3U5YA

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
501
structure length
470
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Raucaffricine-O-beta-D-glucosidase
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 174
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u5yA00
1V3JA 4HOXA 2DH3A 2RGMA 1AQ0A 4WKHA 3FW6A 4J3WA 4AXNA 2WW5A 4EAMA 1QHPA 5DEZA 3WF3A 1KGUA 4K68A 1ZU8A 2VO5A 1CZ1A 4P7RA 3W82A 1CGXA 1YHTA 3CBWA 2XVPA 2VC9A 4PTXA 2QF8A 3CUJA 3U57A 1LF1A 1UWSA 3TOPA 4U5KA 4TOQA 1XSKA 3T0DA 1QNQA 4E8DA 5A2BA 4B3LA 3WUGA 4W89A 3WFLA 4CCEA 1UWUA 5LA0A 4D6EA 1W32A 1NM9A 1MQPA 1E4MM 2J47A 2G4FA 2E8ZA 1UYQA 4GIAA 1HJVA 1E6ZA 4IM4A 4GO8A 4LPCA 3UERA 6CGTA 2D0GA 4JFSA 5I79A 2YOCA 3M07A 1HXJA 1BG4A 4UFLA 3U7VA 3W24A 2X05A 2NT0A 4LYQA 2VZOA 1E56A 1CXFA 1VENA 1ECEA 3MV11 1WZMA 1G01A 1E73M 2J7GA 2XPKA 1GVIA 4W7WA 2W92A 5BXPA 1CBGA 2WSPA 2XVKA 3MS8A 5A6SA 3OIHA 1FOBA 1KXVA 2GDUA 3CUFA 2JF7A 4YPJA 1OBAA 3AISA 3FAWA 2YKKA 5D9PA 2WVVB 1TMQA 3W81A 1ZBWA 1CGVA 3PN8A 3N11A 4HZ8A 2YL6A 2VCAA 3SIMA 1V03A 2IXVA 4W8BA 8A3HA 3EDFA 2XVGA 2MANA 1UWIA 4NRSA 2BXYA 3TTSA 4UQ9A 2G3JA 2YDQA 1CTNA 5HNNA 1US2A 2Y8KA 3OGSA 1ZS2A 3UR7A 5I24A 4E4PA 1JYXA 3GXMA 3VIFA 4PUEA 3EDKA 2GVYA 4JKMA 3GNRA 2WC3A 4CN4A 1G94A 2WMKA 3RMEA 4UFKA 2VCBA 3BCFA 1E55A 5C70A 2JIEA 4AIEA 2BY0A 3MKKA 1E72M 2GJRA 2IXUA 5HXMA 3U5YA 1M7XA 1V0MA 1UZ4A 1BAGA 4P8UA 1V0NA 4UOZA 1E3ZA 2VZVA 3CZEA 1QW9A 3WF1A 2J8FA 2X8RA 1EIBA 4M82A 4PUDA 1UR8A 1UH4A 1J18A 1QI4A 3MUZ1 1J0ZA 1C7SA 3SURA 3ZJ8A 5A95A 1J12A 4AW7A 2QMJA 1E6RA 4AEFA 1US3A 4U5IA 1LL7A 2J7BA 2ZX9A 3L4TA 3M6DA 2DIJA 5A8OA 3RJYA 3WF0A 2NW0A 4S3JA 1GVYA 3WD1A 2DSKA 3ZMRA 1JNDA 4TVUA 3AZRA 3OLEA 4U2ZA 3WH7A 2DT1A 1CNVA 5JBFA 4LX4A 2V3EA 3N18A 4P7OA 2EPNA 4AD4A 2PWGA 4H8UA 2VI0A 3BAKA 1G0CA 2JEQA 1C8YA 4IISA 2CIPA 3GYCA 1HP5A 4D1JA 1LL4A 1NWTA 2WWCA 3EDEA 2BY2A 1VEPA 2OWWA 4MJ2A 1UR1A 2X09A 3CH9A 1UD6A 3VIMA 4NRRA 2XHYA 1KGXA 5FL1A 1DP0A 1WZLA 3A3HA 4CU8A 3ZT5A 5CZKA 5IFPA 1W3JA 3ARPA 2XYLA 1EHNA 5A6KA 3WIJA 3WH5A 4D71A 1DWAM 2Y4SA 2OWCA 3NSNA 3WMCA 1UQYA 2VQUA 3WQ5A 5BROA 3J7HA 1C8XA 1V3KA 1K9EA 4H2CA 4M80A 4FLRA 2UY4A 1JYWA 2DH2A 5E0FA 5BRQA 1W9BM 1Z32X 1XCWA 3HJEA 1V02A 5CGTA 4PMRA 3BXWA 4HU8A 2VZUA 3WF2A 3ARWA 4N42A 4IPLA 1ZJAA 3OA5A 2XG9A 2ZE0A 4MADA 2VX4A 2Y5EA 1KB3A 3VD3A 3SCRA 3OGRA 1IT0A 1WKYA 2E40A 1JF6A 1KXHA 3K46A 1Q6EA 4D6DA 5IXEA 4HA1A 5DMYA 1GQJA 3BH4A 2A3AA 3NCOA 4MAZA 1JZ2A 4U3AA 3WD2A 1VFOA 4WSKA 1C3FA 1VAHA 2XFFA 3M46A 2ZXQA 1NARA 4MPKA 4UQCA 3W6MA 5BWFA 1BSIA 3ZQ9A 2XGIA 1M04A 3VM7A 1J0KA 1UUQA 4QCFA 2AAAA 1WDQA 2ZUVA 3VKKA 4Z2JA 1E0XA 1J0IA 4GINA 5CPQA 3WH8A 1W1YA 4E8CA 5A69A 1JD7A 1ISXA 1KBBA 2CNCA 3WBEA 2WMFA 3AIUA 2XVNA 2ZOXA 3TA9A 2XUCA 4HTYA 2OYKA 1WZAA 1HVQA 1QPKA 1B1YA 1SYTA 3OZOA 5CSUA 1TE1A 3QHOA 1K9TA 4Z2HA 2WZIA 1S46A 3LPPA 4HPGA 2GJXB 2O9OA 6A3HA 1E3XA 3N15A 4Q22A 3T0AA 4B15A 2RGLA 1SR0A 3K4DA 4MDPA 3DC0A 4UFJA 2O9RA 4D6CA 4U31A 3B9DA 3RJXA 1OM0A 1BGAA 3G6LA 3RM8A 1JZ5A 3AOFA 1KCLA 3WQ6A 1W9PA 4W8LA 1E1EA 3QOKA 1CXEA 3T2PA 4JFVA 2YDSA 3VM5A 3PTKA 1A3HA 3RDKA 1EDTA 4PBGA 1EDGA 3ARXA 1H5VA 3GDBA 1PZ3A 3A4XA 2ZWZA 1C92A 1HKJA 3OB8A 1C91A 4WLCA 2YA2A 3FHQA 4U2YA 5JIWA 4LXFA 3WF4A 2J8GA 1QNSA 1SMDA 3IK2A 3NDZA 2OLHA 3K4AA 1XH1A 4AYSA 3BAXA 5EBAA 2FH8A 1KWGA 3SUWA 4TTGA 2CITA 2C0HA 2WBKA 1L0PA 1XSIA 3K8LA 3AHZA 3WH9A 2WAGA 4X0VA 3K8KA 3UCQA 3SCPA 4XB3A 1XC6A 1WE5A 4H8HA 1GPFA 3BSGA 3VILA 4UZSA 2DSUA 5I2UA 3AYSA 5IHRA 2D2OA 1V6WA 2VVSA 1DWGM 1JZ7A 5M17A 1OD0A 2YBTA 3CUIA 3TTOA 5C71A 1DWIM 2Q8XA 3PTQA 3BSHA 1MYRA 4JKKA 1MFVA 2VNCA 3N1AA 4W86A 1KGWA 1KCKA 3AMKA 2WZEA 4D6GA 1WZKA 3VO0A 4MDOA 4BS0A 1MW2A 4F8XA 1CLXA 1TVNA 1W2VA 3AIEA 1E6SM 2VZTA 1XD0A 2CETA 4NI3A 4TXEA 1FFQA 5E70A 1UQZA 5A8QA 2FGLA 3S2CA 2WKLA 2AOSA 4JCLA 1JZ4A 2PB1A 1ISYA 4ATWA 2JE8A 4WJXA 3N12A 4ML4A 2VOTA 1HKKA 7A3HA 2J7FA 1GQIA 4IPNB 3OLGA 3ZSSA 1J0YA 1QNRA 4KMQA 4ZENA 1OIMA 3DYOA 3A47A 1UHVA 1CGTA 4PN2A 4AEEA 3WDIA 1VFFA 3HMCA 2WZHA 3PZQA 4WIWA 1OIFA 3WSUA 4GO9A 1DWFM 1XYFA 1QI3A 1KQYA 1CXKA 3BAIA 1CLVA 2WWDA 3RCNA 3AROA 5AYBA 3EYPA 3PZOA 3VUPA 3B9AA 4Z2IA 2YL9A 3FNDA 1UD3A 3N9KA 4JCMA 3VMOA 4DWSA 4UCFA 3WQVA 2VX7A 5BYWA 1A47A 4PEEA 1WP6A 1VB9A 1Q4NX 3RILA 1I1XA 2BFGA 1OGGA 1JFXA 4MTVA 2X0HA 3UG5A 4BA0A 2CESA 1CGWA 3NIYA 3QOMA 3CMGA 3RPMA 5CJ5A 1QNOA 1BGGA 1D3CA 3PZGA 2VJXA 4LYPA 3WENA 1VBUA 2EPOA 5D8ZA 3BAJA 3AHYA 1KQZA 3AZSA 1EO5A 5GNZA 3UEQA 3WFZA 1NP2A 1JZ3A 2CBVA 4XV0A 1XH0A 2E4TA 3SUUA 1H1NA 4TVDA 2UY5A 3KEHA 2V3GA 3SCUA 1E6QM 2VR5A 3ARTA 4FF5A 1W2PA 2FH6A 2WMGA 5DT7A 3ZSTA 2E0PA 3GH5A 3WD3A 3WDPP 3AIVA 5E6YA 5DF0A 5D9OA 1J11A 1E0WA 2A3EA 4MNMA 2DT3A 2WXDM 2Z1KA 2UWFA 2CBIA 3CZJA 4DUXA 3G6MA 4P7LA 3TTQA 2ZWYA 4FMVA 3AS1A 4YN5A 4CVWA 4ATLA 2TAAA 2FGZA 5DO8A 4BF7A 2ZXBA 3AICA 1CYGA 1XV8A 1WNOA 5I5RA 5CSYA 2XM2A 1TUXA 3KL3A 1UR2A 1E6NA 3CUHA 1DWHM 4AIOA 4WK9A 1HL9A 2D22A 2ZICA 1ODUA 2VR4A 1RH9A 1QI2A 1UKTA 4DUVA 2GDVA 1BLIA 4AZ6A 1R87A 5F7UA 1B31A 1C90A 1OT2A 1GZJA 2QV4A 2JFEX 2BY3A 2ZUNA 1BYAA 4H7VA 4HA4A 3WY1A 5GNXA 1CXIA 5BXSA 4D72A 1ISVA 2CXGA 1FHDA 2QHAA 3WQ4A 4RL3A 1WCGA 2ZUWA 3VNZA 4XUYA 3THDA 2CHOA 1NOUA 3N04A 1NQ6A 1DWJM 3WNLA 1JAKA 3TP4A 1OCQA 1GQLA 1WB0A 1EA9C 1QHZA 2ZUMA 3OGVA 4AISA 4OUEA 4W85A 1OINA 3SCSA 4BQ5A 1LG2A 2XGBA 1EXPA 2FHBA 2PWEA 2X1IA 4UQEA 1MXDA 2QLYA 4WSJA 4AZHA 2NSXA 1CWYA 1W9UA 3O9NA 3WNMA 3WEOA 7CGTA 3KE0A 4CCCA 1W3HA 4CD4A 5A2CA 1HIZA 2W62A 3POHA 5FOOA 4ACZA 1HL8A 3M7SA 1PEZA 1PZ2A 2WVTA 5HDRA 3WD0A 3CTTA 1CXLA 2DPEA 1E9LA 4U33A 3BC9A 2FDMA 2V38A 5IFTA 3VDAA 4DM2A 5DT5A 2PWDA 1W9VA 3ARUA 4B16A 1JXJA 1ESWA 1ZJBA 2GSJA 3GM8A 4F9DA 4Z2LA 1HJUA 5KZ6A 1J01A 2DT0A 1HJSA 1BYDA 4QDMA 1W9XA 1AQHA 2XIBA 1AVAA 3AHVA 3DECA 3UG4A 3BAYA 1LWHA 4L4OA 2WHKA 4W88A 3ZIZA 2CEQA 5CGMA 1B3XA 1JXKA 4TX6A 1HT6A 2DT2A 4YHEA 3UESA 1BTCA 3VGDA 3WKZA 1B3ZA 4B9ZA 3FN9A 3PTMA 1VBRA 4GKLA 3FY1A 4HA3A 1H0IA 1R7AA 3F4VA 1GW1A 1Y7VA 1OD8A 4WKAA 4W7VA 2JALA 1MW0A 3AIRA 1F4AA 1WDPA 3HN3A 2E9MA 4M56A 2G3NA 4BQ2A 2G3MA 1QI0A 4WF7A 1BHGA 2QPUA 1HJQA 2J74A 2YA1A 4JHZA 1QHOA 2XJ7A 5FKYA 4PMUA 1NWRA 1B3YA 2O9PA 1E4IA 2ZX7A 3MSGA 4H04A 1BYCA 1PPIA 3RIKA 4OJYA 4ZE5A 2CCRA 2DEPA 5M3WA 4M29A 3W29A 3WELA 3ZM8A 2YBUA 4J3SA 1EOKA 1Q6GA 1P6WA 4DWSD 3AXIA 1OSEA 4V27A 3MUAA 4TX8A 3LPFA 4XZWA 2F2HA 4PMQA 4X9YA 5LA1A 4AZCB 1UD2A 1Q6CA 3EMQA 2ZX5A 4OBRA 1H0GA 1J0JA 3VIGA 4UFHA 3BLKA 3MUIA 5I3DA 1JI1A 1Q6FA 1R8LA 1X1NA 1LJYA 4GXPA 3PZVA 2VURA 5CPSA 4JL2A 2QPSA 2VZSA 2VTFA 3SUVA 4AZCA 1HNYA 2VVNA 5BXTA 4MB1A 1PX3A 2J7HA 3WQ8A 2B31A 4RE3A 4ZXOA 4AIUA 2X0YA 4QLKA 3CLWA 4ZFMA 3T09A 4R27A 3SUTA 2WHLA 4MNJA 1LWJA 4GPNA 2D0FA 2XWEA 2ZUSA 1JDAA 1WDSA 4MB3A 3WNOA 3ALGA 1V02E 1O6IA 3OBAA 3CHFA 4FK9A 4S3KA 4KRTA 2YDRA 1V0KA 5KEZA 1ISZA 3VMPA 2J7EA 4QP0A 5CPTA 2A3BA 1RP8A 1VJSA 1BYBA 3I3EA 4UR9A 4WKFA 3BCDA 3ALFA 2PC8A 2XFRA 4MNKA 1JZ8A 2EXOA 3NJ3A 2J77A 2WVSA 5GNYA 4DWSC 2JEPA 4W93A 3VOCA 4ATDA 4JAWA 1Q6DA 4P8VA 4PRWA 4CD8A 4F66A 1ITXA 1KBKA 4P8XA 1VF8A 3VDCA 3L4VA 5EMYA 3SCTA 1UZ1A 2VT0A 3CZKA 1LG1A 1DEDA 1MFUA 1UWQA 1WO2A 4ZE4A 3VDBA 3GBDA 2W66A 5EB8A 4AZIA 1B9ZA 1KR1A 1UWTA 1E40A 4QAWA 3WL1A 4CVUA 3A4WA 1NOWA 2WANA 1JFHA 3T08A 2YJQA 2VRQA 3ARZA 3N17A 5A6BD 3LMYA 4LQ1A 2W91A 1V3MA 1JD9A 3ZJ7A 3CGTA 1K9FA 3WDJA 3LPOA 1R85A 3CUGA 1CXHA 5LA2A 1UG6A 1B2YA 5EFDA 4MNLA 1EDQA 4JHOA 3WD4A 1UKSA 5D8WA 2CKRA 3DHUA 1WAWA 2OSWA 3SCOA 3CHDA 4AD3A 1EQPA 1H2JA 4JZ5A 4HPHA 1JI2A 2VL4A 1VFMA 1MW3A 4GQQA 3WNKA 3MO4A 4ZEPA 3L2LA 2YLAA 4HZ6A 1M01A 3AZTA 3WMBA 2J25A 1W9DM 3AI0A 2BVTA 3W4RA 2G3IA 4C7DA 1QI5A 3I3BA 3PZTA 5CQ1A 1BQCA 1OGBA 2D3NA 1NWSA 1B3VA 2E9BA 1HX0A 3KZSA 3L4YA 3CHCA 4UQDA 4ZXLA 4FLSA 3VNYA 2BHZA 1W1PA 1GOQA 4PSRA 1E70M 3OZPA 5GQBA 4M81A 1OB0A 2YL8A 1LLOA 5IDIA 1GOMA 1G9HA 1X6NA 2DSVA 1JDDA 4OOUA 4QCEA 1HP4A 3QHMA 2DGAA 1E71M 3L4XA 4GZEA 3ZR5A 4CN1A 5ABHA 4LGXA 3WDHA 3NUKA 2CERA 1UKOA 4P8WA 4A4AA 4A3YA 1M53A 1E4NA 2W63A 1GOIA 2V3DA 2WPGA 1J10A 1DHKA 4KH2A 4AD0A 5C8BB 3WH6A 2CBUA 2PWHA 3GXDA 9CGTA 3VIPA 1UH3A 2ZX6A 4V28A 3WDRA 1B90A 2WC4A 1XCXA 1L8NA 1TA3B 3AS3A 3CPUA 2QMKA 4AD1A 4M8UA 2WMIB 3ARRA 1EH9A 3GTNA 5I77A 1XH2A 4D6JA 2J7DA 3VINA 2HISA 3L2MA 4PCSA 4TUFA 1W3KA 5BXRA 1UR4A 4HMDA 4KGLA 4MB5A 5A8NA 4P7QA 4DWSB 2OYLA 4JKLA 1TA3A 2DQXA 1YQ2A 5E0CA 3VX1A 1SMAA 3WEMA 3ARSA 4PTMA 1NWUA 2WMIA 3W28A 3TONA 4QFUA 4W84A 1FH8A 2CPUA 4JIEA 3VIKA 2VX6A 4CD7A 3GNOA 3W6LA 1TFVA 1EO7A 1R7OA 4CGTA 1RD6A 1GQKA 2V5DA 1MVYA 2WLYA 1UA3A 1CIUA 3ECQA 2FHFA 3K1DA 3AFBA 4RE2A 1PAMA 4R5EA 1O7AA 3QR3A 4EE9A 1N82A 2XSBA 1NH6A 1PIFA 1GJWA 2NT1A 1CPUA 3EDJA 3VD5A 3AHXA 1KR0A 5HOSA 1BPLB 3VD7A 1I75A 2XM1A 1C7TA 3VD9A 4GZIA 3AIQA 4PMYA 4AMCA 3L4UA 2PBGA 3ZJ6A 2WSKA 3FHAA 2F61A 4HU0A 2GUYA 1E15A 4J28A 1ZBCA 4H8VA 5BCAA 4OKDA 3GH7A 2J78A 4AD5A 1U2YA 3AMLA 3CZLA 2IUZA 1AMYA 1XYZA 5M03A 6TAAA 2D3LA 1W1TA 5A6AA 2O9TA 5IHSA 4W5UA 3PHAA 4MJ4A 3VGBA 2CBJA 1EHAA 3LPGA 1CECA 4GZJA 2WLZA 1LQ0A 3NYDA 4C7GA 4GI9A 1V08A 2E8YA 2WHJA 2EPKX 4HP5A 3AXHA 3WNPA 3WUBA 2OYMA 1GJUA 3PBGA 1BVNP 2JIWA 2WKGA 4UFMA 5AY7A 5A3HA 4X0NA 4J7RA 4CKQA 1KXTA 3IJ7A 1V0LA 2UY3A 4IUGA 3POCA 4UQBA 5D9MA 3IJ8A 3OLDA 2J79A 3MMUA 4OOZA 4D6IA 3MMWA 4B9YA 5I78A 4J3TA 4J3VA 4F79A 1GOOA 1BVZA 1UKQA 2Y2WA 5A8MA 4OBSA 5JBDA 5A8PA 4Q7NA 1TG7A 1UWRA 4AWEA 2G8ZA 4KGJA 4LYRA 1JF5A 1M03A 2BNJA 3MSDA 3VIJA 5AC4A 2ZUTA 1SFSA 5CLWA 1GNXA 1PBGA 1G5AA 5A6MA 2PI6A 4W7UA 3W27A 2WCSA 4MB4A 4AZGA 4TVCA 3WEZA 1FP8A 4HOWA 5A6BA 2V3FA 5ABEA 3UETA 3PZIA 2CKSA 3QGVA 3SUSA 4GQRA 3EBVA 4Z2KA 5M5DA 3WDQA 3THCA 5A2AA 2WVVA 3MU7A 4ACZB 2DSWA 1UD5A 3ZO9A 1GHRA 1FH9A 3CIVA 5HPCA 4BQ3A 1H49A 3GXFA 4UNIA 4RE4A 4XX6A 1PJ9A 2DIEA 3VVGA 1ZBVA 1UD4A 3DHPA 5LYRA 3W38A 1XSJA 2WM0A 4BCEA 1E6PA 1GUVA 2EBNA 4UTFA 4UOJA 3IJ9A 4JL1A 3EDDA 4MAVA 3W26A 2DSZA 2PBOA 1E5JA 3AMCA 2OSXA 3VIIA 3OG2A 2Y8VA 4HOZA 3SEPA 1IZKA 3JUGA 5HBFA 4AC1X 1ZB5A 1I1WA 2WNWA 1XHGA 1DTUA 3NSXA 1E0VA 3T2OA 2EQDA 4PMXA 4U3CA 1JG9A 2G41A 4W87A 3IAPA 1CDGA 3AJ7A 5AC5A 3PZNA 5FCZA 5A1AA 4F9JA 4PMOA 1V6YA 1IZJA 3VD4A 3UG3A 5CG0A 2WMJA 3O2LA 4KWUA 3II1A 1ITCA 4W5ZA 3N13A 4Y7EA 2CHNA 1OGSA 5JIPA 1VFUA 4J3XA 2YLLA 2DDXA 1D2KA 3WMSA 3FXYA 5FIPA 1J0HA 2D1ZA 5AYIA 1HKMA 2EO7A 2YA0A 1MWOA 3IANA 3AHTA 1UH2A 2XVLA 3FAXA 1H41A 1NOFA 1XD1A 1JIBA 3U7BA 1JYNA 1W1VA 5I23A 1HJWA 4URIA 3NSMA 1MXGA 3GNPA 1PIGA 1TVPA 2PF0A 3MUY1 2BV9A 5E6ZA 2OSYA 5EFFA 3RO8A 3A4AA 1ISWA 1UOKA 3F5KA 4CU7A 4PYSA 4V2XA 3CMJA 3NDYA 3AMDA 2GK1B 1CGUA 2HVMA 7TAAA 1K6AA 2D23A 4N0RA 3U5UA 4AZ7A 3D3AA 2YIHA 5FD0A 1CEOA 1W91A 2FHCA 4NF7A 1ZL1A 5E9AA 4PCTA 3RM9A 2E9LA 1H3GA 1WDRA 1JYVA 4TTUA 3SCVA 2J75A 1VJZA 2VQTA 1JZ6A 3EMZA 2GK1A 4KRUA 1QNPA 2WCAA 3W53A 3VX0A 5D9NA 4PMNA 1ZBKA 3A6OA 5DFAA 3ZOAA 4HMCA 4EANA 3F5JA 1VEOA 4FLQA 1KXQA 3PZUA 2BVDA 4YHGA 1TR1A 1XGZA 3E1F1 5CXPA 2ZXDA 1WPCA 2VX5A 2W61A 2V5CA 4J27A 3VU2A 3WUFA 2J62A 5FL0A 2BHYA 4P7NA 3AIBA 1KWKA 1G1YA 3VIHA 3W37A 2EEXA 2ZX8A 3DYMA 3BAWA 4OIFA 3AS2A 4DM1A 4QLLA 2C8NA 3AMGA 3CZGA 3GXIA 4D6FA 1C93A 1H11A 2EPMX 1R86A 4E2OA 2XWDA 3UR8A 3VMNA 3ARVA 1H09A 1GONA 1HN1A 1GOKA 4H41A 5JUVA 2Z1SA 1HJXA 2J4GA 2BS9A 1TCMA 1E43A 1EOMA 2D0HA 4BQ4A 1FP9A 2UY2A 4UZUA 1V6VA 1B0IA 4UFIA 2WYSA 2ZIDA 5CLTA 1CENA 1E5NA 2WCGA 1OT1A 1V6UA 1V3LA 2WC7A 2WHMA 4GI8A 1JGIA 5BRPA 3VGEA 1E6XM 1D7FA 1J9YA 2WVUA 3CZ8A 4PMDA 4D1IA 2GJPA 5E09A 5TD4A 4AY1A 5A6LA 5ECUA 5JBEA 3SCWA 4ACYA 4AZ5A 3WBAA 4QLJA 3GH4A 8CGTA 1VEMA 2XTKA 3AYRA 3VIOA 3KL0A 4PTWA 4CD6A 1MQQA 1UKPA 1W3LA 3HU7A 2VRKA 1C8QA 2EJ1A 3I3DA 4J3UA 2XFYA 4A3HA 5D4YA 2A3HA 2PWFA 2VMFA 2AMGA 2GJXA 3AQUA 3TTYA 1JAEA 2W4XA 4AD2A 1HF6A 3WNNA 1JDCA 3WN6A 3ZT7A 3KL5A 3ZJKA 1V6XA 2E3ZA 2WBGA 1PX4A 1HVXA 3VGFA 4JFWA 3VDHA 1VIWA 3SCNA 4M24A 2X2YA 3BGAA 3T2QA 2JF6A 1F4HA 3QHNA 1ODZA 2ZXAA 3GBEA 5A6JA 1FH7A 1X6LA 4NSBA 3ARQA 4OZOA 1V3HA 1RP9A 1GHSA 3MV01 4HZ7A 1NP0A 4UQAA 3VGGA 1LL6A 1U30A 1MQRA 3OLIA 2WK2A 2ESCA 3DYPA 3KWXA 3O6AA 4CN6A 1GCYA 1QOXA 1KFWA 1MW1A 4BZYA 3L4WA 3W25A 5ABFB 3EMCA 2D20A 1B30A 1PX8A 1UA7A 3WUEA 4XZBA 3RM4A 3MMDA 3ZT6A 3VGHA 1E1FA 3APGA 1FFRA 4GI6A 4DUWA 2GFTA 1RPKA 2VUYA 2VRJA 2XSAA 3MANA 2A3CA 2EPLX 1XRVA 2C7FA 2BY1A 4HMEA 4UOQA 5ABFA 4FLOA 3CHEA 2BXZA 5A94A 1BG9A 3WQWA 3L4ZA 2BHUA 3F5LA 1UR9A 2WB5A 3D5HA 1K9DA 4EKJA 1UD8A 3AXXA 1V3IA 1TZ7A 3VTRA 2CYGA 3BMVA 1B3WA 1FA2A 3W0KA 5GPRA 5I6SA 5ABGA 1IV8A 3AS0A 4PMZA 1BFNA 1EGZA 3IAQA 3WL0A 4CCDA 2J7CA 4M1RA 1QW8A 3B8SA 2XIIA 1QBAA 3B9EA 3CO4A 3PZMA 1JNEA 1OWQA 4C7FA 2VCCA 4CU6A 3GZAA 3BLPX 3S6TA 3T0BA 1BF2A 3PZ9A 4CD5A 1QBBA 3ARYA 3K8MA 2F8QA 2W67A 1GOWA 2YL5A 4JFTA 1H4PA 1VRXA 2D24A 3AIWA 2Y24A 4NZCA 3SCQA 2W5FA 1HKIA 4Z2GA 1AQMA 1EQCA 1QVBA 4L4PA 1CGYA 4PMVA 5I0DA 3BMWA 1GORA 3VPLA 2WMHA 4W8AA 4AZBA 5HPOA 4CUCA 2BVYA 2OWXA 4D6HA 4JFUA 4B3KA 2O92A 1FHLA 4PTVA 4PSPA 1JL8A 1UR0A 1U33A 1E4LA 2ZUUA 3ZR6A 4EK7A
chains in the Genus database with same CATH superfamily
4HOXA 3WLPA 3EPMA 3WLOA 1OG0A 1QHPA 4K68A 3CHVA 2VO5A 4E4FA 3W82A 3GIYA 3CBWA 4JY9A 5H91A 3W3OA 4NAEB 2PA6A 3WBWA 5TF0A 3FGCA 3REQB 2P3EA 3EB3A 1L2QA 2X41A 5HWNA 4LVFA 1S1PA 4HCHA 3G3DA 1KM0A 1L6FA 4H6EA 2E1WA 1IEIA 4UTTC 3S1GA 4C6KA 4JQ1A 4LPCA 1FXQA 1K70A 3K5XA 2VFHA 1MZHA 4I7VA 4LYQA 2E6AA 3CTLA 4UTLA 1CXFA 3E0IA 1G01A 1LT8A 1KM2A 2J7GA 3D3FA 1GVIA 4W7WA 2QJIA 3C8FA 2QEZA 2OQYA 1TTJA 4GNJA 4EPEC 1CBGA 4JDBA 3MS8A 4UB9A 3AISA 2QJHA 5D9PA 5E93A 1F6PA 4C5ZA 4R88A 1TMQA 3PK7A 4CNOA 1CGVA 5DCDA 3N4EA 3N11A 3V7PA 1IXOA 3LLDA 4C6JA 3M0YA 4E38A 1H7OA 3H7RA 1AZ1A 4BWLC 4ZOEA 2XVGA 3W7RA 4IIEA 1UWIA 2VC6A 4NRSA 2QUMA 5HNNA 4C6DA 4DXVA 1GEQA 1EF2A 4Z1YA 2DZPA 1ZS2A 4E4PA 4PUEA 4JKMA 1XG3A 2HXTA 5D05A 5RUBA 3HPSA 4CN4A 5MHBA 2VCBA 1E55A 4J2MA 2Z6IA 4HHHA 2JIEA 4DY1A 3MKKA 3H6OA 2C91A 4PUKA 1M7JA 3HFTA 1LYXA 2VZVA 2NWRA 3ID7A 3CZEA 2Y0FA 3WF1A 2J8FA 2E6YA 2ZZ5A 4PUDA 4M82A 1UR8A 1Q13A 3L5LA 2WO5A 5J8LA 4UMBA 4NZJA 1J0ZA 3T1GA 4L5ZA 1O5RA 2Z28A 5A95A 3MVIA 2VR2A 1E6RA 1DE5A 4U5IA 2ZX9A 3TSDA 4DBEA 3UZYA 4XZIA 3BURA 4JR5A 4GY7A 3RJYA 3HG3A 2G4JA 1OFRA 2OKOA 4Z08A 3ZMRA 4XKMA 2Z6JA 5EGRA 3NXLA 3N18A 4P7OA 2EPNA 4Z1CA 4AD4A 3TN5A 3VOGA 2B7NA 3BAKA 3QY8A 2A5HA 3CK5A 1F61A 3NFUA 4EX4A 1GYNA 4MJ2A 3DDMA 5CH9A 4DQWA 4NRRA 4CNNA 1XBVA 1WZLA 3LXBA 5HA7A 4GX8A 3RYSA 1Q8AA 4XVDA 4HHMA 2XYLA 1MZRA 2YCLA 1KFCA 3DIPA 3TSMA 2Y4SA 2E1DA 3NSNA 4WGXA 5D04C 3EEGA 2VQUA 5BROA 1UBPC 5FF0A 2XSXA 4H2CA 4FLRA 2UY4A 2J66A 3HJEA 1EUAA 3VNIA 5CGTA 3QBUA 5AN7A 4LWWA 2PDXA 1V6TA 3OA5A 3STEA 2GGEA 3RCMA 1XLDA 3OGRA 3W1PA 1ZGDA 3KHJA 5I03A 1N8IA 2PTXA 4ZCWA 4B5NA 4GUHA 1WKFA 5DMYA 4QX4A 3R12A 4EPKA 3DU0A 4MAZA 1JZ2A 3I7RA 4FNUA 5EYWA 4WSKA 4HNVA 2ZXQA 3EB2A 1NARA 4UQCA 3BARA 3A5VA 3W76A 3VM7A 3DEQA 4QCFA 3LCLA 2QJNA 3VCCA 2ZUVA 5FF3A 3TYAA 4KESA 2NV1A 2R1NA 3WH8A 1EWEA 4HGXA 4GUIA 3HG2A 1ISXA 1N7KA 1NU5A 4IQDA 4FIQA 2XVNA 5DN1A 1NTHA 4PFHA 2D69A 1HW6A 5IOBA 2ZE3A 4LUTB 1QPKA 1O60A 2R8WA 4NP7A 1MRAA 4JTGA 1NSJA 5CSUA 3C6CA 3DFPA 3QHOA 4Z2HA 6A3HA 3T0AA 4JQ2A 2WJZA 3FOKA 2I14A 4H6QA 2PC4A 5AHLA 3B9DA 3WQCA 1DJXA 4A8IA 4F0SA 1JZ5A 2ISVA 3WQ6A 4DI9A 2ZQ0A 3M43A 3ZS4A 1TQXA 1TPC1 1XCFA 3T2PA 3RX3A 2CZVA 1A3HA 3TR2A 1BKSA 4NZ3A 4LB4A 3WQFA 2ZWZA 4MZ8A 4E8GA 1HKJA 1XLGA 3OB8A 1YXYA 1OC5A 2YA2A 3CAVA 3FHQA 5U7SA 4X3ZA 1XS2A 3NDZA 2FJUB 3NM1A 3K4AA 1JR1A 1XIEA 3DI0A 3QMSA 2WBKA 3PUDA 1XRSA 4TTGA 1L0PA 4FB7A 1LQ2A 1XSIA 2DP3A 1IXPA 3WQPA 3JS3A 3S42A 2FQIA 3WH9A 1KM3A 4X0VA 3K8KA 1UASA 3UCQA 2Z26A 3GRIA 4GC4A 3NO3A 4DO6A 3QVQA 1JPDX 1WE5A 1KV5A 4H8HA 4QGCA 4C6FA 4HHPA 5CCZA 3V36A 3QRHA 1DVJA 1U5HA 1MNSA 1F3XA 3WLMA 1X8FA 3M5YA 3PUOA 4LC6A 3LA4A 5LNVA 5M17A 2I7GA 3V3WA 4MZ1A 3UWUA 1DWIM 5FJOA 4CQ9A 1Q63A 3W74A 3C61A 1DYSA 1KCKA 4GFIA 1CB2A 3UY8A 4D6GA 2OEMA 4BS0A 3M5XA 1MW2A 2G96A 4ZVJA 4ALDA 3F4WA 1B9BA 1Z44A 4HU3A 5HNRA 4NI3A 4TXEA 1GYLA 4ZZ9A 1VBJA 2FGLA 3KBMA 3DFHA 4EWND 3HGRA 2AOSA 4JCLA 4WDXA 3NQAA 1XR2A 1P1XA 3LDVA 4IHCA 4TMCA 3N12A 1E1CA 2PTYA 4O1AA 2C14A 1GQIA 1YLVA 3IGXA 4JQ3A 4QQ3A 3MB9A 5G4WA 4CLMA 3HF3A 1UHVA 3R5EA 1F07A 3WDIA 4TQTA 1OIFA 3XISA 3OVQA 4H3DA 1DWFM 3THAA 1QI3A 1KQYA 4CQCA 3RCNA 5AYBA 3FGCB 3KRBA 3B9NA 3DENA 3N9KA 3OOQA 4UTWC 3BJTA 1UP3A 3TYZA 1VB9A 2OMAA 2Q71A 4HIBA 3RILA 1OGGA 4AMAA 3GG7A 3UG5A 2CESA 4OQVA 1CGWA 3QOMA 3EWZA 3RPMA 2VJXA 4LYPA 1NF7A 1VBUA 3BAJA 1KQZA 1OFOA 1JZ3A 4E3VA 3HPZA 3UQNA 2VR5A 4DLMA 1W2PA 2FH6A 3N4AA 1F2JA 5B7ZA 2E0PA 3MY9A 3W1MA 3GH5A 4Y90A 3PPCA 5HMFA 3OEXA 4MGGA 5E6YA 4QQUA 4NNBA 4MZYA 3C0JA 2RDXA 1J11A 1E0WA 4Q8TA 1H51A 2A3EA 3LUTA 4MNMA 2NUYA 2UWFA 3VKCA 4HMNA 3CZJA 1RALA 2ZWYA 3AS1A 4GJ1A 2WNNA 3IRSA 2ZXBA 4KFOA 2F84A 3VOFA 2XZ7A 5CSYA 3QC0A 1TUXA 4ZQMA 4M7SA 3TNBA 1E6NA 2YYUA 2RFGA 2I9UA 1RY0A 5EBUA 1ME9A 4DUVA 1EJUC 2AL1A 4MY8A 1IYXA 1GZJA 3BG3A 1T8XA 5DANA 3TH6A 3NL5A 2Z2BA 3WLJA 3EOUA 1MUMA 4MG4A 5AC8A 4LS1A 2QHAA 3WQ4A 2J9ZA 3NM3A 1RBLA 2ABBA 3H4GA 4ADTA 1BTMA 4O0ZA 1EYWA 2H9AB 5C5YA 4S2CA 3VFLA 3QPEA 2J8TA 3RU8X 1EA9C 3GG0A 2ZUMA 3OGVA 3V35A 3ORWA 4OUEA 2X1UA 4W85A 1XM3A 4GA8A 1LG2A 1EXPA 2FHBA 1LBMA 3HQNA 2PWEA 2ISFA 4QBXA 1AW2A 3I6RA 3UF9A 3PB2A 2NSXA 7CGTA 1T5AA 1YW1A 3OIXA 1GZ1A 5LIYX 4B2DD 3UU0A 3POHA 4ACZA 2VENA 4DF0A 2WVTA 5HDRA 1CXLA 3H22A 2DPEA 1PTGA 4L9ZA 2FDMA 3VDAA 4DM2A 1POJA 4TIMA 3E0LA 2GSJA 3GM8A 1HJUA 5KZ6A 3EXSA 2DT0A 2PDFA 1BYDA 1JUEA 2YXGA 3MUXA 2PAJA 1AQHA 1AVAA 3AHVA 5F2MA 4IQLA 2OEJA 4L4OA 3ZIZA 4DO4A 3I65A 1JXKA 4TO8A 3MUCA 3FN9A 4ORMA 4LVBA 1L6YA 3PTMA 4Y9PA 1ZQ5A 1VBRA 1O5XA 1H0IA 1R7AA 1HGYA 4QS5A 3FSUA 2YCLB 1Q65A 4W7VA 3KVJA 4DF2A 2RDTA 4L64A 3VDGA 2A1YA 1NWRA 3NPWA 2ZVIA 4YYCA 4I3GA 4H04A 1H5YA 1Z69A 3CV7A 3LEPA 5M3WA 2G3FA 3W29A 3WQOA 2YBUA 2OVLA 5AZ1A 5BRBA 3JW7A 3GSMA 4GE8A 4V27A 4QJ3B 3MUAA 3LPFA 3P93A 3RLHA 1DHPA 1J4EA 1Q6CA 2PF8A 4OBRA 4QJ4B 3KHDA 4G8TA 3TAKA 4XBSA 2NUXA 3BLKA 3GKAA 4O53A 4DUOA 1Q6FA 1R8LA 1X1NA 2DUZA 4JL2A 4K37A 3OBKA 2QXWA 1HKWA 2EKGA 4AZCA 3RHGA 2VVNA 3MSRA 3RLGA 2J7HA 2ZC1A 1S5NA 3GO2A 2B31A 4ZXOA 2ZTKA 4AWTA 4ZFMA 3T09A 4R27A 2ZZ6A 4G6CA 3STGA 5H8MA 4DN1A 2D0FA 4JICA 5SWUA 4DYEA 2GQ8A 5AECA 2C18A 4PEKA 3EWUA 3UA3A 1XIBA 6XIMA 1O6IA 5AHMA 1DXEA 1EJXC 5KEZA 1ISZA 3VMPA 2J7EA 4N7QA 1H7WA 3L66A 5DRCA 4HYWA 4RZBA 3BCDA 3ALFA 2XFRA 4MNKA 3QH2A 4GC3A 4WR3A 3UWZA 1XYMA 4Z1BA 2EXOA 1JUKA 2FZMA 3WO8A 2A7NA 3EPOA 2JEPA 4A6GA 4W93A 4G1NA 1DOSA 4ATDA 1H61A 1RCQA 5K4ZA 4H9XA 4PRWA 4CD8A 3OPSA 4F66A 1ITXA 3QYQA 3QC3A 1CCWB 4P8XA 3L4VA 1TTQA 2FDSA 5T8GA 1DEDA 3TMQA 1QOQA 4ZE4A 3TU9A 4MUZA 1TWSA 3WL1A 1I0DA 3TQ0A 5A6BD 1JD9A 4HSOA 5FACA 1V7YA 1G4TA 5LA2A 5BMWA 5D2VA 2Z25A 3VE9A 2V67A 3RMJA 3M4HA 3O07A 3WD4A 2AQWA 5D8WA 3CIWA 3MZNA 3G1SA 1O12A 2PGWA 3F2CA 3EWWA 3CHDA 4LCRA 4HPHA 1R9YA 2VL4A 4EPDC 1DTNA 3WNKA 3L2LA 1ECQA 4GKTA 3AZTA 4WY0F 1X6UA 2J25A 3MTWA 4JIHA 3AI0A 2ALRA 2G3IA 1J79A 3QPYA 1QI5A 3I3BA 1OGBA 5GJMA 3CQ0A 3GC2A 1HX0A 1IR1A 3CHCA 2QT3A 3TA6A 4ZXLA 1TV2A 1RJQA 4GG9A 2GGGA 1W1PA 1GOQA 1WXZA 4BI6A 1E70M 4FNRA 3S0CA 4RW3A 1CI1A 1GK8A 4WDTA 2BG5A 4JTKA 4KRZA 4QCEA 3QHMA 3APYA 2H8ZA 3DUGA 5LHFA 5D37A 4G5DA 3ME3A 2YW4A 3G8EA 3P67A 2OGYA 2BVWA 1E1CB 1VYSX 4ZBCA 2LLEA 2H90A 4O4VA 4H9VA 4AD0A 3WH6A 9CGTA 2ATSA 3VIPA 3LHZA 1UH3A 1RQBA 3WDRA 1RCXB 1L8NA 2NVDA 3BLFA 3UNTA 4PTDA 3VINA 4PUUA 1C9DA 3TCSA 2VDGA 3SJ3A 4N6EA 4MB5A 4DJEA 4RNHA 4NZ1A 2X7WA 4JKLA 4FX6M 1R3RA 3KCJA 1TA3A 3LBCA 3T8LA 1LRQA 2QVHA 1TV3A 3LTSA 4PTMA 1TJ2A 1D8WA 4OHQA 4IZGA 4QFUA 4YWIA 4ILSA 1FH8A 2BXVA 4I90A 1UMYA 4FI4A 1LORA 4A2RA 3GNOA 4M6UA 3W6LA 1TFVA 1TB3A 4A2SA 1MVYA 1W5QA 4RE2A 4R5EA 2E25A 3QR3A 4YVXA 4NNCA 5I09A 2DW6A 4OV9A 3MJYA 3VD5A 3AHXA 2OGJA 2QCCA 4XUGA 4GZIA 4BF5A 3FHAA 1ZPTA 3NOEA 1P6BA 1RCOB 4EAYA 1E15A 4J28A 4Q8UA 1KRAC 1VFTA 2OX1A 3GR8A 3NQDA 2RJGA 3ERPA 1BXCA 1XG4A 2IUZA 5M03A 2D3LA 2Y63A 3E2RA 2OZTA 4E3TA 4XWUA 1VIZA 3VGBA 2CBJA 3BO9A 1EHAA 3L7RA 4H9UA 3SSZA 3S9ZA 2BGQA 3W7CA 1UP0A 5F4SA 3TW9A 1JRBA 3AALA 4C7GA 3ANUA 2EPKX 3GFYA 5F1UA 1KBLA 1KFBA 2ZC8A 5LIWX 4RXGA 3E38A 2JQXA 5C7HA 1P0DA 1BVNP 4RPPA 2WKGA 4D8LA 3N29A 2QW5A 3S2NA 4LNCA 1R2SA 3JR2A 1KXTA 3LGDA 3TXZA 1BD0A 4Y2WA 3VNLA 5D9MA 3GTHA 1IIHA 3OLDA 3HURA 1S2WA 2VEGA 1AW1A 4GUFA 4R53A 4H19A 1Q6LA 4C6QA 1BVZA 2PD9A 1VJIA 6ALDA 4XAPA 1PIIA 5HNTA 5JBDA 4Q7NA 4AWEA 1EJRC 3MSDA 5AC4A 2SFPA 2P5NA 1XDJA 1PBGA 4WCJA 2E5CA 2POZA 3G5EA 2ZRXA 1QXLA 1FP8A 4HOWA 2VGBA 3THQA 4FOKA 3QGVA 3SUSA 3EBVA 1J2BA 4UTJA 4ACZB 2DSWA 2Z00A 1UD5A 5C6MA 4JTUA 1K7XA 4O1CA 1RZMA 1TV4A 4RJEA 4BQ3A 3GXFA 4UNIA 3T8QA 4RE4A 2I5IA 2Q3OA 4NASA 2DIEA 3VVGA 3TROA 3DHPA 1GWJA 1XSJA 5DY2A 1Y5XA 2EBNA 5CC6A 5H6HA 3QTPA 3UW6A 3T4WA 3QV6A 4WEVX 3EDDA 3QFEA 1GJPA 3R89A 4MAVA 2PBOA 3HPXA 1R9ZA 4I8YA 3VIIA 1A80A 1E0UA 2Y8VA 5D09A 1IZKA 1VC4A 4IG2A 1RD5A 2CLEA 1AL7A 5G5IA 3Q37A 5AHFA 3NSXA 1AJ0A 3BE7A 1A4MA 1DIDA 2I17A 4O57A 3UCDA 3IAPA 3W7KA 4F2BA 1CDGA 5BU6A 3KP1A 3MMTA 1LUCA 2PURA 2NQLA 4PMOA 1L6GA 3UJ2A 1E9IA 3UG3A 5CG0A 4GY1A 1P48A 3II1A 1EBGA 1V5XA 3M16A 3PJXA 2YLLA 4JNYA 3Q58A 2AKMA 3ONBA 2YYTA 4WSHA 3WMSA 2HCVA 2HDJA 4KWSA 2X1RA 1UH2A 5G1TA 3NPVA 4NXKA 1H41A 2KX9A 4QNEA 4Q4RA 4FOUA 3CQJA 1JIBA 2D2GA 4URIA 2FTPA 3NSMA 4LW7A 3GNPA 3FVDA 9XIAA 3E49A 3MUY1 2OSYA 1UOKA 3F5KA 3GVQA 4RDVA 4N4QA 5HATA 1DJGA 3AMDA 1O5KA 1CGUA 2HVMA 7TAAA 4LBUA 2HTMA 4JTFA 1GT8A 3IGSA 4N0RA 3U5UA 3F4CA 3NQCA 1SSGA 4Z1DA 3EKZA 1W91A 3IVUA 3UWVA 4GI4A 3EGJA 3ATZA 2JBMA 1ITUA 3D46A 1JYVA 4A35A 1JZ6A 3B8IA 3SM0A 4F0RA 3NZQA 4L1XA 3TE9A 4B4HA 5D9NA 3ZOAA 1ZBKA 4GGBA 4Q4QA 3WQGA 5K4XA 1XGZA 1T99A 1JGMA 2ZXDA 1UC5A 4LRTA 4IP7A 2CLFA 2VX5A 5LXXA 2ZZ1A 3OJGA 1CLKA 2J62A 3AIBA 3M0LA 3VIHA 2E6FA 3RR4A 1XIJA 1NVMA 5LXEA 1AA1B 2VP8A 3BAWA 3DHFA 1Z9AA 2QZRA 4OIFA 3BL3A 4DNMA 3RRXA 2VC5A 3AMGA 1BXBA 1BEUA 3AU2A 1H11A 4E0CA 2CLOA 3U2EA 2XWDA 3PJWA 4YTQA 3LNMA 5BOEA 3EXRA 1FCBA 3ARVA 1XBYA 3BLOA 3S5SA 3UCCA 1HJXA 3N9SA 2J4GA 2PRHA 3STPA 4K8HA 2GQ3A 2UY2A 4MF4A 5CPNA 1EJVC 8RUCA 5CLTA 4EXAA 4B5VA 2CXEA 1P7TA 4PR4A 2WHMA 2QJMA 2GJPA 3VCNA 1G4PA 5E09A 3KS5A 2QCFA 5ECUA 4ACYA 4QLJA 5XIMA 4PUWA 2YBVA 3AYRA 3BQ5A 3VIOA 4CD6A 2QAFA 4GWEA 2DIKA 4S3BA 3TLLA 2ISSA 2I5GA 2EJ1A 3I3DA 2HQAA 3KXQA 3H8AA 5KZDA 2PWFA 4IFKB 3ICJA 4AY8A 1E0TA 4HU4A 1JAEA 4YCOA 2JKAA 4UTKA 1JDCA 3ZT7A 2INZA 3RFAA 2WBGA 4X22A 1JRCA 3VGFA 2PDNA 4JFWA 3W2KA 5CSRA 2B0MA 1H1ZA 1L2UA 1TPEA 2ZBTA 1FVPA 4DWDA 7REQA 5BOFA 3P80A 1ALDA 3WG6A 1ONEA 1PCWA 3MV01 1EKOA 1BWVA 3MO7A 4PE8A 1DORA 4MY1A 2VGGA 5HWJA 4Q6XA 1VHCA 4GQGA 1GCYA 1MW1A 2VWTA 2Z7GA 3PJUA 1R9XA 2VWSA 1FWBC 3EMCA 1DQUA 2D20A 1B30A 4FX7A 3NZGA 4XZBA 3RM4A 3MMDA 1UP2A 3ZT6A 1E1FA 2ZZ3A 3APGA 2G37A 2WZMA 1FFRA 2P53A 3BSMA 3L68A 3U8GA 1RPKA 1S2UA 2HS8A 2VUYA 3TNOA 3WLRA 3CWNA 3W1RA 3MANA 2A3CA 5MKGB 1XRVA 4HMEA 3NO5A 4IJBA 5ABFA 2G5WA 1R46A 3CHEA 1BG9A 3WQWA 3L4ZA 4JOMA 3R2GA 4Q7IA 3D5HA 1TZ7A 2CYGA 4QR6A 5GPRA 1KCZA 2V9DA 3TN4A 2PP1A 3G1FA 5FF4A 1GW9A 1BFNA 1QO2A 2ABAA 3WL0A 4M1RA 3U4AA 4XO6A 2WOQA 3RK8A 1OWQA 4AB4A 1DJQA 3GUWA 1G7UA 1BF2A 2R91A 4CD5A 2F6XA 2ZZ4A 3ABZA 3G1HA 4RV3A 1VRXA 2R1MA 4AXKA 3ABXA 3GAYA 4HVXA 2Y24A 3W75A 3GFZA 4R7JA 3H2FA 3INPA 4NZCA 3SCQA 2W5FA 4TX9A 4A8LA 1AQMA 4A3UA 4OE7A 1EQCA 3BCJA 3ZVHA 1O1ZA 3UA4A 1OFAA 2E5BA 1GORA 2Z1XA 1SZNA 2WMHA 4AZBA 4CUCA 2OWXA 4J40A 2IS7A 4Q3MA 5LSMA 3GHRA 4B3KA 2O92A 1TCDA 1FHLA 3H4XA 4PSPA 4J5NA 3STFA 1JL8A 1A0EA 3TCEA 1SUXA 1E4LA 3KOZA 3UPBA 1QCWA 4EK7A 3W83A 5A5WA 3TAOA 2RGMA 4WKHA 3LCGA 4EAMA 3UVAA 3IV8A 5DEZA 3WF3A 1KGUA 5CGQA 1ZU8A 1IT8A 1K3UA 1XLIA 1IQ8A 1TJRA 1CZ1A 5DCEA 1CGXA 1ZJHA 2YXOA 1E9YB 5KSWA 2FVMA 2XVPA 4JD4A 3MCOA 3M0VA 4PTXA 3S1XA 3T4CA 1OFQA 4L6OA 4U5KA 1T41A 5AYZA 2E09A 3VC5A 4E8DA 4FNPA 1TVLA 4B3LA 2DZVA 4CCEA 5JH2A 1NM9A 1HZYA 1E4MM 1UYQA 1E6ZA 2GLKA 4HCLA 3P74A 1TTPA 3UZJA 3DG3A 5B7YA 4DBDA 2D0GA 1I4NA 6CGTA 2PEVA 1O1HA 1RUSA 5I79A 1HXJA 3EWXA 4M6QA 3IVTA 3SY5A 4N9BA 1W5OA 2X05A 3I6EA 2VZOA 4GH3A 2XISA 5D02A 3M5VA 1VENA 1ECEA 4LH8A 4NX0A 1LBFA 1WZMA 4LAKA 1L6WA 2XPKA 1LCOA 5AFDA 2HV5A 2Q3RA 2XVKA 1KW1A 5KITA 4HSHA 1KXVA 3TQVA 3CUFA 4YPJA 3B97A 4S3DA 5EMJA 1FDYA 5GVJA 4FXSA 3W81A 3L5MA 4GXWA 1QR7A 2ZZ2A 3LG3A 3PN8A 4LV9A 3ZLGA 3WYZA 5CZJA 2QUNA 3WQEA 8A3HA 1ZHAA 1PXGA 3TTSA 1RHCA 3IUIA 1V51A 4F48A 1N2VA 5PTDA 1P1MA 5BMXA 4FX8A 1XDMA 2RDUA 4O8RA 3EDKA 3URAA 3VIFA 3L2IA 1G94A 5DELA 3OZYA 3VA8A 2H3BA 3PB0A 3RNDA 5C70A 4R34A 4D8ZA 4AIEA 1E72M 2GJRA 4K6AA 5HXMA 3U5YA 2MNRA 1LUCB 1V0MA 2G95A 1VPXA 1A5AA 1SZGA 1E3ZA 1SW7A 3B04A 4NIRA 3DFTA 1QK0A 4PUNA 2XH0A 1J18A 2V69A 1REQB 1YNPA 3FSTA 5HMEA 3GUGA 3D47A 3SURA 3TYEA 1M1BA 1J12A 2HZGA 4DXKA 4IH3A 5J5RA 1LL7A 1IZCA 4XKYA 3L4TA 3M6DA 3BJSA 1XGEA 2PE4A 2NW0A 1GVYA 4GJJA 4LTSA 4H9YA 3P3BA 3KRSA 1JNDA 1YPIA 4RZ4A 4TVUA 3OLEA 4U2ZA 2DT1A 1CNVA 3W7LA 2FMOA 3SY8A 4DELA 4ES4A 2CZFA 1C8YA 1QJWA 3BG5A 4XZNX 3GYCA 3YPIA 1HP5A 2BBFA 4NHVA 4D1JA 1LL4A 1DJNA 2WWCA 4F0LA 2OWWA 1KM5A 5FF2A 5HJXA 3TWBA 1DP0A 3H70A 5CZSA 2E28A 2V6AA 4HNNA 5A6KA 3WH5A 5AHIA 4D71A 4ZMGA 3CT2A 2OWCA 1UQYA 4AFYA 3J7HA 1DIKA 3PULA 1W1B1 1K9EA 4M80A 3G1XA 1FWRA 2DH2A 5E0FA 5BRQA 2PTWA 2NXHA 2OQLA 4PMRA 3BXWA 1UIPA 6PTDA 4K7VA 3NQEA 3EOSA 1SM9A 1U83A 4GMEA 4JBRA 4JQ4A 4HNTA 2C13A 5FJUA 5FESA 1WDDA 2VX4A 3VD3A 4LRSA 2PU0A 1EP3A 1JF6A 3LTPA 4OT7A 3HFYA 1KXHA 4NZ5A 4D6DA 2VFGA 5IXEA 2YGYA 1Q7ZA 4HA1A 1EBHA 1GQJA 4YU1A 3L0KA 4U3AA 2A2IA 2GVEA 4MHBA 2FMNA 3B9OA 2XFFA 1VAHA 3RLUA 4TV6A 1UUMA 2W9MA 4MPKA 3W6MA 2GVJA 1RSCA 5BWFA 3V0SA 3B8VA 1M04A 4DBUA 2DQWA 1GKQA 2Y88A 1Z7AA 5JH1A 1VLIA 1E0XA 3NGJA 1J0IA 4GINA 4DBWA 4IP4A 1JD7A 1KBBA 2P3ZA 5H8PA 1ZTVA 3AIUA 4RW5A 2H3DA 3QY7A 3TA9A 4HTYA 1Q3NA 3A24A 1HVQA 1GYMA 4JNMA 4O8AA 3CEPA 3EWYA 3VOHA 1B5TA 5T91A 1R2RA 4OFCA 1K9TA 3MW7A 2ACUA 1E3XA 3N15A 2VEMA 4Q22A 5E9XA 3ZR4A 3S5YA 2RGLA 4YTUA 2J27A 3K4DA 2YCIX 2A7PA 2O9RA 4DAIA 3SQSA 3S8HA 3RJXA 3R0UA 1AG1O 1W8GA 5CJNA 2GVGA 3RN6A 3V0UA 5IM51 1XPYA 4X2RA 1M68A 3CU2A 1NDWA 3CXOA 2NQHA 4CNSA 1WUEA 4JIPA 2HXUA 2GWNA 4IXHA 3VM5A 5BOOA 1EDTA 4PBGA 3W70A 1PZ3A 1KRMA 4AQLA 1C91A 4DYJA 4Q4KA 5C9XA 2XH4A 3KOFA 3HIJA 4X60A 1DL3A 2OLHA 1Q5MA 2WJFA 1IWPA 3G24A 5DXYA 4AYSA 3LNPA 2Y8UA 1EJSC 3SUWA 2C0HA 2GZXA 4HK6A 1LT7A 3GHSA 4IGMA 3GVVA 6TIMA 5BU9A 4O1DA 3LCWA 4LUSA 3ABSA 3EA3A 3TC3A 2DORA 5HWMA 1GVOA 2QR6A 5ABTA 4RX0A 1LROA 3WLNA 2D73A 1AK5A 1QU4A 3LM3A 4UZSA 3ZLHA 1S5TA 2DSUA 6XIAA 3AYSA 3GE7A 5IHRA 4HCDA 1V6WA 2A79A 3SB0A 1WV2A 1S3HA 3TTOA 3GC5A 2GUBA 1S5MA 4Q8QA 3SI9A 1WDWA 2Q8XA 3GW0A 4KCTA 4EXBA 3BSHA 1MYRA 4EF9A 1MFVA 3N1AA 4W86A 4FSAA 3AMKA 3G1VA 3UXDA 6REQB 3HJZA 3DERA 1O4UA 4F8XA 1CLXA 1XFCA 3G1AA 4GUJA 3ISIX 5DXXA 1VYPX 1E6SM 1L6SA 1S1RA 1UQZA 1AL8A 4O50A 1FWGC 3CPRA 3S2CA 1K8XA 1JZ4A 3BUVA 1VKFA 3H23A 2Z2UA 4WJXA 4DF1A 3CQKA 1G4EA 1Q8JA 4IP5A 4ZB2A 1LWIA 4I7WA 3OLGA 1A5NC 3FIGA 4PBFA 1XLHA 3K30A 3W02A 3A47A 3NZPA 4AEEA 2V5KA 1VFFA 2PDIA 3VUSA 4MWAD 3WSUA 3M0HA 3F4NA 1G69A 2YFOA 1CLVA 2WWDA 5L9FA 1RQEA 4X61A 2A21A 3L23A 4NY2A 3B9AA 4GIRA 4F2UA 4CNTA 1W6TA 2PCQA 3AJXA 4S3CA 2F9RA 4YJ5A 1A47A 1MEIA 4PEEA 1WP6A 1QDSA 1Q4NX 3FCPA 3PC0A 2E6DA 4HBKA 3S9IA 2X0HA 3C2VA 3G77A 4OVXA 5CJ5A 1BGGA 1D3CA 2DZTA 2X1SA 3WENA 3USBA 3AHYA 5XINA 3AZSA 2YFNA 2DY3A 3UEQA 5F2IA 3I4EA 2HK1A 1XH0A 4YTSA 2UY5A 3V18A 4H9MA 3MA8A 2V3GA 2FJKA 2P1FA 4FF5A 2ZRWA 5DT7A 2X42A 4KETA 1C29A 1SJDA 3AIVA 1A0CA 3M0XA 2HEJA 4C65A 4QXIA 3PBUA 4LBRA 3QEZA 3KBJA 4DUXA 4O1FA 5HQEA 3G6MA 4P7LA 2B7OA 2TYSA 1K1DA 4UUIA 4BF7A 9XIMA 4WZHA 4KBXA 1P43A 4AIBA 1POKA 5I5RA 3GXTA 1UR2A 1DWHM 4AIOA 3ITVA 4WK9A 4FOJA 2D22A 2ZICA 2VR4A 1RH9A 4AY7A 4ZR8A 3N4FA 1BLIA 5F7UA 1R87A 3WJZA 1B31A 2J13A 1C90A 1OT2A 2QV4A 4ZB5A 2BY3A 1W1ZA 3WJSA 1J2WA 3M64A 4H7VA 3TTEA 3UXAA 4M51A 2CZ5A 1A4LA 5BXSA 1ISVA 2CXGA 4G1KA 2OELA 1GKRA 3QR0A 3W6YA 3MHUA 3G8RA 1FRBA 1AQFA 2ZUWA 3M41A 3N2CA 4XUYA 3BZJA 4GYJA 2J88A 3BV4A 4JYEA 1NOUA 4JGDA 1PWLA 1TMLA 4H83A 3UYCA 5FJPA 3TP4A 1OZMA 1GQLA 1QHZA 3L21A 2OR2A 3UWQA 1I9CB 2DW7A 4KWWA 2BZNA 3CYVA 4EP8C 4DZ5A 3R43A 3IIVA 4UQEA 4BJHA 3R1ZA 2AL2A 1VFLA 3R13A 4RLIA 1CWYA 4QHRA 3KE0A 1M7OA 3LI1A 1SFLA 1W3HA 1HIZA 2OPJA 7ENLA 3S83A 5IBXC 2A3LA 1OJXA 3BICA 3WD0A 1F5ZA 4WD0A 5HR7A 1E9LA 1X98A 2V38A 3LM7A 3R10A 4KEZA 1JCMP 1NEYA 3GR4A 3ARUA 1ESWA 1XIFA 2ACSA 3RITA 1HJSA 3KCOA 3TJIA 1TJPA 2XIBA 3E74A 2VFIA 3DECA 1Q2RA 3HO8A 4FPSA 4L9YA 1IWBA 4TX6A 1UIOA 4YHEA 3K1GA 4LBSA 1MDLA 1QK2A 4IIGA 3P7YA 2PUZA 1EWDA 2H8XA 3ATYA 4LYKA 1R38A 4DVOA 2JALA 3W86A 1F4AA 3HN3A 2G3NA 4BQ2A 1J8VA 1QI0A 4DJED 4NJJA 4HB7A 4WF7A 1YKWA 3CT7A 1MNZA 1P0EA 2J74A 1I2PA 2FLIA 5G2HA 2XJ7A 5FKYA 3QQ0A 4DJFA 5G2IA 2O9PA 3VI2A 2TSYA 4OJYA 1JJKA 4ZE5A 3N6HA 4LEQA 4M1BA 4V33A 3T9PA 4IUOA 3WELA 1Z42A 3ITGA 1EOKA 2Y5SA 3QSRA 4TX8A 3TXVA 2ZDRA 2F2HA 4XZWA 4YWSA 2XH7A 3QW4B 3IJQA 1H0GA 1VR6A 3ITTA 4LALA 1KNWA 1JCJA 5BZAA 3MUIA 3OHIA 1TMHA 3V5FA 3GY1A 4RCXA 2WSYA 4DLFA 3O7UA 3DBNA 4IICA 4L4LA 2QPSA 5T9BG 2VZSA 4RZ6A 5EY5A 3MQTA 1ZUAX 3LX9A 1WQ5A 3TC6A 3QZEA 1PX3A 1KKOA 5EKYA 2R82A 3SQLA 2X0YA 3SRHA 1AH0A 4MNJA 3S47A 4GPNA 3G1YA 1PSCA 2FZDA 2XWEA 1JDAA 3R8HA 3PM6A 4MB3A 4O0KA 4M3PA 1QPRA 1FCVA 3OBAA 4FK9A 3H2EA 1YADA 4KRTA 3C2RA 1IE7C 3UXLA 2ASHA 4B5SA 1VJSA 3I3EA 2QCNA 3PPGA 3QQWA 3DH7A 3W1AA 2PC8A 1JZ8A 3NYZA 2P0IA 3MBFA 2QDGA 3W7JA 1ZP3A 4L56A 2DZUA 2J77A 2WVSA 4DWSC 3WLTA 4FALA 4MM1A 2JK2A 3QMTA 4XD3A 2PGEA 5CG7A 1KBKA 2EGZA 1VF8A 3FS2A 1F3WA 1JCLA 4AUBA 3AYVA 1UZ1A 1LOSA 1MFUA 4JN7A 3CMFA 1NIUA 4AZIA 4V1XA 1S2VA 1UWTA 1E40A 4B5UA 4CVUA 1K8CA 3T08A 3A12A 2YJQA 3ARZA 3SN1A 3N17A 4LQ1A 8XIAA 3ZJ7A 4GBDA 3LPOA 1R85A 3PR2A 1LTDA 3OZMA 1XI3A 1ZAJA 3T7VA 2ALDA 3QGKC 1VCGA 3G0XA 5EFDA 3QN3A 1F8IA 2PGRA 3R7MA 4TMBA 4JHOA 1UKSA 4XTIA 5A8GA 1WAWA 1XLKA 1KC7A 4QG8A 3U9IA 3CB3A 2OSWA 3RLVA 3E3HA 4C6NA 3CASA 1G6CA 4D8AA 1T7LA 4KWVA 1XLFA 1VFMA 3OVGA 3I6TA 4NJIA 3MO4A 1X97A 4ZEPA 3AYTA 3VYLA 3EKGA 1M01A 1A3WA 4GYPA 3WMBA 4RUBA 3W4RA 1FHVA 1UROA 4FS9A 5CQ1A 1BQCA 2D3NA 2E9BA 3LLXA 2HE8A 1A5CA 1KRCC 2PDBA 4KS0A 4FLSA 2P50A 3PAOA 4LS0A 1OY0A 3FJ4A 3OZPA 4XD5A 3R58A 2HRWA 3AO0A 1LLOA 1OFBA 4N9CA 5IDIA 1X6NA 1RQHA 1JDDA 3L0NA 4G2DA 4QEEA 1JCNA 1Z8AA 1FWTA 2DGAA 3B8WA 3DG7A 3FA4A 4GZEA 3ZR5A 1KFEA 4CN1A 5G4HC 4LGXA 1M3UA 1QW7A 3NUKA 3P82A 1UKOA 1US0A 3NG3A 4P8WA 4A3YA 2W63A 1GOIA 2V3DA 1J10A 2O7SA 1DHKA 1QATA 1FWWA 2PWHA 3IPWA 4GISA 3TZFA 1XBXA 4KW2A 1KTCA 2I9EA 1TPUA 2WC4A 1XCXA 3CPUA 1DJHA 3IGUA 2QMKA 2XDFA 5LNWA 1XH2A 2J7DA 3JU2A 4GACA 1OFEA 3L2MA 4PCSA 2YCKX 4Y9NA 1KLYA 1VHNA 1W3KA 5BXRA 1UR4A 5KZMA 3HG4A 3A5FA 5A8NA 1H7RA 2PLCA 1H7NA 3W71A 3B8UA 4I9MA 4G7EB 2OYLA 2EPHA 2NXIA 2DQXA 3VX1A 1DXIA 3PFMA 2WMIA 4J3ZA 4S3AA 3W28A 4IMAA 5EMUA 3TONA 3M44A 3CQIA 2CPUA 4JIEA 2XIQA 4CD7A 1N8FA 2POTA 1R7OA 1DJZA 1RD6A 1UA3A 1NAL1 3K1DA 3AFBA 3TWAA 1W37A 3LXCA 3KM8A 4EE9A 5C9UA 3SZ8A 3AAMA 1ELSA 1BPLB 1RR2A 2XM1A 3IIOA 3VD9A 1AH4A 4S2BA 1R2TA 3HA1A 3VZXA 3L4UA 2PBGA 4AMCA 1DIEA 1EB3A 3A13A 5H2ZA 1BWKA 1RK5A 4H8VA 4GH1A 2YX0A 4Q4PA 4OKDA 3GH7A 1RY8A 4DJDA 3PWAA 3AMLA 3CZLA 1R6WA 2CZEA 4JIRA 2PDUA 3UZXA 2BP1A 1Z89A 1XYZA 2ZA3A 2I5QA 4JTCA 2CLKA 1W1TA 3N2TA 5IHSA 4W5UA 3NEVA 4HZMA 2PLJA 4K3ZA 4MJ4A 3LPGA 1CECA 2C1IA 2WJDA 3QM3A 3WJWA 3GKFA 3T42A 3UR2A 4MY9A 2WLZA 5G1YA 4LUYA 5KTLA 3S4TA 3NYDA 1V79A 1QNVA 2DUXA 4REQA 1WKEA 4GI9A 1QMLA 3GU2A 4LY8A 1AODA 4JX5A 3DKLA 5HANA 3M0KA 3PBGA 1A50A 4UFMA 1SFTA 5AY7A 5A3HA 4X0NA 4H8NA 2VDHA 4EIVA 3TQKA 4HNLA 4IUGA 1A3XA 4UQBA 4B5WA 1MSSA 4XVEA 2J79A 3DAQA 4JEJA 5FI8A 4PFMA 3E9AA 4OOZA 5I78A 1HO1A 3WK1A 3H55A 4RPQA 3IIZA 2Y2WA 1ONXA 3FDGA 5A8PA 4HHLA 3I10A 1Q6RA 4D2JA 4LYRA 1M03A 2BNJA 2ZUTA 5CLWA 1YE6A 5A6MA 5G4EA 2PI6A 5I06A 4AZGA 2PDMA 2V3FA 3GNXA 3PZIA 2CKSA 1PZ1A 1UJQA 4Z2KA 5CAKA 2E5DA 3HZ3A 2ZA1A 5A2AA 2UZ9A 2WVVA 3MU7A 4XO7A 1HTIA 2FFIA 1O66A 4ZQRA 4O4WA 4KEVA 1F8MA 1FY6A 1PJ9A 3WJXA 1W5PA 4AHQA 2NV9A 3LV6A 1UD4A 5LYRA 3W38A 4UIOA 4IFOA 3S9YA 3LD5A 1EFZA 2HNHA 4L7ZA 1PHWA 2QQ6A 3TFCA 4LAZA 4RV8A 3P6LA 3IK4A 1EYEA 4S23A 3W26A 4FHAA 4LC8A 1E5JA 2OSXA 1BQGA 1F05A 2VOMA 3TIMA 3P61A 3TEVA 3G22A 3GG8A 5CKSA 3JUGA 2F2KA 1ZB5A 2W27A 2DZWA 1I1WA 2C71A 1XHGA 2QCDA 3R11A 3Q67A 3HV9A 5AB3A 2EQDA 4PMXA 1SW0A 4ZA0A 2QUVA 2G41A 4W87A 1Q45A 4KF1A 3AJ7A 3H4WA 1TWWA 5AC5A 5A1AA 1OK4A 4GQ0A 3KRUA 3APTA 3IV3A 1I8JA 3H7VA 3RX2A 2Z27A 1K4HA 5DBUA 4GNKB 1J0HA 3C2OA 2YA0A 4DB7A 3IGHX 3AHTA 1O5QA 2XVLA 3FAXA 1OCBA 4UNKA 1XD1A 4HA0A 3U7BA 1W1VA 5I23A 4C5YA 1H60A 3E12A 1X38A 4ZFCA 1TVPA 2PF0A 5E6ZA 3A4AA 4HJFA 1VZWA 4UTTA 4N6FA 4V2XA 3CMJA 1SU5A 2GK1B 4ZSTA 5T9CE 4AZ7A 1QFEA 1V7AA 2J9YA 4YNGA 4A3RA 3W72A 3L12A 2FHCA 5DY3A 4LY4A 4MLJA 1I2RA 4PCTA 3RM9A 1ZZMA 3PVFA 4TTUA 3SCVA 2QYGA 2J75A 1PTDA 4O1BA 4KRUA 1QNPA 3W53A 1XLCA 3VX0A 4WQ6A 2YW3A 2NLYA 4HMCA 2V2HA 3PZUA 4YHGA 1DQXA 2RAGA 4QG6A 1TR1A 3V4BA 5CXPA 4QTGA 3W22A 2HROA 2CLPA 2G50A 1L9WA 4A8NA 3O63A 1XC4A 4E5TA 2BHYA 3ANVA 1TJ0A 1W1A1 1UMLA 2GL5A 3UBPC 2UBPC 4U10A 3KAOA 1R3VA 4DM1A 2VGIA 4HTBA 3CZGA 2E68A 4JDYA 1C93A 4KFNA 2EPMX 4GZ7A 3TOYA 4JTDA 3DKJA 3CPGA 4BWLA 5M2FX 1YX1A 3KWSA 3NZ1A 1GONA 1HN1A 4H41A 5JQ9A 4GLEA 2BS9A 1TCMA 1EZ2A 1EOMA 2NSOA 1K03A 1FP9A 3N2BA 4B91A 3NL3A 3LI0A 4PL2A 2DZXA 3E2SA 1CENA 3H2MA 3NL6A 4Z42C 2TODA 2E7FA 3SRKA 4HK5A 2Z7KA 1V6UA 2WC7A 3RX4A 1SGJA 1B54A 1H7PA 5BRPA 4L65A 2EAWA 3VGEA 1JQVA 1UZHA 2ZA2A 5A6LA 2P76A 1YDYA 4AZ5A 3OYXA 4XBKA 2XTKA 3DC8A 3CEUA 4OUIA 3WZ0E 1MQQA 3HG5A 5DCBA 2I16A 3VNDA 3FYYA 4JPGA 1U1JA 2NQ5A 5D4YA 2VMFA 1ICSA 2Y1HA 3VCRA 4AHOA 4NAFA 1Q4WA 4C1NA 2ZRVA 2JKEA 1A5SA 3PPHA 1PX4A 4F0MA 1HVXA 1AJ2A 4FIRA 4NT0A 2W79A 4QE5A 2YZ5A 3SCNA 2HSAA 4M24A 3W1TA 2JF6A 4OWGA 1F4HA 3QHNA 4FA3A 2ZXAA 3GBEA 4W9TA 2O55A 1X6LA 2OFJA 4UR7A 3ARQA 3C0QA 1V3HA 1RP9A 1GHSA 4HZ7A 1QOPA 3QQ1A 3RG6A 2A0NA 1U30A 3E5PA 2WK2A 3QR1A 4H9TA 4YTTA 1BWLA 4IXXA 3H2AA 7PTDA 2E77A 4BZYA 2V30A 4H1ZA 3CUXA 1YXCA 1UA7A 3S5OA 5FSEC 3EPNA 4HT3A 3WUEA 1NELA 1LBLA 2QJJA 1IGSA 3CL8A 4MJMA 3A64A 4PRTA 2REQB 1X96A 3WLLA 2Z2AA 3UZWA 2XSAA 3B0VC 1KKRA 2XU2A 2XIJA 3L9CA 1HGWA 2QCLA 3CM4A 2PDPA 5A94A 1WA3A 3F2DA 2BHUA 1VCVA 1TV7A 1YNQA 5G1MA 3WJYA 3BW3A 3BMVA 5I6SA 1OF6A 3V1HA 1T96A 4PMZA 3SQMA 3TFXA 1RA0A 2J7CA 3ITLA 2ZCGA 1FCUA 3B8SA 4LNYA 4C6CA 2IQ0A 3NQVA 3LMZA 2PZNA 1ONRA 5KZEA 4C7FA 5F1VA 2VCCA 4K39A 4JEQA 3S6TA 3T0BA 3S2LA 3PZ9A 2YSWA 2ZDSA 1MO0A 2P0OA 2RKXA 1H4PA 2QIIA 2NXGA 2ONEA 1N8WA 1HKIA 4R7WA 1YNYA 4AWUA 5TNVA 1OHLA 4O14A 1FX6A 3LHTA 3TJLA 1Y5WA 3BGGA 4KT2A 3VPLA 2BWGA 3BJFA 2OZ3A 2BVYA 2BTMA 4D6HA 1XUZA 2PODA 3W7NA 4PTVA 2VHLA 5D38A 4O0QA 1O68A 1U33A 2ZUUA 1SFJA 3ZR6A 4ADSA 1V3JA 1K8ZA 2FB2A 1TPVA 2P8CA 3FW6A 3UGRA 4PCNA 1X7IA 4LCQA 1P0KA 2ZVRA 4P7RA 1YHTA 2X16A 1FTXA 4IT1A 3PBMA 2VEPA 1Y65A 1EF3A 2VD8A 3CUJA 4REQB 5F2GA 1LF1A 2ZYFA 1UWSA 3FV9A 1ZNNA 1F3TA 3L0GA 2AGKA 1XSKA 1QNQA 4LEFA 3IJIA 4KERA 5C7VA 3WUGA 4W89A 3WFLA 1D8CA 1OADA 4D6EA 1RBAA 1W32A 1T40A 1MQPA 3IJLA 2G4FA 2E8ZA 1VGAA 4XSLA 4PTNA 4I5XA 4GIAA 4K1WA 4MMWA 1HJVA 4YIWA 3QFWA 3E96A 3O0FA 4JFSA 2WKJA 3GDRA 2YOCA 2D2HA 2CLMA 1BG4A 4UFLA 2QIWA 2V0TA 3W2JA 1E56A 2VFDA 2VM8A 3MV11 4IIBA 2NX1A 4B4FA 1S2AA 2OJPA 2W92A 1W8SA 1P4CA 1MUWA 3O3RA 4QSFA 3C3UA 2WSPA 2YCEA 1FOBA 1OBAA 3UP8A 1VLWA 4RZ5A 3FAWA 4NUWA 2WVVB 1WBHA 2PGFA 1PKYA 1ZBWA 3O06A 1OVDA 2W3ZA 1H62A 1MI3A 4HZ8A 4HQVA 1JULA 2YL6A 3E2VA 2WM1A 3K2GA 2IXVA 3KBVA 2VUNA 3EDFA 1TJ1A 1OFDA 1I60A 2MANA 2BXYA 4UQ9A 2YDQA 4KEUA 4R3UA 2MUCA 1US2A 2Y8KA 3IEBA 4JXCA 2HVNA 1OX6A 4L4MA 1O95A 3W87A 4L80A 1PYFA 5I24A 3GX9A 1JYXA 2PRMA 1FWCC 3HGSA 4MIMA 2GVYA 3GIPA 3QMRA 3GNRA 2EJAA 2QCDB 2J6XA 4UFKA 3BCFA 4GVIA 4PA8A 3P62A 3OA3A 2V5BA 4H9ZA 2BY0A 2IXUA 3W9ZA 3VKDA 1K8YA 5CC3A 3VE7A 4HN4A 4P8UA 4UOZA 3NEHA 3RGTA 1F6YA 4XIAA 2X8RA 1UH4A 1EPXA 1QI4A 1VCFA 4FZIA 3S6OA 2IKIA 2OB3A 5EA9A 4QJ5B 3ZJ8A 2FZ8A 2OODA 4AW7A 2QMJA 4MLRA 4AEFA 3SFKA 1US3A 3TV8A 2J7BA 3N19B 2ZKMX 4BI7A 2DIJA 4XZ9A 1L8PA 3WD1A 2DSKA 2ANUA 4UTWA 3AZRA 1QPNA 1IIGA 4LX4A 2PWGA 2VI0A 4MKVA 3SN0A 2Q6ZA 1SW3A 2CIPA 4HK7A 4JQAA 2OX4A 4ML9A 3TDFA 1W31A 3EDEA 1VEPA 4Q4SA 3AXMA 5J04A 1C8VA 1UR1A 2X09A 3B0UX 1GGOA 1VH7A 3HOJA 4US6A 2XHYA 1UCWA 3W1UA 3C3NA 3RAOA 5FL1A 2GWGA 4IMFA 4B5TA 5IFPA 3H26A 1W3JA 3HM7A 4A22A 3WIJA 4RK8A 4GUGA 3S2MA 1DWAM 2J24A 3WMCA 2HNEA 1IEQA 2I57A 1C8XA 1V3KA 3I4KA 4I5RA 1JYWA 1TIWA 2X40A 3DBPA 1W54A 4S38A 1V02A 4RE0A 1I2QA 1XIMA 4MWAA 2GQ9A 3WF2A 1W0MA 3GTFA 3WLHA 4IPLA 3KX6A 3SADA 4O11A 5K9DA 2XG9A 2ZE0A 4GFSA 3LCHA 2Y5EA 4DXXA 1IT0A 2V2CA 2E40A 1FCQA 2VEKA 4K8EA 3N2XA 1Q6OA 1Q6EA 2QUTA 2Z1VA 4WJ8A 1OC6A 2A3AA 3NCOA 3VNMA 3NQ8A 2DZSA 2QJGA 3W7HA 1OC7A 4E4UA 2OT1A 4A21A 4Q8VA 3M6YA 1BSIA 3ZQ9A 2XGIA 1J0KA 1R47A 5CC5A 4O15A 3VKKA 1J96A 2W0UA 1JDEA 4RKAA 3LHUA 3HBLA 4E8CA 2EHHA 5A69A 1OG6A 2CNCA 3WBEA 1KTNA 2WMFA 3GG1A 3B4YA 2OYKA 4C6IA 1H1YA 3NQBA 1WZAA 2PD5A 3O6DA 2F6UA 1SYTA 1CB7B 1AFSA 1KRBC 1YEYA 1ICQA 3QKEA 4DEFA 2WZIA 1S46A 2OTDA 4B15A 4NAFB 4MDPA 4C1NB 3DC0A 4UFJA 4D6CA 4U31A 4UTIA 4I5UA 1BGAA 2CZDA 2ATMA 4IX2A 3RM8A 5C55A 2QUUA 4W8LA 1B4EA 3WK0A 5FJTA 3QOKA 1TWZA 1OABA 4ICCX 1XLLA 4JFVA 2YDSA 4F40A 1H5VA 4BKNA 3GDBA 3NPUA 4Y6GA 3A4XA 3BLEA 3GK0A 2NV2A 1W3NA 3MJMA 1Q7MA 3LRKA 5JIWA 3KBSA 3PF3A 4BEQA 4QRNA 4YYFA 1SMDA 4IJCA 2ZTJA 4EF8A 3BOLA 5EBAA 3OG3A 3CC1A 1KWGA 3G18A 1CX9A 3K8LA 3B06A 2DV0A 2PP3A 2WAGA 4RXFA 3SCPA 5AZ0A 3GDMA 4JN8A 4WXYA 4NI8A 2QDHA 3M47A 1ADDA 3CV1A 3BSGA 4ZQOA 3VILA 4C6LA 3DCPA 5I2UA 1Y5VA 3H53A 3ES7A 3TMLA 1I2OA 4GYFA 1V4YA 3MDUA 1DWGM 1ZAHA 3F7JA 1JZ7A 1OD0A 2EG8A 4IX0A 3S3GA 3WLKX 4QG9A 5C71A 3PTQA 2Z24A 1KGWA 1NFPA 2WZEA 1XQLA 2GJNA 4MKNA 5KINA 5K3VA 1TVNA 3W7PA 4IGSA 1IXQA 2CETA 2IPWA 3LGEA 5E70A 1PS9A 5A8QA 1Q6QA 5I02A 2WKLA 4ZL1A 3RF9A 3UNDA 4DJFD 2PB1A 1NF0A 4WX2A 2FYMA 5C9RA 1ISYA 4ATWA 4LAUA 2JE8A 4I8DA 4AH7A 4ZTYA 1U22A 3EOLA 2VOTA 4IF2A 1HKKA 3A21A 1I6NA 5FEXA 3ZSSA 1J0YA 1QNRA 4ZENA 2YB4A 5DLCA 3W7EA 5JU6A 3DYOA 2AGTA 1CGTA 4GIYA 4QJ1A 3HMCA 4WIWA 2BX7A 3PWGA 2R14A 4GO9A 1U1HA 3A9BA 3BAIA 4XAGA 3AROA 4ENLA 3EYPA 3PPFA 3VUPA 1GVRA 3U4FA 3UWYA 5FJIA 1KBIA 1UD3A 3QY6A 4O12A 3ZVIA 1SJCA 3WQVA 2VX7A 4ONVA 1KM6A 3G1DA 3MKCA 4A05A 2BFGA 3UPWA 1JFXA 3KTSA 4MTVA 3K13A 5AHNA 4BA0A 3CMGA 1ZAIA 1QNOA 4IMCA 3PZGA 3C52A 3ZZ1A 4JX4A 1QWGA 2XH2A 5D8ZA 3IIPA 4PUMA 1EO5A 1LOLA 2EG6A 5GNZA 4US5A 4XV0A 4BFAA 2BB0A 4O28A 1K6WA 1H1NA 4Q8WA 3UPMA 3T0TA 3QF0A 2VDIA 2DJXA 3ZSTA 3WDPP 3MP5A 4IIFA 2E67A 1P0NA 5D9OA 2PDJA 3LB0A 3HQOA 1WAUA 1NFGA 3FA5A 2WXDM 3EEZA 2AAMA 4K7YA 4PULA 3BOFA 4F2TA 3EOOA 3TTQA 2Y70A 4YN5A 4ATLA 4K38A 2FGZA 5DO8A 1YTKA 3AICA 2XINA 4IPJA 1CYGA 1WNOA 3F2BA 2XM2A 3T6CA 2FPYA 3KUMA 3VZZA 4FAMA 1HL9A 5HUPA 1DJIA 4O18A 1ODUA 4JYFA 3QV9A 2BOGX 1UKTA 4JTEA 3R0DA 4AZ6A 3LK6A 3NAVA 1QTWA 2PDCA 1MXSA 2EKCA 4C6OA 1PKLA 2ZUNA 3L67A 3BTNA 3LHWA 3SGGA 4ZQNA 4HA4A 3WY1A 1YTDA 5GNXA 1CXIA 4D72A 3SGUA 1FHDA 2WV8A 4Q4OA 3KOWA 1PKMA 3LENA 3PNZA 1GQNA 3A4JA 2CC0A 4AX6A 1T6MA 4LF2A 1KTBA 1ZJIA 3S5NA 2DUAA 3THDA 2CHOA 1XLEA 1NQ6A 1JAKA 3A3WA 1OCQA 3VZYA 4DIAA 1LLZA 3GFXA 3FX4A 4AISA 3PBYA 3UY7A 3N6QA 1OFPA 7TIMA 2X1TA 2PMQA 2GGJA 2H9AA 4JTJA 4WVXA 3UG8A 2Y89A 3PS7A 3U6WA 4XK2A 4WSJA 4AZHA 1W9UA 3F1QA 1KLZA 3RRAA 4CCCA 4CD4A 1EGVA 2ACQA 3KDOA 2XN1A 5FOOA 1HL8A 3TZNA 3PANA 5LGXA 4WY0A 3M7SA 1UUOA 1TO3A 1PEZA 1PZ2A 3C0LA 4ERAA 1D7KA 5IFTA 4S1FA 2GGIA 2C6QA 4Q4MA 3KOYA 4WDUA 4B16A 1JXJA 3AWOA 3I68A 1LM1A 1PDZA 2QCMA 3THUA 3NQGA 2OLSA 3CH0A 3W7GA 4NU7A 3A23A 1LWHA 4WDWA 3SJNA 5CGMA 5REQA 1SR9A 2OT0A 3WKZA 3UESA 1BTCA 3FKRA 3VGDA 1B3ZA 3SW6A 4O1EA 2DU2A 4GKLA 4HA3A 2IKJA 4UTMA 2ODOA 3F4VA 4E2DA 1Y7VA 2ZADA 1OD8A 4LJ3A 3Q65A 3AIRA 4M56A 1ZSXA 3GC4A 1JCYA 1VYRA 1BSLA 1BHGA 1HJQA 3UWEA 1D3GA 3RU6A 4M7TA 5HUOA 4PMUA 3KP0A 3N14A 1E4IA 3JZUA 3MSGA 2XGZA 3USZA 4M19A 4QNWA 3CL6A 4MWAB 2DEPA 4LVDA 3EZ4A 3S2JA 3U0HA 3BLLA 3ITOA 3PSWA 1U5JA 1P6WA 4DWSD 1OSEA 2Y7GA 1K7EA 1LDCA 1LLWA 2YCJA 4QEHA 4X9YA 5LA1A 4AZCB 1EX5A 2JGYA 5BW6A 3QYSA 3LERA 1QUMA 1LJYA 4B3ZA 2IKHA 1V93A 4GXPA 4J4KA 3L5AA 3W01A 4DJDD 2GOUA 2A4AA 3SUVA 3I7QA 1HNYA 3T40A 3EAUA 3OQ8A 4MSSA 1MMFA 4RR4A 1UJPA 1EZWA 4RE3A 3CLWA 3WBXA 5F4WA 1LWJA 1M65A 5DX7A 2OLAA 1WDSA 1F9CA 5CPLA 3WNOA 4IMDA 3ALGA 1V02E 1GKPA 1TPB1 2X7VA 2YB1A 3CHFA 1AW5A 4MWAE 4S3KA 2HVOA 1ZRQA 3CNYA 2YDRA 1V0KA 4N4PA 2PLKA 1QAPA 5HNUA 3M0IA 1RP8A 4YTRA 3E2QA 3N34A 5JVLA 4I9AA 3KTCA 1XLJA 3LY0A 3HB9A 4XZHA 4C1LA 3NJ3A 3CAKA 2PZ0A 4YMZA 4CQDA 5GNYA 1F74A 1ZY9A 1F3EA 3NOYA 4GD0A 4OECA 2IW0A 3WK2A 3VDCA 4ROPA 3ABRA 3SCTA 9RUBA 5I3IA 1EGMA 4KQNA 3VDBA 4FP1A 3G2GA 3GBDA 2W66A 1KR1A 2Y61A 4QAWA 1NOWA 2WANA 1JFHA 1SZRA 4JTSA 3SIZA 3LMYA 4U28A 1V3MA 3FJLA 5I7GA 4A8RA 1K9FA 3MYOA 3GVRA 3MYPA 2GDQA 4FXJA 2VKZG 1B2YA