4H6KA

W116i mutant of oye1
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLIVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 155
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4h6kA00
4DF1A 3L0NA 3Q37A 3GAYA 5D04C 3SZ8A 1FBAA 1XXXA 2QDGA 1I2PA 5AB3A 3W71A 3BVJA 4NX0A 4UTWA 4YCOA 1SZEA 3W1XA 4JTSA 2VOMA 4N9BA 2GJNA 4Z1AA 3AJXA 3BLFA 3W7DA 3CM4A 1ZCOA 3GR8A 4DO6A 3VE9A 1KFKA 1D3GA 1LYXA 2RFGA 4MUZA 4E38A 5EL1A 1W5PA 1H7RA 2DZXA 4UMAA 4AMAA 3GR7A 3Q94A 5KINA 3S9YA 3W74A 1LBMA 3OEXA 1H5YA 4N4PA 1H1ZA 4HNNA 4IMDA 1XBXA 3IVSA 3W75A 4K37A 3RF9A 4WXZA 3GDKA 3QW4B 3W7JA 1EUAA 3EWUA 3C52A 4FHAA 3F4WA 1EPXA 2QCCA 3MUXA 4M6VA 3W7CA 5G1YA 1LOSA 3O15A 1IF2A 1OK6A 3NQCA 4OHQA 4K39A 1ZAIA 1R2SA 2DU2A 5K3VA 3O63A 3TE9A 1LOQA 1I2OA 4OU1A 4DBEA 2EHHA 4RK8A 4O11A 3NQAA 1SO4A 1HUVA 4R53A 2QUUA 2QF7A 4N02A 3W2JA 4NXKA 1FCQA 1ZJIA 5LNSA 2R91A 3PB0A 4Z1BA 3H55A 3QSRA 3GNNA 2Z1BA 2WSYA 4UTMA 4O12A 5TQLA 5IM51 1OX4A 3CLMA 3W84A 1J4EA 1T0OA 2B7OA 3P74A 3DI1A 2XN0A 2V2CA 3LB0A 1J5TA 3W2LA 1EEPA 2OZ0A 4DPPA 3DHDA 3M44A 1KFEA 1XDLA 5AYZA 3LX9A 1EP2A 4IXXA 1OVDA 1DJNA 1H7XA 3WK2A 3TW6A 3CWNA 1IXPA 2J6XA 5AC8A 2A6NA 2FB3A 4BFAA 5E1QA 1O4UA 3FA5A 4UR7A 4GUHA 5DY2A 3QRHA 1FCUA 3I68A 3W1PA 1ML1A 1SW7A 2QCGA 2HTMA 2NWSA 3UY7A 1IGSA 3LHYA 1K8XA 3A23A 1ZAJA 3SGZA 1OHLA 1EX5A 3IIOA 1YADA 2VEKA 3EB2A 4CCCA 1H62A 3W72A 1ALDA 2O7SA 2B7QA 1R2TA 4POCA 2WNQA 3NPVA 4XTIA 4NQ1A 5CZSA 3EX2A 4O1BA 2W0UA 1P0KA 2A85A 4FXSA 1NF7A 4N9EA 2W79A 3SSJA 1YXYA 1I4NA 2OT1A 3CEUA 1TV8A 3LLFA 5LZLA 4ZQRA 3DFNA 1GT8A 2Y7GA 3IGUA 5CG7A 4JDYA 5FESA 4KFOA 1O5XA 5D32A 3KRSA 1VGAA 5AHFA 1Q45A 1DJQA 2FTPA 4UCGA 5D38A 4RX0A 3IIXA 4FNRA 3LXAA 4N2YA 1VLIA 1WOBA 3LHTA 5I3IA 2E5CA 1A53A 3GAKA 4LUJA 2GQ9A 1FY6A 1K7FA 1SFJA 4UFLA 4CNOA 3G1DA 2C6QA 3NEVA 3RLUA 4O28A 1UB3A 1DL3A 2Q8LA 4XTDA 2XFWA 5K9DA 3LCWA 1K8YA 1TPB1 4CNPA 4GUIA 1EP3A 5D05A 3T4CA 4PL2A 2CU0A 2P10A 5C55A 3IEBA 1JVNA 2HS6A 3HQ1A 2R94A 3G1VA 2C13A 4UTUA 1I2QA 1SSDA 2V0TA 3FS2A 1VH7A 2QJGA 2YX0A 2G97A 4A22A 1EB3A 3NQVA 3NOEA 5FF7A 3LCXA 2ZZ6A 2WSRA 2NUWA 1YDVA 3PC0A 1MEIA 1X1ZA 2CFFA 2VEPA 5F2IA 1SW3A 2V2DA 5KITA 2WOQA 4AWTA 4IPJA 4M6PA 3NGJA 3LCIA 3MP5A 1LBLA 1M7PA 5DCBA 1K7XA 5AHLA 5AC6A 3NR0A 3GDMA 3K30A 1QR7A 3NQ8A 4UNLA 4ICNA 1DOSA 3MYOA 2R14A 3EWYA 3WJYA 1M6JA 3BW3A 4LC6A 3G24A 4ALDA 4R34A 2PC4A 4P2VA 1RZMA 4FO4A 1AMKA 2C18A 4OV4A 3TXZA 1F74A 3EXTA 3PBWA 4MKNA 4AF0B 1WA3A 2CLOA 2VEMA 1OFQA 1SSGA 2A0NA 3LHZA 4O19A 3A5VA 1KBJA 2QCEA 4JXCA 1PV8A 3P80A 1FWWA 2OCZA 1PHWA 3RK8A 3DENA 3R8RA 1W5NA 4E0CA 3TH6A 3G18A 3HPXA 1ME9A 1YXDA 2A2IA 4HPXA 1QPOA 3I6RA 3FJ6A 3N9SA 5AHIA 1VS1A 1QNVA 3I7RA 1WV2A 4WY0A 4O0ZA 3NVTA 2NV2A 3M43A 5BW6A 5LGXA 1SFLA 1VJIA 2GJLA 1LZOA 3G8EA 3MJYA 5A8GA 2BWGA 1X1OA 1TJRA 3ANYA 4WOQA 4K36A 1K03A 3W2MA 1TPUA 4Q4KA 1LDCA 1DBTA 1F6KA 3DFPA 1FXQA 1SZFA 1PCKA 1YXCA 1KM5A 5F4XA 1S5VA 3STEA 3STFA 3MP3A 3S6DA 3EEGA 3OA3A 5FEWA 3HGJA 3PY2A 1B4EA 1QO2A 2Q8ZA 3C6CA 4LY8A 1ICSA 4RR4A 5AFDA 3LRMA 4IMFA 3QMRA 5AHNA 3W1UA 4TIMA 3P5YA 4R7JA 2JGYA 1VPXA 5U4NA 4CQAA 3BLIA 3OHIA 1KM6A 3RLVA 3B05A 1MEWA 4PL1A 5J5RA 1H7WA 3TUUA 2FPTA 1P5BA 3W2KA 5DLCA 2Y6ZA 4WY0F 4UTJA 1S3HA 2ZRYA 3DI0A 5CSSA 2CZ5A 3QQ0A 4ZMGA 2ZRVA 3TV8A 1N8FA 1HFBA 5BMWA 3IVTA 1N7KA 3C2OA 3O05A 4H3DA 3W7PA 4CQ8A 1TO3A 2O7QA 4Y96A 5DN1A 4ADTA 3UWZA 2H8XA 4MY1A 4XQ6A 1CX9A 2E1DA 3ELFA 5DY3A 4I7WA 4YL2A 4NJIA 3MW7A 3BG5A 2ZTJA 4LRTA 3B0VC 3TK7A 4JX4A 4RCXA 1PL9A 1TTJA 1UCWA 4IMGA 3P60A 2ABBA 1FDZA 2YPIA 3R2GA 1YDNA 2QCLA 3GYEA 1G67A 3BG3A 5HWJA 2CLKA 4OT7A 2QCDA 3F1QA 1CI1A 5EMUA 2FPYA 1FUYA 5DCDA 1QCWA 3N14A 3W76A 4EVZA 3G0XA 1OYAA 3JS3A 4PFMA 4WOZA 1G69A 3I7QA 3LLDA 2TRSA 4GNJA 4CCDA 2Y88A 2F7FA 2ZRUA 1B4KA 1RD5A 1GTHA 2QAPA 2BLEA 4FIRA 3UWVA 1YDOA 3TFXA 2RDUA 1KTBA 4UMBA 4LC8A 3R12A 1SZNA 3QMSA 2C0AA 4UFJA 4NT0A 5EBUA 4CCEA 3HPZA 1GZGA 3OVQA 2Y89A 1GEQA 3QF0A 3GB6A 4NUWA 5FF3A 4IPIA 5ABTA 3E02A 5D2VA 5AHEA 1MEHA 2DZUA 4O50A 2YCEA 5DXYA 1XCFA 3C2EA 3W2UA 4JTJA 4FNSA 3H53A 4NX5A 3UD6A 1KM0A 1GTEA 3W7OA 2X2GA 5D2TA 2J9ZA 1G4PA 4DEFA 4O1AA 5L9FA 4FB7A 4LVFA 3IVUA 3TX9A 5HR6A 5FI8A 4E2DA 1OX5A 3W2NA 4AVFA 4Q32A 3B06A 3P7YA 5T26A 2X1TA 2A21A 1W1ZA 1AL7A 3EX1A 3THQA 3A21A 3CB8A 3SFKA 3TSDA 3IGSA 3T40A 2X1UA 4UTIA 3U8GA 1NF0A 3PG8A 5HMSA 5K9XA 3TNOA 2QDHA 3NQGA 2V82A 2EAWA 3T44A 3E49A 2PCQA 1C29A 3A9IA 1NAL1 3P61A 1W3TA 2H8ZA 4N6FA 5GVJA 1LORA 1K02A 1TPEA 5I3GA 3G0UA 2V8ZA 3P8IA 3MBFA 1OABA 3SECA 4AWSA 5F4WA 1UUOA 1TPDA 4AHPA 5I3KA 1G7VA 3G22A 1F2JA 3M5VA 1PCWA 2JKPA 1DQXA 4JEQA 4NNBA 1OX6A 4HN4A 1RR2A 5G2HA 4K7YA 2XN2A 3HG2A 3VKJA 4CLMA 1D3HA 5HWNA 1WXJA 1LM1A 1FX6A 1WX0A 5EPDA 1ICQA 4IJBA 1QPRA 4IQLA 2OT0A 3LDVA 3CHVA 4IMEA 4WJEA 2H6RA 2Y70A 1F05A 3JR2A 1XBYA 3TU9A 2ISSA 3VNDA 3UY8A 1NEYA 5G5IA 3NQFA 6ALDA 5A5WA 3HGSA 4JTIA 4UFHA 4DF2A 1SU5A 1OF6A 3W7IA 1P0NA 4C1LA 1XBVA 1A5BA 3TMQA 4NZJA 2BTMA 4XKYA 2A5HA 3GK0A 4UTTA 4O8RA 1B9BA 4FNUA 2A7RA 2V81A 4BWLA 2J9YA 3FYOA 2RKXA 3NYZA 5C5YA 1JR1A 1XUUA 5MHBA 3O6CA 1UJPA 5CPNA 3WFAA 3NQ2A 1SUXA 2CWNA 2Y7FA 5K7JA 3BO9A 4PH6A 4KFNA 5H2ZA 3LBMA 4CNNA 1JQXA 3P82A 2NUYA 5CGQA 3S0CA 4JR5A 3C61A 4O1CA 3V75A 1U83A 2HMCA 1OFRA 1OFDA 3G1FA 1KM3A 1H60A 1GWJA 1LLZA 3WK0A 3L9CA 2J27A 4NNAA 3VI2A 2ZBTA 3HG3A 2A4AA 3N9RA 1GQNA 2JKEA 1RQHA 3HGRA 3LCHA 3NQ6A 1LRTA 2FPVA 4XZ9A 1JCMP 4LVDA 5SWUA 2FB2A 5EYWA 3LBCA 3O07A 1E51A 3IIVA 5IBXC 1JJKA 1XFBA 2GQ8A 3W22A 2GQAA 1TPFA 4JTGA 2V2HA 5J5DA 1RV8A 3L66A 3C2RA 2B4GA 3T7VA 4BR1A 1Z41A 1SO3A 2QR6A 3W87A 3NZ1A 4YCPA 3M5XA 4BF9A 1KM1A 3UWUA 4O10A 5D2YA 2BX7A 3LHWA 4H6KA 1H50A 1HO1A 1OJXA 3H54A 4HHPA 2WPBA 5KMYA 3SI9A 3NDOA 3MO7A 4IUOA 3PUOA 3S5ZA 1SR9A 5E93A 1LOLA 3LHUA 1U5JA 3IIZA 3B4UA 4LT9A 1SO5A 3NL5A 4O4WA 5DCEA 5F4SA 5AC7A 4JIQA 1PS9A 4LVBA 5CPLA 5HQEA 2QCFA 1IIGA 4MYAA 5KSWA 3DAQA 4OE7A 2X16A 4LU0A 2FLIA 3HO8A 1GVSA 1SZGA 2QJHA 3NQMA 5LHEA 3OBKA 1FWSA 3RFAA 4C1KA 1F5ZA 3TW7A 3EX4A 1FCVA 3DU0A 1P4CA 2WNZA 3M41A 1RVGA 1Z42A 4JNMA 1HL2A 4K8EA 1XKYA 3FKRA 3M1ZA 4WX2A 4JD4A 2NX9A 4BI7A 2C1HA 4JY8A 3VFLA 1KV8A 2YZRA 2C3ZA 3W7GA 2WO5A 1F6PA 2Z0IA 4Y6GA 2ZZ2A 3W1AA 3WK1A 2KZHA 1EWDA 4X3ZA 3L0KA 4UFIA 3DFTA 4MLRA 4NJGA 4RXGA 2BSLA 3HG4A 3LRKA 3LV6A 3EKLA 5I3HA 4PEKA 4O15A 4O17A 3HF3A 4AEOA 1QAPA 4I9AA 4QM1A 1QOQA 1G7UA 1AG1O 1FXPA 3TAOA 1F73A 1B3OA 1KLZA 4ORIA 1A5SA 5KZDA 4QNWA 4LW7A 4QITA 4L4LA 5FF0A 1FCBA 4JYEA 3IIPA 4PTNA 3FYPA 3ZWSA 2PRLA 3NQEA 4NZFA 4M7TA 1ME8A 3EX6A 3P62A 4JYDA 4DBDA 3KOFA 2YSWA 4MY9A 1W3IA 3LCFA 5K4ZA 1O94A 2WSQA 2E77A 1IXNA 1VC4A 4IX0A 4HPJA 3SIZA 5HUPA 3O6DA 1XDMA 3EXRA 3UPWA 3KVMA 4A2SA 3QFEA 3G1SA 1KFJA 2A7PA 1LRNA 2QAFA 2ZZ3A 2PRMA 2YFNA 1JCJA 4RJEA 5G2IA 1DKWA 4PA8A 1Q6RA 4ZVJA 2ZRXA 2R8WA 1BTMA 2CLHA 3CU2A 1C9DA 1C8VA 2XN1A 5DBTA 3LI0A 3WJXA 2JBMA 4L4MA 2QEZA 4O4VA 3BPWA 4KWVA 2ZCGA 4X22A 1ONRA 3TR2A 1LCOA 3W07A 3HPSA 4UTKA 4QAIA 2A7NA 4DF0A 1THFD 2QJIA 1TPH1 1KBIA 4OGZA 4YMZA 2GVJA 4M5PA 4JTHA 4ZQMA 1YYAA 2YR1A 3PS7A 4ZQNA 3NZRA 3NL2A 2DZVA 1PHQA 4Y90A 2VXNA 3TCEA 4M7SA 3KFTA 4LS1A 4PODA 1TJPA 3ABQA 3ZR4A 3TAKA 2TPSA 2ZDRA 4LS2A 4QJ1A 4XWUA 5K9CA 4K6AA 2YDAA 5F2GA 2ZA1A 3AO0A 1YTEA 4MFEA 3PSVA 3M9YA 4DELA 3CT7A 3KHJA 4YLWA 2FIQA 3L5LA 1MZHA 1FWTA 2OX1A 2CLIA 3TC7A 1QFEA 1XC4A 1YPFA 5TBOA 5FF2A 2DZSA 3UZJA 4KKXA 5EY5A 4UTWC 1JCYA 1JUBA 1BEUA 1LRQA 3OG3A 2G96A 4GXMA 4AF0A 3MP4A 3BARA 3TJLA 4MIMA 3DZ1A 4HNTA 1SPQA 3PBVA 3UZ5A 4MJZA 5LKYA 3MYPA 3W1TA 3WK3A 3WJSA 1IXQA 1RQEA 3W88A 2Y7DA 4UTTC 1TPC1 3PUDA 4BWLC 1K3UA 5HNRA 4MVAA 1VCGA 3UYCA 1QPNA 3W70A 1A5CA 1J2WA 3KVJA 4OV9A 3MBDA 5BMXA 3N73A 3QC3A 4HT3A 1JRBA 3STGA 4UFMA 1WBHA 3C3NA 3MHUA 1OFBA 3QJAA 4JS3A 3RMJA 1GYNA 3W86A 3SW6A 3A5FA 2ABAA 4LOCA 3ZWTA 1FDJA 2DZPA 4DO4A 2V9DA 1H51A 3L5AA 3JRKA 1G4EA 1VYRA 5F1UA 1R46A 1KM2A 2QUVA 4JTEA 3MHGA 4JYFA 4FF7A 3KX6A 3W1NA 5C54A 4OBTA 3WJZA 1KA9F 4D2JA 3UQNA 2PURA 3BGJA 4WQ6A 2ZRZA 4UTHA 4Z08A 3LGEA 3DFOA 1D9EA 3N2MA 4WD0A 1TTIA 3QW3A 1JUKA 1VHNA 3DH7A 4U4MA 3W7RA 1T96A 5K4XA 5LGZA 3QZEA 3UWWA 1EIXA 4UMCA 3FLUA 1V7YA 4NVTA 4UTLA 1EP1A 4YXGA 1GJPA 3W1MA 1F7BA 3G3DA 3W1RA 3IGXA 2JKAA 3TROA 4QSHA 2PE4A 4MLJA 3G1HA 3PF3A 3UXDA 3G1XA 3GXNA 3R89A 1GOXA 3ATYA 2H90A 2VC6A 1TPWA 2ATMA 1FDYA 1EWEA 3GIYA 2YFOA 3NO5A 4S2CA 2A6LA 3TQ0A 1AW1A 2P0OA 4BI5A 2OJPA 1W5QA 4GFSA 1JCNA 3W7EA 3KAOA 2ZQ0A 2RHGA 2ZTKA 5U7SA 4JGDA 4X9SA 3W1QA 1EUNA 5F2MA 3FKKA 2V5LA 2W6RA 4QISA 2P1FA 2WV8A 3LI1A 3M7WA 4Z0JA 4TR9A 2X1RA 1VRDA 2J24A 4MFDA 2CLFA 4O16A 5KTLA 1H1YA 4R33A 4RZ6A 2JK2A 4O53A 4I7UA 3O8AA 1QPQA 1W56A 3LXBA 2Q3RA 1B57A 3DHFA 3ABOA 1TQJA 1DVJA 1ZY9A 4H4IA 3U6WA 1O5KA 3W7MA 1GYLA 4DXVA 4K8HA 1H7NA 3QEZA 3GZ3A 5D2XA 4NNCA 3R5EA 1GVOA 3N19B 4XUGA 5D33A 2EKCA 5FF4A 2ZFAA 3GDRA 4JN6A 4NJKA 2X1SA 3M6YA 5TIMA 2NZLA 1WBJA 3N34A 4AXKA 3CIWA 4Z0SA 3TIMA 1JUEA 1H61A 4DPQA 1LROA 2RDWA 2CZEA 3NM3A 1SW0A 2YW4A 4OWGA 3HBLA 1UBSA 2CZDA 2G95A 3EX3A 3PM6A 1A50A 4K7VA 2E6YA 3O1NA 2VENA 3ABRA 4QIUA 2I1OA 1O60A 1KTCA 3UXAA 3Q2DA 2TMDA 4G1KA 4HKPA 4NU7A 3TFCA 3LERA 4RKAA 2NXIA 3NL6A 3ZS4A 5AYXA 4QNEA 1Z44A 3G3MA 4XBKA 4HNUA 2WKJA 3P84A 3L65A 1Q3NA 4IGHA 3VCRA 2PRHA 5CPMA 5G4WA 2ZRWA 4A3UA 1N55A 4O57A 3P5ZA 3CPRA 1QMLA 1JULA 4M6QA 3TSBA 3GNDA 1T8XA 5LNVA 1H7OA 2NWRA 3EWZA 3S5NA 3W83A 3W73A 1LP6A 1AK5A 4FIQA 3E0IA 1DQWA 2ZZ1A 3CQ0A 3VE7A 1AW2A 3LM7A 4KFPA 3CWOX 4IX2A 3O06A 1VZWA 1OX4B 3ABSA 5D03A 5DBUA 3N2XA 1TQXA 1G4TA 3RU6A 1WOAA 3BW4A 1W37A 4FNTA 5E0KA 1ZALA 3S5OA 4MJMA 2VFEA 3C2FA 2E09A 4S2BA 4RV8A 5F2LA 5D02A 5KZMA 3M16A 1I8JA 2EPHA 5FEXA 4LRSA 5BRBA 4LVAA 3QMTA 4JIPA 2WNNA 5LSMA 3L2IA 4LVGA 3W6YA 3B04A 5LNUA 4N9DA 3HOJA 4BI6A 4HSNA 4ZZ9A 4M19A 2WQPA 1ME7A 2Y63A 1P1XA 3CEPA 2VFHA 1TSIA 1HO4A 2FJKA 5CSRA 4OQVA 4CQ9A 4GUJA 1MXSA 1TMHA 3F03K 5F1VA 1MSSA 3V1PA 1K8ZA 2ZA2A 5FEZA 1W31A 1Y0EA 4AH7A 5I3FA 3SR7A 1G4SA 4UC5A 1JQVA 3BGGA 2YYTA 4P61A 3TQKA 1X8FA 1OG0A 3Q58A 5D2WA 4LNYA 3PBYA 3IV3A 2ZZ7A 4U28A 1KFCA 2Q3OA 5HUOA 3PR2A 3BK0A 1LTDA 2VEIA 3M5ZA 3LCLA 1OFOA 1W5MA 1DV7A 3KRZA 3EXSA 3P8JA 4JTKA 4RZ5A 4FNQA 3STCA 1VHCA 1OFEA 3YPIA 3PB2A 1LLWA 4FXRA 4A21A 1TB3A 3DBPA 4Z1DA 2TYSA 5D09A 3S1WA 4IXHA 3SJ3A 5HJLA 4Y9AA 5I3JA 4Z1CA 1GVFA 1KV5A 3GX9A 1EA0A 3C56A 2J9XA 4XBSA 1KLYA 3W23A 3C4UA 4GE8A 3W7KA 3NQDA 1PVNA 2RH9A 1M5WA 1FWNA 1M7OA 3EWWA 3QPYA 1TRDA 4BK9A 3GVGA 4GBUA 4ADSA 3TA6A 4EOUA 2B7PA 4LS0A 1L6YA 1VCFA 4ZQOA 1X7FA 3S42A 2VFIA 5LHFA 3GXPA 1ZENA 5D37A 4FX7A 1WYIA 4JX5A 1L9WA 2D73A 2NLIA 1VYPX 4GWEA 3NAVA 1TV5A 1TIMA 4LWWA 4WZHA 1DORA 2Z6IA 4S1FA 3E9AA 3O6YX 5CKSA 4A29A 3C8FA 2NV1A 3KVKA 4O54A 1IIHA 4MZYA 2Y61A 2E68A 4TU1A 2ZZ5A 1XM3A 3TKFA 4EWND 5HULA 3NM1A 3OIXA 1YTDA 5HINA 3PULA 4GUFA 2GUUA 2QCMA 1W3NA 5KZEA 1L2UA 2DJLA 1TRIA 4JX6A 4IOTA 1JRCA 2QKFA 3L67A 3R13A 1BKSA 2B7NA 3L0GA 4ORMA 4JTTA 1GVRA 4W9TA 6TIMA 1ZFJA 2YGYA 4PCFA 3C2VA 4LUIA 1Z48A 1JCXA 3I65A 3LXCA 3FIGA 1TCDA 5CZTA 2VFDA 2ZZ4A 3S5YA 4I7VA 2B0MA 1W0MA 4JDBA 4UUIA 1TYGA 2I9EA 4JTFA 3NG3A 3GKAA 4MOZA 4ZQCA 1I45A 4N9CA 4RXFA 2C19A 4TX9A 5CPOA 4A2RA 3UPBA 4WY0B 4E2BA 4MY8A 5LNRA 1R47A 3NPWA 5D30A 3S8HA 1SQ7A 1KM4A 1ZNNA 2DJXA 2IQTA 1TV7A 2AAMA 2J88A 4MZ1A 4UIOA 2H3BA 4QQ3A 1IXOA 5C2XA 2FFCA 1H63A 4EF9A 3UNDA 1W5OA 3B0UX 3MMTA 4FNPA 4JTUA 3IRDA 1VCVA 2EGZA 1CW2A 1LBFA 2E6FA 3LTYA 4EF8A 2GVLA 1L6SA 4LTSA 2FDSA 1X6UA 4JICA 3SGUA 1Q6LA 2VKZG 5DXXA 2ZYFA 2ISWA 2EF9A 4MYXA 4LV4A 3HMJG 3P67A 1ZHAA 4TMCA 3T55A 3G1AA 1PIIA 3HJZA 3OVPA 3QYQA 3T78A 3ZFHA 1OFAA 3G0SA 4Y8FA 3GDTA 4HSOA 3MWAA 1TREA 3N3MA 3W7LA 1VR6A 3E12A 3W3OA 1S5WA 2ISVA 1TTQA 4IWWA 2AQWA 4HIBA 1YLVA 1PE1A 3PAJA 3MI3A 3M5YA 1QWGA 2Y85A 1BWKA 3OVRA 2NX3A 3L21A 3S1XA 5K2ZA 3G8RA 2JGQA 3B0PA 3LOTA 3TXVA 3LV5A 5AYYA 1HG3A 5G2WA 4AB4A 3WJWA 3FEMA 4ML9A 3QQ1A 2ALDA 3TDFA 4FEZA 2Z2UA 3TQVA 4ZL1A 4LV9A 2WJZA 5CZJA 3A24A 3B8DA 3TMLA 2A1YA 3MHFA 3DFQA 3L5MA 2HSAA 4RLIA 3W9ZA 2QCDB 5G1TA 8TIMA 1QO5A 1KFLA 2E6DA 5DELA 1UASA 7TIMA 5H91A 4GUGA 1NSJA 5IBXA 3W1LA 3GLCA 2E5DA 4X2RA 3P81A 1KTNA 2CW6A 4JTLA 5BNKA 3UWQA 1R2RA 2CZFA 3PWAA 4DO5A 4FX8A 1OYCA 4NJJA 4AHQA 1KFBA 2ATSA 1GG1A 1GG0A 4GC4A 4UNKA 3NA8A 4KWWA 4AWUA 2Y62A 5AOUA 3CIXA 3S1VA 3HGOA 3PVFA 2FQIA 3C0JA 3DXIA 5AN7A 1ICPA 3BV4A 3PBUA 3QH2A 3USBA 3BLEA 3KXQA 1GVQA 3W7QA 4RZ4A 2LLEA 4IMCA 4J9JA 5FEPA 2QCHA 1XBZA 4N6EA 3I7SA 3PG9A 1DHPA 1OYBA 3PSWA 1MO0A 4ZQPA 5CZ0A 1AL8A 2CLMA 4O18A 2YYUA 4GRSA 3LRLA 4UXDA 4N4QA 3FJLA 3PUEA 2QUTA 1XUZA 1RQBA 1FWRA 5BOOA 4GJ1A 5HWMA 2F84A 4O0KA 1G6CA 3NXFA 1O95A 3L68A 2HS8A 1JCLA 1HTIA 3LTSA 1K7EA 2V5BA 3BG9A 1OK4A 2C14A 3GXTA 4FX6M 3RNDA 1T99A 3EWBX 3F4NA 1VLWA 3KVLA 3HB9A 3QPZA 2YXGA 4TO8A 3TSMA 3BW2A 3A22A 2Z6JA 4NJHA 1WDWA 2NX1A 1ADOA 2X30A 4WUIA 3TC6A 2VELA 3CC1A 1QDSA 4NXSA 4O1DA 3B03A 1SO6A 3HIJA 2GPTA 3G1YA 3NPUA 4O14A 3KRUA 3E96A 4YWIA 2BXVA 1S5TA 5L6UA 4WXYA 3TJXA 5C6MA 2YW3A 1WAUA 3EWXA 5HR7A 3THAA 1RPXA 2RDTA 4B5NA 3NL3A 3QSTA 2DZWA 3DGRA 1WQ5A 2E5BA 3NQ7A 1VYSX 1H7PA 2OMAA 1W54A 1GPWA 1QOPA 2VFFA 3W7NA 3FFSA 4O13A 4EIVA 4PC8A 1W8SA 1I2RA 3NNTA 3DKLA 1OFPA 1UUMA 1YTKA 4AHOA 4DQWA 4UFKA 3MI6A 1NVMA 2QCNA 1R30A 4K38A 2UV8G 1YPIA 2I14A 1L6WA 4ADUA 3NPXA 3CTLA 4UR8A 3DKJA 4Q33A 1V5XA 1KW1A 1VQTA 3INPA 2CLLA 3LTPA 3D0CA 3ATZA 3MI2A 3S1UA 2NUXA 3M0ZA 5LNWA 1XL9A 2TSYA 4HNVA 1Q6OA 4AAJA 4O52A 3M47A 1Q6QA 4MZ8A 3UWYA 2AGKA 3LHVA 2VFGA 1I2NA 3W85A 1A5AA 3QM3A 1NFBA 4MPQA 1TPVA 5G4EA 2G5WA 3DFSA 3HG5A 2GOUA 2NXHA 3GKFA 4XKYB 2DP3A 1F76A 2BZNA 4JY9A 3U2OA 1OF8A 2H3DA 3FOKA 2C15A 2NXGA 2V30A 1TTPA 2E6AA 3EKZA 1XI3A 3O16A 2GVGA 1BWLA 2ZA3A 5EKYA 3W7HA 2CLEA 3GDLA 5EA9A 1FQ0A 1ZAHA 4TMBA 1AW5A 2DORA 2C16A 2DZTA 2Y7EA 5AHMA 4ONVA 3LCGA 3SY5A
chains in the Genus database with same CATH superfamily
1I1WA 3GXFA 4IMAA 3L0NA 3H4XA 3LPGA 1VFMA 5D04C 2Z1KA 4PN2A 3FY1A 2OLHA 1I2PA 4YCOA 1SZEA 1NDZA 3WKZA 4JTSA 1GYMA 1M01A 1V4YA 2A3AA 3WQEA 4Z1AA 3BLFA 3S3GA 4M6UA 3W7DA 3OZMA 1KFKA 4MUZA 5EL1A 3CZGA 3MC5A 3SGGA 4UMAA 3Q94A 3H21A 4UWMA 1W9UA 3N4EA 1BVWA 1WDRA 3DG6A 2EPMX 4WXZA 3QW4B 1EUAA 4FHAA 1C90A 1UZDA 2QCCA 5G1YA 1YE4A 3CWHA 4E5TA 1EDQA 5A69A 1OK6A 4X0NA 4OHQA 4K39A 4S23A 1TWIA 4UZSA 2R1KA 1V93A 2EHHA 3SQLA 4DJFC 5IFPA 4R53A 5LNSA 2QV5A 3VMNA 5I02A 4DUXA 5C7HA 3VOIA 3H55A 4AYSA 4ZXLA 3SY1A 3K8MA 2J66A 1G0CA 5E9AA 4AZHA 3GC5A 1OX4A 1G94A 3W84A 3HMCA 1T0OA 3H2OA 4QDWA 2OWCA 1EEPA 2OZ0A 3CBWA 4IH3A 3W00A 1TELA 1Q8AA 1KFEA 3BSMA 3R11A 3IAPA 4TVUA 1OVDA 1CXHA 2ZUWA 1CNVA 1XQKA 4UR7A 3QRHA 1FCUA 1D3CA 3I68A 3W1PA 2GDQA 2HTMA 3UY7A 4CGTA 1XYZA 3QXBA 3LHYA 4LEQA 3SGZA 3IIOA 1YADA 5DMLA 5LIXX 5BXPA 2WNQA 4XTIA 3CPGA 5C9ZA 4O1BA 2EQDA 2A85A 1NF7A 3CEUA 1TV8A 4ZQRA 4M56A 3MUZ1 3S2MA 4MWAE 3V5OA 5CG7A 1EYWA 2FTPA 2OR2A 5D38A 2WNWA 2XSXA 3IIXA 4FNRA 3MCOA 2CYGA 1VLIA 5CLTA 4C6JA 1OCJA 2CETA 5I3IA 2VOTA 1TJ2A 4HA4A 3QN3A 1FY6A 4CNOA 2C6QA 3NEVA 4O28A 4ZGYA 2C0HA 1OB0A 2Q8LA 3WG6A 2XFWA 2NT1A 4JFUA 4HHHA 3K13A 1K8YA 1R0MA 1TPB1 1UJQA 4CNPA 3ITTA 1EP3A 1ECQA 3T4CA 4AG0A 3BJTA 3SSZA 3CH0A 5C55A 1JVNA 4W4QA 1LJYA 2R94A 3G1VA 2KX9A 3TW9A 1WZMA 3BQ5A 3FS2A 5XINA 2XH4A 3ARQA 1A3WA 1WE5A 1E73M 1CBGA 3N3TA 3A4JA 4L9XA 3Q67A 4TTUA 4QGCA 4NAEA 4H9ZA 2RUSA 1XF0A 1X1ZA 5F2IA 3VKAA 4BF5A 4IQJA 4AWTA 3LZ3A 3NGJA 1JXJA 3UR7A 3MP5A 3MWCA 5AC6A 1HJQA 3GDMA 4GBDA 4UNLA 4ICNA 3ARWA 1QBBA 3TP4A 3UT0A 3GUGA 3K4WA 3BW3A 1Y65A 3GXIA 4HJWA 2PC4A 1RZMA 4S3DA 1QI4A 3SCVA 2C18A 3VNYA 4OV4A 3TXZA 3EXTA 4PBEA 1OM0A 1XCWA 2OGJA 3POHA 4O19A 2D69A 1KBJA 2QCEA 3IJLA 1ELSA 1PV8A 3P80A 4KS0A 1FWWA 1GJWA 3CH9A 3DENA 3T0BA 5LYRA 1SZRA 2DT1A 1W5NA 3TH6A 5A6MA 1YXDA 1OEPA 1CPUA 2YIHA 1QNVA 3GTIA 4WY0A 4O0ZA 3NVTA 5BW6A 1SFLA 4FLQA 5A8GA 3ANYA 4K36A 2VR5A 4OZOA 1LDCA 1S2AA 2CBUA 3MJMA 1DBTA 4EXAA 3W53A 3DFPA 2DT0A 1J11A 2Z7GA 2ZUVA 4RDYA 1FXQA 1YXCA 2VRQA 1KM5A 3A4WA 3VDAA 1S5VA 3A3XA 3MP3A 2PD5A 3OLIA 2JEPA 5LIWX 3PJWA 3PY2A 1Q13A 1IEIA 2PDIA 1US2A 2VZUA 4ZOCA 1ICSA 3LRMA 3VIPA 4BEQA 3P5YA 4D8ZA 4P7QA 1KM6A 3KOWA 3KRBA 1UR1A 3E2QA 4Y8EA 1AVAA 3T4WA 5FJRA 3WD4A 1XRFA 4PL1A 3VU2A 1QXLA 3SCUA 1RK5A 2Y6ZA 3VD9A 1ZTVA 4L5ZA 2WMKA 3NZQA 4GQGA 2CZ5A 4D9PA 3W25A 1HFBA 2CIPA 3UG5A 1N7KA 3UR2A 4DWSD 1F4AA 2OPJA 1JZ6A 3O05A 3W7PA 3PUGA 2J78A 5HJXA 3WBXA 1VBJA 4ZOAA 3C0LA 2VP8A 3GM8A 4HHLA 1M41A 4YL2A 1MNZA 2VWTA 3BG5A 2ZTJA 1TUFA 3FJNA 1UCWA 1RY8A 3P60A 4C6LA 5T8GA 4AD1A 3BG3A 5HWJA 1HP4A 4DNHA 4HQVA 4QE1A 1CI1A 1W32A 3VKCA 5AC4A 3ZZ1A 3N14A 3XISA 1OYAA 3JS3A 2TRSA 4GYPC 3UG3A 3ID7A 4H9MA 3PFMA 1J12A 1UKOA 3VXGA 3RHGA 2ZRUA 3M0IA 1GTHA 3VA8A 4FIRA 3OB8A 5A8MA 4A6GA 1CXFA 3PAOA 2WAGA 4GCXA 2PCEA 1XX1A 2X42A 3ARXA 3I4EA 4K8GA 1PJ9A 2C0AA 4DZIA 2OEMA 4CCEA 3HPZA 1XYLA 3OVQA 2Y89A 3R6IA 4F48A 5FF3A 5ABTA 5IFTA 3E02A 3BTNA 5JIPA 5DXYA 1WPCA 3WNOA 4NZCA 4XZNX 4W7UA 3DYPA 1UD3A 4NAFB 2G41A 4FNSA 2VVSA 2WZHA 3IJDA 2OLSA 2X2GA 2BG5A 5D2TA 2J9ZA 4HZ7A 1BVZA 1TCMA 1MDRA 4O1AA 1PKLA 1WDSA 5ABFA 1GOQA 4PMOA 4LVFA 3GVWA 5CJNA 4GPNA 1K9DA 4L6HA 1EQCA 1J0JA 3AXIA 3CMJA 3GBEA 3B06A 3P7YA 2VZTA 3EWCA 3UGVA 2JE8A 2A21A 1AL7A 3F5LA 4XKMA 4YJ5A 1LWHA 1JYNA 3H2CA 3IGSA 3T40A 1DHKA 2D24A 1KNWA 2D0HA 3E0FA 2YBUA 3PG8A 3VCCA 5CC3A 2PCQA 3ARRA 1C29A 2BXYA 4K68A 3CHFA 1Z89A 3F2DA 1E5NA 3U48A 1NAL1 3U2CA 2CNCA 4MB5A 1K02A 1TPEA 4D6FA 1X6NA 4M80A 3SUSA 3P8IA 1OABA 2ZE0A 3SECA 3OGVA 4NAFA 5F4WA 1TPDA 1GJUA 5M17A 3G22A 3WQ8A 3M5VA 1PCWA 1TA3B 1DQXA 1OX6A 3AHZA 2F6XA 4YTRA 4US5A 2PU1A 2XN2A 3HG2A 1RHCA 4YN5A 1B3WA 4GFIA 5F7UA 3WMSA 2NW0A 4JAWA 1QPRA 3KLLA 2Z4GA 4WJEA 3LLXA 4MG4A 3JR2A 4B9ZA 2ISSA 3E2RA 3VNDA 4CNSA 3S47A 1JZ2A 5A5WA 3BJSA 2WMGA 3VILA 4YPJA 1SU5A 1OF6A 4C6BA 1QNPA 1XBVA 2ZC8A 3TMQA 4NZJA 2BTMA 3CQHA 3GK0A 4O8RA 4Q8PA 2A7RA 2V81A 1FTXA 4JFWA 2RKXA 3NYZA 1W1YA 2J8FA 1XUUA 3O6CA 4J3VA 3H8AA 5FSEC 3BO9A 3D3FA 3N11A 1V6UA 4IT1A 3WX7A 1JQXA 1TA3A 4PUUA 3S0CA 1PYMA 3C61A 4O1CA 2PBOA 5LIUX 1OFRA 1OFDA 4JHMA 5CPTA 3PP7A 1LLZA 4ZXOA 2EPNA 3WK0A 4HYVA 4RE3A 1PX4A 4GA8A 1QUMA 1OQFA 4GG9A 3NQ6A 3AYVA 4R7WA 3FVDA 4XD3A 4LVDA 3V5FA 2HE5A 4QTGA 2VDGA 1ODZA 2RGMA 1JJKA 2JEQA 2XZ7A 1DWFM 1JD9A 3L66A 3C2RA 3MO4A 4BR1A 3AZRA 4V1XA 3VUSA 3M0MA 3W87A 2GDUA 5CPQA 3ZT6A 5A2CA 1E0WA 4YCPA 3E0VA 2IXVA 4O10A 1XPGA 4GIAA 1F4HA 5D2YA 1UZ4A 3LHWA 1OJXA 4HHPA 3SI9A 3NDOA 2VZOA 3H12A 4ERIA 3LSCA 2PTYA 3PUOA 3TTYA 1SR9A 4QE5A 2DSUA 4KEUA 1A80A 2ZXDA 4X60A 4E4FA 3WNNA 1FFQA 1SO5A 2J7EA 4Z17A 3QR3A 4JFSA 4AZGA 5CPLA 3VTRA 5HQEA 2QCFA 5H8PA 1JL8A 4MYAA 2BOGX 4RNJA 2X16A 2Z24A 1FWIC 4C6FA 1FWSA 2OX4A 3TW7A 1RVGA 4FMVA 1HL2A 1VFFA 1XKYA 3FKRA 4WX2A 3TA9A 1HKVA 1KV8A 3W7GA 1UMLA 2OKTA 1MUMA 1NH6A 3G5EA 3ZJ6A 1EWDA 4X3ZA 3L0KA 1UD5A 3DFTA 3T9PA 3QY6A 2BSLA 5E70A 4AZIA 1QK2A 4PEKA 2V3EA 4O15A 4WDUA 5JH1A 1GKQA 1XRVA 1F73A 1FWGC 2W9MA 1A5SA 3CTTA 3NO1A 3EOSA 3PK7A 1FCBA 3VDCA 4JYEA 3IIPA 3NQEA 1D2KA 1E4LA 1BXCA 9XIAA 1ME8A 3EX6A 1XIHA 3MUCA 2E8YA 3F2BA 2J7GA 1O94A 2WSQA 4WSKA 1WAWA 3SIZA 2VEGA 5HUPA 3VDHA 2UZ9A 3K4DA 1XDMA 3UPWA 3KVMA 4BEUA 3G1SA 1H3GA 1XLMA 3BSGA 3WH8A 4DJDA 4RJEA 5G2IA 3KLKA 1ZP3A 4KIEA 1KQYA 1C9DA 5FA5A 3AMLA 1CGXA 1KXQA 4L4MA 3A3WA 2QEZA 4D6GA 4KWVA 3ME3A 4DJEC 3TR2A 3W07A 4DF0A 2QJIA 1WUFA 4YMZA 1YYAA 4MNKA 1DIDA 4Y90A 2J79A 1IYXA 3TCEA 4B91A 1EHNA 4LS1A 4PODA 2PLJA 1TVLA 3ABQA 1ISVA 1KBLA 1DPMA 3CZ8A 1VFSA 2PDMA 4DIAA 3PSVA 4C6PA 4M8UA 3T0DA 1MZHA 4OVXA 1JPIA 1NM9A 2O4QA 2OX1A 1W1TA 1GK8A 3GS6A 4DVOA 5EY5A 4UTWC 2BVWA 1JCYA 3AS3A 1LRQA 3IK4A 3UP8A 2O4MA 4GXMA 4G6CA 4DHGA 3BARA 5IDIA 3TC3A 3URBA 4R9XA 1E6PA 1SPQA 4MJZA 4RNHA 2OZ8A 3UG4A 4AX7A 5LKYA 2HPMA 1Q6FA 2FTWA 1IXQA 4L80A 2F6UA 3DEQA 3PWGA 1Q7QA 3W88A 4GH3A 4UTTC 5M2FX 4HMCA 3PUDA 3ANUA 3MU7A 5HNRA 1L8NA 3W70A 5BRQA 4XISA 1J2WA 3KVJA 3H2FA 2C91A 2DSVA 5BMXA 1H0GA 1PEZA 4JTAA 3ITLA 3WD0A 3VOHA 1XSJA 5XIMA 1OFBA 4DLMA 1A5MC 4H83A 3SDOA 2JFEX 1MXGA 4KT2A 3WD3A 1PXGA 3GD6A 4LAKA 2Y8KA 3DHUA 1TZ9A 1FDJA 2DZPA 3GG0A 3VIOA 1H51A 3L5AA 3U0HA 3JRKA 5KEZA 3M07A 2Q6ZA 1VYRA 5F1UA 4XIMA 2QUVA 4JTEA 5DMNA 3VZZA 8CGTA 2XINA 2PP3A 3W1NA 2P5NA 5C54A 3ARTA 5T9BG 2A3HA 4PCSA 4XZHA 3DFOA 2Z1WA 1D9EA 1VPQA 4MSSA 4UBPC 1YHTA 1TTIA 3W7RA 4U4MA 5LGZA 2I17A 1JAEA 1EIXA 2ZWZA 1FP8A 2PAJA 1V7YA 1BYDA 1E56A 3OU8A 4FXFA 5A2BA 4EX4A 1QNRA 1I0BA 2ODOA 2D0GA 4NG3A 1FHLA 1IQ8A 3TROA 1JZ3A 1DIEA 2QJNA 2PE4A 5A6BA 2L5HA 3PZTA 3GXNA 3R89A 1GKRA 2VC6A 3CO4A 1AJZA 5MF5A 1LT7A 4S2CA 2A6LA 2XFYA 1AW1A 3KAOA 3UR8A 2ZQ0A 3LA4A 2GWGA 2ZTKA 4GQ0A 4U3CA 3FKKA 1OBAA 5A8PA 2P1FA 3LI1A 1ITXA 1E0TA 3M7WA 3NDZA 2J24A 4MFDA 4O16A 5I06A 1BF6A 4ZOEA 3ARSA 3ANVA 4MDOA 3ZVHB 5ENLA 3BGAA 5A6LA 4O53A 1XYFA 4MKSA 4QXIA 1V77A 1B57A 1JPDX 2VTFA 4B3KA 1W3JA 2OZ3A 4M29A 4AD0A 1O5KA 4IIDA 2HPIA 3F7JA 4DXVA 3GZ3A 4IIFA 4WRHA 2OSYA 4MNMA 7REQB 1NQKA 2P3ZA 5EMMA 2ZIDA 2WC4A 1J9YA 2D2GA 3W38A 4NJKA 3PPGA 4HPGA 5TIMA 3UFYA 3AC0A 3AIWA 3KBJA 1SW0A 2ZC1A 4OWGA 1J0KA 2CZDA 3GVRA 4A8RA 4K7VA 3UJRA 3GFZA 3O1NA 3LYEA 3QC0A 2QV4A 1NTHA 3LNPA 4JHOA 1WDPA 3ZLFA 4HKPA 4NU7A 3DFYA 2PDFA 4RKAA 3UGRA 2QPXA 4JQAA 3M7SA 2VURA 3RDKA 4LPCA 4J5NA 1HW6A 4GYJA 4HNUA 1R3VA 4ZO8A 3VCRA 4GX8A 1QMLA 4ZR8A 5H8MA 4M51A 1QWKA 4QE4A 1LQAA 1QNOA 3EDFA 5LNVA 1H7OA 2NWRA 2HRWA 1LP6A 3NZPA 1WDDA 1AK5A 3K8KA 1EJSC 3WF0A 3CQ0A 3NSNA 3CWOX 3CNYA 3ABSA 3IJ7A 4QAWA 2ZX7A 1WOAA 4JL1A 2J75A 3FDKA 4TV6A 4JTCA 2E09A 3RO8A 1QW8A 3N4FA 2BVYA 5EMLA 1KQZA 1ONEA 3FYYA 1B0IA 5HANA 4IL0A 3I3EA 1S38A 2EPKX 2Z25A 3K1GA 4PUEA 1JYWA 1V79A 4N9DA 4L61A 2PWEA 5HNTA 2NQLA 4LYRA 4CQ9A 1TMHA 3DC8A 3AZSA 5HATA 4HNLA 3UXIA 3WYZA 5AC5A 2E9BA 5AVNA 1W31A 1NWRA 4JKLA 1G4SA 1JDAA 2QIWA 3TQKA 1OG0A 3MSDA 4LNYA 3IV3A 2ZZ7A 4U28A 1KFCA 4UNIA 3F2CA 2P53A 2PDLA 5FJJA 2BHZA 4D6DA 2BOFX 1W1PA 3M5ZA 3LCLA 4FNQA 4NZ1A 3STCA 3UVIA 3WH5A 1DJXA 2EPLX 1LLWA 2JIEA 1FWFC 2VNCA 2CEQA 4FXRA 3VD5A 4A3QA 4QLLA 3S1WA 1IT7A 3J7HA 3N25A 4PUNA 3OJGA 4Y9AA 4KQNA 4PMRA 1TX0A 3SCNA 4Y9NA 3W37A 1KV5A 3GX9A 3UZXA 1EA0A 1D7KA 4JQ1A 3NJ3A 4XBSA 3C4UA 1UKPA 3NQDA 2RH9A 1PB0A 5TAOA 1FWNA 1HJWA 2SFPA 3JVAA 1M7OA 4BK9A 4GBUA 3WL1A 3TA6A 3UBPC 4PR4A 3U3HA 5LXEA 2B7PA 1VCFA 1X7FA 3S42A 1Y5WA 1ZENA 1J79A 1O1ZA 2W61A 2QJJA 4H9VA 1S2VA 1O68A 1TV5A 4WZHA 4HK5A 3ITGA 2ZUTA 1DXFA 3C8FA 2NV1A 1EC9A 1VBRA 2DT2A 3T8LA 4TU1A 4DY1A 3TKFA 1EFZA 3OIXA 3LU2A 4US5D 2ACRA 5D9PA 5KZEA 2DJLA 2Y8VA 1TRIA 2DZAA 2B7NA 4ORMA 1O5RA 4W9TA 1KCZA 1A5LC 4PCFA 4R88A 4LUIA 1KBKA 2XZ9A 3I65A 3LXCA 3BOFA 2ZZ4A 4ZO7A 1VD6A 2HV5A 3CPUA 5FL0A 4I7VA 3VM5A 3OO2A 2G8ZA 1W0MA 4A8NA 4UUIA 3WFZA 3GKAA 4MOZA 2ZICA 3GFXA 4D6CA 3MDUA 2BVDA 4RXFA 2Y4SA 3URNA 4FOJA 5LNRA 3TOPA 3U4AA 3NPWA 1BXBA 4L6OA 1L0PA 2DJXA 1KM4A 1ZNNA 4MZ1A 4QSFA 4UIOA 3VOFA 1BKHA 4NYYA 1LL6A 3KOYA 3GTNA 2ZX5A 3MMTA 3IAQA 4JTUA 3GRIA 4TX6A 1CW2A 4ROQA 3RPTA 3O0FA 1VJSA 2PZNA 3OW1A 1X6LA 5TNVA 3RAOA 1UQZA 4JICA 3BV7A 1Q6LA 2VKZG 5ABHA 3LENA 2EF9A 4MYXA 4R5EA 1ZHAA 1OC7A 3G1AA 3TJIA 3HJZA 1J0ZA 4GYFA 4M3PA 3MT1A 3T78A 2VZVA 3S2CA 4HSOA 5T9CE 1W91A 5GNXA 1HVQA 2ISVA 1TTQA 2NQHA 1HXJA 2AQWA 4ACYA 1YLVA 1CT5A 1V0LA 3LNMA 2PWGA 3MI3A 3LG3A 3M5YA 5FOOA 3D46A 2NV9A 1E6SM 4GXPA 3PJUA 1VP5A 3LOTA 3LV5A 5HMEA 4MKVA 1F3TA 3C2YA 2ALDA 2WJZA 1IWPA 5CZJA 3PJTA 1Z32X 3B8DA 2A1YA 3DFQA 5AYBA 2XIIA 2J62A 4CKQA 8TIMA 3QR0A 3SUVA 4CU6A 4E8GA 3I6TA 2UY3A 3UWQA 4QR6A 2PDXA 3I3DA 3T2PA 2PDWA 4KGLA 1HKWA 4XVEA 3NA8A 1IEQA 2IQDA 1S2UA 3S1VA 3VCNA 7TAAA 5KETA 3BLDA 3SRFA 5AN7A 3PBUA 4XBJA 4LUSA 2PSNA 3BLEA 3MVIA 2NLYA 1Z69A 3W7QA 4RZ4A 2LLEA 4GGHA 4IMCA 5FEPA 1XBZA 1EBGA 3NVDA 3H4GA 5BU9A 5JBFA 2D2HA 4J27A 2Z2AA 4UTFA 2WLYA 4O18A 5GQBA 1DYSA 4OOUA 2QUTA 5HK4A 5I07A 1J96A 3QHOA 3LPPA 5HWMA 1QPKA 1E40A 4D8LA 3NXFA 3NIYA 1JCLA 3LTSA 1O12A 3ECQA 3EA2A 2V5BA 3OZYA 3P3BA 3QVQA 4Y9MA 1Z7AA 2O9OA 2R1PA 2C14A 2Y5SA 1SJCA 1T99A 3KVLA 3QPZA 4TO8A 3TSMA 4TV5A 1ZJBA 2VVNA 2QZRA 3A22A 4NJHA 3L7RA 1V03A 1WDWA 4BJHA 1A5OC 2DUXA 1ADOA 1B90A 3TC6A 1OCBA 4O1FA 2OWWA 4DJDD 1QDSA 4S38A 3HIJA 2GPTA 3NPUA 2BXVA 5G1MA 1T41A 5C6MA 2GVYA 3QYSA 1XSKA 1A5NC 1NWUA 1RD6A 2RDTA 3WBYA 3HN3A 3DGRA 4CN6A 2V67A 3NQ7A 1VJZA 4O13A 1C7SA 4EIVA 1W8SA 1MXDA 1P1MA 2BGQA 2FVLA 4MB1A 4AMCA 1YTKA 4DQWA 4UFKA 2PDYA 2TAAA 2QCNA 3T42A 2E3ZA 2RJHA 1HGYA 3IS4A 3VGFA 4MNLA 4UR8A 2VMFA 3DKJA 4DB7A 4FOUA 2XVNA 6ENLA 1M65A 1H41A 3ATZA 4DBWA 3WN6A 1QTWA 4LF2A 1W9PA 2E28A 4AZBA 1Q6OA 1R7OA 3A6OA 3B8UA 3GVQA 3B0XA 4MZ8A 4PMXA 1ODUA 3UWYA 2W91A 2VFGA 3QM3A 2FKPA 1NFBA 2XWEA 4MPQA 2NXHA 2PPGA 3GKFA 4XKYB 4MUPA 2YDRA 2DP3A 4QCFA 3WUBA 4JY9A 2QDDA 1CYGA 1EA9C 1VIWA 2V30A 4G1NA 3EKZA 1PZ3A 3EOOA 5C9XA 1Q66A 2XM2A 4IFOA 2GVGA 1EQPA 1BWLA 2CLEA 5D8ZA 3SAZA 4XO6A 3E0LA 4GY7A 1QOXA 1AW5A 2DORA 5AHMA 3DN5A 3U5UA 4DUVA 4FR6A 2VHLA 3WIJA 4I6KA 3MA8A 3VNLA 1NDVA 1XIBA 3MANA 4FK9A 2QUNA 1I75A 1FBAA 4LB4A 1XXXA 2QDGA 1LLOA 1K6WA 2ANUA 1XLLA 1PIGA 2WQDA 3W1XA 2VOMA 2VGFA 1BG4A 2TODA 5FIPA 2GOKA 4XAFA 3WFLA 3CM4A 1ZCOA 3GR8A 4J3UA 1LYXA 4E38A 1XYAA 1H7RA 2ZXQA 4AMAA 4KCVA 4IFKA 1H1NA 2D20A 1E9YB 1AH0A 3S9YA 3EZ4A 4ZFCA 1LBMA 2OTDA 4Q4MA 1XBXA 3IVSA 4K37A 3RF9A 2VX5A 4KW2A 4KESA 4OTKA 2RGLA 3S6OA 3WQ6A 3F4WA 1EF3A 1XQLA 3BH4A 3MUXA 3N2BA 3GNRA 3WF3A 1TIWA 3O15A 1TZ7A 3NQCA 1ZAIA 1R2SA 1LOQA 3RILA 3V4BA 3NO3A 2ZWYA 1A5KC 1K8CA 4O11A 3NQAA 5A6BD 2QF7A 3SADA 3W2JA 4Z1BA 4XZMX 3QSRA 2YDQA 1V02A 2I7GA 1G5AA 2WSYA 5ECUA 3BL3A 4I8YA 3RO6A 1J4EA 3LGDA 1UC4A 4GYPA 2XN0A 4GIRA 4C6DA 4DPPA 3CIVA 1QATA 2QS8A 5AYZA 4UQ9A 1OCQA 1BG9A 1EP2A 3H7VA 4IXXA 1NOFA 3VX1A 1EIBA 4R27A 4DBSA 3TW6A 3C86A 4HA3A 4GYKA 1C7TA 5JU6A 3VNMA 2INFA 2FB3A 4GUHA 6PTDA 2VCCA 3NYDA 1ML1A 3FK4A 2NWSA 4J4KA 1CGWA 1K8XA 2F61A 2VEKA 3EB2A 4CCCA 3CUFA 1H62A 2WMJA 3W72A 1ALDA 1R87A 4POCA 3NPVA 1GQKA 5CZSA 2HVOA 4N9EA 3SSJA 5TF0A 3BXWA 1J01A 3U5YA 1WO2A 2OT1A 1A49A 5LZLA 6CGTA 4R7OA 3DFNA 1P43A 3CAVA 4TX8A 3UF9A 2GUBA 1S2CA 1ONXA 4Z2LA 5D32A 2YJQA 3ZT5A 2WZIA 4KCWA 3WLTA 3HJEA 1Q45A 3TN5A 1DJQA 4IP7A 1XSIA 3LXAA 1IWAA 1S46A 1PO9A 1A53A 4LUJA 1ZS2A 2ZKMX 1K7FA 4UFLA 2YXXA 3G1DA 3RLUA 1W9DM 1DL3A 3KS6A 3OPSA 1MQRA 4IISA 4AX6A 2QULA 1XYMA 1O66A 4F3HA 1RH9A 4PL2A 2CU0A 2P10A 2XFFA 3IEBA 1Z8AA 3FXYA 2C13A 3SJNA 3WF4A 2V0TA 4AZ6A 4RPPA 4AEFA 3IUHA 3RYSA 1EB3A 4P8XA 4MM1A 5CJMA 1XP3A 3LCXA 3ISIX 4INFA 2H9AA 3CQIA 1QHOA 2CFFA 1IGWA 5D9MA 3WMLA 3BAXA 1EKOA 4ML4A 2GZXA 4KGJA 3G6LA 1LBLA 5DCBA 2WVSA 5AHLA 3N29A 1PSCA 3K30A 1UZHA 3M0XA 4IICA 3WJYA 3NUKA 1M6JA 4QROA 4ALDA 2C8NA 4P2VA 1FOBA 4FO4A 4IGMA 1J6OA 1XLBA 3PBWA 2ISDA 3PHAA 1WA3A 4CU8A 1OFQA 4AD5A 2EG7A 1F61A 4HZ6A 2FH8A 4PYSA 3KEHA 3LHZA 4KIRA 4JXCA 1H49A 1WB0A 8XIAA 5FJOA 4S3KA 1PHWA 4C6OA 4AW7A 3LGGA 3LD5A 4ICMA 5DO8A 2FVMA 1E4NA 2WVVB 2A2IA 1XDJA 4YYFA 3FJ6A 5AHIA 3VIKA 3FCPA 1RJRA 2ALRA 1WV2A 2BY0A 3GH5A 3B97A 1XLIA 1UW9A 1LZOA 3G8EA 1TJRA 3ZOAA 3ZT7A 3W2MA 1VEPA 4Q4KA 2FZBA 2ZXAA 2OOFA 2WM1A 1SZFA 4PFHA 3STEA 2PDGA 3M6DA 1QO2A 3SCRA 3U9IA 3C6CA 4LY8A 4RR4A 5AFDA 1JDEA 3QMRA 5AHNA 3W1UA 4R7JA 2JGYA 2GJXB 3T09A 1FWDC 1E9ZB 4U5KA 1H7WA 3WUGA 2PMQA 1P5BA 4V15A 3W2KA 4WY0F 1A0EA 4D6EA 3F4CA 3T05A 4GACA 1CDGA 4FOKA 3QQ0A 4ZMGA 4GINA 3BQ6A 3TV8A 1N8FA 1BWVA 2PC8A 1BSIA 1TV2A 4EANA 1TO3A 3M0YA 2O7QA 7XIMA 3UWZA 4MY1A 2DIEA 1CX9A 1EOKA 5DY3A 3MSYA 1PTGA 3DERA 2IQ0A 1B1YA 3B0VC 1R38A 3RG6A 3TK7A 1TWWA 4CD6A 3BANA 1FDZA 2CHNA 4QJ4B 1BPLB 2PGEA 3AU2A 3GYEA 2CLKA 2QCDA 3CUGA 1QCWA 3W76A 2GJXA 4EVZA 2AQOA 1QW9A 1MUWA 2AMXA 1ITUA 2EO7A 2PGFA 3REQA 1B9ZA 4JIRA 2F7FA 2OSWA 2QAPA 5C70A 2BLEA 3N2CA 3UWVA 1YDOA 3CZLA 4TVCA 4HMDA 2AQVA 2RDUA 1JDFA 4URIA 4HCHA 4UMBA 4LC8A 3GW3A 2J4GA 3TYZA 4NZ4A 5JVLA 3QMSA 2GFTA 4UFJA 2DW6A 4NT0A 2AGTA 4W7WA 5EBUA 2V63A 4IIEA 2XHYA 1GZGA 3HA1A 3KW3A 1E72M 1Q4WA 3WQDA 5M5DA 4IPIA 2DZUA 4C91A 3VDGA 3KTCA 4H9YA 1J2BA 3BLLA 4LYPA 2E40A 3U7BA 1BGAA 1F8IA 3CZJA 4JTJA 4GVFA 1GTEA 4W86A 4XAPA 3W7OA 2XGZA 3GNXA 2GDVA 3CZKA 3UJFA 5L9FA 5HDRA 3T0TA 3CO8A 3HQNA 5FAGA 5HR6A 4DWSC 1GNXA 4PUKA 1ZLPA 3W2NA 4AVFA 4Q32A 4G9PA 5T26A 1GQLA 1JI2A 3GYCA 3WH9A 1XKJA 4LCRA 2XVLA 1E55A 3SFKA 3TSDA 4FZIA 4QS5A 3WQ4A 4HOZA 4DNMA 2X1UA 4J3ZA 4UTIA 3U8GA 1W9XA 1L6GA 2QIIA 3TLQA 5C9UA 3WLKX 2V68A 3NQGA 2EAWA 3T44A 1G1YA 1OG6A 3UJ2A 5BXRA 1ZGDA 4Z2JA 3TWAA 1W3TA 2H8ZA 1PX8A 4B5XA 3T2OA 4AWSA 3VDBA 1F2JA 3THDA 3AHTA 4EAMA 4HN4A 3BAYA 1RR2A 3ARZA 2V3FA 3N15A 3VKJA 3UZYA 5HPCA 2P0IA 1GONA 4YVVA 5HWNA 1WXJA 1LM1A 3PTMA 2XDFA 1F6YA 4GD0A 4IJBA 3NWRA 2DIKA 2Y70A 1F05A 1XBYA 2AKMA 4P8WA 4F40A 3HFYA 3UY8A 1NEYA 3OGRA 2NSOA 2WZEA 3NQFA 5HMDA 3OYXA 4DZAA 4JTIA 3BJFA 4C1NA 3W7IA 1TJ1A 1P0NA 1UIPA 3TN4A 4PRRA 4GH1A 3I6EA 3KBSA 4UTTA 1QHZA 3MSGA 3SUWA 1NIUA 5KZ6A 5LXXA 2AL1A 1UJPA 4DZ5A 1ZP4A 4JIIX 3QOMA 4AISA 5A94A 5I24A 2ACSA 2I16A 2XIMA 3Q45A 5H2ZA 5I78A 3LBMA 1ZBWA 5EFFA 4DXKA 1A0CA 2PFHA 4OUEA 1S1PA 4GZJA 1JPMA 1U83A 4Y9OA 1IR2A 1YIXA 3M0HA 3F4DA 4WGXA 1H60A 2ZX6A 1KCKA 1N2VA 4HMEA 1UWIA 4GNVA 4NSBA 1V02E 1DQUA 5A6TC 4NNAA 2V5JA 3VI2A 2G50A 3HG3A 3V3WA 3HGRA 3A9BA 1H5VA 3QBUA 4B4FA 4XZ9A 1JCMP 2FB2A 1UIOA 4EPDC 2QVHA 1NOUA 1MW1A 3QLLA 3K8LA 3O07A 3RJYA 3IIVA 5IBXC 2OYMA 1XFBA 3BICA 2GQ8A 3K2GA 1YNYA 2J25A 4JTGA 5J5DA 1RV8A 3PZNA 2VJXA 5I0DA 3T7VA 1Z41A 2PGRA 2DUZA 2QR6A 3IUIA 4MWAB 2XIOA 5M3WA 1XFCA 3JUGA 4BF9A 1KM1A 4I3GA 4QJ3B 2DPEA 2BX7A 4H6KA 1HO1A 3LS9A 2FYMA 2GLKA 5HPOA 4YNGA 3MO7A 4IUOA 3LHUA 1DJGA 4HU8A 1V3JA 3IIZA 5AKQA 2WCGA 3A4AA 4KWUA 4NL1A 3UESA 2A3LA 2OB3A 5DCEA 3VZXA 1PS9A 4LVBA 3P6LA 2WC7A 1KWKA 1XR2A 3MKVA 4GIEA 1HJXA 3DAQA 3HO8A 4DO7A 2QJHA 3NQMA 4Z2HA 3RFAA 4EK7A 1F5ZA 5JQ9A 1E1EA 2HJPA 2YL9A 3M41A 4WSJA 4JNMA 2E67A 1TV4A 3M46A 1FHUA 2XGBA 3VFLA 2YZRA 4B5SA 1IT8A 1XIIA 2AOSA 3ES8A 1BRLA 2ZZ2A 3W1AA 1P7TB 3AAMA 5LIKX 1E6XM 2KZHA 4F2BA 3RJXA 1GOOA 5HNNA 1DJIA 3XIMA 2FJUB 4RXGA 2ZADA 5I3HA 4GISA 4YWSA 4AEOA 3T08A 3WQPA 4I9AA 3IJ9A 2HROA 6TAAA 1DIKA 1QOQA 3OP2A 1CEOA 3TAOA 4KEZA 1RVKA 3IPWA 4U33A 2QT3A 4ORIA 4OFCA 5KZDA 4QNWA 4QITA 4L4LA 5CBBA 4PTNA 3FYPA 3MMUA 4NZFA 4M7TA 3K1DA 3P62A 2Y2WA 3EDJA 4JYDA 3G6MA 4DBDA 2E25A 4V2XA 2BY3A 2VZSA 3LCFA 3L2MA 5K4ZA 3ZJKA 4L9YA 4BZYA 1IXNA 4IX0A 1DXIA 1JF6A 3N9KA 3RR4A 3WF1A 3K46A 2DFAA 3SUTA 2KAUC 2QAFA 3OLDA 2FTYA 4Z2KA 1W1IE 1F3WA 4ZFMA 4CNUA 1VENA 3IANA 3DYMA 4OIFA 3THCA 1I0DA 4H19A 5DBTA 4AUBA 2XVKA 1LQ0A 2ZCGA 1U1HA 1LCOA 1MRAA 5D9OA 2WVUA 4BY3A 3BAIA 2FZDA 4LAUA 4OGZA 1UD6A 3IWPA 4OECA 4HB7A 4JTHA 1UP0A 2QMKA 3PZOA 3PS7A 2DZVA 1JZ5A 3CAWA 2CC0A 3ITVA 4WR3A 4H9TA 3TAKA 2TPSA 4XWUA 5K9CA 4K6AA 1PDYA 4HNCA 1R3WA 1YTEA 2DUAA 2FIQA 1EJXC 5I7GA 1UOKA 5CC5A 2QUMA 1AH3A 1FWTA 3TC7A 3EA1A 1BTCA 2GJPA 2DZSA 1W3HA 3RXZA 4XSMA 1BEUA 1R85A 4C90A 3WD1A 1EJ7L 4TOQA 3DESA 3OOQA 3E74A 5B80A 4S3CA 4AF0A 5A1AA 3M0LA 1J0YA 4MIMA 1CCWB 1YNQA 3UZ5A 2DEPA 3F4VA 1ZRQA 3U4FA 1RQEA 4RE0A 1QNSA 4XG1A 4A3RA 2I9UA 1VCGA 3UYCA 4PULA 2D3LA 1UOZA 4BQ3A 1MFVA 3APYA 4OV9A 3MBDA 3N73A 4WLCA 1JRBA 3APTA 1WBHA 1B54A 3HPFA 1UKSA 2I5GA 4Q8UA 2YCLB 1BYAA 4LFYA 3SW6A 4ZO6A 3A5FA 3FNDA 1TMQA 2ABAA 3ZIZA 4RZBA 2GL5A 1SJDA 1JDCA 1V6TA 3SIMA 1H2JA 2HISA 3G77A 4CU7A 2Q09A 2A3BA 4GVGA 2ZUNA 3VGDA 3KX6A 4UOQA 5FJUA 4B5UA 4IL2A 3EA3A 1UWUA 3UQNA 2PURA 4PMVA 4WQ6A 3USZA 1K4HA 1GHSA 4UTHA 5AYIA 2HCVA 5M1TA 4L4PA 4WD0A 2ACUA 1Q65A 4YS1A 4JTQA 3ZJ7A 3BURA 5K4XA 4EPKA 4UMCA 1EP1A 4YXGA 1GJPA 2DVUA 4KWSA 4V33A 5I3DA 1F7BA 3G3DA 3W1RA 4Q4QA 4LSBA 4QSHA 4MLJA 4ZCWA 3G1XA 1CZ1A 1JIBA 3ATYA 2YCLA 3H23A 5FL1A 1XIJA 3BLKA 2YFOA 3AIUA 3TQ0A 3ZXWA 3AWOA 1YDYA 2P0OA 3GY1A 5CGMA 5LA2A 2P50A 1K9TA 3ZR6A 1XRSA 5F2MA 2PD9A 2W6RA 4H8UA 1ENUA 1GVEA 4ENLA 1FWEC 2CLFA 4CN1A 2XH7A 3VGHA 1H1YA 4U31A 4RZ6A 3MZNA 1R9XA 2JK2A 3ZLHA 1QPQA 1W56A 2J74A 1NFGA 3ABOA 5CBIA 4MJ2A 1TQJA 2FZMA 2D2JA 4Y2WA 4H4IA 2DQWA 4FALA 2DVXA 1DE6A 4K8HA 1H7NA 3R5EA 4XUGA 2Z2BA 4IUGA 2NSXA 3I3BA 2DH2A 1WBJA 3N34A 4AXKA 3TIMA 2RDWA 2CZEA 3WUFA 1J6PA 3HBLA 4LALA 4S3JA 1A50A 4P8UA 4XX6A 2DV0A 2VENA 1E0XA 4JHZA 3UXAA 4CVUA 2WVTA 2V5KA 3LERA 2XU2A 1SYTA 2UY2A 5AYXA 4HNOA 3G3MA 2WKGA 1R5YA 2WKJA 3BDKA 4AFYA 4YIWA 3P84A 3L65A 2PRHA 4A3UA 1LL7A 1N55A 4O57A 2X1IA 3P5ZA 3RM9A 5IHSA 2VDIA 3UEQA 1JULA 1KR1A 2J47A 2PZ0A 1CWYA 2EXOA 3GNDA 1HNYA 1EGMA 2FVKA 3W83A 3DFHA 1TJ0A 4FIQA 3GHTA 1TE6A 5FD0A 3E0IA 1DQWA 4H9XA 5CAHA 4PMDA 4G8TA 3VE7A 1AW2A 1DXEA 3LM7A 4KFPA 3SFWA 1OX4B 2C1GA 3H2EA 1PZ1A 4GO8A 1G4TA 3VKBA 4NI3A 1W37A 4RDZA 1DWJM 1POKA 4MJMA 3QQWA 5E0FA 3IV8A 4RV8A 3HFTA 5F2LA 5D02A 5KZMA 1I8JA 4LRSA 4CNTA 3H7UA 3RCYA 2WNNA 5LSMA 1S3TC 1Y5VA 4LVGA 4AY1A 3B04A 5LNUA 3HOJA 3TYCA 1MW2A 4BI6A 4HSNA 1ME7A 3E3HA 1P1XA 4WF7A 2FJKA 5CSRA 1D8WA 4Z42C 3ALFA 3V1PA 1K8ZA 2ZA2A 3EB3A 1N82A 3VGEA 1JQVA 2IPFA 4E2OA 2QJMA 1OZQA 3R0DA 5D2WA 3CK5A 4PTXA 3PR2A 4BF7A 3RRAA 4G5DA 4RZ5A 4M1RA 5I6SA 2YCIX 4PB4A 3YPIA 5LIYX 2IKGA 4I5UA 1VBHA 4A21A 1TB3A 4C6KA 3MUAA 2VI0A 2TYSA 2POTA 2VM8A 2O0TA 5BCAA 3KP1A 1V51A 4MB3A 1V3IA 3KZPA 4IXHA 1UWSA 4MJ4A 4ERGA 5I3JA 4Z1CA 5H6HA 1MWOA 1GVFA 4RDVA 3C56A 4AVNA 1KLYA 2OGYA 3W23A 7PTDA 1C9WA 2X0HA 3WMCA 2VRJA 1XPYA 3EWWA 3SCOA 3QPYA 5IOBA 1TRDA 2X40A 4EOUA 1L6YA 3W6MA 4Q6XA 5LHFA 2HE8A 1M68A 3GXPA 5D37A 4HU3A 3V1HA 1CECA 3RM4A 2ASHA 2IS7A 3C8NA 2NLIA 2XGIA 4F0LA 4NAEB 4AC7C 3W0KA 3O6YX 1OY0A 3D5HA 4I8DA 3KVKA 4GABA 1XHGA 1IIHA 1R3YA 4MZYA 4WCJA 2E68A 2OG9A 3UW6A 5HULA 3KDNA 5HINA 1VBGA 3AHXA 3QGVA 2GUUA 2QCMA 1MYRA 4PMNA 1CXEA 4XUYA 2PI6A 1UH4A 3L67A 3GSMA 1X96A 4JTTA 1GPFA 2J7HA 6TIMA 3FDGA 2XTKA 1Z48A 4IF2A 1P6WA 4MPKA 3GO2A 3AQUA 2VFDA 3KBWA 2O9RA 3S5YA 4GNKB 4ZODA 2B0MA 4XVDA 4BCEA 4CN4A 4JDBA 3ARYA 4JTFA 4QBXA 4J40A 2B81A 4IHCA 3AYTA 2ISFA 4ZQCA 4XB3A 4UQCA 4WY0B 4E2BA 4MY8A 3SUUA 3S8HA 5REQA 1SQ7A 3SY8A 4ZE5A 1TV7A 2AAMA 1VAHA 2GUYA 1OT2A 3MVTA 4MADA 1JYXA 4HJFA 1KC7A 3ZMRA 1VCVA 1LUCA 1XCXA 2EGZA 1AQ0A 2E6FA 1UR0A 1Q85A 2GVLA 1L6SA 2FDSA 3SGUA 1RUSA 2QDEA 2ISWA 3AI0A 1W9BM 2E1WA 2EBNA 1K9FA 3MDWA 2BVTA 2VGBA 3AYRA 1PIIA 4RE2A 3B9EA 1LT8A 3QYQA 1OFAA 2DH3A 4Y8FA 5D4YA 3MWAA 3W7LA 3MB9A 1VR6A 3E12A 3W3OA 3VPLA 4I9MA 1S5WA 2QGYA 4HIBA 3AMCA 3S1GA 1PE1A 3PAJA 2BY1A 3QFWA 4G56A 3QTGA 1VRXA 3NEHA 2PS2A 2Y24A 4ML9A 8XIMA 3PFRA 3TDFA 2G3MA 4IP5A 4FR1A 4FEZA 4ZL1A 3TQVA 4LV9A 4QEEA 1TR9A 2IW0A 2HSAA 3W9ZA 1QO5A 1FHVA 2E6DA 5DELA 1UASA 2HEJA 5H91A 4GUGA 1AZ1A 4AZCA 4X2RA 3P81A 2CW6A 3B8WA 4HA1A 3PWAA 1OYCA 4NJJA 2W3ZA 1TV3A 2OLAA 2E8ZA 3PPFA 4Q8TA 1HKKA 1KFBA 2ATSA 3VMOA 4ACZB 4AWUA 1XYCA 1A4LA 2F2HA 4WDTA 4GQBA 4LXFA 1V3HA 3BV4A 1GKPA 1Q7MA 2EG6A 3PWIA 2GWNA 1GVQA 4Q6JA 5EB8A 3MV01 1XINA 3GIQA 4J9JA 3B8IA 2QCHA 3LEPA 2PDJA 4N6EA 4UOZA 4MWAD 3PG9A 1LL4A 1MO0A 2YA2A 4JFTA 2QF8A 5CZ0A 5JH2A 3STPA 2AAAA 3PUEA 3TZFA 4EAYA 2XG9A 2CCRA 1FWRA 1R6WA 5BOOA 3RCMA 1EJRC 1JEZA 3OIHA 1I6NA 3UNTA 5ABFB 2GSJA 4IQEA 2IPWA 4C5YA 2D0FA 3GXTA 1M1BA 2WW5A 4WKFA 1I1XA 3RNDA 3EWBX 3F4NA 1V0MA 3DECA 1A3HA 4ACZA 2WMIA 1YEYA 2HZGA 4J2MA 4WUIA 2XWDA 3TN3A 4Y7EA 4NRSA 3CC1A 3LQGA 1WP6A 3B03A 1SO6A 3A3HA 3AROA 2Q8XA 2XSAA 3E96A 3OQEA 2WHLA 2J6VA 2QHAA 4WXYA 2YW3A 3AISA 2UY4A 3EWXA 3THAA 2Y5EA 2ZUUA 1RPXA 2DZWA 2FMOA 4Y9PA 4AQLA 1WQ5A 2E5BA 5HBFA 1VPYA 1QOPA 2VFFA 3FGCA 3FFSA 2GK1A 3W01A 2PEVA 1UUMA 1BSLA 3E5BA 1C92A 3VD4A 4S3EA 1ZB5A 4K38A 1CGVA 2UV8G 1YPIA 5EGRA 1DEDA 4Q33A 2AL2B 1VQTA 1KW1A 3LTPA 3D0CA 3MI2A 2NUXA 1U5HA 1JFHA 1XL9A 2ACQA 2WJEA 5ABEA 4O52A 4QCEA 1A47A 4PRTA 2AGKA 3BAWA 3N12A 1A5AA 1UMYA 3AS1A 2G5WA 1VFOA 5DQPA 1K4GA 1YBQA 2X2YA 2X7VA 4PE8A 2YA0A 3U2OA 1OF8A 3FOKA 1XI3A 4DI8A 2ZA3A 1QVBA 1E5JA 5CH9A 4W7VA 1LG2A 3GVVA 1LF1A 5CAKA 4REQA 3SY5A 4DJDC 4DF1A 3DHPA 2W27A 4MAVA 1XLFA 3GAYA 3IGHX 1Z3NA 2AL2A 1W2PA 3SZ8A 3W29A 4DUWA 1GUVA 3BVJA 3KCOA 3MS8A 1US0A 1TWZA 4N9BA 1XRTA 1IEWA 3EDDA 2DIJA 3AJXA 5DEZA 1DWGM 3R58A 4E4UA 2PTWA 1H11A 1RALA 1KB3A 2VUYA 2RFGA 3GZAA 3UA4A 2A3CA 4U10A 3FAXA 5KINA 1N8IA 3KZSA 3W74A 2VD8A 3MCMA 1O5QA 3OEXA 4N4PA 4S3BA 4HNNA 4IMDA 4UQAA 1ISYA 1PZ0A 1W9VA 3WQGA 4HBKA 2WJDA 3GDKA 4ZTXA 3C52A 1OSEA 3SCQA 1TVPA 4M6VA 1LOSA 2WSPA 3O63A 1WXYA 3TE9A 3H70A 4PRWA 3EOEA 4RK8A 4KEMA 4N02A 4NXKA 1ZJIA 4Q4OA 1JYVA 2R91A 4OJYA 2INZA 3NZGA 3RM8A 2EG8A 2Z1BA 4ZB0A 5TQLA 3UU0A 3CLMA 4K1WA 2CLPA 2B7OA 3NURA 3DI1A 1J5TA 3DHDA 2FH6A 3KP0A 4XAYA 3LX9A 1FWBC 3T6CA 3URQA 2ZX8A 4JTDA 5HNUA 1C91A 3WMBA 4AD3A 1H7XA 3WK2A 1JPHA 4F9JA 3CWNA 1IXPA 5AC8A 1O4UA 2RAGA 1R7AA 1SW7A 1ONWA 4QEHA 4CQDA 4XZLX 2Q02A 2Y5JA 2F9RA 1KD0A 3WLPA 2INEA 3PZMA 2B7QA 3KE0A 2V3GA 1YX1A 3EX2A 1EF2A 1P0KA 4A3YA 3KOZA 1YXYA 1I4NA 4PUWA 4I5XA 3GQYA 4Q3MA 1GT8A 3VIGA 3IGUA 3RX4A 4QG6A 3RX2A 3CUJA 4DWSA 5G4HC 1IV8A 4KFOA 2YCKX 1XJBA 2PWFA 5AHFA 2WBGA 3T2QA 4E3VA 4RX0A 4GMEA 5A3HA 3LM3A 4N2YA 1WOBA 3LHTA 4PBGA 1V08A 1QT1A 2E5CA 3ZO9A 3GAKA 1BD0A 5BOEA 2GQ9A 1SFJA 3VC5A 3VKDA 4XIAA 1SFSA 4P7LA 3GU9A 4V28A 3W27A 4Q8NA 5MKGA 4GUIA 5D05A 1GW1A 3ZR5A 1V3MA 1FH7A 2HS6A 5BRPA 3W6LA 5HQMA 1EZ2A 3HQ1A 5E09A 1NY1A 2MANA 1U1UA 4UTUA 3VIFA 1HP5A 3APGA 1SSDA 2F38A 1VH7A 2G97A 3LUTA 1CLVA 3UYIA 3COTA 4K3ZA 1JAKA 3OQ8A 4PEEA 1YDVA 1Q7ZA 3PC0A 1MEIA 2ICSA 1OZMA 2V2DA 3VOCA 2WOQA 3AJ7A 4GCAA 5I5RA 5KITA 3TYUA 4M6PA 3ERPA 3UA3A 5BXTA 3WLRA 1M7PA 2QLYA 1T40A 3NR0A 1O7AA 3VVGA 1DOSA 4DAIA 2BY2A 4LC6A 4U5IA 4F2UA 4JL2A 3DCPA 1OC5A 3OTRA 4R34A 1AMKA 1EHAA 4PUMA 4B5VA 4MKNA 4US6A 2CLOA 2VEMA 4K2SA 4F9DA 1E15A 2Z1XA 1IT0A 4GI9A 3CMFA 1OD0A 5I23A 1ZBVA 2DT3A 4NILA 4J2PA 4E0CA 4D71A 1ME9A 3QV9A 4B15A 2IKIA 3I6RA 4J3TA 4H8HA 3N9SA 1VS1A 4ILSA 3WBWA 3I7RA 4A35A 5E5CA 2FGLA 4QQUA 2NV2A 3M43A 4W87A 1DP0A 1XGDA 3UG8A 2GJLA 3MJYA 3CS2A 3LPFA 1PYFA 2REQB 4WOQA 1UR3M 1RBOB 3FX4A 3CMGA 1ZU8A 4D6IA 1B2YA 5EMKA 1PCKA 1W1B1 1V3KA 3FV9A 2WM0A 2A79A 3EEGA 5FEWA 3HGJA 5CC7A 3U57A 2Q8ZA 1JPKA 4HSHA 4H41A 3MSRA 3S9IA 5U4NA 4CQAA 1MRQA 3BLIA 3V0SA 1X38A 3B05A 4HHMA 3WELA 4B4HA 5J5RA 3P0WA 1UH2A 3NGFA 3TUUA 3UVAA 2FPTA 1R8LA 4XSLA 1S3HA 3AIVA 2PDBA 2ZRYA 3DI0A 1V3LA 2ZRVA 1E6RA 5BMWA 4AYGA 5CSUA 3IVTA 5FJPA 2OXNA 4CQ8A 4Y96A 4ADTA 3DDMA 4EXBA 2REQA 4LQ1A 3BMVA 2H8XA 3P93A 3TVAA 1AJ0A 4I7WA 4GI6A 1JGMA 3FA3A 3MW7A 4LRTA 4JX4A 1PL9A 1TTJA 4IMGA 3KTXA 5BXSA 3R2GA 1YDNA 1G67A 3NCOA 3F1QA 3GH7A 1FUYA 4YTQA 4LBUA 5DCDA 3PBMA 4HMNA 1GQJA 4DYJA 4GLEA 3OVGA 4GNJA 2Y88A 2WZTA 4CQBA 1RD5A 4UQEA 1HX0A 1SMAA 3EOUA 1UYQA 5CEWA 5FAJA 3TFXA 1KTBA 3WDRA 1OCNA 3S2LA 1SZNA 4UB9A 1C3FA 1J0IA 3QY8A 1ZZMA 4DLFA 1ZCCA 3QF0A 3GB6A 2PP0A 4C6NA 3CASA 4HTBA 5AHEA 4TUFA 1CB7B 4LNCA 3C2EA 1M04A 3ZM8A 4GZ7A 1LWIA 1X98A 3W2UA 4HPNA 3V16A 2HWGA 1UZ1A 2WC3A 3HPAA 4NX5A 3UD6A 1U2YA 2F2KA 3EBVA 3V0TA 1EPVA 4DEFA 3NXLA 2VCBA 4AIEA 3TX9A 5A8NA 5FI8A 1OX5A 3AWNA 3KS5A 4LUTB 1KCLA 2FZ8A 3QV7A 2X1TA 2OEJA 3B4YA 1EBHA 3EX1A 3THQA 3A21A 5I00A 3H26A 1ADDA 4QS6A 3GC4A 1E70M 1A4MA 5DMYA 1OD8A 2PDQA 3ARUA 2X0YA 5HMSA 2J7FA 2QDHA 1DWAM 2ONEA 4LYQA 4BQ4A 4PSRA 3A9IA 3VABA 2DW7A 1QI2A 1S5MA 1SVDA 5GVJA 1LORA 2CBIA 3RLGA 3WEMA 1KKOA 5I3GA 2CWXA 3G0UA 3MBFA 1BVNP 4PB5A 3WH6A 5I3KA 4BKNA 1J8VA 4F2TA 2JKPA 4BQ2A 4ZA0A 4JEQA 4NNBA 5A2AA 5G2HA 1W17A 1D3HA 3T0AA 4ZBCA 2IMRA 1OC6A 3AXXA 1HVXA 4WGHA 3TEVA 4LUTA 1FX6A 1WX0A 4NY2A 4IQLA 5EPDA 3CHVA 4IMEA 2H6RA 3PZVA 3IJ8A 3KBMA 3TU9A 4K1GA 1HZYA 1IZCA 5EU9A 4NASA 5G5IA 4YTTA 6ALDA 3HGSA 5FCZA 4UFHA 4EPBC 4F4RA 5BROA 4NZ5A 1A5BA 1J18A 2A5HA 1B9BA 6REQA 2J9YA 3FYOA 3CV6A 2E7FA 1JI1A 5MHBA 2J8TA 3QV8A 5CPNA 3NQ2A 2CWNA 2Y8UA 1D8CA 2Y7FA 4MHBA 3ARPA 2C79A 2CBJA 4KFNA 4CNNA 2NUYA 3ICJA 5CGQA 4R3UA 1V6VA 4JR5A 3M0KA 3DGBA 3V75A 3WNLA 3U2ZA 3R10A 3O2LA 2Q71A 3W81A 2P8CA 3G1FA 3ITYA 1GWJA 3IACA 4RL3A 3TOYA 3L9CA 3T81A 2J27A 4XAGA 1AD1A 3AMGA 3N2TA 3FW6A 2W4XA 3N9RA 1GQNA 3UJEA 3SN0A 1LRTA 2P3EA 1PKYA 1XH1A 5SWUA 4OBRA 5EYWA 1MDLA 3GDBA 1E51A 3B8VA 3CHEA 4GY0A 3W22A 1TPFA 1KRCC 2V2HA 1AJ2A 2G4FA 3PJXA 3O7UA 5GPRA 4H2HA 4ZTYA 4Z2GA 2GQ3A 3OLGA 1SO3A 2WCSA 2PDKA 5C0QA 4L1WA 4D6JA 3WLLA 3S5ZA 3HM7A 5E93A 5ABGA 1XLJA 1UD4A 4LT9A 1EO7A 3LY0A 5F4SA 4L4OA 1BHGA 3LSBA 1IIGA 1KXHA 1XISA 5KSWA 5B7YA 4OE7A 2R6OA 1GVSA 1EJUC 4AXNA 5LHEA 4B90A 4KBXA 3EX4A 1YW1A 3EPMA 2WNZA 4K8EA 2IXUA 1HIZA 1PIFA 4BI7A 2C3ZA 1F6PA 1MFUA 2Z0IA 3KUMA 2Z00A 3A13A 1M9HA 4GI8A 1V0NA 4UFIA 4NJGA 3ARVA 3HG4A 3LRKA 3LV6A 3EKLA 2VUNA 4O17A 3HF3A 1BQGA 3AXHA 3L23A 3M0JA 2Z27A 3EMCA 4QM1A 4FAMA 3OODA 1G7UA 1AG1O 1FXPA 1B3OA 2A3EA 1TWSA 4GI4A 1KLZA 4XZWA 3GTHA 4M81A 4LW7A 1DWHM 1GOMA 1EX1A 1POJA 4E6MA 4AZ5A 2YSWA 1FKXA 3CGTA 4MY9A 1W3IA 1U1JA 2E77A 4HPJA 1EJVC 3QFEA 4M1BA 2XIQA 1XD0A 2A7PA 2PDCA 2PRMA 2YFNA 1JCJA 3N2OA 4PA8A 1Q6RA 4FA3A 3BE7A 1BTMA 3CZEA 3CU2A 2XN1A 2PDHA 4AY7A 3MKCA 1LQ2A 3CV2A 1RK6A 3HPSA 4QAIA 2A7NA 4W5UA 1THFD 1TPH1 3T0CA 4HD5A 3R1ZA 3N1AA 2GVJA 4HZMA 4M5PA 2R82A 4PCPA 3CUHA 3NZRA 1JNDA 1MVYA 1RPKA 4IP4A 5AVHA 1KXTA 3KFTA 5B7ZA