4H6KA

W116i mutant of oye1
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
total genus 155
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4h6kA00
1W3TA 5D2TA 3OIXA 4S1FA 5CPOA 2V2DA 2C3ZA 5G4EA 3N2XA 5HNRA 3HGRA 1PHWA 3PVFA 3P82A 4X3ZA 2WSYA 4NNBA 4PL2A 2CLKA 3NL6A 3S1VA 1G4PA 1O4UA 3G22A 4ZZ9A 3QH2A 1LOLA 3HG2A 1EWDA 4W9TA 4UCGA 1FXQA 1VCVA 2VFHA 4XBSA 3ATYA 2C14A 1D3HA 1K8ZA 1QPQA 1TTIA 4A29A 1GYLA 4RX0A 3EX2A 5DCBA 3CPRA 2VFFA 4Q33A 1OX4B 1SSGA 1F6KA 2X16A 5LNVA 5I3KA 2Z6IA 2V5BA 3ABSA 2H6RA 4IX0A 5I3FA 5DBTA 1GPWA 4CNOA 1O5KA 1MSSA 4G1KA 3L21A 5BOOA 1FWWA 5LNRA 1H50A 1K02A 2NXGA 3W7QA 4Z08A 4FNSA 1B4KA 2ABAA 3A5FA 4DO5A 2B7NA 2J9YA 2A6LA 1R46A 2HS8A 4IWWA 4ZQNA 4NZFA 4RXGA 5KZMA 1RZMA 1XL9A 2C16A 1OG0A 1FCUA 1QCWA 1ICSA 1LM1A 1C29A 1W37A 3LXAA 3PBUA 1ICQA 2C15A 4JD4A 3TMLA 1M7OA 3VCRA 5K3VA 1TTQA 5D2VA 4Y6GA 2JKPA 1TYGA 4M5PA 3EX1A 1JJKA 3P8JA 3O07A 1W5MA 3B0UX 1LRNA 4ORMA 1QPRA 1ZENA 4UTLA 2PRMA 4C1KA 2ISVA 1JCXA 3QSRA 1UUMA 2TRSA 5EBUA 5F1VA 1TPUA 3C2VA 1OFBA 3DFSA 2OT1A 3CTLA 1KLYA 3NG3A 3PB2A 2DZTA 4JYEA 5FF3A 3PBYA 3W73A 4FO4A 1P0NA 1H60A 3NL5A 4MFEA 2JGQA 2P10A 2H3DA 1Q6OA 3PSWA 4Z1CA 4XZ9A 2A7NA 4LV9A 4MLRA 3GNNA 1RD5A 3NEVA 1LLZA 1PIIA 4IX2A 4I7UA 5KITA 3NQGA 1DHPA 2WNNA 3LV5A 1THFD 3FLUA 4JTUA 4HSOA 2ZQ0A 3T44A 2QR6A 4CNNA 1XBXA 3W2LA 3I68A 5AHFA 4L4MA 1YTEA 3PS7A 4UTUA 5D32A 3KRSA 4BK9A 1KM1A 2QJGA 3W1RA 4LY8A 4M6PA 5A8GA 2ZA1A 2EGZA 2XN0A 1VCGA 4R34A 3W7IA 4ZQPA 5E0KA 3BK0A 4NUWA 4AF0B 3G3DA 1YPFA 4FF7A 2B7OA 2H90A 3PBWA 3O6YX 1EUNA 2OT0A 3PR2A 5CPLA 3B8DA 4I7VA 1KTNA 1ME7A 1Z41A 5DCDA 3C6CA 1SO5A 5AC8A 3EWBX 5FI8A 5CSRA 4JTKA 5C54A 4NXKA 1N8FA 1EPXA 2ZZ3A 3MUXA 4BI7A 2E5BA 1ZFJA 2DORA 3CIWA 4QIUA 1DOSA 3EXSA 3ABQA 4WY0F 4DPPA 1JCLA 1G4EA 3W1LA 3W7RA 4LWWA 3TXZA 1PV8A 4UR7A 2R94A 3W88A 1VS1A 1LOSA 1LRQA 4JX6A 1I2RA 3W1UA 2PC4A 2W6RA 4UMCA 3W6YA 3E49A 5FF2A 1LLWA 5K9XA 2H3BA 3OVRA 4OV4A 1OABA 4ADTA 3W7NA 2QJHA 2V8ZA 5BRBA 3QEZA 3HF3A 3TROA 1DBTA 1S3HA 4ADSA 4FB7A 3DFPA 5TIMA 3PF3A 3L66A 2Y88A 1H62A 3M9YA 3NPWA 4PTNA 3WFAA 1RPXA 3W1TA 1E51A 5KZEA 2ZDRA 4XTIA 5AHEA 3LCFA 3TC7A 2Y85A 2G95A 4UFJA 1GQNA 1FX6A 4LRSA 2WSRA 1VJIA 1ZHAA 1AK5A 5LHEA 2W79A 3VI2A 1K7XA 1GEQA 5CZTA 2GVGA 1GYNA 3G8RA 3EXRA 3SECA 1IIGA 1BWKA 4JTTA 5K9DA 3MP3A 1RV8A 3WK0A 2B7PA 1VCFA 1X8FA 2A1YA 2A5HA 2Z6JA 3IIPA 4KFNA 1LYXA 2I14A 4QQ3A 2NXHA 4N6EA 3GLCA 3BLEA 2FPVA 2AGKA 3GYEA 3GKAA 5AN7A 4LV4A 1SW0A 2W0UA 3NQAA 2IQTA 4AMAA 3HPZA 2RDTA 3W83A 2V0TA 4PODA 1SSDA 3EX4A 3DENA 3W74A 2ZRXA 3MW7A 1RVGA 3LM7A 3LB0A 3NM3A 4YWIA 4X22A 4Y96A 2P1FA 3CQ0A 1TRIA 3P62A 4K37A 1QR7A 3MHFA 4NVTA 1SFLA 2O7QA 4O14A 1TO3A 1X1OA 2C6QA 1WBHA 2E1DA 3SJ3A 1GJPA 2RDUA 4K38A 2CLMA 1FWSA 3W85A 2YYTA 2C0AA 3ZWSA 3BO9A 2ZZ7A 3LOTA 3TQVA 4JIQA 3W1XA 2LLEA 1GWJA 1H7PA 3E12A 3NQ6A 4NJKA 4O0KA 3TSBA 1TIMA 5DN1A 3CEUA 2A0NA 2VEMA 4GRSA 4GXMA 3UWWA 4NX5A 1M6JA 3C2RA 3W72A 1PHQA 4NJHA 2VELA 4JX4A 2XN2A 2AQWA 2ZFAA 2Q3RA 1OFRA 1HO1A 4M6QA 1OFEA 3P80A 3M5VA 1Z44A 4WOZA 2ATSA 4PCFA 2WO5A 4TO8A 3S6DA 1HUVA 1TPC1 4MPQA 3V75A 2J27A 5I3IA 1OYBA 3KVKA 3M16A 1EIXA 2QCDB 4WOQA 5DLCA 1V5XA 3DU0A 5F4XA 4ZQOA 5DBUA 3SGZA 2UV8G 3FKRA 4DF0A 4FX8A 3LI0A 1DQXA 3TQKA 3M44A 2J6XA 1F05A 4UTTC 3V1PA 3BV4A 5LZLA 3KFTA 1AW5A 4JTIA 4K7YA 3LGEA 2BWGA 3N2MA 2DJLA 4O50A 3BGJA 2YXGA 3EXTA 3QF0A 1FWTA 2PRHA 1IIHA 4PC8A 1O94A 3NL3A 3T7VA 1WOBA 3E0IA 4FX7A 5AYZA 3W07A 4N9DA 3HG5A 4JICA 3CT7A 3M7WA 3VFLA 4D2JA 3CC1A 1JCYA 2B0MA 1TV5A 4FX6M 4N6FA 4OGZA 1QOPA 3DKJA 3M43A 1NEYA 5HWJA 5D38A 3KVLA 4RR4A 1OK4A 1JCMP 4UTKA 5BNKA 1EP2A 1R2RA 2CLEA 1EB3A 1VGAA 4NX0A 4ADUA 3HJZA 3S5YA 3QMSA 1OFQA 4DQWA 5LSMA 4HPJA 4B5NA 2GQ8A 3W86A 4UMAA 5EPDA 4BWLA 1MO0A 3PSVA 4JN6A 1RQEA 2ZA3A 4N9BA 3BPWA 4HHPA 4FNQA 3HQ1A 4LC8A 4LUJA 3G24A 3P7YA 3R8RA 3A9IA 1IXPA 5F4SA 1TMHA 2PE4A 2PURA 3NOEA 5LGZA 3USBA 2VFGA 5E1QA 2ZZ6A 1NAL1 5DY3A 4IJBA 1EEPA 1JVNA 1FQ0A 2GOUA 5D04C 1S5VA 3CM4A 1YPIA 4O1DA 1LCOA 2FJKA 1HG3A 1KFCA 4MZ8A 5G4WA 2Y62A 3QZEA 4JXCA 3W75A 3LLDA 3NQ8A 4BI6A 1B3OA 4O8RA 1SW3A 2YFOA 3LDVA 3CEPA 3T4CA 3O05A 1H7OA 2OZ0A 1XXXA 1FDZA 4FNPA 1J4EA 1G4TA 2TYSA 4GFSA 2HSAA 1KFBA 1T96A 3MJYA 3L9CA 1CI1A 1WAUA 3LBMA 4ZQRA 2BXVA 1DKWA 4NJGA 4R53A 3UPWA 2CZEA 4BWLC 1WX0A 3F1QA 4QJ1A 2QCLA 4DBDA 3FOKA 3RF9A 3T55A 1QO5A 1JUEA 2NV2A 3GNDA 3O8AA 3VE7A 4MY9A 1XCFA 5LHFA 3TFXA 4DBEA 3GR7A 2A7PA 1KTBA 1TJRA 5AB3A 3E02A 4WUIA 2ZCGA 1M5WA 3SY5A 1WDWA 4AXKA 5SWUA 3O6CA 2CLOA 3FA5A 3G1YA 5U4NA 2A6NA 2A2IA 2QUVA 1LOQA 1WQ5A 3I7RA 1ZAJA 1PCKA 4RJEA 2CLIA 4MLJA 4O52A 3NQ2A 1JRCA 3UNDA 1SFJA 4XUGA 5C5YA 3S0CA 2ZTKA 2QUUA 4GNJA 1YDNA 3GDMA 5C55A 3LRMA 2YX0A 1W5QA 2H8ZA 3C56A 4LVAA 4M7SA 3LLFA 5LNSA 4IXXA 2KZHA 2Y7FA 4TMBA 1L2UA 4CQAA 2WJZA 4UFLA 1LORA 1Z42A 2JGYA 1DJNA 1LZOA 3GXTA 4JDBA 1UJPA 1JQVA 4A21A 1OFPA 3TUUA 1VZWA 1YXYA 3EX6A 1L9WA 2YGYA 4QITA 3LCHA 1KM6A 3TXVA 3NL2A 4M19A 2CWNA 3ZWTA 4FHAA 1GVOA 3A21A 2Y7DA 2ZA2A 1W5NA 4S2CA 4UFKA 1SO3A 3EWUA 1OX4A 3UYCA 5J5RA 5EY5A 4MYAA 1XBVA 3B0VC 3QPZA 3DFQA 2JBMA 3W7LA 4AHQA 3N73A 4UUIA 4XWUA 1PS9A 2YW4A 3Q37A 2NUYA 1R47A 1XC4A 2QCFA 3TW6A 2FLIA 5AHNA 3KAOA 4XBKA 1UCWA 5D2WA 3LCIA 2YR1A 4UFMA 2QEZA 3EWXA 3TSMA 5I3JA 2ZZ1A 1ZAHA 1SQ7A 4DF1A 1KTCA 5D05A 3BG9A 5LKYA 4BFAA 1MEIA 4JY8A 1LROA 5CZ0A 2XFWA 4OT7A 1RR2A 4DPQA 5HUPA 3N14A 2OMAA 2RDWA 4O57A 3D0CA 2EF9A 1X1ZA 1AL8A 4C1LA 1VLWA 2Y7GA 2GVLA 2NWRA 4LS2A 2OJPA 1Z48A 2TPSA 3G0UA 1TPWA 3PG9A 4N02A 3MI3A 5AC7A 2E5DA 1KM5A 3UWQA 1ONRA 3CIXA 3R12A 4GC4A 1YDOA 4XTDA 1ME9A 3EWYA 3KHJA 1I45A 1UASA 3HG4A 3DGRA 4N9EA 2X2GA 4A3UA 4POCA 4HNVA 1FCBA 1N55A 2R14A 2ZRWA 3IV3A 2VC6A 3DAQA 3P5ZA 3B04A 3HG3A 2BTMA 3LCWA 3F03K 3EWZA 3HB9A 3NNTA 4CQ8A 5L9FA 4E0CA 2CW6A 2CZFA 4NNCA 3UXDA 4JGDA 4EF8A 4Q32A 2RKXA 3NQCA 4HN4A 3LHVA 1BTMA 4KFPA 3NYZA 3CWOX 4IPJA 4NJIA 1F5ZA 2ZZ5A 3NXFA 1DV7A 3SIZA 2ISSA 3AJXA 2QUTA 4EWND 3BGGA 5K2ZA 1JRBA 5F2LA 4IQLA 3IVSA 3NZ1A 3GDLA 2EKCA 8TIMA 1F73A 3W2MA 1JR1A 3F4NA 3T78A 1W5OA 1H1YA 3M47A 3C2EA 4GJ1A 4Y9AA 4JTSA 3IEBA 3S1XA 3U6WA 4PL1A 3TCEA 4O16A 5FESA 3YPIA 3BARA 3KVJA 3FEMA 1FWNA 1B57A 1IGSA 3NQVA 3G1HA 1A5SA 5FF0A 2GJNA 1ADOA 4O0ZA 4KFOA 2FPTA 2NX1A 3I6RA 3QC3A 5BMWA 1WBJA 3LCGA 3O6DA 1WV2A 4U28A 3R89A 2ISWA 1L6WA 3FS2A 4KWWA 1GVQA 3QSTA 5G1YA 1K7FA 4CNPA 5HMSA 1TCDA 2CLFA 4WY0A 1KFJA 1PE1A 3DBPA 1SR9A 4EVZA 3TDFA 3HGOA 4O1AA 4HNTA 3THQA 3NQFA 4Z1BA 2ZZ2A 4U4MA 1KM2A 3LTYA 4N2YA 3STFA 1FY6A 3QQ0A 3W1MA 1TQXA 1FXPA 3MO7A 3OVQA 1W3IA 3KOFA 5J5DA 4O15A 4QNWA 2NUXA 2J9ZA 3IIVA 1QAPA 1SZFA 2R91A 4OBTA 2E09A 3Q58A 5T26A 3G0SA 1TTPA 1MEHA 1OHLA 4UTMA 4IUOA 4ZQMA 2P0OA 1MZHA 1IF2A 3G1DA 4MJZA 5C2XA 1VHNA 3W1QA 2VXNA 1GTEA 4S2BA 1XDMA 4ZL1A 2F7FA 1TPEA 3W7PA 4A2RA 4UC5A 4MZ1A 3UQNA 4O4WA 3NDOA 5G1TA 3W7OA 1LTDA 2RH9A 3W7EA 3M5XA 2Y6ZA 3QJAA 5EA9A 3IIZA 3L0GA 4AHPA 4H4IA 5KSWA 1W54A 3DFNA 3W76A 5FEPA 3S9YA 2WNZA 1NFBA 3QW3A 3NZRA 5HQEA 1UB3A 2HMCA 2NUWA 1TPDA 1AW2A 2VOMA 1ICPA 3C4UA 5AHMA 4LUIA 3PM6A 4JTHA 4NT0A 1DVJA 4LVFA 1PVNA 3KVMA 3GVGA 3TR2A 1H7XA 2J24A 3W7DA 3CU2A 4UNKA 2E6FA 3EB2A 3A22A 4LT9A 4TU1A 1ZAIA 4AHOA 4FXSA 1AL7A 3LXBA 3K30A 5HR7A 2DZWA 2CLLA 1HL2A 3OG3A 4A22A 3O16A 4ZQCA 3L0NA 3O63A 4WQ6A 3WJZA 3L65A 3PULA 4AWSA 3P67A 4UNLA 3PAJA 3DXIA 4XKYA 5FF4A 3PUEA 5FF7A 2NZLA 4NQ1A 3TK7A 3UZJA 4JTFA 4NXSA 4JS3A 3ZS4A 5BW6A 5DELA 3L5MA 1KW1A 2FB2A 2ZRZA 3ATZA 3NGJA 3TX9A 1W56A 4IXHA 4HNNA 4WXYA 3FFSA 3IRDA 1TB3A 1KFEA 1FDJA 4MY1A 3MWAA 1KV8A 5D37A 2Y7EA 1R2SA 2NXIA 3M5YA 5AFDA 2O7SA 3LBCA 3HO8A 4BR1A 3NPUA 1O5XA 2ABBA 4FNTA 5KINA 1TPB1 1WOAA 4PFMA 2QDGA 3LERA 3O15A 5H91A 1KBJA 1XBYA 1MEWA 3CWNA 2B7QA 3MYPA 3B03A 2V82A 3C2OA 3IIXA 4WX2A 5AHLA 3QM3A 5EL1A 3NAVA 1XBZA 1G7VA 4HKPA 3SFKA 3FIGA 3B06A 3HGJA 3VKJA 3LHYA 1OYAA 1GG1A 1P1XA 3Q94A 3QQ1A 1XFBA 5TQLA 3WJYA 2R8WA 3KX6A 1F6PA 2V30A 1LBFA 5HULA 4NNAA 4WZHA 4O11A 2WSQA 3EKLA 3S42A 2E5CA 5DCEA 3EX3A 1T99A 4DELA 3N9SA 5CZJA 4M7TA 1S5WA 1A5BA 4AAJA 1KA9F 4RXFA 2G96A 5I3HA 3E96A 2DZUA 4E2DA 3BVJA 1HFBA 2CZ5A 3KRZA 4LC6A 3ANYA 3ABRA 2RFGA 2FB3A 3MI6A 1FBAA 1QPOA 5EYWA 3PB0A 1DL3A 3W23A 4JTJA 3LV6A 2EPHA 1BKSA 3IGXA 2QCGA 2YDAA 4O17A 3TIMA 5DXXA 5D30A 1EX5A 1I2OA 1GG0A 2V5LA 3MP4A 2DZVA 2Y89A 2QKFA 5CZSA 5FEZA 3NR0A 3OVPA 3W7HA 4OU1A 3MMTA 2Q8ZA 1G6CA 5AYYA 4LRTA 4JTLA 2GVJA 4JYFA 1N7KA 1B4EA 4EIVA 1P4CA 4FNUA 1WYIA 1WXJA 1LRTA 1L6YA 4UIOA 1F76A 2GPTA 3L5AA 3W7GA 4LOCA 4AH7A 2QCEA 4UR8A 1YTDA 2V81A 3W9ZA 4O4VA 1PCWA 4XQ6A 2Q8LA 4O28A 2QCCA 2I9EA 2QAPA 2XN1A 1FWRA 1VH7A 1KM4A 3RU6A 5C6MA 1TRDA 4K6AA 3M6YA 3W1AA 4LW7A 2NWSA 2OX1A 4JY9A 2TMDA 3HMJG 1QWGA 2D73A 4TIMA 2I1OA 1TJPA 4HIBA 4PH6A 3N3MA 3CLMA 4O53A 3H54A 4MFDA 4RV8A 4RKAA 5G5IA 4RZ4A 5LGXA 1J2WA 3PC0A 4CCDA 2QCNA 4DO4A 4A2SA 3DFOA 2QCMA 4NJJA 4CLMA 1TSIA 5A5WA 2DZPA 1QPNA 5HUOA 3PUOA 1ZJIA 3IVTA 1ALDA 1Q6QA 6TIMA 4O1CA 4UMBA 1AMKA 2BX7A 2DZSA 3B0PA 1KLZA 4IMEA 4RZ5A 1SZNA 4RLIA 3IGUA 1FCQA 1S5TA 3WK1A 3O06A 1GVSA 4X2RA 4IMDA 4NU7A 2X30A 3THAA 3G8EA 1YDVA 4ORIA 2FFCA 1I2NA 1C9DA 1H51A 3SI9A 2JK2A 5F2MA 5D03A 3GR8A 7TIMA 4HT3A 3NQ7A 4AWTA 4GUHA 4ZVJA 2ZBTA 4JDYA 4MOZA 4UTIA 1GOXA 4UTWA 3DI0A 2ZRUA 2A21A 2WPBA 1A53A 1T0OA 4N9CA 5K4ZA 3QMTA 4NZJA 3RLVA 3P84A 3L0KA 2VKZG 4YCPA 3M41A 1F2JA 1WA3A 4IGHA 1LDCA 1X7FA 4YXGA 3A24A 3BG5A 3JR2A 3DHFA 1OFAA 3U2OA 4QAIA 3N9RA 4LS0A 5FEXA 3LHUA 5CPMA 1TPH1 4R33A 4RCXA 3GDKA 2CFFA 5LNUA 3A23A 3SW6A 1VHCA 4N4PA 3M5ZA 1SU5A 4K39A 1K8XA 4JYDA 2EHHA 6ALDA 1H1ZA 1R30A 2PCQA 2QAFA 3MBFA 5G2HA 1K7EA 2JKEA 3G3MA 2EAWA 1KM0A 5K4XA 1F74A 1G67A 2E6DA 4OV9A 4LVBA 4AEOA 3LRKA 4YCOA 3NQDA 4GUIA 1AW1A 3M1ZA 4DF2A 4P61A 1HO4A 5AOUA 1NSJA 3N34A 4O18A 3L5LA 3SZ8A 2VEPA 4FEZA 1VYSX 5F2IA 4CCCA 4UTWC 3MP5A 4GE8A 4RZ6A 1OJXA 1XUZA 4I9AA 3WK3A 2FPYA 4KKXA 3UY8A 3O1NA 2QJIA 2Z0IA 3EKZA 5L6UA 3RMJA 4K7VA 3GXNA 3BLFA 2X1RA 5AYXA 4Z1AA 2J9XA 3JRKA 3GX9A 4Z1DA 2C1HA 4L4LA 1W8SA 5D33A 3BLIA 5HJLA 5LNWA 1M7PA 3P60A 3EEGA 1RQBA 3W7CA 1G4SA 3NQMA 4MY8A 4O19A 3B05A 3G1XA 1QMLA 1V7YA 1W3NA 3MI2A 4DEFA 4TR9A 2A7RA 3H53A 3LHZA 2DJXA 3RFAA 5F2GA 3PBVA 2HTMA 2GUUA 2FDSA 3NQEA 1SZEA 2NX3A 3W2KA 4WJEA 2ZRVA 3M0ZA 2GJLA 2YFNA 3C3NA 5IM51 1R2TA 3SGUA 4QNEA 4HSNA 1LBMA 2C18A 5KTLA 3UWYA 3E9AA 4UXDA 3G1AA 1BWLA 3INPA 1YXCA 4I7WA 2DP3A 1TPVA 2RHGA 3TFCA 1K3UA 1UUOA 3NO5A 5CSSA 3P61A 4ICNA 4AF0A 3G1SA 3L67A 1NF0A 3GK0A 2FTPA 3HPSA 2E6YA 4YLWA 3W2UA 4LU0A 1JUBA 3L2IA 4AB4A 5FEWA 2Y63A 2G5WA 3MBDA 3W3OA 3G18A 5F4WA 4R7JA 3A5VA 1OF6A 2OCZA 1UBSA 2E68A 3QRHA 4YL2A 4IMGA 2Z1BA 3UWUA 3BG3A 3BW4A 3W22A 3W70A 3DH7A 2JKAA 4DO6A 1P0KA 4JTEA 3TH6A 4LVGA 3F4WA 1TV7A 3UPBA 2WKJA 3DZ1A 3OBKA 3WK2A 3S5ZA 3LHTA 3W1NA 3P5YA 2E6AA 1D3GA 1CW2A 1OFOA 1Q45A 1OVDA 3OA3A 4P2VA 5D2XA 3TQ0A 3W84A 3BW2A 1W1ZA 3W1PA 1PL9A 5HINA 3H55A 2BSLA 3C61A 1MXSA 4N4QA 4WY0B 3LX9A 3S8HA 1JULA 4MIMA 3TE9A 2V9DA 3FYOA 5CG7A 3S5NA 3W87A 1VYPX 1W0MA 5E93A 1FDYA 1TREA 1VRDA 1O95A 1OFDA 1LBLA 4OQVA 4IMCA 4MKNA 1QOQA 3STEA 2X1TA 3UD6A 2B4GA 3FYPA 2Z2UA 1LP6A 2YW3A 3HBLA 3QMRA 2YZRA 3MHGA 4M6VA 2DU2A 5F1UA 3ABOA 1VQTA 5CPNA 1XKYA 3S5OA 4LTSA 4LS1A 1EA0A 3GDRA 3STGA 1Q6RA 1TPFA 3MYOA 1L6SA 5TBOA 1SPQA 5CGQA 3AO0A 1KV5A 3Q2DA 3RK8A 2WQPA 3UY7A 4TX9A 1JUKA 2X1SA 2YSWA 4QISA 4Y90A 2AAMA 2ATMA 2BZNA 4WXZA 1FUYA 3CB8A 4UFIA 4LNYA 5MHBA 3UWVA 2V2CA 4JTGA 4Y8FA 2V2HA 5HWNA 3I7SA 2VFIA 4HNUA 4K36A 2X1UA 3MHUA 2YCEA 4OWGA 1EP3A 4JR5A 3LCXA 1SO6A 1SZGA 3HOJA 5HR6A 4IMFA 4TMCA 3TV8A 1NF7A 3KRUA 2Y70A 1A5CA 3SR7A 1GVRA 2YYUA 5IBXA 3LTSA 3FJ6A 1H63A 2ZYFA 3HGSA 3UWZA 2C13A 3W7JA 1G7UA 4H3DA 3RNDA 2VEKA 1SUXA 2Y61A 3FJLA 5U7SA 2A4AA 1VC4A 1OK6A 5K9CA 4UTTA 1A5AA 1Q6LA 2VFDA 4CCEA 1GVFA 1EUAA 1YXDA 2J88A 3G1FA 1H7WA 3ZR4A 1EWEA 1I2QA 4BF9A 4AVFA 2BLEA 1JCNA 3W7MA 4GWEA 3C0JA 3N19B 4JIPA 5EKYA 5EMUA 4KWVA 3KXQA 4XKYB 3LI1A 2NLIA 3GIYA 4ALDA 3RLUA 3LRLA 3TJXA 1JCJA 4Z0JA 3I65A 2QCDA 2ZZ4A 3QFEA 1XI3A 2FQIA 4O1BA 3OEXA 4FIQA 1W31A 1XDLA 2VFEA 1I4NA 1ML1A 3WJXA 1YADA 3I7QA 3W7KA 2WOQA 1TQJA 2GQ9A 3TAOA 3TC6A 4O13A 4ZMGA 4PEKA 3GZ3A 3LHWA 5IBXC 1NVMA 3GKFA 1Q3NA 1KBIA 3EWWA 4MYXA 2ALDA 2YPIA 3LXCA 3T40A 4JNMA 4MJMA 1ME8A 4MUZA 3TKFA 4LVDA 3NA8A 1C8VA 4E38A 1IXNA 1SO4A 1TTJA 2FIQA 1GTHA 2G97A 3DFTA 3GAKA 1AG1O 3LTPA 1QNVA 1X6UA 3CHVA 4O12A 1YYAA 4GUJA 3PUDA 3QYQA 3HIJA 4UTJA 2ZRYA 3LCLA 3GAYA 5H2ZA 4QSHA 5D09A 3S1WA 3WJSA 1ZNNA 1QO2A 1K8YA 3DHDA 3G1VA 3VNDA 1CX9A 1I8JA 2GQAA 4YMZA 4E2BA 5KMYA 2F84A 3IVUA 2QCHA 3GB6A 3BW3A 1QFEA 4AWUA 3TSDA 1IXQA 5DY2A 1IXOA 2H8XA 2ZTJA 1H7RA 4O54A 1VPXA 4BI5A 1VLIA 4HPXA 1HTIA 1KM3A 3QPYA 1Y0EA 2C19A 1GT8A 1SW7A 1JQXA 1VR6A 4FIRA 1U83A 4QM1A 1QDSA 4RK8A 3S1UA 1DJQA 1OYCA 1U5JA 3UZ5A 1K03A 1P5BA 3TNOA 3NVTA 4UTHA 4GUGA 3GDTA 3FKKA 3B4UA 4IOTA 3QW4B 3NPVA 4UFHA 1OX6A 1TV8A 3PWAA 3R2GA 4X9SA 4OHQA 3ELFA 1VYRA 3IGSA 3TJLA 3WJWA 3TA6A 2QDHA 3PY2A 3W2JA 3L68A 4OE7A 5G2IA 1FCVA 1H5YA 4Z0SA 1ZALA 1RQHA 4Q4KA 1H61A 2Q3OA 3TW7A 5HWMA 3P81A 5AC6A 2CZDA 4FNRA 4FXRA 1OF8A 1I2PA 4GUFA 4CQ9A 1XM3A 3C8FA 1T8XA 1GZGA 2PRLA 1YTKA 2NX9A 3P74A 5KZDA 4PA8A 3JS3A 3NM1A 4JX5A 3UXAA 3STCA 5D2YA 4MZYA 3DI1A 3GXPA 4EF9A 3C2FA 4JEQA 3ZFHA 2CLHA 1B9BA 4O10A 3G0XA 2A85A 1F7BA 5ABTA 4DXVA 2WNQA 3R13A 1ZY9A 1BEUA 3R5EA 1KFLA 1O60A 5AHIA 4WD0A 1YLVA 3PG8A 1ZCOA 3TMQA 4J9JA 5GVJA 1DORA 3DKLA 3W2NA 5BMXA 4ML9A 1J5TA 2QF7A 2WV8A 1A50A 5DXYA 4K8EA 1D9EA 3TU9A 2E77A 4MVAA 3HPXA 1XUUA 5I3GA 2VENA 5CKSA 5D02A 2DZXA 4EOUA 4H6KA 1KFKA 3U8GA 3P8IA 2CU0A 1G69A 4K8HA 3IIOA 5G2WA 3TAKA 3C52A 2TSYA 2VEIA 4ONVA 1DQWA 3SSJA 4GBUA 1OX5A 5K7JA 2NV1A 3NPXA 4IPIA 3VE9A 1H7NA 3W71A 3OHIA 2HS6A 1W5PA 1EP1A
chains in the Genus database with same CATH superfamily
3F5LA 5D2TA 4F40A 3AROA 2DUXA 2ZICA 3JW7A 5CPOA 3TYBA 5HNRA 2Z27A 1PHWA 3LGDA 3VDGA 1V6TA 2HVNA 4ZZ9A 4GBDA 3CL7A 1JZ6A 2VFHA 4XBSA 3ATYA 1GZJA 3ZO9A 1M41A 5BU6A 2VHLA 1OD8A 1BKHA 2PDGA 4RX0A 1BYAA 4Q33A 1SSGA 6A3HA 3AI0A 3L21A 4GVIA 1K02A 3W7QA 4AY1A 2GUYA 1HJQA 2PTWA 4Z08A 1B4KA 2ABAA 3H2FA 2J9YA 1R46A 2HS8A 5XIMA 2QF8A 3O0FA 1RZMA 3A12A 2VCAA 1OG0A 2WMIB 4ZFCA 3PBUA 4JCMA 3TMLA 3VXGA 2FKPA 1TTQA 5AC5A 1V3MA 1M03A 4E8CA 1FH7A 3O07A 1XLFA 1W5MA 1LRNA 3SUWA 5HXMA 1QPRA 1HIZA 2PRMA 5JIWA 1XYZA 3UJSA 1JCXA 3QSRA 1UUMA 3PJUA 4D8ZA 5EBUA 4GG9A 1TPUA 3O9NA 3CTLA 1MQRA 4AU0A 4KW2A 5BXRA 2DZTA 4JYEA 3CT2A 4PMVA 4BQ3A 2JGQA 2H3DA 5CC5A 2WQDA 1QHZA 1Q6OA 1S2AA 3M4HA 2VDIA 3NVDA 4LV9A 1DWHM 2O55A 2WMFA 5D9OA 4I6VA 3NEVA 2XIOA 2EPMX 4AIEA 4I7UA 3RRAA 4HU0A 3NQGA 2P3EA 1FRBA 4UZUA 2WNNA 4ACZA 3LV5A 2DT3A 3M0XA 3FLUA 2QIWA 3WH5A 3TCSA 1E0WA 3I68A 2O56A 4L4MA 3ARYA 3K46A 1KM1A 4PFHA 1GJUA 3U2ZA 3TTQA 4R34A 2WHKA 2WBKA 4GHRA 5E0KA 2VGFA 4NUWA 1H1NA 2GJXB 1YPFA 3O6YX 7PTDA 1V02E 2HK0A 4LXFA 2V3EA 2EPLX 3MCNA 4I7VA 3L12A 4RNJA 3SY1A 5M17A 5DCDA 4QJ5B 3LMZA 4LPCA 5CSRA 1W1VA 2D0GA 1UZDA 5I23A 1ZFJA 3EXSA 5LA0A 1EF3A 4UR7A 1V6XA 3XIMA 4JX6A 1I2RA 2W6RA 4UMCA 1OCQA 1Q66A 1PXGA 4NYYA 3WKZA 2DIJA 2GUBA 4OV4A 1OABA 2V8ZA 2WCAA 2W62A 3HF3A 4ADSA 3CMFA 4MPKA 4JN8A 4EAMA 5E9AA 6CGTA 1H62A 1F3EA 3M9YA 3NPWA 3AIBA 4PTNA 3WFAA 3TJIA 3W1TA 1E51A 3WEZA 1CB2A 3P6LA 3HN3A 3RXZA 1MWOA 2W79A 3VI2A 4ERGA 3ZR5A 2BP1A 2Y5EA 4AC7C 5CZTA 4W8LA 3LZ5A 2HJPA 4H8NA 3S2JA 3BICA 2R82A 1P0BA 3T0CA 2RAGA 5K9DA 1H4PA 2TODA 1VCFA 2Z6JA 3S6OA 3S9IA 3QQWA 4KFNA 3HZ3A 1LYXA 4NAEA 3A4XA 4FMVA 4KMQA 3GYEA 2PDCA 4WSJA 4LV4A 4N0RA 4LALA 4GX9A 3FDKA 4QCFA 1KKOA 1SSDA 1GQIA 3LB0A 6REQB 2WM0A 3CQ0A 3TEVA 3MHFA 4MMWA 4O14A 4PCTA 1X1OA 1FWAC 2HISA 2C6QA 3H70A 2CLMA 5DQPA 4HPHA 2DH2A 4GZIA 2FZBA 1EYEA 4HZ8A 2HZGA 1IEIA 4IP4A 5A6JA 3EWCA 2PD9A 4CU7A 3P0WA 1GWJA 1H7PA 3E12A 3NQ6A 4NJKA 4O0KA 3TSBA 4OBRA 4U10A 3VYLA 1TIMA 2DVTA 4NX5A 1DTNA 1M6JA 5BYWA 4GGHA 4DUVA 4CEUC 4NJHA 3PZMA 1OC7A 1HJSA 1XLEA 3VK5A 1QNQA 3P80A 3H4WA 4EPEC 4MDPA 1HUVA 7TAAA 4MPQA 5LA1A 1XRVA 2J27A 1GKRA 2WB5A 2R9RA 5DLCA 4LH8A 1QATA 4J3ZA 4DF0A 4FX8A 1XYLA 3JZEA 2CBIA 5FKYA 4GVGA 4TVCA 1TZ7A 2PS2A 1ZQ5A 3W38A 3BV4A 5LZLA 3OG2A 1DYSA 1QK2A 2DJLA 3OP2A 4M1BA 3HMCA 2PRHA 3L2LA 1OCBA 4LYPA 4YN5A 2VUYA 5JBDA 3H24A 4FX7A 3DGBA 5AYZA 3W07A 1TX2A 1QW7A 5CC3A 1MQPA 1LG2A 3M7WA 3SBFA 3L4WA 5A6LA 5LXXA 4D2JA 1TV5A 2P8CA 4FX6M 2Q8XA 4C5YA 1QHPA 3NJ3A 1ZRQA 4NIRA 1MFUA 2J7GA 5BNKA 3GDBA 1R2RA 3WL0A 2DZAA 1ENUA 3KRBA 1EB3A 4NX0A 5CPTA 2GDQA 4ADUA 4L7ZA 2PF0A 3C2YA 1EGMA 3R94A 3FXGA 3IK2A 2GQ8A 2REQB 4BWLA 1MO0A 3SY8A 3PSVA 2DVUA 1RQEA 1XYAA 1X8CA 3OLEA 1IV8A 2XGIA 1E4LA 1FWIC 3MQTA 3MU7A 3A9IA 2PURA 1KKRA 3NOEA 1ECQA 3WDPP 1GKQA 3MT1A 5DY3A 3HPFA 5I3DA 4IJBA 1EEPA 1HL8A 1UA7A 5DRCA 4JTAA 1KCKA 4DB7A 3VMPA 1EO7A 1OEPA 1L6GA 2ODOA 4PR4A 5LIUX 3EDDA 5D9MA 2PMQA 4PYSA 3NQ8A 4F8XA 4QEHA 4O8RA 1K4HA 2YFOA 2PA6A 1H7OA 4D1JA 1XXXA 4WJXA 2H9AA 3TTEA 2CERA 1S2WA 1AJ0A 2HSAA 1KFBA 3PWIA 2TAAA 3MJYA 1U5HA 1WAUA 4LBSA 3HJEA 4NJGA 3S9ZA 3UZXA 1W17A 4C6PA 3T55A 4QJ3B 3GNDA 3O8AA 5LHFA 4WGXA 2J79A 1TJRA 1X39A 3SY5A 1WDWA 5IFTA 5SWUA 1HVXA 1C7SA 2WWDA 1EQCA 2CLOA 4NI3A 3G1YA 2A6NA 1JAEA 2XSAA 2A2IA 1Y5VA 4UZSA 1WQ5A 5E9XA 5MF5A 2VYOA 3MTWA 1YW1A 3ECQA 1XF0A 1TWSA 3UNDA 3KE0A 5C5YA 1DWGM 4M81A 4AD0A 1YDNA 3GDMA 3C56A 4LVAA 4B2DD 3ZMRA 4IXXA 4YTRA 3B0YA 2WLZA 3GBDA 4TMBA 4Y9MA 3AICA 1LORA 2JGYA 4K68A 1DJNA 3WDJA 4JDBA 1DE5A 1UJPA 3SADA 1B30A 4LEFA 3NL2A 1JAKA 2CWNA 3ZWTA 4FHAA 1SO3A 5EY5A 3CASA 4LUYA 1QI0A 3ZLFA 4UUIA 4N7QA 4ATDA 5EGRA 2NUYA 1R47A 3CH9A 3KAOA 5I7GA 4UFMA 3TSMA 1UR1A 6ENLA 1V4YA 1PX4A 3AIRA 3IJ8A 5EMYA 2PUZA 4BFAA 4JY8A 1UR0A 1US0A 3WLTA 2XFWA 3VOIA 1A0EA 1PAMA 3MUCA 3OZMA 4GQQA 1X1ZA 4D6FA 1AL8A 1G5AA 1J93A 4E4PA 3MKCA 4KIEA 2OJPA 3B40A 4QE1A 3ITYA 4N02A 4KETA 5CBIA 3MV11 3LBOA 4J3WA 1KM5A 1QXLA 4H8HA 1KXQA 4ZFMA 3R12A 4XTDA 1WUFA 1QU4A 3VM5A 1I45A 2X2GA 1US3A 2UY4A 2ZRWA 3IV3A 4C6KA 3DAQA 3BAYA 3BANA 5A8MA 4QG9A 3HB9A 5GNXA 2CW6A 1UBPC 3R43A 1EJVC 3AHTA 2RKXA 1BTMA 3CWOX 4NJIA 3NXFA 2ZZ5A 3GVVA 4CKQA 1XINA 3MMDA 2E9MA 3V5OA 2J78A 2MUCA 2HXUA 4BF7A 2VX4A 4W85A 2BASA 4UQDA 5A2BA 4NHVA 1S2VA 4DUXA 1VFOA 4NY2A 4H9YA 3TWBA 3GUGA 4DLMA 4UTFA 4JTSA 3IEBA 2EG6A 3U6WA 4PL1A 4O16A 4EX4A 4X63A 3YPIA 1FWNA 1B57A 1IGSA 1MDRA 2J7DA 1S2TA 1BRLA 2GJNA 1ADOA 3KDNA 1W1IE 7CGTA 3SCOA 4D9PA 4AZCA 4M24A 3BL3A 4IIHA 4GXPA 4DZ5A 3C0LA 1VJSA 3GFZA 3FS2A 3MWCA 2WANA 4KWWA 4UQEA 1GVQA 1MQQA 1K7FA 4CNPA 5CJMA 5HMSA 1MW2A 2I57A 2Y8KA 2CLFA 4M0XA 3FGCB 1KFJA 4GCAA 1EOMA 4PSRA 5TAOA 4H83A 2CITA 4HNTA 1ITUA 3U48A 3WUFA 3CUIA 4N2YA 2CHRA 1XG4A 1E9YB 5J5DA 3O2LA 1E9ZB 1HP5A 2XIBA 4EACA 2J9ZA 3WN6A 1SZFA 5T9CE 1LWIA 2GWGA 2R91A 2FHFA 4BZYA 2E09A 5T26A 4INFA 3CAWA 2QUNA 3IJLA 3A3WA 2PZNA 4IUOA 1LG1A 4ZQMA 1MZHA 3BLLA 1NP0A 3G1DA 1OWQA 5TD4A 2OYKA 5HBFA 2A3HA 1OZQA 2HK1A 4MM1A 1W3KA 3BCDA 1AZ2A 3W7PA 4B3LA 1VAHA 2CHNA 5G1TA 1E1CA 2V5CA 1SMDA 3GC2A 4J5NA 4CEXC 3M5XA 2Z7KA 2NQZA 2V3DA 3QJAA 5EA9A 3IIZA 2A3EA 1EDTA 3QLDA 5KSWA 1W54A 1XLAA 3S9YA 4UQAA 2QDEA 4CN6A 3QW3A 1KBBA 1CZ1A 3WQEA 3K4AA 1AW2A 1J18A 1YKWA 5AHMA 4JTHA 1JPHA 4LVFA 2HQAA 3RO6A 1EGVA 4CQDA 3W7DA 3CU2A 3CUHA 4IZGA 4UNKA 4FF5A 2E6FA 3V3WA 1X7IA 1HT6A 2VEGA 4IFKB 4FXSA 3ANVA 1AL7A 5FJJA 2ZVIA 3RCNA 2EO7A 5LYRA 2CLLA 5DFAA 1HL2A 4IG2A 3OG3A 4V1XA 2NSXA 2E9BA 3L65A 4QROA 4AWSA 3CIVA 2VMFA 3QV9A 3UCQA 5I24A 5FF4A 2NZLA 4NQ1A 1FHDA 2FMNA 3QV8A 1KW1A 1QBBA 3NGJA 3OYZA 4HNNA 4WXYA 2HPIA 1KCLA 3IRDA 1E1EA 4DJFD 1TB3A 1KXHA 4BA0A 1GVYA 4TUFA 4DRSA 1VD6A 5ABFA 2D0HA 1KRAC 2VX7A 5FD0A 5AY7A 4GZJA 2ABBA 4CNUA 4WDTA 5KINA 1H09A 2WVUA 3PPFA 2HWGA 3T2OA 1Q4WA 1TV4A 3T09A 3KWXA 5H8MA 2XJ7A 1TJ0A 1KGXA 5H91A 1XBYA 4R7OA 2B7QA 3MYPA 2QIIA 3ZJ7A 4ZGYA 2BVWA 3NOYA 5EL1A 4HKPA 1TWWA 2YLLA 2E67A 2YBTA 1UC5A 3EB4A 2QW5A 1GG1A 1E40A 1XFBA 5TQLA 3KX6A 2V30A 4US6A 5HULA 4JIHA 3HV8A 1K1DA 2YJQA 5AZ1A 3EX3A 3SCUA 5HPOA 1EC8A 4AAJA 4IISA 3OLIA 2G96A 4WJ8A 5I3HA 3E96A 4YNGA 3VC6A 1HFBA 2BGSA 4WK9A 2RFGA 1FBAA 4S3CA 3WD2A 5EYWA 3KCOA 4XZBA 1MXGA 2EPHA 1BKSA 3IGXA 1JGIA 9CGTA 2QCGA 5BRQA 3TIMA 5DXXA 2WBGA 3OBAA 1X97A 3PPCA 4PBGA 1MNSA 3MP4A 3T0DA 2CXEA 1TZZA 3ITXA 4JEJA 4OU1A 2Q8ZA 5AYYA 4JTLA 1N7KA 3NZPA 4EIVA 3FDGA 4QFUA 1WYIA 4JBRA 1MZRA 4ACYA 1F76A 2GPTA 5C0QA 3LS9A 2QULA 3W7GA 3FJNA 3UGVA 4ICCX 4AH7A 1JYNA 2QCEA 2YB4A 1YTDA 3W9ZA 4BS0A 2ZX8A 1BQCA 1M68A 5T9BG 5HQLA 1F3TA 1XLLA 2QAPA 2XN1A 1FWRA 4U5IA 3URBA 1GOWA 3H2NA 4GPNA 1TRDA 3M6YA 2NWSA 4G7EA 1A49A 4JY9A 2TMDA 4EXAA 1RP9A 4E5TA 4TIMA 4GI6A 2DFAA 1TJPA 4GD0A 4JL1A 4O53A 1EX1A 4B15A 8XIMA 1M7XA 3GS6A 3MMUA 4RV8A 2CZVA 4ZOEA 5LGXA 4CCDA 3URQA 4A8LA 5A1AA 2DZPA 1ALDA 1J0IA 4YIWA 6TIMA 4L4PA 1JPIA 4UMBA 4IMEA 3HTWA 1QPKA 1KLZA 1UKQA 4DM1A 1DJHA 4JHMA 4PCPA 4H8UA 1WKYA 4NU7A 3THAA 1W1B1 3G8EA 3ARZA 3JUGA 4HOWA 2FFCA 2OPJA 5F2MA 4FOKA 3GR8A 7TIMA 4GUHA 2ZBTA 4C7GA 4QLJA 4UTWA 3G1RA 3QR3A 4Z2HA 4NZJA 3RLVA 1UD6A 3M41A 4GIEA 5FAJA 4IGHA 3TTOA 2VX5A 1O5QA 3ITGA 4Q4PA 4PB4A 1DWAM 2CFFA 5LNUA 3SW6A 3M5ZA 4K39A 4ZB0A 4U2YA 6ALDA 2QAFA 1K7EA 2JKEA 1VPQA 3L23A 5K4XA 3F4DA 1F74A 1KRCC 3C0QA 4PEEA 2E6DA 4OV9A 1CENA 1A5UA 4LVBA 3LRKA 5B7ZA 4DI9A 1HKKA 1JIBA 3M1ZA 3E0FA 3SFWA 4DF2A 4OUEA 1QI2A 3B9OA 2I56A 5F2IA 4CCCA 1LQ2A 3M07A 1OJXA 3GHSA 3SAZA 3P14A 4IP7A 3IK4A 4K7VA 1XIDA 2VNCA 3GXNA 5DT5A 3KL3A 4S23A 1FWDC 3CH0A 2C7FA 2YB1A 3JRKA 2Q09A 3PZUA 4Q8VA 3BLIA 1V0MA 5E6YA 3NQMA 4MY8A 1KC7A 1FOBA 2XTKA 1W3NA 2AL1A 4DEFA 4TR9A 1QASA 3PZ9A 1A5NC 3RFAA 1XLGA 1O5RA 4FSAA 3ZOAA 5A2CA 4GKTA 4B91A 1EQPA 1Q63A 1EH9A 3M0ZA 1S3TC 1AD1A 4V33A 1LBMA 3E9AA 1EJTC 3G1AA 4WKAA 3INPA 3TA9A 3CHCA 3UXLA 5CGMA 1YXCA 4IGMA 3PBMA 1JDEA 1HKVA 1UUOA 3NO5A 4AUBA 2GJXA 3U7VA 3HPSA 2RJGA 3W2UA 4LU0A 1R0MA 4DN1A 3PAOA 4YU1A 1J01A 3A5VA 3DFYA 3I3BA 3L4TA 1XIIA 2E68A 3QRHA 4IMGA 1I0DA 2NT1A 3PNZA 4QJ4B 4DO6A 3TH6A 3F4WA 1TV7A 2VQTA 3OBKA 3WK2A 1Q45A 3OA3A 5D2XA 1ZZMA 3BW2A 4NAFB 3VMOA 5HAOA 1W1ZA 1LL4A 1SFSA 1FKWA 3ZXWA 2OZ8A 2QPUA 3H55A 4AZ6A 2BSLA 1WB0A 1MXSA 4N4QA 2A3BA 3LX9A 2BNJA 5XIAA 3S8HA 4WSHA 3U0HA 3BDKA 3UT0A 1XLDA 2IMRA 3W87A 1EBHA 3K1DA 3VTRA 2BB0A 2E28A 1LBLA 1WUEA 3WD3A 2YA0A 3OZYA 1QOQA 1R38A 3UD6A 5I0DA 1DE6A 3KP1A 4X60A 3HBLA 3QMRA 1BSIA 3GHTA 2VQUA 3TLLA 3TLQA 5H1WA 4M6VA 1BPLB 5F1UA 3ABOA 1VQTA 3DCPA 6XIAA 4LTSA 3R79A 3AO0A 1KV5A 3UF9A 4YTTA 1OQFA 3RK8A 2VZUA 2WQPA 1YNQA 4ZCWA 3SN1A 4QISA 3TYCA 4HTYA 3UNTA 2BZNA 4WXZA 2G3MA 4LNYA 1VRXA 2VFIA 4HNUA 2X1UA 2PGRA 4OWGA 4HA1A 1V93A 2FZDA 3BC9A 3A4AA 3MPGA 2W3ZA 1IT7A 5HR6A 4IMFA 6REQA 3KRUA 4HZ6A 2BY0A 6PTDA 3ARVA 3ZVIA 3PJWA 3SR7A 4XIMA 1XICA 3BQ5A 1H63A 4ZO7A 3HGSA 4L80A 3C8NA 3UWZA 1RUSA 1V8EA 2GWNA 1CNVA 1G7UA 3W7JA 3AIEA 3FJLA 2GGJA 1XIJA 4PUUA 3VNKA 1TE6A 4WR3A 4CCEA 3KCLA 2V6AA 3OGRA 1YXDA 2J88A 3ZR4A 4XZLX 1I2QA 4DYJA 1LF1A 4LJ3A 3ERPA 1JCNA 4XSLA 3C0JA 5EKYA 3M0JA 5EMUA 1AQHA 3HFTA 4IP5A 3ARRA 2XM1A 2E0PA 3LRLA 2VUNA 3VOGA 4DUWA 1R8LA 4CU8A 4R88A 4WDWA 2AQVA 1XI3A 3QFEA 2FQIA 1CXKA 4AZIA 2ZX7A 5FL0A 1XDLA 1K6WA 1M9HA 3I7QA 3NZGA 4S3EA 1XSKA 2WOQA 1XG3A 3LHWA 5IBXC 1NVMA 3GKFA 1OGBA 4L1GA 5A69A 5AC4A 4MJMA 1ME8A 4GGBA 4LVDA 1O12A 4E38A 1D7FA 1JZ7A 3DFTA 2OGYA 5I09A 3GAKA 4LSBA 2XFRA 3MKVA 2F6KA 3CHVA 1WDDA 2XGBA 5FL1A 4P7NA 3AUOA 2NQLA 1XYBA 4W8BA 2ZRYA 4YVXA 3LCLA 4AD5A 1LJYA 1YX1A 2YL9A 3DHDA 4Q8QA 3G1VA 5AKQA 4YMZA 3EDKA 3SN4A 5D4YA 1XH1A 2QCHA 1QFEA 4HU8A 4AMCA 3MV01 3AUJA 4Z2KA 1IXQA 5DY2A 1F8IA 2V38A 2ALRA 2OWCA 1JPDX 4RNIA 4O54A 8XIAA 1QVBA 1VPXA 3GC4A 3WQWA 1HTIA 1OBAA 1KM3A 2REQA 4CU6A 2C19A 3UXIA 1UOZA 1ESWA 1BD0A 4WIWA 2D20A 3COTA 4HK6A 1QDSA 4RK8A 3LZ3A 3HU7A 3H21A 1U5JA 1VBRA 1ZU8A 1UD8A 2J13A 4AD2A 4AIUA 4QBXA 1P5BA 1PYFA 4YJ5A 3NVTA 4I3GA 4Z1YA 1TJ1A 3FKKA 4IOTA 3QW4B 3NPVA 1SYTA 3LQLA 3PWAA 3R2GA 2CKRA 2IPJA 3IGSA 3TJLA 3WJWA 4S3GA 5FIPA 3W2JA 3L68A 4KS0A 1H5YA 3WFZA 3CXOA 5JQ9A 1C8XA 1F6YA 4Q4KA 4V27A 3TW7A 2ZXAA 1JDFA 1I2PA 1C90A 1T8XA 1GZGA 1YTKA 3S6TA 1NFPA 1B5TA 1IT8A 3E2VA 4QLLA 4MWAC 4EF9A 4PMJA 2FZNA 1CXLA 3ZFHA 1POJA 4X2PA 3G0XA 5IHRA 1W3HA 2A85A 1F7BA 4DXVA 3R13A 3TYDA 1IHIA 1KFLA 4DWSC 1O60A 5AHIA 4WD0A 5BWAA 3TMQA 1CXEA 1JYWA 4S3AA 5BMXA 4ML9A 1J5TA 2YCJA 2YBVA 1QT1A 1A50A 4DZAA 5DXYA 1D9EA 4XK2A 2G41A 1XUUA 4LAOA 1HKMA 4EOUA 1KFKA 4TXEA 4XG1A 1J8VA 4OVXA 5G2WA 3EKGA 1BXNA 3W6LA 2TSYA 4C6MA 3A47A 5K7JA 5LIYX 3N4AA 2ICSA 4IPIA 4GIYA 1V51A 5M03A 1EP1A 3VMNA 3OIXA 3QBUA 4FXJA 1HKIA 5J8LA 5G4EA 3N2XA 2WSYA 4NNBA 4PL2A 2CLKA 4HYRA 3OLGA 4QAWA 1G4PA 3S1VA 2RGMA 3QH2A 3HG2A 1EWDA 4M6UA 4A05A 3FK4A 1OC5A 2C14A 2BHZA 4XISA 1D3HA 4B9YA 3BXWA 1UP2A 3CHDA 3QPEA 4A29A 3UCCA 2VZSA 5DCBA 2VFFA 1IEVA 3LK6A 1OX4B 3B0XA 2RDXA 1F6KA 2X16A 1IZKA 4J2PA 4B16A 5I3KA 1W9BM 1M04A 3SRDA 3BTNA 1GPWA 3ZT6A 1O5KA 4A3RA 4G1KA 4J3XA 5LNRA 4FOUA 4AZBA 4FNSA 1PBGA 2D3LA 1FHLA 4HNCA 3CHFA 2X05A 2ASHA 2W67A 1XLHA 5IFPA 1XL9A 4W4QA 2C16A 2Y2WA 3SIMA 3VCRA 5D2VA 3ZVHB 2J62A 2WXDM 4Y6GA 3GSMA 4HD5A 1Z8AA 3WBXA 4M5PA 3EX1A 5FJOA 3P8JA 2V67A 3B0UX 4LCQA 4AX6A 1WDQA 4FK9A 2DSUA 4JPGA 4GABA 4UTLA 1BXCA 3RDKA 4J27A 2QPSA 3WCZA 2YDQA 2WAGA 1XISA 2O9OA 2DW7A 4IJRA 2O9PA 3NL5A 3UETA 1GOMA 5KZ6A 2DH3A 2X0HA 3W4RA 1PZ1A 1YRRA 1J79A 1M7JA 3GC5A 3URNA 1S5NA 3PSWA 3PTQA 3KOYA 3LPGA 4PCNA 1E43A 2A7NA 3NURA 2DUAA 1PX3A 2W9MA 4MLRA 2PDBA 3GNNA 2PLMA 4I6KA 3BZJA 4Q8UA 1MUWA 5LIXX 4D8LA 3WG6A 1THFD 5I79A 4JTUA 2ZQ0A 5I00A 2QR6A 1XBXA 1NH6A 4WKFA 3PS7A 1WAWA 3VIMA 3GRIA 3W1RA 4BQ4A 2UY3A 4M6PA 5A8GA 2XN0A 3VNIA 3S47A 2RJHA 3R0KA 3AMGA 1WKFA 2PAJA 3G3DA 3ZIZA 4HHMA 4XV0A 2B7OA 3FGCA 4PULA 2OT0A 4GFIA 2PLJA 1KTNA 4RW5A 4GYKA 3PHAA 3C6CA 4WRHA 3BZGA 1SO5A 5FI8A 4IQJA 1K70A 1KR0A 1EPXA 4GCXA 3AJ7A 2AGTA 2DORA 4MNJA 4DPPA 3MVTA 3ZYZA 3W7RA 1XP3A 1R3SA 4LWWA 3SCRA 1PPIA 2FMOA 3M0KA 4XUYA 1FWGC 1GCYA 4IL0A 1LRQA 3W1UA 2PC4A 3CAQA 2PWDA 2O9TA 2PDIA 5K9XA 2D2GA 3QKZA 3OVRA 4Q4OA 1SFTA 3AOFA 4ADTA 2GYIA 3QEZA 3TROA 2WK2A 2XYLA 1VBJA 4B2DA 5TIMA 4HN8A 2I16A 3L66A 4GOAA 4AWEA 1DEDA 2DGAA 2VWSA 4H6EA 1OD0A 4GO9A 3VNLA 5KZEA 4LUSA 4XTIA 5AHEA 3S46A 3LCFA 2Y85A 2G95A 1GQNA 2DIKA 2VD9A 3H12A 2WSRA 1VJIA 1ZHAA 1AK5A 4QS5A 3SDOA 1GEQA 4RPQA 4CNTA 1EIBA 5RUBA 3MUIA 1IIGA 4JTTA 1UWAA 2WYSA 1Q2SA 3L4YA 1JFHA 2NXHA 1A47A 2XZ9A 3BJSA 3GLCA 3BLEA 3VOJA 4DJDD 1GUVA 2W0UA 3GW0A 4E3VA 4AMAA 3W83A 3W74A 3MW7A 1GQKA 1CGYA 1EC7A 2OEJA 4X22A 4L6OA 3KZPA 4Y96A 4WDUA 1I1WA 1QR7A 2V5DA 4A4AA 2XWEA 1TO3A 4C6JA 1I60A 4GH3A 2E1DA 3LPFA 1GJPA 5F7UA 3W85A 1B3VA 2YYTA 3ZWSA 1RVKA 3BO9A 4HP5A 3LOTA 4J3UA 3TQVA 4MWAE 3HA1A 1TWIA 2LLEA 4AY8A 5DN1A 3CEUA 2GVYA 3GD6A 4GXMA 3C2RA 1A5LC 2XN2A 3S2NA 3P3BA 2ZFAA 2Q3RA 1B3XA 4M6QA 3S3GA 3M5VA 2ATSA 2WO5A 3S6DA 4FP1A 5HK4A 3WLNA 1CTNA 3KP0A 2XVKA 1BQGA 4NSBA 4WOQA 3DU0A 2D2HA 3LQGA 3SGZA 2UV8G 5CBBA 2AMXA 3LI0A 1DQXA 2WC7A 3M44A 3MB9A 1ZL1A 3W81A 3MZ2A 5CBJA 1XGEA 4JTIA 2WJFA 2BWGA 3N2MA 4DZIA 3BGJA 3A4JA 3GVQA 3QF0A 2G3FA 1NOUA 3ABZA 1H2JA 4TV5A 4K2SA 4PC8A 3NL3A 2CCRA 1E0VA 1WOBA 3CZ8A 2FJUB 4M29A 3SM0A 1EJRC 3GHUA 4XIAA 4LY4A 1YDYA 5D9PA 3APTA 4D6CA 2CC0A 2E4TA 3HG5A 5E6ZA 3VNJA 3CC1A 1BG9A 4QTGA 4OGZA 4YS1A 3B4YA 3M43A 1NEYA 5HWJA 5D38A 3KVLA 3GG7A 2UBPC 4ZTXA 3DERA 3VD3A 3DC8A 3ARSA 3UWEA 4P7OA 4RE3A 3OGSA 1GQJA 1NOWA 4Q4QA 1OFQA 4QR6A 4DQWA 4B5NA 3OO2A 4UMAA 4H04A 3BCFA 1EXBA 2JF6A 3SJNA 2XZ7A 1UKSA 4LUJA 3G24A 4UQBA 1PIFA 3V35A 3P7YA 1E3XA 1K6AA 1TVNA 3U5UA 2XSBA 1IXPA 2PE4A 3CV2A 4MB3A 4AQLA 2J7BA 2WCSA 5D04C 1S5VA 1DJGA 4U31A 4O1DA 3CL8A 4C6EA 1HG3A 1XS2A 3OVGA 4MZ8A 5G4WA 3QN3A 3BAXA 3SRKA 3VIFA 3W75A 3TYUA 4F2UA 4FR1A 3O0KA 4KWUA 2OR2A 3O05A 3GH5A 1J4EA 3KOXA 5DMMA 3ZLGA 4GFSA 2VR4A 4JIRA 1L8NA 5H8PA 2BXVA 2NQJA 2XHYA 2CZEA 3WDRA 4HZ7A 3F1QA 1XIBA 2QCLA 2CEQA 4DBDA 3FOKA 2J7CA 1ISWA 2NV2A 3CHEA 4DYEA 3VE7A 4MY9A 3GR7A 3NGFA 1R7AA 4MUPA 1KTBA 1P0EA 2ZCGA 4AXKA 9XIMA 4GIRA 3PJXA 4IMAA 3H2EA 3FA5A 1TR9A 2DVXA 5HANA 3TONA 4PRTA 3TYAA 5FJRA 1H49A 4KF1A 4CD6A 2QUVA 1ZP4A 4HCHA 1ADSA 3E2QA 4Y9NA 4RJEA 1KD0A 4LANA 1YMYA 2Q71A 1JRCA 4XUGA 3S0CA 3RX3A 5C55A 3HQOA 3PZOA 7ODCA 2QT3A 2WJZA 1AQFA 4UFLA 1MNZA 1LZOA 3GXTA 1ISZA 1OFPA 1FP9A 2HEJA 1VZWA 1YXYA 4DXKA 2IKIA 4MJ2A 3LPOA 5DEZA 3I6EA 1HP4A 3A21A 1F4HA 2D2OA 2ZA2A 4S2CA 1MFVA 4QDPA 3IANA 3AC0A 3UYCA 5J5RA 4H7ZA 3QPZA 4UOQA 2JBMA 1DJIA 1S2CA 3N73A 5EMJA 1UZHA 1V3IA 2YW4A 1XC4A 4MB1A 2IXUA 3TVAA 4XBKA 4J4KA 1REQA 4FOJA 3EA3A 2VI0A 2YR1A 2Y5SA 1Z3NA 5LKYA 2C1GA 1MEIA 2PDUA 2V3GA 2BFGA 2PWFA 4BF5A 3CB3A 4OT7A 1TR1A 1RR2A 5HUPA 3N14A 3D0CA 2EF9A 3NQBA 1VLWA 1FA2A 2B31A 3K1GA 2NWRA 1EJXC 1YNPA 3SQMA 1HJVA 1TPWA 7ENLA 1E5NA 3E2RA 5AC7A 1D8WA 2FHCA 3SQSA 2WZEA 4R3UA 3A4WA 1J9YA 4GC4A 4P5UA 1YDOA 3VDCA 3B9NA 1V6YA 1XR2A 3CZEA 3VOHA 1AD4A 3DGRA 1T41A 4OUIA 4DI8A 3HG3A 3NNTA 1CBGA 5L9FA 1CYGA 2DW6A 4H41A 1G94A 4GIAA 4EF8A 7XIMA 3NQCA 3LHVA 4KFPA 1U1JA 1F5ZA 3WH8A 3OA5A 3SIZA 3N4FA 2ISSA 2QHAA 3SCSA 1E6XM 5KEZA 3FHQA 2XH7A 3T1GA 4YYFA 1JRBA 4IQLA 3IVSA 3PPHA 2G4FA 4EANA 3GDLA 5I78A 3W2MA 3RG6A 4NF7A 3T78A 3VDAA 3M47A 5HJXA 3TCEA 5FESA 2PCEA 4J7RA 1J0JA 3FEMA 3MO4A 3G1HA 2EKGA 1A5SA 5FF0A 1RJRA 4A6GA 3PZTA 1OT2A 3B8SA 4JIIX 3SUUA 5DMLA 2BBFA 1DIDA 3MSRA 4V1YA 3QC3A 3LCGA 3O6DA 4KEVA 5C9WA 1YQ2A 4GQ0A 3H2CA 1IEWA 2ISWA 1EJSC 3FJ4A 5EB8A 3LY0A 1T8QA 1TE1A 4AG0A 2WVSA 1PE1A 4JKLA 1MUMA 2XIJA 4Z1BA 2OZ3A 4U4MA 2P8BA 4LF2A 1I6NA 4L6HA 2A79A 1JF5A 2ZIDA 3QQ0A 3E5BA 1FXPA 3N15A 1JD9A 2ESCA 4PBFA 5BU9A 4H9VA 1V03A 2NUXA 4HJFA 1BLIA 1RPKA 4OBTA 3Q58A 4QP0A 3G0SA 1TTPA 4UTMA 4Z17A 4UWMA 1IF2A 4F0SA 2Z1WA 4P7RA 1VHNA 3K2GA 1GTEA 3AIQA 4S2BA 3EDJA 4ZL1A 3STPA 2F7FA 3VX0A 1TPEA 1RXOB 1ODZA 4A2RA 3T07A 1TFVA 3CQKA 4CUCA 3EMQA 3WQ8A 3UVAA 1RP8A 1ITCA 3UPMA 3GHRA 2QVHA 2WHMA 3GBEA 3L0GA 1LWJA 1Y8BA 3AHZA 5AVNA 4GC3A 3WMCA 4A8RA 2O4MA 1NFBA 3RJYA 1PB0A 1ZCCA 5HQEA 2HMCA 1S5MA 1S1PA 2NUWA 1V6WA 2BOFX 4AD4A 1ICPA 3CTTA 2DIEA 1SMAA 3C4UA 4GYPA 1GYMA 2V68A 4NT0A 1DVJA 1PVNA 3KVMA 3GVGA 3TR2A 1R5YA 2J24A 1TG7A 3KTSA 4CCZA 4UQCA 2HBXA 3EB2A 3A22A 1HKWA 2XH2A 1FWCC 4A3HA 3PANA 4HK7A 3GG1A 3UZZA 1Q7MA 5EU9A 5HR7A 4W8AA 2OO6A 1R9YA 3NIYA 4YTUA 3Q4DA 3RILA 4ZQCA 2O9RA 3RAOA 3O63A 3WJZA 1AJZA 1RLDA 3KDOA 4IHCA 4MNMA 1B1YA 4HSHA 4DJED 4D6GA 4UNLA 3PUEA 3TZNA 4JTFA 4JS3A 4LGXA 3AHXA 5DELA 1F3XA 1XIMA 2FB2A 2ZRZA 3TX9A 2QZRA 1W56A 1M3UA 1PDYA 1TUFA 5JBEA 1VP5A 2Z00A 4A3QA 1F07A 1MW3A 4AYSA 2FVKA 3RX4A 1MUCA 1QJWA 2GJPA 1CGUA 1WXYA 3H23A 1KB3A 1LQ0A 4H2CA 2Z1SA 1Q6DA 1PWLA 1TPB1 1V3HA 1E4MM 1LT7A 2PLCA 1WPCA 2J77A 4E3TA 4R9OA 3LERA 3QC0A 1JCTA 1MEWA 4FXFA 3GNRA 2V82A 4EKJA 3IIXA 4WX2A 1HGWA 1HXJA 5JUVA 2NQ5A 1MW0A 5JH1A 3R10A 3B06A 4TTUA 3LHYA 4H9MA 1P1XA 4D72A 4C6OA 4ENLA 3HV9A 4XO7A 1F6PA 1LBFA 4X0NA 3WH6A 3MCOA 4DVOA 4X9YA 2QDDA 3CYVA 1UG6A 1Z9AA 2BY3A 2DT2A 4WZHA 4I5XA 3EKLA 3S42A 2E5CA 5DCEA 2ZXBA 4B4FA 3ZSTA 2PDKA 4XAYA 5ENLA 3S5SA 3LSCA 3N9SA 4JKKA 4KQNA 2J8FA 4J2MA 1ONWA 1JI1A 1A5BA 1OZMA 1Q2RA 4J3VA 4LYQA 3GM8A 4IIFA 4E2DA 8A3HA 3AZSA 2P50A 4E6MA 1B3YA 2Y4SA 1K9EA 3KRZA 4LC6A 3CK5A 2FB3A 4IT1A 4C6QA 3BOLA 4PUDA 3N9KA 1QPOA 1NQKA 1CB7B 1DL3A 1UHVA 4REQA 4JTJA 2Z2AA 5BROA 4P8WA 3W23A 3QOMA 3DBNA 3D3FA 2VCBA 1I2OA 2Q02A 2INFA 3CO4A 1AA1B 3OU8A 2DZVA 3WQ6A 2XFYA 4A8NA 3AXHA 3LN3A 2GVJA 3GUWA 3EZ4A 3FYYA 2E9LA 2F61A 3WNOA 1LRTA 5A6TC 1L6YA 3PZNA 3L5AA 3N11A 1GQLA 1KBKA 2J7EA 1NOFA 2C91A 3BAJA 2UZ9A 3U4AA 3RU6A 3I4EA 4GNVA 2P5NA 1QI4A 2D73A 1VBGA 3KBMA 2VOTA 5A6AA 4PH6A 2VWTA 3CLMA 3N3MA 1AVAA 3H54A 4MFDA 3WH9A 4Q6XA 4YTSA 4RZ4A 2AL2B 4C6LA 3K8MA 3UR2A 4Z2GA 5A5WA 1QPNA 4DUOA 3PUOA 1ZJIA 3SCTA 3VKCA 5PTDA 4BEUA 4G5DA 3NFUA 3L4ZA 2DZSA 3PTDA 1TIWA 2OEKA 3O06A 1BGGA 2GGIA 2PDPA 1GKPA 3GNXA 1FKXA 1HNYA 3E0WA 4IPPA 4PTVA 3UJ2A 4BQ2A 4IPNB 1C9DA 3CUZA 2IPGA 2PTDA 2JK2A 1J0HA 1XQLA 4HT3A 4AWTA 4ZVJA 4MOZA 4PBEA 4UTIA 1Y65A 1R9XA 3AHVA 2ZRUA 1P0DA 3VUSA 2GSJA 4N9CA 5ABHA 1DXIA 4WVXA 1GNXA 2VGGA 5A6MA 3BG5A 1R3TA 3DHFA 1BYBA 2OKOA 4JFWA 3IAPA 1EHNA 3LHUA 5CPMA 1TPH1 2X09A 4RCXA 3GDKA 3LMYA 2Y8UA 1JXKA 1XSJA 3GXIA 3DIPA 1P6BA 2PCQA 5G2HA 2XSXA 3TOYA 1G67A 3NXLA 1OC6A 3WL1A 4I90A 2I5GA 1EJWC 1KRMA 4L9ZA 4GUIA 3N04A 1HO4A 4P61A 5AOUA 2ACRA 3N34A 4LFYA 3O6AA 2XIIA 4DJFC 3SZ8A 4HA0A 2VZTA 4FEZA 2ACSA 3R58A 1VYSX 3ZVHA 1FWHC 3E38A 1XUZA 3WK3A 2FPYA 3UY8A 3O1NA 2QJIA 4C6CA 3WENA 2XG9A 1CLKA 3PWGA 2X1RA 4Z1AA 2POZA 2VDGA 4Z1DA 5C9RA 2C1HA 4JOMA 5D33A 4B9ZA 3IUDA 3RLHA 4R7WA 2YDRA 2OZTA 1X6LA 2IKGA 4O19A 1EGZA 1QMLA 4I9MA 4FR6A 2A7RA 3LHZA 2DJXA 4C6DA 5F2GA 2QUMA 3PBVA 4QE5A 1SZEA 1EL3A 1XH2A 2NX3A 4WJEA 3IAQA 4ZB2A 2YFNA 3CMGA 2QYGA 3BGAA 4K3ZA 4QNEA 5IDIA 3RPTA 3WDQA 5KTLA 4UXDA 3OQ8A 1BWLA 2INEA 4F9JA 2RHGA 1B9ZA 1K3UA 4M51A 4KEUA 1GORA 3L67A 2F2HA 4ACZB 4GI4A 4YLWA 3UG5A 3L2IA 1CIUA 4GO8A 4CVUA 4JFSA 3G18A 1JG9A 5F4WA 4R7JA 1UBSA 4L9XA 4JKMA 2W4XA 4Q22A 3OQEA 3UXKA 2WZTA 1UZ4A 3DH7A 4JQ1A 2JKAA 5T91A 3UERA 1Q7QA 1P0KA 3AHYA 1UWRA 2ZUVA 4FPSA 4JTEA 2ZADA 4G56A 1RBAA 2NVCA 4L56A 3VPLA 3GTNA 2OLAA 1CGXA 3DZ1A 2XFFA 1UWTA 1U1UA 1SZRA 2E6AA 1D3GA 1OFOA 2YA2A 4W87A 3TOPA 5CH9A 3W84A 1E6SM 3A9BA 2PDYA 1CDGA 1PL9A 2BV9A 1I0BA 1FWEC 4F0HA 4GI9A 4W7UA 3N2TA 4LAKA 5MKGB 4MIMA 3TE9A 2V9DA 3F5JA 1W0MA 1PTAA 4HBKA 4MAVA 1VRDA 4OQVA 4IMCA 4G1NA 4WCJA 3STEA 3S2CA 2OSWA 2DU2A 3IJ7A 4U5KA 3GIPA 3T8QA 4LS1A 3IARA 1EA0A 3GDRA 4LNCA 3STGA 3MYOA 7REQB 1SPQA 4B5WA 1XWYA 1XX1A 1B31A 2WNWA 3WYZA 1IWAA 1E6PA 3CZJA 3R11A 2X1SA 4Y90A 1MYRA 2AAMA 3DECA 2Z29A 2BGQA 4RNFA 4UFIA 1TMLA 5MHBA 4S38A 3UWVA 2V2CA 4OZOA 4Y8FA 4NP7A 3VILA 1TVLA 1V02A 4QLKA 7A3HA 3ARWA 4IGNA 1BTCA 3MHUA 2YCEA 5CC6A 1E1FA 3RPMA 1EP3A 1Q85A 3LCXA 2V69A 2VDHA 2FTWA 3B9EA 2AMGA 1SZGA 3WNPA 3QY6A 4TMCA 1UD5A 5C9XA 1EPVA 2YYUA 5LIKX 3T4WA 5DF0A 5CJNA 2YCKX 2ZYFA 1D3CA 4KEMA 2RGLA 4MGGA 4ASTA 3RITA 4D71A 1PSCA 2VEKA 1SUXA 3QY7A 1SVDA 1VC4A 4C6IA 1Q6LA 4XKMA 1KGUA 1EUAA 3B97A 5GJMA 1EWEA 1JI2A 4BF9A 4I5UA 3N1AA 4AVFA 4K1WA 1OM0A 3AYVA 5FA5A 3KXQA 4KT2A 1A80A 3GIYA 1LL7A 2PDHA 2PTZA 3TJXA 1VFTA 1JCJA 3LM3A 3WLKX 3I65A 2VFEA 1E73M 3UP8A 3WJXA 3KW3A 3W7KA 1VENA 3TAOA 1ZBKA 1ZPTA 1D7KA 2PWVA 1Q3NA 1H11A 1KBIA 4MYXA 3VIIA 2YPIA 4QDWA 2J7HA 4HVXA 1GPFA 5E0CA 1W9VA 3SCVA 3URAA 2FIQA 3WNMA 3LTPA 1QNVA 1X6UA 3WX7A 3ALFA 4URIA 1IEQA 4O12A 1YYAA 4GUJA 4UTJA 5GQBA 3WBAA 1J6PA 4B5SA 1ZNNA 3POHA 1XV8A 1QO2A 1K8YA 1CGVA 3I3EA 4DNMA 4O1EA 4E2BA 1JZ8A 2QV4A 3GB6A 3BW3A 4AWUA 3TSDA 3ONCA 3ARTA 1NARA 3IACA 5BRPA 4S3FA 1JNEA 3HPAA 1IXOA 3KL0A 2H8XA 4C6BA 2HPMA 1UH4A 4FS9A 2AQOA 1V3JA 1XRSA 4XD6A 4BI5A 1VLIA 1Y0EA 3TN6A 5HPCA 1GT8A 4YPJA 1U83A 4QM1A 2BXZA 3S1UA 1HJXA 4HNLA 2NQ9A 2X7WA 1RK5A 3O3RA 1OINA 5JVLA 3VIGA 3WDIA 1SM9A 4UTHA 3B4UA 1TV8A 3ELFA 1A3XA 3UZWA 3BLPX 1H41A 1NIUA 1Y5XA 3WD4A 3ZJ6A 4C7DA 5G2IA 4Z0SA 1ZALA 3OZPA 1DPMA 2BS9A 2CKSA 5HWMA 3BOXA 5JH2A 2CZDA 1F4AA 4FXRA 1XM3A 1XC6A 4AZGA 1ZBWA 4KESA 5KZDA 4PA8A 1DTUA 2QMJA 1E56A 2FDMA 5D2YA 1I75A 4MZYA 2ZC8A 3FN9A 5HQMA 2NVAA 4LB4A 5C2GA 4L64A 1B9BA 5FJTA 4PMUA 4JFUA 1LUCA 1K9FA 4PTXA 2H9AB 3R5EA 1Q6GA 3ARUA 4GY1A 1YLVA 1TWDA 3PG8A 1ZCOA 4ICMA 1KBLA 5GVJA 1OGSA 3M0HA 3DKLA 4DJDA 2HCVA 2QPXA 3ARQA 3K8KA 4H6RA 3QFWA 2E77A 3CQJA 3HPXA 3EOOA 4OOUA 2IXVA 2VENA 3PBGA 4H6KA 4PGLA 3P8IA 4PB3A 2PDMA 1V0NA 3MMWA 3QXBA 1YEYA 2VEIA 3VGHA 4GBUA 2NV1A 4ZENA 1MMFA 2VT0A 4MDOA 3W71A 2GOKA 2HS6A 1W5PA 2CBJA 1W3TA 3SEPA 3BMXA 5CQ1A 5HA7A 4S1FA 4JQ3A 2OLSA 4AYGA 3LGGA 5I07A 2FZ9A 4MF4A 1XHGA 3P82A 3T08A 3NL6A 1M01A 2G3NA 2NQHA 4UCGA 2QGYA 1VCVA 5CSYA 3GH7A 4XZHA 3CPGA 1GGOA 1Z32X 4Y7EA 4LCSA 3C0SA 3CPRA 3OZOA 3VC5A 4PMQA 4KRUA 1L2QA 1DJZA 1SJAA 4ERIA 1XGDA 4D6JA 2Z6IA 2Z1KA 2A3AA 5C9UA 2H6RA 4IX0A 5I3FA 2GL5A 5DBTA 3WQOA 4CNOA 1MSSA 4A3YA 5BOOA 1LLOA 3BJTA 4V2XA 5A6BD 1H50A 1OT1A 2NXGA 4Q8PA 4C5ZA 5DRIA 4H6QA 4DO5A 3BMWA 1O7AA 2A6LA 1XCWA 3VGBA 4ZQNA 2FHBA 2X7VA 4RXGA 1FCUA 2OSXA 1QCWA 1WNOA 1LM1A 1W37A 4JD4A 1M7OA 5K3VA 2DV0A 1W2VA 3EB3A 3ITTA 2JKPA 1TYGA 1TV3A 4JQ2A 1JJKA 3AQUA 2PBOA 1ADDA 2D23A 4ZEPA 3E2SA 4M56A 4J35A 4ORMA 1ZENA 4JCLA 4KWSA 3KBWA 3VDHA 3BJFA 1HF6A 1OFBA 3DFSA 3R8GA 4C1NB 5CAKA 1F9CA 1SJDA 2GK1B 2OQYA 5HNTA 3PB2A 5FF3A 2QLYA 4R85A 4FO4A 1P0NA 1H60A 3OW1A 2P10A 4GQBA 4JZ5A 1E15A 3VNMA 2PGEA 1C7TA 4XZ9A 1RK6A 4RV3A 3VAVA 1K9TA 2R1NA 4B5VA 1RD5A 1LLZA 1PIIA 4IX2A 3T8LA 2Z2BA 3MKKA 1VF8A 1ONXA 1DHPA 4PRWA 3U2CA 3AXMA 4HSOA 3T44A 2WJDA 4OECA 3LD5A 3KRSA 1K4GA 4GISA 3CYJA 1CXFA 4EXQA 2EGZA 1XW8A 2R1MA 1VCGA 3W7IA 4HA3A 3D47A 5HMEA 1G01A 5CEWA 4FF7A 3B8UA 4US5A 1W1A1 3PBWA 3FCPA 1FWJC 3PR2A 3M0YA 2XDFA 5ABGA 5M1TA 5AC8A 1L8PA 3V1HA 4MWAD 2ZZ3A 1A5KC 1BF6A 3MUXA 2E5BA 4WGHA 1DOSA 1ODUA 3FSUA 3GE7A 4WY0F 3ABQA 2Z4GA 1G4EA 3W1LA 1UD2A 3VZXA 1NU5A 4W86A 1OY0A 1XLCA 3W88A 1VS1A 1LOSA 2IQ0A 3E49A 2VZVA 3TR9A 4DWSD 5FF2A 3BV7A 2KX9A 4XAFA 2H3BA 3CL6A 2QJHA 5BRBA 3E3HA 3FV9A 1RAKA 4FB7A 1DBTA 4MHBA 3CQHA 3VKKA 3EMCA 2Y88A 1A0DA 4FI4A 4IICA 3AIVA 1OADA 3L4UA 1XYFA 2HDJA 1RPXA 2F38A 4RW3A 3E0VA 1VIWA 3TC7A 2J74A 4UFJA 1FX6A 3FHAA 5LA2A 5A8PA 4M3PA 4FLQA 5LHEA 3ONBA 3AS3A 3HQNA 4NZCA 1KWKA 2JEPA 1UKTA 1IZJA 4G7FA 1E1CB 2BHUA 4W93A 1ZJHA 1R3WA 2GVGA 1GYNA 3N6JA 3SECA 3HURA 4M80A 2JIEA 4JTCA 3RLGA 4JQAA 1UP3A 3WK0A 4IFOA 2A1YA 2A5HA 5EMKA 3WQDA 1KFWA 4DYKA 2XH4A 3ITLA 3R4IA 3NSXA 2I14A 4N6EA 1TZ9A 2FPVA 1XRFA 2VTFA 5AN7A 1SW0A 4C6FA 3HPZA 2RDTA 2V0TA 3W29A 4PODA 3EGJA 4Q4RA 4GI8A 4ZE5A 3EX4A 3S83A 1IR1A 3ZM8A 1PDZA 3LM7A 5FACA 4YWIA 2P1FA 3P62A 4NVTA 1SFLA 2YXOA 4K8GA 1J12A 3M0VA 4K38A 4YYCA 1FWSA 4IG2B 4HJWA 2WLYA 4H9UA 1XCXA 5IDZA 4TQTA 5A95A 2FYMA 1H3GA 1AH3A 3PJTA 3GU1A 2A0NA 4GRSA 3C5QA 4F48A 1UWQA 1PHQA 2VELA 1CXHA 2W91A 4M8UA 3SUVA 2YCLB 1Z44A 1WZKA 4I9JA 3DC0A 4PCFA 1GOKA 3WQCA 4TO8A 1TPC1 5DT7A 3PUGA 4DLFA 4HU4A 1FWFC 3W02A 2DQXA 1V5XA 4W89A 1ZGDA 4WSKA 5DBUA 2VJXA 4HGXA 2ACUA 1CWYA 3SUSA 3N6HA 3TQKA 1R9ZA 3TQPA 1EZWA 2J6XA 3WEMA 3ID7A 3N17A 1PKMA 3DUGA 1AW5A 2O92A 2VL4A 4K7YA 1PO9A 4FALA 4O50A 4GH1A 4RUBA 2YXGA 1VKFA 3EXTA 1FWTA 2DUZA 4L6DA 1HN1A 3W28A 3T7VA 3SB0A 1DHKA 3U3HA 2KAUC 3SO7A 3QGKC 1O6IA 3T42A 3LA4A 3M7SA 3E0IA 4GQGA 2ZWZA 4N9DA 2ZKMX 3VGEA 3NUKA 3T05A 5DO8A 4ML4A 3CT7A 3VVGA 1WDRA 1BXBA 3AXKA 4E8GA 3VFLA 2XVNA 1JCYA 2B0MA 1N2VA 4IIEA 4N6FA 1QI3A 2IW0A 3AZTA 3ES7A 4AX7A 1TELA 1QOPA 1E0UA 5A6SA 1OK4A 1JCMP 1PX8A 3W6MA 1EP2A 2CLEA 2OWXA 3NCOA 3TP4A 1V7AA 2WSPA 4ZOBA 2VZOA 4CQBA 3AALA 1VFLA 3HJZA 5HATA 4MWAB 3KTXA 1JF6A 1K8CA 4HPJA 1IQ8A 3W86A 1IWPA 5EPDA 2VGIA 4GXWA 1QHOA 2ZA3A 4N9BA 2C8NA 4FNQA 4LC8A 4HTBA 4I8DA 1V77A 4H1ZA 4PUMA 3R8RA 5F4SA 1TMHA 4DWSB 5LGZA 2PP1A 3WFLA 2VFGA 5E1QA 5REQB 4B3ZA 4HCDA 1FQ0A 2GOUA 2BOGX 2YZ5A 2YL5A 4ZO6A 3WQ4A 1KFCA 3QZEA 4JXCA 2R1KA 3LLDA 1B3OA 4QS6A 3LDVA 3CEPA 3T4CA 3KL5A 2OZ0A 3CUFA 1EA9C 1BHGA 2J8TA 1FDZA 5IOBA 4QSFA 1OG6A 1G4TA 2TYSA 1BFNA 3QVQA 4G7EB 3TYZA 1CI1A 3LBMA 4ZQRA 4TV6A 1AUSL 3UPWA 2D69A 3WF1A 4BWLC 5JMUA 4AXNA 3T0BA 1XFCA 1QO5A 1JUEA 1LWHA 4NRRA 1J10A 1AMYA 5HMFA 1Q7ZA 5AB3A 3E02A 4MADA 3ITOA 2GVEA 1RH9A 2BXYA 5U4NA 3SCNA 3AIWA 4B5XA 3CS2A 4DX3A 1LOQA 4F9DA 3SURA 2BHYA 1W9XA 4ZBCA 4CD7A 4DJEA 1SFJA 3CV6A 2OSYA 1AFSA 3LRMA 1W5QA 2H8ZA 2WVVB 4M7SA 4AZ5A 5LNSA 5BXTA 2X2YA 2GGEA 2Y7FA 1EDQA 1L2UA 4W7VA 3WMLA 3CJPA 1Z42A 5BOEA 3IUHA 2WMHA 3TUUA 3E6EA 3EYPA 4IIDA 5D8WA 2YGYA 2VC7A 3LCHA 4FLRA 1JEZA 1KM6A 4LQ1A 3TXVA 4WF7A 2YBUA 3W37A 4M19A 3BAKA 4DJDC 3BLKA 1GVOA 1IR2A 1C8YA 1W5NA 4H7VA 4UFKA 3S2MA 3EWUA 1SJBA 4ZOAA 4XZIA 1HJUA 2DSZA 4HMCA 1XBVA 3I3DA 3FEQA 3W7LA 3CPUA 4AHQA 2WMKA 1PS9A 3GVWA 3Q37A 2QCFA 3GFXA 4BEQA 2YA1A 2J4GA 2FLIA 3A6OA 5AHNA 3PFMA 4F0RA 1UCWA 1WP6A 5D2WA 2DY3A 1Q5MA 3DG6A 5KETA 2ZOXA 2QEZA 3EWXA 2ZZ1A 1ZAHA 1SQ7A 1KTCA 3ORWA 1BGAA 5I5RA 1YHTA 4P8UA 1LROA 5CZ0A 3F4VA 2PDQA 4DPQA 2OMAA 2RDWA 3NWRA 4O57A 2WMIA 1WZAA 1Z7AA 3VCNA 3EMZA 4KRTA 1DJWA 2CPUA 4C1LA 2Y7GA 4ZXOA 2GVLA 3QGAC 1GHRA 4B90A 1A4LA 1Z48A 1ZBVA 3PG9A 2E5DA 3ITVA 4FLSA 3VCCA 1CECA 5GJNA 3UWQA 4QX4A 2CNCA 2OKTA 3WLHA 1ME9A 3KHJA 1UIOA 1UASA 2PF8A 4A3UA 1N55A 3EOLA 4HCLA 2BTMA 4AZ7A 3LCWA 3F03K 3EWZA 1ZBCA 2ZUTA 4MNKA 4E0CA 4LEQA 2CZFA 4NNCA 4JGDA 3OLDA 3BURA 3NYZA 1DV7A 1XLJA 1UPPA 3AJXA 1Y5WA 2QUTA 1Q65A 2FZMA 4RZBA 4EWND 2VM8A 4KCWA 1EHAA 3BGGA 4NILA 3TN3A 3FVDA 3GY1A 5F2LA 3SCPA 4NI8A 1W1TA 1RCOB 3RGTA 1UJQA 8TIMA 3IJDA 3VA8A 3V18A 3F4NA 2HRWA 2JE8A 4G6CA 2QXWA 1H1YA 3M0LA 4GJ1A 3VOCA 4Y9AA 3OJGA 3S1XA 1KQYA 1WCGA 4OOZA 4JAWA 4LAZA 4RNHA 2GDVA 2J8GA 3IUIA 1GW9A 5CXPA 4AIOA 3QLLA 5DMNA 1E4IA 4O0ZA 2J6VA 4KFOA 2FPTA 3HM7A 2NX1A 4QG8A 3GTXA 4XX6A 3I6RA 5BMWA 2PFHA 3WLOA 1KGWA 1R3RA 1WV2A 3R89A 1L6WA 1HW6A 5FAGA 3QSTA 5G1YA 1XDJA 3QR1A 5I02A 3MSYA 2WZMA 2EG7A 3HGOA 3WF0A 4O1AA 5MKGA 4GKLA 3NQFA 2ZZ2A 2IPWA 3EA2A 3LTYA 3APYA 3STFA