1JUEA

1.8 a resolution structure of native lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
311
structure length
311
Chain Sequence
b'MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 116
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jueA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jueA01
1G4EA 4PTNA 2J9ZA 2Y89A 2C1HA 3W7RA 3VI2A 5FEZA 4GBUA 4OGZA 5AN7A 3GDRA 3O07A 4ZQOA 4Q32A 3QJAA 1RR2A 1LBLA 2QUVA 5HUOA 4O1AA 3LCHA 2ZZ7A 1YXCA 1CX9A 1TIMA 4XTIA 4BWLA 4K39A 3N2XA 1LDCA 1OK4A 3PBUA 4IMCA 4A2SA 4ZVJA 1X8FA 2JKPA 4H3DA 1W37A 3M5ZA 3IRDA 1FUYA 3DGRA 2E68A 2A2IA 2X30A 1DHPA 4UCGA 2QDGA 3UNDA 3LRMA 3M5VA 4HNUA 2V30A 1OG0A 3DFNA 1EP1A 1EUAA 1S5WA 3CPRA 2FLIA 4C1KA 1LM1A 4RJEA 4RR4A 3W1XA 3HB9A 3IIZA 3P61A 2J27A 2BLEA 2YGYA 3GDLA 2GJLA 2DORA 1H7WA 1J4EA 5CPLA 3EWXA 1YPFA 5C6MA 2Z6JA 4UIOA 4B5NA 3TSBA 6TIMA 4EVZA 2G5WA 3LI1A 4O15A 3U8GA 3W86A 4AF0A 3L9CA 4JYFA 3EWZA 4IMEA 3MJYA 3IEBA 3W7DA 1EUNA 3SSJA 4BFAA 2FQIA 1I45A 4QIUA 4MJMA 1WOAA 4Z08A 4UMBA 3RK8A 2J24A 4FHAA 4CQ8A 1GZGA 3HBLA 4HPXA 2NXGA 3W2MA 4ZQCA 2G95A 3TDFA 3G18A 4FIRA 3MMTA 3PAJA 4Z0JA 4CNNA 3LHTA 4Q33A 3SY5A 3BPWA 1G6CA 4JTEA 3STGA 3P82A 1DV7A 1JUKA 1UB3A 1OFPA 1R47A 3VE7A 3MI2A 2GPTA 4RXFA 4C1LA 4FX6M 1BKSA 2E5DA 4RV8A 1JCJA 1BTMA 4JD4A 2C16A 2FTPA 1IXNA 2X1SA 2X1TA 5AHFA 1UCWA 2JGYA 3NQ8A 4LC8A 3TX9A 2ZZ5A 4NNCA 3KVKA 4O54A 3W1NA 5GVJA 1QPOA 3NM1A 2CLOA 5C55A 3TAOA 3TMLA 3HJZA 5DY2A 2I1OA 4AMAA 1AK5A 3HGJA 3O6YX 4DPPA 4X9SA 4ML9A 2QJIA 1Q6LA 3M43A 3NGJA 2YZRA 2ZBTA 2ZDRA 5TQLA 5LNSA 3CLMA 3EX1A 3R12A 3DXIA 4M6PA 1Z44A 3S5YA 1SU5A 3W7PA 5BW6A 3TFCA 1KM6A 1VS1A 2ZZ1A 4TR9A 3F1QA 1QPQA 4IUOA 4FF7A 3UZ5A 4K36A 2ZFAA 1LRNA 3OVRA 2QF7A 3KVJA 3CEUA 4NQ1A 4I9AA 1HG3A 1GTHA 3LTPA 3TW6A 2RDWA 4DELA 5KZEA 4O28A 1IXOA 4LY8A 3HG3A 4G1KA 5AHEA 3NO5A 4NT0A 4AF0B 5K3VA 3HOJA 4LVGA 4YL2A 4FNTA 3UWVA 2A7RA 1B4KA 2VENA 3G0SA 4MFDA 4OV4A 1UUMA 1F7BA 3UZJA 3L21A 3P84A 3NM3A 3SECA 1WBJA 2KZHA 5AC7A 3KOFA 2Y63A 3WJXA 1LBMA 4LUJA 4XQ6A 2TPSA 1VCGA 4M7TA 1QO2A 5CG7A 3CHVA 3UD6A 3O05A 1LLZA 2VELA 4UMCA 2ZZ6A 1G7UA 4PL2A 4UTMA 1GQNA 4O1BA 3QZEA 6ALDA 3RLUA 4JTJA 1EA0A 4BF9A 3C2RA 4PCFA 1FCBA 2DZUA 2JBMA 3TQKA 4DO5A 2E6AA 5F4WA 3EXSA 4LT9A 3M9YA 1EWDA 3GK0A 1VH7A 4ADTA 1SW3A 2BTMA 3N19B 3G24A 2BZNA 3I65A 1G7VA 3TIMA 3DU0A 3ATYA 1R2RA 1XFBA 1LOQA 4WQ6A 5G2WA 5HQEA 2A6NA 1YTKA 5IBXC 2BXVA 5HNRA 4TO8A 1Q3NA 2CZ5A 3P67A 2C3ZA 2QCHA 1W3IA 3HGSA 3C8FA 4LNYA 3GXNA 1C29A 3VCRA 1GOXA 1GG1A 2YCEA 3LHYA 4FEZA 4D2JA 1VHNA 3S1WA 1VGAA 5KZDA 3IIOA 1ADOA 1K8XA 2JKEA 3NAVA 1G4SA 4UTTA 2X2GA 3IGXA 3TAKA 4FB7A 4NJKA 3M6YA 1VQTA 1H61A 3O6DA 3IVSA 4O19A 1TYGA 3G1XA 5HMSA 1SW0A 1TTPA 1XKYA 4ICNA 3HF3A 3NQCA 4JTUA 4M7SA 1XXXA 2E1DA 1I2OA 3C4UA 1B4EA 3MI3A 5KZMA 2DZWA 3M1ZA 3W1AA 3P7YA 1Z41A 2BWGA 4NX0A 3DI0A 1H7OA 3W71A 2NWRA 4NX5A 3W1LA 1Q6OA 1R2TA 3FS2A 1XBYA 3HPSA 1PCKA 4K6AA 5LHFA 1XUUA 2A6LA 3JRKA 2CW6A 2YYTA 5D2VA 2C14A 5DBTA 2DJXA 3MHFA 3L66A 2Y88A 1ZY9A 3GXPA 3RU6A 4UTKA 1AG1O 3FA5A 1QO5A 2DZSA 4JTTA 1KFEA 3UWWA 4MLJA 4J9JA 3GNNA 3UWQA 1A5BA 1SSGA 4O8RA 4Z1BA 4CCEA 1QMLA 3GAYA 3D0CA 1VYSX 1C8VA 3TK7A 4UTWC 2JK2A 1LZOA 1M7PA 4TU1A 3E49A 3PVFA 3QYQA 3I7SA 3W75A 4NZFA 3W2LA 2X1UA 3EEGA 3GYEA 3QM3A 5I3FA 3KRZA 4EOUA 1A5CA 2C0AA 4I7VA 5KTLA 4Y9AA 1QPRA 3NQDA 3MHUA 3MYOA 4GUFA 3AO0A 4DXVA 3TKFA 5CZSA 4I7WA 1A5AA 1TV5A 1ALDA 3LI0A 5DXYA 5G2HA 3LCGA 4K8HA 3MP4A 3QMRA 4RZ6A 3WJWA 3W85A 1O95A 4MUZA 4LC6A 2VEMA 1GYLA 2RH9A 3NQFA 1ZALA 3C56A 3O6CA 5AFDA 4O12A 3R2GA 4WOZA 3W7JA 2F7FA 4CQ9A 3Q2DA 1TPUA 1HO4A 5I3HA 1H63A 2OT1A 4ZQNA 4DBEA 3TQ0A 4QQ3A 4YCPA 1W31A 1P0KA 2YX0A 3BG9A 4LUIA 1OJXA 4FNUA 2HTMA 5KSWA 3BLFA 3OBKA 1H7PA 3ZWTA 1S3HA 4IGHA 2V0TA 3E9AA 1L6YA 3LTSA 3S0CA 4R7JA 3N9RA 1RV8A 5D03A 3MYPA 1XBXA 2Y7DA 3SJ3A 4IPJA 1GVQA 4MPQA 4ADUA 3KXQA 2QCLA 3ZR4A 4IPIA 1L9WA 3DFOA 1I2PA 3STEA 3W1QA 1K7XA 4FO4A 4MOZA 3HIJA 1QDSA 1M5WA 1N7KA 5AYYA 5DLCA 4JGDA 4ZL1A 3C3NA 1DVJA 1LCOA 2DP3A 3UXDA 1KFJA 3GDKA 2QR6A 4TX9A 5TBOA 1K03A 2C6QA 2Y7GA 4MKNA 3USBA 3PSVA 2XN1A 3S1VA 5D2YA 3PR2A 3PUOA 3LHZA 3NL6A 2RKXA 1Q45A 1FDZA 3TNOA 3W7GA 2R94A 4JXCA 2QCFA 3R5EA 3ATZA 5BOOA 4IOTA 3W7NA 4HIBA 3KAOA 1KM5A 4UR7A 2FFCA 4YMZA 3TXVA 1IXQA 2RHGA 5LHEA 4AWUA 3EWYA 4O13A 4KWWA 4E38A 1BWKA 2A5HA 5C2XA 2A7PA 4BWLC 5J5RA 2E6FA 2EAWA 3G1FA 1ZHAA 2VC6A 3TUUA 2OCZA 3TR2A 1TTQA 2CLKA 1BWLA 4LVDA 4POCA 3NDOA 3W87A 4M6VA 3EXRA 1FWWA 3C2VA 1PIIA 3BW4A 2FB2A 4NXSA 3IVTA 4ORMA 5E93A 1FQ0A 1G67A 4YCOA 1GJPA 4MY1A 3STCA 4IMDA 2DU2A 3NPXA 4S2CA 2FPTA 4BR1A 2X16A 4S2BA 1FCUA 4RXGA 3M5YA 3EX6A 1EIXA 3G8RA 3EX4A 1J5TA 1TPDA 3P8JA 1QWGA 4DPQA 5H91A 4AEOA 4O4VA 4JX4A 3INPA 2J9XA 1F05A 2GQAA 1TO3A 1L6SA 1FXPA 4LW7A 3GNDA 4XBSA 5DBUA 5E1QA 5BMXA 3P81A 4GNJA 1E51A 1H5YA 3O15A 3W2UA 3W23A 1Q6RA 1VZWA 4O1DA 1LBFA 2VFEA 3LOTA 1N8FA 3OEXA 1W5QA 3LXAA 4UTIA 1L2UA 4XUGA 5T26A 3C2OA 1R2SA 5LZLA 3W74A 3Q37A 3TMQA 3HMJG 1OF6A 4Y96A 5BRBA 3W3OA 1F74A 2NUXA 3CB8A 3KFTA 4ZQMA 2Y6ZA 3M47A 3LXBA 3OVPA 3L5AA 3UWUA 3SGZA 3R13A 2ZQ0A 1FDYA 2PRHA 3VNDA 1KV5A 4O16A 3STFA 1DBTA 1L6WA 3PBYA 1ZAIA 3WJZA 1EP2A 3M16A 3SFKA 1P4CA 1WBHA 3U2OA 1FCVA 4QNEA 5F2GA 1AL7A 3Q58A 2VKZG 5L9FA 1TPFA 1T0OA 3I6RA 2VEKA 4Z1DA 3BARA 3C2EA 1DQXA 2QAPA 5EY5A 1KFBA 4ORIA 3KVLA 2V9DA 4O57A 3T40A 4JTIA 4UNKA 1AW5A 3FOKA 1I2QA 1K8ZA 2WSQA 4IXXA 1WV2A 3LGEA 3PB2A 3FJ6A 1VR6A 4E2DA 4UFIA 4UFKA 5D32A 1VLWA 4QAIA 1DQWA 3B8DA 2E6YA 3JS3A 3FFSA 3A5FA 2VFDA 3GLCA 1W3NA 3OIXA 1LP6A 4JTKA 4LOCA 4IX2A 5HR6A 3C6CA 2NX9A 1ME7A 4JDYA 3GAKA 4AVFA 5AB3A 3LXCA 4W9TA 1PCWA 1O5KA 5EYWA 5K2ZA 3QMSA 2GOUA 2ZA2A 3NQVA 1JR1A 1Y0EA 1H1YA 2ZZ4A 3ABSA 1NFBA 2TYSA 1H1ZA 5HWNA 1YTEA 5EBUA 1PE1A 3BO9A 4WUIA 3NQMA 1XI3A 2WKJA 2ZZ3A 1KFCA 4A2RA 1XUZA 4PH6A 2QKFA 4Y8FA 2ZA3A 4GXMA 3W73A 1OX4A 3C0JA 3NXFA 1NF7A 1H60A 2P0OA 4ZZ9A 4DF2A 1O4UA 2DZTA 3W1RA 4PEKA 4Y6GA 5J5DA 4WJEA 2FJKA 3HGRA 2RFGA 2ATMA 1VC4A 4JYDA 4DO6A 4N9CA 5DCBA 4AWSA 3G1YA 4NJIA 3NQAA 4OE7A 5HR7A 2YW4A 3CIXA 3GDTA 1AW2A 1YLVA 2VXNA 4IMGA 5LGXA 2YW3A 5AHIA 4LS0A 3UWZA 4R53A 2E09A 2QCMA 3DH7A 2FPVA 3KRSA 1DJQA 4NNBA 5D09A 1YXDA 3W2JA 5D37A 1IIGA 2YFOA 4UFJA 1D3GA 3T7VA 3PULA 2LLEA 2VFGA 4RZ4A 2QUUA 3RF9A 3LLFA 1KLZA 2CLEA 2Q3RA 3B0PA 4O4WA 2GUUA 4MIMA 1TQXA 1HFBA 1D3HA 4JEQA 3ABRA 3T55A 2A7NA 2NLIA 2WV8A 3BLIA 1WAUA 4JTSA 3EWUA 5AC6A 2WNQA 3L5MA 4O50A 4NJGA 3PWAA 1SPQA 1T96A 4PODA 4X3ZA 3QH2A 5G1TA 4KKXA 1LORA 3R89A 1OFBA 1HL2A 3VE9A 2QUTA 3W7CA 1F5ZA 3H54A 4BI5A 4H4IA 5HWJA 2EF9A 1M7OA 2QCNA 1OYAA 3W7OA 2V5BA 3JR2A 3FKRA 4N4QA 5BNKA 1K3UA 4Z1CA 3PUEA 1X7FA 3RNDA 1KA9F 3LRKA 1KTCA 3QPZA 4MYXA 2ABBA 1KBIA 2CU0A 3FYOA 4MFEA 5KMYA 3QSTA 2BX7A 3DAQA 3NQ2A 4I7UA 3KX6A 4JYEA 4OU1A 3KRUA 5G1YA 2B7NA 4TMCA 2GQ9A 1AL8A 2NZLA 4O10A 4K8EA 1O5XA 1KM2A 5C5YA 3W72A 4FNQA 3NPWA 4UTJA 1P5BA 3NZ1A 1SR9A 1HTIA 2E5CA 4FX8A 5F4XA 3SR7A 1GT8A 1OX4B 5K4ZA 3GIYA 3W9ZA 3TV8A 2OMAA 3P5YA 3W2NA 4KFPA 1W54A 2C15A 4MJZA 3BW3A 3THQA 3EXTA 3B06A 1JCXA 3A24A 1UBSA 3DZ1A 2W0UA 4RK8A 1SZNA 2H6RA 1KM0A 4XZ9A 3N9SA 5CSSA 3L0KA 4HKPA 4CCDA 1XDMA 2G97A 2OX1A 1MSSA 2GVGA 3THAA 4O52A 3T4CA 1QAPA 3GZ3A 4ZQRA 5CPNA 5EPDA 3HPZA 3NQ7A 1W5PA 2C13A 3N34A 1KV8A 3NEVA 2H3BA 3P5ZA 2ATSA 4KWVA 5LNUA 5I3IA 1H50A 2QCEA 3NA8A 3TJLA 4M6QA 4OQVA 5E0KA 3QW3A 3SW6A 4CCCA 1OVDA 2ZRYA 4ZMGA 4WZHA 1TJRA 3A5VA 1N55A 4HHPA 4O0ZA 2P10A 5D02A 1FX6A 3L68A 3BV4A 2YXGA 1MEIA 1NSJA 2IQTA 2D73A 4N2YA 2WPBA 1H51A 5EL1A 1CW2A 1TQJA 3NR0A 1SO3A 1S5VA 4IWWA 3R8RA 3SIZA 3HGOA 3QSRA 1GVSA 1M6JA 3G1DA 4MZ8A 1W5MA 3G3DA 3HG5A 3PG8A 5I3GA 3EWWA 3PUDA 1TV8A 1XDLA 1JVNA 1DJNA 5HJLA 1KW1A 1GVRA 2DZVA 3G1VA 3PM6A 1ML1A 4E2BA 4RCXA 2H8XA 2R8WA 1RQEA 1WOBA 3GDMA 3TU9A 4JX5A 4K38A 4JTGA 3A23A 1A50A 3S5ZA 1V7YA 3QQ1A 1TPH1 2HS8A 2AAMA 3ZFHA 1Q6QA 3GKFA 5IBXA 1JQXA 3A22A 4CNPA 3W84A 3CWOX 2ISSA 3DFPA 3P60A 2Y85A 5DY3A 4AHOA 1ZNNA 4HPJA 2NUYA 3W07A 1PHQA 4NU7A 3KVMA 5CKSA 3TXZA 1X1ZA 2V2HA 5CSRA 2YDAA 5G2IA 3N73A 1JCNA 4GWEA 4JS3A 3G8EA 1KFLA 1VCFA 4QISA 3G0XA 3PSWA 3MP3A 1MO0A 3L0NA 2V2CA 1LYXA 2H3DA 4UFLA 4IXHA 2DJLA 5D2TA 2CLHA 2J9YA 2YSWA 5U7SA 1GTEA 4HSOA 4H6KA 3WJSA 3B0VC 5FESA 3UXAA 4MLRA 4AWTA 3N3MA 1NF0A 1K02A 1KTBA 2J88A 3G1AA 5LNVA 3W7QA 2TSYA 2ZRXA 3GR8A 3W7MA 4UXDA 3M7WA 1EWEA 2E77A 1JULA 3N2MA 3MUXA 4AXKA 3UY7A 1W0MA 3EKZA 2AGKA 4JIQA 4OHQA 4UFHA 4HNTA 1FDJA 1PV8A 1PVNA 1Z42A 3TE9A 1VPXA 2Y7FA 4UMAA 1H7NA 5AOUA 2ZRZA 1JUEA 2HS6A 1IIHA 4X2RA 3VKJA 1TJPA 4WY0F 3HG2A 5KINA 1V5XA 3OG3A 3P62A 1ICQA 3P74A 4YWIA 4IJBA 4O11A 1KM3A 1U83A 3MBFA 4ADSA 3SGUA 3DFTA 2Z6IA 3CM4A 4UTWA 1ZFJA 5A8GA 4E0CA 3M41A 8TIMA 3Q94A 3BVJA 3BW2A 1JRBA 3OVQA 3W7HA 2V82A 3LV5A 4HT3A 2CZFA 3QFEA 1TPB1 1T99A 1SO4A 4WXZA 3W7EA 4WOQA 4O53A 3GVGA 4FNRA 3W1MA 2DZXA 3V75A 3NNTA 3UWYA 1B3OA 1NAL1 2CLIA 3E02A 4JY8A 2E5BA 2O7SA 4R33A 5BMWA 4DF1A 4NJJA 3S9YA 2Y7EA 1WDWA 2YYUA 2OJPA 1OFQA 4OWGA 1RPXA 4AHQA 2DZPA 3TSMA 2EGZA 3LHVA 4JN6A 1KM4A 1B9BA 3TCEA 3QEZA 1VYRA 3W1PA 3LCWA 4XKYB 2Z1BA 1SSDA 2ZTJA 5HULA 3O8AA 1FWNA 1R30A 3EX3A 4JTFA 3DKLA 4HSNA 4Q4KA 3RMJA 1OHLA 3TROA 3P8IA 4K7VA 4DF0A 2RDTA 3MHGA 1U5JA 3LX9A 2B7PA 4Z0SA 1SFJA 3HPXA 3L0GA 2PRLA 5CZTA 4K7YA 2Y70A 2XN2A 1AMKA 1KBJA 2XFWA 4JX6A 1SZGA 1OYCA 1MXSA 3IIPA 3NZRA 4O17A 1YPIA 4A22A 3MW7A 4WX2A 4JICA 2W79A 3OHIA 4MVAA 3QF0A 3B4UA 4HNVA 1OFDA 3W83A 3W76A 5F2IA 1KLYA 4AAJA 2V5LA 3PBVA 2H90A 3ZS4A 3NL3A 1RQHA 3S42A 4GFSA 3BGGA 5D05A 1OABA 1W5OA 2B4GA 2WSRA 4M5PA 7TIMA 1IF2A 5AHMA 2FB3A 5CPMA 3C2FA 1FBAA 4A29A 3TJXA 3W7LA 2VEIA 3TW7A 3B03A 2NX3A 1I2RA 1EB3A 1P0NA 1GVFA 3WK2A 1IXPA 3F4NA 4MYAA 3IVUA 2AQWA 4TIMA 3LCLA 5U4NA 1XC4A 3BK0A 4LU0A 4QSHA 1SZEA 4QNWA 5CPOA 5AHNA 1LROA 1WXJA 3FJLA 3LB0A 2QEZA 3L5LA 4DEFA 3FIGA 1I8JA 4QITA 4WY0A 1SQ7A 3TA6A 3CU2A 2J6XA 2FDSA 3NPVA 2WSYA 1LLWA 3EKLA 3IGSA 4NNAA 5A5WA 5FF4A 3DHFA 2PE4A 4JTHA 4PC8A 3IIXA 3G22A 4R34A 1KTNA 1TMHA 2EHHA 2GQ8A 4K37A 1JCLA 1F73A 4U28A 1FWRA 5AYXA 4S1FA 2P1FA 3KHJA 2NXIA 4JIPA 4EWND 5F1UA 1TPVA 5H2ZA 3PF3A 5F4SA 1GVOA 1SUXA 1GPWA 2YFNA 3V1PA 4LRTA 1QNVA 2QDHA 1MZHA 2NV1A 1ME9A 4P61A 5AC8A 2A4AA 3BG5A 3EB2A 1FXQA 3GB6A 5C54A 4JNMA 1C9DA 1F6KA 1GYNA 3WJYA 1A53A 2QCDA 4JR5A 1RVGA 3DENA 3BGJA 4DQWA 3LHWA 1ZAJA 2ZRVA 1SW7A 2CFFA 5K9CA 3YPIA 4AHPA 4LRSA 1XBVA 2TRSA 1W3TA 4KFOA 3SZ8A 1PS9A 3W22A 1OFAA 3W7KA 2WO5A 3GX9A 3CWNA 3MO7A 1SFLA 3MBDA 3GR7A 3G1SA 2HSAA 1I4NA 2PCQA 3PY2A 1WYIA 3I7QA 5HWMA 1FY6A 3HO8A 3NG3A 4UUIA 3LTYA 4A3UA 4NUWA 5FF0A 1OYBA 5DELA 1JQVA 4LVBA 4WXYA 2Z0IA 2NXHA 3WK1A 5L6UA 2QCCA 1NVMA 2ZCGA 2FIQA 3HG4A 1TRDA 1TTJA 1VCVA 3F03K 1UASA 3O63A 4OBTA 2I14A 4PL1A 3T44A 2NWSA 4O1CA 3A21A 1OFEA 3VFLA 4RZ5A 5LNRA 3P80A 1J2WA 3W1UA 1K8YA 1R46A 4N9BA 5FF2A 1YXYA 3IV3A 4GRSA 3S8HA 1YYAA 1O94A 3G0UA 2WNNA 3GKAA 1EEPA 3GXTA 5EKYA 4WY0B 3ELFA 1S5TA 1XL9A 3NL2A 3QRHA 3NYZA 2CLFA 2Q8ZA 2ZRUA 1JCYA 2GJNA 5CZJA 1ICSA 2ISVA 3DBPA 1G4TA 1TPC1 2V81A 4UTTC 1CI1A 3NQEA 5G4EA 3I7RA 1JUBA 1QOPA 1JCMP 5I3JA 4XBKA 1VRDA 1EPXA 5CGQA 1H7XA 3G3MA 1THFD 3LCFA 2JGQA 4YXGA 1HO1A 3LBMA 4GUGA 1H7RA 2PRMA 2V8ZA 4CNOA 2ZRWA 3HQ1A 4Z1AA 1QCWA 4Y90A 3E96A 4O14A 5LNWA 3TH6A 3PBWA 3CTLA 3PG9A 4AB4A 5F1VA 2HMCA 1I2NA 3ABQA 3CEPA 3LLDA 2EPHA 2QCDB 5HUPA 3DI1A 4FIQA 4YLWA 2QAFA 4N4PA 5G4WA 3WFAA 2B7OA 5CZ0A 2A1YA 3M5XA 1FWTA 1LOLA 1ME8A 5LGZA 1W56A 1WX0A 2VFFA 3H55A 3LM7A 1JRCA 1TPWA 1GWJA 1A5SA 4DO4A 3TFXA 1XCFA 1W8SA 4WD0A 3L65A 4N9DA 5I3KA 5D04C 2NV2A 2PC4A 3ABOA 5D38A 2CWNA 5FF3A 5DN1A 2UV8G 3LERA 1Z48A 1UJPA 1MEWA 1QOQA 2W6RA 4HN4A 2Q3OA 2WJZA 2WQPA 4LV9A 4QJ1A 2GVJA 2B7QA 2JKAA 5IM51 1W1ZA 1WQ5A 1YADA 3O16A 4RKAA 3TQVA 3QW4B 5KITA 5MHBA 3NVTA 4ONVA 4UR8A 1OX5A 3BG3A 5D2WA 5AYZA 3UQNA 1XBZA 4FNPA 1H62A 5DCEA 1IGSA 2F84A 1VHCA 2I9EA 3B04A 3S1UA 5DCDA 1GG0A 4PFMA 3CQ0A 3UY8A 1AW1A 3W1TA 3I68A 1RQBA 4RLIA 5SWUA 2X1RA 4EF9A 1OF8A 2ALDA 3NOEA 5LKYA 5HINA 4NZJA 2V2DA 4EF8A 4MZYA 1WA3A 3EWBX 3LBCA 2A0NA 1DL3A 1YDNA 3M0ZA 4O18A 4KFNA 5G5IA 3BLEA 3MP5A 1YTDA 3L67A 1VJIA 5ABTA 1TV7A 3E12A 1TCDA 1ZENA 2ZA1A 3N14A 3DKJA 2BSLA 4QM1A 2Z2UA 4PA8A 4L4MA 2VFIA 2ZZ2A 3UPBA 4LWWA 4GE8A 1OFOA 4LV4A 3NQ6A 3TC7A 5FEPA 4FX7A 4L4LA 4OV9A 3MI6A 5FEWA 3LV6A 4N6FA 3B0UX 1BEUA 3O1NA 1KM1A 4LS2A 3S6DA 3UPWA 1D9EA 2C18A 2CZDA 2XN0A 1ZAHA 1B57A 4FXSA 5K7JA 4IX0A 3NPUA 3NQGA 4OT7A 4UFMA 3SI9A 4MY8A 3S1XA 4BI6A 5FF7A 2OT0A 3WK0A 1TREA 1SO5A 1X6UA 4LVAA 5D2XA 3QMTA 4ALDA 1OK6A 4XKYA 2B0MA 1EP3A 1SZFA 2ISWA 2R91A 3S5OA 4HNNA 1FCQA 3U6WA 3W7IA 1NEYA 1LRQA 3PC0A 3E0IA 4NJHA 2CZEA 3CIWA 1HUVA 1P1XA 2ZYFA 3DFQA 2GVLA 2TMDA 3S5NA 4JDBA 3H53A 5D33A 2R14A 3LHUA 2WNZA 4UNLA 5AHLA 2E6DA 4UC5A 2WOQA 4BI7A 1PL9A 4N9EA 1KFKA 1G69A 1VLIA 1PHWA 3EX2A 1F6PA 2OZ0A 3B05A 4GUJA 1TTIA 2A21A 4P2VA 2RDUA 5K4XA 1SO6A 3DFSA 1ZCOA 3MWAA 1VYPX 1UUOA 4UTLA 3F4WA 4RX0A 1T8XA 4NVTA 3K30A 3ANYA 3FEMA 4FXRA 2C19A 4FNSA 2PURA 1TPEA 4DBDA 1ONRA 5FEXA 5K9DA 5LSMA 4XWUA 4GUHA 1GEQA 4CLMA 1QFEA 5F2LA 3PB0A 3FYPA 2H8ZA 4MZ1A 2VOMA 2Y61A 1YDOA 1ICPA 1QR7A 2ZTKA 3CT7A 4X22A 3RFAA 4BK9A 1RD5A 2G96A 3UYCA 3FKKA 3OA3A 1XM3A 3QC3A 4LVFA 2QCGA 4U4MA 4N02A 2QJHA 1FWSA 1DKWA 3LCIA 5D30A 2NX1A 4CQAA 1O60A 1X1OA 1LTDA 1EX5A 4GC4A 4XTDA 3G1HA 1K7EA 4IMFA 1G4PA 2Q8LA 3W70A 3TC6A 4LTSA 4EIVA 2NUWA 4JTLA 1QPNA 1RZMA 3A9IA 3AJXA 1ZJIA 5F2MA 3W88A 2O7QA 1TRIA 1DORA 2FPYA 2YR1A 3C52A 4TMBA 1F2JA 3QPYA 3ZWSA 2VFHA 3NL5A 3RLVA 3O06A 4LS1A 1OFRA 3QQ0A 5EA9A 3TSDA 1MEHA 4N6EA 4AH7A 4ZQPA 3W6YA 4A21A 1W5NA 3IGUA 4IQLA 3CC1A 4MY9A 3L2IA 1TSIA 3PS7A 3IIVA 1LRTA 4UTUA 1JJKA 3FLUA 4NXKA 5K9XA 2YPIA 5DXXA 2ABAA 1YDVA 3M44A 4O0KA 4GJ1A 2A85A 4M19A 2CLMA 5TIMA 5EMUA 2VEPA 2CLLA 1LOSA 3W2KA 2EKCA 1F76A 2Y62A 4GUIA 3LCXA 3T78A 1OX6A 4JY9A 3LDVA 3DHDA 1DOSA 1K7FA 5FI8A 1TB3A 4UTHA 3LRLA 2QJGA 3C61A 3WK3A
chains in the Genus database with same CATH superfamily
2Y89A 4QG9A 2ZXAA 1CCWB 3VI2A 3CAKA 5FEZA 1V3LA 4GBUA 2O4MA 4LB4A 4Q32A 1RR2A 1ADDA 1LBLA 5HUOA 4XZBA 3CUIA 4HP5A 4LF1A 3FJNA 3S2NA 3ENLA 2NQJA 1ODZA 3N2XA 4PMRA 3ZO9A 1OK4A 4IMCA 5I06A 4GH1A 4ZVJA 3VIJA 1X8FA 1W37A 3L4YA 3RCYA 1K77A 3M0YA 2A2IA 3UNDA 4QAWA 5CAKA 4HNUA 4QX4A 2INEA 4M81A 3NJ3A 3N17A 3DFNA 1S5WA 3ARPA 2FLIA 1K9DA 1LM1A 3VGEA 4RR4A 3WD0A 3IIZA 4LNCA 2J27A 1MW3A 3RPTA 3GDLA 2X40A 3MUIA 4M51A 5GPRA 1J4EA 1S2TA 2P8BA 4B5NA 4LYRA 1XIBA 3BSMA 5BXTA 4V1XA 5DRIA 3OLEA 2R1MA 4Q8MA 3N6QA 2XFFA 4IMEA 2NQZA 3MJYA 3PTMA 3U2ZA 3RO8A 1MZRA 1EUNA 1XRTA 3FYYA 4BFAA 4QIUA 4MJMA 4UMBA 1F07A 2J24A 4FHAA 4JFVA 1ZS2A 3PHAA 3W2MA 2VGIA 4ZQCA 4AZCA 3TDFA 2XYLA 5JH2A 4Z0JA 3S47A 2ZE0A 4CNNA 3T08A 4XD3A 1ZBKA 3NYDA 4JTEA 3STGA 3P82A 1UB3A 1R47A 4C1LA 1XLCA 1VEOA 4GNKB 2ZVRA 2E5DA 3VZZA 4RV8A 4HK7A 2C16A 4HMEA 2X1TA 3WLSA 3OIHA 2JGYA 1OCQA 3NQ8A 1AQ0A 4LC8A 1IEQA 4GIAA 3KVKA 3IJ7A 5GVJA 3NM1A 4DJDC 1IT7A 5C8BB 3HGJA 1PUDA 2QJIA 2DPEA 3NGJA 4RE2A 2ZBTA 5TQLA 4CCZA 3R12A 1OM0A 1QASA 3PJTA 4M6PA 1FWEC 3MO4A 1JXJA 4XSMA 3T0AA 1SU5A 3W7PA 2CC0A 1QPQA 3K2GA 1KGXA 2VD9A 4JN8A 3IJLA 1Y7VA 4AC1X 4B2DD 2ZXQA 3THDA 1BXCA 1XIDA 3VOFA 5KZEA 4O28A 4LBUA 2HXUA 2PDNA 5EFFA 3S46A 5AHEA 3NO5A 3WLRA 4AF0B 3WL1A 3NEHA 2VENA 2BVDA 3AZRA 4TV5A 4OV4A 1XLGA 3UZJA 3F5JA 1EC8A 3L21A 4YN5A 3P84A 4C1NB 1WBJA 3GIPA 2VX4A 3ZXWA 1CGYA 5C0QA 4LUJA 4DBUA 3FJ4A 4QG8A 3OO2A 1QO2A 1W3LA 1R85A 3MDWA 3R79A 4UMCA 4DZHA 4F0LA 3CYJA 4OUIA 3OBEA 1GKPA 4JTJA 2JQXA 1W8GA 1EA0A 1K8CA 4PCFA 1PB0A 4EPDC 1WZLA 5CLWA 3TQKA 4DO5A 2QLYA 5F4WA 4DYKA 3EXSA 4LT9A 1EWDA 1FKWA 1WO2A 4H41A 1YHTA 3I65A 4FLOA 4MB4A 1G7VA 1TV3A 3BMVA 1EOKA 3DU0A 1R2RA 2FMNA 1LOQA 3ZT7A 1AFSA 3USZA 3TA9A 4Z17A 2BXVA 2CZ5A 3A4JA 2G3NA 2FKPA 3JU2A 4LNYA 1OIMA 4GVIA 3ALFA 1E4IA 4PSPA 3LHYA 2YCEA 1VHNA 1QBBA 3UU0A 1VGAA 5KZDA 1FWGC 5HNTA 4D1IA 3H2CA 3NAVA 3WDPP 4MKSA 3UG8A 3TN3A 4ATLA 1VQTA 3IVSA 1EZ2A 1ONEA 4H7VA 1XKYA 3HF3A 5HA7A 4M7SA 1XXXA 4GKTA 1MNSA 3C4UA 5KZMA 4AG0A 3P7YA 3GVQA 1Z41A 2BWGA 2YCKX 1XYZA 3DI0A 4H8HA 4TQTA 3FS2A 3LMZA 4BCEA 1XBYA 4K1WA 3R11A 3R0UA 3WQ6A 1JYXA 1A0EA 4HQVA 4MWAB 2CW6A 2YYTA 2PDHA 4J7RA 4R7OA 5TD4A 1VP5A 3AIUA 3L66A 4RUBA 3ARZA 2Y88A 1ZY9A 2FJUB 2XSBA 1J6PA 4B5WA 3PPHA 3H22A 5CG0A 1F3WA 5BWAA 5E09A 3UCCA 3FA5A 4CEUC 4BJHA 3VM7A 3UWWA 4MLJA 2VZTA 2BHYA 4O8RA 4DJFC 3OLIA 3WBAA 3BLKA 3D0CA 3SAZA 1VYSX 4LF2A 1RCQA 9CGTA 2JK2A 2ZX8A 1EJRC 3E49A 3QYQA 3OOQA 3W75A 4NZFA 1Q85A 1V3KA 3QM3A 5I3FA 3KRZA 5LIXX 1T41A 1A5CA 2C0AA 3E0WA 1LG1A 4LFYA 3VNZA 3GBEA 3WMSA 1TV5A 3BH4A 1ALDA 5BCAA 3LI0A 1W1A1 2CXEA 3QMRA 4OOZA 1SZRA 3AIVA 3F2BA 1W1PA 4LC6A 3NQFA 4PTMA 2VC9A 3C56A 3II1A 4O12A 3R2GA 2NSOA 4E2OA 1TCMA 1EYWA 1L6GA 4NRRA 5C9RA 3NSXA 4CQ9A 4M82A 3Q2DA 4HMCA 1TPUA 1H63A 5EGRA 3ZOAA 4DBEA 1BG9A 4PUEA 5T91A 1HJWA 1P0KA 4AXNA 3LPPA 4FNUA 1L8NA 1DXIA 3DIPA 2X05A 5A6BA 1V0MA 2Q09A 1H7PA 1UKQA 4IGHA 4AD1A 3E74A 3LTSA 1K9TA 4HSHA 4PFHA 3VOJA 4YVPA 2MNRA 2YCLB 2HVOA 1I0BA 5M1TA 5CC5A 4IPJA 4MPQA 4XZWA 3KXQA 4IPIA 1L9WA 5A3HA 1CLXA 3K4WA 3VK5A 1I2PA 3W1QA 4FO4A 1UQYA 3WQ8A 1N7KA 3QOKA 1M41A 4ZL1A 2BFGA 4PBEA 3CYVA 3C3NA 1DVJA 1JYVA 1KFJA 4TX9A 4KEVA 5TBOA 1HKMA 3BC9A 1UPMB 4C6EA 4DWSB 4B9YA 4BHYA 2QZRA 3GVWA 2YCJA 2F2HA 5D2YA 5CEWA 3PUOA 1OSEA 3LHZA 4JCMA 1H09A 4JXCA 2PLKA 2RUSA 3R5EA 5BOOA 4HIBA 4ZB2A 2OYMA 2VZVA 1YRRA 5LIUX 3TXVA 2RHGA 1TZ7A 3G6LA 4EE9A 4E38A 5BOFA 3DERA 2YA1A 3W02A 2D0GA 3TUUA 2NVCA 4CVUA 3RXZA 4GVHA 4POCA 1IZJA 4M6VA 3AHTA 4JQAA 1FWWA 4XBJA 3QV9A 2FGLA 2DUZA 3VIFA 3STCA 2DU2A 3WLIA 3WQOA 3NPXA 1KRCC 3F7JA 4S2CA 2RGLA 2YL8A 2GJPA 4FLQA 4S2BA 1FCUA 4YPJA 1KB3A 3VZXA 1OY0A 3G8RA 1J5TA 3PJUA 5ABFB 1F05A 3RJXA 2GQAA 3CZKA 4G7EA 3GNDA 4XBSA 4KEZA 3KL0A 3O2LA 4RW5A 3P81A 3W2UA 4O1DA 3V5CA 5HNNA 2P3ZA 2KAUC 3AYVA 3VNMA 2VYOA 2PLJA 1L2UA 4FS9A 3KTSA 4KPLA 5T26A 1E1FA 3OGVA 4PTXA 1QW7A 1K9FA 4IJRA 4Q8QA 1Q2RA 3CB8A 4HYVA 3U4AA 5CGTA 3H6OA 1AD4A 4HGXA 3WQ5A 1B3VA 1GONA 3LXBA 3ZM8A 4HA1A 1GOMA 3OVPA 4YIWA 1XYFA 3UWUA 4LPCA 1R3YA 2YDSA 3UZYA 3PBYA 7CGTA 5CJMA 9RUBA 3G1RA 5F2GA 1HKIA 3BL3A 1XIFA 1AL7A 1E9IA 1TPFA 3H2AA 2VX6A 2XDFA 5E0FA 3GVRA 4KBXA 1PZ2A 2VEKA 1Q7ZA 5T8GA 1HJQA 1BPLB 4AX6A 4CEXC 3SRFA 2A79A 4HYWA 3W25A 1KFBA 3N29A 2GGHA 5IHSA 2P3EA 1WB0A 5XIAA 4AYSA 2VZOA 2RDXA 2ZUWA 2F2KA 3QN3A 4IISA 3PB2A 3FJ6A 1VR6A 1S39A 3OPSA 4LGXA 4LXFA 4QAIA 1DQWA 2E6YA 3CQHA 5FJRA 4XZNX 4XB3A 2DUXA 1FWHC 4HA4A 1G1YA 1Z6KA 3HQOA 1PCWA 5K2ZA 1YDYA 1SJDA 3NQVA 2ZZ4A 1H1ZA 4TVCA 3QR3A 3M0HA 5EBUA 4PMQA 5A2CA 1XUZA 4QR6A 4E8DA 1OX4A 2WJEA 2V68A 4ZZ9A 4GLEA 1O4UA 3W1RA 4Y6GA 4WJEA 2RFGA 2ATMA 3KTCA 1CDGA 1J10A 3IACA 3TQPA 2YDRA 2HVMA 2QPSA 2QIWA 4MUPA 2YW4A 4IMGA 3C0LA 2YW3A 5AHIA 1Z89A 3GXDA 3VIKA 4YHGA 3DH7A 1XYMA 2DSKA 3KRBA 4DWSD 4S3KA 4S3DA 3W2JA 5D37A 4EPBC 3A47A 4C6CA 2GSJA 4DUOA 4UFJA 2FTWA 3TLLA 2WYSA 3PZNA 3CMFA 4PULA 4DN1A 4PUDA 1KLZA 2Q3RA 3B0PA 3SY1A 1E9LA 4ZR8A 1HFBA 4F40A 3ABRA 3OZMA 1Q8JA 2J7HA 2A7NA 1XLMA 2F6KA 3EWUA 3Q65A 1NWRA 1QI0A 1QT1A 1SPQA 4FMVA 3JUGA 1FRBA 4BI5A 3AQUA 1M7OA 2VO5A 3BGAA 4N4QA 4LAMA 1K3UA 4Z1CA 2AQOA 3PUEA 4BS0A 3KOWA 3QV6A 3LRKA 1E6NA 4MYXA 4C6NA 1CGTA 2ABBA 3FYOA 1UWUA 3B8IA 3B3DA 3PPFA 4OU1A 3HJEA 2HROA 3KRUA 2GQ9A 4O10A 4ERAA 4XAZA 1I9CB 1LWHA 5C5YA 4JIIX 1WUEA 4Q4OA 4RZBA 2O56A 1G0CA 2Q01A 2E9MA 3GXFA 2J13A 3QGVA 1GT8A 3GIYA 2OOFA 3TV8A 2OMAA 3W9ZA 1XIGA 3IK2A 2REQA 2VX5A 4ZOEA 1RJQA 4KFPA 4MJZA 3SRKA 3BW3A 2J74A 4RK8A 4AEEA 3AI0A 1KM0A 3N9SA 5CSSA 4CCDA 1RXOB 2G97A 1J12A 1QI2A 3T4CA 3AIRA 5KETA 1VBGA 5EPDA 4NAFA 3ITGA 5EFDA 2QGYA 1RCXB 2H3BA 3P5ZA 2YB1A 3WDRA 5LNUA 4YVVA 3TJLA 4M6QA 1UH4A 1W9DM 3SW6A 3AAMA 4WZHA 1UMLA 2XIMA 4ACYA 1EGMA 4O0ZA 2P10A 2DT1A 2E3ZA 1MEIA 2D73A 2D22A 5G4HC 9XIMA 3EMQA 8XIAA 1H4PA 1VAHA 1XINA 4FAMA 1SO3A 1S5VA 3R8RA 1ZJBA 4TXEA 1GVSA 1RP9A 2JFEX 4Z2KA 2WCGA 2VEGA 5I3GA 7ODCA 1WCGA 2WHLA 1JVNA 4LUYA 1DJNA 5PTDA 5FJOA 1TUFA 2PODA 1E6SM 1FKXA 4E2BA 4PE8A 4P5UA 3KBWA 2GJXB 1DIOA 1RVKA 4IIFA 1A4LA 5JU6A 4K38A 2EG6A 3A23A 1X97A 3R58A 3S5ZA 3SUUA 1FH9A 3AXKA 1TPH1 2PGWA 3JZUA 3PZOA 1Q6QA 3GKFA 2CKSA 4MM1A 2FVKA 1JQXA 4CNPA 4REQB 1MFVA 4UB9A 3P60A 3UESA 2Y85A 4ZTXA 5CKSA 2V2HA 3LMYA 5G2IA 1BFNA 3T07A 2ZUTA 3AUOA 3G8EA 2Z26A 1ITXA 1WKFA 3PSWA 3MP3A 4ZFMA 1J6OA 1W9VA 4KMQA 2EPKX 2FZ8A 3B0VC 2YBVA 2A3LA 5FESA 4NG3A 1XR2A 1XISA 5ABEA 1E4NA 2J88A 2PBOA 2TSYA 3PTKA 1N8WA 3GDBA 1XIHA 4NILA 2X2YA 4FK9A 4Q8OA 5H8MA 4AXKA 3UY7A 2YOCA 3EKZA 3REQB 4HNTA 1PVNA 4MNJA 4CN6A 2WVVA 4WK9A 1GEHA 1H7NA 1ZBVA 3PNZA 4C6FA 4X2RA 3VKJA 2NSXA 1QK0A 1TUXA 3KOYA 1ZP4A 1E6QM 1IR1A 2UY5A 4LX4A 1P7TB 2QGHA 3LZ5A 1U83A 3ZLGA 2Z6IA 1XH1A 1ZFJA 5A8GA 4AWEA 4E0CA 4I5XA 1IE7C 4CNUA 2TODA 3GUGA 8TIMA 2NVDA 2IQDA 4UTFA 4HZ6A 5B7YA 2XH0A 5JH1A 1XPGA 1SO4A 4IJCA 1TVLA 2DVXA 3SJNA 3QR1A 3M0VA 4O53A 2HBXA 2ODOA 1XP3A 5JQ9A 1NARA 2O7SA 4M3PA 3S9YA 4NJJA 1JZ6A 8XIMA 3OGSA 7XIMA 2YYUA 1W2VA 2CPUA 2OJPA 2EXOA 1RPXA 4AHQA 4M1BA 3IRSA 3UP8A 3LHVA 3K46A 3PJXA 1KM4A 5ENLA 1B9BA 3WF2A 4C7DA 4G7FA 1VYRA 3W1PA 4OOUA 3ICJA 4XKYB 5DF0A 1WAWA 3IJ8A 1QNRA 1SSDA 4G1NA 5HULA 4XZIA 4US5D 1OHLA 2W66A 5I02A 3TROA 3P8IA 4F9JA 2RDTA 1O1HA 1KGUA 4Z0SA 3HFYA 1EC9A 3WQPA 2DGAA 4E4UA 1NDYA 2PRLA 1X7IA 1SYTA 1V3JA 2I57A 2Y70A 4HNCA 4ZA0A 1AMKA 1KBJA 2ACQA 2PMQA 3RPDA 2PZNA 4JICA 2W79A 4MVAA 6TAAA 3B4UA 4YJ5A 4HNVA 4CGTA 3EWCA 3W00A 5F2IA 2V5LA 3F5KA 1VFUA 2GSHA 4ZB5A 3W6LA 3ZS4A 3NL3A 4I8DA 4U3AA 1VBHA 1M1BA 3S42A 4GFSA 2BODX 1OABA 1UD8A 1QU4A 4B15A 7TIMA 3M0MA 4S3EA 1IF2A 1M9HA 4HVXA 5A6TC 1FBAA 4LYKA 3TW7A 3B03A 5REQB 4UQCA 1HZYA 1EB3A 3L2LA 1OG6A 1PDZA 1IXPA 2ADAA 2AQWA 4KH2A 4KW2A 4TIMA 3LCLA 4XZMX 4G56A 2E9LA 4ZXLA 4HB7A 4QNWA 5CPOA 4Y9MA 1J93A 4WVXA 1LROA 1WXJA 3E2VA 3L5LA 4DEFA 3E1F1 3FIGA 4XZHA 3TA6A 3CU2A 2O55A 1US0A 4JKLA 2DVTA 2BY3A 5CSUA 3EKLA 3IGSA 1DE6A 2WSKA 5FF4A 2OQYA 3LPFA 4PC8A 3IIXA 3G22A 4R34A 2WMIB 4NZ4A 1TMHA 2FGBA 2GQ8A 4GCXA 5D4YA 1F8IA 3IAPA 3UZXA 3PZVA 2V5JA 3KHJA 2PD9A 4JIPA 1XLLA 1GPWA 3WL0A 3VDBA 5FIPA 2V5KA 3VOGA 2NV1A 1ME9A 3EB2A 2HRWA 4DB7A 1ZJAA 4MMWA 3GB6A 4Y8EA 3ZVHA 1RVGA 4MWAC 4DQWA 4NI3A 1OT2A 5FD0A 4PUKA 3ARQA 4LRSA 2XJ7A 1UW9A 2VRJA 1W3TA 3SZ8A 1PS9A 3AZTA 4WEVX 4PBGA 4GG9A 1FH7A 4H9ZA 1SFLA 2EKGA 3IAQA 3GR7A 5JBDA 1I4NA 4L6HA 4Q8UA 3SUTA 1XQLA 2J25A 5HWMA 4ML4A 3NG3A 4UUIA 4A3UA 3ANVA 3N2TA 4C6LA 1RHCA 4L6DA 4GVFA 1BAGA 4PTVA 1QHPA 2ZCGA 4KWUA 1EQPA 5M03A 4C6BA 2FIQA 4KCVA 1XFCA 4NY2A 5XIMA 5LXEA 1GW9A 2FH8A 3LZ3A 1CYGA 3FGCA 1XLIA 3AMCA 1OD8A 2XG9A 3W1UA 3B97A 4B5UA 1I0DA 1K8YA 1R46A 2D24A 3TYUA 3IV3A 4GRSA 3RG6A 3S8HA 1V6YA 1HXJA 1YYAA 5DFAA 3G0UA 4IUGA 3CLWA 1B3XA 1VIWA 3AIEA 3GXTA 3ELFA 1S5TA 2O9RA 5E9AA 2GK1A 3QRHA 5HMDA 2BV9A 2C8NA 1EJWC 2Q8ZA 2ZRUA 4L80A 5CZJA 4QLJA 3EGJA 1ICSA 1QW8A 5I77A 1EOMA 3I7RA 3AWNA 1HKWA 3UJSA 2C7FA 1XRVA 1JCMP 4U10A 1EPXA 3AISA 3EMCA 2PWHA 2C79A 4FOKA 3EEZA 4F2BA 3G3MA 4GUGA 3HQ1A 4Z1AA 3E96A 1E70M 1JDEA 1BWVA 1WUFA 3SQMA 7REQA 1J11A 3ABQA 3GU2A 5A2AA 4XIAA 3WMBA 4KWSA 3LLDA 3CUHA 2EPHA 2CITA 2QCDB 3DI1A 4FIQA 2QAFA 3QHNA 2XVPA 1OEPA 1JF5A 2A1YA 3M5XA 3C8NA 4JHMA 1ME8A 1PZ1A 1B9ZA 1A80A 1W56A 4QFUA 3LM7A 1GWJA 3PZUA 3TFXA 4DWSC 6A3HA 5ECUA 4B5SA 1NJJA 4AVOA 5D38A 1KKOA 3O3RA 5FF3A 2ASHA 2OYKA 3U48A 1UJPA 3SY8A 4QDMA 2ON3A 4D6EA 3AXMA 5IRPA 4S3AA 1KXQA 1FWIC 1VBUA 2IKHA 3S2JA 2WJZA 5M3WA 2QPUA 2C91A 4L65A 3QY8A 1ZL1A 2JKAA 3BSHA 4XISA 1W3KA 5MHBA 4JL1A 2J77A 4ONVA 1TG7A 4XAFA 5AYZA 1FHVA 4AEFA 2D3NA 1KRMA 2OLSA 4I90A 2PDYA 4L1WA 4WDXA 3CK5A 3GC2A 5DCDA 3CQ0A 3UY8A 1FHUA 4MPKA 2ACRA 3W1TA 3UR8A 4YTRA 3EWDA 1XRSA 2X1RA 2ALDA 3SRHA 3WH8A 5HINA 5HNUA 3EWBX 3AU2A 4NP7A 4QEHA 2FZDA 4R9OA 4KFNA 1U5VA 3UJEA 2VUNA 4H9UA 3T2OA 4EANA 1TCDA 1HJXA 5JIWA 1V93A 1BHGA 4KETA 4WCJA 4FF5A 5A6KA 3ZT5A 4LWWA 4GE8A 2HJPA 4GJIA 2QJNA 4L4LA 2AL2B 1O1ZA 4PUMA 3RHGA 2I5QA 3B0UX 4N42A 3O1NA 4D8AA 2CBVA 2BXYA 1KM1A 4LS2A 3S6DA 3UPWA 3B9NA 3I4EA 2C18A 5D8WA 1B57A 3OQEA 1V6TA 2ZC1A 1TWSA 4HU0A 2VEFA 3XIMA 3PN8A 2Y5SA 5I7GA 4H7CA 3NQGA 3SI9A 4MY8A 4A3RA 3S3GA 5D2XA 4GBDA 3BOFA 2B0MA 1SZFA 3MZNA 3S5OA 4HNNA 1FCQA 1RP8A 4NZ3A 1F6YA 1NEYA 3HN3A 3LBOA 4GIYA 2CZEA 5H8PA 1PTAA 3SCVA 2E6DA 3SCQA 1V02A 1XYLA 4A35A 4N9EA 1KFKA 1VLIA 2VC7A 1S5NA 3MMWA 2ZUMA 3CO8A 3FCPA 3STPA 2VCCA 1ZCOA 1VYPX 2HVNA 4YTTA 1UUOA 2Z7GA 2OG9A 4NVTA 1EJ7L 4FXRA 1UR4A 1TPEA 3B9AA 4DUXA 1W32A 3A4AA 2WVUA 3UJFA 3FYPA 4MZ1A 3K4DA 4S3FA 3CT7A 4X22A 4QSFA 2QVNA 2VGBA 3RFAA 4ATDA 3UYCA 1E4LA 3OA3A 3QC3A 2QCGA 1MMFA 2BY0A 1DKWA 5D30A 2NX1A 1O60A 1XLDA 3QZAA 3VX0A 4GC4A 3LEPA 4S3BA 3U2CA 2Q8LA 3W70A 3WH5A 4QQUA 4EIVA 4AYGA 3MA8A 2NUWA 3KE0A 3A9IA 2YR1A 1TRIA 2FPYA 4Q4SA 4C5YA 3ZIZA 3C52A 4K8GA 3COTA 1WNOA 1DWFM 4IFRA 1J9YA 4HU8A 1F3TA 2V5DA 1J0JA 1QOXA 5FOOA 3QQ0A 1B30A 5EA9A 2FVMA 4B4HA 3ZR6A 2FMOA 1CENA 4FR6A 4NYUA 3W6YA 1RY0A 3IGUA 4IQLA 4NZCA 3L2IA 2XFYA 1LRTA 1QNQA 5K9XA 4J27A 1DXFA 2EG8A 2YPIA 5DXXA 2ABAA 1YDVA 4YTUA 4GJ1A 4M56A 2CLMA 1DE5A 2W62A 1BF2A 5EMUA 3W53A 2WC4A 2PZ0A 4GUIA 3LCXA 1R7AA 4JY9A 1BGAA 3LDVA 1DOSA 1K7FA 5FI8A 3TZNA 3HV9A 4ZGYA 1TB3A 4UTHA 1MUWA 1QATA 4CD7A 2VD8A 3RMEA 4H00A 3HA1A 3VX1A 1EYEA 1PAMA 3GU9A 2R9RA 5FACA 1JNDA 4PB4A 4GIEA 1TE6A 3GDRA 1WZAA 3O07A 4ZQOA 3QJAA 1LWIA 1YXCA 1CX9A 1TIMA 3NUKA 3SIMA 3I6TA 3LA4A 1XIEA 2PUZA 1VPYA 1D2KA 2DV0A 4A2SA 4D8LA 3ARUA 2JKPA 3L12A 1J79A 1RJRA 2WC7A 1FUYA 1B1YA 1DHPA 1YQ2A 4CD5A 3VIMA 3LRMA 3CV7A 2XH4A 3FHAA 4MDPA 2G3FA 2ALRA 3N11A 4IPLA 3SFWA 1FFRA 1OG0A 4IIBA 2B31A 4OBRA 3NFUA 1EP1A 1EUAA 3CPRA 3QOMA 4A3QA 4C1KA 3W1XA 2VUYA 2BLEA 4IGSA 1Z3NA 2GJLA 1H7WA 5CPLA 5AYBA 1YPFA 5C6MA 3TSBA 6TIMA 4YTQA 3SQSA 4B92A 4QJ5B 4O15A 2IPGA 3R0DA 1GKQA 3IEBA 3APYA 3L4ZA 3S4TA 2D2OA 4Z08A 3D5HA 2R1PA 5I09A 1GZGA 3HBLA 3U5YA 3QHMA 3G18A 4FIRA 4AZBA 3PAJA 3D6NA 5LA2A 4V2XA 3LHTA 1MYRA 3VMNA 2BY2A 2X0YA 3VE7A 3MI2A 2GPTA 1K4GA 1H3GA 3ITCA 1BTMA 4JBRA 2X1SA 2Z29A 3WQWA 2HPMA 4BF7A 4O54A 1PX4A 1QPOA 5IDZA 5DT7A 5BOEA 1AZ1A 4AMAA 3VC5A 1YMYA 3RR4A 3O6YX 3PTQA 1JYWA 3WF1A 4IP5A 3BLDA 3EX1A 1IEWA 1W9UA 2E25A 3DXIA 3K1DA 1Z44A 2QPXA 2ICSA 4U31A 3CHCA 3TFCA 5BW6A 1YX1A 4TR9A 4IUOA 3EPOA 3UZ5A 1ZB5A 1UP0A 1LRNA 4CU6A 4QLLA 3CEUA 4NQ1A 2V3DA 3BMXA 1VENA 1HG3A 1GTHA 1GUVA 3GTXA 3GY1A 3WG6A 1IWBA 6XIAA 4Q8TA 3BQ6A 4MB1A 3UYIA 4W86A 1EA9C 3K13A 1E73M 1US2A 3QC0A 3HOJA 4LVGA 2PBGA 4KRTA 3KOXA 4ZEPA 1V02E 5IFPA 1XSKA 1KD0A 1E43A 3QR0A 4QRNA 2OO6A 3SECA 4GISA 3N18A 3KOFA 3WJXA 2FHFA 2J7GA 2TPSA 1FWFC 3ZR5A 4AZCB 1SGJA 4M7TA 1REQA 3L4UA 1S2VA 2ZZ6A 1G7UA 4Q22A 1GQNA 2QDEA 4BF9A 4C6OA 3C2RA 4P7OA 2AAAA 2E6AA 1VRXA 1ITQA 4C5ZA 3M9YA 3GK0A 1VH7A 3N19B 2J8TA 5CC7A 3MANA 1J18A 2EQDA 3HQPA 1O66A 3TIMA 2D23A 3NZPA 5B7ZA 2CNCA 2NQLA 2H9AA 3NTYA 2A6NA 4DJED 1DJZA 5IBXC 1NWUA 1Y5VA 4IGNA 4EWJA 1DJWA 2C3ZA 1CEOA 2QCHA 3C8FA 2OB3A 4Q6JA 1EJSC 4WSJA 1GG1A 4FEZA 4IIHA 3IIOA 1Y8BA 1J8VA 1G4SA 2X2GA 3IGXA 3VKKA 5KEZA 3M6YA 3BLPX 5HMSA 4JOMA 1SW0A 3NQCA 2VVSA 3QFWA 5GNXA 2E1DA 1B4EA 2DT3A 2DZWA 4LCRA 3M1ZA 2W3ZA 2GDQA 4JHZA 5DMYA 5E70A 5LHFA 3PZ9A 2NQ9A 1PJ9A 2A6LA 1J0ZA 5D2VA 6ENLA 1MQRA 5DBTA 1WDDA 2POTA 1O12A 3T0DA 1R3RA 2RJHA 1PKNA 1HJSA 1TX0A 4UTKA 4HTBA 1E40A 1OC7A 4JTTA 1R9ZA 2HK1A 3SN0A 1XD0A 2J8GA 3GNNA 1A5BA 5EBAA 4CCEA 4D6CA 3GAYA 1C8VA 3TK7A 4UTWC 2PDKA 4MB5A 1A0CA 4TU1A 1U5HA 3BV7A 3I7SA 3T2QA 2X1UA 3JVAA 1DHKA 1HP5A 4Y9AA 1DPMA 4JZ5A 4QJ3B 1BGGA 3MYOA 1E9YB 4GUFA 3AO0A 4AD2A 3MV11 3VGDA 4I7WA 1T6MA 4KF1A 3O0KA 1TZ9A 4ILSA 2HISA 4OKDA 4GINA 4RZ6A 3WJWA 1L0PA 2BASA 3BJSA 3W85A 2F9RA 2PWFA 4PZVA 4NIRA 4OVXA 3O6CA 5AFDA 3VKDA 1J0KA 3EPMA 1FTXA 4B9ZA 4C6QA 3S5SA 1LG2A 3TQ0A 4YCPA 1W31A 2J7FA 1EHAA 4W84A 4LUIA 2WWCA 3F2DA 5HANA 3V18A 3A13A 1VPQA 3BLFA 4A3HA 3GHSA 5F7UA 3R43A 2O9TA 2OLAA 1R3WA 3AS1A 3N9RA 1TA3A 3DYPA 5D03A 4BQ5A 1V6UA 3XINA 2V63A 1A5KC 1GVQA 3ABZA 3ZR4A 1T7LA 2GFTA 4W87A 3RO6A 3DFOA 2NW0A 1K7XA 5CLTA 4MOZA 3HIJA 2G37A 1DWAM 1M5WA 2JIWA 5DLCA 4QG6A 3BANA 4MG4A 1LCOA 3UXDA 2WZIA 2ESCA 5C2CA 1ZUAX 2QR6A 3KWSA 1W3JA 1K03A 4Z42C 4MKNA 3USBA 4K2SA 4A8RA 2KX9A 3S1VA 1Q6EA 4HCLA 3KBNA 1CT5A 3NL6A 4PGLA 2WPGA 4D6FA 3W7GA 1XJBA 1QNSA 2QCFA 1HGYA 3ATZA 3HZ3A 4TX6A 2QJMA 4LYPA 3ES7A 3PZQA 4N0RA 4LJ3A 1EDTA 2FFCA 4KCWA 4XD4A 4YMZA 1X1NA 1M3UA 3MKCA 4D6DA 5LHEA 4AWUA 1OGSA 4C6MA 1BWKA 1V6VA 2WK2A 1HL8A 2EAWA 3G1FA 1Q6CA 1ZHAA 1JPMA 5A8NA 3WDHA 2ISFA 1LQAA 3WKZA 3W87A 3TTEA 3C0SA 1PIIA 3BW4A 4NXSA 1JAEA 1QUMA 3WMLA 3SSZA 1G67A 3VIGA 3FA3A 3L23A 1Z32X 1GJPA 4MY1A 4IMDA 2AMGA 4ZTYA 2FPTA 1VFSA 2BS9A 3W38A 1Z9AA 4HHLA 2DUAA 1HF6A 3VDHA 1ENUA 3IGHX 2J9XA 2PD5A 4M29A 2X42A 3BAKA 1IEIA 4OUEA 2VZUA 3N9KA 4I6VA 2GWGA 3B8WA 1GOOA 1LBFA 4AD5A 1IHIA 2Y24A 1N8FA 1EFZA 2XIBA 2E7FA 2PP0A 4JFTA 2XWDA 4M8UA 3C2OA 1R2SA 5LZLA 1AQHA 3W74A 3WH9A 3TMQA 3UERA 1OF6A 2WLZA 4Z2JA 3OU8A 3EA2A 1X38A 3KFTA 4ZQMA 2Y6ZA 3M47A 3UXKA 1BXNA 2QUNA 2X1IA 3R13A 5CBJA 2OKTA 4LEQA 1UWIA 5FCZA 2HZGA 1KV5A 4O16A 5TAOA 1L6WA 4GABA 4JIRA 2RGMA 1CXLA 3EZ4A 1UHVA 1PX3A 4TOQA 3ME3A 2E28A 3GC4A 2VOTA 1Q6GA 2WBKA 1FCVA 1EGZA 4RE3A 4IHCA 4QNEA 1JG9A 2DEPA 3AIQA 4RPPA 4J5NA 4W8LA 1VJSA 3ITXA 1B3WA 1UZ4A 3QV8A 3C2EA 1E1CA 4H9MA 3SBFA 2YJQA 4ORIA 4P7RA 4O57A 1ZPTA 4C6IA 3NIYA 3FOKA 1I2QA 1E3XA 2GOKA 4IXXA 3H2MA 3R0KA 4GIRA 2VT0A 3A5FA 1XF0A 3GLCA 2QUMA 2PDUA 5HR6A 3C6CA 5AC5A 4JDYA 4AVFA 3WQGA 3QMSA 2GOUA 1JR1A 1NFBA 4RDYA 1EO5A 1UKPA 2VCAA 1G01A 1KFCA 4Y8FA 3W73A 4DNMA 3A9BA 3EDFA 5AZ0A 3C0JA 3WN6A 2PTDA 2YA0A 1NF7A 1H60A 2P0OA 3THCA 1PSCA 3VD3A 4CNTA 2FJKA 5T9BG 3WNKA 4HK6A 1VC4A 4JYDA 4R85A 4DO6A 1RBAA 2UY4A 3TP4A 3NQAA 4OE7A 5A6SA 3AICA 1QJWA 3UWZA 2E09A 4PTDA 2OO0A 4L1GA 3KRSA 1DJQA 4NNBA 1WKYA 5RUBA 5D09A 1YXDA 3P93A 2J66A 4DZ5A 4NI8A 2ZUSA 4DX3A 3H24A 4AZIA 2YFOA 3T7VA 3WUEA 3PULA 5A8QA 1TWWA 1BYAA 1ZCCA 1VEMA 3WQCA 1MW2A 2QUUA 2CLEA 3LN3A 4JEQA 3UGVA 1R3QA 1TMLA 3IJ9A 2NLIA 3BLIA 4P8XA 4MWAA 2Z1XA 4NJGA 3PWAA 1N2VA 4KKXA 1UWSA 2QUTA 4DAIA 1DTNA 1S2CA 3H54A 1OYAA 3FNDA 1R3SA 3W7OA 3JR2A 4S23A 3BWWA 2F6UA 4IPNB 3ZJKA 4QEEA 3RNDA 1O6IA 3M0LA 1KTCA 2DSZA 3QPZA 4P7NA 5KMYA 3WENA 4DIAA 2DT0A 4HHMA 5G1YA 2B7NA 1AL8A 3PPGA 1V8EA 1KM2A 2R6OA 5A6BD 3KHDA 2BMBA 4FNQA 2E5CA 5F4XA 4XKMA 1OX4B 5K4ZA 1B31A 1VKFA 3GIQA 1UD4A 1M53A 3T1GA 4CD6A 5MKGB 1W54A 3TC3A 3OLGA 1WKEA 2V3EA 2OR2A 1JI1A 3QLDA 3DZ1A 2XINA 1JIBA 5EMMA 1ONXA 2G8ZA 2W92A 4XZ9A 4FZIA 1LT7A 4HKPA 4JAWA 2ISDA 1U30A 1A4MA 3GZ3A 5CPNA 2VZSA 5HAOA 3TTOA 1AZ2A 3HPZA 4IICA 3A3XA 1W5PA 2C13A 2ATSA 3TYBA 4JQ1A 5I3IA 1H50A 2DH2A 3GHTA 2QCEA 3MUZ1 2I5GA 4OQVA 4CD8A 4HNLA 4ZMGA 4DNHA 1N55A 3ES8A 5D02A 2BOGX 1GGOA 1FX6A 3L68A 2Q02A 3BV4A 3KP0A 2WPBA 3B9EA 1RCOB 1TQJA 3VDGA 1ZP3A 6CGTA 3QSRA 1M6JA 2BG5A 2XVKA 3SUWA 3W01A 1W5MA 2VL4A 3PANA 3SCOA 4Q7NA 3VD9A 3EWWA 1TV8A 4H6QA 1AVAA 5HJLA 1KW1A 4B5XA 4NSBA 1GVRA 2DZVA 3G1VA 3PM6A 1ML1A 3TN4A 2H8XA 2R8WA 3DHPA 2VCBA 5C7VA 2FZMA 2I56A 4H83A 3IPWA 3N6JA 3B8UA 4HU3A 5I2UA 1RY8A 2F61A 4L9ZA 4NYYA 3E3HA 2NV9A 2AAMA 4C6JA 3EOSA 3DDMA 2OTDA 3VUSA 3EDJA 3W07A 1PHQA 4NU7A 3TXZA 2REQB 4GK8A 2VI0A 5DMLA 3RRXA 3FA4A 3FW6A 3OTRA 4QISA 2W61A 4MSSA 2X0HA 1MO0A 3L0NA 2V2CA 3NO1A 1P0DA 2ZX5A 4IXHA 2J9YA 2YSWA 4IF2A 4HSOA 3PTDA 1U2YA 3H8AA 1QI5A 1KXTA 3TJ4A 4NAFB 3UXAA 1RALA 3U7BA 4KGLA 4H19A 5LNVA 2ZRXA 4ZFCA 3M7WA 1EWEA 2HK0A 4P8VA 2G4FA 3MUXA 4JIQA 1EQCA 3TNBA 1VPXA 2Y7FA 4O1EA 3E5PA 2ZRZA 1JUEA 2DVUA 1TJPA 3VMPA 5GJPA 2UY3A 3MSYA 5KINA 4IH3A 3POHA 4KIEA 3P62A 3AWOA 1ICQA 3P74A 2JEPA 3H7UA 4CU8A 1ZBWA 4O11A 3NZQA 1KM3A 3MBFA 4ADSA 1J01A 4W8AA 1UR2A 3BVJA 3TEVA 3BW2A 4LUTA 3ITVA 1KC7A 4ZENA 1A5NC 3WD4A 3W7HA 1LL6A 4QJ4B 3LV5A 3QFEA 1TPB1 2OQLA 2DT2A 4J2MA 2Z1VA 3R25A 2DY3A 1Q7MA 4GC3A 4ACZA 1U1JA 4FNRA 4ERIA 1DIDA 3NNTA 2CLIA 5DT5A 5BMWA 4GZIA 2Y7EA 2WHMA 3SQLA 1HVQA 4WHBA 3KCLA 3UCQA 1U33A 4PCSA 4V28A 1E0UA 3URQA 3OODA 2E8YA 1HKKA 3QZ6A 1FA2A 1PWMA 3ZJ8A 2GGJA 1R30A 2OLHA 3EX3A 3KUMA 4PRRA 3B9DA 3RMJA 4YYCA 1E0WA 1IGWA 2XUCA 3PPCA 1U5JA 3LX9A 3CV1A 1B54A 1BYCA 1EXBA 3S83A 3L0GA 1OINA 3VM5A 4Y9PA 1FWDC 5CZTA 4K7YA 2EPOA 2XN2A 4JQ3A 3TN6A 3WX7A 1OYCA 3NZRA 3MW7A 4U33A 2WVVB 2QYGA 2DH3A 3QF0A 3VNIA 1DJHA 4E8GA 2DW7A 3QKEA 3W76A 4MWAE 1C7SA 3TWAA 2O92A 3PBVA 1C7TA 1S46A 1RPKA 4J3SA 4DLFA 5E0CA 1RQHA 1TE1A 3BGGA 1W5OA 3W4RA 3O7UA 4BQ4A 2B4GA 1OGBA 4M5PA 3AXIA 4A8LA 4QHRA 2FB3A 1FP8A 5CPMA 3C2FA 3LLXA 3T8LA 2VEIA 1XYAA 4AY7A 1ZBCA 3BQ5A 4JQ2A 1P0NA 4PRTA 1WDSA 3WK2A 4HMNA 4PMDA 4X9YA 2QW5A 1QXLA 3CASA 5HJYA 1UG6A 4LU0A 3VKCA 3VUPA 5AHNA 3FJLA 3S1GA 1KBBA 1NDZA 1I8JA 1J2BA 1W1IE 2J6XA 2FHBA 3CPGA 2YXOA 3PFMA 4RV3A 5A5WA 2YL5A 3DHFA 4PMJA 2G0WA 1KTNA 2PTZA 3E0FA 3N2OA 1JCLA 2PDQA 4GY1A 2JE8A 2EPNA 1GVYA 5F4SA 3H7VA 4OBSA 1NFPA 4HCHA 3WNPA 4MNKA 1UWRA 1MZHA 3KOZA 2A3CA 2A3EA 4P7QA 5I3DA 3EB3A 4WJ8A 5C54A 3UXIA 3MDUA 3EOUA 1GYNA 3WJYA 1XQKA 3G6MA 2GUBA 1TWIA 3BGJA 4GKLA 1ZAJA 2R82A 2PGFA 5HBFA 4FALA 1AH3A 2ZVIA 1WKDA 2VQTA 1XBVA 2TRSA 3VOCA 2CHNA 3KW3A 3AS0A 2WO5A 3GX9A 3EPNA 3MO7A 3MBDA 1MW0A 3G1SA 2HSAA 2PCQA 3I7QA 1VFTA 3QGKC 1GZ1A 4RNIA 2CESA 4FXFA 4NUWA 1OYBA 4Q8VA 4WGXA 1JQVA 5DELA 3CUZA 4LVBA 3HMCA 4TV6A 1E71M 4FP1A 2QCCA 1NVMA 3WQDA 4R27A 4G2DA 5M2FX 3M6DA 1UASA 3O63A 4OBTA 1EHNA 4O1CA 2Z00A 1OFEA 6REQA 1PXGA 2XZ7A 2D3LA 1V03A 1YXYA 4IIEA 1O94A 3IJIA 3GKAA 3O9NA 4EK7A 4GGHA 5I5RA 3NL2A 3FVMA 4X61A 4DUVA 2EJAA 4LBRA 3KWXA 1JNEA 3EAUA 2Z7KA 1TFVA 2ISVA 1TPC1 2V81A 1CI1A 3NQEA 1JUBA 4LAKA 1MUMA 2Y5JA 5I3JA 3KTXA 5CCZA 5CGQA 1VJZA 1UR3M 2O0TA 2ZX6A 5J04A 1PKYA 2YKKA 4QS5A 1H7RA 3WDIA 2V8ZA 4CNOA 2ZRWA 2BVWA 2V67A 1V51A 1QCWA 1ISZA 4O14A 2ACSA 5LNWA 4N7QA 4GA8A 2HMCA 1I2NA 4V33A 5GJMA 3ZVHB 3UGRA 5CXPA 4N4PA 1UMYA 3S6TA 3VMOA 4CN1A 4MAVA 3WLQA 1Q63A 5HJXA 5A6MA 3H55A 4HMDA 4PBFA 2VR4A 5D04C 2NV2A 3WD1A 5A6LA 3M0XA 5DN1A 3GUWA 2GVEA 1MEWA 2W6RA 2D1ZA 3BCJA 2OEJA 4HOXA 3RYSA 4HN4A 4KEMA 4LUSA 3T42A 2Q8XA 2XVNA 1JEZA 1W1ZA 1YADA 3O16A 2QV4A 3QW4B 3TLQA 3CMGA 1H1NA 1ECQA 2OEKA 3BG3A 5D2WA 1POJA 3CH9A 2BOEX 3M7SA 1E4MM 3N13A 1PTGA 4KRUA 2Q71A 3RU8X 3S1UA 1GQLA 3WLPA 4PFMA 4DUWA 3I68A 4RLIA 3OW1A 3IK4A 4EF9A 4NZJA 2A3BA 2GK1B 1GYMA 3LM3A 4C60A 3LBCA 2PDXA 3M0ZA 4O18A 5G5IA 3BLEA 3NWRA 1DWIM 1YTDA 1P7TA 5ABTA 1DTUA 1DJYA 3E12A 2FVLA 8CGTA 1KWKA 3CNYA 1ZENA 4B5TA 4Q4PA 2BSLA 2VDHA 3R7MA 4QM1A 1HKJA 1XGEA 4PA8A 4XD6A 1VIZA 3DGBA 4IFKB 1GCYA 2VFIA 5FSEC 5E6ZA 1JD7A 3A12A 2GQ3A 3U5UA 4XIMA 1KXVA 4LV4A 3V3WA 3QHOA 1VEPA 1ONWA 1XRFA 3TC7A 3WEMA 2EPMX 2J47A 1V3IA 4B91A 1OCBA 4GOAA 1BEUA 8RUCA 3DC0A 2HWGA 1D9EA 2ZKMX 3UXLA 2PDFA 3V7PA 3GG7A 4M24A 3UR2A 3NO3A 4C7GA 4IX0A 3NPUA 1KO0A 4OT7A 5I6SA 1JPKA 2OELA 4J3XA 1X6UA 4YHEA 5HQMA 3ECQA 4LVAA 2PDIA 3QMTA 3RX3A 4XKYA 4U5IA 1EP3A 2R91A 3S9ZA 1ESWA 1UZDA 4G6CA 1KRAC 4NJHA 3PWIA 3CIWA 1HUVA 4Q4RA 4ERGA 3DFQA 2GVLA 2JF6A 1Z8AA 2BBFA 5D33A 1KGWA 4U5KA 2Y8KA 4UNLA 4UC5A 4ZE4A 3O6AA 3G2GA 3WD3A 1G69A 4GD0A 1PHWA 3EX2A 3VZYA 1F6PA 1YNYA 3WUFA 3TWBA 4DYJA 4U3CA 1OT1A 2A21A 4P2VA 1ZJHA 3ZSSA 1PIGA 1PPIA 3F4WA 4HZMA 4XZLX 4RX0A 2Y5EA 1V0LA 2VWSA 3FEMA 1QBAA 1CXIA 1PZ0A 2PURA 1GNXA 4EP8C 3N2CA 4XWUA 1GEQA 3W0KA 3KZPA 3SGGA 3RM9A 2ZTKA 3EDDA 4BK9A 1K4HA 1XYBA 2G96A 3BJTA 4AZ7A 4RDZA 2QJHA 2VP8A 1ODUA 3WDQA 1E6PA 3KCJA 1X1OA 1YBQA 1XH2A 2XVLA 1EX5A 3RR1A 3QKZA 4D8ZA 2GGGA 4IMFA 2RAGA 2PS2A 3RX4A 2Z4GA 1BG4A 2E67A 1RZMA 1A5UA 2GYIA 4WJXA 4AU0A 3NDZA 2O7QA 4JL2A 1DORA 3VNLA 3QPYA 3TZFA 4UZSA 3RLVA 4LS1A 2XGZA 4V1YA 3P0WA 4AH7A 4A21A 3CC1A 3DC8A 1TKKA 3V0SA 4EAMA 1TSIA 1RBOB 4W93A 3FLUA 4AQLA 3M44A 1XV8A 1O5QA 4GQBA 3BCDA 1MRQA 2A85A 4R9XA 1TZZA 4ZO9A 1F76A 2Y62A 1OX6A 4A8NA 2V69A 1HKVA 3OLDA 3ARWA 4ZODA 5AKQA 3DHDA 2NQHA 1VBJA 9XIAA 1F3EA 1PZ3A 2OZTA 4KESA 3C61A 2XM1A 2OVLA 1G4EA 4QXIA 4PTNA 2J9ZA 5ABHA 4EXQA 3RCNA 3FXYA 4L7ZA 4Q3MA 5AN7A 1W3HA 4O1FA 3MSRA 1JFXA 2QUVA 2PDPA 4H01A 3LCHA 1O5RA 1NOWA 1ZQ5A 2QQ6A 1LDCA 5CSYA 3MQTA 4H3DA 2P88A 1ZGDA 3CV2A 3UW6A 3D3AA 2BB0A 4DHGA 4UCGA 3DFHA 1O7AA 3PFRA 3M5VA 2V30A 3W82A 4AFYA 3SDOA 2XFRA 4OECA 4DJDD 4RJEA 1ELSA 6PTDA 4EX4A 3HB9A 3QVQA 3LU2A 1GK8A 4D71A 3EWXA 3VC6A 2Z6JA 4A8IA 4UIOA 4UWMA 1EZWA 1HX0A 1NTHA 3GFXA 2J7EA 3U8GA 3W86A 3RDKA 3VKBA 3L9CA 1TJ1A 1SJBA 3EWZA 4DO7A 1EGVA 5E5CA 3SSJA 1GOKA 2FQIA 5DO8A 4PMVA 1WOAA 3RK8A 3MU7A 2XPKA 4DZIA 4W5ZA 3WNMA 2YBTA 2PWEA 4PR4A 4HPXA 2R1NA 1FH8A 4GYPA 4IG2A 4F66A 4Q33A 2MUCA 3SY5A 1TVPA 3BPWA 3FHQA 1G6CA 4B90A 4F0SA 3ZYZA 1EJVC 1HN1A 2PDCA 3NSNA 2JALA 4JKKA 1OFPA 3VNJA 1AJZA 4NF7A 3RJYA 5A94A 4RXFA 4GX9A 1BKSA 3WUGA 1JCJA 4GYJA 4JD4A 2FTPA 1IWPA 1IXNA 3IJ6A 4J40A 3TX9A 3AS2A 3VNYA 4NNCA 5D8ZA 4GYKA 1W6TA 3GTNA 3TAOA 3TMLA 3HJZA 1MI3A 2VURA 1AK5A 1YPXA 3CL6A 5A8PA 1FFQA 4DPPA 4X9SA 3M43A 2YZRA 4IL2A 2ZDRA 5FJUA 3BMWA 2YXXA 1CECA 1ZLPA 2P5NA 4FSAA 4G5DA 4FLSA 5C9XA 2QMKA 1VS1A 4AZHA 4J35A 4JTCA 3GR4A 5TNVA 5D9NA 4ROQA 3OVRA 4UQAA 3KVJA 5HPCA 1QTWA 2GDUA 4I9AA 5FJIA 4S38A 3LTPA 3TW6A 3TTQA 4DELA 2G41A 5C7HA 3N25A 4WIWA 3KBSA 4I9JA 3HG3A 1L8PA 4AZ5A 3WF3A 1R3VA 1SVDA 4G1KA 4Q8PA 4YS1A 5K3VA 2PB1A 3VVGA 2XM2A 4S3CA 4W8BA 3N6HA 3UWVA 1B4KA 3LPGA 4MFDA 1UUMA 1Q4NX 4RDVA 4DZAA 4ZO8A 3NM3A 1EDGA 5AC7A 2Y63A 1XCWA 1LBMA 2DFAA 5FL0A 4LY4A 3SN1A 4D72A 4B16A 3DECA 3UD6A 1LLZA 3IUHA 3DX5A 3PUGA 1DJGA 4I9MA 4UZUA 4UTMA 4LAZA 1R8LA 4O1BA 6ALDA 4DBWA 1FCBA 2DZUA 2JBMA 4F0HA 2DW6A 1XG3A 4RNFA 1SW3A 1V0NA 3G24A 3FXGA 2BZNA 2XSXA 2VHLA 3S2MA 2Z2AA 1E0VA 1HVXA 4EAYA 1KQYA 4WQ6A 3FSTA 5HQEA 1AH4A 4TO8A 4WR3A 1Q3NA 3HGSA 3SUVA 1C29A 3RLHA 2AMXA 2Y0FA 2F6XA 1FWCC 4D2JA 4XV0A 4TX8A 4F0KA 1UYQA 1ADOA 1BXBA 1AJ2A 1K8XA 3OHMB 4UTTA 3B40A 3CT2A 4C65A 1S2UA 3TAKA 3B8TA 4NJKA 1S1RA 3O6DA 1H61A 3WBEA 4NRSA 4O19A 3G1XA 3LD5A 1TTPA 1XPYA 4JTUA 3GVVA 3DBNA 1R9XA 3V1HA 1I2OA 4GZEA 4D1JA 3UEQA 5H6HA 3GS6A 3QV7A 2OWWA 1OIFA 2G3MA 4NX0A 1H7OA 1UH2A 2E1WA 3OQ8A 5CJ5A 3W1LA 1R2TA 3HPSA 1PCKA 5AY7A 3CTTA 3TVAA 4J3WA 3OA5A 3VCNA 1XUUA 3JRKA 2DJXA 3GH5A 1MWOA 3GXPA 3RU6A 1R9YA 5E9XA 3NXLA 1B3YA 1F3XA 1QO5A 2DZSA 5FAJA 5GNYA 5H1WA 1KFEA 1RA5A 2HNHA 4J9JA 3UWQA 4I5RA 2WXDM 1PIFA 3GG0A 2BNJA 1M7PA 1RBLA 1RAKA 3PVFA 3NCOA 1P6BA 2YZ5A 3W2LA 4J3UA 3GYEA 5I07A 3AHYA 3B0XA 1QPRA 4DXVA 5CZSA 4JKMA 2XZ9A 5IHRA 5G2HA 3LCGA 3MP4A 2NQ5A 4LAUA 2H9AB 1MXDA 4MNMA 3VABA 1A47A 1E6ZA 2YIHA 1LL7A 4MUZA 2VEMA 3ZZ1A 1ZALA 3BAXA 1BD0A 3W7JA 1B3ZA 2F7FA 4PB5A 2DZAA 1HO4A 1Q6FA 4ZQNA 5FJJA 2CIPA 3DFYA 5E6YA 5LIYX 3R6IA 2YX0A 3ABXA 3BG9A 1V6WA 4FXJA 3A4WA 7A3HA 2HTMA 1I75A 1M7JA 3GYCA 2EPLX 5M5DA 3OBKA 1XSJA 4NAEA 3ZWTA 8A3HA 1L6YA 4R7JA 3MYPA 5MF5A 5ABGA 1XBXA 3MCOA 1XIIA 2Y7DA 3SJ3A 1FWJC 2WCAA 4DWDA 1OZMA 1U22A 1LQ0A 2V6AA 3R94A 3STEA 4DVOA 1H11A 2ZUNA 1MFUA 5AYYA 4JGDA 3QGAC 2CKRA 3HM7A 2DP3A 3UBPC 1RD6A 5CC3A 3WBXA 1EPVA 2Y7GA 5LYRA 3IUIA 3PSVA 3VGFA 3TYAA 3UF9A 2XN1A 2PA6A 4ENLA 3PR2A 1QPKA 1FDZA 1C9WA 3TNOA 2R94A 3PWGA 2P76A 4IOTA 1UC4A 3KAOA 1KM5A 1F8MA 2MANA 3DG3A 3LUTA 1IXQA 2WW5A 3EWYA 4O13A 4KWWA 1UWQA 1A5MC 4WRHA 2A5HA 5BRPA 2A7PA 4BWLC 2E6FA 2VC6A 3GTHA 2OCZA 4PCPA 1TTQA 2CLKA 1BWLA 2BGNE 4HZ8A 2B81A 1HP4A 2Z27A 2FB2A 2XU2A 3IVTA 3E2RA 3H4GA 5GQBA 1FQ0A 4FR1A 2AKMA 4X0VA 3CIVA 4KGJA 1NWTA 1UOKA 2AGTA 3FX4A 4BR1A 2X16A 3BAIA 2CBJA 1GKRA 4XVEA 2QHAA 3PAOA 3EX6A 1EIXA 4AZGA 4UCFA 3P8JA 1QWGA 4DPQA 5H91A 3RITA 1OADA 1FXPA 4YTSA 1ZTVA 3J7HA 4QDPA 5E1QA 4GNJA 4HD5A 1E51A 1H5YA 5FL1A 2YB4A 1Q6RA 1TA3B 1VZWA 3R1ZA 3LNPA 3TTYA 3LXAA 4IIGA 4XUGA 1UUQA 4AY8A 2ZUVA 4PB3A 5AC4A 5BRBA 3W3OA 2IKJA 1F74A 1RSCA 2WZMA 3WLNA 4PMNA 1V08A 4Y9NA 3W28A 4US6A 3SGZA 2EG7A 1QWKA 2DSUA 4Z2LA 1POKA 1C91A 3LQLA 2JF7A 3BOLA 1DBTA 3MCMA 3GSMA 3MT1A 3EOOA 3GW0A 1ZAIA 2V5CA 3KDNA 3M16A 3SFKA 1WBHA 3HPFA 5AYIA 4PMXA 3U2EA 5IXEA 1IYXA 5I23A 3Q58A 2VKZG 5L9FA 3K8KA 3WZ0E 3I6RA 2WZTA 4Z1DA 3BARA 2HQAA 3FAWA 1Q8AA 1J0IA 4DY1A 3IS4A 3EOLA 1DQXA 3VDCA 1U1HA 1ISXA 4RL3A 1S3TC 4JTQA 1E0XA 3OYXA 3RUBL 4QE4A 3T40A 4JTIA 4RE4A 3I4KA 1AW5A 4W85A 1QI4A 1ISYA 3SCPA 3AJ7A 4CN4A 3QBUA 4UFIA 4UFKA 5D32A 2INFA 1H49A 1QW9A 2VR2A 3F4CA 1TELA 1W3NA 3GC5A 3N2BA 1LP6A 1YW1A 4NASA 3QTGA 3CHDA 4GY0A 3IJDA 2NX9A 4I6KA 4OTKA 3LXCA 4W9TA 5EYWA 4JIHA 1Y0EA 1E55A 2XVGA 3GHUA 4YU1A 3BO9A 4WUIA 2Y1HA 1CLVA 2WWDA 2XH2A 1XI3A 3MVTA 2WKJA 2ZZ3A 3CL7A 1GPFA 2QIIA 4A2RA 4DM2A 1EIBA 4PH6A 2WKLA 4JNZA 1HT6A 3AYRA 3RILA 1W9PA 3ZMRA 4PYSA 4DF2A 3AMDA 2DZTA 5J5DA 5BU6A 4N9CA 4AWSA 3G1YA 2PEVA 4NJIA 4H2CA 3EMZA 3CIXA 3GDTA 1AW2A 3KS5A 2VXNA 3TYZA 4LS0A 2G4JA 4R53A 3Q45A 1TWDA 3PZGA 2FPVA 4H9TA 3AOFA 3H23A 4AZ6A 4YYFA 4QE1A 2WZHA 3VILA 2RJGA 1XGZA 3VTRA 3AXXA 3CH0A 1D3GA 3AHZA 2JIEA 2PWUA 2VFGA 4XG1A 4RZ4A 2C1GA 1UC5A 3RF9A 3LLFA 3OB8A 1MQPA 2XSAA 4O4WA 1E1CB 2GUUA 1JPDX 1D3HA 2OKOA 2WV8A 1WAUA 1NY1A 3WEOA 2WNQA 4O50A 3CMJA 4PODA 5G1TA 4V27A 3RGTA 1PBGA 4LH8A 5JBFA 1L2QA 2O9OA 1LORA 3R89A 1HL2A 3VE9