4H6KA

W116i mutant of oye1
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase 1
total genus 155
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4h6kA00
3KHJA 4JYDA 1J5TA 2E6YA 3NQDA 1O5KA 3HQ1A 1IXNA 1UUOA 3PF3A 1BWKA 2V2HA 3O07A 4NT0A 3C2EA 4EWND 2YW4A 2E5CA 5F4SA 4O52A 1J4EA 1KM2A 2A85A 1TTPA 3L9CA 1R2RA 5K4ZA 3PUDA 3NOEA 3TDFA 1YDVA 4A2RA 1VH7A 3M7WA 1JVNA 1JRCA 4UXDA 4R53A 3UWUA 3C2FA 3E0IA 2ZA1A 2NV2A 2V0TA 2CLOA 4DBEA 4WD0A 3MP5A 3W7NA 5H2ZA 5D2WA 1SSDA 1YYAA 1VLIA 2H8XA 4UFHA 1LTDA 1A5BA 4IPIA 5LKYA 1OHLA 5FF4A 2P10A 2ZRWA 3TW7A 2HS8A 1AW2A 1OYCA 2E1DA 1RVGA 3WJZA 3WJXA 1L2UA 3LHZA 3QYQA 4JNMA 3B06A 4O13A 3P5YA 4JTLA 3DFPA 3NZRA 3S5ZA 3UWYA 3L66A 3T7VA 2Y70A 3TSBA 4M7TA 1P1XA 5TBOA 5EL1A 1SO4A 1W0MA 1YXCA 2PURA 2DORA 1O95A 4DF0A 2ISWA 2UV8G 1MEWA 3MUXA 3QF0A 2ATMA 3EEGA 1C8VA 4QQ3A 4POCA 5D05A 3W7OA 3MBFA 4LV4A 4UTWC 1OFDA 3EX2A 1YPFA 4KFNA 2QCMA 1SZNA 4UC5A 1ZENA 4AAJA 1WAUA 3M43A 1VQTA 1GZGA 4G1KA 4WXYA 2NWRA 5HWJA 4LY8A 3FJLA 5D38A 1M5WA 1TV8A 1QPNA 3P74A 3W23A 4LUIA 3GB6A 3SI9A 1G4EA 5LNWA 1SW0A 1YTDA 4N9EA 1QNVA 3W86A 1ZAJA 4DPQA 4NU7A 3S1VA 4FX6M 3UWVA 4YCOA 2VKZG 3R5EA 2J6XA 1W31A 1RQEA 4DELA 4BWLA 3GVGA 3F03K 3PULA 1KTNA 2E09A 1GTEA 3UWWA 2D73A 3TQ0A 2GJLA 3EXSA 3EXRA 1XXXA 4K8HA 4Y90A 5KMYA 3NL6A 4K38A 3UNDA 1W8SA 2Z0IA 4X2RA 1TPEA 4KWWA 3PAJA 4HT3A 3T4CA 4UFKA 5AYXA 2RDUA 4FIQA 1VCGA 2ZZ3A 5KZEA 3ZWTA 1LOQA 3KRSA 4UTIA 3PSVA 1WV2A 3G1DA 3ELFA 3W1RA 5I3FA 5CGQA 4W9TA 4WOZA 3W7LA 3W9ZA 1EEPA 5MHBA 2B7QA 3TA6A 1FCBA 1RZMA 2E5DA 4JDYA 3LLDA 1HL2A 2FPVA 4HPXA 1K8ZA 5D03A 3NNTA 4NNCA 4IQLA 5AHFA 2Y7EA 1ZAHA 1WOBA 4UFJA 2V30A 1OK4A 2VEPA 4IMEA 5KZMA 3UXAA 3CEUA 3W1UA 1CW2A 2NXIA 4ADSA 3DFOA 3OHIA 4N02A 2DZWA 2NUYA 4LS2A 4AHQA 2QCCA 4ZQMA 1I8JA 4JY8A 3LCXA 1Y0EA 1TTQA 3LCFA 1XUZA 4X3ZA 4UTTA 3BGJA 3CWNA 4DPPA 1D3HA 3M44A 4UMCA 5HWNA 1T0OA 1LCOA 1H7XA 3TXZA 5D2XA 4MLRA 3W84A 5AC6A 3QSRA 2JGYA 4LWWA 2ISVA 2WKJA 1LBFA 2GJNA 2ZRUA 3DKJA 3BV4A 1LDCA 5KTLA 1H7OA 3G1VA 5G2HA 2NXGA 1GYLA 3WK2A 3G24A 3S9YA 1N7KA 3W7JA 5HWMA 4UTUA 3PB2A 3LCGA 3PB0A 1F6KA 3KVJA 3GNNA 3M6YA 5DN1A 1FXQA 3P7YA 1OFRA 3ABRA 2VOMA 3GYEA 3LBCA 1A5AA 1RR2A 5C5YA 3LHUA 1XDLA 4Z1AA 1G4TA 2CLEA 3HB9A 3NGJA 4FHAA 2QCFA 1WYIA 1WA3A 3GR8A 3BARA 1H7NA 2QUVA 5BMWA 3INPA 2WV8A 1NF0A 3N3MA 1PV8A 4QSHA 3G0UA 3E9AA 3HIJA 4Y96A 1GQNA 3MHGA 3M5VA 2Y7DA 2PC4A 3OBKA 4LVDA 4AWUA 3NPWA 4IUOA 4O28A 1XBYA 3EX6A 1X1OA 2VEKA 2V2CA 5D2TA 3W7EA 4R7JA 3KVMA 1TCDA 1PHQA 3P84A 4RCXA 2PRHA 1TMHA 1C29A 2C16A 4O1AA 1LLZA 3P82A 1TJPA 5F1VA 3THAA 3TUUA 1JQXA 2V5LA 2QCGA 5U7SA 1JCNA 3KVKA 1SPQA 1XL9A 3W7PA 4ALDA 1JCXA 5CZ0A 1TPWA 1XBXA 4IXXA 4JTGA 4N4QA 4K8EA 1SW7A 2F7FA 1LBMA 3LTPA 1MXSA 4UR8A 3QJAA 2CLFA 4J9JA 4GUFA 3N34A 5G4WA 4AWSA 2DZUA 3UWQA 5IBXC 4CLMA 2ZZ2A 4ZMGA 3B0PA 3C61A 3PBVA 1ME8A 2OX1A 3MHFA 2GQ8A 2HS6A 5HUPA 2NZLA 4ORIA 5DCBA 4ADTA 2ABAA 3B05A 1B3OA 1JUKA 3NPUA 1RQBA 2GVGA 1I4NA 4UFMA 2XN2A 2WNZA 3PG8A 2RHGA 2YGYA 4ZL1A 2EPHA 4PODA 1K7FA 3QQ0A 3W1QA 2OCZA 1THFD 4O11A 3P81A 3JRKA 4DEFA 4P61A 3EX3A 3UZJA 2GVJA 3RF9A 1UB3A 4UUIA 3HPXA 2R94A 1YPIA 1DBTA 5LNVA 2G97A 2FB3A 1QO2A 3B04A 2A1YA 3TXVA 1GYNA 4LU0A 1XFBA 1JCYA 2YX0A 2R91A 3UPWA 4Z0JA 4AEOA 3FIGA 3GK0A 3DAQA 1KM5A 4KFPA 4U4MA 4WOQA 1HO1A 4RZ6A 3EX1A 2IQTA 3W1XA 2BLEA 4IJBA 2V5BA 2NLIA 4N4PA 1TV7A 3TAOA 2QUTA 4E2DA 4O14A 3M5XA 5A5WA 2OZ0A 2A6LA 3SSJA 5F4WA 5CKSA 1B4KA 1FY6A 3WJYA 1KTCA 3GAYA 5CSRA 3LV5A 2C1HA 3S8HA 2HMCA 1BEUA 3TKFA 3CIXA 1T99A 4PL1A 3PY2A 3CQ0A 1GPWA 1IIGA 2WNQA 3C2VA 4NX0A 3LB0A 3QPZA 2H3BA 5CG7A 5CZSA 3SZ8A 4GWEA 4IMCA 3GXTA 2JGQA 4O15A 1AG1O 3QMSA 3FOKA 3FYPA 3IEBA 1JCLA 3IV3A 1Z48A 3LDVA 1W54A 1FCUA 2B0MA 3LCIA 3NG3A 3IGUA 3HOJA 3G22A 1A5CA 4UFLA 4TU1A 4NX5A 3LERA 3S42A 4CNNA 5HNRA 2Y89A 5DXXA 3GX9A 5GVJA 2VFHA 3C6CA 1S5WA 1QO5A 1XUUA 4O4WA 2CLKA 3IRDA 4NZFA 2QF7A 4HSOA 2DZVA 3GDKA 1J2WA 3QZEA 5D09A 4MY8A 5DCEA 4DO4A 3M5YA 3S5NA 1W5QA 1FWTA 2Y62A 1R2SA 5AHMA 3W2NA 5K7JA 4O16A 3NVTA 4WY0B 2ISSA 3GXPA 1SFLA 2QAPA 3LLFA 4N9DA 2Q8LA 1DORA 3F4WA 1OF6A 1UASA 2V8ZA 4OV9A 1IGSA 4NXSA 3LV6A 4RZ4A 3R8RA 3W1TA 2H6RA 3GLCA 3IVTA 4JTSA 3ZS4A 1KLZA 5F2LA 2QR6A 1TPB1 4LRSA 4WZHA 3L68A 3I65A 3ATYA 3W1AA 5FEXA 1JCJA 3CT7A 3BO9A 3Q2DA 4MFEA 1LBLA 2WO5A 3PS7A 1P0NA 3O06A 2J27A 4A21A 1KFEA 1W37A 2G96A 4NJKA 3QC3A 5F4XA 3W76A 3L0NA 3H54A 2E68A 2X16A 1I2OA 4O54A 3SY5A 4FX8A 4LV9A 3OG3A 5HUOA 3GKFA 5U4NA 5CPMA 4AH7A 4X22A 1G69A 4O17A 4XWUA 3TMQA 1G7UA 3UXDA 4GUGA 4YXGA 3YPIA 4GC4A 3GXNA 3P5ZA 1KTBA 3EWYA 4Y9AA 1YADA 3QEZA 4O4VA 4AVFA 2W6RA 3DHDA 4JX6A 3W1PA 2R8WA 1WX0A 2Q8ZA 4JR5A 3R13A 3NZ1A 4JD4A 5C55A 2YXGA 1U83A 3VE9A 3KFTA 2FQIA 5I3HA 5C2XA 1LROA 3EX4A 3TCEA 4KFOA 2AQWA 3BPWA 2QEZA 1W3TA 1Q6QA 3HJZA 3ANYA 3ATZA 4PTNA 3E49A 1OX4B 2PRLA 3W22A 1S5VA 3TV8A 3A23A 3L21A 1ZCOA 3BG5A 3IGSA 2C3ZA 4JTEA 1SZEA 5LGZA 1OFAA 3GR7A 1ADOA 3V75A 3DKLA 1EPXA 2WSQA 4HHPA 3SFKA 5AC7A 4MY1A 3KXQA 4IMGA 3LHYA 4AB4A 1NEYA 3E12A 4K36A 1XBZA 1PE1A 1DQWA 1EWEA 1ONRA 4DF1A 1H7PA 2VC6A 2QJHA 1GJPA 5EBUA 4FXSA 1WBJA 5CSSA 1GVRA 4UMBA 1ICPA 4RJEA 2NWSA 5D37A 1K7EA 1DV7A 4M6QA 1F74A 3P8IA 4N9BA 2ZRZA 2QDHA 1DJQA 1TTJA 3QPYA 1O4UA 3S1XA 1VR6A 5FEWA 1KLYA 4MPQA 2CZDA 2X1SA 4HKPA 1RV8A 1TO3A 2CZFA 3GZ3A 3PR2A 2R14A 4WX2A 1P5BA 1Q6OA 4JX5A 5EYWA 1KM1A 4WUIA 1ICQA 4LS0A 1TYGA 2QCDB 4LT9A 4JGDA 2YFOA 3WK0A 2WQPA 3UQNA 5T26A 3O6DA 1OFOA 1W1ZA 3QRHA 3W71A 4HIBA 3GNDA 3LTSA 3IIPA 3MYOA 2FPTA 5F1UA 4NJGA 3VFLA 3OVQA 5FF0A 1T8XA 2QCHA 3TC6A 2QDGA 3EB2A 3T55A 5AHEA 4OU1A 3M16A 4M19A 3SR7A 3TMLA 4JX4A 4UCGA 5E0KA 4DQWA 3LM7A 4NZJA 1S3HA 1W5OA 3LRLA 4FNSA 1O60A 2C15A 3MO7A 3C0JA 7TIMA 3C52A 3C8FA 3W88A 1FXPA 2J88A 2VENA 1UCWA 4XKYA 1OABA 1QPQA 3IIOA 3NO5A 3N9SA 2RKXA 4AF0B 3SW6A 3OVPA 1IF2A 1PIIA 4O0ZA 5AHIA 2OT0A 3NL5A 5LNSA 3G8EA 4WJEA 1EIXA 3GDLA 3TNOA 4M7SA 5EKYA 4LC6A 1XBVA 2ZA3A 2HTMA 5EY5A 1IXOA 1FWRA 3QW3A 5K9CA 3FYOA 4O1BA 2ZA2A 1GVFA 5BMXA 5G4EA 2EHHA 4HSNA 3CPRA 3DH7A 3QMRA 3M0ZA 1FBAA 1XM3A 3G1XA 4M6VA 2H8ZA 4TR9A 1KFKA 1Q6LA 1F76A 3W2JA 3V1PA 4RXFA 4RR4A 5L9FA 1KFLA 3BLIA 3P80A 3HG3A 4O53A 4Z1DA 4B5NA 4XTIA 5I3KA 3BGGA 3L0GA 3GDTA 4OGZA 3B03A 1GVOA 3L2IA 4YMZA 1B57A 3HO8A 2J9ZA 1LYXA 4UFIA 2QCEA 2NUXA 3F1QA 1QMLA 5J5DA 3NAVA 5AOUA 1KM4A 2ZZ6A 5G1TA 1OYAA 4LRTA 1F5ZA 2YZRA 5TQLA 2ALDA 3L5AA 1K02A 2Q3OA 4XBSA 5D32A 2Y7GA 5AYZA 3DXIA 3M9YA 1ZJIA 4MJMA 4ZQPA 3PC0A 3KAOA 3B0VC 4M5PA 4CCDA 2Y85A 5K9XA 3W7KA 3M41A 1LRNA 4JTTA 2YCEA 3M5ZA 5CZJA 1H51A 1VZWA 5FF2A 1GT8A 3L67A 3O63A 1HUVA 4IX0A 4EF9A 2NUWA 3U8GA 2PCQA 1W5NA 1W56A 3NQAA 3EWXA 3S6DA 2XFWA 1SO3A 2GVLA 3FKKA 4RV8A 1K7XA 1C9DA 4CQ9A 1QOPA 1AK5A 2CU0A 4HPJA 2ZZ7A 5D2VA 4I7UA 3MMTA 1DJNA 4LVBA 4JYEA 5C54A 2WSRA 1K03A 3KRUA 5FEPA 3FA5A 2QCLA 1I2PA 2TMDA 4GBUA 1BWLA 5I3GA 3E02A 2V9DA 4N6EA 3EWBX 3L65A 2JKAA 3NQ8A 3BG9A 4H6KA 3P67A 2E5BA 4WY0F 5DELA 5BRBA 4O1CA 2YW3A 3MW7A 4FO4A 1VC4A 3TSMA 3R12A 1TPH1 3O8AA 1F73A 1NFBA 4E2BA 4PFMA 1MZHA 4DF2A 1H61A 5J5RA 3LCWA 4I9AA 4UNKA 4CCCA 3DHFA 3O6CA 2EF9A 4MLJA 1UBSA 1NAL1 4DXVA 3HGJA 2CFFA 1HTIA 1KBIA 1TJRA 2FLIA 2H3DA 1K8XA 3G18A 3HG2A 2DP3A 4JN6A 1X6UA 3W7GA 4FIRA 1QPOA 3LCLA 2C13A 3Q37A 4A29A 3G0SA 3IGXA 4NVTA 4N2YA 1F2JA 3N9RA 1LORA 1DL3A 2FIQA 3HGOA 4MIMA 3RMJA 2C0AA 3BW3A 4JTIA 3N14A 3TH6A 5HMSA 3FLUA 4MUZA 3IVSA 1ZY9A 1FCQA 3O16A 4EOUA 5CZTA 3AO0A 2BSLA 4NJJA 1I45A 3W7IA 3ZFHA 2I9EA 3MWAA 5KITA 4MOZA 4ADUA 3S5YA 1ME9A 1EB3A 1B4EA 1R47A 3I7RA 1IIHA 1TSIA 3PUOA 4BFAA 4XUGA 2WJZA 4RLIA 3NQMA 1TQJA 3T44A 1SZGA 2Y63A 2ZZ4A 3UD6A 5LHFA 4QM1A 2RH9A 4IXHA 3D0CA 4L4LA 4BR1A 2RDWA 4LS1A 4XZ9A 2ZTKA 3NQ7A 4O0KA 1WOAA 3O05A 5BW6A 2A5HA 2GQ9A 6ALDA 3S1UA 4U28A 1VGAA 1MO0A 3W83A 3DFTA 1FUYA 2WPBA 1YDOA 1XC4A 3VKJA 4JY9A 4LTSA 4JTFA 1ALDA 1ZFJA 4NNAA 5LSMA 4N9CA 5E93A 1TPC1 3O1NA 4O1DA 1VHCA 3LCHA 4OE7A 2VFIA 2ZZ1A 4EVZA 5LZLA 2BWGA 2FTPA 3HG5A 5LNRA 5TIMA 4UTLA 1YXYA 3G1YA 2A6NA 2W0UA 4RXGA 3DI1A 1FWNA 2V2DA 3SECA 4E38A 2ZFAA 1F7BA 1H60A 2A7PA 1JULA 1OFPA 3RLUA 4EIVA 5IBXA 1LLWA 4I7VA 2E6FA 2WSYA 1JRBA 4MKNA 4MY9A 3G3DA 5HQEA 2Y61A 5G2WA 3MBDA 3CWOX 3G3MA 5EPDA 4K7YA 2X1RA 1W5PA 3IIZA 5H91A 3LI1A 1PL9A 2EKCA 3G1AA 1X1ZA 2X1TA 1ZAIA 3PBWA 4H3DA 2QUUA 3ABSA 5K9DA 2VELA 2XN0A 1KM0A 3C2RA 3LI0A 5K4XA 5AC8A 1W3NA 3TROA 1R30A 2LLEA 4OT7A 4OWGA 5AFDA 1XKYA 4XTDA 5F2IA 4XBKA 3PBYA 1OX4A 2BXVA 1EP1A 4ZQRA 3TK7A 3LBMA 2B7PA 3W1NA 2GQAA 1H63A 1L6WA 1VLWA 1MSSA 1PVNA 5K2ZA 3GAKA 3NA8A 1VPXA 3W2MA 4KKXA 1VS1A 3W74A 3MI3A 1SSGA 3A24A 3FJ6A 4S1FA 3IIXA 3TQVA 2GOUA 4QIUA 3KX6A 3NQVA 4H4IA 1QCWA 1EA0A 2PE4A 4GJ1A 1YLVA 4BK9A 2CZ5A 4GRSA 4DO6A 1FDZA 5HJLA 4RK8A 1E51A 3FKRA 5CPOA 3W7DA 3UYCA 3TW6A 2E6DA 1GG1A 1PCKA 1KW1A 3NPVA 4DBDA 3QQ1A 4O19A 5C6MA 1EUAA 5L6UA 1GTHA 4PCFA 1TRDA 3DFQA 1TREA 4MVAA 5HR7A 3LHVA 3W7MA 3DBPA 5EA9A 3W87A 2QCDA 1FWWA 2V81A 3RLVA 4GUJA 3PUEA 1A50A 5G5IA 1KM6A 1L6SA 2EAWA 3STGA 1LRQA 1QWGA 1CI1A 2I1OA 4ONVA 5D02A 3TR2A 3H53A 5DLCA 2BX7A 1SO6A 5DY2A 2CLIA 3W1LA 4EF8A 4UIOA 3WFAA 1NF7A 3LX9A 5F2GA 1X7FA 4RKAA 3N2MA 2NX9A 3B4UA 2B4GA 3NEVA 1RD5A 2JBMA 3EWZA 4LUJA 3BLEA 3VI2A 5AHNA 3NL2A 3PWAA 3N73A 3N19B 4TMBA 1JJKA 4UTTC 3S0CA 4XKYB 4AF0A 4AHPA 3TSDA 1M6JA 3MYPA 1ZNNA 2QJGA 1Z42A 3KOFA 1IXPA 4LVFA 2YFNA 1TB3A 5AYYA 1FX6A 1RQHA 2CLHA 3VNDA 1Q45A 3HMJG 4IPJA 1I2NA 2FB2A 2V82A 1FDJA 2AGKA 3NDOA 1FCVA 2TSYA 3HPSA 5D04C 3DZ1A 3MP3A 5D30A 1H1YA 5ABTA 1SW3A 3LRKA 1HO4A 2ZCGA 4OV4A 1TV5A 5F2MA 2NX3A 3W3OA 4KWVA 4M6PA 3W7QA 1W5MA 4MYAA 1VCVA 5D2YA 4HN4A 1TPUA 4RZ5A 1FQ0A 1HFBA 1H62A 1U5JA 1R46A 3QH2A 3ABQA 4FXRA 3U2OA 1H5YA 3LRMA 1JUBA 1OX5A 3W1MA 2O7QA 4R34A 5A8GA 1S5TA 3NQFA 3BK0A 1KBJA 3S1WA 2P1FA 3W2KA 1KFCA 3BVJA 1PS9A 1XDMA 3IVUA 3A9IA 3NQGA 3P60A 3O15A 3OIXA 4IOTA 3TJLA 4IMDA 4D2JA 1OJXA 5G1YA 3AJXA 3USBA 2B7OA 4YCPA 3NYZA 1JQVA 1SR9A 1TRIA 1DKWA 3TFCA 1ME7A 2DZTA 4K7VA 4BI5A 4IGHA 4NJHA 3VE7A 3P62A 5AN7A 2DU2A 1UJPA 1P4CA 2JKPA 1W3IA 3EKZA 4JS3A 1G67A 1SQ7A 3R2GA 1O94A 4WY0A 1TPFA 2Z1BA 3G1SA 5KINA 1FDYA 3NM1A 5BNKA 2WNNA 3STCA 4CNPA 3NR0A 2ZQ0A 1GOXA 2YPIA 1NVMA 1F05A 1PCWA 3MHUA 2TYSA 4JTUA 3HGSA 3CU2A 3WJSA 5BOOA 2E77A 4ML9A 2CWNA 5DXYA 3I68A 3HGRA 4C1KA 4MZYA 3WK3A 1LRTA 2VFDA 3MP4A 4MJZA 4JTKA 1WDWA 3HF3A 1ML1A 3ABOA 1O5XA 2ABBA 2CZEA 3S5OA 4AWTA 1I2RA 3LXCA 1XI3A 4ICNA 4UTHA 1KFJA 4BWLC 1Z44A 4HNNA 3A21A 2PRMA 1QDSA 3PBUA 3QMTA 5CPNA 3C4UA 4PC8A 2FFCA 3L0KA 1LP6A 3B8DA 3Q94A 2P0OA 4K39A 3NQ2A 2AAMA 2NXHA 3OA3A 3KVLA 1V7YA 3QW4B 3W6YA 1R2TA 3U6WA 3W72A 1DVJA 2A7NA 1FWSA 4YWIA 2G95A 1YXDA 4UNLA 4JYFA 1TIMA 3BW2A 1IXQA 2FPYA 2VXNA 2OJPA 3SGUA 4FB7A 3I7QA 4LOCA 3EWUA 1YTKA 1TPVA 4JIQA 1VHNA 4QNEA 1SO5A 1G6CA 1LZOA 4UMAA 3C2OA 3DENA 2OMAA 2ZZ5A 1SZFA 4Z0SA 4LVAA 4FNPA 4GXMA 2Q3RA 5K3VA 1UUMA 2W79A 5I3JA 2QKFA 4PL2A 1OK6A 4NQ1A 1DOSA 3UPBA 3CTLA 1AL7A 1K8YA 3C56A 3NPXA 3LTYA 5HINA 1WXJA 2Z6JA 2GUUA 2VFFA 1M7PA 2E6AA 1P0KA 2A21A 4R33A 5SWUA 2GPTA 4Y8FA 4NUWA 4ZQOA 1H7RA 1JUEA 3MJYA 3UWZA 4HNTA 3DI0A 1DHPA 3E96A 5DCDA 3BLFA 4ZQNA 2Z6IA 5LNUA 2ZTJA 4UTWA 2A2IA 2FJKA 3PM6A 4IWWA 1H50A 1OFBA 1KFBA 1OVDA 1TTIA 3LHTA 3EXTA 4QAIA 1M7OA 2C6QA 3TIMA 2Z2UA 1Q3NA 1RPXA 1AMKA 3SIZA 3STFA 1LOSA 1OYBA 4P2VA 4IMFA 2ZRYA 2YR1A 4MZ8A 2FDSA 3WK1A 5DBTA 3ZR4A 1CX9A 4NJIA 3M1ZA 4UR7A 3DFSA 1H1ZA 1D3GA 2JKEA 1EWDA 4FNUA 4XQ6A 1G4PA 1ICSA 4K37A 4PA8A 3UY8A 4TX9A 5AHLA 2KZHA 1G4SA 2BZNA 2RDTA 2Y88A 4O12A 3W2LA 1QAPA 5FF7A 1NSJA 4NXKA 3STEA 3UZ5A 2C18A 1Z41A 1VJIA 2DJLA 4MYXA 3T40A 5LGXA 2NX1A 1KM3A 4A3UA 1WQ5A 4WXZA 3TAKA 2C19A 4O10A 3GIYA 3CM4A 2XN1A 4JXCA 3DGRA 3QSTA 1I2QA 2F84A 3HG4A 4IX2A 4Z08A 4UTKA 2J9XA 4BI7A 3NM3A 5E1QA 3TU9A 3VCRA 2J9YA 1WBHA 3W7CA 4O57A 3OVRA 4CNOA 1KA9F 2ATSA 3RFAA 4TMCA 3F4NA 4O50A 4FNTA 1B9BA 2OT1A 1SFJA 4JTHA 2CLMA 1L6YA 3P8JA 3HPZA 2WOQA 1GVQA 3CB8A 1GVSA 2A7RA 2G5WA 4MFDA 4ZQCA 4C1LA 3C3NA 2VEMA 5IM51 3QM3A 3THQA 3W73A 1DQXA 3CEPA 4GUHA 1AL8A 3G8RA 3W85A 4HNUA 1YTEA 3EKLA 3H55A 1ZALA 2TPSA 3MI2A 3MI6A 4FF7A 4QNWA 3R89A 5KZDA 3FFSA 1K3UA 3A5VA 3FEMA 3A5FA 5EMUA 3Q58A 5FESA 4A22A 3O6YX 4I7WA 1Q6RA 4GNJA 5FI8A 1TPDA 3GDMA 2QAFA 4MZ1A 1F6PA 3SGZA 2I14A 3NQCA 4OHQA 4Z1BA 1HG3A 1A53A 1EUNA 4JTJA 1N55A 1OFQA 6TIMA 2J24A 4LNYA 4WQ6A 3CLMA 3SJ3A 3FS2A 3LXBA 3CC1A 3TX9A 2QCNA 2X2GA 1JCMP 1OX6A 4CQ8A 2DJXA 3JR2A 1XCFA 3UY7A 1LOLA 4O18A 4E0CA 2ZDRA 3RK8A 4YLWA 1A5SA 3A22A 1L9WA 2A0NA 4Q4KA 3G0XA 4Y6GA 3P61A 2VFGA 4LVGA 1QR7A 2YDAA 3NQEA 2NV1A 4AMAA 5D33A 1ZHAA 1YDNA 1MEHA 4YL2A 1EP2A 4OQVA 4FNQA 4UTMA 1OG0A 5AB3A 3TC7A 4N6FA 1KV8A 4ZVJA 2QJIA 3DU0A 3NXFA 4L4MA 4PH6A 3K30A 1VCFA 1G7VA 5KSWA 3GDRA 3IIVA 4QITA 2JK2A 2X30A 1KV5A 2X1UA 2H90A 1JR1A 2ZBTA 2ZRVA 1X8FA 4HNVA 2DZXA 3T78A 2CW6A 2ZYFA 1BTMA 2ZRXA 4S2CA 1OFEA 3GKAA 3LHWA 1BKSA 3PSWA 4Q33A 5I3IA 5FEZA 3L5MA 1AW1A 4ORMA 1N8FA 4AXKA 1V5XA 3W07A 3LOTA 3W7RA 1GWJA 4K6AA 4JDBA 5DBUA 3PG9A 3EWWA 3NQ6A 2A4AA 2YSWA 2O7SA 3CHVA 1MEIA 4S2BA 1D9EA 1EP3A 3ZWSA 1QPRA 4JICA 3TJXA 1OF8A 3RNDA 1PHWA 3RU6A 4RX0A 5FF3A 4OBTA 4QISA 3LXAA 3BG3A 4FNRA 1GG0A 3BW4A 3L5LA 3B0UX 3OEXA 1TQXA 2HSAA 4GFSA 2Y7FA 1VYPX 4GE8A 4GUIA 4Z1CA 3NL3A 4X9SA 2CLLA 3HBLA 2BTMA 3I6RA 5HULA 4AHOA 3G1HA 8TIMA 1VRDA 3W70A 4Q32A 5G2IA 4BF9A 1AW5A 4PEKA 5CPLA 2C14A 4CCEA 3G1FA 4TO8A 3DFNA 3PVFA 4O8RA 3CIWA 2RFGA 4NNBA 2VFEA 4UTJA 5DY3A 2EGZA 3TQKA 4FX7A 1QFEA 4BI6A 1QOQA 1H7WA 1VYSX 3KRZA 2YYTA 4ZZ9A 1VYRA 1EX5A 4QJ1A 2VEIA 4LC8A 3TFXA 3LGEA 2TRSA 2YYUA 5HR6A 2DZSA 3M47A 4TIMA 1SUXA 3N2XA 3JS3A 3TE9A 1SU5A 3W75A 3W2UA 4JEQA 4DO5A 2B7NA 1T96A 5LHEA 2DZPA 3W7HA 4LW7A 4CQAA 3I7SA 3QFEA 1LM1A 1GEQA 4FEZA 4JIPA 2Y6ZA 3WJWA 4A2SA
chains in the Genus database with same CATH superfamily
3RCNA 4AY7A 4QS5A 1UPMB 4S38A 2PFHA 3RGTA 3NQDA 1O5KA 3VIHA 3HPFA 4ZE4A 2IXUA 4QDPA 3UVAA 1EXPA 2DVXA 2VZOA 4EWND 2E5CA 1DE5A 5DRCA 2A85A 1ODUA 1WCGA 2ON3A 1TTPA 3L9CA 1R2RA 3PUDA 2CEQA 3NOEA 3K8MA 2NVDA 3GC5A 4AIEA 4HSHA 3M7WA 4HMNA 4JIHA 2WWCA 2P3EA 1UA3A 1RY0A 3E0IA 2A79A 1UOKA 2NV2A 2CBJA 2CLOA 4DBEA 4WD0A 5H2ZA 3AXHA 4IJCA 5D2WA 3T0CA 1SSDA 1VLIA 3RM4A 1Z8AA 2PPGA 5EB8A 4IPIA 4ECLA 1RA0A 2V5DA 3EA2A 5FF4A 1CB7B 1I9CB 3OYZA 3WJZA 4DXKA 2BOEX 2PZ0A 2JFEX 2W62A 1OGBA 3QYQA 4JNMA 3NIYA 4JTLA 3O3RA 3DFPA 3UWYA 2BDQA 2NT0A 3M4HA 3RLGA 2Y70A 3T7VA 2C1GA 1YPXA 4M7TA 4PBEA 1P1XA 1U22A 5TBOA 1M01A 4RNJA 4AZCA 1W0MA 4KF1A 4C6MA 4DF0A 8XIAA 2YB1A 2QPSA 3UFYA 1BSLA 3SJNA 1J6PA 3EEGA 2J7FA 3OG2A 3I6TA 1GUVA 2X0HA 2HXUA 1RVKA 1OFDA 2G3MA 3B40A 4UC5A 4HCHA 4AAJA 4DJFC 1GZGA 1V0KA 3FJLA 1M5WA 3WLKX 4GCAA 4GQQA 3VGDA 1OIMA 4L4OA 1G4EA 1JIBA 1UPPA 4MDPA 1YTDA 4N9EA 1QNVA 4KIEA 5IDIA 3ZLFA 4DPQA 2OWXA 3MUCA 4HYWA 4L1WA 3UWVA 5A6SA 2J6XA 1EO5A 4DELA 3WLLA 1FP8A 2FYMA 3GVGA 3F03K 4RNIA 1RD6A 2E09A 2HVMA 4GY7A 5C70A 2QV5A 2D73A 1OADA 1JPDX 4DZHA 4UCFA 1AJZA 4F9JA 3NO1A 2I56A 2EJ1A 1W8SA 4IFKB 1J0IA 1VCGA 2ZZ3A 4UTIA 4JBRA 3PSVA 3G1DA 5I3FA 1US0A 1KNWA 2Y24A 3IJ7A 1KQYA 1QI4A 1BRLB 3TA6A 1JD9A 4JDYA 2E5DA 1ESWA 5CZKA 3BMVA 2WMHA 2VDHA 2FGBA 2Z2BA 4AWEA 4QGCA 3BZJA 1KWGA 3WL1A 1OK4A 4I5UA 3ZIZA 4MAZA 4ZCWA 1CW2A 2NXIA 1EC7A 2G50A 3OHIA 1WDPA 1B0IA 3BV7A 2ZDSA 2NUYA 5A8PA 1BYCA 4LS2A 3WFLA 1TR9A 3H7UA 2QUNA 3A47A 1Y0EA 1TTQA 2PDQA 3LCFA 1XUZA 4X3ZA 2WAGA 1FWCC 3M0IA 1TWDA 3DECA 3CWNA 4WK9A 1T0OA 1LCOA 2AOSA 3TXZA 4MLRA 3W84A 2RJGA 2UY2A 2Q02A 3K4DA 1H7OA 3G1VA 3WK2A 3G24A 3S9YA 1F6KA 2NW0A 1BQCA 3GNNA 5DN1A 3N18A 4YVPA 1V0MA 4YU1A 1ADSA 5H8MA 3F7JA 3M0YA 3NGJA 4F2UA 4B2DD 3GR8A 1REQA 1H7NA 3V16A 3CZLA 3CK5A 1SMDA 1VEOA 3SUUA 1PV8A 1YRRA 2B81A 2XH4A 2O9OA 4AWUA 4W7UA 3VKBA 3KCJA 1Q2SA 2VEKA 3CJPA 1E6QM 2BGNE 2KAUC 3OOQA 3P84A 2G3JA 1GOIA 3N4AA 5F1VA 5C0QA 2FZBA 1JQXA 4KS0A 4YJ5A 5U7SA 2PUZA 4NILA 3KLLA 4CD8A 3NURA 1JCXA 1TPWA 4IISA 3XISA 4KWOA 2YA2A 4K8EA 4GYFA 3HPAA 1LBMA 2BASA 4UR8A 4IIDA 2ACQA 9RUBA 1XYMA 2PDPA 3WQFA 5C7HA 1ZPTA 3AMLA 3WDRA 3K5XA 3LZ5A 4CLMA 2OO0A 3SQMA 4W4QA 3C61A 4QFUA 3PBVA 3IJ9A 1AFSA 4Q7IA 4ZXLA 2ABAA 4E3TA 2DUZA 1PX4A 3NPUA 4FLQA 1P43A 1I4NA 4CKQA 2VDGA 3PG8A 4ZL1A 3JW7A 5CAHA 3MA8A 3TYBA 3E0VA 2OCZA 1UP2A 2PDHA 4MB3A 4GISA 2GVJA 3TNBA 2QPUA 3S6OA 2R94A 3RN6A 4HZ7A 3PPCA 1VF8A 4H8UA 5LA0A 3OW1A 2GJXA 1GYNA 1JCYA 4D8ZA 2YX0A 4B90A 3GTXA 4U4MA 2F8QA 4WOQA 3R6IA 1HO1A 3EX1A 1HL9A 4DZIA 2O9PA 3VKCA 3B8UA 3TAOA 2QUTA 4NI3A 1UYQA 1R7AA 2OZ0A 3WNNA 5CKSA 3ES8A 5FJIA 1KTCA 2GGEA 3VIGA 4LBUA 3WJYA 4TV5A 4X0NA 5XINA 3QY6A 2PF0A 3GVRA 3LU2A 3QPZA 4NASA 3URNA 3T9PA 2PP0A 3QPEA 1MDRA 3SZ8A 2REQB 2PGEA 4U2YA 1CEOA 2MUCA 1AG1O 3WMBA 2IKJA 3IEBA 5JIPA 5FA5A 3IGHX 1FCUA 1WP6A 4WJXA 3AMGA 2J74A 3HOJA 4DJDC 3N2OA 3G22A 4UFLA 1E56A 4MAVA 3N12A 5HNRA 3BAYA 5GVJA 1BVWA 4O4WA 3VIMA 2CLKA 4NZFA 1RY8A 1F3WA 1J2WA 4PCSA 3CMGA 5D09A 4MY8A 3H2FA 5DCEA 4U3AA 3M5YA 1W5QA 3OZPA 2ISSA 3LLFA 2QAPA 2HPMA 4N9DA 3WBEA 4KRTA 3DEQA 4GNVA 3GO2A 4OUEA 3V36A 4UQBA 1OF6A 4BKNA 1X39A 2PWUA 1Q13A 4RZ4A 4FZIA 4TV6A 2WKLA 2A3BA 3HMCA 4US5D 4LRSA 3B0XA 3ATYA 2XWEA 2R1NA 2WBGA 1CBGA 5AVHA 2F6KA 3P2VA 3CT7A 3Q2DA 3PZMA 1LBLA 1L8NA 4US6A 5FJTA 4UQ9A 3IJDA 1RLCL 3W76A 4H1ZA 1MQQA 2X16A 4OZOA 5AYBA 3POHA 1CB2A 3FHAA 4KCTA 4FOJA 4RZBA 3BTNA 5C2CA 3VFCA 1EJUC 3TMQA 4LYPA 3WIJA 1G7UA 3OBAA 4GC4A 2BGQA 4IICA 3GXNA 3P5ZA 1KTBA 4EP8C 1CZ1A 4H9UA 1W2VA 4Y9AA 3QEZA 4AVFA 4WDTA 3DHDA 4DAFA 1Q7QA 4IQEA 4PMZA 2VX7A 4IPLA 5I02A 1GW1A 1LT8A 2YDSA 3R13A 3NZ1A 3LN3A 4J4KA 4K1WA 1EX1A 2HV5A 3KFTA 2EPLX 4D6HA 5LIKX 3WQ6A 3KE0A 1W17A 1HXJA 3BPWA 2ZC8A 1SGJA 3ATZA 4PTNA 3E49A 1OX4B 1S5VA 3A23A 3L21A 4LNCA 1CPUA 1P0EA 3IGSA 3MUZ1 4BF7A 4P7LA 1SZEA 1XRFA 4OTKA 3DKLA 4CNUA 2WSQA 5AC7A 4Y7EA 4AZHA 2PCEA 1PBGA 4IMGA 4FOKA 2VQTA 5M5DA 1PE1A 3CT2A 5I00A 1EWEA 3S83A 2BP1A 5TF0A 2W66A 2WMFA 3QOKA 2QJHA 1WBJA 5CSSA 2OQHA 4JKKA 3GTNA 2NWSA 1DV7A 4N9BA 4H6RA 2QDHA 4JTRA 3M07A 1O4UA 3GVQA 3KBJA 4CCZA 2CZDA 1Q6EA 3H2OA 2W27A 1TJ2A 2R14A 4ZO9A 3KZPA 1AH3A 3VOJA 1P5BA 1WXZA 4JX5A 3AMCA 1EF3A 4L61A 1ICQA 2DT1A 1TYGA 4DX3A 1OD8A 3H6OA 3B8VA 4JGDA 3S5SA 3WK0A 1A5NC 6TAAA 3BOXA 1OFOA 4DO7A 1A5LC 5CGMA 3CL8A 3MYOA 4A8IA 3WLJA 5F1UA 4NZ4A 3VFLA 2X05A 3OVQA 1W3LA 1EJVC 3NJ3A 3EB2A 3M16A 3SR7A 5E0KA 1E55A 5ABHA 1DQUA 3AC0A 4FNSA 1F3XA 4W85A 1BXNA 3C0JA 2NSOA 2TODA 3C8FA 1TX2A 1JL8A 5JVLA 1QPQA 3NO5A 3TC3A 1WKFA 1VJSA 3OVPA 2D22A 4MWAE 4BF5A 1XBVA 2ZA3A 2HTMA 4YHEA 3QZ6A 3T0AA 2YIHA 3FYOA 2OSYA 2ZA2A 1VFMA 2YXOA 3R8HA 1P0BA 3T0DA 1ZQ5A 2FKPA 4QHRA 3M0ZA 4YTTA 2DFAA 4M6VA 3W2JA 2GVYA 3V1PA 2E1WA 4RR4A 5L9FA 1U5HA 3S4TA 1JYNA 4LY4A 4Z1DA 3MCMA 4GZEA 2OOGA 1TIWA 3I6EA 2ZX6A 2F9RA 4OGZA 4QCEA 1K9FA 4AVOA 4CU8A 2J9ZA 1QMLA 1QK0A 3NAVA 2EXOA 5CBIA 4IG2A 2J77A 3T1GA 4FPSA 5IXEA 2YZRA 3S47A 2PLJA 1DWFM 2GUBA 2Y5SA 1BG9A 3UA3A 5TD4A 1JZ5A 4WKHA 1GNXA 3OP2A 1HT6A 3I4KA 1ITUA 3CAVA 4HN8A 4CCDA 3EA1A 4B5UA 4OUIA 3M41A 4E3VA 3GFZA 5FF2A 3H2NA 2BMBA 5XIMA 4M81A 3P93A 1HUVA 1PTGA 3BLKA 3CV6A 1JDFA 1K8CA 2NUWA 3S46A 3TCSA 1TZ7A 4JN8A 4RV8A 1QVBA 1KKOA 2XZ7A 4NAEA 1QOPA 2GDUA 4GKLA 2CU0A 5I23A 1YIXA 1H2JA 2PF8A 4B15A 3WH8A 4I7UA 4LVBA 1VFSA 3RJXA 4US5A 2XH2A 1I2PA 4GBUA 1XIGA 4MJ2A 3FY1A 1JDEA 4RW5A 4H6KA 4WSKA 5DELA 3WMLA 5BRBA 4Q6JA 1KRBC 1D7FA 4V1XA 3TSMA 3TONA 2D2GA 1TJ1A 3PZ9A 1F73A 4ATLA 4E2BA 4PFMA 3ZJ7A 3V5OA 4BY3A 3SY1A 4CCCA 5MKGA 3KTCA 2VM8A 1ZGDA 4TQTA 4DXVA 3B4YA 3HGJA 1TJRA 3FSUA 1FHDA 3G18A 3HG2A 1CGTA 2DP3A 3NEHA 1NDYA 4ZOCA 2QYGA 2C13A 4XAPA 2INFA 1HJXA 1L0PA 3HTWA 1F8IA 4N2YA 3HQOA 2P0IA 4S3FA 2FIQA 3HGOA 3N9RA 2C0AA 3K8KA 5HMSA 3WUBA 1ZY9A 4P7RA 1FCQA 2BSLA 1I45A 2I16A 3W7IA 4LYRA 1PEZA 1CGXA 3VDHA 4ADUA 2QMKA 3AI0A 3WBYA 1Q85A 3EDEA 1MW1A 3U2CA 4Y2WA 5I06A 1PYMA 4BFAA 3TTEA 2W61A 1RA5A 5LHFA 3ONBA 3U48A 3AMDA 4BR1A 4W89A 2ZTKA 1WOAA 3M0LA 5IFPA 3CAWA 4Y9NA 2Z28A 4XVEA 2A5HA 2P8CA 3P0WA 1V93A 5B7YA 1QPKA 1MO0A 3DFTA 4J7RA 5D9PA 2PEVA 2WMJA 4KQNA 1OQFA 1JZ8A 4HU8A 4N9CA 2ANUA 3LNMA 2BY2A 3STPA 1TV3A 1VHCA 4OE7A 5GJNA 3BXWA 1HNYA 2ZZ1A 3E2QA 2BWGA 2FTPA 1IEQA 5TIMA 3A3HA 2A6NA 2ZUVA 4RXGA 5JIWA 3DI1A 2V2DA 3SECA 1HKKA 5BOEA 3CYVA 1F7BA 1H60A 2A7PA 1WPCA 3OIHA 4I7VA 1JRBA 4MKNA 2OQLA 1EDTA 1GQLA 5A6KA 4GX8A 4GH3A 2V68A 3DG3A 3CS2A 2OXNA 1W5PA 3TWBA 2XINA 1ZL1A 3LI1A 3G1AA 3R8GA 1EHNA 3PBWA 3U4FA 3G77A 1KXQA 4M82A 1XH2A 3ABSA 4XISA 3WQVA 4QDMA 1OWQA 3WLMA 1NOFA 3TROA 2LLEA 2OLHA 5AFDA 4IP4A 3FAXA 4BQ5A 4D1JA 4XTDA 3HV9A 1EP1A 4ZQRA 4ZTXA 2J13A 4YIWA 2B7PA 3QQWA 1M7JA 2D2HA 2GQAA 1K4HA 4UBPC 3GHUA 4PB3A 3QN3A 4MGGA 2YZ5A 4A3HA 1PVNA 3GAKA 3NA8A 4LJ3A 4AVNA 1YBQA 2VP8A 4N7QA 4EPEC 3HZ3A 1UIPA 5REQB 1QCWA 2CZ5A 4HB7A 4ZB5A 5HJLA 1ONEA 2PDBA 4RK8A 1E51A 3VIJA 2OYLA 3R0KA 4KCVA 1E4LA 3KBWA 3U5UA 1VBUA 4D6IA 4J28A 4O19A 1EUAA 3POCA 2VJXA 3AYTA 1HJUA 4PCFA 1EJSC 1TREA 1FWBC 5IHRA 3LHVA 3W7MA 3DBPA 4EKJA 5EA9A 1X6NA 2WZEA 2GOKA 1XIIA 2Y8KA 3Q65A 1LUCA 4HU0A 3RLVA 3PUEA 3WDJA 1A50A 1UA7A 1R85A 1ENUA 2ZX9A 1LRQA 2BY0A 4LYQA 3BAXA 5D02A 3XIMA 4XV0A 1CLVA 5DY2A 4H7CA 4DWSB 3W1LA 2GGHA 2XJ7A 4BEQA 4UZUA 1PJ9A 5CPQA 2P50A 3LX9A 1X7FA 1HGYA 4RKAA 3B4UA 2B4GA 2JBMA 3EAUA 1OGSA 5CJ5A 1RJRA 3BL3A 3N73A 3N19B 5EMMA 7TAAA 1JJKA 4UTTC 3FV9A 4QX4A 4XKYB 4AF0A 3OBEA 1EIBA 2I5IA 1NM9A 1ZNNA 2QJGA 1UR8A 3LMZA 1Z42A 4MKSA 3WNMA 3DYMA 5FACA 3TTSA 1GJWA 1XKJA 1BYBA 1RQHA 1Q45A 2VCBA 4ZA0A 1FFRA 2V82A 3SDOA 3VZZA 2AGKA 1FCVA 1JF5A 1AZ1A 3HPSA 4JIIX 3DZ1A 3MP3A 1QI2A 2DT0A 2ZCGA 2OPJA 1X97A 1TV5A 3VNIA 4KWVA 4D9PA 3CZGA 3TOPA 5D2YA 5BU9A 1XRTA 4HBKA 4KCWA 1HFBA 1H62A 2WVVA 4G56A 1R46A 4MWAB 3U2OA 1JUBA 1OX5A 4E8DA 4R34A 3PZUA 2WCGA 4EAYA 3AXKA 1O1ZA 4HU4A 1IR2A 3CGTA 1QHOA 2WC4A 3IVUA 1MDLA 2QGHA 3P60A 1XP3A 4CNSA 1GOWA 2UWFA 1GOKA 3FVMA 1XLIA 4ZBCA 1OJXA 1O7AA 3BANA 4YCPA 3NYZA 3AJ7A 1SR9A 3JVAA 4BI5A 4IGHA 4ES4A 1XV8A 1J5SA 4RV3A 3MZ2A 3WO8A 5CLTA 1SQ7A 1DWJM 1TPFA 3KS5A 4X9YA 3ZOAA 1FDYA 6A3HA 2WNNA 4CNPA 4NAEB 3ZLGA 1NVMA 3JUGA 3DIPA 4PTXA 4GMEA 3CU2A 1EKOA 5B7ZA 2E77A 5F7UA 3EDKA 5DXYA 4MZYA 1Z69A 3IRSA 2E8ZA 4U5KA 1KXTA 1V6UA 4LAUA 2XIOA 5A2BA 3ABOA 1NWUA 2WB5A 2CZEA 1QATA 3DHPA 1I2RA 4ICNA 2PDYA 1KFJA 1SJBA 1Z9AA 4BWLC 4HNNA 4KMQA 3TWAA 1SMAA 3L0KA 3EB4A 3VGHA 2WHLA 3CHDA 5IHSA 4PYSA 3Q94A 3NQ2A 1FWAC 2BBFA 1DVJA 2A7NA 2ICSA 3QR1A 2V67A 1UWTA 2VGGA 4WLCA 4JYFA 1EDGA 2R1LA 3Q4DA 3GC2A 1ZU8A 5A94A 6REQA 1IXQA 1KD0A 1XGDA 1YTKA 1FWJC 4JIQA 3KTSA 4QNEA 4AG0A 1PZ1A 3BCDA 3QZAA 2CKSA 1ISWA 3DC8A 2ZZ5A 4L64A 4CN1A 4FNPA 4GXMA 2GDQA 4QG8A 5K3VA 4OBRA 1DOSA 1TMLA 5JMUA 3FEQA 4L56A 1LQ0A 4Q3MA 1OY0A 3LTYA 1VFFA 4D6EA 3UR8A 4AZCB 1E4IA 1FFQA 5SWUA 3WLNA 2GJPA 3JZUA 3CH9A 4PMJA 4UQDA 3E96A 5LNUA 3CLWA 1TWSA 4UTWA 2A2IA 1H50A 1KFBA 1OVDA 1UKTA 3C8NA 3LHTA 1BF2A 2WW5A 2PSNA 3ARWA 4Z17A 1LOSA 2E9BA 4IMFA 4KCUA 2ZRYA 5DBTA 3M0XA 4DJDA 4NJIA 3M1ZA 1KRAC 1EWDA 3VCCA 3UCDA 4W7WA 1G4PA 4GVIA 4JQ1A 2OO6A 3CV1A 3KUMA 2Y88A 4O12A 1QAPA 4B92A 4NXKA 4AQLA 2AMGA 3STEA 3TJ4A 3UZ5A 4PZVA 1KM3A 4P7QA 4A3UA 3TAKA 3FSTA 2C19A 3W27A 4ZENA 5BYWA 4PTWA 3F5LA 1VRXA 2FHCA 1D8WA 4BI7A 3R0DA 1EJRC 3GH5A 3UJRA 4EXBA 1ISZA 2VQUA 3RITA 1E71M 2J9YA 2BOGX 4CN4A 1J0KA 2IUZA 4O57A 3OVRA 4AIBA 2QDDA 1NOWA 2ATSA 3PWIA 1H5VA 1JYVA 2OT1A 2YL5A 3RX3A 1EYWA 4JTHA 4PRTA 1L6YA 5EMKA 4AZBA 4C6KA 4GVFA 2WOQA 3CB8A 1GVSA 4MFDA 4ZQCA 3H4GA 3RX2A 4QS6A 3THQA 4HK7A 1TWZA 3APYA 2BXZA 4RL3A 1K9DA 3MSYA 1GKQA 4QNWA 2HNHA 3FFSA 5HDRA 3VD9A 1Q6RA 2I5QA 4GNJA 1TPDA 1BLIA 2IKHA 5PTDA 1UMLA 1W1B1 3RCMA 4Z1BA 3LLXA 3NUKA 1QOXA 4JFTA 4AC7C 5EMJA 1K77A 3ALGA 3GTFA 1N55A 2V3EA 2P5NA 3EB3A 4Q8NA 4PTDA 2FH8A 3ME3A 3TX9A 2ZADA 1QNSA 1S2TA 2PA6A 1QNPA 1TELA 3UY7A 1LOLA 4O18A 4DIAA 1RBAA 2AQOA 3OGVA 3KBSA 4AZIA 3LUTA 4XZLX 3G0XA 1FWEC 4Y6GA 4MM1A 1QR7A 4ZB2A 1ZHAA 1YDNA 4YL2A 3VMOA 4OQVA 2C0HA 4AFYA 3TC7A 1KV8A 2QJIA 2DGAA 4PB5A 2BVWA 5FJRA 2ACSA 3ZLHA 3IK2A 4Q4PA 1O1HA 1VCFA 5KSWA 3GDRA 2D2OA 1J8VA 2CETA 2OLSA 1MFVA 3UJEA 1JR1A 3OZMA 3SCOA 2CW6A 2ZYFA 3BZGA 4F2BA 2CZVA 1OFEA 3GKAA 5I78A 2XH7A 5I3IA 2BHYA 4P8WA 1IEXA 4QEHA 1N8FA 1YMYA 1GWJA 2Z7KA 3RHGA 1HVXA 4JDBA 3AS0A 1MMFA 3CV2A 2FMOA 3O7UA 3NQ6A 4AW7A 4QJ4B 3GXIA 3ZWSA 1QPRA 3TJXA 2VRQA 1OF8A 1VEMA 2VEGA 4RX0A 1F4AA 1JGMA 4HZMA 1V0NA 1GG0A 4FNRA 3WQCA 3B0UX 2HSAA 4F0KA 4GUIA 4Z1CA 1M3UA 1EF2A 3PP7A 3R11A 4NF7A 4JNYA 2IKGA 5EU9A 2X41A 4E4UA 1VP5A 5AZ1A 4JN7A 1AW5A 1WAWA 1UC4A 1JDCA 5CPLA 2ACRA 3DFNA 1GZ1A 4QJ5B 4HPHA 3OQ8A 4FX7A 1S1RA 2WHMA 1QOQA 2PDKA 1H7WA 4BQ4A 2BXYA 4Q4MA 3KDOA 2XDFA 5DMMA 2DZSA 4TIMA 3JS3A 4KPLA 5HNNA 1QI0A 1E15A 1AQHA 4FK9A 4DO5A 1IWPA 1EZWA 1XIMA 4YHGA 2JALA 4GI8A 1WDQA 1LM1A 3W6LA 1CYGA 2ZUUA 4FEZA 3TP4A 4A2SA 3FCPA 3W53A 2I57A 1XIHA 4B4FA 3KHJA 4LGXA 3REQA 2PD5A 3BQ5A 3RPDA 3SBFA 1J5TA 1FWIC 1WDDA 5DO8A 1UUOA 2FTYA 3CZKA 4U5IA 2YW4A 1EOKA 3VMPA 4N42A 4B3LA 2REQA 1T7LA 2ADAA 3T8LA 3NFUA 4NAFA 3WQ4A 1YDVA 1VH7A 4LX4A 1C93A 1JVNA 2X42A 1V3KA 4R53A 3C2FA 2FZNA 1OCNA 2ZA1A 3QVQA 1W9VA 1XPGA 1F3EA 3SRKA 2DSZA 4UFHA 3MCOA 3KWSA 1YNQA 4KERA 1W3KA 1AW2A 3LGDA 3KM8A 2E1DA 1A0EA 4F40A 4O13A 4Q4QA 3TEVA 5I03A 3S5ZA 1S2VA 1E3XA 3V0UA 3TSBA 4JEJA 3FXYA 1SO4A 1YXCA 4KT2A 2PURA 3AIEA 3UVIA 4B2DA 1DIDA 4S3DA 3AQUA 2ISWA 2UV8G 4J3UA 1MQRA 2OGYA 3QF0A 2I5GA 1C8VA 4UQEA 4DB7A 5D05A 3BURA 3W7OA 1JF6A 3MBFA 4H9VA 4LV4A 3GC4A 3VKDA 4KFNA 1SZNA 4K68A 3UETA 4AEEA 4Q4OA 3PZIA 3EZ4A 4JTCA 1Y5WA 4F3HA 1TMQA 2NWRA 3A6OA 5HWJA 4LY8A 1QW8A 4ZOBA 1TV8A 1WZAA 3W23A 2D2JA 3SI9A 1DTNA 3VOCA 4Y9MA 1XR2A 1SW0A 2RDXA 5LNWA 4WF7A 4ACZB 1ZAJA 3E74A 1ZBWA 2VR2A 3KLKA 3R5EA 3BE7A 4H2CA 4BWLA 1R87A 3T6CA 1DJGA 2XSXA 3BAKA 1XICA 1AA1B 1X96A 2GJLA 4C6NA 3GQYA 1XXXA 3RR1A 2J79A 2Z26A 2YB4A 5KMYA 2IQ0A 3NL6A 2YCJA 3UNDA 2VRJA 2WSKA 4NIRA 3D6NA 3PAJA 3T4CA 2YCIX 4AXNA 2RDUA 5A2CA 3NTYA 5KZEA 1MFUA 1WV2A 2VCAA 3ELFA 3RO8A 1JPHA 2E7FA 1UWAA 3UF9A 4WRHA 2O9TA 4NZCA 2FZ8A 2FPVA 3VOGA 3GNPA 4HPXA 5D03A 2RGLA 2HDJA 2CHRA 1R38A 1ZAHA 4UFJA 3CAKA 4AIOA 2PDXA 5KZMA 4PMOA 3AUJA 2E4TA 1A47A 3ABZA 4KRZA 3GNOA 2VWSA 2QCCA 2GZXA 4W5ZA 1I8JA 4LUTB 1W9UA 4TOQA 4UTTA 5DEZA 3BGJA 1E1EA 2VGBA 1POKA 4UMCA 4XUYA 4LH8A 1H7XA 5AC6A 2PDFA 5CH9A 4F79A 4R9XA 1ADDA 2ISVA 1CLKA 2ZWYA 1AZ2A 2ZRUA 1HJQA 3DKJA 1LDCA 5KTLA 2NXGA 3W7JA 4CVUA 5HWMA 4EPBC 2RJHA 4UTUA 3AIRA 1BXCA 3M6YA 2WJDA 3SN4A 3TYUA 5AYIA 1F6YA 1XDLA 4HK6A 1G4TA 2CLEA 4FHAA 1UKOA 2QCFA 3S2CA 1EGMA 1F3TA 3BARA 3BLOA 1N8WA 3PNZA 1ZSXA 1R3WA 1JGIA 2GVEA 1M41A 4S3EA 3V5CA 4LEFA 4IUOA 3EX6A 3UBPC 3W7EA 7ODCA 1AQMA 1N82A 1YQ2A 1UH4A 2VUNA 1TCDA 4QLLA 1PHQA 2Q09A 4RCXA 1Z32X 4O1AA 5HATA 4KBXA 4L6HA 4LUYA 1TJPA 2PTDA 3THAA 3R4IA 4LF1A 3LZ3A 1F8MA 2HCVA 1SPQA 1XL9A 3WEZA 4HVXA 3VIIA 5CQ1A 5CZ0A 1XCWA 3WD4A 3N6JA 4HHHA 4IXXA 1FH8A 4GPNA 4DJFD 1TVNA 4AX6A 4ZFMA 3UR5A 2CHNA 4L9YA 4J9JA 4GUFA 5G4WA 1YW1A 5CXPA 2BVTA 1HN1A 4JKMA 3FYYA 3PJTA 3B0PA 1PKYA 6CGTA 1OB0A 1VAHA 4YYFA 4GVHA 4AY8A 2OX1A 2NZLA 4G9PA 1ZZMA 4IM4A 2RGMA 4UFMA 1M9HA 4PODA 3M64A 4GQGA 4OFCA 2GJRA 3UZJA 1YX1A 1UB3A 3VABA 4Z42C 2TAAA 1P0DA 1DBTA 1ITQA 4LF2A 1H41A 1VB9A 2A1YA 4QSFA 3TXVA 5CC3A 1FHUA 4LU0A 2A3AA 2QVNA 4JTDA 2V5CA 4Z0JA 1JXKA 4PBFA 3DAQA 1KM5A 3MV01 1QBBA 2BFGA 2NVCA 4Q8WA 2IQTA 4RDYA 4ATWA 2BLEA 4IJBA 3AUOA 2V5BA 3WF0A 2NLIA 1XSJA 1TV7A 3KOZA 3WDIA 1DE6A 4F66A 4ZB0A 1ZBCA 1FY6A 3TLLA 2J7DA 3GAYA 5CSRA 4JTAA 4XZNX 3S8HA 1B5TA 3TKFA 1T99A 3L4VA 3CQ0A 3E6EA 4PSPA 4PUDA 2WNQA 1ODZA 4XZIA 3BAIA 4QDWA 5CZSA 3N15A 1BG4A 2VURA 4IMCA 3EOUA 2XYLA 4O15A 1PYFA 1WKEA 3FOKA 3FYPA 4PUNA 2J7EA 3I3EA 3AHXA 2XFRA 1PTDA 1W54A 3SCTA 1C8YA 2B0MA 3LCIA 3IGUA 1P48A 4ERAA 1A5CA 4TU1A 4NX5A 3S42A 2Y89A 5DXXA 3GX9A 1QHZA 2F2KA 4ZR8A 3GBEA 2EPKX 2D20A 1XG3A 1KR0A 2JE8A 4KGLA 3IRDA 2QF7A 3GDKA 3QZEA 4RNHA 1OBAA 1IE7C 3N6HA 1FWTA 1S3TC 4I8YA 5BXPA 3GS6A 5K7JA 3QTGA 4WY0B 4CVWA 3GXPA 4GO9A 4GOAA 2Q8LA 3KW3A 4RDZA 1TG7A 3F4WA 4H8HA 3PN8A 4OKDA 3W1TA 2H6RA 3GLCA 1BTCA 3TYAA 4O0QA 4C6BA 4U2ZA 5F2LA 1TPB1 5CGTA 3DHUA 3RR4A 3W6MA 2R6OA 1KRMA 3LS9A 4XAZA 4XIAA 1KO0A 1W1TA 2WO5A 1DYSA 3ARUA 1V7AA 1RXOB 2G96A 3QC3A 5F4XA 3R0UA 1R9ZA 3H54A 2QW5A 2E68A 4H04A 1BGGA 1W9BM 3WQPA 4G7EA 3OG3A 1T5AA 5U4NA 5CPMA 2PGFA 4MWAC 4AH7A 1IEIA 2O92A 2DQWA 3T05A 1E6RA 1G69A 4O17A 3M0HA 1US2A 1NU5A 1GJUA 2W63A 4ACZA 4GUGA 4YXGA 5FAJA 3SN0A 3L4WA 3AMKA 4GO8A 4JX6A 4MB1A 4PRWA 3W1PA 2MANA 4Q8QA 1ITCA 1NJJA 5FKYA 1I75A 1PSCA 1GQJA 4M0XA 1S2AA 3GSMA 4JD4A 4B3KA 3BLPX 1SFSA 3UCCA 5EMLA 5DMLA 5C55A 1U83A 1UG6A 4L1XA 4Z2LA 2ZX7A 1LROA 2OKTA 3H24A 3H2EA 1JG9A 1R3QA 4Q8MA 4KFOA 3QHNA 3TYDA 1R86A 2OU4A 1H09A 4BCEA 2O55A 2PRLA 4XZMX 1LJYA 2AQVA 3N04A 4KGJA 3PZVA 1B1YA 1ADOA 3V75A 2YDRA 1EPXA 2UY3A 4MY1A 4AB4A 3E12A 1O6IA 4ACYA 4FLSA 2ZXAA 4A8RA 4EE9A 1H7PA 2VC6A 1UR4A 2XFFA 5EBUA 3MU7A 1ZTVA 3WH5A 4UMBA 1GPFA 1ICPA 4RJEA 3GH7A 1TUXA 4M6QA 1F74A 3APGA 1UHVA 1DJQA 3RIKA 5FEWA 4XD6A 4HKPA 1RV8A 2PWDA 3GG7A 3GZ3A 1KXVA 1C90A 2OWWA 2FFIA 1Q6OA 5EYWA 4IUGA 3QV9A 4LS0A 2DSWA 4DUOA 3WQGA 2YFOA 2WQPA 1XX1A 4RW3A 3AROA 2WBKA 5T26A 1KBBA 3QRHA 3GU9A 4D8LA 3GHSA 4HIBA 3ZM8A 2E67A 2YBTA 4NJGA 4XAGA 3KWXA 1RCQA 2QDGA 5AHEA 4M19A 3TMLA 1PZ0A 2PS2A 1O60A 2C15A 3MO7A 4D6FA 4A3RA 1DJXA 3MSRA 3W88A 1FXPA 3RG6A 1F9CA 5D8WA 4M51A 1P1MA 4XKYA 3UG4A 4AF0B 1X38A 3ZJKA 2EPOA 4JHMA 4YVVA 1KCKA 1PIIA 1Y8BA 4O0ZA 4WJEA 3MVIA 3TNOA 5EKYA 1ISVA 1FWRA 5K9CA 1XH0A 4AD2A 4O1BA 1S39A 5BMXA 2RUSA 3SRDA 5G4EA 2EHHA 1EQCA 2Z1WA 5FD0A 5C9ZA 3QMRA 4CEUC 1FWFC 2J8TA 3GNRA 3QYSA 2H8ZA 1F76A 1Z3NA 3QLLA 4GA8A 1XRSA 3OYXA 4ZXOA 1KFLA 3BLIA 4KIRA 1US3A 2DH3A 3HG3A 5JU6A 1Y65A 4O53A 3H23A 2VT0A 1E70M 1VBRA 4XTIA 2QS8A 3L0GA 2ZICA 3GDTA 3UESA 3B03A 4MWAA 4F9DA 4YMZA 4JQAA 5FJOA 3HO8A 4UFIA 2QCEA 4AZ6A 3MUIA 2WWDA 2POTA 4TXEA 4XIMA 2EKGA 5G1TA 1QNQA 2XIMA 5TQLA 3L5AA 4BA0A 5DMNA 2B31A 1RHCA 4NYYA 4HNCA 5D32A 1BYDA 4HYVA 1ZJIA 4MJMA 5ECVA 4ZQPA 3PC0A 2QGYA 3N1AA 1IZCA 5ECUA 2DPEA 4M5PA 1LL7A 2BNJA 4QJ3B 4GX9A 3V7PA 4XB3A 1LRNA 1J01A 3QOMA 1VZWA 5CZJA 3THCA 4WCJA 4MADA 5A6BD 3L67A 3O63A 4NZ1A 3WNOA 4H41A 1QHPA 4GH1A 4IX0A 1A4LA 2BV9A 2DT2A 3U8GA 4EF9A 2PCQA 3ZR6A 1E40A 1JFXA 3NQAA 3EWXA 3L2LA 3A4AA 5CBJA 1E9ZB 1SO3A 1SYTA 2FDMA 3FKKA 1JZ7A 2NQ5A 2IKIA 1C9DA 4QLKA 2ZZ7A 4IP7A 1DJNA 1AH0A 2GGJA 3LSCA 5FEPA 2OYMA 1BWLA 3LYEA 4H9TA 4Q22A 2HXTA 3E02A 2VOTA 3C0QA 3W82A 4GQRA 2WMIB 1RJQA 4LQ1A 4WY0F 4O1CA 3JZEA 3WENA 4GVGA 5M2FX 4YTQA 1VENA 4JZ5A 1GW9A 4DUWA 3R12A 1TPH1 3O8AA 1H61A 4UNKA 5BWFA 3DHFA 2EF9A 3ZZ1A 1UBSA 1NAL1 4CD7A 1W2PA 4DYJA 4JQ3A 2H3DA 4Q7NA 2Z1XA 2EQDA 2X40A 3KTXA 3CQIA 4GIRA 4DM2A 4H7VA 3SCQA 4AISA 3IV8A 5M17A 3IGXA 4NVTA 3QV6A 1F2JA 2VTFA 1DL3A 3RMJA 4JTIA 3L12A 1W1IE 2BHZA 1NP0A 2G37A 5FSEC 4D72A 2ZWZA 2PZNA 2EG8A 4NJJA 2NT1A 3ZFHA 3MWAA 3QGAC 2G0WA 2DVUA 1EB3A 4IFKA 1B4EA 1FWDC 1IIHA 3PUOA 2CPUA 3D5HA 4HMEA 1GGOA 2XIBA 2OKOA 1TQJA 3T44A 2ZZ4A 3ITXA 1IQ8A 2CBIA 2JEQA 4XZ9A 1XIEA 3O05A 1DPMA 4E4FA 3OLIA 3FA3A 2CBUA 3AS2A 1EH9A 2GQ9A 4U28A 4J3XA 2WPBA 3E0LA 4GINA 2VC9A 1E9YB 4JTFA 3WLRA 2ACUA 3W26A 4V28A 4NNAA 5E93A 1TPC1 1E9IA 4EVZA 1NFPA 4GYJA 5LNRA 5ENLA 4NZ3A 1YXYA 1R7OA 5I7GA 5HMFA 2V3FA 3WQWA 5I24A 3CO4A 5GPRA 4X2PA 1T40A 3M46A 4EIVA 5IBXA 1FVPA 2WSYA 3VZYA 3VGBA 2X0YA 3S9IA 2XSBA 3WF2A 1UKSA 2X0SA 5EPDA 4K7YA 1MUCA 2X1RA 1UIOA 4JNZA 5AECA 3MKVA 5HMEA 1ZAIA 1V08A 2PAJA 4H3DA 2QUUA 2VELA 1K6WA 1R30A 1ZS2A 2WCSA 4OT7A 4OWGA 4DY1A 3DYPA 1REQB 1ECQA 4XZHA 3LBMA 4QAWA 4JTQA 1HZYA 1JYXA 4G6CA 3AZRA 1MSSA 5FJJA 3W2MA 4ERIA 4KKXA 3KCLA 3MI3A 4J2PA 3A24A 1EYEA 3TQVA 4OJYA 4QIUA 3NQVA 1YLVA 2DQXA 4GRSA 3ZSSA 3W7DA 3UYCA 3TW6A 3QHOA 3RJYA 4HOWA 1PCKA 2VZVA 1KW1A 4PE8A 3NPVA 5FIPA 3EA3A 3QQ1A 1UP3A 2OWCA 8XIMA 1GTHA 1TRDA 3UJFA 4CN6A 4PCNA 4GQBA 4XAFA 3ARYA 3PZTA 2WLYA 1KM6A 2EAWA 2O4QA 4R85A 1QWGA 1NDZA 3L2MA 2I1OA 3B3DA 3H53A 1HIZA 1SO6A 2CYGA 1J11A 3C0SA 4PEEA 2FGLA 5LA2A 2DIEA 4WR3A 3CIVA 2D3LA 3N2MA 1VIWA 1Z7AA 3EWZA 2QVHA 1J0HA 3A64A 4FA3A 5AHNA 3NL2A 4AZGA 4GI9A 1LG1A 3S0CA 1B3VA 4LYKA 4W86A 4XD5A 2GJXB 1FHLA 1MVYA 4F0SA 3WD1A 1TB3A 5AYYA 1FX6A 3VNDA 2PB1A 5CC5A 3DG7A 2FB2A 4S3JA 2HRWA 2TSYA 2CIPA 3MQTA 3BSHA 3SIMA 3DYOA 2WMGA 5CPSA 5F2MA 4J3WA 3W3OA 4FF5A 4C6IA 5FJUA 1FQ0A 2PTZA 2WC3A 3EBVA 3ABQA 1C91A 5D9OA 1UR1A 3MUAA 1YE4A 2O7QA 3TYZA 4JPGA 5A8GA 3WX7A 1AMYA 3URQA 2P1FA 1B3XA 1KFCA 3BVJA 4EX4A 1VBGA 2YA0A 3L23A 5D8ZA 3ARVA 4LB3A 4K1GA 3TJLA 4FP1A 3HURA 4D2JA 3N9KA 4MNJA 1E3ZA 5G1YA 1ONXA 2CNCA 2XTKA 1OCBA 4NJHA 3ARPA 1CWYA 5GJMA 3ZT6A 2DU2A 3EKZA 4JS3A 2Z1BA 1VD6A 4PRRA 1E6PA 4H8NA 3NM1A 5BNKA 3K2GA 2ZQ0A 3U7VA 1DJHA 1GOXA 1CGUA 2YPIA 2J25A 1WKDA 3HGSA 2ZE3A 3CHEA 2DIJA 4E2VA 2CWNA 3PANA 3I68A 3REQB 3WK3A 3NZQA 2VFDA 4MJZA 3A13A 4JTKA 5M1TA 1O5XA 5CLWA 2INEA 2PMQA 2Y0FA 3S5OA 3AIQA 5A3HA 1Z44A 4HHMA 8A3HA 1E0XA 1QDSA 4J27A 3QMTA 2YBVA 3C4UA 4PC8A 2FFCA 3VIOA 3VNMA 2AAMA 4B16A 3BJFA 3OA3A 4BJHA 1B3YA 3W6YA 3SY8A 1Q5MA 3U6WA 2G95A 1I0DA 3EDDA 4DBSA 1EJTC 2C1IA 5JBDA 1UH2A 3BW2A 3ITOA 2FPYA 2OJPA 3CUGA 1CGYA 3QFWA 3I7QA 4Z2HA 3EWUA 2QF8A 3SCNA 3PBMA 2EEXA 1PKMA 1VHNA 2Z1KA 1DJIA 4CQBA 4PBGA 4RNFA 1H1NA 1W8GA 3H22A 2W79A 4PUUA 2QKFA 1OK6A 4NQ1A 3UPBA 1Z89A 1AL7A 4IIEA 1K8YA 3NPXA 1HW6A 1WXJA 3IAPA 2GUUA 2VFFA 4ATDA 2A21A 2PTXA 1C3FA 4NUWA 4ZQOA 2HJPA 3CZ8A 3PPFA 1JUEA 3HJEA 1SR0A 1PWLA 5DCDA 2ZUWA 3WL0A 2Z6IA 4H8VA 4GJIA 2DW7A 4IWWA 1TTIA 5HJYA 1XLDA 3R58A 2DVTA 2Q6ZA 5BOFA 2VMFA 1KC7A 4QAIA 1M7OA 1WZLA 3IACA 3RUBL 1Q3NA 2VL4A 3V4BA 1AMKA 2IPGA 3SIZA 3GUWA 2WHKA 5KEZA 1PXGA 1UZDA 2VC5A 4MZ8A 3WH6A 3WY1A 3ZJ6A 2KX9A 4UR7A 3DFSA 5CSYA 4FNUA 3VMNA 3SAZA 1ICSA 4Y8EA 4K37A 3VOHA 4G8TA 2KZHA 4I9MA 4MJ4A 3W2LA 1IHIA 4H19A 2Z25A 4X60A 1TWWA 1V3HA 5LGXA 2DJLA 4MYXA 2CCRA 3H2CA 4C6EA 3IAQA 3GIYA 1GK8A 3CM4A 4C6JA 5XIAA 2XN1A 1NIUA 3AICA 4IX2A 2J9XA 2VWTA 2JQXA 2HPIA 1SFTA 2J7GA 1MNZA 3VCRA 1JPMA 2QV4A 1J96A 1W3JA 4QEEA 3ARQA 5FCZA 3CO8A 3VIFA 2Y8VA 1KA9F 1GZJA 4C7DA 3RFAA 4TMCA 3F4NA 3TJIA 3Q67A 1PB0A 4X0VA 3HQNA 3GG1A 3RAOA 2AAAA 1E0VA 1LL4A 1CNVA 3P8JA 1GVQA 4C6PA 3LBOA 3BOFA 3C3NA 1CLXA 2VEMA 5IM51 3QM3A 4EXQA 1DQXA 5HNUA 1I1WA 2QLYA 6XIMA 2G41A 2PWHA 5E9AA 3GR4A 4UNIA 2F38A 2G8ZA 3A5VA 5I09A 2OR2A 4GGBA 1K6AA 3Q58A 5EMUA 3KL3A 3NYDA 4LUTA 4V27A 5FI8A 1W3HA 3GXMA 4I9TA 2QAFA 1S1PA 4MZ1A 3SGZA 2I14A 3NQCA 4IQDA 4JHOA 1HG3A 4U33A 2VX6A 4EPDC 3WBAA 3N2TA 3NSMA 1A53A 4P5UA 4LBSA 2ZVIA 5HAOA 3C3UA 2PI6A 1OFQA 3EOOA 3ERPA 3IJQA 5D9MA 4D6JA 1TCMA 3SJ3A 4IHCA 3FS2A 3LXBA 2G3NA 2X2GA 3EOSA 1JCMP 4CQ8A 1EBHA 3JR2A 2A0NA 4Q4KA 1VKFA 5D33A 1JZ2A 4PUJA 5IOBA 3PK7A 2NQHA 4UWMA 3LA4A 1OG0A 2D23A 4N6FA 4ZVJA 3BLDA 3KOYA 3DU0A 3CZEA 2V3GA 1IT7A 1MXDA 2PWGA 3GW0A 3IIVA 3R7MA 4ROQA 2X30A 2ZBTA 4URIA 4LUSB 2ZRXA 4C6OA 3MCNA 1W1VA 4PUWA 1RBOB 3BJTA 3T2QA 3PSWA 1LG2A 3IK4A 3R43A 3L5MA 4ORMA 3ISIX 3LOTA 5A6MA 3W7RA 1BPLB 1V02E 1R6WA 3VGEA 3U4AA 3PG9A 3EWWA 3FDKA 2O7SA 2ONEA 1MEIA 4S2BA 2ODOA 5AY7A 3HA1A 3MS8A 4GYPC 3RU6A 4JFUA 4MHBA 2IPWA 4QISA 4HCLA 3LXAA 1TZ9A 2RAGA 5CSUA 3BG3A 1UWRA 3OEXA 1XIFA 1TQXA 2Y7FA 1UMYA 3OO2A 1RCOB 1NWSA 4HOZA 4MNLA 3EPOA 3I6RA 1YE6A 4AHOA 1Y5XA 2VX4A 3EMQA 3BAWA 5G2IA 2HK1A 3F2CA 3CH0A 4CCEA 4GY1A 5DY3A 3TQKA 4FXJA 1PIGA 2OZ3A 1E0TA 3LG3A 1QFEA 3G6MA 5BXRA 4ZZ9A 3WLQA 1VYRA 4QJ1A 4IL0A 2TRSA 2PWVA 3SSZA 2YYUA 1ZJBA 3N2XA 4H00A 3TE9A 3PBGA 1V79A 2NQZA 2ZVRA 2UBPC 3W75A 3OLGA 3DBNA 4LW7A 4DUVA 2J4GA 3IWPA 1S5NA 3I7SA 5M03A 3DGBA 1GEQA 1J18A 2Y6ZA 4C65A 3VD7A 3VK5A 3MSDA 1R3RA 4DWSD 4L5ZA 3E5PA 4KWUA 3LPPA 2PDLA 4C5ZA 1BHGA 3HQ1A 1IXNA 4AD3A 4I3GA 1PTAA 1V02A 4NT0A 3C2EA 4CU7A 5F4SA 1QNRA 3GE7A 4QCFA 3TDFA 4W8AA 3VD5A 1YNPA 2XM2A 2PDUA 3UG5A 1K9EA 4DJED 2EPMX 4S23A 2V0TA 3SUVA 3IJIA 3WDQA 4I8DA 3CQJA 2H8XA 1LTDA 1A5BA 1CXLA 1OHLA 2ZRWA 3LNPA 4AYSA 1D7KA 1VFUA 1C8XA 2DH2A 3LHZA 3P5YA 1WZMA 2OX4A 3NZRA 4GFIA 3T42A 1E4NA 2XUCA 1GHRA 3II1A 1MUWA 4A8NA 4GQ0A 1RP9A 4HHLA 1EA9C 4LAZA 1MNSA 4LSBA 3NDYA 2YKKA 4POCA 3QR3A 1OG6A 2Y1HA 1EHAA 4UTWC 4RE2A 4OBSA 1TV2A 3WF4A 3EX2A 1MWOA 1XG4A 3SURA 1JZ6A 1EJ7L 1ZENA 5BRPA 4RE4A 1DWAM 4G1KA 4WXYA 3K13A 1QPNA 4B9YA 3GB6A 4KH2A 3F5KA 1V3IA 3ALFA 1ZJAA 3W86A 2PBOA 4L80A 3AU2A 3BICA 4NU7A 2I17A 3VNYA 2WZHA 4YCOA 1WKYA 5HNTA 1V4YA 3VPLA 3EKGA 3AZTA 3PTQA 2DZAA 1NTHA 1A0CA 3PULA 4HNOA 4WGXA 3FN9A 1GTEA 4B5VA 3UWWA 1ZRQA 3CMJA 3TQ0A 4Y9PA 2BHUA 3VM5A 1FTXA 2WVSA 3O0KA 4PTVA 3EXRA 1QT1A 3C0LA 3TZFA 2VEFA 4PCTA 9XIMA 3OA5A 3QGVA 1V3JA 2Z0IA 4X2RA 1TPEA 4KWWA 4MB5A 4GI6A 4V15A 2WJEA 4HT3A 4FIQA 2D1ZA 2CERA 3RMEA 3ZWTA 3H8AA 3W1RA 5CGQA 3W7LA 3GUGA 4PMQA 5MHBA 2WC7A 1KBLA 3RRAA 2B7QA 1FCBA 3VYLA 4E8GA 1HL2A 1E0UA 5HQMA 4LCRA 7REQA 1K8ZA 3UPMA 1B3WA 4NNCA 4W5UA 4IQLA 3EGJA 1RAKA 1WOBA 4JQ2A 4B4HA 5DQPA 2FJUB 2V30A 2VEPA 4IMEA 2HQAA 2VC7A 3GD6A 3GM8A 4I6VA 3W4RA 3DFOA 3HFTA 4GGHA 3E2RA 4N02A 4H9MA 2DZWA 4GD0A 3T2PA 1OC6A 4AHQA 4R88A 4QE5A 5DT7A 2FZ9A 1H11A 1Q8AA 2G4JA 2QPXA 4IIHA 3VNZA 1U33A 1JDDA 1LLOA 3MB9A 1D3HA 3AAMA 4IFOA 5HWNA 1O66A 3BLLA 5D2XA 3FAWA 2JGYA 1JNEA 4LWWA 1HKIA 1XLGA 3BV4A 4JCLA 2ZKMX 4AMCA 3RDKA 5HJXA 1XINA 3PTMA 1V6WA 4A3QA 2YL9A 4MNMA 4PUEA 3LCGA 3PB2A 3PB0A 2GQ3A 2Y5EA 3W0KA 4PMDA 2XISA 1FXQA 2F6UA 1DWGM 1OFRA 3PNUA 5BXTA 4GNKB 4GLEA 2VOMA 3GYEA 3LBCA 2QJJA 4MG4A 3LHUA 4Z1AA 3HB9A 1WYIA 3INPA 2WV8A 1V0LA 3N3MA 2VD9A 1HX0A 4DLFA 1TWIA 4QSHA 3HIJA 1GQNA 1KR1A 5CBBA 3W28A 5EFFA 2PC4A 4R7WA 2HVNA 4LVDA 4C1NB 3U3HA 4O28A 1Y7VA 3OODA 4JFVA 1XBYA 6PTDA 3DUGA 2V2CA 4Q4RA 3KVMA 5REQA 3WCZA 2QIWA 4GIAA 2PRHA 1G1YA 1TMHA 2C16A 7CGTA 5I5RA 1LLZA 2NVAA 3TUUA 3CTTA 1E73M 4NG3A 1DXFA 1W32A 2V5LA 2QCGA 4YN5A 1JCNA 4DHGA 3W7PA 4ALDA 3C5QA 1XBXA 1NDVA 2XVGA 4JTGA 5E9XA 1SW7A 2F7FA 4BS0A 1W91A 3AXXA 3LTPA 1IEWA 1MXSA 2PWFA 3QJAA 3R79A 5A8MA 3N34A 1XLEA 4F0HA 2DZUA 4GACA 3HV8A 5IBXC 2ZZ2A 4ZMGA 3K46A 4PMXA 1TA3B 4QG6A 4MUPA 5A6LA 1MQPA 2A3EA 3O9NA 3PPHA 2GQ8A 2HS6A 5HUPA 4K2SA 1EZ2A 1E1FA 1T8QA 1TR1A 4N0RA 4DWSA 1RQBA 2Z00A 2YGYA 3QKEA 4JQ4A 2PDJA 1KB3A 3W1QA 5LIUX 4O11A 1P6WA 3RF9A 4IPPA 3AYSA 1YPIA 5LNVA 2G97A 1ZCCA 4HD5A 1UWUA 2X7WA 2ISDA 1XFBA 3OPSA 1NWRA 3CAQA 4AEOA 2VGFA 3FIGA 1AJ2A 5CC6A 3V5FA 3GK0A 4KFPA 2HWGA 4W8BA 1JFHA 2F61A 1A5KC 4RZ6A 3W1XA 1LQAA 2ZUNA 3PHAA 4GKTA 4MMWA 4E2DA 4J3ZA 3WKZA 3OU8A 4HP5A 3M5XA 5A5WA 2A3HA 2A6LA 3SSJA 2VR4A 1B4KA 4D6GA 2O4MA 5A2AA 4QE4A 4ZFCA 2XG9A 3OLEA 3WELA 2HMCA 1BEUA 3PFRA 3PY2A 1C92A 4FLRA 1GPWA 1IIGA 3VD3A 2WVVB 4FI4A 3LB0A 4PSRA 2QT3A 2H3BA 5CG7A 3UGVA 4GWEA 3GXTA 2Z7GA 2JGQA 3PZQA 4JCMA 1R9XA 3QMSA 2OSWA 1TE6A 3IV3A 1Z48A 1IR1A 2AL2A 3LDVA 1J9YA 3NG3A 5DMYA 3MC5A 3GBDA 3WFZA 2EG6A 2VFHA 1S5WA 3UNTA 1XUUA 1FKXA 3TN6A 3WUEA 2DZVA 4QQUA 3T08A 2HE5A 4BQ3A 3CUHA 2J7CA 3S5NA 1XSKA 1FKWA 2Y62A 1R2SA 4ICCX 1NQ6A 3W2NA 1DTUA 1A49A 4O16A 1UZ1A 3NVTA 1LT7A 4IZGA 3QV8A 1DORA 2V8ZA 3VDCA 1FHVA 1A0DA 4NXSA 3GU1A 5DRIA 4S3GA 3M0MA 1V3LA 2BOFX 4WZHA 3I65A 1JCJA 4C7FA 3BO9A 3DFHA 3O06A 4A21A 1W37A 4NJKA 1OCQA 3L0NA 4WGHA 2ISFA 1IT0A 5T9CE 1I2OA 4D1IA 4NL1A 4FR1A 3T8QA 1Y5VA 3B8IA 1R3SA 4FX8A 4GBDA 4LV9A 1CXKA 3GKFA 2ASHA 4NRSA 2VDIA 2O56A 3RLHA 4J1OA 1FP9A 4XWUA 1AJ0A 4DZ5A 5HA7A 1PUDA 3YPIA 4J3VA 2HROA 3N3TA 3EWYA 3CUZA 1YADA 4O4VA 1NP2A 3GXFA 2W6RA 5E0FA 3UW6A 1DIEA 1VBJA 2Q8ZA 1AH4A 4ZEPA 2FQIA 2XGZA 5C2XA 1DP0A 4H9ZA 3EX4A 4HQVA 2CITA 3TCEA 2AQWA 2V5KA 2QEZA 1W3TA 1HQTA 1Q6QA 3HJZA 3ANYA 3QC0A 3W22A 3KL5A 3TV8A 2WZMA 1W9XA 3OZYA 3N29A 4KEZA 5A8NA 2OZTA 3BG5A 4L1GA 3I10A 4AZ7A 1OFAA 3VUSA 1E5NA 1YDYA 3SFKA 3RM8A 4MKVA 3LHYA 1CIUA 1NARA 1DQWA 2YL6A 1ONRA 3LQGA 1LWIA 3T09A 2HVOA 1UD5A 3B9EA 4FXSA 4PB4A 3L7RA 1X7IA 5D37A 3P8IA 5E0CA 5C9RA 1HF6A 2PTYA 5H8UA 3UWEA 1KFWA 4IFRA 3PR2A 2XPKA 5M3WA 4PMRA 4WX2A 2OQYA 4PN2A 1KM1A 4WUIA 5BCAA 5G1MA 5HXMA 3UQNA 4E4PA 1S38A 3COTA 3O6DA 1JXJA 4S3BA 5LYRA 4TX8A 4ASTA 3SCUA 1KQZA 3GNDA 3LTSA 1X8CA 3IIPA 3V1HA 1VFLA 3R94A 3IUHA 1XGZA 4MNKA 2DW6A 4M1RA 1T8XA 2QCHA 3GRIA 1V6TA 3TC6A 3AXMA 2HBVA 3AYVA 3T55A 3L4UA 4EANA 4JX4A 2AL1A 4UCGA 4DQWA 4FAMA 4NZJA 1W5OA 3LRLA 4V1YA 2WLZA 4GIYA 3C52A 2J88A 1UR3M 3FGCA 1OABA 1O5QA 3IIOA 3N9SA 2RKXA 5E09A 3BMWA 1RK6A 3SM0A 4D71A 7XIMA 2OT0A 3NL5A 3G8EA 1V8EA 3UG3A 2FGZA 4LC6A 5EY5A 3QW3A 1FA2A 1Q4NX 2WQDA 1KGXA 4H6EA 4WDXA 4C1NA 3LQLA 4XVDA 3NSXA 3DH7A 4GXPA 4XD3A 1FBAA 4AD4A 1RCXB 3P80A 2GGGA 3SQSA 4B5NA 5I3KA 3BGGA 3ENLA 3VOFA 1B57A 3HU7A 1OC5A 1XLAA 5AOUA 3V0TA 2ZZ6A 4PTMA 1P6CA 4R27A 3RX4A 1F5ZA 1MRAA 3WNKA 4ZE5A 4K8GA 4UZSA 2Y85A 1XQLA 1L6FA 3VUPA 5K9XA 2FVLA 3W7KA 2VHLA 7PTDA 2YCEA 1RPKA 4UQCA 3M5ZA 1H51A 5LIYX 4IP5A 1S2UA 4H2HA 1C7SA 1W5NA 1BGAA 1W56A 3S6DA 1XIJA 3SO7A 3CPGA 2XFWA 3H2AA 2GVLA 3R1ZA 3W29A 2PDNA 1AODA 4HJWA 4NKCA 3H4XA 5C9WA 4HPJA 1JPIA 4NSBA 4TTUA 4P8VA 3MMTA 4JYEA 2WSRA 1AQ0A 1K03A