3U5YA

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
501
structure length
470
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Raucaffricine-O-beta-D-glucosidase
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
total genus 174
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u5yA00
3MV01 1WZMA 2YA2A 4QLKA 4D1IA 1C90A 2D0GA 1GJUA 1JD7A 1OGSA 4HU0A 3DHUA 4PCTA 4A3YA 4ATDA 2DH3A 2ZWYA 3KL5A 4W8LA 2G3JA 4PN2A 1KWKA 1ZJBA 1C93A 4F79A 4Z2HA 4UQAA 1W9PA 3AI0A 4CCDA 5C71A 3K4AA 3SCUA 4HA1A 5DF0A 4J3SA 3T0AA 3AS1A 4RE3A 3VIMA 4UOJA 2UWFA 2ZUNA 1CGTA 3W29A 1MW3A 4GKLA 1HJWA 3GH7A 4S3JA 2WCAA 3W28A 1FFRA 2G41A 1ISXA 3VTRA 3SCWA 3MUIA 3SCOA 2WVVA 1C91A 2DIEA 1JFXA 3UG4A 3WIJA 3AHVA 3VOCA 1BYAA 1UOKA 3VX0A 1HKIA 1JZ7A 3AQUA 1H3GA 1O7AA 2WWCA 1E0VA 2VQUA 1QHPA 3VMPA 4LX4A 4P7RA 2CETA 1HNYA 5CGTA 2YLLA 1HL9A 2AAAA 2YLAA 3BAWA 4QDMA 3WDHA 4PTXA 2CBIA 3S6TA 5C70A 5CJ5A 1OB0A 3QR3A 2V38A 1JGIA 1JDAA 1BGAA 3UR7A 3GNPA 3HMCA 3F4VA 9CGTA 2E8ZA 3VUPA 3ZSTA 3CZEA 1EO5A 1UH3A 3POHA 3A4XA 4AD4A 1MWOA 3RPMA 1UWQA 1QNPA 5LYRA 1HP5A 5GQBA 1XH0A 4PUDA 4U2ZA 1V3JA 3GXMA 1DWFM 4UZUA 2BY0A 2QPUA 1SFSA 1CXHA 1U33A 5E70A 1TG7A 3ARSA 3VDCA 2O9RA 3WFLA 3BLPX 4UOZA 3EDFA 3A4AA 3EDJA 3GH4A 1CWYA 4FLSA 3ZT6A 4J7RA 2GDUA 3ARQA 1CXIA 1UUQA 4D6EA 1VFMA 3WF2A 3W37A 1J11A 5HDRA 3CZ8A 1QHOA 1X1NA 2XVGA 1K6AA 1P6WA 1E71M 4JKKA 3PZIA 1C7TA 3ZR6A 2WXDM 3NYDA 1W32A 2QMJA 2ZX6A 3A6OA 1BVZA 3UERA 1E3ZA 1UR8A 3SUWA 4LPCA 4PTVA 1E1EA 2F2HA 3L4XA 2G3NA 1HJSA 4MDPA 3ALFA 2A3BA 1FHLA 3G6LA 2W67A 1LF1A 1B2YA 1GPFA 3THCA 2Y8VA 2ZX8A 2ZWZA 1KR0A 1UG6A 2W62A 5JBDA 2XTKA 4W93A 4QCEA 2YL6A 1CGVA 2JF6A 3EDEA 4JFVA 3LPPA 1BGGA 3BAJA 1E6XM 3M7SA 4J3XA 3K8LA 8A3HA 4HMEA 1I75A 1BG9A 1EXPA 1RPKA 1V3KA 2WC3A 5EMYA 2FGLA 2ZXBA 3NDYA 1CNVA 2Y24A 4JFTA 2GK1A 4OBSA 1V0KA 3D5HA 3II1A 4J27A 5CPTA 1UQZA 3W25A 1O6IA 3BH4A 1SMAA 3ZOAA 4IPLA 2EBNA 3WDPP 1AQ0A 2WWDA 4QP0A 2D22A 3OZOA 2PWHA 1V6YA 3NDZA 4HMDA 2C0HA 5A6LA 4PCSA 4AIUA 4CKQA 5FL1A 3OLEA 4FMVA 3TTOA 2WMFA 1K9FA 4HP5A 2ESCA 3ARUA 5D8ZA 4CVWA 2V3EA 1H1NA 3AIEA 4AZCB 2F8QA 1XH1A 1EQCA 4W7WA 4BS0A 1OBAA 3CHCA 3KZSA 2BVYA 2XWDA 1GOOA 3MMUA 1QI5A 1QI2A 4F66A 1UKQA 1RP9A 2CCRA 5HPOA 4E2OA 4LXFA 3BC9A 2Q8XA 5I79A 2EXOA 3W0KA 3CMJA 2ZXQA 5JBEA 5LA2A 1R86A 1EIBA 3M6DA 3A4WA 4AZIA 3RO8A 5CLWA 1PX4A 2XIIA 4UQCA 1EDTA 2EO7A 2XM1A 3WDQA 3O9NA 1DWHM 2XSAA 3B9DA 4AY1A 2XGBA 3APGA 3ZJ7A 3WH6A 3PZOA 1ZL1A 1GVYA 3NCOA 3W4RA 3DYPA 4HPGA 1BYCA 1UWRA 4TTUA 3ALGA 1GQKA 1V3IA 4JIEA 3CTTA 2DT0A 3MUY1 1Z32X 2QHAA 4D6JA 4ZEPA 2WMIA 3SCTA 4AZ5A 4KRTA 2CITA 1WDSA 2GJRA 1OIFA 3BAYA 3KL0A 2D0HA 3AROA 3TTSA 1WP6A 5EFDA 1YHTA 3N9KA 5D8WA 4LQ1A 1JI2A 3B9AA 4AD3A 2GVYA 3LPFA 3T2OA 3TA9A 4PMDA 4J3TA 3WF4A 3UEQA 1JZ3A 2X1IA 2BHYA 4AZ6A 2VR5A 2ZE0A 3FAWA 1BAGA 1LG1A 2BVDA 2XGIA 1EO7A 2EPKX 2YDQA 3WNMA 1TA3A 1TFVA 5BXTA 3EMZA 3RIKA 4ZE5A 3SEPA 4WKAA 2J8FA 1UA3A 4X9YA 1GOWA 1GOIA 4K68A 3WL1A 4WIWA 3WNOA 2YKKA 1BSIA 4GI8A 4X0VA 1CBGA 1GQIA 2JFEX 2WC7A 1ITXA 1GQLA 4QLLA 1A47A 1QI3A 4ZXOA 5CXPA 1ESWA 3IJ7A 4PSPA 3CPUA 6CGTA 5E6YA 4NZCA 1U30A 3U57A 3L4WA 4N42A 1J10A 4OOUA 2V5CA 4W86A 1VFUA 5DFAA 3M46A 4QLJA 1V3LA 3ZT5A 1BF2A 4H8UA 2JIWA 3ZSSA 2VZSA 1LL7A 1R7AA 3PZ9A 4AC1X 1X6LA 4CVUA 4PMQA 1FA2A 2J7EA 4D6DA 4MADA 2D0FA 3W26A 2EQDA 5I2UA 4M56A 3TTYA 1MFVA 5DO8A 1EH9A 4U5IA 2YBUA 5M03A 4UR9A 1V08A 4L4PA 4OJYA 3VMNA 2YDRA 3BCFA 1VEMA 3GH5A 2WZEA 1QNSA 3W53A 4MJ2A 2J8GA 1KXVA 1IV8A 2A3AA 2DSUA 4CN1A 5GNXA 4Z2LA 2WYSA 3SURA 2JEPA 1W9VA 3CUHA 2X05A 3EYPA 1QI4A 2WCSA 1OGBA 1LLOA 5BXPA 2FHCA 3EBVA 2VZOA 2G3MA 5HBFA 1EDQA 2DSWA 3SUUA 2XVNA 1CDGA 3CIVA 2GJXB 1V3MA 4GQRA 4FLOA 1JYXA 1V6WA 3WNPA 3W81A 2VNCA 3WUEA 4A3HA 1OT2A 2DGAA 6A3HA 5A6JA 4Y7EA 1LJYA 4RL3A 1HVQA 4OIFA 2BNJA 3E1F1 4UFHA 1TVNA 4PMNA 5GNZA 5FCZA 3L4UA 3GTNA 4HU8A 1MQQA 2VT0A 3KWXA 3K8MA 3VGEA 2VVNA 1UD8A 3CMGA 5A2AA 1ZJAA 4PMZA 1Q6CA 4AZBA 4M82A 4U5KA 7A3HA 1E72M 2G3IA 2D3LA 3AYSA 3VD4A 3AMGA 1GHRA 2VZTA 4E8DA 4NI3A 2VC9A 1VB9A 4MB4A 5DEZA 2B31A 3WUFA 1ZBKA 1OCQA 4ML4A 1J0KA 3ARXA 4BQ5A 3M07A 1E4NA 1JD9A 5D9PA 2W63A 1V02A 4V27A 4ACZB 6TAAA 1B1YA 5CPSA 3LMYA 1XSKA 1PBGA 1JYWA 3NSNA 1K9EA 2VJXA 1LQ0A 4KH2A 2BHUA 2EPOA 4W87A 3AIQA 3OGRA 3SCPA 4IISA 2DDXA 4PMOA 1E4IA 5AC5A 2GSJA 1TCMA 3CO4A 1V0LA 1KQYA 4JCLA 3W27A 3VD3A 3VNZA 1V6UA 5C8BB 2XFYA 2VO5A 4TVDA 5ABFA 1XSIA 3U5YA 2JF7A 1G1YA 3UG3A 1VAHA 4HPHA 4R27A 3WENA 2IXUA 5ABGA 3WD1A 1V3HA 3QOKA 5HOSA 1VENA 4E4PA 3W24A 5AYBA 2V3GA 1LG2A 1H09A 1ISWA 4U33A 1DWIM 4BCEA 1UH2A 1V02E 1WDRA 2X0HA 2DH2A 1C8XA 4DM1A 3RJXA 2XVLA 4UFJA 2PF0A 2ZUSA 2WZIA 3IJ8A 1H11A 3I3DA 1OM0A 2EPLX 2W61A 3SCRA 3AISA 4JL2A 2FH8A 3OA5A 1IZKA 4CD4A 3THDA 5A8MA 1HJUA 4AISA 3AIUA 1KGUA 3MANA 3WD0A 3GZAA 1R7OA 2WVVB 3RCNA 2Y5EA 1W9UA 3F5LA 4AEFA 4HOXA 1EHAA 1WNOA 2PB1A 1CENA 4IM4A 2VX4A 1QOXA 1JNEA 3CUIA 3NUKA 5BRPA 1OD8A 4HOZA 2WHJA 1FH7A 3N15A 3VIHA 3VDAA 3BSHA 1J0IA 4AEEA 1GHSA 3D3AA 5ABHA 1H49A 4NF7A 3NSMA 5D9MA 3RJYA 1H5VA 1PPIA 1H0IA 1WDPA 1WZAA 1E3XA 2UY2A 2E9MA 4AW7A 4YHEA 3VIIA 2FDMA 4AZHA 2YL5A 4OOZA 4ZENA 4CD8A 2DQXA 3VD9A 3SCNA 4D6GA 2UY4A 3CBWA 1J0ZA 2A3CA 3WQWA 4AZGA 1KGWA 1E15A 2CNCA 2DSKA 3VIOA 1OGGA 1GUVA 3AIBA 1H41A 4W7VA 2YL9A 4PUEA 1E6SM 1JDDA 2D3NA 3CHDA 2VL4A 1B90A 1NOUA 2ZUWA 3WD3A 1U2YA 3WDRA 2WHMA 1US3A 1QBAA 2XVPA 1XYZA 3T2QA 1NWRA 3CZLA 2NW0A 1RP8A 4MJ4A 1WPCA 5A69A 3SIMA 1JNDA 4HZ6A 4URIA 3VM5A 2CBJA 3EDDA 5DT7A 2PWGA 2X8RA 4JKMA 1HN1A 1D2KA 5I78A 1V6VA 1JZ2A 4BQ2A 1J0JA 3FY1A 1UD4A 1JAEA 1GW1A 2JALA 3PBGA 3A3HA 3WBAA 1CZ1A 1E70M 5IHSA 4PMUA 1JZ5A 4MTVA 4PRWA 5I3DA 5A8NA 4HA4A 2PC8A 3WH9A 5HNNA 1JZ4A 3MS8A 1HP4A 3T2PA 1KXTA 3QGVA 1CGUA 2WK2A 3N1AA 1AVAA 4B15A 3ZQ9A 1NM9A 3FAXA 1M01A 4BF7A 4BZYA 1E6ZA 3CUJA 1PIGA 3J7HA 4TOQA 2GUYA 3AXXA 3LPGA 4Q22A 2WMKA 4D6IA 4F9JA 2J4GA 2RGLA 4GQQA 4J3UA 1XYFA 1A3HA 4FLRA 8CGTA 4CD6A 1JI1A 2PWDA 3OLIA 2ZX7A 3AZSA 1WB0A 4UQDA 2RGMA 4DUXA 3GM8A 2WLZA 5FL0A 2Y8KA 3EDKA 5EBAA 3VDHA 1V0NA 4L4OA 2VCAA 2WMJA 2J7HA 2NSXA 4GPNA 4JKLA 4M81A 3OGVA 2BXYA 2YBTA 5TD4A 3WQ6A 3AIVA 4MAZA 4H8HA 3OG2A 1TR1A 1VF8A 1M04A 3OGSA 3OLGA 1J0HA 1US2A 3KE0A 4PMYA 2O92A 3KEHA 1ODUA 3WL0A 3SCQA 4D6CA 1CGYA 5BWFA 3BMVA 2O9PA 2XPKA 3ZT7A 1B3VA 1K9TA 3BCDA 3QHNA 3GNRA 1J01A 5FOOA 2J7CA 4UFMA 1Q6EA 4BQ3A 3PHAA 2E9LA 2OYLA 4XUYA 4MB3A 3RM8A 3VD5A 3L4YA 2PWEA 1AQHA 1H0GA 1F4AA 5A94A 5I77A 3CH9A 2CESA 3WFZA 2WPGA 4H41A 4TTGA 1UD5A 4M29A 4LYRA 3WF3A 3VGHA 1ISYA 1NP2A 2EPMX 4W89A 3IAQA 1C8QA 2CBVA 4PMXA 2Y2WA 3VIGA 3WQ8A 2YOCA 4HZ8A 3MSDA 4H04A 3WQVA 1NP0A 1CGXA 3WNLA 1TUXA 1S46A 1PJ9A 3O2LA 3U7VA 1PEZA 4UZSA 2FHFA 1HIZA 1YQ2A 2BS9A 1ISVA 2XJ7A 4DUVA 1Q6GA 3JUGA 4XX6A 2WZHA 4LGXA 1WCGA 1UWUA 2CHNA 1JF5A 2WMIB 1BG4A 1WZKA 1J0YA 1UR1A 2VRKA 1G5AA 2BFGA 3DHPA 4J3VA 2V3FA 2WC4A 2Z1KA 4P7NA 2VQTA 3WH5A 4C7GA 1E6RA 3WF0A 3WDJA 2CERA 3WD4A 3ZO9A 1L8NA 5BCAA 1PZ3A 2WANA 3GXDA 2AOSA 3RILA 1DP0A 2WW5A 1HJXA 2DT3A 4J28A 4EKJA 1V0MA 2VZVA 1XH2A 3HN3A 4W7UA 4F8XA 3WKZA 2BVTA 3SUTA 1QNRA 4AD5A 2JIEA 4FLQA 1R87A 3S2CA 3T0BA 2VRJA 4GZJA 4CN6A 3WNKA 2J7DA 5E0FA 3QHOA 3ARRA 1E43A 2O9TA 4N0RA 1HXJA 2CEQA 1GORA 4DWSA 4MNJA 1GNXA 1RD6A 2J77A 1B0IA 1UKPA 3VM7A 3UG5A 5A6AA 4DUWA 1FFQA 3HJEA 1E6QM 2D1ZA 3N18A 3GBDA 1OINA 3A47A 1VEOA 2QF8A 4MNKA 2ZUVA 5JIPA 1KR1A 4U31A 1UA7A 2D24A 5A8QA 4W8AA 1EHNA 3NJ3A 3CHEA 1EGZA 3DC0A 3DECA 4NSBA 2J74A 2NT0A 2XYLA 3MU7A 1NQ6A 1XSJA 1UQYA 4CD7A 1SMDA 5IFPA 2OYMA 5JBFA 4AD2A 1UD2A 3ARTA 1NWTA 3BAKA 5CZKA 2C8NA 4QCFA 1BPLB 1C92A 2A3EA 4KGLA 3WY1A 2WSKA 3NIYA 1MQPA 2VX7A 3GDBA 1HKJA 1BFNA 4F9DA 1E56A 3GYCA 4W5ZA 2GJPA 2HISA 1JZ6A 4GI9A 1XD0A 4YPJA 1ZBCA 3AXIA 3PTQA 2VRQA 1J9YA 4UQBA 4CU8A 2XSBA 4QAWA 4AMCA 2FGZA 1EDGA 3AS0A 3WMSA 2YJQA 2C7FA 4UFKA 3WF1A 1EQPA 4BQ4A 1UHVA 2ZXAA 4XZBA 1WKYA 1H2JA 3VIJA 1JZ8A 1W1TA 4CD5A 3VIKA 1JYNA 1KCLA 3OB8A 5E6ZA 3AHZA 1J12A 5CPQA 1B3XA 4FK9A 5CSYA 1KBBA 1XC6A 4WK9A 2GJXA 5KZ6A 4QFUA 2OWWA 1TZ7A 3ZM8A 1GOMA 1KBKA 5IXEA 1BTCA 1AMYA 1JXJA 2DPEA 3L2MA 4TX8A 2BY2A 1JF6A 2DT1A 4JFWA 1EOMA 3TTQA 3IJ9A 2XG9A 3WQ5A 3UETA 1GOQA 5A6KA 1ZB5A 1DEDA 5BRQA 1MFUA 5KEZA 1UWTA 1G01A 1VJSA 2QMKA 4D6FA 5E0CA 2Z1SA 1G9HA 4JFSA 3ARPA 2VX6A 2EEXA 3CLWA 1LWJA 5A3HA 3VPLA 1E5NA 2FH6A 4R5EA 3O6AA 3SCVA 5M17A 5ABEA 4JHZA 2OSXA 3PZTA 2J7BA 1UZ4A 1TVPA 4UTFA 3W38A 1KCKA 1D7FA 4IUGA 4PEEA 7TAAA 3T0DA 2BY3A 2UY5A 3WEZA 3N17A 4HA3A 1QI0A 3ARZA 1W9XA 2WBKA 2W5FA 4FF5A 4WSKA 3WMBA 1HVXA 1XRVA 1BLIA 3L4TA 3AHTA 3IAPA 4WF7A 1DTUA 4HOWA 1FHDA 2ZICA 4YHGA 2YA0A 3OZPA 5DMYA 4OZOA 2DSVA 2X09A 3B9EA 2WM0A 2O9OA 1E40A 4GZIA 4KRUA 3NSXA 1JAKA 2YDSA 2MANA 4B9YA 1C3FA 3AMCA 1ISZA 1M03A 1XD1A 5CSUA 1JG9A 1BVNP 3CZGA 5I6SA 4NRRA 1GZJA 2VOTA 1G0CA 1KWGA 2OYKA 3DYOA 3UESA 2VR4A 2G4FA 1GJWA 4P8VA 4ACYA 4UCFA 1KXHA 1CPUA 1VJZA 1W3LA 1W1YA 4J3WA 4X0NA 5CGMA 1UR4A 4AIOA 3QHMA 1G94A 3OBAA 1F4HA 2XFFA 2DSZA 1DWJM 2WHLA 2ZUUA 4Z2KA 5I5RA 5D4YA 2VZUA 2CHOA 4GZEA 3TONA 4TXEA 5A2CA 4D71A 1QPKA 3ZMRA 1HJQA 3AHYA 3PN8A 1B3WA 2BV9A 5A6BA 2XFRA 4Q7NA 4OBRA 1K9DA 3VGFA 3MMWA 4B3KA 2QV4A 3FN9A 2OWCA 3VKKA 2VCBA 2XVKA 5ECUA 3CZJA 4DWSD 5BXSA 2WMHA 3SCSA 2OLHA 3RM4A 1V03A 3BLKA 4CCCA 5HPCA 2VMFA 1UYQA 3AYRA 2VCCA 3WN6A 4TX6A 1M53A 5I24A 4ZXLA 1CXLA 2Y4SA 4MPKA 1MW1A 2CXGA 4UOQA 1XHGA 4A4AA 3MMDA 1FH8A 2NT1A 3CHFA 3G6MA 3MV11 4GXPA 1DWAM 2A3HA 4JHOA 4CN4A 1PZ2A 3ECQA 2VVSA 4B3LA 4P8WA 1XCXA 3MUAA 2D20A 3RDKA 3VGGA 3F5JA 1W3HA 1Q4NX 3TOPA 4GINA 1E9LA 4B16A 1NOWA 1W3KA 1CTNA 2WCGA 3K8KA 3VD7A 1E0XA 1EA9C 1MXDA 2OSWA 1Q6FA 3MUZ1 3I3BA 1UD6A 2JEQA 2WHKA 4ATWA 4B9ZA 1UKSA 2GDVA 1KB3A 3ZJ8A 5A8OA 3AZRA 3OLDA 1CXFA 2QPSA 3L2LA 4XB3A 2W92A 4ATLA 4PTWA 3OIHA 2E9BA 1KGXA 3N11A 4HTYA 2WNWA 1H4PA 4RE2A 3U5UA 2BY1A 1XCWA 4P7QA 2ZX5A 1I1XA 1MQRA 1ZBVA 3BXWA 1OSEA 1BQCA 3CUFA 4UFIA 3IANA 3KL3A 3RMEA 4D1JA 1E5JA 3AS2A 4S3KA 4LYPA 4M80A 3W6MA 3IK2A 3BSGA 2PBGA 1GCYA 2FHBA 3FNDA 3K46A 1SYTA 3VX1A 1B3ZA 1W2PA 1XV8A 4PMRA 2GK1B 5AC4A 2WB5A 4EAMA 1TE1A 3ARVA 3SUVA 4DWSC 1VBUA 3HU7A 1W2VA 3VU2A 4EK7A 2CYGA 4RE4A 1VFOA 1UKOA 4TVUA 1Q6DA 2AMGA 2D23A 2W91A 2PI6A 1KFWA 3ZJKA 1NWUA 3AMLA 3BGAA 3ARYA 1E4MM 1JFHA 2E0PA 1MVYA 4YN5A 2XWEA 3W6LA 2TAAA 2DIJA 1HL8A 2HVMA 3DYMA 3L4ZA 4TUFA 3AHXA 3ARWA 4E8CA 1QW8A 1UR9A 3L4VA 3AIRA 4KWUA 1ZS2A 1E6PA 3FXYA 3VIFA 1OD0A 2ZUTA 4CGTA 4V28A 3AICA 2IXVA 2VUYA 1NWSA 1HX0A 3U7BA 2VURA 2WVTA 5E09A 1M7XA 1IZJA 4AZCA 1LL4A 5A1AA 1QVBA 2J62A 4MNMA 1MW0A 1CIUA 3POCA 1HJVA 1WDQA 1CLVA 2YL8A 4PBGA 5E9AA 2ZX9A 1VRXA 3AZTA 1SR0A 4WSJA 2WBGA 1BYDA 4AIEA 4XZWA 4JAWA 4M24A 4M8UA 2V3DA 1IT0A 2VI0A 1PX3A 4GO8A 1UR0A 1BYBA 2E8YA 3WELA 3CUGA 3BAIA 2V5DA 2XUCA 3WH7A 3VILA 2W4XA 1HT6A 4WJXA 3MO4A 4U2YA 1VIWA 4D72A 3B8SA 1OWQA 2X0YA 1OT1A 5IHRA 3T09A 4PMVA 1E1FA 1JXKA 3AS3A 3PZQA 2J47A 3GBEA 3PZGA 1UD3A 4W88A 2ZXDA 1R85A 5DT5A 3VMOA 4CCEA 3WEOA 1QNQA 2BXZA 2VX5A 5EB8A 3VVGA 1UR2A 5M5DA 4UQEA 3MSGA 1OIMA 1NOFA 1VFFA 5FIPA 4PSRA 1FP9A 4P8XA 1C8YA 2ZIDA 2QLYA 3PZVA 1W9DM 4GI6A 1MXGA 2CPUA 1TA3B 3AMKA 1PAMA 1ITCA 3AXHA 1UH4A 4JFUA 5A6BD 1L0PA 1QW9A 2WKLA 5LA0A 1QBBA 1X6NA 3N13A 2CKSA 1RH9A 4MB1A 3SUSA 1GONA 3UR8A 4NRSA 3GXFA 4AWEA 3WUBA 3VIPA 4HZ7A 2XM2A 5M3WA 1PIFA 4TVCA 5GNYA 4DWSB 2W66A 4H7VA 3PTKA 1LL6A 4XV0A 4Z2JA 4KGJA 2DT2A 2JE8A 2CBUA 1EOKA 1FH9A 4IPNB 5CG0A 4JCMA 3ZR5A 1E0WA 3WNNA 3WSUA 1B30A 5F7UA 2E3ZA 3AJ7A 3EMQA 2F61A 5AYIA 3AFBA 3PZMA 4H8VA 1KXQA 2UY3A 4CU6A 5CLTA 3WH8A 1CXKA 1JDCA 3MKKA 1CLXA 4AXNA 3W82A 2VTFA 2EPNA 5FKYA 2J7GA 4LYQA 3WEMA 2E40A 3VDBA 4W8BA 1B9ZA 1GVIA 1I1WA 4P7LA 1KQZA 2WAGA 3K4DA 1JYVA 1UWSA 2IUZA 2BHZA 1C7SA 1AQMA 1WZLA 4H2CA 2J75A 4JZ5A 3LPOA 2EJ1A 1Y7VA 1ZBWA 3RM9A 4ZE4A 1HKKA 1E73M 2WVUA 5FD0A 4DM2A 1E4LA 5D9NA 4UFLA 1WE5A 3CZKA 4W84A 3VINA 4JL1A 3ZIZA 2ZUMA 1V6XA 7CGTA 5IDIA 4MNLA 2YIHA 4GO9A 1MYRA 1UWIA 5I0DA 4UNIA 1LWHA 1B3YA 3I3EA 3GXIA 3FHQA 1MW2A 1W91A 2WSPA 1NH6A 4MB5A 3WQ4A 4BA0A 1UZ1A 3CGTA 4MDOA 4AZ7A 3FHAA 1CXEA 3PZUA 4AD1A 2DEPA 2XHYA 5D9OA 1HKMA 1HF6A 5EFFA 2E4TA 4AYSA 5I23A 2WMGA 4PTMA 4AD0A 4PYSA 4EE9A 4W5UA 1VBRA 1QHZA 2WKGA 1XGZA 4P8UA 1D3CA 1JIBA 3PTMA 1FOBA 2J25A 3WMCA 1FP8A 5A6MA 1CEOA 5CQ1A 3AIWA 2J79A 1ECEA 1R8LA 1J18A 4HMCA 3GNOA 2WLYA 1WO2A 5BXRA 3VGBA 1CYGA 3UCQA 2XIBA 4OUEA 5JUVA 2X2YA 2J78A 1DHKA 4UQ9A 5HXMA 1VEPA 4M1RA 1JL8A 4GIAA 3VGDA 1E6NA 4U3CA 3WDIA 3ZJ6A 2ZOXA 2CKRA 1E55A 3PZNA 4P7OA 4WKFA 3N12A 4C7DA 4D6HA 4Z2GA 3FW6A 3WBEA 5BYWA 5A95A 2OSYA 1NARA 4CUCA 3N04A 4EANA 5A2BA 1BHGA 3VO0A 3BMWA 1W9BM 3AOFA 1PX8A 3EMCA 1DWGM 4CU7A 5A8PA 1WAWA 1ODZA 1GOKA 4OKDA 4Z2IA 4ZFMA 4U3AA 1W3JA 2YA1A 1W1PA 2GFTA 4C7FA 3TP4A 2J7FA 1W1VA 5A6SA 1GQJA 4ACZA 1ZU8A 2OWXA 1CECA 2D2OA 3QOMA 5LA1A 2PBOA 3AMDA 3BAXA 1TMQA 5GPRA 5ABFB 3WD2A 5BROA 2WVSA 4WKHA 1B31A 3K1DA 3T08A 2CIPA 1CGWA 3F5KA 4V2XA 4WLCA 3WUGA 5IFTA 3VNYA 4W85A 2G8ZA 5JIWA 1UKTA 1N82A 2PWFA 1QNOA 4KMQA 5AY7A 4MAVA
chains in the Genus database with same CATH superfamily
3MV01 4X2PA 2YA2A 3RITA 5G2HA 3C5QA 1C90A 3LB0A 4IJCA 1GEQA 2C1IA 3DHUA 4XAZA 1EJVC 4A3YA 5CJMA 3C0JA 4IPIA 5KETA 4W8LA 3BMXA 3EKLA 2HXTA 4F3HA 3AI0A 2FMOA 4AVOA 3CLMA 3KVKA 1I60A 4HA1A 4MKVA 4RE3A 1UBPC 2D69A 3NL6A 4OGZA 4YVXA 1MW3A 1UC4A 4O15A 3CV1A 2G41A 4QE1A 3R43A 3MUIA 3B06A 1C91A 3W02A 4PFMA 4PUJA 3VOCA 2NSOA 3VX0A 1DYSA 3KBSA 4HNLA 1E0VA 4AX7A 5HNUA 3WLRA 4IMCA 3IACA 4P7RA 4QHRA 2AAAA 2YLAA 4QDMA 3NQAA 2CBIA 4RPQA 1LLWA 3O06A 4IIBA 3U2CA 3HMCA 4ADSA 4I5RA 4JIIX 3VUPA 5K9XA 1EO5A 3POHA 4XZHA 4UTWA 1MWOA 3RPMA 1UWQA 1QNPA 2Z6IA 5LYRA 3FGCB 3SZ8A 3N9RA 3ITLA 1XH0A 1NY1A 2DZBA 3QF0A 4O0QA 1KM0A 4C6EA 2BY0A 2QPUA 1CXHA 1U33A 1TG7A 3M0HA 3SN0A 2O9RA 4UOZA 3EDFA 4L80A 3EDJA 5HWMA 3N6QA 3GH4A 1CWYA 4FLSA 3ZT6A 1PV8A 1T0OA 2PDQA 4J7RA 2GDUA 2OU4A 3LD5A 3EWCA 1SJBA 1VFMA 3WF2A 1JPIA 2AAMA 4UTTA 3TMLA 1QHOA 1X1NA 4UR8A 4GY0A 4QEEA 4JKKA 1A5UA 3ZR6A 4HHHA 4GY1A 1BVZA 3UERA 1UR8A 4UC5A 1E1EA 2Q09A 2G3NA 3L4XA 3D46A 4MOZA 5C9UA 2PDNA 3ALFA 2A3BA 4YTTA 2PDYA 1FHLA 3G6LA 1LF1A 3WK2A 3QY7A 3STCA 3EB2A 4NY2A 2Y70A 2Z6JA 2XTKA 2YBVA 1LQ2A 2QJJA 3O1NA 4GYJA 2E09A 5LXEA 4JFVA 2NUWA 5HUPA 2P1FA 3DFPA 3KVLA 3C0LA 3G0XA 3W87A 1I75A 2NLYA 2PAJA 3EOEA 2DV0A 3L0NA 2D2HA 2NQ5A 3NDYA 4JTCA 1RJQA 3N19B 4JFTA 3W7EA 1TIWA 3RRAA 1V0KA 3NQFA 2QUVA 2PD5A 3IUIA 3D5HA 3II1A 4A6GA 3HURA 5EU9A 3UCCA 4LV9A 4NX5A 3ZOAA 1DTNA 1V7YA 3OTRA 3NZ1A 5KITA 4DHGA 3FVMA 1P6CA 5IBXC 1Z3NA 4PCSA 3L0GA 3OLEA 5D38A 2O4MA 2V8ZA 4ZO6A 1Q63A 2ESCA 1DOSA 5AYXA 3AIEA 4JIHA 4W7WA 5TQLA 5KINA 4BS0A 1V51A 3PSWA 5HNRA 2YXOA 2BVYA 3OQ8A 1M7JA 1IEIA 3MMUA 3PFRA 1QI5A 2YCLB 3KP0A 5HPOA 3NO3A 4LXFA 3BC9A 3EOOA 1RJRA 2IPGA 1ZAJA 4YXGA 1EIBA 3INPA 3RO8A 3UXLA 1OFBA 2XM1A 5LNUA 2CLFA 3W2NA 3WH6A 2CLHA 3HGRA 3AUOA 4NAFA 2Y8UA 1XKJA 3TYDA 3GU2A 2XIOA 4B91A 3GC5A 2CC0A 3PFMA 2YFNA 1OC5A 3EKGA 4KBXA 4XO6A 3LY0A 3NPXA 2FZ9A 5HR7A 4AXKA 5BU9A 1YMYA 1Z32X 3FLUA 3P0XA 3TFXA 4JTRA 3NZRA 1D7KA 1Q3NA 1DXEA 4K37A 3AROA 1WP6A 2ZDSA 2PFHA 1YHTA 2DZAA 4AD3A 4IICA 3LPFA 3T2OA 4JTLA 3G1VA 3TA9A 4PMDA 4J3TA 1GYMA 4A35A 3QQ1A 4IXXA 1HO1A 2DIKA 3UJRA 2Z29A 2VR5A 2ZE0A 3W2JA 1OFOA 2GUUA 3GUWA 3FCPA 3E0VA 5BXTA 4N02A 3ZVHA 1OJXA 1UPPA 3TWAA 3RIKA 3BW4A 1X39A 4O0ZA 3TV8A 2O56A 2J8FA 4X9YA 3BG9A 1IF2A 4K68A 1TV7A 3UVIA 1J6OA 3WNOA 1S38A 1RZMA 3SQLA 3O16A 1ADOA 2QCNA 2DUAA 4WJEA 4AWSA 4C6IA 3A9BA 4ZXOA 1QI3A 1K8YA 5DN1A 1KO0A 3IJ7A 1F7BA 4IP4A 4PSPA 2PP0A 1Z44A 4NZCA 2Z00A 3U57A 4JYFA 3DCPA 3T7VA 2V5CA 1CW2A 3IK4A 1VFUA 3RO6A 1IXPA 2GVJA 4LUSA 2VZSA 3MHUA 1MEHA 3W74A 4UB9A 1X6LA 2RKXA 4CVUA 1SGJA 3E2QA 4E6MA 1C9WA 4MADA 3UR5A 2PD9A 4C6QA 5HJLA 4JR5A 4CQCA 3PPFA 3E0IA 1MFVA 5DO8A 1EH9A 4U5IA 4L56A 4UR9A 1A5NC 4L4PA 3VMNA 2YDRA 3GH5A 2WZEA 3IGSA 5D04C 1QNSA 3QMSA 4HYWA 3GHRA 2J8GA 3CL6A 2A3AA 4CN1A 2WZMA 4QGCA 1W9VA 1L8PA 2X05A 2ZC8A 3W1PA 3VA8A 2PTXA 4ADUA 3MBDA 3GR4A 5HBFA 3ANYA 1XFBA 5I7GA 2XZ7A 4FX7A 5I3FA 2QCHA 2XVNA 4KIRA 3CIVA 2GJXB 1Z89A 3EWDA 4GIEA 4JHMA 1JRBA 3OVPA 1OT2A 2GLKA 4OIFA 2BNJA 1FKWA 4JQ2A 1OC6A 1R30A 4PMNA 4GIYA 4HU8A 1R3SA 1AH0A 3E2VA 3LLFA 3TJIA 4IX2A 3U2ZA 1SU5A 2VVNA 4O12A 3SW6A 2HTMA 1XICA 5F4XA 4M82A 2G3IA 2D3LA 4GUJA 1JPMA 3AYSA 3UWZA 3AMGA 1U1UA 3W1MA 4Z1DA 2VZTA 3RLVA 4E8DA 4FOJA 1XX1A 4MB4A 4PUWA 1XJBA 3ITYA 4A3QA 3GVWA 4MSSA 3W86A 3KOZA 2ICSA 4A8LA 3U2EA 3ARXA 4PTNA 5BOOA 3M07A 3EPNA 1JD9A 2H9AA 1AMKA 4MYXA 3BLEA 3DU0A 3TN6A 1PBGA 3ITGA 1RQHA 1UW9A 4X9SA 4W87A 3TN4A 3CB3A 1YE4A 3SCPA 1POKA 4GGHA 3OHIA 1TCMA 1LZOA 1LT8A 4DO6A 1YX1A 3WK3A 5C8BB 2XFYA 5F2MA 4ZSTA 1ONXA 3G1RA 2V6AA 3GFYA 1G1YA 4HHMA 1VAHA 4XZIA 3UG3A 4HPHA 4R27A 2PU0A 4HT3A 2IXUA 3OIXA 3WENA 5CBBA 1V3HA 3BV7A 3S2NA 5HOSA 1VENA 2E25A 4CEXC 5LNWA 4E4PA 2Z1VA 3NEHA 4DYJA 2QDDA 4Z1CA 4Q8VA 1V02E 2X0HA 3QC3A 1C8XA 4DM1A 3RJXA 3W7MA 2XVLA 4Q32A 2PF0A 2Q02A 3GVQA 2EPLX 3SCRA 3DFOA 3AISA 1RLDA 4MWAA 3M64A 2UBPC 1IZKA 3OA5A 5HMFA 5A8MA 4M7SA 4QG8A 3SR7A 4AISA 3AIUA 3C2FA 3GZAA 1R7OA 4LS0A 4J4KA 3RCNA 3R2GA 4WHBA 3F5LA 4XBSA 4P5UA 2PB1A 2BZNA 2G97A 3NUKA 1S5WA 5CC6A 3T8QA 1OD8A 4HOZA 4G1NA 4DI8A 1FH7A 4C60A 1KBIA 3BSHA 4AEEA 1VLIA 3WQEA 4QEHA 4NF7A 3NSMA 2QGYA 5LSMA 4XSMA 1H0IA 4YU1A 1YNQA 4AW7A 4YHEA 3VIIA 2FDMA 1MZRA 3LGEA 1OFQA 1OYCA 4CD8A 2DQXA 3SCNA 1H63A 3UWVA 3NPVA 4AZGA 2YW3A 1E15A 1GYLA 2H3DA 3ORWA 2DSKA 1WA3A 1KM1A 1AD1A 3OZMA 3AIBA 1BQGA 2Y7GA 4LF1A 3OPSA 1QAPA 1B90A 2ZUWA 5B7YA 4H6KA 2NQLA 4M6VA 4NZ5A 1QBAA 3CQKA 4DF1A 4ECLA 1RP8A 4MJ4A 1V8EA 5G5IA 3SIMA 4JYDA 2FTYA 4HZ6A 4URIA 4LANA 3TAOA 5JU6A 2ACQA 4FI4A 4JKMA 2DVTA 1HN1A 3AJXA 4UTHA 1B4EA 2OLAA 3FY1A 5CSSA 4IMEA 2YCEA 4UNLA 4EX4A 2Q6ZA 3WBAA 4IMFA 1CZ1A 4ZSUA 1JZ5A 4MTVA 4PRWA 4RCXA 4NHVA 3KBMA 2Z7KA 4HA4A 2QAFA 2PC8A 2VEPA 3LTSA 5HNNA 2OEKA 1TWIA 3ITXA 1KXTA 3FAXA 4BZYA 1VYSX 2G3FA 4Q22A 3LV5A 3H4GA 2NVAA 3KS5A 4GQQA 4J3UA 4MFDA 4W9TA 1M41A 3A3XA 2PWDA 3RU6A 3W7PA 1W3IA 2ZX7A 3LRKA 4UQDA 1R3QA 2JBMA 1OFRA 2X1TA 1EIXA 3DG7A 3G8EA 5AOUA 3W84A 3MCNA 2NZLA 3VDHA 1V0NA 1QPQA 2V2CA 2VCAA 1PS9A 2WMJA 4HPXA 4GLEA 2NSXA 4M81A 3QGAC 3OGVA 4DY1A 5H6HA 3WQ6A 4BFAA 1HW6A 3NDOA 4PCPA 5IOBA 3OG2A 4BHYA 1VF8A 1M04A 4JD4A 1A4LA 4XZ9A 4OQVA 3QFWA 1J0HA 2DZXA 1XUUA 2DP3A 3L2IA 5HA7A 1Q6OA 5LNVA 2X7WA 4ZO9A 5LHFA 4Y8EA 5C6MA 4NAEA 5DMLA 3BMVA 4RNFA 3ZT7A 1ICPA 4B5TA 3CV6A 3FDGA 1BD0A 1K9TA 5JMUA 1SR9A 1M65A 1J01A 4QSHA 1CI1A 4BQ3A 1Z69A 3PHAA 2XN2A 2E9LA 3CAWA 2OYLA 3G1AA 4Q3MA 2X42A 3RM8A 1OK6A 3O6DA 4BI7A 3VD5A 1MUCA 1H0GA 1G7VA 4R88A 3WFZA 3QEZA 3EX2A 5BNKA 3U9IA 3VGHA 4FOUA 4O18A 2EPMX 4J1OA 4W89A 4Q4KA 5AHNA 1GW9A 1SM9A 4W4QA 3OQEA 1P1MA 4LWWA 5AHIA 1Y5VA 3UP8A 1TV5A 1NJJA 4PH6A 2GYIA 2A21A 1R5YA 4YIWA 4MG4A 2QT3A 2G50A 3O2LA 2ATSA 3U7VA 4RR4A 4UZSA 2FHFA 1LRNA 1ISVA 1F3WA 2XJ7A 4XX6A 3SM0A 4TMBA 1WCGA 1JF5A 3RPTA 1BG4A 4A29A 1UR1A 2CZVA 3M5ZA 1G5AA 1BVWA 4ES4A 4LBUA 4J3VA 4B2DA 5DANA 4P7NA 3CUZA 3IJIA 4IGHA 2CERA 2WNZA 3WD4A 3ZO9A 2WJEA 1X6UA 3N3MA 4EWJA 3DERA 2AMXA 1M9HA 1VPQA 4EKJA 3EXRA 5CPMA 3CWOX 2ZQ0A 1MDLA 3LLDA 2ZBTA 3LSBA 2HK1A 2BVTA 4UTMA 4AD5A 2JIEA 4GMEA 4AC7C 4LC6A 3O05A 3S5ZA 4JNZA 5E0FA 1G4EA 3R0DA 1NDZA 3ARRA 3B8UA 1E43A 3B4UA 1Q65A 2CEQA 3TLLA 1FWIC 4TV5A 5FI8A 5CBIA 5DBTA 2J77A 4C6JA 1UKPA 2FB3A 1D8CA 1FFQA 3WJYA 1QPRA 3F2BA 1GPWA 2B7NA 1MNZA 3M1ZA 1VEOA 3TCEA 4QM1A 3MKVA 1N8FA 4W8AA 1EHNA 3CHEA 3DC0A 3DECA 4NSBA 3W07A 2NT0A 3SRFA 1TPC1 3LHVA 3DESA 3IGHX 3T0TA 1P6BA 2OZ3A 2CW6A 3ARTA 1NWTA 3E38A 2RH9A 3QXBA 1UIPA 4LH8A 1C92A 3URNA 4CQBA 4LY4A 1FHUA 2I56A 4F9DA 4W5ZA 5CPLA 3AXKA 4GI9A 1A5AA 3GD6A 5HINA 2XDFA 2VRQA 5C9XA 3NM3A 4AIBA 3P7YA 3WQFA 2JKPA 3I65A 1UP0A 4GRSA 3GG7A 3NGJA 4LTSA 2P3EA 4UFKA 1EQPA 4BQ4A 1UHVA 1P7TB 3NZQA 2VXNA 1K6WA 4JOMA 1JYNA 1KCLA 1FWDC 4AU0A 3LGDA 1WYIA 3THUA 1W3TA 1J12A 2IKIA 2OO6A 1KBBA 3W73A 1T41A 4WGXA 6TIMA 1FWSA 3EAUA 1OFEA 3ZWSA 5KZ6A 3MWAA 1TCDA 2J9YA 1W5MA 1PZ1A 4Z42C 3RR1A 4H4IA 4HBKA 1JF6A 3V1HA 2HE8A 5HQMA 5HQLA 3S1XA 3IJ9A 4A8IA 3WQ5A 1ICSA 2GVLA 1BWKA 2GWGA 5KEZA 2BLEA 2P88A 2Z1SA 1G9HA 4JFSA 4E3TA 4DWDA 4ORMA 1T99A 3CLWA 1LWJA 1THFD 1PL9A 2FH6A 3O6AA 1WXJA 3IEBA 4JHZA 2OSXA 3PZTA 2Y7DA 4UR7A 1H7WA 3CXOA 3MHGA 5EYWA 1L2UA 1TVPA 3W7RA 1LWIA 3C0QA 3TKFA 3BL3A 4WEVX 3ONBA 3D47A 3WEZA 3VCRA 1SSGA 4HA3A 4NJGA 3QKZA 2W5FA 4FF5A 4CLMA 3WMBA 2J24A 1JCJA 2VEFA 1ECQA 4MY8A 3LCLA 4RXGA 3AHTA 4Z08A 1U1HA 2XZ9A 1BEUA 2ZTJA 2ZICA 3W22A 3QBUA 1KM2A 1KBJA 3OZPA 2REQB 2DSVA 5A6TC 4Q8QA 1S5MA 1E40A 1YBQB 3NSXA 3SY1A 4LSBA 4B9YA 2GOKA 5FA5A 1KFCA 4E0CA 3UGVA 1TJRA 4DNHA 1WKEA 1JCXA 3IV3A 1TRIA 1JG9A 1AL7A 5I6SA 1VD6A 3I6TA 3O6CA 1DJYA 5XINA 3NM1A 3O3RA 1D9EA 1XGEA 4JXCA 4HNVA 1SFTA 1EZWA 1CPUA 1VJZA 4KIEA 4X0NA 2BG5A 1M7PA 3THQA 2DVUA 1RSCA 1G94A 1FTXA 1SSDA 2ISDA 2ZUUA 2OZ0A 2Z25A 3QPEA 2Z0IA 2P8BA 3NQVA 2ZZ4A 5D2TA 5A2CA 5C9WA 3L5MA 5C5YA 3ZMRA 4QS6A 3W2KA 3PN8A 1PCKA 2BV9A 1GWJA 2J13A 1K9DA 5IDZA 3KHJA 3H22A 3MMWA 3GE7A 3CT7A 3FN9A 4M5PA 3PNUA 1SW7A 3ATYA 1B4KA 2CFFA 2Y88A 3MHFA 2HQAA 5BXSA 3GG8A 1AH4A 1S39A 3BLKA 1S1RA 3VOHA 1SFLA 3AYRA 3HQ1A 2VCCA 3BDKA 3WN6A 4ZXLA 3W2UA 5HNTA 4MPKA 3UNTA 1XHGA 3WK0A 1XLCA 2C15A 4WRHA 3R79A 4GXPA 1DWAM 1PZ2A 3ECQA 3S5OA 4IIFA 2PRMA 2R82A 3A12A 2QW5A 1Q4NX 4QNWA 4RDZA 1NOWA 1W3KA 3VD7A 1MXDA 5E9XA 2QCCA 3I3BA 2J8TA 2JEQA 3G22A 4R3UA 4ATWA 3T81A 2WSRA 2GDVA 1KB3A 3TN5A 1Q7MA 3ZJ8A 4PA8A 1CXFA 3GYEA 3OIHA 3ME3A 3W76A 3SJNA 5EMUA 2E9BA 3N11A 2ALRA 3R12A 2KX9A 3U5UA 4P7QA 4RXFA 1MQRA 5C2GA 4YVVA 1TYGA 3KX6A 1I6NA 3WJWA 5E93A 1VH7A 3AALA 3CUFA 4UFIA 4Q4SA 2WPBA 4HHLA 2HRWA 3RMEA 4H9VA 3FS2A 2VGGA 3W6MA 3BSGA 3LHYA 2PBGA 2FHBA 2IKHA 4U4MA 1W2PA 2ZRWA 5FJPA 3IRSA 4HPJA 4HMNA 4DWSC 4HZMA 1P1XA 2CYGA 3MP5A 1O95A 3H21A 2PZ0A 4DQWA 1UKOA 1Q6DA 2D23A 3GKFA 1FWGC 1M3UA 4G9PA 2ON3A 3AMLA 1KFEA 4O19A 1QR7A 1E4MM 3MT1A 5FF0A 5AZ0A 1K8CA 2BSLA 2NQZA 3W6LA 1MNSA 3W1NA 3FSUA 2PP1A 3BWWA 3SB0A 2CWNA 4IXHA 3QMRA 3EOLA 2GGJA 2ZUTA 1KV8A 4V28A 3KDNA 3TOYA 4AWUA 4IFOA 1WUEA 3FYYA 5HR6A 3TC3A 3TW9A 2WVTA 5E09A 3PBUA 2FZBA 4QAIA 3OP2A 1QVBA 4MNMA 2DUXA 1CIUA 3QZAA 4K1GA 1DL3A 3RHGA 1HJVA 3UPWA 3KVJA 1WDQA 2VP8A 2Z2AA 3LTPA 1SJAA 2C18A 5BZAA 4N6EA 3H2MA 4S3EA 2FLIA 1BYDA 1RQBA 2F6KA 5EA9A 7ENLA 1AH3A 4GO8A 2X1UA 4L4LA 4UTJA 3WELA 1G67A 4TR9A 5TF0A 3AYVA 1HT6A 2ABBA 3VCCA 2QV5A 1AUSL 3RUBL 1OWQA 1OT1A 3DGBA 1ZSXA 3LX9A 3M47A 1E1FA 3BLDA 2ZXDA 1A53A 1XP3A 3VMOA 1Y0EA 5EB8A 4V33A 1IXOA 3CS2A 1NOFA 1DJIA 5BMXA 4P8XA 3R4IA 1C8YA 3HGSA 3N14A 4YMZA 4DBWA 1U5JA 3IUHA 1VBGA 2NLIA 1EC8A 2FZMA 3AXHA 3L12A 4R34A 5G2WA 4GJJA 3UWQA 1J5SA 1XBZA 3R94A 4S3GA 5LKYA 4WDXA 2OMAA 3LXBA 1J5TA 2CKSA 5FAGA 3UR8A 4C1NA 3ZLGA 4AWEA 5LGZA 3WUBA 2EKCA 3SQSA 3W7JA 1QK0A 1O12A 4ERIA 4TVCA 3UXIA 2W66A 1A5SA 3HO8A 4Z2JA 2QDGA 4RDYA 2DT2A 1GZ1A 1ZQ5A 4IPNB 1TELA 4JCMA 3ZR5A 3WNNA 3AJ7A 1WKFA 3AFBA 3P8JA 2UY3A 1XIIA 3F4NA 4H9XA 4S1FA 3P84A 4GXWA 3BQ5A 5EMMA 1JR1A 3VCNA 2WNQA 3HZ3A 4LUSB 3MQTA 4ZO8A 3W7DA 4H9YA 4IPPA 5IBXA 4GE8A 3V18A 3ZVIA 4DBDA 1AODA 4DXXA 5H2ZA 2FVLA 3S2LA 1RQEA 3QYSA 4P7LA 2WAGA 3K4DA 2IUZA 4PRTA 4ERGA 1AW1A 1UUOA 5DY2A 1I4NA 3HFTA 3PG8A 1K7FA 1DORA 1W0MA 2Z24A 5LHEA 1YXYA 3RM9A 2OEJA 2WVUA 4QDPA 4LUJA 3IIVA 3L7RA 1Z9AA 4W84A 3VINA 4JL1A 2Z1WA 3IJDA 3W6YA 3IJLA 5TAOA 1V6XA 3F2CA 2YIHA 1A49A 5D05A 3DFSA 1XKYA 1LWHA 2FQIA 3FHQA 1W91A 1NH6A 1PDYA 1UZ1A 3FHAA 1Q8AA 4AD1A 2XHYA 3S6OA 2WMGA 2D2GA 4AD0A 4ZOCA 4O8AA 1JUEA 3CQ0A 1X97A 4ZOBA 3R10A 1GVSA 2WKGA 2FGBA 1MO0A 3KP1A 3LCXA 1ECEA 3RLGA 1XFCA 1PB0A 4HMCA 3H2FA 4FEZA 2WLYA 5BXRA 3IVTA 3UCQA 4OUEA 5JUVA 4RZ6A 3QLDA 4MLJA 4UQ9A 4H00A 2P0OA 3GDKA 1DJNA 2OODA 3FJ4A 4IHCA 3RX2A 1TO3A 3GO2A 4OHQA 6REQB 4C7DA 1JJKA 5CKSA 3WBEA 5BYWA 5A95A 4QXIA 5G1MA 1XDMA 2C0AA 5A2BA 3LEPA 2HSAA 3BMWA 4WSHA 3AOFA 5I3JA 3C3NA 3DZ1A 3EMCA 6ALDA 4UTLA 1DWGM 5A8PA 1ODZA 3B8IA 2J7FA 1W1VA 4DPPA 2OWXA 4Q4MA 1F6PA 1FX6A 3QOMA 1K77A 1EJSC 1TMQA 3H12A 3WD2A 1EPXA 2P76A 3TYBA 4X2RA 4G7EA 4R33A 1N82A 2CLKA 3BGGA 3CAVA 2PWFA 5KSWA 4IIHA 4KMQA 5AY7A 3KWSA 1V7AA 3S83A 4QLKA 2I7GA 4GD0A 1ZY9A 1OGSA 5HWJA 1BRLB 2GZXA 3C2YA 1P0DA 4ATDA 2EF9A 1RA0A 3KL5A 2G3JA 1CB7B 4REQB 3UFYA 1IXNA 2EG6A 4CCDA 3K4AA 1JEZA 4LW7A 1A50A 3A5FA 5DF0A 2ZUNA 3MP4A 3W29A 1HJWA 3NQDA 3PVFA 3VTRA 3E6EA 1XXXA 1JFXA 3PUGA 2VYOA 3URBA 3UG4A 4ZODA 2WJZA 1HKIA 1JZ7A 1O7AA 2WWCA 3WQDA 2VQUA 3LK6A 3QPYA 3UZXA 1VFLA 4TIMA 3OODA 2CETA 1UASA 1HNYA 2C16A 1HL9A 2GGIA 2Q01A 2YLLA 3WDHA 4DO4A 1LRQA 4PTXA 2H8XA 3A13A 4Z1YA 2XSXA 3GVGA 1BGAA 2YFOA 4HIBA 4JS3A 9CGTA 1TB3A 2E8ZA 2OT1A 3VC6A 1UH3A 2Y1HA 1YYAA 1W3NA 1HUVA 2PLJA 3NNTA 2FFIA 2R14A 4K8GA 1V3JA 3V1PA 3ANVA 4UZUA 2E6YA 1KRAC 5D37A 1TPFA 2VWSA 3GTXA 3G77A 4KWVA 3VDCA 3A4AA 3KHDA 3V4BA 2NQ9A 3M0KA 2AQWA 4D6EA 3W37A 1U5HA 5HDRA 1GQNA 1LBFA 5MKGA 2C1HA 3GXNA 1DQWA 1K6AA 4OFCA 4JY8A 3GR7A 2HROA 2ZX6A 1QPOA 1E3ZA 1NEYA 3SY5A 4LPCA 1KRMA 3S0CA 3BOXA 2F2HA 3S9YA 3L23A 1HJSA 4O1EA 3UXDA 3W01A 3CMFA 1A80A 1B2YA 3THCA 3PF3A 2Y8VA 2ZWZA 2PUZA 3CUXA 2W62A 4L4MA 4NUWA 5JBDA 4PBFA 2YL6A 4KPLA 4RW5A 4J2MA 1W8SA 2PGFA 4US6A 3CT2A 3EDEA 1XIJA 3LPPA 4I8DA 1BGGA 5GJMA 3K8LA 2WM1A 4XTIA 2R1KA 1RPKA 1V3KA 2WC3A 4BF5A 4YJ5A 4ZTXA 1PIIA 3R6IA 2ZXBA 2Z26A 1CNVA 2GK1A 4OBSA 2P3ZA 2PE4A 4J27A 4HPNA 1SW0A 5CPTA 1QMLA 2GGGA 3VFCA 3SADA 3BH4A 4QS5A 1YXCA 2JKAA 1SMAA 3G5EA 4IFKA 4PB4A 1YADA 2P53A 3VAVA 4XBJA 1SZGA 1AQ0A 3FEQA 3Q4DA 3BZJA 2DJLA 2PWHA 1V6YA 4HMDA 2C0HA 5GVJA 4AIUA 4CKQA 1ADSA 1YTEA 3TTOA 3BUVA 2V68A 1K9FA 5LXXA 3ARUA 5D8ZA 2V3EA 3AU2A 1Q7ZA 4AZCB 5C54A 3IVUA 1WBJA 2OX4A 3WQGA 3CHCA 1QOPA 3PC0A 1KTBA 1GOOA 1PKYA 3NGFA 3L5AA 4XIMA 4F66A 4D9PA 1QFEA 1XR2A 1OYAA 5CPNA 2E6AA 4Q6XA 4ZQOA 3W0KA 3CMJA 2ZXQA 1R86A 1LM1A 3A4WA 3KRSA 4P2VA 4ZOEA 1TR9A 3KBNA 1KNWA 1DWHM 2PDPA 2XSAA 3B9DA 3RG6A 3RN6A 3Q65A 3PZOA 2J66A 1Q85A 4H2HA 4HYRA 3NCOA 3W4RA 4LY8A 3VOGA 3DYPA 1XIEA 4HPGA 3RCYA 3XISA 3VKAA 4EIVA 1NDVA 1RALA 3R89A 1V3IA 1RCXB 1KKRA 2QUUA 3MUY1 1I2PA 4XAGA 4ICNA 1D3GA 3VNKA 2GSHA 3FV9A 1T96A 2R6OA 3H8AA 1VCVA 4CCZA 4D6JA 5HATA 2OPJA 2CITA 3BAYA 2D0HA 3NQ6A 5D8WA 3TU9A 4LQ1A 1JI2A 3B9AA 3SO7A 3K5XA 2GVYA 4Q7IA 2X1IA 1XPGA 1VPYA 2BHYA 4AZ6A 2R9RA 1LG1A 2HPIA 3KZPA 4Y9NA 3IGUA 1TA3A 2IPWA 3EMZA 1AFSA 1ZP3A 4LUTA 4H6RA 5LNSA 4H8NA 1R38A 2PDKA 3IV8A 4FO4A 4JQ1A 3Q94A 3TQVA 4US5D 1UA3A 6ENLA 1GOIA 1FWWA 5F2LA 3U4AA 2OKOA 3T4CA 4WIWA 2YKKA 4O53A 4MM1A 1CBGA 2PTDA 2WC7A 3P60A 3TH6A 3IRDA 3QY8A 1ITXA 2WNNA 4H9UA 6CGTA 1U30A 3L4WA 3G1XA 1ZPTA 3B3DA 1J10A 1W37A 2Y7FA 1X98A 4W86A 1B3OA 4RDWA 1POJA 2AL2B 4QLJA 5BOEA 4DAIA 1GT8A 4H8UA 4QJ4B 3G1HA 3NYZA 1LL7A 1R7AA 5AZ1A 3VKJA 3P0WA 3PZ9A 4AC1X 3C8FA 4PGLA 3H6OA 1FA2A 3ZLFA 5D32A 2D0FA 1CT5A 3W26A 2EQDA 4QE4A 3T78A 4O1BA 2YR1A 1TPB1 2FYMA 4IG2B 5M03A 4L9XA 3TVAA 1V08A 3CV7A 3OW1A 3BCFA 1VEMA 2VFHA 3QC0A 3I7SA 1GVRA 3CNYA 3B0YA 1ZTVA 3N3TA 1T40A 1LDCA 2VEMA 5BXPA 5BRBA 2VZOA 2G3MA 2V67A 4KCWA 1VHNA 3MSRA 3SUUA 2QUMA 3G18A 4FNQA 4OTKA 4GQRA 1V6WA 4Y9AA 2VNCA 4L6OA 2PLCA 5A6JA 1FXQA 3M16A 4Q8OA 3SFWA 2KZHA 5GNZA 1OX5A 1NFBA 1MQQA 1EJRC 4RZ5A 3K8MA 3VGEA 5C9RA 1UD8A 4WY0A 1F6KA 1YTDA 3EB4A 4WDUA 4XD5A 4U5KA 3GKAA 1E72M 4FXFA 1QCWA 2XINA 2W79A 1TZZA 4J3ZA 1VB9A 5DEZA 3M43A 1ZBKA 5DRCA 4I90A 4PR4A 2OT0A 1B9BA 4LB4A 2IQTA 2PDMA 1R47A 2Y63A 3JS3A 3TTEA 4QJ3B 4ACZB 1PO9A 3LMYA 1XSKA 4AH7A 3W85A 1K9EA 2VJXA 2BHUA 4Y96A 4MKSA 1SO6A 3V5CA 3LLXA 4LS1A 2HWGA 2DDXA 4PMOA 1E4IA 4OU1A 5DQPA 3CO4A 1A0CA 3W27A 4EPKA 1XSIA 2JF7A 4G5DA 4MKNA 3QOKA 2AGKA 1X96A 3T9PA 4EP8C 2WV8A 1UMLA 1SJDA 2V3GA 1T5AA 4U33A 1DWIM 3HBLA 2HCVA 1TMHA 3N2CA 2DH2A 4UFJA 2ZUSA 4XD6A 1H11A 3GIYA 3W1TA 3KBJA 2D2JA 4O1CA 2W6RA 6PTDA 7REQA 5K3VA 4HHPA 2ZZ5A 3BW2A 3PB0A 2QCLA 4GX8A 1GOXA 2WVVB 3EWBX 4WDTA 3LQLA 3NXFA 2W0UA 3GFXA 2YGYA 4ZZ9A 3CU2A 1EP3A 1R2SA 5BRPA 5DMNA 1HKWA 1VKFA 2XFWA 3DUGA 2WHJA 3VI2A 1GVEA 3N15A 1XPYA 1VS1A 3R8GA 3B40A 3VDAA 2Y61A 1J0IA 1VYPX 3LCFA 1GHSA 4OV4A 3L21A 3R8RA 1H49A 1L9WA 4MWAE 1PPIA 1WDPA 2QR6A 2UY2A 2OB3A 2E9MA 1Q2SA 3NO1A 3B8VA 4DO7A 1C29A 4MJZA 1GZGA 4D6GA 3EX1A 3CBWA 2VD9A 2A3CA 3KLLA 4NG3A 4LCRA 1KGWA 1MMFA 4H9MA 3WJZA 1VLWA 2YCKX 3FDKA 3SY8A 3TMQA 1JCTA 3FJ6A 5I3HA 2YL9A 4PUEA 2D3NA 5D2VA 3LUTA 2PZNA 3HV8A 1EUNA 2E67A 2WHMA 5LGXA 1XINA 2XVPA 2NW0A 1WPCA 2ISFA 5BMWA 5DMMA 5A69A 1E9ZB 3VM5A 5CAKA 1J2BA 1W1IE 3FA5A 5DT7A 2PWGA 1AJ2A 2X8RA 1REQA 5I78A 5AHMA 1JZ2A 1XI3A 1JAEA 1GW1A 1LCOA 5H8PA 3A3HA 4D2JA 4O11A 2NXGA 4DJED 5I3DA 2OOGA 4MGGA 1A3WA 4Y90A 3WH9A 2QKFA 5ECVA 1JZ4A 4LEQA 5F2IA 3MS8A 3NXLA 7TIMA 3FYPA 3LA4A 3DXIA 4BF7A 2RHGA 2XU2A 1YDNA 3LPGA 4D6IA 4F9JA 2J4GA 1XYFA 1O66A 2A6NA 2A2IA 2NWSA 2X7VA 4CD6A 1ENUA 2P5NA 2VEKA 4IJBA 3DC8A 1KCZA 3OLIA 4LFYA 4N9CA 3KOWA 3BZGA 2FIQA 3T40A 4YTUA 3ZS4A 2RJHA 2ZRYA 4XKYA 4DUXA 5JH2A 5D2XA 3VXGA 5G4EA 1R3WA 2WLZA 2R1MA 4NL1A 3KFTA 1XISA 3IPWA 2FKPA 1UIOA 1BXNA 5HWNA 2J7HA 3NO5A 1I2OA 1JQXA 2YBTA 2PDLA 5AHEA 3DHDA 3TYAA 3H7VA 5DBUA 2DORA 1US2A 2NX9A 2O92A 5I3GA 1W1A1 1I9CB 3C0SA 3GIPA 4D6CA 1WOAA 4Q7BA 3M4HA 4HQVA 3R1ZA 3EOSA 4JTUA 1B3VA 1KRCC 3BCDA 4GNJA 3GNRA 4HCLA 2BGSA 3GG0A 2J7CA 3H2AA 3LI0A 4U10A 2HS8A 4XUYA 4XVEA 2QCDA 4HYVA 3MB9A 2TPSA 3GUGA 3D6NA 2PWEA 4G6CA 1F4AA 5A94A 3REQB 5I77A 2CESA 3WLOA 1UD5A 2G5WA 1W5PA 3TCSA 1N8WA 3NURA 1E1CA 1X7FA 2CBVA 3PBYA 4O57A 2IKJA 2Y2WA 2F6XA 3WQ8A 2E6DA 4H04A 3PNZA 1RAKA 3I4KA 1NP0A 2YYUA 1CGXA 3UWYA 1HTIA 3TIMA 3SGUA 2J6XA 1HIZA 1NSJA 3EXTA 4DUVA 4C1LA 2PDIA 2Q3OA 2WMIB 2WZTA 4G1KA 4ZMGA 2NVCA 1CLKA 2EJAA 2WC4A 4Q8MA 3V35A 2YW4A 3WH5A 4UTUA 2EKGA 4OV9A 3UJ2A 3FA3A 3M9YA 3GXDA 3K4WA 3KW3A 3KTCA 4GQGA 4C1NB 2B7OA 1V0MA 2VZVA 3R5EA 3HN3A 2FTWA 3HF3A 3FOKA 4W7UA 4F8XA 1MZHA 3WKZA 1QNRA 1I8JA 4MUPA 4HN4A 5G4HC 1ZCCA 1R87A 3S2CA 1F74A 4GZJA 4CN6A 1FWCC 3QHOA 1H61A 3MI3A 4DWSA 3BE7A 2DZVA 1VFSA 2A7RA 1B0IA 3VM7A 3M7WA 3HJEA 3N18A 2VFDA 4KETA 2INFA 3GBDA 2NV1A 1P43A 5IM51 1VHCA 2QF8A 1AJZA 3DI1A 3PPHA 4MNKA 4U31A 5CCZA 4WD0A 1TMLA 3ELFA 3TLQA 4Z0JA 2XYLA 3T05A 2SFPA 3M0VA 3MU7A 4ZBCA 1XSJA 4CD7A 1SMDA 2MNRA 5IFPA 3OZYA 2OYMA 1YPXA 3G1YA 4AD2A 4DJFD 3SRKA 3BAKA 4I6KA 2ISVA 3CYVA 3E0WA 3L67A 2XH0A 3WY1A 2WSKA 1MQPA 3C4UA 1AZ2A 3GHUA 1M5WA 3GDBA 1HKJA 2GJPA 4JTAA 3W7HA 3FSTA 5AHLA 4YPJA 4XD4A 1ZBCA 3AXIA 2QCGA 1YLVA 1J9YA 3E74A 4RE0A 2PWVA 4QAWA 4GKTA 4AMCA 2FGZA 1ZP4A 1VYRA 4IQJA 1K4HA 2YJQA 4IGMA 2VKZG 1OF6A 1GVFA 4XZBA 1H2JA 3DG3A 4D8LA 1CCWB 3VIJA 2WSQA 4QTGA 2PDFA 3ITVA 1SZRA 1XC6A 4WK9A 2FB2A 4B5WA 3PSVA 1TZ7A 2CLIA 4NASA 5K4XA 1BTCA 3C86A 1JXJA 2DPEA 3L2MA 2BY2A 2JK2A 2TYSA 2OXNA 1L6WA 2XG9A 1JVNA 3UETA 5CZJA 2B4GA 2A3LA 1UWTA 3NOEA 3O63A 4GBUA 5E0CA 3W7NA 1DIEA 4UNKA 3ARPA 2VX6A 1LQAA 5HMEA 5A3HA 1E5NA 4HB7A 3SBFA 4R5EA 5M17A 3AXMA 1OY0A 1EZ2A 4UBPC 1D8WA 2OR2A 3OYZA 3W38A 1KCKA 4PEEA 1DIKA 1H62A 4AB4A 1OFDA 3T0DA 1Q45A 2BY3A 3FKKA 3N17A 3QV9A 4WVXA 1FWRA 1JUKA 3C52A 1HVXA 3NQ8A 4G7EB 4JEQA 3T07A 3W7QA 4EVZA 1TRDA 5REQA 4MY9A 4DZAA 4HOWA 4QJ5B 1LUCA 1OG6A 4WXYA 2YA0A 4R9XA 3MJYA 5DMYA 1Y65A 4HJFA 4LJ3A 2V82A 5C2CA 4ZO7A 3S5YA 1QATA 1JAKA 2YDSA 3STEA 3W1AA 3AMCA 1RPXA 1ISZA 4GG9A 3IIOA 3KTSA 3H7RA 3NOYA 1M03A 4V15A 1XD1A 1DJGA 7XIMA 2CLMA 3M0ZA 3KDOA 2H3BA 2PU1A 3U4FA 4PUMA 2VR4A 3LCWA 3MW7A 1DXIA 4IPJA 1NDYA 1KM4A 2PPGA 3V0TA 1F4HA 2DSZA 1TX2A 3R13A 5I5RA 5D4YA 4NZ3A 3RX3A 2Y0FA 1BXBA 3G2GA 1K7EA 2CHOA 1PWLA 4GZEA 3TONA 2P50A 4TXEA 3DH7A 3WLIA 3DN5A 4BWLC 5A6BA 2O55A 2NXIA 4O1FA 4OBRA 1KTCA 2Y7EA 3F7JA 4B3KA 1XLBA 2QV4A 2PDXA 2OWCA 4LVBA 1WBHA 3R8HA 1NFGA 3S1WA 4YYFA 5ECUA 3CZJA 2ISWA 2OLHA 2E28A 3RM4A 1CB2A 3MZ2A 4CCCA 5IRPA 1EFZA 4DXVA 4TX6A 1M53A 1UZDA 5I24A 4UMCA 2CXGA 4UOQA 2PWUA 3E9AA 4A4AA 3LOTA 3MMDA 1UMYA 3CHFA 3G6MA 1ZJHA 1MEWA 2GSEA 5DCDA 1BF6A 4DZIA 2A3HA 4EWND 3MUCA 1US0A 4CN4A 3TJLA 4B3LA 3N4AA 4P8WA 1Q66A 4JNYA 3BOLA 5CAHA 3FGCA 3I4EA 3RDKA 4TMCA 3H2CA 1E9LA 3W1XA 3W1QA 2WOQA 1JRCA 2RAGA 5MKGB 4NZ4A 3K8KA 1J4EA 1E0XA 2HE5A 5KMYA 2OSWA 1QWGA 4HGXA 1Q6FA 2O7QA 3MUZ1 1FCUA 4JN7A 4JBRA 1Z48A 3C56A 1XLIA 2W92A 4LCSA 1PTDA 1QJWA 3GWQA 4K8HA 4WCJA 3EA2A 4HTYA 1H4PA 1M1BA 2BY1A 4RX0A 2ZX5A 1I1XA 3BXWA 4IGSA 1UP2A 4C6NA 3S9IA 3IANA 1XW8A 1E5JA 4F0MA 1S5VA 4LYPA 4M80A 1K3UA 3IK2A 1YDOA 2QNEA 4KFNA 1UR3M 2AL1A 3VX1A 5G1YA 3LDVA 2GK1B 3Q45A 3MBFA 1HL2A 2V5BA 2HVOA 1GVOA 3ARVA 3MCMA 3LNMA 2Q3RA 2OELA 2CLLA 3HU7A 3TE9A 4TV6A 3VU2A 3HG3A 1TWSA 4JX5A 3FIGA 4GFSA 4EK7A 4RE4A 1V93A 1VFOA 3URQA 2XIMA 2AMGA 1KFWA 3ZJKA 4BI6A 1NWUA 1A0EA 4YN5A 2VUNA 4AF0A 2XWEA 5AB3A 3DKLA 3MMTA 1P0NA 3W72A 1UOZA 4GYFA 3AHXA 4TUFA 1QW8A 3L4VA 1DE6A 3GU9A 1ZENA 3AUJA 1VCGA 3FXYA 3VIFA 1OD0A 3AICA 2IXVA 3HOJA 2ABAA 1NWSA 4FPSA 2VURA 4XVDA 5H1WA 1M7XA 3T42A 1IZJA 3U48A 2J62A 3BARA 2G37A 4GH1A 2CHRA 4GNVA 2CXEA 3XINA 3WBYA 3BLLA 1O5QA 4GYKA 2YCLA 4NILA 4AHOA 1EPVA 1A5LC 4A3UA 4AIEA 4DYKA 1IR2A 3AWNA 3NEVA 3S9ZA 4FXRA 1IT0A 3OG3A 1PX3A 3WG6A 1FWAC 1MSSA 1PXGA 1UR0A 3DX5A 5C0QA 3CUGA 5F4WA 1P5BA 2V5DA 2A7NA 2W4XA 4BY3A 1KD0A 4EAYA 3VNDA 1Q8JA 4JTTA 1VIWA 1FBAA 3QLLA 2Y85A 3B8SA 2X0YA 4G8TA 3T09A 3GTIA 4PMVA 3PZQA 4H01A 3DFTA 4LOCA 5FESA 1R85A 5M1TA 1IEWA 2PCQA 2GL5A 3GVVA 4CCEA 4CNUA 4GY7A 2VX5A 4O0KA 2D73A 4UTKA 4LAKA 4WY0F 3JRKA 4UQEA 5T8GA 2VDIA 1K02A 2ACUA 3APYA 3GW3A 1W5OA 2HS6A 2TSYA 2ZFAA 3PZVA 2CPUA 1U22A 3TR2A 1TA3B 3AMKA 1PAMA 1LOLA 2OEMA 1FWTA 1EJXC 2PTYA 3D3FA 1QW9A 4LUYA 5LA0A 1AW5A 4LAUA 2YCIX 1QBBA 1X6NA 1K4GA 4JX6A 1RH9A 2PDUA 3HV9A 1PWMA 3T0CA 3WYZA 4C6FA 1PVNA 3W7KA 3AAMA 4GUGA 4H7VA 3NVTA 1TZ9A 4FB7A 3HPAA 1EOKA 4I9JA 1EA0A 1JDEA 4RPPA 3WSUA 1B30A 3EMQA 3KRBA 3H7UA 4NQ1A 4B5UA 3DGRA 5C2XA 3WH8A 4LVDA 5HJYA 1QW7A 4FOKA 4HNNA 1AZ1A 2PTWA 3NZPA 3TNOA 2VTFA 1OCNA 3GU1A 3RLUA 1WDWA 2E40A 3ID7A 1XL9A 3L68A 3VDBA 4W8BA 4N9BA 1YE6A 3O0KA 1I1WA 4XBKA 1S5NA 1KQZA 2DW7A 3M0LA 1JYVA 1UWSA 1SW3A 2BHZA 3H53A 4L6DA 1DXFA 1WZLA 4IFRA 3GAKA 4ASTA 2VDHA 2J75A 4JZ5A 5KZDA 4S39A 3B9OA 3RR4A 4IX0A 4ZE4A 1HKKA 3R11A 5I07A 5FF3A 3K2GA 1WE5A 2ZVIA 3KRZA 3ZIZA 3S1UA 1T8XA 2ZUMA 7CGTA 4MNLA 5D30A 4FNPA 5I0DA 2CLOA 4UNIA 3A4JA 4QR6A 1XG4A 3V75A 3WQ4A 1EEXA 4BA0A 1CXEA 1AQFA 2GPTA 2BOFX 4DJDD 5D9OA 1HF6A 2E4TA 4AYSA 4EE9A 2PDBA 3EZ4A 4W5UA 1RK5A 3JZEA 3EWZA 1D3CA 3WMCA 4O4WA 3AIWA 2A85A 5T9CE 3GNOA 4AG0A 2C1GA 5HXMA 1VEPA 1RHCA 3FK4A 3PP7A 1FQ0A 4M1RA 3GSMA 3VGDA 3ZJ6A 4HVXA 2ZOXA 2CKRA 1E55A 1FWEC 3E0FA 1TVLA 4DLFA 1TJ2A 4QDWA 4GXMA 2VR2A 2B0MA 1PSCA 3S1GA 1OYBA 3N04A 1RBAA 3BJTA 1PX8A 1FCBA 1SVDA 2LLEA 1KA9F 4CU7A 3S5SA 1WAWA 3G3DA 4OKDA 1TJ1A 4ZFMA 1QRQA 1W3JA 4PEKA 3PANA 1IEQA 4HNCA 4H3DA 4F0RA 2W3ZA 1CECA 5LA1A 2ZYFA 2PBOA 4J2PA 2IS7A 3AMDA 2V2HA 1YXDA 1Z6KA 5BROA 5I09A 4WKHA 1UP3A 5HULA 3NQMA 1CGWA 4V2XA 5GJNA 4ZB0A 3NFUA 5IFTA 5M2FX 2G8ZA 4Z17A 1R9ZA 1UKTA 2Y5SA 4DRSA 1E6ZA 1QNOA 4MAVA 1WZMA 4O17A 5TBOA 4C90A 4IMDA 2BOEX 1G7UA 3FXGA 3C8NA 2D0GA 1GJUA 1JD7A 4HU0A 1NAL1 3UY7A 3QV8A 3GDRA 3S1VA 2CZ5A 2XN0A 4PN2A 1KWKA 1XGDA 1ZJBA 1C93A 1W9PA 2YYTA 4Q8PA 3LQGA 3AS1A 4L6HA 3LCIA 3VIMA 1OHLA 1KCXA 3H2NA 2QDHA 3KM8A 1FWBC 2IW0A 3WLJA 1YPFA 1T6MA 3IIXA 3SCWA 3M0IA 2DIEA 3GNNA 3AHVA 5AC8A 3PR2A 1BYAA 1UOKA 4HNTA 4O14A 3JW7A 4ZTYA 3AQUA 4DO5A 3VMPA 4LX4A 2QCMA 5CGTA 3TSBA 2RFGA 3BAWA 2R24A 2ZZ3A 3V16A 3L65A 4C6LA 4Y8FA 3S6TA 5CJ5A 2V38A 3NZGA 4DX3A 1JGIA 4EXAA 1JDAA 1Q4WA 3ITTA 3E96A 3RRXA 3UR7A 3GNPA 1TIMA 3F4VA 3MA8A 3TAKA 3ES8A 3ZSTA 5CC7A 2CLPA 3V7PA 3N6JA 3P82A 3WJSA 4YS1A 3A4XA 4AD4A 4BK9A 1YTKA 4JIRA 2W9MA 4MHBA 4AUBA 4PUDA 4U2ZA 3ZR4A 1EC9A 3GXMA 1DWFM 3OYXA 2DZPA 3UJEA 4OE7A 1R2TA 3N4FA 3ARSA 3BLPX 3EX4A 3S2MA 4A05A 4L1GA 4B92A 4HU3A 2NX3A 1EJTC 1CXIA 1J11A 4L1WA 1T8QA 2H8ZA 4CEUC 3R0UA 3GIQA 3PZIA 4E8GA 1C7TA 2WXDM 3NYDA 1W32A 2QMJA 3E5PA 5FJIA 2GJNA 3RLHA 5ENLA 4MDPA 3PBMA 4O52A 5EGRA 4JX4A 1ZFJA 3V3WA 3BICA 1A5BA 4MJMA 5FACA 3AC0A 2F9RA 2ZX8A 2P0IA 1UG6A 3H70A 1YDVA 5K2ZA 3BLIA 1CGVA 4ZR8A 1ZRQA 3HPFA 4JTHA 5CZ0A 1E6XM 3M7SA 4J3XA 5SWUA 1GJPA 4HMEA 3SI9A 5CBJA 3ABOA 1EXPA 2E7FA 5AYYA 4O4VA 2L5HA 2FGLA 4IUOA 1A5KC 2Y24A 2RJGA 3TQ0A 2I5IA 1H7XA 4Q8UA 3SAZA 2E5BA 3P67A 5FAJA 3C2EA 1AG1O 1DJZA 1LLZA 3L66A 2AGTA 3WDPP 5F4SA 4TQTA 4QQUA 2WWDA 4IQLA 1O60A 4NZ1A 3NDZA 5DXYA 3VNLA 5FL1A 5I03A 5DY3A 4L7ZA 2WMFA 3DG6A 1GGOA 4H6QA 4HP5A 2QCDB 4CVWA 4ICCX 1W5QA 4JY9A 4FX6M 1UBSA 4GQ0A 4ZA0A 2F8QA 1XH1A 2TMDA 2DFAA 4S2CA 2OFJA 4IT1A 1DE5A 4QITA 1OBAA 3GDLA 3QQWA 1DBTA 3KZSA 3EOUA 4KS0A 3QY6A 3P6LA 4IGNA 1RJPA 5HK4A 3UWUA 2XWDA 3TJXA 2C79A 1MUMA 4M0XA 1QI2A 1UKQA 1RP9A 3B8WA 4ILSA 4E2OA 2ZRZA 3KCOA 4KCTA 5I79A 2A0NA 2EXOA 5JBEA 5LA2A 3G0SA 3VKBA 2B81A 3GC4A 4AY7A 1W17A 2XIIA 4UQCA 3M0MA 4GI4A 3O9NA 4CNTA 3O8AA 2XGBA 3APGA 3ZJ7A 3LRMA 1ZL1A 3GHSA 3PJTA 4K38A 2GQ3A 2YX0A 2ZA1A 3H2EA 1BYCA 1UWRA 3ALGA 3TJ4A 1QK2A 2OZTA 1GQKA 2F6UA 3CWNA 3CTTA 2QHAA 1VIZA 4BR1A 1L6SA 1IEVA 4ZEPA 1QU4A 2FZ8A 3SCTA 4AZ5A 5AKQA 4KRTA 4CQAA 3WLQA 5AN7A 1WDSA 3KL0A 3PWIA 3N9KA 1ITQA 6XIMA 3APTA 4RNHA 1DJWA 3WF4A 3EPMA 1JZ3A 3P8IA 1IYXA 2XISA 2OGJA 3CAKA 3C3UA 3FAWA 1BAGA 4I5XA 1LORA 1XS2A 2PLKA 2XGIA 2EPKX 1RLCL 2NUYA 4M6PA 3WNMA 4LAMA 1RD5A 3E5BA 1TFVA 2ACSA 2Z7GA 3SSJA 2X40A 4ZE5A 3SEPA 1GOWA 1NDWA 1WKDA 2INEA 4KESA 1RCQA 2GGEA 3WL1A 1TREA 1BSIA 1XIGA 4GI8A 1KM6A 4X0VA 1GQIA 2JFEX 1GQLA 1TSIA 1A47A 1P0EA 1TTJA 5E6YA 4GX9A 5AHFA 4OOUA 3IARA 5AC6A 5DFAA 3ZT5A 2F2KA 1BF2A 1SZEA 3UGRA 2JIWA 2V9DA 3ZSSA 4K7YA 3LV6A 3CM4A 1UWAA 2V81A 4ENLA 2QVNA 4PMQA 2I16A 2VGIA 2J7EA 1H7RA 3USBA 4D6DA 1PKMA 5I2UA 2ONEA 3F4DA 3CTLA 4FNTA 4IL0A 2YB1A 4OJYA 3W53A 2OQHA 1KXVA 5MF5A 2RDUA 3DFYA 5GNXA 2WYSA 4K36A 2CWXA 1W1ZA 4YLWA 3EYPA 1LLOA 2FHCA 2PCEA 1EDQA 4GISA 3F4CA 1FWHC 1G4SA 3LXCA 3CC1A 2PGWA 3NQBA 3B04A 1JYXA 2WQDA 3WNPA 4GCXA 3CYJA 3WUEA 4GH3A 1UC5A 3VOJA 2VEIA 4Y7EA 4NZJA 5PTDA 1W56A 1HVQA 3HQOA 3E1F1 1TVNA 1SO5A 4WDWA 1KFKA 3HPXA 1XIFA 3CMGA 4XWUA 1SJCA 2ISSA 3S2JA 1ZJAA 1L6GA 4PMZA 3QW4B 4JTFA 4PBEA 3R25A 3EKZA 3SRDA 5LNRA 7A3HA 2ASHA 3VD4A 4G56A 3GFZA 3UWWA 4NI3A 2VC9A 1O5XA 4B4FA 5EY5A 2Y89A 1J0KA 4AHPA 3K30A 5TIMA 1E4NA 4I7WA 5D9PA 5T91A 4V27A 3I10A 3OOQA 2INZA 4PODA 1B1YA 1R3RA 5CPSA 4DLMA 2QF7A 4AY8A 3A21A 4QG9A 1Q2RA 3H26A 3T4WA 2A1YA 5AC5A 2GSJA 4ROQA 2O0TA 4JCLA 1KC7A 2E6FA 3VNZA 1V6UA 2VO5A 1W1B1 4TVDA 3R58A 3BG5A 5LIWX 5ABFA 3U5YA 2VOMA 3GLCA 2VM8A 4V1XA 1R9XA 2CZEA 3JVAA 3W23A 2HNHA 2REQA 5ABGA 3SECA 4M6UA 1YBQA 4MFEA 4LBSA 5E1QA 1UH2A 1YIXA 1K8ZA 4QJ1A 4HA0A 3DAQA 3MSYA 3HGJA 5LIKX 4S23A 3HPSA 2WZIA 3DFHA 3IJ8A 1OM0A 1SO4A 3OEXA 3A9IA 3S5NA 3WLPA 1PUDA 1IT8A 3GDMA 1ONEA 4JL2A 2FH8A 1ZGDA 3GG1A 4CD4A 1HJUA 3BJSA 3MANA 1F07A 3WD0A 3CAQA 4L61A 4RNIA 4DBUA 2PEVA 4A22A 2DY3A 5HUOA 5K7JA 1S2AA 1TV2A 2WO5A 1YNPA 1W9UA 4PMJA 1DJHA 4HOXA 2FMNA 1EHAA 4GYPC 3GDTA 1AA1B 1CENA 2VX4A 2ADAA 5H91A 4MYAA 1QOXA 2FVKA 5J5RA 4NI8A 1Q13A 1XLGA 1ZALA 3CWHA 1JUBA 1A5MC 3VIHA 3PK7A 3D3AA 2C71A 4DIAA 5FSDC 5D9MA 3RJYA 2PODA 3G24A 1WZAA 1E3XA 3LM3A 4AZHA 1PCWA 2YL5A 3NL2A 2FPVA 3VD9A 2ZC1A 2UY4A 2HK0A 1J0ZA 1VJIA 3WQWA 4WJ8A 1Q5MA 1H51A 3DDMA 4NZFA 4RKAA 2CNCA 4FSAA 3VIOA 3KBWA 3TYZA 1JPKA 1E6SM 1JDDA 1VBHA 2VL4A 3WD3A 1J8VA 3G1FA 1I2RA 1U2YA 3WDRA 4EXQA 1US3A 3RCMA 3KVMA 3T2QA 1NWRA 3CZLA 1Q6LA 3KCJA 1TUFA 3N2TA 1GTEA 1SPQA 4NYUA 3W83A 3PJUA 3OVQA 4TU1A 4LVAA 4WQ6A 1OF8A 3EDDA 3PS7A 4QNEA 4L9YA 4BQ2A 4HU4A 1BWLA 4O28A 2JALA 3PBGA 3SN4A 3HQNA 1E70M 4PMUA 3ZYZA 3W71A 2JGYA 5A8NA 3ZXWA 2R91A 5LIUX 4BJHA 3QMTA 1ONWA 3ATZA 1HP4A 4G7FA 3T2PA 3QGVA 1CGUA 3GC2A 3ZQ9A 1NM9A 1BKHA 5CH9A 3A22A 1PIGA 3J7HA 4TOQA 2ODOA 3V0UA 3AXXA 3CB8A 2WMKA 3N2BA 4E4UA 4GHRA 4FLRA 1A3HA 1DJQA 3WLKX 1B54A 2BBFA 1WB0A 3VNMA 3UPBA 1E51A 1VR6A 1OVDA 3GM8A 1Y8BA 4FHAA 2PRHA 3QSRA 3T55A 5FL0A 2Y8KA 1HQTA 2TODA 5EBAA 2OJPA 4Z1AA 2HBVA 1VBJA 4PCNA 2J6VA 1A3XA 2BXYA 4LAZA 5EMLA 4AF0B 5TD4A 3H55A 5L6UA 4MAZA 4H8HA 1TR1A 1H7PA 3UXAA 2ZE3A 1LBLA 1OFAA 2I1OA 1XYAA 3OLGA 4BWLA 2QCEA 4GBDA 4PMYA 1JCMP 1KM3A 1ODUA 3SCQA 1CGYA 4Q8WA 1IWAA 3G8RA 2DVXA 2O9PA 2XPKA 3VZZA 1D3HA 5FEZA 3QHNA 3VNIA 4EXBA 1FXPA 2CZDA 2Z2BA 2BX7A 4AWTA 4UFMA 1Q6EA 5HJXA 4AFYA 3Q67A 2R1LA 1M7OA 4TO8A 3MPGA 3ISIX 2F7FA 3L4YA 3QV7A 3WK1A 3CH9A 1C8VA 4H41A 4JGDA 4TTGA 4M29A 4LYRA 3UPMA 3WF3A 1NP2A 1HG3A 5K4ZA 3IAQA 4ZVJA 4DJEC 3B03A 4N6FA 3CH0A 3GY1A 4JDBA 3Q37A 1XLEA 2YOCA 2AQVA 4IWWA 4NAFB 3MSDA 4GVIA 4GVFA 4FR6A 3BURA 4YWIA 3USZA 1HGYA 3PAOA 4QIUA 3KTXA 2EG8A 1EBHA 4NNCA 1EYWA 1TX0A 2Y6ZA 3KLKA 2RUSA 2GQ9A 1YQ2A 2BS9A 1X7IA 1FWJC 1Q6GA 3JUGA 3E3HA 2WZHA 4LGXA 5BU6A 1TPEA 3F4WA 4R7OA 4MWAD 2VRKA 1XYMA 2I9UA 5AYZA 2BFGA 1OK4A 8RUCA 1PHQA 2V3FA 4KWWA 2VQTA 3WF0A 1L8NA 5BCAA 1PZ3A 3BCJA 3BANA 1TPWA 3G3MA 2AOSA 3RILA 2WW5A 3P5YA 3MC5A 2DT3A 4NVTA 4J28A 2OCZA 2QCFA 1XBXA 1XH2A 4HSOA 1QO5A 4I9MA 1KFBA 3ZVHB 1EGMA 1ZNNA 4JDYA 3HFYA 1QPNA 4PFHA 1F3XA 4GACA