3U5YA

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
501
structure length
470
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
molecule keywords Raucaffricine-O-beta-D-glucosidase
total genus 174
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u5yA00
1J0IA 4Q7NA 4RE3A 1L8NA 3CIVA 3VGHA 2J75A 3VNYA 3TONA 1IZJA 1BHGA 1EIBA 3II1A 1HN1A 5BYWA 3CUGA 4KRUA 1JYNA 4QLJA 4Z2JA 1OD0A 6CGTA 2J4GA 4TUFA 3WF2A 1XRVA 2WZIA 1LLOA 1NWRA 2XVLA 3GNOA 2FHCA 1E5NA 1H4PA 4DWSC 2BXYA 1QHOA 4CUCA 1E6PA 3QHMA 3ARVA 3S6TA 3NSXA 1EHNA 4P7RA 2RGMA 1CGYA 1W9DM 1NWUA 4P7NA 1UKPA 1UWSA 2VURA 3AHXA 2EPOA 1EGZA 1ODUA 2WVTA 2DIEA 2NT1A 8A3HA 1M03A 3FAXA 3LPFA 3PN8A 4X9YA 3EMCA 2DSWA 4PCTA 2ZX6A 3THCA 4CVWA 5IDIA 4AXNA 1DWHM 1GVIA 3CGTA 4Q22A 2PBOA 1VEMA 4KGLA 3OZPA 3WDIA 8CGTA 1AQMA 4YHGA 2WKGA 3ZJ8A 4Y7EA 3WEOA 2YLAA 2WAGA 1BVZA 3GH7A 2VQUA 3GNRA 5ABGA 1CIUA 2YBUA 1IV8A 1CGXA 3NJ3A 2ZX9A 4A3YA 2VQTA 2BVYA 4MDPA 2UY2A 3VDBA 1MW3A 1Q6EA 1U30A 4JFWA 3WQ4A 3WMBA 4JIEA 3AICA 4WIWA 3KZSA 1ESWA 1EH9A 2WHLA 1W32A 1TA3A 1KCLA 2ZUWA 2MANA 4JKMA 2BFGA 5I24A 3PZOA 2D23A 3WD2A 3CUHA 1DTUA 2D24A 1M01A 3OLDA 1LL7A 1ZBKA 1OGSA 4PMYA 1WNOA 2YLLA 1XGZA 1PAMA 3WFLA 2QHAA 2DH3A 3ARRA 4DUVA 1E4NA 1SR0A 4ACYA 3RJYA 2G3JA 2QPSA 4TTGA 3WH6A 3B9DA 3J7HA 1CLXA 1E6ZA 3VVGA 5GNYA 3N17A 2D20A 1XH2A 2CKRA 2J7GA 2D0FA 4AD0A 4EKJA 3O2LA 1LG1A 5HNNA 3TOPA 1EO5A 3RCNA 3A4XA 4AD1A 2GJXB 3U7BA 3U5YA 4PCSA 1BSIA 3W28A 1V3LA 3AZTA 3T2OA 1UD5A 3AIBA 3WH9A 3UEQA 4ZXLA 1GJUA 2ZXAA 1BG9A 5CG0A 3AHYA 2W66A 2GJRA 1CXKA 3ZT6A 1WDSA 3WF1A 1ZL1A 5BXSA 3BC9A 2VZUA 2F8QA 5A2BA 4Z2HA 1NOFA 1W9XA 1FH8A 5JIPA 5M3WA 1DHKA 3W81A 2CERA 4AZGA 2BHUA 1XC6A 4JKKA 4J28A 4U3AA 1AVAA 3BMVA 3AZSA 2QLYA 1J01A 1BYDA 1RD6A 4RE4A 4OBRA 2ZX7A 1C8QA 4CKQA 4D6FA 2ZIDA 4B3LA 2DT1A 1W1TA 4JFUA 1Q6GA 5CPSA 3KEHA 3EMQA 1H1NA 2WMKA 1HT6A 2FHFA 3WBEA 3PTMA 3W0KA 2ZWYA 3D5HA 3T2QA 2EPLX 1B3ZA 3WQ5A 5KEZA 2QMKA 1Q6CA 2YKKA 3WF4A 1JIBA 2PWGA 4GINA 5DMYA 4UQCA 4PEEA 4ATLA 4M24A 1BYAA 3VNZA 1CYGA 3AISA 2WC3A 3WDHA 2GSJA 2E9LA 4AZHA 3HN3A 4E4PA 2VNCA 1MQPA 1KR0A 2YOCA 5D9PA 3RO8A 3SUUA 2W5FA 1W9VA 2VX4A 4PYSA 4RE2A 4M56A 3CHFA 2BY3A 3F4VA 1VF8A 1FHDA 3W37A 3QR3A 5AYIA 5CQ1A 1V3HA 4AEFA 2W91A 3SCTA 3CZKA 3T09A 1QOXA 5ABEA 3W53A 3DHUA 2VX6A 4DWSB 1WZKA 1PX3A 3PZIA 3A3HA 5FL0A 1NQ6A 2JEPA 3WMCA 3O9NA 4URIA 3KL3A 2XVPA 4J27A 3SCPA 2CIPA 3N1AA 4D72A 1UKSA 1R7AA 4TVUA 4HZ8A 5A6AA 3BSHA 1C93A 3K1DA 2V38A 4DM2A 1QNSA 1CDGA 5GNXA 2ZUNA 2PB1A 2AOSA 1GQLA 5LA0A 5JBEA 3MMUA 1K6AA 3WFZA 3VDAA 4KWUA 1UKQA 4MPKA 1US3A 4NSBA 3WH7A 4QP0A 5IHRA 1H49A 4P8WA 2OYMA 3WSUA 4W7UA 3RIKA 1LWHA 2OYKA 1HF6A 1E6RA 1CGWA 5JBDA 4UQEA 3AXHA 1RPKA 3BMWA 5AYBA 4U31A 1OGGA 3EYPA 1GOOA 1HL8A 2D1ZA 3UCQA 5A94A 3FY1A 1HKJA 2GFTA 1WDRA 3SUSA 3VGGA 1W1PA 3WD1A 2XVNA 3CZLA 3CZEA 3HU7A 3ARPA 2X05A 4PRWA 3FAWA 3LMYA 2ZUUA 3RDKA 3WNMA 3WMSA 3NSNA 2X2YA 4AMCA 1BF2A 2W62A 1YQ2A 5D9NA 5CLWA 1K9DA 1GHRA 2QV4A 3CUFA 3U5UA 5A2AA 1HJUA 2Y24A 1QNRA 2GDVA 4PMDA 1C7TA 2VUYA 3GZAA 3VM5A 3OA5A 4OIFA 1FFRA 1TA3B 3UG3A 3VGDA 3SCVA 3THDA 5E0CA 4C7GA 1MYRA 5E6YA 1UD3A 4GO8A 4YN5A 2VCCA 3WENA 5A8OA 1Q4NX 3AROA 3SCWA 3L4VA 4UZSA 1JZ4A 3BAKA 3IJ8A 1JYXA 4JKLA 3RILA 4HPHA 1CGTA 4S3JA 1TZ7A 4C7DA 3WUGA 4TVDA 1DP0A 4B16A 1NWTA 1LL4A 2OSYA 2XFRA 3BAYA 1K9TA 4H41A 2JF6A 4PSRA 5FD0A 5D8WA 5M03A 4C7FA 2YL8A 1OWQA 1ISZA 5A3HA 2Q8XA 2JIWA 1D2KA 4CGTA 1PJ9A 7A3HA 5A8NA 2WHJA 3F5KA 3CZ8A 3WEMA 1CXEA 5FL1A 4OJYA 3AMDA 2J8FA 4WLCA 4HTYA 4W5ZA 2VR4A 3VIIA 1GOQA 4NRSA 5AY7A 4XUYA 4GZEA 1UQYA 3CMGA 2DT3A 2UWFA 4CD4A 1ITCA 1X6NA 2O92A 5AC4A 5LA2A 3L4UA 4PBGA 4UQDA 3WNPA 1DEDA 2J79A 3BAXA 4MNJA 3VILA 2OWCA 5LYRA 3A47A 1QNOA 3ARTA 4AEEA 4FMVA 4AIUA 3WUBA 4D6JA 3I3BA 3SCUA 4TX6A 1W9BM 4AZ5A 2ZUMA 3W4RA 3AHVA 2PWHA 4PMOA 2CBVA 5EBAA 1E72M 2RGLA 5E0FA 3MO4A 3L4YA 5BXPA 2CBJA 1EOMA 1VJZA 1VJSA 1JZ2A 1H5VA 1A47A 2J7HA 4OZOA 3RM8A 5F7UA 1WDQA 1UA3A 4XZBA 4ACZA 1MFVA 1JAEA 3IJ9A 1HJWA 2X0HA 1KR1A 1H0IA 2QF8A 2X8RA 5D8ZA 3VIHA 3VINA 3IK2A 4DM1A 3N04A 2XG9A 2VX5A 1QBAA 3WQWA 5A69A 1KXTA 1E6QM 2J47A 4NZCA 4J3VA 4HOXA 4JL1A 1PPIA 3FN9A 1L0PA 3ARWA 2WSKA 1BYCA 1FA2A 1ODZA 3WQ6A 3L4TA 1QHPA 3BXWA 2OWWA 4HU0A 4M81A 4UTFA 2XGIA 1E1EA 3PTKA 9CGTA 1KCKA 3CHEA 1UZ1A 3AMLA 1KQYA 1W9UA 1WP6A 2WPGA 2E0PA 4BQ2A 2V3FA 4JFTA 4JL2A 5JIWA 3TTYA 3U7VA 1JNDA 4E8DA 2PC8A 4NI3A 1V0KA 4AC1X 4Z2IA 5IFTA 4HA1A 1Q6DA 3ARSA 3TTQA 2YA2A 1E0VA 1IT0A 4P8XA 4PMVA 4UFMA 3POHA 3T08A 5BXTA 2WWDA 2CPUA 1GJWA 2W61A 4LYPA 3WD0A 4W89A 1F4HA 1UH4A 1ISYA 2G3MA 4TTUA 5A1AA 1H41A 4M8UA 3VD9A 4CN6A 2GK1A 3VDHA 5HOSA 1K9EA 3ARZA 3BAJA 3EDJA 1ISVA 3EDDA 1TFVA 3B9EA 4EAMA 4BQ4A 3GH4A 1FP9A 3VMPA 3RJXA 5DFAA 2Y4SA 2Y8VA 1HJXA 5A8MA 2ZXQA 1CZ1A 4D6CA 2E40A 4MAZA 1H2JA 3IANA 4CU6A 1V03A 1HVQA 1UD8A 5CJ5A 5DF0A 2O9OA 2OYLA 3BLPX 1V0MA 5FKYA 3PZ9A 1UZ4A 1DWIM 3N13A 2JE8A 2J7DA 3CZGA 4F79A 4IPLA 3ZJ6A 3CZJA 5AC5A 1RP8A 4JZ5A 3WN6A 3WDQA 4P8VA 2Y2WA 2PF0A 1TMQA 4AD2A 2GJPA 2BNJA 2J8GA 1JD7A 4ZE5A 3MSGA 4H2CA 5DO8A 2WSPA 4F9JA 1CTNA 3OLGA 4EE9A 1GQKA 3M6DA 1UR0A 1LJYA 5D4YA 3OBAA 3N15A 3A4WA 4UOJA 1CPUA 2CETA 3VD4A 3AIQA 1VFMA 1MQQA 4LX4A 5I6SA 1TVPA 5A95A 4M80A 2EO7A 3W26A 2WMJA 1M53A 3FW6A 5A8PA 4W84A 4KGJA 2XSBA 1UA7A 3VIKA 4BA0A 3MMWA 4U2ZA 3IAQA 3BAIA 2X09A 1WCGA 1SFSA 2D3NA 2XSAA 2ZUVA 4CD6A 3W29A 3AHZA 1FOBA 5I23A 2V5CA 2BXZA 2DT2A 4MNLA 1E6NA 2XJ7A 4M82A 1JZ8A 2PWDA 1JFXA 2PBGA 1Q6FA 1XD0A 5HDRA 2XVKA 2VZTA 1GHSA 5CZKA 3AFBA 3WQ8A 3L4XA 1CXLA 3WEZA 1LQ0A 4GPNA 4H7VA 2WMGA 1XCWA 4OUEA 1AQ0A 3FHAA 2C7FA 3M7SA 1WPCA 3IAPA 2VI0A 1W3KA 1VEOA 2XWDA 4D1JA 2Y8KA 5HXMA 4QLKA 4AZBA 4LQ1A 3ZSTA 3WL0A 1UWTA 3VIGA 2FDMA 3DYMA 1TVNA 1G5AA 4UFJA 1LG2A 4A3HA 3W82A 1J10A 5I78A 4B9YA 2V3GA 3AXXA 1JGIA 3WNNA 2XFYA 1QHZA 5ABHA 4U3CA 3AIUA 2D3LA 2ZOXA 3CMJA 1E43A 3F5JA 4LGXA 3AJ7A 4OOZA 5ECUA 1BLIA 4WKFA 4XX6A 2VCAA 1DWJM 4QAWA 1MXDA 2CHOA 3ZM8A 1JYVA 2WCAA 1VFFA 1FH9A 3AXIA 1HJQA 1E9LA 1OBAA 2FH6A 1EQPA 3T2PA 3AHTA 2OWXA 3VX0A 5EFFA 1KFWA 3KWXA 1V6XA 3VIOA 2XIIA 2VRKA 2XWEA 2PI6A 2ZXDA 3WKZA 3SCOA 1V02E 4PTWA 1E4MM 4S3KA 3EDFA 1GOKA 1JF6A 2FH8A 1UR2A 3ZR6A 1E15A 1ZBWA 5CSYA 3T0BA 3VIFA 4AZ6A 1JDDA 4V2XA 3AMCA 1UWUA 2DSZA 4AD3A 1KQZA 1BYBA 3TTSA 3M46A 1MFUA 5I2UA 2YBTA 2WXDM 5CPTA 3VGBA 2XGBA 1PIFA 3VIPA 2BVDA 3SEPA 3OZOA 2VL4A 4XV0A 4F9DA 1J0ZA 2J7CA 3AI0A 1UWIA 1UD4A 4QLLA 1V6YA 2G3NA 3NDZA 1OB0A 4MB1A 3AYRA 1TR1A 4PTVA 2ZX5A 3SUTA 3VKKA 1US2A 4M29A 2ZUTA 3SIMA 1UWQA 2CNCA 1WKYA 4UFHA 1C92A 2D2OA 2C8NA 4MNKA 4B3KA 1HKKA 5JUVA 1E73M 3I3DA 1VENA 1NP0A 3ZO9A 4MJ4A 4N42A 4CCCA 1UR9A 1E55A 3VO0A 2WNWA 3K8MA 4UZUA 3VU2A 1CXFA 2G4FA 5BCAA 4DUWA 2GK1B 1FFQA 3MV11 4GI9A 2XUCA 1UH3A 2ZX8A 3NSMA 1ZU8A 3KL5A 2J7FA 4HMCA 4UR9A 4HOZA 2FGLA 1OT2A 2WC4A 2WMHA 2WCGA 3OLEA 4R5EA 2WC7A 3OLIA 5M5DA 1HP4A 3UG4A 4UQBA 4MTVA 4CU7A 3VX1A 1E71M 5I0DA 4GO9A 3WQVA 3AIEA 3FNDA 2BHYA 2E9MA 1ZBCA 4F66A 4YHEA 1EA9C 4ATWA 5C8BB 4CN1A 1CWYA 2ZUSA 1GPFA 2W63A 2VR5A 5CGTA 1J0KA 3UETA 2QMJA 3PHAA 3AIWA 3NUKA 4MDOA 4W8AA 4P7LA 4F8XA 2OLHA 1UQZA 2CYGA 1FHLA 3K4AA 1S46A 4AWEA 3S2CA 1NP2A 1KB3A 4UFKA 4OKDA 4PUEA 3WD4A 1TCMA 2UY5A 1BQCA 4ZEPA 3WUEA 4D1IA 5I79A 4ZENA 1U2YA 1QW8A 3N18A 1W3LA 3WH5A 4GKLA 1KGUA 2VRQA 3BCDA 4ZE4A 1CEOA 1OT1A 1OCQA 1BG4A 1VIWA 2VJXA 2WZEA 2BV9A 5A6JA 3DECA 1B3XA 3VGEA 2VRJA 1NOUA 2E9BA 3MANA 1LF1A 4ZXOA 1I75A 3OGVA 2EBNA 4P8UA 1V3IA 3HJEA 2AMGA 4FLOA 1LL6A 1GNXA 5CPQA 3JUGA 4UNIA 5EMYA 3WUFA 3O6AA 2D0HA 4U5IA 4AD4A 5E6ZA 5CXPA 1V3JA 5BROA 2J7EA 4WKHA 3GM8A 4AZCB 2J77A 1GW1A 5BXRA 2DH2A 2WHKA 2YDQA 4Z2GA 3VUPA 4A4AA 2EEXA 1O6IA 2J78A 1BVNP 4X0NA 3L2LA 2W4XA 2E8YA 3W27A 1JNEA 4TOQA 4CVUA 1JZ3A 2Z1KA 2WB5A 2J25A 2WBKA 6TAAA 3TTOA 3PZVA 3WNKA 1F4AA 2XIBA 2V3DA 2EPNA 3WBAA 3NYDA 3OGRA 3PZTA 1CGVA 2O9TA 1E0XA 1VFOA 5ABFB 1W3JA 3RM4A 2V3EA 3GBEA 4N0RA 1B2YA 4BCEA 1V6VA 4CD8A 1NM9A 2BHZA 4FLRA 2G41A 2NW0A 1ZJAA 4W86A 2V5DA 3DYPA 1CNVA 4X0VA 2VZVA 3RM9A 1OGBA 2FHBA 4JCMA 1JDAA 3AS2A 3L2MA 4D71A 4MB3A 3ZOAA 3VMNA 3BSGA 3DC0A 1JL8A 4J3SA 2W67A 1VBRA 2WVVB 5FOOA 5EFDA 1EXPA 2J7BA 2YA0A 1C7SA 1GZJA 1XSKA 1ZJBA 2IXUA 3ARYA 2VO5A 2PWEA 1LWJA 1VB9A 3ARQA 2CXGA 3ZT7A 1EDQA 2WBGA 1QPKA 3N9KA 5I77A 3VMOA 4J3UA 1JFHA 1B90A 1WE5A 3WH8A 1H0GA 3AS0A 3WF0A 3CHCA 3GXIA 4JAWA 2CITA 4MJ2A 4H8UA 7TAAA 1W2PA 4HPGA 1KBBA 4PMRA 1MVYA 2GDUA 4HA3A 2D0GA 2VCBA 3VIMA 1E1FA 1UYQA 4FLSA 4CCDA 2TAAA 2FGZA 1AQHA 3FXYA 4GQRA 3OB8A 1UKTA 3CPUA 4RL3A 3AZRA 4W8BA 1J18A 3KL0A 4DWSA 1E6XM 1B30A 2ZE0A 4UQ9A 4EK7A 1V08A 2AAAA 3GXDA 2DDXA 3CBWA 2JF7A 2VTFA 1KXVA 2WZHA 1WAWA 2YDRA 4ZFMA 1E4LA 3MUZ1 3WDPP 3ZSSA 1J9YA 3CO4A 1XHGA 5IFPA 1WZLA 1E5JA 4JHZA 1AMYA 5M17A 1EO7A 1TE1A 2CKSA 5A6BD 1RP9A 4QDMA 5ABFA 4PMQA 3G6LA 1J0HA 3GYCA 3MKKA 1NOWA 1XYFA 1WDPA 3AS1A 3EMZA 1HJSA 4TXEA 2BY1A 2VMFA 5GNZA 2VT0A 4HZ6A 4V28A 4BQ3A 3MUAA 3W6MA 2ZWZA 3SURA 1CBGA 4WF7A 1C3FA 1WZAA 4TX8A 1WZMA 3RMEA 3ZIZA 4AYSA 2JALA 4L4OA 1QI0A 4HZ7A 4IISA 1UKOA 3B8SA 4HMEA 2WMIB 4AY1A 1ZBVA 2X1IA 3UR7A 3WL1A 2Y5EA 4QFUA 1E40A 3BAWA 2OSWA 3E1F1 1HJVA 1QI3A 2EPMX 2WLYA 4J3TA 4IPNB 2NSXA 4AIOA 1B9ZA 1XH0A 1EQCA 1PZ2A 1PX8A 3MV01 5DEZA 1OSEA 3OGSA 1JF5A 3ZQ9A 1H3GA 3ZT5A 1QI4A 3SUWA 1JXJA 1YHTA 3G6MA 1FH7A 4WSKA 2ZICA 4Z2KA 4UOQA 4LPCA 3KE0A 4L4PA 3UG5A 3PZUA 2JIEA 5GQBA 3MSDA 4W87A 1XSJA 2XYLA 1PBGA 3EBVA 3OG2A 4P7QA 5D9OA 4U2YA 1B1YA 3ALFA 3AMKA 4UQAA 6A3HA 2VZOA 1DWGM 1E4IA 4CN4A 5CGMA 2DIJA 3L4WA 3MMDA 2BS9A 1JAKA 3QOMA 4BS0A 3W24A 2A3AA 2BY0A 1R87A 1E0WA 2VX7A 3ZJ7A 3VTRA 2G8ZA 2QPUA 5JBFA 4HMDA 4UFIA 1H11A 1M7XA 4HP5A 5I5RA 1I1WA 1PZ3A 3NIYA 3SCNA 3PZGA 1WB0A 5FCZA 1NH6A 2YL6A 4E2OA 1ITXA 1W91A 3AQUA 4YPJA 3N11A 1MXGA 3AS3A 3K8LA 4MADA 3CHDA 3QOKA 3MU7A 4FF5A 2BVTA 4GIAA 2VOTA 7CGTA 2XFFA 2JEQA 3K8KA 3MS8A 1BPLB 3RPMA 5E70A 1CECA 1GCYA 2OSXA 4PSPA 1W1VA 4AISA 1G1YA 2E8ZA 3GH5A 1J11A 2VVNA 2YA1A 3DHPA 1JG9A 1HL9A 2WMFA 5C71A 2YDSA 5BRPA 1E3XA 2F2HA 4FLQA 1R8LA 5E9AA 2WW5A 5A8QA 1J12A 4PMXA 1GVYA 2WMIA 4FK9A 3A6OA 3SCRA 4J3XA 4U33A 5EB8A 4D6IA 4XZWA 5A6SA 3UERA 1HNYA 2XVGA 2UY4A 3F5LA 1EOKA 2CBUA 3LPOA 5CLTA 5DT5A 4HA4A 5A6KA 1GOMA 5BRQA 1R85A 3WELA 2GJXA 5D9MA 4IUGA 1QI5A 4P7OA 1QVBA 1HXJA 2YIHA 1OD8A 4D6DA 1GOIA 3WF3A 1JYWA 5BWFA 4R27A 3LPPA 1TUXA 1R86A 1VAHA 2WKLA 3MUIA 4PUDA 2EXOA 1H09A 3QGVA 2A3HA 1UD6A 2J74A 4D6HA 2EPKX 3PBGA 4ACZB 1SMDA 3M07A 1JZ7A 3T0DA 1VFUA 3EDEA 2WK2A 3GXFA 4DUXA 1HP5A 2UY3A 3WY1A 1B3WA 1ISWA 1MQRA 2O9RA 3GDBA 5IXEA 1HKMA 2WANA 4JCLA 2IXVA 4BZYA 4BQ5A 1JI1A 1J0JA 1R7OA 3EDKA 3L4ZA 4AZ7A 2DT0A 2YL5A 2E4TA 3VD5A 1DWFM 2WVSA 5A6LA 3WNOA 1C8XA 3OIHA 1W9PA 2G3IA 3AIVA 3PZNA 1UOKA 4OBSA 4W93A 3DYOA 1UR4A 2PWFA 1E6SM 5A2CA 4MB4A 3W25A 1UG6A 2VVSA 4LYRA 1QI2A 3AMGA 1N82A 1XSIA 1CLVA 4UFLA 4WJXA 1JZ6A 1E3ZA 4JHOA 1W1YA 2W92A 4WSJA 1I1XA 2J62A 1B3YA 4XB3A 1UR1A 1KXHA 4ML4A 4UOZA 1RH9A 1C8YA 3BH4A 3ZJKA 1J0YA 3VD3A 2WWCA 4AW7A 1W2VA 1QBBA 2DPEA 3ZMRA 4MAVA 5A6MA 4KMQA 2B31A 2EJ1A 1G94A 1CXIA 3IJ7A 4LXFA 4KRTA 4PN2A 1XCXA 1Z32X 2ESCA 1OM0A 2XM1A 1XH1A 2WLZA 2GVYA 2XPKA 2Z1SA 1GONA 2ZXBA 4W5UA 5GPRA 3PZMA 3K4DA 1B31A 4GI8A 2CCRA 2IUZA 4ATDA 1V6WA 2XTKA 5C70A 1BAGA 2BY2A 1GORA 1KXQA 4W85A 4AIEA 1E70M 1PEZA 1BGAA 1JXKA 4CU8A 3U57A 3POCA 1UD2A 1P6WA 2HVMA 1W3HA 3SCQA 3ALGA 1WO2A 1V02A 4KH2A 5E09A 4PMNA 3VGFA 4DWSD 1O7AA 4MNMA 5LA1A 4W8LA 4IM4A 1C90A 1UWRA 2CESA 3PZQA 5TD4A 3NCOA 3W6LA 2C0HA 3GXMA 3VDCA 4PMZA 4GXPA 3NDYA 5I3DA 1EDTA 3TP4A 1XD1A 1GOWA 1UR8A 2CHNA 5A6BA 4E8CA 2WVUA 1BFNA 3CH9A 1V0NA 3QHOA 4MB5A 1ECEA 4JFSA 4H8HA 3GTNA 2JFEX 3WDRA 3QHNA 4CD7A 2D22A 3VD7A 5HPCA 1MW2A 3HMCA 4WK9A 1HIZA 1SYTA 1CENA 3CTTA 3GBDA 4B15A 4D6GA 1ZS2A 4AZCA 3SCSA 3UESA 2X0YA 1KWGA 4TVCA 1V3KA 4Z2LA 4CD5A 1G0CA 2DEPA 2VC9A 4CCEA 4AZIA 2NT0A 1K9FA 3CLWA 2VZSA 1BGGA 1ISXA 1KGXA 1SMAA 4QCFA 3WD3A 5HPOA 4GQQA 1V6UA 4JFVA 3BLKA 1VEPA 1OIFA 1HKIA 4NRRA 4WKAA 3VPLA 4W7VA 4HOWA 2DSVA 2EQDA 3I3EA 4M1RA 4W88A 1B0IA 1V0LA 1EHAA 1V3MA 1GUVA 2YL9A 4GZIA 3ZR5A 3CUJA 4D6EA 1EDGA 3LPGA 1OINA 1KWKA 3UR8A 3MUY1 1NWSA 2XHYA 2XM2A 3AIRA 4K68A 3WNLA 2GUYA 1JZ5A 1MW0A 2DGAA 4H8VA 4OOUA 3W38A 1GQIA 1XYZA 2DQXA 4LYQA 3K46A 4QCEA 1M04A 4GI6A 1CXHA 3WDJA 1E56A 1IZKA 3AOFA 4W7WA 1CGUA 1MW1A 2E3ZA 3GNPA 3N12A 2CBIA 1QNPA 5FIPA 1UUQA 2A3BA 1X1NA 1VRXA 1NARA 1HVXA 2F61A 3T0AA 1Y7VA 2A3EA 4EANA 1G9HA 1DWAM 4GZJA 4J3WA 1BTCA 1JD9A 4UCFA 1FP8A 1C91A 4HU8A 1PIGA 3FHQA 5HBFA 1MWOA 1QW9A 1TG7A 1HX0A 2WCSA 3BGAA 4PTXA 4J7RA 1A3HA 3BCFA 5KZ6A 1KBKA 1D7FA 1QNQA 4V27A 2DSKA 5IHSA 2HISA 2WHMA 3APGA 3VIJA 3VM7A 5DT7A 2A3CA 1D3CA 3SUVA 3D3AA 2O9PA 1XV8A 2WM0A 1JI2A 2DSUA 3ECQA 2CEQA 1X6LA 4PTMA 3WIJA 1OIMA 2WYSA 3VOCA 3ARUA 5CSUA 2YJQA 2WVVA 4BF7A 4PMUA 4AD5A 3ARXA 3CUIA 1B3VA 1ZB5A 1JDCA 4H04A 3AYSA 1G01A 1U33A 3TA9A 1GQJA 4B9ZA 1KGWA 3PTQA 4U5KA 3A4AA 1UHVA 1VBUA 3B9AA 4NF7A 1PX4A 1UH2A
chains in the Genus database with same CATH superfamily
2OO0A 4H7ZA 5AC6A 2XFWA 4JIRA 1EEPA 1S38A 4HCDA 3ITYA 3RMJA 2I9EA 1WKDA 1LOLA 4J9JA 3U9IA 1HN1A 3CUGA 4LS0A 4EPKA 4OFCA 4U10A 6REQB 1OD0A 4ZO7A 1LM1A 3R11A 4TUFA 3NO5A 1IWPA 1XRVA 3NEHA 1XKYA 1AJ2A 1S5NA 5DY3A 4Q4MA 2XVLA 4MWAE 4F48A 1FX6A 4CUCA 3S6TA 3NSXA 3MC5A 3GW0A 4JICA 4KFOA 1RSCA 3NQ2A 2D2HA 3M0JA 4P7NA 1UKPA 1UWSA 1EJWC 5JXQA 2A1YA 3O6YX 1ZALA 4DJDD 1M03A 1HUVA 2Y88A 3BLOA 3JR2A 4HHMA 5AC8A 1GVIA 1UP3A 2J8TA 3R8RA 4KCWA 4KGLA 3VOIA 1ICPA 1F8MA 3THQA 2PPGA 4HCLA 2WKGA 3ANVA 4NAFB 2WAGA 3G1HA 4O1CA 5ABGA 2OLSA 1CIUA 3LOTA 1GEQA 2OTDA 4YJ5A 2WOQA 4JTUA 2C3ZA 5LNSA 2BVYA 4MDPA 1Q6EA 4QE4A 3AICA 3B04A 1UZHA 2PLMA 4H9ZA 1Y8BA 2WHLA 3RR4A 1KCLA 2ZUWA 2MANA 2BFGA 4FSAA 4RK8A 5I24A 1DTUA 3GX9A 4WDWA 3WLSA 2NZLA 4OQVA 4PMYA 1XIHA 3H23A 3TNOA 3Q94A 3G0SA 1B4KA 2FZNA 4DUVA 3ANYA 4LS1A 3J7HA 1E6ZA 5AYXA 3VVGA 1IXNA 3S42A 1MXSA 3LDVA 1HKVA 3UCDA 3DDMA 2A2IA 4EKJA 3W1PA 1LG1A 2G96A 1TPB1 3CV2A 2IKJA 1TV5A 1EO5A 5HUOA 4AMAA 4XAPA 3RU6A 5E5CA 2GJXB 2C15A 1VYPX 3AZTA 3T2OA 2PU0A 1U1JA 1P4CA 1I0BA 4IHCA 3P0XA 1H63A 4FNUA 1ZL1A 2FVKA 5BXSA 5K4XA 1DE5A 4Z2HA 2PDWA 3ENLA 1FH8A 5M3WA 1UH2A 2WJDA 1XC6A 4ZODA 1XIFA 4QG8A 3CQJA 4REQB 1BYDA 1F3WA 1LUCA 3HPXA 2J9YA 3MP3A 2DT1A 1OADA 4PA8A 2C79A 4CQDA 3KDNA 3UZXA 4DELA 2ASHA 1X7IA 4RX0A 3GG1A 3S5YA 2PTZA 1E1CA 2RAGA 4O1EA 1XFBA 5CGQA 4S3EA 4R53A 5TIMA 4MMWA 4WUIA 4GINA 3GTFA 7ENLA 5DMYA 2F6XA 4M24A 3S3GA 3NOEA 3M43A 4AZHA 3HJZA 3UZYA 2DUAA 1MQPA 1K8YA 1S5TA 2VC5A 4NYUA 5M1TA 3PM6A 1R9ZA 4EXAA 4MWAD 3T4CA 5KSWA 1FHDA 1V3HA 5FEPA 4AEFA 2VGIA 3H7UA 3GDTA 3T09A 1QOXA 1S1PA 1NY1A 5HQMA 5EMKA 1OX4B 1WYIA 5ABEA 3HURA 3W53A 3I4KA 4DWSB 3REQA 4Y96A 3P2VA 4QQ3A 3LSBA 3PZIA 3A3HA 5FL0A 3VFCA 1NQ6A 2JEPA 3L21A 4AU0A 4HZ8A 3QBUA 5A6AA 1QPRA 1IEQA 2DORA 3KRSA 3EWBX 2PB1A 4JTLA 3WFZA 4ICMA 1DORA 2ZRZA 5I3IA 2OZ0A 1OHLA 2F84A 3BG9A 5G4EA 1NAL1 1Q5MA 1ZHAA 3RIKA 1HW6A 4FNSA 3PJXA 2OYKA 3R43A 2NLIA 4ZQMA 4A35A 2B7PA 3B40A 4IQDA 3EX4A 1H62A 1U22A 3KVLA 4ERAA 4U31A 1OGGA 1HL8A 2D1ZA 4LAKA 4Y8EA 5A94A 1YEYA 4IGHA 4GG9A 1GTHA 3SDOA 1FWWA 1W5NA 2HCVA 3HPZA 2QULA 4PUUA 2CLPA 3W2NA 4UIOA 4IP5A 1EFZA 2WPBA 3WMSA 1L8PA 3NSNA 1F6PA 4W9TA 4AHOA 3BW4A 5CLWA 4DF1A 5L6UA 2VDGA 1TELA 2QV4A 3KRUA 2H3DA 2Y24A 2POTA 1EP1A 1FHVA 3ES7A 2Q3RA 2GDVA 3SGUA 1KFCA 4PMDA 1C7TA 1I6NA 4DY1A 1I9CB 1EYWA 2A7RA 3DFNA 3THDA 5IM51 3STGA 4YN5A 2VCCA 1T96A 3AROA 3NNTA 3MBDA 2Q3OA 1T6MA 3QQ0A 1YLVA 2X16A 3RILA 4ZFCA 1XW8A 4O54A 2WNQA 1CGTA 3TN4A 4C7DA 5HR7A 4KFPA 1WUEA 4US6A 1I2PA 3SQSA 3V35A 1I45A 4XZIA 4IP7A 5FD0A 5D8WA 1D9EA 3N29A 3UP8A 1A0EA 4MKVA 1NVMA 4RXGA 2OEJA 4M5PA 2RFGA 1P0BA 5A8NA 1P5BA 5I09A 1CXEA 5FL1A 4OJYA 4PH6A 2JK2A 4LRTA 4WLCA 4HTYA 1ZLPA 4L5ZA 3V18A 3VIIA 1GOQA 3QZEA 1KM6A 4XUYA 5HA7A 1LZOA 4GD0A 4LUSB 2YCEA 3M0YA 4UQDA 1DEDA 4MY1A 1QNOA 4AIUA 2YXXA 4GVHA 4D6JA 2ISWA 1O1ZA 4GUJA 1B9BA 3M0XA 3FYOA 1VZWA 5E0FA 1DJXA 3NPUA 1LCOA 1NDZA 4X2RA 1VJZA 2INEA 2POZA 1VJSA 1H5VA 3DFTA 4OZOA 1SR9A 4YTSA 4CNPA 2UBPC 4TIMA 1TV7A 4MJZA 5EPDA 3BG3A 1R47A 1AK5A 4GUIA 1XIJA 3L0GA 2E28A 1EWEA 4WDTA 1IIHA 3G3DA 4NAFA 2QF8A 5CBIA 5CZTA 3LHTA 5K7JA 4TV5A 1A4MA 4DYJA 2XG9A 5DBUA 1QBAA 2OELA 2H6RA 3WQWA 1KXTA 5I3HA 3G1DA 5BU9A 2RJGA 3QYQA 3GVRA 1KLZA 3UY7A 3NO3A 4HOXA 3FN9A 1BYCA 1ODZA 5I06A 3L4TA 1EZ2A 1QHPA 1GYNA 2A79A 2FZDA 2YXOA 2GDQA 3BARA 3FA5A 2PTYA 2QCDA 4JNMA 1LBMA 3CHEA 4TX9A 3AMLA 1R6WA 1KQYA 3MPGA 2E0PA 3CHVA 4JFTA 4JL2A 5HK4A 1JPMA 4RDYA 3W1RA 3C6CA 4Z42C 1W54A 4DYKA 1UR3M 3WQPA 1YIXA 4HA1A 3TTQA 3H2MA 2HS6A 2YA2A 4XZNX 4WEVX 4RW5A 5LIWX 4PMVA 3PB2A 3B4YA 1SSDA 4GX9A 1NEYA 2DUZA 5B80A 4KETA 1QUMA 1ZP4A 3A12A 3C2RA 3NQMA 1A5BA 3QW4B 5C5YA 1H41A 2WV8A 3VDHA 3NA8A 3CT2A 1ISVA 3BSMA 2PDXA 1TFVA 1EJVC 3URQA 4DBUA 1RJRA 3VMPA 5A8MA 2ZXQA 1CZ1A 2E40A 1XLJA 3NFUA 4CU6A 4R85A 4NNBA 1UZ4A 4S3CA 3TN6A 4DI9A 3H55A 4GQBA 2I5GA 5H91A 1XBXA 3CZGA 1S2WA 1KTNA 3A22A 3NGFA 5AC5A 3IUIA 2ABAA 2CU0A 1UIOA 3IVSA 3NQ6A 3ZVHA 2Z7KA 4LEQA 2YCLA 1PYMA 2BNJA 1JD7A 5LGXA 1GWJA 1QATA 1R30A 4NAEA 7PTDA 1CTNA 3HG3A 4NQ1A 3G77A 4GLEA 3AIQA 3CIXA 1MQQA 3HGOA 4LX4A 5A95A 3W26A 1HGWA 1M53A 3BTNA 3SY5A 3TFXA 3VIKA 4N9CA 3MMWA 3BAIA 2ZUVA 4CD6A 1FVPA 1DL3A 3XIMA 1ZP3A 2V5CA 3EA3A 3UYIA 4MKSA 3VZXA 1E6NA 4H6QA 4I7UA 1YDNA 2JGQA 1XD0A 3TYAA 1K1DA 1R3QA 3INPA 4A6GA 3AFBA 3WQ8A 4L9YA 4H7VA 1KBJA 2ON3A 7REQB 1AQ0A 3KCLA 3QF0A 1W3KA 4D1JA 2Y8KA 1QTWA 2CLHA 4K8EA 4LQ1A 5AHFA 3WL0A 1GKRA 5DY2A 4PULA 3S9YA 1LG2A 1SQ7A 4A3HA 3QMSA 1J10A 1DJZA 5FJTA 4IQLA 5HJXA 3AXXA 3SN1A 4REQA 2XFYA 3W7MA 1QHZA 1FWAC 1Y5VA 1OC5A 4OOZA 1ELSA 3W2UA 5T9BG 2OO6A 3KUMA 4RDVA 4MUPA 5HULA 1EF2A 2AKZA 1E9LA 1OBAA 2FH6A 4J2PA 3VX0A 4WOQA 4AYGA 3VIOA 4YS1A 2VRKA 3P5ZA 2ZYFA 3STEA 4O8AA 3ZS4A 1JUBA 1QASA 4RPQA 3KBVA 1GOKA 4X22A 4C1LA 4C6EA 2BP1A 3T0BA 4AZ6A 3CJPA 3E5BA 4NX5A 2FJUB 1KQZA 2G50A 3E2VA 3TTSA 4LSBA 1CB2A 1PV8A 2WXDM 3NZRA 3ISIX 4UUIA 3VGBA 1PIFA 3REQB 3A21A 1KFKA 3URNA 3THAA 5FJOA 4XV0A 3SGZA 2Z00A 3SFWA 5DQPA 2G3NA 1OB0A 3W7HA 4LUYA 2ACRA 1VKFA 2PSNA 4B5NA 2ZX5A 3NEVA 5HINA 4JTTA 3VKKA 4BHYA 4M29A 1WBHA 4I9TA 3SIMA 1RQHA 1P1XA 1A5OC 1C9WA 3BDKA 1WXZA 2D2OA 5JVLA 2PDFA 4L65A 3LRKA 1HKKA 3DI1A 1E73M 1DJWA 3PANA 3ZO9A 4MJ4A 4N42A 3GY1A 4JPGA 4CCCA 1S3TC 1S2CA 1FWJC 5L9FA 3PSWA 4KRZA 3VU2A 4S3FA 4WVXA 1US0A 1UH3A 2NQLA 3LLDA 3LM3A 2P0OA 1GYLA 4GIYA 4FPSA 3SSZA 1QO5A 2I5IA 2FB2A 2WMHA 4QDWA 4R5EA 3OLIA 2QCHA 1BXCA 3TR2A 2X1TA 5M5DA 3B0XA 2ISSA 4GJJA 3NG3A 1REQA 5I0DA 4GO9A 2Y7FA 5CG7A 1LRTA 1R2RA 1Q7QA 1ZBCA 1TIWA 3P0WA 1C8VA 1RA0A 3PP7A 4CN1A 1CWYA 4AHQA 1J0KA 1MZRA 3L0NA 3LTPA 1J5SA 2QMJA 4MDOA 4W8AA 3ID7A 3S1WA 5REQA 1FHLA 2BZNA 5JH1A 3K4AA 1JDEA 4C60A 4Q8OA 3AALA 3BPWA 2ZRUA 2PEVA 2PLKA 3OU8A 2QKFA 2VEPA 4JTSA 4UFKA 4OKDA 4PUEA 3WD4A 4DZHA 4GY7A 3H21A 4JX4A 3P82A 1YKWA 1U2YA 1XBZA 2FZBA 4HBKA 2VRQA 4C65A 4ZE4A 2EJAA 1P0EA 2J9XA 1OCQA 4Q8VA 1PTAA 3D0CA 4YTUA 5A6JA 3VGEA 3LS9A 4UB9A 4QG9A 4L64A 4O16A 2RJHA 3HJEA 2AMGA 3TR9A 4CEUC 4UNIA 4J1OA 3TQ0A 3TYBA 4JTGA 3CMFA 3UWZA 4KEMA 5CXPA 2QCDB 1R9YA 4IXXA 4I90A 3OW1A 1VBGA 3D3FA 4ZA0A 3MWAA 2DH2A 1O6IA 3L2LA 4QJ3B 3TXZA 1JNEA 3KFTA 1OK4A 3MO7A 1P1MA 3TTOA 4FIRA 3WNKA 5F4WA 2V3DA 1RVKA 3WBAA 1QCWA 3OHMB 3CC1A 1RCQA 3I7SA 3UPMA 3KS5A 2FMOA 3PZTA 5HWJA 1CGVA 2O9TA 1KTCA 1E0XA 3OZMA 2QUMA 4F0HA 3AWNA 4H3DA 3RM4A 4LNCA 3W7QA 4N0RA 4HMNA 4BCEA 3L67A 4OBTA 3EWYA 4FS9A 4FLRA 4XO7A 5FI8A 4LCQA 1ZGDA 3PUGA 4GA8A 4S38A 2VZVA 3I4EA 1TJ0A 5HNRA 2FHBA 2MNRA 4JCMA 1JDAA 2EKGA 3L2MA 4D71A 4MB3A 3DC0A 3MKVA 1JL8A 5EFDA 2J7BA 2PDGA 2YA0A 3WLRA 4OECA 1ZJBA 3W1XA 1JQVA 4Z1CA 1K3UA 4HU4A 1KA9F 4ICNA 2WBGA 4F0KA 1OFEA 3M5ZA 3AS0A 3WF0A 3UWQA 3HM7A 2CITA 3LXAA 4HPGA 5FJPA 4XQ6A 1CX9A 3MP4A 3C0SA 3CLMA 1J6PA 1E1FA 2CWNA 1OCJA 4JTKA 1S2VA 4UXDA 4JX6A 3BE7A 5I3JA 1VCVA 3W6YA 4O52A 3E96A 3LA4A 3RG6A 3AZRA 3LI0A 4X63A 3PUDA 4B91A 3OIXA 3V0TA 2O55A 1V08A 3CB3A 2FYMA 2AAAA 3Q4DA 2DDXA 2RDTA 4QS5A 5HJLA 2Y7DA 4ZFMA 3WDPP 1J9YA 1XHGA 1W1ZA 3CWOX 2CKSA 4DLFA 3RFAA 4QDMA 1A5AA 1XYFA 4O12A 2P3ZA 3AS1A 3BLFA 1VCFA 5KTLA 4C6PA 3WLHA 3BLLA 3W6MA 4CQ9A 3HIJA 3TWBA 4M3PA 4TX8A 1XYMA 2VKZG 3U2ZA 3LXCA 3AUJA 3EOSA 2I14A 2ACUA 2C1HA 1X8FA 3S5OA 1AMKA 3B8SA 4AY1A 1ZBVA 3WL1A 2Y5EA 2OU4A 3BJFA 1E40A 1IXQA 1QI3A 4QIUA 2XZ7A 2EPMX 4J3TA 4PL2A 3A3WA 1LYXA 1B9ZA 4DPPA 2HPMA 1XH0A 1ENUA 3QPZA 4IWWA 1GK8A 1X39A 3H2FA 1OSEA 3CEUA 3KX6A 2EKCA 3SUWA 1FH7A 4WHBA 4EXBA 3MHGA 3KBJA 2ATMA 5AHIA 3UG5A 2EHHA 1KCXA 4DPQA 3MJMA 5D9OA 2XH2A 3MB9A 4U2YA 3IRDA 2VZOA 1GGOA 3H26A 4UNLA 3M44A 4E3TA 5FEXA 4IG2A 2A3AA 2BY0A 3RYSA 1R87A 1E0WA 2PDBA 4EPEC 2XH0A 4KCTA 1YXDA 3FYPA 2NLYA 4UFIA 3O1NA 1H11A 4YVXA 4HP5A 1MDLA 1LORA 1MUWA 4NX0A 1I1WA 1RBAA 3NIYA 3SCNA 2GWGA 3PZGA 4A3UA 1DHPA 4JN6A 1WB0A 1OC7A 4C5YA 4E2OA 3WQOA 4GK8A 4L1GA 1W91A 1MXGA 1TJPA 3AS3A 4LY4A 4MADA 3W7RA 1EC9A 1YXCA 3CHDA 3QOKA 2YCKX 3V4BA 4JN8A 4F4RA 1ZCOA 5E70A 2TYSA 1GCYA 2OSXA 3GH5A 1VFHA 4EP8C 4RNFA 5C71A 2Y62A 2F2HA 2E67A 5A8QA 2V5BA 3PNZA 3R0DA 3T44A 5A5WA 3A6OA 3SCRA 5MKGA 3MI2A 5A6SA 1LUCB 2RDXA 3LPOA 4DO5A 3PBWA 1U5VA 2VC7A 3F4WA 2ZC8A 4HSOA 3WELA 3H4XA 4HVXA 4O0ZA 2QCCA 4PMJA 3PBVA 3IGHX 4RZBA 4D6DA 4E4UA 2ZZ4A 4Q8TA 2VHLA 4MG4A 1ZAHA 3LPPA 2FTYA 2HS8A 1VAHA 4NNAA 1OFQA 3MUIA 4PUDA 1H09A 4WR3A 1WKEA 5CJNA 5F1UA 2J74A 2EPKX 4ACZB 1JZ7A 5LHFA 1SVDA 1VP5A 2WK2A 3WY1A 1ISWA 1AD4A 4DJDC 4E5TA 4E38A 1OYAA 3V5CA 3TLLA 2NV1A 4BZYA 2PDYA 1JI1A 1J0JA 2J6XA 1KM3A 4AZ7A 3NURA 2DVXA 4KEZA 1DQXA 2EG7A 3QLDA 3VD5A 5DRIA 4MPQA 1C8XA 1WDWA 6ALDA 1OFAA 4POCA 1Y0EA 1HQTA 1W9PA 1Z89A 3GHRA 2QCFA 1UOKA 2IPFA 3C0QA 1E6SM 4MIMA 4S39A 1DIEA 1X7FA 4AF0A 4MB4A 2GSEA 3BLIA 1UG6A 1N8WA 3FJLA 1TTIA 1N82A 1XSIA 3HQPA 1NF0A 1JZ6A 2OQHA 1I1XA 5FESA 4QR6A 2QCGA 1N7KA 4ML4A 3FKRA 3F4DA 1C8YA 3ZJKA 4AW7A 1BSLA 1PKNA 3P80A 1W5MA 4NZ5A 2QZRA 1IGWA 1EXBA 3N2MA 4LW7A 4O13A 2EJ1A 3VFLA 1Q13A 4LXFA 4GABA 1XCXA 3OVQA 1Z32X 2CW6A 3TW7A 4ZQNA 1AZ2A 1MSSA 2QUTA 2GVYA 1GJPA 2JKAA 1GONA 3H2CA 5GPRA 4IT1A 1UJQA 4ATDA 3QMTA 1BAGA 4LUSA 2BY2A 8RUCA 3EWWA 4DAFA 4AIEA 4LB4A 1JXKA 3EPOA 1LT8A 1XX1A 5FF2A 4ZO9A 2PGRA 5I07A 4K2SA 3PWAA 1RHCA 4OU1A 4KFNA 2HVMA 4E0CA 2J88A 2X1SA 1V02A 2ZA2A 3VGFA 4DWSD 1WA3A 1O7AA 2FZ9A 5LA1A 4W8LA 6XIMA 4IH3A 3KOZA 4HSHA 3KTSA 4DF2A 3Q58A 2PZ0A 1LQ2A 1F05A 3AJXA 2Y6ZA 4Q8WA 3WJZA 1EDTA 3TP4A 4LS2A 3QKZA 3T1GA 2DZPA 3CH9A 1V0NA 2I17A 5DN1A 1EJ7L 3TYUA 2QUUA 1H60A 2JFEX 1MW2A 4WK9A 1HIZA 2L5HA 3GBDA 4B15A 2XGZA 4XBSA 5T26A 1FWFC 2OODA 1ZS2A 5CC3A 2YPIA 1KWGA 4TVCA 1V3KA 3PY2A 3O07A 3BANA 4JD4A 1G0CA 4X3ZA 2NT0A 3G2GA 1K9FA 2BWGA 3FS2A 4I9AA 5KZDA 1ZY9A 1SMAA 4JN7A 3LN3A 4OWGA 1KBIA 3QZ6A 3WZ0E 5J5RA 4LC6A 1ZJIA 3N25A 1J2BA 4WKAA 1Z48A 2Y85A 3VKJA 3I3EA 3MI6A 1DJIA 3UXAA 5C9ZA 3NL2A 3UW6A 4B2DD 1EHAA 2D2JA 1GUVA 4XG1A 3ZR5A 1LOQA 3UWEA 2XN0A 3LPGA 3QV9A 1OINA 4FXJA 1SU5A 1KWKA 2XHYA 3AIRA 4D8AA 1A53A 1O5KA 3GSMA 3HFYA 2FLIA 4OOUA 4N9BA 1J2WA 3RPDA 3W76A 2A21A 2P50A 1M04A 3W70A 1BRLA 1IZKA 3R8HA 4NZ1A 1CGUA 4LVGA 4AIBA 3FXGA 3DBPA 1MW1A 2E3ZA 2C71A 3N12A 2CBIA 2A3BA 3DGBA 4HSNA 1VRXA 1NARA 2F6KA 4NNCA 2A3EA 1G9HA 5F1VA 4H9VA 4GZJA 1TX2A 2NX1A 5HMSA 2HVNA 4GXMA 4HU8A 3FHQA 1WAUA 4OHQA 5BZAA 3MHFA 5H2ZA 1XG3A 2PWUA 3KBNA 5KZ6A 2Z1XA 4V27A 1W5OA 5IHSA 2PE4A 3L68A 3MYPA 3G1VA 4MJMA 1S2UA 2WSQA 1XV8A 1JI2A 2ZZ6A 4PTMA 3UWYA 3DG3A 1OIMA 5CSUA 4O15A 4G1NA 3TN3A 4PMUA 3BCJA 1B3VA 3ZFHA 1ZB5A 4H04A 1U33A 4BK9A 3TA9A 2CLOA 4M19A 3PTQA 4MVAA 3OJGA 3B9AA 2B7NA 4BF9A 2VOMA 1UWAA 4Q7NA 1NFGA 4RE3A 3CIVA 3VGHA 3TA6A 4MYAA 2A6LA 4CNUA 5HNUA 1BHGA 3II1A 1W56A 5BYWA 4KRUA 3BQ5A 3VAVA 1R3VA 4ZTXA 4O0KA 1PS9A 3VZZA 1EL3A 3EA1A 1LBFA 3OHIA 4DJFA 2WZIA 1LLOA 2O56A 3GNOA 2FHCA 1E5NA 2Z1VA 3TZNA 4MWAC 1QHOA 4DRSA 3QHMA 4JDBA 3AYTA 4L1XA 1EHNA 4H9TA 4P7RA 4U4MA 3W73A 1GVOA 1NWUA 4CLMA 3T9PA 3M1ZA 2V67A 1S39A 1KD0A 2VP8A 3R5EA 1EGZA 4HU3A 2G3FA 3UVAA 2ZDSA 1RAKA 1YTEA 2GQ8A 2NT1A 8A3HA 3FAXA 1RVGA 4X9YA 2DSWA 5EU9A 3TJIA 1O5RA 5AZ0A 3THCA 4CVWA 4AXNA 5HR6A 1FDYA 2PBOA 5BMXA 1FCQA 3OZPA 1JCLA 4FAMA 3WEOA 3GC4A 3GNRA 3AWOA 1AW5A 2YBUA 3T05A 1K77A 4ZB5A 4HYWA 4JTAA 2BOGX 2ZX9A 2UY2A 3DHFA 3VDBA 4H6RA 3WQ4A 1ESWA 1VHCA 1EH9A 3GUWA 3MCMA 1OF8A 1NELA 4ZBCA 2DZUA 3T8QA 3VABA 4UTJA 3WD2A 1VH7A 4QXIA 4PFHA 3OLDA 5ABTA 1OGSA 4E2DA 1XLKA 2YLLA 1XGZA 3RU8X 1PAMA 5FEZA 3WFLA 3N2TA 2QHAA 2DH3A 1FCUA 3F2DA 3THUA 3TV8A 4LUTB 2G3JA 4TTGA 1P6CA 4X60A 1CLXA 5ENLA 5GNYA 1JCTA 3C2YA 3N17A 1IF2A 2D20A 2G37A 2J7GA 3STCA 3VI2A 1T0OA 2P0IA 3HGSA 4LVBA 5K9CA 4R7JA 1FCVA 3RCNA 5HQEA 1XPYA 4AD1A 3JZUA 3U5YA 4INFA 4NHVA 4C1KA 3ABSA 3WH9A 3UEQA 2PDIA 3P62A 4ZXLA 3HG4A 3TU9A 1AA1B 1E0TA 1GJUA 4LWWA 3QPEA 4GZ7A 3GAYA 4LAUA 3WF1A 4C6KA 3BC9A 1AH3A 2PDUA 1NOFA 5JIPA 2NUWA 3GDMA 5U7SA 3KZPA 2WJFA 3NR0A 2YDAA 3BMVA 3AZSA 1J01A 4AWUA 4OBRA 3K2GA 1XLDA 1C8QA 3GAKA 4CKQA 1KV5A 3EPNA 1FKXA 1W1TA 4JFUA 2R8WA 4J4KA 5F2GA 3PUEA 1KTBA 1HT6A 4NJKA 3WBEA 1KM0A 3DENA 3W0KA 3WQ5A 3W71A 2JGYA 5A8GA 4YWSA 1W0MA 3JW7A 3UR2A 2AAMA 3TMQA 1BYAA 4LUTA 3RCMA 1RBLA 1MI3A 4WXZA 2E9LA 3O15A 3U48A 3ZLHA 2VNCA 4WJ8A 3OTRA 4UTWA 3RO8A 4NUWA 4JEQA 4RE2A 2OKOA 3C61A 4ZB0A 4IIEA 5E93A 1IEWA 4D8LA 3DG6A 4HNUA 5BMWA 2W79A 3QC0A 3SCTA 3B05A 2YCLB 3RUBL 4D2JA 3DHUA 4GFSA 2VX6A 4JTCA 1WZKA 4YCPA 1UP2A 4ORIA 3KL3A 3EZ4A 1R2TA 2P53A 2XVPA 4J27A 1UKSA 1R7AA 4WY0F 3B0YA 3VNJA 4DB7A 1C93A 2V38A 4CNNA 2FGBA 5GNXA 2ZUNA 3MVTA 5LA0A 2AOSA 5JBEA 1K6AA 3VDAA 4FA3A 2X1RA 1US3A 4NSBA 3WH7A 4ASTA 4N6FA 5IHRA 3N6HA 1M3UA 1EF3A 4YTTA 2C14A 1FWHC 3ZLGA 3JRKA 3GR7A 3KS6A 1K7XA 3QZAA 4AUBA 1B57A 1CGWA 5JBDA 4UQEA 4HYVA 1DXEA 2QDGA 5AYBA 4M6UA 3EYPA 2XH7A 1GOOA 2CWXA 1WDRA 2P10A 4K38A 3SUSA 1W1PA 2QVNA 3N4FA 3CZLA 2Y7GA 3CZEA 1XJBA 2A3LA 3HU7A 4HN4A 3LBMA 1VIZA 3FAWA 3LMYA 4LAMA 2HSAA 3RDKA 3TW9A 1UUOA 1BF2A 2RH9A 4WSHA 2W62A 3TX9A 4EF8A 1GHRA 4JNZA 2PP3A 1UASA 1CLKA 3EWDA 3P8JA 1TPFA 4ZGYA 5LNVA 1MNZA 1QNRA 1YE6A 3LCLA 4G56A 2VUYA 3OA5A 2R91A 1BWLA 1KM5A 5E0CA 3S2LA 2HE5A 1UD3A 1XR2A 2DZWA 4CNTA 1SGJA 1AJZA 5A8OA 4G2DA 4NL1A 4HJFA 2A6NA 3STFA 1P0KA 3ZZ1A 3IJ8A 1JYXA 4I8DA 2PTWA 1SZEA 4GKTA 3WUGA 2HE8A 4TVDA 2V82A 1DP0A 3M47A 3OYXA 2YBVA 1NWTA 4FX8A 2XFRA 5K3VA 3BAYA 4YWIA 1K9TA 2Z6JA 1T99A 3PJTA 2JF6A 3UR5A 5M03A 3O3RA 4C7FA 3SO7A 2Q8XA 1NDWA 1TRDA 2JIWA 2P8BA 5LKYA 1QWGA 3F5KA 3KW3A 5HQLA 2BG5A 2FPVA 4W5ZA 2VR4A 1DXIA 3A64A 2QCLA 2ALRA 4RPPA 2C1GA 3QSRA 2UWFA 5I02A 4NXKA 1FTXA 3EPMA 3JZEA 4JXCA 4LALA 3L4UA 3QN3A 4MNJA 3UXLA 4FNPA 5LYRA 3A47A 1RA5A 3KM8A 3IGSA 4AEEA 3WUBA 4JIPA 1W9BM 4Q6XA 3W1MA 4AZ5A 3AHVA 2ZZ2A 3CQIA 4OE7A 5G2WA 1W8GA 5DX7A 3MO4A 3L4YA 1MUMA 1UP0A 2CBJA 4RNHA 5E9XA 3WLNA 3C2FA 1JZ2A 1A47A 1RXOB 3RM8A 1UA3A 3C8FA 1RCOB 3N9SA 5DMLA 2QXWA 3NAVA 1JAEA 1F2JA 1ZCCA 1HJWA 3R7MA 1KR1A 1A5CA 2YB1A 5D8ZA 3VIHA 5MF5A 3VINA 1SPQA 1IIGA 4PC8A 3U6WA 5A69A 3QR0A 2R1KA 4NZCA 1QXLA 1DJYA 1Z8AA 4J3VA 1PPIA 1SO6A 2V0TA 1L0PA 3ARWA 1FA2A 1Q6QA 2X41A 3BXWA 4HKPA 3VC5A 5XIMA 4QSHA 4UTFA 2XGIA 2QJGA 3UZJA 1UZ1A 7TIMA 1I2QA 1BKHA 1OX4A 3H2OA 3QW3A 2V3FA 5JIWA 5FAGA 3FVDA 4PBFA 4DBDA 5LHEA 4S3DA 3TC3A 4LEFA 4FR1A 4QHRA 1PHQA 4QRNA 1FQ0A 1V51A 2Z29A 5FEWA 5IFTA 3BK0A 1Q6DA 3ARSA 3SN0A 1UJPA 4Z0JA 1E0VA 5BW6A 4WZHA 3UJEA 3RX2A 3PG9A 1NQKA 5FAJA 1XDMA 4RDWA 4K7YA 3NL5A 4IIHA 3WD0A 3M0ZA 2OT0A 1ISYA 4K39A 2BBFA 2YR1A 3P61A 1QO2A 4M8UA 3T0TA 4CN6A 1K9EA 4NJHA 5KETA 3G0UA 1RR2A 1YX1A 4MGGA 4BQ4A 4IPJA 3GH4A 3P6LA 1FP9A 1A3WA 2Y8VA 1HJXA 2PFHA 3WG6A 4D6CA 3N6JA 4MM1A 3CO8A 3IUDA 4JYFA 1LT7A 1RD5A 3SI9A 3W87A 4H83A 4RR4A 1Q6RA 3N13A 3F03K 2JE8A 1XCFA 4F79A 1EZWA 3WN6A 1XINA 5IRPA 1PZ1A 3WK0A 2GGEA 3MWCA 3HPFA 5DO8A 2PDLA 1R46A 3IEBA 1GQKA 4GWEA 2OJPA 2FTPA 1XC4A 1P7TB 4GQGA 1VFLA 2X2GA 4M80A 2EO7A 3WLIA 2WJZA 4W84A 3DKJA 2XSBA 5D04C 4KBXA 4YYCA 2ODOA 4BA0A 9RUBA 3CPRA 4U2ZA 4E4FA 2X09A 1WCGA 3OVGA 1SFSA 1E9IA 4FNQA 3W29A 1WKFA 3AHZA 1FOBA 5JMUA 3UA3A 2DT2A 2O4QA 2QR6A 2R1PA 5IOBA 1YYAA 3MKCA 2PWDA 3E9AA 1FWNA 2GVJA 3KVMA 3RLUA 3W1QA 1V4YA 4FIQA 4FX6M 1CXLA 3WEZA 1LQ0A 4GPNA 4DWDA 3HB9A 4CEXC 2WMGA 1DVJA 3FHAA 3M7SA 5HXMA 4IL0A 3LQLA 1IR2A 4QLKA 4AZBA 2E25A 4UR8A 3VIGA 2FDMA 1KNWA 3MZ2A 3W82A 4B9YA 2V3GA 5LNRA 1JGIA 2Y5SA 2ZZ7A 4C6FA 3H7VA 4U3CA 2D3LA 3W1AA 1VRDA 4LGXA 5ECUA 3EXSA 2VCAA 4TO8A 3G3MA 1FWSA 5AZ1A 1JYVA 3NQDA 5TNVA 4BI7A 3Q67A 3AXIA 1HJQA 1EQPA 2VGFA 3T2PA 3BGGA 4HNTA 2OWXA 1VGAA 2AL2B 1KFWA 1DYSA 3KWXA 1V6XA 2XWEA 1XISA 3SCOA 3W1UA 3NQBA 4C6DA 3LCXA 3UZZA 2QT3A 2NV2A 4QS6A 2QDHA 2FH8A 3ZR6A 1E15A 1TJ1A 1ZBWA 3L12A 1JDDA 3AMCA 4AD3A 1IZCA 3ONBA 4FI4A 1GG1A 2YBTA 3SRHA 4XVEA 4TV6A 2XGBA 3VIPA 2BVDA 3VKCA 4IIBA 4JBRA 2E6YA 4JYDA 2VL4A 1DJHA 3B3DA 4ZQRA 4HA0A 3TIMA 4F9DA 1OEPA 1J0ZA 2J7CA 1UD4A 1V6YA 4IZGA 2YFOA 1BF6A 3M64A 2Q02A 1M6JA 4YYFA 4P5UA 4PTVA 3SUTA 1D3HA 3VKBA 3W84A 2DW6A 1X1OA 1UWQA 2NQZA 1TCDA 2CNCA 1FDZA 1G4TA 1WKYA 4FOJA 4UFHA 4AQLA 2HQAA 1M5WA 4QM1A 3GD6A 2C8NA 4Z17A 4N7QA 5FF3A 1VENA 3LLFA 2PDNA 4RE0A 4AWSA 1NFPA 4KKXA 1E55A 1UPPA 1L6FA 3VO0A 2WNWA 5LXEA 3K8MA 4IF2A 5CKSA 1W8SA 4V1YA 1HFBA 4DUWA 3ICJA 1XG4A 4KCVA 3MQTA 1R9XA 4Y9PA 4HOZA 1OT2A 1BWKA 3UG4A 3EOLA 2BX7A 2BTMA 3VX1A 2D73A 4XKYB 3FNDA 2BHYA 2DY3A 2E9MA 4CQCA 4YHEA 3NQAA 1XIEA 4I6VA 2ZUSA 2IMRA 2W63A 4ZQPA 2VR5A 5CGTA 4F2UA 3B03A 1RLDA 3OYZA 1RUSA 2PDPA 5F2MA 3NUKA 3BOLA 1L6GA 3SQLA 3SN4A 1UQZA 3GNXA 4GFIA 1M41A 2Q71A 3P84A 2C1IA 4ROQA 3UT0A 3S2CA 3AUOA 4GH1A 4O8RA 1IR1A 3SRFA 5CZ0A 3M9YA 3E49A 1TPH1 4ZENA 4IGSA 4MKNA 3PPHA 1CEOA 1CT5A 1EC7A 3ZR4A 1ZUAX 1TIMA 5CC6A 3DXIA 2OOGA 3GYEA 3GXTA 3NM3A 3DECA 1VR6A 2E9BA 1I75A 2EBNA 4P8UA 4B92A 2RDUA 4L9ZA 4FLOA 1LL6A 4Y2WA 1GNXA 4M6VA 5CPQA 5CZJA 1DV7A 3QXBA 4JIHA 1OC6A 4AD4A 3CTLA 4AZCB 1AH0A 3S83A 3H2EA 1GW1A 5BXRA 2OEMA 3P5YA 3R25A 4HNCA 1X8CA 2EEXA 2VWSA 4Q33A 3UPWA 5G4HC 7REQA 4X0NA 4DJDA 3GG7A 2W4XA 4TOQA 4PCNA 1JZ3A 3TROA 3NGJA 4WJEA 2J25A 2WBKA 1L6WA 3HFTA 1EIXA 1XYAA 3BZJA 1PWLA 3OGRA 2NVAA 2Q8ZA 3UPBA 4KIEA 2V3EA 2C6QA 3FV9A 3P60A 1XGEA 3KOYA 3W01A 1QFEA 4K36A 5AVNA 3QH2A 1B2YA 4O19A 4YU1A 2H3BA 1DQWA 1JJKA 3EX6A 3S46A 2G41A 3V16A 4B5TA 4DNHA 2NW0A 1A0CA 2V5DA 3DYPA 1CNVA 4X0VA 4N6EA 3RM9A 1OGBA 3N3MA 2AGTA 1VFSA 4UNKA 3AS2A 3QY7A 3W1NA 3VMNA 4R88A 3BSGA 7XIMA 1ZAIA 1VBRA 2WVVB 5FOOA 1EXPA 3CAWA 3CM4A 3VKDA 3EWZA 1GZJA 1XSKA 1F73A 2PWEA 3W7GA 4NI8A 1AD1A 3DOPA 1QPKA 4KW2A 3VMOA 1H7WA 4J3UA 2F2KA 1B90A 1WE5A 2TPSA 1AJ0A 1YADA 2BGQA 3FGCA 3GXIA 3SY1A 1LLWA 4MYXA 4MJ2A 5CPNA 7TAAA 4PMRA 1C9DA 4E2BA 1AODA 2DP3A 2FMNA 3VIMA 1Z7AA 4CCDA 1I60A 2TAAA 4S3GA 1AQHA 2BB0A 3IIZA 1UUMA 1E9ZB 3N2OA 2X40A 4OV9A 4RL3A 1JRBA 1M7OA 2VGGA 4W8BA 1J18A 3KL0A 1U83A 1Y5XA 3RF9A 2P5NA 1RALA 3O05A 2FQIA 1B30A 3M0HA 4UQ9A 4EK7A 4PUJA 1Q66A 4Y9OA 3GXDA 1F3EA 2JF7A 1KXVA 5D38A 3O7UA 1WAWA 2YDRA 1SJBA 1V7YA 4I6KA 3RK8A 3CO4A 4UTMA 4JHZA 4LV4A 5M17A 1TE1A 3EKLA 5ABFA 1RP9A 1XQKA 4PMQA 3G6LA 1J0HA 1WDPA 2PLJA 3ATZA 2YFNA 2VFHA 3GHSA 3V36A 1WZAA 3BUVA 1XRFA 1WZMA 4BI6A 1TV8A 4N4QA 3LXBA 4JTJA 4HZ7A 1I8JA 4IISA 4GX8A 4PUMA 4I5XA 5HWNA 1UKOA 4I8YA 4HMEA 1T5AA 1VLWA 3QV7A 4ADTA 4QFUA 3GWQA 3E1F1 5K9XA 2MUCA 2WLYA 3N14A 2ISFA 4Q4QA 4AIOA 5DBTA 2Q09A 1K8XA 1PX8A 3MV01 1JF5A 4Q4PA 3ZT5A 4QE5A 2DZBA 3FGCB 1QI4A 2ZICA 3KE0A 1P7TA 5REQB 4KPLA 4L4PA 2X42A 4W87A 1T7LA 2XYLA 2R1MA 2VUNA 3TVAA 3OZYA 3M4HA 4P7QA 3PWGA 4OGZA 3ALFA 3AMKA 4UQAA 4WDUA 2REQB 1EC8A 1ME8A 4A8RA 4UTWC 1E4IA 3L4WA 3MMDA 4BS0A 1ADDA 2HZGA 2VX7A 1GTEA 4ENLA 2Y1HA 3VTRA 2G8ZA 2X7WA 3EKZA 3NQEA 1M7XA 1OG6A 5JQ9A 4OV4A 3IJ6A 3C52A 3TE9A 4AXKA 4YVPA 1OABA 4DHGA 5J5DA 4FXFA 3RO6A 2YL6A 2G5WA 4X2PA 1OF6A 3AQUA 4QNEA 4B5XA 3DFSA 4IIDA 3S5ZA 1J93A 4R3UA 3HA1A 2YSWA 4GIAA 4UBPC 2Y89A 5EY5A 7CGTA 1YDYA 4G9PA 3R0UA 3KRZA 3CNYA 1W1VA 3R13A 1G1YA 2XISA 4M7TA 1Z69A 2VDHA 2VVNA 4IMEA 2F6UA 1ITUA 3DHPA 2WKJA 1JG9A 1HL9A 2WMFA 3PF3A 4PZVA 4LRSA 1E3XA 1RBOB 4FLQA 1R8LA 3IPWA 2ZKMX 1GKQA 4PMXA 1RLCL 2Z24A 2WMIA 4U33A 4D6IA 2UY4A 1EOKA 1GOMA 3W2JA 2GJXA 2AQWA 1QI5A 4P7OA 1OD8A 2ZZ5A 3MJYA 3WF3A 3UJ2A 1OJXA 1TUXA 1R86A 2WKLA 5RUBA 4LC8A 4PTNA 4C1NA 2A3HA 1UD6A 2E7FA 4QG6A 2V30A 3WK1A 1XM3A 4Z08A 3WLOA 3VA8A 1XUZA 3GXFA 4JTDA 1HP5A 1VYSX 4DBEA 3ME3A 3VNMA 5LZLA 3DX5A 2WANA 1TX0A 4JCLA 4BQ5A 3G1SA 1R7OA 2QEZA 1QR7A 3KBMA 2VENA 3VZYA 3W2MA 5G1YA 3OIHA 3T8LA 3NQCA 1J79A 3IVUA 2V68A 4OBSA 4W93A 3WFAA 3N4AA 4ROPA 4Y6GA 1UR4A 2PWFA 1B5TA 3SAZA 3CV7A 1OY0A 4MFDA 1QMLA 1ICQA 2NVCA 1L9WA 1QPOA 4ORMA 4UFLA 4WJXA 2VFEA 1W1YA 5FSEC 4WSJA 3QFEA 2J62A 1UR1A 3APTA 4NASA 4LU0A 5AOUA 4NILA 3VYLA 2FPYA 1J0YA 3TFCA 2WWCA 4AVOA 1W2VA 1QBBA 3ZMRA 5A6MA 4H01A 3VOFA 4KMQA 1YTKA 2PDQA 3S5NA 3PFMA 4J2MA 2ZZ1A 4S23A 4IPPA 1CXIA 3KOWA 3IJ7A 2ZA1A 5G2HA 2JKEA 2ZVRA 4G6CA 3GFZA 1XH1A 2WLZA 2ALDA 4LAOA 2OQYA 5DCDA 3LERA 2XN1A 3CYVA 4W5UA 3A24A 1TQXA 3PZMA 3L23A 1MO0A 1V6WA 2XTKA 4HYRA 3V5FA 4W85A 1Z41A 1Q65A 4CU8A 1ME9A 5F4SA 1WUFA 3M0MA 3U57A 4JTQA 4GIEA 3BICA 4A05A 1UD2A 3CV1A 8XIAA 3SCQA 3ALGA 1G4SA 4KH2A 1X96A 3L66A 3LGEA 4IM4A 3LCHA 2TMDA 4HPXA 4I7WA 3PWIA 5TD4A 4R34A 1R38A 3W6LA 3CQKA 3KCJA 3GXMA 3QTPA 4U28A 3VDCA 3TUUA 4GXPA 2P8CA 3NDYA 1OG0A 1Y65A 1XXXA 1O66A 1XD1A 4NAEB 4WRHA 1MMFA 2Y8UA 3QFWA 4ZOBA 3BJTA 3LQGA 5LSMA 4GY0A 4Z1BA 3H2AA 2P88A 4JFSA 3ITXA 1YBQB 3GTNA 1OZMA 1XFCA 3CTTA 5H8UA 2YW4A 4D6GA 3N2XA 3D6NA 1KRMA 4AZCA 4JOMA 3G8EA 2FKPA 4CD5A 3VKAA 2DEPA 4CCEA 1UC4A 1FUYA 2VZSA 1BGGA 2FFCA 2TODA 1L6SA 5FJUA 4GQQA 1K6WA 1WOBA 2X1UA 3UNDA 4M51A 2AMXA 4B5VA 3O6CA 1OIFA 3TCEA 4NRRA 1XUUA 4FF7A 4W7VA 4HOWA 5MHBA 5GJPA 3MMTA 2EQDA 4PGLA 3B8UA 1V0LA 3S9IA 4DJEA 3LHZA 2X7VA 2QIWA 2DW7A 1K02A 3HGRA 1L2QA 4D6EA 4LF1A 2GLKA 6REQA 2KAUC 3UR8A 3MUY1 2XM2A 2NUYA 4AB4A 4K68A 1TTQA 2GUYA 3T40A 4V33A 1DIDA 3W38A 3UF9A 4H6EA 1GQIA 1TMLA 2DQXA 4LYQA 3K46A 4QCEA 1OCNA 4GI6A 3WDJA 2PP1A 1F61A 3DCPA 4KCUA 1EP3A 4W7WA 4JQ4A 1QNPA 1MRQA 3QKEA 3PSVA 1JCJA 1DWAM 4J3WA 1BTCA 3ITLA 4UCFA 1XS2A 1FP8A 1ZTVA 3NVTA 5HBFA 3N2BA 1TREA 2R94A 2VFGA 2H8XA 2QCNA 1R3TA 1KBKA 1D7FA 1QNQA 2A85A 5HANA 4PB5A 3VM7A 5DT7A 3SUVA 4XAZA 3FA3A 3D3AA 4XZ9A 2O9PA 2I5QA 2WM0A 4J35A 2DSUA 4XAFA 3A13A 1X6LA 1GEHA 2WNNA 3WK3A 3NO1A 4BF7A 1ONWA 2REQA 3CUIA 1UC5A 1JDCA 1G01A 3S2NA 3W85A 4B9ZA 2HJPA 1KFBA 1KGWA 4U5KA 1L6YA 1XLBA 3KP0A 4DJED 3S1UA 5T9CE 3URAA 1PX4A 4O14A 4S3BA 2GUBA 2PGWA 3FJ4A 2OVLA 3M6YA 3QJAA 3LNPA 1LOSA 3W72A 1AH4A 3VNYA 5I3FA 2HV5A 3TONA 2OMAA 3DBNA 3FLUA 3TMLA 2R6OA 2V2DA 4LNYA 1JYNA 3PS7A 1M68A 3LV6A 4QLJA 4ZO8A 4JYEA 2J4GA 3N2CA 3TCSA 1YPXA 3WF2A 5I7GA 2HK1A 1H4PA 5C54A 4DWSC 2CZEA 4PR4A 2HRWA 3ARVA 4KIRA 4L56A 4H4IA 3BVJA 5AVHA 4B5UA 2GJNA 1CGYA 1W9DM 3B8IA 2VURA 5EKYA 2EPOA 1ODUA 2WJEA 2WVTA 5KZMA 2YCIX 2GOUA 2DIEA 3PN8A 3EMCA 5CJMA 4Z1DA 2Z1BA 5G4WA 5IDIA 1XICA 3ITCA 1DWHM 3CGTA 1QPQA 4AX7A 4Q22A 1VEMA 3PG8A 3PAOA 3HQ1A 4S1FA 3B0PA 2WQPA 3NPVA 3ZJ8A 2Z1WA 4AH7A 1BVZA 3UWUA 1J96A 2PRHA 3TEVA 1IV8A 3NL3A 1R3WA 1CGXA 4BFAA 4C5ZA 3NJ3A 1SO3A 2ACQA 4A3YA 3B9NA 1IE7C 3E0LA 1Q3NA 1U30A 4JFWA 5M2FX 3KZSA 1EP2A 4TMBA 4JIQA 4NJGA 1KKOA 4Y9AA 3R1ZA 4JKMA 4O18A 3TYDA 3H53A 3A9IA 4FEZA 3LY0A 2IQTA 4XSMA 1QW7A 2PRMA 5TBOA 2D24A 3TZFA 3GIYA 1LL7A 2PURA 3ZVHB 3CPGA 3BOFA 3KAOA 1WBJA 1E4NA 1SR0A 3RJYA 3H4GA 1XLHA 2QPSA 3WH6A 3B9DA 4JX5A 3AYVA 3R79A 3D47A 2B7OA 2OQLA 1XH2A 1F6KA 3D46A 4H1ZA 2CXEA 1K4GA 3O2LA 4UWMA 5HNNA 3ELFA 1QNVA 3IVTA 3KTXA 3FJNA 3LX9A 4JQ3A 4PE8A 3A4XA 4PUKA 1GVSA 3U7BA 4I3GA 1BSIA 1RJQA 1I2OA 3BQ6A 2PC4A 4EF9A 3PPFA 3USBA 2ZXAA 3EX1A 2X0SA 5J8LA 2W9MA 4HIBA 4MZYA 4LANA 5KZEA 2GJRA 1CXKA 2Z0IA 5GJMA 3ITTA 5A2BA 1D8CA 3G18A 5CCZA 1XYCA 3PJWA 2CERA 4HNNA 4AZGA 2BHUA 3CS2A 2BOFX 4U3AA 5ECVA 4K8HA 1PHWA 1AVAA 1YW1A 1W1IE 3VOHA 1RD6A 4NJJA 4RE4A 4FZIA 4MSSA 2ZX7A 3UXIA 3LRMA 2BMBA 2ZIDA 1TWWA 8TIMA 2AL1A 4Q8UA 4UTUA 1YNQA 1Q6GA 5CPSA 3W7CA 5FJIA 3EX2A 1H7NA 4PB4A 3QM3A 3SADA 3NPWA 1TV4A 1TTPA 2FHFA 3I10A 3PTMA 2QNEA 1N55A 3T2QA 3D5HA 4DLMA 2EPLX 1B3ZA 5KEZA 2QAPA 1Q6CA 2YKKA 3G1RA 3DIPA 3GIPA 1VPXA 4KEUA 4O4WA 2OG9A 2PWGA 3TH6A 1PKLA 2NXIA 4UQCA 3LTYA 4PEEA 1FHUA 4ATLA 2E5CA 4HPJA 4X9SA 3VNZA 1CYGA 3T55A 5U4NA 5HUPA 1FWCC 4NJIA 4Y90A 4LBSA 4DIAA 1WDDA 2YOCA 3TYEA 4GNKB 3H8AA 2W5FA 1W9VA 2NXHA 2VX4A 1VD6A 2BY3A 3C4UA 1OK6A 1VF8A 4IX0A 3GC2A 2BVWA 4GIRA 3VC6A 2XN2A 2QAFA 1V93A 2W91A 3CZKA 3FVMA 2IPJA 5EYWA 3E0WA 1PX3A 3USZA 3N6QA 1H7XA 3YPIA 3O9NA 4URIA 4RZ4A 3OVPA 4NG3A 3SCPA 2CIPA 3N1AA 4D72A 4DVOA 2DQWA 1GZ1A 3K1DA 5H6HA 4D8ZA 3QYSA 1QNSA 1CDGA 1EEXA 2QIIA 5MKGB 3MMUA 4LUJA 4MPKA 3CQHA 1Q45A 4QP0A 1H49A 4AWTA 2PCEA 3WSUA 4W7UA 3RRAA 3VUSA 4HJWA 1HTIA 1LWHA 3LRLA 4MZ1A 4G7FA 5BNKA 1HF6A 3LHWA 4A29A 3AXHA 4L9XA 2PD9A 4CQ8A 1XLGA 2RHGA 1HKJA 3FY1A 2ONEA 3NWRA 2GFTA 3W2KA 4LVAA 3GIQA 3LCFA 3IIPA 4IGMA 4GGHA 4PRWA 1A5MC 4BY3A 2ZUUA 3WNMA 2BODX 2X2YA 4AMCA 4C6NA 2VDIA 3V1HA 4GI4A 4US5A 4Q8NA 1DJGA 1OQFA 1LP6A 1TV3A 2XU2A 5A2AA 1P6BA 4XZHA 1G4PA 5TQLA 3GZAA 3W7KA 1K8CA 1SO5A 1ZSXA 1TA3B 3TSBA 3VGDA 3O16A 2INFA 1X38A 5H1WA 4LCSA 2HNEA 1J6OA 1XLIA 2J24A 3WENA 3W23A 3SCWA 3L4VA 2G97A 1AFSA 3UBPC 3UXKA 4UMCA 3KRBA 4ZR8A 1QT1A 4HPHA 2QJHA 4X61A 2R1NA 5EMUA 3AO0A 2DUXA 1B4EA 4NU7A 1TZ7A 3TJ4A 1VBHA 4KT2A 1NF7A 3M0LA 1T41A 2PAJA 3LHVA 3GXNA 2OSYA 3KP1A 3LUTA 3XINA 4FXSA 4PSRA 5G1MA 3R58A 3DFPA 3BO9A 3W88A 5C55A 1ISZA 1WXYA 1PDYA 2PZNA 5A3HA 3UJRA 1M1BA 2VELA 1F3TA 1EPVA 1Q8AA 3GTXA 1PJ9A 1S1RA 4DBWA 5FF0A 3WEMA 4A2SA 4IP4A 3LBCA 3S0CA 2J8FA 3C56A 4IIGA 4ZOAA 3TC6A 4EIVA 5C2GA 3CMGA 4CD4A 1X6NA 5AC4A 3IIXA 5LA2A 2PDMA 4PBGA 2J79A 3EKGA 3VILA 2OWCA 2VEMA 4I7VA 1OYCA 4FMVA 4HNLA 3I3BA 4TX6A 3W4RA 2PWHA 2D2GA 3GNNA 4PEKA 1F76A 2I16A 1UCWA 1DBTA 1K03A 1EOMA 2YW3A 1A80A 2J7HA 5F7UA 1WDQA 4GYPA 5A6TC 2V6AA 1V8EA 1SFTA 3WLKX 3P67A 3TK7A 1BRLB 3HZ3A 1O68A 3H7RA 3IJ9A 2NSOA 2V9DA 2W3ZA 2X0HA 4WCJA 1H0IA 3W7NA 2X8RA 2CLMA 1BKSA 3IK2A 4DM1A 1ZQ5A 3N04A 1W1B1 5H8PA 1HO1A 2VX5A 4F0LA 4GYFA 3PK7A 1E6QM 2J47A 3CEPA 1P0DA 1A5SA 4S2BA 4WGXA 1A0DA 4JL1A 3WX7A 3ZYZA 3WQ6A 3LK6A 3S47A 2OWWA 4HU0A 3QEZA 1FKWA 1E1EA 3PTKA 9CGTA 4GUGA 3EAUA 3GHUA 1W9UA 3OBEA 2WPGA 4O17A 5EL1A 4BQ2A 2NXGA 3UGRA 1EUNA 3U7VA 1ZENA 4RJEA 2PC8A 3C2OA 4E8DA 4FNRA 2NQJA 4EWND 4AC1X 4BEQA 4Z2IA 4C6IA 1PTGA 3C2EA 2I57A 3LENA 3IACA 5T8GA 1YPIA 3MW7A 1IT0A 1TPDA 2P1FA 3N19B 5E1QA 3SIZA 3T08A 3I7QA 1JCMP 1V7AA 3M16A 1GJWA 2DJXA 2I7GA 4W89A 1F4HA 1UH4A 4QITA 1NDVA 2QW5A 1IEVA 5FF7A 4TTUA 1EBHA 2GK1A 3NQ7A 3FDGA 4L6DA 3ARZA 4C90A 2OR2A 2GUUA 3RJXA 2UV8G 5DFAA 3P81A 4YVVA 3GTHA 3NXFA 1H2JA 3IANA 3CAQA 1KLYA 1UD8A 5CJ5A 3BLPX 1V0MA 5FKYA 3QV6A 4B3ZA 4BF5A 3E74A 4GVIA 5C9RA 3PNUA 3KVKA 3GLCA 3WJXA 1X1ZA 2VEGA 4IPLA 3CZJA 4JZ5A 3ONCA 5D2WA 4Q4RA 3GW3A 4P8VA 2Y2WA 3E38A 3H24A 1TMQA 1HGYA 1LDCA 4AD2A 1M7PA 4ZE5A 4XKMA 5GJNA 3MSGA 1TE6A 1DPMA 2OLAA 3OLGA 1TPVA 2JBMA 3M6DA 5F2IA 2QJJA 5D4YA 3OBAA 3A4WA 1ONXA 5AYZA 2ICSA 3TJXA 4UOJA 3U4AA 4RV3A 1CPUA 2PGEA 3VD4A 3DU0A 2DZVA 5I6SA 3FSTA 3EOUA 3FW6A 4G1KA 2OOFA 5A8PA 3CIWA 4KGJA 1R0MA 1UA7A 1UBSA 4LUIA 2WSRA 5B7YA 1CI1A 2V8ZA 2W0UA 3IARA 2D3NA 3TC7A 2AQOA 2XSAA 1NDYA 2ANUA 5I23A 3GS6A 1JZ8A 2PBGA 3CL7A 3MTWA 5HDRA 5H8MA 2VZTA 4I9JA 3UZ5A 1I4NA 2DV0A 3M0KA 4ZTYA 4GC3A 1XCWA 1EX1A 1WPCA 1XIBA 1UWTA 4C6CA 2ZA3A 3DYMA 1TVNA 1G5AA 1Q4WA 4UFJA 1VYRA 3KOXA 4CQBA 5I78A 5I03A 2GL5A 1TJ2A 5AFDA 2ZOXA 1EGMA 5EMLA 3G22A 1E43A 3S9ZA 3U8GA 1VLIA 4WKFA 4O53A 3SW6A 3V5OA 3DC8A 2Z2UA 3KWSA 1DWJM 1MXDA 2PCQA 3GVQA 2WCAA 1TWSA 1VFFA 1W1A1 1FH9A 4A2RA 1OFBA 1W5QA 5CPOA 5AHEA 3AHTA 1MEWA 3HG5A 2XH4A 1QJWA 2C13A 3WQEA 2XIIA 3SBFA 5AN7A 1SO4A 4FHAA 4A3RA 1YRRA 2XZ9A 2PI6A 3GK0A 1XIDA 5D2TA 5D2VA 5CPMA 3EDFA 1JF6A 4O1AA 3MP5A 5D2XA 5CSYA 3VIFA 1EJTC 4DUOA 2VEIA 4R7OA 4V2XA 4FR6A 1UWUA 3HO8A 2DSZA 4JQ1A 1BYBA 2DU2A 1MFUA 4JTIA 5I2UA 3CWNA 2PDCA 1UMYA 5CPTA 3OP2A 2DZXA 5HMDA 3W7IA 1TTJA 5C7VA 2P3EA 4PCPA 2OGJA 3SEPA 4FALA 4G7EB 3EEZA 3WCZA 3ITOA 3TAOA 3NL6A 1UWIA 3DFQA 4QLLA 2X30A 4DQWA 4XD3A 3VOGA 3B06A 4XISA 3KBWA 5BOEA 3IV8A 1TYGA 3AYRA 1WX0A 1OFOA 3B8VA 3FCPA 4XO6A 5IBXA 3WBWA 3N9RA 3BMXA 3R12A 2ZUTA 3AU6A 1JQXA 4YXGA 1C92A 2O0TA 1XP3A 1NTHA 2EPHA 4MNKA 2FFIA 3JVAA 4B3KA 5LIYX 1ZNNA 4KS0A 3ZVIA 1Q2SA 1UR9A 4ZSUA 1RQBA 3SR7A 3ABQA 1CXFA 2G4FA 1BQGA 4JR5A 1Q6OA 3AU2A 1FFQA 3MV11 3UD6A 4GI9A 3G8RA 3NSMA 3KL5A 4AC7C 2J7FA 4HMCA 4XAYA 3E5PA 4UR9A 2FGLA 5BRBA 2WCGA 2WC7A 4NZ4A 1LWIA 4XD5A 4MTVA 2NQHA 1E71M 3WQVA 3EB4A 2CFFA 2EG6A 3B97A 1EA9C 3B9OA 4ATWA 4E8GA 5C8BB 3QV8A 5AKQA 1GPFA 5F2LA 4JEJA 1YBQA 5C9WA 3UETA 2J6VA 2Y63A 3MY9A 4F8XA 4R7WA 1IQ8A 3ATYA 3W7PA 2CYGA 3LCIA 3DFYA 1S46A 4AWEA 1G4EA 2C18A 3MHUA 2NWSA 1NP2A 1KB3A 2IKHA 4UMAA 1TCMA 2QV5A 5C7HA 4ZEPA 4D1IA 5I79A 4GC4A 1QW8A 1W3LA 4LT9A 1KGUA 3BCDA 4NKCA 4Q3MA