4H6KA

W116i mutant of oye1
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 155
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4h6kA00
1DORA 5TBOA 3TXZA 1OX4B 4OGZA 3S9YA 1K03A 1VS1A 1ZENA 4UXDA 3IIZA 1YPIA 4ICNA 2GUUA 4IX2A 3EB2A 3SIZA 3ZS4A 1FCBA 3G3MA 2CLEA 4RR4A 3LCXA 4NX0A 4O17A 4IGHA 3ABRA 4ZVJA 1SO5A 5K7JA 2NXGA 2E5DA 4AAJA 1P1XA 5F2IA 1MSSA 1KLYA 2PRHA 2X1TA 4CNOA 1X7FA 1UB3A 4O0KA 1ZFJA 1H7PA 4HSNA 1NSJA 4MZYA 2QDHA 2ZQ0A 3OVRA 5AYXA 2G95A 3AO0A 1KFBA 4UR8A 5TQLA 2WO5A 2QCFA 1K7FA 5AB3A 1Q6LA 1K8XA 1QR7A 3W7QA 2QJIA 2Y62A 2HS8A 3KX6A 1AW5A 2JKPA 3IV3A 5I3HA 5DY2A 4FEZA 2VEMA 4W9TA 1VLIA 5D32A 2QCGA 4I9AA 3A5VA 3TC6A 3LLDA 3IGSA 2VC6A 1KA9F 3FJLA 4M6VA 3HG5A 3C2RA 5FEXA 3UYCA 3BGJA 4MZ1A 1NVMA 3CC1A 3EWUA 1GVSA 3S5OA 2YPIA 3L0GA 4NNAA 2QJGA 3GR8A 4JICA 4OU1A 2ISSA 4UTLA 1IGSA 3N9SA 3ATZA 5A8GA 2YX0A 4LVBA 3WJWA 3VE7A 1XDMA 5F2GA 4N6EA 1K7EA 4MY1A 1BWKA 4LRTA 3W86A 4RXFA 4K7YA 1B4KA 1JUBA 1WA3A 4UNKA 1TPFA 1GT8A 3IEBA 1BTMA 3MBFA 2TSYA 4JX6A 5D2XA 3LERA 1JQVA 5C2XA 3M16A 3W7DA 3M5VA 3MHGA 1TPWA 3HG4A 2YW3A 2ZZ3A 3ZR4A 4LY8A 2A7PA 1HO1A 2ATSA 3S5NA 3QMSA 4CCEA 3CEPA 4O18A 1LBFA 4O1CA 4HSOA 2DZSA 5FF2A 3ZWSA 3UPBA 1QMLA 5CZ0A 4HPXA 1UASA 5LKYA 4IOTA 1F05A 3P80A 3A9IA 3NO5A 2WJZA 1X1OA 3DAQA 1BKSA 2YXGA 4GJ1A 4K7VA 3PG9A 1FWNA 4CQAA 5C6MA 4WD0A 4JTIA 3STGA 4O10A 1UBSA 5HNRA 2Z1BA 2BXVA 2Z2UA 2ZDRA 4IX0A 1KTNA 1P4CA 4IQLA 4CNPA 2V9DA 3W2UA 4RLIA 1KTCA 1OFQA 4BK9A 3P60A 3CIWA 3G1DA 3KRSA 3O63A 3OIXA 5F4WA 3WJSA 1F76A 2NV2A 3M5XA 1VH7A 3EX3A 2XN0A 5EA9A 4JIQA 3QMTA 3NR0A 1ICQA 3P5ZA 3LRMA 1QO2A 1SR9A 3W83A 1LROA 3DI1A 2VOMA 4YLWA 4FIQA 4XWUA 5AHMA 4N9BA 3UY8A 2J9YA 1FCVA 2ISWA 4S2BA 5I3GA 4UTTA 1X8FA 3QEZA 3NXFA 1G4TA 4Q4KA 4LVGA 4NZJA 4UFLA 1UUMA 3HPXA 4CNNA 3HBLA 3W1QA 3UWUA 1JCYA 1L2UA 2ZBTA 3DI0A 2A7RA 3F4WA 4NJJA 3LTSA 3WJXA 4A22A 5K4XA 3I7SA 2O7QA 4PC8A 1O94A 3EKLA 3BG9A 1XBXA 1JJKA 1GG1A 4JXCA 3C2VA 3WK3A 1M5WA 4JNMA 3G1FA 1RPXA 4MJZA 4PH6A 1G67A 1RR2A 5CGQA 4Y96A 1SSGA 1GEQA 5HINA 1JUEA 3H53A 5D02A 2ZRZA 3G3DA 1DKWA 3M7WA 1KV5A 2Y7EA 2Q3OA 3BW3A 3QSTA 1YTEA 5U7SA 4ONVA 3DZ1A 3G8EA 1QO5A 2QCLA 4FNTA 3H54A 2I1OA 1OFOA 3B4UA 4EWND 5K9CA 1LOSA 2CZDA 3EKZA 3GDTA 1Q45A 1F6PA 2WOQA 3NQFA 5D09A 1NF0A 1E51A 4UFHA 4NT0A 2OMAA 1HUVA 3P81A 2W6RA 2A6LA 3BPWA 1SQ7A 3EEGA 3F1QA 4UIOA 3LCIA 1B3OA 1SO6A 4UC5A 3S1WA 1JCMP 2V5LA 4MY8A 5LHEA 3EX4A 3SZ8A 2JKEA 3CWNA 4E0CA 3HPZA 3W87A 5L6UA 1PCWA 2XN1A 2ZZ5A 1DJNA 4LUJA 3IRDA 1W56A 3EWBX 2QEZA 1SUXA 1KFCA 3KVJA 2NX3A 3LHTA 1D9EA 5U4NA 3PY2A 4KFNA 4N9EA 1J5TA 1S5TA 1F2JA 1QPNA 1LDCA 4AXKA 1PS9A 2CZFA 1RVGA 3HJZA 3TIMA 4M7SA 3PF3A 3WK1A 3W85A 1Y0EA 1ZY9A 1EX5A 2GQ9A 2WSRA 4NNBA 5HR7A 3GX9A 3SI9A 4S1FA 3P61A 4AF0B 2TRSA 4I7WA 1YADA 3NL6A 5AOUA 2EPHA 4MIMA 2XFWA 4YCPA 3VCRA 3MJYA 3LHZA 4TR9A 1ONRA 4FXSA 4PL2A 2YGYA 1KFKA 2AAMA 4QQ3A 1KV8A 3W70A 2JKAA 3N14A 3W07A 2C6QA 3KVKA 3UNDA 2BZNA 5LNSA 3TSMA 5FEPA 4JS3A 4MYAA 3TC7A 2B0MA 3L5AA 1KBIA 2LLEA 2WV8A 4MY9A 3F4NA 3N19B 2FDSA 3PBUA 4HPJA 3RNDA 1LM1A 1VGAA 3O1NA 3CT7A 3O05A 3QF0A 4UTWA 1DHPA 2ZZ7A 3NM1A 2BSLA 4KKXA 4CCDA 4MLRA 4HNTA 1KFJA 3BK0A 1KTBA 1VQTA 3VI2A 3P8IA 1KM1A 1FQ0A 3TNOA 5FF3A 3FFSA 2Y61A 4MVAA 3NDOA 3FKRA 3SSJA 5KZDA 3TXVA 1GVQA 2EHHA 3STEA 2NXHA 1ZAJA 1GQNA 3P74A 1FXPA 1G4PA 2FFCA 4FHAA 3S1VA 2C16A 4O14A 5EKYA 4GUIA 1XL9A 2V2DA 2B7QA 3P82A 1H7RA 8TIMA 4H3DA 5I3JA 1PIIA 4JTLA 4K39A 5KZMA 4IUOA 1JR1A 3CHVA 4RXGA 1XC4A 4Z1CA 1MZHA 3INPA 3MP5A 3DFSA 4MFDA 3KRUA 2GVJA 4IJBA 2BLEA 1KM4A 3PSWA 2QAFA 1OABA 3O6YX 3QPYA 4K8HA 3RLVA 2GVLA 1T96A 3EWYA 1JQXA 5H2ZA 3QMRA 2ZRUA 3BV4A 3LX9A 1EP1A 4LWWA 3PVFA 4KFOA 1BWLA 2FLIA 2W0UA 1CX9A 1Q6QA 4WY0F 1LRTA 2XN2A 1LORA 3PWAA 2QCDB 5KTLA 4PODA 1TMHA 1F74A 4QISA 3N2MA 1HL2A 2A1YA 3W75A 4HHPA 4B5NA 3W72A 3NOEA 1FCQA 2ZA3A 3CIXA 4JEQA 4ZQMA 4IWWA 2R14A 4FX7A 3W1TA 2AGKA 3SW6A 4IMCA 4UFMA 1KFLA 3DGRA 3Q94A 4GRSA 1GZGA 4ADSA 4DBDA 1W37A 3RU6A 4BWLA 1P5BA 1B4EA 4PEKA 1PL9A 3C61A 5AC7A 3TMLA 5D30A 4N02A 2DZXA 1R2RA 2CWNA 4GXMA 3PG8A 2V82A 3MI2A 3G0SA 1XM3A 5K9DA 3W1XA 3C2OA 4UTKA 3L2IA 1GJPA 5AHEA 4O57A 1KFEA 1JCNA 4JTUA 3WJZA 2QCHA 1ME8A 1G69A 3RLUA 2VFDA 3R8RA 4LS2A 3S0CA 4XTIA 3NM3A 1ICSA 3TKFA 3NL3A 3P7YA 5CPOA 4UTJA 4YCOA 5D2WA 1QPQA 3LHWA 4JYFA 1AL8A 4M5PA 5BMWA 1TQXA 2JBMA 3FYPA 4LS1A 4LRSA 4AB4A 3LLFA 4C1LA 3L9CA 2ZA2A 2ISVA 3QC3A 5FESA 5SWUA 3G1AA 5F4SA 4NJGA 4R33A 3W7LA 1H61A 3MWAA 3RF9A 4DO5A 4O0ZA 1SW3A 4NXKA 1LOQA 4I7UA 1BEUA 1S3HA 2NWRA 1JCXA 1QCWA 1O60A 3QW3A 1UCWA 3W74A 2QUTA 2X1RA 1YDVA 5EY5A 3KOFA 4ZMGA 2GJLA 1OFAA 2R94A 2J24A 4DO4A 1H7OA 2RHGA 2A5HA 1TV7A 1JCLA 2YYUA 4DXVA 2CU0A 4EOUA 1HG3A 4LS0A 4HNNA 1ICPA 1OHLA 3WK0A 4Z08A 4NU7A 3C2FA 1IXPA 1A5CA 1I45A 4BFAA 5D05A 2JK2A 5KINA 3F03K 1XBYA 5HQEA 3L0KA 1TV5A 2NV1A 4UUIA 4XTDA 5CZSA 3UWWA 1WV2A 1NF7A 2WSQA 4PFMA 2ALDA 4OV9A 1Q3NA 2Y7GA 1VJIA 2RDTA 4AHPA 3EWWA 4PCFA 1V7YA 1PCKA 5AYZA 4UFJA 4AHQA 2C1HA 4Z1AA 1OVDA 1DV7A 4JX4A 1W0MA 2D73A 4O1DA 1W5MA 1SZGA 3G22A 3HIJA 1TTPA 3IVTA 3OG3A 3S8HA 2CLOA 4Y8FA 3TAKA 5D2VA 5A5WA 5DELA 4K38A 3TQVA 4E38A 3O16A 1AK5A 3IGUA 1GVFA 3DH7A 3NL5A 3KXQA 3UXDA 3PSVA 3O06A 1RD5A 1KM5A 1IXOA 2YZRA 3L68A 2F7FA 3HB9A 1FWRA 1IF2A 4JYDA 5CPMA 1KM3A 2E6AA 5CSRA 2O7SA 3PC0A 3T7VA 3P62A 1KLZA 3FA5A 3CQ0A 1LCOA 5TIMA 3W2NA 5AYYA 1DL3A 3T78A 4A21A 2A2IA 2PE4A 3TR2A 1H5YA 4KWVA 3MYPA 1R2SA 3W22A 3GKAA 2E68A 3QW4B 3BG5A 3V75A 4E2DA 2C14A 3LCLA 3M41A 4WY0B 1QWGA 1YXDA 4FNRA 1WBHA 1FDJA 2Y7FA 4OBTA 4O13A 1LBMA 3BARA 1X6UA 3FS2A 1OK6A 3CM4A 4UNLA 4ZQCA 1JUKA 1L6SA 1OFRA 3B05A 5EMUA 2Z0IA 3A22A 5E0KA 5DCEA 1R46A 5LGZA 1XDLA 3TQKA 3OA3A 4N2YA 4OV4A 4MUZA 1B57A 1MEHA 5D2YA 2PURA 2G97A 2EGZA 3BW4A 4ORIA 4BI5A 1TPDA 4UMCA 1T0OA 1U83A 4GUFA 2B4GA 2WNNA 5D38A 3SR7A 4BI7A 3N2XA 4GUHA 1WAUA 4O1BA 3ELFA 1RZMA 1WXJA 3GKFA 4FX8A 1IXNA 3M6YA 3TK7A 3WFAA 2YCEA 3VNDA 2CW6A 2NUXA 2H3BA 3TW7A 5KMYA 3PR2A 3QQ0A 2ZRVA 3C2EA 4DQWA 4JTFA 2X16A 2H3DA 3A21A 3W1PA 3LV6A 1GVOA 3DKLA 4MPQA 3PB0A 5K4ZA 2W79A 3VKJA 4UMAA 3OHIA 3W7EA 4RZ6A 3KAOA 2DORA 4HNVA 3ATYA 2E6FA 1SZNA 1R47A 3W7MA 3LCFA 3EX2A 5C54A 1J2WA 4U28A 5BOOA 3UXAA 3LV5A 1YXYA 4KWWA 4EF8A 4N4QA 1ME9A 4XUGA 3JRKA 3KHJA 2OJPA 2PCQA 3LCGA 1AW2A 1H7NA 5J5RA 1F7BA 5AHNA 3GYEA 1JRCA 2I9EA 2PRLA 3O07A 3P8JA 3EXRA 2X2GA 3DHFA 4MYXA 5LNWA 3UWZA 3TU9A 3EX6A 4FF7A 3TFCA 2ZZ1A 1LRNA 3CU2A 3GK0A 3QM3A 4YWIA 4FX6M 3NL2A 2VENA 4ADUA 5EBUA 4LV4A 3BW2A 5LGXA 4LOCA 2V30A 5FEWA 1IIHA 3DFTA 3N73A 5AFDA 1W5OA 3IVSA 1VRDA 3N9RA 3GVGA 3NVTA 4JY9A 1GVRA 1G6CA 4QSHA 1WDWA 3SECA 2UV8G 1NFBA 1EA0A 2GJNA 1VCVA 3I7RA 4O52A 4HN4A 4QAIA 4CQ8A 3IVUA 3TROA 3W7JA 1EP2A 3MO7A 3W7HA 4GUGA 3TDFA 1OFPA 3IIVA 2VFFA 4IXXA 2Y88A 1A5SA 4WJEA 1MO0A 4Y90A 4IMEA 4DF1A 3SY5A 3OEXA 3GXPA 1YDOA 2RH9A 1H62A 3CTLA 4AWTA 4O4VA 4NVTA 3NGJA 1YLVA 4JDBA 2VKZG 3B04A 3W7RA 3HPSA 3NPWA 1H51A 5H91A 2PRMA 2DZVA 1OK4A 5FI8A 1DQXA 2ATMA 3LOTA 1FWTA 5DN1A 4WUIA 3K30A 1W3TA 3G1XA 4BI6A 2AQWA 3G24A 2E09A 2RDUA 1YYAA 2J9XA 3AJXA 3FIGA 3HGJA 4NJHA 3TAOA 1EWDA 2RFGA 4AH7A 4R53A 4X2RA 1RQEA 3W7IA 4NXSA 2CZEA 4RZ5A 4ALDA 3TJXA 1D3HA 1YXCA 3LDVA 2C19A 4NJKA 3DBPA 3S1XA 5FF4A 3W2KA 2E6YA 2YR1A 4EF9A 4Y9AA 1DOSA 1UJPA 3W88A 4FNPA 5DBTA 4C1KA 4XZ9A 4UFKA 4L4MA 5EPDA 1AMKA 2EF9A 3TH6A 1Z48A 4AHOA 1SFJA 5F1UA 4RK8A 2H6RA 1VHCA 3D0CA 1PV8A 2TPSA 4NJIA 3LI0A 2WQPA 2IQTA 2Y7DA 3KVLA 3M1ZA 1K3UA 3HG2A 3NEVA 4KFPA 3UD6A 2G96A 3W7CA 1EB3A 2J88A 1LTDA 3G1HA 3LM7A 3T44A 4TMBA 3DU0A 2A4AA 1JVNA 1FXQA 4M6PA 1PE1A 4UCGA 4JX5A 1TPH1 3L67A 4PTNA 4O12A 2VFIA 3OBKA 4O28A 1H1ZA 2JGQA 4A2RA 4LVAA 3QQ1A 4O16A 1GTHA 3JS3A 1A5BA 3MMTA 3TA6A 4AMAA 3V1PA 3W7PA 5IBXC 3MP3A 3IGXA 4Y6GA 3GAYA 3USBA 1K8ZA 1TSIA 3LCHA 5E1QA 4ZQNA 3UZJA 5T26A 5DCDA 4M7TA 2QR6A 3P5YA 2TMDA 4XBSA 1WQ5A 1T99A 3DFPA 4DEFA 3I7QA 4L4LA 3NG3A 1DJQA 1K02A 4YMZA 4BF9A 4LUIA 1XFBA 4GC4A 4RKAA 2EAWA 4H4IA 2GQ8A 3ANYA 3OVQA 4O8RA 1Q6OA 3G0UA 2E6DA 1ALDA 3O8AA 3C0JA 1FDZA 1VYRA 3P84A 4FNQA 2NUWA 4LTSA 1SW0A 2DJLA 1FBAA 3T4CA 1I2NA 2B7OA 2FPVA 3QYQA 5KZEA 2QCCA 3PBWA 4JD4A 1TPEA 3G18A 3Q2DA 3THAA 2ABAA 5AC6A 3NQ7A 1TIMA 5MHBA 3R12A 5CPNA 1TYGA 3LRLA 1K7XA 2NWSA 4UMBA 3NYZA 3NNTA 1KM2A 1WOBA 4O4WA 3HO8A 1PHQA 5C5YA 4K6AA 2YW4A 4LVFA 1FX6A 3H55A 3HQ1A 1TJRA 3W2JA 1H7XA 4AVFA 3L5MA 4H6KA 2NLIA 1EPXA 2YYTA 5BW6A 4P61A 3W7GA 4LVDA 4IMGA 1OG0A 2NZLA 2QCNA 5G5IA 2E1DA 1OYBA 5IM51 2CFFA 4CQ9A 5FF7A 4S2CA 3GXNA 4LV9A 2B7NA 1OJXA 3N3MA 4JR5A 4RJEA 5LZLA 3VFLA 2ZYFA 4QM1A 3CWOX 1NEYA 3L21A 4QITA 3UWVA 3TCEA 2CLFA 1CI1A 1U5JA 3E0IA 4IMDA 1I2QA 1F73A 3NA8A 1A50A 1TREA 4NNCA 2C18A 1LBLA 5D03A 4ML9A 1C29A 3NQGA 5AHLA 1F6KA 3PULA 5DLCA 1OYAA 3NQ6A 2Q8LA 1OF8A 5I3FA 1EUAA 2QAPA 3LXCA 4LU0A 1W3IA 3S5ZA 3O6DA 3M9YA 3B8DA 1TV8A 2ZZ4A 4LNYA 1HTIA 4JTEA 3W1UA 2YFOA 4WX2A 3U2OA 1N55A 3PS7A 3W7NA 5G2IA 4TO8A 3TFXA 3LHUA 3R89A 4QNWA 3LBCA 1H60A 5EL1A 2E5CA 1XBVA 3BLFA 5D33A 2DZWA 1W54A 4LC6A 4Z1BA 4NX5A 1TRIA 4CCCA 1TPB1 3W71A 1GWJA 1L9WA 3A23A 2V5BA 2VFHA 3B03A 2VXNA 1H7WA 3GDRA 4GFSA 3GNNA 3G0XA 4JIPA 3B0PA 2JGYA 5HUPA 3W1RA 4Q33A 1VC4A 4U4MA 1CW2A 1FWSA 3UZ5A 4LW7A 1L6YA 5CSSA 4R7JA 3MHUA 4E2BA 3LXAA 3MI6A 3B0VC 1QNVA 4JGDA 4TIMA 2TYSA 3S42A 4M6QA 3DFNA 4JTJA 1W1ZA 2ZA1A 3BO9A 1Q6RA 4UTTC 1W3NA 3NPXA 3O6CA 3EWZA 3FLUA 3GNDA 1SO3A 4FNSA 4UTMA 3E96A 1KBJA 3NPVA 5FF0A 1WX0A 1M7PA 3M5ZA 3A5FA 3BLIA 4DPQA 1LYXA 2H90A 3L65A 2X1SA 3TV8A 2HSAA 3CPRA 3W3OA 4ADTA 1DVJA 3QFEA 1SZEA 3DHDA 4GUJA 3C6CA 3C56A 1W8SA 1EEPA 3IIPA 3M47A 4NQ1A 4P2VA 3NZRA 5LHFA 1I8JA 2C3ZA 4Z1DA 3W76A 3E9AA 4ZZ9A 5D04C 5DBUA 1TPVA 1R30A 1LLZA 5AHIA 2DZUA 3DFQA 1OYCA 2YDAA 3W2MA 1XXXA 3A24A 1DQWA 3N34A 3LRKA 3DKJA 1P0NA 1YTKA 3HG3A 1TPUA 2J27A 5D37A 4OE7A 4DF2A 2G5WA 4ZL1A 5J5DA 2ZZ6A 4NUWA 1GYNA 3OVPA 1THFD 3RFAA 1KM0A 2YFNA 1FDYA 5G2WA 3DXIA 3PBYA 2ZTKA 2NX9A 4GWEA 2ZRXA 5F2LA 1C9DA 2B7PA 4D2JA 5K3VA 3L5LA 4JN6A 4LT9A 1PHWA 1OF6A 1XUZA 1VLWA 3LTPA 1ME7A 4IPJA 3LI1A 4FB7A 1FUYA 2C15A 1GG0A 4O19A 5F2MA 3S1UA 1PVNA 2E5BA 3L0NA 3TE9A 3W9ZA 3HMJG 3R5EA 3LGEA 2Y85A 4QNEA 1ZNNA 1VR6A 3GB6A 1ADOA 3IIXA 3PUDA 1L6WA 2CLIA 3MW7A 2CZ5A 5HWMA 3QSRA 4TX9A 4Z0JA 3W7OA 1H1YA 1VHNA 4DPPA 5LSMA 3B06A 1XCFA 3QH2A 4K8EA 4O1AA 4IXHA 1WOAA 1SSDA 3U6WA 1I4NA 1SW7A 4JTHA 2X1UA 2OX1A 1SFLA 4JTTA 5BRBA 2H8ZA 4QJ1A 1TPC1 5GVJA 4AF0A 1VYSX 3FEMA 1F5ZA 3QZEA 4AWSA 1TTQA 1TCDA 2Y70A 4MKNA 4AEOA 1SPQA 5KITA 5D2TA 5L9FA 2HMCA 4K36A 4X3ZA 4ZQRA 2NXIA 3TUUA 1NAL1 1O4UA 4RV8A 3ZFHA 3W73A 1GOXA 1K8YA 3DFOA 2OCZA 3NQAA 3FOKA 1M6JA 1S5VA 3GDLA 2BX7A 2FQIA 4DBEA 4LC8A 3LBMA 4YXGA 3W1AA 2OT0A 3S6DA 3CB8A 3SJ3A 3WJYA 3TSDA 3CEUA 1MEIA 5ABTA 3M43A 1IXQA 3E12A 3M0ZA 1QFEA 1A53A 1QPRA 3W1NA 2DZPA 5HR6A 1JRBA 1AW1A 1I2PA 4BR1A 5G1YA 3TSBA 1ZCOA 2QKFA 4I7VA 1RQHA 2J9ZA 4WXYA 3QRHA 2E77A 3QJAA 4WOQA 2Z6JA 3VE9A 2YSWA 4PL1A 3EX1A 4UTWC 4Q32A 5F1VA 3ABQA 5HWNA 4X22A 3LCWA 3LHVA 3STFA 5BNKA 4OT7A 5DXYA 1FCUA 4FNUA 1SO4A 2DU2A 5BMXA 4FXRA 5I3KA 1JULA 1YPFA 3Q37A 3PAJA 1W5QA 3LTYA 4JDYA 4UTHA 3IIOA 1SZFA 4QIUA 4OQVA 2GQAA 1G7VA 3FYOA 2BWGA 3NAVA 4WOZA 3C3NA 1G4EA 2A85A 2V2CA 2FPYA 3FKKA 1LP6A 4DF0A 1P0KA 2V81A 3TW6A 3MYOA 3HF3A 4JY8A 3HOJA 3MHFA 1XI3A 3FJ6A 4A2SA 1AL7A 5AN7A 1EP3A 2QUVA 2X30A 4NZFA 1LZOA 3PM6A 4A3UA 5G4EA 5E93A 1Z44A 4JTGA 4YL2A 3W84A 4EVZA 3KVMA 3BG3A 4N4PA 1QPOA 1ZHAA 2QCDA 2V0TA 2FIQA 3W7KA 5KSWA 1ZALA 4FO4A 1QDSA 2P0OA 1EWEA 1QAPA 1H63A 3W6YA 4N6FA 3U8GA 5LNUA 1YDNA 1DBTA 4G1KA 4GNJA 3L66A 5CPLA 3TQ0A 3W2LA 3PUOA 3SGUA 1B9BA 2CLHA 1SU5A 2CLLA 2OT1A 1HFBA 1UUOA 2R91A 3PBVA 3C52A 3G1YA 3NQEA 4ZQPA 2H8XA 2QF7A 2J6XA 2FPTA 1OFDA 2DP3A 3HGOA 3UQNA 1D3GA 1G4SA 3G1VA 4JYEA 3TMQA 1TTIA 5CG7A 4BWLC 3P67A 1C8VA 2KZHA 2Y89A 1M7OA 2C0AA 5EYWA 2F84A 1EUNA 2Y63A 3MP4A 1TB3A 2EKCA 2A0NA 4HIBA 3M5YA 4PA8A 2ABBA 2RDWA 1ZAIA 1QOPA 3EXSA 3ZWTA 1Z41A 1N8FA 4O50A 4O54A 4M19A 5AHFA 1QOQA 4O15A 2C13A 3NQDA 3PB2A 1LOLA 4DELA 4N9CA 2A21A 3MBDA 3DENA 5K2ZA 1JCJA 3CLMA 2A6NA 2ZCGA 2Y6ZA 1TJPA 2R8WA 4GE8A 2VEPA 4HKPA 1N7KA 1FWWA 3EXTA 4JTSA 2GOUA 4IMFA 1TO3A 3NQMA 3UWQA 1I2OA 2VFGA 3EWXA 2NX1A 5HULA 2RKXA 5CZTA 2QDGA 4X9SA 3E49A 1OFBA 1HO4A 3UY7A 1J4EA 3TJLA 1KM6A 3HGRA 3NZ1A 6TIMA 3W23A 3QPZA 2VEIA 1VCGA 1GPWA 4MFEA 3C4UA 3YPIA 4XKYA 2WNZA 1ZJIA 2QCEA 4CLMA 3MI3A 2V8ZA 2Z6IA 4MZ8A 4RX0A 1OX4A 2ZZ2A 3NQCA 3W1MA 3LHYA 4J9JA 1XKYA 3B0UX 3KRZA 4O11A 4EIVA 1KW1A 2VFEA 5G1TA 3T55A 4R34A 3RK8A 5HJLA 4UFIA 1ML1A 2ZTJA 3ABSA 4HT3A 5LNVA 1VZWA 5CKSA 2HS6A 4OHQA 3T40A 1RQBA 4DO6A 4AWUA 3S5YA 4RCXA 3GIYA 2QJHA 5AC8A 1VYPX 1FY6A 5G4WA 1V5XA 6ALDA 5DY3A 3M44A 3NQVA 1W31A 3I65A 2Q8ZA 3THQA 1YTDA 2GPTA 1W5NA 3W1LA 1T8XA 4A29A 3KFTA 1EIXA 3E02A 4WXZA 2HTMA 5LNRA 1MEWA 3O15A 4UTIA 1X1ZA 2VELA 2WKJA 1ZAHA 2Q3RA 3JR2A 1XUUA 1IIGA 3LXBA 2CLKA 4UTUA 5K9XA 3STCA 4UR7A 3UWYA 5G2HA 1LRQA 3GXTA 3PUEA 1I2RA 1OFEA 2WNQA 4IPIA 1XBZA 3I6RA 4TMCA 3WK2A 3GDMA 1OX5A 3MUXA 5HUOA 1GTEA 3G8RA 3R2GA 1O95A 1LLWA 4RZ4A 4HNUA 2OZ0A 1O5KA 3ABOA 3I68A 3GLCA 4ORMA 2V2HA 1TQJA 2DJXA 3TX9A 4XBKA 1TTJA 4MJMA 1AG1O 4WQ6A 2CLMA 1R2TA 3RMJA 3BLEA 4FIRA 3GZ3A 2FB3A 2FJKA 4JTKA 3NQ8A 1TRDA 3Q58A 1OX6A 4TU1A 4MLJA 3UPWA 3NQ2A 4XQ6A 3BVJA 4O53A 2DZTA 4ZQOA 1WBJA 3LB0A 5C55A 1RV8A 2ZRWA 3SFKA 2GVGA 4N9DA 4WZHA 5I3IA 3GDKA 1WYIA 7TIMA 3SGZA 3NPUA 3HGSA 2A7NA 2PC4A 3BGGA 5DXXA 3R13A 2FB2A 2WSYA 1GYLA 3GR7A 2QCMA 4WY0A 4POCA 1W5PA 1VCFA 2FTPA 4GBUA 5FEZA 5DCBA 1MXSA 4Z0SA 5F4XA 5IBXA 2ZFAA 2I14A 1S5WA 1VPXA 4OWGA 1Z42A 2NUYA 3GAKA 1A5AA 2BTMA 1G7UA 5CZJA 3G1SA 2P10A 5HMSA 3C8FA 4XKYB 4MOZA 2QUUA 1H50A 1O5XA 4K37A 5HWJA 2VEKA 2P1FA 2WPBA 2ZRYA
chains in the Genus database with same CATH superfamily
1S5NA 1V6TA 5TBOA 2XVLA 1U1UA 3R11A 1F61A 5CC3A 3AJ7A 1S2AA 2HK1A 1ZENA 1WDPA 3A4JA 3EB2A 9XIMA 1FCBA 4UCFA 2CLEA 4HGXA 4DVOA 3H12A 4NX0A 1QK2A 1UUQA 2WZHA 1GHRA 4IFOA 2NXGA 4F0SA 1DYSA 1ZZMA 1L2QA 3GHRA 1KLYA 3WNKA 2X1TA 4AZ7A 3PNUA 1UB3A 1ZFJA 1H7PA 4QFUA 4MZYA 5IFPA 2EPNA 5A6SA 1HL9A 1O1ZA 2G95A 3KOWA 1K7FA 4GYPA 8RUCA 4X0VA 4MWAC 3W7QA 2VZUA 3H22A 1IEVA 3AHTA 3CL7A 3V3WA 1XWYA 2VEMA 5B80A 5XIAA 1VLIA 4XVEA 4XAGA 2O4MA 3AAMA 1C8YA 1EHAA 2HBVA 3SAZA 3HG5A 1NVMA 3VC5A 3CC1A 3EWUA 2YPIA 4NNAA 2IKIA 3GR8A 4JICA 4OU1A 4UQBA 4UTLA 1XP3A 2YX0A 4LUSB 1XDMA 3JU2A 1XLDA 3C86A 5F2GA 1J11A 2XIQA 1HVXA 1PYMA 4LRTA 3WNMA 2BY0A 3IEBA 3MBFA 4JX6A 1L8NA 1M03A 5C2XA 3M16A 2GDUA 5J04A 2YW3A 2V3EA 3ZR4A 2EPOA 3DCPA 4CCEA 2CIPA 2VX6A 3F4DA 4O18A 4KRTA 1LBFA 4O1CA 3O0KA 2OB3A 3OHMB 3U7VA 1V6WA 4HPXA 3WF2A 3OO2A 1F05A 3NO5A 3DAQA 4K7VA 2E28A 4W7VA 2YL5A 1UBSA 2Y5EA 2Z1BA 2BXVA 2Z2UA 1KTNA 1MRAA 4IQLA 4DXKA 2WZMA 2V9DA 3W2UA 1OFQA 3P60A 3KRSA 3K46A 1MQRA 3OIXA 5F4WA 4FZIA 1R85A 3IJDA 1NTHA 3M5XA 3VGHA 2XN0A 3AFBA 3QMTA 1ICQA 3ITXA 1Q63A 1K9EA 3LRMA 4GO9A 1KRMA 3CMGA 4U3CA 4FIQA 4XWUA 4ZOAA 3S2CA 1FHLA 3GVQA 4WEVX 1WDDA 4H7ZA 4LVGA 4NZJA 4KBXA 3N2BA 4D8LA 3W1QA 4NG3A 2ZBTA 1L6GA 1DJGA 3SRDA 3M07A 3UXLA 3R43A 5I6SA 1XBXA 3HQPA 3OJGA 3CZKA 3WK3A 2OZ3A 2NQZA 4L1WA 4AZCB 5MKGA 3F5LA 3W25A 1QHPA 4ZXOA 3OW1A 3OA5A 1GEQA 1LG2A 2W63A 3CZJA 3H2EA 1T7LA 4JFWA 3KM8A 3RPMA 1YTEA 1PDZA 4ONVA 4NL1A 2IKGA 4FNTA 2OO0A 1RY0A 3B4UA 3QY8A 4I9MA 1LOSA 2CZDA 4MF4A 3I3DA 4MAVA 4NT0A 1JI1A 3P81A 2W6RA 4NAFA 3TWBA 2PLJA 2FH8A 3EEGA 5CZKA 3CH9A 5LA0A 1B3OA 3OBEA 1IWAA 1QOXA 1FTXA 1JCMP 2WC4A 1GPFA 4G1NA 4B9YA 2NV9A 1X7IA 1JNEA 3SZ8A 1C8XA 3ZLHA 3ANVA 3CPUA 1W56A 1OD0A 1KFCA 4ICCX 2NX3A 8A3HA 1J5TA 3TTQA 4H8NA 3DG3A 1F2JA 1QPNA 1LDCA 2CZFA 1RVGA 3TIMA 4LALA 3RU8X 2AL2A 3F7JA 1FWIC 2BV9A 4W93A 2P3ZA 3VKBA 5BU6A 4DYEA 3S2MA 3THUA 1TFVA 3B8WA 2NVCA 2OOGA 5HR7A 3OLEA 1C7SA 2TRSA 4I7WA 1YADA 3MMWA 4NAEB 4TR9A 2QXWA 4Y9OA 4FXSA 4RDVA 3QV7A 1DHKA 3GVWA 3QR3A 3VNLA 3W70A 3W07A 3R8HA 2C6QA 5ABFA 5G1MA 2CKRA 2JIWA 3SSZA 4MYAA 3WNLA 2B0MA 3L5AA 1Q2RA 4MWAD 2ZVIA 4XAYA 2VDIA 3N19B 5FAJA 1KO0A 1LM1A 2DSKA 1RJRA 4UTWA 3C5QA 1DHPA 5CBBA 2ZZ7A 3NM1A 3K13A 5C9XA 4KKXA 1L6FA 3WX7A 5KETA 2NQJA 4D6JA 4R85A 1Q7MA 1Z9AA 1ZUAX 1KM1A 1FQ0A 1YQ2A 3CAQA 3NDOA 5KZDA 3W4RA 3UW6A 2NXHA 4BS0A 2XINA 2FHBA 1G4PA 2FFCA 4V1YA 4URIA 4GUIA 3V0UA 2HRWA 5HDRA 3ZMRA 4YYFA 8TIMA 3SY1A 3BH4A 4LCRA 1UROA 3Q45A 3SCSA 4LYQA 4IUOA 5FL1A 3MCMA 2YB4A 2ZUTA 2QS8A 4Z1CA 4ZOEA 3ITGA 3KRUA 2W61A 3GHSA 4IJBA 1XV8A 2QAFA 3QPYA 2GVLA 4AZIA 4FLQA 3BOXA 1T96A 4E8CA 3BQ5A 1JQXA 3PUGA 5H2ZA 1TA3B 2F6XA 2BDQA 3H7UA 3U57A 2J4GA 1QJWA 3MZ2A 3WH9A 2FFIA 1P1MA 1YEYA 4W87A 4A8IA 4JZ5A 3ZOAA 1W1B1 2VZOA 1CBGA 4B91A 5KTLA 1HKVA 2FVLA 4GKLA 1TMHA 3D6NA 4XD6A 5A8PA 1US3A 2A1YA 3ZJ6A 3W72A 3NOEA 1FCQA 3BCJA 2ZA3A 3AXIA 4JEQA 4C1NA 4IWWA 3B8VA 1WUFA 3KBNA 2AGKA 2GJPA 3PZGA 1K4HA 4IMCA 1CXEA 5ENLA 1KFLA 3Q94A 4JFTA 4ADSA 5ECUA 4DBDA 1W37A 3A4XA 1NQ6A 2BNJA 1K70A 4QAWA 1K9FA 1PL9A 1ONEA 3C61A 4EX4A 5D30A 4N02A 3VKCA 3CH0A 3WUBA 1R2RA 1E3ZA 4IPPA 3G0SA 2BGQA 5K9DA 2BGSA 3C2OA 4C6EA 2AAAA 4UTKA 4ZENA 1XGEA 1KFEA 4XZLX 1J9YA 1DJIA 2QCHA 4QLJA 1HGYA 5A6KA 1G0CA 4XTIA 2NSXA 3TKFA 4US6A 2DIKA 5CPOA 1C9WA 4FA3A 1RVKA 3AROA 3W6MA 1FWAC 4F0MA 3FYPA 3REQB 2Z28A 5JVLA 2PDJA 2ISVA 3QC3A 5A6MA 4CU6A 3H2MA 4RV3A 1E0VA 4R33A 4FOKA 4JCLA 4I7UA 5C9WA 1GVIA 5GJMA 5AYIA 3SN0A 1O60A 3AYSA 2EJ1A 3W74A 2A79A 2QUTA 1YDVA 1BVWA 3FJNA 4U3AA 4P5UA 4DAIA 1J6PA 1OFAA 2R94A 4DO4A 2YL9A 1CXIA 3VNMA 4EP8C 1TV7A 2G4FA 2QT3A 3RRXA 5A2BA 3GVVA 4LS0A 4TQTA 1A80A 1DWFM 4Z08A 4NU7A 1ODUA 3N6JA 1ZGDA 1IXPA 4IG2A 1XBYA 3L0KA 3CO4A 3TNBA 3UWWA 1PZ0A 1GK8A 2I5IA 1BAGA 4HYVA 3EWWA 4PCFA 1PCKA 3C2YA 1KXVA 3RLHA 4UFJA 4LUYA 4S3FA 1OCBA 4MB4A 4Z1AA 4XD3A 1UP0A 1SZGA 3G22A 3HIJA 1TTPA 2YXOA 4XG1A 3OG3A 2XZ7A 5A5WA 3U4FA 4K38A 2E1WA 3K4WA 1GVFA 3DH7A 1Z7AA 5JBDA 3PAOA 1MMFA 4E5TA 4KGJA 1ZRQA 3E2VA 1UJQA 1FWRA 1E6SM 3T9PA 2E6AA 4HK7A 5CSRA 3TYEA 5D4YA 1H2JA 5TIMA 1AH4A 4BEQA 3WMBA 5A6BD 2PE4A 4KWVA 1R2SA 2DDXA 4CQCA 4HA3A 2PBGA 3WQGA 1KB3A 3LCLA 4GYKA 5ABGA 2BHUA 2PDIA 3CUXA 1YNYA 5HMEA 1OK6A 4AIUA 3E5BA 5E0KA 4NSBA 4N2YA 4OV4A 2WMHA 4MUZA 1B57A 3W38A 1MEHA 2H9AA 2PURA 1YIXA 4ORIA 4BA0A 2V5JA 1JNDA 1E4IA 2OWCA 4IP5A 2DFAA 1U83A 4Y9MA 3ELFA 1SYTA 1HJQA 1IXNA 3WFAA 2YCEA 4HZ7A 3N4AA 5CJNA 2J66A 4W84A 3VTRA 3DHPA 2WC7A 2VX7A 3QQ0A 3PZQA 2WVVA 5CSYA 4DQWA 4UTFA 2H3DA 3A21A 3W1PA 1RAKA 4J7RA 3A12A 4BF5A 5K4ZA 4GZIA 2HVOA 2D3LA 2WC3A 2E40A 3W7EA 3KCOA 4Y9PA 4I8DA 2E6FA 1TVLA 4GQRA 2OWXA 1W32A 5C54A 1J2WA 1UHVA 2OLAA 1D3CA 4U28A 3GH7A 4QLLA 3UXAA 2YCLA 4WVXA 4HJFA 4TX6A 5BWAA 3GYCA 4IGSA 4XK2A 3BMXA 4QEEA 2WB5A 3WQ5A 1EXPA 1F7BA 4GI8A 1JRCA 2I9EA 3O07A 3GTXA 1HJXA 4OBSA 2G0WA 4FF7A 4GZEA 2Q09A 1NDZA 1LRNA 1R9YA 1YBQB 3CU2A 4DBSA 1OC6A 3NL2A 5E5CA 4OIFA 2HXUA 3WN6A 3GTIA 2D2JA 3AISA 1KQYA 2OGYA 3BW2A 4IQEA 3GS6A 1V02E 3TYBA 3UFYA 5EMLA 2NT1A 3N73A 3A3WA 1HKJA 1VRDA 4IL2A 1G6CA 4GIRA 4WDUA 3VVGA 1EA9C 1HT6A 3I7RA 4O52A 3VGEA 3S5SA 2CHNA 3IVUA 1ADDA 2NVAA 1AQFA 4MJ4A 3TN4A 4GUGA 3TDFA 3WLLA 3IIVA 3RJYA 1AFSA 2ALRA 3BICA 1B5TA 1B3VA 4IMEA 4ZCWA 3F5KA 1ISWA 3OEXA 4Q8TA 3FA3A 1TR9A 1R7OA 2J13A 1UP3A 2Y8KA 1UWSA 1TWDA 1VJZA 4XBJA 1TUFA 2DVTA 3QC0A 3AIUA 3EOLA 2DZVA 4C6NA 3R1ZA 3R7MA 1JYXA 5DN1A 3LS9A 3OVGA 4GX9A 2AQWA 4U2YA 3G24A 2RDUA 3AJXA 3HGJA 4NJHA 3M0XA 3QV8A 2RFGA 2YBUA 2Y5SA 4WDTA 1C3FA 5I78A 4GISA 4I5XA 4XISA 4NJKA 3GM8A 3GFXA 3IGHX 3DBPA 3S1XA 4P7NA 4HYWA 3RXZA 3MSRA 1XIBA 3KBSA 4GH1A 3CHDA 4JPGA 5DBTA 1E1CA 2J7CA 5DRIA 2XH2A 4UFKA 1KWGA 1AMKA 2WMFA 3ES7A 2QQ6A 4RDZA 7ENLA 3QGKC 1JPHA 2FJUB 2ZIDA 1UIPA 1AD4A 3LBOA 4LSBA 6REQA 1OSEA 3KVLA 1J0IA 4FF5A 3HG2A 4KFPA 2Y4SA 4QJ5B 1VEOA 3G1HA 4W85A 4WK9A 1TX0A 1U1HA 2A4AA 1N8IA 3XINA 2PLCA 4UCGA 4M56A 4YIWA 3S9IA 4HOWA 2DZBA 4ZB0A 3EPMA 4O16A 1A5BA 4L9ZA 4AMAA 7REQB 5CCZA 2Y2WA 2FDMA 4Y6GA 1RCOB 4QBXA 4GNVA 5JIPA 4ZQNA 3UZJA 5A2CA 3ERPA 4M7TA 3VINA 4ZE5A 3P5YA 5DX7A 2ANUA 3N2OA 4NZ3A 4LUIA 1XFBA 3O2LA 4RKAA 1KBKA 3IV8A 2BY2A 2EAWA 5GJPA 5E6ZA 3VKAA 3A6OA 2MNRA 1N8WA 4M51A 1Q6OA 1ALDA 2J6VA 3PBMA 4DZIA 1TR1A 4DI9A 2DVXA 3JVAA 4PN2A 1X97A 3UZWA 4JN8A 2SFPA 2QCCA 2YL6A 1HVQA 1MW3A 5A6JA 2PA6A 2VGFA 4LYPA 1TIMA 5MHBA 2E7FA 1KGWA 1XIDA 4M1BA 3TN5A 3AS2A 5TAOA 3TYCA 3GXDA 3NYZA 2W91A 1SGJA 1EZ2A 3ZO9A 1KM2A 4MPKA 3L4ZA 4DJEA 5C5YA 1NWTA 1I0DA 1QK0A 1ZJHA 1H7XA 1VFSA 4PUEA 3CZGA 4H6KA 4FALA 4LANA 1ISVA 2WCGA 1EPXA 2YYTA 4P61A 4RNJA 1BYAA 1NELA 1OG0A 1FA2A 2E1DA 1OYBA 3GU1A 4CQ9A 3VZYA 1V0NA 4S2CA 4PTVA 1AQHA 4TVCA 1A3HA 2WLZA 1HJVA 4I9JA 1NY1A 4LAUA 3CWOX 3T2OA 1NEYA 2CLFA 1HZYA 1CI1A 3UZYA 1I2QA 2OEJA 2PI6A 3S9ZA 2VUNA 4EE9A 4O1EA 2ZUWA 1LBLA 1NDWA 4PB3A 3E0LA 2XPKA 4FLOA 1OYAA 5I02A 2BODX 4XKMA 3GQYA 3LXCA 4WJXA 4LU0A 1W3IA 3M9YA 3B8DA 1TV8A 1F07A 4LAMA 5CG0A 4L5ZA 2WMKA 1UZ1A 3WFLA 3RCYA 2GDQA 3PS7A 3W7NA 2ACUA 4DNHA 5EL1A 4LY4A 3EB4A 5IFTA 3PP7A 2IPWA 4R3UA 5EMYA 1UWTA 1L9WA 3A23A 3WD3A 2WHKA 4GFSA 1NOWA 3W1RA 3B0PA 2JGYA 4Q33A 1EKOA 3W27A 2J7FA 4U4MA 4KQNA 4OZOA 5I77A 3KLLA 1EL3A 4R7JA 3BE7A 4GVGA 1ZTVA 3DFNA 1UPMB 2Z24A 1UWAA 3BO9A 4UTTC 1JZ7A 4FMVA 3TTOA 3EWZA 3GNDA 1KBJA 3NPVA 2VDGA 1MUWA 1XPYA 2IUZA 4WSKA 1LYXA 3L65A 2VYOA 3W3OA 4ADTA 2BG5A 3GU2A 3FN9A 1VFLA 4GUJA 3TLQA 3C6CA 3IS4A 4PUMA 3M47A 5LHFA 1M01A 4HHHA 1R30A 4KCVA 2DZUA 2F6KA 1ZQ5A 2JE8A 3W2MA 1TV2A 1XXXA 3G77A 1QXLA 3PWIA 3TLLA 3ICJA 4YVPA 3DKJA 3HG3A 4DXXA 3FAWA 3DYPA 2BOFX 1JZ8A 4OE7A 4ZL1A 4R7OA 2ZZ6A 4EANA 4NUWA 1WZAA 3VFCA 4HOZA 4BY3A 3OVPA 2XIJA 1KM0A 4X0NA 2ZTKA 1BXBA 3POHA 3RCNA 1H41A 3ZT7A 4D2JA 1NP0A 4LT9A 4IGMA 4E4UA 3LTPA 3VM7A 1ME7A 2QV4A 4O19A 3S1UA 3TE9A 4G56A 1A3XA 3PUDA 4AZHA 2W9MA 2CZ5A 5BU9A 3WELA 2D2GA 4MB3A 1EBGA 3W7OA 1FWEC 4DPPA 4O1AA 1AD1A 1SSDA 1QNPA 4JTHA 1MW2A 2X1UA 4EXAA 3Q4DA 1QHZA 2C7FA 3GUGA 4JTTA 1A3WA 2H8ZA 1TPC1 3WDJA 1A0DA 4I6VA 3ARRA 3BJFA 1ENUA 3CL6A 4GCAA 1VYSX 2PDWA 1F5ZA 1TTQA 5AC5A 1SVDA 4NAEA 4ZODA 3TONA 4JFVA 4XUYA 2EG6A 1IHIA 2X8RA 2VQUA 1O4UA 2IQ0A 1GOXA 5T8GA 3FY1A 1XYCA 3UA3A 4H2CA 1K8YA 1OCNA 3DFOA 3NQAA 5I7GA 1KD0A 4YXGA 4LC8A 3MB9A 2OT0A 1V77A 5H6HA 3S6DA 3CB8A 1C8QA 3NVDA 3NWRA 3E2RA 3QHMA 3E12A 2BVTA 3W1NA 1WAWA 1OG6A 5G1YA 3VCCA 4N42A 1XW8A 2QKFA 4XO7A 1EDQA 1UD3A 2WLYA 1VF8A 2E77A 3QJAA 3VE9A 4GQQA 2YOCA 1FWBC 4BCEA 2QF8A 3ABQA 5HWNA 3GH5A 3LCWA 3STFA 1FCUA 4QE5A 1XH2A 3EYPA 5I3KA 3IUHA 4NHVA 3WQVA 3MPGA 5DO8A 2CESA 4IFRA 4JDYA 3PK7A 3IIOA 3E5PA 2CXEA 1REQB 4QE1A 4OQVA 2W66A 4U33A 4L4OA 3LMZA 3OQEA 2V2CA 3CMFA 4Q4PA 3WLHA 4PMVA 3TW6A 4JY8A 2WHJA 3PTMA 3DOPA 1EP3A 2GGEA 2X30A 4NZFA 4E4PA 1EC9A 3RPTA 3EDDA 3TYDA 5FJJA 2GQ3A 1P7TA 2E9LA 3OPSA 4HZMA 1CLVA 1GW1A 2FIQA 2ZKMX 1NWUA 3GG8A 4HP5A 2O9RA 4NI3A 1EWEA 3NEHA 4N6FA 4RE4A 3U8GA 4C6KA 4UZUA 1YDNA 1DBTA 1NDVA 3LPFA 4G1KA 1IT8A 4JKLA 3SB0A 1TWWA 1RBAA 2CZVA 2Z7GA 5FJTA 2CLLA 5M3WA 2OT1A 2Z4GA 1HFBA 3RRAA 1TCMA 2FPTA 1HW6A 4B5WA 3UJ2A 2QUNA 1W1PA 5F7UA 1D3GA 4AD4A 2PDKA 3TMQA 4JQAA 3CHFA 3WDRA 1M7OA 2C0AA 5EYWA 1MNSA 1B90A 3M64A 4REQB 4HIBA 2VZVA 1RJQA 3OGSA 3ZWTA 1XYZA 4D6FA 1IQ8A 3NQDA 3WD1A 4J3TA 2AKZA 1LOLA 4C6BA 3WEOA 4DELA 2JEPA 1CLXA 3WUFA 3DENA 1JCJA 3CLMA 4H8VA 1PX8A 2A6NA 1GCYA 2ZCGA 5JH1A 1TVPA 1TJPA 4C60A 1FWWA 3HPFA 3GTHA 1BPLB 4IMFA 1TO3A 1I2OA 2VFGA 3MCOA 5CZTA 4C6MA 1G94A 1Q13A 3REQA 2P53A 3S2JA 2DSZA 1TJ2A 1W1YA 4B5UA 3W23A 3DESA 3QPZA 4EXBA 3VNZA 5D8WA 1ZJIA 3IJLA 3N13A 3UCQA 2YA1A 1V3JA 4L7ZA 3W1MA 4B3ZA 2DZAA 3A9BA 1O5RA 2YZ5A 3OZMA 4JAWA 3SCPA 2VFEA 5G1TA 1DTNA 4P7OA 5HJLA 1XIGA 2ZTJA 3FK4A 1BSIA 4HT3A 4CGTA 4H9MA 3TEVA 1IT7A 1QI2A 2R24A 3BAXA 3N6HA 1RQBA 3CNYA 2P76A 3S5YA 3AC0A 1ZBWA 1FY6A 1PUDA 1V5XA 3L7RA 6ALDA 4DY1A 2W4XA 1EYEA 5C71A 5DY3A 3M44A 3NQVA 1EJUC 4OUIA 3THQA 1YTDA 3CV2A 3N18A 1UBPC 1T8XA 4WXZA 4PUWA 2VT0A 3LENA 3TN3A 3O15A 2VELA 4S3CA 4B5SA 1IIGA 4HTYA 2A3CA 1BYBA 1D2KA 2EXOA 1SZRA 3HJEA 3FAXA 3WF0A 2B31A 2FGBA 1EEXA 3QFWA 1DIKA 3VMPA 2PWUA 1E40A 5HJYA 4DX3A 3P0XA 4JKKA 4GQBA 5C9RA 1VPQA 3NZPA 4MJMA 3WQ4A 4UOJA 1E73M 3TJ4A 2FJKA 4JTKA 1TRDA 1BGGA 5I06A 1E43A 3BVJA 3M7SA 1EPVA 2GVGA 2PSNA 2R1PA 4A3YA 4B2DA 1TE6A 7TIMA 3R13A 2VVNA 2OU4A 1AJ2A 1GOOA 1TMLA 3CS2A 4GBUA 4L9XA 4G2DA 3D5HA 2XYLA 2CC0A 1PTDA 3WBAA 1XLHA 3DIPA 2BTMA 3UVAA 4B90A 5HMSA 3C8FA 4XKYB 3BSMA 2QUUA 1H50A 5DT7A 1WDRA 4XO6A 2VEKA 2WPBA 4RE0A 3TXZA 1OX4B 3VNKA 4OGZA 1K03A 4AYGA 4UXDA 2ZX9A 1U22A 2GUUA 3STPA 4GIAA 4B4FA 4HMNA 3G3MA 4EAYA 2OLHA 3E0WA 1IEQA 1W9BM 3WF4A 1DJXA 4RR4A 3LCXA 4O17A 1SO5A 3BAJA 1XLMA 1CWYA 1P1XA 2GGHA 1MSSA 4Q3MA 1XIFA 4H6EA 3IJ6A 1W3LA 4O0KA 4HSNA 1NSJA 1XLFA 1Y5XA 4KT2A 1PX3A 3WG6A 5TQLA 2QCFA 1QR7A 1UPPA 3AXXA 2Y62A 3B9EA 4G7EB 5BZAA 3HQNA 5I2UA 3NSMA 5DY2A 5D32A 2XH4A 2J75A 1XLBA 2QCGA 1ADSA 3A5VA 1A5NC 1YMYA 4PTMA 3TC6A 1M1BA 3IGSA 1B3YA 2VC6A 1B31A 3FJLA 4EPEC 2PCEA 3R4IA 3BLKA 4M6VA 4GBDA 3GG0A 3C2RA 5FEXA 1XIHA 3ZXWA 4MZ1A 1XIEA 1GVSA 2QJGA 2ISSA 4QHRA 1Q65A 2QGYA 4H04A 4LVBA 3WJWA 3SCUA 4N6EA 4Y2WA 4MY1A 4LEFA 1RP9A 1B4KA 1JUBA 1WA3A 1BTMA 2PS2A 4Z2LA 5D2XA 1AVAA 2ZXQA 1XFCA 3QTGA 1JQVA 3MT1A 3W7DA 3GU9A 1TPWA 2ZZ3A 3WEZA 4LY8A 2HK0A 3I4KA 1KCKA 3CEPA 4GVHA 3ARUA 2DZSA 4HSOA 1MZRA 3ZWSA 1XD0A 5CZ0A 3ME3A 1UASA 5LKYA 4IOTA 2WJZA 1X1OA 1BKSA 4F48A 2D69A 1XYMA 1FWNA 5C6MA 1XH1A 3VNJA 4FS9A 4IX0A 4GD0A 4D6EA 4JFSA 4IUGA 5DRCA 1PTAA 7PTDA 3O7UA 1KTCA 4BK9A 3VIGA 2QULA 1U2YA 3CIWA 3G1DA 2REQA 1F76A 5LIUX 1UD6A 2UY2A 2CHOA 7XIMA 1VH7A 1FOBA 3P5ZA 1WXYA 4Q4MA 1QO2A 3RR1A 3W83A 2O4QA 1FCVA 3W6LA 3WMSA 3VYLA 3ZR6A 1UR8A 3T0DA 1X8FA 4Q4KA 5A8QA 2OTDA 1V0MA 3M0HA 4UFLA 1UUMA 1EJVC 1QI3A 3HPXA 2D0HA 1A5LC 3HBLA 2AL1A 3WY1A 3L4UA 4J2PA 3KBWA 1ZJAA 3LTSA 3WJXA 4A22A 3F4VA 3RX2A 5A8OA 3EKLA 1JJKA 1IV8A 4HHMA 2OOFA 5A8NA 4G8TA 4JXCA 4JNMA 1DP0A 1RPXA 3GNRA 1JPMA 1XJBA 3FNDA 4FXFA 1GNXA 1NFPA 4Y96A 1SSGA 3DEQA 5HINA 5D02A 4AMCA 2ZRZA 2Y0FA 3AZTA 1IEIA 3M7WA 3BW3A 3QSTA 2WW5A 5U7SA 3G8EA 3QQWA 4BZYA 2I1OA 1OFOA 2YL8A 1E0TA 1JAKA 4YPJA 1NOFA 3GDTA 3NQFA 3CB3A 3VILA 1NF0A 3B8SA 5HPCA 3ZLFA 4QXIA 2O92A 3PJUA 4UIOA 4H2HA 3MC5A 4UC5A 2V5LA 4MY8A 1LF1A 2JKEA 2VRQA 2O56A 4JFUA 3BURA 4DYJA 3GRIA 2XN1A 2DUAA 1DJNA 2ZZ5A 3BQ6A 3LM3A 2FVMA 3CQKA 4K68A 5D9PA 2YBVA 4N9EA 3KRBA 1O68A 1S5TA 4JQ4A 2V69A 1PS9A 1BWVA 3HJZA 1C93A 3CV1A 4D8ZA 9CGTA 3CBWA 1R7AA 3PF3A 4Q7NA 3WK1A 2ZICA 1Y0EA 3R8GA 2E67A 1UIOA 1H49A 3CMJA 2WHMA 5TNVA 1OT1A 4L6HA 4H9YA 3NSXA 1E9YB 3WQ8A 4HU3A 1R3VA 2J8TA 1ONWA 1SJAA 2EPHA 3AALA 3B40A 2RDXA 5JQ9A 3VCRA 3LHZA 4NIRA 3KS5A 1KFKA 2Q01A 3VMOA 2E8ZA 5CGTA 3UNDA 2BZNA 4OTKA 3TSMA 3ZVHA 4UWMA 3OLGA 1TUXA 1XIJA 3TC7A 1SMDA 1WO2A 2LLEA 1UA3A 4K3ZA 4XSMA 1UZHA 2WV8A 3F4NA 4DIAA 3PBUA 1DJHA 4QDMA 4PMQA 4IPNB 3TC3A 1IZCA 4F2TA 3CT7A 1EBHA 3L4VA 5CEWA 1MUMA 4GJIA 2G41A 3UZZA 4MLRA 1XLCA 3SIMA 4GPNA 2DV0A 1VQTA 3VI2A 3UWEA 3P8IA 3SBFA 3SN1A 1ZBKA 1ZAJA 3MMDA 3CQJA 4J40A 1FXPA 2XZ9A 3F2BA 2PEVA 4FHAA 1KXQA 1XL9A 2V2DA 3PZIA 1JGIA 1E6ZA 1H7RA 1XHGA 3ALFA 2Q71A 5JXQA 3WQOA 2BVDA 4FXJA 4K39A 5KZMA 3DC8A 1XC4A 3W0KA 3INPA 4ACYA 3MP5A 3KCJA 3VOJA 2GVYA 4NAFB 2GVJA 3DHUA 1OABA 3K8KA 3H4GA 2VJXA 2J8GA 1UMLA 3LX9A 3WEMA 1BXNA 3PVFA 3QZAA 1BWLA 3GXIA 2FLIA 1Q6QA 4WY0F 2HPMA 1LRTA 4CD8A 2XN2A 1EOMA 4HA4A 2QCDB 1QPKA 1KKRA 4MDOA 1NJJA 4QISA 3N2MA 1HL2A 3T05A 2AL2B 4J3VA 4PB4A 3MDUA 4NZ5A 4L65A 2Q02A 4ZQMA 1BG4A 2R14A 1RY8A 6TAAA 4Z1YA 2WZTA 2HJPA 4PCTA 1K1DA 3T0TA 4CEUC 3IJ8A 3RU6A 4BWLA 2ISDA 3WQDA 1S38A 1FKWA 1YW1A 3CL8A 4PEKA 4PUDA 2VCCA 4HPHA 1YE6A 4PCPA 3FVDA 4L6OA 1DWIM 3TMLA 2DZXA 3QGAC 2HWGA 3QBUA 4PMRA 5XIMA 5ABFB 3PG8A 2V82A 3ES8A 1EQCA 3ORWA 1US2A 1XG3A 1CYGA 3KL5A 1GJPA 4QRNA 4GQGA 1EOKA 4O57A 4Q6XA 3WJZA 1XYBA 1O6IA 3BLDA 5FCZA 2F6UA 3OGVA 2IMRA 1CLKA 4L56A 4ZTXA 4JYFA 1J12A 4M5PA 4LEQA 2JBMA 3WH5A 2X7WA 4LS1A 4AB4A 4WR3A 4C1LA 4GI9A 4B5VA 2EEXA 5FESA 5SWUA 1A5MC 3G1AA 4N0RA 5F4SA 3W7LA 1H61A 3MWAA 3RITA 4O0ZA 3NDZA 1MUCA 4B15A 4NXKA 2UZ9A 1BEUA 1S3HA 3BGAA 2TODA 1X38A 3QW3A 2HQAA 7TAAA 1EJWC 3RCMA 4Q8OA 5LA1A 3NURA 3KDNA 2YYUA 4JHMA 4DWSB 2BOEX 4HNNA 1D8WA 3GWQA 4HSHA 5D05A 4LFYA 2JK2A 3VAVA 1QUMA 2J7DA 4WDWA 3UJFA 4UUIA 4XTDA 4ZO8A 3LGDA 1JG9A 2WSQA 2GJXB 1J0JA 1TX2A 2Y7GA 4XAZA 1V7YA 4B3KA 5BRPA 2ZUVA 4PMJA 4F9JA 4A3HA 3MWCA 4AHQA 2C1HA 1ITCA 4HU0A 4PR4A 4J3ZA 3R10A 1W0MA 2D73A 4O1DA 1A49A 2PGRA 3DFHA 3TAKA 5D2VA 5DELA 3VD7A 2WKGA 3O16A 5CQ1A 1AK5A 2FZ9A 3NL5A 3WLJA 1RLDA 3KXQA 3E2QA 2VR5A 1IXOA 3HTWA 5BCAA 5KEZA 2F7FA 4PUKA 4D72A 3AXMA 4DBWA 5CPMA 3ARTA 4FOUA 3ARPA 1KLZA 3CQ0A 4OVXA 2C8NA 5HQLA 4S38A 3LK6A 3AS1A 5I23A 4RL3A 3T78A 3ABZA 4WGHA 3MYPA 2ACQA 1VP5A 3T08A 1SM9A 3IJIA 3S47A 1R6WA 3WQ6A 4E2DA 1V8EA 4LBRA 2PZNA 2YB1A 3PPGA 1YXDA 5IXEA 3A4AA 1X8CA 3VIIA 1LBMA 4JNYA 1IR1A 3FS2A 4UNLA 2ZUUA 4MMWA 8XIAA 5DCEA 1R46A 1XDLA 4H00A 1JDCA 4LH8A 3EWDA 1PX4A 4Z2HA 5E6YA 3I3BA 1TPDA 1TZZA 1F3WA 1WNOA 1VIWA 1LL4A 4IFKA 1DE6A 2X42A 1MW0A 2WNNA 3W00A 3NFUA 4BI7A 1WAUA 4O1BA 3GKFA 4FX8A 4C6IA 1DWGM 2V6AA 1W2VA 2CW6A 2OZTA 2J25A 3C3UA 2H3BA 2PC8A 3TW7A 5KMYA 2PDHA 5IHRA 1V6XA 4IG2B 3C2EA 2PF0A 1KR0A 2X16A 2Z1VA 1VAHA 1W3KA 1GVOA 3WH6A 4MPQA 4KCTA 3VKJA 3OHIA 1LLOA 5EMMA 3KAOA 2DSUA 2DORA 3FSTA 1HP4A 2ZOXA 3LZ5A 1XRFA 3GH4A 4W8AA 5CC5A 1ITXA 4PSPA 1GORA 3RYSA 1ME9A 4JOMA 5BOEA 5A95A 2EO7A 3KHJA 1IEWA 3LCGA 1AW2A 4YTRA 4GVIA 2PRLA 3P8JA 4ZB5A 2ZWZA 3DHFA 4MYXA 3UWZA 1XLGA 2ZZ1A 2D3NA 3VPLA 2VENA 3AMGA 3U2EA 4ADUA 4EPBC 2Y8VA 5EBUA 1Z89A 1MFUA 4I90A 4M81A 5LGXA 2V30A 1IIHA 3AHVA 2J79A 3VMNA 4PMZA 2J47A 1M7XA 1WDWA 1NFBA 4PMUA 2V3GA 2A3HA 4IIHA 3PPFA 4BKNA 4QAIA 4LQ1A 3OBAA 1EP2A 3W01A 5JBFA 2O0TA 2G4JA 2Y88A 3OIHA 1MO0A 1JDFA 3N29A 1NP2A 3SY5A 4DF1A 4CVUA 2WSPA 3GXPA 4INFA 1X96A 1YDOA 2H9AB 3QV6A 1H62A 1JAEA 4NVTA 5BOFA 3CZLA 3NGJA 1D8CA 1XD1A 4JTAA 3NPWA 1H51A 1Q85A 3DYMA 1KBBA 5H91A 2OQLA 1YNPA 1OK4A 4A6GA 2X1IA 1DQXA 2PMQA 3K30A 3HZ3A 2HDJA 2J9XA 3TAOA 3GNPA 4X2RA 1RQEA 4NXSA 2CZEA 4RZ5A 4GO8A 4NY2A 2WVVB 1YXCA 3LDVA 3AUOA 4F4RA 1OADA 5A69A 3GTNA 3W2KA 1W1A1 1XC6A 2YR1A 1CECA 4GHRA 4IP4A 4D1IA 1FWGC 2BY1A 1GHSA 4XZ9A 2VZTA 3RM9A 5EPDA 3BCDA 2CBJA 2POTA 4QG6A 2EF9A 3IRSA 3WKZA 3TCSA 4JHOA 3TH6A 5F1UA 1PPIA 3UEQA 2YCLB 4LJ3A 1OQFA 3D0CA 1PIGA 1J0ZA 4NJIA 2Y7DA 2G3NA 1MVYA 1K3UA 4H19A 2FZ8A 4HNLA 3E38A 1HJUA 4YTTA 4W7WA 2FTWA 3W7CA 2BOGX 1CB7B 1LTDA 3EDKA 3GG1A 1LT8A 1CXLA 3T09A 5CJ5A 3ITVA 3GO2A 4J2MA 1RCXB 5LIXX 3HFTA 3ARVA 1PKNA 2Z2AA 3UETA 4A3QA 4O28A 3S46A 1H1ZA 3VNIA 4IL0A 3SN4A 3MV11 1GTHA 1PEZA 3MMTA 3PFRA 3TA6A 2QNEA 3SQMA 1QW7A 3NIYA 3W7PA 2IKHA 1SJBA 5IBXC 3MP3A 1Q6EA 3USBA 3LCHA 1OWQA 5T26A 2ISFA 1KRAC 4AD3A 4IIEA 4XBSA 3DFPA 2BMBA 3NG3A 1LQAA 1UA7A 4BF9A 3NZQA 4GC4A 2XH7A 3UNTA 3CQHA 4RNIA 4PMOA 4H4IA 1VD6A 4MSSA 2E6DA 4LUTB 3N25A 3C0JA 3EA1A 3LA4A 2NUWA 1EIBA 3EOUA 5HNTA 4K1GA 2B81A 2B7OA 2WWCA 5I5RA 3URAA 1E0WA 3FW6A 3PPHA 4JD4A 4F0HA 3Q2DA 3FDGA 3IAQA 3THAA 5CAHA 5AC6A 3N15A 3ZSTA 3NQ7A 3RX4A 3WFZA 3KOZA 3R12A 4ACZA 3N4FA 1TYGA 1FHDA 3LRLA 2FMNA 3MSDA 3ARZA 4HHLA 1M9HA 1ISZA 3NNTA 1HKMA 1WOBA 4O4WA 4G7EA 1PHQA 1HKIA 1I6NA 4GYPC 1FX6A 3H55A 5A3HA 1E1CB 4AVFA 4M8UA 1DWAM 5FA5A 3WQEA 4W5ZA 3MS8A 3W7GA 3I3EA 4IMGA 4H8HA 2W67A 4MNKA 1QI5A 1OC7A 4PRWA 6REQB 2OX4A 4X60A 4HD5A 2PDXA 4EWJA 4IQJA 2O9PA 4J3WA 1UH4A 1W3JA 3CT2A 3L21A 2PLMA 4QITA 1U5JA 3EMZA 3KBMA 1KRBC 4BQ3A 3TW9A 4XZHA 3LMYA 3RAOA 3QTPA 4YVVA 4NNCA 2VX4A 2C18A 5D03A 4ML9A 3V5FA 5ECVA 4ICMA 3EOOA 4CD4A 5I3FA 1EUAA 5CSUA 3O6DA 5B7YA 4TOQA 4WX2A 1N55A 3LQGA 2GSJA 3UP8A 4TO8A 3P2VA 5DF0A 4EPKA 2E9MA 4EPDC 1AZ1A 4O0QA 1XBVA 3BLFA 1IWPA 1V3HA 2DZWA 3GC4A 4LC6A 2PDFA 4CCCA 4CVWA 1EF3A 3UGVA 2VFHA 3B03A 1UZDA 3IK2A 2VXNA 1Q6GA 4WKHA 4QG8A 3TQPA 3GNNA 3A64A 4JIPA 1FWCC 3MJMA 4S3BA 4Q8WA 4JTCA 3MV01 1CW2A 4KCWA 3A3XA 2XSXA 1FWSA 1W8GA 2PDYA 1KGUA 1QI0A 5CSSA 3V5OA 1XS2A 5HXMA 2XSBA 1ZB5A 2XFFA 3GW3A 3LXAA 2DIJA 1QNVA 2Z1SA 4Q4RA 2TYSA 3SQSA 4CN4A 3BOFA 3UGRA 4JTJA 1W1ZA 3MTWA 3U4AA 1W3NA 3NPXA 3S83A 2A3LA 2ZWYA 3E96A 2IS7A 5FF0A 1FFRA 1AQMA 2FVKA 1Q6DA 3TV8A 3WSUA 3GNOA 1SZEA 3DHDA 4I3GA 1K4GA 1W8SA 3QKEA 3QV9A 2OEKA 3RMEA 4L80A 4NQ1A 2X2YA 2C3ZA 3GG7A 4Z1DA 5D04C 3UA4A 4KEVA 3DFQA 2CBVA 2YDAA 4P8XA 3A24A 2V38A 1DQWA 3N34A 1P43A 4CU8A 1YTKA 1TPUA 2J27A 4EXQA 5EGRA 2VL4A 5D37A 4DF2A 2G5WA 3ZIZA 4TXEA 2VCBA 1GYNA 3EOSA 3D47A 2VEGA 4H8UA 4AYSA 4DJFA 3U3HA 4GJJA 4GI6A 1FDYA 5G2WA 3DXIA 2NX9A 4P8VA 2B7PA 2X0YA 4HK6A 4JN6A 1TVNA 1WZKA 1S46A 2IQDA 4FB7A 5KZ6A 1FUYA 1O1HA 2E5BA 1YHTA 3L0NA 2QPSA 3W9ZA 1E72M 3LGEA 5M1TA 3SCQA 3WF1A 1ZNNA 2VD9A 3GB6A 2C71A 1R3SA 5EMKA 4PRTA 3TYZA 3OU8A 1L6WA 3MW7A 3QSRA 4TX9A 4Z0JA 4AG0A 5CBIA 4ECLA 3C8NA 2R1LA 4C6CA 1I4NA 1SW7A 1IE7C 4QEHA 2OX1A 2KX9A 1SFLA 5BRBA 4W8LA 4W88A 1GYMA 4WF7A 4FOJA 3MUAA 4R9OA 1M65A 3C0LA 2NXIA 1B3XA 3MVTA 5HBFA 2NLYA 4UBPC 3KTXA 1SMAA 1M6JA 2WPGA 3GDLA 2BX7A 4GG9A 4CN6A 1I9CB 5JU6A 3W1AA 2P0IA 3O9NA 3HMCA 5BXPA 3CEUA 1MEIA 4J4KA 3PFMA 3WDHA 2OEMA 2WMGA 1A53A 3K4AA 4NILA 1AW1A 1I2PA 1WKYA 4GQ0A 3CZEA 3TSBA 3WH8A 3N9KA 3N4EA 2TAAA 4WXYA 4NKCA 3UT0A 4FI4A 1T40A 2P3EA 2YSWA 4UTWC 2HE8A 4H9UA 4S3KA 3LHVA 3MCNA 3VUSA 5BNKA 4FNUA 5BMXA 4UQEA 3M0YA 3V1HA 3Q37A 4QJ3B 3PAJA 4S3EA 2F9RA 1SZFA 3KWSA 4PBEA 2EG8A 2GQAA 2DUXA 3ZQ9A 2BWGA 4Z2KA 1VBUA 3C3NA 2DIEA 3FKKA 3MSYA 5J8LA 2V81A 4GX8A 1S1PA 3MHFA 3AHZA 4A2SA 3B9OA 2QUVA 3CWHA 3GBEA 2HEJA 4TV6A 4IICA 5G4EA 1MXGA 5BROA 2G3JA 5E93A 5GQBA 4MGGA 5CC7A 1H3GA 2ZC1A 1CTNA 1D7FA 1E6QM 3KVMA 1M41A 1QPOA 1BVZA 2QCDA 3RM4A 3W7KA 3W81A 1BSLA 3QY6A 1V93A 1QAPA 3MUIA 2F38A 4ASTA 2PDCA 4IM4A 4A8NA 4GNJA 1F8MA 2FZNA 1EO7A 2ACSA 2ZUMA 3PUOA 4E8GA 4M24A 1B9BA 4O1FA 2WBKA 2Z27A 4AX6A 4HCHA 4DJDA 4A3RA 3NSNA 1FWDC 4ZQPA 3UR5A 1YE4A 3UQNA 4KEMA 1TTIA 5DMNA 4JL1A 2HPIA 3P67A 3UJRA 3GR4A 2BVYA 1W9XA 1EUNA 4IJCA 1UG6A 2ASHA 3MP4A 2EKCA 2A0NA 4XZWA 1PZ3A 1VEMA 3T2PA 2RDWA 4JQ1A 1Q8JA 5D9OA 3EXSA 4O50A 4O54A 1XH0A 2CITA 6PTDA 5CH9A 1XQLA 3UERA 4ERAA 3WF3A 4GIEA 3MBDA 5K2ZA 3O3RA 2Y6ZA 3VXGA 3ARWA 2ESCA 3K1DA 3WLRA 3VZZA 4Q8NA 4HKPA 3EXTA 1PB0A 3NQMA 1UWRA 3N1AA 3GTFA 3WLQA 1PSCA 2QDGA 4X9SA 5CLTA 3NZGA 2WVUA 3GVRA 3CYJA 1R38A 4W89A 1POKA 5FJPA 4C5ZA 5T91A 3UF9A 2VEIA 4XVDA 1ZSXA 4CD6A 3SUTA 3C4UA 1XISA 2BBFA 4HMCA 2V8ZA 4MZ8A 3CAKA 2RJHA 4CD7A 5JH2A 2ZZ2A 4ERGA 3LHYA 2E25A 3VD9A 3B0UX 3KRZA 4A4AA 5DMYA 4O11A 2EBNA 1XKJA 1G1YA 1XGDA 3RK8A 2DW6A 1UWUA 2BHYA 5LNVA 1T6MA 1U5HA 1VZWA 4AFYA 4OHQA 7ODCA 3T40A 1W3HA 3I10A 4DWSA 1P7TB 4JHZA 3TTYA 3GIYA 5AC8A 5G4WA 1VFOA 2I57A 4B92A 1W31A 1GONA 3I65A 4PBGA 4HTBA 2INEA 2FMOA 4MTVA 1TG7A 3EKGA 1RXOB 1W9DM 2GPTA 3W1LA 3WLSA 2GJXA 4A29A 4L9YA 2HTMA 3QR1A 5DQPA 4F2BA 4CCZA 1CENA 1P0EA 4UTIA 4DZ5A 1A5OC 3LXBA 1ZU8A 2BP1A 4UTUA 5K9XA 3UWYA 1Q66A 3BDKA 4DJDD 1Q6CA 3NTYA 4IPIA 4TMCA 3WK2A 3ONBA 2OSWA 3K5XA 2WANA 4NYYA 4I9TA 3R2GA 4F40A 1EJXC 1O5KA 1MFVA 3I68A 4PCNA 2CBUA 3K4DA 5C9ZA 2PDUA 2W5FA 2DJXA 1AG1O 4MM1A 1OEPA 4RDYA 3T6CA 4FIRA 1EJSC 4C91A 4PSRA 3Q58A 1OX6A 1DE5A 2XVPA 1NFGA 3NQ2A 1QNRA 5I07A 1WBJA 2OGJA 5C55A 1J0HA 4WZHA 2Z1KA 1UKPA 3NPUA 3SGZA 3GXFA 3BGGA 4MG4A 2WSYA 1R9XA 1E0UA 3GR7A 1EC8A 1Z3NA 3H8AA 1VCFA 2GSEA 2WQDA 3T1GA 4S3GA 5DCBA 2DQXA 3FX4A 1S5WA 1Z42A 1UOZA 2QDDA 4D8AA 5C8BB 3KHDA 3LYEA 3G1SA 3OZYA 1PIFA 1DORA 4JEJA 3S9YA 1VS1A 1RK6A 3IIZA 1YPIA 4ICNA 4W7UA 5MF5A 3SIZA 1KWKA 2RUSA 3ZS4A 4Z2GA 2ZE3A 4H6QA 4UQAA 5IDZA 2R1MA 4IGHA 3ABRA 3CUJA 5K7JA 4P8WA 3G5EA 3GHTA 2FTYA 1FWHC 4C7FA 4DWSD 5F2IA 4UZSA 3VKDA 2PRHA 3WZ0E 4CNOA 1X7FA 2X7VA 2KAUC 1MDRA 2QDHA 3KOXA 4TUFA 4AEEA 2VURA 3AO0A 1GOIA 1HL8A 2WO5A 1W9UA 2R6OA 4XX6A 4QTGA 5AECA 1TMQA 5AB3A 4Q8MA 4HK5A 5IDIA 3KE0A 2HS8A 1VRXA 2QJJA 3KX6A 2JKPA 3WDIA 2CWXA 5GNXA 5I3HA 3UJEA 2DEPA 4YTQA 1HP5A 3LLDA 3LUTA 1V7AA 4XB3A 4AVOA 1BGAA 5DEZA 3UYCA 3AU6A 3SCRA 1JXJA 2D2HA 4OECA 3S5OA 3TOPA 1VIZA 2BHZA 3W53A 1UW9A 3ATZA 2VQTA 2PWFA 2F2HA 2YDSA 1W1VA 1OBAA 2E0PA 4I5RA 4UNKA 1TPFA 1UR1A 1GT8A 3TA9A 3SDOA 2TSYA 1GGOA 3FSUA 4G6CA 1VKFA 1M04A 3FGCA 3S5NA 3QMSA 1VFMA 2BS9A 4NZCA 1JF6A 5I3DA 1DJYA 5FF2A 3SCVA 4A35A 2OVLA 2VGIA 3A9IA 3CUFA 1E9LA 4GJ1A 5FKYA 4CQAA 4WD0A 2GGGA 4O10A 3L2MA 4DM1A 3R94A 1P48A 4M82A 2ZDRA 3MUZ1 3IJ7A 2GFTA 4ZEPA 2QVNA 1M53A 1ZPTA 1V51A 2NV2A 2VI0A 3EX3A 5EA9A 4MUPA 4AVNA 4HCDA 4BF7A 1SR9A 3WLMA 5D9MA 1LROA 2VOMA 4YLWA 3FJ4A 4N9BA 1VEPA 4C90A 2J9YA 5I3GA 1V08A 3VGBA 5C0QA 4LF2A 4Z2IA 5DFAA 1JCYA 5AZ1A 3F4WA 3GSMA 5HNNA 4NJJA 5I00A 4BQ2A 2FZDA 4QQUA 1V3IA 3I7SA 4PC8A 5H1WA 3GUWA 2VC5A 3H24A 3BG9A 1GG1A 4GH3A 4B5XA 4PB5A 1M5WA 2OKTA 1UD2A 3G1FA 4HMEA 4C6QA 1QNQA 4HVXA 4PH6A 4AD0A 3JUGA 1RR2A 5CGQA 1JUEA 3W24A 3G3DA 5M2FX 2Y7EA 2Q3OA 1ELSA 1UKTA 4WKAA 3OZOA 2UWFA 1QO5A 1CIUA 3H54A 3FDKA 3URQA 4EWND 5K9CA 4P7RA 3EKZA 2ZXAA 5EMJA 4V28A 1Q45A 2WOQA 2C1IA 1GOMA 5CLWA 4GACA 2CLPA 1SQ7A 3F1QA 1J93A 3LCIA 2O55A 1SO6A 3AICA 5LHEA 2CKSA 3S2LA 3MA8A 3CWNA 4E0CA 3AMKA 4QP0A 5FACA 3IRDA 3EWBX 2QEZA 3KVJA 3LHTA 3PY2A 3VIOA 3DECA 3AOFA 4AXKA 4CN1A 1ZCCA 4M7SA 4DLFA 1E56A 4LUTA 5HANA 1EX5A 2OODA 5BYWA 4RDWA 4Y8EA 4AWEA 2QJMA 2GQ9A 1LL7A 3UR2A 2WSRA 3V36A 3GX9A 2OKOA 1BTCA 2REQB 3P61A 1DXFA 4A05A 4AF0B 1RSCA 1EGZA 4ZFCA 3NL6A 3QHNA 2PWDA 5BXRA 4YCPA 3MJYA 3CYVA 4P7LA 5H8MA 1XCWA 4YNGA 4HCLA 1E70M 4KGLA 1XLIA 3WMCA 5CBJA 1BLIA 2YGYA 2AMXA 3ZJ8A 4QSFA 2AAMA 1JZ2A 1O5QA 2JKAA 3WNPA 2GJRA 2DVUA 4JS3A 1RK5A 3B9NA 2BGNE 4DJEC 3VDCA 2GGJA 4E4FA 3MKVA 4CU7A 2FDSA 2G3MA 4HPJA 3RNDA 3WO8A 1EJTC 1VFFA 3O1NA 4LXFA 1J5SA 3O05A 4ZO7A 1XGZA 1E6PA 1FRBA 3N17A 1E3XA 4HNTA 1KFJA 2P50A 1KTBA 5E0CA 2QDEA 2ZC8A 3SSJA 4E2VA 3TXVA 1GVQA 2EHHA 3STEA 1HNYA 4PMXA 1GQNA 1TV4A 3P74A 1X1NA 3S1VA 2C16A 5EKYA 2WJDA 3TZFA 1PZ1A 1HJSA 2VEFA 1P6CA 4H3DA 2PB1A 5JUVA 1PIIA 2PTZA 3KWXA 5BXSA 3SY8A 1JR1A 2F2KA 3CHVA 1EZWA 4MFDA 2FKPA 2Z1XA 3M0MA 2YCIX 1KM4A 3PSWA 3O6YX 3ENLA 3RLVA 3EWYA 4AC1X 3QMRA 2ZRUA 4ES4A 4RNFA 4LWWA 2HVNA 2J74A 1R3RA 1WP6A 3LNMA 4KFOA 3VIKA 1CX9A 1SJCA 3O0FA 2DT2A 3AZSA 1BRLB 1G01A 5LA2A 3CK5A 1F4HA 4XV0A 4PODA 1DPMA 2P8BA 2FHFA 3EPOA 3W75A 2OG9A 3BLOA 3CIXA 3UJSA 2OQHA 4GC3A 3CZ8A 4FX7A 4MKVA 3RR4A 3IJQA 1E9ZB 3ZLGA 4A8LA 3SW6A 3DGRA 4GRSA 1GZGA 3EGJA 4GLEA 2CPUA 4NYUA 4LX4A 3KW3A 1P5BA 2GVEA 2BY3A 1H5VA 1B4EA 2EQDA 2PDMA 2UBPC 1OM0A 3WQWA 1LUCA 3A47A 3PJXA 2XFRA 2IXVA 4JIEA 1PWLA 3M46A 3DC0A 4M29A 2UY5A 3ZVHB 1CT5A 1MWOA 2IXUA 3AWNA 5TD4A 2Z29A 3RIKA 3M0LA 4R9XA 4QJ4B 3L2IA 1JF5A 1OY0A 1CPUA 3B8TA 1JCNA 4JTUA 3UXKA 4KW2A 4KS0A 3R8RA 4AISA 3PTDA 1FHUA 3NM3A 1ICSA 3P7YA 4UTJA 3G1RA 5D2WA 1B3WA 3VU2A 4H9TA 1TQXA 5HOSA 4LRSA 3N04A 2JALA 4LAKA 1W9PA 3L9CA 1BKHA 3AHYA 2WVTA 2YKKA 4PBFA 4C7GA 1Z32X 4NJGA 3RF9A 4DO5A 2CHRA 4P8UA 1SW3A 3FEQA 3H21A 3R79A 1LG1A 1X6LA 4AIBA 4Q7IA 1P6WA 1QCWA 9XIAA 1I1XA 5FOOA 1UD5A 4DZHA 4IZGA 4KMQA 1WE5A 1JDDA 2X1RA 5EY5A 3RPDA 3GIQA 3CXOA 3PJTA 4FP1A 4ZMGA 2GJLA 4AU0A 1W91A 1Y7VA 2RHGA 6XIMA 2A5HA 4DXVA 1JCLA 4EOUA 1HG3A 1E4LA 1ICPA 1OHLA 3WK0A 1ECEA 2OYLA 3BLPX 2EPKX 4HNOA 4IQDA 4HU8A 2PP3A 1QW8A 3PTQA 4C65A 3F03K 2J7HA 1TV5A 2NV1A 5CZSA 2CERA 4ZGYA 1B54A 1NF7A 2PGWA 4PFMA 1DTUA 3EMQA 2VR4A 1VJIA 1OB0A 4AHPA 2C1GA 4KWOA 4HYRA 3WNOA 4NASA 4MAZA 2AKMA 5FD0A 5HMDA 1OVDA 4Y7EA 2WCAA 5REQA 4JX4A 1WKEA 3IVTA 4N7QA 3ARXA 4JTDA 3S8HA 4Y8FA 4R5EA 3SFWA 1DXIA 4GZJA 3IGUA 2YBTA 7CGTA 3PSVA 1RD5A 3LPOA 3FA4A 1S1RA 3PANA 3VDAA 3HB9A 1EHNA 1PBGA 4DJED 4JYDA 3UVIA 2X09A 1KM3A 3RLGA 3WLIA 5FAGA 2O7SA 2QVHA 3PC0A 1H1NA 5I09A 3FA5A 4LB4A 4IIBA 1W1IE 1LCOA 4OBRA 3CO8A 2QIIA 2WCSA 1F9CA 1DL3A 2PLKA 4A21A 2A2IA 3TR2A 1H5YA 2WK2A 1A0CA 1G9HA 4K1WA 4GXPA 3GKAA 2MANA 2E68A 3QW4B 3B3DA 3V75A 2Y8UA 4PE8A 3M41A 4FPSA 4HN8A 4WY0B 1BYDA 5M03A 4FNRA 1FDJA 3C0SA 4OBTA 5A8MA 2D0FA 4YHEA 4HMDA 2D23A 1D7KA 2J7EA 1GQJA 3BARA 3ZT6A 2PODA 3T8LA 4V15A 1PZ2A 1L6SA 1OFRA 3TYAA 3B05A 1NU5A 3A22A 1ISXA 1VBHA 4GY1A 2VWTA 5LGZA 1IZJA 1XYLA 3ONCA 3OA3A 2CEQA 3KDOA 5D2YA 3QYSA 4IHCA 1U5VA 3MMUA 2G97A 3BW4A 4BI5A 1PAMA 3H6OA 4UMCA 4CQDA 4GUFA 5A6AA 1EH9A 4GUHA 3SJNA 3OQ8A 1RZMA 2OZ8A 3WLTA 2PZ0A 3TK7A 3VNDA 3I6TA 5AC4A 3H23A 1A0EA 4FLSA 4H01A 2NUXA 4HQVA 4AY1A 1J0YA 5A6LA 2ZRVA 4H7CA 1JPKA 5C2CA 3LV6A 2WSKA 2VGGA 3MUCA 2XVKA 3PB0A 2ZVRA 3MVIA 4MWAA 3DGBA 1EDTA 3ATYA 3W7MA 1SZNA 4LNCA 5BOOA 1VFUA 3LV5A 3CJPA 1YXYA 4ATDA 4Q4OA 1CXFA 3K8MA 3CUIA 1UR9A 1KBLA 4AUBA 3OLDA 3WH7A 4MDPA 4US5A 3S6OA 3GYEA 4B3LA 4ZO6A 8XIMA 4OOZA 2X2GA 5LNWA 2PD5A 3EX6A 1NM9A 3K8LA 3GK0A 3QM3A 4FX6M 1CGTA 4LV4A 2J62A 3PZMA 2ZX7A 1A5KC 2WMIA 5FEWA 1R5YA 5AFDA 1W5OA 3IVSA 3BANA 3N9RA 3EZ4A 3NVTA 2YCJA 4QSHA 3VIHA 4DUVA 1M68A 3SECA 1GQKA 1XIIA 3HFYA 1EA0A 2DT0A 3UXIA 4MB1A 4CQ8A 1CGVA 3BOLA 3VOGA 4NP7A 4JIRA 3W7JA 2VR2A 3MO7A 3W7HA 4IXXA 4S3AA 4L4PA 1A5SA 3FHQA 4BEUA 2OELA 4ILSA 4Y90A