4AD2A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-isofagomine
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
345
structure length
345
Chain Sequence
b'TELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
total genus 128
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad2A00
4BZYA 3VTRA 2WKGA 3FN9A 3N17A 2DSVA 4ATLA 4JFUA 3BMWA 3DYPA 4IM4A 4TTUA 2WMIA 5FIPA 1JFHA 5IDIA 4PSPA 5ECUA 1XD0A 1M04A 3ARVA 3UG5A 5EFDA 2YA1A 4PMNA 1CPUA 2FHFA 1RPKA 2W67A 1HJVA 2ZXQA 4H2CA 3VMOA 4UTFA 2CPUA 4W93A 4NSBA 4PMQA 5E70A 2G3NA 1WDRA 1OB0A 3AS3A 2ZWYA 4UR9A 2NT0A 1HVXA 1KGWA 4H8HA 2D0HA 3AMGA 1UWIA 1XSIA 4BQ5A 1SMDA 3HJEA 3ZT6A 2PB1A 3AS1A 3SUTA 2ZUSA 4AZIA 4YHGA 1VFOA 1CXIA 4A4AA 2GFTA 3AMDA 2XM2A 3VX0A 3SCSA 3L4TA 5IXEA 1BQCA 1HL9A 2VZUA 3N18A 4AWEA 3UETA 2CBUA 1W9DM 3ARTA 1ZBWA 4UOQA 2CBVA 2CNCA 3PZQA 5HPCA 3J7HA 1NM9A 3T0DA 1KQZA 3AICA 3PZMA 1NWTA 2JF6A 4AMCA 1GJWA 4PN2A 4AD1A 3VDAA 4D6IA 2YDQA 4D71A 2RGMA 1SYTA 3G6MA 5A8OA 1KXVA 4D6JA 2W92A 4AY1A 3SIMA 3BH4A 1X6NA 2J7DA 4IPNB 3T2QA 4M8UA 3TA9A 1HT6A 1PZ3A 3GXIA 3VGBA 1W1YA 1X6LA 2DQXA 2HISA 3MMUA 3WNMA 5I0DA 2VL4A 1MW3A 5C70A 1WO2A 4U5IA 2VX4A 3CUHA 3W37A 4DWSA 3BXWA 2GJRA 1ZL1A 2WVVA 4GO8A 4J3VA 2UY5A 5FCZA 1QVBA 1QI4A 4NRSA 5FD0A 1FH8A 4KRUA 3AMKA 2VURA 4PMUA 3K8KA 3SCNA 1VENA 1OIFA 1B3WA 3ZJ6A 2WVUA 2WCAA 4B15A 4RL3A 2EEXA 4PCSA 4WSKA 3S6TA 3AHYA 1PBGA 3WDPP 1GQKA 3T09A 4W87A 5ABGA 2JFEX 5HOSA 3WQ6A 1EA9C 1UD4A 2MANA 4L4PA 1WNOA 2V38A 4D6GA 5CJ5A 2E8ZA 3ZIZA 1E1FA 2E40A 1BLIA 1WDPA 1U33A 4D72A 1B0IA 5A2BA 1W9VA 3FNDA 2BY2A 5EB8A 3JUGA 2YLLA 1PJ9A 4PMXA 4XV0A 5JUVA 1CENA 2DSWA 1LG1A 3WNNA 3SCQA 3MUAA 3AIUA 2C7FA 2X1IA 1GHRA 3SUUA 2ZUTA 3GH4A 3WUFA 3QOKA 2DT1A 1BSIA 1B1YA 2WNWA 2Y8VA 1CLVA 1U30A 3GDBA 4U2YA 4TUFA 3VGFA 3W82A 2PC8A 1GCYA 4QLKA 1XRVA 5CGMA 1TUXA 2FGLA 4WK9A 3SCUA 1AQHA 4M1RA 2G8ZA 2Z1SA 1R7AA 4F9DA 2J7EA 1UD6A 1KGUA 2F61A 3U57A 3QHOA 1NOUA 1BGAA 3VIMA 7A3HA 2E8YA 2GJXB 6A3HA 3ARXA 4E8CA 3M07A 3L4XA 2BV9A 4PTMA 1E56A 3VMPA 1E0XA 3VNZA 1QNPA 2ZUVA 3EYPA 3S2CA 3L4WA 3WQ4A 1UR0A 1W2VA 2EBNA 4ZXLA 3GTNA 4GI8A 1TVPA 4YPJA 5A8QA 2DEPA 3OIHA 1W3KA 4HZ7A 1GPFA 1JNEA 1ESWA 4HU0A 4RE4A 1UQYA 2XIBA 1J0KA 3ARRA 3II1A 3DHUA 3WF2A 4MADA 1EHNA 1GORA 1RD6A 4BS0A 5FOOA 3CUGA 1GVYA 3NCOA 3IK2A 1V3IA 2YL8A 3ZMRA 4PBGA 1V0MA 1O6IA 1W9UA 5A69A 4ZENA 3WH6A 4ACZB 1ODZA 3EMCA 4HP5A 4CD4A 1Q6DA 5E9AA 4AD3A 1GOQA 5CLWA 1W3LA 4CVUA 4DM2A 5IHSA 3VM5A 3FAWA 4JL1A 3RMEA 2VX7A 1JI1A 2CEQA 4V28A 3VDBA 1CXFA 2ZXBA 4B3LA 1W3JA 1W3HA 4PUEA 3ZR6A 3VDCA 4TVUA 3VIIA 5LA1A 2XWDA 4XB3A 2IXVA 3AIVA 1ISVA 1FH9A 3WF1A 5I23A 3WFZA 4X9YA 4CN1A 3A4XA 4UQCA 3CMGA 2XVGA 2W62A 4B16A 1EGZA 1J10A 3WF4A 2QPSA 3T2PA 1JIBA 2XPKA 1KXQA 1DWFM 5E09A 2YOCA 3VILA 1V08A 1UYQA 1LL6A 4IPLA 3WMSA 3GNPA 4AEFA 2VZTA 2OYLA 4CCEA 2XVNA 4WIWA 1MWOA 3UCQA 5CXPA 1EO5A 1CGXA 1KGXA 1E55A 2WZIA 1BG4A 3AMCA 3ECQA 3RO8A 2WWDA 3CH9A 3PZVA 1J12A 3MMWA 2PBGA 4WJXA 4PUDA 4U31A 5D8WA 3WMCA 2DPEA 4AZ6A 2CKSA 2UY4A 2CXGA 2QMJA 5A8NA 1E6QM 1QW8A 1J01A 4LXFA 4ZEPA 1E5NA 3MU7A 1I1WA 1ITCA 4ZXOA 1V6WA 4AZGA 1J9YA 3GBDA 3ZJ7A 3B8SA 3UERA 3W27A 1GNXA 1V03A 1QHOA 2GK1B 3WD0A 2DGAA 2BS9A 3VD7A 4S3JA 3OLEA 3WH5A 2EO7A 1OGSA 2A3BA 2J7FA 5E6ZA 3U7BA 1UWTA 3MUIA 3CHEA 2TAAA 2QF8A 4P8UA 2WXDM 2VVNA 2Y8KA 2ZE0A 4QAWA 2J77A 3WSUA 4KRTA 5C8BB 1BYCA 3VPLA 2OSWA 4AZCA 1H41A 3KEHA 2OYMA 7TAAA 5ABFA 4P8XA 1OGGA 2J47A 1KWKA 1TCMA 2A3EA 3UG4A 1CGUA 1UUQA 4JL2A 4W88A 3AIQA 1H0IA 4HZ8A 2DSKA 4U3CA 1HJXA 1UD3A 2XVPA 3OLGA 3WBEA 3WD3A 3GZAA 2VCCA 3L4VA 4MB3A 1JXKA 2DIEA 3CTTA 4M80A 3WH9A 3SCPA 1Y7VA 3CZGA 2V3DA 2WMJA 4AC1X 2YA0A 1JAKA 1QPKA 2VT0A 5A94A 1UOKA 4CD5A 2DT0A 1PX8A 2QLYA 5I2UA 3D5HA 4GQQA 1DTUA 3EDEA 3HMCA 2ZWZA 3TONA 5HDRA 5LYRA 2W4XA 3VD5A 5BRPA 4CN4A 4LX4A 1JZ4A 4GO9A 2YJQA 1LWJA 4UQAA 3SCWA 4FLQA 1D7FA 1JG9A 3G6LA 2X0YA 3A4WA 2YL5A 2XHYA 4M81A 4CUCA 3CIVA 2ZIDA 2C8NA 3N11A 1J11A 2WSPA 3WDHA 1M7XA 3MS8A 4DUWA 2X2YA 1OINA 5CPTA 4PMVA 4D1JA 2EPNA 2V3EA 3WF3A 4UQBA 1C7SA 1C3FA 1UD2A 5A6JA 2OSXA 3BAYA 3CHFA 3ARQA 2CYGA 1HF6A 1ISZA 2ESCA 1B31A 1E4LA 5E0FA 4R27A 4TVDA 1JZ3A 1JZ7A 2Z1KA 4AD4A 1OD0A 2J75A 4MJ4A 4AIEA 1MW2A 3VOCA 1EDQA 1CGYA 4P7LA 3B9AA 2VVSA 2D20A 1C91A 3PZ9A 4AIUA 1HVQA 3HU7A 1RH9A 1KFWA 1E4MM 2PWDA 3OZPA 3QGVA 4M56A 4C7FA 3WNOA 1EIBA 2VR4A 4F9JA 4H7VA 5HXMA 1VFUA 1ZBKA 4WKFA 1QNRA 4JZ5A 1BVNP 1HKKA 1DWHM 3AISA 1BYDA 2YDSA 1VRXA 3WNLA 3SCOA 3QR3A 1KB3A 2WPGA 2D1ZA 4W8LA 1QI5A 2BVDA 4P7NA 3EBVA 2XSAA 4J3XA 2V3FA 2AMGA 1E3XA 2J78A 1JXJA 3WQWA 2YKKA 3SUSA 1KQYA 1IZKA 2JF7A 1S46A 4BQ2A 4QCFA 3VGHA 2Y4SA 2GDUA 1V6UA 1CEOA 4MJ2A 1E6RA 1QI3A 4P7QA 4HA1A 3RJYA 2WCSA 1NWSA 4PTVA 1CZ1A 5FL0A 1HNYA 3W6LA 4HZ6A 3WEOA 1PAMA 1VFFA 9CGTA 3CHDA 3MO4A 2DIJA 3SEPA 3VUPA 2GVYA 5EBAA 2FHBA 6TAAA 1H4PA 1E72M 4BCEA 3VINA 2G41A 5F7UA 3WD4A 1LG2A 2VZSA 1C92A 1KCKA 1JAEA 3AZSA 1V02E 3AHVA 3WQ5A 2D0FA 1V0KA 1CGVA 2YLAA 4GQRA 1QHPA 1XHGA 2VMFA 2WHKA 2CBIA 3ZSSA 4MB5A 1V02A 1GQLA 3WMBA 1BAGA 3D3AA 3RM4A 3NUKA 3LPGA 1US3A 3OGSA 4JIEA 4GINA 4J7RA 4EAMA 5HPOA 2CBJA 2D23A 4B3KA 2BHZA 2NW0A 2FH8A 3I3DA 1ZJBA 1AMYA 5DT5A 3UR7A 4W89A 4CVWA 1CXKA 1FA2A 5BCAA 5JBEA 4JCLA 1TMQA 3SUWA 2J25A 1FHLA 3NIYA 2E9BA 2WZHA 1MW1A 1EXPA 4OIFA 5I78A 3TOPA 3N13A 3N9KA 3OBAA 2W61A 1Q4NX 1OIMA 2WM0A 1JYVA 1TA3B 1JZ5A 2DH3A 1VB9A 3F5LA 1UR4A 1WE5A 3L4ZA 4ATDA 3I3BA 2VX5A 3CZEA 2FGZA 2F2HA 2QV4A 1KXTA 1TE1A 2YBTA 3BLPX 1UKPA 1XYZA 2O9OA 5IHRA 2BVYA 3IJ9A 3W24A 3EMZA 4UFLA 2WW5A 4PCTA 3W28A 1BF2A 4AXNA 4OUEA 2OLHA 3QOMA 2AAAA 1E6SM 5D9MA 3VU2A 2EPKX 1CXEA 4WSJA 4AZBA 5GPRA 3ZSTA 3EDJA 1V3HA 4MNKA 1LQ0A 1WDQA 1HKJA 4EKJA 1UWQA 1HKIA 4CKQA 1IV8A 2JEQA 1I1XA 3NYDA 5CQ1A 3BAIA 3VGEA 3AZTA 1OD8A 4Q22A 3PZNA 4UFIA 5CPSA 1BFNA 2CCRA 2WMHA 4H04A 3VIJA 3WELA 1OBAA 1IZJA 2ZXDA 1CXHA 1GONA 2ZX8A 1MXGA 3WDJA 1PX4A 3OLIA 3ZR5A 4GIAA 3KZSA 1V6YA 1V3KA 4J3UA 1JD9A 3FXYA 1W9PA 2GJXA 3RDKA 1BG9A 1F4AA 2E0PA 2WHJA 3U5YA 2WCGA 4AYSA 2CKRA 3W38A 5CLTA 2WZEA 3K8MA 4HPGA 1KR0A 3KE0A 1RP8A 2UWFA 1MYRA 2OWXA 3LPFA 4F79A 3AHTA 1K9DA 3AIBA 2ZUMA 4LGXA 3L2LA 1B30A 1VIWA 1V3JA 4ZFMA 2D24A 1WAWA 3U5UA 2WSKA 5CSYA 3PTQA 4ACYA 4WKAA 2WHLA 1R7OA 5D8ZA 2JALA 2G3MA 4AISA 4QCEA 3SUVA 3NJ3A 2OYKA 7CGTA 1H49A 1OT2A 2PWFA 2ZX6A 5I3DA 3W4RA 5A6KA 3BCFA 4DM1A 3B9EA 3FAXA 1GOKA 2XTKA 3IANA 3TTYA 1WZLA 1UKQA 1IT0A 4KGLA 3T08A 4FF5A 3LPOA 4PEEA 2D3NA 4PMZA 1GJUA 4FMVA 3LPPA 1Q6EA 3WDRA 1W1PA 4D6FA 1E73M 4K68A 1QBBA 4D6CA 3NDZA 4W5ZA 3VIGA 5A1AA 5JBFA 4MNJA 4TTGA 3WUGA 2VX6A 2FDMA 3T2OA 4JKMA 3TTQA 3DHPA 5A6MA 1MQQA 3MSDA 1JDAA 3QHMA 3AI0A 1EOKA 1H11A 3UEQA 2NT1A 1NP2A 1EH9A 4LQ1A 1FFQA 3IJ8A 1WB0A 3TP4A 4PSRA 3EDKA 1KR1A 2O9TA 3NSXA 4OOUA 4AZ5A 1ISWA 3AXIA 1GOIA 1E9LA 2VC9A 3OB8A 3BAXA 2ZOXA 1VBRA 4OZOA 2VI0A 3IAPA 4KMQA 1UD8A 1QNSA 3GM8A 4MPKA 1HL8A 3MANA 4MB4A 4ZE5A 5I6SA 3L4YA 2WB5A 4JFTA 4TX8A 1E6XM 3VD9A 2CHOA 5DO8A 4M24A 2E9LA 2PF0A 2J8GA 2Q8XA 4LYPA 2J7CA 1PPIA 5CG0A 1CECA 1EDTA 4HMEA 1JDDA 3CUIA 5DT7A 5I79A 2VRQA 2WMGA 4PMDA 3CGTA 4TXEA 4P7RA 1UZ4A 5DFAA 4HU8A 1XC6A 1E71M 1M01A 4LYQA 2GK1A 1FP8A 1G1YA 2J7GA 1I75A 1N82A 2XFFA 2XFRA 4UQDA 3WL0A 4NRRA 3PZIA 1O7AA 3RCNA 4PMOA 2XUCA 1UR2A 1H1NA 1CLXA 4BA0A 4TOQA 1DWAM 2F8QA 3VVGA 1JZ8A 3VD3A 4DUXA 4BQ3A 1CGWA 4QLJA 1X1NA 3BSGA 1W9XA 2BY1A 3HN3A 1K9EA 3ZQ9A 4W86A 3ARPA 3VIHA 1GHSA 3CHCA 3AXXA 1CGTA 2VCAA 1JL8A 1NARA 5LA2A 3N15A 1AQ0A 3T0AA 2BNJA 1V0LA 4HPHA 5A8MA 4CCDA 2EPOA 2UY3A 1A3HA 5A6LA 1UR9A 1DP0A 4GI9A 3W6MA 2J79A 4WKHA 2DSZA 1B3XA 1AQMA 1GQJA 1XYFA 4R5EA 2WMFA 4RE2A 5A3HA 3A3HA 2UY2A 1XH0A 1JF5A 4CN6A 4UFKA 1KWGA 1HJSA 1TVNA 3UESA 3ZJ8A 1E6NA 2BHUA 1E0VA 4CD8A 1XH1A 5IFPA 3CUJA 1V3LA 2WANA 2W66A 2ZX7A 1NOWA 5A6BA 1QOXA 4E2OA 4QLLA 3SCRA 4OJYA 1MVYA 3F5KA 1ZS2A 2VRJA 1E40A 4JKLA 2W91A 1JYNA 2GJPA 1U2YA 3WN6A 2XVKA 3BAJA 1TZ7A 1LJYA 4AZCB 1Q6FA 3CZLA 4GKLA 4BQ4A 1YHTA 4OKDA 1QW9A 4Z2LA 3OLDA 4W7WA 4Z2IA 3EDDA 4MB1A 1CTNA 4GXPA 1J18A 3AIWA 1W1TA 5DF0A 2O92A 3ZT5A 3NSNA 2VZVA 2BFGA 1J0JA 2RGLA 4MTVA 2G3JA 4UFMA 3WFLA 5EFFA 5C71A 3ZOAA 1ZJAA 4AD2A 3ARZA 1V6VA 2A3AA 1XV8A 1W32A 4WLCA 3RIKA 4ATWA 3PBGA 1HP5A 3THCA 4EK7A 2J4GA 4NZCA 4FLRA 1VJZA 3ARSA 4AW7A 2EJ1A 2XVLA 5A6AA 4PMYA 1UH2A 3POHA 1QI2A 3F5JA 3L2MA 4JFVA 4EANA 1NP0A 2XM1A 2W5FA 2ZUUA 1E3ZA 4F66A 5BXTA 1OGBA 4CCCA 4H41A 1MFUA 3M7SA 2YA2A 4S3KA 4Z2GA 1HJWA 3W26A 5I77A 1B9ZA 4OBRA 3ARUA 1VEOA 4UFJA 2ZUWA 2EXOA 3AYSA 1EO7A 1E0WA 1EQPA 3PZGA 1D2KA 2G3IA 3VGGA 4B9YA 1XCXA 5HBFA 3WKZA 4XX6A 2VRKA 2VQUA 3MUY1 4HTYA 4HOZA 4UCFA 5BYWA 3VD4A 5BROA 1G01A 2D22A 3NSMA 3VDHA 1MW0A 3WENA 1WPCA 4AZHA 3BAWA 1ZBVA 1W2PA 3WBAA 3ZM8A 2QMKA 3A6OA 2E3ZA 3PHAA 4PTXA 4AIOA 4V27A 3KL0A 1UR8A 3IJ7A 3K4AA 4V2XA 4YN5A 5AC5A 2CHNA 4MNLA 2WBGA 2OSYA 5D9OA 3AIEA 1CDGA 1UH3A 2GUYA 1VAHA 1JI2A 2IXUA 4KH2A 2VTFA 4LYRA 4MDPA 4NF7A 2CIPA 3EDFA 1H2JA 1WZKA 1V6XA 3VM7A 2WWCA 1NWRA 4A3YA 1W1VA 3KWXA 1HP4A 4JHZA 3VIKA 1FOBA 4D6HA 2JEPA 3SCVA 2BXZA 1VJSA 5BRQA 4P8VA 2WLYA 5JIWA 4ML4A 2WMIB 1R85A 1CXLA 3ARYA 3WEMA 1W91A 1QNQA 5A6SA 4J28A 3OGRA 1G94A 4P8WA 2OWCA 4JFSA 4C7DA 3E1F1 1UWSA 1HX0A 1PIFA 2O9PA 3UG3A 5JBDA 3DYMA 1UQZA 1GOWA 5GQBA 4MAZA 3AZRA 1VFMA 1B90A 2V5DA 3VX1A 1GOOA 4W84A 1ZBCA 1SR0A 2J8FA 1H3GA 3ARWA 1WCGA 3PZOA 1VBUA 2D0GA 3IAQA 4J3TA 2XFYA 1C90A 1JDCA 3DYOA 1WKYA 1WP6A 1OSEA 1TA3A 3GNRA 4UQ9A 4MDOA 4UOJA 1GQIA 3VIPA 2YL9A 3GNOA 3N04A 3VIOA 2JE8A 3MV11 4LPCA 3RJXA 1SMAA 1CNVA 4J27A 3CZJA 4OBSA 1OWQA 4UNIA 4TX6A 3WUBA 1PEZA 2C0HA 1PX3A 5CSUA 2O9RA 3PZUA 4AD5A 4HA4A 5D9PA 1B3ZA 4BF7A 3M46A 3U7VA 3BMVA 1WZMA 1NWUA 1P6WA 4W7UA 3AIRA 5GNXA 5M17A 3MUZ1 1C7TA 3CBWA 1JZ6A 1K6AA 4M82A 1CYGA 3MSGA 4DWSB 1B3YA 2WVVB 5I24A 4PRWA 3UR8A 1M03A 2VNCA 3CMJA 1LF1A 1CBGA 2EQDA 1B3VA 2BVTA 2A3CA 1HN1A 3CPUA 1HXJA 3FY1A 2XSBA 1G9HA 5M5DA 1R87A 1XD1A 3K4DA 1E4IA 3AJ7A 4HMDA 3WH8A 1HKMA 5D4YA 6CGTA 5A2AA 1MXDA 3T0BA 1LLOA 1ISYA 2E9MA 2GSJA 3WEZA 8CGTA 3WD1A 1MQPA 1UD5A 2J7HA 1ISXA 4FLSA 5GNYA 3CZ8A 1JYWA 2J7BA 1KCLA 4UQEA 1RP9A 1TG7A 3PZTA 3SCTA 1L0PA 2JIEA 3CZKA 2CERA 1BYAA 2D3LA 1WDSA 5FL1A 4D1IA 1BHGA 4W85A 1YQ2A 4W8BA 5D9NA 3POCA 4JKKA 1UZ1A 1Q6GA 3AHZA 2J74A 2VUYA 1ODUA 1QNOA 1V3MA 2B31A 5E0CA 3W25A 1ECEA 3BC9A 1UWUA 2YIHA 3ZT7A 1J0YA 1JF6A 4JAWA 2X09A 4D6EA 1PZ2A 4UZSA 3OG2A 1BTCA 1E70M 4X0NA 1UA7A 1OM0A 2JIWA 1JFXA 4JCMA 3OA5A 4GZIA 4B9ZA 3ALFA 4W5UA 2DH2A 1UWRA 1Q6CA 3WY1A 4DWSC 3ZJKA 1K9FA 3RPMA 2WYSA 5CPQA 3WDIA 4AEEA 1XGZA 1E6ZA 4DWSD 4GI6A 4E8DA 4P7OA 4W8AA 3WUEA 3RILA 4KGJA 3AHXA 1TFVA 1XCWA 3W81A 4ACZA 3A47A 4Z2KA 3BAKA 1ZU8A 1UG6A 1UKTA 1JZ2A 5FKYA 5E6YA 1LWHA 1XH2A 2Y5EA 2DT2A 2YBUA 3K8LA 1ZB5A 2YDRA 5BXSA 3CUFA 2WAGA 5I5RA 3WNPA 1B2YA 1QHZA 5ABEA 1GOMA 1QI0A 2GDVA 4GZEA 3AXHA 4QFUA 2WBKA 1C8XA 4E4PA 1K9TA 1UA3A 5AYBA 3F4VA 1ITXA 1J0IA 3GH5A 2ZX9A 4JFWA 1XSJA 1JYXA 5BWFA 3SURA 2W63A 4M29A 1G0CA 2XIIA 5DEZA 1E43A 3WQVA 2PI6A 2WC3A 1E6PA 1DEDA 2V3GA 1J0HA 4CU6A 1G5AA 2WK2A 3KL3A 2XJ7A 3A4AA 2QHAA 3DC0A 1R86A 4Q7NA 4D6DA 5CGTA 2X8RA 2VR5A 1DWJM 1VF8A 3GXFA 3AS0A 1UH4A 5JIPA 2VQTA 3W29A 4CU7A 1HIZA 1VEMA 3VIFA 5GNZA 5IFTA 2YL6A 4QP0A 4PMRA 4C7GA 2DSUA 3WQ8A 3ZO9A 3AQUA 3BLKA 5M3WA 5HNNA 2Y24A 1E5JA 2D2OA 1FHDA 2VJXA 3N1AA 3AMLA 1E15A 2G4FA 2IUZA 2VZOA 3FHQA 4AD0A 3WH7A 1NH6A 1OT1A 4N42A 4KWUA 1D3CA 1NQ6A 1BYBA 4XZWA 1UR1A 5BXPA 4U33A 1EHAA 1H5VA 4YHEA 3RM9A 5AY7A 1JGIA 2VO5A 3WF0A 2CITA 4CD6A 4HMCA 1M53A 5AYIA 3W53A 2X0HA 1HJUA 3BCDA 3GXMA 3O9NA 1LL7A 4HOXA 3FW6A 2J62A 3BGAA 1F4HA 3BSHA 5M03A 4PTWA 1GUVA 4U5KA 1H0GA 4ZE4A 4IISA 1KXHA 3AFBA 1HJQA 1GVIA 2WHMA 2BY3A 3O2LA 2WMKA 3I3EA 2VCBA 4UOZA 3M6DA 3WNKA 1BVZA 3OGVA 3O6AA 2DT3A 2BHYA 4FLOA 2EPLX 4X0VA 1EDGA 2FHCA 1KBBA 1AVAA 1NOFA 2HVMA 1R8LA 1UKSA 4W7VA 2PWEA 1PIGA 1BPLB 4FK9A 3VGDA 4GZJA 8A3HA 3N12A 3PN8A 1CWYA 3GYCA 2ZICA 3AYRA 1C8QA 3PTMA 1GZJA 1US2A 4DUVA 1L8NA 1XSKA 1C93A 4NI3A 5ABFB 4RE3A 5KEZA 4UFHA 1DWIM 2WLZA 1TR1A 3WIJA 3GBEA 3K46A 5ABHA 4WF7A 3AROA 5A2CA 4L4OA 4PYSA 2EPMX 3AS2A 1DWGM 1QBAA 1BGGA 1Z32X 5EMYA 3WDQA 5CZKA 2QPUA 1OCQA 4MNMA 3RM8A 2VOTA 2WKLA 4UZUA 4CU8A 1CIUA 2V5CA 3CLWA 4MAVA 1W9BM 1JD7A 4J3WA 1EQCA 4AZ7A 3TTSA 5TD4A 4J3SA 3VMNA 1V0NA 4CGTA 1E4NA 3DECA 2WVSA 2WC4A 1LL4A 3W0KA 2AOSA 3L4UA 3GH7A 2ZUNA 4Z2JA 1J0ZA 3GXDA 4HA3A 1UKOA 4H8VA 3MV01 4Z2HA 2BY0A 3FHAA 3EMQA 3MMDA 2PBOA 3B9DA 3WD2A 3CO4A 4JHOA 3VKKA 4A3HA 2XYLA 3MKKA 4TVCA 3PTKA 1C8YA 1GW1A 2CETA 2PWHA 2OWWA 3VNYA 2NSXA 4HOWA 2BXYA 2XWEA 1SFSA 4GPNA 1UHVA 2ZXAA 5LA0A 1E1EA 1FP9A 5DMYA 2Y2WA 2A3HA 1EOMA 1MFVA 1VEPA 2ZX5A 3LMYA 4N0RA 5A8PA 4CD7A 4OOZA 2CESA 4EE9A 5AC4A 4XUYA 1FFRA 1JNDA 2DDXA 2PWGA 3NDYA 3QHNA 2XG9A 4U3AA 1MQRA 3THDA 3APGA 4XZBA 1H09A 3WL1A 3ALGA 1WZAA 2FH6A 2E4TA 5BXRA 3OZOA 4URIA 5KZ6A 5A6BD 3KL5A 1KBKA 1A47A 2WC7A 2XGBA 4QDMA 1DHKA 2X05A 4Y7EA 4U2ZA 4IUGA 3AOFA 2XGIA 3K1DA 1FH7A 3VO0A 4H8UA 5A95A 2WVTA 4F8XA 3TTOA
chains in the Genus database with same CATH superfamily
3VTRA 1FWBC 4Q4RA 2WKGA 2CFFA 3GTXA 2A1YA 3FA3A 2OOGA 3BMWA 2VOMA 2QPXA 1YDVA 4RXFA 5FIPA 1JFHA 3UG5A 5EFDA 3SRDA 1A53A 4DXKA 4N02A 3RRAA 3KS6A 1XGEA 3PB2A 4NSBA 4PMQA 2GDQA 1A5NC 3AS3A 3N2TA 3C8FA 1HVXA 3VCRA 1ZNNA 4LUIA 5I02A 1K77A 1CXIA 3H22A 4A4AA 2GFTA 1TELA 3AMDA 3VX0A 4AX7A 2R91A 3AC0A 4XTDA 3DG3A 1C29A 2F84A 3TZNA 3UJ2A 1CI1A 4LF2A 3H4XA 1H1ZA 1VFHA 1ZBWA 4UOQA 3PZQA 1RK5A 1W8SA 3VOJA 1NM9A 3TJXA 2ISSA 1KQZA 1GJWA 1KTCA 4PN2A 3TNOA 3CB8A 3VDAA 4F0SA 5SWUA 1RA0A 4OGZA 1NVMA 1SYTA 3H2AA 1KXVA 2FMOA 1FWCC 4IPPA 2QUTA 3BH4A 3YPIA 3VE7A 1WKDA 4M8UA 5I0DA 3MMUA 2VL4A 4GJIA 3W2UA 5I3HA 2RKXA 2R1KA 1EBHA 1Q6QA 3W37A 3QKEA 3TTEA 3LB0A 2ZDSA 1FDYA 2UY5A 5IBXA 5FD0A 4WJ8A 2HE5A 3AMKA 1A5KC 2HVNA 3K8KA 1AQFA 4JBRA 3RNDA 3LHWA 2WNNA 3ZWTA 4DBSA 2BOFX 2EEXA 4PCSA 4NYYA 1PBGA 3TLQA 1GQKA 5REQB 2QAFA 4W87A 5FJUA 3IUHA 2FJKA 3V1PA 4CQ9A 3IWPA 4M5PA 3W1XA 4F0KA 1PZ0A 1TKKA 3W2JA 1EA9C 1UD4A 2MANA 3QJAA 1KRMA 1S1PA 1WNOA 2E8ZA 1R3VA 2E40A 1BLIA 5CPLA 1BRLB 1B0IA 3C2VA 1A4LA 3QR0A 4M7SA 3JUGA 3MDUA 2YLLA 3H7VA 3D46A 1BF6A 1IE7C 2GOUA 4ZQMA 2DSWA 3WNNA 4LC8A 3AIUA 3NQAA 2Y89A 4NAEA 3SDOA 1K3UA 3H2NA 3SUUA 3HGOA 5F4XA 3QOKA 1ELSA 2QNEA 1BSIA 1B1YA 2Y8VA 1CLVA 1EB3A 1YXYA 4JTHA 3W82A 3NPVA 1XRVA 4GIEA 2E6DA 1JCMP 1XIIA 2Z1SA 3UA4A 4YTTA 2VUNA 1EUAA 3QHOA 1BGAA 3LHUA 2E8YA 3CXOA 6A3HA 3ARXA 2YCKX 3BLDA 4LAZA 3L4XA 5G2WA 2QEZA 3VNZA 1YTEA 3DFPA 1SQ7A 4LUTA 3FJLA 4O0ZA 1UR0A 1KV8A 2NUWA 4NAFA 2J6VA 2Q02A 3PBWA 2AKZA 4YPJA 1XLCA 3OIHA 1XM3A 2RDWA 1LRTA 5DBUA 1A50A 1GPFA 1KM3A 5B7YA 4RE4A 4Y96A 3F4WA 1UQYA 4E4FA 3ARRA 1J0KA 1VCFA 1GTHA 3MBDA 4O1CA 1S2TA 3DHUA 1BEUA 3GDTA 1GVYA 2VFDA 3NCOA 3P0XA 1Q4WA 4JS3A 4PBGA 1R3YA 2QCCA 3NM3A 4OT7A 5A69A 3E02A 3NO3A 1ODZA 1KCXA 3EMCA 4C1NB 2OZ0A 3ABOA 1Q6DA 4AD3A 3TUUA 1W3LA 5LIUX 1MDLA 3R2GA 3QYQA 5CKSA 3UNTA 4V1XA 3W1PA 1ME8A 3LHZA 4LBUA 4V28A 1FDJA 1S39A 1W3HA 4PUEA 8TIMA 3VIIA 2PCEA 1NQKA 3ONBA 1F8MA 2A3LA 4M1BA 4UQCA 3MA8A 3MHGA 2W62A 3CQKA 2V9DA 1EGZA 5HR7A 1NFPA 2QPSA 4NJJA 2GQ9A 1MNZA 1SM9A 2XPKA 1DWFM 4QHRA 4LH8A 3TW9A 3EX1A 3BMXA 1V08A 1UYQA 1LL6A 2PWUA 2ZQ0A 3WMSA 3GNPA 3P14A 5CPMA 2VZTA 4M6VA 1Q3NA 4CCEA 3FCPA 5ENLA 1E55A 2WZIA 3IVUA 4RUBA 3ECQA 3RO8A 3KBWA 1WDDA 2Q71A 1FBAA 2DPEA 1K70A 3URAA 3BANA 3TXVA 2CKSA 3RK8A 2CXGA 1TV4A 1E6QM 4E2VA 2A7RA 2OQYA 1E5NA 4G7FA 2DQWA 2YXGA 1VS1A 3H2MA 1XLHA 1ITCA 1KNWA 4AZGA 4JIQA 3GBDA 3RG6A 2QT3A 3DI0A 5EL1A 1IXNA 3BW4A 1QRQA 4WDWA 1Q2RA 2GK1B 5G5IA 5TAOA 4H00A 3WD0A 4C6NA 4GY7A 1CCWB 3VD7A 1B57A 3OLEA 1YPIA 1XCFA 3HURA 3SY5A 2ZRUA 4FHAA 3E12A 1T6MA 1SZRA 2I16A 1XYBA 4I3GA 1ZRQA 4P8UA 2WXDM 1NELA 2Y8KA 2FPVA 4DB7A 3N6HA 3P74A 4J2PA 3JVAA 1BYCA 2RJHA 3H2OA 3KHJA 2I1OA 3RU6A 1QASA 4ZQCA 2A7PA 5HQMA 5C9RA 3UXDA 5MKGA 2A3EA 1UUQA 3SB0A 1H0IA 2DSKA 5J8LA 1X7IA 2OEJA 1OF6A 3IUIA 3L4VA 1UOZA 3AO0A 3P60A 4M80A 1QAPA 3WH9A 1Y7VA 3V0SA 2V3DA 3KOYA 2YA0A 4JN6A 5A94A 1PX8A 2IKGA 3PG9A 4GCAA 4GQQA 4L9YA 4Q33A 4R7JA 4L1XA 3KXQA 2Z6JA 3HGJA 4I9AA 3TONA 4DIAA 2W4XA 3TR2A 3GYEA 4Q7BA 3VD5A 1AJ2A 3PSVA 4OFCA 2B4GA 3NQ8A 1OC6A 1D7FA 1YNYA 1JG9A 3QV8A 1DOSA 1P6CA 2ASHA 3A4WA 4K8EA 4HHHA 2VDIA 4C6IA 3N11A 1IWPA 3W7OA 1BXBA 5AHMA 3MS8A 4GK8A 5DX7A 2X2YA 3LV5A 1A80A 1OJXA 5CPTA 4ZTYA 4R88A 4E5TA 1KV5A 1MO0A 1Y0EA 4BHYA 3QN3A 4GYKA 4O11A 1ZALA 5FI8A 1VFLA 2OSXA 3HZ3A 3BAYA 3GK0A 2F38A 2YSWA 5HQEA 3GFZA 1HF6A 1VQTA 3EB4A 3V0TA 3TW6A 3EKLA 2FPYA 1QOPA 2VEIA 1OD0A 2J75A 4AIEA 4IF2A 1EDQA 1CGYA 3LA4A 3CYVA 1DV7A 2VVSA 3M44A 1VYSX 3HU7A 2GGGA 3OZPA 3QGVA 4M56A 1UW9A 3Q37A 2DZPA 3S46A 3BLIA 1BVNP 1KRCC 3C6CA 3P8JA 4E2BA 1I60A 2YDSA 1VRXA 4O50A 3WNLA 1F73A 3CHVA 4LS2A 4U28A 5KTLA 3MUXA 1QI5A 2NLYA 1I6NA 5FSDC 3EBVA 4FNSA 5EMMA 3KX6A 2J78A 1FHUA 2NX1A 5K2ZA 1F05A 3SUSA 2H9AB 1KQYA 2GWNA 1P1MA 3LX9A 1XKJA 3QF0A 2JF7A 1XLGA 2C1GA 3VOFA 3LGGA 2FB3A 3BICA 3T7VA 2J13A 2GDUA 1ZP3A 4MJ2A 2W9MA 4JXCA 4US6A 1VHCA 4P7QA 2PGRA 5EMJA 3RYSA 3OQEA 1KKRA 5FJIA 4HA1A 3RJYA 3ANYA 1HNYA 3S2MA 4JPGA 3RCMA 1VFFA 9CGTA 4MJZA 4ZB0A 2DIJA 3VUPA 5EBAA 2FHBA 1E72M 3WLOA 2P5NA 1XLBA 3WLKX 3C0SA 2OLAA 3O16A 3WQ5A 4GQRA 1BXCA 3FVDA 4C5YA 2EPHA 5DANA 4GVFA 2NQZA 1BAGA 2YZ5A 3ISIX 2NLIA 3RM4A 3N2CA 3HMJG 3TAOA 4JYFA 5HMDA 1US3A 4GINA 4J7RA 1IEQA 3MTWA 1Q5MA 2FH8A 3M43A 1AMYA 2FDSA 2O0TA 1OFDA 4PFMA 3GAYA 4JCLA 2XZ7A 3VNMA 3OODA 3G1FA 3PJXA 3W88A 1EXPA 3V4BA 3OBAA 2DVTA 4C60A 4YS1A 5CH9A 3UZZA 3F5LA 3BOLA 1WE5A 3L4ZA 4LRTA 3R25A 3VABA 3MDWA 2WJFA 1KXTA 1TE1A 1T96A 5FEWA 1UKPA 1XYZA 2O9OA 5IHRA 3L9CA 2FPTA 2PDMA 2WW5A 3NR0A 1NDVA 1BF2A 1V79A 4KS0A 2W6RA 3LHVA 1H1YA 1EJUC 1UB3A 3AAMA 3G22A 4UTKA 4GQ0A 1WDQA 1DJWA 1HKJA 5AVHA 2Z7GA 5LNVA 2JEQA 3NYDA 3W1QA 1XLMA 4DJFD 3DFQA 3HV9A 1OD8A 1R6WA 4REQA 5CPSA 4HN8A 3W7GA 3LU2A 3HPFA 3FIGA 2INEA 4YWSA 3WCZA 2Z27A 2ZXDA 1CXHA 2ZX8A 4GJJA 2HMCA 1V6YA 4NZFA 1V3KA 2GGEA 3PFRA 2E0PA 4RNJA 1TR9A 2WCGA 1RLCL 3UWYA 4HPGA 1R38A 3ATZA 3M5YA 2UWFA 2NXGA 3L2LA 3LLXA 1A0DA 1VIWA 3E0LA 1GT8A 3U5UA 1VFSA 4A8LA 4HNUA 3L5LA 2DJLA 3V0UA 3CWHA 4A2SA 5D8ZA 5EGRA 4JEJA 2JALA 2QJMA 4AY7A 3TSBA 2PDKA 1H49A 3R10A 3PTDA 1FRBA 3W4RA 4DM1A 3FAXA 5I06A 3B3DA 1GOKA 3R12A 3IANA 2Z28A 3FS2A 4MYAA 2C16A 1Q8JA 1IT0A 4JY8A 2EF9A 3RRXA 3GD6A 5LIWX 4ZB5A 4PMZA 3MC5A 2CWXA 1W1PA 1E73M 3GG1A 1HW6A 3MJMA 4GA8A 3QY7A 3WUGA 2Y7GA 2FDMA 4CLMA 3VE9A 5A6MA 1MQQA 3MSDA 3QHMA 3AI0A 4HMNA 2NT1A 4MZYA 4Z1BA 1X1OA 4FXRA 4BJHA 3WJXA 2ACUA 1P6BA 3TN3A 1T8XA 1TX2A 1KR1A 4OOUA 4I5RA 3USZA 2E1WA 2V0TA 3DKLA 3BAXA 2ZOXA 1TVLA 4YYCA 3VYLA 3IAPA 2V2DA 5HJYA 4ZO8A 3M0LA 3PSWA 1KFEA 4A2RA 4ZTXA 1D7KA 1I0DA 2WB5A 4TX8A 1E6XM 3EWBX 3STFA 3SIZA 1QWKA 2BB0A 9XIMA 4UTJA 3ME3A 4ICNA 4AF0B 1F3EA 1LOQA 3KRSA 3NQVA 2DUAA 4M24A 2VFEA 2E9LA 3R0UA 3RX4A 2J8GA 2Q8XA 1KC7A 1EDTA 3CUIA 2WMGA 4TXEA 4HU8A 5FEXA 2E5DA 3C61A 1VPQA 1FUYA 3W1AA 1JPKA 4LYQA 3LZ5A 1G1YA 4FXJA 4UQDA 1R5YA 3R6IA 1UR2A 4BA0A 4TOQA 1E0UA 1KFJA 4DUXA 4XZLX 4S23A 1CGWA 1F6KA 1SU5A 1X1NA 2FZBA 5EU9A 4J35A 1ZCCA 3RMJA 4W86A 3ARPA 3VIHA 1YDYA 1FWAC 1JRBA 1NARA 3W86A 2Y88A 1V0LA 4HPHA 1JUBA 2UV8G 5K9DA 3QYSA 4CCDA 3S4TA 5A6LA 2PDUA 1EJ7L 4RK8A 4GI9A 2G4JA 3WG6A 4XD6A 1XYFA 2D2HA 4HBKA 1EC9A 1SW7A 2UY2A 1XH0A 3IK4A 3LXCA 4G1KA 1HJSA 4ERGA 1TVNA 3T55A 2B7QA 2HXTA 1DJIA 4Q8VA 3ZVIA 3GE7A 3QR1A 1W1A1 3SW6A 2W66A 2ZX7A 2H3DA 1PHWA 4M7TA 2INZA 4IP7A 4QLLA 5JQ9A 1TPDA 1ZS2A 4KWOA 1XYCA 1GYLA 1L6SA 1U2YA 1L2QA 4U10A 3BAJA 2R8WA 4S2BA 1K02A 1Q6FA 4DXVA 4BQ4A 4RZBA 1XISA 4IX0A 1EJXC 4OKDA 1QW9A 2V2CA 4D9PA 3FA5A 3IV3A 4LFYA 4KETA 5HQLA 3D47A 4ONVA 1J18A 3M41A 4Z1AA 2O92A 4BK9A 4DBWA 3MYPA 4C1KA 5CBJA 4DWDA 2G3JA 3AXMA 4NXKA 1SFJA 3CWOX 3WLMA 1S5NA 4KW2A 4LB4A 4AD2A 4EXBA 1V6VA 3S5SA 3UWUA 3OBEA 1S2UA 1UC5A 1RQBA 4WOZA 1K4HA 4ATWA 5F1UA 4R9XA 4BEQA 2J4GA 3T1GA 1KLZA 1LT8A 4FLRA 4BKNA 3ARSA 5LIKX 2VYOA 2DUZA 3PAOA 2PSNA 4JR5A 3CV1A 3S6OA 1TSIA 1YLVA 1MMFA 1Y8BA 2IW0A 3F5JA 3N4FA 2V5BA 4F66A 1E3ZA 4O1BA 4RJEA 2B0MA 5AYXA 5D02A 1HJWA 2O55A 3R8HA 1JPHA 1VEOA 2QCMA 2ZYFA 2EXOA 3LEPA 1W5QA 4AMAA 4PUNA 2QDDA 3NQFA 1D2KA 3A21A 3URNA 4B9YA 4GQGA 1V5XA 2DP3A 3V5CA 4JTKA 1DJNA 3WQCA 3K4WA 1G01A 4EX4A 4CQBA 3NSMA 1O5XA 2VFFA 3LUTA 4LAOA 1TTPA 1AJZA 1W2PA 4FX7A 3ZM8A 1G69A 2QMKA 1M7OA 3BG5A 5H1WA 3K4AA 1XPYA 3QGKC 4YN5A 4X60A 4IMGA 2WBGA 1SFLA 1VAHA 4OU1A 2IXUA 2J27A 5HWJA 3SZ8A 1OVDA 4MDPA 3IJQA 4NF7A 4MLJA 3VM7A 1NWRA 2WNZA 4JHZA 1D9EA 3L23A 3WK1A 1SSDA 5EMLA 3LDVA 1QW7A 5BRQA 1GVOA 2BOGX 1R85A 2CLFA 4UNKA 4IP5A 1QNQA 3DHFA 3OGRA 1G94A 4P8WA 4AH7A 2PDXA 4JFSA 1JPIA 1UWSA 3L21A 3PK7A 1HX0A 1YMYA 3UG3A 4A21A 1CB2A 1UQZA 4DJDC 3AZRA 4B3ZA 3VX1A 4XZ9A 4HNLA 2DZAA 2J8FA 4O1DA 1M65A 4DEFA 1OCJA 4FB7A 3OIXA 1TUFA 2VC6A 4IJBA 1VBUA 2XFYA 4N7QA 1TJPA 1EZWA 4GZ7A 1EJSC 4UQ9A 2Z1WA 4TQTA 3UF9A 1W1IE 1SO4A 3MV11 3VC5A 1CNVA 3LERA 2HV5A 3LBMA 1OWQA 4OBSA 4UNIA 2NQ5A 5DBTA 3CH0A 2QCHA 3EKGA 5CSUA 1A5UA 1H7OA 2F6KA 4AD5A 4HA4A 1XYLA 5D9PA 4BF7A 4R33A 1P6WA 3I4EA 3ITVA 2J24A 3ZWSA 3LQLA 5M17A 1C7TA 3CBWA 1K6AA 3PUDA 1UZHA 4DWSB 4LB3A 4OVXA 5AHFA 3KZPA 3G5EA 1O5RA 5I24A 4PRWA 3DKJA 4O0KA 2V5LA 1DHPA 3CMJA 4AHQA 5I7GA 1YX1A 2EQDA 3NEHA 2BVTA 4ENLA 1HN1A 1A3XA 1XIGA 1XD1A 4HMDA 5D4YA 3HPZA 1QK2A 2KZHA 5H8PA 4HPJA 3WYZA 3UVAA 3T40A 1MQPA 4XAGA 5GNYA 2R82A 1UZDA 4XG1A 3H7RA 1P5BA 3GTHA 1RP9A 2Y61A 1TG7A 5LNWA 2JIEA 3RLGA 3CZKA 1BYAA 3UZJA 4X61A 5DRIA 2PU1A 4HHPA 2FLIA 3POCA 1Q6GA 3AHZA 4REQB 2VUYA 1QNOA 1JF6A 3M4HA 4JAWA 3ITCA 4X0NA 3W75A 4DYEA 4HK6A 4JCMA 3M64A 1XR2A 3ERPA 3EX4A 3OA5A 4GZIA 4FP1A 4Q8TA 3UPWA 3T0CA 1I0BA 1SJBA 1J79A 4W5UA 3MZ2A 5D2YA 1WKEA 2XN1A 3C2YA 4L4LA 4P7OA 4W8AA 2A5HA 3RILA 3R1ZA 1I2NA 3FGCB 3PP7A 2QGHA 3QVQA 3V35A 1TFVA 1R9ZA 1IEWA 3DZ1A 1ZU8A 1UKTA 3KM8A 4B5SA 1JZ2A 3KTCA 4AG0A 4NY2A 5E6YA 1LWHA 4NZ5A 1XH2A 2Y5EA 5DMLA 3TVAA 4GYPC 3AU6A 2R24A 3BK0A 3G1AA 4GZEA 4HHMA 4WY0A 4QFUA 2NSOA 5F4SA 4X22A 1ZUAX 3LRLA 1Y65A 3F4VA 4YTSA 1OFOA 3QFWA 2VC5A 1GYMA 4HNCA 4EPBC 3UG8A 3ANVA 3SURA 2W63A 1Y5XA 3QV6A 2XIIA 3TYUA 1E43A 3WQVA 3LV6A 4A3RA 4IQEA 4LNCA 4DBEA 1LT7A 3GSMA 3W7IA 1OFPA 1O1ZA 4QQ3A 4KQNA 3GB6A 3DC0A 3GHRA 1KBJA 3S83A 5CGTA 2A79A 1ZCOA 2VR5A 3LOTA 1R2TA 1Z44A 3LSBA 2ZBTA 4LANA 1TV7A 5JIPA 5JXQA 3WX7A 2PC4A 1OFRA 1K4GA 3GUWA 3VIFA 2JKPA 2YL6A 1YRRA 3JZEA 1XG4A 3EPNA 4I6VA 5I3KA 3AQUA 3JRKA 5M3WA 5HNNA 2Y24A 1Z42A 4ZMGA 1FHDA 2CZ5A 5E1QA 3CPGA 3U3HA 3FHQA 2Q3OA 4LVDA 1NH6A 1OT1A 1NQ6A 2XISA 3QZ6A 1BYBA 5BXPA 1MRAA 4U33A 1EHAA 2W3ZA 4YHEA 1IZCA 3RM9A 2E5BA 4MKVA 4ZOBA 2VO5A 2CITA 1AH4A 1M53A 4S39A 3TYAA 1N7KA 3F2DA 1LL7A 4BI7A 5U7SA 4I5UA 1VYPX 4RCXA 3QTGA 3FX4A 3TCEA 1H0GA 4EPKA 1KXHA 2Z24A 1H7WA 4N9EA 2KX9A 2ZZ1A 2WMKA 3G1VA 4JX4A 1XICA 3I3EA 4KESA 4DBUA 3BZGA 4AVFA 4EVZA 3C2OA 3BSMA 1OFAA 2G0WA 2FHCA 2NV2A 2QQ6A 3OYXA 3EOSA 4V1YA 1OADA 1AVAA 4MKSA 1GKRA 3KVMA 5FEZA 1BPLB 1G67A 4GZJA 8A3HA 3PN8A 2C1IA 1YADA 2DZBA 4PA8A 3PTMA 1GZJA 3QMTA 1L2UA 4DXXA 2Z1XA 1XSKA 4UBPC 5ABFB 1X7FA 2Y63A 4TX9A 4A8RA 2NQLA 3GBEA 2OZ8A 4WF7A 3AROA 1OCNA 3GVGA 4Q6XA 3E3HA 3V1HA 5J5DA 1CW2A 3SQSA 4H1ZA 1K8XA 5HUOA 4DBDA 4MSSA 3SRHA 3NO5A 2BDQA 2Z26A 2VOTA 2WKLA 4YTQA 4XVDA 4UZUA 3W1RA 2ONEA 4MAVA 4C65A 3CIWA 3OVRA 4ZCWA 4QJ5B 4J3WA 4Q4OA 1R3SA 1FWFC 3MYOA 5MHBA 1LYXA 3DECA 2V6AA 3GG8A 4GVGA 1VLWA 4HA3A 4Z2HA 1V6TA 3N2OA 5TIMA 3EMQA 1OFQA 3MMDA 3GW0A 2PBOA 3TAKA 2Z2AA 3BLLA 3KDOA 3MKKA 4Z1CA 2D73A 4H6EA 2PWHA 4DJDA 4HOWA 4LV9A 1ITQA 2ZXAA 5LA0A 1E1EA 1FP9A 2V69A 3QFEA 4R53A 1MFVA 4UTTA 4NVTA 1DIEA 3R11A 4JTCA 2ZX5A 5A8PA 4OOZA 3CO8A 1FFRA 3H24A 2OT0A 4GCXA 1JNDA 1S2WA 1ECQA 2BWGA 1O5KA 1LQ2A 2ALRA 2PTYA 1JJKA 1MQRA 4C6QA 2D69A 3ORWA 1EGMA 1XRFA 2FH6A 2I9EA 2WOQA 3UVIA 4IL2A 5EMKA 5A6BD 5HR6A 4Y9OA 3W70A 4J3ZA 1A47A 2XGBA 2QCNA 2X05A 3CV6A 1AH3A 1FCBA 2XGIA 4H8UA 4K36A 2WVTA 2HBXA 4BZYA 5DMNA 1EA0A 2IQTA 1EC8A 2I9UA 3NQ6A 3ITGA 4ATLA 1EKOA 4TTUA 1PKYA 3GVRA 3W7PA 2WMIA 4OWGA 4K38A 4PSPA 5ECUA 3S5OA 4PMNA 1CPUA 1W3NA 2FHFA 2ZXQA 1M68A 1QNVA 1FCQA 2Q8LA 3V36A 2CPUA 4LUJA 4W93A 3PVFA 2DW7A 4LY4A 1XWYA 2VFIA 2NT0A 1EGVA 4QJ4B 4LBSA 4H8HA 2Q09A 1REQB 1UWIA 3W2MA 4WEVX 1XBXA 1G7VA 2ON3A 4I8DA 2PB1A 4AZIA 1SR9A 4DF2A 1VFOA 3GNXA 1KRAC 3SCSA 3P5ZA 2IKHA 5IXEA 4ZQPA 1BQCA 1HL9A 1QT1A 2HTMA 3N18A 4M3PA 2XH7A 1W9DM 1XDJA 3TYDA 3W7MA 2OO0A 2CBVA 1TJ2A 5HPCA 2E6YA 3J7HA 2H6RA 4HPNA 3PZMA 1V8EA 4AMCA 3LTPA 4AD1A 1LUCB 2RGMA 1FWSA 5A8OA 2X1SA 4D6JA 5BU9A 4AY1A 2FJUB 2XH0A 3EKZA 3SIMA 4KCUA 3U48A 5G4EA 4E3TA 4IPNB 3CV2A 1K1DA 1PZ3A 3GXIA 3VGBA 1VJIA 3DCPA 3WNMA 1WO2A 3W7RA 3NVTA 2VX4A 5BMWA 3CUHA 1EZ2A 4QG6A 1EX5A 1Z69A 4RE0A 1G4TA 2UBPC 3FDKA 4L9ZA 5TBOA 2GVLA 4R9OA 3H2FA 4X2PA 4W9TA 1FH8A 3UPBA 3LMZA 4X3ZA 2VURA 4PMUA 1SFTA 4D2JA 4QTGA 2A6LA 3ZJ6A 3M0JA 4Q6JA 2WCAA 4RW5A 1G4SA 4B15A 3S6TA 4YCPA 3AHYA 1NFBA 1WOAA 3WDPP 3FEMA 3UR5A 4GYPA 5ABGA 3AWOA 2KAUC 2GVJA 3WLQA 1VRDA 3ZIZA 1QPRA 4D72A 2OGYA 5A2BA 1W9VA 1TIMA 2BY2A 5C5YA 3IRSA 2CZVA 5HMEA 5D2XA 3TMQA 1LG1A 3G24A 3O07A 3MUAA 3SCQA 1DJGA 2AL2A 2PU0A 3MP4A 3GH4A 3WUFA 3M0ZA 3QH2A 5HJLA 3OQ8A 1RBLA 2WNWA 2XGZA 5T91A 4E3VA 3GDBA 4TUFA 5I03A 3BE7A 1GCYA 3V5OA 2FGLA 3OG3A 1PTAA 3C5QA 4DO6A 2ZA3A 3QW3A 4M1RA 3WBYA 1VP5A 4F9DA 1UD6A 1W5MA 1NOUA 2DW6A 3N4EA 2GJXB 1S2CA 4E8CA 3A13A 1IXQA 2BV9A 3DFTA 1FX6A 1VPXA 3VMPA 3NFUA 4FSAA 3W7NA 2OO6A 4BFAA 4MWAE 2OX1A 1QNPA 3NTYA 1YPXA 3EYPA 1THFD 3L4WA 3WQ4A 3GKFA 1Q7QA 1SZEA 1TVPA 5A8QA 1TQXA 3KBMA 1P0NA 3TX9A 4Y9AA 1UP2A 4JD4A 2XIBA 3EWYA 3LSCA 5D38A 4QJ1A 5FOOA 3ITLA 1V3IA 2L5HA 4H9MA 5CSRA 3ZMRA 3C2RA 1W31A 3APYA 4HZMA 4ZENA 1H7NA 3WH6A 1F07A 3FK4A 3Q45A 1J8VA 3R89A 4NUWA 4O17A 5E9AA 4PUJA 1GOQA 2PDGA 3SFKA 4CVUA 3GDKA 1RQHA 3N14A 2R6OA 1RY8A 1UP3A 4JL1A 3S5YA 3KUMA 1O4UA 3R43A 4IFKA 2ZXBA 4B3LA 4TVUA 4A35A 2XWDA 4XB3A 2IXVA 4R7WA 4CN1A 5E9XA 2XVGA 1XBYA 3BGGA 3SN4A 1HUVA 4B16A 4EAYA 2BBFA 1JIBA 4QEHA 4MY1A 1KXQA 3O8AA 4Z0SA 4NX0A 1MWOA 1EO5A 1GVRA 2VR2A 3UXLA 3AMCA 4IMDA 3CH9A 3PZVA 1J12A 4PUDA 4U31A 2PDQA 3QV9A 3TJ4A 5FSEC 4Q8MA 1RSCA 3CQIA 2VDHA 2QMJA 4LXFA 4B90A 4FNUA 1I1WA 1C9DA 4V15A 4ZXOA 1V6WA 4JN7A 1OEPA 2OEMA 3B8SA 3W27A 5I3IA 1UASA 2NV1A 2AAMA 5CZ0A 3QC0A 2DGAA 4EXQA 2BS9A 4S3JA 3RUBL 1YDNA 3U2EA 2EO7A 1OGSA 2A3BA 3HQNA 1UWTA 3UP8A 4NNBA 3W83A 3CHEA 3G18A 1Q45A 1RV8A 2ZE0A 4O15A 4QAWA 2IKIA 3STPA 4KRTA 1F5ZA 2VGIA 5C8BB 1ENUA 2CW6A 4AZCA 3P2VA 2OYMA 7TAAA 1X8FA 3SI9A 1KWKA 1TPUA 3UG4A 4W88A 4HZ8A 4U3CA 3WLRA 1R3WA 2XVPA 3S47A 3WD3A 3GZAA 2VCCA 3CL7A 3QLLA 3U2OA 3LI1A 1TV3A 3BPWA 4OUIA 6REQA 3CZGA 4WDUA 4AC1X 2J9YA 4JTLA 1QPKA 4B92A 2VT0A 4HJWA 1JCJA 2DT0A 2QLYA 5I2UA 3D5HA 5BRBA 3E49A 2J6XA 4QBXA 4HB7A 1YPFA 3CAWA 4KEUA 4RPQA 3PUOA 2BLEA 5BMXA 4GO9A 1TREA 3MQTA 4YCOA 4FLQA 4ZODA 3G6LA 2OZ3A 4UXDA 4LUSB 1KW1A 1F3WA 3P3BA 4O8RA 3TN5A 2PGWA 1J11A 4XO6A 5CC7A 2WSPA 3WDHA 2HXUA 4KWVA 4K2SA 4XKYA 3NZPA 4ZZ9A 2V82A 5G1MA 4D1JA 4Q8QA 1TTQA 2V3EA 3WQDA 5JVLA 3W7KA 4UQBA 3ENLA 4JQ4A 1EP3A 1C7SA 1XI3A 4EOUA 4O57A 2NQJA 4US5D 3ARQA 4DLFA 1T99A 1ISZA 2PDFA 2TODA 2ESCA 1B31A 1E4LA 4JTQA 4QE5A 4S3BA 2ISFA 1JZ3A 1F76A 3CYJA 4WHBA 1XIBA 4CNUA 2DUXA 1XIHA 3I6RA 5AYYA 2D20A 3GVVA 3PZ9A 1GOXA 3I68A 1EF3A 3EXSA 4AIUA 1HVQA 3EGJA 2QCDA 4DRSA 1KFWA 1E4MM 2PWDA 4C7FA 1EIBA 2VR4A 3ITXA 1YBQB 4WKFA 4JZ5A 3QQ1A 1T40A 4UMCA 1HKKA 1DWHM 3AISA 2CLPA 1BYDA 2HQAA 4YXGA 3PS7A 3IVTA 3QR3A 2WPGA 3V7PA 5BOOA 2NWRA 5F1VA 4J3XA 2FMNA 3ZVHA 2AMGA 1OK6A 4F2UA 4MVAA 2G50A 4JDYA 5EYWA 4H8NA 1S46A 4BQ2A 1OG6A 3GC4A 4QNEA 3K1GA 1Q6RA 1E0TA 1E6RA 1QI3A 4HQVA 5CZSA 5AHLA 1KM4A 4PTVA 1CZ1A 2WSRA 3WEOA 4HZ6A 1PAMA 2OCZA 2Z25A 1VBHA 3SEPA 4A8IA 3S1UA 3U2CA 3WD4A 1LG2A 1R46A 2VZSA 3TFCA 4HCDA 4HSOA 1OFBA 4S3GA 1V02E 4OQVA 3QLDA 4JOMA 4C6LA 2GQAA 1QHPA 3T05A 4JHMA 1XHGA 2VMFA 3ZSSA 3DHDA 4B5TA 1EWEA 3DUGA 4HN4A 3D3AA 4Q4SA 3T0TA 3EX2A 2Z7KA 3NUKA 4O4VA 4PRRA 3OGSA 4CNOA 4JIEA 4EAMA 2CBJA 2ZRVA 2BHZA 4NZ4A 2NW0A 1YE4A 1G7UA 2PMQA 5D37A 4B2DA 5JBEA 2JGQA 3SUWA 2J25A 2FB2A 5I78A 4LBRA 3HG4A 3N13A 3BUVA 1XUZA 3AYTA 1Q4NX 3CJPA 4HJFA 1JYVA 1VB9A 3CT2A 4J40A 1D8WA 2E77A 1RUSA 1V77A 3BLFA 3BW2A 3NAVA 4PUWA 3A5VA 2GSHA 4QM1A 1PCWA 3IJ9A 4UFLA 3UD6A 4PL2A 1BRLA 4S3CA 4AXNA 4K8GA 4FPSA 4OUEA 2C79A 3QOMA 4HD5A 3MCMA 2AAAA 1E6SM 2EPKX 3EDJA 4MNKA 2FIQA 1LOSA 4IZGA 4CKQA 3A64A 3W7LA 1I1XA 4MG4A 1ADSA 5CQ1A 1VBGA 3F03K 1I2QA 2Q8ZA 4V33A 4UFIA 1BFNA 5FJRA 4GJ1A 2WMHA 4JTEA 3VIJA 2WSQA 2OJPA 4C91A 1GONA 1EJTC 4WUIA 3ZR5A 4BR1A 4BWLC 1OX4A 4J3UA 1M5WA 1JD9A 3FXYA 2PRLA 5GJPA 4AVOA 4WD0A 1BG9A 1F4AA 3C0JA 4QX4A 2CKRA 4S1FA 3W38A 5CLTA 2WZEA 1RJPA 3IRDA 3KE0A 4WGXA 2ZC1A 1V51A 1MYRA 2OWXA 3LPFA 3PULA 4F79A 1EJRC 1XIJA 3AHTA 1K9DA 1PXGA 3AUJA 3W87A 2G95A 2VGGA 3LTYA 2D24A 2X2GA 3PTQA 3U4AA 4WKAA 2POZA 2WHLA 1R7OA 4KFNA 1UPMB 2I7GA 3TKFA 2OYKA 3OZMA 1DXEA 4NU7A 1XLDA 2PWFA 2FTPA 1BQGA 4WQ6A 3QY8A 3SJ3A 3W7HA 4PUKA 5IBXC 2ZE3A 3MI6A 5C0QA 1UIPA 3GXPA 5DCDA 2ZZ2A 2LLEA 3TTYA 3NZ1A 4PCFA 2F6UA 3KOWA 4C1NA 1Z89A 4G2DA 1M6JA 3LPOA 3CASA 2B7OA 3WJSA 1JQXA 4LY8A 1P0DA 1U5JA 4FMVA 3LPPA 1Q6EA 1V7AA 4FS9A 3S3GA 1IGSA 4D6FA 2DIKA 2ZTJA 4D6CA 3WLJA 3LRKA 5A1AA 5JBFA 3EPOA 3W84A 3B8WA 3WQOA 4DZAA 3T2OA 5I00A 3GHSA 2ZVIA 4IPJA 2J88A 1K8YA 1FVPA 3VFCA 3M6YA 1FFQA 3OPSA 3TEVA 1WB0A 3P82A 3FKKA 4ZO7A 2HNHA 2P76A 3RF9A 5I3GA 4YU1A 2CHRA 4GGHA 4OV4A 1RR2A 1TPC1 4FX8A 3M0KA 4MY9A 3M0MA 2PP1A 3N73A 3SQLA 1QNSA 3GM8A 4MPKA 4ZE5A 5I6SA 2Y5SA 1JCYA 3OJGA 3QMSA 3O3RA 4JIIX 3L4YA 4GC4A 5H91A 3A22A 4NL1A 4POCA 3FYOA 3E96A 3B0XA 2PF0A 3BV7A 1Q85A 1J2WA 2J7CA 5CG0A 3Q94A 4HMEA 3TN4A 3RLUA 3B8TA 5I79A 5DT7A 4PMDA 4FF7A 1UZ4A 1KA9F 3L0KA 5DFAA 4IFRA 3R7MA 1DQUA 1E71M 1W54A 2GK1A 2J7GA 7ENLA 5I3JA 4GUHA 3WL0A 3LD5A 3E2RA 4GUFA 2EG8A 2F8QA 2VFHA 1NDZA 3VD3A 4BQ3A 4LCQA 1LRQA 3URBA 4EP8C 1PSCA 4DJEC 5HWNA 2BY1A 5AHEA 3HN3A 3STGA 1K9EA 3ZQ9A 3AXXA 3TYEA 2VCAA 1JL8A 3EPMA 1JDFA 5LA2A 3N15A 2IS7A 2BNJA 1FXPA 2UY3A 4XWUA 2BG5A 1S3TC 3PAJA 2RH9A 1GQJA 2BX7A 4M6UA 4GISA 3NGFA 3NOYA 4N4PA 2C71A 1I9CB 2NZLA 3RITA 1KWGA 1ME9A 3UESA 4Y8FA 3S2NA 2ATSA 5IFPA 2OELA 2OQLA 4E2DA 2WANA 3Q58A 4NHVA 4LV4A 2D2JA 1OC7A 3LXAA 2PDJA 2VRJA 2OG9A 1RQEA 2W91A 1JYNA 5HK4A 1EYEA 4AZCB 3ONCA 1YHTA 4Z2LA 3OLDA 4W7WA 3WJZA 5D30A 1O94A 4Z2IA 3W23A 1W1TA 3NSNA 2VZVA 4YL2A 3S5ZA 3S8HA 1J0JA 2P3EA 5D2VA 4MTVA 3H21A 3TJLA 4UFMA 4GNVA 3CS2A 2XIMA 5C71A 3HBLA 5FACA 4A3UA 5BZAA 1XIEA 2HRWA 4KWWA 1POKA 3ARZA 4DX3A 3E74A 1OX5A 1EEXA 1XV8A 4N6EA 1ZFJA 3Q2DA 1JPMA 3UWEA 5HWMA 1VFTA 4GMEA 3H8AA 1JCLA 4L56A 1XQKA 2HBVA 4PFHA 4EK7A 3MP5A 4JQAA 1VJZA 4AW7A 1L6YA 2XVLA 4XISA 5BOEA 4A29A 1M3UA 3L2MA 4JFVA 4WR3A 4AUBA 1R30A 2ZRXA 4AYGA 2X30A 2QIWA 3MPGA 4CCCA 1Q2SA 4H41A 4NIRA 4FOKA 4Q4QA 1TJ0A 1W3TA 3UGRA 3W26A 4AC7C 4EPDC 1B9ZA 5I77A 3EWZA 3UXIA 4I7UA 2ZUWA 1WXZA 2QCFA 3AYSA 3GU9A 3D3FA 1E0WA 4Z1YA 4HT3A 3PZGA 1VCVA 3NYZA 3RGTA 2NX3A 5E0KA 3P7YA 4XX6A 2VRKA 2VQUA 2RAGA 3QM3A 5BROA 2X16A 1WPCA 1FWIC 3WBAA 4PODA 2E3ZA 2ISDA 3TQKA 3PHAA 1EWDA 4IJRA 2QCDB 3T4WA 4V2XA 5AC5A 2OSYA 3TZFA 4CNNA 3SADA 1CDGA 2FFIA 2QKFA 1UH3A 4H2HA 1X6UA 3LK6A 4GIRA 4XSLA 2DV0A 4LYRA 2QJIA 5CZJA 3W7JA 3EDFA 4JTUA 1V6XA 1ICQA 1W1VA 5B80A 4G8TA 3LZ3A 3CNYA 5TQLA 3ZVHB 4X9SA 3SCVA 2BXZA 5DCBA 3SGZA 4P8VA 5JIWA 4HK7A 2ZZ6A 4RDYA 1US0A 3P6LA 4IPIA 5CC5A 1KFLA 3PANA 3CQJA 1UBPC 4C7DA 5CJNA 3GY1A 2BVWA 2C3ZA 1P48A 2AQVA 3OHIA 3WBWA 1OY0A 1E9IA 3DYMA 1GOWA 2E68A 1UR3M 4XVEA 3CEUA 3E2VA 5GQBA 4RR4A 1VFMA 2V5DA 3CAVA 1W5PA 5EKYA 1X96A 2DVUA 4BWLA 2ZRZA 2QUMA 4DJDD 2YFOA 1ZBCA 1EXBA 4HU4A 4IXXA 2OR2A 4FOJA 3IEBA 4A22A 2TYSA 3TXZA 4J3TA 3L0GA 2G97A 3G0SA 5DQPA 1WKYA 1RCXB 1WP6A 1OSEA 2NXHA 2Q6ZA 4UOJA 3OEXA 4QQUA 5M1TA 3VIPA 2DZWA 3TV8A 3VIOA 1Y5VA 2ODOA 3NGJA 3RJXA 1XL9A 1FTXA 1G4EA 3CZJA 3NQMA 4TX6A 3WUBA 3WK0A 1WOBA 3PWAA 2ACSA 1PX3A 2R1MA 3PZUA 4L6OA 1B3ZA 3QEZA 3U7VA 3BMVA 1HG3A 1G4PA 3V3WA 4O8AA 1DPMA 2W0UA 4W7UA 5FJTA 2Z0IA 2IPGA 4RNFA 3RFAA 3NZGA 3LBOA 3COTA 5XIMA 1JZ6A 1RLDA 1UCWA 1CYGA 2E7FA 2GUUA 3S1VA 3GRIA 5ECVA 3BQ5A 1TO3A 1OG0A 1XRTA 2WVVB 1XLLA 1M03A 1LF1A 4AHPA 1YXCA 2I14A 3LGDA 1B3VA 1E1CB 2HS6A 4UR7A 4NNCA 1CT5A 3DOPA 1A5CA 2V5KA 1RK6A 1E4IA 1HKMA 1ALDA 5A2AA 2XH4A 1ISYA 2E9MA 4DELA 2GSJA 5K7JA 2OX4A 3TSDA 3S9IA 4EPEC 3WD1A 4HGXA 1IXPA 1CLKA 4CQ8A 3W7QA 4HSNA 3CZ8A 4GACA 4UTHA 3SCTA 1L0PA 2D3LA 3KAOA 3O63A 4D1IA 3SY8A 1YQ2A 4Q8WA 1K8ZA 4GRSA 4B5XA 5J04A 1XLIA 4JKKA 2PDHA 1ODUA 2B31A 2SFPA 4IX2A 2CU0A 5E0CA 3WQGA 1ECEA 5DXYA 1F6PA 1UWUA 2WJDA 4LOCA 3DGBA 2FTWA 4UZSA 2PRHA 1UA7A 1JFXA 5CCZA 1L6WA 1OX4B 4KFPA 3WZ0E 4HNVA 1UWRA 1BWVA 4DWSC 3RPMA 3PNUA 5CPQA 1RJQA 1E6ZA 1XGZA 4S3EA 2NX9A 1H5YA 4LEFA 3N2MA 4GI6A 3MT1A 4KGJA 3EX3A 1LP6A 2E6FA 3TQVA 4ACZA 1P0EA 3BAKA 5C9ZA 4D8ZA 1M7PA 2O4QA 1Q63A 3NQCA 4CEXC 4ZQRA 5FKYA 1SJDA 3VOHA 2YBUA 3IIXA 4MWAB 3NO1A 4C6OA 2RUSA 1F74A 3CUFA 2WAGA 2PZNA 3KP1A 5I5RA 1B2YA 4DJEA 2GDVA 1SZNA 2YFNA 3APTA 4AWSA 4HIBA 2WBKA 5HNTA 3HO8A 1DXFA 1UA3A 4N2YA 5AKQA 5FA5A 5TNVA 2NVAA 5AZ0A 2ZX9A 1A5BA 3K5XA 4JFWA 1NF0A 1JYXA 3CLMA 4H9XA 1TQJA 4ZGYA 1O1HA 1G0CA 4NP7A 3WLTA 2PI6A 4LCSA 2V3GA 1DEDA 1J0HA 1U5VA 2WK2A 3N6JA 3KL3A 2XJ7A 4XKMA 3L7RA 4MM1A 3A4AA 4XZIA 2OPJA 4AF0A 1F8IA 4NI8A 2VDGA 4PMJA 3VDGA 4Z42C 2X8RA 3GC2A 2OEKA 3KFTA 1KFCA 3AS0A 1UH4A 3PJUA 2RDUA 1W0MA 3LCGA 2AQOA 1P4CA 3W29A 1V7YA 3OZYA 1HIZA 1VEMA 3R0DA 3MHUA 5IFTA 1VGAA 4F48A 3PC0A 4PMRA 4C7GA 2DSUA 3WQ8A 2ALDA 1C8VA 3BV4A 3ZFHA 3BLKA 2QGYA 4AXKA 1WX0A 2IPWA 2HPMA 3DESA 4C1LA 3VNDA 1XJBA 4GBUA 5CBBA 4EACA 1SZFA 3WLLA 2DJXA 1A49A 2G4FA 4QIUA 2HWGA 2PDCA 3N19B 4UTMA 5KZEA 1H5VA 2TPSA 1OABA 3W74A 1VIZA 3WF0A 1DORA 2P0IA 5AYIA 2X0HA 3W6YA 4OE7A 3RLHA 1AODA 3BCDA 3ZS4A 2J62A 2QJGA 1Q6LA 1F4HA 1JGMA 3N2BA 3MCOA 4JTTA 3MHFA 5XINA 4ZE4A 2ZC8A 3WBXA 2NWSA 1GVIA 2ATMA 3CAQA 3IJIA 3FJ4A 1C9WA 4INFA 3O05A 4UOZA 1WYIA 3WNKA 4ZQNA 4WRHA 4Y9PA 2DT3A 1Z9AA 4FLOA 4X0VA 1EDGA 5A5WA 2CLOA 1FWNA 5K9XA 3PJTA 3TW7A 1T7LA 2X1TA 2C6QA 1X8CA 4W7VA 1LM1A 1PIGA 3NXFA 4A05A 3NL5A 4D8AA 3N12A 1CWYA 3AYRA 5AC7A 4EXAA 5CZTA 1NF7A 2P50A 4RE3A 2EKCA 2PFHA 3W71A 3CL6A 4F2BA 3DFNA 2WLZA 3WIJA 4C90A 4PYSA 2EPMX 2BGSA 1ZAIA 1BGGA 4XAPA 2A0NA 5CPOA 5EMYA 3WDQA 5CZKA 4DNHA 1IGWA 2QPUA 3S1GA 4MNMA 3B8VA 3O6DA 3GNDA 3RM8A 4CU8A 1Q8AA 3QSTA 4J4KA 2ACRA 1YNPA 1T0OA 5DN1A 1JD7A 1EQCA 3NURA 5F4WA 1P7TB 4ERIA 3G0XA 3GXTA 1TYGA 5TD4A 3XINA 4J3SA 1V0NA 4CGTA 3E6EA 4NZ1A 4XZHA 3LCXA 3IJ6A 1UKOA 4H8VA 3FHAA 5G1YA 3PM6A 3VKKA 1JUEA 4TVCA 1IT7A 1ZTVA 1DVJA 3VAVA 3VNYA 4Y9MA 2BXYA 1SFSA 1JCXA 2ZDRA 1UHVA 3TYCA 2YXOA 2PLKA 2Y2WA 2A3HA 4GD0A 1EOMA 3VI2A 3L5AA 4CD7A 2PDYA 4XUYA 4DN1A 2Q3RA 5CPNA 2DDXA 3C2FA 2PDIA 1LORA 2XZ9A 3MSYA 2XG9A 4U3AA 2A21A 3THDA 4XZBA 1H09A 1Z48A 3ALGA 2PP0A 5KZ6A 3MW7A 2VEKA 3U4FA 2Z1BA 3TFXA 4JN8A 3S1XA 1P1XA 4KCVA 4QDMA 1DHKA 2PGEA 2X7VA 4Y7EA 3FV9A 6TIMA 1HO4A 3UCDA 1XLEA 1ZHAA 1LRNA 5A95A 4RKAA 1GG0A 3TTOA 1K8CA 1RHCA 2IKJA 4XD3A 3SO7A 3N17A 4JFUA 3N34A 4XBJA 5IDIA 1XD0A 3OHMB 1ZLPA 3NQEA 2W67A 3HPXA 1HJVA 4O13A 3UU0A 3VMOA 2GUBA 2YYUA 5CEWA 1WDRA 1OB0A 4UR9A 2ZWYA 1S38A 1IT8A 1RA5A 2QUUA 1VHNA 3OU8A 3MWAA 2D0HA 3TYBA 3HJEA 3MZNA 3DEQA 3D6NA 3SR7A 3SUTA 2GGHA 4MYXA 3L4TA 3P0WA 4IGNA 4QE4A 4X2RA 2VZUA 3OVPA 2I56A 3UETA 4AWEA 3G3MA 2RDTA 2CNCA 3DH7A 1LZOA 4GXWA 3T0DA 1KCZA 1NWTA 2JF6A 1IEXA 3HOJA 1TTJA 4MLRA 4H6RA 3NXLA 4D6IA 1TWIA 5TF0A 1ZQ5A 1DJHA 2Y0FA 3DXIA 3QPYA 3G6MA 1XKYA 1B9BA 1KLYA 2WJZA 4H7CA 5LIYX 3B9NA 3CV7A 3T2QA 5HJXA 3TA9A 4DYKA 1HT6A 4KPLA 1X6LA 2DQXA 3DC8A 3Q65A 1MW3A 5C70A 1ZAHA 3CUXA 1MUMA 3BLOA 4MOZA 4DWSA 3BXWA 2GJRA 4GO8A 3E38A 3H4WA 3ZLGA 1QVBA 4NRSA 1RY0A 1W5NA 2OT1A 3GHTA 1M9HA 1JCTA 3SCNA 1VENA 1OIFA 4GBDA 1B3WA 5D05A 4RL3A 3NDOA 5T9CE 2GVEA 2QR6A 3T09A 4LS0A 2J9ZA 2JFEX 5HOSA 1QMLA 4LW7A 3WQ6A 4CQDA 4UR8A 4L4PA 2V38A 4D6GA 2QYGA 3O0FA 5HAOA 2YXXA 1E1FA 3W9ZA 3JW7A 3TH6A 1WBHA 1R2SA 2YX0A 4GQBA 3M1ZA 4E4UA 1H63A 4XQ6A 4FAMA 3AUOA 2VEFA 2PTWA 1CENA 2FVKA 3G8EA 3AWNA 1BXNA 3QTPA 3W2KA 2X1IA 4FNPA 2ZUTA 2QVHA 3REQA 2DT1A 3LM3A 3VGFA 2PC8A 1GYNA 1TUXA 4WK9A 4XBSA 1AQHA 2PP3A 3FOKA 3VKJA 1R7AA 2J7EA 3BJFA 3M0HA 1KGUA 2F61A 3VIMA 3R8GA 7A3HA 3FGCA 3UJSA 3M07A 3I7QA 3ABQA 4E0CA 3NVDA 4PTMA 1E56A 4B2DD 4IIDA 2R9RA 4YTRA 1YDOA 1W2VA 1F3XA 1SGJA 5CBIA 3MI2A 1RXOB 3R13A 4GI8A 5DRCA 3TK7A 1GVQA 1W3KA 4HZ7A 1D3HA 2ABBA 2PLMA 4HU0A 3ES8A 1VPYA 3I65A 3MJYA 4MADA 3F7JA 1EHNA 1RD6A 4BS0A 4ZQOA 2YL8A 4M51A 3JR2A 2GLKA 1V0MA 1NJJA 4C6BA 2OFJA 4B5NA 4ACZB 3UYCA 2C18A 1TWZA 5AZ1A 4HP5A 4CD4A 3LLDA 4YTUA 5EA9A 4MZ8A 5MF5A 1QOQA 3SGGA 3W1MA 5D2WA 3VM5A 3FAWA 3H23A 1GWJA 3LTSA 1JI1A 2QUVA 4A8NA 4RW3A 1TB3A 1Z6KA 5LA1A 1ISVA 1ZZMA 2GGJA 4X9YA 3SY1A 3M47A 5H8UA 5A8GA 3MO7A 4O4WA 3GG0A 1J10A 1YTKA 4YLWA 5D32A 2YOCA 3F4CA 1OC5A 3VILA 1N8IA 4GX8A 3GDLA 2AGTA 4IPLA 4JICA 1XUUA 3DX5A 5D04C 4DUOA 3V18A 1CGXA 1KGXA 3OW1A 1BG4A 2E25A 2WWDA 1OK4A 3USBA 3EWDA 3MMWA 2PBGA 4WJXA 3WMCA 3LXBA 3RR4A 2HROA 4NX5A 6ENLA 3IGHX 2QXWA 4FXFA 3PUEA 5BU6A 1O60A 4ZEPA 4NT0A 1NY1A 3V5FA 2ZZ5A 4JEQA 4IGMA 4MIMA 1WV2A 2X7WA 2FTYA 3I4KA 4PBFA 2GQ8A 3G1YA 5FF7A 3PG8A 3IVSA 4GABA 5CGQA 4IMAA 1B4EA 1JDEA 2OU4A 1QWGA 2C15A 4DZHA 3DDMA 3WH5A 5XIAA 4OECA 4QDWA 5E6ZA 3KOXA 3NNTA 1I45A 3UXAA 5F2LA 2TAAA 1XYMA 2QF8A 4XAYA 1LDCA 2VVNA 4QSHA 2J77A 2QCLA 1JR1A 4UMBA 1F2JA 1EFZA 1LBFA 1YNQA 3VPLA 1UJPA 4I9TA 1H41A 3DFHA 3KEHA 5ABFA 2J47A 4O54A 1TCMA 3EAUA 3ITTA 3AIQA 4GFIA 4TMCA 3FSUA 1UD3A 3WBEA 2G96A 1JXKA 3A3XA 3CTTA 3SCPA 1OX6A 3P81A 5CAHA 3NA8A 2WMJA 3CUZA 3M5VA 1JAKA 3B03A 4Z1DA 2IPFA 5BW6A 1UOKA 1B5TA 4CD5A 4GY0A 1DTUA 1XLFA 1X1ZA 2ZWZA 4XIAA 5LYRA 1FY6A 2ZZ3A 4YWIA 4PZVA 1DJZA 1AJ0A 1U5HA 1JZ4A 1WQ5A 1H50A 2YJQA 3SCWA 4RLIA 6PTDA 5J5RA 3C8NA 4AFYA 2X0YA 1I2OA 2XIJA 2YL5A 2XHYA 3H12A 3MKVA 4CUCA 3CIVA 1SVDA 4ICMA 2C8NA 1LCOA 2X40A 1VCGA 4A3QA 1H51A 4R34A 1ONWA 4LWWA 1OINA 4PMVA 2FYMA 4KEMA 2EPNA 1MUWA 2BMBA 1NAL1 3WF3A 4GUIA 4XTIA 4XK2A 1DJXA 4GNJA 1C3FA 2V68A 4IIHA 1DQWA 4O12A 1UD2A 3CHFA 2B7NA 2EG7A 4HVXA 3OVGA 2CYGA 5LSMA 1W6TA 2ZADA 2DU2A 5E0FA 3RO6A 4PL1A 2QJJA 2Z1KA 4AD4A 4MJ4A 1MW2A 2Y1HA 1FHVA 3C52A 3LENA 1C91A 5LNRA 4WXYA 1PWMA 2GPTA 3W2NA 3W02A 3EOOA 2I5IA 4HNOA 3WNOA 4H7VA 2O7SA 1VFUA 1J2BA 1ZBKA 2NVCA 5H2ZA 1PL9A 4YIWA 3MB9A 5F2MA 3SCOA 2ZVRA 2YBVA 1KB3A 3MCNA 4EF9A 4UB9A 4P7NA 1SO5A 2AMXA 3UA3A 2OB3A 3ZXWA 3HF3A 5FJPA 2QV5A 1Y5WA 3DENA 4DO5A 2X1RA 2Z00A 3EOLA 1XDMA 4JTAA 1IZKA 1M41A 2CZFA 4QCFA 4B5WA 3GAKA 3VGHA 1OYAA 2Y4SA 1REQA 2OOFA 1V6UA 1KM1A 4Q8UA 5EMUA 1YE6A 3MMTA 2WCSA 3UY7A 5FL0A 3GO2A 3ABRA 4MY8A 5AYZA 1B54A 2QAPA 4P5UA 4QE1A 2DFAA 3CHDA 2P10A 3HFYA 3CK5A 3KHDA 6TAAA 1H4PA 2G41A 3E0WA 4AB4A 5F7UA 9XIAA 3QPZA 1C92A 1KCKA 1JAEA 3VK5A 1LUCA 3AZSA 2D0FA 1V0KA 1CGVA 2YLAA 3UYIA 2Z4GA 2VD8A 1TTIA 4I90A 2CBIA 3FA4A 3TE9A 3NPXA 4CNPA 3M7WA 2YW4A 5FAJA 1GQLA 2H8ZA 3N6QA 2FKPA 4IP4A 4GLEA 4UTTC 3LPGA 2DZSA 2A6NA 4CNSA 4B3KA 2HJPA 2PF8A 1ZJBA 4M6PA 1SSGA 3UR7A 4CVWA 1FA2A 5BCAA 3FSTA 1FHLA 3HTWA 3NIYA 4LCRA 3KRBA 4I7WA 3TOPA 4O0QA 1XIDA 1JVNA 2W61A 1OFEA 3U6WA 3BGJA 1OIMA 2WM0A 1TA3B 1JZ5A 1UR4A 2OODA 3A23A 4ATDA 2VX5A 4QXIA 4DAIA 1P43A 1LLZA 1WUFA 3PNZA 4Y2WA 4Q8OA 2DY3A 4QROA 4PH6A 3P84A 3SN1A 2OLHA 4EF8A 2R94A 4GYJA 4QS6A 4ADTA 2MUCA 5D9MA 4WSJA 4AZBA 8XIMA 5GPRA 3ZSTA 2VGFA 3HQ1A 1LQ0A 2OGJA 4JX6A 5HULA 3BW3A 4EKJA 4PEKA 4GH3A 4PBEA 4Z17A 4JY9A 4KCWA 1IV8A 2E09A 3T8QA 3BAIA 4QJ3B 3F1QA 3E5BA 3PZNA 1KBIA 4CQCA 4TMBA 1JPDX 2CCRA 3XIMA 4H04A 4JIHA 3WELA 3BOFA 1IZJA 5H8MA 4KEZA 1PX4A 3OLIA 3KZSA 4C6MA 4LTSA 3WLPA 1VC4A 3HQOA 1HKWA 3E0VA 2GJXA 4FNTA 3RDKA 1JULA 2VEGA 5G1TA 4AYSA 3K13A 3GC5A 3UNDA 1AH0A 3UZ5A 2ZUMA 1LQAA 4MFDA 2HPIA 4GUJA 1TPFA 1WAWA 5CSYA 3REQB 1XQLA 4HHLA 1TPWA 2AGKA 2GVGA 3T8LA 4O10A 3SUVA 1H62A 1YTDA 4KKXA 1XX1A 1OT2A 1IEIA 2ZX6A 1AW2A 1A3WA 1MRQA 3PJWA 4YVVA 3UWQA 5A6KA 3BCFA 4ZSUA 3B9EA 3VC6A 4WDXA 1WZLA 1UKQA 1XFCA 5KINA 4KGLA 1TPB1 4GC3A 1R3QA 1ZAJA 4ZO9A 4GHRA 1GZGA 3W3OA 4PB5A 3WK3A 5H6HA 4IJCA 1YYAA 4W5ZA 3N3TA 4MNJA 2G37A 4RDVA 4R85A 1DL3A 2VX6A 1HGWA 1AK5A 4JKMA 3TTQA 2FZDA 1EOKA 4PUMA 1N8FA 4H9VA 1UC4A 4LQ1A 3S2JA 1UJQA 1IF2A 3IJ8A 4DLMA 1FXQA 4QDPA 3TP4A 4EIVA 2WNQA 1U83A 4FO4A 1FWWA 3EDKA 4IGSA 4KCTA 3NSXA 4FALA 3AXIA 4FEZA 3NPUA 3INPA 1GOIA 1E9LA 2VC9A 3OB8A 1VBRA 3QBUA 3WJWA 1UD8A 1Q65A 1ZSXA 1G6CA 4MB4A 3BZJA 3M0YA 2P1FA 3KP0A 3EOUA 4JFTA 4UNLA 5IOBA 3IV8A 1XW8A 5KITA 3N25A 3VD9A 2CHOA 5DO8A 3EB2A 4LYPA 1CECA 4UCGA 2VRQA 3LLFA 4P7RA 3VNKA 1ML1A 4HU3A 3VKDA 3VA8A 4IQDA 4F3HA 3MVTA 3OA3A 1M01A 3MI3A 1FP8A 1I75A 1N82A 2IMRA 2XFFA 2ZRWA 1NSJA 3IIOA 2XFRA 3EA2A 4NRRA 1O7AA 4S3AA 3RCNA 2CLMA 4PMOA 1DWAM 4LVFA 1JZ8A 1F9CA 1XDLA 5AOUA 1ZGDA 3AU2A 4N9CA 1AG1O 4H19A 3T78A 1QJWA 1RVKA