4AD2A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-isofagomine
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
345
structure length
345
Chain Sequence
TELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
total genus 128
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad2A00
3IAPA 3BXWA 4GPNA 3VILA 2C7FA 1B3XA 3CLWA 3WD4A 3DYOA 1WDRA 5EMYA 1A3HA 1HXJA 2Y4SA 2VR4A 2PWHA 3WNPA 1W3LA 3VIIA 1BTCA 3N1AA 4AWEA 2CNCA 3B9AA 1M53A 1ITXA 2VRJA 3OGVA 1EH9A 4LYRA 2GFTA 4W93A 3FY1A 1HL8A 3ZJ7A 1NP0A 2YBUA 2X8RA 3WFLA 3AMLA 4QLJA 1J0ZA 1CIUA 2XGBA 2WPGA 1V6WA 3SUSA 1MFVA 1KQZA 4BS0A 6TAAA 4FLRA 5A2BA 1EGZA 3BAWA 2GSJA 1CXKA 4GINA 5IFPA 3WDHA 3IJ9A 1OGGA 4WKHA 3IJ7A 1UUQA 1QOXA 4QP0A 4HOXA 4CN4A 1LL7A 1HT6A 3GZAA 3BLPX 3GDBA 3VD4A 3A4AA 4PTMA 1HKKA 4J3XA 1YHTA 4W7VA 3W81A 2WSKA 4HZ8A 2A3EA 3WD0A 2QV4A 3EDKA 1DTUA 2WBKA 1R87A 4TX8A 1E3ZA 2J7BA 1UH2A 2YDQA 1QW9A 1EDTA 5BXPA 4J3UA 1CENA 3DHUA 2BNJA 3FHAA 1B3WA 3UG5A 2OWXA 1GOOA 4CKQA 3BAYA 5DMYA 2J77A 3M07A 3CZGA 1EXPA 3IJ8A 1JZ8A 1CXFA 3VDCA 3L4XA 1XYZA 3RPMA 5A6AA 1E56A 1EHAA 3WD3A 1KXTA 3EMZA 1CGVA 2W91A 3AQUA 3CZJA 3PHAA 3U7BA 2IUZA 2ZUTA 1VJZA 3ZT5A 1R7AA 4D71A 1UD6A 1BSIA 1UD3A 3NJ3A 4D6DA 2OSWA 4UR9A 2VC9A 3VKKA 3ARQA 1H41A 1KBBA 4OIFA 2XVGA 1H2JA 4W86A 1A47A 4JKLA 2G8ZA 3QGVA 5AC4A 2YA2A 1NWSA 3QHNA 1WPCA 3UG4A 5FL0A 2BHUA 3PZGA 1HF6A 3AJ7A 3NYDA 4PCSA 5JBEA 2WVSA 5A2CA 4Q7NA 1IT0A 1VFOA 1JDAA 1UD4A 3U5YA 4CGTA 4OUEA 3AIUA 1LJYA 1JZ3A 3VD5A 1KGXA 3FHQA 2VOTA 5AY7A 2QPSA 3BSGA 4P8WA 4AISA 3AMDA 1BYDA 3AIQA 3PN8A 4WKFA 4EKJA 4C7FA 2V3DA 4OBRA 3MV01 4AYSA 1XCXA 2VI0A 1OIFA 1AQHA 4HMCA 2WC3A 4PMYA 1W2VA 4DWSA 4C7GA 3AYRA 4NSBA 3GBEA 1J01A 1KR0A 5AYBA 3WEOA 4JZ5A 1JNEA 1Z32X 1V3JA 2J7GA 3WDQA 4CD7A 2ZUMA 3ALGA 2YIHA 2X05A 2G41A 2C8NA 3RJYA 4AIUA 1EHNA 5FIPA 2GJXB 1PBGA 1JAEA 3HJEA 3A3HA 1K9DA 4K68A 1E73M 4KGLA 2ZWZA 1E6XM 5FD0A 4GO8A 2VNCA 2ZX7A 2XSAA 1JYWA 3B9EA 4UCFA 3HU7A 4MNMA 2ZE0A 4L4PA 5DF0A 1FHDA 4JL1A 1UWQA 2VCAA 1E4IA 3D3AA 3VM7A 3VX0A 1CLXA 1H5VA 1R85A 1UD2A 3CUGA 3KZSA 5D9OA 1PZ2A 3WELA 1DWHM 1J10A 1ZBVA 2ZUWA 1EO7A 5D8WA 4AY1A 3KL5A 1JDDA 4EANA 1JZ4A 3AZRA 2XJ7A 3T2QA 1D7FA 1UKSA 1GCYA 1QHZA 1NH6A 2ZX5A 3OG2A 3N15A 1CYGA 1VRXA 3BAJA 1Q6FA 3WDRA 2WW5A 2VX5A 5CPQA 4HU0A 1C90A 2ZIDA 3PTKA 1ZB5A 3MUAA 4QFUA 2XVPA 2DSZA 1ODUA 4ZE4A 5EBAA 1W9XA 1X6LA 5CQ1A 4Z2LA 4MDOA 4UTFA 2WLYA 3AS1A 1D2KA 5BXSA 2J4GA 3UEQA 1M04A 1FOBA 2G3NA 4MB3A 2UY3A 3D5HA 1LF1A 1HVQA 1SYTA 3FN9A 3VIKA 1GHSA 4U31A 2A3CA 4IISA 4JKMA 2Y24A 5C71A 3EBVA 3TTYA 5EFFA 3VPLA 3WSUA 1GQJA 4IPNB 5LYRA 2CKRA 4UFIA 1J9YA 2CHOA 4CN1A 3TONA 1BYCA 3BLKA 3T08A 5DT7A 4UQ9A 4AD2A 5GNZA 1W9DM 1WCGA 3CUFA 2EEXA 1UR4A 5JBDA 2DSUA 2EPLX 5JIWA 2CPUA 4MTVA 3AISA 1V08A 1EO5A 1WKYA 4KGJA 4J3WA 2D0GA 1C92A 4LQ1A 1ISVA 3BAKA 3WN6A 2YLLA 3N17A 5ABHA 4AZGA 1TZ7A 4PMOA 1S46A 1SFSA 3N13A 2O9TA 3DYMA 2J75A 2WHMA 5A69A 3G6LA 1C8YA 1UYQA 3A47A 4W84A 4M81A 2OSXA 1CEOA 2NSXA 1H09A 3JUGA 3MU7A 1XD0A 3AMKA 2VURA 3IK2A 4TVCA 3VIOA 2O9RA 3A4WA 3E1F1 2EQDA 4CUCA 4BQ4A 1V0MA 4OKDA 4D6IA 4TVDA 2BY2A 1DHKA 4HPHA 3GBDA 1JG9A 3VIPA 3OLDA 4Z2KA 2GUYA 1JF5A 4GQRA 3WH8A 4Y7EA 1JI2A 3WIJA 2J79A 3WMBA 4GXPA 4UOZA 3PZIA 1JFHA 1OWQA 4W88A 3RDKA 3U5UA 1OD0A 4P7QA 3CMJA 1GJWA 4AD0A 1MW3A 3AFBA 2VVNA 1FA2A 4OBSA 4PMQA 1X6NA 4UQBA 4XZWA 4BQ2A 1UG6A 2WMIB 3EDFA 1OBAA 4DM1A 2JFEX 4W85A 4DWSD 2BHYA 1GVYA 5A3HA 1V6XA 2BHZA 5E09A 3GYCA 1NWRA 2W67A 4FLOA 2CCRA 3VNZA 3GNPA 1EA9C 4MB5A 1B9ZA 1ZL1A 4U3CA 3KE0A 3W27A 2F61A 4HPGA 3ZR5A 1FFQA 1CPUA 1V0LA 1MW0A 3APGA 2O92A 1XHGA 3TTSA 3SCUA 2ZUVA 3VDAA 2ZUSA 5GNYA 3WDIA 1ZU8A 5E9AA 3OB8A 1WZKA 3VOCA 9CGTA 3AZSA 1L8NA 3TOPA 4XB3A 4LGXA 2YL5A 1NQ6A 1DWAM 4PBGA 1HNYA 3AHVA 2FGLA 2VQTA 3CZEA 3SCVA 4Z2GA 1LG2A 2XFYA 1UKOA 5A8QA 5IHRA 3QR3A 3WQVA 2XGIA 2J7DA 1W3JA 2YL9A 4M1RA 2IXUA 3VX1A 2QPUA 5FCZA 4U5IA 4U5KA 5IHSA 4AEEA 3WBEA 5CGMA 2PWGA 1WAWA 1TFVA 2V3FA 4MB4A 3PTQA 1VFMA 3ARWA 1CTNA 1KWGA 1DP0A 4CD8A 3QOKA 1MVYA 4PN2A 2Z1KA 1E0XA 4F9JA 1BLIA 1E6RA 2VJXA 5DEZA 3UETA 4TXEA 2D20A 3NDZA 4JAWA 3GNRA 1J0YA 2WXDM 1OD8A 4PUEA 3W4RA 5M5DA 2BXZA 2OLHA 3WH6A 3GH7A 3MANA 4V27A 1NM9A 1UKQA 2WWDA 2D0FA 4W5ZA 3NSNA 1ISZA 3UR7A 1JI1A 3VMPA 1B3VA 1DWIM 1VEMA 1B30A 2PWEA 1GZJA 3PZQA 1BGAA 1J18A 4J3VA 3N9KA 3M6DA 3POCA 4ML4A 3S2CA 5A95A 1ZS2A 4HA3A 5HPCA 2BVDA 1TE1A 3CUHA 3AXIA 3SUTA 4AD3A 3SURA 5ABFB 1ZBWA 2D24A 3AXXA 4M56A 2AMGA 4HZ7A 3WNOA 3WDPP 2VTFA 1JFXA 4P7OA 1OM0A 6CGTA 2WAGA 3MKKA 4KRTA 1JZ7A 1V3KA 5E0CA 1H4PA 3CO4A 5LA0A 1MQPA 1GVIA 2G3IA 3HMCA 4M80A 3HN3A 2Y2WA 3VD3A 3ZJKA 1JNDA 2XTKA 1Q6GA 2MANA 3J7HA 1LQ0A 1VEOA 2GJXA 3VGDA 1AMYA 2EPKX 4ZEPA 2GVYA 1E72M 1VENA 2V38A 4TVUA 3CZLA 2E8ZA 2DDXA 1ZJAA 4OZOA 1NWTA 2DSVA 3O6AA 3OZPA 1VFFA 1E9LA 2FHBA 2V5CA 1W9BM 4PTWA 1BPLB 1GOWA 4HP5A 3WQ8A 2A3AA 1KR1A 2QHAA 1QBAA 1NARA 3UESA 3SUVA 1B31A 4HZ6A 4ZE5A 1EDGA 3FAXA 5FOOA 1XH2A 2ZICA 1QI5A 5M03A 1RP8A 3RJXA 3IAQA 1V03A 3WUEA 1V3LA 1E6ZA 4OJYA 4WF7A 1KXVA 1XRVA 1G0CA 1V0NA 2Z1SA 1W1YA 1VBUA 1W3HA 1W1VA 5I77A 4ATDA 3ZT6A 4XUYA 5A8PA 2JIWA 2D2OA 3K4AA 1CGUA 1VAHA 2RGMA 1G5AA 2J62A 5CZKA 3BSHA 3ZSTA 4AC1X 4TX6A 3AHXA 3U57A 2YA0A 1WZMA 2A3HA 4RL3A 3ZT7A 4AZ7A 1ECEA 4PRWA 2ZUUA 3VINA 4MNJA 2QF8A 1CXLA 2GDVA 2OWCA 3TP4A 3WNKA 5EB8A 4P7NA 2CBUA 1J0IA 4GI9A 1W2PA 4JFUA 3UR8A 1QNPA 5A6BD 2ZXBA 2VO5A 4E2OA 2W5FA 3EYPA 4N0RA 1W32A 3FAWA 4KWUA 1UZ4A 2YDSA 1BYAA 3RM9A 4CU6A 1HP4A 2XUCA 4X0VA 4URIA 1FH9A 1BYBA 2G4FA 4BQ5A 3CZKA 3N12A 2AOSA 3WKZA 5CSYA 5A8NA 1HJXA 4GIAA 1KB3A 2WSPA 3FNDA 3BCDA 3VIJA 1V0KA 3ZOAA 5BCAA 1E3XA 4MAVA 3WF3A 2CERA 1W91A 4NRRA 1WO2A 4D6HA 1KQYA 2WLZA 4AZCA 3RIKA 8A3HA 4CU8A 3II1A 3VGBA 2QLYA 4JHOA 2V3GA 2VMFA 3BH4A 3EDDA 3WFZA 1HJUA 2VT0A 4PMUA 1BQCA 2DEPA 4CD5A 1JXKA 4PMVA 3ZQ9A 1VIWA 2WMIA 3BMWA 4P7LA 3SCPA 4JFWA 4HMEA 1BFNA 2W66A 3K8MA 4PEEA 2CETA 3AHTA 3A6OA 4JCLA 1F4HA 1UD5A 4CVWA 4GKLA 4BF7A 1ISWA 4AD4A 1ITCA 3W37A 4MJ4A 5KEZA 2QMKA 3LPFA 4YHEA 2FH6A 3WUBA 3AS0A 3AOFA 1DWGM 1PZ3A 4D6EA 3AIRA 4HU8A 3UCQA 1CGYA 2BFGA 1E5JA 4WKAA 3K8KA 1P6WA 1SR0A 2VX4A 4MNLA 5CPTA 5D9MA 3SUUA 3B8SA 3OBAA 4MAZA 4DM2A 4CCCA 5A94A 4UZSA 2CKSA 3EDEA 3MSDA 5IFTA 1V3MA 2BY3A 3GXMA 2XPKA 1UWTA 2DSWA 3BAIA 1B90A 4B16A 1C7TA 3UERA 2YBTA 3T0BA 1UQYA 3UG3A 3W0KA 3PZUA 1JAKA 4NF7A 1OCQA 1VBRA 2WHKA 1WDPA 1GORA 2WNWA 3T2PA 3RILA 3WF1A 3PBGA 2EJ1A 3WNNA 3WF0A 5BROA 2XSBA 2YA1A 4FLSA 1E1FA 3VO0A 4BCEA 1DEDA 3M7SA 2F8QA 1I75A 4H41A 1NP2A 1OGSA 2VRQA 5M17A 4M82A 1QI3A 1E0VA 4GZJA 4GI8A 1US2A 2OYLA 3W26A 3ECQA 5BXRA 3IANA 1K9TA 3PZTA 1NOWA 1C8QA 3DHPA 4E8DA 4JL2A 1BVZA 2PF0A 1MFUA 1PIGA 1ZJBA 1E1EA 3VGEA 3L4TA 2O9OA 2WHLA 1UR0A 1B2YA 1JL8A 1FP9A 4JCMA 1UZ1A 2XG9A 1E15A 2VQUA 1UR8A 1CGWA 4D6FA 5TD4A 3O9NA 4FK9A 1DWJM 4AW7A 4H8VA 1CECA 4LXFA 4GO9A 5D9NA 2V3EA 3AIBA 4HOWA 3NIYA 1E40A 2WC4A 5ABFA 1OT2A 3AIWA 1WE5A 2A3BA 1E4NA 4ATLA 1V3IA 1MYRA 2HVMA 1AQ0A 1D3CA 3AIEA 2E9BA 4W8BA 1TA3B 1H0GA 5HBFA 3WQ4A 3WNLA 1KFWA 4DUWA 1I1WA 5ABEA 1HKIA 2FH8A 1UOKA 2CBVA 2VVSA 3SUWA 3CIVA 1PPIA 3ZO9A 4AZHA 3GH4A 4AZCB 3GH5A 5CXPA 2YKKA 3QOMA 2WVVB 1SMDA 1UKPA 4AZBA 3KL0A 3LMYA 2WCAA 4ZENA 4HTYA 3L2MA 3VIMA 3VDBA 4ZFMA 1C93A 4BA0A 1VEPA 2YOCA 3SEPA 2WHJA 3BAXA 4XZBA 1OT1A 4PCTA 2DT2A 4GI6A 4ZXOA 4PYSA 3VGFA 1PEZA 1UA3A 4RE4A 4CU7A 3VD7A 1HJQA 3MUIA 3ZM8A 1LLOA 1ESWA 1V02E 1PX3A 4MJ2A 5D4YA 3RM8A 1B0IA 2QMJA 3AI0A 4X0NA 4UFJA 3O2LA 4F9DA 2DGAA 1W3KA 1J0HA 3WQWA 4J28A 1KCLA 1AQMA 1OGBA 1W9PA 4PMNA 4HA4A 3BMVA 3QHOA 5BWFA 2V5DA 3AROA 1TUXA 3THCA 3T2OA 3CMGA 1JD7A 2VZVA 2J8FA 1RH9A 3WF2A 2VCBA 4W89A 4WSJA 4D1IA 1U33A 2XWDA 1OIMA 2GJRA 1GOMA 2CHNA 1HKJA 5HNNA 4NI3A 3L4ZA 1ZBCA 1UR1A 1W9VA 1K9EA 2WZHA 1E43A 2J74A 1QNQA 3WF4A 4WIWA 1FP8A 2BXYA 2DH3A 4CVUA 2FDMA 4J3TA 1WDSA 1M01A 5CLTA 3W53A 3WEMA 1JZ2A 2XIBA 4GZIA 1QHOA 4UOJA 5CPSA 3CH9A 5HOSA 1ISXA 1U30A 3PZ9A 2XFFA 3VGGA 2X0HA 4UQDA 4HOZA 1PX8A 3THDA 1I1XA 4D1JA 2F2HA 4MNKA 3VIHA 2E3ZA 3AIVA 3EMQA 3VD9A 2UY4A 5C70A 2W61A 1JYVA 5KZ6A 4WSKA 3POHA 3WENA 4NRSA 3ARZA 1GHRA 2Y5EA 1KGUA 1LL6A 3VVGA 1RP9A 3T0AA 4JIEA 4PSRA 1CGXA 1FFRA 3S6TA 4AD1A 3W82A 1QNSA 2ZWYA 1KBKA 2DIEA 3WBAA 3MO4A 2DT3A 2W63A 1Q6CA 4UFMA 3W28A 2WVUA 2YLAA 4GZEA 4KH2A 2RGLA 2ZXQA 5LA2A 1UR2A 4W87A 1CXEA 4PUDA 3W38A 3T09A 3EDJA 2Y8KA 4JFSA 3WD1A 1QPKA 3I3BA 2NT1A 1XCWA 1AVAA 3EMCA 4D6CA 1E5NA 1BAGA 1VB9A 1LWJA 1H1NA 2XM2A 2WM0A 2WZEA 2BVTA 2XVNA 2PC8A 4J27A 4UQEA 1O6IA 4UFKA 5I79A 1J0JA 1GQIA 2J25A 3WNMA 1OINA 1HIZA 2OYMA 1R7OA 1CBGA 1JXJA 2ZUNA 1PJ9A 3TA9A 3OA5A 1R86A 1WZLA 2J8GA 1WP6A 4LYPA 2C0HA 3MMWA 1Q6EA 2E4TA 4E8CA 3AYSA 4A3HA 1UWRA 4MPKA 4PMXA 3WH9A 3NUKA 4TOQA 5A6SA 4W7WA 3RMEA 1RPKA 2VZOA 3L4WA 5JBFA 1UH3A 1FHLA 4Z2HA 2OSYA 1C3FA 3F5JA 3VDHA 1QNRA 4AD5A 2VR5A 3ARYA 1UR9A 2D23A 3NCOA 1U2YA 1W1PA 4ACZB 3ARVA 3VIGA 1E6QM 3RCNA 4QAWA 1IZJA 4R5EA 5BXTA 1XH0A 4S3JA 3GNOA 4Z2IA 5LA1A 2G3JA 4M29A 4X9YA 2DPEA 2O9PA 3K4DA 1MQQA 1M7XA 3CBWA 1XSJA 5E6YA 3ALFA 3AHYA 1EDQA 2ZXDA 1EOMA 2CXGA 3T0DA 3W6LA 2PBGA 2VX6A 1HP5A 4CCDA 3TTQA 5HXMA 1GOQA 3VTRA 1H49A 2PI6A 3NDYA 1E0WA 4CD4A 3CUJA 3SCNA 1BVNP 5I3DA 4TTGA 1ZBKA 2VZTA 4RE2A 3PTMA 5CLWA 1JGIA 1TMQA 4ZXLA 3SCTA 4TTUA 1MXGA 1TR1A 4HA1A 3ZMRA 2J7HA 4QCEA 3ARXA 2D3NA 3OLIA 3CUIA 1Y7VA 1IZKA 4BZYA 2X0YA 4QCFA 2BS9A 2UY2A 1E6SM 4DUXA 4U3AA 2WMGA 3CHFA 1EOKA 2WYSA 3FXYA 4CCEA 1CDGA 3CHEA 2PB1A 2BY0A 5EFDA 3BGAA 1HL9A 1O7AA 4AMCA 2CEQA 5GPRA 1TCMA 1E71M 4M24A 4MADA 1XSKA 1BGGA 3ZSSA 2W4XA 3VMNA 3OIHA 1E6NA 1PX4A 1KXHA 1E4MM 2WCGA 4W8LA 2WMKA 1UWIA 2JF7A 2CBIA 1KXQA 1TA3A 3I3EA 1L0PA 2WANA 3F4VA 3SCQA 3MV11 4UNIA 5ECUA 2EPMX 2NT0A 1BG9A 4H04A 1UHVA 4NZCA 1QNOA 4YHGA 1J11A 5CG0A 4JKKA 4BQ3A 1WZAA 2D22A 5AYIA 5DO8A 3B9DA 1Q6DA 4N42A 7CGTA 1JYNA 3VNYA 5AC5A 2WVVA 5CJ5A 3AS3A 2D1ZA 2WC7A 5D9PA 3GXDA 3WQ6A 5A6LA 3DYPA 1V6YA 1F4AA 1CGTA 4P8XA 4FF5A 3MSGA 3VU2A 2J7FA 1E55A 1TVNA 4DUVA 2VUYA 5BYWA 2VX7A 4H2CA 1NOUA 3MUY1 2DT0A 3VMOA 4IM4A 2VZUA 1G1YA 3ARUA 1YQ2A 3MUZ1 2EO7A 1HX0A 3BC9A 4WK9A 1CLVA 3GM8A 4M8UA 3A4XA 1PIFA 1GUVA 4PTVA 1B3YA 4PTXA 5A1AA 1C91A 3OLGA 3MMUA 1CWYA 4CD6A 1W9UA 3RO8A 4W7UA 1XGZA 1H3GA 1XV8A 2EPNA 1QBBA 7TAAA 4H8HA 3KEHA 3ARPA 2JEQA 1QI0A 4AZIA 3N04A 1UWSA 3PZMA 4UOQA 4ACYA 1BHGA 2X1IA 3SCRA 4J3SA 4F8XA 2UY5A 1K6AA 3LPGA 4XX6A 3AICA 2JEPA 4WJXA 1V3HA 2WMHA 4XV0A 1VFUA 3PZOA 5M3WA 4AEFA 4J7RA 3WUFA 2EBNA 3G6MA 5DFAA 4JFTA 1VJSA 1V6VA 5A6JA 1G94A 3VGHA 1US3A 2XYLA 4UFLA 3LPPA 2J7CA 2WMJA 1HVXA 2YL8A 1V02A 1J12A 3GTNA 5BRPA 2XHYA 2XFRA 2VCCA 4KMQA 2GK1A 3WD2A 1X1NA 2ZX9A 3AMGA 4UFHA 6A3HA 2WK2A 2AAAA 3WMSA 4AZ5A 3RM4A 5FL1A 3W29A 3WEZA 3CHDA 5DT5A 3W25A 1GPFA 2ESCA 4P8UA 1B1YA 1MW2A 3K8LA 1R8LA 1GQKA 4MB1A 5I6SA 3W6MA 1B3ZA 2DIJA 5E70A 1GNXA 5A6MA 4V28A 1V6UA 2DH2A 2E40A 5D8ZA 1LG1A 4JHZA 1Q4NX 3OGSA 1CXIA 1XYFA 4H8UA 3M46A 5I5RA 4EK7A 1KGWA 3L4UA 2GDUA 1ODZA 2CIPA 2WKLA 4EE9A 2YL6A 2IXVA 3MMDA 3KWXA 2Q8XA 2J7EA 3OGRA 4IUGA 3CHCA 4W8AA 4HMDA 2PBOA 1UH4A 2Y8VA 5HPOA 2OYKA 1HJVA 4U2YA 1MXDA 2WKGA 3ZJ8A 4D6JA 1N82A 3PZNA 2VRKA 2OWWA 1QVBA 1HN1A 2WVTA 3SCWA 4IPLA 1G01A 4P8VA 1JZ6A 4C7DA 1MW1A 2DQXA 1M03A 5CGTA 1UKTA 4U2ZA 2ZX6A 3CPUA 3WUGA 1BF2A 3OZOA 2DT1A 4PMDA 1FH7A 2D0HA 1UWUA 1UD8A 3WL0A 3FW6A 5GQBA 4B3LA 4W5UA 5I24A 2GJPA 3W24A 4UZUA 1UQZA 3SCSA 1EQCA 2B31A 1J0KA 4B3KA 1WDQA 1G9HA 1NOFA 4KRUA 3AHZA 5E6ZA 2WCSA 1E70M 4PMZA 3K1DA 1H11A 4H7VA 3AMCA 4F79A 2WBGA 2BV9A 4DWSB 3ZJ6A 1ISYA 1EQPA 1QW8A 4YPJA 4Q22A 3F5KA 1GOIA 3AZTA 3L2LA 1UA7A 3DC0A 3L4VA 3L4YA 5IXEA 5F7UA 2BY1A 1MQRA 4ACZA 2J47A 1JYXA 4AIEA 4EAMA 5BRQA 1QI4A 4QLKA 5E0FA 3WL1A 2WZIA 2VZSA 1MWOA 5FKYA 1JZ5A 1OSEA 8CGTA 3ZIZA 3N18A 3MS8A 2JIEA 1HJSA 3U7VA 1K9FA 2ZOXA 3CGTA 4AXNA 3VM5A 2CESA 4QLLA 2XWEA 1EIBA 2XIIA 1E4LA 1IV8A 3QHMA 1C7SA 2E0PA 4GQQA 4PMRA 2HISA 3WH7A 2D3LA 2WMFA 5A2AA 2FHFA 4MDPA 3F5LA 4E4PA 2XVLA 5C8BB 1JDCA 2CITA 3N11A 2DSKA 1CZ1A 1PAMA 5CSUA 2E9MA 3WH5A 1HJWA 3NSXA 1GONA 4D6GA 1WNOA 1CXHA 3DECA 5IDIA 1JF6A 3VIFA 2J78A 5A6BA 7A3HA 2XVKA 3BCFA 3GXIA 5HDRA 5I2UA 3AXHA 4F66A 2JALA 2NW0A 4ATWA 2GK1B 4FLQA 3ARRA 5JIPA 4OOUA 1XSIA 2YDRA 3WQ5A 3SIMA 1XC6A 4Z2JA 3WY1A 3PZVA 3TTOA 5A6KA 2EPOA 4L4OA 4B9ZA 1GJUA 2YJQA 4JFVA 1QHPA 1TG7A 4B15A 2PWDA 1NWUA 1FH8A 4AIOA 3OLEA 4V2XA 1VF8A 4A3YA 1LWHA 1WB0A 2XM1A 3I3DA 4LX4A 5ABGA 3ARTA 4UQAA 1H0IA 2E9LA 2G3MA 1C8XA 4AZ6A 2ZXAA 5A8MA 4OOZA 5JUVA 1GW1A 4P7RA 2TAAA 1HKMA 4QDMA 2VL4A 4U33A 4UQCA 3ZR6A 4DWSC 4WLCA 4D72A 3AS2A 5GNXA 1JD9A 4B9YA 1LL4A 3GXFA 2JF6A 1TVPA 3CTTA 4A4AA 4CN6A 5I0DA 3SCOA 1QI2A 4TUFA 2WB5A 2FGZA 4YN5A 2CYGA 2E8YA 1GOKA 1GQLA 1SMAA 1OB0A 5A8OA 1CNVA 2ZX8A 1E6PA 1KWKA 4R27A 2W62A 3VUPA 1KCKA 3LPOA 4S3KA 3CZ8A 3KL3A 2X2YA 1XH1A 3WMCA 1W1TA 3WDJA 2CBJA 4PSPA 2PWFA 4LYQA 5I23A 2BVYA 2W92A 4FMVA 5I78A 2UWFA 1BG4A 3NSMA 2FHCA 2JE8A 4LPCA 3ARSA 2X09A 4RE3A 1XD1A 1RD6A 1DWFM 2EXOA 1JIBA 3K46A 2WWCA
chains in the Genus database with same CATH superfamily
5AFDA 5H91A 1B3XA 5I03A 3DYOA 1WDRA 4N2YA 5EMYA 3WNPA 1LOSA 1IWPA 3VIIA 3UJ2A 3N1AA 2CNCA 3UWQA 4Q33A 1EH9A 3FLUA 3FXGA 2WV8A 9XIMA 4AB4A 3FSUA 2XGBA 4G5DA 1KQZA 4IMFA 4PEKA 6TAAA 2Z2UA 1EGZA 1P6BA 2GSJA 2ZVRA 4Q8TA 2I57A 1F7BA 3LCGA 1DIDA 1UP0A 5C55A 3V1PA 2OQHA 3S1WA 4IFKA 3FYOA 3KBJA 3P62A 1DJQA 4L9XA 2A21A 4WY0B 3BLPX 3GDBA 3LCFA 3VD4A 1QOPA 3S83A 4XIAA 2B4GA 2A3EA 4HPJA 4HZ8A 4FALA 1DTNA 1R87A 1YDOA 4AHOA 1E3ZA 1LOLA 4J3UA 4MLJA 2BNJA 3UG5A 1VYSX 2OWXA 3TWBA 1Q66A 5TBOA 1RA5A 2J77A 4Z0SA 3A3XA 4IWWA 5KZEA 4JN6A 3VDCA 1R3YA 1XYZA 5CSSA 3WD3A 3QTPA 5HJYA 4H19A 1HFBA 3TW9A 1Z7AA 1UOZA 3WJZA 2W91A 1O5KA 1ZY9A 4WSHA 3U7BA 2CW6A 4GRSA 1R7AA 4D71A 3S2NA 1IT7A 1UD3A 3NJ3A 4D6DA 1VBJA 3VKKA 3SGGA 4HNVA 1A47A 2Y61A 4XAYA 2G8ZA 3CL7A 2G95A 1LBFA 5AC4A 3QHNA 4NAEB 1GPWA 2BHUA 4ZQOA 1G4PA 3WLSA 5A2CA 1IT0A 4S2CA 3U5YA 4MF4A 1JZ3A 4RE0A 2X16A 2ALDA 2VOTA 4P8WA 4XBJA 4AISA 2R9RA 3C0LA 3M47A 3F1QA 3N9SA 3DKJA 4X3ZA 3MSYA 4UR7A 1B4KA 1K8YA 1W5MA 4HMCA 2DVUA 3QSTA 4PMYA 4C7GA 2D2GA 4LAUA 1KR0A 3WEOA 1G6CA 4DYJA 3ZR4A 1V3JA 2OJPA 2XINA 2YIHA 1UPPA 3HPFA 4HCHA 4NYUA 1E51A 1S38A 3RJYA 4ZTYA 1LM1A 2A7RA 1M7JA 3UPWA 3W1XA 4HHHA 4AG0A 3S5OA 3H7VA 3T07A 3ENLA 4KWWA 1DJHA 4HIBA 5LXXA 1XX1A 4D8ZA 1E73M 2YCEA 1LUCA 1R9XA 2CLHA 1ZNNA 3B9EA 3QZAA 2DZXA 1N55A 4UCFA 1JCLA 1ZCOA 1TTIA 1TMLA 4OGZA 3TAOA 3I7SA 5DF0A 2B7PA 2VCAA 3VX0A 1AH4A 1H5VA 5AZ0A 1XXXA 3CUGA 3KZSA 3TAKA 2RH9A 4G8TA 3ANVA 1ZBVA 4N02A 1EO7A 2Y89A 5T9CE 3WK1A 3KL5A 4EANA 4IICA 5FJPA 3R25A 3KFTA 2R14A 3KM8A 2XJ7A 5G1TA 4PR4A 1GCYA 1NH6A 1P7TB 3N15A 1TV8A 2OEJA 1FCQA 1VRXA 3GDRA 3BJFA 1C90A 1ZB5A 1ODUA 4NJGA 5CQ1A 1ML1A 3UQNA 2O7SA 2YXXA 1QDSA 5GJMA 1Q8AA 3P0XA 1M04A 1KFKA 1HO1A 2PDNA 2UY3A 1LF1A 1HVQA 3USBA 5AHLA 5EGRA 4MY9A 3G8EA 2A3CA 3EOEA 4IISA 1EC8A 3TYZA 3TTYA 5EFFA 3VPLA 1GQJA 1JPDX 2OCZA 4IPNB 3MHGA 4DBDA 1KKOA 3IPWA 4EWJA 1BYCA 3BLKA 3H2EA 3R94A 4AD2A 1OADA 4S3DA 3MTWA 3OODA 1XLMA 3E02A 1UR4A 4Y9AA 4S3CA 1GOXA 3AALA 3BG3A 3AISA 1EO5A 4KGJA 1C92A 4LQ1A 1ISVA 3N17A 5CEWA 4C1NB 1K7XA 3H24A 3RFAA 3FGCA 4GABA 1SFSA 3WZ0E 4FAMA 4NYYA 4ZODA 2WHMA 4M81A 5D2YA 1OYAA 4XO6A 2YB4A 3QR0A 2PP1A 4NASA 2D2JA 1MUCA 3GC4A 3XIMA 2EQDA 4BQ4A 1V0MA 1FWAC 5MKGA 3ES7A 2BY2A 3SB0A 1Q3NA 3MCOA 3OLDA 2QCFA 4P61A 4Z2KA 4YCOA 2GUYA 4GQRA 3C2YA 4Y7EA 4YWIA 3WIJA 2J79A 2GUUA 1E0UA 4GXPA 4KFPA 4ZSTA 1OWQA 1QJWA 1JCXA 3F4DA 1OD0A 4A3UA 3AFBA 2VVNA 3PK7A 5C2GA 2HNHA 1X6NA 4UQBA 4BQ2A 4YTTA 4F2TA 2QDHA 4ZOCA 3MYOA 1CT5A 2JFEX 4LCRA 4XKMA 4W85A 3QVQA 4DBUA 2V2DA 3N6JA 4AWSA 1NDVA 1GGOA 4JTJA 3V3WA 2OT1A 3W73A 8RUCA 2CCRA 3LRKA 3N4AA 4MB5A 4B4FA 1PCKA 4L61A 1QOQA 3RCYA 5FEWA 1TR9A 3H12A 2NX3A 3ZR5A 3WG6A 1V0LA 2O92A 1F05A 1XHGA 3NEHA 4X60A 4DI9A 3W1RA 4Y8FA 1PHWA 3WDIA 2PA6A 1XIEA 3N29A 3N4FA 4B2DA 3NOYA 4LGXA 3CQIA 4HSOA 2FGLA 2VQTA 1CB7B 1QUMA 4RDZA 1JPKA 2IXUA 2C6QA 3VX1A 5IHSA 3E0IA 1Y5WA 3VFLA 4JTFA 1LBMA 3PPGA 2PDUA 4MB4A 1VFMA 2VFGA 3ARWA 3BDKA 1CTNA 3S2JA 1DP0A 3HMJG 3QOKA 4QAIA 4F9JA 1TX0A 5DEZA 2CLMA 4UR8A 1AW5A 3GNRA 2H9AA 2WXDM 4PUEA 3KVMA 3W7EA 3MANA 1ENUA 4LS1A 1NM9A 4ZBCA 3G3MA 3M64A 3HF3A 3N6QA 3EWBX 1S3HA 2WQDA 3ZLGA 1ISZA 1JI1A 4IQLA 5C0QA 1KM3A 3PZQA 2NQLA 1QFEA 5T26A 1UROA 2E68A 1GTEA 3S2CA 5HPCA 1KFCA 1SFJA 1XIHA 2HQAA 3CL8A 1TE1A 3BG5A 4GNJA 1JUBA 4CEXC 3GTIA 3SURA 1ZBWA 2QJIA 3M44A 4HZ7A 2VTFA 5BW6A 4I9AA 2WAGA 3NO3A 1AJ0A 3RMJA 2P0IA 3S2MA 1UC4A 5BMWA 5LA0A 3FEMA 3HN3A 2BX7A 3FYYA 2PRLA 2XTKA 3J7HA 1VEOA 2GJXA 1AMYA 3LCHA 3GKFA 5DANA 2EPKX 1EA0A 1E72M 1VENA 3TC6A 1K4GA 2V38A 2ATSA 3CZLA 2Z25A 3PTDA 5U7SA 3E38A 4NNCA 1NWTA 2DSVA 3RGTA 1E9LA 1BPLB 3TCSA 1KR1A 3TYUA 4O1AA 1F3WA 1OX4A 3GYEA 2QHAA 1NARA 3UESA 4JTAA 2TYSA 2V5KA 4LSBA 4NUWA 4XZ9A 1XH2A 1QI5A 1RP8A 2C1GA 2VKZG 3R89A 1KXVA 3BLLA 1W3HA 4FSAA 4LFYA 4GY1A 3ABRA 4H2HA 3BZJA 3MZNA 4XUYA 3RNDA 5LNSA 5A8PA 1FWHC 3FS2A 5LHEA 2QULA 4DAFA 2FZ9A 3IUHA 3MB9A 4LW7A 3VOIA 1VAHA 3BGGA 1G5AA 2FKPA 5JXQA 5CZKA 5AYYA 3NQ2A 2ALRA 1C9DA 4F0MA 1N2VA 3AHXA 2A3HA 4FNTA 1YPXA 4MLRA 3ZT7A 4LC6A 1X98A 4WXZA 1NTHA 2DVXA 1XLLA 3N73A 4MNJA 1CXLA 3O6DA 2Z00A 2OWCA 3TP4A 4DJFC 1GYLA 3WNKA 5EB8A 1YXCA 7ODCA 4LNCA 1NVMA 2CFFA 4IGHA 3STGA 1QNPA 1OG6A 4PCPA 1EBGA 1IEQA 1O1ZA 1UZ4A 3AJXA 3RM9A 4W4QA 2BP1A 2QJNA 4X0VA 3OZYA 1FH9A 5HR7A 4BQ5A 5KETA 1PKNA 2AOSA 1KD0A 4GUIA 5A8NA 1DJYA 4MYXA 3FEQA 3FNDA 3ZOAA 1V0KA 3S1UA 3KBVA 1EJXC 1R2SA 4JTUA 3C2EA 4IHCA 4I5RA 4L6OA 3C2RA 2CERA 4WQ6A 2TRSA 1S2UA 1H7XA 4WD0A 1H7OA 5EMKA 8A3HA 4A35A 2O4MA 4JGDA 3II1A 5I3GA 2NWRA 2H3DA 2V3GA 4ERGA 5HNTA 2ZQ0A 2OQLA 1NDZA 3TYCA 4UTMA 1IR2A 4PMUA 3N9RA 2QCCA 4I8YA 3BLEA 1VIWA 4HMNA 4M5PA 3BMWA 3SCPA 4V1XA 2EJAA 3UNDA 1MNSA 1EF2A 4NIRA 3K8MA 4PEEA 2CETA 3IJLA 4CVWA 4HK7A 3C2VA 5KEZA 3DZ1A 1XDJA 1DWGM 1PZ3A 3M16A 3AIRA 4E8GA 1E5JA 3I7RA 1SR0A 2VX4A 1EJSC 2PODA 4IIEA 1YXYA 3SUUA 4AF0A 4H00A 1Q7QA 2PDFA 4B5NA 2F2KA 3HGJA 2O56A 2CKSA 3MSDA 4QR6A 2BY3A 3T55A 2DSWA 3BAIA 1B90A 4ZQNA 2GJNA 1FHUA 1C7TA 1ZCCA 1G7UA 4YCPA 4GG9A 1UQYA 3T0BA 3UG3A 4EPKA 3CAKA 4NX0A 3VCNA 4PUNA 4TV5A 3PG8A 3EZ4A 3OBKA 4JTTA 2CLFA 3GVQA 1PB0A 5AOUA 3UCCA 3WNNA 3LRLA 3L5MA 5BROA 3V35A 1DEDA 2PTYA 1NP2A 1OGSA 4L56A 1DE5A 3U0HA 1E0VA 2VGBA 2VFFA 3P84A 4GI8A 3MVIA 3IANA 1K9TA 3PZTA 3RK8A 2PF0A 3YPIA 5CC5A 1VS1A 1Z44A 3VGEA 5HMSA 1JCNA 3O6CA 1XJBA 1UZ1A 4LUIA 3FJNA 4JD4A 5HWJA 4D6FA 3CUZA 3F4WA 5DRCA 4GH1A 2H8ZA 5D9NA 3UJSA 5CBBA 3SIZA 3AIBA 3T0TA 5K2ZA 3NIYA 4IJRA 2RJHA 4HPXA 2PD9A 5F1VA 2FQIA 1ZQ5A 3MUXA 5ABFA 1F6KA 3WLJA 1VZWA 1EF3A 1MYRA 4UNLA 4BWLA 1WDDA 2PDKA 4DBWA 1ME7A 2E25A 4W8BA 4H9VA 2I5QA 3WNLA 1PE1A 3CV1A 1I1WA 4TX9A 3KOXA 2J24A 3TNOA 1XYLA 1AA1B 4GA8A 2PCEA 3P74A 3SUWA 3N3TA 4PTNA 5FF0A 3ZO9A 4JYDA 3IRSA 1I2PA 1P48A 3GH4A 3M5VA 4NAFB 4YNGA 3IJ6A 3P6LA 3QOMA 5TQLA 3UWVA 3L5AA 4FOUA 1FKWA 4PUUA 2WCAA 3SN0A 2AKMA 3VABA 1WKDA 3VDBA 2PDQA 4V15A 4BA0A 4EP8C 2YOCA 2WHJA 3UWUA 3HPXA 4PCTA 3R8RA 4GI6A 4ZXOA 1UA3A 1A5LC 3G1VA 3GU2A 3QPZA 4KESA 1TYGA 4LY8A 4Q8UA 3P5YA 2PC4A 4MJ2A 3PPCA 1B0IA 2QMJA 1WXJA 1A5AA 4OUIA 3O2LA 2YB1A 2QV5A 2I56A 1KCLA 1W9PA 1Q85A 3GW3A 3IIXA 4FNUA 1O66A 3CMGA 2CLKA 2V0TA 3MA8A 4AF0B 4WSJA 4D1IA 4JTEA 3R2GA 4B4HA 1U33A 1GWJA 3E2SA 1HKJA 3LLXA 4NI3A 3A5VA 3NVTA 3L4ZA 5DX7A 1W9VA 4LBSA 3B8WA 2J74A 3T78A 2Q02A 1QNQA 4WIWA 5I02A 4Q8MA 1S2CA 2BXYA 5G1YA 3VCRA 4CVUA 4J3TA 3M0IA 2CLIA 3WEMA 4UOJA 5HOSA 1A0CA 3EXSA 1B9BA 1U30A 1XKYA 3PZ9A 5HK4A 2A6LA 3THQA 4JTSA 3B97A 2X0HA 2NVCA 1JPIA 5DELA 4OV9A 4O1DA 3THDA 4OTKA 2QCGA 1Q6LA 1I1XA 4GLEA 3N34A 3AIVA 4DELA 4MWAD 1EJRC 3K4WA 3CH0A 5C70A 1YNPA 4WSKA 3BW2A 4NRSA 9RUBA 3MP3A 3UA3A 3OG3A 2E6DA 1V4YA 3UJRA 4JIEA 4PUWA 4AD1A 1Q7MA 2NWSA 2ZWYA 1KBKA 3WQOA 1R9ZA 2DT3A 1TIWA 5F2GA 4AY7A 4J40A 2WVUA 4DLMA 2POTA 3B0XA 3W87A 5LA2A 1E9ZB 1XCFA 1CXEA 2ISDA 3DFSA 1AL8A 4JQ4A 3WJXA 4NT0A 4H7CA 2QF7A 1QPKA 1JDEA 3I3BA 4UTWA 1XCWA 1AVAA 4S39A 3EMCA 1W8SA 2Z2BA 2PLCA 2HXUA 2QCMA 1I2RA 3F2CA 2WM0A 2ATMA 4EPEC 4J27A 4LYKA 1S39A 1EGVA 4EPBC 1R7OA 3LGGA 3UZZA 4RV8A 3HQPA 3RU6A 4O8RA 1WZLA 3HZ3A 4M19A 2W6RA 4YMZA 2C0HA 3FJLA 1Q6EA 2E4TA 3BK0A 1SO4A 2XZ9A 4IX2A 1L6FA 1UWRA 5DRIA 4MPKA 4PRRA 3QJAA 4TOQA 3SSZA 1RPKA 3L7RA 3MBFA 1YE4A 2YFOA 4B3ZA 4RPPA 4MIMA 4Z2HA 3I68A 2VC6A 3A3WA 3M1ZA 1TSIA 3DFQA 4UCGA 1SVDA 3U2OA 3LX9A 1U2YA 3ARVA 3TVAA 1IZJA 4CQCA 4PODA 1XH0A 3GX9A 4S3JA 3TROA 3GNOA 1DKWA 4Z2IA 2IW0A 3IV3A 4WVXA 3N25A 4X9YA 2DPEA 1HGWA 1W5PA 4GFSA 4K38A 3QZEA 2DY3A 2VFIA 3ALFA 2WSRA 3AHYA 2FVMA 4Y2WA 3T0DA 3LK6A 3W6LA 2PBGA 5HXMA 1GOQA 2J6XA 3VTRA 3OHIA 1FCBA 4DJEC 1N7KA 1E0WA 1TPB1 4LBRA 1L6WA 4OT7A 1BVNP 4ZO7A 4WHBA 4DZAA 1A49A 4HNLA 1ZALA 5CLWA 4O12A 3ZMRA 1Y7VA 1X6UA 1IZKA 4BZYA 2BS9A 2UY2A 1OABA 4DUXA 5AYXA 3CHFA 1EOKA 4IUOA 3DIPA 3BURA 1KTNA 2WYSA 3OJGA 3VZXA 3BGAA 4UTTA 1HL9A 1O7AA 4AMCA 2CEQA 1TCMA 4MADA 1XSKA 5FEXA 4ZOAA 1TRDA 3QV7A 1EPXA 4HHLA 3PBVA 5D03A 1Q65A 1E4MM 4HU4A 3I3EA 1KXQA 3SCQA 5ECUA 4UMAA 3LMZA 3TJLA 3N2XA 4PUMA 1BG9A 3FDKA 3LENA 1KV8A 1QNOA 3NXFA 1J11A 2F38A 4U10A 3PNZA 3KOZA 4N42A 1QTWA 7CGTA 1IXOA 1XGDA 1JYNA 2IS7A 4PRTA 2WVVA 5CJ5A 1VFLA 2ICSA 3DU0A 1RR2A 4AWUA 3VOFA 1V6YA 1CGTA 3GU9A 4P8XA 4FF5A 3OP2A 3U8GA 3MSGA 4KCWA 1ADOA 1MI3A 4MYAA 3VU2A 4DUVA 1IE7C 1F73A 3MDUA 4CQAA 4LBUA 1NOUA 1H62A 3GO2A 2VZUA 1G4EA 1RCXB 3BC9A 4MKSA 5E9XA 4QTGA 5HUOA 4LH8A 4IXXA 2R1PA 5AHFA 4D2JA 5DMLA 3G1SA 4PTVA 4LUYA 1C91A 4O4VA 1XI3A 3PP7A 4N9BA 4CD6A 3ONCA 2JQXA 3RO8A 4QDWA 4NQ1A 3HJZA 4JTCA 3HG5A 2PCQA 4YVXA 2ZADA 4JBRA 3RR1A 3ARPA 2Y7DA 1QI0A 1UWSA 7REQB 1FBAA 3SCRA 4J3SA 4E38A 3E5PA 2VENA 4GC4A 2Q8LA 2BGSA 3AICA 3IGUA 1J79A 2GGJA 1V3HA 3UGVA 4XV0A 1VFUA 2Q3OA 1S5NA 4QIUA 3G6MA 1V6VA 3NZPA 3MI6A 5CC6A 1CW2A 1US3A 2V67A 3LPPA 4US5D 2WMJA 3O0KA 1V02A 1OEPA 3CWHA 3PUEA 2VCCA 1KNWA 2HBXA 4XK2A 2ZX9A 4UIOA 4XG1A 5CH9A 2CWNA 3CIWA 2V63A 3EPMA 5AZ1A 3M0ZA 2XH4A 5IBXA 3CHDA 3DBNA 3S9YA 4IF2A 1IR1A 1MW2A 1B3ZA 1PS9A 1P1MA 3KDNA 4M6UA 1GJPA 5A6MA 1TPEA 2E40A 1PDYA 2OFJA 2PTXA 4I3GA 4F4RA 1AODA 4XD5A 1H7WA 2QYGA 2PFHA 4IJBA 4I7VA 7PTDA 1RBLA 4FIQA 1U5HA 4HCDA 4K6AA 2GDUA 1DE6A 4DO5A 1FWWA 1QATA 4Q6JA 2IXVA 1I9CB 5K7JA 3QSRA 2Q8XA 2DJLA 3AU2A 3CHCA 2OYKA 5J04A 2QCDB 3EOOA 5D38A 3ZJ8A 4KFNA 3P7YA 3E12A 2WSQA 4NNAA 4PCNA 2VRKA 2OWWA 1EP1A 1H7RA 4X2PA 2YXGA 3QC0A 2DQXA 1M03A 4BI6A 1UKTA 5LZLA 4E0CA 3OZOA 2DT1A 5DCEA 5I3KA 1UWUA 1GZ1A 5FJIA 5BU6A 3PANA 4W5UA 3U2EA 2HS6A 3P61A 1KLZA 1J0KA 3TFXA 4WDUA 4NI8A 3K1DA 3W23A 1SW7A 4O53A 2XIQA 3OVQA 3AMCA 4F79A 4DWSB 3ZJ6A 1ISYA 1OC7A 1QW8A 5HMEA 1IXPA 2A4AA 2PDXA 4MWAE 4Q22A 3F5KA 3AZTA 3L2LA 3BSMA 4O18A 1UA7A 3L4YA 3LQGA 5F4SA 1MQRA 2PGRA 2J47A 1JYXA 5BRQA 5FF2A 2P88A 5C7VA 2VZSA 2GQ3A 2XH2A 3KLKA 3ZIZA 3LY0A 3IVUA 1YX1A 1GYNA 2QNEA 1K9FA 1OHLA 3NM1A 3IV8A 4G2DA 3UU0A 2XIIA 1IV8A 3QHMA 1C7SA 3DFPA 3VAVA 1ZRQA 2HSAA 2NQHA 3KLLA 1W1A1 5A2AA 1OX6A 4MDPA 3F5LA 1RQEA 2CITA 4ORIA 2C91A 1TPFA 1MZHA 5AVHA 1W1B1 3NSXA 1GONA 1WNOA 3SDOA 1CXHA 4FOKA 1AJZA 1JF6A 3VOHA 3EA3A 4UTKA 1BKSA 4FR6A 2XVKA 3AAMA 5HDRA 3AXHA 4F66A 1RLDA 3QV8A 4ATWA 1VHNA 4S3EA 4Z08A 5LHFA 2YDRA 4K39A 3UZWA 4XZHA 2MNRA 1I2QA 1NWUA 1GVFA 2J9XA 4MY1A 3CL6A 3F4NA 3DG6A 3OO2A 1BQGA 1LWHA 1I8JA 1TQJA 1WB0A 2XM1A 3I3DA 4LX4A 3R8HA 5ABGA 4H6KA 4ZGYA 2E9LA 1G69A 1A53A 2ISVA 3VFCA 5HINA 1Z8AA 3BZGA 3KDOA 3TN6A 4QDMA 3QKEA 4UQCA 2P8CA 4WLCA 1XIJA 4B9YA 3S5SA 4ZOEA 4WGHA 4DY1A 5I0DA 5FEPA 3SCOA 4QM1A 4TMBA 1QI2A 4TUFA 4Y96A 4DF0A 1RSCA 1TWSA 3P8IA 3GB6A 3ZFHA 5A8OA 2DZWA 3H55A 4AMAA 2HNEA 4S3KA 3TR9A 3CZ8A 2X2YA 3H22A 5HNUA 4MG4A 2OZ8A 5C9ZA 2HJPA 3NQ6A 5I23A 2YW4A 2W92A 3B8TA 3UJEA 5I78A 3NSMA 3QN3A 3NL2A 3ARSA 3MSRA 4JOMA 1DWFM 3DI0A 4Q4KA 4J3ZA 5EU9A 1BRLA 2XN2A 1MMFA 4RK8A 3VILA 3CLWA 4IIGA 3ZS4A 1A3HA 2Y4SA 1PV8A 2PLMA 2PWHA 4MWAC 3STPA 3FX4A 1XISA 1LZOA 1ITXA 4LYRA 4W93A 1FCVA 2ZVIA 4RNJA 4IFRA 1QPRA 2NV9A 1H51A 1XLGA 3NR0A 4LS2A 3L67A 4XAFA 3NQBA 1XL9A 1Q8JA 3T05A 1W6TA 3S1GA 1WKFA 2YPIA 4EPDC 3DFHA 1V6WA 1MFVA 1X1ZA 4IIBA 5A2BA 2F7FA 4HVXA 4AY8A 3O05A 1CXKA 1RALA 4GINA 1FTXA 3IJ9A 1OGGA 3IJ7A 3W7GA 3KZPA 3RRAA 5D05A 1DJXA 2E5BA 1L2QA 4QQ3A 4PTMA 4W7VA 3B3DA 3WD0A 1JR1A 3EDKA 4TX8A 4QNWA 1XINA 1QW9A 3UCDA 3K1GA 3FHAA 1UR3M 1B3WA 2ACRA 4ZFCA 3HOJA 1TZ9A 3W7KA 3CZGA 1Z9AA 2DUXA 5EBUA 3IJ8A 4PZVA 5A6AA 3RPMA 1E56A 1H63A 3LTPA 2X0SA 3EMZA 1CGVA 3DFOA 3H7UA 3CZJA 3PHAA 5FF4A 2IUZA 1EZ2A 3DXIA 3ZT5A 4TR9A 2OSWA 2AL1A 3ARQA 1H41A 1KBBA 2QCEA 4H6EA 1R3TA 3UNTA 3KS5A 1JGMA 3PUGA 1NWSA 2VXNA 1WPCA 3UG4A 2GVGA 5REQB 1QNVA 3MHUA 3FK4A 3AJ7A 2Z4GA 4MFDA 3TN4A 3I65A 2WVSA 4E6MA 3BQ5A 1VFOA 5B80A 1UD4A 1B54A 4OUEA 3VD5A 1KGXA 3FHQA 4YYCA 3PBMA 3AMDA 4GH3A 3AIQA 3PN8A 2O4QA 2V3DA 4OBRA 1HUVA 4HK5A 1XCXA 5K4XA 2VI0A 4QJ5B 2C1IA 1XDLA 3W7IA 1GKRA 3S46A 3N2TA 1Z32X 1MUWA 1SJCA 3WDQA 4CD7A 3PUDA 1PCWA 2VFDA 4FNPA 3W1LA 2OGYA 2VEPA 3G0XA 2C8NA 1EHNA 1WUFA 1OK4A 5A8GA 2F84A 1PBGA 1XYBA 3HJEA 2X7VA 3PR2A 2DZAA 3BQ6A 4LCSA 3A3HA 1AD4A 3C52A 4R85A 4KGLA 2GQ9A 4N6EA 1E6XM 5FD0A 3TTEA 3O1NA 4GO8A 1T8XA 3UZ5A 4BEUA 2G5WA 4JY8A 3WQPA 1OQFA 1WOBA 4JL1A 1X97A 1UWQA 1UD2A 3N14A 2EPHA 2H3BA 3L21A 4WOQA 1EWEA 5D8WA 3ABSA 1JDDA 3ITOA 1JZ4A 2RUSA 1UKSA 4TV6A 3CU2A 3NAVA 1CYGA 3JU2A 4FOJA 1SSDA 5CPQA 2ZIDA 5IRPA 3MUAA 1XG3A 2XVPA 2DSZA 3V0UA 1Q4WA 1O5RA 3AS1A 1D2KA 4X9SA 3FDGA 3W7JA 4QS5A 1Z6KA 4PULA 3D5HA 1W54A 1HL2A 3I7QA 3IACA 1SUXA 4QGCA 1GHSA 1OCNA 1EPVA 3UD6A 3PG9A 3WSUA 2GVLA 6XIMA 3LM7A 4F0HA 4UFIA 2CHOA 1EEPA 2C15A 5AB3A 2RDUA 1M9HA 1P4CA 4RLIA 2EEXA 3REQB 3W9ZA 1W1IE 5JIWA 2CPUA 4MTVA 4M3PA 4LAMA 4JQ3A 4EF8A 3T4CA 2VEIA 1W31A 4IQEA 3IWPA 2YLLA 5F2LA 1BXNA 2J88A 4BI5A 4GYPC 4C6CA 1UBPC 2NX1A 1LDCA 2XFWA 4LWWA 3N13A 2WOQA 3A23A 5A69A 3G6LA 5LIXX 4J2MA 3ABOA 1VC4A 1G7VA 1CEOA 2NSXA 1H09A 3MU7A 1PZ1A 4WGXA 2ZYFA 4LUJA 2HRWA 4TVCA 3VIOA 3E1F1 1JQXA 4PFMA 4B92A 3VCCA 4D6IA 4HPHA 3GBDA 4GBUA 1T99A 4K36A 3WH8A 2YCLA 2HVNA 1L6SA 4HA0A 2E1DA 4H4IA 4WUIA 4UOZA 3LB0A 1REQB 2P1FA 1A5MC 4XSMA 3R79A 3CMJA 4FXRA 3D47A 4S2BA 4IP5A 1C29A 3D6NA 3SN4A 4PCFA 2WMIB 2FVLA 3EDFA 3NPVA 3L66A 4DM1A 2Q71A 1EFZA 1H5YA 4B91A 5K9XA 2BHYA 2DVTA 5TNVA 1GEQA 3RX4A 3VXGA 2PU1A 1VBHA 1RVKA 2W67A 5CGQA 2NX9A 5D2XA 3TLQA 3OTRA 5K9CA 2QIWA 3VNZA 3GNPA 2YSWA 1EA9C 4GCAA 4HU3A 1JULA 1ZL1A 4U3CA 3V7PA 2X42A 3TK7A 1VPXA 2JGYA 3KE0A 3A4JA 3B03A 4HPGA 2ZRUA 5F2IA 1ZJIA 3ONBA 1CPUA 2X41A 4AHPA 1NU5A 3APGA 3TTSA 2ZUVA 3VDAA 3UA4A 1ZU8A 4H8NA 9CGTA 1JEZA 3AZSA 1DYSA 2ASHA 1Q6RA 4XB3A 1OFDA 1B3OA 4PBGA 4ZB5A 3VNKA 1XRTA 3TYBA 3B8DA 3SCVA 3GR4A 1UKOA 1P0NA 1QWGA 3QR3A 4QJ4B 2J7DA 1XPYA 5J5RA 1W3JA 4Q8VA 2YL9A 2PMQA 4IGSA 4AWTA 4AEEA 4JXCA 4L6DA 5CGMA 1GVOA 4O50A 3QGKC 3M4HA 3NL6A 1TFVA 1QMLA 1MEWA 5LGZA 5G4EA 4CD8A 4XD6A 4JHMA 1E6RA 3VNMA 1KM6A 3V18A 4IX0A 1OD8A 5M5DA 2OLHA 4IIHA 4E3TA 1YDVA 3M0XA 4V27A 2WWDA 1P1XA 4CNNA 3UR7A 1B3VA 1J8VA 2HK1A 1VEMA 3PJUA 3QQ1A 4O0QA 2PWEA 2KZHA 1GZJA 1MRQA 4DO6A 1DQXA 4C6NA 2IQ0A 3INPA 1HKVA 3S42A 3M6DA 4ML4A 4Q4SA 4QE1A 3EX1A 4HA3A 3PWAA 3RYSA 2BVDA 3S1XA 4Y9PA 3CUHA 3SUTA 4AD3A 1MEIA 3WNOA 1OFAA 3WDPP 1JFXA 4P7OA 4CNOA 4KRTA 4REQA 4QJ3B 2B81A 3CB8A 2XGZA 1IHIA 1A4LA 3R13A 4HD5A 3O6YX 5GJPA 3HMCA 4M80A 4QSHA 2Y2WA 1JNDA 4FXJA 2MANA 1LQ0A 3CPRA 4RDYA 8XIMA 3WJYA 2HDJA 3ITCA 5J8LA 4BKNA 3CQ0A 2V68A 2E67A 3M5ZA 4TVUA 1X7IA 2ZZ4A 2ZRVA 3UXKA 1Z41A 4XSLA 3HQNA 4YYFA 2DDXA 1ZJAA 1PHQA 3GLCA 4OZOA 4DPPA 1VFFA 3ZLFA 1GOWA 3VE7A 3WLNA 4GQGA 3SM0A 3WLPA 3QF0A 1B31A 4ZE5A 3UPBA 1Z69A 2V30A 5FOOA 1YRRA 2ZICA 4KT2A 1U83A 3WMLA 5KINA 2ACUA 1A5BA 4WDTA 4C6MA 4GACA 3ABZA 4JTLA 1VBUA 5DXXA 3E5BA 3DOPA 3GQYA 3PB2A 4ZO8A 2D2OA 1OZMA 2RKXA 2F6KA 3DGRA 2V82A 2J62A 1W3IA 3BJSA 3BSHA 3RX3A 4BHYA 3ITVA 3VNLA 3ZSTA 1J2BA 4NG3A 3FA4A 3NZGA 5LIWX 4RL3A 1QO2A 4DUOA 2VEGA 1VJIA 5FJUA 3WBWA 4AZ7A 2Z24A 1SZRA 2NXGA 2EG6A 3JR2A 1LRTA 3UR2A 4QROA 2GDVA 5LSMA 3USZA 1GVEA 3IVTA 5BNKA 4P7NA 5ABTA 1J0IA 4GI9A 5KITA 4ZVJA 5JMUA 3UXLA 5A6BD 2ZXBA 2VO5A 1F3TA 3M9YA 1KM4A 1TTJA 4C60A 4N0RA 2RDTA 1W32A 1Y8BA 4KWUA 4WDWA 4HBKA 5HA7A 1DORA 3KBNA 1HP4A 1BYBA 2G4FA 4IFOA 1Q6QA 3CZKA 2VGGA 3N12A 4ML9A 3WKZA 2VWTA 2PZNA 5BZAA 1KBLA 1TPDA 4FXFA 2H90A 4C6JA 1YBQA 3V5FA 5AHNA 1K03A 1TELA 3TOYA 1W5NA 4JIQA 3EWYA 3KAOA 2OO0A 4NRRA 3ZZ1A 1KQYA 4AZCA 3RIKA 4CU8A 4JX4A 3KTSA 4LB3A 4LUSB 2VT0A 1BQCA 2DEPA 1OYBA 3V5OA 3P81A 3FJ6A 1Q2RA 4IMGA 4TMCA 5CAKA 4P7LA 4Q8OA 4HMEA 1O60A 2TODA 4EACA 4JCLA 1UD5A 3IIZA 3BV7A 4GKLA 4ZQRA 2XIJA 4BF7A 3M41A 3EEGA 1OC5A 2BB0A 1R30A 4AD4A 1ITCA 3VNIA 3W37A 4FHAA 2FH6A 4CQ8A 3WUBA 3APTA 1CGYA 1AZ2A 2EG7A 4HJWA 7XIMA 2BFGA 1P6WA 4MNLA 3B8SA 3WLOA 2GSEA 4R53A 3M0KA 3KVLA 2XISA 4G9PA 4UZSA 3RAOA 5IFTA 2EGZA 1EIXA 4DN1A 3DN5A 2P3EA 2YBTA 3W0KA 4HYWA 4L9YA 1SU5A 1BEUA 4Q3MA 4XIMA 3ABXA 3EWUA 3WF1A 3PWIA 3PBGA 4X61A 4DHGA 3W7DA 4MZYA 3LUTA 1XC4A 2B7QA 4BCEA 4QE4A 5F4XA 2F8QA 1KC7A 2OZTA 1T41A 3OBEA 2V81A 1US2A 3W26A 4O13A 3BG9A 4X22A 3BW4A 3K13A 4KFOA 4AUBA 1SFTA 3DG7A 3TZNA 2VDHA 1MFUA 3EWWA 1SSGA 3L4TA 2O9OA 2WHLA 1UR0A 4OBTA 2DZTA 1GKQA 1GG1A 1W37A 2XG9A 1E15A 3ATYA 3IUIA 3H2OA 7TIMA 4TIMA 3ANYA 4S1FA 1OYCA 4NX5A 4GUFA 3N3MA 3SECA 1OVDA 1KM2A 1TZZA 2ZZ6A 3TMLA 4HOWA 2FLIA 2Y6ZA 4DJFA 1XLDA 3AXKA 2WC4A 2YCKX 3P80A 3UPMA 4XVDA 1V6TA 4RZ5A 4ATLA 3KUMA 2HVMA 1YMYA 2E9BA 1YBQB 1NFGA 5D32A 5HBFA 3TYDA 5ABEA 1HO4A 2C18A 3VUSA 2I17A 3DESA 3NNTA 3AUJA 3CIVA 3DFNA 3PFRA 4DB7A 4AZCB 4FNQA 1YDYA 5CXPA 4P5UA 3ITLA 1LP6A 4AZBA 3LMYA 4ZENA 2ZZ2A 3RLVA 2A3LA 4G56A 3SEPA 1JDFA 3BAXA 4XZBA 1OT1A 4XAZA 1XF0A 5HQMA 1T0OA 3H53A 3LERA 1QCWA 4RE4A 2V5LA 3MUIA 1GVSA 3VYLA 5F4WA 1PX3A 5T8GA 1XLEA 2A7PA 2KAUC 1W5QA 2DGAA 4J28A 1OGBA 3EXRA 4HA4A 4PMNA 1BF6A 3AROA 3THCA 3CV7A 4FO4A 3VZZA 3ZWSA 2VZVA 2J8FA 1RH9A 4K8EA 3WF2A 2VCBA 3AWNA 5AC8A 3RX2A 2OEMA 3DENA 1NEYA 1CI1A 1OIMA 3PAOA 3TYAA 5HNNA 1L6GA 2OZ3A 3FA5A 1ZBCA 3CEUA 1G4SA 3PPHA 1XS2A 4RXGA 4O10A 5I06A 4JDYA 3BOXA 2Y85A 1KM0A 3W86A 1OFBA 5FJTA 2FDMA 5CLTA 4ZB0A 1JZ2A 3ELFA 4QXIA 3CH9A 2Q3RA 1XWYA 1GKPA 3C61A 1QK2A 1TWIA 2F2HA 3VIHA 1LTDA 3EA1A 2BGQA 2VM8A 2Y5JA 3WENA 2BG5A 4R34A 1EWDA 1LL6A 3B0PA 3NZ1A 1XFCA 2HS8A 1BXBA 1RP9A 2FZBA 3T0AA 4PSRA 1CGXA 3S6TA 1JCMP 1XIIA 3LU2A 2HCVA 2OKTA 4PGLA 2Z7GA 1J5SA 3TYEA 4UFMA 3I6RA 3FA3A 5H8UA 2YLAA 4QSFA 4EWND 2GZXA 4GZEA 4KH2A 1K7FA 3LCXA 4IMEA 4UC5A 2VEFA 1H61A 1DQWA 4L6HA 4NXKA 4MJMA 3H6OA 1K1DA 4MZ1A 4FIRA 1PWMA 2ISFA 3FKKA 4B5UA 2TSYA 4D6CA 5TIMA 4TQTA 4ALDA 1BAGA 4C1KA 3NQ7A 2PDMA 3WLIA 4WEVX 1VB9A 1LWJA 2ZA3A 4A3QA 5DBUA 2XM2A 4M0XA 3CWNA 2PC8A 1ZUAX 5T9BG 4DEFA 3GY1A 1CLKA 2NXIA 1XLBA 1J0JA 1GQIA 2J25A 3WNMA 1OINA 1DXFA 3FYPA 2F6UA 2V2HA 3TA9A 3MBDA 3Q58A 1R86A 4Y8EA 1AJ2A 2J8GA 2RAGA 4K37A 3KTXA 4G6CA 1WP6A 1PKYA 3AYSA 4HGXA 5DCDA 3GIPA 1ICPA 3PUOA 1SR9A 5A6SA 3L4WA 5JBFA 4A8RA 4GI4A 1S5WA 4JTRA 2BASA 2OSYA 1K8XA 3W2NA 3O06A 3F5JA 2FTWA 4DXXA 4OHQA 4AD5A 3ARYA 4KEMA 3HO8A 4LNYA 2D23A 3NCOA 6ENLA 4GNKB 3T6CA 3RU8X 4MGGA 3NXLA 4IG2B 1N8WA 5BXTA 3MY9A 1J5TA 2NUWA 3S5YA 5LA1A 1TPWA 3PY2A 4Q4MA 3A21A 5E6YA 5GVJA 3LEPA 1B4EA 2VX6A 5A5WA 3TTQA 1UC5A 1H49A 1IEVA 1P0EA 5DY3A 2GLKA 2VC5A 4MVAA 4CD4A 4JTIA 1UJPA 5I3DA 2HZGA 4TTGA 2VZTA 2Q6ZA 1JGIA 5CAHA 3WO8A 3U6WA 4QCEA 3ARXA 3M7WA 1IIGA 3CUIA 2WMGA 5LIYX 1KFLA 1DXIA 2Z2AA 4XKYB 3TXVA 1CDGA 2BY0A 2PSNA 3LCWA 3QQ0A 4GYKA 3HGOA 4UWMA 3SY1A 2BBFA 2IKJA 4UTIA 1D3GA 1E71M 4M24A 1BGGA 3P67A 3ZSSA 4GNVA 3N19B 1E6NA 3BOFA 5E93A 1NQKA 4D8LA 1KXHA 3XINA 4B90A 1JCTA 2REQB 1UWIA 4D9PA 2CBIA 1TA3A 1NFPA 3F4VA 2E77A 2EPMX 4DJDD 1A4MA 2V9DA 4YHGA 5CG0A 4BQ3A 3DH7A 1WZAA 2D22A 1B5TA 3SAZA 5AYIA 2BZNA 5DO8A 3TR2A 3B9DA 2NQJA 3THUA 1PZ0A 2GUBA 5DMNA 2WC7A 3WQ6A 2WQPA 5BRBA 1F4AA 3R0KA 4KKXA 4C6IA 4O17A 2J7FA 1E55A 3A24A 4KF1A 4LJ3A 1U5VA 4QE5A 4H9YA 5BYWA 2VX7A 4H2CA 3ID7A 2DT0A 4K8HA 2GJLA 1YQ2A 4UTHA 3QW3A 3W01A 2I16A 2PTDA 1AMKA 3M0VA 3GM8A 1PYMA 1WKEA 3V36A 1J6OA 3A4XA 3CAWA 3UG8A 2BTMA 1RQBA 2PLKA 3NZQA 3OLGA 3P14A 4ZQCA 4W7UA 3QGAC 5RUBA 4J5NA 2Z1BA 2E6FA 1Q2SA 2PDPA 7TAAA 3KEHA 3OYZA 2ISSA 1VYPX 4JQAA 3GIQA 3N04A 2QDEA 3LV6A 1FWGC 4UOQA 4ACYA 5I09A 1WOAA 2X1IA 4I9TA 4HTBA 2HBVA 4XD4A 2JEPA 3N2CA 3FCPA 3PZOA 4J7RA 3WUFA 3RF9A 1VYRA 4WDXA 5DFAA 1G94A 2XYLA 4UFLA 4XISA 2J7CA 1XPGA 1HVXA 4HT3A 3RHGA 4ONVA 1C9WA 3NG3A 3B0VC 1I4NA 5F1UA 3CNYA 5BRPA 1H7NA 2XHYA 5C9RA 4KMQA 3QY8A 1X1NA 4YJ5A 5CJMA 2AAAA 4LVGA 3WMSA 3U2CA 1NJJA 3VKBA 3OZMA 3W29A 3WEZA 1GPFA 2ESCA 4IFKB 3KHDA 4HSNA 2P10A 1FHVA 4W9TA 5I6SA 3U4FA 1FDZA 5AECA 5JVLA 3KWSA 3MYPA 4DJEA 2ACQA 2GOUA 3HBLA 1V6UA 2DH2A 1OC6A 2PRMA 5D8ZA 3WQDA 1LG1A 4JHZA 1NAL1 1U1JA 1AH3A 3FV9A 3IRDA 2YX0A 1JRCA 2W0UA 5SWUA 1ODZA 2CIPA 2WKLA 4EE9A 2HROA 2Z29A 5C6MA 3ZVHA 2ONEA 4KCUA 3KWXA 3GIYA 3I4EA 2XN1A 1R47A 3OGRA 1B57A 5E1QA 4W8AA 3P93A 5HPOA 1JCYA 3CM4A 3C8NA 1IQ8A 4GUJA 2X1RA 2WKGA 3KCLA 4D6JA 3I10A 2JBMA 2FZ8A 2PGFA 1N82A 5KZMA 4GXMA 1HKWA 1QVBA 1S2VA 3HG2A 3SCWA 1JZ6A 4C7DA 3B9OA 1X96A 4GVHA 2PWVA 3TH6A 3HGRA 2ZZ7A 2ZX6A 4U2ZA 3WUGA 3BL3A 1VD6A 1E1CA 3IIOA 4PMDA 2FFIA 4ZMGA 4DO7A 1UD8A 5EMMA 3FW6A 4ZR8A 3GUGA 1FQ0A 3O07A 5I24A 4N4QA 3VC6A 2B31A 4RV3A 4GVGA 4YU1A 4KRUA 1LQ2A 3LD5A 4NXSA 4PMZA 1H11A 4AH7A 4WR3A 1K4HA 3EEZA 4B5TA 4RZ6A 1EQPA 1O94A 2HK0A 4JEJA 3L4VA 5IXEA 1O5QA 4ACZA 2BWGA 2NVDA 4G7EA 3W70A 1NELA 5E0KA 5E0FA 3WL1A 3QMSA 1MWOA 3KCJA 1JZ5A 1OSEA 5HAOA 2VD9A 3T4WA 3P3BA 3P82A 5BOEA 5LXEA 2AQWA 1LUCB 2XWEA 2OELA 3CEPA 4GQQA 2HISA 2D3LA 2C16A 3OQEA 4IZGA 3T81A 1AW1A 2XVLA 4BF9A 2DSKA 2G3FA 1PAMA 3WH5A 1VH7A 3TQ0A 2BLEA 1KKRA 1KCZA 3WLKX 2YGYA 4KWSA 3RO6A 2OT0A 1JCJA 4UNKA 1XFBA 7A3HA 4HQVA 3BCFA 2BMBA 2CLLA 4HNUA 3RN6A 2NW0A 4M6QA 3UVIA 2PWUA 3ARRA 4LY4A 4OOUA 2PGEA 4IH3A 1PO9A 1RAKA 3EOSA 3WQ5A 3SIMA 1Q45A 1XC6A 3SZ8A 4IJCA 1SZFA 3WY1A 5A6KA 4Y9MA 1ONWA 1M3UA 1EJ7L 1KTCA 2G37A 1OF8A 1TWZA 2ZZ1A 2I5GA 2PD5A 2WZTA 1VF8A 1SJAA 3BTNA 5B7YA 4HZMA 4UQAA 3DG3A 2QT3A 4QISA 2OOGA 4FNRA 5DXYA 3TN5A 5JUVA 3A12A 2TAAA 1DJWA 4DWSC 4DJED 4M7TA 1ZZMA 5GNXA 2CXEA 3P60A 3NVDA 3BE7A 1LL4A 4X2RA 2QUNA 5TF0A 2JF6A 3CTTA 4A4AA 2DIKA 3T8LA 2FGZA 4YN5A 3R43A 3I6EA 2CYGA 2E8YA 3GHRA 1OB0A 2WNQA 3FGCB 4RNIA 3C4UA 3SRHA 1JQVA 3LXAA 1TRIA 3VUPA 1ZJHA 4UBPC 2QUVA 1W1TA 3WX7A 4PSPA 3N4EA 1K8ZA 2QUTA 3W7CA 1E1CB 3D0CA 3CAVA 2FHCA 3WQFA 2JE8A 1SZEA 5MKGB 3C86A 4IOTA 3NQMA 5C9WA 3IAPA 4Z42C 3PNUA 3NM3A 5D2TA 3BXWA 4HHPA 2C7FA 4GVIA 1K7EA 4E4UA 1AG1O 1YPFA 1HXJA 3B8IA 3NQ8A 3STEA 2VR4A 1Q13A 2PF8A 5I3FA 4PL1A 4H1ZA 3Q67A 2PDYA 5K3VA 1YEYA 1X8CA 2HE8A 2VRJA 2A1YA 3EXTA 3OGVA 2GFTA 4CLMA 1NP0A 2QDGA 1PVNA 3RLHA 3WFLA 3AMLA 5HWNA 3OU8A 1J0ZA 4Q8NA 2WPGA 1ONEA 5G2WA 2Y88A 1FXPA 3G1AA 4FLRA 3BAWA 1FWNA 1EXBA 4OQVA 3GK0A 1DIOA 3WDHA 1VHCA 5HR6A 3LLDA 4Q4RA 4HOXA 5DMMA 1LL7A 3GDTA 1HT6A 5LKYA 4NHVA 3V75A 3A4AA 1XLFA 3EKGA 4J3XA 1YHTA 3W81A 5DCBA 3K5XA 5AKQA 1VR6A 3ANUA 1DTUA 2WBKA 3KCOA 1EDTA 4HJFA 1HW6A 3ORWA 3DHUA 2J9YA 4CKQA 2A79A 3BAYA 1DXEA 3VNDA 3M07A 1JZ8A 1CXFA 1TV3A 4IQDA 2HPIA 1KXTA 3HPAA 4Q32A 4H9UA 4Z1CA 1A5NC 4JX5A 1XUUA 1KA9F 1VJZA 2QVHA 2FVKA 3HV9A 1MEHA 1MNZA 4ECLA 2H9AB 5EMJA 3GAYA 4MY8A 1OJXA 2ZFAA 1K3UA 1KRBC 4OIFA 3GKAA 2FJKA 2OPJA 1I2OA 1IT8A 4LVFA 3EPNA 3TDFA 3PZGA 5H1WA 4DBEA 1A50A 3NYDA 4PCSA 5JBEA 4Q7BA 1S1PA 4Q7NA 3KOWA 1JDAA 4OECA 4CGTA 2NQ5A 3H2MA 3WLLA 2OR2A 2X30A 5AY7A 2QPSA 3BSGA 1BYDA 4WKFA 1MDRA 4EKJA 3L5LA 4C7FA 3UZYA 1OIFA 1AQHA 2DUAA 3GC2A 8XIAA 2WC3A 1W2VA 2R8WA 3C3NA 3KOYA 4ADSA 3AYRA 4LUTA 4NSBA 2Z27A 3BLIA 4PUKA 2NUYA 3DAQA 4G1NA 4JZ5A 2J7GA 2I1OA 4XQ6A 2ZUMA 3ALGA 5HJXA 4IIFA 5AHMA 4AIUA 1TX2A 4J1OA 2GJXB 4TO8A 4AAJA 1JAEA 1UP3A 1XYCA 1XLAA 4K68A 3SO7A 2ZWZA 1DVJA 2QIIA 3CPGA 2ZX7A 1JYWA 1JPMA 4HNNA 3GUWA 1H60A 4MNMA 5C2XA 3LXBA 1OX4B 1FHDA 2WO5A 3TJXA 1CLXA 4NILA 4P2VA 2XH7A 1SQ7A 1PZ2A 3VI2A 3WELA 1DWHM 3WLMA 1LRQA 4C6EA 3AZRA 4QG9A 1D7FA 2YZRA 5AYZA 4XZNX 4MWAA 3C3UA 3ZYZA 2VDIA 4UB9A 3LHYA 2ZX5A 1FDYA 4PB3A 5K4ZA 3WDRA 2WW5A 3W7RA 4QFUA 1XQKA 4DJDC 4ZE4A 5DLCA 5EBAA 4HYVA 4Z2LA 3W84A 2WLYA 1ADDA 1ZSXA 2CU0A 4WX2A 1PYFA 1ZP3A 1FOBA 1IWAA 4MM1A 5JQ9A 2FZMA 1Z89A 2ZRXA 1CX9A 3PBUA 4IPJA 2YBVA 2Z26A 4DXVA 1X1OA 4JKMA 5C71A 4PBEA 1J96A 2JKAA 4KEZA 4BK9A 1VGAA 4ZQMA 2CKRA 4PUJA 1J9YA 4CN1A 3TONA 3NYZA 4JEQA 5DT7A 4UQ9A 1M5WA 5GNZA 1W9DM 3JRKA 2Z1XA 1KM1A 1KRMA 2QCLA 3CUFA 1ZAIA 2OGJA 3LHZA 1F6YA 2OQYA 5JBDA 2DSUA 2DZVA 3TC3A 4H9TA 2IKGA 1WKYA 3LCLA 3W7PA 2D0GA 3LXCA 4DF1A 3HQ1A 2EF9A 3BAKA 1K70A 3WN6A 2OXNA 5CZJA 1XLIA 3GS6A 1TZ7A 2O9TA 3DYMA 2J75A 6REQA 3PFMA 1UYQA 3A47A 4W84A 4CNUA 1U5JA 3GRIA 4O1EA 2OSXA 1GVQA 1YPIA 1RY8A 1YW1A 3BO9A 3T0CA 3IJQA 1XD0A 3W83A 2VURA 3SW6A 2V6AA 1RUSA 3Q65A 2L5HA 2PLJA 4OKDA 4TVDA 5HQEA 1JG9A 3VIPA 3MJYA 1U1UA 3F4CA 1IEXA 4Y9OA 3TSMA 1JFHA 2C14A 1VFTA 1V79A 4NJKA 3RG6A 2GGHA 4P7QA 1LBLA 1R2RA 3F7JA 4AD0A 3OA3A 1POJA 3L23A 1FA2A 2CLEA 4RUBA 4PMQA 4E3VA 4XZWA 3MKCA 4KPLA 1UZDA 1F07A 5I3JA 1OBAA 1GTHA 3H7RA 4DBSA 3S2LA 1EX5A 1GVYA 1K8CA 2BHZA 2G96A 5E09A 4JICA 3LBCA 2FB2A 4XBSA 1NWRA 3S4TA 4FLOA 3C8FA 3RLGA 3NFUA 2Z1WA 3UWEA 1KV5A 1B9ZA 2X1TA 4PMJA 4C5ZA 3L68A 1WX0A 2PDGA 1OCBA 3NQFA 4PL2A 1FFQA 2B7OA 1MW0A 1M7PA 4YTRA 3V1HA 2ZUSA 1EEXA 5GNYA 4WY0A 3OB8A 4I8DA 3VOCA 3TOPA 1O95A 3SADA 4JPGA 1RJQA 1ONXA 1DWAM 2QJGA 4NP7A 1L6YA 2WM1A 3CZEA 2XFYA 5IHRA 2HWGA 3WQVA 2XGIA 5D30A 2ZZ5A 4M1RA 4U5IA 1PIIA 3WBEA 2YCIX 2PWGA 3MZ2A 1XUZA 2V3FA 3HGSA 3PTQA 4K1GA 4U28A 2GGEA 3GC5A 4PN2A 2Z1KA 1F74A 4FS9A 4TXEA 1J0YA 4E2DA 2A85A 1ZFJA 2BXZA 4DNHA 3WH6A 1R46A 3QM3A 2DZUA 3UJFA 3BGJA 3M0LA 1OF6A 2QGYA 2D0FA 2NV1A 3DHFA 4JTDA 3SI9A 3A5FA 3VMPA 4NAEA 2QPXA 4S3FA 3G24A 4JX6A 4CNSA 3R12A 4EF9A 3QMRA 4BI7A 1Q63A 1YTEA 4J3VA 3N9KA 3POCA 3W88A 1ZS2A 3QV6A 4RZBA 3RRXA 1V51A 1WYIA 3AXIA 5ABFB 1XYMA 4M56A 1J4EA 2AMGA 4L1GA 2NQ9A 2FZNA 3MQTA 3MKKA 1QRQA 4WJ8A 1V3KA 1H4PA 7ENLA 3CO4A 2B7NA 1MQPA 1GVIA 5KTLA 2G3IA 3VKAA 3ZJKA 3JZEA 4GIEA 2DV0A 4ZEPA 1M41A 2GVYA 1XW8A 4KQNA 4N4PA 2GWNA 3W1UA 3EKZA 2ZZ3A 4CCZA 4IT1A 1ICQA 1QPOA 4WJEA 1XRSA 3LQLA 2E8ZA 3KS6A 1TWDA 1GK8A 1ADSA 3MHFA 3O6AA 3OZPA 2FHBA 3KBWA 2V5CA 3NQCA 4K7VA 4HP5A 2A3AA 4YVVA 5CPMA 3LGEA 4AU0A 1QBAA 4HHMA 4GISA 1EDGA 1Y0EA 4AYGA 5FEZA 5CBJA 3EOUA 3DKLA 3RJXA 1V03A 3DDMA 4US5A 3E49A 3EAUA 1V3LA 1EB3A 3MKVA 4WF7A 3B8VA 5H8PA 4HNOA 1G0CA 1P7TA 3QPEA 2P0OA 3KX6A 1R2TA 4Y9NA 2C0AA 5I77A 4DXKA 2ZC1A 3ZT6A 1N8IA 3QY6A 1SFLA 1TB3A 1PTAA 2JIWA 2ZRYA 1A3WA 3MCMA 4INFA 1I0DA 4KW2A 3HG4A 3K4AA 3TJIA 3GXTA 4LV9A 2AKZA 1JRBA 3LYEA 3P0WA 4LRTA 4AC1X 4TX6A 3NEVA 1A0DA 3GFZA 1RBOB 4M1BA 3NPUA 2PU0A 3VINA 4S3BA 4IP4A 2QF8A 3G77A 3EPOA 3UZJA 3SRFA 4L4LA 5DY2A 1O12A 2CBUA 1JUEA 2P50A 4JFUA 3V4BA 4LT9A 3TX9A 5M2FX 4WY0F 4E2OA 4FX7A 2PTZA 4R3UA 2PS2A 3QMTA 4YIWA 1Y65A 4CU6A 3TV8A 2JK2A 4LAZA 1GYMA 2XUCA 2O0TA 1RLCL 3WLHA 4C1NA 3PBWA 3S0CA 3QC3A 3CV6A 3BPWA 5CSYA 1LT8A 3R8GA 1HJXA 4GIAA 1KB3A 3S6DA 2J27A 2WSPA 3BCDA 3VIJA 3ZLHA 1E3XA 3WF3A 3S1VA 1WV2A 1HGYA 2AL2A 3LG3A 4R9XA 1KFBA 4ADTA 1DL3A 3CO8A 3EX4A 4GOAA 3HB9A 1NSJA 1WO2A 3IJDA 1DJNA 2QLYA 4AXKA 3BH4A 4KEVA 1CCWB 4GX8A 3PSWA 3QYQA 4NZ1A 4CD5A 1T96A 4PMVA 3ZQ9A 4FZIA 3UT0A 3W07A 1BFNA 2W66A 3E2VA 4M6PA 3CB3A 4RNFA 2Y70A 4J2PA 3CJPA 4DPQA 2I14A 1R0MA 5XIAA 4L65A 2QMKA 3LPFA 4PB5A 4YHEA 4IGMA 4JTHA 4HU8A 3UCQA 4ADUA 2AGTA 4WKAA 4XTDA 5D04C 4K2SA 3TA6A 5C2CA 3C6CA 2VP8A 4CCCA 5A94A 1AK5A 3EDEA 3GVRA 4LC8A 3GXMA 3B4YA 1ZAHA 4B16A 4G7FA 3OPSA 1S1RA 3UERA 4DZHA 2YZ5A 3PZUA 2ZDRA 4DI8A 4XTIA 1I6NA 1JAKA 1TE6A 1I60A 1LLWA 1OCQA 1RK5A 4IMCA 1WDPA 2WNWA 3LNPA 3WK2A 4ZSUA 4E5TA 3WF0A 4A8LA 3UYIA 2YA1A 2OMAA 3G8RA 5I07A 2VRQA 2IMRA 4MUPA 3HG3A 3QKZA 4GZJA 3E74A 3IGSA 2OYLA 3ECQA 4GHRA 5BXRA 1TV5A 1S5VA 5FSDC 2ZA2A 1HQTA 4JL2A 4KERA 5LNWA 3ZWTA 4FXSA 4KRZA 1ZJBA 4KS0A 3ZVIA 1JL8A 1P0BA 4JCMA 3W2UA 1EJTC 2VQUA 1TJ2A 1XG4A 1UR8A 3EKLA 4F3HA 1KRCC 3LGDA 3O9NA 4QQUA 3W1MA 4AW7A 2GGGA 1CECA 4GIYA 1Y5XA 2JGQA 3BJTA 3OVGA 4GO9A 1TMHA 4JNZA 4GQ0A 3MPGA 4YTQA 2VEKA 3AWOA 5EPDA 4KEUA 1UPMB 1XICA 1OT2A 3BLFA 3AIWA 1WE5A 2A3BA 3ITXA 2XH0A 1U1HA 3W2LA 1E4NA 5MHBA 4HN4A 5HMFA 2GYIA 1D3CA 3AIEA 1H0GA 2QR6A 5G1MA 3WQ4A 4DUWA 2AL2B 4FA3A 1XDMA 1HKIA 2FH8A 3AYVA 3NO1A 1UOKA 2QEZA 2VVSA 4GCXA 1WDWA 3B9NA 2DW6A 3JW7A 4KWVA 4EVZA 3RLUA 4C1LA 4AZHA 3GH5A 4A3RA 1UUOA 2YKKA 3L9CA 2WVVB 4R7WA 4WOZA 5HJLA 4DYKA 1FWCC 4HTYA 4GJIA 3UYCA 4ZFMA 1XLKA 2XSXA 1VEPA 2VUNA 1YYAA 4JIIX 4FNSA 5CC3A 1CB2A 4PYSA 2P53A 4H9MA 1FVPA 3VOJA 3O16A 3URBA 3C2FA 3UXAA 3AU6A 3A13A 3ZM8A 2R6OA 3ITYA 5HMDA 4Q8QA 3RM8A 4AFYA 3AI0A 3G3DA 2QGHA 1TPVA 5HULA 3G5EA 1W3KA 1XBZA 3LM3A 4ICNA 3WQWA 4Z17A 1AQMA 3QHOA 5BWFA 3T2OA 2YR1A 5KMYA 4F48A 4O1BA 1JD7A 1QWKA 1QXLA 4W89A 4ZZ9A 4J4KA 3Q2DA 1XQLA 2XWDA