1KQZA

Hevamine mutant d125a/e127a/y183f in complex with tetra-nag
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFAIAHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFFNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hevamine A
publication title Expression and Characterization of Active Site Mutants of Hevamine, a Chitinase from the Rubber Tree Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 98
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kqzA00
3KL5A 1JYNA 1B31A 1B1YA 1J0KA 2CESA 2ZUUA 1WP6A 4MTVA 1EGZA 4DM1A 3ARSA 5AYIA 2BHUA 2J7BA 3RJYA 5A2BA 2YA0A 1CENA 1QW9A 5BWFA 4JCLA 3ZT6A 3U5YA 1E6XM 2D22A 2W5FA 2TAAA 3POCA 3SCPA 2E9BA 1QHPA 2J25A 3AHXA 2Y5EA 3WMSA 3ZOAA 1KQZA 4ML4A 3HMCA 3VMPA 3WD3A 4X0NA 3BLPX 4HTYA 1RPKA 1G0CA 2J79A 2O9RA 3PTMA 4EE9A 2WMIB 2O9PA 5GNYA 3WEOA 1BGAA 2Y8VA 4MNKA 5I23A 2ZUWA 1C3FA 2XWDA 5A8MA 3AXXA 1UQZA 3WSUA 3BGAA 4B9ZA 3NDZA 2CHNA 6TAAA 2FH8A 4JHZA 2D3NA 1G5AA 4AEFA 5M3WA 3PZIA 2WVUA 1OD8A 1AVAA 1OT2A 2Y24A 2NSXA 4NRSA 4PTMA 2CPUA 5HDRA 3SEPA 2VURA 3UEQA 1VBRA 5A6BD 1GQKA 2XWEA 4QLKA 1VEMA 1JF6A 3NSNA 2J7FA 4M29A 4XZBA 2XVNA 3ARUA 2W91A 2J7EA 3AMDA 1L0PA 2G3IA 4OJYA 1M53A 3SUSA 3VMNA 4J3WA 4PMRA 2JF7A 1W2VA 1XRVA 2Z1SA 4J3VA 2CXGA 1ZU8A 1PX3A 1A47A 3TTSA 1JIBA 1J9YA 4NF7A 1JNEA 2WZHA 3ARQA 4D72A 4W93A 3A4AA 1B30A 2J78A 1WB0A 4M1RA 1DWHM 5FIPA 3ZSSA 4AWEA 5M5DA 1KWGA 3TONA 1IT0A 2A3HA 2CBUA 4TTGA 5CLTA 7CGTA 4CN4A 1CGYA 2GK1A 1SMAA 5IFTA 3MUZ1 2VX4A 1HX0A 3W4RA 3EMCA 1GUVA 5A8QA 5I77A 2HVMA 2VR4A 1HIZA 3WFZA 2J74A 4AEEA 1QHOA 4EANA 3CHCA 4AZBA 2YDSA 1XSKA 2XM1A 3B9AA 4W5ZA 4NSBA 2ZX5A 1MW0A 3WD4A 2PI6A 2GJXA 1TVNA 3T08A 4MNMA 3J7HA 3ZJ6A 3K8LA 3AI0A 1FOBA 1TA3B 1WE5A 1JYXA 1OB0A 2XG9A 5CSUA 4PMXA 1ISXA 3AJ7A 1PX4A 4AZGA 2A3CA 2CHOA 1CECA 2JEQA 1CLXA 2XTKA 3GYCA 2DIJA 3POHA 1JDDA 4D1JA 3AZRA 4AZHA 1E3ZA 4PN2A 3WN6A 1MFVA 4U2YA 4RE4A 4PMUA 4W8LA 2EQDA 4F9DA 2BVYA 1SYTA 1IV8A 1PEZA 4S3JA 1E6ZA 2CKSA 3RDKA 3PTQA 2GUYA 3A6OA 4D6CA 2XVLA 4Z2IA 3VMOA 2FH6A 4AMCA 1CXLA 3TA9A 1K9TA 4ATWA 1MVYA 5KEZA 2HISA 2XSAA 2WB5A 4ACZA 4HOZA 1HJSA 3AQUA 3K4AA 2QV4A 2WBKA 4B3LA 1PIFA 1V08A 1VENA 1ZL1A 4IPNB 5DO8A 3KEHA 1C7SA 1ODZA 1HT6A 3GXIA 2D23A 4WKAA 2CITA 4BQ4A 1VFMA 1UOKA 2VRKA 1J0JA 2GVYA 2WVVB 3EDFA 3WDRA 5I2UA 4GZIA 4IISA 2YIHA 1QOXA 4WKHA 4GI6A 3LPGA 1BAGA 4V2XA 4P8UA 3CHDA 1W9VA 2ZX7A 6CGTA 3WNKA 1JZ6A 5GNZA 4ZE5A 5BXRA 1JZ5A 3WUGA 1PAMA 1NOFA 2QF8A 1XH1A 2YDQA 1U30A 3CMJA 1V6YA 4YN5A 1Q4NX 2WHLA 3UG4A 1B9ZA 1CGUA 1B3XA 1R8LA 2DGAA 4PMDA 1KBKA 5I3DA 5LYRA 1BTCA 2VL4A 4CVWA 1HJWA 1WDSA 3T09A 1EIBA 4AZCA 1Q6CA 3CPUA 4ZEPA 1VJSA 1FA2A 5E0FA 1MQRA 1GHRA 1UR2A 2V3EA 4GXPA 2F2HA 1EA9C 1LG1A 2DSVA 1PPIA 3L2LA 3ALGA 3CLWA 2X2YA 3AMLA 3NIYA 3DYPA 2FHFA 1JF5A 3ZO9A 2WWDA 2CYGA 2J7GA 1KQYA 4CUCA 1BLIA 1DTUA 1HF6A 1UR9A 3AS3A 1M01A 2B31A 1ZJBA 3WF0A 4ATDA 1BG4A 3VOCA 1W1PA 1MXDA 1PIGA 2VX6A 3BH4A 4HA3A 2D20A 2Q8XA 5A8NA 2WMJA 5IFPA 2ZUTA 2AMGA 2G41A 3WEMA 1EDGA 1WPCA 2DQXA 2OYLA 3AXIA 3K1DA 4UQCA 3G6MA 2RGLA 1V6XA 3MUAA 1ZBWA 4MNLA 3ARZA 2VQTA 2CBJA 5EFDA 5D9PA 4J3XA 1LQ0A 1XH2A 3QOMA 2EBNA 3VM7A 5E70A 3VDCA 5A6BA 3NJ3A 4MAVA 3SCVA 1CXKA 4W7VA 2EJ1A 3VO0A 1HVQA 3BSHA 1NWTA 3NSMA 4UZUA 1LL7A 3WD2A 1RP9A 3VX1A 1J0IA 1FH8A 1W3HA 1FP9A 2BVTA 3D3AA 3VIJA 4PMZA 4HU0A 5M17A 3WL0A 2WSKA 1VFFA 2OWCA 3WDQA 2O92A 2C0HA 2V5CA 4CU8A 3EDJA 1GZJA 4DUXA 1E3XA 4L4PA 3OLDA 1LWJA 2WZIA 1V0MA 4LXFA 1W1TA 2D1ZA 3PHAA 3GXMA 4AZ6A 5ABFA 4AZ5A 4QCEA 1NOUA 4MAZA 2JIWA 1KR1A 4GQRA 1VIWA 2VZTA 3I3DA 2Y2WA 1ISVA 3B8SA 1UKTA 2WCGA 3ZJKA 5HNNA 3OGSA 3SUWA 3CUGA 5HXMA 2JIEA 4LX4A 3WIJA 2FGZA 2XVKA 1E5JA 2XSBA 1W3KA 4AD2A 2WC3A 1MW3A 3VDAA 4JHOA 1UA3A 3VDHA 3CHEA 1UD8A 4CCEA 1P6WA 4X9YA 1D3CA 3WMBA 1JNDA 3FAXA 3FW6A 2EPNA 3IJ9A 1J11A 4LPCA 2YKKA 1EHAA 4OKDA 3W28A 1NQ6A 4FMVA 1ISYA 1V3KA 4ZENA 4WJXA 5ABGA 3WENA 2ZWZA 3WF3A 4D1IA 1OIMA 4GIAA 3W53A 2ZIDA 1EXPA 5D8WA 2J7HA 1QI0A 2YDRA 4TOQA 5BCAA 3SCTA 2DIEA 1V3JA 1MWOA 5I24A 2GFTA 3T0DA 2XGIA 4OOZA 4CU7A 3B9DA 2VO5A 4PUEA 3ZM8A 4GI8A 4BZYA 5FCZA 4QCFA 2WNWA 4P8VA 3VIFA 1HKJA 3RM4A 5I0DA 1J10A 3PZQA 3LMYA 4F79A 3BAWA 1E72M 2WVSA 4J7RA 2G8ZA 3UETA 1KXTA 4JFWA 3ZIZA 4GZJA 2BHYA 5ABEA 1XGZA 3CO4A 2GK1B 2J8FA 3QOKA 4R5EA 3ARYA 3ECQA 1E4LA 3VD4A 4AIEA 2X0YA 4P8WA 4PMVA 1EQPA 4HPHA 2J62A 2DT2A 3UERA 5FOOA 2J47A 1UR1A 2XVGA 5BXTA 4AC1X 2ZICA 4UZSA 1BF2A 1AQHA 1CWYA 5CXPA 1XYZA 3QR3A 1K9EA 3ZR6A 2E9MA 4IM4A 3N17A 2YA1A 1FH9A 1TR1A 1V6VA 3ZJ8A 2UY5A 4GZEA 1EDTA 4A3HA 1CXIA 3AIRA 4QFUA 3OA5A 1ZS2A 3VD9A 3WQVA 2CBVA 5IHSA 3M7SA 5CSYA 4URIA 1AQMA 2FHCA 5BXPA 4UR9A 4DWSA 4QLJA 4W8AA 1RP8A 1GOOA 4AD4A 3AICA 4OUEA 1JZ8A 3WNLA 2W92A 2E0PA 1I1WA 4MJ4A 5E6YA 4B3KA 4H2CA 2XFYA 3M07A 3WBEA 5E0CA 3WH6A 1K6AA 1E71M 3WKZA 2VOTA 1V0NA 4D6DA 1JFXA 2PWGA 5FL1A 3WQ8A 1UWQA 2DEPA 3FXYA 3W26A 4ACZB 4KMQA 3OGVA 1HJVA 1C90A 1GOMA 4M56A 1W1VA 3BAJA 2EPLX 1M04A 1TVPA 3AMGA 2CERA 2CIPA 1TCMA 3WQWA 4FLSA 4W88A 1U33A 1VAHA 1GQIA 1JYVA 4PMYA 1LF1A 2YOCA 4EAMA 4XZWA 3GXFA 3N12A 4FLOA 4AIUA 3AZTA 5DEZA 3N13A 2DSWA 5D9NA 1HKMA 2VRQA 3CBWA 1MQPA 1XSIA 3IK2A 1TFVA 4JL2A 4UFIA 3GH5A 3HN3A 1LL4A 2J4GA 5A3HA 3GM8A 1EQCA 1GVYA 4M80A 4AZCB 5I6SA 3T0AA 1KGXA 3WELA 2ZOXA 5CG0A 5BRPA 3PZNA 3W6LA 2PWEA 3WDIA 5GNXA 3AZSA 3VGBA 1E56A 3WDJA 5E9AA 2YL8A 2WWCA 4CU6A 3RIKA 3ARVA 2V3FA 4BQ2A 4HA1A 4EKJA 4NI3A 3VGGA 2FDMA 3MMDA 3I3BA 4JKMA 2JF6A 1FHDA 3AHVA 1I75A 2QMJA 1UWTA 2JE8A 1HVXA 3CMGA 4JKKA 3A4XA 4PMQA 1B90A 2VUYA 2GSJA 4BQ3A 4D6EA 4XV0A 2VVSA 4HZ7A 2RGMA 2WMGA 4C7DA 3GTNA 5EBAA 2XYLA 1DWFM 1N82A 2ZXDA 3ZR5A 2V5DA 1H4PA 3VGFA 1XHGA 4K68A 3OLGA 4Y7EA 1KXQA 1BG9A 3WDHA 3RPMA 3QHNA 4AD0A 2G4FA 1KGUA 3U5UA 2PB1A 2WLZA 2F8QA 4BS0A 1WO2A 2BHZA 3EDEA 5A6JA 3CUFA 3GZAA 1QI2A 4OZOA 4J28A 4AD3A 2YLLA 4A4AA 5AC5A 3VGDA 1UD6A 1GVIA 1H41A 3OLIA 1KFWA 2V38A 3A47A 5C70A 1CXHA 1GJUA 5D9MA 3VTRA 1UZ1A 3AFBA 3VIIA 1TG7A 1E73M 2WKLA 3RILA 1FH7A 4V28A 2QMKA 1OM0A 4JCMA 3W24A 5M03A 1UH3A 7TAAA 1WDQA 3WF1A 5ABFB 3PZMA 3S6TA 4E4PA 2VX7A 1UH4A 5HPOA 1VBUA 5DT5A 4DWSC 3RM9A 2UWFA 3M46A 4P7RA 3VGHA 1E70M 1JXKA 2BY3A 2GDVA 1VEPA 2WHMA 4J27A 1MFUA 4U3CA 5BROA 4TVCA 1QI4A 3AHTA 3PZOA 1VFOA 3FY1A 2OYKA 3GH4A 1JZ3A 3AS2A 3ZQ9A 2VRJA 5FL0A 3VPLA 1EO5A 5TD4A 1H3GA 3WL1A 4GQQA 4KRTA 2X05A 4AY1A 1VFUA 2O9OA 1VEOA 1E0VA 2OSXA 4UFMA 4H41A 2CCRA 2DSKA 2C8NA 3ARXA 2OWWA 2WLYA 3PZVA 4UCFA 1H11A 1BYDA 1TMQA 1X6LA 1BVZA 2BY0A 2YBUA 4Z2HA 3F5KA 1JG9A 3IANA 3MV11 1UUQA 5I79A 3II1A 2X1IA 1QNSA 2VJXA 2ZX6A 2W67A 1YQ2A 3SUTA 1UWSA 5A8OA 4MB1A 1E4MM 1R7OA 3MSGA 1AMYA 4WIWA 4HA4A 1QHZA 1NM9A 4H04A 2DT1A 1OWQA 4IUGA 3EBVA 1BYBA 1WZLA 1GNXA 2EPOA 5E09A 3CGTA 1E55A 2E3ZA 1BVNP 1MW1A 3THDA 4JFSA 2MANA 1E6PA 2QPUA 1OGGA 2ZWYA 4AISA 1UWUA 1QNPA 4DWSD 1C92A 1EOMA 4B9YA 5CQ1A 1UD4A 2Z1KA 2VTFA 3HU7A 4UOJA 5CPTA 4E8DA 3NCOA 4D6HA 4YHEA 1HL9A 1KXHA 2VCBA 1UZ4A 1S46A 1OSEA 1FP8A 1WZAA 1JI1A 4KGLA 3F4VA 1D2KA 3AMCA 3G6LA 1OCQA 3W27A 1GORA 2WVTA 5C71A 4CD7A 1NARA 2YL6A 1LL6A 3N9KA 4HZ8A 2WMFA 4PCSA 4W86A 3NUKA 5EMYA 4UFLA 2WYSA 1AQ0A 1HXJA 3ZSTA 1Q6FA 4QAWA 1H49A 2EXOA 2OSYA 2WSPA 1C93A 1GCYA 2OLHA 1DHKA 3VM5A 4TVUA 4J3SA 1WDPA 2YBTA 3RM8A 2O9TA 2QPSA 3DHPA 1ISZA 2EO7A 1SMDA 2PBGA 4UQEA 1K9DA 1ITXA 2UY3A 1H2JA 3ZMRA 5CPQA 2G3MA 5A6MA 5A95A 5HPCA 2OWXA 2IXUA 4DWSB 2E8YA 1LJYA 3ARTA 4AZIA 3GBDA 3UR7A 5JUVA 4PUDA 1JD9A 4TX8A 4Z2JA 1H0IA 2XJ7A 2NT1A 3SCSA 4P8XA 4W84A 1V3LA 4H8HA 4MPKA 5HOSA 3T2PA 3AIQA 3GH7A 3SUVA 4CVUA 3FHQA 4GI9A 3UG5A 1E0XA 1TA3A 5FKYA 5DT7A 1EHNA 1ZBCA 5IHRA 4P7OA 1CGXA 3N18A 3BAKA 4EK7A 3AYSA 3WNMA 3ARWA 3L2MA 1B2YA 5BRQA 4D6FA 3WNPA 3F5LA 1R86A 2ZUNA 1KBBA 5EB8A 3OB8A 1D7FA 1HJXA 1W2PA 3GNPA 1JZ7A 3RO8A 1BGGA 5IXEA 5CZKA 2CETA 4PMOA 5LA2A 1NWUA 5AY7A 4W7WA 3K4DA 1J0ZA 2ZE0A 1C8XA 2D0HA 2Y4SA 3WQ5A 4AXNA 1XCXA 1GOIA 5D9OA 2ZUMA 1BYAA 4P7QA 4TX6A 4HOXA 5JIPA 1R87A 1SR0A 2YA2A 1C8YA 3FNDA 4M82A 2WVVA 4KWUA 3CZEA 1VRXA 1W1YA 4U5IA 1ECEA 5A2AA 1LWHA 2BV9A 2EPKX 3EMZA 1CNVA 3AOFA 3BAYA 3MO4A 4MNJA 1QBBA 1QI3A 1O6IA 3T0BA 3TTQA 3WBAA 3N04A 3OG2A 2E9LA 4MDOA 1WCGA 4AD1A 4GO9A 4U31A 2VCCA 5I78A 1OINA 5A69A 2YL9A 2J7DA 3BXWA 1ISWA 1HL8A 3UESA 5KZ6A 1A3HA 1E9LA 4F8XA 4N0RA 3WF2A 1BYCA 1CXFA 3VGEA 3W82A 1WAWA 2VZVA 3MV01 4HP5A 1W9UA 4WLCA 2DT0A 4HOWA 2VMFA 3W25A 4U3AA 1HJUA 3BC9A 3AIUA 3L4YA 1L8NA 1SFSA 1VJZA 4OIFA 3CHFA 1QNRA 3MMWA 1GPFA 1UR0A 3MS8A 3BCDA 4PBGA 3GDBA 1HKIA 3SCOA 1QBAA 2GJXB 1BQCA 1B3ZA 8A3HA 2WAGA 1DWGM 5I5RA 5CGMA 1LG2A 2YL5A 1G9HA 1OGBA 5JBFA 2ZXAA 4WF7A 1UG6A 2XM2A 4PTWA 4ACYA 1E5NA 3SCQA 4HMEA 1ZBVA 1E43A 1V0LA 9CGTA 2G3NA 3DECA 1W9XA 3CZGA 3WUBA 3K8MA 1BFNA 3CTTA 4PEEA 3KWXA 4LYRA 1BHGA 1E15A 2J75A 2QLYA 1UA7A 2GJPA 1J0YA 1O7AA 1ODUA 1X1NA 4H7VA 1PZ2A 2VR5A 2WCAA 1NWSA 3O2LA 4Z2LA 1ESWA 7A3HA 3CZLA 1V3IA 4FK9A 1G1YA 1U2YA 3ALFA 5DF0A 2WXDM 5D8ZA 1NOWA 4F9JA 1EDQA 3VINA 3O9NA 4WSKA 1CGTA 4DUWA 2WHJA 1DWJM 2CEQA 3DHUA 2BNJA 2XUCA 3MANA 1UD5A 4H8VA 3E1F1 1V0KA 3VIGA 2C7FA 3MMUA 4UFHA 5A94A 1XV8A 1DWAM 3KL3A 2D0GA 4F66A 1GJWA 3T2QA 2JEPA 1OIFA 2DSUA 5JBDA 2WMHA 3WD0A 1KCKA 3WFLA 3MUIA 1UD3A 3I3EA 1JZ2A 1EOKA 3L4UA 4AYSA 3TOPA 4D6GA 4PTVA 5D4YA 2DPEA 4MDPA 3GBEA 4CN6A 2ZUSA 4U5KA 4PYSA 2DH2A 4PRWA 4UFKA 3NYDA 2GJRA 4FLRA 1C8QA 3F5JA 2PWDA 1H09A 3VU2A 1UKOA 5ABHA 5EFFA 5A6LA 3WY1A 1HNYA 1J01A 1WKYA 2JALA 2DH3A 1B3YA 4AIOA 2XIBA 5A1AA 3QHMA 1V6WA 3VIKA 2DDXA 5DMYA 4Z2GA 2CKRA 1UWIA 4V27A 1HJQA 2BVDA 2XIIA 1K9FA 4NZCA 3IJ8A 3MSDA 3KE0A 3BAIA 4QDMA 1M7XA 3N15A 3AIBA 1CGVA 1NH6A 3MUY1 5CPSA 1GONA 1KR0A 5CJ5A 4H8UA 1UKSA 2E4TA 1F4AA 4FF5A 3L4XA 4UTFA 3AHYA 1IZKA 2EEXA 4KGJA 3U7VA 3WNNA 1MYRA 1FFQA 1OBAA 1NP0A 5A6SA 4LGXA 3N11A 1NWRA 2PC8A 3OGRA 3WMCA 4A3YA 4JZ5A 5C8BB 5HBFA 1H1NA 1KCLA 3AS1A 1CTNA 4N42A 3CZ8A 1OGSA 2QHAA 3L4ZA 4CD4A 1W9BM 5BXSA 3W38A 1E0WA 3OIHA 3EDKA 1CZ1A 4CD5A 4JFUA 3WUEA 4JFVA 2WK2A 3AHZA 1I1XA 3WQ6A 4QP0A 3PBGA 4Q7NA 1EH9A 3QHOA 2ZXQA 4W89A 4RE2A 1QVBA 1ITCA 3CZJA 2BXYA 4UFJA 4UQBA 4S3KA 3DYMA 4C7FA 3VIHA 4PMNA 4E2OA 3W29A 1ZB5A 4HU8A 1B0IA 4E8CA 3PN8A 2IXVA 3VKKA 1CPUA 1MXGA 3UCQA 4B16A 2GDUA 3W0KA 1E1FA 2J8GA 2V3DA 1UQYA 4L4OA 4RL3A 3EYPA 1PBGA 4ZXOA 3KZSA 1F4HA 3FAWA 2UY2A 3OZPA 4MB5A 4FLQA 1X6NA 1KB3A 1CDGA 2A3AA 3VUPA 1E6RA 4UQ9A 3S2CA 2ZX9A 2PWFA 3WQ4A 4AW7A 3MKKA 2XGBA 3OBAA 3VD3A 2BXZA 5CLWA 3EDDA 4JFTA 3RMEA 2F61A 4JIEA 6A3HA 4XB3A 4HMCA 3RCNA 4OBRA 3CZKA 3PZGA 2YLAA 2IUZA 1Q6GA 1JYWA 3DC0A 4Z2KA 1E4NA 2G3JA 4RE3A 3BLKA 3JUGA 3GNOA 1PX8A 1PJ9A 4AD5A 2WBGA 3WH7A 4MB4A 2WKGA 5GQBA 1ZBKA 1V3MA 1JXJA 3BSGA 3W37A 1US2A 3DYOA 3PZ9A 2VCAA 2VI0A 1JFHA 2YJQA 1E6NA 3VNZA 2PWHA 4WK9A 2CNCA 1FFRA 3VIMA 1BSIA 2FHBA 4OOUA 5A8PA 2WMIA 3BCFA 3VNYA 1UKPA 3WNOA 1XC6A 3B9EA 1XYFA 4TUFA 4M24A 4CD8A 3CUHA 4BCEA 2D2OA 3U57A 2D3LA 3UR8A 4XUYA 2EPMX 4GPNA 4TTUA 2XHYA 3GNRA 3SURA 4PCTA 3SUUA 1GHSA 1HP4A 3PTKA 5GPRA 1CEOA 3MU7A 4KRUA 3LPPA 4YHGA 4MB3A 1NP2A 3SIMA 3K8KA 1RD6A 5JIWA 3CUIA 2DT3A 4TVDA 4Q22A 4CKQA 1CYGA 3BMWA 3SCRA 3THCA 2WCSA 3RJXA 4QLLA 1KGWA 4W8BA 3OLEA 3BAXA 5LA0A 3PZTA 2BY2A 1HN1A 4M8UA 3VD5A 3WH5A 2VC9A 1J12A 1JDAA 1WDRA 2PF0A 3A3HA 4DUVA 2WPGA 3AYRA 2W66A 1H5VA 4J3UA 1EO7A 4MADA 1JAKA 2D24A 3TP4A 1OD0A 3WH8A 4BA0A 2WW5A 2A3EA 1GQJA 1G01A 4D6IA 4J3TA 3NDYA 1JD7A 4YPJA 2W61A 4WKFA 3WEZA 4PTXA 2XVPA 1HP5A 1MQQA 2ZUVA 3WF4A 2UY4A 1TUXA 4UNIA 3T2OA 4B15A 4ATLA 1C7TA 2NT0A 2WZEA 3AXHA 4D6JA 3AROA 1V3HA 1UR8A 2ZXBA 2WM0A 4P7NA 4LYPA 1YHTA 1MW2A 8CGTA 4U2ZA 1GOQA 4NRRA 3AIWA 1QW8A 4U33A 3U7BA 3WUFA 1R85A 2WMKA 3OZOA 5BYWA 3VIPA 1QNOA 5F7UA 1UD2A 1JI2A 2W62A 5ECUA 1E40A 2JFEX 4C7GA 5FD0A 1IZJA 1LLOA 5CGTA 1DEDA 1HKKA 2BY1A 4JAWA 4BF7A 1UH2A 4HZ6A 3UG3A 1XH0A 4JKLA 3SCNA 4UQDA 2NW0A 4W7UA 2ZX8A 1XD1A 3L4WA 1W32A 1UYQA 1R7AA 5LA1A 1TZ7A 1CXEA 3WD1A 1Q6EA 3HJEA 1UHVA 3QGVA 4HPGA 3M6DA 2AOSA 1CBGA 2J7CA 3VD7A 1UKQA 5AYBA 1H0GA 4OBSA 2XFRA 3O6AA 3AIEA 3AS0A 2DSZA 1W3LA 1E1EA 3APGA 2CBIA 1XCWA 3CUJA 1KXVA 4TXEA 1WZKA 1CIUA 1C91A 4D71A 3CIVA 3ZJ7A 5A6KA 3VVGA 5IDIA 2D0FA 4BQ5A 4GO8A 1J0HA 2VX5A 2X09A 4LQ1A 2V3GA 1QI5A 4JL1A 2W4XA 3AISA 4CCCA 4GKLA 2WC7A 3CH9A 2A3BA 1W9DM 4R27A 5JBEA 5A2CA 2W63A 2VZOA 3ARRA 1E6QM 2OYMA 1Z32X 3KL0A 4PSPA 5E6ZA 3FN9A 1B3WA 1M03A 2XPKA 2BFGA 1V6UA 4CCDA 3AMKA 2VT0A 4PSRA 1VF8A 3D5HA 3K46A 2FGLA 1W91A 5DFAA 1V02E 4WSJA 2OSWA 1DWIM 4KH2A 2X0HA 1FHLA 4CD6A 3WDPP 3IAQA 4HMDA 3LPOA 2VNCA 4W87A 5A6AA 4W5UA 3SCWA 2PBOA 3ZT7A 1JDCA 2E8ZA 3SCUA 1CGWA 3N1AA 4ZFMA 2E40A 1XD0A 1V03A 1GOKA 3FHAA 1JL8A 1V02A 2X8RA 1Q6DA 3VDBA 4W85A 1GW1A 3NSXA 4ZXLA 1JGIA 2VZSA 4M81A 3AIVA 1CLVA 1WNOA 1PZ3A 1B3VA 2J77A 4IPLA 4MJ2A 1UR4A 1W9PA 2ESCA 2VVNA 4XX6A 1TE1A 3IAPA 2WANA 1J18A 2VQUA 4CN1A 1JZ4A 4UOZA 1GQLA 1E4IA 3TTYA 3ZT5A 4CGTA 2XFFA 4DM2A 2AAAA 3L4VA 3EMQA 4AZ7A 1Y7VA 3LPFA 3IJ7A 2VZUA 1XSJA 2WHKA 3BMVA 1JAEA 2WC4A 5AC4A 4GINA 1W3JA 1UWRA 3VX0A 3L4TA 1RH9A 3VILA 3ARPA 1ZJAA 1QNQA 1WZMA 1KWKA 3W6MA 4LYQA 1OT1A 3TTOA 3W81A 3VIOA 2BS9A 1GOWA 3PZUA 4UQAA 1E6SM 1G94A 1BPLB 1US3A 3A4WA 4P7LA 3GXDA 4UOQA 1DP0A 4X0VA 1QPKA 4ZE4A 3WH9A 2Y8KA 1VB9A
chains in the Genus database with same CATH superfamily
4FX6M 4NY2A 4EPBC 1H5YA 1B1YA 2X1TA 5EMLA 3W7NA 2PDBA 3UJSA 1R5YA 1AL7A 4DM1A 5CBBA 3W00A 2PLJA 4S1FA 2ZA3A 4JN7A 2BHUA 4HIBA 1XLEA 2NUXA 4FSAA 4DBWA 1UZHA 4QS5A 4Q4SA 4L64A 5FJOA 2EKGA 1BTMA 4Z1AA 2D22A 2W5FA 3POCA 1XKJA 4RK8A 3SCPA 3HZ3A 2J25A 4XQ6A 1Q2RA 4X0NA 3QM3A 4TR9A 1RPKA 3ZVHB 1CT5A 2WMIB 1L6WA 4C6EA 4LBSA 3AXXA 3BGAA 4B9ZA 1EGMA 3RR1A 2FH8A 3SY8A 4LH8A 3PZIA 3LXCA 2WVUA 1AVAA 1OT2A 2Y24A 5AHIA 2NSXA 3U8GA 2PLCA 2A6NA 2CPUA 5HDRA 1DJNA 3UEQA 1UASA 2VGIA 3MHFA 1GQKA 4Y8FA 5LIWX 3NSNA 4M29A 4WGHA 2XVNA 3CAKA 4S2BA 3AMDA 2G3IA 3EA3A 1M53A 4PRTA 4IZGA 1XIIA 5F2IA 2J27A 4RLIA 4J3VA 3E0LA 1PX3A 1S2AA 1XLMA 4O0QA 1J9YA 3UZXA 4MY9A 3EOLA 4CNTA 2FFIA 3ARQA 2HMCA 4D72A 1SFLA 4MUZA 4KESA 3OHMB 3TH6A 3BLFA 5BMWA 4M1RA 1DWHM 5FIPA 3L12A 5M5DA 1XXXA 4PUMA 5HJLA 1TIMA 2CLHA 5REQB 5LHEA 4ZO7A 2Y7DA 1E9ZB 2RFGA 1P0KA 1JDEA 1ZAJA 1M6JA 2ON3A 1OFEA 4MY8A 1EJUC 3E6EA 1SMAA 3NZQA 3MUZ1 4H3DA 3TW9A 1EX1A 3KRSA 3EMCA 5A8QA 4UBPC 1I0DA 1TMLA 3TC7A 1KV8A 3S47A 3SRHA 2J74A 2ZQ0A 4AEEA 2PDYA 1RQBA 3CHCA 2EG6A 1AH0A 3LSCA 2XM1A 4W5ZA 1U5JA 5G2IA 2PI6A 2NVDA 4DIAA 1OG6A 2GJXA 3V0TA 3NM3A 5LXEA 5D33A 4MNMA 1TA3B 5I3GA 2XDFA 1WE5A 1FTXA 1OB0A 2XG9A 4RE0A 4TMCA 3AJ7A 3T6CA 2QIWA 2A3CA 1I2RA 2XTKA 3GYCA 5HMFA 2PDHA 1OZMA 4D1JA 1NQKA 4AU0A 4AZHA 2CLPA 4U2YA 4RE4A 4L1XA 2EQDA 4F9DA 4S3JA 3DI1A 2V5LA 2GUYA 3PC0A 3W86A 2XVLA 2OVLA 1B3OA 4Z2IA 2FH6A 1K9TA 3A5VA 4MF4A 4DBDA 5HJYA 3AUOA 3FDKA 4HK7A 4YTRA 1E1CB 4HU3A 2YCLA 4AMAA 2PP1A 4F4RA 5HR6A 1V08A 2EG8A 3KEHA 1C7SA 5G4HC 1XUZA 1RJRA 1VFMA 1A5BA 3MI2A 1UOKA 5I2UA 1OABA 4GI6A 2HVNA 4V2XA 4P8UA 3BLOA 4R53A 4ZE5A 2QCNA 1F3EA 2YDQA 3A12A 1JPMA 1SSDA 1V6YA 2WHLA 3HPZA 5L6UA 3KVKA 1R8LA 1H7RA 3NPVA 5I3DA 4C6LA 1BTCA 2VL4A 1WDSA 5C2GA 2FPYA 4HN4A 1QXLA 1EP3A 4ZEPA 1TREA 2V3EA 4XTDA 3VZYA 2XFWA 1DJWA 4EF8A 2X16A 2WNNA 3L2LA 1K8XA 1EF2A 3ALGA 3NIYA 3U6WA 2FHFA 4X2RA 1JF5A 3ZO9A 3U4AA 3GTIA 2J7GA 4TO8A 4CUCA 2DW7A 1DTUA 1HF6A 4IQJA 2ZZ1A 1ZJBA 1BG4A 3QV6A 1Z42A 3HV8A 3T44A 1NFGA 3UGRA 4DJEC 1K7XA 1QFEA 3DN5A 4E38A 1LWIA 4YTSA 2P10A 1P7TA 1MUCA 1M9HA 1DQWA 2W6RA 1GGOA 3W1AA 3QJAA 3COTA 1TJRA 3M64A 4IL0A 5BNKA 3ZS4A 4IIBA 1QU4A 1ZBWA 3BURA 3URBA 3K30A 4R85A 5T26A 1LQ0A 1XLCA 2EBNA 3VM7A 5DRCA 1H1ZA 4L80A 1RQEA 3E38A 3MKVA 3KHDA 9XIMA 4KF1A 3I7QA 1LL7A 1RP9A 1W5PA 1W3HA 1P48A 2C0AA 4GUHA 3EB4A 3H7RA 2QUNA 4LUIA 1A0EA 5M17A 4DF2A 4B4HA 1VFFA 3R0KA 3IIPA 2O92A 3EDJA 1GZJA 2VEKA 1QPOA 4EPKA 3CPRA 2WZIA 1V51A 2QF7A 3PHAA 1TB3A 3OTRA 1Z69A 4G7FA 4FF7A 1YMYA 1HO1A 4C6PA 3G1SA 4GQRA 5HMDA 1JDFA 1VIWA 2VZTA 2Y2WA 1ISVA 4BEUA 5E9XA 3ZJKA 3QMRA 1I0BA 3W70A 3WLSA 1MXSA 1E5JA 4AD2A 3VNLA 4YTQA 4JHOA 2E5BA 4CCEA 3PBYA 1N2VA 3MCOA 3NQFA 5SWUA 1P6WA 1SO4A 3NZPA 3QN3A 2YFNA 5BMXA 3RO6A 1O5QA 3U4FA 3REQA 1EHAA 4MSSA 4JHMA 2GGIA 4GY7A 4FMVA 5K9XA 4WQ6A 1T40A 4GCXA 2PTYA 2BG5A 3WF3A 4D1IA 4H9VA 3CUZA 3STGA 2QV5A 3W53A 3SGGA 1TIWA 4XIAA 2YDRA 4TOQA 2UZ9A 1R6WA 4YWIA 5BCAA 4KW2A 3I65A 2XINA 3NQ6A 4NXSA 4LUTA 5I24A 2GFTA 5C9UA 1NFPA 4LUJA 4OOZA 1KKOA 4TX9A 5T91A 4YVXA 4PCPA 2KAUC 3KW3A 3SECA 2P3EA 2WNWA 2PDPA 1J10A 3PZQA 3LCFA 3CQKA 1TVLA 1E72M 3CTLA 5G2WA 2G8ZA 3EZ4A 1UZDA 4DNHA 4JFWA 3W1UA 2PMQA 5ABEA 3KOYA 1RBOB 3IVUA 2GK1B 2FZ9A 2RDXA 4R5EA 4WUIA 5AVNA 3N2MA 1E4LA 1GOXA 3VD4A 4IG2B 4DQWA 4ZO6A 4Q4QA 4PMVA 4NAFB 3BL3A 3FX4A 4AVOA 1UR1A 5BXTA 4AC1X 2ZICA 3SSJA 1GPWA 4KCUA 4FPSA 5CXPA 1OJXA 3QR3A 2OKTA 1BWKA 3ZR6A 1R3SA 2E9MA 4UMBA 3DKLA 3CO8A 3LTPA 2Z24A 5FSDC 2HEJA 3V36A 1X7IA 9XIAA 3TJLA 4QR6A 2E6YA 3VD9A 1JQVA 3DHDA 5LZLA 1N55A 4IOTA 5CSYA 1YBQA 3U3HA 1B54A 2QDEA 4URIA 1BKHA 1AQMA 5BXPA 4C1KA 1XLFA 4ZTXA 4DWSA 1XIDA 2XSXA 4W8AA 1BWVA 2W0UA 2PDJA 4JDYA 3RF9A 2I9UA 3P61A 1I1WA 1K4HA 3MVTA 1KRCC 4KWOA 5E0CA 4O14A 3WKZA 1I45A 4GLEA 1FDYA 3UWEA 5LIKX 4BKNA 1V0NA 1JFXA 1JCMP 2DEPA 3P62A 1XLJA 3OZMA 2PWVA 1WV2A 1EFZA 2YGYA 2PGFA 7ENLA 4M56A 2EPLX 1HG3A 1XDMA 1P6CA 3NPXA 4PFHA 5AFDA 3VABA 4EXBA 4W88A 1ICSA 3VUSA 1XBZA 2DFAA 4YXGA 3OZYA 4I3GA 4PMYA 4EAMA 5LNWA 3SN1A 1VCFA 5I07A 1OCJA 4AIUA 3BZGA 3UCDA 2DSWA 1F74A 1BRLA 5BOOA 1HKMA 1O5RA 1XSIA 2RUSA 4WY0A 4UFIA 3GH5A 3HN3A 4A8LA 1GK8A 3TE9A 4DO5A 3LGDA 1ZP3A 2R1LA 4IPJA 1TPUA 4MKSA 3WELA 4JTTA 2VGGA 2DUAA 2ZOXA 5CG0A 4IXXA 3CC1A 2WPBA 4CNOA 3WDIA 4IMFA 4JX4A 2WWCA 3LCIA 3IGSA 4CU6A 1BD0A 2V3FA 2YX0A 1SJAA 4DJFA 3B0VC 4QE5A 3MMDA 3WFAA 3BOFA 4JKMA 5RUBA 2QMJA 1EJSC 1HVXA 3CMGA 3GAYA 3A4XA 2VUYA 2GSJA 3TW6A 1AJ0A 4XV0A 3TLLA 1O1HA 4HZ7A 4MWAE 2RGMA 4OFCA 2WMGA 4C7DA 2F84A 3VAVA 1DWFM 3THUA 4EXAA 4LY4A 2RDTA 4Q6JA 4K68A 3VC6A 4QJ4B 1TWWA 1KXQA 5BRBA 1SU5A 3WDHA 3QHNA 3LHZA 3A5FA 3CPGA 1Z6KA 3IJ6A 1GVFA 2QVNA 2WLZA 4BS0A 2WM1A 3EDEA 5A6JA 4EACA 5DCDA 4QJ5B 3E5PA 5FJUA 1TPH1 2YLLA 4M7TA 3VCCA 1TKKA 5AC5A 5J5DA 2WZMA 1H41A 3OLIA 1KKRA 5CPLA 4DZ5A 1AQFA 3S6DA 3VTRA 2Y61A 5F4XA 1EGVA 1VZWA 2QJMA 4GD0A 2WKLA 4V28A 1W0MA 5HATA 5DRIA 2R1KA 3NQGA 3W1MA 4O8RA 1QTWA 2J9ZA 4JCMA 3WF1A 2QJNA 3S6TA 2VX7A 4PE8A 3TSMA 1VBUA 2DZUA 4DWSC 1S3TC 4P7RA 3UBPC 2BY3A 2GDVA 4ZA0A 4GX9A 4GUJA 1EC7A 3JU2A 5D38A 1ML1A 1QI4A 3FY1A 2OYKA 1D3GA 1JZ3A 3UY7A 3DFPA 3T0TA 5TD4A 4F0RA 4AY1A 1E0VA 2QGHA 1R38A 1Q4WA 1R3YA 2AL2B 1UP0A 1AK5A 1TMQA 2C6QA 8RUCA 2OLSA 1EB3A 1JG9A 3II1A 2H9AB 2ZX6A 1EL3A 4L6DA 5A8OA 4MG4A 3S4TA 1QR7A 3QMSA 1DXIA 4L9XA 1E9YB 1QHZA 2DT1A 1P0BA 1BYBA 5E09A 1QK2A 2VWTA 3CGTA 4J2PA 1E55A 3MB9A 2E3ZA 3HURA 2YPIA 4YWSA 1BVNP 4NX0A 1TX2A 1FWAC 2ZWYA 2P1FA 1C92A 4B9YA 4B91A 1KM5A 2Q02A 1V6TA 2Z1KA 4UR8A 2VTFA 5F2LA 2J9XA 3MKCA 1KM4A 4UOJA 5CPTA 1VKFA 4MY1A 2XH2A 3B0PA 5F2MA 1UZ4A 1R2RA 3O06A 4KEVA 1O5KA 1S46A 1OSEA 3T8LA 4DJFC 3N2BA 3KS5A 1GORA 2WVTA 4WEVX 4CD7A 4ENLA 3L7RA 2GLKA 1NARA 5HQLA 4F2BA 4GNKB 4W86A 3TOYA 1IGSA 1M7JA 2PDNA 2QUUA 3TJ4A 1HXJA 1H49A 2WSPA 2QJIA 1S5WA 1TRDA 4KEUA 2KZHA 5REQA 4DN1A 4EXQA 2EO7A 3GIQA 3DFOA 5CSSA 3UJ2A 4XO7A 3WLQA 5CPQA 2BX7A 4AC7C 2G3MA 5A6MA 4JOMA 3H2FA 5EMKA 5GVJA 1JVNA 4E3TA 1LJYA 3BVJA 3GBDA 3TWBA 3UR7A 5JUVA 8TIMA 2X42A 4PUDA 1W3IA 1VFLA 4J4KA 3P3BA 1MUWA 1H0IA 4LRTA 3GG1A 2XJ7A 2NT1A 1V3LA 4KEMA 4UMAA 4MPKA 3ITGA 3CWNA 2ZDRA 2REQB 5J8LA 1BWLA 3RXZA 1F6PA 3AIQA 3GH7A 3DEQA 3W22A 3RHGA 1SVDA 1GKRA 1E0XA 3CMFA 1TA3A 2HXTA 5DT7A 4LTSA 2ODOA 3GB6A 2BZNA 5C9WA 1VGAA 1SZNA 4WR3A 3N18A 3BAKA 2BXVA 4D9PA 3NQDA 4RV3A 3L2MA 1VPYA 4LS0A 3FSUA 3OU8A 2WJFA 1KA9F 5CAKA 1GVRA 1QO2A 3UXKA 3L9CA 4H4IA 3LSBA 1HJXA 3FGCB 1JZ7A 3HO8A 5C0QA 1BGGA 5FACA 3O05A 4X2PA 5C2XA 3KVMA 5AY7A 3ENLA 2ZE0A 2D0HA 2Y4SA 3BK0A 1SO6A 2WZTA 1IF2A 5JIPA 1XISA 1R87A 2IQDA 4NNAA 1WXYA 2ZTKA 4FHAA 2I17A 4U5IA 1XM3A 2BV9A 2V81A 1QBBA 1QI3A 2QAFA 3MP4A 2G0WA 4UWMA 3THQA 1IE7C 4IGMA 4MDOA 2GUBA 1L6SA 4GO9A 2RDUA 3CUXA 2YL9A 4K3ZA 4Q4OA 4TIMA 3HGOA 3GKFA 5KSWA 1ISWA 3BG3A 4F8XA 3WF2A 1CXFA 2E1WA 3W82A 1WAWA 3W9ZA 4YU1A 3DX5A 4HHPA 3W7OA 4WRHA 2DT0A 3M5XA 3H23A 3WK2A 2R82A 1N8WA 1NDWA 4LNYA 3AIUA 1SFSA 3KWSA 1FWFC 3CHFA 4JTGA 1QNRA 3UT0A 1R9XA 1XIHA 4PBGA 1I60A 3GDBA 3HJZA 2HSAA 2O0TA 1X39A 3VFLA 3SCOA 1QBAA 4XISA 2I56A 3UYIA 1TV4A 3SB0A 1QPRA 4K7VA 4YL2A 1DWGM 4KWVA 3MSRA 2YL5A 1G9HA 3LI0A 4XVEA 3EWYA 5JBFA 1VP5A 2IKGA 4IICA 2CWNA 4PTWA 1U1JA 3MA8A 3SR7A 2VEFA 3RGTA 3TEVA 4PB3A 3M16A 5CC6A 4MFDA 2PCQA 4B2DA 3IJLA 3P60A 2A7NA 4GJIA 4Q8MA 4PEEA 1BHGA 4EP8C 4K38A 3YPIA 1PS9A 4XKMA 3R1ZA 4H6QA 1YIXA 5HNUA 2OMAA 2ZTJA 2DVXA 1XYLA 1TV5A 1H7XA 3SM0A 5M2FX 1Q6OA 4KKXA 1KCXA 3HPXA 1F6YA 4LAZA 1V3IA 3H54A 3D3FA 1U2YA 3UVAA 3IVSA 1LP6A 2WXDM 1OYBA 4Y2WA 1TV2A 1KFCA 1O94A 1DJIA 3IIZA 5KZMA 4DUWA 4LUSB 4C5YA 2GYIA 3ZZ1A 1DWJM 1KRMA 2XUCA 3EWCA 2DVUA 1Q3NA 3E1F1 4C1NB 3MP3A 5EYWA 5A94A 2V9DA 4Q8TA 4HSNA 3C4UA 2Y7EA 4F66A 4AG0A 1D7KA 4E2VA 3HOJA 1NDYA 1KCKA 4AF0B 2I1OA 2BTMA 3WFLA 3DHFA 1JZ2A 2OOGA 4AYSA 3P5YA 5JU6A 4D6GA 4PTVA 5D4YA 2DPEA 3GBEA 4CN6A 2ZUSA 2IPFA 2Y63A 4PRWA 3MYPA 8XIAA 3NYDA 2PE4A 3EOEA 3C3UA 3UWWA 4A8RA 4LVAA 3F5JA 4IGNA 4GYKA 1UKOA 2D2JA 5EFFA 3BJFA 3CLMA 3GVGA 1WKYA 1B3YA 4AIOA 4LU0A 4ZQRA 2VFEA 1V6WA 1OC7A 4Z2GA 2ISVA 3HM7A 1UWIA 1HW6A 1ZY9A 4NU7A 4HSOA 1NDZA 1M7XA 3BV4A 3N15A 4K8HA 1IIGA 3AIBA 1NH6A 3DDMA 1W5MA 3AHYA 1IZKA 1EIXA 4MWAA 3U7VA 1FFQA 5A6SA 4LGXA 3N11A 1OFQA 1U1UA 4IPPA 4JZ5A 1BQGA 4JBRA 3VKDA 2QHAA 1W9BM 3P8JA 2V2HA 1TZ9A 4QISA 4JD4A 5EPDA 3SZ8A 3WUEA 1Q2SA 4ZFCA 3B40A 4LBRA 1I1XA 3WQ6A 4QP0A 1SO3A 2ZXQA 4RE2A 3GVVA 3NQCA 3CZJA 3H55A 3I6TA 1LOSA 4ZOCA 3UWYA 2Q8LA 2FB2A 2IKIA 3NL3A 2ATSA 4XAPA 1ZB5A 3MI3A 3N2XA 3NA8A 1B0IA 4E8CA 1CPUA 3AXMA 2PWUA 4IFRA 3W0KA 3E2RA 2V3DA 1T41A 4YCPA 3A22A 1MEHA 3UJEA 1FWEC 4RZBA 4JYDA 4MB5A 1CDGA 2A3AA 3VUPA 1UP3A 3LQLA 3WQ4A 4AW7A 5DMMA 1XRTA 1EC8A 2Y0FA 5GJNA 1AL8A 1N8FA 1R47A 4IXHA 4JIEA 4XB3A 4FXJA 4MIMA 5CJMA 3CZKA 3QZAA 1Q6GA 4Z2KA 2OJPA 1U83A 2G3JA 2BMBA 3VKAA 3GNOA 1PJ9A 4PULA 2WBGA 3DBPA 3GAKA 1KD0A 2WKGA 4ZQPA 4AWUA 3R6IA 1JXJA 2NSOA 1US2A 4XZNX 4GYPC 2VI0A 1YPFA 3EOOA 4UUIA 2FHBA 2F2KA 3QF0A 3B9OA 4GK8A 1M7PA 3CJPA 2DJXA 1TTQA 3QKZA 3VNYA 2YBVA 4HKPA 1YYAA 3PBMA 3HMJG 4IJRA 4TUFA 1M1BA 3N9RA 2D2OA 4N2YA 1SUXA 5C9XA 1LYXA 3T07A 3TYCA 5EMMA 4JQ4A 3EKGA 3STFA 5LGZA 3T42A 3MU7A 4GQGA 4KRUA 4MGGA 3GS6A 4WJ8A 4IQEA 2RHGA 4LS1A 4MB3A 3P0WA 1RD6A 3CUIA 2DT3A 3NAVA 4Q22A 1CYGA 3THCA 1VYRA 3KBVA 1KGWA 2PEVA 3OLEA 3ABZA 2VELA 3PZTA 4ERGA 4LEQA 3WH5A 2VC9A 1JDAA 3QC3A 3A3HA 1W5QA 4JTLA 1EJTC 1RJQA 5HQMA 1RVKA 3VKJA 1Z41A 5MF5A 3WH8A 1OX6A 1SQ7A 2WW5A 1GQJA 2R9RA 4J3TA 3OQ8A 3NDYA 3NL6A 4HVXA 4PTXA 2XVPA 1EJXC 6REQB 1MQQA 2ZVRA 3WLPA 2UY4A 1LQ2A 2P76A 3T2OA 1C7TA 2NT0A 1N8IA 4BHYA 4G7EA 1UR8A 1W3NA 5EY5A 3ITLA 4X61A 3QGKC 4HA0A 3V3WA 1YHTA 4NI8A 4Z0SA 1FHVA 1GOQA 4GISA 2XZ9A 1QNOA 4HMNA 2X0SA 2E25A 5DMNA 5HQEA 1JI2A 5ECUA 1E40A 5FD0A 3SGZA 1RZMA 3M0MA 1IGWA 1LLOA 5CGTA 2QGYA 1FWTA 2GQ9A 1XFBA 2C3ZA 4BF7A 2PZ0A 4RW5A 5K9CA 4G1NA 1IR1A 3I4KA 3GWQA 3PJTA 2Z4GA 3HFYA 4W7UA 4Y90A 4O19A 1YXDA 3AXKA 1XD1A 4DJED 5CSRA 3L4WA 3LQGA 3QW4B 4PFMA 1TZ7A 1SJDA 2J6XA 1TJ0A 1TWSA 4GI4A 2PD5A 4Q8QA 1CBGA 1UKQA 5AYBA 3MCMA 3RAOA 3GSMA 5HANA 1E1EA 3APGA 3WQEA 1IQ8A 4K1GA 2JKAA 2BGNE 3CIVA 3AC0A 1WUFA 2WQPA 3EOUA 1RPXA 4TQTA 4BQ5A 4GO8A 1J0HA 4YMZA 4MKVA 2X09A 3M0XA 3IPWA 2AL2A 3AISA 4CCCA 2A3BA 4R27A 4HSHA 1W5NA 2OYMA 3PUGA 3FN9A 1B3WA 3SFWA 4MYXA 1EYWA 2BFGA 2G4JA 2QJJA 4CCDA 4GACA 1EC9A 3KCOA 3CB8A 3K46A 4I7VA 4JQ3A 1RLDA 3JS3A 4IMAA 3K4WA 2PDFA 3XINA 4PL2A 2ZFAA 3GFZA 4WOZA 3EX3A 3LYEA 2KX9A 5A6AA 4HZMA 3SCWA 1TUFA 3TN6A 7XIMA 2YZRA 1V03A 1GOKA 4NYYA 3WJSA 1JL8A 4NNBA 1RV8A 1TJPA 1MEWA 1RK6A 3IIVA 3HA1A 3ABXA 3AIVA 4C91A 3F4NA 2UV8G 4OWGA 2VVNA 4XX6A 4YCOA 1J18A 3BICA 4FXRA 5LGXA 3TSBA 2XH0A 2A85A 4CN1A 3UYCA 1AZ2A 2AGTA 1F3TA 3H53A 3EMQA 4N9BA 4B5XA 1TE6A 5CZJA 3L0GA 3BMVA 4LAUA 4NYUA 3M4HA 3GYEA 2ZVIA 3VX0A 2ACRA 1J6OA 3PPGA 2B7OA 3E74A 3RMJA 4GC4A 3WQGA 1XINA 1IYXA 2BS9A 5DXYA 2OELA 1KLZA 3NURA 4UQAA 2FVMA 1E6SM 1S5VA 3GNNA 2NZLA 1BPLB 3A4WA 4AWSA 3M0JA 4LVBA 1JYNA 1B31A 1J0KA 1V5XA 2REQA 2CXEA 2ZUUA 1WP6A 2GSHA 1EGZA 1W37A 3NG3A 3C8NA 3ARSA 5ABTA 1JCJA 1GKQA 4O0KA 4ZQCA 2YA0A 4LVGA 1B4KA 3UWZA 3CH0A 4EIVA 1PCWA 1B5TA 4JCLA 3A23A 3U5YA 1XYCA 1DVJA 1P6BA 2E9BA 3WMSA 4JQ1A 3SI9A 3ZOAA 1KQZA 2QCFA 4ML4A 3V5OA 3WD3A 3HGSA 3M7WA 4HTYA 2J79A 2O9PA 4JTEA 1BGAA 2CLFA 4MNKA 4CCZA 1S3HA 2DJLA 5A8MA 1UQZA 5C5YA 4B92A 1PUDA 4N4QA 6TAAA 3F03K 5A8GA 2XH4A 2FDSA 1G5AA 1VFSA 4AEFA 1D3HA 4N9EA 2YCJA 4PTMA 4LB3A 3SEPA 4DAIA 3GVQA 3PP7A 4H6KA 4QLKA 5K7JA 1KFJA 2J7EA 2FKPA 3SUSA 3VMNA 1MRAA 3LLXA 4WX2A 1W2VA 1XRVA 2BGSA 1ZU8A 4LALA 4HHLA 3G1VA 4UTUA 1JNEA 3W07A 2WZHA 3VNMA 1TX0A 2R1NA 4DUOA 1S2CA 2J78A 4ORIA 1XIEA 3Q4DA 3ZSSA 3TONA 4TTGA 7CGTA 3HBLA 2CZFA 3URAA 4Q8OA 5IFTA 3AALA 1HX0A 2VDHA 1P4CA 1GUVA 2HVMA 4OU1A 1HIZA 1F5ZA 1NU5A 2NVCA 3NPUA 2I9EA 1XKYA 1QHOA 1LUCA 4AZBA 2QDDA 1XSKA 2VC6A 2QEZA 3ITYA 2E6FA 4NSBA 4QGCA 2ZX5A 1MW0A 3LXBA 3WD4A 4PUKA 1DJGA 1OEPA 4FNTA 4O12A 3QY8A 4HNCA 3S6OA 4AH7A 3PFRA 3AI0A 1FOBA 1JYXA 2E6AA 5KZDA 4JN8A 1ISXA 1PX4A 2DIJA 4PTNA 2NXIA 3G1FA 3AZRA 1DBTA 1JCNA 2GOKA 3WN6A 4W8LA 2BVYA 1IV8A 3MUCA 3NR0A 4HGXA 1YNPA 1DIEA 3MWAA 4AMCA 3TA9A 2WJZA 3NPWA 2JBMA 3Q67A 2GZXA 2P88A 2XSAA 4ACZA 1OYAA 3PJXA 2WBKA 3UZJA 3W01A 4B3LA 1PIFA 3G1DA 3SIZA 2P0OA 1WUEA 1AODA 5DO8A 2NVAA 3NXLA 4A6GA 3EDFA 2R6OA 3WZ0E 3TX9A 2YIHA 3LPGA 3E0WA 2GGGA 2V6AA 3ORWA 3CHDA 1W9VA 2ZX7A 5GNZA 1JZ5A 2DY3A 4C65A 3WUGA 3W85A 3GFYA 1ELSA 2QF8A 2OO0A 1Q4NX 2CLKA 4GQBA 1XRFA 4PMJA 1WBHA 2DGAA 4PMDA 5CPNA 4J5NA 4FAMA 5LYRA 3IS4A 3T09A 3W7QA 1GYNA 2C1IA 4IMCA 1GZGA 1XR2A 1GHRA 1T8XA 4DF0A 2NUYA 1ME7A 5FEWA 2QCEA 3S1XA 1AFSA 4DO6A 1KQYA 1FY6A 1BLIA 1UR9A 5FEXA 2B31A 3W2MA 1XLDA 4AQLA 2VX6A 3SQSA 1R3VA 5A8NA 2GJNA 4GUFA 2WMJA 3OPSA 1UC4A 5IFPA 3AYTA 2FZMA 1GEQA 1LQAA 2AMGA 2ZUTA 1UC5A 3S1VA 4M5PA 1PZ0A 3E49A 4OECA 1EDGA 2DQXA 3KZPA 4DX3A 2O55A 5GJMA 3FV9A 4DLFA 3K1DA 1SW7A 5LIYX 1DJYA 1WX0A 5CC7A 4BI6A 3XISA 3M0HA 2OEJA 1XS2A 2HS6A 4ZZ9A 4H01A 4Q8PA 4QROA 1XH2A 3W7EA 3VDCA 4Y9OA 1IWPA 1EKOA 4L6OA 4W7VA 1FBAA 2EJ1A 1ITQA 4FIQA 3BSHA 1IIHA 4LC6A 1FWNA 3LLDA 3QRHA 1THFD 1WKDA 4DNMA 2BVTA 3TJIA 4IP4A 5L9FA 3MHUA 4HU0A 3H7UA 3DUGA 2XIMA 4JTAA 2NXHA 2HBXA 1HUVA 3A21A 3LXAA 2V5CA 1VRDA 5EL1A 2JGYA 3WLLA 1E3XA 1K8YA 3ZFHA 3G22A 4Z1CA 3FA3A 4LXFA 2OGJA 2D1ZA 3S2NA 4XIMA 4DJFD 5ABFA 4AZ5A 2P8CA 5FESA 2R91A 1XPGA 4MAZA 1KR1A 4S2CA 4IT1A 3I3DA 1UKTA 3CL7A 3OGSA 3CUGA 5HXMA 2JIEA 3PY2A 3KLLA 2XVKA 1W3KA 2WV8A 2JQXA 4LT9A 1MW3A 4L61A 1UW9A 3IUHA 1SPQA 4X9YA 3KVJA 4H1ZA 1T96A 1LCOA 1JNDA 2RKXA 3UQNA 1TELA 2EPNA 3IJ9A 4RUBA 2I14A 2YKKA 3GXNA 5TQLA 2F6UA 3PR2A 1OFAA 4PCNA 3WENA 4ZENA 4WJXA 5ABGA 1Q7QA 2FZNA 4GIAA 3M0ZA 2ZIDA 1EXPA 2YCKX 2R24A 4H83A 1NSJA 3DGRA 1OVDA 3AWNA 2OXNA 1A5CA 4WCJA 1O4UA 2H90A 3A3WA 3GVRA 4DEFA 2NLYA 4ES4A 3KBWA 4PUEA 4R3UA 4QCFA 4O1EA 3RM4A 5I0DA 4XVDA 2EPHA 4R9XA 1I4NA 1FWJC 1DXFA 4TV5A 4DF1A 1KXTA 4UTHA 3B97A 3ANYA 3P8IA 5F1UA 3OEXA 1XGZA 1EBHA 3QOKA 2QS8A 1O1ZA 2FIQA 2QR6A 3QZ6A 3W73A 3VKCA 2RDWA 2J62A 2DT2A 4IX2A 1A5UA 1R9YA 2J47A 4WGXA 4Q7IA 3UNTA 4UZSA 2Z26A 4IPIA 1ALDA 1XYZA 1LTDA 3W88A 3JZEA 2ALRA 3P2VA 4JNMA 1F61A 1FWWA 1FH9A 1TR1A 5HUPA 2ZA1A 3ZJ8A 1VBHA 2UY5A 3G0XA 5EKYA 4GZEA 1CXIA 4QFUA 3VNJA 4AHPA 3ES8A 3R94A 1LLZA 4BR1A 4HYRA 4C90A 5HINA 2D2GA 4YLWA 4QLJA 1GOOA 3AICA 3ZWSA 4OUEA 4H9YA 4WXYA 1O5XA 1E0TA 3GUGA 2E0PA 4MJ4A 5E6YA 2HJPA 3TN3A 4H2CA 4AXKA 2XFYA 3M07A 3WH6A 3W84A 1K6AA 2ZZ5A 4HJWA 3S2JA 2VOTA 2OR2A 2ZRWA 4D6DA 4IIEA 4AUBA 4HNTA 2PWGA 1UWQA 2G96A 4JGDA 3GUWA 3KTSA 4KMQA 3V0SA 3CEPA 4HD5A 1C90A 2YCLB 3IIOA 3ITTA 5DMLA 3PTDA 1TQXA 4IP5A 2IMRA 3M0LA 4S3DA 4HNNA 2GJLA 1S1PA 3C0LA 2PP3A 1BXCA 4F0KA 2Z7KA 4HN8A 3NXFA 3ANUA 4DVOA 2NQJA 4FLOA 4Z08A 4QITA 5DEZA 4IIHA 2C71A 2HWGA 1XG3A 4G5DA 4XG1A 2EHHA 1H60A 3IK2A 1TFVA 3HB9A 3DFSA 1LL4A 4HTBA 3V1PA 3GM8A 3MI6A 4O1DA 4M80A 3GDMA 2ZRUA 2OG9A 1T6MA 2GUUA 3AZSA 4A05A 1G4PA 2QDHA 1WXJA 4A2SA 1T7LA 3ARVA 3SGUA 3ZLGA 4HA1A 1DL3A 4NI3A 2JF6A 1FHDA 3AHVA 2JE8A 2VKZG 4A3RA 1TO3A 4BQ3A 4D6EA 3W2LA 2VVSA 4O4VA 4J35A 3GTNA 3CNYA 4A3UA 2XYLA 1N82A 3OHIA 3ZR5A 1P7TB 2V5DA 3VGFA 1M41A 2Y85A 1BG9A 5H1WA 1YNYA 2DZBA 3W1TA 4E8GA 2QULA 2FPVA 3U5UA 4A35A 1M5WA 2H6RA 2PB1A 2F8QA 3MP5A 1UROA 2GQ3A 2R94A 4US6A 4CEXC 3CUFA 3LBCA 3GZAA 1QI2A 4J28A 1XBYA 2V5KA 4Q32A 3LI1A 3TN5A 1GVIA 4GNVA 5C70A 1CXHA 4HNLA 2ISWA 1SZGA 4LRSA 3AFBA 4UTWC 1E73M 4JS3A 2C79A 1ZAHA 1R30A 1W56A 1OM0A 4XZHA 1UH3A 3PPHA 7TAAA 1WDQA 3HGRA 2ATMA 1UH4A 5DN1A 5DT5A 3RR4A 3U2EA 3RM9A 3E5BA 1NY1A 4Q4RA 2F38A 1JCTA 3NZGA 2WHMA 1MNZA 5B7YA 4Y9MA 3HFTA 3AHTA 1L6YA 1VFOA 2H3BA 3AS2A 3ZQ9A 1R2SA 5FL0A 5ECVA 2PPGA 1EO5A 5XIAA 1N7KA 1VFUA 1VEOA 1ZTVA 3MZ2A 1ZSXA 4H41A 2PUZA 1PB0A 2CCRA 4O28A 5G4EA 1FCVA 2C8NA 2DSKA 3ARXA 1ADSA 2OWWA 2WLYA 3PZVA 1OFDA 3GZ3A 4UCFA 1X6LA 1GYMA 4IL2A 3URQA 3IANA 2VJXA 1YQ2A 3SUTA 3RLGA 4WIWA 4JTDA 4LUTB 3RCMA 4KEZA 1NM9A 4OE7A 4L56A 3HPSA 4AHQA 4EF9A 2EPOA 1OC5A 4I6KA 4X22A 1MO0A 3ERPA 2Z2BA 4AISA 1GVQA 4HPNA 3W23A 5CQ1A 3KRZA 3HU7A 4B2DD 3HQOA 5A5WA 3TFXA 3T05A 4N6EA 2VCBA 2NWRA 3MHGA 5TAOA 3V75A 4QG9A 4REQA 4YYCA 1FP8A 1JI1A 3F4VA 3G6LA 1OCQA 1M3UA 5C71A 4GIYA 1DYSA 5K4ZA 1LL6A 3N9KA 1WOBA 4PCSA 2WMFA 1K70A 4XZMX 3BLLA 4XD5A 3W7LA 3B0YA 3FEMA 4UFLA 2WYSA 5H91A 2VDIA 1JUKA 3T8QA 2EXOA 3TAKA 1C93A 1GCYA 1DHKA 3E2SA 2YZ5A 3GTHA 1SO5A 4J3SA 1WDPA 1S38A 2YBTA 2CZEA 4QAIA 3SRFA 4GVIA 3WK3A 3DHPA 4A3QA 4RX0A 3APTA 3CK5A 4UQEA 3VC5A 3GU1A 1ITXA 1H2JA 3OVPA 3ZMRA 2WJDA 1XBVA 1YBQB 2YXXA 3IARA 4F2UA 2OWXA 4DWSB 3IV8A 1OFRA 3ARTA 3NL5A 3E3HA 4Z2JA 5I3JA 4ZOEA 4GC3A 5I3HA 1R3WA 3UVIA 5HOSA 3PUOA 1UIPA 1WOAA 3TK7A 3V7PA 3R43A 4CVUA 3O3RA 5B7ZA 4O0ZA 3UG5A 3G8RA 1PO9A 5FKYA 4HHMA 1ZBCA 5CH9A 3TDFA 3W7MA 2YSWA 4H2HA 1A0CA 5IHRA 3L65A 1LDCA 3EX2A 4HNOA 3WNMA 1JQXA 2Q3RA 3MPGA 2PTWA 3UZ5A 1DJHA 4DZIA 1S2VA 5BRQA 4JN6A 3M5YA 3F5LA 2ZUNA 3A24A 4GHRA 3M41A 2NV1A 4XZ9A 1W2PA 3GNPA 4Z1DA 1Q45A 5G5IA 1BRLB 2BOEX 4RNJA 2CETA 4PMOA 4WY0B 1NWUA 3WO8A 3CYJA 4QE1A 1G69A 3WQ5A 1K03A 3GD6A 3BO9A 1XCXA 5BWAA 3FVMA 1VCVA 4XWUA 5D9OA 3R12A 3M5ZA 2YA2A 3FNDA 4GCAA 1Q8JA 4KWUA 1H63A 1YTEA 2OQLA 4GG9A 5A2AA 3B0XA 1LWHA 4Z17A 3AOFA 1XLBA 1Z3NA 3T0BA 3WX7A 2A2IA 3N04A 3D47A 3M43A 1NDVA 2E9LA 2HQAA 5C55A 4AD1A 4JIPA 4U31A 4JICA 1VHNA 5I78A 5A69A 4YJ5A 4G1KA 4GH1A 3R0UA 3G1AA 3F2CA 3ZLHA 1UOZA 1W6TA 4HU4A 4PCFA 1VBJA 4N0RA 4NP7A 3TR2A 5TNVA 2VZVA 1C9WA 3C61A 4HP5A 4EVZA 3O0KA 1HJUA 1MI3A 5FEZA 5TF0A 4Q8VA 1L8NA 1AA1B 3TR9A 4P2VA 1UR0A 3A13A 4A2RA 4M6UA 4NJGA 3EGJA 2PDIA 2IPJA 3GW0A 3B8TA 3U9IA 1IWAA 3LRLA 2ZRVA 4AYGA 1B3ZA 2DZPA 3KRBA 5EA9A 4QXIA 2OX1A 5I5RA 3GQYA 1HFBA 4C6MA 1KM1A 4KETA 1AMKA 3H2CA 1SR9A 2WOQA 5FJRA 1XBXA 1E5NA 3CQHA 3B4UA 1RD5A 3CV2A 3SCQA 1V0LA 5E1QA 2FPTA 9CGTA 2VD8A 3WUBA 3CTTA 4C1LA 4IJCA 1XCFA 4LYRA 4AY7A 2QLYA 4BJHA 4H9MA 3TYEA 3E0VA 1UA7A 4MKNA 4C6OA 3QFEA 1O7AA 1X1NA 4H7VA 5F4SA 3P14A 1P43A 3DG6A 3GLCA 2Q6ZA 5AC8A 4UB9A 4MOZA 4HPJA 1X98A 4Z2LA 3T9PA 3CZLA 3ITCA 4FK9A 5FAJA 1PKLA 3ZXWA 3NO5A 5DF0A 4WDWA 3B8DA 1NOWA 4F9JA 1EDQA 2ZZ3A 5EMJA 3VINA 3O9NA 4XAFA 4JYEA 1CGTA 2PFHA 4BEQA 4BY3A 4H00A 2QCHA 2GDQA 2ISDA 2CEQA 2FGBA 1GEHA 3MANA 2C7FA 3QSRA 3M0YA 1Y5VA 2FZDA 3H7VA 2VFDA 3KL3A 2D0GA 3E96A 1CCWB 1M65A 2QCCA 4IIFA 4GFIA 3NO3A 3PULA 4NAEA 2WMHA 3M0KA 2Z1VA 4M1BA 1FDZA 1TV7A 3L4UA 4JTHA 4XZLX 4U5KA 4UFKA 1OYCA 3S9YA 1EEPA 3UFYA 2OX4A 1C8QA 4LF1A 1K8ZA 2PWDA 5A6LA 3WY1A 4D8ZA 4OVXA 1J01A 5D02A 1X7FA 2JALA 3GDKA 2XIBA 5A1AA 3DH7A 1QCWA 2WNQA 3BPWA 4Z0JA 2DDXA 5DMYA 1FDJA 1F07A 4YTUA 4CQ9A 2F6KA 2XIIA 4NZCA 3W1XA 4DJEA 4HK6A 1CGVA 3MUY1 5CPSA 1GONA 1KR0A 5CJ5A 1UPPA 4BF9A 2PF8A 3WNNA 5HWMA 1OBAA 3RU6A 4EAYA 2QVHA 3MVIA 5CGQA 3OGRA 2B7QA 3WMCA 5C8BB 1S2UA 3AS1A 4P5UA 1CTNA 3CZ8A 3L4ZA 4CD4A 1E0WA 3OIHA 4CD5A 1VS1A 3WQOA 5F2GA 5TIMA 1PE1A 1VYSX 3DBNA 1DIKA 4E6MA 5HNTA 1J4EA 4Q7NA 1EH9A 1UUOA 2VD9A 1KV5A 7ODCA 3QY7A 4C6JA 3B8UA 4UQBA 4S3KA 3DYMA 1RAKA 2GL5A 2IQTA 2PDXA 4PR4A 3IJIA 2TRSA 3VIHA 1KC7A 5AHFA 4HU8A 4D8LA 5AC7A 1PHQA 4QE4A 4YIWA 4LV9A 4AEOA 1U1HA 3F4DA 2IXVA 3S1GA 2NQ5A 3VKKA 1MXGA 4B16A 2GDUA 1E1FA 1TPB1 3DFNA 2PS2A 1XRSA 4NJIA 5AECA 3R4IA 4ZQMA 1RY0A 1UUMA 4RDWA 2OOFA 3N2OA 4O57A 3TFCA 2ZCGA 3RRAA 3G0UA 4ZMGA 4C6KA 1E6RA 3S2CA 4JIHA 1P0DA 1V4YA 2PWFA 5I09A 4JIRA 3RCYA 4B5VA 3RMEA 4CNNA 3QBUA 4XD4A 4JTRA 2YLAA 3QYQA 5B80A 1JYWA 2ZADA 3S1WA 3PBWA 2O4QA 3EB2A 2QJHA 2PTZA 1PX8A 5G1MA 3E02A 4AD5A 2FMOA 5I3KA 3ICJA 2QZRA 4MB4A 3BANA 3P74A 5GQBA 4FXFA 3W1QA 1V3MA 2Y89A 5D2VA 5AZ0A 1M7OA 1TR9A 1JFHA 1V7YA 1E6NA 2YJQA 2ZC8A 4FB7A 2CNCA 1FFRA 3CAQA 1ZLPA 4DYKA 3OIXA 3BUVA 3QPEA 1X1OA 1VLIA 2OO6A 3G24A 1TTJA 1DE5A 3BCFA 1XC6A 1XYFA 3KDOA 1W1IE 2PDUA 2VXNA 1ZHAA 2Z1BA 4HK5A 4LS2A 1UJQA 3UR8A 2EPMX 4GPNA 4ZB5A 1GHSA 1YTKA 1GJPA 5AYZA 3SN0A 5GPRA 2A1YA 3IGXA 4PUWA 2RJHA 4QJ3B 6PTDA 4UTLA 4G6CA 1NP2A 5CJNA 3K8KA 5JH1A 2F7FA 2Q8ZA 3C0SA 3BMWA 4GUIA 2WCSA 3RJXA 5MKGA 4IQDA 4TV6A 4YTTA 4N02A 3O8AA 4I9JA 2DIKA 3UY8A 1KFEA 4FNQA 1J12A 3LNPA 3WJZA 4LVFA 1JPKA 1BVWA 5IOBA 4Q33A 3LM3A 4MADA 1JAKA 2WSRA 3TVAA 3W75A 3TP4A 4UTMA 3QTPA 2ADAA 2FJUB 2A3EA 3UJFA 4YPJA 2W61A 4MMWA 3F7JA 4WKFA 4Y9PA 3TMLA 2ZUVA 3P80A 3GG7A 3WF4A 3AU6A 1TUXA 2UBPC 2C19A 4ATLA 4D6JA 3AXHA 2TSYA 4DPPA 3AROA 1V3HA 3V18A 2ZXBA 1B9BA 2WM0A 4P7NA 3T81A 1UB3A 5JMUA 3TIMA 5I00A 5CKSA 5AHLA 1XYMA 2DV0A 3QVQA 3WUFA 4YVVA 3K13A 3ZVIA 2Z28A 3OZOA 5BYWA 3P82A 1UD2A 2W62A 2C16A 5HWNA 3RPDA 3GFXA 1EZ2A 2I16A 3W7HA 1HKKA 2BY1A 4JAWA 4RZ4A 3THAA 5KINA 3BLIA 3UG3A 3MTWA 4JKLA 3CQJA 4UQDA 2NW0A 4AFYA 2ZX8A 3VZZA 1UYQA 3LHTA 1EUAA 1VC4A 3WD1A 1CXEA 3KTXA 3TJXA 3FJ6A 1L8PA 4POCA 2AOSA 1XLIA 1KTCA 1K02A 4QEEA 3AS0A 2CU0A 3HPFA 3IACA 3H8AA 5I06A 1WZKA 3G18A 5C7VA 1CIUA 3OQEA 3G0SA 4QTGA 2J13A 1VLWA 5FF0A 3C0QA 4O17A 4WDUA 5IDIA 5BU6A 5G1YA 3VDGA 3O6DA 3IV3A 2WQDA 3MMTA 2W4XA 2ZBTA 4QG6A 4YVPA 3FS2A 5EU9A 1NFBA 1SW3A 3NM1A 3S2MA 5A2CA 4EPDC 1E6QM 1VHCA 1FWBC 1LRTA 3V1HA 3L68A 2PTDA 5LNRA 1YADA 3QKEA 3O6CA 2C18A 3N6JA 1V02E 2ZDSA 4D2JA 1QDSA 1GWJA 2HCVA 3DKJA 3WDPP 3IAQA 4HMDA 3LPOA 2VFIA 1GTHA 5D32A 4MWAB 3PWIA 3N1AA 4WDTA 3TUUA 3UR5A 2VHLA 2WO5A 2X8RA 4O18A 4W85A 1QO5A 4C6NA 5IBXA 2HROA 3VE7A 1AJZA 4M81A 2VZSA 1VFTA 1I2QA 4GMEA 1CLVA 1WNOA 1PZ3A 2J77A 3PAOA 1DTNA 1UR4A 2DORA 1O12A 3TNOA 4M3PA 1U5HA 2CWXA 1AG1O 2WANA 1GQLA 2B7PA 3TTYA 3LOTA 4CGTA 5AOUA 2AAAA 3GXPA 3O07A 1BXNA 1I2NA 1PKYA 4AY8A 5D03A 2WHKA 4FA3A 2NV2A 4GH3A 3N19B 5AC4A 4GINA 1UWRA 1NEYA 4CLMA 3FKRA 4Q7BA 3EX1A 1QNQA 4F0HA 1WZMA 4CNUA 1IEIA 2QW5A 1OT1A 3DENA 3TTOA 3VNDA 2G95A 3W81A 1WDWA 2BVWA 3ABOA 3QH2A 1FCQA 8XIMA 4GGHA 1GVSA 1G94A 4X0VA 4P7LA 3UWQA 3QPZA 1VB9A 3FXGA 3KL5A 4X9SA 2TYSA 3MJMA 1LOQA 3C56A 2PCEA 4AVFA 1RSCA 4MTVA 4DYJA 3CV7A 2IPGA 3KTCA 1KBIA 3LB0A 2VC7A 1VPQA 4CQAA 5A2BA 1CENA 6XIMA 1VBGA 2CLMA 1E6XM 1VPXA 4L9ZA 5HR7A 3RPTA 3BDKA 4JDBA 4E2DA 3AHXA 3HMCA 3VMPA 3V0UA 4GYJA 3MC5A 3KBMA 3VCNA 4O1CA 1Q6LA 1G0CA 2O9RA 4EE9A 1F73A 4F0LA 1JPHA 3MUXA 5BZAA 5EMUA 1PXGA 6TIMA 4PH6A 1P0EA 2ZUWA 1FCUA 2CLIA 2D2HA 3WSUA 2XH7A 3NDZA 2CHNA 4A8IA 4JHZA 3AWOA 3PB0A 2PP0A 3GC4A 3T7VA 5M3WA 3IUDA 1OD8A 4GKTA 2VURA 1VBRA 1YX1A 1JF6A 1XYAA 1SZFA 3LCHA 4PODA 4HNVA 4OJYA 2A21A 4IJBA 3AUJA 3LCWA 4PMRA 2JF7A 3SQLA 3BE7A 9RUBA 1LM1A 2CXGA 4F40A 1TZZA 3LGGA 1XUUA 1PKMA 4NZ5A 4A29A 3BMXA 1W31A 1B30A 1WB0A 4HHHA 2ZZ7A 1U22A 2DZVA 3T40A 1XYBA 1H7NA 3QR0A 1HQTA 3R79A 3NFUA 2CBUA 5CLTA 2GWNA 3H2NA 3B8IA 4J3ZA 2ISSA 5KTLA 1R3QA 3GK0A 4E2BA 2VX4A 3W4RA 4QNWA 1BXBA 5GJPA 5I77A 3CQIA 3KOXA 1DXEA 1XP3A 1KRBC 1LT8A 3WFZA 1F6KA 2EKCA 5IBXC 4ADSA 4G7EB 4EANA 4IGHA 4N7QA 4I5UA 2ACQA 3LHUA 3JVAA 4RR4A 3J7HA 1S5NA 1BEUA 1XIJA 1RUSA 2NQLA 5CSUA 3BG9A 4PMXA 3GDRA 4LAMA 3WJYA 3VK5A 4DB7A 1LT7A 2JEQA 1CLXA 2QXWA 4FOJA 1JDDA 3AAMA 2X2GA 2SFPA 3S5YA 3H4GA 4PMUA 1SYTA 1AW1A 5CBIA 2AMXA 3LGEA 3RDKA 1E51A 1P1XA 3HF3A 1CXLA 1EJRC 1EPXA 5FJIA 1QOQA 4E4UA 5CZ0A 1HJSA 3AQUA 1CB2A 1OF8A 2QV4A 4JXCA 3ZLFA 1VENA 1ODZA 3NO1A 4WKAA 2CITA 4IFKA 3W7GA 4BQ4A 5DQPA 7PTDA 4DPQA 1J0JA 2WVVB 2PZNA 4IISA 4RXFA 4INFA 1US0A 6CGTA 3WNKA 1JZ6A 1PAMA 2I7GA 5KITA 1ENUA 1C9DA 1S2TA 1G7UA 1XH1A 3VZXA 1EBGA 1DQXA 2Y62A 2HBVA 3VI2A 1Z9AA 3UG4A 1B3XA 1F05A 4YYFA 1SGJA 1KBKA 4DBUA 3WG6A 4CVWA 3APYA 3QYSA 4AZCA 1IWBA 4MHBA 3CPUA 1FA2A 5E0FA 4XSMA 4LANA 1MQRA 3C2FA 3O63A 4EX4A 2XN0A 2Y7FA 2F2HA 1EA9C 2Q3OA 2DSVA 1PPIA 3O16A 4XBJA 3CLWA 2J66A 2X2YA 4LB4A 4JQ2A 3U0HA 2QNEA 4KCVA 2PRLA 3AS3A 3LCGA 4Q8NA 3WJWA 1M01A 3URNA 3B06A 4EOUA 3G2GA 3WF0A 1QW7A 4Q4MA 3H22A 1ZQ5A 3EWZA 1RR2A 3FK4A 3H21A 1W1PA 1MXDA 1PIGA 3F1QA 4HA3A 2FZ8A 2D20A 2G3FA 3MCNA 2Q8XA 4OTKA 3NWRA 4JY8A 3GX9A 1WBJA 4KCTA 4L7ZA 3WEMA 1H1YA 3NYZA 1WPCA 1MZRA 3ZWTA 3AXIA 5G4WA 4UQCA 3G6MA 3TYZA 3QFWA 4OGZA 2RGLA 1V6XA 3QQ1A 3ARZA 2VQTA 4C6FA 3RX2A 2CBJA 3NVDA 5EFDA 4J3XA 5BOFA 3BW4A 2EJAA 2B81A 5E70A 1J5SA 5A6BA 3NJ3A 3SCVA 1CXKA 3H2EA 4ERIA 3VO0A 3LTSA 3PS7A 1SFTA 1NWTA 4UTIA 3C2YA 4JTSA 4UZUA 3WD2A 3VX1A 1FH8A 3F4WA 3FEQA 3VIJA 4PMZA 2W3ZA 4C6CA 3MBDA 3GDTA 3IRDA 3Q65A 2TMDA 1WKEA 2WSKA 2OWCA 3EWBX 3WDQA 3BLDA 4CNPA 2C0HA 5H8UA 4CU8A 1JEZA 4WSHA 4L4PA 1NF0A 3OLDA 1LWJA 1GG1A 1V0MA 3PBVA 4GY0A 1KW1A 4DXVA 4KPLA 4AZ6A 1ME8A 1PKNA 2JIWA 2XN1A 3CT2A 1SSGA 3TA6A 4L1WA 3B8SA 2WCGA 5HNNA 3SUWA 2QAPA 3M5VA 4LX4A 3HG3A 3IEBA 1TTPA 4GWEA 3C52A 2FGZA 3W7RA 2WC3A 1SM9A 3ME3A 1UA3A 3K2GA 4MVAA 3VOGA 1WAUA 1OF6A 3UXDA 3L2IA 4R7WA 3UW6A 1Q6QA 4R7JA 3FAXA 3FW6A 4LPCA 3EEZA 5HUOA 2OLAA 1ISYA 1CW2A 1TSIA 2XIJA 2LLEA 2O4MA 5AYYA 4NHVA 4PUNA 3G8EA 1FWIC 1YW1A 2P50A 3BW2A 4L4LA 3EPMA 5D8WA 1FRBA 4N9CA 1QI0A 4UR7A 3H12A 1XL9A 1V3JA 1QPQA 1MWOA 1RCOB 3TYDA 4V1XA 1FWRA 1TYGA 3FVDA 1QUMA 3H4XA 2XGIA 2Y7GA 3JW7A 3BOLA 3A64A 3B9DA 3ZM8A 4GI8A 1J8VA 4QBXA 4KT2A 4H9TA 3VIFA 2G5WA 4DRSA 3TZFA 2V63A 3LCXA 1EP1A 3OJGA 2PGRA 4LJ3A 3LMYA 4F79A 1Z7AA 2YB4A 1W1ZA 5C7HA 4ZBCA 3MQTA 3UETA 3ZIZA 4GZJA 2BHYA 4WVXA 3W72A 3CO4A 2WKJA 2J8FA 2VC5A 2VR2A 3ARYA 4ZSUA 2X0YA 3DFTA 3BGJA 3PSWA 2J24A 5HULA 1TMHA 1UBPC 4U28A 4Y9NA 1LUCB 1A5OC 1V79A 3UGVA 3LK6A 1EA0A 2VUNA 1ECQA 2G50A 3TC6A 4F0SA 1QPNA 2V82A 4JNYA 5CPOA 4IM4A 3PVFA 3C2OA 4JTCA 1PWMA 4GJJA 1Q8AA 4A3HA 2ZZ6A 1ZS2A 2OPJA 2F6XA 2FTWA 3WQVA 2Z7GA 5IHSA 3GXTA 3M7SA 2C1GA 3FJNA 6ENLA 4LC8A 3NZRA 1H51A 3NQ8A 4QSFA 4UR9A 4KIRA 3UCCA 2PAJA 1RP8A 4AD4A 4JQAA 1AD4A 4J2MA 1KM6A 4DWDA 3WNLA 4AAJA 3CB3A 2QYGA 1DE6A 4B3KA 1TJ2A 4IGSA 1UIOA 4C6BA 4R34A 2GPTA 3LA4A 2X30A 3W02A 4ACZB 1GVEA 3OGVA 3T55A 2FZBA 2TPSA 3BAJA 2X41A 4Y9AA 3SFKA 2CC0A 2OZ0A 3A9BA 4RW3A 4FLSA 1KO0A 1LF1A 2HTMA 2YOCA 1XLLA 4J40A 4XZWA 1Y65A 3GXFA 1JCXA 4GYPA 3N12A 3M9YA 4H7CA 1OK6A 3B0UX 3D0CA 3EB3A 1XI3A 3E12A 4XKYA 3KOWA 5E93A 4WZHA 3LRMA 2YXOA 4FNPA 4JL2A 1R3RA 2J4GA 5A3HA 3UZZA 1EQCA 1I8JA 4XO6A 5FF4A 1HGWA 1GVYA 4JTUA 2YXGA 3PZNA 2PWEA 1PWLA 4EWND 3VGBA 3WDJA 5E9AA 1A50A 5MHBA 1VQTA 2AQOA 1OQFA 2ZC1A 4MJMA 5DY2A 4BQ2A 4IMEA 1KNWA 2HZGA 3A9IA 4EKJA 2FDMA 1A5AA 4Z42C 1A3WA 2Z25A 4PMQA 1B90A 1A49A 1GYLA 3CS2A 3OODA 5BU9A 3ELFA 3W1NA 2A7RA 2VEPA 3QMTA 1SJBA 2ZXDA 3WK1A 1A80A 3W7KA 4S3GA 4AX7A 4ZQOA 4Y7EA 3OLGA 2YYUA 4V33A 1OK4A 1YNQA 4WY0F 3RPMA 3GNDA 4AD0A 2G4FA 1KGUA 4FNUA 1OCBA 4HPXA 2OT0A 3CQ0A 2V2CA 2BHZA 1E9IA 2OT1A 4DLMA 1EUNA 4LAOA 2E5DA 1AUSL 4OZOA 1JRBA 4AD3A 4W4QA 4A4AA 3VGDA 1UD6A 4WD0A 4Y96A 3A4JA 1KFWA 3R8HA 2NXGA 5D9MA 5HWJA 1UZ1A 1L9WA 2X1SA 1SZEA 3UU0A 4LCQA 1FH7A 2QMKA 4LFYA 1OFPA 3LBMA 5ABFB 3PZMA 3I7SA 4E4PA 1ZFJA 4EWJA 1QOPA 4L65A 4ALDA 3BOXA 3OA3A 1WKFA 4ZVJA 4OUIA 5AYXA 4ROQA 3VGHA 1P0NA 3ZR4A 1VEPA 1L6GA 4J27A 3CYVA 4JY9A 1A3XA 5U4NA 5BROA 4IH3A 4TVCA 1FX6A 4KFOA 1KFLA 1QNVA 3GH4A 2ZRYA 2VRJA 2CZDA 4CQCA 3VPLA 3SY1A 4O8AA 1H3GA 1EXBA 2BODX 4GQQA 3IJQA 2ABBA 5HNRA 2ASHA 1FXPA 3S5NA 1XJBA 2A7PA 4RZ6A 4NQ1A 4GZ7A 2PA6A 3MYOA 2NLIA 1IXQA 2Z2AA 1QATA 4RDVA 1XC4A 2BY0A 2YBUA 5KETA 1KTBA 1XF0A 3PFMA 4I6VA 3MV11 5I79A 2ZE3A 4W9TA 5HMEA 1LLWA 1UWSA 2EAWA 1AMYA 1G67A 3SADA 3S83A 4H04A 1OWQA 5HAOA 4NZJA 4R88A 3KX6A 3EBVA 3VKBA 4C6QA 1GTEA 3B8VA 3NGFA 2GVJA 2V2DA 1F7BA 5JQ9A 1KBJA 1MW1A 4JFSA 3KOFA 2QPUA 3N73A 1UWUA 1QNPA 1EOMA 5I03A 3W3OA 1UD4A 3KRUA 4M6QA 3N6HA 2FVLA 3NCOA 4D6HA 3SO7A 1KXHA 2AQWA 2NQZA 2DVTA 4S3AA 3WCZA 4DI9A 2FLIA 3M1ZA 3G5EA 4KGLA 3TCSA 3AMCA 1YDNA 3KDNA 3R58A 3W27A 2YL6A 1WA3A 2D69A 4HZ8A 4LUYA 2PDQA 2ACSA 4BF5A 3NUKA 4FP1A 1KLYA 4QRNA 3Q45A 1ZRQA 1Q6FA 4QAWA 3T78A 1TQJA 2OEMA 2OLHA 2OFJA 4I7WA 4TVUA 2O9TA 1ISZA 4MLJA 2ZZ4A 5XIMA 3LHWA 3S5OA 2PBGA 5C9ZA 1GQNA 3UA3A 1K9DA 2AL1A 3W1PA 1O66A 2QCDA 3RN6A 1XICA 3UF9A 3SQMA 1RVGA 5A95A 3UJRA 5HPCA 1GG0A 1GZ1A 1Y0EA 1CB7B 4AZIA 3M0IA 3PSVA 1OX4A 2Y70A 3GTFA 1YE4A 3TYAA 1DOSA 1T8QA 2VYOA