1JUEA

1.8 a resolution structure of native lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
total genus 116
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jueA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jueA01
3PAJA 2RH9A 2FLIA 4N6FA 5CG7A 8TIMA 4NNCA 4MJZA 4O53A 3OVPA 2YX0A 3TFXA 3L21A 3M1ZA 4JTHA 2X1TA 3SGZA 1ZALA 4AH7A 5DN1A 3ZWSA 2HSAA 3W7EA 1GG1A 2R94A 5K7JA 2YW3A 5I3FA 3EKLA 4JTEA 5K4ZA 3W7HA 2FB2A 2P1FA 3W2KA 2Q8ZA 3S1UA 1K8ZA 3NQ7A 2WNQA 4B5NA 4CQ9A 1P0KA 3USBA 4DPPA 3A5VA 2GVLA 2B0MA 2G5WA 3TMQA 4UTWC 1KA9F 2DZSA 1O4UA 1NAL1 2J24A 4AWSA 4N4QA 4IX2A 4BF9A 4BK9A 1FCVA 2Y7EA 2Q8LA 4S2CA 1YTDA 3LDVA 1TB3A 4JTTA 1YXYA 4UTJA 3OVQA 4UNKA 4O0KA 4DF1A 3LB0A 4M5PA 4LUIA 4NT0A 2WPBA 3DFTA 4AVFA 4XKYB 3G3DA 1ME7A 4UFJA 3QMRA 3L67A 2CU0A 4JTFA 1QCWA 2AGKA 1K7EA 2VEKA 4NQ1A 2DJLA 2QDGA 2XN0A 1DJQA 3SFKA 1V5XA 1GTHA 4LVGA 4DF0A 1UCWA 4ML9A 3TJLA 3PSWA 5F2GA 4OV4A 3EWXA 1HTIA 1U83A 3WK2A 4LTSA 3FIGA 2CZEA 3V75A 4J9JA 5AHEA 1DORA 3TQ0A 3S1WA 4DO6A 5DY3A 3W1NA 2Q3RA 3W7OA 3LV6A 2YZRA 3L0KA 4AF0A 3QSRA 1DHPA 2WNZA 4JTGA 4I7VA 4ZQPA 2QCNA 1ZY9A 3R2GA 3SSJA 1XFBA 4RXGA 1ML1A 3M43A 3W1LA 4IX0A 2NUXA 5E1QA 1Z41A 4OBTA 4JTLA 1EEPA 3PB2A 2A7NA 2Q3OA 3LCFA 4O57A 4OE7A 2O7SA 2VFHA 4JTKA 1XI3A 2PE4A 2X1UA 4LRSA 1THFD 3O06A 4LV4A 3M0ZA 4YLWA 1OFPA 5D2TA 4O50A 4N9BA 1KBJA 1VZWA 4K39A 1FXQA 2BX7A 3IVTA 1TPFA 4XQ6A 2ZZ7A 3TA6A 5CKSA 1ICSA 1TYGA 3W1TA 4NUWA 1JRCA 2OT0A 1FY6A 3BVJA 1ME9A 3LRKA 2YW4A 4JICA 5D2VA 4X2RA 4CCEA 4O28A 4YCPA 3NNTA 1QFEA 1IXQA 1EUAA 1T99A 2X16A 4NJKA 1JULA 3HGSA 4JEQA 3BPWA 5D33A 1TPH1 2C19A 1TPB1 2ZFAA 1A5BA 1GWJA 3O63A 4R33A 3V1PA 4NZJA 1RR2A 4NJJA 3M47A 4XUGA 4Q32A 4N9EA 3BW4A 3MYPA 1MEWA 2VC6A 4UMAA 5AYXA 3CTLA 1GYLA 2PCQA 3UYCA 2Z1BA 1XM3A 3PUDA 3NPWA 4IWWA 4UCGA 3W2MA 3FJ6A 1K03A 2ZRXA 1TRIA 4WY0F 4LS1A 5FF0A 3PVFA 2FPYA 2NXHA 3L5MA 3LHUA 5AB3A 2GQAA 1DVJA 2XN1A 1WDWA 4MLJA 3DGRA 3PBUA 1XXXA 3NM1A 1YPFA 5FEPA 3T44A 3GAKA 1DBTA 1KM1A 3LHWA 3P81A 3G1VA 2TYSA 4PEKA 3YPIA 1FWRA 1NVMA 1J5TA 3W07A 1X7FA 2KZHA 1VH7A 1WOBA 2ABAA 3LCIA 4NU7A 4POCA 3VE7A 4LNYA 1ICQA 1OF6A 2RFGA 4RLIA 3C2FA 3EWUA 3CEUA 5EKYA 1KFKA 1MEHA 1VLWA 4GXMA 4O0ZA 4JIPA 1GPWA 2VFIA 1L6YA 5TBOA 3G1DA 1MXSA 3RMJA 3UNDA 2NUYA 3RNDA 5BMXA 1I2OA 2DP3A 5AYYA 5CGQA 2J27A 1QO5A 4IXHA 4LC8A 4OQVA 5LNRA 4FNUA 3CWNA 1A5CA 3NG3A 3SIZA 2WO5A 2A7RA 1QPRA 3LV5A 3GLCA 4O15A 1KFCA 1LTDA 1I8JA 5CPMA 1Q6RA 3QW4B 2NX3A 4Z1DA 1W8SA 3W7PA 1X8FA 2V2CA 5D05A 3TJXA 1QDSA 2I9EA 5DY2A 1LOQA 1OK6A 3L65A 3LCXA 2ZRYA 2ZYFA 4DO5A 4FXRA 5LSMA 5E0KA 2WNNA 2E6DA 3HGJA 2OCZA 3F4NA 1SO6A 2J9YA 1WBHA 3G18A 1B57A 3G0UA 1YDVA 3G1FA 1KFEA 2FDSA 3G0XA 4BWLC 5L6UA 1GZGA 4UTTA 3UWQA 3C61A 4Y9AA 3KX6A 1W54A 1QOPA 2BWGA 3IIXA 1VYSX 3DH7A 3KVLA 3W1UA 3PBYA 1FCUA 4FXSA 1QWGA 3W87A 4PFMA 1OX5A 3GDKA 3STEA 3HG3A 3STGA 4S1FA 1EUNA 4CCDA 4ONVA 2DORA 3W1AA 3M9YA 3W7IA 1YXCA 2QR6A 3S5YA 1XDLA 3B0VC 4WY0B 2C6QA 1TPVA 5DBTA 4MUZA 5F1VA 1DQWA 5SWUA 3QF0A 4QQ3A 3NQFA 5FF4A 3KVMA 3TAOA 2QJGA 4WD0A 4LS0A 3TW7A 3B04A 2NXIA 3W70A 5G5IA 3N9RA 4HNTA 2DZVA 4XKYA 2A85A 4PTNA 2QDHA 2Z0IA 1D3GA 4C1LA 1PCWA 3WJWA 3GYEA 3TROA 2WV8A 2H3DA 3EX4A 3TX9A 1FWNA 1OK4A 1GVOA 5AYZA 4NZFA 1B9BA 3OIXA 3HG2A 4JTUA 3UXAA 3T78A 4O4VA 3WJZA 1KM3A 2NX1A 2OX1A 5I3GA 3W86A 4AHPA 3EX1A 3DXIA 4MY9A 1JCYA 3QEZA 3LLFA 1XDMA 1TTQA 2A7PA 1HO4A 3EKZA 1MSSA 4TIMA 5CPLA 4MFEA 5F2MA 1KTNA 5K9DA 3RK8A 3RLUA 3GR8A 1EWEA 4UFLA 1JUEA 2GPTA 1AW5A 4UTIA 5BMWA 3N3MA 4YXGA 2V9DA 4K37A 3QMSA 1JCXA 2ZZ1A 1OG0A 2GVJA 1KTBA 4UMBA 5J5DA 4ZMGA 2JK2A 3ANYA 1XUZA 3FKRA 2AQWA 2QCDB 2WSYA 3I6RA 4FHAA 1J4EA 4JX6A 2VFFA 2ISWA 3MMTA 3W7NA 3L2IA 3SW6A 5FESA 1JJKA 3MBFA 1R2SA 2FJKA 3HGRA 3M7WA 4ZQNA 3MHUA 1RZMA 4P61A 5HMSA 1R2TA 1PHWA 5C5YA 1VRDA 3W2JA 3STCA 1PL9A 2ZRZA 1K02A 4NVTA 1SZGA 1T96A 3IIPA 2VEMA 3TV8A 4HNUA 3S8HA 3D0CA 3G8EA 3NZ1A 4PODA 1VPXA 4EIVA 3IEBA 1VC4A 4Z1BA 3DKJA 2XN2A 4PCFA 1EWDA 5K9XA 1G4EA 1SR9A 3FEMA 5C2XA 2Y63A 2A2IA 4RCXA 3MP4A 3NVTA 3HB9A 2CLLA 4RV8A 1M7PA 1H63A 1H7WA 1TPEA 2W6RA 1IIHA 1G7UA 5LNVA 4IPIA 5AFDA 4P2VA 1QO2A 1LRTA 1QAPA 4KWVA 3O15A 1LRQA 1FUYA 4WOZA 1LLZA 4G1KA 3ABQA 4EWND 4HN4A 4PA8A 2GJNA 3JS3A 3G1YA 4O12A 4O13A 3C8FA 1W5NA 3P5ZA 1OYBA 5IM51 4JTSA 1UASA 1GYNA 3BK0A 1NFBA 3LBMA 4XTDA 3Q37A 3O6YX 4JX4A 1L9WA 3UXDA 2NZLA 3CEPA 2HMCA 3TAKA 4QSHA 3ABSA 1QPOA 2H8XA 3N2XA 4JX5A 1BTMA 4PL2A 3OHIA 1TJPA 2ZCGA 3CQ0A 1LOLA 2EAWA 3HMJG 2C18A 2YR1A 3LGEA 3UWWA 5HQEA 1FDZA 5C55A 3GZ3A 1ZNNA 3W85A 5D2YA 1H7RA 3HBLA 1C29A 3TK7A 5H91A 3A9IA 3MHGA 4TMCA 4XWUA 2X2GA 4O1AA 2CZ5A 3W7RA 2VXNA 2LLEA 4FNSA 4UIOA 4K8HA 1KM5A 4O18A 1MEIA 3P62A 1FCQA 2YCEA 1G6CA 5A5WA 3G24A 2QF7A 3DFNA 1W3TA 4LOCA 3S42A 3Q2DA 2H90A 4JY9A 4A2RA 1VHCA 1O5KA 3ATZA 3TC6A 3MJYA 4ZVJA 3OBKA 2V5BA 3W83A 2QCLA 4R34A 4WXZA 4AMAA 4HIBA 1AG1O 4EF9A 3W1MA 3SI9A 4HSNA 1OABA 1VLIA 1TTJA 5IBXC 2Z6IA 3MW7A 2CLIA 2FTPA 5D38A 1TPC1 3BLFA 1TJRA 1DL3A 1EP1A 5G4WA 3VFLA 4KKXA 1I45A 3B8DA 4DELA 3EWYA 5AHIA 2WKJA 4O52A 3BW3A 1VHNA 1XCFA 1TCDA 3TCEA 2TRSA 3TQVA 3WK1A 4QNWA 1UB3A 5CZSA 2YYUA 4RX0A 3IGSA 2I1OA 2G95A 3PR2A 1QPQA 4NX0A 4DXVA 3N9SA 4KFNA 3QFEA 3UQNA 1PV8A 3PBVA 4GJ1A 3BG9A 3IVUA 4A3UA 1ZENA 4ZQCA 3F1QA 2E1DA 1K8YA 1N55A 2H8ZA 3LXAA 4QITA 2V2DA 3C2RA 1BWLA 2QCHA 4WY0A 3T40A 3MBDA 3GDRA 1IXOA 1ONRA 2ZZ5A 2ZDRA 1XBYA 1RVGA 5D02A 4OU1A 3ZWTA 5HUOA 1FXPA 2NV2A 1YLVA 5F1UA 4EVZA 2X30A 1TV8A 3LOTA 3TSDA 3EB2A 1X1ZA 1YTEA 2B7OA 1TO3A 4UTLA 5AC6A 4FB7A 2J88A 3NQCA 2RKXA 3L0NA 3QH2A 1P1XA 3R12A 5FF7A 4FNRA 3I65A 3NL3A 5AN7A 4EOUA 4IQLA 5LNSA 1D3HA 4IOTA 5U4NA 4BFAA 1ZAJA 3W23A 4UTKA 5HR7A 4OGZA 4UFHA 2Z2UA 4K6AA 3S5OA 4LVAA 3ATYA 5FF2A 1O94A 3CT7A 4Z0SA 1W3NA 3UWYA 1VYPX 3DFQA 5CZJA 3GNNA 1X6UA 4M7TA 2CLOA 3W1PA 3E49A 5F4SA 3W7QA 2CLEA 3TR2A 3N19B 2QUTA 4DF2A 2ZZ6A 5HJLA 5F4XA 1LORA 3LHTA 3W3OA 2QCDA 2VELA 3PS7A 4UC5A 2TSYA 1MO0A 3TMLA 5G2WA 1OX6A 5D32A 3W74A 4WZHA 2W0UA 3FJLA 1XL9A 3PB0A 3VE9A 2GQ9A 3H55A 2JBMA 1A5AA 2EKCA 3SJ3A 3UWVA 4MOZA 1TSIA 1GEQA 1PHQA 3LXBA 4AHOA 5CSRA 2NX9A 2YGYA 4Y6GA 3NEVA 4IJBA 2EPHA 3SR7A 3GNDA 1AW1A 4NXSA 4UFKA 5AOUA 4JYDA 2V0TA 4BI6A 1FDJA 3NPXA 1DKWA 1PCKA 2R14A 4CNNA 3AO0A 3W7JA 4PH6A 2Y88A 5TIMA 1CX9A 3DI1A 4ORMA 4ALDA 2RDTA 3AJXA 4LV9A 3MI2A 4GNJA 3DZ1A 4HPJA 3LTPA 2HTMA 1F76A 5DBUA 3O1NA 1SO5A 1H5YA 4JTJA 4LY8A 2ISVA 2Y70A 4UTHA 1EIXA 1W5PA 4LRTA 4GWEA 4XTIA 4JTIA 4PL1A 3TIMA 3HQ1A 1KV5A 3MHFA 1VCGA 4RZ4A 4FF7A 4LWWA 5DLCA 4O14A 4GUIA 4H4IA 2ZA2A 3IIZA 3QJAA 3GDLA 1KM2A 3T55A 2ZRUA 3G0SA 4K7VA 2E6AA 3N34A 4HHPA 3NQDA 3UPWA 4AHQA 6TIMA 3A24A 2DZXA 3GDMA 1ZAIA 3NOEA 3Q94A 2O7QA 1LCOA 2FQIA 2ZZ2A 3LBCA 1H7XA 4LC6A 1BKSA 5DCDA 1QR7A 2JKEA 1GVSA 4U4MA 4MZ1A 3P74A 3W7GA 3R8RA 1YPIA 4NJGA 1VR6A 1P0NA 4MY1A 5AHFA 5F4WA 2QAFA 2NUWA 1R46A 3HG5A 2GQ8A 4ZQMA 4M6VA 2V81A 3PG9A 4MFDA 4LW7A 2EGZA 4BI7A 3DFSA 1G7VA 3GB6A 1G69A 1W3IA 1SQ7A 3DKLA 2YSWA 3NA8A 3QYQA 5AHNA 3I68A 5EL1A 3NL5A 1HG3A 4MYXA 5EBUA 4WQ6A 3B0UX 1SFJA 3IVSA 5D03A 1FBAA 3E02A 4FNTA 3W76A 4KFOA 5DCBA 1I2PA 1WYIA 3UWUA 2JKPA 3TXVA 2QCEA 1ICPA 2OJPA 1B3OA 4AWTA 4E38A 1AMKA 3TH6A 5A8GA 3NQAA 2GUUA 2FIQA 1AK5A 4HKPA 1UUMA 3TW6A 1GTEA 3DHFA 3EEGA 3CHVA 4MZ8A 1XC4A 2ZZ4A 2P10A 2A21A 2Y62A 2VFGA 1W5OA 1FCBA 3UY7A 1VJIA 5K2ZA 3U8GA 1KM4A 2A6NA 1YDOA 1H60A 1I2QA 1SZFA 1TTIA 3GK0A 3W71A 3STFA 1W37A 4IPJA 2ZA1A 2CLHA 3P67A 1FQ0A 3SGUA 4ICNA 1H7NA 1EX5A 1UBSA 1IF2A 2CFFA 3C2OA 1KFLA 3N2MA 5F2IA 1Z42A 2R91A 4I7WA 1R2RA 5EYWA 4LVFA 5DCEA 2NLIA 3CM4A 2X1SA 3IIVA 5C6MA 3CC1A 4YCOA 1JCNA 6ALDA 1V7YA 4FX8A 1H61A 2NWSA 3W7LA 2VFEA 2Y6ZA 4UTTC 2YDAA 3L68A 3E9AA 5KSWA 4WJEA 1WOAA 3HIJA 2F7FA 4NXKA 1WA3A 1QNVA 3TSMA 4LS2A 3T7VA 3VCRA 1NEYA 3L5LA 3EWWA 1ALDA 2WQPA 3LTYA 3P5YA 2TMDA 4QM1A 5U7SA 5LGXA 2IQTA 4CLMA 1OFRA 2DU2A 3LI1A 1GOXA 4IMDA 1SO4A 3DHDA 3NL2A 2G96A 4K36A 3M5VA 2V8ZA 3HJZA 3IGXA 2HS6A 2ATMA 5EMUA 3LCHA 3SECA 1N7KA 3FYPA 3P84A 3QMTA 2C13A 3O8AA 3NQMA 5D37A 2WOQA 2NV1A 4ADUA 4O1BA 4WUIA 2WSQA 1HL2A 2B7PA 1DQXA 4O16A 2BSLA 3MI6A 5KITA 1SW3A 4OHQA 1PS9A 3W7CA 5HWMA 2A5HA 2G97A 1A53A 2BXVA 1HFBA 2B4GA 3WFAA 2GJLA 3G1SA 3NQGA 5LNWA 1TPWA 2QCFA 5BRBA 2BLEA 1SU5A 5EY5A 2WJZA 3QPZA 5KMYA 2H6RA 2ZRVA 3G1HA 3NPVA 3RU6A 3S5ZA 3NM3A 3KVJA 1JCMP 5AC8A 1OFOA 1M7OA 2FB3A 2V82A 1U5JA 2PRHA 5HNRA 4WXYA 5G2IA 1SSGA 3TFCA 4YWIA 4LVDA 4N9CA 3HOJA 4X3ZA 1LOSA 3LLDA 3C6CA 4FNPA 4FX6M 5KZDA 1BEUA 1TMHA 1S5WA 1I2RA 3NQVA 3CIWA 3Q58A 3LHZA 3P7YA 3M6YA 3NGJA 4ZL1A 3NAVA 4RK8A 3B05A 3PULA 3QQ1A 4OWGA 3R5EA 3ZFHA 1ME8A 1OVDA 2VEPA 2XFWA 3R89A 1YXDA 3R13A 3B06A 1T0OA 4ADTA 1OF8A 4ADSA 2V30A 3BG5A 3OVRA 3LHYA 3PBWA 5KINA 3O16A 1DOSA 3W7KA 3NO5A 2QCCA 3GXTA 1OX4B 2J6XA 2ALDA 2Y7DA 3BO9A 3NDOA 4BR1A 1F6PA 1KW1A 3S1VA 5CZ0A 4GUGA 1P4CA 1FX6A 3LM7A 2A6LA 4CNOA 3GVGA 3UY8A 1TPUA 3KAOA 4JS3A 5LGZA 1F2JA 4TMBA 1RPXA 2ISSA 5C54A 2WSRA 1SZEA 1ZHAA 2F84A 1A5SA 2ZRWA 1JVNA 1RV8A 2E5DA 1IXNA 4Q33A 1GVFA 4IXXA 3G3MA 4D2JA 2QJIA 2GOUA 2UV8G 4UUIA 4H3DA 4CCCA 3CU2A 1F7BA 5KZMA 1E51A 3OG3A 2FFCA 1LP6A 2HS8A 3GIYA 4Z08A 3RFAA 1SW7A 3PM6A 3EWZA 4QJ1A 3A22A 1RQHA 2C1HA 3LRMA 4HT3A 2A1YA 5FEXA 3KOFA 3PWAA 3NXFA 1O95A 3L0GA 1OFQA 3B4UA 3GXPA 3LCLA 1LBLA 4UTWA 4UMCA 3LXCA 2P0OA 3W7MA 1FWWA 4ZZ9A 3M5XA 4UTMA 4RZ5A 1RD5A 1WAUA 4UXDA 4W9TA 5HULA 5G1YA 4TO8A 3HG4A 3ZS4A 1IXPA 2B7NA 3N14A 3DENA 1KFBA 1LROA 1YADA 3QQ0A 5HWNA 3KHJA 4EF8A 3B0PA 4GUJA 3WJYA 2VENA 3JRKA 4GE8A 5K3VA 1H50A 1VCVA 5FEZA 3T4CA 3C56A 4L4LA 3FLUA 1Z44A 5LKYA 3WJXA 3W88A 3G1XA 3GR7A 1ZJIA 2R8WA 1PVNA 1Q6QA 1GVQA 1FDYA 3EXTA 3IIOA 1HO1A 3NYZA 1F5ZA 3S5NA 3W2NA 4O17A 5T26A 3GAYA 4Z0JA 3INPA 3ZR4A 4X9SA 1SO3A 2OZ0A 3O07A 1G4SA 1TQXA 1PIIA 1MZHA 4FX7A 3W7DA 4C1KA 3W84A 3LI0A 1KLZA 1GQNA 2RDUA 4HNVA 4JD4A 3LCWA 3OA3A 4MKNA 4K8EA 4JY8A 4N9DA 1OJXA 1A50A 5LHEA 3K30A 1S5VA 4LU0A 3M41A 4QIUA 3E0IA 1RQBA 4KWWA 2QEZA 5E93A 4O11A 3W6YA 3S0CA 1G4TA 1O60A 3EXRA 4M19A 1M5WA 3EX6A 1W0MA 1ZCOA 3M5YA 4HPXA 1GT8A 1TIMA 2QUUA 5CPOA 4S2BA 2C16A 3S6DA 2D73A 5I3JA 2ZTKA 1QOQA 3O6CA 1EB3A 2PRMA 1WX0A 1DV7A 4JR5A 4UTUA 4O1CA 4O4WA 1Y0EA 5J5RA 1P5BA 3GKAA 3S1XA 2QAPA 3L9CA 1TPDA 4IMCA 1SPQA 1L6SA 3TKFA 1WBJA 5LZLA 5F2LA 1VYRA 5HUPA 5K4XA 1XBVA 3C2EA 1NF0A 1SZNA 2VKZG 4PC8A 2AAMA 4CQAA 2CZDA 2E6FA 3VKJA 1AL7A 1OFDA 1JR1A 2J9XA 1FWTA 3FFSA 1WXJA 3GXNA 2E68A 1O5XA 1W5QA 3BG3A 3W9ZA 5ABTA 1W31A 1XUUA 4N6EA 2FPTA 3DBPA 4AB4A 5FEWA 2E77A 2ZA3A 4HSOA 2TPSA 1B4KA 4DBDA 4WX2A 3O6DA 3LX9A 4IMFA 2DZUA 4Y8FA 1K7XA 3RF9A 3KRSA 1NF7A 4JGDA 2I14A 3U2OA 3CIXA 4Y96A 4L4MA 3ABOA 3HPXA 1SFLA 5DXXA 3ABRA 3BARA 3B03A 3TUUA 1UJPA 4MPQA 1AW2A 1G67A 5D04C 1N8FA 5CZTA 5D09A 4OV9A 3MP5A 3DI0A 1L6WA 3PSVA 4AXKA 3KVKA 5DELA 3QC3A 4M6QA 3HO8A 1D9EA 2BZNA 4H6KA 1XBXA 1S5TA 1WQ5A 2ZZ3A 2NWRA 1OYCA 1EA0A 3MYOA 3KXQA 3E96A 1OFBA 4Q4KA 3IV3A 4A29A 3MI3A 1GJPA 1X1OA 1EP3A 4R53A 2C15A 3IGUA 5CPNA 3WK0A 2PURA 3TC7A 4BI5A 1S3HA 3C0JA 1KM0A 4QISA 1W5MA 5I3KA 5KZEA 5D2XA 1YTKA 1K8XA 5DXYA 1LZOA 1OX4A 3C2VA 1I4NA 4YMZA 5L9FA 1KV8A 3H54A 3CLMA 5CSSA 5HR6A 2EF9A 2EHHA 1H7PA 3P8JA 4GFSA 4RJEA 3UZ5A 4MYAA 1TTPA 4OT7A 3LRLA 3G1AA 1KFJA 3MWAA 2E09A 2J9ZA 1G4PA 2CW6A 5EPDA 1CI1A 1WV2A 3W22A 5HINA 1OYAA 4DPQA 4GUHA 4MZYA 4HNNA 4JNMA 3NQ2A 3P60A 3BGJA 3TNOA 3JR2A 4BWLA 4DO4A 2RDWA 1H1ZA 4K38A 4FIQA 2GVGA 1VQTA 3BLIA 1YYAA 3GDTA 2YYTA 3I7RA 2VEIA 2RHGA 3EWBX 1TRDA 1OHLA 3W72A 4CQ8A 1F05A 4JIQA 4U28A 3FOKA 4NNBA 1K7FA 3FS2A 2BTMA 1J2WA 3BW2A 1LM1A 3QPYA 2Y85A 3H53A 1TV7A 4FO4A 5AHMA 1H1YA 2YXGA 5TQLA 4MVAA 3NL6A 1R47A 3NQ8A 3PG8A 3NQ6A 1VGAA 3KRZA 2Y89A 3EXSA 3NZRA 2Y7GA 3QSTA 3PUOA 3BV4A 4E2DA 3HPZA 1H51A 4YL2A 2A4AA 2DZTA 3UWZA 3MP3A 3W2UA 1K3UA 5FI8A 1B4EA 2PC4A 3DFOA 5BOOA 3G8RA 1XBZA 3LERA 1JCLA 4GUFA 3M5ZA 5K9CA 1M6JA 1VCFA 3P80A 4N2YA 1T8XA 4IMGA 4ZQRA 3G22A 1BWKA 1GVRA 4DQWA 3N73A 2ZQ0A 3W1QA 4DBEA 3WK3A 1ZAHA 1Q6OA 3TQKA 2JKAA 2E6YA 4JXCA 4XBSA 3S9YA 1QMLA 2NXGA 2YFNA 3QM3A 1EPXA 3EX2A 4LUJA 5D2WA 2ABBA 4UFIA 1TV5A 4IUOA 2JGQA 5BNKA 1UUOA 5HWJA 2OMAA 3W2LA 3PY2A 1EP2A 4LT9A 2QUVA 3OEXA 5G4EA 2PRLA 4GC4A 1W1ZA 3A21A 3GKFA 1FWSA 3W1XA 2QCGA 3FYOA 4RKAA 4E2BA 4JYFA 1LDCA 4FNQA 2E5BA 3CPRA 4NJIA 1OFAA 5I3IA 3M16A 4UR8A 3QZEA 4AF0B 3TU9A 1GG0A 4CNPA 2Y61A 2H3BA 3SZ8A 2CLKA 1W56A 3MO7A 3O05A 1TREA 5AHLA 3KFTA 3QW3A 3LHVA 1C9DA 4FIRA 4M6PA 7TIMA 2A0NA 4RZ6A 1ZFJA 4R7JA 3FKKA 4KFPA 3SY5A 3BLEA 3VNDA 4FEZA 4NJHA 4DEFA 3W1RA 3PF3A 2CWNA 4UNLA 1LYXA 4E0CA 2YPIA 4N4PA 2DZPA 4JDYA 3I7QA 2JGYA 1Q45A 2C0AA 1OFEA 2CLFA 4ORIA 4AWUA 4MJMA 3PUEA 3W73A 1I2NA 4N02A 3RLVA 3U6WA 1H7OA 4IMEA 3TDFA 3LTSA 3ELFA 4X22A 1CW2A 4MY8A 4RR4A 5H2ZA 3WJSA 5LNUA 4A22A 4I7UA 1VS1A 4I9AA 2X1RA 3M44A 3A5FA 4UFMA 5LHFA 1H62A 1Q3NA 1JRBA 3TE9A 3FA5A 3C52A 4O10A 4QNEA 1F73A 4LVBA 5AC7A 4MLRA 3HPSA 3UD6A 1RQEA 5EA9A 4IGHA 1KBIA 2CLMA 3CB8A 2V5LA 1IGSA 2OT1A 3THAA 2VOMA 2YFOA 4A21A 3TXZA 4JYEA 2V2HA 1QPNA 4TU1A 3C4UA 4AEOA 2ZBTA 1C8VA 4O1DA 1TQJA 1F74A 1R30A 3UZJA 4GRSA 1L2UA 2W79A 3LCGA 3CWOX 4XZ9A 3L5AA 3E12A 5FF3A 2B7QA 4NNAA 4TR9A 5D30A 3VI2A 4JDBA 3EX3A 5MHBA 4AAJA 4Z1AA 2CZFA 2C14A 5BW6A 4O8RA 2DJXA 4GBUA 3QRHA 1LBFA 4JN6A 1NSJA 1KTCA 1AL8A 4Z1CA 3NPUA 3MUXA 1KLYA 2Z6JA 1ADOA 3HGOA 4K7YA 4M7SA 2QCMA 3DAQA 1JQXA 1JUKA 2E5CA 5G2HA 3IRDA 3P82A 3DFPA 3NR0A 2DZWA 1KM6A 3P61A 1IIGA 1Z48A 2QJHA 1LBMA 1XKYA 1LRNA 3NQEA 3F03K 3HF3A 4XBKA 4ZQOA 2QKFA 5KTLA 3UPBA 3F4WA 3P8IA 3PC0A 1SUXA 3I7SA 4TX9A 5I3HA 1Q6LA 3L66A 4Y90A 1SSDA 3THQA 2VFDA 4RXFA 3W75A 2ATSA 2FPVA 4NX5A 1DJNA 3TSBA 2Y7FA 2ZTJA 1JQVA 1SW0A 3A23A 5IBXA 1PE1A 4QAIA 1F6KA 3BGGA 3C3NA 4O54A 1HUVA 4WOQA 5G1TA 2C3ZA 4O19A 4A2SA 3DU0A 1YDNA 4MIMA 3KRUA 5GVJA 1JUBA 3GX9A 1JCJA 1LLWA 4UR7A
chains in the Genus database with same CATH superfamily
4IISA 3T2QA 2J74A 3CQJA 3AYVA 2RH9A 1SJBA 4PRTA 3T6CA 4O53A 3CLWA 3M1ZA 1EJXC 2OGYA 2PDKA 4DWSA 3SGZA 2PDNA 5T91A 1E15A 4Q8MA 1V77A 5I3FA 1OY0A 4JTEA 1QOXA 3W7HA 4J5NA 4XIAA 4C6MA 2V3EA 5IFTA 1YBQA 1R3RA 4WDXA 3NQ7A 4Z2IA 5CEWA 3R94A 1M04A 4FXJA 1W1B1 2GVLA 2D2JA 3DC0A 1V03A 3OODA 4OZOA 3GTIA 2RGLA 1O4UA 1HF6A 3VINA 4IX2A 4HHLA 4M3PA 3EOLA 5C8BB 4L9ZA 1AJZA 3BSMA 2QPSA 5F7UA 9RUBA 2L5HA 4DRSA 1L2QA 4PCNA 2O4QA 2JIEA 4UTJA 3OVQA 4UNKA 2AAAA 3WQOA 4S38A 4DF1A 1PZ1A 2CPUA 3FYYA 3P0WA 4LUIA 3DFTA 3RHGA 3TN3A 4XKYB 3QMRA 4QEHA 3L67A 5I09A 4D6EA 2YA1A 1XIBA 4XISA 2FJUB 5HXMA 3QY6A 3WLNA 1BHGA 2QDGA 4YYFA 1DJQA 3SFKA 4RZBA 3MCNA 4CNUA 4ML9A 3SFWA 5F2GA 4GVHA 4OV4A 3EWXA 5T8GA 3DFHA 1WDDA 2CZEA 3RIKA 3TQ0A 3W1NA 1ZPTA 3LV6A 1H1NA 3S47A 4FPSA 4K8GA 1EBGA 3W37A 1DHPA 2WNZA 4JTGA 4I7VA 4KRUA 4ZQPA 2QCNA 4H8NA 4H8HA 1BTCA 1XFBA 3OBAA 4GMEA 3JU2A 4J3WA 4OBTA 4WCJA 4XO7A 4OE7A 3B8VA 2O7SA 3M0ZA 5TF0A 1HL8A 3QR1A 3N15A 4O50A 4XV0A 3O6AA 2OQHA 3SCQA 2R24A 3IVTA 3TA6A 1TYGA 1UIPA 1JRCA 2OT0A 4GBDA 3WLSA 5D2VA 1MI3A 4L61A 1SVDA 1BYBA 2PEVA 2DVUA 3PPHA 1T99A 3VIJA 4JEQA 3BPWA 3GWQA 1TPH1 4Q8PA 5D33A 1A5BA 1OT1A 3O63A 1NIUA 2E40A 4B92A 4NZJA 1RR2A 4S3AA 3BW4A 2HE8A 3CTLA 5BCAA 5EMKA 4IFKA 3WF1A 3DC8A 1MUMA 4IWWA 4UCGA 3KL5A 3FJ6A 3S2CA 5JU6A 3OGSA 4O8AA 5FF0A 4LS1A 2GQAA 4QG6A 2EPKX 1XXXA 3NM1A 1A49A 1YPFA 2FHFA 3BWWA 4G7EA 1VEMA 1UR3M 1D7KA 4JKMA 4X60A 1NVMA 4KESA 1TUFA 3W07A 2ZWYA 3URNA 4E8CA 1VH7A 4POCA 2DSKA 1DWIM 1V6VA 1JPIA 1QHZA 3HTWA 1CLXA 2OB3A 2PDYA 5XIAA 2YCKX 3CEUA 1OINA 1KFKA 1MEHA 1VLWA 2WK2A 3DERA 3ITTA 4OUIA 4CD7A 4UOZA 3HZ3A 2ZC1A 1UR8A 1KNWA 1T6MA 2NUYA 3WF0A 5BMXA 4HPNA 1RP8A 2WBKA 1XH2A 2J27A 1QO5A 5CGQA 4OQVA 3TLLA 5LNRA 4FNUA 4DWDA 3VIHA 2PZ0A 2WO5A 2A7RA 3QKZA 1DEDA 1KFCA 1LTDA 1GGOA 1RBOB 2A3HA 2PODA 2J7EA 1QUMA 3AZRA 4Z1DA 1W8SA 4HJFA 1ZQ5A 1MXGA 1QDSA 5I79A 1X98A 1F8MA 3TQPA 3ZSSA 2F8QA 1NDWA 2OO0A 2WNNA 4DZHA 3U0HA 2J9YA 1UH2A 4U3CA 4PRWA 3G0UA 3G1FA 1DTUA 2EPLX 2FDSA 2HNEA 5L6UA 3URAA 4UTTA 1JZ4A 4PEEA 4Y9AA 3KX6A 1EO7A 1W54A 3N2CA 1W2PA 3U4FA 4HU4A 4J4KA 4CUCA 2WM1A 3ES7A 3PBYA 6REQB 1FCUA 3W87A 3GDKA 3STEA 4GGBA 1EUNA 1AUSL 2D2HA 2WVUA 3BANA 4ACZA 4TX6A 1QT1A 5LA2A 1FWCC 3S5YA 3B0VC 5JIPA 2C6QA 3E2VA 1DQWA 5D8WA 2AQVA 3NQFA 1VFTA 2QJGA 4WD0A 3B04A 5CAHA 3BC9A 4HNTA 2DZVA 3GTXA 3V18A 1V51A 3WNOA 3A47A 1HKIA 3ZJ6A 1DIKA 1D3GA 5IDZA 2WPGA 3QZAA 3GYEA 4QX4A 3TROA 1XSJA 1DXIA 3TX9A 1B9BA 3OIXA 2Z1XA 2HPIA 4C6EA 4HK6A 1WAWA 3NOYA 4O4VA 3GHSA 3FX4A 1KM3A 4I6VA 2GL5A 3B3DA 4R27A 4C6QA 5A3HA 3DXIA 4MY9A 3QEZA 1XDMA 2J25A 1HO4A 1XPYA 1R5YA 1KTNA 4U10A 4ZODA 1N8WA 3GR8A 1EWEA 1IWBA 1FOBA 4UTIA 3GS6A 2X1IA 1JCXA 1F6YA 4QS5A 3QHNA 4LEQA 1XUZA 3GH5A 3FKRA 4BKNA 3LPGA 1S1RA 3ARPA 4FHAA 4XZBA 1CPUA 1YNPA 2VFFA 1E4NA 2BOGX 3MMTA 2WMIA 4D6IA 3L2IA 1MRAA 3LGDA 1R2SA 1JZ8A 3KUMA 3WFLA 3BURA 3VFCA 1RK5A 4ZQNA 4ACYA 3MHUA 1R2TA 3DESA 5C5YA 2C1IA 3STCA 5FL0A 4NVTA 1CXFA 3U5UA 4PFHA 1Q8JA 2VEMA 2QVHA 3LSCA 1UZ4A 3IEBA 3DKJA 3V0SA 1S2CA 5HOSA 3FEMA 1Z89A 2PTWA 4D6HA 2OEMA 1GORA 4EPDC 4W84A 2FH6A 4HZ6A 1TV2A 3VX1A 1VEPA 1Z32X 3DYPA 2HROA 1FA2A 1DWFM 1SYTA 3CV7A 4GZEA 4K68A 3EDJA 3DYMA 2ZICA 2YCIX 1GKPA 3B9OA 1FH9A 3KS5A 1B9ZA 5AFDA 1LRTA 5DX7A 1FUYA 1A3WA 4HN4A 1QWKA 3GG7A 4E3VA 4ZSTA 3VGHA 2F2HA 1E1CB 1Y5VA 4EPEC 1UASA 1CGUA 4JX4A 3O6YX 4NG3A 1XW8A 4DLFA 1L9WA 3UXDA 1HKVA 3CEPA 3WYZA 4V33A 3ABSA 4W5UA 2D23A 3ZVHA 1EJUC 4QFUA 3HMJG 4HCHA 1GVIA 2NW0A 5C55A 3V4BA 3GZ3A 1ZNNA 1HNYA 3W85A 1H7RA 3TK7A 5H91A 1LWIA 4KIRA 5CLTA 3UCDA 2XU2A 4QLKA 4ZTYA 4UIOA 4K8HA 1ENUA 3L4TA 4O18A 3U2EA 4ZOBA 5A5WA 3NCOA 4LOCA 1GQKA 3Q2DA 2H90A 3WLOA 1O5KA 4ZVJA 2V5BA 2QCLA 4R34A 4WXZA 5A6AA 3GW3A 1NTHA 1E5JA 3IK4A 4HSNA 1OABA 4JHMA 2ZOXA 2Z6IA 3MW7A 5A8MA 3BLFA 1TJRA 3QTPA 1EP1A 5G4WA 3VFLA 4KKXA 5JBEA 4DJFD 1PPIA 1VHNA 1XCFA 1TCDA 3WK1A 2TRSA 4QNWA 2YYUA 3IGSA 2I1OA 4IQJA 3NSMA 2XJ7A 3PBVA 4A3UA 4XG1A 4ZO7A 3LPOA 4ZQCA 3WDIA 3UJFA 3TYAA 2WKGA 4TVCA 4DWSC 4PMNA 1N55A 2RJGA 4DNMA 3N6JA 1US3A 2UZ9A 3RN6A 2H8ZA 1FFRA 3UG8A 2V2DA 3SRKA 3LENA 3C2RA 2QCHA 1TWZA 3T40A 4IFOA 4IUGA 3GDRA 1RVGA 1F3XA 3M0YA 3N2OA 4OU1A 3ZWTA 5D02A 3N1AA 5HUOA 1FXPA 3I10A 4P7NA 3AHXA 3GVVA 4MWAA 1X6NA 3LOTA 3TSDA 3R10A 1K1DA 1BAGA 4ZB2A 2B7OA 1TO3A 4PUWA 1W3KA 2GGGA 1PX3A 4PSRA 2RKXA 3G5EA 4JFUA 4S3CA 3H12A 4HA0A 4TVDA 1A3XA 2ZIDA 5FF7A 2JF7A 1D3HA 3MO4A 4V1XA 5JMUA 1S46A 3COTA 6XIMA 3GVQA 1KXVA 4K6AA 4IIDA 7ENLA 2A3EA 1QI0A 5FF2A 4Z0SA 2PLJA 1V0LA 1VYPX 3UWYA 3DFQA 3GNNA 4PMOA 2PDBA 5F4SA 2WVSA 1OCBA 2QUTA 3QLLA 4HB7A 2ZZ6A 5HJLA 3N3TA 1W6TA 2O9TA 4XBJA 3W3OA 1EIBA 1XYLA 2VELA 1BVZA 1W1TA 4PUNA 4UC5A 5A8NA 5DMLA 1ISXA 2W0UA 2DW6A 3QV7A 4KF1A 3LZ5A 1U5VA 1SFSA 2FVKA 1IEXA 3SJ3A 1A4LA 3ZZ1A 1W1YA 1TSIA 3UGVA 1HQTA 2PWFA 4IJBA 3GNDA 1DJGA 3BXWA 1EC7A 4JYDA 2NQZA 3SSZA 1Q7ZA 4BI6A 1BXCA 3NPXA 3KBVA 3QV6A 3W7JA 4PH6A 3DI1A 4GJIA 2TODA 3MVIA 4GZIA 4AD0A 1UR0A 4GNJA 4GKTA 3DZ1A 3ALGA 2BXYA 4ZSUA 3SDOA 4DN1A 2HTMA 1F76A 3QR3A 3AHTA 4GH1A 1SO5A 1H5YA 2QQ6A 3KWXA 4UTHA 3K1GA 4LRTA 4X63A 4PL1A 2Y5SA 1KV5A 4JN7A 1VCGA 4Y7EA 3K1DA 2DIEA 4YTTA 4O14A 4GUIA 2BOFX 3TYDA 2ZRUA 3P14A 3IJQA 1F61A 5GPRA 2PTZA 2OLSA 1UBPC 2QULA 3WENA 2ZZ2A 1H7XA 1SGJA 1BKSA 1QR7A 1GVSA 1WKYA 2D2GA 2XH4A 3A12A 2IXUA 4GI8A 4XZIA 2NUWA 1O5RA 2GQ8A 4QQUA 1HKJA 3MSDA 2D0GA 2FKPA 1Z6KA 2XVNA 1W3IA 3DKLA 3NA8A 4LGXA 2A3BA 3NL5A 5EBUA 4WKAA 2PA6A 5C71A 3IVSA 4PUMA 3NWRA 1FBAA 3EOUA 3W76A 5DCBA 1V08A 4JIIX 5HPOA 3WZ0E 1B3OA 4AWTA 3MANA 1AMKA 4US5D 2JEPA 4O1FA 3KTXA 1GTEA 4JKKA 4D6JA 4C60A 2P10A 5DMMA 2RJHA 4YVVA 1GOMA 1W5OA 1FCBA 6CGTA 2A6NA 4X61A 2INEA 3MMDA 4I9JA 1SZFA 1UP3A 4UQBA 5I07A 4ICNA 2VEGA 4IM4A 1OT2A 2CNCA 2I5IA 1IF2A 3UCQA 2CFFA 1GQLA 1FP9A 1UKTA 1AQMA 2HVNA 4PUJA 3KCLA 3IIVA 5C6MA 3CC1A 4Q7BA 1MW3A 2NVAA 1W9BM 4UTTC 3L68A 3E9AA 3HIJA 1XLDA 4LF1A 2O9PA 4GO8A 3TSMA 4LS2A 4DJDA 4L1XA 4IMAA 2WWDA 2ZX5A 3FAWA 3P5YA 2TMDA 1KD0A 5LGXA 2IQTA 1OFRA 4F2TA 2DU2A 3MKVA 5A8QA 3LI1A 3QV8A 4IMDA 3QY8A 1OADA 3DHDA 4XAGA 3NL2A 4JFTA 4K36A 4PMVA 3OTRA 2VP8A 5IOBA 5EMUA 5I00A 4XVEA 3QMTA 3P84A 2C13A 1FWAC 5AVHA 2ZDSA 2CKRA 4L80A 1HL2A 2B7PA 1NU5A 3R1ZA 1PS9A 3W7CA 5H6HA 2G97A 4FR6A 1A53A 2B4GA 2GJLA 1RCQA 3NQGA 3TVAA 3IV8A 1XQLA 2VC9A 3S2JA 3QPZA 5BOEA 3OIHA 1WP6A 2H6RA 3RU6A 3S5ZA 5GNZA 3SCTA 1M7OA 1U5JA 3W6LA 1XJBA 4C1NB 5HNRA 1UP0A 4WXYA 4MNLA 3ZLGA 5G2IA 1EGMA 4YWIA 4N9CA 3WBXA 2Z24A 3BSGA 3HOJA 3OPSA 5CAKA 3QOMA 4U2YA 3GXDA 4J3VA 3C6CA 1YPXA 1I2RA 4V27A 3ZO9A 3P7YA 2WHKA 3NGJA 3L4XA 4AY8A 3B05A 3OQEA 4OWGA 4Z2KA 3R5EA 3ZFHA 1J0HA 1AFSA 1E4IA 2VEPA 1Q7MA 2XFWA 3P93A 1YXDA 3R13A 1OF8A 2HISA 4X2PA 2ADAA 3VIGA 3PBWA 2WSPA 5GQBA 3O16A 3MWCA 3W7KA 3NO5A 4D8ZA 2QMJA 3QHMA 1DIEA 2ALDA 3BTNA 1UW9A 3NDOA 4LY4A 5E6YA 4BR1A 3MDWA 1ZJAA 3WF4A 5CZ0A 1E0TA 1IEIA 3EYPA 4YS1A 4F2BA 4CNOA 2A6LA 3B4YA 3EA3A 1R86A 2ON3A 3KAOA 1F2JA 2RUSA 2V3DA 4Y8EA 3BICA 4LAMA 3G3MA 4D2JA 2WZMA 2GOUA 3CU2A 3ICJA 5KZMA 1DJZA 1Y5WA 3J7HA 3LUTA 1IWPA 3PM6A 3OJGA 4QJ1A 3R0KA 4RNHA 3KOFA 4KEVA 3SEPA 5D8ZA 1NY1A 3L0GA 1OFQA 3B4UA 1IHIA 3E0LA 3LCLA 2ZUUA 4NRSA 3QXBA 4JTCA 3TWBA 3LXCA 4HTBA 1XRFA 2WMHA 5CG0A 1P7TA 1GHSA 4UTMA 1UD3A 2HCVA 4I3GA 4XAZA 3CMFA 1IXPA 4D9PA 3VGEA 3RRXA 2PU0A 1KC7A 3QQ0A 5HWNA 2V69A 1SMDA 3W53A 4ZFMA 1V4YA 1W3HA 3A4XA 5FEZA 4JBRA 1RJRA 4JTRA 4L4LA 4YYCA 2X05A 5CBJA 5CH9A 3FLUA 3D3AA 3GW0A 5LKYA 4PMYA 2EO7A 5C7HA 4AC1X 5BXTA 2XGZA 1Q6QA 5I02A 3EXTA 4TV5A 2ZXBA 5T26A 5JXQA 3WLJA 1SJAA 1WPCA 1IQ8A 3IAQA 2WC3A 3EBVA 1PIIA 3S3GA 2RDUA 1GVEA 3B9NA 3VC6A 2PWUA 5LHEA 1JF6A 1R6WA 3K30A 3TJ4A 4XZWA 3E0IA 5A95A 1ECQA 1TVPA 3CH0A 4KH2A 3S0CA 2AL2B 1AH3A 2C1GA 4ATLA 4KMQA 3AMLA 3EX6A 2OLHA 2BVTA 3ARYA 1R3QA 3ZOAA 1EX1A 3WX7A 1V3IA 4PUEA 2D73A 2ZTKA 1QOQA 1EB3A 2PRMA 1DV7A 4JR5A 2O9OA 3UR5A 1JDFA 4UTUA 1Y0EA 4LFYA 1EGVA 4G2DA 2INFA 4PB5A 4AD2A 5LZLA 5F2LA 4DAIA 1VYRA 5HUPA 4IPNB 4E5TA 5T9BG 3D6NA 4LB4A 1CCWB 4H2HA 4H1ZA 1SZNA 3NURA 1ZP3A 3Q65A 1QK2A 3PPFA 3FFSA 5AC4A 2GSJA 5EBAA 3KOYA 2BGSA 2OELA 4AY7A 3H2AA 3LPFA 2EPNA 2E8ZA 4JQ4A 1LQ0A 2TPSA 2R9RA 2OYKA 2DZUA 1K7XA 3T4WA 1K8CA 4B5SA 1Q6CA 4JGDA 4MWAC 3U2OA 3CIXA 4PMJA 4U2ZA 3ABOA 2QUNA 1OM0A 3B03A 4MDPA 5BXRA 3WBYA 2VGGA 4F48A 2E25A 1KRCC 1J01A 4QDWA 3DI0A 1L6WA 4AXKA 3M07A 4PUDA 2VRQA 1TX2A 1ZS2A 1D9EA 2ZX8A 3R79A 3MY9A 1S5TA 1WQ5A 4CD6A 1D8WA 1OYCA 3E38A 3MYOA 3GTFA 4HOXA 4CNTA 1JPMA 4Q4KA 2QS8A 4A29A 3CPGA 2Q8XA 4R53A 1XDJA 2C15A 1MXDA 4AEFA 1GOQA 2PURA 3ZR5A 3WD0A 4Q4RA 4R7OA 3SO7A 4QISA 5I3KA 2INZA 2IUZA 1B3ZA 3T08A 3KHDA 2D0HA 3RPMA 1B3XA 2P3ZA 3FSUA 1CZ1A 1OX4A 3IJLA 3M0KA 1L0PA 3C2VA 4MHBA 4KWUA 3OB8A 1KV8A 4RJEA 3NO1A 4MYAA 4GVFA 3LRLA 2Z28A 2WZEA 3MWAA 2J9ZA 3GD6A 3W22A 3N13A 4JNMA 4AZ7A 3JR2A 3L12A 2ZUVA 4FIQA 4R88A 1VQTA 2YYTA 1TWWA 3OHMB 3LS9A 4KCUA 4MB4A 3I7RA 2RHGA 4UR9A 3WD3A 4FR1A 4B2DA 1ADSA 3S46A 4BQ5A 1KWKA 3W72A 4U28A 4WJ8A 5T9CE 5AYBA 1J2WA 3BW2A 4QDMA 1T40A 1XF0A 1BQGA 5M03A 1V0NA 4CQCA 2BDQA 4P8XA 4A3YA 2YXGA 3WEMA 3NL6A 1R47A 1VGAA 3EXSA 3NZRA 3GM8A 4E2DA 1VBRA 4YL2A 2DZTA 3ZR6A 4BS0A 3W2UA 4MJ4A 1RSCA 4TVUA 1SFTA 1J0ZA 1XBZA 3LERA 1JCLA 1TJ2A 3M5ZA 4N2YA 2KAUC 3BAIA 4ZQRA 1MWOA 1I0DA 1JZ6A 1BWKA 3WLTA 1GVRA 2V3FA 3WK3A 4KCTA 4EK7A 2OOGA 4AXNA 2E6YA 3S9YA 1F4AA 3VNKA 2NXGA 4LUJA 4FOUA 4C5ZA 2ABBA 3UCCA 4KS0A 5DMYA 4TOQA 1UUOA 4E4PA 3GNOA 3PY2A 5H8UA 1A5KC 1VD6A 2QUVA 3USZA 3O3RA 4YN5A 3R58A 1PYMA 4D6CA 2XH2A 4JQ3A 2PB1A 1MNZA 4E2BA 4JYFA 1LDCA 3EZ4A 3EA1A 4MB5A 3AIEA 4S23A 1HN1A 4LYRA 6PTDA 4IL2A 3TN5A 2WAGA 2Y61A 4IF2A 4CQBA 3G6MA 1MNSA 3O05A 5E70A 4EAYA 1TREA 1B3VA 3F5KA 3KFTA 7TIMA 2A0NA 3VKBA 3LU2A 2HXTA 3FKKA 4QEEA 1C9WA 3BLEA 4D6GA 4NJHA 3R8GA 1JDEA 3IACA 4JTQA 1HJWA 2CWNA 2YPIA 4WHBA 2QLYA 4MNJA 1UWSA 3W73A 1I2NA 3WQEA 4N02A 3U6WA 4B3LA 4IMEA 2VURA 4L6DA 1GJUA 1UROA 4LNCA 2A3LA 3CQHA 2YLAA 1E3ZA 4TX8A 4A22A 4I7UA 4EX4A 2VTFA 1J9YA 1Q3NA 4B5VA 1HGYA 3BL3A 3DG6A 1RCXB 1F73A 5AC7A 3EWCA 4G1NA 4G8TA 5EA9A 2YDSA 1OZQA 1IGSA 3OZMA 4AX6A 1E6ZA 5XINA 1YRRA 3L4UA 2E1WA 4YTUA 3WIJA 4S3EA 1EOKA 3CPUA 2XG9A 2VX6A 4GRSA 3LCGA 4XZ9A 3E12A 1BG9A 3BQ6A 1I9CB 2GJXB 2B7QA 3TCSA 3C86A 3R0DA 1OGSA 1ADDA 3EX3A 2KX9A 2OSYA 4AAJA 3KW3A 1R87A 3MUIA 2HE5A 5I77A 1XIGA 2WZIA 2CHOA 4ZR8A 3P3BA 4GY0A 2J78A 3KE0A 1CGVA 3WDPP 1AL8A 1BVWA 3MUXA 5HQMA 3UPMA 1RPKA 1ADOA 3HGOA 2QCMA 3HN3A 1ODUA 3PTQA 2WYSA 3P61A 4I8DA 1LBMA 4QJ4B 3RITA 1LRNA 3W29A 3PZ9A 3EAUA 2ZUTA 4XBKA 4Z2LA 3UPBA 1SUXA 3I7SA 4TX9A 2DT3A 4Y90A 1SSDA 3AI0A 3W75A 1FHDA 3KBNA 2ATSA 2FPVA 3TSBA 1JQVA 1PE1A 4Y9OA 3C3NA 1U30A 3ZT7A 2OFJA 4M8UA 2W61A 4H7ZA 3QZ6A 1QU4A 4O19A 4W7WA 2C71A 4XKMA 1JCJA 5M17A 1QASA 1SMAA 4NAEA 3HQNA 2JF6A 8TIMA 4NNCA 4GYFA 5GJNA 2HRWA 4XD5A 4FALA 1ZALA 4AH7A 5DN1A 3W7EA 3IARA 1E6SM 3WF2A 1XLGA 1BXBA 1JF5A 5HJYA 5K4ZA 2ASHA 3Q4DA 3XISA 2FB2A 3BOFA 4NHVA 1Q4WA 4C7GA 1E9LA 1K8ZA 2X40A 4DPPA 1YX1A 4YHGA 2BG5A 3TMQA 2FVMA 4N4QA 4BK9A 1ECEA 3AYRA 4S2CA 4NZ4A 2OOFA 1TB3A 1W8GA 4JTTA 2ZUNA 2PPGA 1J93A 3PHAA 3UG3A 4DZIA 3CUJA 1AJ2A 2DV0A 1UOZA 1XGDA 3G3DA 3OLEA 4UFJA 2CU0A 4JTFA 1O6IA 1QCWA 2AGKA 4V28A 2VEKA 3WQGA 2DJLA 5EFFA 1FKWA 2PGFA 1XYAA 3B0YA 1GTHA 1UCWA 3TJLA 5GNXA 1HTIA 1U83A 3WK2A 4LTSA 4PMUA 4QJ3B 3V75A 4J9JA 5AHEA 1DORA 4DO6A 3UU0A 3V1HA 3SM0A 3NXLA 1M1BA 4AF0A 2YZRA 3L0KA 3WF3A 1BYAA 1EZ2A 1V8EA 2PLMA 3JZUA 3SRFA 4IPLA 2ALRA 3FGCA 3R2GA 4RXGA 3SBFA 4IX0A 4DNHA 5E1QA 4PBFA 2VI0A 3PB2A 2A7NA 3V3WA 2Q3OA 3QVQA 3VDBA 3MUZ1 4HHHA 8XIAA 4GOAA 2G4JA 4OOZA 3TN6A 1UZHA 2X1UA 4LRSA 3ZMRA 4XK2A 2XUCA 4E4FA 1W1IE 5D2TA 4N9BA 1KBJA 3BLKA 4QSFA 3GC5A 2I7GA 3WNNA 4EPBC 2GSHA 3SRHA 1FY6A 3BVJA 1OQFA 3N6HA 3U4AA 1EEXA 4X2RA 1B54A 3T0BA 3GE7A 1IXQA 1EUAA 4UQ9A 1B31A 1UD6A 3UZZA 1KKOA 3DUGA 3ITVA 3V1PA 3AUJA 5AVNA 3WELA 5BZAA 1MEWA 2VC6A 3RAOA 4UMAA 3V0TA 4GINA 4MB1A 1DE6A 1ITCA 3NUKA 3UYCA 5A69A 3PUDA 3UG5A 3NPWA 5IHSA 3W2MA 2ZRXA 4WY0F 2FPYA 5DT5A 3LHUA 4ZE4A 3G77A 3BGAA 1WDWA 3ITLA 1IYXA 2VDGA 2WKLA 4E4UA 3T44A 2XVPA 3WH5A 1KM1A 1HKWA 4ZOEA 4E2VA 3LHWA 3P81A 1K77A 3G1VA 3RUBL 4PEKA 3R43A 4H6QA 1WCGA 3BCDA 3WFZA 1X7FA 2KZHA 1WOBA 2ABAA 2W62A 4OECA 1OSEA 3M0IA 4AZHA 2XSXA 5FJJA 3UR2A 4LNYA 2G0WA 3ES8A 2G50A 4D6DA 1XS2A 2WVVB 4JIPA 1O66A 1QW9A 2VFIA 3PTKA 4IIGA 2X7WA 5AY7A 5G1MA 2NT0A 3DG7A 3E2SA 4U5IA 4QE4A 2V63A 2PI6A 2DP3A 1XCWA 5AYYA 4LC8A 3T1GA 3ZSTA 3WCZA 4B9ZA 1A5CA 4ZE5A 4AZGA 1QPRA 4IGNA 4Z2HA 4YTRA 5I0DA 3GLCA 3OBEA 1K9TA 1I8JA 3DN5A 5CPMA 3QW4B 2NX3A 3L23A 1P6WA 3W7PA 4L5ZA 1X8FA 3L4VA 1UOKA 1SR0A 4GNKB 3T42A 2HDJA 2WW5A 3WG6A 3LCXA 3ZVIA 1PZ3A 5LSMA 2VHLA 1BD0A 4M1BA 3MZNA 3HGJA 5BROA 3H7UA 4HYWA 2OCZA 2DVXA 4QAWA 1YDVA 4W85A 3G0XA 4H9YA 4R9XA 1GZGA 4DUOA 4PCPA 3IIXA 3PJWA 1ZBKA 4OFCA 3N4EA 4JOMA 1VJZA 5HBFA 1QXLA 4PFMA 5FOOA 3AIRA 1NFPA 3AIQA 3PFRA 2BASA 5BRPA 1B90A 2NV9A 1YXCA 2QR6A 2OU4A 3GRIA 4GD0A 4BEUA 1Q7QA 4AIOA 3PTDA 4WY0B 1TPVA 4MUZA 5F1VA 5SWUA 3QF0A 4GACA 1DIDA 3SQMA 1VFLA 1WDQA 4FAMA 3SCWA 4J1OA 1LLOA 1TA3A 4A8IA 3IRSA 1L6GA 2FZBA 4K1WA 2HBVA 3WJWA 3TWAA 2BY3A 3EX4A 5BRQA 1CDGA 5HNNA 2W27A 2AKZA 1GVOA 5AYZA 4JTUA 1UPMB 1VFFA 7REQA 3WJZA 1FTXA 2NX1A 5I3GA 1UZDA 3W86A 3CL7A 4LH8A 5C9UA 4UWMA 2J8GA 3LLFA 4XX6A 2GDUA 1TTQA 4DXKA 2A7PA 3NSNA 2PDJA 3IPWA 3RX4A 1KCKA 4PUUA 4YVXA 5IDIA 4XVDA 3B8UA 2VEFA 1JUEA 2GPTA 5BMWA 1P0BA 4YXGA 3QMSA 4C65A 2GVJA 2BP1A 4B5XA 2J7GA 1LWHA 2JK2A 3W26A 3BAWA 3VOCA 2QCDB 2GGJA 2WSYA 3I6RA 1T8QA 1J4EA 4Z1YA 5HQLA 1JFXA 3VUSA 5ABFA 3W7NA 1JJKA 3MBFA 2OWXA 1EDGA 3HGRA 3SY8A 1EH9A 5E0CA 1RZMA 2PC8A 5HMSA 3GC4A 2V5JA 4GYPA 2J6VA 1PL9A 1E1FA 4YU1A 4NP7A 1HJQA 1SZGA 2YCLB 4H7CA 3TV8A 3W0KA 4PODA 1VPXA 3SADA 2O92A 1AD1A 1EHNA 4E2OA 3POHA 5K9XA 2WNWA 4AFYA 4KIEA 1T5AA 2FGLA 5C2XA 3WDQA 1KRMA 3UBPC 3S2NA 3MP4A 1E9YB 3NVTA 3HB9A 1MQRA 4WJXA 1CXHA 1V3HA 3UFYA 3UZYA 3VDHA 4RV8A 1AQHA 1H63A 4F0LA 1H7WA 3A4JA 5CSYA 1TPEA 4JPGA 1VFOA 1AZ1A 1E0UA 4PRRA 4UQCA 4IPIA 4JQ2A 2VOTA 1QO2A 2J7BA 4KWVA 1S1PA 4ZB0A 1RALA 3VABA 4PMZA 3VOJA 4R85A 3S2LA 1U2YA 3DDMA 4EWJA 3HA1A 3JS3A 2VCBA 1UC5A 3DHUA 1W5NA 3CYJA 2HPMA 3GIQA 4XD3A 1W32A 1GYNA 3BK0A 4UTFA 4Q4OA 1UH4A 5XIMA 4I8YA 4G7FA 4LCRA 3N2XA 4JX5A 4E8DA 4ZB5A 3QC0A 4AZCA 1ZZMA 3A3WA 1P48A 4UZSA 4AY1A 4GISA 4J2PA 4AMCA 2D69A 4AZ5A 1C29A 2Q09A 1WB0A 4FOKA 2Z25A 2PP3A 4GQRA 4DXXA 3E0WA 4O1AA 2CZ5A 3CZEA 4FF5A 2BVDA 4F66A 2V5KA 3P62A 5CCZA 1W9XA 4L9XA 4CEXC 3UJEA 3G24A 2QF7A 3F7JA 1W3TA 2JALA 2I5GA 4ICCX 2IW0A 3OBKA 4KWOA 1W9VA 1R3YA 3PNUA 3GXMA 1AG1O 3W1MA 3KBMA 2OX4A 1W9UA 2FZDA 6TAAA 3SI9A 1VLIA 4GIYA 1TTJA 1J6OA 1JAEA 2DQWA 3B8IA 5BXPA 3UWEA 4J7RA 3GU1A 1TPC1 1DL3A 1I45A 1WDRA 4H8VA 3EWYA 4V15A 4ZO8A 1M41A 1OD8A 3BW3A 1KWGA 3FXYA 3TCEA 2GWGA 1UB3A 3GVRA 4RX0A 4DY1A 1E5NA 3V0UA 1JYVA 1QPQA 4RV3A 4GABA 3QFEA 1M3UA 4LYPA 3BG9A 1ZENA 2R1MA 2REQA 2YJQA 1REQA 3ZXWA 2E1DA 1K8YA 3ORWA 4AIBA 1J8VA 5A8PA 3AUOA 1ZL1A 2E7FA 1ONRA 1JXJA 4GG9A 4HVXA 4W93A 3FHQA 4TTUA 2FYMA 5BOFA 3TW9A 3GG1A 1TV8A 2PDPA 1UMLA 3XIMA 4ZGYA 3H2NA 5EMLA 1BSLA 2DW7A 4UTLA 5AC6A 2HWGA 3L0NA 3HJEA 1P1XA 3VIKA 1R7OA 4EOUA 3AROA 4REQB 4IOTA 2VCCA 1ZAJA 4UFHA 3S5OA 2P50A 2VUYA 1NOFA 4LVAA 3ZLFA 1VJSA 3ATYA 3PZOA 4QROA 5JBDA 3W1PA 2CLEA 2GK1A 3TR2A 5DEZA 4DBUA 1IR2A 3CO8A 3VXGA 1XLKA 1QW7A 1TR9A 5F4XA 2EBNA 1JZ7A 2OWWA 2XIJA 2TSYA 5H1WA 1LT7A 1OX6A 1XSKA 3FJLA 3VE9A 1XIMA 3AMGA 3MMWA 3W81A 3CHEA 2D22A 2BXZA 4MOZA 1PHQA 4IP5A 5CSRA 4CN4A 1V0MA 3CZLA 3NEVA 2PDUA 3PJTA 3SR7A 3CAWA 1UH3A 1AW1A 4FI4A 4UFKA 5AOUA 1KCLA 2SFPA 4Q6XA 1CGXA 3VU2A 1KBLA 2W5FA 2Z2BA 3SCVA 2QV5A 3AO0A 3II1A 3P0XA 1MVYA 4QXIA 2OYLA 5TIMA 4ORMA 1KGWA 1VB9A 3AJXA 4GZJA 1A5NC 1CGWA 4LV9A 3A3HA 4LUTA 3LTPA 1UPPA 4LAKA 3O7UA 3IUDA 4JTJA 3PJUA 3SCPA 2QT3A 2BY0A 2ISVA 2W67A 2Y70A 2WCSA 1W5PA 4WDUA 5J04A 4GPNA 3MVTA 3VMNA 1RUSA 3TIMA 3HQ1A 2XVGA 4D72A 5FSEC 1LG1A 4HQVA 3PJXA 4B5UA 4LWWA 5DLCA 3H24A 2ZA2A 1XLEA 2XM2A 3QJAA 1KM2A 3ME3A 1RJPA 3EMZA 3DHPA 3NZPA 3G0SA 1V6WA 4UB9A 3KOWA 3NQDA 3UPWA 1PTAA 2XIQA 2ODOA 2ZUWA 2DZXA 4M51A 1YEYA 3GDMA 1ZAIA 4RW5A 3T0CA 2WSKA 4QCFA 5MKGB 1ZBVA 2JKEA 3LG3A 1G01A 3K4WA 3EOOA 2HV5A 3W7GA 4NJGA 4MY1A 1AMYA 3OLDA 1KQYA 1R46A 1XYZA 3HG5A 4BQ2A 4PTWA 2WB5A 4WRHA 2EGZA 3W00A 3OU8A 1F3WA 3WUEA 2YSWA 3QYQA 3CASA 5FIPA 3GNXA 4MADA 4MYXA 3LQLA 3IUHA 3KP1A 3SB0A 2C7FA 1TUXA 1RK6A 3E02A 2QNEA 4KFOA 1WYIA 4GIEA 3UWUA 3EDFA 1H11A 3VIOA 4E38A 3WSUA 4L4OA 3NQAA 1XR2A 2FIQA 1UUMA 3DHFA 3EEGA 4MZ8A 1XC4A 2Y62A 5BYWA 5HANA 1V02A 3UY7A 5K2ZA 1YE4A 1TTIA 3GK0A 3IANA 3STFA 1X1NA 1W37A 3I4KA 3CL8A 4IPJA 3WMSA 1ZRQA 4ZO9A 4KBXA 1UBSA 5F2IA 1KR1A 1CT5A 4I7WA 1R2RA 1DWGM 5EYWA 5DCEA 3GNPA 1ISZA 2E28A 2FTWA 1H49A 2CXGA 3CM4A 1EC9A 1JCNA 2P53A 1FWEC 1YNQA 1H61A 2VFEA 2Y6ZA 1EBHA 2Z00A 2YDAA 1J0IA 3BAKA 1OD0A 4WJEA 1WOAA 2F7FA 1WA3A 4AYGA 3M0JA 4I5UA 1NEYA 3MT1A 2Z1VA 3EWWA 1ALDA 3LTYA 4QM1A 3R8HA 2DSZA 5U7SA 3CJPA 4FLQA 1SO4A 3RU8X 2V8ZA 3HJZA 3IGXA 2ATMA 3GG8A 3VTRA 4L65A 3LCHA 3FYPA 4E8GA 3NQMA 5FKYA 2PWGA 3E6EA 2MNRA 4LBSA 1DQXA 1UD5A 1SW3A 5BXSA 5KITA 2A5HA 1PJ9A 1E6NA 1HFBA 4I90A 1XIJA 3SURA 2QCFA 1ONXA 4G9PA 2OEKA 5BRBA 1F07A 3IJ9A 3ABZA 2WJZA 1U5HA 3UJSA 3T07A 5AC8A 4H7VA 1OC6A 3CK5A 4HJWA 2IKHA 3TYCA 2PRHA 1EPVA 1B3YA 1BYDA 3T09A 1J0KA 3V5CA 2P8BA 3WMCA 2AGTA 3GZAA 3K13A 1BEUA 4NYUA 4WDWA 3NQVA 3CV6A 3M6YA 3PP7A 2GGEA 1ME8A 1AJ0A 3R89A 2F61A 3B06A 1T0OA 2Q01A 4I6KA 2DQXA 4ADTA 1XD1A 4ADSA 2PLKA 2V30A 3URBA 3OVRA 4O0QA 2VVNA 3LHYA 1L8NA 5KINA 1XGEA 4IG2B 3PPCA 5FD0A 3GXTA 4PSPA 3VGFA 3L2MA 1S2WA 3QR0A 1I1WA 1N8IA 3H7VA 3F5LA 3AIBA 2ZX6A 3UP8A 4GYPC 3CYVA 1XICA 4JTAA 5GJPA 1ONEA 3UY8A 3UETA 4DI9A 2WSRA 4JFSA 3GFXA 1SZEA 1ZHAA 2BY1A 2DVTA 1JVNA 4YIWA 2E5DA 4IT1A 3OZYA 2UV8G 4UUIA 3EB4A 4CCCA 1DJWA 1F7BA 3WLQA 2IPJA 1ISWA 2HS8A 3GIYA 3I3DA 4Q8WA 4GVIA 3EWZA 1JDCA 3H4XA 3M0VA 1PWLA 2A1YA 3E3HA 3GXPA 2J62A 1LBLA 2JIWA 1J79A 4UTWA 3VCCA 2P0OA 3W7MA 2P76A 3CZJA 3SIMA 1TJ0A 4XD4A 4GLEA 2BGNE 4MWAD 4B3KA 1RD5A 4UXDA 5HULA 5C9XA 2JFEX 1VFHA 3HG4A 4F9JA 3ZS4A 1E3XA 2BB0A 4AVNA 2ICSA 4FS9A 1KFBA 4H01A 1YADA 3IWPA 1AQFA 3KHJA 3BSHA 3VA8A 1NH6A 3B0PA 3JRKA 5K3VA 4KEMA 2IS7A 1H50A 2XWDA 3BLPX 3G1RA 1NOUA 1RLCL 4AD3A 3ENLA 3WJXA 3WQ4A 1Q6DA 3GR7A 1UWTA 3KM8A 4PMRA 1K9FA 1GVQA 2B31A 4NI3A 3IIOA 2PBGA 3RO8A 3CNYA 3FA4A 4G5DA 3VDGA 3GAYA 4Z0JA 3VMOA 3INPA 2ZUSA 1CLKA 2UBPC 1MW0A 1J6PA 4WKFA 1X7IA 2J7HA 3GYCA 5D9OA 1W1VA 3W7DA 4C1KA 2DY3A 2WHLA 3LI0A 5LIWX 1KLZA 1GQNA 4HNVA 1ZUAX 3W38A 3LCWA 3ZQ9A 1XLJA 3NGFA 4QRNA 4K8EA 3M0MA 4N9DA 2Y8UA 2YDRA 2ZXDA 3H4WA 1S5VA 3M41A 1EDTA 1RQBA 2QEZA 1GNXA 2R82A 4MKSA 1M53A 5DF0A 1G4TA 1O60A 3TN4A 5ECVA 8XIMA 1A0DA 1OC5A 1J0JA 4HPXA 2OG9A 5B80A 3AZSA 4LAZA 3WD2A 7A3HA 3S6DA 4AYSA 2QMKA 2WZHA 1P5BA 1WUFA 3GKAA 4M29A 3L9CA 3A13A 1TPDA 4IMCA 2PP0A 3N29A 1WBJA 1UWUA 5I78A 1XBVA 2VJXA 2OODA 5FJIA 2E6FA 3FCPA 3VKJA 1AL7A 1OFDA 1A5OC 2C91A 1WXJA 3GXNA 1E6QM 2XGBA 3UXLA 1VFMA 1O5XA 3WMLA 2BHZA 5ABTA 1B3WA 4DHGA 1XUUA 4LUYA 2FPTA 3BAJA 4MB3A 2E77A 4DBDA 2CWXA 3O6DA 3B97A 3RF9A 3CO4A 3DOPA 2I14A 4L4MA 3HPXA 3ABRA 1QNPA 7XIMA 1AW2A 3E0VA 2F6XA 4F2UA 1YQ2A 3IGHX 5D04C 1N8FA 3FXGA 5CZTA 3CMGA 4OV9A 3F2BA 3MB9A 2GSEA 3PSVA 2VNCA 3AMKA 3S83A 4LXFA 3HV8A 3CHFA 3QC3A 2BZNA 4H6KA 3WDJA 1SJDA 2PDQA 2DGAA 3U57A 3VNZA 3E96A 3LQGA 1XIFA 3AISA 4Y2WA 3DGBA 3NVDA 3CV1A 5REQB 3MI3A 3BUVA 3OZOA 3MZ2A 1LQ2A 1KFWA 3WK0A 2HZGA 4GX9A 3U2CA 5B7YA 5D2XA 3LMZA 5G4HC 3OQ8A 2EXOA 1LF1A 1LZOA 1PYFA 5DT7A 1I4NA 1LT8A 1XGZA 5I24A 3M6DA 5AC5A 5CSSA 5HR6A 3AHVA 1H7PA 2PCEA 4GFSA 3UZ5A 1TTPA 1XKJA 3G1AA 4ERIA 1KFJA 3E1F1 1G4PA 2CW6A 5EPDA 4WSJA 4GUHA 4HNNA 5A2CA 3NQ2A 3P60A 1US2A 3BGJA 3TNOA 1QVBA 4BWLA 4XZNX 4F4RA 1YYAA 2QYGA 3KLLA 1U1UA 4ZXOA 3RRAA 2YCJA 3ARSA 2GZXA 2J47A 4JFVA 2IMRA 4AD4A 2E67A 4NNBA 1K9EA 4DWSB 3QPYA 4F0SA 3M0LA 3H53A 4FO4A 4DJDD 3KEHA 4PE8A 1A47A 4MVAA 3PG8A 3NQ6A 5CGTA 1J11A 1YNYA 3KRZA 2ANUA 2QDEA 2Y7GA 1YBQB 2ACSA 1OIFA 1UMYA 1K3UA 5FI8A 2PC4A 2Z7GA 3VD9A 5BOOA 1PKYA 1WZLA 4ATDA 4IMGA 2FVLA 1NDZA 1ZAHA 3VX0A 1IWAA 4ICMA 4XBSA 2GJRA 1UKQA 1C91A 2GGHA 3T05A 4QHRA 3MC5A 1BRLA 3PANA 5HWJA 3K8MA 3VIPA 3M46A 4LT9A 4UOQA 3OEXA 5G4EA 2V68A 3B40A 1W1ZA 4U33A 5HA7A 2QGYA 2QZRA 9XIAA 1EGZA 3UG4A 1FKXA 1HVQA 3PZGA 4U5KA 4NJIA 2VZTA 4CNPA 4LUSA 3FY1A 3FDGA 3SZ8A 4XAFA 3EOEA 1W56A 3LMYA 3SCUA 4H2CA 2ISDA 3QW3A 4JIRA 3EDDA 1B1YA 3KBSA 4GXPA 4EXQA 1KKRA 3SY5A 3VVGA 1R9XA 1QBBA 1TV3A 1XLIA 3VNDA 4FEZA 3LK6A 3W1RA 3GU9A 3WEOA 4E0CA 1DIOA 4N4PA 3ZT6A 1Q45A 2DH2A 2C0AA 2CITA 3ZJKA 2EG7A 1H7OA 1YW1A 1JD9A 1RJQA 4X22A 4JFWA 5JH2A 1CW2A 4Q8TA 3GTNA 4ES4A 1DWJM 3H7RA 1VS1A 5LHFA 1FVPA 1JRBA 3TE9A 3FA5A 3C52A 2DZAA 3UD6A 2FMOA 1UWRA 3E74A 1KBIA 1TJ1A 2V5LA 3CBWA 3GXIA 3THAA 4IFKB 2PAJA 1BWVA 2YXXA 4JYEA 4W8BA 4TU1A 2I17A 2ZBTA 1C8VA 4DBWA 3ZLHA 3VGDA 1TQJA 3GG0A 2YBUA 1F74A 3OZPA 2W79A 3AFBA 3PZMA 3V7PA 2P5NA 4G7EB 1MUCA 1HXJA 2IPFA 3UXKA 4GQ0A 1LUCA 1V3KA 1K6WA 4Q4PA 2ESCA 4Z1AA 3QTGA 1Q63A 2C14A 1XRVA 1JIBA 1GOOA 8RUCA 4LALA 1NSJA 4Z1CA 1N2VA 4AU0A 4PGLA 1GJWA 3DAQA 3QBUA 2DT2A 1HKKA 2V6AA 4HGXA 4B15A 5G2HA 3IRDA 3M0HA 4C6IA 2H9AB 2NQLA 1M9HA 2DZWA 1KM6A 1ISVA 4V2XA 1XKYA 4JZ5A 4IQEA 4IIFA 4MWAE 1RA0A 3NQEA 3RMEA 3LEPA 3WN6A 5KTLA 4QP0A 4P8WA 1Q6LA 3PAOA 3BQ5A 3WD4A 2PP1A 3W6MA 2ZTJA 5IBXA 4JTDA 4QAIA 2WMKA 1P0DA 1CB2A 3KRBA 4J40A 3IUIA 1VPQA 4TXEA 5M3WA 1V6UA 1PB0A 5GVJA 3GTHA 4UR7A 2AMGA 1KO0A 5CG7A 3ARZA 5M2FX 2PDWA 4MJZA 3ARXA 5I2UA 3TFXA 3F5JA 3I3BA 2X1TA 2WVTA 2HSAA 2X0HA 1GG1A 2X42A 1XLFA 2R94A 5K7JA 1P6BA 4P7QA 4XSMA 2QW5A 3VNLA 3EKLA 4U3AA 3AU2A 5I7GA 4GIAA 2P1FA 2WNQA 4B5NA 2XVLA 4L64A 1FWHC 2QF8A 3USBA 4ACZB 1YMYA 2Y1HA 1E73M 4UTWC 1JXKA 3H2OA 1NAL1 2J24A 3MKKA 4AWSA 4H9ZA 4DUWA 1BXNA 3BH4A 3T2PA 4BF9A 1IZJA 1FCVA 5IXEA 1J5SA 2PWDA 3WQCA 1YTDA 4WEVX 2BVYA 3B9AA 2DEPA 3MCMA 1YXYA 1R9YA 3V35A 3REQA 2VD8A 3MUCA 1YIXA 2O9RA 4DVOA 4H9MA 1R3TA 3SUSA 4AVFA 1VIWA 1ME7A 3AICA 2WMFA 3EEZA 2NSOA 4NQ1A 4GZ7A 3HU7A 3WQPA 3PZQA 1D2KA 4LVGA 4L1WA 3BAXA 3PSWA 5CSUA 1IZKA 2IKIA 1WE5A 3FIGA 4D1JA 3CUXA 3KS6A 3W7OA 1EA9C 2GVYA 2VDIA 5FJTA 3QSRA 4CGTA 5D9PA 2PUZA 1NWUA 1GOIA 4ZENA 1UWIA 2CCRA 1NWSA 3SSJA 1ML1A 3M43A 3ZT5A 1HP4A 5CBBA 3CH9A 4PULA 3WDHA 2VWTA 4S39A 1Z41A 4MAVA 4JTLA 1XINA 1R3SA 3V5FA 4O57A 8A3HA 3VD5A 4G56A 3MA8A 3BZGA 2PE4A 1TZ9A 3OGVA 2UY5A 1THFD 2WMIB 5I5RA 2Y0FA 4YLWA 5I06A 4K39A 4JHZA 1KXQA 4GI6A 4XQ6A 2ZZ7A 2ZUMA 1VBGA 3AZTA 3DEQA 1ICSA 4C90A 4RW3A 3W1TA 4CU6A 2XTKA 4BEQA 1ME9A 4H41A 4HCLA 4JICA 4JAWA 4CCEA 3M64A 4GK8A 2FTYA 4B2DD 3C5QA 4NJKA 1JULA 3HGSA 3C3UA 1TPB1 5FJRA 3K8KA 3KDOA 1GWJA 4NJJA 4N9EA 1IT7A 4Y9NA 5AYXA 1HP5A 4FMVA 2WJDA 4H19A 2PCQA 3NSXA 1PKLA 2WJFA 4HU0A 3KZPA 4LPCA 1NQKA 3D46A 3T0TA 1TWSA 3PVFA 2XSAA 2NXHA 3L5MA 3RCYA 3S2MA 3P6LA 4HNCA 1C90A 3HPAA 1MW2A 1FWIC 2QDDA 1XYBA 1LJYA 1MDRA 1IZCA 1KBBA 6ENLA 3YPIA 1FWRA 4OUEA 4NASA 5JBFA 3VE7A 4NU7A 1R85A 2QUMA 1EKOA 4J3UA 1ICQA 1NWTA 1NP2A 3C2FA 3ZVHB 1DPMA 2PGEA 2VRJA 1FHUA 2PGRA 4GXMA 4B4FA 2EJ1A 2A3AA 4O0ZA 1S3TC 1GPWA 1Q8AA 4QLLA 1L6YA 1V79A 5TBOA 3PK7A 3PFMA 1XC6A 1MXSA 5A6MA 3UNDA 3CHDA 3ANUA 1HX0A 3WL1A 1WKFA 2V5DA 1I2OA 3CQIA 3CWNA 4M24A 3NG3A 4P8VA 2FZNA 4FLOA 3SIZA 2HK1A 2VRKA 2YOCA 2Z1WA 3G6LA 5H8MA 4FLRA 1BSIA 1M68A 3WNKA 2I16A 3WQ6A 2Z29A 3L65A 4Q4SA 2CYGA 2ZRYA 1LL7A 4DO5A 4AIUA 1E6PA 2G41A 4HZMA 1WNOA 4FXRA 1EF2A 3Q45A 1XRSA 3F4NA 4PYSA 2G3JA 3WMBA 2E9BA 1WBHA 2WCGA 3G18A 2VZOA 3KBWA 3LYEA 5BWAA 1KFEA 2OWCA 4BWLC 3EDEA 1PKMA 5EMJA 4DZAA 3UWQA 1S5MA 2G8ZA 3DH7A 2FGBA 2CKSA 3W1UA 5IHRA 4BA0A 1F3TA 2BNJA 1K6AA 1QWGA 2YL8A 3HG3A 1UR9A 4F0RA 4IFRA 2VCAA 4N0RA 4AVOA 4ONVA 3W1AA 2VDHA 3TJIA 1XDLA 1UKPA 5DBTA 5LIUX 3ONCA 3GSMA 4QQ3A 5FF4A 5E5CA 3TAOA 3C2YA 4LBUA 5D9MA 3UERA 2HK0A 4LS0A 1Q2SA 3TW7A 4MWAB 2Y5EA 2NXIA 5G5IA 3N9RA 4XKYA 2A85A 2QDHA 2Z0IA 1V3JA 4B90A 1PCWA 5E9AA 2WV8A 2H3DA 1OK4A 3ISIX 1ESWA 3D3FA 4HNOA 4C91A 2FHBA 3UXAA 3T78A 3O0FA 1FHVA 4Q8QA 4YPJA 2OX1A 1ZJHA 4AHPA 3EX1A 5BU6A 5LYRA 3W25A 1RA5A 4NL1A 3DX5A 2OQYA 3EKZA 1MSSA 5CPLA 1CGTA 4MFEA 3JZEA 3SCNA 3RK8A 3RLUA 4UFLA 3N3MA 2V9DA 4K37A 3K4AA 1OG0A 2EQDA 3VNMA 5J5DA 4NSBA 2YBTA 2AQWA 5HK4A 1WUEA 2G3IA 1EHAA 5LA0A 2PWEA 2VVSA 2ISWA 3IJ7A 1C7SA 4OKDA 5FESA 4F79A 4BHYA 2FJKA 3UGRA 1XQKA 4P61A 4HZ8A 1H41A 1PHWA 5M5DA 1VRDA 3W2JA 3BJTA 2G37A 1K02A 1TG7A 3OP2A 1T96A 3IIPA 4NILA 4HNUA 1H0GA 3D0CA 3NZ1A 5DQPA 2E0PA 4GC3A 3PTMA 2XN2A 2XZ9A 4PCFA 2NVCA 3LNMA 2W3ZA 1E1EA 3K4DA 1J12A 1AZ2A 3V5OA 4KRZA 2CLLA 2WLZA 1UIOA 3QPEA 1A3HA 4P2VA 4LQ1A 3AIUA 1V6YA 2POTA 3O15A 5TNVA 3CIVA 4IP4A 3ITOA 1R0MA 1LLZA 2FFIA 3ABQA 2GYIA 4BY3A 1GHRA 3P5ZA 1OYBA 4QJ5B 3S6OA 4IHCA 4F3HA 1BLIA 2DFAA 5LA1A 3LBMA 4XTDA 3Q37A 4MKVA 2NZLA 1ZJBA 2HMCA 1EXPA 1VEOA 3TAKA 1QPOA 1HT6A 2HBXA 4PL2A 4A4AA 3OHIA 1XPGA 1TJPA 3MV01 2PBOA 1LOLA 3VZYA 4K2SA 5CPTA 2C18A 5C9ZA 2GQ3A 1DTNA 3UWWA 3C0LA 2YKKA 3ALFA 7PTDA 4MNMA 3A9IA 3MHGA 4RPQA 4XWUA 3AWNA 3W7RA 1QNSA 4HZ7A 2VXNA 1QTWA 4A3QA 2CC0A 3FEQA 4F9DA 4YTQA 2WMJA 4A2RA 1JZ3A 4INFA 1M65A 3TC6A 2D2OA 2XPKA 2D0FA 4PMQA 2UWFA 1C8XA 2W4XA 2VR5A 4FP1A 5EMMA 4EF9A 3WLRA 3ECQA 1RY0A 3SQSA 4GNVA 5A6BA 5IBXC 3RDKA 1L8PA 3LA4A 3FHAA 5D38A 4Z2JA 1C3FA 2W92A 2GUBA 3UR7A 1XLCA 2OR2A 1FP8A 2PWVA 4DELA 5AHIA 1PDZA 1G0CA 1HZYA 2PD9A 2WKJA 4ZBCA 2YB4A 4XAYA 3ANVA 3K5XA 3TQVA 1QI5A 4C6DA 5CZSA 1A0EA 3PR2A 2YXOA 1UZ1A 6REQA 4NX0A 1EYEA 4DXVA 2QHAA 4J35A 4KFNA 3I6TA 1HJXA 1M7XA 2O4MA 1C8QA 3F1QA 3T8LA 3N6QA 2CEQA 3MTWA 1U1JA 1AD4A 4M56A 4MUPA 3LXAA 3GBEA 1ZP4A 1IXOA 3WQ5A 1DJIA 4GVGA 5BWFA 3EB2A 3EPOA 2OZ8A 3GR4A 3AS3A 1XCXA 4FB7A 3RYSA 3TTOA 2J75A 3WLLA 1UQYA 4FNRA 1M7JA 1PXGA 5LNSA 5U4NA 3TLQA 3W23A 3FJNA 1JGMA 1MRQA 5HR7A 4OGZA 2Z2UA 7CGTA 2VUNA 1M03A 1ODZA 1UYQA 1N82A 1RP9A 2P88A 2VMFA 1O94A 4PB3A 3CT7A 4PBGA 3SJNA 1W3NA 1L6FA 5CZJA 1X6UA 2CLOA 3WD1A 2VC7A 1XSIA 2DPEA 1PSCA 4XZMX 4DF2A 1E9ZB 4J3XA 4FLSA 2G4FA 2NSXA 1NDVA 1EXBA 4ZXLA 1MO0A 4HPGA 3TMLA 3D5HA 1KR0A 1WDSA 4CN1A 1XL9A 2R1NA 4YWSA 3A6OA 3MV11 4H83A 1A5AA 1RCOB 2UY4A 3QKEA 1QPKA 2XFRA 3UWVA 1BYCA 2NX9A 2EPHA 3ITYA 2NLYA 5E9XA 2BV9A 2BOEX 2W63A 1FDJA 5C70A 5PTDA 1DKWA 4CNNA 4GHRA 3TP4A 3QOKA 4CQDA 3LY0A 3MSGA 1PTDA 4GIRA 1EO5A 3MI2A 3RLGA 4DJEA 1CBGA 2PD5A 3WBWA 5FJUA 1F9CA 1DWAM 2YB1A 5DBUA 4C6FA 4LY8A 3EA2A 1CEOA 2Z4GA 1QI3A 4HMCA 3UZXA 4NYYA 4XAPA 3CAVA 3RX3A 3O2LA 3VILA 3IIZA 5JIWA 3GDLA 3T55A 3CGTA 3QV9A 2GVEA 2H9AA 3GH4A 5C2CA 2GDVA 4XB3A 3BOXA 6TIMA 1E1CA 3A64A 2Y8KA 3Q94A 1LCOA 3LBCA 3NDZA 4GQQA 1P7TB 3T81A 5DCDA 7ODCA 2UY3A 4MZ1A 3N2BA 3R8RA 1CLVA 1YPIA 4GY1A 5AHFA 5C9RA 2QAFA 1Z7AA 4ZO6A 2PFHA 4M6VA 2V81A 4TTGA 3PG9A 1PWMA 4LW7A 3WO8A 5A8OA 3SY1A 2AL1A 3DFSA 3GB6A 3RCMA 1H0IA 1VP5A 4B9YA 2NQJA 5AHNA 3I68A 5EL1A 1WXZA 5CPQA 1X96A 1EC8A 3OVGA 1A5MC 4WQ6A 4B3ZA