1KQZA

Hevamine mutant d125a/e127a/y183f in complex with tetra-nag
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFAIAHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFFNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression and Characterization of Active Site Mutants of Hevamine, a Chitinase from the Rubber Tree Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Hydrolase
molecule keywords Hevamine A
total genus 98
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kqzA00
1JIBA 1JD9A 1GHRA 2W91A 4U31A 1E72M 2ZUTA 3WFZA 3WD3A 1B90A 3TTQA 2VX5A 2QPUA 2CPUA 3J7HA 1J0ZA 1WCGA 4JCMA 4UQDA 2CBIA 4AD4A 3CIVA 5A8QA 4L4PA 1GQJA 5D9OA 5CSUA 4KMQA 1R8LA 1UZ4A 3NSMA 2VJXA 2B31A 1OGSA 3VIMA 2WHJA 4MJ2A 4DWSC 1VJSA 5BXTA 1GOMA 2UY3A 2ZXDA 3L4UA 4H04A 5A1AA 4CCDA 2DH3A 3WMBA 4UOQA 1AQMA 3K4AA 1ZBVA 1LL6A 3ZJKA 5A8OA 1CECA 1JYWA 2DIEA 2WBKA 2E40A 5IFTA 1UZ1A 4U3AA 4DWSA 1TMQA 2BFGA 2D24A 1NP0A 1ODUA 3GNOA 2EXOA 1DWJM 4BS0A 2OLHA 1EOMA 4MNMA 1E4NA 4FMVA 3NDYA 1EGZA 4CCCA 3WNOA 3WN6A 4PCSA 2CEQA 4X9YA 2DSUA 3NYDA 4UQBA 3VGGA 2BY3A 1K9TA 4QCEA 1BG4A 2YL5A 4LQ1A 2JIEA 3DHPA 4MDPA 1NWRA 3AXXA 5LA1A 1MW3A 3RIKA 1E6NA 2D22A 3FNDA 1E6PA 5ABEA 2BVYA 2C0HA 1OD8A 2EJ1A 4PMVA 2PI6A 4GI6A 8CGTA 2VQUA 1GHSA 1CIUA 2JF6A 1LL7A 4TXEA 5CGMA 2CITA 1UKSA 5GNZA 5IHRA 2ZXQA 2V3DA 5BWFA 4F9DA 3IANA 1TR1A 2WMGA 3CUJA 4B9ZA 4TVCA 4P8UA 1EO5A 2WSPA 2AMGA 4JFUA 4M80A 2BY1A 1ZBCA 2Y4SA 4MAZA 4NSBA 1V6WA 3QHMA 1MXDA 1E6SM 1JXJA 6CGTA 3SCOA 2PB1A 2XVPA 2W67A 5M17A 1GCYA 1V3KA 3FW6A 4W5UA 4GKLA 3KWXA 1WP6A 2XM2A 2WLYA 3F4VA 1JI2A 4UZSA 1UR0A 5HXMA 4JL1A 4ATDA 1QPKA 1LWHA 3EMQA 2XVNA 1E5NA 1HNYA 1K9FA 5DF0A 2V38A 3VIKA 3KL3A 1JFHA 3MV01 3VO0A 4UFJA 1U30A 1JDDA 4P8XA 1GVYA 2BNJA 2JF7A 3OGSA 1CGYA 1KXHA 4E8CA 5GNYA 1DHKA 3MMDA 2YDRA 3UESA 3PTQA 3DYMA 1DP0A 2ZX8A 4WSKA 3VIGA 2ZUNA 3ARTA 4W7VA 5C8BB 1W3JA 3PZTA 3VX1A 2PBGA 2XFYA 4PMYA 3MSGA 1A47A 3W4RA 1FFQA 4HMCA 4PMXA 4S3JA 1B3XA 3WD4A 5GQBA 3SCWA 1PZ2A 1XH0A 1Q6CA 4C7FA 4Z2HA 5EFFA 3WF1A 4M81A 3PZGA 3NUKA 4UQCA 3WH8A 1G1YA 1H0GA 4PTMA 2VZSA 1UR8A 4WKHA 3VX0A 3B9DA 4AEEA 1E55A 1H09A 1VEMA 1GOIA 3UG4A 1V0LA 1HF6A 4KRTA 1J9YA 5CQ1A 1B3VA 1B31A 1DTUA 1XSIA 1XHGA 5FIPA 2WZHA 5CJ5A 5A2AA 4XZWA 1E1FA 3WDQA 2PC8A 3ZT6A 1W1PA 5A6BA 1NWTA 1PIFA 2F8QA 4AD1A 5M3WA 4XB3A 1GQLA 1KQZA 5JBEA 2DH2A 3F5JA 1JZ6A 1R7OA 1ZS2A 4XUYA 1UWQA 3PZNA 1VEOA 3BCDA 3MU7A 2QV4A 3UERA 3VINA 3CHCA 1XCWA 3RM9A 2E3ZA 4NZCA 4UFHA 3A4AA 3WD2A 2UY4A 2WZEA 1HIZA 2WK2A 1WNOA 4KRUA 3CHFA 1FFRA 1W9XA 5E6ZA 2AAAA 5FD0A 2EO7A 1OT2A 3T08A 1CENA 4Z2JA 5I6SA 2D1ZA 1G5AA 1HJXA 4PUEA 1M03A 3E1F1 1WB0A 4ZXOA 5I3DA 1ODZA 1NOFA 4WSJA 1VAHA 3T2OA 1JYNA 2UY2A 4EKJA 4IUGA 1QHPA 3FN9A 4E8DA 3SCNA 4B3KA 1EA9C 4UFIA 4OZOA 2DGAA 4M29A 2ZWYA 3L4YA 1L8NA 1JAEA 3WD1A 3A3HA 2BY2A 1X6LA 2OYKA 3FHQA 1PZ3A 2D23A 3POCA 3MMUA 4PMRA 3W38A 2VI0A 2XVGA 1W9BM 4PMNA 4PYSA 4D6FA 5BCAA 3IJ8A 1D2KA 2DSWA 2WWCA 4DUWA 4HU0A 7A3HA 3SIMA 4MAVA 1E73M 1OIFA 3SCQA 5D9NA 2WNWA 4P7OA 4U33A 4TVUA 1NARA 2VT0A 4E2OA 3T0AA 5ABFA 4H8UA 5JIWA 4HZ7A 2BVTA 4MDOA 4W87A 1GJWA 2WB5A 2J7EA 4MB3A 1C7SA 4AZ5A 2GK1B 4AZBA 3IAQA 4P7RA 4H2CA 3QHOA 2J7BA 3CZEA 5HPOA 5BROA 1HKJA 3SCSA 2O9OA 5I24A 4JFVA 3WBAA 1FA2A 4AYSA 3I3DA 2ZWZA 4V2XA 1FP8A 1ZJAA 2Y24A 3GXFA 4MB1A 4AZCB 4ZE4A 3WQ8A 3PTKA 1KWKA 3K1DA 2VRKA 3F5KA 1C7TA 2VCBA 4N0RA 1OT1A 3ZR6A 1FOBA 3CGTA 3ZSTA 2BV9A 1PX4A 4RE3A 1UD6A 3VIJA 2W66A 2XPKA 1EOKA 2WVVB 2WMJA 5E9AA 1UUQA 1LQ0A 1UWSA 4YPJA 4PTVA 4C7GA 3WNNA 2YKKA 3ARUA 4NRSA 1ZBWA 1CGWA 2V5DA 4TVDA 5EFDA 3D5HA 5IXEA 5C70A 3CUHA 3WL1A 2WMIA 4HA4A 4IPLA 2X2YA 5KEZA 4MNLA 5JIPA 1UG6A 2WC3A 5LA2A 5FCZA 4MNKA 5TD4A 4KWUA 3WMCA 1LLOA 4AZHA 1VFFA 5I79A 1QHOA 3AIQA 4W85A 3WL0A 1GORA 3ARWA 1UA7A 3OBAA 1H11A 2EBNA 3PZQA 1ZU8A 3RJXA 2OSYA 3BMVA 2IXUA 4MADA 1KFWA 5I23A 1B3WA 3FAWA 2A3HA 3CBWA 1CNVA 3ALFA 3U57A 3BAJA 2CKSA 1LF1A 3MS8A 2J7GA 4WF7A 2EQDA 4TX8A 2CERA 3BXWA 5FL0A 4AC1X 2G41A 5GNXA 5AYBA 2O9PA 4HOZA 3O6AA 4W89A 1JF6A 1H41A 5A94A 3SCPA 3PN8A 3U5UA 3AMDA 1RPKA 3A47A 4GQRA 5CXPA 3AYRA 1BYBA 3AISA 4RE2A 4M1RA 1J0HA 1JZ5A 3T09A 2VQTA 5E0CA 3SCUA 1WZLA 2WWDA 3ARXA 2D0HA 4OIFA 1BYAA 1HVXA 2PWFA 4ZE5A 1E9LA 3RM8A 3ZOAA 1AMYA 1UKTA 2J4GA 2XWDA 4JFTA 3TP4A 3I3EA 1V6YA 4QLKA 3W37A 2FHCA 2WAGA 4JKKA 1VBRA 2ZOXA 3ZO9A 1OSEA 1JZ3A 2XFRA 1IZJA 1BGGA 2WC7A 1J18A 1TZ7A 1U2YA 4CGTA 1OINA 1HJSA 1HJQA 1VFOA 1ZBKA 2WVTA 2Y5EA 2ZE0A 4P7LA 2E8YA 2DDXA 2BVDA 5DFAA 2E9MA 2ZX6A 4XV0A 1C8YA 1XYZA 4D6JA 7TAAA 3HJEA 4QP0A 2YA2A 2WHLA 4UQAA 3W28A 1QNRA 1BVNP 2CXGA 4M56A 1NOWA 3AHYA 4EE9A 4HA3A 2ZX7A 3VIFA 4FLSA 4PUDA 4BQ2A 1SMAA 3GH4A 4TUFA 3AZSA 1WDRA 1SYTA 1QNQA 1CXKA 1W3HA 4F8XA 2CHOA 3BSHA 1JL8A 5HPCA 3WDIA 1FP9A 3AHTA 3SUVA 2DT0A 4D72A 4CU7A 1S46A 4Z2IA 2J8GA 1QNOA 1UWUA 1C92A 3LPFA 3K8KA 1Q6DA 2WKLA 3TTYA 3RMEA 4CVUA 1SR0A 2EPKX 3N17A 3WF3A 1CEOA 5BRQA 1B0IA 5I5RA 2VVSA 1CXEA 1KGXA 2VR4A 5A2CA 3VD9A 1WAWA 4W7WA 2XGIA 1Q6EA 1V3MA 4J3WA 3W82A 3CUIA 1V0KA 3AROA 2WMFA 2WCSA 4J3TA 3CZGA 1KCKA 5C71A 4OJYA 3W6MA 1R87A 5HBFA 2DQXA 1E43A 1UH3A 2XWEA 4PTXA 1HJVA 3WQ5A 3AMKA 4R27A 1CXFA 1OIMA 2OWWA 3UETA 1XYFA 3GNPA 3OB8A 4AIOA 2D20A 1WZAA 2CETA 5D9MA 4W7UA 2OYLA 4X0VA 3K4DA 2PWDA 1EDTA 1B3YA 5A6BD 5DEZA 5AC4A 2GDUA 2RGLA 2Z1SA 1O6IA 4AMCA 1BHGA 1IV8A 4JAWA 4K68A 2A3CA 3WD0A 1MQPA 2VVNA 1VB9A 3AMLA 5A6JA 1Q6FA 4XZBA 2XIBA 3PBGA 1F4AA 3MV11 3POHA 1E15A 3IK2A 3RJYA 3WF4A 4DUXA 4HMDA 2D0FA 3B9AA 3WNMA 1UKQA 3RPMA 4D1JA 2YL8A 1LG1A 4FK9A 2UY5A 4ZENA 5A6MA 1KXVA 1HVQA 2XVLA 5CZKA 5D8ZA 1CLXA 2XIIA 2ZXAA 1HKIA 4JZ5A 3AIBA 3VMPA 3WKZA 2CBVA 1CXHA 4D6EA 2C8NA 4F66A 2PBOA 4JKMA 3A4WA 1KR1A 4ACYA 1H0IA 4WLCA 3UCQA 4CCEA 4UQ9A 2VX6A 2YJQA 4CUCA 3AHZA 1W9PA 2VTFA 3NIYA 1BQCA 3APGA 2WVVA 2YBTA 3PTMA 1C8XA 3BAKA 4J28A 3ARPA 1OGBA 2J74A 1GPFA 2JALA 2EPNA 1E71M 2JFEX 3QHNA 4CU8A 1US3A 2D3LA 2NT1A 1HJWA 3ARSA 3LPGA 4U2ZA 4AISA 3RILA 3N13A 3AS0A 4HZ8A 3WQ6A 5A8NA 1QW9A 5AY7A 2VZUA 2ZUVA 3OA5A 3WQWA 1E6ZA 1IT0A 1CZ1A 3EDDA 3THCA 4TX6A 4YN5A 3WUBA 4M82A 1BPLB 3ZM8A 7CGTA 1JFXA 1UKOA 3RDKA 4MTVA 1PAMA 3U5YA 5A95A 1B1YA 2WVSA 1CBGA 3GNRA 3ECQA 1V6VA 2CBJA 4H7VA 2J75A 2YL9A 4TOQA 3VKKA 4CU6A 2PWEA 1QBAA 1B3ZA 1VBUA 5CPQA 4AD0A 1DWAM 3AXHA 2J79A 1W9VA 3KE0A 3MUY1 3ARRA 1H3GA 4QFUA 1VENA 1W1YA 3WBEA 1GZJA 4CD5A 4PSRA 2CIPA 3WUEA 5BXPA 2Y8VA 3ALGA 5EB8A 1GQKA 4CKQA 2YA0A 5F7UA 1J0IA 3FHAA 3CZLA 1XH1A 5CG0A 5FOOA 3VPLA 4URIA 4HOWA 1V3HA 1BTCA 3OZPA 2J7DA 1RH9A 1HXJA 5I0DA 1J11A 3WDPP 4GPNA 3BAXA 1E0VA 1E6RA 3AI0A 1EQCA 1UD3A 2V5CA 3MSDA 5HDRA 5EBAA 3OLDA 1NWUA 2OYMA 1EHNA 5I78A 1MW0A 4PMDA 2PWGA 3GZAA 3AIEA 5CPTA 5ABGA 2YL6A 1UD2A 1MWOA 1UWRA 4U5KA 3WEOA 2J7HA 1JF5A 1Z32X 2FH8A 1SMDA 3N04A 1MFUA 2VCAA 4PEEA 3S6TA 2E0PA 3SURA 3WQ4A 1L0PA 1GQIA 2W63A 4LYQA 4P7NA 4M24A 4UNIA 4CVWA 4AY1A 1C90A 4HOXA 1HL8A 2DT2A 4CD4A 2A3EA 3MKKA 4U3CA 2BY0A 3M46A 4RL3A 5A2BA 1W1VA 3WENA 4AXNA 1W9UA 3N15A 1US2A 2FHBA 4D71A 2BXZA 1GUVA 5CLTA 3AMCA 2QMKA 2CESA 2F2HA 1UR1A 3BLPX 2ZX5A 3BC9A 4FF5A 1C8QA 3II1A 1E3ZA 4LYPA 1A3HA 3WNLA 2GK1A 1O7AA 2J8FA 1CGUA 1ISZA 4ZXLA 2WMIB 1BYDA 2RGMA 5AC5A 1XV8A 1KXQA 1R85A 1JZ2A 1ITXA 2IXVA 3LPPA 4R5EA 2JIWA 1EH9A 3CLWA 3LMYA 4W93A 3SUSA 3WEMA 1W32A 4JCLA 1WDSA 2EPLX 3BCFA 3VIPA 3BGAA 4AIUA 3VNZA 1TVPA 2CCRA 5CPSA 3GXMA 1ZB5A 1XCXA 1GOOA 3SUTA 3VVGA 4AD5A 4PMUA 4P7QA 3VMNA 5ECUA 3ZMRA 4TTGA 3VDAA 5E0FA 4DWSD 1KBKA 1R7AA 3ZQ9A 3N11A 2MANA 4H8VA 1JZ7A 1JAKA 4X0NA 3GH7A 1WZKA 1ESWA 2ZX9A 3KEHA 2WCGA 5IDIA 4XX6A 3AOFA 1FHDA 3A6OA 4S3KA 4A3YA 4QAWA 3RO8A 1HT6A 1G01A 1UWIA 4AZ7A 5A6LA 3GYCA 4U5IA 2O9TA 3AIWA 2ESCA 1MVYA 3UG3A 4UTFA 4F9JA 1JZ8A 3CUGA 2WLZA 2QMJA 3MUZ1 2XSBA 4Z2KA 1KB3A 1GONA 1UR2A 3OGVA 4DUVA 3AIRA 3MUAA 3WQVA 1UD8A 3QOMA 1JZ4A 5I77A 1VEPA 1J0KA 4GINA 2EPOA 1ITCA 1VJZA 2QF8A 1JD7A 3U7VA 3OIHA 1J0JA 1XSJA 5D4YA 3VDHA 4QLLA 1UHVA 3VM5A 1RP8A 2PWHA 5BXRA 3NSXA 2CNCA 1VIWA 2DT3A 3EMCA 3SUWA 3D3AA 1TVNA 2J77A 2FH6A 4CN1A 1E3XA 2Y2WA 2GDVA 5A8MA 4UOZA 1MW2A 1X6NA 4W84A 3CMJA 4P8VA 2TAAA 2VZVA 1FH7A 1OD0A 5IHSA 4OUEA 4PMQA 1V3IA 1ISYA 5A6KA 3BMWA 3L2LA 3MMWA 1E40A 3GBEA 2CBUA 2JE8A 1W9DM 1PPIA 3ZR5A 5DO8A 2JEQA 1GOWA 2E4TA 1MW1A 5FKYA 4Q7NA 2HVMA 4UQEA 3CH9A 4J3SA 1W2VA 1GOKA 1XGZA 4BQ3A 2WHKA 2XUCA 2DT1A 1V03A 4WKFA 5HNNA 3CHDA 1JDCA 3AFBA 4HMEA 3PZVA 4D6DA 2E9BA 1WO2A 2VRQA 3W25A 3SCTA 2HISA 4JFWA 2XG9A 2NSXA 2WM0A 1AVAA 3F5LA 1KXTA 3NDZA 1CWYA 3UR7A 1DWIM 2WXDM 1MQRA 1QOXA 1M01A 3HMCA 3N12A 1QNSA 2YOCA 4NI3A 3W26A 1Y7VA 2Q8XA 3K46A 2J7CA 4BF7A 3WSUA 2XSAA 3ZT7A 3OG2A 2GJPA 3BSGA 3VIHA 4V27A 5A69A 3L4VA 1JG9A 5BXSA 3HU7A 4H41A 4P8WA 1TUXA 3VM7A 4CD7A 1BGAA 1ISWA 2WVUA 2CYGA 2G3JA 1V02A 4V28A 1PJ9A 3L4TA 2FGLA 4MJ4A 3ZJ6A 1C91A 2D3NA 3KL5A 4GO9A 2BHYA 3VGDA 4B15A 3L2MA 1BG9A 4EK7A 3BH4A 1YQ2A 2Y8KA 1U33A 1E70M 1N82A 4AD3A 1HL9A 3KL0A 3VILA 3CHEA 5D9PA 1W2PA 1J01A 1EQPA 1H1NA 1GW1A 1H5VA 3DYOA 3THDA 4GO8A 1GVIA 3M6DA 3CUFA 2DIJA 5A3HA 4Z2GA 1C3FA 1CTNA 1BYCA 4NRRA 2YLLA 2VCCA 1JGIA 2VRJA 2VZTA 4MB4A 4W8BA 1GJUA 1E56A 1FH9A 1I75A 2ZUUA 3GTNA 3G6LA 2OSXA 1Q6GA 1HKMA 2X0YA 3VD3A 4ATLA 4HPGA 3UG5A 1GOQA 1HN1A 1TA3A 2WKGA 2XFFA 1J12A 1E4LA 2YBUA 3WFLA 2DSVA 4FLOA 2DEPA 1PEZA 4GQQA 1QI2A 3WUGA 4B16A 2VOTA 3PZOA 1TA3B 3VDCA 3TA9A 3SCVA 2ZIDA 1FHLA 2WPGA 3PZUA 4PBGA 1G9HA 3WH5A 3OLEA 3AJ7A 3CMGA 3NCOA 2W61A 3AYSA 3UR8A 1CGXA 2X09A 4D6CA 2J25A 3WDRA 5D8WA 2QLYA 2XTKA 1UOKA 3CZ8A 1QHZA 4MNJA 4UZUA 4D6GA 4BZYA 1BFNA 4JKLA 3T0DA 1EIBA 2O92A 4ATWA 5LA0A 1W91A 1KCLA 3AXIA 4WIWA 3VD4A 1QW8A 4OBSA 3T2QA 3B9EA 1UH2A 2J47A 4LYRA 3VMOA 2WSKA 3AS2A 4ACZA 5JBDA 3OLIA 1BAGA 3L4XA 5CSYA 1HJUA 2VURA 4HTYA 1ZL1A 3EMZA 3WELA 3BLKA 4QLJA 1RD6A 1QI3A 2BHZA 1C93A 4GZIA 4U2YA 3WH7A 4LPCA 1NH6A 1WZMA 2QHAA 1OWQA 4BQ4A 2W62A 4ZEPA 3DYPA 2J62A 4UFKA 1UH4A 1M53A 2DSKA 5CLWA 1BSIA 1JNDA 1TE1A 1QBBA 4NF7A 4JHOA 1K9DA 1EXPA 2CHNA 3OZOA 2XHYA 4EANA 1WKYA 2JEPA 1H4PA 1XD1A 3K8MA 3W27A 1XH2A 2NW0A 3PZMA 2FHFA 2AOSA 5DT7A 1JYVA 3DECA 4WJXA 1ECEA 3VD7A 3ZIZA 4WKAA 3FXYA 1R86A 1M04A 1VFUA 5DMYA 1HP4A 1JDAA 3VIOA 3AHXA 3WNKA 1OBAA 1J10A 1KGWA 4D1IA 5BRPA 2GUYA 2XM1A 1UKPA 2J7FA 3MANA 4DM1A 1V3LA 3T2PA 2A3BA 3AHVA 1CGTA 1TFVA 2VZOA 4AW7A 3PZ9A 3SCRA 4IM4A 2ZXBA 2V3FA 1E1EA 4L4OA 4OOZA 1BF2A 1MXGA 1YHTA 4BCEA 3AZTA 4M8UA 3N1AA 4Y7EA 2GJXB 3LPOA 1AQ0A 4GI9A 1DWGM 3BAIA 2D2OA 2W4XA 4GI8A 3N18A 5E70A 4FLQA 1B30A 3ARVA 2D0GA 3NSNA 3VGHA 3WUFA 1NQ6A 4FLRA 2FDMA 1IZKA 1H2JA 3L4WA 2WZIA 1LG2A 1X1NA 4UCFA 5JUVA 3WDHA 3T0BA 2VC9A 1OCQA 4QCFA 1W3LA 5A6AA 4QDMA 1CXLA 1KGUA 3CTTA 1XRVA 3WDJA 2X0HA 3AICA 4BQ5A 3KZSA 3O9NA 4AZIA 4HPHA 3O2LA 1KBBA 3N9KA 2O9RA 3IJ7A 1M7XA 4YHEA 1PX3A 3S2CA 1PX8A 4A4AA 1DWFM 1FH8A 1KR0A 4UOJA 1QVBA 4TTUA 3VGBA 4AZCA 2E9LA 5E6YA 3EYPA 1UYQA 4E4PA 4ML4A 1G0CA 1VRXA 3W81A 2W5FA 3DHUA 3SUUA 5HOSA 3AS1A 2G3MA 2DPEA 1LJYA 2E8ZA 3DC0A 1XC6A 5M5DA 1HX0A 2ZUMA 5FL1A 1QNPA 2J78A 4CN4A 2VL4A 3FAXA 3GH5A 3NJ3A 1NM9A 3CZJA 4LXFA 5ABHA 2A3AA 2VR5A 1B2YA 1K6AA 1TG7A 4KGJA 4Q22A 1JI1A 3I3BA 3BAYA 2YIHA 2X8RA 1XD0A 2DSZA 5LYRA 5AYIA 1CPUA 3UEQA 5A8PA 3MO4A 4AIEA 1V0MA 3VD5A 3WNPA 1CGVA 4J27A 4ACZB 4OOUA 3VUPA 2VO5A 3VU2A 3VOCA 1QI0A 1UWTA 1BVZA 1UQYA 2FGZA 1DEDA 3QR3A 2XYLA 1E0XA 2ZUWA 4B9YA 1UR9A 3AQUA 4JL2A 1WPCA 2YLAA 3W53A 1E6QM 1NOUA 3VGEA 5CGTA 2G3NA 3EDFA 4F79A 1Q4NX 1GNXA 1V02E 2WHMA 3GXIA 1HKKA 3VDBA 1CDGA 1D3CA 2IUZA 3W6LA 1G94A 2CKRA 2VMFA 4CD8A 1J0YA 2WANA 1QI5A 3MUIA 2EEXA 1SFSA 4PSPA 4MPKA 5I2UA 2OWCA 2NT0A 3GXDA 3W29A 1ZJBA 3G6MA 4W8LA 2V3GA 2XGBA 3TTSA 3GM8A 1ISVA 3WY1A 4UFLA 2YDSA 4GXPA 1VF8A 1W3KA 9CGTA 2QPSA 2C7FA 4J7RA 2BHUA 4PMOA 4CN6A 2WYSA 3CO4A 3IJ9A 4AEFA 1P6WA 3L4ZA 4YHGA 1OB0A 2PF0A 2X1IA 4PCTA 3PZIA 2X05A 1I1XA 4Z2LA 3RM4A 4ZFMA 2WC4A 4HZ6A 1UA3A 3BAWA 3ZT5A 3M07A 1V08A 3AMGA 3VTRA 4AD2A 3AIVA 2EPMX 1V6UA 4MB5A 3SEPA 1HP5A 3K8LA 1I1WA 1LWJA 1LL4A 4H8HA 4J3UA 2WMHA 5ABFB 1UQZA 3ZJ7A 1BLIA 3M7SA 1NP2A 1EDQA 1DWHM 3JUGA 4OBRA 2GFTA 1H49A 1PBGA 2ZUSA 3PHAA 4W5ZA 2XJ7A 8A3HA 4W8AA 5EMYA 1JXKA 3W24A 1E4IA 3EDJA 5BYWA 2VUYA 2WBGA 1UR4A 4BA0A 2GJXA 4UR9A 3AIUA 1D7FA 1UD4A 4KGLA 4DWSB 1ISXA 3WF0A 2G4FA 4OKDA 3WH6A 3EDEA 4CD6A 4EAMA 1KWGA 4JFSA 4WK9A 6A3HA 2ZICA 2F61A 3AS3A 4PMZA 1CYGA 1W1TA 1WE5A 2GSJA 1NWSA 2G8ZA 1UD5A 3GBDA 4IISA 2GVYA 5E09A 2YA1A 3QGVA 5M03A 3ARZA 1V3JA 4W88A 1VFMA 5A6SA 1V0NA 2V3EA 1E0WA 1WDQA 2WMKA 3ZJ8A 1PIGA 4GIAA 1V6XA 3TTOA 2VX4A 3CPUA 3GDBA 3FY1A 3HN3A 1K9EA 4PN2A 3WF2A 3VNYA 4N42A 3ZSSA 2YDQA 4JHZA 1OM0A 3IAPA 4KH2A 4DM2A 1KQYA 4GZJA 2WW5A 2Z1KA 3WEZA 4HU8A 2WCAA 3WMSA 4RE4A 4AWEA 1EO7A 1MQQA 3EBVA 3W0KA 5JBFA 1E4MM 2G3IA 3WH9A 3B8SA 1EDGA 1F4HA 1CXIA 1AQHA 4D6HA 3TOPA 3ARQA 3OGRA 4JIEA 2VX7A 4A3HA 2VNCA 5KZ6A 5GPRA 1RP9A 1B9ZA 1WDPA 2OSWA 4C7DA 3VGFA 1OGGA 2OWXA 4HA1A 1JNEA 4LX4A 4PRWA 2W92A 4LGXA 2XVKA 1TCMA 4PTWA 2GJRA 1XSKA 4W86A 3EDKA 4GZEA 1CLVA 4J3VA 1E6XM 4HP5A 5IFPA 1EHAA 4AZ6A 3ARYA 1QI4A 3VIIA 1MYRA 4IPNB 3QOKA 4UFMA 1E5JA 4AZGA 3TONA 2BXYA 4B3LA 4D6IA 3RCNA 2BS9A 6TAAA 3OLGA 3WIJA 1MFVA 1JYXA 2UWFA 3CZKA 4J3XA 3AZRA 3U7BA 3A4XA 5DT5A
chains in the Genus database with same CATH superfamily
1R3WA 4AVNA 3M41A 1E72M 2FTPA 1WCGA 4AD4A 4WY0F 5A8QA 1XLHA 2DZUA 6XIMA 1GQJA 5E9XA 3DG3A 4WCJA 4JTAA 2BP1A 2VJXA 4L9XA 3U0HA 2GGEA 1XLCA 4DWSC 3B8VA 5BXTA 4NILA 5H6HA 1GOMA 3V1PA 4JYFA 3UPWA 5XINA 1V79A 3L4UA 1LRNA 3B9NA 5I3FA 3I7RA 5G2HA 3WMBA 4UOQA 4FI4A 1VYSX 3ZJKA 4BK9A 3M5XA 3EWCA 5FJUA 2R1MA 1K02A 2DIEA 1BWLA 3F03K 1UZ1A 2X0SA 4DWSA 3M9YA 4A29A 1ODUA 1J96A 4WRHA 4RPPA 1EOMA 4MNMA 1E4NA 1OFOA 1RLCL 3NDYA 4CCCA 4MWAD 2CEQA 4X9YA 5MF5A 3MP5A 2F6UA 2RHGA 5F1UA 1OCNA 4UQBA 1NFBA 4QCEA 1QPQA 2C3ZA 2YL5A 2JIEA 1OFEA 3CL7A 1TREA 4MDPA 5E1QA 1UMYA 4GZ7A 2FZMA 2HDJA 3LCFA 2D22A 3QKZA 4S3GA 3M5ZA 1FWFC 1F9CA 3E02A 2ZDSA 1GJPA 4QE4A 3S2JA 2PZNA 3T0TA 2OQHA 3S5OA 2I5GA 4PBFA 4GI6A 8CGTA 4DJEC 1C29A 4HYVA 1FCBA 1LL7A 4OGZA 2A6NA 4F9DA 3JR2A 3UXLA 4ZB5A 2WMGA 2PDBA 3CUZA 2W3ZA 4TVCA 3NQBA 5I3GA 4C1NA 1Z7AA 3STGA 1VZWA 2Y4SA 3HPSA 4C6OA 4GFIA 4JX6A 1I45A 2PB1A 1KRCC 2W67A 1XJBA 1EL3A 1GCYA 2FZ9A 1VLIA 1EKOA 4GKLA 3KWXA 3F4VA 4LUYA 1T41A 4F2TA 2E6AA 3H4XA 3CO8A 4UZSA 4GQGA 5J8LA 1F07A 5L6UA 5K9CA 4DJFA 1OG6A 4DUOA 2VP8A 5F2LA 2ABBA 4JQ3A 3VUSA 5EMJA 4RZ6A 1F6PA 1FY6A 1PCKA 1IWBA 2QVNA 5DF0A 2PRHA 3VIKA 3OJGA 1GW9A 4UFJA 1Q6RA 1GG0A 3MHGA 2Z2BA 5TAOA 5EKYA 3W2NA 2ALRA 1RBOB 2JF7A 3OGSA 2P8BA 2HEJA 1CGYA 1R3YA 1KXHA 4E8CA 3G2GA 3MMDA 3TJ4A 4Y9AA 3O63A 1POKA 3ANUA 1L6YA 4Y96A 5LNSA 1W3JA 3T8LA 3OZMA 3W07A 2GSHA 1OK6A 2QVHA 3R0UA 1S2AA 2V9DA 3ITYA 4O13A 1FFQA 4FHAA 4S3JA 3GHSA 3HV8A 3ITVA 1WUEA 3ZFHA 1QATA 1ME9A 5GVJA 3G3MA 4NKCA 1KC7A 4UTMA 1XH0A 2FMNA 1Q6CA 3U6WA 3W7OA 5CC5A 4MLJA 4M81A 3QMTA 4OE7A 3NUKA 4JX5A 2FQIA 3R10A 3VX0A 1UP3A 3B9DA 1E55A 4K1GA 1M3UA 3A21A 1B3VA 5LIUX 4F40A 2FYMA 3PJTA 3SB0A 3JS3A 3ZT6A 3LSCA 1TWZA 2F8QA 4KCWA 5M3WA 3B8UA 3ICJA 4XUYA 1UWQA 1J8VA 1VEOA 1VRDA 3TQPA 2QV4A 2P0IA 3RAOA 5JH1A 4L56A 4UFHA 3A5FA 3A4AA 3C2YA 3BV7A 3LBCA 2PURA 1HTIA 1XG4A 3EA2A 5FD0A 1OT2A 4XAGA 3T08A 3ATYA 3S1XA 2ISWA 1PL9A 5I6SA 4MKVA 3RMJA 4PUEA 3KTXA 3KHJA 3NQDA 2OOGA 1M03A 3H7RA 1WB0A 4ZXOA 5I3DA 4O28A 4KCUA 5HNTA 2Y5JA 3REQA 2VELA 3T2OA 2UY2A 3FX4A 3ABSA 4Q4RA 3E0LA 4YMZA 1PVNA 2PAJA 1KKRA 1JAEA 3A3HA 4F3HA 2BY2A 3OBEA 4HN4A 3FHQA 3VOGA 4GA8A 2A21A 3W38A 3I4KA 3PBUA 1OC5A 3TN4A 1W9BM 1OX4A 1KM5A 2DSWA 2Y7DA 1QT1A 3V16A 2QULA 3GAYA 4Q8PA 1OIFA 5D9NA 4P7OA 1PCWA 1KFJA 3NM3A 5D37A 2VT0A 4OFCA 3QR1A 3T0AA 3C56A 4XSLA 3BG5A 4HZ7A 3L21A 3W7NA 3DG6A 2W9MA 3PUGA 4AZBA 4R88A 1A5CA 2IPGA 2ZE3A 5BROA 1HKJA 2AL2B 2O9OA 2PP3A 2CZ5A 4H01A 1G67A 3I3DA 2P3EA 3MKCA 4H83A 1ZJAA 4RZ5A 2ZRVA 4JDYA 1HO1A 4MB1A 4ZE4A 3PTKA 1GKPA 2VRKA 3T9PA 3DENA 3PULA 4KERA 4Y90A 1UJPA 1UD6A 2WJZA 1EYWA 1E0TA 1YNPA 1UWSA 4E2DA 1FWJC 2VDHA 1IZCA 1ZBWA 4L9ZA 4J40A 4MVAA 4TVDA 1MRAA 5EFDA 3D5HA 3T78A 5IXEA 1BXCA 4O8RA 4C6JA 4HA4A 2ABAA 1JR1A 4IPLA 2E1WA 2X2YA 1EX1A 2PU1A 5JIPA 1UG6A 3AAMA 5EL1A 1HUVA 4KWUA 3WQOA 3P8IA 1QXLA 3ZYZA 1EF3A 3C3UA 2PGRA 3GHUA 1R9XA 4RV3A 3NO1A 1ZLPA 3UJFA 4LAZA 2EBNA 4B4FA 4XUGA 5DMNA 2I9UA 3QFWA 3NURA 1B3WA 4QBXA 5AHNA 2YPIA 1A53A 3GKFA 1CNVA 3KRZA 3U57A 3BAJA 2CKSA 1ONWA 3BLIA 1VIZA 3C5QA 4QQUA 3BXWA 5FL0A 4AC1X 1H7OA 1W1ZA 3TNOA 4IP4A 1JF6A 2RJHA 4JTJA 3SCPA 3PN8A 1RPKA 3QTPA 4BWLC 3G1HA 3CV6A 3EXRA 1SFJA 1BYBA 1PHWA 1XBXA 3T09A 1O5QA 3AUJA 9XIMA 3VABA 2PGEA 3ARXA 4OIFA 4RK8A 5FESA 2PWFA 4EIVA 1BF6A 4TV6A 3SN4A 3RHGA 1AMYA 1YDOA 4XZIA 1UKTA 4YTUA 4KETA 4Q3MA 2WAGA 2Z27A 2YDAA 1LUCA 2ZOXA 3ZO9A 1R5YA 2OX1A 1OSEA 5ABTA 1JZ3A 4I7WA 1J18A 5AKQA 3O6YX 4QISA 3S46A 1ZBKA 3UWZA 3CNYA 1KFCA 3RRAA 2ZX6A 4D6JA 2EG8A 4NNCA 5F4SA 4JQAA 3DH7A 2NUWA 4UQAA 1E9IA 3F2BA 3C0JA 5MHBA 3AHYA 2CU0A 4FLSA 4PUDA 4BQ2A 4TUFA 3R1ZA 4BI5A 2R1NA 4PH6A 3IJLA 1VH7A 1QNQA 1EB3A 4GIYA 3TDFA 1XIJA 4XZNX 3MPGA 2ZQ0A 3BSHA 5HPCA 1DOSA 1KNWA 3QEZA 2J8GA 5B80A 4MJZA 2NVDA 2P76A 1Q6DA 3RMEA 4CVUA 1W0MA 1CEOA 1SJAA 3GC5A 3R25A 3LY0A 4JTDA 3UZJA 1FTXA 3G1AA 3BW4A 1WAWA 3QKEA 2FB3A 3W1AA 1XLJA 3PBWA 3CUIA 3QLLA 5BU9A 5HBFA 1XRTA 3W87A 4GWEA 2J9XA 4US5D 2EKCA 2H8ZA 4PTXA 1KM2A 2EF9A 1OIMA 1WZAA 5D9MA 1Y5XA 2PWDA 1TQJA 1AH4A 3LI0A 1X7FA 4LVFA 2RGLA 1O6IA 3PBYA 1P6CA 1BHGA 1L8PA 4JAWA 3OVRA 2A3CA 4RXGA 1MQPA 1VB9A 5A6JA 1LQ2A 4XZBA 3E2VA 1MO0A 3O16A 4RDZA 4HD5A 4R9OA 1E15A 4DUXA 5IBXC 4A3QA 2G97A 3B9AA 4D1JA 3G3DA 4FK9A 1VGAA 3DHFA 3R0DA 1HVQA 3UBPC 5D8ZA 3TYCA 7PTDA 3HG3A 4D9PA 1DHPA 3VMPA 1CXHA 1FWSA 2C8NA 4GUHA 4F66A 3ZR4A 2P88A 2NV2A 1H0IA 2HS6A 1ZP3A 3UCQA 3DIPA 3BOFA 2YJQA 1BQCA 1S38A 1IR1A 4NASA 1IWPA 4C5ZA 1OGBA 4Q4SA 2J74A 3EOSA 4LUJA 1XQKA 3QHNA 5EMMA 4RNJA 3LGDA 5FSEC 1Q6LA 3LXCA 4UTJA 4ERIA 3WQ6A 3UJ2A 4NVTA 2A79A 3OA5A 4KCVA 4UMBA 3O6DA 3EDDA 3L68A 4HSNA 1A5SA 2J88A 3THCA 4X2PA 2AAMA 4M82A 3KBWA 4IFKB 4CEXC 4NIRA 1JFXA 3U5YA 3S5NA 5A95A 1B1YA 3KS6A 3V1HA 2VR2A 1S2CA 3BCJA 1V6VA 3F4DA 3ITXA 4ERAA 1S1PA 1OABA 4Q32A 1W3NA 2J75A 3EEZA 2OZTA 4C6KA 4TOQA 2QJGA 1D8WA 5LNWA 1B3ZA 4AD0A 4A8IA 5KETA 1W9VA 4B91A 4HK6A 4X60A 3V0SA 4QFUA 1VENA 4NAFB 5LNRA 2CIPA 3TOYA 1WYIA 3ALGA 1TJ1A 1RUSA 3K2GA 3PSWA 4IFRA 1GQKA 2PC4A 4CKQA 5F7UA 4URIA 3BANA 1RH9A 3R79A 3MZNA 1J11A 4EP8C 3URQA 1EQCA 1UD3A 4V1XA 4INFA 1TWSA 1W37A 1T0OA 4LCRA 3OLDA 5FEZA 2V82A 1P0EA 3PFMA 2C18A 5HMSA 3CHVA 4X63A 3UXAA 5CPTA 3VYLA 5CZTA 3HA1A 5ABGA 3U3HA 4QJ1A 1FCQA 1TB3A 5G1TA 1K03A 5CBIA 3WQ4A 4PEEA 4IOTA 2E0PA 4ORIA 4MYXA 1VHNA 1GQIA 4TMCA 3W7KA 2QJHA 5D02A 2OMAA 4P7NA 2ZA2A 1LDCA 4AY1A 1HL8A 4CD4A 3A24A 3MKKA 3DGBA 5A2BA 4DYJA 3UD6A 2VC7A 4AXNA 3EB4A 2B4GA 1KW1A 4H1ZA 2FHBA 2POTA 1AJ0A 3AMCA 4YTQA 2CESA 3DHDA 4DNHA 1N8IA 3TSBA 4N7QA 1E3ZA 3H22A 2J8FA 3LCGA 1T6MA 1BYDA 3GD6A 4AU0A 1ZJHA 1KXQA 1JZ2A 3T40A 1ITQA 4A35A 4QEEA 3WEMA 1SZFA 2F6XA 2CXEA 2F2KA 1M7JA 3V75A 3WG6A 4AIUA 2CCRA 2VM8A 5CPSA 3GXMA 3WBXA 2IKIA 3ZVIA 1GOOA 2Y5SA 3VVGA 1TVLA 4PMUA 4G7FA 4Y9OA 4QJ5B 3FK4A 1TV7A 4IICA 4NUWA 3AALA 4DWSD 3O7UA 4O16A 2VHLA 4H8VA 3ZS4A 1FBAA 2NZLA 4I8DA 4X0NA 1WZKA 1ESWA 3G1DA 4Y2WA 1GQNA 4WDXA 1FHDA 1Y0EA 2ZA3A 4S3KA 1A5KC 4QAWA 1QDSA 3RO8A 1UWIA 6TIMA 2DZPA 5C9WA 2ESCA 1MVYA 5C0QA 4F9JA 4DAIA 3MUZ1 4AHOA 4Z2KA 1GONA 3AIRA 3N4AA 3WQVA 1JZ4A 5I77A 1LBMA 4IJCA 1VKFA 4EPBC 3W7GA 4UNKA 3GU9A 3P60A 1VJZA 2QF8A 1S5VA 3IUDA 5C2CA 1VFLA 4MUPA 3VDHA 2ZZ7A 5LNVA 3GRIA 2Z2AA 3C2OA 3UXKA 4TIMA 2CNCA 2DT3A 3ITCA 1A5MC 4ERGA 1LOQA 4DJED 2QCMA 1PKLA 2BOGX 4UOZA 4W84A 1GZ1A 3CMJA 4UR8A 2VZVA 3EB3A 3E74A 4Q4KA 2Z00A 4OUEA 5IRPA 3F2DA 1PTDA 3UP8A 2X41A 1JCXA 1YTKA 3MMWA 3QRHA 2CBUA 1W9DM 5KSWA 2JEQA 4JNZA 1VJIA 5C55A 2TYSA 5T26A 1W2VA 4YVPA 3YPIA 1X96A 1IEWA 2Q09A 1Q65A 3PY2A 3VA8A 2WSYA 2TMDA 3PZVA 3TYDA 3VKAA 2F38A 3DI1A 3ANVA 1UUMA 1WO2A 2OT1A 3WBWA 1C9WA 1D8CA 2NSXA 4DXKA 2WM0A 1YXDA 3C3NA 4A21A 1AVAA 3STPA 4R53A 1CWYA 2WXDM 3SADA 3EX2A 1A0CA 4HNCA 2PZ0A 3BMXA 3W26A 3IIVA 5JXQA 1Y7VA 2VDIA 2TPSA 1EC9A 2AQVA 1IEIA 3MDUA 3TZNA 1ISWA 1XIFA 3EOEA 2QT3A 1YYAA 1V02A 1PJ9A 1XLLA 2FGLA 4MJ4A 5FF7A 3ZJ6A 1ADOA 2BG5A 4NNBA 3GTIA 4GO9A 4HHHA 3NEHA 3FYYA 2OZ8A 1YQ2A 2Y8KA 1JCNA 3KL0A 3VILA 5D9PA 1EQPA 1JCJA 1H1NA 1GW1A 4ZQMA 1GVIA 3CUFA 4FNTA 3OEXA 4UCGA 4IGHA 1C3FA 4DWDA 2WPBA 3W7JA 4M1BA 2YLLA 3TJXA 1JQVA 3DC8A 2VRJA 4HA0A 4G7EA 1E56A 1KCXA 5DCDA 4QTGA 1AH3A 3A9BA 4WUIA 3GC4A 3L0GA 4C6NA 4N02A 5FI8A 2OSXA 1HKMA 2J9ZA 4LALA 4ATLA 3CB8A 4HPGA 2HXTA 2DVUA 1Y65A 1NY1A 1TA3A 4FA3A 1P7TA 4GVGA 2YBUA 3UQNA 1J4EA 4FLOA 1UIOA 1PEZA 4JPGA 2CWNA 1KM0A 4GQQA 3PNUA 1IEVA 1RJQA 3NPVA 4JY9A 1FHLA 2WPGA 3AJ7A 2FFCA 3L0KA 4H9ZA 3NCOA 5F1VA 3AYSA 3ITTA 3UR8A 2AQWA 4R3UA 3STEA 4D6CA 5AB3A 3WDRA 4QJ4B 2F84A 2HCVA 2XTKA 1S5MA 5BOEA 1AJ2A 3UA3A 1SJCA 4U28A 1RVKA 1LP6A 1LZOA 3H2FA 4G6CA 1QW8A 1XPGA 4LCQA 4LYRA 2HNEA 4B90A 1M7OA 2WSKA 3AS2A 4A05A 4HNLA 4JIRA 1VC4A 3W71A 5DBUA 5CSYA 5CPNA 4ECLA 1EJSC 1ZL1A 4EVZA 2LLEA 4ZCWA 5EMUA 1RD6A 1YXCA 3WX7A 4LPCA 1WZMA 2BOEX 3QV9A 1IQ8A 3LHUA 4UFKA 1UH4A 4EF9A 3NL3A 2R24A 2YXGA 3CAWA 4NF7A 3KBNA 3THAA 1K9DA 4MY1A 1XDMA 1H5YA 2O0TA 1WKYA 5HMDA 4O1EA 3W27A 3K8MA 4YCPA 3V7PA 2HVNA 1K8XA 1BD0A 2BGNE 4ALDA 3DECA 3W1TA 3RCMA 4A8NA 1R86A 1OF6A 1XP3A 2A85A 3KAOA 5DMYA 3A3WA 1HP4A 3W22A 1U1JA 3WNKA 2FVMA 4PZVA 4NJKA 3N4FA 4Q6JA 2J7FA 1V3LA 2IMRA 3P5ZA 3DEQA 3AHVA 5LHFA 1JULA 2VEIA 3PZ9A 4IM4A 3WLKX 2CZFA 4X9SA 1E1EA 4OOZA 1BF2A 2JKAA 1XG3A 4LSBA 4Q7BA 3BO9A 4M8UA 3LPOA 4LBRA 4PUUA 4GI8A 4MG4A 2D0GA 3VGHA 4LWWA 1SFTA 3MWAA 4HU3A 4G1KA 5JQ9A 3XISA 1TUFA 3GW3A 2Z2UA 6XIAA 3CWHA 1LG2A 3KP0A 3S4TA 2Q3RA 4R85A 5JUVA 2GGGA 4IZGA 3WDHA 2PP1A 2VC9A 3S83A 3G1YA 4DJFD 1Z69A 4IIFA 4QDMA 3AXKA 1H63A 1OX5A 1Q85A 1XRVA 3WDJA 5CCZA 2PTDA 2X0HA 3AICA 3KZSA 2FZNA 2CLIA 3FCPA 4UUIA 5K9DA 3IJ7A 3C0QA 3SECA 1F7BA 2HE8A 4A4AA 3FXGA 1KR0A 2JQXA 3URBA 1QVBA 5I00A 4AZCA 3VGBA 5E6YA 2O7QA 4HK7A 4E4PA 1LOLA 1VRXA 3SUUA 3GDRA 1PUDA 5RUBA 3QC0A 1XDJA 2DPEA 4UTWA 3GXTA 1XC6A 4DELA 2E6YA 3TR9A 2ZUMA 5FL1A 3L23A 4CN4A 4Q8TA 1P4CA 1FWTA 1ZALA 2J6VA 4FOUA 3CYVA 4QNWA 4LXFA 4GYFA 1B2YA 2OKTA 4PFHA 3CT7A 3PR2A 3D47A 4ZFCA 1EBHA 4M0XA 2Y85A 2H90A 1DBTA 3L9CA 2X7VA 1XD0A 3T44A 2VWSA 4AIEA 3WNPA 3TW7A 1R3RA 3VU2A 4RKAA 4FX8A 3NPXA 1BVZA 1NELA 4H00A 4LF1A 3EAUA 3UCCA 1GOXA 3V4BA 2YLAA 2DUAA 5CGTA 1ELSA 3UZWA 2G3NA 1RZMA 1T8XA 3G22A 2ZBTA 1TELA 5C54A 3K30A 1JVNA 4V15A 3MUIA 4AIBA 3DFOA 1N8FA 5I2UA 1GVQA 2OWCA 4CCZA 3GXDA 3W29A 3G6MA 1X98A 2V3GA 2XGBA 3TTSA 4ZO8A 1FXQA 3P3BA 4GD0A 4KWOA 3GM8A 1YEYA 4UFLA 1XLGA 2YDSA 3DI0A 3W1QA 1LTDA 5GJPA 3B8IA 4XBSA 4PMOA 1KRMA 2PCEA 4Q8WA 3UJEA 2PRMA 3HPXA 3IJ9A 2CLHA 3GX9A 2PF0A 2X1IA 4PMJA 3S9IA 1I1XA 1GPWA 3FEQA 1UA3A 3HGSA 3W2JA 3BICA 3AIVA 3NXFA 1RPXA 3QW4B 2UBPC 4UTTA 1LL4A 2BX7A 1Q5MA 4LAKA 5HNRA 3ZLGA 1G4EA 4J3UA 3G77A 4GXMA 5ABFB 3BLEA 1SW3A 2ZDRA 4ICNA 1BLIA 3GHTA 2A4AA 1RQEA 4JTHA 4NL1A 2BOFX 2D2HA 4DZAA 8A3HA 3H23A 3T81A 3GVVA 1JXKA 2D73A 1OX6A 4WEVX 3EDJA 1TJ0A 4S2CA 2VEGA 4PUMA 5BYWA 4WSHA 4DEFA 2B7OA 4UR9A 1Q45A 4O50A 1D7FA 2I9EA 1UD4A 4DWSB 3QV7A 4I6KA 4CD6A 4GYKA 1EZ2A 1KWGA 5K2ZA 2C1IA 4L4MA 4HNVA 3AS3A 4GYPA 3LM3A 3PWGA 4J2PA 4PL2A 1WE5A 1VP5A 3GVQA 3EWWA 1NWSA 3GBDA 4J5NA 2YCKX 4J4KA 2GUBA 3PB0A 3W1LA 4S38A 4JIPA 1TX2A 1SO5A 2C1HA 4R9XA 4FIRA 1PIGA 1KA9F 1IT7A 3TTOA 1UROA 3BV4A 3VNYA 5IDZA 4Z1YA 3RU6A 1GK8A 2TSYA 4KH2A 2ANUA 3COTA 1KQYA 1XCFA 4ZOAA 4DO7A 1HW6A 2I7GA 3WEZA 2WCAA 4LUSA 3WMSA 3KWSA 1EO7A 1CLKA 1H1YA 3EBVA 1FWGC 1L6WA 3W0KA 2G3IA 1DXIA 3LU2A 4JTLA 1CXIA 2YXXA 1AQHA 2J9YA 4JIEA 2HSAA 1OCJA 4MZ8A 5KMYA 4A3HA 9RUBA 4E3VA 4OT7A 1RP9A 4IMEA 4CQBA 2BWGA 2F6KA 3CL8A 4HA1A 3O0KA 4CNNA 1XWYA 4LX4A 4JN7A 1GTHA 1IR2A 2W92A 1SSGA 1MXSA 4GGHA 4LGXA 1TCMA 4PTWA 3GHRA 3GK0A 1XLIA 3VOFA 2VFEA 2INEA 2D2JA 4Y8EA 5G2WA 3FDGA 2BS9A 1V93A 4ZB2A 5M1TA 4QS5A 3EX1A 4RW5A 3U2CA 2UWFA 1JYXA 4DPPA 5SWUA 4O52A 3AZRA 3Q2DA 4CNOA 1JIBA 1JD9A 4KEVA 1GHRA 3CQKA 1Z3NA 4GY0A 4GK8A 3TTQA 2CPUA 3J7HA 4F0KA 3CIVA 4L4PA 3DG7A 3LQLA 4KMQA 3NA8A 4G8TA 3BOLA 1OX4B 5CZ0A 3S3GA 3MZ2A 4MJ2A 2ZXDA 1ZUAX 5A1AA 2DH3A 4FR1A 5LXXA 5DY3A 1GZGA 2HJPA 3PBVA 3KDNA 1RQHA 4MFDA 1JYWA 4ZBCA 2E40A 5IFTA 4ADTA 4U3AA 3DFPA 4HCLA 4BKNA 3CTLA 4BS0A 4AQLA 3MB9A 3WFAA 3PG9A 3E0WA 4GFSA 3RX2A 2A1YA 3NYDA 4YXGA 5D30A 3W88A 1K9TA 1BG4A 1KLYA 2VFFA 2HXUA 3IIOA 1NWRA 1W54A 5D32A 5DY2A 3RIKA 4JQ2A 5ABEA 1MZHA 3TIMA 4DJDD 3N2XA 1OD8A 3GUGA 3PPFA 4PMVA 4NAFA 2VQUA 1BSLA 1I4NA 1FXPA 4TXEA 5CGMA 2CITA 1UKSA 5GNZA 1FKXA 4XWUA 4LB3A 2FGBA 4MY9A 3IANA 3U2OA 5EYWA 3DERA 1MDLA 1XIDA 3H8AA 1NDZA 3HF3A 2JKEA 4P8UA 4EPDC 2V63A 2WSPA 4JFUA 2ZRWA 4MPQA 3NXLA 3QH2A 2BY1A 4IFOA 1ZBCA 4ES4A 4NSBA 1V6WA 4KW2A 3NQ2A 1E6SM 3EX4A 2OX4A 3EWZA 3SCOA 1EJXC 1RVGA 4W5UA 1TSIA 1WP6A 3M0HA 4MWAE 3B06A 1JI2A 1SVDA 3HG4A 4KCTA 2PD5A 3WMLA 1AA1B 1ME8A 4JL1A 4ATDA 1R38A 4YYCA 4US6A 5DCEA 1XF0A 1ZPTA 2OODA 2XVNA 2Z29A 1K9FA 1EPVA 5AHLA 3VOIA 3LBMA 3MV01 3UZXA 4CQ8A 3PG8A 4GHRA 1U30A 3TH6A 3HQOA 1GVYA 2BNJA 3AJXA 2Y8UA 3PJWA 5DN1A 5AN7A 2YDRA 1IXQA 2WV8A 3LCXA 2ZX8A 3VIGA 1IYXA 2ZUNA 4NJGA 3ARTA 1S5TA 3PZTA 4RX0A 3NZQA 3M47A 2PBGA 5C9XA 4PMYA 3DFHA 4KESA 4HPXA 4IJRA 4S2BA 1UOZA 5REQB 1QK0A 2WOQA 3RLUA 4WX2A 3UCDA 4JXCA 4REQA 1Z6KA 5GQBA 1RJRA 3HGRA 3FJ4A 4C5YA 4FX6M 4MSSA 4C7FA 1FRBA 3WF1A 3TAKA 1MMFA 1QAPA 3K4WA 4NNAA 3XINA 4PTMA 1UR8A 4AEEA 1VEMA 5JH2A 1HF6A 4KRTA 2GVJA 5B7YA 1B31A 3UJSA 1B4EA 1U5VA 3V3WA 3E5BA 1VYRA 3DDMA 3LB0A 1EJVC 3VZXA 1NWTA 4AD1A 4XKYB 4XB3A 1KV8A 1KQZA 5JBEA 3F5JA 1R7OA 2PGFA 4QEHA 1X97A 3CHCA 1BWVA 1F3XA 3T05A 3USZA 4C6IA 3CIWA 4ZSTA 2WZEA 1HIZA 4I9MA 4EX4A 4KRUA 3CHFA 1FFRA 2AAAA 2IQ0A 1CENA 1J5TA 2D1ZA 4JTIA 1L6SA 3LI1A 2OJPA 4MYAA 4RW3A 5EMKA 2SFPA 5D2TA 1ZENA 3NQMA 3HZ3A 1VAHA 2ALDA 5BOOA 4IUGA 3A13A 1JQXA 4B3KA 2NQZA 2DGAA 4PE8A 1L8NA 4DZ5A 3WD1A 4DLMA 3UWUA 2AKMA 4PCNA 3KLLA 2D23A 5LGXA 3MMUA 3P14A 1IEXA 2AGKA 3NGJA 1JUKA 1VLWA 1J6PA 2XVGA 5BCAA 2R14A 4DUWA 1DPMA 5FF2A 3G18A 1NQKA 3SCQA 3SJNA 3QV6A 1PS9A 3CQJA 2PGWA 3CEUA 3GG8A 4M6PA 3PVFA 4AYGA 3W2MA 4PCPA 1F73A 4W87A 3S1VA 3S9YA 4FXSA 4AZ5A 2GK1B 4ZODA 3CAKA 3GZ3A 5HPOA 3LXAA 3Q94A 1CB7B 1AZ2A 4YU1A 5I24A 3NZPA 3WBAA 1AQFA 3FKRA 4AYSA 3IUIA 4CNSA 1FP8A 3K1GA 2Y24A 4HNUA 3GXFA 2YFNA 5AVHA 4AZCB 4LAMA 3K1DA 2OZ0A 5KZMA 1FOBA 3CGTA 2BV9A 2ZC1A 3T07A 1XLEA 3VIJA 1EOKA 2PLMA 2WMJA 1UUQA 4KEMA 4YPJA 1O4UA 1XYBA 3LRKA 1UP0A 4C7GA 3C61A 3WNNA 1EUAA 2YKKA 3ARUA 4RPQA 3TYEA 1JUEA 3AC0A 1X38A 2C13A 3CUHA 4C60A 1TCDA 2WMIA 4F0SA 1DIKA 1IT8A 2WC3A 5LA2A 1O5XA 5FCZA 2C15A 2Y7FA 4MNKA 5TD4A 1LLOA 3O1NA 4M3PA 2FDSA 3AIQA 4W85A 1GORA 1UA7A 3OBAA 3E96A 3LZ3A 3TLQA 3PZQA 3E12A 1QOQA 2CLMA 2ODOA 3BWWA 2V30A 3BMVA 4FX7A 4GRSA 1KFWA 4MADA 4Z1BA 2IPWA 3EPOA 3VDGA 4HYWA 3M4HA 3QZAA 2J7GA 3QPZA 4G9PA 2CERA 1YDYA 5AYBA 2O9PA 4W89A 3O0FA 5A94A 3RFAA 3W1PA 1XYAA 5G4HC 1A4MA 4M1RA 4ZTYA 4OV4A 5E0CA 1LT8A 1WZLA 4QHRA 1E9LA 2FLIA 3ZOAA 4B5VA 1QWKA 2QJIA 4JFTA 3OYZA 4QLKA 1V6YA 4XBJA 2FHCA 4S1FA 4JKKA 3GR4A 1YKWA 4HHPA 4Y9NA 4EXAA 2Z1BA 2XFRA 3C86A 1IZJA 2QUTA 4GX9A 3WQPA 2WC7A 3D0CA 4V1YA 4NP7A 4CGTA 1OINA 5C6MA 2ZZ2A 3V36A 4P7LA 5DFAA 3FGCB 3ONCA 4QP0A 2YA2A 2WHLA 3SJ3A 3M0LA 4M56A 1NOWA 4HA3A 2ZX7A 3VIFA 1HO4A 1SMAA 1W5PA 2RAGA 1NF0A 3W2LA 3N2TA 3LD5A 4O57A 2CLOA 3M5VA 2E7FA 4IUOA 1UR3M 3WDIA 1J5SA 3AHTA 5LSMA 4CU7A 4D72A 1S46A 1QNOA 3EOLA 1UWUA 1C92A 3MW7A 4OBTA 5FJRA 3TVAA 4YCOA 2O4QA 4C1NB 2WKLA 4H9VA 2EPKX 2NX3A 1A3XA 3DKLA 3T1GA 4WXZA 4DN1A 1CXEA 4LC6A 2YYUA 2Z1WA 4MIMA 1YMYA 1GVOA 3G1SA 1NDYA 3S1UA 1RK6A 1KCKA 2VYOA 1R87A 2DUZA 1UH3A 1KKOA 2FB2A 1TRDA 1FWCC 1XL9A 1HJVA 3ID7A 4HB7A 3KVMA 3FSUA 3TLLA 3GNPA 3VK5A 3OB8A 1BTMA 3NM1A 5AVNA 3QY7A 3DFYA 2QDDA 3PUOA 3TEVA 3VC6A 3EKLA 5A6BD 3GE7A 1SQ7A 4HT3A 5DEZA 3HTWA 5C7VA 3S2LA 1IV8A 4K68A 3WD0A 2VVNA 3AMLA 2WO5A 1Q6FA 3O15A 2XIBA 3MV11 1WXZA 3IK2A 2PODA 3AXMA 3RJYA 1UKQA 3RPMA 3B97A 1TR9A 5A6MA 1Q6QA 1VFHA 4QX4A 1SPQA 5T9CE 4FR6A 4GNJA 2ZXAA 2X1SA 2YZ5A 4JZ5A 3P62A 1XFCA 3WLTA 4D6EA 1IXOA 4AY8A 4G1NA 3TAOA 4WLCA 1PHQA 1EF2A 2VX6A 3RN6A 3TR2A 1YRRA 3RLGA 5MKGA 4CUCA 1W9PA 2VTFA 3NIYA 2YBTA 4Q4MA 4GISA 4AY7A 4CQDA 1C8XA 3BAKA 1DKWA 2NVAA 3ARPA 3H26A 2QNEA 2IW0A 4AWUA 3UZZA 4MM1A 4CU8A 3IEBA 3R12A 3BQ5A 1US3A 2D3LA 4Q8OA 3R58A 2NT1A 4WGHA 3LPGA 2EG7A 4JTRA 3N13A 2GQ3A 4PRRA 1TJPA 1QW9A 5A8NA 5REQA 2PA6A 3WQWA 1F3WA 2VC5A 1K1DA 1AW2A 4IQLA 4TX6A 5AECA 1HKVA 2REQA 1BPLB 2XFWA 4O0QA 2E6FA 1UKOA 3UYIA 5HQMA 4AFYA 2ISDA 4IG2A 3GNRA 4OWGA 7TIMA 2CBJA 2HV5A 3VFCA 3ZLHA 4H7VA 1I2OA 2YL9A 1XLBA 4XVDA 1QBAA 1VBUA 2NQJA 5CPQA 3NL6A 4E8GA 3AXHA 2J79A 3ARRA 1GZJA 4CD5A 1JPHA 5CJMA 5BXPA 3OO2A 5EB8A 4HKPA 4AB4A 3BW3A 1J0IA 1LM1A 3FHAA 1ICSA 4DHGA 2V68A 1XH1A 3TSMA 1WKEA 5FJIA 5CG0A 3EX3A 2ONEA 4TX9A 4HOWA 3WLIA 1V3HA 3SGUA 2J7DA 4KWSA 3B8WA 4GC4A 3E0FA 3BAXA 4R34A 2V5CA 1R3VA 4DI8A 1QTWA 1D7KA 3F4CA 2V8ZA 4X2RA 4B2DD 2ADAA 3GVWA 3BLOA 3U4AA 2ISSA 3H12A 1T40A 3W85A 1MWOA 4U5KA 2J7HA 3VZYA 3SN0A 1AMKA 3UXDA 1SMDA 3FKKA 4QG6A 1MFUA 2VCAA 3S6TA 2NX1A 3C6CA 2OGJA 4EXBA 2W63A 4DB7A 2DP3A 1X6UA 4JHMA 4CVWA 1TIWA 3EKGA 2BASA 1J2BA 2BY0A 3EWBX 3O07A 3M46A 3ISIX 5EU9A 1W9UA 4DX3A 3N15A 4D71A 1FWIC 1YADA 3CS2A 3JU2A 3DKJA 4L64A 2W27A 4UMAA 3EWYA 3NEVA 2X7WA 3AWNA 4LYPA 1A3HA 3EXSA 2GK1A 3DGRA 1S1RA 1S5WA 3MCOA 4UTLA 1QUMA 3WJYA 5FF0A 3LPPA 4LRSA 2VC6A 3SY5A 2JIWA 1EH9A 2BTMA 3LMYA 4W93A 5T91A 4UR7A 2NUYA 1VFTA 1WDSA 2XGZA 4C90A 5EGRA 3BCFA 1TV3A 4O1BA 3VIPA 3IVTA 5BOFA 3WO8A 4WJEA 1XCXA 3SUTA 1LYXA 4P61A 4AD5A 4F0HA 4FZIA 5D38A 3S0CA 3HG2A 3VMNA 5ECUA 2Z25A 3VDAA 5E0FA 1D3GA 1R7AA 3ZQ9A 2OB3A 2Y61A 4WVXA 4KKXA 1JAKA 4L6HA 2WCGA 3STFA 3CASA 3RR1A 3WK0A 1G01A 3GFZA 2O9TA 4GVFA 4UTFA 1JZ8A 4BI7A 4D8LA 5D09A 3GW0A 2XH0A 1UR2A 5CC7A 3N29A 1ADDA 3DCPA 5J5RA 1JEZA 4GINA 4IG2B 2GGJA 1EYEA 3OIHA 1YIXA 4QLLA 4IIHA 4DJDC 1FWHC 4LS0A 4PGLA 1RP8A 3SSZA 3NSXA 4PODA 3SUWA 3D3AA 3C0LA 4GJIA 3BLFA 3MP4A 3KDOA 1P43A 1TTQA 1E3XA 2GDVA 3RGTA 2REQB 4HJFA 1FH7A 1OD0A 3CQ0A 4YVXA 4A3RA 3TC6A 4PMQA 3P61A 3MSRA 3BMWA 3L2LA 2CLPA 3GBEA 1XXXA 3OP2A 3ZR5A 4U4MA 5DO8A 4K38A 1I0DA 4DLFA 5A5WA 5FKYA 3ABXA 3G0SA 4Q7NA 2HVMA 4UQEA 4J2MA 5I03A 4L1GA 4J3SA 4US5A 5CPLA 3M1ZA 1GOKA 1TIMA 1V03A 2HK1A 3K13A 4WKFA 4H6QA 4Q4PA 3CHDA 4KPLA 3G0UA 4HMEA 2ZYFA 1HKWA 5AYXA 4D6DA 2E9BA 1G4TA 3QZEA 4PFMA 3CWNA 1XLKA 3W25A 1FVPA 5TNVA 3LOTA 3OHIA 3MA8A 3UR7A 1T5AA 1QOXA 4DYKA 4S3EA 1M01A 3MBFA 1JGMA 3UWVA 4LF2A 5JVLA 2QCEA 4B5NA 2QUVA 2YBVA 3K46A 2J7CA 3SDOA 3WSUA 2OR2A 3LHYA 3IRDA 3LUTA 2GJPA 3VIHA 4V27A 1EEXA 5BXSA 3HU7A 4H41A 4P8WA 2TRSA 1UCWA 4DNMA 2G3JA 1XRFA 3SN1A 1SFLA 4TO8A 4AEOA 4V28A 4JNMA 1BQGA 1UP2A 1C91A 2ZZ4A 1JUBA 1OZQA 1ZHAA 3CUXA 4QQ3A 5D2XA 2Q6ZA 4WOQA 2QCHA 2QPXA 1ZAJA 4XD6A 2WSQA 4AD3A 1HL9A 1W2PA 1J01A 1H7PA 4HPNA 4GO8A 5T8GA 4WDUA 4FNSA 4K36A 1CTNA 3BPWA 3G24A 4ZSUA 2KX9A 1BYCA 1KO0A 2VZTA 2ZUUA 3PM6A 5TIMA 1HL2A 4N9EA 4XO6A 1GG1A 5CC6A 4MKNA 4H8NA 3OVQA 3UG8A 3VD3A 3S5ZA 4DF2A 5TBOA 2ZADA 4DJFC 3MYOA 3U4FA 3UG5A 5LHEA 1HN1A 1QK2A 1VFSA 2XFFA 1RV8A 3STCA 4DAFA 3QSTA 2V2CA 3N3TA 3PJXA 4X61A 3JZUA 3VDCA 3H54A 4R33A 1R46A 2ZIDA 4BFAA 2VGIA 4XK2A 1ENUA 3CMGA 1ZRQA 5CBJA 4O17A 2X09A 2I17A 4IPPA 2QV5A 2DJLA 5D8WA 1OY0A 2QLYA 5H91A 3IVUA 4MNJA 1A5LC 5H8PA 1XINA 3TE9A 3W74A 3N25A 4NZJA 4JKLA 4BZYA 2O92A 4GUGA 4ATWA 5LA0A 3GXPA 1KCLA 2ICSA 1DVJA 3T2QA 4IIBA 1UH2A 2J47A 2PDFA 4Z08A 5FEXA 3F1QA 5FF4A 2GDQA 4ACZA 1LQAA 1BAGA 4MJMA 3ITGA 3L4XA 5IM51 1IIHA 4GY1A 2A7NA 4HTYA 4FXRA 3LS9A 3WELA 4WXYA 4QLJA 2AL1A 3I68A 3RXZA 1Z48A 1C93A 2JGYA 4BQ4A 3SRHA 2OCZA 1M53A 1Z42A 2DSKA 3CL6A 3QGKC 1GYLA 1BSIA 1QFEA 3BE7A 1DORA 1DJWA 5G5IA 1QBBA 3H4GA 2CHNA 1H4PA 1XD1A 3FJNA 3NR0A 4GABA 2NQLA 4Q8NA 3PNZA 2NW0A 3PZMA 5DT7A 4WJXA 4H9UA 1QCWA 1ECEA 4WKAA 3EWDA 4XISA 1M04A 3SQLA 1YLVA 1KM6A 3GUWA 3VIOA 1LLWA 4NZ5A 1OBAA 3W7PA 4D1IA 5BRPA 3PK7A 2O4MA 5J5DA 1XICA 3T2PA 1MEHA 3H7UA 3M16A 5H8UA 1IXNA 1CGTA 3C8FA 1R47A 1PDYA 1R2RA 4OHQA 3SCRA 2V6AA 1TTIA 4QG9A 3M64A 2PWVA 3HPZA 1S2VA 2ZTJA 3KM8A 1X39A 1MXGA 1FWAC 4Q4OA 2NX9A 3N1AA 2Z28A 4H7CA 1DL3A 3QGAC 2W79A 2W4XA 2ZVRA 3LTSA 3N18A 5D33A 5HAOA 2UV8G 4MWAA 4FLQA 5K4ZA 1F8MA 3WUFA 1NQ6A 5F2IA 3I6TA 3L4WA 3TYZA 3BW2A 4UCFA 3T0BA 4AWTA 1UB3A 3SY8A 5XIAA 3D6NA 1KGUA 1F76A 4UTKA 4AZIA 4NJJA 3EEGA 1REQA 1KBBA 2YW4A 2O9RA 1VCFA 4XQ6A 2WJDA 4I90A 2WM1A 4YHEA 4B3ZA 1PX3A 2ASHA 4XZ9A 1PX8A 3QQ1A 3QBUA 1UYQA 3W81A 5J04A 2W5FA 2BZNA 1J79A 5HOSA 1TJ2A 2YW3A 1LJYA 2E8ZA 3DC0A 5FA5A 5M5DA 4ZL1A 3G1FA 1IWAA 2HBVA 2VEPA 2VL4A 3FS2A 3FAXA 1KFLA 3GH5A 4GLEA 3VNIA 2VWTA 3W23A 5ABHA 4HHMA 1KRBC 5HINA 1K6AA 3TWAA 1TG7A 1KTCA 4Q22A 1JI1A 2Z0IA 2YIHA 5AYYA 2X8RA 1VR6A 1Z8AA 1MZRA 2G3FA 5AYIA 4BJHA 6ALDA 3MO4A 1V0MA 1E9YB 1ZP4A 3EOUA 4J27A 4OOUA 1QI0A 1ITUA 3W1XA 4GMEA 1DJHA 2XYLA 1WBJA 3H2EA 3VNKA 1UR9A 1E6QM 1MSSA 5CG7A 3EDFA 1Q4NX 3SM0A 1GNXA 3W83A 2WHMA 4BI6A 5FJOA 1KCZA 3TU9A 1D3CA 3RO6A 2CKRA 3IUHA 2WANA 1QI5A 1RXOB 1VYPX 3KRBA 2NT0A 2PP0A 4W8LA 2C1GA 1UZDA 4C6BA 1ISVA 2ZZ1A 4BWLA 1LWIA 4ROQA 3WY1A 3P84A 3E6EA 3CT2A 1VF8A 1EX5A 4J7RA 5BU6A 3MVIA 4N9BA 1XGEA 4GCAA 5DRCA 3ME3A 1FUYA 3KOWA 3TFXA 1OG0A 3CO4A 4LB4A 1P6WA 5AOUA 1EC7A 4YHGA 3HMJG 1PZ0A 4PCTA 3QLDA 3PZIA 2Y0FA 2X05A 4Z2LA 4ZFMA 1I2RA 2GUUA 3BAWA 1OEPA 3M07A 1P1MA 4AD2A 2QEZA 1V6UA 1HP5A 7ODCA 4MZYA 3LN3A 8TIMA 1UQZA 3PUEA 3ZJ7A 1BEUA 2RDUA 1NP2A 5DXXA 1DWHM 4QSFA 2VD9A 4OBRA 1F05A 3I7QA 2ZUSA 2XJ7A 1A5OC 1J6OA 2HZGA 3W24A 2VKZG 4NXSA 1E4IA 5A8GA 4G2DA 3LLFA 4F2UA 3NVTA 3AIUA 4IP5A 4KGLA 1GWJA 1ISXA 4HPJA 2G4FA 3WH6A 1YBQA 5L9FA 2DJXA 1GEQA 3HBLA 4BY3A 3I10A 4NZ3A 2QAFA 3EWXA 1L2QA 4N4PA 3WK3A 3O3RA 2F61A 1XPYA 4XAPA 4KFPA 3WQGA 3NZ1A 3RCYA 1CYGA 2GVLA 2OLSA 4O1FA 1K70A 2GSJA 2G8ZA 1UD5A 4IISA 5E09A 3CB3A 1GKQA 4LC8A 4ZMGA 5M03A 3ARZA 1M1BA 4W88A 3R89A 2V3EA 5EBUA 1WDQA 5BZAA 3DAQA 3MHUA 2VGGA 3FYOA 2Y7GA 4Z0JA 4M7TA 3AUOA 2YDQA 4DXXA 4JHZA 2ZKMX 2NXIA 4FF7A 1P7TB 1P6BA 4HGXA 3VNMA 2R82A 1EDGA 3B8DA 4D6HA 3OGRA 2CZVA 3A3XA 4IQJA 4LVBA 4Z0SA 1K6WA 3OHMB 1OFDA 2OWXA 3QM3A 1KRAC 2PEVA 5GJMA 7ENLA 1U83A 3I4EA 3TMLA 4S3FA 5BMWA 1MNZA 1ZAIA 1QO2A 3RK8A 4NZ4A 4XD5A 2GJRA 5I7GA 4GZEA 4J3VA 3WJSA 1A4LA 3EX6A 3R8GA 1NF7A 3VIIA 2FTWA 3DOPA 1TPB1 3TONA 4K7VA 4B3LA 4D6IA 5HJLA 3RCNA 2R1PA 4DBSA 3B0VC 2BGQA 6TAAA 2DQWA 1MFVA 1PB0A 1UC4A 1TPUA 5U7SA 3DXIA 3U7BA 1BWKA 3QSRA 4O11A 1S2WA 5DT5A 4PUNA 4DF0A 2INZA 2ZUTA 3L5LA 3O05A 1J0ZA 1WV2A 3NYZA 4KFOA 4LNYA 4D8ZA 2HE5A 5D9OA 3FA4A 3Q45A 3CAVA 3NZRA 4S23A 1R8LA 1UZ4A 3NSMA 1J93A 3E2SA 3S2MA 3VIMA 2WHJA 4C6FA 2AGTA 3A22A 3FGCA 2X40A 2YYTA 1EWDA 4ROPA 2UY3A 3IK4A 2PRLA 3W75A 4H04A 3E0IA 3KP1A 4CCDA 1FCUA 3THUA 1ZBVA 5AHIA 4JICA 3MYPA 2Z7KA 3NQCA 2PPGA 2WBKA 5HK4A 1TMQA 2D24A 1NP0A 2EXOA 1VQTA 1SZRA 4RUBA 3H21A 4FMVA 1EGZA 2DSUA 3VGGA 2BY3A 3L12A 1WKDA 4E4FA 4LQ1A 2R94A 2PDLA 1CB2A 3TV8A 5LA1A 4HSOA 3G1RA 1E6NA 1TMHA 3WJZA 2FPVA 2BVYA 2KAUC 2NXGA 4EXQA 2EJ1A 1Q63A 2PI6A 1X8FA 2R9RA 1CIUA 4UNLA 2JF6A 3E2RA 5IHRA 4DIAA 3BOXA 4S3DA 4B9ZA 3IJ6A 2AMGA 4YTSA 4RDWA 4M80A 1Q8AA 4MAZA 4OTKA 3RX4A 1PWMA 1MXDA 3SY1A 2XIJA 4ZO9A 1TPFA 4CNTA 1JXJA 6CGTA 4OU1A 1BRLA 3NQAA 3NVDA 2XVPA 3SI9A 5FF3A 5M17A 3BUVA 1EP2A 4QGCA 3M0KA 4IX2A 3VZZA 1POJA 5AZ1A 4IP7A 1JRBA 4LBUA 2FJKA 2G0WA 3VNJA 1TWDA 1PZ1A 1XKJA 3ITLA 1KD0A 1MEWA 3AYTA 4ML9A 8XIAA 1LWHA 1E5NA 1HNYA 2V38A 4L1WA 1UBSA 1JFHA 3TKFA 2OEMA 5K3VA 2C19A 3EA1A 3D3FA 1JDDA 4FOJA 4P8XA 5HNUA 2OG9A 1PKYA 4GQBA 1R30A 5GNYA 1DHKA 4N9CA 3UESA 3DYMA 1DP0A 4WSKA 4W7VA 5C8BB 1V51A 1IHIA 3VX1A 3CK5A 1YDNA 1O1HA 2OEJA 4A2RA 4HMCA 4PMXA 1OFAA 1A0EA 1JCLA 1EWEA 3R94A 3N34A 3WD4A 3TZFA 1A5UA 1AW5A 1PDZA 3SCWA 2WKJA 1PZ2A 2A7RA 4LS1A 3T0CA 5TQLA 3PZGA 3PAOA 4F0RA 2PLKA 4JIQA 3N6JA 3TN3A 1G1YA 3WH8A 4MMWA 4WKHA 2O56A 3BURA 3V5CA 1H09A 1V0LA 3KOFA 2RJGA 1J9YA 5CQ1A 5FIPA 4CNPA 3LTPA 5CJ5A 2IKJA 1UUOA 1OZMA 3UF9A 1TTJA 2RDXA 3WDQA 2PC8A 3MP3A 4X3ZA 3BGGA 3KX6A 2DW6A 5A6BA 1XM3A 1PIFA 3NPWA 3M0YA 3WCZA 3PWAA 1HQTA 2DH2A 3QF0A 3TW9A 1I60A 1U5JA 2WZMA 3VINA 2WNZA 3KLKA 3JRKA 3RM9A 3P0WA 3V0TA 3LMZA 4I9JA 3WD2A 2UY4A 4M6QA 3ABOA 1WNOA 1YNQA 1LBFA 3L2IA 1W9XA 3VKJA 4AF0B 1JCMP 4IXHA 3H2CA 3UT0A 5G4WA 4I5XA 1HG3A 3CV1A 1VCGA 1G5AA 1HJXA 4GVHA 3E1F1 1RY0A 3TC3A 4JIHA 1Q7QA 4L6DA 4WSJA 5G1MA 1JYNA 1US0A 2NQHA 1GTEA 1XYMA 5HQEA 1QHPA 3NQ7A 4E8DA 3SCNA 1EA9C 5CAHA 4QR6A 4R7JA 3V5FA 4M29A 1ALDA 3ELFA 3UR5A 1X1ZA 2Q8ZA 1X6LA 1HGYA 2OOFA 3KS5A 1AZ1A 4Y9PA 4WZHA 3U2ZA 2VI0A 4PMNA 1XIIA 4PYSA 9XIAA 3RG6A 4E2VA 3IJ8A 5KINA 1D2KA 2P50A 4LY8A 1W8SA 3R5EA 2WWCA 4PTNA 1NFGA 4XAYA 4DZHA 2QIIA 4O0ZA 4H6EA 3T4WA 4ZO6A 3LSBA 2WNWA 4HVXA 1XLDA 4GVIA 4E2OA 2YCJA 1DE6A 5ABFA 4NG3A 4JGDA 3PTDA 1U5HA 2BVTA 1RALA 1GJWA 1P0DA 3JW7A 1B57A 5F2GA 3E0VA 3RX3A 1C9DA 3W7DA 2FZBA 4H2CA 4P7RA 3NQGA 2J7BA 3CZEA 3GDMA 3CPGA 5CZJA 3REQB 4JFVA 2GOUA 4HNTA 4MWAB 2XSXA 2ZWZA 3OTRA 1BRLB 3OU8A 1ADSA 1H50A 3LERA 1KWKA 1C7TA 4IGNA 2PDMA 2VCBA 4N0RA 3KW3A 4ORMA 1JPKA 4KFNA 1PX4A 5M2FX 3S6DA 3KBMA 3W3OA 3H2AA 2W66A 1R6WA 3FJLA 2WVVB 5E9AA 2C71A 1LQ0A 1EGVA 2XIMA 4UMCA 4K6AA 4PTVA 2C14A 4ZOCA 4AMAA 3NFUA 1A5NC 4IJBA 3UVAA 4Z42C 1SW0A 1JDEA 4O54A 3GR7A 4J9JA 4AZHA 4RDYA 1VFFA 4Q6XA 3H70A 3GVRA 4DYEA 3WL0A 4IWWA 1W8GA 3ARWA 2CZDA 5DXYA 4XO7A 1QASA 3C2RA 3N2CA 4TQTA 3P8JA 2YZRA 3RJXA 2OSYA 2C16A 2IXUA 1TPEA 5I23A 3ZVHA 4FP1A 3O6CA 4UBPC 2ACQA 5LZLA 3MS8A 3OA3A 2EQDA 4TX8A 3LHTA 4DRSA 2G41A 3E9AA 1F6YA 3W01A 2ACUA 3O6AA 1H41A 1N2VA 1RCOB 2PDPA 2ISFA 3U5UA 3A47A 4GQRA 3AISA 4RE2A 3H7VA 1JZ5A 4E3TA 2QCGA 2VQTA 4NJHA 1TQXA 6ENLA 1DJZA 1VHCA 1DXEA 3UZYA 4QROA 2PS2A 2D0HA 4K8GA 1F3TA 1HVXA 1O68A 3UWQA 4K2SA 2J4GA 2XWDA 4O10A 4ILSA 1F74A 1V5XA 2QF7A 3TP4A 3W37A 3NTYA 2I57A 3Q67A 1VBRA 4DBWA 1EJUC 4L61A 1M5WA 3G8RA 1OCBA 2P53A 5DMLA 3SBFA 1BGGA 4DO4A 1K8ZA 3P2VA 1SJDA 3LHVA 1TZ7A 1U2YA 3WLOA 3TQKA 4GYJA 4WHBA 1HJSA 4BEQA 2WVTA 1OF8A 4D2JA 3CMFA 2E8YA 5DLCA 2H3DA 2E9MA 2C6QA 1AH0A 1K4GA 3CEPA 3HJEA 1P0BA 4ZGYA 1OC6A 3W28A 1QNRA 2XN2A 1BVNP 2CXGA 4PCFA 1F8IA 1YE6A 3MVTA 1AL7A 3DU0A 4HIBA 5AHEA 2V5KA 1R2TA 1CXKA 5JU6A 3W86A 1M9HA 2VDGA 2HQAA 1W3HA 2OEKA 4MUZA 1FP9A 1XRSA 4Z2IA 4POCA 4A8RA 1TV8A 3FVDA 4PBEA 3K8KA 2XU2A 3TTYA 1SR0A 3N17A 3FIGA 3TK7A 3M0XA 5I5RA 2P5NA 2VVSA 3TJLA 3VD9A 3N19B 4LS2A 3UPBA 4W7WA 2NV1A 4KQNA 1V3MA 3CH0A 4J3WA 2NUXA 4G7EB 1V0KA 2WMFA 3CZGA 2GOKA 4OJYA 2DQXA 3VI2A 3LV5A 1YTEA 1E43A 2XWEA 3NQ8A 3AMKA 3QXBA 4A3UA 2OWWA 3UETA 1XYFA 3TMQA 2D20A 1HFBA 2CETA 2OYLA 3MWCA 3K4DA 3W7EA 1K7XA 3QJAA 1B3YA 3R4IA 5AC4A 2GDUA 2Z1SA 2HWGA 3H2MA 2NLIA 1O60A 3FYPA 2GPTA 2PDNA 4RNHA 3POHA 4HQVA 4RNIA 3TYUA 3GU2A 3ZWTA 2CFFA 3HG5A 3WF4A 1ZSXA 3IIPA 4HMDA 2D0FA 3WNMA 1SO6A 3ATZA 4RLIA 2YL8A 1KXVA 1SO3A 4Q7IA 3HO8A 2CHRA 5CZKA 5I07A 4I5UA 5G1YA 2V2DA 3IRSA 1OC7A 2XIIA 4RZBA 3NQEA 1UZHA 2OGYA 3AIBA 3H4WA 3WKZA 2CBVA 1M65A 3WBYA 1W6TA 3MJMA 4JKMA 3A4WA 1Z41A 4CCEA 4UQ9A 1TZ9A 1VCVA 4ONVA 4YLWA 2VFGA 4AHPA 3APGA 2PDGA 4JTKA 3URAA 1UWAA 1YXYA 4UTHA 3RLHA 1EFZA 2JALA 1E71M 2PDHA 2JFEX 1UPPA 3EPMA 1LRQA 2B7QA 5CJNA 3OQ8A 1HJWA 3ARSA 1U1HA 4L4LA 4U2ZA 3RILA 2CLKA 1Q7ZA 5CC3A 2OZ3A 3ZWSA 2VZUA 2ZUVA 2DZXA 1QJWA 4EOUA 1E6ZA 1CZ1A 4IPJA 2O7SA 3SRFA 3IS4A 5K4XA 1TRIA 3LLXA 2GLKA 3E3HA 4H9MA 3ZM8A 4EWJA 5C7HA 5U4NA 1PAMA 1ONEA 4IIGA 5HWNA 4GOAA 3ECQA 1P0NA 2DZWA 2YCLB 3C4UA 2DZBA 2XN1A 3AYVA 3FDKA 3W84A 2PDYA 4Z1AA 5IOBA 4IT1A 3VKKA 4HCDA 2PWEA 4K37A 5HR7A 1Z9AA 1DWAM 3KE0A 3LENA 1KBJA 3KTSA 3H2NA 1UC5A 2ON3A 2POZA 1JPMA 4M5PA 3PC0A 3WUEA 1Y5VA 3CQIA 3CYJA 1N8WA 4LV4A 5LGZA 1JCYA 3L66A 3CZLA 1PIIA 4KIRA 3VPLA 1KTNA 3OZPA 1EA0A 1RHCA 2B81A 1RR2A 1KM1A 1E0VA 1E6RA 1AL8A 3H24A 1D9EA 1NTHA 4XTIA 3MSDA 1Q2SA 4B4HA 2OYMA 1EHNA 3WQFA 2CZEA 3T4CA 1PKMA 1MW0A 4PMDA 3N2OA 2PWGA 4JTQA 3AIEA 3GDTA 4JN6A 4N6FA 4AWSA 5LIWX 4FO4A 4LANA 3WEOA 4DVOA 3IIXA 3N04A 2GQAA 3SURA 1L0PA 1V7YA 4EACA 4FALA 3THQA 1UPMB 4LYQA 2OQYA 3LRLA 4HK5A 3MQTA 2E6DA 1C90A 5DRIA 3CLMA 1CX9A 3EKZA 2DIKA 3LEPA 3WENA 2DW7A 2WQPA 1CCWB 1O12A 2MNRA 1US2A 5FSDC 3SFKA 2OELA 5CLTA 2VFHA 1YX1A 2QMKA 2F2HA 3VNLA 4O4WA 2ZX5A 3BC9A 2WQDA 2BBFA 3V5OA 5EY5A 2QUNA 3ITOA 4O15A 2HMCA 1ISZA 2WMIB 2OTDA 3O8AA 4LVDA 4LOCA 5AC5A 1XV8A 3G0XA 4PUKA 1ITXA 4XKMA 3WLLA 4R5EA 2V67A 1IXPA 5CBBA 3CLWA 4LEQA 4F4RA 1XS2A 3QMSA 4JDBA 4JCLA 4JS3A 2EPLX 3PSVA 1WX0A 1ZCCA 1QPNA 3W1RA 1W3TA 4XZHA 1PV8A 2INFA 4TTGA 1W3IA 2FJUB 5G4EA 3M43A 1H61A 2MANA 5C5YA 5HATA 2QYGA 3VCNA 1JZ7A 3GIYA 4NXKA 2ZX9A 1Q66A 5IDIA 3R13A 3AOFA 1GT8A 2I5QA 3A6OA 4HYRA 4ZB0A 1GKRA 5A6LA 3UG3A 1H62A 2WLZA 1KB3A 3OGVA 3S47A 5CPMA 3UY7A 3IV8A 3MUAA 4QNEA 1RQBA 1UD8A 3QOMA 4XG1A 1F3EA 1VEPA 5CEWA 1J0KA 3S1GA 1I6NA 4WOZA 1S2TA 4DPQA 3KBVA 1SSDA 1RCXB 2EPOA 1JD7A 2NXHA 1F61A 2JK2A 5D4YA 3TN6A 1G4PA 4WDTA 3TWBA 3HM7A 3UA4A 4GUJA 3VM5A 2Z6IA 3A23A 5H1WA 3EMCA 4G5DA 1R3QA 3W7CA 1TVNA 2A2IA 3M7WA