 1CWYA 5BROA 1CXEA 2BXYA 5ABFA 1JYVA 2JFEX 1XC6A 1XYFA 6TAAA 3SCPA 2YKKA 3B8SA 4GO8A 1KXTA 1UOKA 1E6XM 4CUCA 3BAJA 4RE3A 1FOBA 3A6OA 2V3GA 3RJYA 3MUY1 1EQPA 5D8ZA 1HJWA 4U3AA 3B9AA 3VNYA 3KE0A 2FH8A 4E4PA 1Q6DA 4KWUA 1KWKA 1ESWA 2A3CA 3SIMA 3N12A 4P8VA 1CXIA 4Z2GA 4HPHA 2BXZA 2WKLA 4UFJA 4S3KA 4A3HA 5A6LA 1XSJA 3GYCA 4R5EA 4U5KA 1HJSA 2D3LA 3QHOA 1CXKA 1BGGA 3O6AA 3CHCA 1JG9A 5I24A 4JFVA 3VGHA 4UFKA 3GDBA 3W29A 1OB0A 2VCBA 3POCA 3B9EA 2XIIA 1QBAA 3MKKA 1Q6FA 1OIMA 2GVYA 1B2YA 3KEHA 1CYGA 3ZQ9A 3CUIA 4RE2A 1WE5A 4CCCA 5CLWA 4ZXOA 3NIYA 1BG9A 4LXFA 3OGRA 3AMKA 1QI2A 2DDXA 3WQVA 3RPMA 2WWDA 3CMGA 5A94A 2E0PA 2G4FA 4PTXA 1BSIA 3AXIA 4N0RA 1C8XA 4ZE5A 1PX8A 1KWGA 3WQ5A 2WSPA 2WMIB 4JZ5A 2PWEA 1DWHM 1E5NA 1KR0A 1MXDA 5I5RA 1K9EA 3M46A 4W7WA 3ZJ6A 3DHPA 3UR7A 4URIA 4FLSA 1C8QA 3E1F1 4D6GA 2VZSA 1UWRA 5HOSA 1GPFA 1ISZA 4AD2A 2CPUA 2F2HA 1ZJBA 4UFLA 4EK7A 3WIJA 1K9DA 1VF8A 2DSWA 3ZR5A 1E4IA 1W2VA 3BC9A 1KQZA 2ZUVA 1ZBCA 2J79A 3AHZA 3LPPA 3T08A 2D24A 2Q8XA 3VIFA 4HZ7A 4XUYA 4NSBA 1CTNA 1E70M 2C8NA 4D6JA 3AHVA 1SFSA 2EQDA 3MSGA 2EPNA 4P7QA 3SEPA 1ODZA 1XSKA 1CENA 1Q6EA 4N42A 1OD0A 1QHZA 3ARVA 3WDPP 2V3FA 2WZEA 1W9BM 8A3HA 1JDAA 1JAEA 3MMWA 1OIFA 2VT0A 3EDDA 1UWUA 1W9DM 1HIZA 1C90A 4HP5A 4BQ2A 1UD6A 3WH7A 1J01A 3AIVA 4BF7A 3MMDA 2Y5EA 4AZHA 3CZLA 3VM5A 2WC4A 3VIOA 4ACYA 3N1AA 5AYBA 4BA0A 2XFFA 3WF0A 2ZE0A 2HVMA 4UNIA 2J78A 3MUAA 1JZ4A 1EGZA 1ITCA 2PBOA 4LYRA 3HMCA 5D9NA 5I6SA 3AS0A 1E1FA 1B3ZA 2WMJA 1CNVA 1HKMA 3VUPA 2OWCA 4E8DA 3TONA 3WNMA 3T09A 1ZBVA 2JE8A 2D3NA 2YLAA 2CBVA 1VENA 1J18A 4ZENA 2GK1B 4F66A 4TVUA 3U7VA 1UKQA 1QNPA 2E3ZA 1Q6GA 1JF6A 3ZJ8A 2AOSA 2NT1A 2NT0A 4PMXA 5AYIA 4QP0A 3ARWA 4CD6A 4H7VA 1V0MA 3EMCA 1A47A 5F7UA 1BVNP 1UZ4A 1XYZA 1O7AA 3VDAA 5DT5A 1W9UA 4P7NA 2GDVA 1TA3A 2VMFA 2G3NA 2YBTA 4BQ5A 1E3XA 2GFTA 4M56A 4WSJA 3VTRA 3WUEA 1CXHA 3ARQA 4QAWA 1JD7A 2XM1A 1P6WA 2J7DA 4PMUA 3GZAA 1E6RA 5D9OA 5CPQA 3VOCA 3EDEA 1GJWA 2WZIA 4KMQA 1I1WA 2JIWA 3WUBA 3LPOA 2WNWA 3N18A 4KRTA 4KGJA 1WPCA 4H04A 3VMNA 4J3SA 1EDTA 1CLXA 1WDPA 2YDQA 3BLKA 3W6LA 4MDPA 1NARA 2AMGA 4B15A 1TFVA 3RM9A 4AD0A 5GPRA 3BAWA 3L4WA 1HL9A 1Q4NX 1XH2A 3M7SA 2DIEA 4HA4A 3WD0A 5AY7A 4GO9A 4WIWA 1XCXA 3GNRA 2UY3A 3GM8A 1UD3A 1C8YA 5A8PA 3WDQA 2CBIA 1H09A 3QR3A 4Q7NA 2VQUA 1GJUA 4AZ6A 1QW9A 2QF8A 3UESA 2DSZA 3NUKA 3VGFA 2ZX5A 2WMKA 1NP0A 2YDSA 1KR1A 2E8YA 4ATDA 1GCYA 3KZSA 2OSWA 5A69A 3VX1A 1RP9A 4UQ9A 1X1NA 2JIEA 1I1XA 2YL8A 1MW0A 2FHCA 4PEEA 4ZE4A 1BGAA 1WDQA 1UYQA 3UETA 4AMCA 1UKSA 3ZSTA 5A8QA 4HZ8A 3G6MA 1WNOA 4UCFA 3VM7A 1C7SA 3WY1A 3K4AA 1J12A 3WEZA 1VFOA 1ZB5A 4AZCB 2PWHA 3AROA 3IJ9A 5I3DA 2ZUMA 1MQQA 2UY5A 1NWUA 1NM9A 3AHTA 1WDSA 3CZ8A 1TZ7A 3WQ6A 1CZ1A 4LPCA 4AZIA 3RO8A 3EMZA 3VIPA 2PWFA 3AIWA 1R87A 1EDQA 1EA9C 2VC9A 7TAAA 1GZJA 5FL1A 2V5CA 3VKKA 2XG9A 3MS8A 4AIUA 4W87A 3WF3A 2O9TA 5E0CA 2XSAA 2WMGA 1V0KA 4ATWA 4B9YA 4AW7A 5AC4A 2GK1A 2VVSA 1TVPA 3WUFA 3DYPA 4KRUA 3VU2A 4PN2A 3GH7A 3PN8A 5A6JA 2Y8KA 1G94A 3M07A 3AHXA 4W86A 4MNKA 3OIHA 1NWRA 1MQPA 4PMDA 1EO5A 4WJXA 3WEMA 3OLGA 4XV0A 7A3HA 3W37A 2WB5A 5IDIA 4W7UA 3U5YA 4TTGA 1UA3A 5HNNA 3RMEA 4F8XA 1UR8A 2WCSA 3NSNA 3T0AA 4PRWA 1MWOA 4HU0A 2QHAA 4OKDA 1XH1A 1JI2A 4Q22A 2GUYA 4DWSD 1RP8A 5GNXA 1XD1A 1HKJA 5CG0A 4JFSA 4UQAA 5LA2A 4HOZA 1H1NA 1WP6A 2CKRA 4AIOA 4WK9A 1GORA 4OUEA 1B3YA 4Z2LA 1WCGA 1V6XA 1LWJA 5CXPA 4MAZA 4JFTA 3U5UA 4TX8A 1V3HA 1UZ1A 1BHGA 3PHAA 1R85A 5FKYA 4A4AA 4PBGA 2DQXA 5CGMA 5ABHA 1VBUA 2ZWYA 5BRQA 3CZJA 2CCRA 1L8NA 4GINA 2D1ZA 4ZFMA 4D1IA 4D72A 4WF7A 3HN3A 3WD4A 3AZRA 4JFUA 4MDOA 1C92A 3CIVA 3GNPA 2EBNA 2GJXA 3BMWA 1HVQA 3W0KA 2Y8VA 1VJSA 4JHOA 1UWQA 1PIGA 1H2JA 2WWCA 3ZMRA 1EDGA 4FLOA 1GONA 5BXTA 2PWGA 4GQRA 5DMYA 2YA0A 2WVTA 3WH9A 4MPKA 4CD7A 1Q6CA 3VVGA 1FFQA 4JL2A 2BHZA 4B9ZA 5EB8A 5EMYA 4UZUA 4H8HA 2E8ZA 4DUXA 3N13A 2WLYA 4LYPA 4AISA 4J3XA 1UR2A 1UH4A 3DC0A 4MAVA 2UY4A 1CGVA 3WNLA 4V27A 5ECUA 2W63A 3RM8A 1V02A 3W25A 1QI0A 2J8FA 2O92A 1B3VA 1UQZA 3WSUA 4BQ3A 1W1VA 4NZCA 2VO5A 3WN6A 3FHQA 3AZTA 4W5UA 2PWDA 2J7HA 1W3KA 4Z2IA 1CECA 1W9PA 1GOOA 1HP4A 1PX4A 2IUZA 1SYTA 3AYSA 3CUGA 2XWEA 1JZ8A 5DT7A 4DWSC 4M24A 1EIBA 2WC7A 5JBEA 4YN5A 2WLZA 3MV11 3OZPA 4JCLA 1UR0A 2AAAA 2NSXA 3WF2A 3S6TA 1V08A 2CIPA 2A3AA 3BLPX 4WSKA 2WCAA 4P7OA 3B9DA 2QLYA 4KGLA 4LQ1A 2NW0A 2YL6A 1KCKA 1B0IA 1GQJA 1WZLA 2D20A 1DWAM 4UR9A 2XVLA 1W1PA 4FLRA 1RPKA 3WENA 3AMGA 2CESA 1XV8A 3APGA 1IV8A 4AIEA 3AIEA 2CHNA 1RD6A 3WDHA 3NSMA 4HMEA 4J3VA 3FXYA 3PZQA 2CITA 4HA3A 3QHNA 4V28A 1UUQA 4GZEA 1R8LA 2XM2A 3OLEA 4CKQA 4CU7A 1G5AA 3ARPA 4AD5A 1GUVA 4DWSB 1AQHA 1D7FA 3K46A 1B9ZA 4PCSA 2BHUA 4DUVA 5FD0A 2EPMX 1CGXA 3TA9A 4C7FA 2DH2A 1JD9A 2RGLA 3ALFA 2J25A 5HBFA 3ZT6A 1GQLA 3K8MA 4W8LA 3RM4A 5I78A 1N82A 2G41A 3EYPA 4U2ZA 2WZHA 4CD8A 3PZMA 2YJQA 2ZUWA 3WL0A 2BHYA 2ZOXA 3ARZA 2WHJA 5GQBA 2Y4SA 4CCEA 3SCUA 3VNZA 4AWEA 2ZUUA 1US3A 5JBFA 2WHKA 4PSRA 5A6AA 1PAMA 3F5JA 3VIIA 1G01A 3VDHA 3FN9A 4UOQA 1E6SM 4EKJA 3CH9A 2WVSA 3RCNA 4JKLA 5HXMA 3OGVA 2DSVA 1F4HA 3OLIA 4PUDA 3T0DA 2FGLA 1LJYA 3GNOA 1ODUA 4V2XA 1CGYA 1R7OA 1UD2A 1B1YA 3EBVA 4H8VA 3KL0A 3WNKA 3VIMA 1BYCA 2OWXA 1ISVA 3WEOA 2J7CA 3FY1A 4X0NA 1QHPA 4NRRA 4CN4A 3SCRA 4FMVA 4IISA 2WVVB 1VAHA 2A3HA 1W1YA 3SUTA 1JZ3A 3W81A 3ZR6A 3N9KA 1H5VA 1PEZA 3GH5A 3QOKA 1O6IA 2A3BA 4LGXA 1GW1A 5C71A 1NOUA 1B3WA 3BMVA 4ACZA 1V6UA 1E6NA 2W91A 1XSIA 4OZOA 4LX4A 3DECA 1KBBA 2ZIDA 5JBDA 1GHRA 4HOWA 5DO8A 6A3HA 1MW1A 4GKLA 5LA0A 4WKHA 1E6ZA 4PMNA 2F8QA 1ISWA 1UKPA 1VFUA 1JFHA 1ZS2A 1PX3A 4D6CA 5A6BD 2J4GA 4ZXLA 4H41A 1SR0A 3VGDA 1BF2A 4M29A 3D5HA 3VD9A 1CGTA 3PZIA 1VB9A 3DYOA 3K4DA 4TOQA 1WDRA 1CIUA 1VEOA 3FW6A 4B16A 1X6LA 4QLKA 2DPEA 3W24A 5E0FA 1R86A 3QOMA 1QOXA 4M81A 2J7EA 2JF6A 2VX5A 4FF5A 1GOKA 1MXGA 1OGGA 1WO2A 4UQCA 3QGVA 3AS1A 1ZU8A 5A8NA 1QBBA 3GXMA 4GZJA 3L2MA 4UTFA 5BXRA 1DWGM 3TTYA 4TVCA 3VMOA 1ZJAA 3O9NA 4J28A 1UD4A 1UKOA 5LA1A 1LF1A 1E4LA 1UG6A 2VJXA 5KZ6A 1HKIA 5EFDA 4JKKA 3KL5A 3CUHA 1JZ5A 2RGMA 5BXSA 3HU7A 1H0IA 2XFYA 1JGIA 4MADA 4UFMA 2VX4A 4D6FA 3AIUA 1KB3A 3CZEA 5I2UA 4HU8A 1EHAA 1LWHA 3K8KA 1WB0A 3MO4A 4HMDA 2ZX8A 4M8UA 1UA7A 2DT1A 2CETA 4Z2JA 2J74A 3PZOA 4AEFA 2E4TA 3BAKA 3WD1A 5M5DA 2CXGA 2XJ7A 3SUUA 4HZ6A 4OJYA 4PTMA 3T2OA 3CPUA 4GI9A 4U33A 1KCLA 4JFWA 4H8UA 4P7RA 3UR8A 2J7GA 1OT2A 3BAYA 4AEEA 2WMIA 1NP2A 2OYMA 1XCWA 2VTFA 1W3JA 4UQBA 3WQ4A 1H49A 2W92A 5JIWA 3VMPA 3PTQA 1JAKA 3MSDA 5A2CA 4DUWA 1LG1A 3M6DA 3BCFA 4PMYA 3UG3A 4MNMA 4P8XA 3WUGA 5IHSA 3AS3A 2FDMA 4HPGA 4TVDA 1JZ2A 2ESCA 1MFUA 3WNPA 1FHDA 2O9PA 2VVNA 2WKGA 1PIFA 2MANA 3A3HA 1G0CA 4J3WA 5I77A 2Y24A 5IHRA 2VRJA 2O9RA 3WF4A 4FLQA 3WH5A 3MMUA 2OLHA 4F9JA 4J3UA 1HKKA 1E56A 4YHEA 5E70A 4F9DA 2OWWA 3BSHA 1S46A 1W9VA 2V3EA 2YBUA 5DFAA 3UG4A 4J27A 1OGBA 1FA2A 3PZ9A 2J75A 5CZKA 1VEPA 3VDBA 3DHUA 4MB3A 2VR5A 1W91A 2XVGA 2C7FA 1QI4A 1ZBWA 1BYBA 1QNQA 1DP0A 3ARTA 3II1A 2G3JA 1DHKA 1CDGA 2X8RA 3AFBA 3OGSA 3CZKA 1OGSA 3WBEA 2WANA 2VR4A 2OYKA 4ATLA 1FP9A 3VPLA 2W66A 3PTMA 5TD4A 3UEQA 3W26A 3ZT7A 2DEPA 2HISA 3CHDA 4JAWA 3AQUA 1X6NA 3SCQA 5ABFB 4CVWA 5CJ5A 5D9PA 3ZT5A 1J0JA 4IPNB 1E72M 1UR1A 4NRSA 3WMCA 1LL7A 1H3GA 1GOQA 4GI6A 2QV4A 5FOOA 1H0GA 3GXDA 3THCA 3WD3A 1LLOA 2DT2A 1JZ6A 2CKSA 1VJZA 3BCDA 2WBKA 1LL6A 4PTWA 2CNCA 2D23A 1E1EA 3CGTA 3ALGA 2W62A 3WMBA 2X05A 3WMSA 1OCQA 4U5IA 2VRKA 3CZGA 1E0WA 2X09A 3U7BA 5E09A 2XPKA 5HDRA 1XD0A 1UQYA 1UR9A 2JALA 1V0LA 2ZX6A 3PTKA 4UQDA 5M3WA 1A3HA 2EO7A 2WW5A 1KGXA 1Y7VA 3LPGA 2QMKA 2BV9A 4C7GA 2XTKA 4BS0A 1J0HA 1IT0A 1K6AA 3A47A 1C7TA 2UY2A 1G1YA 2FH6A 4NI3A 3SCTA 4W5ZA 4GIAA 1HN1A 2J8GA 3AYRA 4GI8A 2J77A 1GOIA 1V02E 3SCWA 2JF7A 2OSXA 4PUEA 3K8LA 1QHOA 4EANA 4AD1A 1TMQA 1L0PA 5DF0A 1QI5A 2YA2A 4J3TA 3SCVA 3MUZ1 1JYWA 4QFUA 1W3LA 2XVPA 1UR4A 1HVXA 1V3JA 2O9OA 3N04A 3CLWA 1GVYA 2YOCA 1JDDA 1KXQA 1US2A 3AIQA 2WC3A 1E4MM 4WKAA 5A1AA 4UFIA 2G3IA 1EO7A 1HF6A 4AZGA 2GDUA 1QNRA 3F5KA 3ARXA 2YL9A 1UH2A 2BVDA 4CN6A 5GNYA 1GQKA 1AVAA 1CLVA 5A8MA 4P7LA 2W5FA 3AMLA 4MJ4A 1IZJA 2CEQA 2WMFA 8CGTA 1ZL1A 1B30A 1ITXA 1BYDA 4DM1A 4UOZA 3S2CA 3AXXA 1JFXA 2BY0A 5EBAA 3SUSA 3AICA 2VOTA 1DWIM 2VZOA 4OIFA 4Y7EA 5AC5A 1VFMA 3UG5A 2XUCA 3CMJA 4AZCA 3L2LA 2IXVA 4ZEPA 2EPOA 4MB4A 1BG4A 1DEDA 3BXWA 2XGIA 3WBAA 3ARRA 2UWFA 3ZSSA 1TE1A 2ZUNA 4JIEA 1MYRA 3TOPA 1V03A 5IFPA 1XGZA 5CSUA 1NH6A 5I0DA 1M03A 1FFRA 1GOMA 4RE4A 3O2LA 2DT0A 3QHMA 2BFGA 3LMYA 3PZTA 3L4YA 3SCSA 1EH9A 4OBSA 4QDMA 5C70A 3WQWA 2XVKA 4MB1A 3VD3A 2CHOA 2PF0A 4W93A 3A4WA 1CGWA 2FHFA 2ZUTA 1E0VA 2TAAA 1W1TA 3A4AA 2EPLX 1JI1A 2BNJA 5A2AA 1E73M 3AXHA 2VZTA 2WCGA 4YPJA 3VINA 3LPFA 2GJPA 2A3EA 2D0HA 4PMOA 4HA1A 4CU8A 3NCOA 3CUJA 1BVZA 2D0FA 1VRXA 5A2BA 2YL5A 2CBUA 1BQCA 5A8OA 4BCEA 4KH2A 4TX6A 4W88A 2CYGA 2E9MA 2DIJA 1V6VA 4ML4A 2PBGA 4P8UA 1HT6A 2QMJA 1AQMA 1E9LA 2VNCA 3IJ7A 2PB1A 5CLTA 3NJ3A 2GJRA 2FHBA 2XYLA 4JKMA 1WZAA 1CEOA 5BCAA 1E71M 4MNLA 2ZXBA 3WL1A 4F79A 4UQEA 1E0XA 4JHZA 1QPKA 5FL0A 1KXVA 1TA3B 1HJVA 5KEZA 1XH0A 2ZXDA 3OBAA 2WBGA 4GZIA 3WF1A 7CGTA 5M03A 3BSGA 3T2QA 2XGBA 5IFTA 2XVNA 3WDIA 3SCOA 4AD4A 1VEMA 3VX0A 4J7RA 1V6YA 2PI6A 4PTVA 1HJUA 4HMCA 3BGAA 1KGUA 1NOWA 3VILA 1QI3A 3VO0A 2ZICA 3F5LA 5E6ZA 3AHYA 1BPLB 2DSUA 3WKZA 1U30A 3RILA 4JL1A 2J47A 1MW2A 1UWSA 4A3YA 3I3DA 2V3DA 1JXKA 5BXPA 1TCMA 1B3XA 3DYMA 1XHGA 2VURA 3AI0A 5BYWA 1UHVA 3W6MA 3MANA 3AMCA 3FNDA 1EHNA 1PZ2A 2WYSA 4L4OA 3EDJA 5D4YA 3GXFA 5EFFA 1H11A 3ECQA 3VDCA 2DT3A 2FGZA 5JUVA 4FK9A 4OOZA 4B3LA 1J0KA 5M17A 1FP8A 4IPLA 3EDFA 2OYLA 4HTYA 4E2OA 3VIHA 2YDRA 1CXFA 4UOJA 4BQ4A 4L4PA 1NWSA 1E6QM 1YQ2A 2WVUA 3VIJA 2DGAA 3W4RA 1BAGA 2G8ZA 1EOKA 1K9TA 1AMYA 1E4NA 1OINA 3CUFA 2ZXQA 4AC1X 3W53A 1C3FA 1WKYA 2YLLA 3F4VA 3N17A 1JL8A 4H2CA 1UKTA 1JYNA 2Z1KA 4QCFA 5ABEA 3EMQA 3AMDA 2ZXAA 3AIBA 1M7XA 2EPKX 2WHMA 1SMAA 4AZBA 1KBKA 3ZIZA 1J9YA 1GVIA 1VFFA 4W7VA 1J0YA 5HPOA 1TR1A 2VCAA 4XZWA 4U31A 4X0VA 3N15A 1OT1A 3KL3A 5BWFA 1U33A 1V3IA 3IJ8A 1M04A 2ZWZA 3BAXA 3L4ZA 4B3KA 1KXHA 4S3JA 3UCQA 2D0GA 1JXJA 3OA5A 1LL4A 3UERA 2W61A 3OG2A 2ZX9A 1E40A 1V0NA 1HL8A 4IM4A 3AJ7A 1HP5A 5C8BB 1J0ZA 2V38A 2WXDM 3A4XA 4MNJA 1CXLA 3J7HA 1WAWA 2VUYA 3NSXA 3NDYA 4BZYA 2X0YA 1E5JA 2DSKA 5A6MA 2WK2A 2W67A 4C7DA 4DWSA 3MU7A 4MTVA 1C93A 3THDA 1FHLA 1TVNA 1HXJA 5D9MA 2CERA 3AIRA 4AD3A 5I79A 3WFZA 1GHSA 1GQIA 3HJEA 2F61A 5FIPA 3L4XA 1K9FA 3WNOA 2VZUA 1V3MA 3T0BA 5BRPA 4M82A 4CVUA 3CHFA 4UZSA 3ZM8A 5FCZA 1EOMA 2ZX7A 1JIBA 6CGTA 3L4VA 1UD5A 3GH4A 5A3HA 2G3MA 1BLIA 1FH8A 3MV01 2D22A 5DEZA 4CCDA 4XB3A 2GSJA 1ZBKA 4W85A 1MQRA 3W28A 4CD5A 4X9YA 1V3KA 2VQTA 5A6KA 1R7AA 2WAGA 1J11A 3IK2A 3K1DA 4OBRA 3SUWA 1UWTA 3PZGA 5CPTA 1TG7A 4W84A 4E8CA 1PJ9A 2D2OA 3L4TA 4W8BA 3PZNA 1FH9A 1QNSA 3KWXA 3PBGA 5CPSA 1CBGA 1OBAA 4HOXA 1H41A 2GJXB 3VD4A 1WZKA 4PMRA 3VIKA 3D3AA 2JEQA 3ZO9A 2Z1SA 2WVVA 4AY1A 1OWQA 4CU6A 1D2KA 3L4UA 3WDRA 9CGTA 4MB5A 4DM2A 1PPIA 4XZBA 2X2YA 4YHGA 1V3LA 2BVTA 4GPNA 2XSBA 4M80A 1LG2A 1FH7A 1JNEA 2W4XA 4CN1A 3RJXA 3AISA 4CD4A 1NQ6A 4RL3A 4TUFA 4D6HA 1UH3A 3BAIA 3TP4A 1IZKA 3VD5A 3WDJA 3PZUA 5CSYA 3WNNA 3WFLA 5A95A 3VGEA 3IANA 3OLDA 4PMVA 3SURA 1GOWA 1JNDA 4CGTA 3WQ8A 2QPSA 1GNXA 3GBEA 2BS9A 4TXEA 3U57A 3CTTA 3EDKA 3T2PA 1LQ0A 3VIGA 5ABGA 3VD7A 3SCNA 1XRVA 1HJXA 3ARYA 2PC8A 5E6YA 3PZVA 5A6SA 1J0IA 1EQCA 2J7FA 1BFNA 2CBJA 1TUXA 4XX6A 4OOUA 3TTQA 1W2PA 3CO4A 1OSEA 3G6LA 2BVYA 1WZMA 2WM0A 2B31A 1M01A 4Z2KA 2XIBA 4UFHA 1MVYA 1E55A 2OSYA 1BYAA 2J62A 2WMHA 3GBDA 2VCCA 2IXUA 4GQQA 1DTUA 4AZ5A 4QLJA 1VBRA 5CGTA 3ZJKA 3JUGA 1C91A 5LYRA 1CGUA 3RIKA 3WD2A 4LYQA 1QW8A 4AXNA 2C0HA 1KGWA 2BY3A 5HPCA 3WELA 1EXPA 2WSKA 2YA1A 3FHAA 2VX6A 2QPUA 1NWTA 1JZ7A 1MFVA 1J10A 3IAPA 2E40A 1VIWA 2XWDA 1HX0A 2BY1A 3ZJ7A 3AOFA 4TTUA 3W27A 2Y2WA 4D6DA 1HJQA 5I23A 1I75A 1SMDA 4NF7A 2E9BA 2XHYA 4D6EA 4WKFA 5IXEA 3POHA 3RDKA 3GTNA 2VL4A 2JEPA 3VGBA 1H4PA 3TTSA 1E3ZA 1D3CA 2VI0A 1G9HA 3W82A 4EAMA 1E15A 2V5DA 2VZVA 1BTCA 4PMZA 1RH9A 1ISXA 1E43A 4D71A 5E9AA 1PBGA 4MJ2A 1B31A 2X1IA 4QCEA 3WH8A 2WHLA 3BH4A 3I3EA 4PCTA 2VX7A 4K68A 1NOFA 2YIHA 1UD8A 4PSPA 3OB8A 2DH3A 4AYSA 1QNOA 3VGGA 4W89A 2EXOA 1OM0A 1AQ0A 5GNZA 4U3CA 1KQYA 1W3HA 4PMQA 1ECEA 1JF5A
chains in the Genus database with same CATH superfamily
4XAGA 2V5JA 3GC5A 2E09A 3KVMA 1SGJA 3W38A 2VRQA 3C8FA 3FYYA 2NLIA 3GC2A 1J96A 3ARSA 1PZ3A 4PYSA 4HTBA 5MHBA 2AKZA 4B5SA 3M0MA 4QLLA 1H5YA 3QSRA 5D8WA 2Z6JA 4WLCA 1IEWA 2EEXA 4BWLC 4DPQA 2CLLA 3CBWA 3LY0A 1U5HA 2E9LA 1O60A 3PUDA 4ZO8A 4H2HA 1B90A 2AQWA 1XYAA 1EGMA 1JYXA 2R14A 4Q7IA 4B5UA 3TROA 4GUHA 1U2YA 3TXZA 1DWFM 3R11A 3A5FA 2WPGA 5HWJA 1O1HA 2CXEA 4ZQMA 1N2VA 1FWWA 3NVTA 1O12A 3MYPA 5HMFA 1W32A 2XFRA 2IS7A 1O5KA 3TTOA 4AZ7A 1XLHA 4FX6M 1VPYA 1IXQA 2X0HA 5EMJA 3N2CA 3I68A 2BXYA 5ABFA 3N2XA 3QC0A 3FCPA 1XC6A 6ALDA 3UGRA 4GE8A 3AYVA 3SCPA 1HG3A 4K8EA 3BPWA 1UOKA 1E6XM 4LBSA 3A6OA 4O10A 1TPC1 2YB1A 3ZVIA 1LRTA 1OG6A 2NQHA 1R3RA 1M41A 4WCJA 4E4PA 4R7JA 3SIMA 4Z2GA 2BXZA 2WKLA 3TAKA 3EWUA 2OOFA 1XIGA 2Z4GA 4GD0A 3NL3A 1CXKA 3T40A 5J04A 1BGGA 3G1SA 3O6AA 1XCFA 5I24A 4UTTC 5ABTA 3NZRA 2XIIA 3QF0A 3MI6A 4NUWA 2ISVA 2GVYA 3FA4A 4LCRA 3I6EA 1IEVA 2INZA 4RE2A 1WKEA 3LNPA 2NV2A 3NM1A 2RUSA 1SPQA 2V2CA 4JTUA 5BU9A 3AMKA 3LHTA 4AIBA 3WQVA 1WX0A 5M1TA 4PL2A 4IG2A 4XAYA 2OGJA 1A80A 4PTXA 3G22A 1BSIA 4N0RA 2E5CA 1CLKA 3IJ6A 4IIDA 3HQNA 3WQ5A 1F6YA 4LT9A 2PWEA 2Z2UA 4O4VA 4O19A 4UUIA 1KR0A 5AC6A 1IT8A 3DHPA 3HJZA 2O0TA 4JQ4A 3UBPC 4KCVA 4WSHA 2YXXA 1K70A 2CPUA 2E77A 1ZJBA 3WIJA 3UFYA 4XG1A 4K6AA 1VF8A 4AWTA 3GU1A 4O53A 3SW6A 5FACA 2D24A 3HG2A 4L1GA 4XUYA 3M6YA 5LXEA 5D02A 3AHVA 2EQDA 3GFZA 3MSGA 2EPNA 2FZBA 4P7QA 3U2OA 1ODZA 2QGYA 1OD0A 3ARVA 3LTPA 1BVWA 3CS2A 3BUVA 8A3HA 3MMWA 4XBSA 3P93A 2I14A 1OC7A 3B97A 2VT0A 3EDDA 2I16A 2D2HA 3JW7A 3ITGA 1X1ZA 1GEHA 3GG0A 3AIVA 3D6NA 4NY2A 2Y5EA 4UMBA 3STCA 3VM5A 5H1WA 1IGWA 3CAVA 5HMDA 3E9AA 2PLMA 2HVMA 2BTMA 2Y0FA 1EGZA 1ITCA 2PBOA 3HMCA 1X1OA 5D9NA 1YNYA 3A3XA 5C9WA 2FZMA 3G0SA 2WMJA 1GW9A 1XWYA 1XLFA 4GXWA 4R3UA 2EKCA 4RKAA 3WNMA 2FVKA 4ZENA 1G7VA 3NQMA 3U7VA 1UKQA 1JJKA 1QNPA 1Q6GA 3I7SA 2AOSA 2NT1A 2NT0A 3WLQA 3W1MA 2BVWA 4CD6A 2HXUA 5F7UA 5DCBA 1Z41A 2PSNA 1W9UA 3GVQA 3H26A 4HYRA 3PPFA 4IJCA 2G3NA 2YBTA 4WSJA 4DJEA 5LIUX 3PNZA 4QAWA 2B81A 2GUBA 1E6RA 4JTSA 2WZIA 4QNEA 2XDFA 3E0WA 3G0UA 3R8GA 1AJ0A 3TC3A 2J24A 4KRTA 4KGJA 4H04A 3DHFA 4R33A 4WGHA 1NDZA 1CLXA 4ECLA 4Q4KA 2YDQA 4LALA 4MDPA 3KCLA 1L6WA 1PYFA 1T8QA 4U10A 3RM9A 5GPRA 4DUOA 3R79A 3SRDA 4HSNA 3OODA 4XAZA 1OX6A 3KTXA 2TYSA 2XU2A 3M7SA 4HNLA 4Z0JA 4WIWA 1XCXA 1G4SA 2UY3A 3SRFA 3LENA 2J6VA 1P4CA 3B04A 2YCLA 4LVDA 4IQDA 3QR3A 3HZ3A 1IEIA 1GJUA 3LHUA 1RLCL 2DSZA 2QXWA 3VGFA 1JCLA 1V93A 1MEHA 2JIEA 1I1XA 3B0XA 1MW0A 3SN0A 2FHCA 2PP1A 5H8UA 4JTJA 4NVTA 1BGAA 2FFIA 3W74A 1KRMA 4UCFA 1C7SA 4WX2A 3K4AA 1EEXA 3USBA 3S5ZA 4GNJA 1T7LA 3GU9A 3RRXA 4BKNA 4E4FA 1OC6A 2V30A 1MQQA 2ZUMA 2AGKA 3CPGA 2CZEA 1XISA 3CZ8A 3BK0A 4Q4MA 4NJGA 3EMZA 2PWFA 3NVDA 3OVPA 2QPXA 2VC9A 3KBNA 1TE6A 4MKNA 7TAAA 1U5VA 1GZJA 2V5CA 3VKKA 2XG9A 3MS8A 3AU6A 2ZRYA 1XLLA 2O9TA 2XSAA 2WMGA 4AW7A 5AC4A 2CFFA 4KETA 1EXBA 2YFOA 3EKLA 4MWAB 3M07A 4W86A 3TZFA 4XKYA 1OCBA 4XTDA 2OX4A 2ZRZA 3KBVA 4Q4SA 1EO5A 4WJXA 4H9VA 1LLWA 7A3HA 4RV8A 2CLOA 3MWAA 4DZIA 3U5YA 2H90A 1UA3A 3RMEA 4QTGA 1UR8A 2BOEX 3CWOX 4LRTA 1XIFA 4IL0A 1ZCCA 4DWDA 4Q22A 2GUYA 1RP8A 4UQAA 5LA2A 3A24A 3OJGA 1KBJA 4R34A 3WLHA 4LEFA 3WJSA 1V6XA 1LWJA 2ZCGA 3UVIA 3E0IA 2VEKA 4FB7A 3U5UA 4TX8A 4GY7A 2VEFA 4YMZA 4FZIA 3SZ8A 4E3VA 2AGTA 2OKOA 2ZWYA 3N4AA 3TYEA 3N25A 3BE7A 3CZJA 1L8NA 2VEGA 1PUDA 4WF7A 2IPFA 3HN3A 4RLIA 4GUFA 3CV6A 1VJIA 4MDOA 3PK7A 1C92A 4UR7A 3CIVA 3UXIA 1F9CA 2Y8VA 1VJSA 4JHOA 3M16A 3TW9A 1H2JA 2DU2A 2DY3A 5HJYA 1ZALA 1F5ZA 4GQRA 2NVAA 1OFRA 2YA0A 2WVTA 3WH9A 1TJRA 4MPKA 2A79A 4JL2A 4B9ZA 2Z1BA 2NXIA 5F1VA 4C5YA 4UZUA 3F1QA 2E8ZA 4DUXA 3ISIX 4XISA 4AISA 2ZC8A 2QW5A 4G1NA 1UR2A 4KW2A 1X39A 4JX4A 5H6HA 1XLDA 3W25A 1B3VA 3R13A 1W1VA 2BXVA 3V75A 1HFBA 2I17A 2ABAA 3QPEA 4W5UA 2PWDA 1CECA 3TEVA 3DFYA 3OHMB 3HFTA 1SYTA 1BKHA 1AW1A 3L5MA 3BL3A 3NR0A 4Z1AA 2O7SA 3UP8A 1EIBA 2WC7A 4AAJA 2ASHA 2WLZA 3DI0A 3R6IA 4J5NA 1A5SA 3NQDA 3VKBA 3WF2A 3NM3A 3S6TA 3BV4A 5JU6A 4A05A 3BLPX 1BXBA 4ZL1A 2WCAA 4P7OA 4N6FA 2QLYA 4L9XA 4H6EA 3VDGA 2D20A 1DWAM 1DJNA 2XH7A 2DJLA 4FLRA 2BGQA 1DTNA 1PWMA 3APGA 1FCUA 4HZMA 3AIEA 3OVRA 2MNRA 3NSMA 4F2BA 4JN6A 1RJQA 4B92A 1XYLA 3PZQA 3QBUA 1IWPA 4QJ4B 2QCLA 1BRLA 4Z1DA 1UUQA 1UROA 3OBEA 3T0TA 1R8LA 2XM2A 4CKQA 1G5AA 4DXVA 1GVFA 1AQHA 3K46A 4DO4A 1OZQA 3N2TA 5FD0A 3BG3A 3NFUA 2EPMX 4GNVA 5D05A 1ZTVA 1JD9A 4ADSA 3T42A 2B0MA 3K8MA 4W8LA 4KQNA 4U2ZA 3PZMA 3CWNA 5D09A 3QY6A 2BHYA 2ZOXA 1M68A 2WHJA 4EXQA 1VHNA 5GQBA 5FF4A 3U2CA 3W7DA 4CCEA 3SCUA 4AWEA 2A7PA 4MUPA 1E6SM 4EKJA 3CH9A 5A6TC 1EP1A 3RCNA 4XSLA 5HXMA 4IIEA 2QUMA 4PUDA 3BZGA 3T0DA 1ZUAX 1LJYA 4P5UA 1TZ9A 1R3QA 1L9WA 1CGYA 3V1HA 4IMAA 1DJWA 1UD2A 3VCCA 4H6KA 4M6VA 3VIMA 1BYCA 2VR2A 2OWXA 1ISVA 4IP5A 4JR5A 4GJIA 2ISSA 4FMVA 4ORIA 1VAHA 1W1YA 5EY5A 1GYMA 2QVHA 3O6DA 2DVUA 1XQLA 3QOKA 1VLWA 4H8NA 4ZB5A 4Q3MA 1NY1A 5C71A 1NOUA 3CIWA 3BMVA 3O06A 1KC7A 4KERA 1PKYA 3KVLA 1XSIA 1UP0A 5IDZA 1J5SA 1PIIA 4HJWA 5JBDA 3CV7A 1GHRA 1OFOA 4O50A 5HA7A 2ACRA 5DO8A 4YNGA 1OC5A 4IMDA 1JDFA 4IP4A 3DX5A 1E6ZA 4A29A 3TV8A 4DZHA 1OHLA 1UKPA 4B5XA 1JFHA 3LD5A 2J4GA 1SR0A 3VGDA 4GCXA 3MTWA 1CGTA 2VGFA 4Y6GA 3LN3A 4BEUA 4Q8VA 1K4GA 3PUGA 3K4DA 2NX9A 1KM1A 1WDRA 1AZ1A 4L1XA 4PB5A 1V77A 1TPB1 3EEGA 1F74A 1R86A 3E0LA 3CC1A 1ZU8A 5A8NA 3GXMA 3TZNA 1C8VA 1F2JA 5AVHA 3TTYA 3LS9A 3PG9A 3PWAA 4LRSA 1ZJAA 3O9NA 4S3BA 5LA1A 2VJXA 4I6KA 1TKKA 4MJZA 3L7RA 4NXKA 4GCAA 1YE6A 1P1XA 2RGMA 2OGYA 4O4WA 1G4TA 1SZRA 3A5VA 4ZQNA 4ZQRA 2Z00A 3VZZA 1NAL1 2V69A 3GIYA 3CZEA 1FXQA 3NXLA 1BXNA 4RK8A 3TLLA 2NUYA 4GA8A 4KT2A 4ZOEA 3WFAA 2YW3A 4Z2JA 2OT1A 3P82A 4LVGA 1NDYA 3BAKA 4M7TA 4NNCA 1XBZA 4OJYA 2VDIA 2QULA 2W3ZA 3CPUA 3T2OA 4YVXA 1O5XA 4U33A 4JFWA 4H8UA 3ZLFA 3UR8A 1OT2A 1AA1B 2OYMA 3FEQA 3N34A 1ML1A 2QJMA 3S2JA 1H49A 1XGDA 5JIWA 1N7KA 3PC0A 4EVZA 3PTQA 1JAKA 3SGUA 5D30A 2V8ZA 3O6YX 1JCJA 4MUZA 4XD3A 4QX4A 4DUWA 4PB4A 3HG3A 1YDYA 2TSYA 3D3FA 5JQ9A 4PMYA 3W7JA 5IHSA 3GDLA 3VC5A 4B90A 4E8GA 4XVDA 1DE5A 1MDLA 1VFLA 3WNPA 4UIOA 4GC3A 4G9PA 3CB3A 1PIFA 1Q66A 3C2FA 5IHRA 2FLIA 2E1DA 3G8EA 5BOEA 4FLQA 3WH5A 3MMUA 1U1UA 2OLHA 1ADSA 3KP1A 3T07A 3MP3A 3F2CA 1E56A 1TV3A 5E70A 1LT8A 4F9DA 3JVAA 4R88A 1NF7A 2V3EA 4F0HA 3UG4A 3P62A 3ABOA 1OGBA 1FA2A 3PZ9A 5CZKA 1F3EA 4LAKA 3MCNA 3UJFA 1A0EA 1JUBA 4NKCA 3A4JA 2YDAA 4I9MA 4F3HA 2VR5A 1AL7A 2XVGA 5G1YA 1DP0A 7ENLA 3II1A 3OZMA 4DJDC 1CDGA 3AFBA 3OGSA 4LCQA 1WXJA 5EL1A 4ATLA 1FP9A 1DJQA 2BASA 3P5ZA 2ZRWA 3KS5A 1XLEA 3SCQA 2BG5A 3URAA 2F38A 5CJ5A 5D9PA 1ZAIA 3ZT5A 2VD8A 1G6CA 1H3GA 1GOQA 5FOOA 4PTDA 1JZ6A 4Q32A 2H8ZA 1XIEA 2CKSA 1VJZA 4R9XA 5IOBA 5TF0A 3CYVA 1T40A 5CBJA 2ISWA 3CGTA 2WM1A 1JPIA 1A0DA 4HB7A 2VRKA 3B06A 2X09A 2PMQA 3U7BA 1WKDA 5KZMA 3RLGA 5HDRA 1IEQA 4CNNA 3E38A 2O4QA 4F0RA 4HGXA 1S1PA 5M3WA 3Q37A 1TWWA 3AWOA 5J5DA 1KGXA 1XW8A 2PU0A 2I7GA 4DJED 2XIJA 1YX1A 3B8IA 3LPGA 2I5QA 3BLIA 3CV1A 1EC7A 1FRBA 2ZC1A 2XTKA 1J0HA 3OW1A 2VKZG 4JTKA 3M47A 3F7JA 4H9XA 2R1PA 2E25A 2FH6A 2EG8A 3FYPA 3PFMA 3IEBA 4DF0A 2J8GA 4GHRA 4GI8A 2J77A 4I9AA 4MZ8A 3EX1A 4C6KA 3C2OA 2OSXA 4EANA 2ZZ2A 1TMQA 3BW4A 2VYOA 4IICA 1QI5A 1ZJHA 2YA2A 3SCVA 3BOXA 4GVIA 1KRCC 1W3LA 3K2GA 4WY0B 2O9OA 4JQ2A 4X22A 1RHCA 3TC7A 3CLWA 5FSEC 1GVYA 1ICPA 1XR2A 1NQKA 4GRSA 5A1AA 4AZGA 1R5YA 4KIEA 2EAWA 1TTJA 4GFIA 2G96A 1POKA 1UZHA 1Q45A 2QUNA 4MJ4A 1VGAA 3OBKA 4LUYA 4ROQA 5EBAA 1KTNA 3SUSA 3S1XA 3P60A 3SADA 1DWIM 1ONWA 2XIQA 5AC5A 3IUHA 4GI4A 1XC4A 2C1IA 3ITTA 5LHEA 2PGEA 2EPOA 4MB4A 3RNDA 1W1IE 2KAUC 5EMMA 3WBAA 1AG1O 2JGQA 4ASTA 4DO7A 2JKEA 1SZGA 4NP7A 3MQTA 1SO4A 3DFPA 4US5A 1XGZA 4D8AA 5I0DA 2G95A 1D7KA 3BGGA 3N4EA 4I90A 5CC5A 3L4YA 4IIBA 3SCSA 4QDMA 4N2YA 1F76A 3WQWA 3VD3A 3KOXA 3A4WA 1CGWA 2QYGA 1W1TA 2DZSA 1IHIA 3JS3A 3W7EA 3M5ZA 4MWAA 5EGRA 2FPVA 3VOJA 4KFPA 4PUUA 3CAQA 1HGYA 5LSMA 5LIWX 3LTYA 4PMOA 4HA1A 4CU8A 3UA3A 1B9BA 3NCOA 1SR9A 1VRXA 5A8OA 1AL8A 3RG6A 2PDMA 2DZVA 4YXGA 4ML4A 4LC8A 2DZUA 2QMJA 5AHLA 4AX6A 3C86A 1E9IA 3IJ7A 1WV2A 1NU5A 4JKMA 4DO6A 4H83A 3W9ZA 3DHDA 1E71M 2OZ3A 2A4AA 2ZXBA 3URBA 4UQEA 4F79A 2QUTA 5LKYA 3PAJA 1F07A 3LDVA 4JHZA 5FL0A 5FAGA 5DMNA 2OZ8A 2FB2A 1XH0A 1XUZA 2BLEA 5BNKA 1J2BA 1QCWA 2GQAA 4GZIA 1W8SA 1RQHA 1SO3A 3WF1A 5M03A 1Q7MA 5IFTA 2XVNA 2E6YA 1HUVA 4JY9A 2HS8A 2G37A 1R9YA 5A8GA 2OXNA 3GVWA 1UUMA 4H7CA 1SJBA 5FJPA 3STEA 2Y7FA 1Z44A 3AHYA 3EZ4A 3UCCA 5EMKA 4JL1A 3T9PA 1ZAJA 1UWSA 3ZXWA 5CPMA 3G1FA 1XRSA 1XHGA 2VURA 3DC8A 1NFPA 1UHVA 3GHSA 3W6MA 4CEXC 5TBOA 3STFA 2FKPA 1M3UA 2WYSA 4EXBA 1ELSA 4HHPA 5CPLA 1P6BA 3NG3A 3GKAA 4U4MA 5D4YA 3GXFA 3KRSA 5G4EA 1C9DA 4OHQA 2Q71A 2NQ9A 3UD6A 4V15A 1FP8A 1IR1A 4IPLA 3LCHA 3SB0A 4FXRA 2ALDA 2OQYA 3TJLA 4E2OA 3WLKX 2YDRA 1H7WA 3NTYA 3FOKA 3M0YA 1LOLA 2I57A 2Q6ZA 3IV3A 3NGJA 1TZZA 4K7VA 1LM1A 3FGCB 3C2YA 4H2CA 3GDTA 4QCFA 3LZ5A 5ABEA 3K5XA 3E2SA 4AZBA 1J9YA 1GVIA 1VFFA 3NOEA 4W7VA 2P50A 4Q8OA 1YPXA 3T7VA 1TV4A 3BLLA 2HVOA 1PKLA 4U31A 1TPDA 3N15A 3R94A 1U33A 4PR4A 3MVIA 3UCQA 5TQLA 3A23A 1FWBC 4ILSA 3UYIA 2WQPA 3EOSA 2YZRA 1SFTA 2GL5A 2ZX9A 4IM4A 3NYZA 4ZA0A 1SZNA 2TODA 4N9CA 1WUFA 3UG8A 2Z7KA 4MNJA 3QGKC 2VUYA 4I7WA 4RZ6A 1VCVA 4LU0A 4NYYA 2BP1A 2WK2A 4HYVA 2NVCA 1C93A 3HPAA 1TVNA 1Z8AA 4IFKB 4RNHA 2X7VA 3C5QA 3T81A 3DERA 4Q8QA 4LAOA 4LC6A 3WG6A 3B4UA 1GHSA 4MZYA 2REQB 4LB4A 4YVVA 3T0BA 4CNTA 1IIHA 3WQEA 3C0QA 2INEA 3CHFA 4C6LA 2B7PA 5FCZA 2DIKA 1EOMA 3Q67A 2CZDA 6CGTA 2X1RA 1TJPA 1DJZA 3L4VA 1K4HA 2G3MA 3C3UA 4WOZA 3MV01 4CCDA 4HNVA 4K2SA 1WAUA 4D8LA 4S3FA 3WBXA 4CD5A 4X9YA 3CL6A 2WAGA 3E5BA 1LQ2A 3KRZA 2GZXA 3IK2A 3K1DA 4CQ8A 1GVSA 3PZGA 3CQ0A 4IOTA 2ZA2A 4J35A 4IPIA 1QO2A 1TG7A 4O28A 3DFQA 5GJPA 1QASA 5F4SA 3UR2A 2Z1VA 1QNSA 5CPSA 4GH3A 4LVFA 1VFTA 1H41A 3CV2A 2ZZ1A 4AWSA 1Q8JA 3VIKA 3D3AA 4XD6A 1FWNA 2Z1SA 3PWGA 3L4UA 3RCMA 1S5VA 4MB5A 3DKLA 4F0MA 3DIPA 3PULA 3ELFA 1V3LA 2BVTA 4GPNA 5HQLA 2A5HA 4MWAC 1LG2A 4GY1A 4NJHA 2W4XA 5CZSA 4TUFA 3V36A 1OY0A 3NDOA 3R12A 3BAIA 3C52A 3LYEA 5CSYA 1A5OC 5A95A 5BWAA 1UPPA 5BW6A 4HK6A 1VC4A 3IANA 4PMVA 1GOWA 1JNDA 2OEJA 2XN2A 2QPSA 3WQ8A 3IACA 5H8PA 2BS9A 4TXEA 4JIRA 3T2PA 1MMFA 4J2PA 5BOFA 4OBTA 3SCNA 1LORA 1RALA 2WNQA 1GVOA 1BFNA 4V1XA 1I2PA 4XX6A 3EA1A 3G6LA 1HKVA 1WZMA 2WM0A 4E4UA 4Z2KA 4O1BA 1THFD 2J62A 3A9IA 3GBDA 1DXFA 1MNZA 4WXYA 1M7JA 4QLJA 3WK0A 3IGXA 3ZJKA 3JUGA 1C91A 3SSZA 1ZGDA 4RZ5A 4AXNA 1KGWA 4NL1A 2BY3A 1LQAA 1QWGA 4JTCA 4E38A 1EXPA 2YA1A 2QDEA 2QDGA 2HE5A 2YCJA 2QPUA 1PKMA 1V4YA 3WMLA 1J10A 3IAPA 1BF6A 4DJFA 1VIWA 1HX0A 3L5AA 4D6DA 4O1AA 3OPSA 4LAMA 1HJQA 1RUSA 3HIJA 4X61A 1DOSA 4WKFA 3RDKA 5CZ0A 3E2QA 1G9HA 3W82A 4EAMA 3BJSA 4Z1BA 2VZVA 1LCOA 5HAOA 2HJPA 2VX7A 1NOFA 4E2DA 5FAJA 2HBVA 2I9UA 2PCQA 2WSRA 1JRCA 2A85A 2QQ6A 3OB8A 1DJYA 4AYSA 1QNOA 1OM0A 4H9UA 1OCNA 5GNZA 2QAFA 4U3CA 1KQYA 1JF5A 3VE9A 1G4PA 2Z25A 1SJDA 2ZUSA 4KRZA 4IGSA 4CEUC 2CLHA 4GY0A 1VFSA 3UZXA 3WH6A 4WR3A 4P8WA 1GVQA 5CQ1A 1I60A 1OD8A 3ATZA 3GXTA 2BY2A 3I3BA 5D2XA 4GQ0A 3PAOA 1CPUA 3NNTA 4O54A 2V5KA 1VBGA 1UBSA 1UWIA 1YNQA 3PSWA 3AZSA 4UTMA 1KRAC 3MHGA 3LCIA 1TSIA 3TA6A 2A7RA 3ANVA 1HNYA 4AVNA 2GVGA 3TCSA 2P3ZA 3H53A 4GK8A 4M1RA 5JIPA 3ENLA 3VFCA 3IAQA 1K02A 1V6WA 3OOQA 4EE9A 1E6PA 5H8MA 1QVBA 1P1MA 3QC3A 2BWGA 4DLMA 4ROPA 3N11A 3E74A 5I00A 1R9ZA 3T05A 3GR4A 4O0ZA 1TPEA 1P0EA 2OELA 3DKJA 1V51A 4EX4A 2NWRA 2JFEX 2B7OA 4A6GA 1XYFA 1FDZA 3DH7A 2V82A 1KXTA 3DOPA 3IGSA 3EEZA 4WJ8A 4CUCA 4RE3A 1FOBA 3FA5A 3QN3A 4H3DA 3RJYA 3TW7A 2R8WA 3GB6A 5D8ZA 5LXXA 1BTMA 4HVXA 3W86A 1GKPA 1JPKA 3PPGA 3B9AA 1KLZA 3GVGA 3KE0A 3HV9A 4NXSA 4KWUA 3PPHA 3UPWA 1CXIA 2O4MA 2QCNA 4HPHA 4S3KA 4A3HA 5A6LA 1XSJA 5FJJA 4U5KA 1HJSA 2HRWA 3Q45A 3GG7A 2NQJA 2E6FA 1QPQA 2VCBA 3QW4B 1QBAA 4C6FA 3W7RA 3M0KA 2ZZ6A 1IQ8A 1FY6A 1ICQA 4DAFA 1BWVA 3KEHA 4A8IA 3ZQ9A 2PRLA 4JOMA 3CUIA 5CLWA 4ZXOA 1T0OA 1BG9A 5AB3A 1TJ1A 3DAQA 1K6WA 3OGRA 4XQ6A 1QJWA 2JBMA 2DDXA 4UTLA 1X98A 3LM3A 3CMGA 3MDWA 1X8CA 2NXGA 2V67A 3GTFA 2FPYA 2FZ9A 3BLDA 4OTKA 4UR8A 1X38A 2PDXA 2WMIB 1EEPA 1TV5A 4ZQCA 1E5NA 2VFEA 3B8TA 1MXDA 1K9EA 4W7WA 3ZJ6A 3V4BA 4MPQA 3CO8A 2WO5A 3PANA 4D6GA 2VZSA 3ERPA 1UWRA 2PDGA 4XO7A 5HOSA 1ISZA 1B57A 2F2HA 1EX1A 3F03K 4EK7A 2DSWA 3BC9A 2ZUVA 1EUNA 3LPPA 3T08A 5HJLA 4LH8A 4HZ7A 1W37A 4NSBA 3ATYA 4D6JA 3ITYA 1SFSA 1FWIC 4UC5A 3THAA 3LXBA 1JUEA 1XSKA 1CENA 1Q6EA 1QHZA 1TR9A 2GWNA 2V3FA 2UZ9A 5AFDA 4FOKA 3UPMA 3ONBA 2XZ7A 2WZEA 1W9BM 3L0KA 1OIFA 4LB3A 1TX0A 1TPH1 1W9DM 5HK4A 4HP5A 1PSCA 4BQ2A 3KTSA 5KETA 6PTDA 4UWMA 1J01A 4AZHA 3CZLA 4EWJA 4PH6A 3PP7A 3MDUA 4WDTA 1MUMA 5FI8A 3W7LA 1W54A 1JZ4A 2WV8A 2PRMA 2ZA3A 3GRIA 1F8MA 1E1FA 1B3ZA 3L2IA 4OFCA 1CNVA 1HKMA 2OWCA 3BGJA 5T9CE 3TONA 2OCZA 2P0IA 3FDGA 3T09A 4MWAD 2D3NA 1W3TA 4DJFC 7REQB 1TV8A 4H6QA 1FWTA 2Z29A 4LUSB 3GG1A 2E3ZA 3ZJ8A 3BTNA 3M4HA 1L6YA 3W2JA 5LGZA 5CBIA 5HJXA 3G1AA 4TR9A 1UZ4A 2RDWA 5FJTA 1O7AA 5B7YA 2E5DA 4E2VA 2WSYA 4AY8A 5DT5A 1BQGA 2VGIA 4P7NA 2VMFA 3FSTA 2QGHA 4O8AA 3EXTA 1P7TB 3V0SA 2Y62A 1J8VA 1E3XA 4M56A 3N2MA 3LB0A 3H70A 1EUAA 3VTRA 3WUEA 1CXHA 1NSJA 2G5WA 3N6QA 2YPIA 3R1ZA 3RPDA 2WJDA 3ARQA 1JD7A 1UMYA 2VC6A 3R5EA 4PMUA 1OK4A 1H51A 3VOCA 3GSMA 4KMQA 3LPOA 2WNWA 4M5PA 1S5TA 3W2MA 3N18A 1RV8A 3VMNA 2AKMA 2RHGA 5T9BG 3KTCA 1XIBA 1QOPA 3R0UA 1QUMA 3MUCA 1TMHA 4B15A 3WK2A 4O1FA 3BAWA 1W3NA 3QFWA 3MC5A 1XH2A 3WD0A 2EJAA 5T91A 5AY7A 4GO9A 4BR1A 1EJXC 1UD3A 3BG5A 4G56A 2VQUA 2HPIA 4QM1A 2ZTKA 3R4IA 2QF8A 3UESA 2RKXA 2VDHA 3NUKA 1RA0A 4ATDA 1GCYA 1AD4A 2OSWA 3VX1A 1RP9A 4GZ7A 3UGVA 1X1NA 3CYJA 3QV9A 2YL8A 3XIMA 4PEEA 4ZE4A 1MDRA 1UYQA 2FMNA 4IHCA 2R1MA 3G2GA 3ZSTA 1EJUC 3HF3A 4PCPA 1FCQA 3CT2A 2NLYA 3ZVHB 3VM7A 1K77A 2PTWA 3WY1A 1BSLA 5CC7A 3WYZA 1QXLA 2YBVA 2C15A 1ZB5A 3W70A 2PWHA 3AROA 2C19A 5I3DA 1NM9A 4TMBA 1X96A 2C13A 3WLRA 3E5PA 1A5UA 1KKRA 1H63A 1TZ7A 3WQ6A 1JVNA 4RUBA 1ALDA 2VGGA 3JU2A 4HSOA 5CZTA 1KA9F 1N8WA 3FSUA 2X42A 4CQ9A 1AH3A 3UF9A 5KMYA 2BOGX 3WF3A 5E0CA 1Q4WA 1V0KA 4A3UA 2GK1A 5U7SA 2VVSA 3GH7A 3PN8A 3BJFA 4AHOA 4FP1A 3R10A 5FF7A 1G94A 5CKSA 2A6LA 3AHXA 3RU6A 3OIHA 1R30A 3QPZA 1MQPA 1CX9A 4ZQOA 4FNRA 2Q3RA 3SQMA 3WEMA 3OLGA 4H9TA 3W37A 4MZ1A 4LY8A 3IIVA 4W7UA 4IFKA 3LERA 4TTGA 5HNNA 2Y7DA 2WCSA 3B05A 3HQ1A 5GJNA 1H62A 1XRTA 1DXIA 4GISA 2X2GA 3MCOA 5GNXA 2REQA 2BGNE 1XD1A 1HKJA 4JFSA 3QV7A 4JDYA 1I0DA 4HOZA 3ZFHA 5KITA 4GYFA 5G4WA 3G24A 3V5FA 2OO6A 4LS0A 3GDMA 4JFTA 3RN6A 3LI1A 4GVHA 1UZ1A 1V5XA 3PM6A 4A4AA 4PBGA 5D38A 1TV7A 4IF2A 2X1TA 2CCRA 4GINA 3DESA 2P5NA 1TTIA 1D9EA 4D72A 3WD4A 3H6OA 3KBWA 4IJRA 2EBNA 3CAWA 3BMWA 1HVQA 3W0KA 3GWQA 3RPTA 5AC8A 3O15A 1PIGA 2WWCA 3UZYA 3ZMRA 3TLQA 1HL2A 1M6JA 4BJHA 1PTAA 5MKGB 2Y63A 1GONA 3QGAC 4XD5A 2BDQA 3N4FA 1OX4B 1SM9A 2FPTA 3L0NA 1JDEA 1UJQA 1Q6CA 2OX1A 3VVGA 3H2OA 2EGZA 5IBXC 4M0XA 1XJBA 4Z08A 2DZPA 2WLYA 3EPOA 4LNYA 4J3XA 1TPUA 3BLEA 2BX7A 1TWIA 3DC0A 4HKPA 1CGVA 4HBKA 4V27A 4NZJA 1JCTA 1NDVA 1V79A 3LCWA 1S5MA 4GBUA 4BQ3A 1FWGC 3QXBA 2W27A 1IZCA 3RLVA 3FHQA 3HGOA 1OEPA 1SSGA 1YKWA 1XG4A 1W3KA 4M6UA 4FSAA 1S38A 4FPSA 1GOOA 2QCHA 1K1DA 2IQ0A 4IH3A 3UWUA 3WO8A 4MFDA 4DWSC 4JYEA 2Y88A 5G1MA 4JICA 3DGRA 3EOEA 2AL2B 3LSCA 3MV11 3OZPA 3H22A 4I9JA 5AHFA 4JCLA 4MGGA 1UR0A 4LF2A 1ZSXA 1FWCC 3W2LA 4WSKA 4DF1A 2W0UA 4C1KA 4LQ1A 1GQJA 3S8HA 1W1PA 3AMGA 1XV8A 1IV8A 4FALA 3MVTA 4QXIA 3BURA 4X9SA 2GVLA 3MSRA 1RD6A 1A53A 3WDHA 4HMEA 4YU1A 4NZ5A 2PGFA 4PA8A 2CITA 3CASA 3H7UA 5F4WA 1X8FA 1P5BA 2AQVA 1TTQA 3BANA 3Q58A 4V28A 1WOBA 3LNMA 3R8HA 1DJGA 1F6KA 4HU4A 3OLEA 3HG5A 4IIHA 1D7FA 4PCSA 2BHUA 1CGXA 4DJFD 5E1QA 3ALFA 4O13A 3ZT6A 5HBFA 1GQLA 1VP5A 5I78A 1O94A 4CNOA 3VKAA 2QDDA 2YJQA 3MY9A 3NPXA 4QJ1A 2PE4A 3TFXA 4J4KA 1QW7A 3M9YA 2DUAA 3SJNA 5E93A 2FTPA 3CT7A 3KBMA 1XS2A 5JBFA 2RAGA 2WHKA 3T4CA 3VIIA 3TQPA 4UOQA 4M19A 4WOQA 4HPXA 2OPJA 2GQ9A 2WVSA 4JKLA 1LOSA 3OGVA 3KP0A 2DSVA 1R9XA 3OLIA 3NZPA 2WPBA 3IJIA 1ODUA 5ENLA 3G5EA 4NZ1A 5KZDA 4V2XA 3OQEA 3V0UA 3B9NA 2EG7A 4N02A 2YYTA 1R46A 3WNKA 3SQLA 3WEOA 3FY1A 4X0NA 1XUUA 1VBJA 3S0CA 3H7RA 4CN4A 3MUXA 3SCRA 1Q63A 2B7QA 4F0SA 2C79A 3L21A 3N9KA 4RJEA 1H5VA 3LOTA 5HNRA 4L6HA 1ITUA 1B3WA 1B3OA 3IVUA 2W91A 3DECA 3G1DA 3BQ5A 2PDCA 3I7RA 1ONRA 3V35A 4ZBCA 3EOUA 6XIMA 3RK8A 3IIPA 3W00A 3M41A 4PMNA 1ISWA 4HYWA 5I3KA 1MRAA 1PX3A 1ZS2A 1QTWA 4BWLA 4H41A 1AMKA 1BF2A 3VD9A 3D5HA 3VOHA 1QR7A 1VB9A 4QQ3A 3RX4A 3DYOA 1ME7A 4A35A 4LNCA 1VEOA 1M9HA 1NTHA 4QBXA 2GGGA 4QLKA 2NVDA 3H2EA 4JN8A 3W24A 4FNTA 3QOMA 4XIMA 2V6AA 3AUOA 4G8TA 3WK3A 3TE9A 3AWNA 4FF5A 1WO2A 3OG3A 3QGVA 1QBBA 4GZJA 4UTFA 3L2MA 5BXRA 4S38A 1JCNA 4MKSA 4TVCA 3VMOA 5L9FA 1SVDA 4J28A 5C9RA 4P2VA 3GY1A 1LF1A 5KZ6A 3P61A 3IJQA 3HU7A 4RPPA 1H0IA 4DO5A 3REQB 3F2BA 3E3HA 4GJJA 3H23A 3UA4A 3AIUA 1KB3A 3NQEA 4EACA 1UASA 4QAIA 3VCRA 1LWHA 5LIXX 1QPOA 5DY3A 5J5RA 3LCFA 2ZX8A 3UWQA 1KFEA 3EX4A 4M3PA 4EAYA 1NDWA 4H4IA 1FTXA 3C8NA 4HNOA 4EPBC 2E4TA 5M5DA 2CXGA 3SUUA 4HZ6A 3MA8A 4BI7A 1KCLA 2J7GA 2BOFX 4AEEA 2WMIA 5G2IA 3HM7A 1OVDA 2ZRUA 1W3JA 1XLBA 4UQBA 3B0PA 4UTTA 7XIMA 2OG9A 4JNMA 3DDMA 3IV8A 2WJEA 2VFIA 1YYAA 4IPJA 1E1CA 3MSDA 5A2CA 2RDTA 4Y9PA 3W1LA 3BCFA 3UG3A 4MNMA 4P8XA 3WUGA 3AS3A 4TVDA 3P80A 3IRDA 4LAUA 3OIXA 2F6UA 2VVNA 1FWHC 1Y5VA 4A22A 3IGUA 5L6UA 4XZLX 1G0CA 4J3WA 3TDFA 5I77A 2ZFAA 3V1PA 4OT7A 3PBMA 3DFOA 3T0CA 3F4CA 3UXDA 4YWSA 3OP2A 3LLFA 5EBUA 2OT0A 1HKKA 4YHEA 1W1B1 3KHJA 3W07A 2OWWA 3N19B 1S46A 1RLDA 2X40A 1A49A 4J27A 1QO5A 3WLOA 2J75A 3TYUA 5DELA 5C9UA 4NILA 3HV8A 4MB3A 1PWLA 5CC3A 2OVLA 3ITCA 1W91A 5U4NA 3UY7A 1QI4A 2I5GA 1BYBA 2J27A 3DI1A 5CSSA 4R7WA 1EF2A 2X8RA 4IIFA 2V0TA 1OGSA 3LCXA 2WANA 7REQA 1EGVA 3VPLA 2RH9A 4QR6A 3EWBX 4PTNA 3B8DA 3PTMA 5TD4A 5LNSA 3UEQA 2PGRA 4ZB0A 2DEPA 2WZMA 3E96A 3IARA 1GTEA 4IMGA 3RITA 1PE1A 1XIMA 3IJLA 1TV2A 1X6NA 2PDIA 3WZ0E 1BXCA 3QY7A 4IPNB 1E72M 1UR1A 1PTDA 2I1OA 2DV0A 1WOAA 1H0GA 3P67A 4O17A 1P7TA 4DPPA 3TW6A 3QR0A 2WBKA 4M6PA 4PTWA 4UMAA 4IIGA 1EZ2A 2X05A 3WMSA 1OCQA 4U5IA 3CZGA 3GZ3A 1X6UA 1XG3A 2XPKA 2CZ5A 1XD0A 2JALA 1XGEA 3W1PA 5LHFA 3PTKA 3TN6A 2D2GA 3QKEA 3EX2A 2Y1HA 2WW5A 3FEMA 1LBLA 3P81A 2X1SA 4X2PA 1P43A 1Q6QA 4C7GA 3A47A 1C7TA 4NI3A 4KEMA 4W5ZA 4GIAA 1Y65A 3M7WA 1ZP3A 4CQBA 3SCWA 2JF7A 4RDVA 2VFFA 2E28A 4NQ1A 4XZ9A 1A5AA 1GZ1A 4J3TA 3B8UA 4QFUA 3N04A 1Y5XA 1TUFA 1KXQA 1JRBA 3AIQA 1E4MM 3SBFA 4HN4A 3ARXA 1KFKA 5GNYA 1GQKA 4QISA 2OTDA 3STGA 3TK7A 1AVAA 1CLVA 2W5FA 3AMLA 4PUMA 4K1WA 1AH4A 3B3DA 3GC4A 3LHWA 2WMFA 3YPIA 1FWJC 2PEVA 8CGTA 1PCWA 1EJ7L 4DM1A 2GGJA 4FR6A 4PFHA 3ZVHA 1R3VA 2QDHA 3TN3A 4A2RA 3MI3A 3G1YA 4R7OA 3H8AA 2PTYA 2IXVA 3GG8A 3SJ3A 3PUOA 1BG4A 3IJDA 2XGIA 3VCNA 3ARRA 3GUGA 2HS6A 3VOIA 3V7PA 5E5CA 3LBOA 2DW6A 4AG0A 4JNYA 3LMYA 3VKJA 4M51A 3AYTA 1V7YA 3WJZA 3MP5A 1IE7C 4S39A 3VI2A 2BSLA 4W93A 2FHFA 4I5XA 2TAAA 1VH7A 1B4EA 3A4AA 5C9XA 1JI1A 4WHBA 3F2DA 2BNJA 2Z1XA 2GDQA 2WCGA 4YPJA 3VINA 1EKOA 2FJUB 2GJPA 3P7YA 2D0HA 5HWNA 5A2BA 4BY3A 2H9AB 2YL5A 4Q8UA 2CBUA 3C0SA 4K36A 1BQCA 1XKJA 4TO8A 1Z48A 2IKHA 4W88A 3U6WA 2CYGA 2E9MA 3BZJA 3EWWA 3NL2A 2GOUA 4LV4A 1AQMA 2VGBA 3RU8X 3E0FA 5CLTA 4G5DA 3NJ3A 2GJRA 2FHBA 1CEOA 3B9OA 4MNLA 3MB9A 4JX6A 3WL1A 5I3GA 1FCBA 3N3TA 1LROA 3N2BA 1QPKA 2HNEA 4J9JA 5KEZA 1TIWA 4Y9OA 4NG3A 4KPLA 2FIQA 3TQ0A 7CGTA 1QDSA 3WDIA 4C65A 3SCOA 4J7RA 3A3WA 8RUCA 3K1GA 1V6YA 5LNWA 2Y7EA 2P10A 3SGGA 1FKWA 1I2OA 4HMCA 2IMRA 1KGUA 1NOWA 3VYLA 1QI3A 4EXAA 3W76A 1Z42A 1BPLB 4G7EB 2DSUA 1MZRA 3WKZA 1U30A 4KCUA 3TSDA 5C6MA 1MW2A 3H4GA 3SM0A 4A3YA 2V3DA 1JXKA 2YCIX 4IX0A 4JTQA 4UB9A 7TIMA 4NNBA 2QCDB 1CI1A 1J93A 3AI0A 4AMAA 5BYWA 2E67A 3PR2A 3EXSA 1XRFA 5BU6A 3AMCA 4AH7A 3FNDA 1EHNA 1WBHA 3MJYA 2HDJA 4L4OA 5MKGA 4I5RA 1U83A 2SFPA 1OX4A 2PD5A 2QVNA 3QSTA 3VDCA 2DT3A 2ZZ4A 5JXQA 5JUVA 1Z89A 4FK9A 4OOZA 4XZIA 5M17A 1EYWA 4C5ZA 2OYLA 3QLLA 2UV8G 3QRHA 4HTYA 4HA0A 1KCZA 3S1GA 1CXFA 4MLJA 4L4PA 1E6QM 1YQ2A 2WVUA 2DGAA 3W4RA 4IQEA 3LBMA 2G8ZA 4K1GA 4WXZA 1OINA 4DIAA 2ZXQA 3W53A 1C3FA 3N17A 3E0VA 1JYNA 4C6BA 3CNYA 1SO6A 4PEKA 3W1AA 3EMQA 4DXXA 1TB3A 2WHMA 5AYYA 1EWDA 1TR1A 5G2WA 4AC7C 4JEJA 2VCAA 2VEMA 4XZWA 4QSFA 2AL2A 4U28A 1PVNA 2HEJA 4NI8A 5HATA 1XQKA 1Q7ZA 1KXHA 2VC7A 1Y5WA 4S3JA 1M7PA 1OYCA 5DBTA 5HANA 3GXPA 3OA5A 3QR1A 4ZOCA 3OG2A 2A3LA 1Z7AA 5FEPA 2HNHA 4KESA 4O16A 3KOYA 4JIHA 3P8IA 3AJ7A 5IRPA 3GR8A 2C3ZA 3R8RA 1HP5A 2IW0A 1TJ2A 1P48A 1YLVA 3APYA 3SN1A 5C8BB 3C2RA 1J0ZA 2V38A 2WXDM 3A4XA 4Q8PA 2YFNA 1C29A 4S3CA 4QS5A 3NSXA 5JH2A 4UNLA 3CK5A 3GHTA 1DPMA 1G4EA 2DSKA 3VNLA 4XSMA 2PDNA 2W67A 3MU7A 3NPVA 1RY8A 1XF0A 4L56A 5F2GA 1Z3NA 5D9MA 2CERA 1IYXA 3TYAA 4C1NB 1X97A 2Z1WA 5I79A 4IL2A 3VUSA 2OLSA 3WFZA 4Q33A 2F61A 3TFCA 1K9FA 1TMLA 2MUCA 2YCEA 4NAEB 1BWKA 2DZXA 3CL8A 2XN1A 1VCGA 3DG7A 5BRPA 4M82A 4CVUA 3H7VA 4UZSA 1XXXA 3I4EA 4JS3A 4IGNA 3ZM8A 4XD4A 1UJPA 3ZLGA 3UCDA 1JIBA 3WLLA 5JH1A 5CAKA 2VEIA 5DXYA 5AVNA 1UD5A 3GH4A 5A3HA 2F6KA 3FJLA 2GSJA 3FVDA 2WNNA 4W85A 3GO2A 1V3KA 5K9DA 4MYXA 1J11A 3UXKA 2KZHA 4OBRA 3SUWA 5FJOA 4IQLA 4JX5A 1GJPA 4W84A 3SY1A 4E8CA 2D2OA 4UTIA 2PRHA 3O63A 3PZNA 1AH0A 1FH9A 2IPGA 1CBGA 3UPBA 3VD4A 4BF5A 4C6JA 2JEQA 2Q02A 4HCHA 4I7VA 3BVJA 1J4EA 5DCEA 3RX3A 3WDRA 9CGTA 4L6OA 2XSBA 4K39A 1ADOA 3MI2A 4M80A 3FJ4A 3ICJA 1UIOA 3AISA 3NGFA 1NQ6A 4RL3A 3I6RA 4AX7A 2GWGA 3TP4A 3PZUA 4MM1A 3WFLA 3N6JA 4G1KA 4FI4A 4NX5A 1VIZA 2CZFA 3MMTA 3S4TA 3S1UA 3BCJA 3S5OA 4HCDA 1XIJA 1IWBA 2VWTA 5EKYA 3U57A 3EDKA 1V7AA 4EPEC 2I9EA 1LQ0A 1MZHA 3VIGA 3RR1A 5ABGA 4EIVA 4LUTB 4IT1A 3PZVA 2HPMA 2C18A 2A1YA 3G1XA 3HO8A 3ABRA 1DORA 1EQCA 3CQIA 3LHZA 1W2PA 3CO4A 3S83A 2ATSA 4C6MA 2QT3A 2BVYA 2B31A 2XIBA 4WRHA 1GKQA 2OSYA 1BYAA 3VNKA 5E0KA 4RDZA 3STPA 1HO1A 4Y2WA 4GQQA 1DTUA 4AZ5A 2PLKA 3NEHA 3SECA 2P3EA 3WD2A 1UOZA 3UXAA 1WDDA 1QW8A 4ENLA 3N29A 2C0HA 2BODX 3W1QA 1ONEA 3O7UA 4ONVA 1IIGA 3FHAA 3REQA 4GOAA 1RBAA 1JZ7A 1MFVA 3TJIA 3WQGA 2HMCA 2POZA 1Q8AA 2XWDA 1BWLA 4FR1A 2BY1A 2WOQA 1OQFA 2DUZA 1HGWA 3AOFA 4LJ3A 3RLHA 5I23A 2GJLA 4Q8TA 4NF7A 3VZYA 7PTDA 1W5NA 4NJKA 4Y9AA 3VGBA 2R1LA 1E15A 3NQ8A 2ZADA 2IPJA 1RH9A 4MJ2A 3O16A 4X60A 3BH4A 2QF7A 3I3EA 4RV3A 1P0DA 5I09A 4A3RA 2PD9A 3W3OA 4PSPA 2VUNA 4W4QA 3VGGA 4FAMA 3TN4A 4W89A 3E2VA 4O15A 3TR9A 4PMQA 2C16A 3AS2A 3GXIA 3DEQA 3MBDA 3OZOA 1DWJM 3TYZA 3NYDA 3GQYA 2OMAA 2ABBA 1MUWA 3TAOA 3AAMA 4LCSA 1O1ZA 4ALDA 4CQCA 3LXAA 4EF9A 3S1WA 3C0JA 4Q7BA 3DN5A 1M53A 1KV8A 4JTRA 3EA3A 4WQ6A 4XAPA 4U2YA 4GXPA 2HCVA 1RVKA 1EP3A 1Q5MA 1P0BA 4ZVJA 4N7QA 2Z6IA 4UTWC 2VXNA 3U48A 5D04C 5HINA 3C56A 3MKVA 1F4AA 2EJ1A 2Y7GA 4F2TA 5CEWA 1YHTA 3H4XA 2O56A 3MUIA 4UXDA 3ARUA 5FJRA 1ADDA 3CHEA 4DRSA 4R27A 4D6IA 4P61A 5A6BA 4A8RA 2R9RA 4FXJA 4MSSA 4D1JA 4AVOA 1MSSA 3KBJA 3ME3A 3RXZA 1CXEA 2CU0A 3NQVA 2R1NA 1A3WA 4DB7A 3CM4A 4YTUA 1XL9A 3B8SA 2GOKA 1PDYA 1KM3A 3BAJA 1A50A 2ZTJA 4OV9A 2V3GA 1EQPA 4JY8A 1XLGA 1HJWA 4PC8A 3OO2A 3FJNA 4AQLA 2FH8A 1Q6DA 3VKCA 1RCQA 2ZDSA 1KWKA 1ESWA 3AXMA 3OYXA 3S47A 3D47A 3C6CA 5K9XA 3GYCA 4DJDA 2D3LA 4JD4A 3UWYA 3G1VA 3CHCA 6REQA 2PFHA 3GX9A 4JFVA 3GHRA 3KRUA 4UFKA 1OB0A 2NV1A 4HNUA 3POCA 3MKKA 1Q6FA 1OIMA 1EZWA 3KM8A 4JN7A 3R89A 5CSRA 3UZZA 1XICA 1CYGA 4AWUA 3PBUA 5EU9A 4LXFA 3TMLA 5REQB 3TSBA 3THQA 4GFSA 2XFWA 1QI2A 3R25A 2XH4A 3RPMA 2XSXA 2WWDA 4AF0B 1KD0A 3G3DA 1OJXA 5A94A 2FB3A 3W23A 3AJXA 1XIHA 1Q7QA 2P76A 2PDKA 2Q8LA 3FV9A 4ZE5A 5AYXA 1JPDX 2XINA 4PCNA 5DBUA 3AU2A 4JZ5A 2ACQA 1RXOB 1DWHM 3PJUA 4LBUA 3UR7A 1A3XA 2I5IA 1SFLA 1C8QA 3E1F1 4JNZA 2RJGA 4GYPA 1UP2A 4L4MA 3NZGA 5AHEA 4UFLA 2C14A 3ZR5A 4DI9A 5F4XA 1QK0A 2OR2A 4S3AA 1KBLA 1GGOA 2POTA 3VIFA 1GG0A 1CTNA 2C8NA 2VWSA 3SEPA 2FTWA 3WDPP 1DJXA 2E7FA 1EC8A 4HQVA 1BEUA 4I5UA 3I7QA 1C90A 3TWBA 1RZMA 5I03A 2GPTA 1UD6A 4JTGA 2VEPA 1WQ5A 3WH7A 4PGLA 2WC4A 4IGMA 3FYOA 3N73A 2XFFA 3H4WA 4GIRA 4MVAA 4LYRA 3TUUA 3AS0A 2H9AA 1W17A 3NO3A 4MOZA 3VUPA 3S6DA 4US6A 4O0QA 2YLAA 4Y90A 1VENA 1J18A 2Q09A 4F66A 4JIQA 4TVUA 5DXXA 2GVEA 1JF6A 4JEQA 3S9ZA 4PMXA 4QP0A 3ARWA 3W88A 4H7VA 8XIAA 4DNMA 2PTXA 2DVTA 3HURA 1A47A 2EHHA 3HBLA 2QCFA 4GX9A 1ENUA 1BVNP 4HPNA 4L4LA 1WXZA 3VDAA 1GK8A 3KOWA 2GDVA 4JQAA 1KM0A 4BQ5A 1L6GA 3E6EA 3UZ5A 5KTLA 1L6SA 3A12A 3UJ2A 3EKGA 1MNSA 2XM1A 3GNNA 3TWAA 3V0TA 1SQ7A 2J7DA 5D9OA 5CPQA 3EDEA 3DFHA 3WUBA 1H7PA 2O55A 3LCLA 2VHLA 4GWEA 4J3SA 3PS7A 4IMCA 1DJHA 4G7EA 3GAYA 3BLKA 3Q2DA 3W6LA 3PVFA 4E5TA 1NARA 1QOQA 2AMGA 2QIWA 3NQCA 3RHGA 4JTIA 4YCPA 2Y61A 4AD0A 5AOUA 3L4WA 2QCDA 1VS1A 1HL9A 1VYRA 1Q4NX 1XBXA 3ZLHA 4HA4A 1GOXA 2DIEA 3TSMA 1ZZMA 2NXHA 3UYCA 1TX2A 4EPKA 1K8YA 5TNVA 3B0UX 3LG3A 4AY7A 1KFBA 5LGXA 3KCJA 1H09A 4AZ6A 1F3WA 1ECQA 3BW3A 4IUOA 5DRCA 1QW9A 4XZNX 3TQKA 3OEXA 2DZBA 4DAIA 3URQA 1KR1A 2Z27A 1AQFA 3DU0A 3QZEA 2QR6A 1W5QA 1O66A 2Q8ZA 2Y6ZA 2OB3A 4Q6XA 4WEVX 4MFEA 3KVKA 5HMEA 4AMCA 3EB2A 5FF2A 3G6MA 1WNOA 1Q2RA 4M1BA 4CNPA 4AZCB 4G6CA 1Z69A 2FZDA 3G3MA 3EOOA 1QNVA 1CZ1A 3H2NA 4FXSA 1YIXA 2BMBA 3VIPA 1R87A 1KO0A 1EDQA 4TV5A 4I8DA 4YYCA 3SN4A 3CB8A 3VA8A 2GGHA 4V1YA 4AEOA 1R2RA 1V8EA 4MY1A 3MO7A 3BWWA 4B9YA 1YPFA 1HO4A 4EPDC 4FHAA 1GG1A 3M0JA 2P1FA 1A0CA 3U4FA 1PL9A 3VU2A 2J6XA 1HKWA 5A6JA 2Y8KA 3BV7A 3LA4A 3W7PA 4GGHA 3O3RA 4H7ZA 2DFAA 2D2JA 2R1KA 1M5WA 4HNCA 2PF8A 2KX9A 2WB5A 3IWPA 3ES8A 4TX9A 2Y5JA 4QE5A 4PUNA 1XYMA 4YJ5A 4XTIA 3R58A 3NSNA 3T0AA 4F0LA 1FUYA 1MWOA 4Z1CA 1QU4A 1JQXA 1XFCA 1XH1A 1JI2A 4CCZA 4LW7A 4NAEA 5CG0A 5D33A 1S2AA 4AIOA 2W9MA 4WK9A 4B5NA 1GORA 4PULA 4NAFB 2DVXA 1OADA 3C2EA 2ZRXA 1VYPX 3FK4A 1WCGA 4ZSTA 4MAZA 2PTDA 4C1LA 1KM5A 3QKZA 3XINA 4GYPC 1R85A 3HA1A 5FKYA 1VBUA 3EOLA 4BI5A 3CLMA 4D1IA 2GLKA 3W83A 2NSOA 3K4WA 4JFUA 4A2SA 2WQDA 2OEMA 5I3JA 3L68A 3GNPA 3JR2A 3N3MA 3A21A 4KEZA 2D69A 2QCGA 1UWQA 1EPVA 2CLMA 3T55A 3UNTA 1EDGA 5RUBA 4XZHA 3NQ2A 1S2WA 4FLOA 5BXTA 5C5YA 3DENA 4LANA 3TKFA 5DMYA 1NVMA 5FESA 1FFQA 4N9EA 4FNSA 2BHZA 5EB8A 3NQGA 2ZE3A 1N55A 2Y8UA 5EMYA 3U8GA 5PTDA 3EWCA 5EMUA 4QE4A 3N13A 3LK6A 4LYPA 4S2CA 4Q4PA 2TMDA 2IPWA 2V68A 4S1FA 5K4XA 2UY4A 2H3BA 3WNLA 3RM8A 5BZAA 1E0UA 1V02A 3L65A 1QI0A 2O92A 5F2LA 4NZCA 2VO5A 3W7OA 4B91A 1AODA 4GLEA 3AZTA 4Z2IA 1W9PA 4LUTA 1HP4A 2ADAA 2IUZA 3CUGA 2XWEA 4ZGYA 4HHMA 4KEVA 3FFSA 4GVFA 4YN5A 4KWSA 2AAAA 2YW4A 2NSXA 1V08A 3LSBA 2CIPA 2A3AA 1YRRA 1EJVC 3BARA 2NW0A 2YL6A 1KCKA 1B0IA 4NZ3A 3RLUA 1WZLA 2YZ5A 2XVLA 3EGJA 3WENA 3ITLA 1FWRA 5EPDA 2XGZA 3G77A 3H2CA 4AIEA 4GYKA 3ZR4A 4J3VA 1Q85A 3QHNA 4HA3A 1YXYA 3GFYA 4GZEA 1FWSA 3ONCA 3GFXA 5AZ0A 4AD5A 1GUVA 4DWSB 1XYCA 4XZMX 4IGHA 5G5IA 2Z7GA 2DH2A 4C6QA 3SFKA 2J25A 2AL1A 3M0XA 3VE7A 4DNHA 3S2LA 5DN1A 1VYSX 3N6HA 1H1ZA 3RM4A 2G41A 3L5LA 3EYPA 4H6RA 4FO4A 2WZHA 2QJJA 4O57A 3IVSA 4HU3A 2RFGA 1OZMA 1G7UA 1DVJA 3VNZA 2ZUUA 1US3A 2CLIA 1OG0A 5A6AA 4Y96A 1KV5A 3RYSA 3F5JA 3HTWA 3VDHA 3W7CA 4LUJA 3C0LA 3GK0A 1R3WA 1H7NA 1X7IA 2CLFA 2ZVIA 2JGYA 3EXRA 1LT7A 4WGXA 4IWWA 2RDXA 9XIAA 2JQXA 1R7OA 3ABSA 4H8VA 1TVLA 3KL0A 1XDMA 1LLZA 3QV6A 2J7CA 1P6CA 4GGBA 3SSJA 4IISA 2WVVB 3B40A 1ZAHA 4N9BA 3WBYA 3MPGA 2RDUA 4LGXA 4Z0SA 3DG6A 3BG9A 4LEQA 1V6UA 3TX9A 4OZOA 3KBSA 1OFBA 3CQJA 4NZ4A 4HOWA 5HWMA 3VNJA 1GQNA 2JKAA 4G7FA 2B7NA 5LA0A 1Y0EA 2F8QA 2GJNA 4Y9NA 1VFUA 4D6CA 1NELA 5A6BD 3TOYA 4M29A 3PZIA 3BLOA 4PBEA 3JRKA 4C6DA 1QK2A 4WY0F 3M0LA 3FW6A 4B16A 5E9XA 1X6LA 5E0FA 5HR6A 1BKSA 3UJRA 4AVFA 2J7EA 3LUTA 3PWIA 4INFA 1OCJA 2VX5A 1XLCA 1GOKA 3S5NA 4GX8A 4UQCA 1WXYA 3AC0A 3AS1A 4ERGA 4CNUA 3CQHA 4FNUA 1UD4A 1UG6A 1POJA 3WLJA 4MF4A 3ABXA 3USZA 5EFDA 4JKKA 3KL5A 4DJDD 1JZ5A 4NX0A 2DW7A 5BMXA 1R6WA 1UPMB 1JGIA 4UFMA 2VX4A 4D6FA 4ICCX 1EHAA 3K8KA 4TQTA 5REQA 1WB0A 2VDGA 2PP0A 4HMDA 3KUMA 1XBVA 3CMFA 3V5OA 2DT1A 2JK2A 1LOQA 2CETA 2G3FA 4AF0A 2FVLA 4AEFA 3WD1A 2XJ7A 1TWZA 3WJYA 1LBMA 4PTMA 1YBQB 3GS6A 3M0IA 4GI9A 3CPRA 4P7RA 3BAYA 4J1OA 1QMLA 1NFBA 5FEZA 2VTFA 3R0KA 3UNDA 3E02A 3VMPA 1S2UA 4QEHA 1EFZA 1F05A 3O0FA 3U4AA 4YTSA 4DF2A 2Q3OA 4F4RA