1JUEA

1.8 a resolution structure of native lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords dihydroorotate dehydrogenase A
total genus 116
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jueA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jueA01
1QMLA 1QOQA 1GTHA 2YFOA 1E51A 3S8HA 5AB3A 1TPUA 4UTLA 3W86A 1T96A 4YWIA 1HL2A 1KM0A 1XBVA 2ZDRA 3TJLA 1OFRA 2C16A 4ZQMA 4E2DA 1ALDA 3LDVA 3W7IA 4XTIA 4Q33A 4RK8A 1UBSA 3STEA 1M7OA 2Y89A 5F2GA 4M7TA 1W54A 4S2BA 1K7EA 2FPTA 4DF0A 5LNUA 2P1FA 1WA3A 3EWXA 4RCXA 4W9TA 4IPJA 3GR8A 3EKLA 3CC1A 1JRCA 5AHNA 3VFLA 2PRMA 3IVSA 4NNCA 1OFQA 2VENA 4OV4A 4BR1A 3CT7A 5HWMA 1DL3A 3P62A 3C61A 5LKYA 1OK6A 3FKRA 3A21A 3G1HA 1K8ZA 4AHQA 4O1CA 2A85A 2YCEA 2QDHA 3W88A 4KFOA 3G18A 4BWLC 2PC4A 3PB0A 2X1SA 1JCNA 3L65A 5KMYA 1EIXA 3W23A 1BWLA 4TMCA 4MFEA 2DJXA 4UFHA 3G3DA 5AC8A 2J24A 2FPYA 3T4CA 2HMCA 3IVUA 1W3TA 2WV8A 2TSYA 2DZXA 1IF2A 1KM5A 1XUUA 1L6SA 5LGXA 4A22A 4O1DA 2O7QA 3KAOA 2W0UA 4CNPA 5C5YA 4LW7A 3DAQA 3TW7A 3B0UX 4GUJA 4XBKA 5FEWA 4IMCA 1QO2A 2QEZA 4UTWA 4AWTA 5KZEA 3LCGA 4FNRA 4NXSA 3S1WA 2E09A 4PL1A 5G4EA 5HINA 4JTGA 4WY0B 5AYZA 1OF6A 3A9IA 3LHTA 2KZHA 3U6WA 3A24A 2AQWA 3SGUA 2TPSA 2EKCA 1R47A 3TROA 3R2GA 5BMXA 4DBEA 1GT8A 2Z6IA 1LZOA 3NO5A 3INPA 1XDLA 2CFFA 3QEZA 2EPHA 2Y7GA 4PA8A 2NWSA 2QUTA 4DELA 3W22A 5K9DA 4UFKA 2J9YA 4O0ZA 3M5ZA 4O28A 1RQHA 1W3IA 1QWGA 4ONVA 3KRZA 5K2ZA 1LBFA 3PULA 2I9EA 4R33A 4YXGA 5FEPA 4CQ9A 4HIBA 4HPXA 1EP2A 4UUIA 1QFEA 4X9SA 3S0CA 2B0MA 4IOTA 4LVFA 3S42A 3TCEA 3KRSA 1OVDA 3FJLA 3UY7A 3VE9A 1OYAA 2VEPA 1ZNNA 3W1RA 2GVJA 4A2RA 4MKNA 4O16A 3G8RA 5AOUA 2VEKA 4JTIA 3LXAA 3LLFA 3W2KA 4R7JA 1S5VA 3WK3A 1OABA 3CQ0A 3QPZA 3GAYA 3HGOA 1NF0A 1VYPX 4DPQA 7TIMA 4QAIA 1TTQA 2GVGA 1UB3A 3KX6A 3EWZA 4JTJA 4X22A 1VCVA 3W1QA 4KWVA 4JD4A 2NWRA 2A4AA 1H63A 4ORMA 1ZALA 1OYCA 3LHUA 3G1YA 3G0UA 2QCFA 4WXZA 1NAL1 4UMBA 4Q32A 1Z42A 3LRMA 5DY2A 2CWNA 4FX8A 4QISA 3F1QA 3W1PA 1FDJA 1UCWA 2NUXA 3OEXA 4JICA 6ALDA 3UZ5A 1QDSA 3Q58A 1Q6QA 3BK0A 3KVMA 5AYYA 1IXPA 2C19A 1XFBA 1PVNA 2O7SA 1BEUA 1TPFA 4XKYA 4PL2A 1KFKA 5BRBA 5LNRA 3N3MA 3R12A 2H8ZA 2QCCA 2QCMA 2A7NA 2CZDA 4AHPA 5CZTA 4XWUA 1SZGA 5HWNA 3TXVA 3MBDA 4A2SA 1VGAA 3W2UA 3TIMA 3O05A 1N8FA 5MHBA 4O18A 3UWUA 2DZPA 1KBJA 1MEHA 3L5LA 2X1RA 1EA0A 1W3NA 5I3FA 3TMLA 1LTDA 1OFBA 4MJMA 5K7JA 1KLYA 2HSAA 3I68A 4LVAA 1LRQA 3B8DA 4I7WA 3TUUA 3L2IA 4A21A 2R94A 4K39A 5HR7A 4EVZA 5F2LA 3CU2A 2WJZA 2E5BA 4UTIA 4BF9A 2V5LA 3F4WA 1JUKA 1FWSA 1WQ5A 3PG9A 1Q6RA 4ADTA 4RJEA 3QW4B 4Z0SA 3DZ1A 3KVKA 4UMAA 3NL5A 3THAA 1I45A 1H1ZA 1H51A 1QR7A 2VEIA 2V2HA 4MY9A 2QUUA 4LVDA 4D2JA 2BWGA 5CGQA 2ABBA 4OBTA 2BLEA 4A29A 3L0NA 1AG1O 5IBXC 4DXVA 1ZAIA 1X8FA 2Q3OA 3C2EA 3LCIA 4IX2A 5T26A 4QNWA 3ABSA 4LV4A 3CTLA 4WY0F 1ZFJA 1UUOA 5FF2A 3LXCA 4QM1A 2C13A 3GKAA 2VC6A 4UTTC 3W9ZA 3MYOA 3RLUA 4DO5A 4ZQRA 5AC7A 3TDFA 5LNWA 2NX3A 1W56A 4WJEA 3NG3A 3M6YA 4IWWA 4FHAA 5C2XA 3NQ2A 3FA5A 2B7PA 3S9YA 5IM51 1C29A 2RHGA 2VELA 2Y85A 4MOZA 1S3HA 1DQWA 5DBUA 5AC6A 4P61A 3KHJA 3W7QA 3NPVA 4IMEA 2Z6JA 2FDSA 2OJPA 4IXXA 3L0GA 1GJPA 1EEPA 2E1DA 1TQXA 1YPFA 4NX0A 3T44A 3R8RA 1TPH1 4AF0B 3DI1A 2YPIA 4GE8A 3F03K 4K6AA 1OFEA 5I3HA 1W0MA 2OT0A 2RFGA 5I3GA 2ZA2A 1WX0A 4ZQNA 2E5CA 4DBDA 4LC8A 1QO5A 4YMZA 4NZFA 2EF9A 4WD0A 3EXSA 5TBOA 1LBLA 1MZHA 1KM1A 4NVTA 4LOCA 2VFGA 1VQTA 1TYGA 5KZMA 4CQAA 3STFA 3WK2A 3GKFA 1B4EA 1K02A 4LS1A 1TMHA 1SFJA 3M7WA 2YZRA 4P2VA 2VFFA 4E2BA 3C56A 3PB2A 3NM1A 1KTBA 1FWRA 5G2HA 2DZUA 3E49A 3MMTA 3MO7A 1H60A 2JGYA 2AAMA 2ISWA 1D3GA 1K8XA 3FS2A 3NM3A 3NQVA 1YDOA 3EXRA 1PHQA 2NX1A 5D02A 5EY5A 1LOQA 3AO0A 1O5XA 3P80A 2OT1A 3Q37A 1R30A 3MBFA 2HS8A 4TU1A 3N9SA 4NJGA 3SR7A 3GDMA 4Y90A 3LHYA 1JCJA 3C52A 4WX2A 4ML9A 3DBPA 1IIHA 3G1FA 3IRDA 1QPNA 5D05A 5FEZA 1I4NA 3E9AA 3G22A 3ABOA 4JTUA 5D2XA 4LRSA 4HNTA 2WNQA 5FF3A 3FFSA 2ZRWA 3GK0A 3C0JA 1KM4A 2GVLA 4HT3A 4KFNA 2B7QA 4ZQCA 3EWWA 2QAPA 3N2MA 4IMGA 1FDZA 2NXHA 4NJHA 3B05A 2C0AA 1KFCA 1FCUA 4OU1A 4WZHA 2BX7A 3W2NA 2LLEA 4EF8A 2ZRUA 1LOSA 3N2XA 2QDGA 2RDUA 1Z44A 3SSJA 1GWJA 4HNVA 3TH6A 2YFNA 3HBLA 4NNBA 1I2PA 4UR8A 1DJQA 2JKAA 3IGUA 3KOFA 3IIVA 4BI5A 4OWGA 3NL2A 4K8HA 3N19B 5GVJA 3LHWA 1FCQA 4LS0A 3IIZA 4LC6A 3BG5A 4AMAA 3C4UA 3KVLA 3S5YA 5J5RA 3L66A 4FO4A 4ZZ9A 3DHDA 3W7PA 3NNTA 1FCVA 1H7WA 3P82A 3BPWA 2FIQA 2CLOA 3PC0A 1ZJIA 3NQGA 3QF0A 3WJSA 2YSWA 3HG5A 3FIGA 1THFD 2FJKA 1SW3A 5D2VA 5H2ZA 4C1KA 4ADUA 3V1PA 2WO5A 3STCA 4NJIA 4NJJA 2ZTJA 4AF0A 2V2CA 3W7CA 5DELA 3NL6A 5AFDA 5U4NA 1AK5A 5CG7A 1P5BA 1FCBA 2J27A 5CPNA 3QPYA 1F76A 5HWJA 3THQA 3C6CA 3BG3A 3UYCA 1NVMA 1KLZA 1F6PA 2QJGA 3HGJA 4EIVA 1I2RA 1ICQA 2QCNA 3ABQA 4OQVA 1YTDA 1LYXA 1G4SA 3W72A 5EKYA 2VFDA 3SJ3A 2ZCGA 1RD5A 1M6JA 1DKWA 1YTKA 3DFPA 2Q3RA 3QRHA 3TAKA 2P10A 2RH9A 4RR4A 4GUHA 5F1VA 1EWEA 1B3OA 4JX6A 4JTHA 3P60A 2A5HA 3NQCA 1H7XA 4JYEA 1XM3A 1VPXA 1YDVA 3ZS4A 1MEIA 3E12A 1JVNA 3MI6A 2WKJA 3HG2A 1SFLA 2XFWA 4O10A 3W74A 1SUXA 1H5YA 3NAVA 1XXXA 2JBMA 2YW4A 4I7UA 3TC6A 3O8AA 2OCZA 4MUZA 4XBSA 1FBAA 4TMBA 2AGKA 4GWEA 4JDBA 1L2UA 5G2IA 1G6CA 3UWZA 1JCXA 1OJXA 4AH7A 1NSJA 3TQ0A 3G1SA 4DEFA 2DJLA 1K7XA 2GUUA 1DV7A 3BLFA 4AXKA 5HUOA 5DBTA 1SZEA 4RKAA 1RZMA 3HF3A 3W73A 4UTHA 5K4XA 1JQXA 4O19A 3VNDA 3BGJA 1IXNA 1Q6OA 2QCEA 3WK1A 4HSNA 3CIWA 1ZAJA 2E6YA 2VFHA 2ZZ4A 3P61A 3HPSA 4HNNA 5BMWA 4MY1A 1VLIA 1W5MA 1VH7A 1KTNA 4HKPA 2V81A 2ZZ6A 3UPWA 3NQAA 1YADA 1WDWA 5C6MA 1GVRA 4JX5A 1VHCA 1VS1A 1VYRA 1OX5A 4OGZA 3DU0A 1QNVA 4K8EA 1GPWA 3MWAA 3DHFA 4GXMA 4JR5A 5F4WA 3OVRA 1G4EA 1SU5A 2JKEA 4NJKA 2XN0A 1EPXA 5H91A 3G1VA 4CNOA 3I7QA 2WQPA 3BLIA 1TB3A 2CU0A 2ZZ1A 5A5WA 1KM3A 2X1TA 2WSQA 5CZ0A 1YDNA 3BO9A 3IIPA 3TSMA 1KFBA 3EX1A 3W76A 1XCFA 3HPZA 3PAJA 3AJXA 2RDWA 1RQEA 1F05A 1JULA 1TPDA 2X16A 3WK0A 4PCFA 4UFJA 4NT0A 3N14A 4UMCA 2GPTA 1FWWA 3IV3A 2Y70A 2C3ZA 3LCHA 2BXVA 3RMJA 1FWNA 4E38A 2V8ZA 1UASA 4AB4A 2A21A 1KFEA 3TK7A 4LWWA 4LU0A 1XUZA 2H6RA 3HMJG 3FJ6A 1MXSA 4UTWC 1DJNA 3LXBA 2A1YA 3O15A 4IUOA 1AL7A 4ORIA 1TIMA 4GUIA 3TW6A 3U8GA 1X1ZA 2EGZA 2Y7DA 1VRDA 5CSRA 3EXTA 3GVGA 3M1ZA 3MHFA 3TA6A 1XL9A 4Y96A 2B7OA 1MO0A 3C2RA 3LLDA 2FQIA 3LGEA 6TIMA 3NGJA 2A6LA 1WYIA 5FF4A 3A22A 1ZENA 5F1UA 3ZR4A 1Z48A 3CLMA 1C8VA 3GNDA 3NDOA 3PUEA 4ZQPA 1TO3A 2YYUA 1SSGA 3W7JA 2YR1A 3DFQA 5CPLA 4GUFA 1PV8A 1QPRA 2ZA3A 1UUMA 3GIYA 1PL9A 1FX6A 2VEMA 3PWAA 1OFAA 5KZDA 1R46A 4YL2A 3CWOX 1X7FA 3P74A 5D38A 1TTIA 3W87A 2YX0A 1H7OA 2V5BA 4TR9A 3M44A 4LRTA 4WY0A 2YDAA 4DF2A 3NZRA 3L5MA 3LRKA 3DXIA 4GNJA 4O53A 3T7VA 2ZRVA 3O63A 4LVBA 1W1ZA 3UZJA 3W1XA 2A6NA 4YCPA 5EYWA 4UTTA 2JK2A 3S1VA 2BSLA 3MHUA 3TKFA 2YYTA 4LV9A 3L68A 4UCGA 1EP3A 2V0TA 5CZJA 4MFDA 3ATYA 3W7OA 1PE1A 3OHIA 3GDRA 2CLEA 4Y8FA 3P67A 1I2QA 1EX5A 1G7VA 1K8YA 3TR2A 3W7MA 4O52A 1PIIA 1U83A 1YYAA 3SECA 2UV8G 3EEGA 5AHFA 4RZ4A 2XN1A 1OFDA 2ZZ2A 5F4SA 5DLCA 1SO4A 2WPBA 3HIJA 3LI0A 3QFEA 8TIMA 4H6KA 3M43A 4HHPA 2V2DA 1TJPA 4DO4A 3C2VA 4KFPA 4CCEA 4O0KA 1OF8A 5FF7A 1QCWA 5BOOA 2VFIA 1O4UA 2EAWA 4O1AA 4JYFA 1B4KA 3O16A 1F73A 3EB2A 3GZ3A 1F74A 3GXNA 4IQLA 4LS2A 3W3OA 1D9EA 3B0PA 4RV8A 3MI3A 5D30A 3T40A 5E0KA 5D32A 2Y63A 3M41A 3O6YX 3G1DA 2ISSA 3I7SA 3CPRA 4K38A 5AHEA 4I7VA 4UFMA 4MPQA 4ZMGA 3W2MA 2CZ5A 3CHVA 1TV5A 3LV5A 1GYLA 1H1YA 3SGZA 4QNEA 3M5VA 1TPVA 3C2OA 3L5AA 4NU7A 4O50A 3YPIA 2PE4A 1XDMA 1YXCA 1B9BA 2FLIA 3QMTA 1P0NA 2YW3A 3QQ0A 4JIQA 5LHFA 3W6YA 1QAPA 4KKXA 3U2OA 3BV4A 4LUIA 1A5CA 3LCFA 3M0ZA 1I2OA 4FNQA 5FF0A 1HO1A 1SZNA 3RNDA 4Z1AA 4ZVJA 4JTKA 3GLCA 5G1YA 3S5NA 2FPVA 1AL8A 3QSRA 3SFKA 2E6DA 1RV8A 3TAOA 1SR9A 5BW6A 2RDTA 4ICNA 1KA9F 3BG9A 1G69A 3MUXA 3LCLA 1M7PA 2H8XA 1SSDA 3NEVA 1B57A 1SQ7A 2J9XA 5AHMA 1PCWA 5HNRA 3OBKA 1DORA 1WOAA 3LTSA 3W85A 2BTMA 4M19A 1LOLA 3PS7A 1X6UA 3P5YA 1GVSA 2Q8LA 5LGZA 3CWNA 3G3MA 3JRKA 1LROA 1YXDA 1W8SA 3LV6A 2CLKA 4HSOA 3B06A 1W5QA 3S5OA 1TREA 1XKYA 1TV7A 5D33A 3NL3A 3UY8A 3GX9A 4YLWA 3I7RA 4FX6M 5EPDA 3NQ6A 4TO8A 5LZLA 2C1HA 4Q4KA 1A5SA 2HTMA 2J6XA 1VCGA 2RKXA 4FIQA 3KVJA 4O4WA 3WFAA 4TIMA 3W75A 3NXFA 4UXDA 1JR1A 3DFOA 1DQXA 2QCLA 3SI9A 3TSDA 1V7YA 3A23A 4XTDA 1KFJA 5CSSA 4POCA 3W07A 2Y61A 1K7FA 4XUGA 3SIZA 3GDTA 3JR2A 3PM6A 1GQNA 3RK8A 4Z0JA 3EWYA 2NUWA 3NPUA 3SY5A 1CW2A 1AW2A 1JCYA 4JYDA 1LP6A 3K30A 3W7NA 3BGGA 2OZ0A 5DN1A 2C15A 4K7YA 4ZL1A 3IIOA 3M16A 1TRIA 4JXCA 3P84A 2ZZ7A 2X2GA 3HGSA 3HJZA 3PBVA 2Y88A 4OT7A 1KM6A 1RPXA 4XQ6A 1GVFA 4HPJA 1XI3A 3PBYA 3R13A 5TQLA 4LUJA 3TMQA 4EWND 3GR7A 5K3VA 3TXZA 1TPWA 1HTIA 1Q45A 2PRHA 1IIGA 3Q2DA 2NV1A 1ME9A 1WOBA 3N73A 3NQFA 4XZ9A 3LHZA 4QJ1A 1EUAA 3B4UA 3FYPA 3ZWSA 2QCHA 3H55A 4ALDA 1SPQA 3B04A 1NFBA 3W7DA 1TRDA 4JTLA 1MSSA 3C2FA 3EX2A 1DBTA 1OHLA 3ABRA 3EX3A 1IXOA 3UXAA 1T99A 3LRLA 4RX0A 3WJYA 2DORA 4RXGA 4CNNA 3CEPA 1V5XA 3W7KA 1J5TA 2CLFA 4EF9A 1IXQA 4LTSA 4MIMA 3DFTA 3LX9A 5LHEA 4NUWA 1RQBA 1TSIA 5DCBA 3PY2A 2DZWA 1OG0A 4GUGA 4QQ3A 5C54A 2D73A 1M5WA 4UFIA 3DKJA 1OYBA 3L67A 2X1UA 4O14A 4UFLA 3E96A 4WOQA 4TX9A 1JUEA 1WBJA 5HR6A 4LNYA 2PRLA 5D2YA 1JRBA 2W79A 3GXPA 3MP3A 3M9YA 1YTEA 1LRTA 1O60A 1OFOA 4K7VA 1DVJA 4E0CA 3LBMA 3O07A 3PUOA 1SW7A 1AW1A 3EX4A 2DZTA 5IBXA 2WSYA 5L6UA 2IQTA 3UWQA 4CCDA 1KFLA 4Y9AA 3QJAA 4PC8A 2CZFA 5SWUA 3QH2A 1ML1A 4UR7A 3MHGA 3QSTA 1PHWA 4FNPA 1JJKA 4FNSA 3G1AA 1YPIA 2ZBTA 5AN7A 2ZQ0A 1LLWA 4QITA 4AWUA 2Y7EA 1RR2A 2ZTKA 1GG0A 2J88A 3W1AA 1FXQA 1N55A 1ONRA 3W7HA 3DGRA 4N4QA 2E68A 1ME7A 5U7SA 3N34A 3RF9A 4C1LA 3IVTA 2B4GA 4JN6A 1YLVA 3A5VA 3I65A 2ATMA 2C14A 3ATZA 3TNOA 3G1XA 3W84A 2CLLA 2E6AA 4GBUA 4IX0A 4MYXA 5F2MA 5AHLA 5F2IA 3NQDA 4O12A 3C3NA 3D0CA 2ALDA 3RFAA 3IGXA 1O95A 2FB2A 3KFTA 1L6WA 5I3KA 4U28A 1TTJA 4Z1CA 2WOQA 1D3HA 4MLJA 1DHPA 5D2TA 4PTNA 1NF7A 1TPB1 4ZQOA 5DXYA 4S1FA 2F7FA 1OFPA 3LERA 5EMUA 2NX9A 1IGSA 3MP4A 2V30A 2NUYA 2YGYA 3TSBA 4A3UA 4JTEA 1XBYA 3H53A 4MZYA 1OX4A 3ANYA 1AMKA 2ZYFA 3O06A 3G24A 1PCKA 1F2JA 3S5ZA 2DP3A 2QCGA 4QIUA 1W5NA 1FXPA 3NVTA 4IXHA 1R2RA 1LDCA 4UNKA 2V9DA 3EWBX 3UXDA 1H7NA 2A7RA 1LCOA 1Z41A 2QKFA 5J5DA 3Q94A 4AWSA 4BI6A 3C8FA 1WV2A 5D2WA 1KBIA 3LI1A 3WJZA 3PVFA 2C6QA 5KTLA 3QQ1A 4GC4A 1A53A 4RLIA 4UC5A 3PBWA 2PCQA 2QJIA 4N9BA 3QMSA 5KINA 1A50A 1XBZA 3CB8A 1GYNA 5G4WA 5LNSA 4JS3A 1U5JA 4WUIA 3W2LA 1I2NA 4H4IA 4M5PA 5E1QA 5D37A 2Z0IA 4MYAA 1BWKA 3MI2A 1FUYA 3GXTA 3B03A 3W1NA 4M6VA 2GOUA 4O54A 4R34A 1J4EA 1J2WA 5EBUA 1RVGA 1WBHA 1ADOA 4JGDA 2QUVA 1TPC1 2GJNA 1HUVA 1BTMA 1CI1A 3LM7A 3OIXA 1SO5A 1WXJA 5E93A 4RXFA 1TJRA 3QC3A 1SW0A 3TE9A 3QYQA 3USBA 3UWYA 2GQ9A 4X2RA 5C55A 2G95A 5K4ZA 3UD6A 3G8EA 2C18A 5I3IA 1A5BA 5G2WA 1LBMA 1GTEA 3LBCA 1F7BA 3QMRA 4O15A 4K37A 3HO8A 1H7PA 4DPPA 3BW2A 3FKKA 2F84A 4PODA 1SO3A 3L0KA 4JTTA 3M5XA 3OVQA 1R2SA 3ZWTA 4I9AA 4NX5A 4IMDA 2VFEA 1EWDA 2GJLA 2Y6ZA 4AAJA 3T55A 3BVJA 2A0NA 1PS9A 3WJWA 3I6RA 4BWLA 4IMFA 1F5ZA 3PR2A 1A5AA 4O1BA 4O57A 1I8JA 2ATSA 2NXIA 4WOZA 3TU9A 1UJPA 1W5PA 4JY8A 3IIXA 2FFCA 3TQVA 1VHNA 3M5YA 3LB0A 3F4NA 3P81A 1G7UA 1JCLA 1H61A 3G0XA 3HGRA 2NLIA 2CLIA 1GVOA 2ZRZA 4IPIA 3LTPA 3SW6A 3ELFA 1WAUA 2A7PA 3ZFHA 3QW3A 4N4PA 3PSVA 3UPBA 4FEZA 2TYSA 3GDLA 4X3ZA 5HQEA 5BNKA 1GZGA 3GB6A 5TIMA 3W70A 3SZ8A 2H90A 1P0KA 4M6PA 4WXYA 3OVPA 2WNZA 1OX4B 2NV2A 3HG3A 1ZAHA 4XKYB 4CLMA 1LRNA 4UTUA 1OK4A 3O6DA 4N9EA 1FWTA 4FIRA 4PH6A 4PFMA 5EL1A 3MW7A 4JEQA 3TV8A 2ZZ5A 2WSRA 4FNUA 4AEOA 5CPMA 3FOKA 1FQ0A 3BARA 4AVFA 1N7KA 1KW1A 1ZY9A 3TQKA 1P1XA 4EOUA 2QR6A 2Y62A 1VLWA 2TRSA 2I14A 4H3DA 1QOPA 2VKZG 5FESA 3LCWA 3O1NA 4N02A 2QAFA 2I1OA 2R14A 4DQWA 3L21A 5ABTA 1F6KA 3NQ7A 1VZWA 4B5NA 2H3DA 3FYOA 3P8IA 2ZRYA 3GNNA 4QSHA 3B0VC 1W37A 2CW6A 1GG1A 5HULA 4FB7A 3W71A 1HG3A 1W31A 2YXGA 3W2JA 2HS6A 2NZLA 3PUDA 4O11A 2X30A 3HG4A 3W83A 2E6FA 1ICSA 1K03A 2QCDB 3PSWA 4NXKA 3PG8A 4FNTA 1VC4A 4O17A 4ADSA 1LLZA 3QZEA 3STGA 4NZJA 1L6YA 3MP5A 2WNNA 4UNLA 1XBXA 1JUBA 3MJYA 2P0OA 5HUPA 4FX7A 4Z1DA 3DKLA 3LOTA 3GYEA 1EB3A 2Z1BA 3HB9A 4Y6GA 1QPQA 2R91A 4LY8A 1LORA 4DF1A 2EHHA 3EWUA 2ZRXA 4RZ6A 4K36A 4CQ8A 3P5ZA 2DZSA 3DFSA 1KV5A 1TCDA 2OX1A 5FI8A 2Z2UA 3NA8A 1T8XA 3S1XA 4DO6A 3TX9A 3P7YA 4FF7A 2DU2A 1KM2A 3DFNA 4M6QA 2ZZ3A 3NOEA 4Z08A 4AHOA 1K3UA 3BW3A 2NXGA 4JTFA 2QF7A 1L9WA 2PURA 1EP1A 5KITA 3TFXA 4O4VA 1P4CA 2JGQA 3TC7A 3O6CA 2J9ZA 3S1UA 5DXXA 4O8RA 3M47A 4JTSA 4MLRA 2CLHA 5HJLA 2W6RA 3NQ8A 2FTPA 3R5EA 3KXQA 1W5OA 3VE7A 3IGSA 2DZVA 2JKPA 2ISVA 4MY8A 4UTJA 2G5WA 3DH7A 3NPXA 5LNVA 5AYXA 4UTMA 3UWWA 5F4XA 1NEYA 2R8WA 4KWWA 4L4LA 3DI0A 3HOJA 3LTYA 1Y0EA 3TFCA 1VCFA 2GQAA 1AW5A 1H62A 4BI7A 1VYSX 1S5WA 2VOMA 1R2TA 4PEKA 1G4PA 3W7EA 4YCOA 1TQJA 2ZFAA 3CIXA 3LHVA 3GAKA 2ABAA 1DOSA 2G97A 5KSWA 1X1OA 4U4MA 5K9XA 4JY9A 4N2YA 3RLVA 3UNDA 4FXSA 4CCCA 5A8GA 1O5KA 1G67A 3HQ1A 5I3JA 3G0SA 4BFAA 4N9DA 2ZA1A 3UWVA 4N6EA 3OA3A 5CPOA 4N6FA 4FXRA 3NQEA 1Q6LA 4BK9A 5DCEA 1ICPA 3NR0A 3IEBA 4G1KA 3RU6A 3NZ1A 4S2CA 1GOXA 3TJXA 3CM4A 3V75A 5K9CA 1O94A 1SO6A 4MZ1A 4LVGA 3GDKA 2CLMA 1MEWA 4HNUA 1XC4A 4J9JA 1QPOA 5D09A 1VR6A 2H3BA 3R89A 1FDYA 3N9RA 2XN2A 3EKZA 4L4MA 4MJZA 3H54A 1OX6A 2G96A 3W7GA 3NPWA 3VCRA 1EUNA 1YXYA 3VI2A 3PBUA 4MZ8A 5FEXA 1ME8A 3LCXA 3EX6A 1CX9A 4OHQA 4NNAA 3MYPA 4Z1BA 3W1LA 4OE7A 3HPXA 1LM1A 1FY6A 3QM3A 4O13A 2Q8ZA 4JDYA 2B7NA 3CEUA 1KV8A 5D03A 4WQ6A 5CZSA 4OV9A 1ZCOA 1SZFA 1Q3NA 1H7RA 2QCDA 1ZHAA 5G5IA 4JIPA 2BZNA 5LSMA 3WJXA 2OMAA 3BLEA 4LT9A 3T78A 3FEMA 3W1UA 1TTPA 2E77A 3VKJA 2E5DA 5DY3A 3UQNA 4UTKA 4JNMA 1C9DA 4IGHA 1H50A 1T0OA 4M7SA 3S6DA 5L9FA 3A5FA 1HO4A 5G1TA 2VXNA 3NYZA 4JX4A 4IJBA 1TPEA 4MVAA 2A2IA 4GFSA 4R53A 3PF3A 2GQ8A 3L9CA 3W7LA 5DCDA 2CZEA 3KRUA 3NQMA 5D04C 3W7RA 3BW4A 3JS3A 2V82A 2TMDA 4N9CA 4GRSA 3E02A 2Y7FA 5CKSA 1VJIA 4RZ5A 2QJHA 1S5TA 3W1MA 4HN4A 5HMSA 1HFBA 3FLUA 1TV8A 3W1TA 4GJ1A 3DENA 1KTCA 4NQ1A 5AHIA 1JQVA 1BKSA 1G4TA 2FB3A 3OG3A 5EA9A 1GEQA 4UIOA 3E0IA 1GVQA 1JCMP 3P8JA
chains in the Genus database with same CATH superfamily
2YFOA 1Q65A 4OZOA 4UTLA 2ZDRA 1M53A 4YVPA 3VX0A 3QY7A 3UW6A 4M80A 3O0KA 3WEZA 1N2VA 2XIMA 4Q8VA 2Y89A 5F2GA 4M7TA 3MMWA 2P1FA 3EWXA 4RCXA 1DPMA 1FHVA 3EKLA 3VFLA 3IVSA 2PC8A 1PIGA 1TJ0A 1OFQA 2VENA 4KQNA 1Q7ZA 3TQPA 3CT7A 2J62A 5HWMA 2YB1A 4AMCA 2VMFA 3PJTA 1K8ZA 4O1CA 1I1WA 4H9UA 1Q8AA 2QDHA 3R7MA 4ES4A 5HNUA 5HPOA 3UA4A 1M68A 3WSUA 4GJIA 3L4YA 3PB0A 1JCNA 2VC9A 6CGTA 2I5IA 3V0SA 2YDSA 2I57A 1PYMA 1UBPC 4UFHA 5ECVA 2J24A 4B9ZA 4EXBA 1BGAA 4HYVA 2OYKA 3PFMA 5HNNA 3ZR6A 4FR1A 1NWUA 3KOXA 3RPTA 3SUUA 3ARTA 1L6SA 1TFVA 3B9AA 1HJVA 3KAOA 2OO6A 2W0UA 5C5YA 4FF5A 3DAQA 3TW7A 1J0KA 2Y0FA 1Q8JA 2D2OA 2OGYA 5FEWA 3V4BA 3HU7A 1QO2A 2QEZA 4AWTA 4YU1A 3LCGA 4MWAE 4NXSA 5G4EA 5A8OA 3JW7A 1IR2A 4WY0B 3GH4A 2QV5A 1VFUA 1OF6A 3LHTA 2KZHA 3U6WA 2AQWA 1R47A 4Y9NA 3TROA 4GI4A 5CPSA 2Z6IA 1LZOA 3SCQA 3PK7A 1BQCA 1XDLA 3QEZA 1RA5A 4FOUA 1LWHA 4UFKA 4O0ZA 3M5ZA 3LLXA 1EGVA 3CQJA 4ONVA 3NSNA 2G8ZA 4V28A 5I6SA 4Y9PA 4HJFA 2Z29A 3GC2A 4CQ9A 4HIBA 1BF2A 1EP2A 1P48A 1QFEA 4X9SA 4Q6JA 4IOTA 1RCOB 4PTXA 4J3SA 3TCEA 3SY1A 4KIRA 1X98A 2GVJA 3LPGA 3T4WA 5AOUA 3TN3A 4R7JA 1S5VA 3WK3A 1OABA 3SCSA 1NJJA 3HGOA 5FSEC 1UH4A 2ZE3A 4UNIA 4LBSA 4JD4A 4ATDA 4ORMA 2QGYA 3LHUA 3T07A 3G0UA 4WXZA 4R3UA 4P8XA 1HZYA 2VURA 1Z42A 2PF8A 3LRMA 3QR3A 4HYRA 2IPJA 4QISA 2RGLA 1Q6QA 3I4EA 3ITVA 2MUCA 1IXPA 4CD7A 4NY2A 3PHAA 3TN4A 3AIRA 2IKHA 5LNRA 1UOKA 2QCMA 2CZDA 3VC5A 1SZGA 2BASA 4NKCA 5HWNA 1WKEA 3ORWA 3RXZA 3MBDA 1WDPA 3W2UA 5E9AA 1HJQA 5IFPA 3AZTA 1XIFA 2PLKA 5HMDA 1BGGA 1MEHA 2X1RA 2YCKX 3PJWA 1W3NA 4MHBA 1Q2RA 1LTDA 3EDFA 3GTHA 1OFBA 5DMYA 2JEQA 2WC4A 1BXCA 3IACA 3BGAA 6PTDA 4HHLA 1JXJA 3KP0A 1HP5A 3MKVA 1BF6A 3GVQA 1Z6KA 1V6WA 2Q02A 4YTSA 4E5TA 5I77A 4BF9A 3F4WA 1FWIC 4NYYA 4AZGA 2XFYA 3CS2A 5HJYA 1E6QM 2I5QA 3N4AA 1WQ5A 4ADTA 3BE7A 4FMVA 3IJIA 4QS5A 4Z0SA 3HTWA 3DZ1A 3GU2A 3KVKA 4CD4A 2X05A 2D2HA 1A80A 4F8XA 2VZVA 2Z1XA 1H51A 4IIEA 2BB0A 1QR7A 2VEIA 1Y8BA 1PDYA 2BWGA 3M4HA 1AH0A 4AY1A 1AG1O 1FHLA 3SJNA 4EACA 4QNWA 4TVUA 1DJYA 4WY0F 1UUOA 1K9FA 5FF2A 3LXCA 1VPQA 3SCTA 3GKAA 2VC6A 3MZ2A 3RLUA 4ZQRA 3TDFA 5LNWA 3SGGA 1W56A 2HISA 1IHIA 4LSBA 4HZ8A 1NOWA 3SN4A 4AD2A 2B7PA 4DUWA 2W91A 3U7VA 2WVVA 4OUIA 4P7QA 1W9BM 3MCOA 2DFAA 2Y85A 1S3HA 4WEVX 4B5UA 4MNKA 3KHJA 3W7QA 1W32A 3NPVA 2Z6JA 2FDSA 2OJPA 3ZXWA 3LNMA 3S2LA 4GHRA 3T44A 1TPH1 4PN2A 4GE8A 1A4LA 4K6AA 4LQ1A 1OFEA 2OT0A 2RFGA 1J79A 4ZQNA 3VZXA 1D3CA 3OODA 2G3NA 4YMZA 1IV8A 4WD0A 3EXSA 5TBOA 1LBLA 4LCRA 1KM1A 2I56A 1RPKA 3UXKA 3WNPA 4LOCA 3GKFA 2UY2A 3GH5A 5FAGA 1TMHA 1SFJA 2VFFA 4E2BA 3VX1A 4YHEA 1WUFA 3ITTA 3PB2A 1CZ1A 3NM1A 1ITCA 1PYFA 3U5UA 1FWRA 2UBPC 1CGVA 1H60A 2V38A 1PJ9A 4IG2A 3U2ZA 3AIQA 2F6UA 4QFUA 3WL1A 3VOGA 5EY5A 1LOQA 3AO0A 4B9YA 3O3RA 1JDDA 1R30A 4HCLA 3MBFA 3G6LA 1HF6A 3GDMA 4Y90A 3L4VA 3MUCA 4M0XA 5FEZA 5AC5A 3E9AA 3IGHX 4JTUA 2WNQA 5A6KA 1DXFA 1XX1A 3SUSA 3OOQA 3UG3A 4IMGA 2NXHA 3B05A 3FXGA 3PZUA 3KL0A 4AUBA 3BLDA 4GOAA 2LLEA 1IE7C 4F66A 1NDYA 3TYDA 3TONA 4PULA 3HBLA 3T05A 2Z27A 5JUVA 1I2PA 1J0YA 5GNXA 2AGTA 3IGUA 1U5VA 4OWGA 3TP4A 3JZEA 4K8HA 4RUBA 1DIDA 1PEZA 1H49A 2QJJA 3COTA 2GLKA 4J3XA 3C4UA 4W7VA 2CKRA 5J5RA 1VB9A 2CLOA 4KGLA 1THFD 3OGVA 1UIPA 2R1LA 4C1KA 2CEQA 1S38A 1PZ1A 3WQDA 3PZVA 4NJJA 2HV5A 2ZTJA 1A5KC 2Z2BA 2CERA 2J27A 5HWJA 3UYCA 3BG3A 2EG8A 3OGRA 4WGHA 2PBOA 1F6PA 2QJGA 1R8LA 4EIVA 1I2RA 1I75A 3WQ5A 1ICQA 4J5NA 1YTDA 1LYXA 2VFDA 3FK4A 3THDA 2I7GA 2WCAA 1M6JA 1DKWA 5DRCA 1HVXA 3DFPA 4XZIA 3A64A 4AD3A 5CCZA 2P10A 3RIKA 1C9WA 1ZSXA 4FXFA 4US6A 4G1NA 5GNYA 4ZSTA 5FJRA 4TUFA 1F3EA 2A5HA 2NQ5A 4W8AA 4UBPC 1VPXA 2OWXA 4YNGA 4AY7A 1JVNA 1ISVA 2P3EA 2BP1A 3QLLA 1UMYA 3V18A 1SUXA 1H5YA 2E40A 2YW4A 3G1RA 4DZAA 3MV11 2PZNA 4XBSA 5JIPA 4JDBA 4U31A 3VD4A 4DM2A 1OEPA 3UWZA 5IHSA 1OJXA 1NSJA 1W17A 1EH9A 4ZTYA 4JZ5A 2FGLA 3T2OA 2GUUA 2YOCA 3BLFA 1BSLA 3B8TA 3LY0A 1V77A 4B15A 2OKTA 4RKAA 1XHGA 3HPFA 1JQXA 4JFVA 1XGEA 1UD6A 1H1NA 1XIMA 2QDDA 3OZMA 4GVFA 5BXRA 4MY1A 5ENLA 4DJFC 1DIOA 4WLCA 4OECA 4HKPA 3UPWA 3NQAA 4QTGA 4DAIA 2HVMA 1YADA 1WDWA 1GVRA 1VS1A 3BZJA 1OX5A 3EDJA 3WLNA 1I6NA 3BTNA 3DHFA 4JR5A 5F4WA 3A3WA 1AH4A 2R1MA 4UQEA 1F6YA 1LG2A 3KLKA 4LAMA 4PBFA 1KM3A 5CZ0A 3SDOA 1YDNA 3BO9A 3IIPA 1XPYA 2VR2A 2PPGA 3PAJA 3AJXA 4B2DA 4MADA 2F6XA 3BOFA 2BFGA 1CYGA 1I0BA 2DQXA 1O7AA 4UFJA 4NT0A 3IV3A 4MWAD 1AQ0A 4URIA 5JBFA 3RMJA 3AZSA 2PGEA 2V8ZA 3WDRA 3MTWA 3ZO9A 3C2YA 1XUZA 3F5KA 3ANVA 1DJNA 3LXBA 4OJYA 2Q6ZA 2J6VA 4A8LA 4Y9MA 4P7OA 3V5FA 4RPQA 2QW5A 1IZCA 2VZSA 3WF2A 4CN1A 1DJIA 3NSMA 4B3KA 6TIMA 3AXIA 3AIUA 3NGJA 1WYIA 3WQ4A 5FF4A 3A22A 4NAFB 2OZTA 5F1UA 1HJXA 3AIEA 3ZR4A 4AIBA 4DJDA 3CLMA 3N2TA 1TO3A 4QG9A 4C90A 3BZGA 3DFQA 5CPLA 2I16A 3TNBA 2ZA3A 4HD5A 1FX6A 1CTNA 4LBRA 3EB4A 2WKLA 3LPOA 3VNIA 2P8BA 4PMOA 5KZDA 2AKZA 3WLTA 3CWOX 4TQTA 5D38A 1TTIA 3SQMA 2YX0A 2GFTA 1JZ6A 3H26A 3B0XA 4NF7A 1MW1A 2R1NA 4C6BA 3KBNA 4DF2A 1VFLA 3VOJA 5A95A 4O53A 3T7VA 4LVBA 3UZJA 4YCPA 2RJHA 2JK2A 4M81A 2BSLA 1V02E 1G1YA 3OB8A 4KEUA 5IOBA 2PP3A 2NQJA 1EP3A 1Q4WA 3VIGA 4R9XA 4QGCA 3OHIA 1FVPA 4HPNA 4Y8FA 4EANA 3P67A 1J0IA 4XAGA 1M04A 3UZYA 3AAMA 4W4QA 3EOUA 4D6JA 1U1JA 3L4UA 1OFDA 4FLOA 1Z8AA 3OZPA 3TJIA 5DLCA 1SO4A 5RUBA 1X96A 2WPBA 3HIJA 1QW7A 8TIMA 1TJPA 4DO4A 3C2VA 1NDWA 1BXBA 2VC7A 4M29A 2PDFA 1JD9A 1UQZA 4AIUA 1QCWA 5BOOA 5AKQA 4US5D 2OSWA 4WJ8A 4IL0A 4O1AA 4L4OA 2QULA 3CYVA 3GZ3A 2G41A 3VNZA 4IQLA 4LS2A 5REQA 5D30A 3T40A 5LXEA 1HL9A 3VU2A 4B90A 4CEUC 3I7SA 4K38A 3F2BA 2CZ5A 3LV5A 3BUVA 4XVDA 4MG4A 3M5VA 2E3ZA 3C2OA 4DI9A 1XDMA 1E5JA 3WQOA 2V68A 1YXCA 1VFTA 2YW3A 2Z24A 1QAPA 1I2OA 3T0DA 1MUWA 1HO1A 1AMYA 1SZNA 3BOLA 3RNDA 4JTRA 4FSAA 4Z1AA 2ZWYA 3MANA 2J7FA 3KOZA 4J3TA 3TWBA 4V1YA 5C7HA 1TR9A 4F2UA 1RV8A 2PGRA 5BW6A 1UD8A 2QZRA 1CGUA 4ICNA 4LNCA 3BG9A 1EQCA 2H8XA 2GSJA 4AEEA 4DUVA 3MKCA 3VUSA 1B57A 4HMEA 1PCWA 5HNRA 2OX4A 3SCNA 3OBKA 1JYWA 5EMYA 3LTSA 3ES8A 3EDKA 5LA0A 3G2GA 1QUMA 1X6NA 1GVSA 4X0NA 4LYPA 1GJWA 1I60A 3BMXA 2XDFA 4HJWA 2CLKA 5BYWA 3ZVHB 4PSRA 1M7JA 1XKYA 3CV7A 2V6AA 1CGTA 2B31A 1XWYA 1A5SA 1H11A 4KETA 1VCGA 2RKXA 2W61A 4Q4QA 4HU3A 1M9HA 1R5YA 1RJPA 3W75A 1JR1A 3DFOA 4TX8A 3A23A 3GU1A 4XTDA 1NDZA 3KOYA 1CXKA 1V6UA 2Y61A 3PPFA 3ARZA 2HNEA 4B5VA 5FIPA 2GK1B 3GDTA 2OXNA 1X6LA 3PM6A 3NPUA 1K77A 4WDUA 2ZX7A 1AW2A 4JQ3A 5GPRA 2ACUA 5E6ZA 4ZB5A 1HGYA 2XIQA 2VX4A 4WK9A 1MMFA 1L6GA 4HHHA 1BG4A 3KDNA 2XIBA 4CQDA 4MAZA 1XLEA 3M16A 4JXCA 3P84A 3FHQA 4ENLA 2X2GA 4RE3A 2Y88A 3FA4A 1KM6A 3D3AA 4HPJA 1XI3A 1C7SA 4LUJA 3GR7A 3W27A 1IIGA 2NT1A 4S3FA 2J47A 1ME9A 3N73A 3NQFA 3LHZA 4QJ1A 3USZA 3B4UA 2J7GA 2VEFA 2WBGA 4ALDA 3WNNA 5D9OA 1P43A 3EX3A 4QLJA 3CWHA 3UJEA 4REQA 3GC4A 4KRZA 1UIOA 4G6CA 3IJQA 4GVHA 1T99A 3GTNA 1US3A 3CEPA 3VNJA 3PTQA 4RV3A 4EF9A 5HXMA 2FZDA 4PMQA 2XIIA 5LHEA 1LT7A 1TR1A 2XIJA 4QQ3A 4C6OA 4P8WA 4QHRA 2UWFA 3DKJA 3W53A 2WCSA 2WJFA 4UFLA 4OOUA 5HR6A 2XYLA 5D2YA 5FACA 3GXPA 1LJYA 3M9YA 3ARVA 3VGGA 3DESA 3NURA 2VQUA 2OEMA 3LBMA 3O07A 3PUOA 1AW1A 4KT2A 2DZTA 3EDDA 5IBXA 2WSYA 1TJ2A 5L6UA 1KFLA 5SWUA 2G3JA 4UR7A 3QSTA 1JJKA 2ZBTA 4IH3A 2Y24A 3M0KA 4E2OA 3ARRA 5FCZA 1RBAA 2AMXA 2ZTKA 1TJ1A 4CGTA 2J88A 1ZPTA 1FXQA 3A4XA 4ZOCA 4Q8NA 4S39A 4BQ5A 2E68A 1WXZA 3H2FA 1ME7A 3N34A 2B4GA 1YQ2A 1EL3A 3RCNA 4N7QA 2ATMA 4AC1X 1N82A 3TNOA 1GW9A 1E1FA 1MYRA 3RLHA 3S1GA 4GBUA 5F2MA 5I78A 1HVQA 5EB8A 4WCJA 2XGZA 3C3NA 2RDXA 3VK5A 1G01A 3D0CA 1ISZA 3RFAA 4MB4A 2EPOA 1DWJM 5JIWA 4MUPA 1L6WA 1TTJA 4I9MA 3H4WA 3N11A 4IFKA 3S9IA 3VYLA 1D3HA 4HTBA 4MLJA 2GUYA 1CDGA 1NF7A 2GJXB 1WKDA 1XLBA 2F7FA 1OFPA 2J74A 3J7HA 5EMUA 2XSAA 2FYMA 1P1MA 3H53A 1OX4A 3UVIA 1FWAC 2ZYFA 3PAOA 4MF4A 1PCKA 1F2JA 3S5ZA 1FXPA 3NVTA 5AY7A 1R2RA 1LDCA 3SCPA 1XCXA 1WZMA 3QLDA 3EWBX 1H7NA 4G2DA 1FWEC 5BRPA 2GVYA 1AVAA 4GLEA 3Q94A 5D2WA 4HU0A 4H7CA 3U5YA 4J3VA 1S5MA 1XLHA 1A53A 2Z1SA 3B8SA 2PCQA 1C90A 3QMSA 5KINA 4IIBA 4CVUA 3CB8A 4ROQA 2G3IA 1VENA 1I2NA 4H4IA 1UWAA 1BWKA 3S2NA 5JQ9A 3B03A 3EOLA 2GOUA 3B9NA 3A9BA 1J4EA 3IV8A 1V3KA 5EBUA 1B3WA 3ZLFA 4GFIA 1FWFC 1NOUA 1WBHA 3B8WA 4BA0A 3ZT5A 4WSJA 3HMCA 1SO5A 2DZAA 5E93A 4OIFA 2Q8XA 1LQAA 1TJRA 3CASA 2ZX8A 5C55A 1U1UA 3UD6A 3VNLA 2C18A 1FWHC 1LBMA 5LXXA 5IDZA 1F7BA 3AS2A 3GS6A 4K37A 3HO8A 3UCDA 3BW2A 3FKKA 1H2JA 5CG0A 2YL6A 4OVXA 3CBWA 4S3GA 3OVQA 4DI8A 1DXEA 4CN4A 3IUIA 1SJAA 4IMFA 3MPGA 3PR2A 1A5AA 1C92A 1Z9AA 2IW0A 1O66A 1XKJA 3GZAA 4IP7A 4QE4A 3AUOA 1I8JA 1DIKA 4GQGA 1GOQA 1W5PA 3I3EA 3O6AA 4GZJA 4CU7A 3LB0A 3EPOA 3P81A 2F38A 3G0XA 1DWHM 3LPFA 1W1YA 2CLIA 3DFYA 2CXGA 1V0LA 2A7PA 2ICSA 2WC3A 2YL8A 5CJMA 2TYSA 3GDLA 4DJED 3H70A 3ZZ1A 4MJ2A 2YXOA 3W70A 3GUGA 3SZ8A 1EOMA 4NP7A 1PX3A 3H6OA 1FFQA 3CZ8A 2A3EA 1OX4B 2J66A 4AVOA 1QWKA 2PDQA 1CXLA 5DMNA 1LRNA 4UTUA 1FWTA 4C6DA 3MMDA 4PH6A 4PFMA 4E8DA 3MW7A 2ZZ5A 3MKKA 4AEOA 1BYDA 3FOKA 1HL8A 4W7WA 2WAGA 4L65A 1QNOA 3ZLGA 3IWPA 5I02A 3KTSA 1QOPA 5MKGB 1YX1A 3EEZA 2QAFA 4GNKB 2VD8A 1LL6A 3NQ7A 2XHYA 1UZDA 4B5NA 3P8IA 3FYOA 4GVGA 2ZRYA 1KCXA 3FNDA 1GORA 1DYSA 2DSZA 2ZUMA 4V1XA 4LCQA 1GG1A 3WBEA 1DIEA 4QG6A 7TAAA 2NZLA 4D6IA 3PUDA 3U4FA 4FP1A 5I2UA 1VFOA 1A5UA 1WKFA 2HQAA 2J13A 1BAGA 4NXKA 4L64A 3VIFA 1LLZA 3WLRA 3FV9A 3A4JA 4YPJA 8A3HA 4HOZA 2J7EA 4GYPC 1K9DA 3L4WA 3QGVA 3TR9A 2P50A 4GH3A 1QI3A 3GHSA 3W02A 3AJ7A 2XPKA 3GYEA 1EB3A 1V0NA 1LORA 3EWUA 2ZRXA 3W01A 4GACA 2ONEA 3QHMA 2WMIB 5FI8A 3VCCA 2OODA 2CIPA 3TX9A 3O9NA 1IWBA 4FF7A 3M0LA 1NP0A 3IJLA 4A6GA 5C2CA 4M6QA 1R38A 2NVAA 3NOEA 2ZVIA 1DJWA 3HQPA 2PDHA 1K3UA 5C8BB 3PTMA 4IGMA 2OG9A 2PWEA 1L9WA 3DCPA 1ONXA 4DYJA 2XFFA 3KRBA 1RY0A 4O4VA 2C79A 2J9ZA 4HSHA 3S1UA 4MAVA 3K4WA 5FJUA 1ONWA 3NQ8A 3SM0A 4GY0A 4DZ5A 3KXQA 3ITXA 3WUBA 2JKPA 1MUCA 3DIPA 8XIMA 2CLPA 1OCBA 9CGTA 1HP4A 3BICA 4UQCA 4DJDC 2R8WA 4E2VA 3DI0A 1UD3A 3F5JA 1Y0EA 3CZJA 5M1TA 1VCFA 3T2PA 2PDGA 4ZXOA 4YCOA 4PB3A 2ZFAA 3RJYA 3GAKA 3MCNA 2PCEA 4E4FA 4U4MA 5K9XA 3KTXA 4N2YA 2Q71A 4PEEA 5A8GA 1EEXA 1G67A 3WEMA 5LIKX 3A47A 2ZA1A 3MV01 3GU9A 4HGXA 4FXRA 1JYXA 3NQEA 2BVTA 3FYYA 3GD6A 3KCLA 1JPIA 3AUJA 1WO2A 3ENLA 3R0UA 3WDIA 2PDJA 3BDKA 3NZ1A 5I24A 4IGSA 4GBDA 5K9CA 1SO6A 4LVGA 3GDKA 1V08A 5E70A 1QPOA 1GZ1A 1Q66A 3R89A 2XN2A 3EKZA 4MJZA 3MSRA 3H54A 3B8VA 4S3CA 2G96A 4WJXA 3S6TA 3VCRA 5DO8A 3LQGA 2Y1HA 3WH8A 2VGFA 3TYUA 3OG2A 2QPSA 3CAQA 3W0KA 3XINA 3EX6A 4OHQA 4H2CA 3OZYA 1LM1A 1UHVA 4S23A 3VM7A 2PB1A 4JDYA 3D5HA 4PFHA 3PWGA 1ECEA 1KV8A 3O7UA 2PDWA 4XBJA 3QOKA 4WQ6A 5CZSA 4NHVA 1H7RA 1ZHAA 3GW0A 2GK1A 1KWKA 1XISA 3WJXA 1EGMA 1E71M 2OMAA 4LT9A 1GKPA 3T78A 3FEMA 4H9XA 1TTPA 5CC3A 3CXOA 4LY4A 1AD4A 1KCLA 5CSYA 1C9DA 3MMUA 4K2SA 5JH2A 2O9RA 4KEVA 4C5ZA 1TE6A 3OU8A 4IJBA 4MVAA 4GKLA 3PF3A 3W7LA 4B3ZA 5DCDA 2CZEA 3KRUA 3BW4A 1JF6A 3S9ZA 1KGXA 2TMDA 4N9CA 5FL1A 4GRSA 3HFYA 3W82A 1Y5VA 1CB2A 4J3ZA 2CITA 1JDCA 2QJHA 5CBIA 4B16A 3FLUA 2VUNA 3RPDA 4C6CA 1TV8A 3HV8A 2GYIA 4PUMA 1KTCA 5AHIA 4HOXA 1QHZA 2YDRA 2PGWA 1S2UA 4TVCA 2FZ8A 3IAPA 2X7VA 4JBRA 4WDXA 1GTHA 4QJ5B 2BHYA 3S8HA 1TPUA 4ERGA 1T96A 4YWIA 4EPBC 4EWJA 2XFRA 3VZZA 4C7GA 1OFRA 1OC6A 2C16A 5A94A 3HQOA 4ZQMA 3FJ4A 1ALDA 3W7IA 3CUZA 4XTIA 4Q33A 4GCXA 4TXEA 4J3UA 3R94A 2PP0A 1TV4A 3OLEA 5T8GA 3S2JA 2HDJA 2V67A 2J7CA 3STEA 1R7OA 1TV3A 4PTMA 1GQIA 1TE1A 2IPFA 3ZM8A 4Q4OA 4GX9A 1WA3A 2A3LA 4W9TA 2EG7A 5C9UA 2NV9A 4L1XA 5AHNA 4HK5A 1Q6FA 3Q4DA 5HA7A 2HZGA 7CGTA 3VCNA 1B3XA 4BR1A 4YYCA 2IKJA 1BYBA 4XD6A 5BCAA 3C61A 8CGTA 5H8UA 3A21A 3FN9A 2HJPA 3R8GA 3VKKA 3LD5A 4FLQA 1B54A 2PC4A 1XSIA 1IEXA 4TMCA 1J01A 1ESWA 2DJXA 1MUMA 3GNRA 3N3TA 1QPKA 3IVUA 2WV8A 2DZXA 4DZHA 3D3FA 1KM5A 1P6BA 3R25A 3NEHA 5HANA 5LGXA 4GYPA 1ODUA 1YW1A 4M8UA 1HKVA 2O7QA 2JIEA 1GYMA 1H3GA 1XIIA 4WKAA 4LW7A 3JVAA 2OFJA 2XSBA 1PKMA 1GCYA 3QQWA 4XBKA 3EPMA 5KZEA 3F4CA 4HPGA 3HZ3A 4PL1A 5HINA 2IKIA 4JTGA 2HRWA 3KHDA 3BL3A 3SRDA 1M3UA 3A9IA 4JN7A 2EKCA 1PZ0A 1XLMA 1ZU8A 3G6MA 1NM9A 4ACZB 1KWGA 3ITCA 5D8ZA 1EJ7L 2EPHA 3IANA 2NWSA 2QUTA 2VWTA 3W22A 5K9DA 1KGWA 1VBHA 4QSFA 2J9YA 3DHPA 3KRZA 1X8CA 4Q22A 1GQKA 1LBFA 1KRCC 4YXGA 3WF0A 5FEPA 3ZJ6A 4BQ4A 4UUIA 3S0CA 4LVFA 1EPVA 4LFYA 4QCFA 3FJLA 3HQNA 3SCUA 3VE9A 1GUVA 1F8MA 1OYAA 1ENUA 2UY5A 3TJ4A 3FX4A 3W1RA 2R24A 4O16A 2ZUSA 3QKZA 3LXAA 1PKYA 3LLFA 4GQRA 1V7AA 2Y2WA 1NWSA 4YTQA 3V5OA 1WP6A 3CQ0A 4LCSA 1NF0A 1JYNA 7TIMA 4YVVA 1TTQA 2VGIA 2FKPA 3GQYA 3L12A 4X22A 3B4YA 4KWVA 1H63A 2VCAA 1YKWA 1BHGA 1ZALA 4W88A 2QCFA 1NAL1 4UMBA 3H22A 9RUBA 3BSGA 3ZIZA 5DY2A 3AMLA 4FX8A 1UCWA 2NUXA 3ARQA 5GJNA 2GDQA 1QDSA 4H83A 1GOMA 3DERA 3KVMA 4ZENA 3LNPA 3QGKC 3CV6A 5I79A 1BVWA 2GOKA 1BEUA 4FALA 3R12A 3N25A 2A7NA 1HXJA 3ZSSA 4XWUA 2YZ5A 3EBVA 3TIMA 5M5DA 3O05A 5BU9A 4ZODA 1N8FA 5A6AA 4O18A 2DZPA 3VNMA 3L5LA 5C9ZA 1EA0A 1IEWA 2FVMA 3GM8A 2PDPA 4MJMA 3BSHA 1KLYA 5K7JA 2HSAA 1C7TA 3MU7A 2DT3A 1HKWA 2R1PA 4LVAA 1BPLB 3TUUA 2PP1A 2KX9A 4A21A 2R94A 1Q63A 4EVZA 5GQBA 2IKGA 1HJSA 1DXIA 4RDWA 2D69A 2PMQA 2V5LA 4WVXA 4BEQA 3H7VA 5DX7A 3PG9A 4U3AA 1YPXA 2V5JA 3QW4B 3M07A 2QIWA 3P93A 4UMAA 3NL5A 4MKSA 1S2CA 2EKGA 2HWGA 2H9AA 1HIZA 4LH8A 2BLEA 2OOGA 4A29A 3L0NA 5IBXC 4DXVA 4MWAB 2Q3OA 4HNCA 3C2EA 3LCIA 4Q3MA 4IX2A 5T26A 3W6LA 1WUEA 4V15A 2AOSA 4LV4A 1HKJA 1ZFJA 3AIVA 4HZMA 2A3BA 1KB3A 3WQ8A 2WNWA 4AD5A 5IRPA 4IP4A 4QM1A 1O68A 2F2HA 4P7LA 4UTTC 3W9ZA 3MYOA 4DO5A 9XIMA 4QEHA 5AC7A 3TVAA 4GA8A 1GVEA 1OGSA 4QAWA 3VILA 3NG3A 3ITLA 5C2XA 2XSXA 2E9BA 3GSMA 2VELA 4MOZA 4HN8A 1DQWA 5AC6A 2RUSA 4IXXA 4QE1A 3CTTA 2XH4A 4GK8A 3KBJA 2ZUNA 1EEPA 4NAEB 2E1DA 7XIMA 1T40A 4NX0A 3AMGA 2J75A 2YPIA 3F03K 3SCOA 4A35A 3K2GA 4LB3A 3VVGA 4XO7A 5DQPA 4LC8A 1CBGA 1QO5A 3BLLA 4IFRA 1SR0A 3RR1A 4QR6A 3DGBA 1MZHA 4NVTA 5CGMA 3WD2A 3PN8A 1B4EA 3PP7A 1W3LA 2YZRA 4QXIA 1XQKA 4P7NA 2OQHA 5CPQA 1O1HA 1GHSA 1SM9A 4Z2JA 3MMTA 4XAZA 3M7SA 2AAMA 1UKQA 1OINA 1QU4A 3EXRA 4F3HA 3FGCA 5H6HA 1CT5A 4HZ6A 4F9DA 1US0A 4ICMA 1FA2A 4MGGA 2QUNA 2HS8A 3AFBA 1OZMA 3LHYA 3W28A 4KBXA 2HK0A 2HVNA 5HAOA 3G1FA 3IRDA 1M7XA 1UPMB 2QQ6A 4KMQA 3RLGA 4DJEC 4ERAA 1B3YA 3FCPA 3G22A 5D2XA 5DANA 4HNTA 1HNYA 5IFTA 1CIUA 2ZRWA 1V3JA 3C0JA 4G5DA 4HT3A 1U33A 2RJGA 3QOMA 2NT0A 5CBBA 3GO2A 4NJHA 1J18A 2C0AA 4QP0A 4F0KA 1FCUA 4OU1A 4DNMA 4I90A 1KFWA 1BKHA 1QOXA 3W2NA 4EF8A 3N2XA 2FH8A 4IL2A 2QDGA 4NZ1A 1A3HA 3BAKA 1GWJA 4JPGA 3N1AA 1MQQA 4QJ4B 2VX5A 3TCSA 1DJQA 2JKAA 1TG7A 1KGUA 3CB3A 3IIVA 4BI5A 2ZXBA 1KXVA 4Z2GA 2Z1VA 3ID7A 3WNMA 3WDPP 4IIDA 3WD0A 1UKTA 3L66A 3BAIA 4ZZ9A 3DHDA 2BHZA 2FIQA 3W6MA 3QF0A 1OWQA 4ACYA 3UXLA 4M51A 5AYIA 5FOOA 3GXFA 2D3NA 4H7ZA 4ADUA 4NAEA 1ZJAA 2IQDA 3OQEA 5ECUA 2OVLA 5AFDA 5U4NA 3IRSA 5CPNA 4ZSUA 1FP8A 1YEYA 3THQA 3C6CA 1KXHA 1NVMA 1KCZA 1KLZA 1J96A 3KUMA 2EPKX 3HGJA 2DSUA 3H2AA 3ABQA 4S3BA 3W72A 2DSVA 5EKYA 3WD3A 4BF5A 1RD5A 1LF1A 1YTKA 2BV9A 2VZUA 2XINA 3QRHA 4B91A 3K4DA 4GUHA 5F1VA 2DH3A 3M0VA 1TWSA 2REQB 4JTHA 3VABA 4EXQA 3NQCA 4JYEA 2P76A 1SFLA 4A8RA 3W74A 4XB3A 1EOKA 4AC7C 1ODZA 1HN1A 1XXXA 1H41A 2JBMA 3A4WA 3TC6A 4H9MA 2OCZA 4W7UA 1FBAA 4TMBA 2AGKA 4Q8TA 4Q7BA 1F07A 3HJEA 1G6CA 4AH7A 1JIBA 1K7XA 4AD1A 4XKMA 2E9MA 1XINA 5HUOA 3OLIA 1W1A1 5DBTA 1PTDA 1VBUA 1VIWA 3QXBA 3REQB 4UTHA 1WE5A 3BGJA 3CH9A 2E6YA 4HNNA 1E6RA 4F40A 3SN0A 1VH7A 1KTNA 2V81A 1J6PA 4DJEA 3VC6A 3AHZA 4ZOBA 4FXJA 4X2PA 5ABEA 1VHCA 2V5CA 1VBGA 1A0CA 3QHOA 3THUA 1XRFA 3SRKA 2VJXA 4DXKA 1TZZA 3MWAA 1TZ9A 3OVRA 4D9PA 4S3KA 3URNA 3RYSA 3S47A 2JKEA 4WHBA 1RD6A 3K5XA 4C60A 1UC5A 1UKPA 5H91A 2O9OA 3G1VA 3I7QA 1R9ZA 4PCPA 2WQPA 1TB3A 2X2YA 4XD4A 3BJTA 4YTRA 2X1TA 2WSQA 3VDBA 4JFUA 1KFBA 3CUJA 3W76A 3N2OA 2HBVA 2RDWA 4ZOEA 1RQEA 2EEXA 1TPDA 1JULA 2X16A 1T5AA 4UMCA 1FWWA 3B97A 2JE8A 4C6LA 3GG8A 3RM9A 2WZMA 5FD0A 4AB4A 4LWWA 4UTWC 3VD5A 3VOFA 4GUIA 3TW6A 1MFVA 4HB7A 2O9PA 4H1ZA 1RBOB 2CBUA 2XGIA 1YBQB 2E25A 3GVGA 2VX7A 4Y96A 2ISFA 3POHA 2GVEA 3BCJA 2B7OA 5I09A 3LLDA 8XIAA 2BS9A 7ENLA 3FSTA 1ZENA 2WK2A 1C8VA 3VMPA 2Q09A 2CC0A 3KM8A 2F61A 1PV8A 5CEWA 2HBXA 1QBAA 3MA8A 1FTXA 3GHRA 1UC4A 2VRKA 1QNSA 1RLCL 2YKKA 3P74A 1FH9A 3ME3A 2OYMA 3W87A 4YTUA 3Q65A 4ZFMA 3VM5A 4KRUA 2V5BA 1XIGA 5BRQA 3MB9A 3H2CA 4Q7NA 4WY0A 4MB3A 4WGXA 3L5MA 3LRKA 4GNJA 4L6OA 2VDHA 1XCWA 3W1XA 4AX6A 4EX4A 3PZIA 3FDGA 3S1VA 3GNXA 3L68A 1JPDX 1DWFM 2V0TA 2WMJA 1Q2SA 3E6EA 3GTIA 5A8NA 4KCUA 1SGJA 4XG1A 1EX5A 3CQKA 1K8YA 3W7MA 4O52A 3VD9A 1RP9A 3VDCA 3ALFA 1EDTA 2UV8G 4DUOA 5I0DA 1ZB5A 4LB4A 6XIMA 4RDZA 3AMDA 4TV6A 4IUGA 3QFEA 4HHPA 1ZRQA 3BAWA 4LEQA 1OF8A 5FF7A 5EMKA 4GZIA 2VFIA 3SN1A 3IARA 3S2MA 4GZEA 4JYFA 3WX7A 1B4KA 1EYEA 3E0VA 2PTXA 4HA1A 2QLYA 3MSDA 5EU9A 1IT8A 1XYCA 5XIAA 3W3OA 3RO6A 2ZIDA 4RV8A 3T6CA 5E0KA 5D32A 2Y63A 2DVTA 2ISSA 1CGXA 1R87A 2C7FA 1MFUA 4ZMGA 3QR0A 1H1YA 2QMKA 3L5AA 3YPIA 4QS6A 3T8QA 1B9BA 3QMTA 4W93A 3QQ0A 5T9BG 4G8TA 5HDRA 4LUIA 4YIWA 1Q6CA 1A5CA 3LCFA 1KR1A 3M0ZA 3ZT7A 3SO7A 5FF0A 4KF1A 4G7FA 2D2JA 3CGTA 4QCEA 1F4HA 5G1YA 4DIAA 2FPVA 5KEZA 3QSRA 1U1HA 1SR9A 1KA9F 3MUXA 3LCLA 2PDXA 1JAKA 3NEVA 1SQ7A 5AHMA 1DORA 4M19A 1LOLA 3EMZA 2IQ0A 1HX0A 3P5YA 3EB3A 1I0DA 2Q8LA 4C65A 4C6JA 4BY3A 4PMUA 2EJ1A 4L1GA 5XINA 4IM4A 3CWNA 1LROA 3XIMA 4CNUA 3BWWA 5G1MA 1TWDA 3B06A 3N4EA 1TV7A 3EOEA 4CQBA 3NL3A 2OOFA 1NWTA 4JIHA 4DO7A 4DVOA 4YLWA 4MSSA 3NQ6A 2C1HA 5A2BA 1V4YA 4JKMA 2HTMA 5JBDA 2J6XA 1V6VA 4K8GA 1E73M 2J25A 4O4WA 4AZIA 5I03A 4U3CA 1YIXA 1R0MA 4AZBA 3FAWA 5CSSA 1K7FA 4DWDA 2QXWA 4XUGA 1VJZA 1ISXA 3KBWA 4MTVA 2WHLA 3UR8A 1GQNA 3RK8A 1RXOB 4Z0JA 1J2BA 2PLJA 4WF7A 3EDEA 3LEPA 1CW2A 1W8GA 4KESA 1JCYA 4JYDA 3SADA 1Q13A 3AIWA 2HK1A 3BGGA 1AA1B 4UOZA 4DB7A 2OZ0A 3WUEA 5DN1A 1J93A 2PDYA 3SRHA 1TRIA 3GFXA 3ITOA 5FJTA 3HJZA 3PZNA 3NZPA 4XQ6A 1GVFA 3PBYA 3URAA 2DIKA 3QGAC 3TXZA 1TPWA 1C93A 1HTIA 3QN3A 1Q45A 3AXMA 1PKLA 4GJJA 1FWCC 2XVPA 4XZ9A 1MXGA 3PJUA 3CUHA 1EUAA 1VIZA 2YL5A 3KS6A 2QCHA 2GDUA 1GOKA 1MSSA 1DBTA 1OHLA 2O4QA 1IXOA 2QV4A 3IAQA 3LRLA 1XIBA 1NIUA 2GWGA 3GTFA 2DORA 5AVHA 1GW1A 1JZ7A 2WSPA 2NQ9A 4GY1A 4M1BA 1RJRA 3MUAA 1IXQA 4LTSA 2BODX 4MIMA 1HKKA 1R3TA 5A6BD 3TC3A 1UKOA 2X42A 3IJDA 4NUWA 5BOEA 3BSMA 3WKZA 4LAZA 4N42A 2DZWA 2IPWA 4I8YA 2ZXAA 3UF9A 1E4NA 1S2AA 4I5UA 5C54A 4UFIA 3ALGA 2F6KA 2BNJA 1JDEA 3NZQA 3E96A 3W29A 1NARA 1E1CB 3R79A 1WBJA 3CAWA 4LNYA 3M46A 2PRLA 4WRHA 5CAHA 1YTEA 4K7VA 3U3HA 1SW7A 3ZVHA 3H2NA 1QW9A 2CZFA 3QH2A 3RG6A 3WEOA 2VGGA 2G0WA 2ZVRA 2X0SA 4GQ0A 1M65A 3PZ9A 4A3RA 4Z2IA 3AHYA 5FAJA 4DWSC 4AQLA 3K13A 5U7SA 3IVTA 1IGWA 1MI3A 3ATZA 1EJTC 5FJPA 1R3WA 4US5A 2IXUA 2PODA 4IX0A 4MYXA 3NQDA 4O12A 1V79A 1V6YA 3FA3A 1D8CA 5I3KA 2BXZA 3N2CA 5H8MA 3CIVA 1DHPA 3UJFA 5D2TA 2V69A 3M6DA 4ZQOA 5DXYA 4S1FA 4X60A 5GJMA 2NX9A 3T0TA 4A3UA 2PDMA 1XBYA 3P0WA 3AYSA 3GH7A 5TAOA 1MRQA 1PAMA 3MDWA 3UA3A 1BYCA 3B9EA 4JCMA 2OGJA 5LA1A 2HCVA 4XO6A 1G9HA 1L6FA 3FGCB 4JFSA 3RILA 4AEFA 3CLWA 1LCOA 2QKFA 5J5DA 4UCFA 1VFSA 5HJXA 1UZHA 1KBIA 1QNPA 4MWAC 3PVFA 5BROA 3VTRA 1XV8A 3EA3A 4UC5A 2ZUVA 3WMLA 3PBWA 2OR2A 3C0QA 2YBTA 4N9BA 5JXQA 1CLVA 5A6JA 1XBZA 3E0LA 2OSXA 5LNSA 1U5JA 3EZ4A 1R6WA 4A8IA 4J3WA 3LQLA 2G3MA 5D37A 4GI9A 4MYAA 3GXTA 3FSUA 3OBAA 1CLKA 4O54A 3URQA 1J2WA 1R3QA 3ARPA 3AHXA 1VRXA 1WNOA 1H0GA 4JGDA 2QUVA 5CZKA 4C6KA 1HUVA 1FP9A 7PTDA 1CI1A 3LM7A 2BVWA 3AXHA 4Q8WA 1SW0A 2CBVA 4LAOA 4QLLA 3TYZA 2YCIX 3USBA 2GQ9A 4S3JA 5EFFA 2WANA 1P7TB 1XYFA 4W86A 5HPCA 4GO8A 5I00A 3G8EA 1TUFA 5I3IA 1GNXA 2DW7A 4NG3A 1XLJA 3PWIA 1H7PA 4DPPA 2OWCA 3ITYA 1MW3A 2GJXA 1AZ1A 1RK5A 3VXGA 4KCWA 1KXQA 3RPMA 1R2SA 2BGSA 3M0JA 2YA2A 5M03A 4IMDA 2GJLA 3T55A 2BBFA 1XP3A 3BVJA 4LX4A 3TA9A 4D6DA 4KEMA 2JEPA 4AZ5A 3VAVA 1F5ZA 2Y4SA 4O57A 1LUCA 1QT1A 2NQLA 2ATSA 2NXIA 4B5XA 1EJWC 3GIQA 4AIOA 3TU9A 1UJPA 3AS0A 5MF5A 2FFCA 1VHNA 3WQCA 3F4NA 3OYXA 3OZOA 3WFLA 1D8WA 4JAWA 2NLIA 4JTAA 1QASA 4DM1A 3LTPA 1WAUA 3LSCA 3QW3A 2H9AB 4RE2A 3PSVA 4C6FA 2VWSA 4UR9A 4X3ZA 3W37A 3ARUA 3E74A 1V3HA 3LMZA 4AG0A 2WZTA 5TIMA 3VINA 2H90A 3WO8A 1ZS2A 4M6PA 1GPFA 3N04A 3SRFA 4DUXA 3HG3A 7ODCA 1UYQA 2WLYA 4FIRA 6REQB 4JEQA 3TV8A 5HQMA 5BU6A 2VRJA 3NGFA 5CPMA 3LZ5A 2PFHA 3E2RA 3KLLA 3BARA 3V5CA 4AVFA 2PDBA 3DYPA 3VKBA 1P1XA 4EOUA 4BQ2A 1VLWA 4KIEA 1A5OC 1DJGA 2I14A 2TRSA 3LGGA 4B4HA 1V3MA 5FESA 1WCGA 3FJNA 2R14A 1RBLA 4GIRA 3M0YA 4L6DA 1CXFA 2OWWA 1MNZA 1P0DA 2PWHA 1XH0A 3WCZA 3GNNA 2NSXA 1JNDA 3B0VC 1W37A 1HG3A 2YXGA 3QV7A 1JF5A 1X1NA 2OEKA 3F2DA 5A6TC 3NTYA 5BOFA 1XLFA 4R88A 2E6FA 2CBJA 4JEJA 4PMJA 4D8AA 4FNTA 5I7GA 4A4AA 3NZGA 3QTGA 1L6YA 2G37A 4AYSA 3KL3A 1XBXA 4GNVA 4D6CA 4RNFA 2W4XA 1CECA 1X38A 5HUPA 4DZIA 4Y6GA 2Z1BA 2J8GA 4LY8A 1A3WA 1QI4A 3KBSA 2R6OA 1DEDA 3A13A 4QE5A 3DFSA 1TCDA 1NQKA 1M41A 2Y8KA 4XUYA 2DUZA 4DO6A 1IWAA 3KS5A 3GHUA 4M24A 1MXDA 3S83A 3OJGA 2DT2A 4AHOA 4WR3A 1XLKA 3DUGA 4JTFA 2G4JA 2NXGA 4Q8OA 4PUUA 2EBNA 1XYZA 3KTCA 5KITA 3TFXA 1P4CA 2ZDSA 1ZLPA 4AZHA 1Z69A 4D6GA 2OKOA 2CLHA 2FTPA 1XRSA 2PUZA 3U57A 3UG4A 3CUIA 3W4RA 2BDQA 3IGSA 4LAUA 2DZVA 3RRXA 1W91A 2ISVA 4MY8A 3K1DA 1GEHA 1RH9A 5AYXA 3VFCA 4UTMA 5F4XA 1E4LA 3LTYA 1JFXA 2I9UA 4BI7A 1AW5A 1VYSX 1E9ZB 2VOTA 4PMVA 1R2TA 1NFPA 1KXTA 3CIXA 3WENA 3NFUA 3WLIA 1DOSA 3QV9A 1X1OA 3GG1A 3RLVA 3UNDA 3BCDA 4I6VA 4CCCA 3CV1A 1O5KA 3HQ1A 4W5ZA 4BFAA 4N9DA 5CH9A 2DZBA 3OA3A 5CPOA 4N6FA 4QLKA 1PWMA 1OIMA 5JVLA 1REQA 4IJCA 1XICA 4JIRA 3WY1A 4BK9A 1CENA 3WH9A 1GOWA 3AXXA 4G1KA 2FTYA 3RMEA 3DEQA 3CM4A 3V75A 2WC7A 4GVIA 4MZ1A 4Y8EA 4HNUA 1MEWA 3UZXA 1XC4A 1X7IA 4Q8PA 2H3BA 2ZXDA 3PTKA 1PSCA 3N9RA 3TLQA 4L4MA 1K9EA 1JZ2A 3FDKA 1BFNA 3ECQA 3EKGA 3APTA 3VI2A 2FHCA 3DECA 1DTNA 3WMCA 1CGWA 1E70M 9XIAA 5M3WA 1ME8A 1K70A 3TYEA 3BQ5A 5CSUA 3LCXA 1J5SA 3IJ6A 4P7RA 1CWYA 3PUGA 4PYSA 1A3XA 2HVOA 4XAYA 3RRAA 1Q3NA 2X09A 2QCDA 3H24A 5LSMA 4ZO7A 1P6WA 3BLEA 3A4AA 1F3TA 4KEZA 3W1UA 3VKJA 4IGNA 5DY3A 3UQNA 1M01A 4UTKA 2O56A 2C8NA 4QQUA 2A79A 3GWQA 4M7SA 3FHAA 5L9FA 2D0HA 4M1RA 1HO4A 4LANA 4YWSA 2P5NA 3NYZA 2W3ZA 2F8QA 2WMFA 4R53A 1EIBA 3NDYA 2V82A 1XLCA 2IUZA 1T8QA 4QROA 1RCQA 2D0GA 4Q7IA 4PB5A 3W1MA 3V35A 4ZB0A 2W92A 3CMJA 2OEJA 1XYAA 3W1TA 2WVSA 3DENA 3URBA 2WZEA 2QDEA 4B2DD 2HNHA 1LT8A 3NWRA 1G4TA 1JZ3A 2WZHA 2PSNA 4W89A 5EA9A 2CZVA 1JCMP 1QMLA 1QOQA 1FWGC 1UD2A 3W86A 3ZQ9A 1HL2A 1E1CA 1A4MA 4F4RA 3LK6A 3XISA 1M1BA 4GKTA 1MDRA 4E2DA 1C8XA 2YB4A 1QW8A 4QDMA 1WKYA 3AROA 1UBSA 1REQB 1V03A 5BWAA 1UMLA 1W54A 2ODOA 4S2BA 2I17A 1K8CA 1K7EA 4YS1A 2FPTA 2XVKA 5LNUA 4IPJA 3K4AA 4BF7A 2Z25A 1GVYA 3AHVA 4UZUA 4NNCA 1AQFA 4OV4A 4IFOA 1ISWA 3R10A 1E0WA 4Q4RA 1DL3A 3UG8A 1OZQA 1OK6A 3EYPA 3FKRA 1XF0A 2WLZA 3G1HA 1QI2A 3NUKA 2YCEA 4RZBA 2X40A 1EJSC 3W88A 4KS0A 4KFOA 1T6MA 3G18A 4BWLC 2OSYA 2X1SA 2WVTA 2WWCA 1QBBA 3SQLA 3W23A 3D47A 5EMLA 3QR1A 1E3ZA 4I9JA 2MANA 3N29A 2TSYA 3VGEA 4JTQA 1XUUA 4DRSA 1AQMA 3K8KA 4O1DA 3WF3A 1AQHA 3KBMA 4CNPA 2VX6A 1Q6EA 5AECA 1Z89A 2A3HA 2BVYA 1J12A 3MQTA 4H01A 1VF8A 4FNRA 3RITA 2E09A 4HP5A 1O5QA 4Q8MA 2E9LA 5AYZA 4QDPA 3OA5A 4KWSA 2TPSA 1JL8A 5BMXA 3QHNA 3AYRA 1UPPA 1XYLA 3LG3A 3NO5A 3INPA 4AFYA 4CNSA 4PSPA 3WD4A 4JHOA 2OYLA 1JPKA 4NZ3A 5ABFB 1HT6A 2Y7GA 4PA8A 3VDGA 4MWAA 3DC8A 3KCJA 4O28A 1RQHA 3VIKA 5K2ZA 4DX3A 4BS0A 1S1RA 4GXPA 4L6HA 3GHTA 1EJXC 4DWSB 2V3EA 3GVWA 4DJFD 1V3IA 1TCMA 4IQJA 4CKQA 4UB9A 1ZNNA 3GY1A 2JF7A 3CL7A 1UWSA 4A2RA 4MKNA 3W38A 3G8RA 4JTIA 3CL8A 4HA4A 3W2KA 3SSZA 1MVYA 4BKNA 4QAIA 7REQA 3KX6A 3BAXA 4Z2HA 1EJUC 4JTJA 2QPXA 3STPA 3VZYA 1TA3B 4IG2B 2A4AA 4YTTA 1TX2A 1OYCA 3G1YA 4Q32A 3GXMA 3CPUA 4EPEC 3F1QA 1NQ6A 1FDJA 4JICA 6ALDA 3Q58A 3AU6A 2BVDA 3NSXA 2VR4A 1F3XA 2WXDM 2Z4GA 2H8ZA 2BOEX 2QCCA 1W9XA 3TTSA 4AHPA 2E7FA 3CH0A 4XIMA 4A2SA 2GQ3A 1TVPA 3TTQA 3T81A 3UWUA 2HE8A 5I3FA 4GH1A 4H8VA 3UVAA 3QV8A 7REQB 3I68A 5T91A 1LRQA 3B8DA 4I7WA 2V3GA 1LUCB 2NQHA 3ABZA 3MZNA 4UQAA 1GONA 3CU2A 1PDZA 2WJZA 2E5BA 4UTIA 4FA3A 1FWSA 5CBJA 4RJEA 3WLPA 2BOFX 2INFA 3C86A 1KRBC 2WJDA 3THAA 1K9TA 3CZLA 1I45A 1EXPA 1ZGDA 3BC9A 3LZ3A 1ZBWA 4MY9A 3KBVA 4D2JA 4OBTA 3UGVA 5A6MA 1ZAIA 4W85A 2X7WA 3QYSA 1RY8A 3N18A 2D1ZA 3CTLA 3E0FA 2JF6A 1IZJA 2C13A 4PUWA 1FH7A 3T09A 4REQB 3TYBA 2NX3A 4WJEA 4H04A 2J4GA 4IWWA 1BYAA 4FHAA 3NQ2A 3RX2A 2D20A 3FA5A 3S9YA 1WPCA 3CPGA 5IM51 4CVWA 3M0MA 1C29A 2RHGA 1GHRA 4H6RA 4P61A 4IMEA 4KWOA 2GGEA 3RN6A 3VPLA 4MB1A 1RSCA 1V6XA 5EBAA 1W1TA 1P7TA 4IPNB 3SQSA 3TZNA 3ANUA 1XPGA 3R8RA 4FI4A 4AF0B 4ZXLA 5E9XA 2O9TA 1WX0A 2E5CA 1EFZA 4DBDA 1WDQA 2O4MA 4CQCA 1O12A 3D46A 4NZFA 2XG9A 4TOQA 3WLQA 1VQTA 1V02A 1YNYA 1TYGA 5KZMA 4CQAA 1OSEA 1K02A 4LS1A 2CXEA 3M7WA 4P2VA 1W2PA 3GVRA 1EHAA 3C56A 4A3QA 1YRRA 4D1JA 1KTBA 1E6ZA 1JI1A 3E49A 2JGYA 2ISWA 4NI8A 4F0SA 2G50A 4D6HA 3R58A 1V0KA 3AXKA 2NX1A 5D02A 2OPJA 5FKYA 2GL5A 4ERIA 2OT1A 3VUPA 2QT3A 3EA2A 3N9SA 3SR7A 4G9PA 3CK5A 2YCLA 5CJNA 3C52A 4WX2A 4ML9A 2REQA 3DBPA 1BRLA 1IIHA 4QEEA 4ZO9A 5D05A 3OVGA 3ABOA 2NSOA 4LRSA 4C6NA 5FF3A 3FFSA 3WDQA 1GQJA 1QI5A 3GK0A 2GVLA 4KFNA 2ZADA 3KZPA 1EQPA 2QAPA 4J28A 1FDZA 1OCJA 4P8VA 1TMLA 2CWXA 4WDWA 2BX7A 4DBSA 5E09A 1AUSL 2O0TA 1LOSA 1JFHA 3SSJA 5FJIA 1E1EA 2EPLX 3PZGA 3T0BA 1CLXA 3KE0A 3H2MA 3NL2A 3PPGA 4HYWA 3N19B 5GVJA 4MB5A 5J8LA 1BG9A 4LS0A 1L8NA 2OLHA 4LC6A 3BG5A 3WLSA 1VPYA 1QNQA 1XIJA 3SUTA 3NDZA 1C3FA 1XFCA 3W7PA 2VP8A 1FCVA 1M03A 2J78A 3P82A 3NNTA 4NAFA 4TV5A 1ZJIA 3NQGA 3PNZA 4MM1A 3HG5A 3QBUA 5AZ1A 3FIGA 2FJKA 5D2VA 2XUCA 2PD9A 5H2ZA 2J7BA 1ZCCA 3V1PA 3M64A 3STCA 4AF0A 3OGSA 2D0FA 5I5RA 1AK5A 7A3HA 3U2EA 3QPYA 1F76A 3WLLA 3OHMB 3TTYA 1H5VA 1UD5A 2QCNA 4OQVA 1E6PA 2OO0A 1DWAM 4MNMA 2ZCGA 1HJUA 2Q3RA 1IR1A 3KW3A 3TAKA 4RR4A 1EWEA 1FWBC 2X41A 1B3OA 3EA1A 4JX6A 4QJ3B 2QYGA 1KBLA 3P60A 5LIYX 1E72M 1H7XA 3ZS4A 1OIFA 1MEIA 3E12A 1R85A 4CNTA 3WF1A 3HG2A 2XFWA 4O10A 1IT7A 2PS2A 4FLRA 1E9IA 4PE8A 3UERA 5I3DA 1W1VA 1E0TA 3ONBA 4D8LA 4PUNA 1IYXA 4I7UA 3O8AA 4L4PA 1XG4A 5IHRA 4JN8A 5D8WA 2W9MA 3DC0A 1JCXA 4IFKB 2XVNA 4J7RA 1DV7A 4FAMA 2ZC8A 4AXKA 3WLMA 2NVDA 4K1GA 1RZMA 5K4XA 4O19A 3P3BA 3GIPA 1GZJA 3OTRA 1IXNA 1Q6OA 1JDFA 3ONCA 2ZZ4A 3HPSA 3SEPA 6A3HA 4K68A 1W5MA 2YCLB 2ZZ6A 4HA0A 4F79A 3M0XA 3OIHA 1PXGA 4JX5A 3A3HA 4JL1A 3DU0A 1QNVA 1IZKA 5M2FX 1PUDA 1SU5A 3PPCA 3MC5A 3H4GA 2WBKA 1EPXA 1TIWA 2XU2A 1JPHA 2CU0A 2WW5A 2AL2B 5A5WA 2Y5EA 2Z26A 2E67A 3E5PA 2YLAA 3GR4A 1UD4A 1F05A 3BAYA 3N13A 3A6OA 2VNCA 1UWTA 1H09A 2Y70A 1Z7AA 3HM7A 2BXVA 1HQTA 4E38A 4S3EA 2A21A 5DT7A 4D6FA 4LU0A 3HMJG 3FJ6A 1MXSA 3O15A 4IUOA 1AL7A 4ORIA 2EPMX 1TIMA 3BOXA 4PB4A 1LL7A 3U8GA 2WHKA 4LYRA 5DMLA 2EGZA 5CSRA 3EXTA 3E2SA 2J8FA 5HBFA 1XL9A 1A5MC 3WF4A 2GDVA 3C2RA 3L2MA 2FQIA 3LGEA 4A05A 2A6LA 3RDKA 3VIHA 1NU5A 3GNDA 4ZQPA 4PZVA 2X0HA 2Y5SA 1YNQA 3W7JA 2YR1A 4GUFA 1FOBA 2PWDA 1W9PA 1DQUA 3VMNA 4PR4A 2VEMA 1ISYA 3PWAA 1Y5XA 3QY8A 1B3VA 3DYMA 1JZ5A 1AD1A 2JQXA 4BQ3A 4DWSA 4YL2A 1ELSA 2FMOA 3M44A 2Z1KA 4LRTA 2YDAA 3PZTA 3VDHA 3DXIA 4R85A 2WVUA 2J79A 3AS3A 3UXIA 3TYAA 1W9DM 1QNRA 3I3BA 1GOOA 3MHUA 1C8QA 3TKFA 4YVXA 4EPDC 2VD9A 1V0MA 3WN6A 3WYZA 1ADDA 2YYTA 4LV9A 4UCGA 4O8AA 2PTDA 2FHBA 4G7EA 3DX5A 4PMDA