1KQZA

Hevamine mutant d125a/e127a/y183f in complex with tetra-nag
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFAIAHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFFNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression and Characterization of Active Site Mutants of Hevamine, a Chitinase from the Rubber Tree Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Hydrolase
molecule keywords Hevamine A
total genus 98
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kqzA00
2J79A 3IAPA 1B2YA 3DYPA 1W91A 1UWUA 4MPKA 2E0PA 4TOQA 2OSXA 5CSYA 3T0BA 4EAMA 4J3WA 1WP6A 3VINA 4GXPA 2WXDM 1UR4A 3PTQA 1HF6A 4FLQA 1DWAM 3GM8A 3WNMA 3MO4A 2W67A 1H11A 4OBSA 1C91A 3CHCA 1QPKA 2WVTA 3WUGA 3L2MA 4W93A 1US3A 2XVNA 2ZICA 3U5UA 3W6LA 3HU7A 3ARVA 4Z2KA 1VEMA 5A6AA 1E6SM 3ARWA 2OYKA 1W3LA 4HZ6A 1X6NA 5I77A 4WJXA 4QLLA 2E8ZA 4W8BA 2VVNA 4CU7A 1VEPA 5GNZA 3RM9A 4CD5A 2W66A 3AFBA 1W9PA 3K4DA 4LYQA 3GH5A 3NYDA 3WIJA 2A3BA 3ZT7A 3WFZA 1QNSA 4V27A 4LGXA 1UWSA 2VCCA 5CLWA 1HVXA 5A6KA 3WQ6A 3WD3A 2CBVA 3RM4A 2NT0A 3AHZA 2FGZA 2VCBA 3WMCA 3ZR5A 4D6CA 2CXGA 1UD8A 1XSKA 1EA9C 3QOKA 2ZUMA 1AVAA 2D0HA 3BH4A 2V3EA 3B9AA 4PCSA 3DHPA 1QNPA 1E40A 4PMRA 1M53A 3GXMA 3T08A 1Q6GA 2WMGA 1JAEA 1J11A 1PX8A 4J7RA 3SUTA 3EBVA 1V3HA 1CTNA 1JYXA 1VFOA 1NP0A 1E1EA 2G4FA 4U3AA 5FKYA 1M03A 1XH2A 3PTKA 3WQVA 1ISXA 3N12A 3TA9A 2YOCA 2VZTA 1W2VA 4AD0A 4JHZA 1E1FA 3U7BA 2DT1A 4BS0A 1UZ4A 5I5RA 4GO9A 4UQ9A 3QOMA 4X0VA 1JD7A 2XIIA 4P7RA 3AXHA 4AD2A 5A3HA 4H7VA 3BAWA 1E73M 4GIAA 5HOSA 4H04A 4P8UA 1WZKA 2E40A 2D2OA 1UG6A 4MJ4A 4XZWA 3M46A 3WQ4A 2G41A 2WKGA 3BCDA 4MNJA 4U5KA 4BA0A 4MAVA 5A2CA 4UOJA 3W37A 1Q6EA 2WCAA 4A3HA 3VMPA 3MUY1 1SMDA 3LPGA 3WNLA 2Y4SA 1MW0A 1RP8A 1K9DA 1RH9A 3L4WA 2EPLX 1E0XA 3VU2A 4N42A 1CGTA 2DQXA 3DC0A 3POCA 4UTFA 4J3XA 5ABGA 5HXMA 1EHAA 2XUCA 1YQ2A 1VBUA 3CUFA 1SMAA 4UFIA 3VIOA 1CXHA 3ZR6A 3VIFA 2WLYA 4XUYA 1ZBKA 2DSUA 1J0JA 2D24A 2B31A 3KEHA 1UH2A 1UOKA 2XG9A 2J8FA 2WC4A 2HISA 4DWSB 2ZXQA 3W53A 1UKPA 5BXTA 4W7VA 4KH2A 2CITA 1J0IA 2E4TA 3GYCA 1H2JA 3LPPA 3CUIA 1VFUA 5BROA 3CBWA 2VZOA 3WF0A 4MNMA 4TVUA 3NDYA 1C7TA 1G0CA 1C8YA 1I75A 3MV11 2WZEA 2OWXA 2YBTA 2O9PA 2A3HA 4AWEA 2WZHA 1BLIA 3WUFA 4HA4A 1HKJA 3EDFA 2Y2WA 1FHLA 3MUAA 5A95A 1V3KA 1QI5A 2WWCA 1V6VA 5M5DA 4C7GA 1FP8A 4M80A 3FN9A 1W9DM 3WQ5A 4HMEA 4TTGA 4D6EA 2OSYA 1KFWA 3AS0A 1GW1A 3VIGA 2J7HA 3PZIA 4AISA 1CLVA 4TX6A 4TUFA 3DHUA 4H8VA 3VPLA 3AIVA 4C7FA 4QDMA 2FH6A 1UWRA 2WVSA 2PWHA 2V3GA 3OLEA 1JI1A 1V02E 1NOUA 3WFLA 4RE3A 4NF7A 3A47A 3PZOA 1E4MM 2VTFA 3W24A 1HJUA 2GDUA 5D8ZA 4WKHA 1EHNA 3AOFA 4IM4A 1V6XA 2VUYA 4D6HA 3FHQA 3THDA 1WDSA 3RO8A 3WDQA 4HOXA 5AC5A 4NI3A 1B3VA 4MADA 1GQLA 1R85A 2WYSA 3DYOA 3AIQA 2C0HA 3BMWA 1UYQA 4WK9A 3ZM8A 2DPEA 2TAAA 4WIWA 4W85A 3OGVA 4KMQA 5A1AA 4U33A 4J3UA 5CPTA 1ISWA 3AIRA 1JFHA 5ABEA 3VD5A 1CECA 1D2KA 4DM1A 4ATWA 1BGAA 3VIIA 2WPGA 1JZ2A 3FNDA 1FFQA 1XSIA 4AC1X 1ZS2A 3HN3A 4OZOA 3BGAA 4H8HA 1R7OA 1MW3A 6A3HA 3UCQA 2XM1A 2OWWA 3PZ9A 2F61A 5EFDA 4TTUA 1ZB5A 4QAWA 3RILA 2EEXA 3AI0A 2D0GA 1MW1A 1B3ZA 8A3HA 4PSPA 4ZE5A 2E3ZA 2PI6A 4BQ5A 1ZBCA 1OSEA 2XJ7A 2ZE0A 3WY1A 2G8ZA 1UD4A 2XM2A 1E4IA 1ZBWA 4GINA 1TG7A 4QFUA 2PBGA 1E0VA 1V3LA 1XGZA 4J3TA 3VGHA 2A3AA 2BV9A 3N15A 4AY1A 3VX1A 2X8RA 3BLPX 3CZEA 4MJ2A 1R87A 1BSIA 1G9HA 4AD1A 2VOTA 1EOKA 3ARRA 2D20A 5FIPA 4E8DA 4RE2A 5FCZA 1E6RA 2QV4A 3TTOA 1JDCA 1JNDA 1XHGA 2PWDA 2BXYA 1Q6FA 1DEDA 3B8SA 3T0AA 4CN1A 1UH3A 2PWEA 4PYSA 1JXJA 2J7CA 3OLGA 4EE9A 4Z2JA 1JF5A 3KL5A 4M81A 5DFAA 4CD4A 2DIJA 2ZXAA 3O2LA 3PHAA 4IPNB 1JZ4A 1W9UA 2EBNA 2XFRA 3EDDA 1XYZA 4UNIA 3DECA 1LLOA 3AMGA 2WMJA 3BAKA 5A8NA 5A69A 4W84A 4Z2LA 1BG9A 3APGA 3AJ7A 1BF2A 1EDGA 3AQUA 4U2ZA 1B3WA 4PBGA 3VD7A 4J3SA 3MMDA 3NJ3A 5I0DA 1CDGA 4PMXA 2ZXDA 1GJUA 1UR0A 3EDKA 2WVUA 4YHGA 4LXFA 4JIEA 3MV01 1GQJA 2OYMA 1ISZA 4P8XA 4CN4A 1QI2A 3SCQA 4H41A 4PRWA 3WNOA 1P6WA 1MQRA 1NWRA 4LYPA 3SUVA 3ARTA 1WO2A 3BLKA 3NSNA 4V28A 3AZSA 1HKMA 3AXIA 4HTYA 1MVYA 4F9JA 4PMNA 3I3DA 1IV8A 3AHVA 1HKIA 5ABFB 1H09A 1J9YA 3G6LA 3E1F1 4TVCA 4PMDA 2YKKA 2AMGA 3NIYA 2DT3A 3VGDA 2XPKA 2V38A 3WD1A 3WH5A 1UWTA 5M03A 1CGWA 3ZIZA 2A3CA 1S46A 4E8CA 4JFSA 4HU0A 1OM0A 1WDPA 3W6MA 5A6SA 2GK1A 1TA3A 1E5NA 2QMKA 1J0HA 4AZ5A 2FDMA 4RL3A 1OT2A 3AROA 3WDJA 1DWFM 2ZIDA 5GQBA 1JZ8A 4CCDA 5I24A 2YL9A 3L2LA 3D3AA 3RCNA 4EKJA 1JF6A 1BYAA 1FH7A 3O6AA 1W1PA 1QNOA 5KZ6A 3GH4A 2CKSA 4PMVA 5I3DA 2J7BA 3AZRA 3LPFA 2OWCA 5HPCA 2ZOXA 5E0FA 2QHAA 4PMQA 3OGSA 1OIMA 1C7SA 4AEFA 5D9MA 4UFLA 3POHA 3ARSA 2ZUWA 5A6LA 1KBKA 4U31A 1MXDA 1CXFA 5A8PA 2YDSA 3HMCA 3K8MA 1CXIA 3U57A 2BNJA 1GQKA 3M07A 5CG0A 2UY4A 2VVSA 3N18A 1FFRA 1PZ2A 2J75A 3AYRA 3ARUA 4GI9A 3UG4A 5HPOA 4ACZA 1BVZA 4J3VA 2F2HA 2J62A 4AD5A 4Z2HA 1OCQA 2WHMA 1U30A 3RPMA 2Y24A 3SCUA 5I6SA 1J0KA 9CGTA 2GJRA 4LX4A 5I78A 1NARA 5CPSA 5A6BD 1GCYA 1EGZA 3CTTA 4PTXA 1UKOA 2WZIA 1ZU8A 2XGBA 4ZEPA 4XB3A 3CZ8A 4HA1A 2WANA 3GH7A 1V0NA 3VIKA 3ALGA 2W61A 1KR1A 2DDXA 3CLWA 3L4ZA 2AOSA 1RP9A 1PEZA 4R27A 4JCMA 4S3JA 1RD6A 3L4YA 3PTMA 4W8LA 3WNNA 3UETA 4JAWA 1XD1A 1V6YA 1HL8A 3S2CA 3ZJKA 1AMYA 4ACZB 1CZ1A 1IT0A 1TMQA 1US2A 1H4PA 2WMIA 3CZLA 5BYWA 1TCMA 2D0FA 1BG4A 1CENA 2DIEA 2V5DA 1K9EA 2VNCA 1KBBA 3UG3A 2EPOA 4TX8A 3JUGA 3VTRA 2BVTA 5CQ1A 3VUPA 4ZXOA 1W3KA 2EPNA 3PBGA 1Z32X 1SYTA 1KR0A 1VBRA 3AMCA 1MXGA 3U7VA 1JG9A 3WDHA 3GTNA 2D22A 3KZSA 5C71A 3SCWA 1CEOA 1OD8A 1XH0A 2BFGA 4M24A 1O6IA 1CLXA 4XV0A 1C90A 4DUXA 1UKTA 1WB0A 3QHOA 1W3JA 3WMSA 1FOBA 1OGBA 2HVMA 5A6MA 3ALFA 2Y8KA 3VMNA 1D7FA 2ZUVA 3AYSA 1ODUA 1BYBA 2EO7A 5D9PA 2CYGA 2ZUTA 3CPUA 5JIPA 2RGLA 1QHPA 2WMHA 1ECEA 1G5AA 1CPUA 2O9TA 3GDBA 4UFJA 1EDQA 2QMJA 2E9LA 1B3YA 2G3NA 5CZKA 1CNVA 4PMZA 3WUBA 6TAAA 1SFSA 2W92A 1VAHA 3FW6A 1WKYA 3UR8A 5A2AA 3UERA 1HX0A 2BVYA 1OD0A 2ZUUA 1NWUA 2WVVB 2ZWYA 1XRVA 1D3CA 4GZIA 3MS8A 2AAAA 3SCRA 1JZ7A 5F7UA 1WAWA 2ZX6A 1EQCA 3W25A 1XC6A 2NW0A 4UQEA 3VILA 1JYNA 3UR7A 2QLYA 2WK2A 4PCTA 1HNYA 1GOQA 5E70A 2BS9A 3EMZA 2XSBA 4ATDA 1E6ZA 1WZLA 3MMWA 1UQZA 3T2QA 5C70A 1MYRA 3L4UA 2FGLA 3MSDA 4CU8A 4TXEA 1G1YA 5E6YA 5CXPA 1LWHA 3SCVA 3ZO9A 2VR5A 3VX0A 1KXHA 1B31A 2ZX9A 5LYRA 3OGRA 2DT2A 3BAXA 3M7SA 1BGGA 3W27A 1DWHM 2VZUA 3UESA 2OYLA 2WHLA 2WB5A 3BSHA 5M3WA 4UOZA 3WH9A 3D5HA 3K1DA 1JZ3A 3ZT5A 2YA0A 1Q4NX 3GXFA 1ODZA 1EDTA 3CO4A 3CUHA 1HP4A 2VX6A 1H49A 2J8GA 4UOQA 5E09A 2ZX5A 4ZXLA 2ZX8A 2PWFA 4OJYA 2WSPA 2O92A 4GQQA 2WKLA 4F79A 5BRPA 1VENA 4PN2A 3QGVA 1E70M 5E0CA 2WBKA 1E0WA 2XYLA 1MFUA 4UQBA 3ZJ6A 1E3ZA 3PZNA 5A94A 1E55A 4J28A 1K9TA 4JCLA 3A4AA 3VVGA 4CN6A 1WCGA 1KGWA 1LWJA 1G01A 5BCAA 4QLKA 4ACYA 5LA1A 2XVPA 2G3IA 3VD3A 3SCOA 1ISYA 4CVWA 3WF3A 3N04A 2D23A 2GSJA 4EK7A 4AIOA 8CGTA 3G6MA 2JEPA 2XTKA 2W91A 5DO8A 5BWFA 3AIEA 1V6UA 2QPUA 2VCAA 1NQ6A 3WDIA 4BQ3A 1JZ5A 3CUGA 4PTMA 1Q6DA 2VO5A 1Y7VA 1DTUA 2QPSA 2VRKA 3NSXA 5D4YA 2FHCA 4B3LA 3K46A 1RPKA 3TP4A 4M29A 2CEQA 3NUKA 2VZVA 5CJ5A 4Q7NA 1GQIA 4D6GA 2DH2A 3IJ9A 1QI4A 1KQZA 1TA3B 3WF1A 2CPUA 2JIEA 4DUVA 2WHKA 1JYVA 4ZE4A 1PAMA 2IXUA 3CH9A 4U2YA 4OBRA 1M04A 4BZYA 1PZ3A 3GNPA 1V6WA 1EO5A 3A4XA 2BVDA 1E9LA 1TVNA 2W5FA 4AEEA 2D3LA 1XCWA 1W1TA 3AZTA 1KGUA 1Q6CA 1EXPA 3ARZA 1LL6A 2OLHA 5GNXA 1GOWA 3VMOA 3QHNA 3ZQ9A 2WMKA 5ABFA 3SCTA 1BTCA 4MDPA 4WKFA 4PSRA 1BAGA 4W5ZA 4XZBA 4GPNA 3ARYA 4MAZA 3AISA 2BY0A 1V0LA 4X9YA 1UWQA 4CVUA 1F4HA 3SCSA 2Q8XA 1W9XA 4HOWA 2C7FA 5DF0A 3PZGA 2WNWA 4UQCA 1EO7A 4ZENA 1NWSA 3VNYA 4W87A 1GORA 6CGTA 1LQ0A 1E15A 3SEPA 1J0YA 3WBAA 1UD5A 3KL3A 4HPGA 2YL8A 4D6IA 3EMCA 3T2OA 1V3JA 3RM8A 2DSZA 4OOUA 5GPRA 2EQDA 3AMDA 1HN1A 3AHYA 1OB0A 2EPKX 2J4GA 3CHFA 4MB1A 3GNOA 5AYIA 1GVYA 5DT7A 2VQTA 1GZJA 5DEZA 3OLIA 3ZT6A 2UWFA 3VIPA 5JBFA 5AYBA 2GJXA 2Y8VA 1LG1A 4UCFA 4D1JA 3ARQA 3VDBA 4P7LA 1VJZA 1QBBA 5D8WA 3AMKA 3EDJA 4DM2A 3BMVA 1KXVA 3ECQA 1IZJA 4IPLA 5D9OA 3WEOA 3WH6A 1J0ZA 4BCEA 4B3KA 4CU6A 2NSXA 2WMIB 1X1NA 4FLOA 3W0KA 1FHDA 1V02A 4V2XA 4D72A 3WF4A 4PMOA 2Y5EA 4JL1A 4WLCA 2WC7A 1GONA 2ZXBA 3SIMA 5C8BB 2CESA 3S6TA 1C93A 3BAIA 4M8UA 2F8QA 1H0GA 3WEMA 4CCCA 3IJ7A 2XHYA 3I3EA 3MKKA 3VGFA 1KB3A 3N17A 2DSVA 3RIKA 1M7XA 5AC4A 2ESCA 1FA2A 3FAXA 4JFUA 1PBGA 3WL0A 1X6LA 3OIHA 2W4XA 1V3IA 4P7QA 3AMLA 2CCRA 2JF7A 2JF6A 1V03A 2OSWA 1UQYA 2V3DA 2YLLA 3A6OA 3CUJA 1E5JA 4UFMA 3AS1A 3W4RA 2RGMA 4AIUA 4HP5A 1OWQA 3F5KA 3WSUA 4HMCA 1EOMA 2FH8A 5FL1A 1CGVA 2QF8A 4GZJA 3VGEA 3VM5A 4LYRA 1DWJM 5TD4A 3KWXA 3CHDA 3BSGA 5LA0A 1PPIA 3SCPA 4F9DA 3AICA 3TTYA 3VD4A 1E6PA 1UHVA 4JKMA 2W62A 5FL0A 4Y7EA 3MANA 1KCLA 1ITXA 2XFFA 3MUIA 5A8QA 3SCNA 3T09A 1HT6A 4URIA 1HJVA 4E2OA 3IJ8A 1KWGA 2WSKA 1QI0A 4XX6A 5HNNA 3CZKA 4DWSD 4U3CA 1R8LA 3VD9A 3NDZA 2WW5A 2JALA 3DYMA 4BQ4A 3AHXA 4WF7A 2D1ZA 3EMQA 4UFKA 1F4AA 3EDEA 1K6AA 3WD2A 3WDPP 3WKZA 1UH4A 5IXEA 3QHMA 2VR4A 2VX4A 5GNYA 4P7OA 5JUVA 2J7GA 4HU8A 3OZOA 3WNPA 1WNOA 3RJYA 4MB4A 4JFTA 2VX5A 4L4OA 1XD0A 1ZL1A 5IDIA 1MW2A 1BFNA 1DHKA 3A4WA 3VOCA 4HPHA 2XGIA 2VRQA 4AZBA 1JDAA 1CXEA 1UKSA 2YLAA 4DWSC 4CD6A 5IHSA 5D9NA 1JAKA 1FP9A 2IXVA 1XYFA 3CHEA 3WEZA 2DGAA 5EMYA 4E4PA 4GZEA 1PX3A 1UR1A 1B9ZA 1JGIA 4QLJA 3WUEA 2PB1A 1JIBA 4CKQA 1HVQA 3W82A 2UY3A 1WDQA 5DMYA 4WKAA 1GJWA 1TVPA 3BAYA 3VKKA 1JZ6A 4BF7A 2VURA 4AIEA 1M01A 1DWIM 3W26A 4UR9A 4KRUA 1L0PA 1AQMA 2PBOA 1VF8A 4KGLA 1GVIA 2BHYA 4UFHA 4WSJA 1JXKA 1TR1A 1CXLA 4BQ2A 1JFXA 4S3KA 3PZMA 2BXZA 3CMJA 4PEEA 5EFFA 2VZSA 2VC9A 4A4AA 1UA3A 3ZJ7A 2CERA 5JIWA 5FOOA 3UG5A 1OT1A 2D3NA 4YPJA 2BY3A 3CMGA 3WD4A 3K4AA 4M56A 4AZ7A 4KRTA 1WDRA 1NM9A 2O9OA 4X0NA 1A3HA 1H41A 1KXQA 2YIHA 1V0MA 2J74A 4QP0A 1BYDA 3ZMRA 3ZJ8A 3B9EA 1JI2A 1ISVA 4B9ZA 2ZWZA 4D1IA 5HBFA 3II1A 2X09A 2CBJA 3MUZ1 3VDAA 2VRJA 1EH9A 4W5UA 2XSAA 1QHZA 1WZAA 1KGXA 4AMCA 5A8OA 7A3HA 1JYWA 4MB5A 2XIBA 2J7FA 4HA3A 4QCFA 1HXJA 1VB9A 4Z2IA 1KQYA 3NCOA 2EJ1A 3KL0A 4CGTA 4GKLA 2XVKA 2DT0A 5E9AA 3CGTA 4AD3A 3FY1A 4RE4A 5DT5A 3AIWA 2CNCA 1UA7A 1B3XA 1B1YA 1CGYA 3PZUA 1UD2A 1EQPA 3GXIA 1W3HA 4ML4A 2XVLA 1GUVA 1HIZA 1V0KA 3QR3A 3ARXA 1UR2A 1H3GA 1R7AA 1J10A 1OBAA 3WMBA 5CGMA 4OIFA 3VM7A 4PMYA 5E6ZA 1EIBA 1WE5A 3SURA 1AQ0A 1WZMA 1W1YA 4PUDA 2E8YA 1PIFA 3K8LA 4MB3A 1GOIA 1OINA 4A3YA 3F5JA 2YA1A 2VJXA 4JZ5A 1IZKA 1TFVA 1V3MA 1OIFA 1O7AA 3PZVA 1BHGA 4FF5A 3CZGA 1CIUA 1JNEA 3A3HA 3VIHA 3W28A 2XWDA 3RJXA 3AHTA 4D6DA 5IFTA 1LJYA 2J25A 2G3MA 1CBGA 1QNQA 2J7DA 4W88A 1LL4A 1MQPA 2XFYA 5BRQA 2FHBA 4FLSA 4OUEA 5CSUA 3CIVA 2WMFA 1B90A 1GOKA 2GFTA 4PMUA 3M6DA 4PTVA 2CHNA 3MMUA 1UKQA 2VL4A 5ECUA 3KE0A 3J7HA 4H2CA 2ZX7A 5BXPA 4UZUA 2X05A 2WWDA 4ATLA 1PIGA 4B9YA 1LL7A 4GO8A 3T0DA 4R5EA 4FMVA 1LG2A 3TOPA 1C8QA 1AQHA 3ZSSA 1YHTA 1XCXA 2X2YA 5M17A 1VEOA 5A8MA 2CIPA 5I23A 1JD9A 3ZOAA 3K8KA 5I79A 1E4LA 3BXWA 3IK2A 3AXXA 2WC3A 4M82A 3AS2A 1ESWA 2YL6A 4AZCB 1GOMA 4D6JA 3T2PA 3IANA 3F5LA 5JBDA 1HJSA 3UEQA 3OLDA 3L4XA 5IFPA 2JEQA 3F4VA 2YDRA 1ZBVA 1HKKA 1W9BM 2X0HA 2CHOA 1HJXA 4FLRA 4AXNA 1W9VA 2EPMX 4J27A 7TAAA 1E4NA 2Z1SA 4N0RA 3L4TA 4AZGA 3WL1A 1E43A 4AW7A 1DWGM 4DWSA 1N82A 1UWIA 1CWYA 2WCGA 3THCA 3AS3A 2J77A 1XV8A 4GI8A 2J7EA 5EBAA 3VIJA 1U33A 4W86A 2WAGA 3WENA 1OGSA 5A6BA 2Z1KA 3HJEA 1QOXA 3CZJA 3LPOA 3N1AA 1K9FA 3BCFA 2YA2A 3WH7A 1VFMA 2VT0A 4UQAA 1FH8A 3PZTA 1GHSA 1BVNP 4KGJA 2BHUA 4JHOA 1FH9A 1MWOA 1GHRA 7CGTA 3MSGA 1GPFA 5BXSA 1J18A 4Q22A 1H5VA 3PN8A 4HZ8A 3GXDA 1XH1A 2VMFA 1C92A 4L4PA 3GBDA 3W38A 4FK9A 1CGXA 4CUCA 4WSKA 5KEZA 3RDKA 3O9NA 4NZCA 4GI6A 4LPCA 3WQ8A 4NRRA 2NT1A 4JKLA 3WNKA 3N13A 3GNRA 4CD8A 4DUWA 2CBUA 1VIWA 1QVBA 2VI0A 1MFVA 2X1IA 1E72M 3WELA 1C3FA 4AD4A 5CLTA 1KWKA 2VQUA 3VGBA 4P8VA 1JDDA 2WHJA 1NOWA 2GK1B 4EANA 1HJQA 4PUEA 1E56A 1A47A 1VJSA 1J12A 2G3JA 1QNRA 2GUYA 1I1WA 2WM0A 1E6QM 1UD6A 3VDHA 4HOZA 2DEPA 2GDVA 3BAJA 4M1RA 4UZSA 2W63A 4KWUA 1UR9A 1VRXA 4OOZA 2JE8A 2CKRA 1LF1A 3VNZA 2V3FA 3AIUA 5I2UA 1NP2A 1J01A 1W32A 4MNLA 5AY7A 3VIMA 1TUXA 1VFFA 4JL2A 4Z2GA 3GZAA 1NH6A 2VX7A 3TONA 4AZIA 4F8XA 4CCEA 3NSMA 1OGGA 1KXTA 1ITCA 1ZJBA 3VO0A 1E6NA 4C7DA 2ZUNA 2FHFA 5ABHA 1BPLB 1QHOA 1E6XM 4UQDA 3EYPA 2C8NA 4AYSA 3N11A 3W29A 3OA5A 1G94A 2CBIA 2X0YA 3L4VA 4IUGA 4K68A 4LQ1A 3OBAA 2UY2A 4W8AA 1QW9A 1PX4A 2JIWA 1C8XA 1V08A 3WQWA 3IAQA 1E71M 1CGUA 2IUZA 1NWTA 2DSKA 2DSWA 2PWGA 2YJQA 4TVDA 1ZJAA 4AZ6A 5A6JA 1MQQA 2A3EA 4D6FA 3AIBA 5A2BA 1UR8A 1JL8A 1HL9A 2WBGA 3N9KA 1UD3A 4CD7A 2WLZA 2WCSA 1H1NA 4W7WA 3VDCA 1B0IA 1E3XA 2YBUA 4U5IA 2WVVA 2E9MA 3OB8A 4JFWA 2ZUSA 3WBEA 1L8NA 3OZPA 1HJWA 4AZCA 3VGGA 1UUQA 2PF0A 4JKKA 3FXYA 3I3BA 2JFEX 5IHRA 5JBEA 1UZ1A 4P7NA 1W2PA 1WPCA 2BY1A 4HMDA 3SUUA 2J47A 3WDRA 3SUWA 3WF2A 4YN5A 4W89A 1BYCA 4MDOA 1U2YA 2DH3A 2GVYA 2MANA 4B15A 1H0IA 2E9BA 4AZHA 1QI3A 1KCKA 5CPQA 1CYGA 5FD0A 2GJPA 3WN6A 5LA2A 2GJXB 3LMYA 2YL5A 1I1XA 4W7UA 4ZFMA 1BQCA 3ZSTA 4D71A 4F66A 4OKDA 4JFVA 1TE1A 1GNXA 4MTVA 1GOOA 2BHZA 1XSJA 3WD0A 3MU7A 2CETA 1QBAA 3FHAA 5HDRA 3TTQA 1TZ7A 3SUSA 3FAWA 2O9RA 1W1VA 2V5CA 3PZQA 3OG2A 3ARPA 5EB8A 1SR0A 1PJ9A 2PC8A 2XVGA 2UY5A 1R86A 3GBEA 4H8UA 3BC9A 1B30A 4IISA 4P8WA 3RMEA 5BXRA 4YHEA 3TTSA 4B16A 3U5YA 2YDQA 4GQRA 5CGTA 4PTWA 4NRSA 1CXKA 1NOFA 3B9DA 2BY2A 2J78A 4QCEA 1HP5A 3W81A 1DP0A 4HZ7A 2EXOA 2XWEA 4NSBA 1QW8A 4MNKA 3WH8A
chains in the Genus database with same CATH superfamily
4H4IA 3DYPA 3OG3A 1FX6A 1W91A 3E2RA 4DI8A 1WKFA 1EL3A 1WP6A 1UR4A 1KV8A 2PE4A 1IGSA 1LM1A 1FWJC 4YS1A 1HF6A 2O55A 3W22A 3GM8A 3WNMA 1H11A 4OBSA 3CHCA 4GKTA 2XVNA 2J13A 4Q4RA 4Z2KA 3KZPA 1XIJA 1W3LA 2H9AB 4J40A 4W8BA 2PDCA 4CU7A 3TW7A 4FNPA 2X1UA 4DPQA 2W66A 4PL1A 3AFBA 3GC5A 4QG6A 3K4DA 3FS2A 3HG4A 1KFCA 1RQHA 4GBDA 4ERGA 3HBLA 5I03A 3ZT7A 2A6LA 4V27A 4LGXA 5BOOA 3QN3A 5F4SA 4HNOA 3SFKA 3WQ6A 1GTHA 3O0KA 3N3TA 4X2RA 2Q3RA 1TJPA 4XVEA 4WCJA 3QOKA 6REQA 3ORWA 4RNIA 4QHRA 2QR6A 1M53A 3GXMA 4OBTA 1JAEA 1FWIC 1HL2A 3SUTA 3EBVA 1CTNA 3WJSA 4U3AA 4QROA 1M03A 3PTKA 4HPNA 1R9YA 3LTSA 2VEMA 5HMFA 5C2GA 3UNTA 4BS0A 3VC6A 1LWIA 3L66A 3KBSA 4GG9A 4EPKA 2I17A 4RZBA 1WXYA 3MSRA 4CNPA 2BGNE 5MHBA 2BP1A 4TIMA 1ZUAX 3P5ZA 4L9YA 2FVLA 3G8RA 2G41A 1TUFA 3NPUA 4L6DA 3U6WA 4BA0A 4OECA 3W37A 3TJLA 2A7RA 4FP1A 3NQMA 1ITQA 4NIRA 3VMPA 4MLRA 4AYGA 2FPVA 1BD0A 3MUY1 3N4EA 3E2QA 3ZWSA 1TSIA 4L6OA 4MWAE 1K8XA 3W7PA 1CW2A 1RR2A 3FDGA 1E0XA 4RCXA 4N42A 1CGTA 1Y65A 4XSLA 4DLMA 3BARA 4MMWA 4WEVX 5HXMA 1YQ2A 3F7JA 1SMAA 3G1HA 2PDKA 3P67A 2D73A 4PCFA 3UZJA 3R12A 2WLYA 1ZBKA 2DSUA 2C15A 2Y89A 1M1BA 4XKYB 2B31A 1SW7A 1R46A 4BR1A 1BWVA 2ZXQA 1UKPA 3KHDA 3LCLA 2CITA 3UZZA 1J0IA 2FZNA 3LPPA 4UTTC 3M0IA 3CUIA 2VGGA 4DLFA 4TVUA 2IMRA 1C7TA 4NNBA 1OX6A 3REQA 1I75A 2WJEA 6XIAA 1GYNA 2C6QA 2YBTA 4O57A 5KZMA 2A3HA 4AWEA 1GVQA 3HPAA 4HA4A 1E9ZB 6PTDA 1QO2A 4HYVA 3RUBL 1T96A 3EDFA 5A95A 5LHFA 3NA8A 1AMKA 4WX2A 1QI5A 1R9ZA 3JR2A 4DJDD 4DXVA 2DY3A 1W9DM 4B90A 4HMEA 3V16A 1KFWA 1BTMA 4JTAA 3AS0A 2QJMA 2GGIA 4ZOEA 4AISA 4RKAA 1HGYA 2RUSA 4MG4A 4F0SA 3VPLA 3QXBA 4IT1A 4IZGA 1UWRA 2WVSA 2V3GA 3UT0A 4AHOA 1O60A 3PZOA 5C6MA 1B54A 2ZRYA 4FOJA 5KSWA 2GDUA 3ANYA 5D8ZA 5FAJA 1TPUA 3OEXA 3KDNA 1EHNA 3S46A 5BRBA 3UD6A 1F76A 3EWXA 4F0LA 2VUYA 1NF0A 1FWTA 4KEUA 2FFIA 3GG7A 3RO8A 2IW0A 3HMJG 4HVXA 1GQLA 3SGGA 1R85A 4OT7A 3DYOA 2C0HA 1UYQA 3IUDA 4S3DA 2P1FA 3GTHA 2DPEA 3KRUA 5C7VA 3RLHA 3OGVA 1EYWA 4M19A 3HPXA 7ENLA 3AIRA 1JFHA 2R1MA 5ABEA 5EMMA 4LNYA 2ZFAA 3MCOA 4ATWA 3MCMA 2CWNA 5CAKA 4RE0A 3CS2A 2WPGA 1LYXA 5AC6A 3FNDA 3OTRA 2VC7A 5HATA 1U5JA 1MW3A 3VFLA 3CQJA 2XM1A 3R5EA 3PZ9A 2OKOA 3CNYA 2Z2UA 3K1GA 1QK2A 3BICA 3ZFHA 4XWUA 1KA9F 1ZBCA 1OSEA 4C1NB 1ICPA 5KITA 2XJ7A 3WY1A 2XM2A 1ZBWA 4GINA 1UW9A 3WLKX 4QISA 1V3LA 2BV9A 4A35A 4AY1A 4NXSA 5CC3A 1BSIA 1J93A 3ARRA 2CLEA 4J35A 2DUXA 2QCDA 4X63A 4OVXA 1XHGA 1W1B1 2PWDA 1TMHA 4G7FA 1EPXA 3B8SA 1EJSC 3H2NA 3LERA 1F2JA 3V0UA 1KRMA 2J9XA 4CNTA 2DUAA 1TV7A 4Z1CA 2DIJA 4H9VA 1KBIA 3O2LA 2A85A 1JR1A 1W9UA 4NILA 1IF2A 3EDDA 1XYZA 4UNIA 3BAKA 5A8NA 4W84A 4RK8A 1BF2A 2VHLA 3H2OA 3VD7A 2J24A 4GGBA 1X1ZA 4IJRA 1F8MA 1ENUA 1GJUA 3EDKA 4YHGA 3IVUA 4MPQA 3GU1A 2PZNA 1ISZA 1UMLA 1QTWA 4MJZA 1NWRA 4LYPA 3ARTA 4V28A 4ZCWA 4IL2A 1PKMA 5ABFB 2H8XA 1J9YA 1AZ1A 4TVCA 2QNEA 3GZ3A 3MW7A 2F2KA 2DT3A 3CL7A 1EA0A 3RR4A 1UWTA 1CGWA 2A3CA 3GFZA 1X38A 2OTDA 4JFSA 2BOGX 3H70A 3KOWA 5A6SA 3GDRA 3NQBA 1IGWA 4S38A 3W6MA 5KINA 3ATYA 2GK1A 1DE5A 1TA3A 3QRHA 3QTPA 2QMKA 3LSCA 4NASA 1DWFM 3IIVA 2A0NA 3ICJA 4JDYA 5EU9A 3QQWA 3D3AA 1K1DA 3LCFA 1BYAA 1IT7A 4RXFA 1QNOA 4KPLA 1VLIA 2QHAA 1OIMA 4AEFA 3POHA 4KCWA 1SFJA 3EB3A 4JEJA 1VJIA 2P8BA 5A8PA 3BLFA 4ADTA 2IS7A 4O0ZA 1GQKA 3M07A 5CG0A 2DJLA 1N8WA 3N18A 4DYEA 4FNUA 2J75A 1FCBA 3C3NA 1RLDA 4GI9A 4H9UA 5HPOA 1W6TA 4GYPC 4AD5A 2GSHA 4H7ZA 3AUOA 3RPMA 4NKCA 1I45A 2ZRUA 3R8RA 4KEVA 9CGTA 3U2OA 3LZ5A 4UTJA 5I78A 5CPSA 1GCYA 4MY9A 1UKOA 4ZEPA 5LNUA 3C2VA 5BOEA 4QEHA 2XISA 3T4WA 3TR9A 3L4ZA 1YMYA 1RP9A 4R27A 3VNIA 4EXBA 4JCMA 1FDJA 1I2QA 3SO7A 3PTMA 4CQ8A 4W8LA 1ZSXA 4JAWA 1XD1A 4GOAA 4KEMA 4F0RA 3ZJKA 4ACZB 3STFA 1IT0A 1TMQA 3GVRA 3KX6A 2OO6A 3AU2A 4NQ1A 5HQLA 5BYWA 3SSJA 2D0FA 2Q6ZA 2V5DA 3MO7A 3TFXA 5AKQA 1XINA 2EPOA 3NPVA 3VTRA 2BVTA 3CAKA 3QBUA 4Y90A 2RKXA 1ME8A 4U28A 5GJNA 1VBRA 3U7VA 3WDHA 1ML1A 4H2HA 5C71A 2D22A 3SCWA 1QUMA 4EXAA 1O6IA 2R6OA 4JX5A 1DXIA 3CTLA 1SU5A 4LT9A 3R58A 3GR7A 1A50A 3VMNA 4IWWA 2ZUVA 4MWAC 2QCDB 3VXGA 4KW2A 2ZUTA 1FWCC 3FJLA 5FSEC 1XW8A 4RPQA 3H23A 1SZRA 1K7XA 3PBVA 5HQMA 4FNQA 3GDBA 3VAVA 3DI1A 1FCVA 3MKCA 1KD0A 2W27A 5AHIA 4KBXA 3QVQA 2ZQ0A 4PMZA 1SFSA 3VZYA 3UR8A 1NDYA 4D8ZA 2ISVA 5DX7A 2ACSA 2BVYA 3TCSA 3W73A 2WVVB 4GZIA 3O05A 4ZQMA 4JTTA 1EQCA 3W25A 5G5IA 3BANA 2PDJA 2QW5A 1JYNA 7REQB 1LDCA 4B4HA 3UR7A 1HNYA 1GOQA 3EX6A 2BS9A 3I6TA 1E6ZA 5EMUA 1Y8BA 3G1SA 3KP0A 3ZO9A 2W6RA 3B0PA 1KXHA 2VP8A 3OGRA 2WQDA 3P81A 1BGGA 3W27A 1DWHM 1YE4A 3LY0A 3S1VA 3GTFA 5M3WA 1PXGA 1PS9A 4DY1A 3VOJA 3B05A 3DBNA 3WQDA 4PFMA 2XU2A 3ZT5A 2V6AA 1E9YB 1Q4NX 1ODZA 2PF8A 4IIHA 1GJPA 2PTXA 1H49A 4ZODA 1FHVA 4UOQA 5E09A 2GGGA 4WDWA 1DHPA 3WJZA 4PN2A 3QGVA 3MZNA 4C6KA 1SSGA 3PBWA 1E70M 5PTDA 5C9WA 3ELFA 4IQLA 1XUUA 2YR1A 1K9TA 1DPMA 4LEFA 4JCLA 3TSBA 4O1EA 3A4AA 1WCGA 1KGWA 1LWJA 2DZVA 1G01A 3G1FA 3B9OA 1L6WA 2XVPA 3SM0A 1ISYA 4DELA 4K39A 3FK4A 4AY8A 3QEZA 3BPWA 4HNTA 1XLHA 3PBYA 2PDYA 2GSJA 2PEVA 4K8EA 5BWFA 1V6UA 2HXUA 8TIMA 3LQLA 2DZWA 3RX4A 3WDIA 5GVJA 1XXXA 3NQ8A 2QPSA 2VRKA 4RV8A 1IXOA 2VZVA 5CJ5A 1GQIA 3F4NA 1N8FA 2DH2A 1MDRA 1EC7A 2PU0A 2Q3OA 2JIEA 2X0SA 3QR0A 3MJMA 4DF0A 4POCA 4F0KA 2IXUA 1A3XA 3CH9A 1VHCA 1ECQA 1M04A 1PZ3A 1EO5A 3A4XA 4AQLA 2BVDA 1TPWA 3RXZA 1W1TA 3ITGA 3T4CA 1EXPA 1LL6A 2OLHA 4TMCA 4NZ4A 4XO7A 4JHMA 1WBJA 1V8EA 3QHNA 1OADA 1W5QA 3N2MA 3W7OA 4UMCA 3A21A 1WKDA 1BAGA 4W5ZA 4A2SA 4REQA 4GPNA 3ARYA 4MAZA 3AISA 1V0LA 3PUOA 3LBOA 3SCSA 5JQ9A 4FHAA 1TR9A 3N2CA 7PTDA 5DF0A 3PZGA 1XYBA 3EKGA 2WNWA 2VEKA 2DVTA 4MWAB 2P3ZA 3IJIA 6CGTA 1LQ0A 3LNMA 2VEGA 4JDBA 3EOLA 3LRLA 1YDVA 4HPGA 3GWQA 4D6IA 1TPEA 3RM8A 1S2UA 4UNLA 5LIWX 5F4WA 5HR6A 3NQVA 2HE8A 5GPRA 3QYSA 3KHJA 4H1ZA 3M16A 2J4GA 3R8HA 3GNOA 2OGYA 4F40A 8XIAA 2UWFA 3F2DA 5AYBA 2GQ9A 3R43A 5FAGA 4B5VA 3VDBA 4A05A 3EOUA 4LF2A 3GAYA 3NQEA 3R13A 1VPXA 3M0MA 3C56A 4DM2A 2WNZA 3KAOA 4KWWA 1Q45A 4PH6A 3BMVA 2X7WA 4IPLA 2NQ5A 2I5IA 1A0DA 3TE9A 4AIBA 3IIOA 5JH1A 3T55A 3M5YA 2ZZ3A 2GVEA 2NSXA 2WMIB 2JKAA 3E12A 3F4DA 4QQUA 3W0KA 4V2XA 4XD4A 3CIWA 3P8IA 2YCLA 2C71A 2ZZ4A 4JTIA 1O4UA 3S6TA 2QGYA 2XHYA 3MKKA 4US5D 2FPTA 1KB3A 4NYUA 2DSVA 3MA8A 1FWDC 4BWLA 1A5NC 2OX1A 5JH2A 4FAMA 3ANUA 3OIHA 1V3IA 1A5LC 1M3UA 3AMLA 2JF7A 4MF4A 5G1YA 4NNCA 1A5UA 2OSWA 1RJRA 1UQYA 2YLLA 1C9WA 3SQLA 3P74A 3VOHA 3EB2A 3F5KA 2PDUA 4J5NA 3UJRA 5FL1A 2FH8A 4ONVA 3FSTA 2QF8A 4GZJA 3VM5A 4LYRA 1DWJM 5TD4A 3BSGA 4Q4MA 3TN5A 3VA8A 2XFFA 4DJDA 4LCRA 1HT6A 4E2OA 5DY3A 3IJ8A 2WSKA 1X98A 4IXXA 3WLLA 3CZKA 3VNMA 4C6CA 4DBUA 2ONEA 3NDZA 2JALA 4BQ4A 1RALA 4MJMA 3UCDA 4H9MA 1YPFA 2CZVA 3WDPP 4YXGA 3WKZA 3U48A 4HYRA 4RDWA 3TJ4A 3CAWA 2G37A 5FJUA 1TV3A 5GNYA 4FX8A 1KM3A 9XIAA 3S8HA 3DHFA 3GVGA 3NO1A 1LORA 4CNOA 3WNPA 4MB4A 1HKVA 3W1AA 1BFNA 3HTWA 3QTGA 1Q7ZA 3TLQA 1YE6A 1JDAA 2ZTJA 2R14A 3G1DA 4M6QA 1ITUA 1L2QA 4CD6A 2E6DA 3E0WA 3GNXA 4M6UA 1R3WA 5EMYA 1B9ZA 3EWDA 1ADOA 2PB1A 3OZYA 1JIBA 1VBGA 3B0UX 5DMYA 1XC4A 1VR6A 3BSMA 3PSWA 4AIEA 1QT1A 4YTRA 4JBRA 4KRUA 3TWAA 1AQMA 4DXXA 3P80A 1AH0A 3SW6A 2IKIA 4KGLA 4Y8EA 1GVIA 1DYSA 3UWUA 3QY8A 1JXKA 3TU9A 3UU0A 1HKWA 4FNSA 1H7NA 4PEEA 1X39A 2AKMA 3A64A 4D8AA 1UUMA 5JIWA 1UZHA 2FZDA 4E2VA 3MI3A 3N6JA 3IWPA 2O7SA 3W2KA 4M56A 1UOZA 3LS9A 3M0JA 4H3DA 4C6LA 1ZNNA 4KRTA 3MUXA 4GBUA 4H9YA 3NQ7A 4KERA 3BTNA 1Q6LA 3E38A 1H41A 1KXQA 2YIHA 1QOQA 4K1GA 1ISVA 3PS7A 5I7GA 1KFEA 2NV2A 3II1A 4NAEA 4KFOA 2TMDA 1W56A 1AJ0A 4AMAA 3MUZ1 3VDAA 3PFRA 1QU4A 2XSAA 1QHZA 1KGXA 4AMCA 7A3HA 1YYAA 2J7FA 4HA3A 4QCFA 1S2CA 2BTMA 3L5MA 2INFA 2PD9A 1KQYA 5MKGA 1XRSA 3F4CA 1RY8A 3HV8A 4GKLA 3KTXA 2Z7KA 5E9AA 3QY6A 5CKSA 3CGTA 4RE4A 5DT5A 3GQYA 3AIWA 3BDKA 2CNCA 1B3XA 1CGYA 2DZXA 3W23A 2NX1A 3H7RA 2PDMA 5FF4A 1LQ2A 3WO8A 3IVTA 4WD0A 3GXIA 4QSFA 4GJ1A 1GUVA 4L7ZA 2JBMA 1UR2A 1H3GA 1R7AA 4CNSA 4I9AA 3MDUA 3W7DA 3G0SA 4TU1A 3RRXA 1DJQA 2UBPC 2VFGA 2VEPA 4XZLX 5T9CE 1JQVA 4GYPA 3GHSA 2G5WA 3K8LA 3F5JA 2VJXA 1TFVA 3GNNA 4DJFC 1MUWA 1BHGA 3M4HA 3DG3A 3LCGA 3DESA 2GYIA 3S2MA 3CZGA 3A3HA 1FWFC 2XWDA 5H6HA 2GJLA 3HM7A 1B9BA 2G3MA 3B04A 2XFYA 3H4GA 5DELA 4FLSA 7ODCA 4DHGA 1WBHA 4OUEA 5CSUA 2NX3A 1B90A 3CC1A 2GFTA 3M6DA 4PTVA 3IACA 4UTHA 1ME9A 1JPHA 5HNRA 4XTIA 3NGFA 4S3CA 2X16A 3DIPA 1KM0A 1SO4A 1PIGA 2G97A 1IHIA 2VDIA 4FMVA 3TOPA 1AQHA 1REQA 4A21A 5A8MA 2CIPA 4C6OA 4GUGA 3ZOAA 5I79A 3T6CA 3DBPA 3IK2A 4OQVA 3STGA 3CV2A 3AXXA 3L23A 4G1KA 2WC3A 3BOXA 5K4ZA 4AZCB 1PDZA 4D6JA 3T2PA 3VI2A 4PUNA 3VC5A 4PTNA 3TDFA 4ROPA 1W5NA 1KV5A 5AHLA 2HCVA 4FLRA 4AXNA 4J27A 2EPMX 4A8LA 3OBEA 3W9ZA 4AZGA 1OZQA 5HUPA 2OCZA 1XYLA 2QCNA 4S3AA 3LGGA 3IRDA 2J77A 4IFKA 4W86A 4PTDA 1K3UA 6ALDA 4MUZA 3N1AA 4D2JA 1F73A 4AU0A 2VT0A 1EWEA 1EXBA 3GYEA 5D33A 4H6RA 1FKXA 5HJLA 5CCZA 7CGTA 3VZZA 1GPFA 1J18A 1ALDA 1H5VA 2AL2A 2XDFA 1JPDX 2VMFA 1C92A 2DZPA 4XK2A 4Q4QA 3KTCA 5EGRA 5AC7A 4WSKA 1UASA 3RDKA 1OG6A 4NZCA 2PWUA 2HWGA 5MF5A 1FWAC 3GNRA 5JXQA 2DU2A 3WK2A 2ON3A 1LROA 3A9IA 1V6TA 4DBSA 1VIWA 2X1IA 1TJ0A 1C3FA 4AD4A 1AK5A 5CLTA 1KWKA 3VGBA 3H2AA 4E0CA 3APYA 5CZJA 4I6KA 2Z1XA 4NNAA 3EEGA 3ITLA 1A47A 1OYAA 1PTAA 4HB7A 1PKLA 2CW6A 4ZOCA 2Z1VA 1E6QM 1UD6A 3TFCA 3VDHA 2QDHA 1EKOA 4HOZA 2DEPA 3MI2A 4H9XA 4M1RA 2W63A 4DJED 3NQDA 1UR9A 1X1OA 4LALA 2JE8A 1LF1A 2V3FA 4JICA 3PF3A 5I3KA 3EXRA 2E5CA 4GX9A 3ABRA 2VX7A 4O15A 3TONA 3A4JA 4L65A 1OX4A 1ONWA 4F8XA 3NSMA 1OGGA 6ENLA 1ITCA 3VO0A 1E6NA 5ABHA 1LUCA 4BF5A 3ABOA 1E6XM 1W17A 1G67A 4HK6A 2NUYA 4LRTA 3VKCA 1YKWA 3N11A 1OCBA 4NAEB 3UWZA 3WJWA 2PRHA 4FXRA 3TROA 4LQ1A 1YNPA 4W8AA 2E5BA 2JIWA 1C8XA 3WQWA 3UJFA 1TQXA 3IAQA 1E71M 3L0KA 1AW1A 2Q8ZA 1W0MA 2F84A 4JQ4A 3T7VA 3G0UA 3AIBA 2CZFA 1JL8A 2EF9A 3N9KA 4CD7A 1FUYA 1JCXA 3DG7A 3OOQA 4S1FA 4ZGYA 2EKCA 1LRQA 3W83A 3AC0A 3OB8A 1Q66A 3OZPA 3UZ5A 3T07A 4AZCA 1O94A 2QAPA 2VDGA 3USZA 1LT8A 3HFYA 3DCPA 3MVIA 4B2DD 5IHRA 1TJ1A 4FOUA 4P7NA 5HMDA 4JN6A 1WPCA 2BY1A 1VGAA 3RG6A 1LLZA 1DIDA 4IMCA 3WDRA 4BHYA 4G9PA 3I7QA 1XIFA 3HB9A 5SWUA 2XN2A 3WF2A 3M5XA 5EY5A 4W89A 3TK7A 1IE7C 4DZAA 1U2YA 3GNDA 1XJBA 2GVYA 5CBJA 4J2PA 4AZHA 5CPQA 1NTHA 3DGRA 5LA2A 4GJIA 4UTTA 3LGDA 4QE4A 5HNUA 3DI0A 1I1XA 1IQ8A 4D71A 3FGCB 3NZPA 3V0TA 1OFBA 1GG0A 1XSJA 1P7TA 4QDWA 3FHAA 4E2DA 3UYCA 1JDFA 1OFOA 5LSMA 5HDRA 3S3GA 1EJWC 1W1VA 2V5CA 3OG2A 1B3OA 4S2CA 5RUBA 1DJYA 2I14A 2PC8A 1W1IE 3AYTA 4H8UA 1T41A 5I00A 1JRCA 2X1TA 3C52A 4P8WA 3U5YA 4GQRA 1W5OA 4A3UA 3HQOA 3EWYA 2BY2A 1JJKA 1VPQA 3B9DA 3RX3A 4HNNA 3W81A 1K02A 4CNUA 1MNSA 4O50A 4S2BA 4AF0B 5JVLA 1W8GA 3A3WA 4OU1A 4DB7A 3OPSA 4MYAA 4JIQA 2X40A 4JS3A 3T0BA 4EAMA 4J3WA 4XISA 1IIHA 3TH6A 1TRDA 1XBYA 1M65A 1ZJIA 1DWAM 4B5SA 3I68A 4Z17A 2YPIA 1QPKA 3WUGA 2PRMA 2VWSA 2HBVA 5D2VA 3E96A 3TAKA 3U5UA 1R2RA 5A6AA 3FOKA 3LUTA 4ROQA 3LA4A 2QEZA 1YXCA 2QT3A 4GC4A 1X6NA 4N9DA 2E8ZA 2VVNA 5GNZA 3STPA 4JX6A 3RFAA 4XUGA 1D8CA 2HS6A 1CLKA 4CQCA 3JRKA 3WIJA 4GUJA 4R33A 3WFZA 3C86A 1KFKA 3T40A 3IV8A 2VR2A 4Q8TA 4KWOA 3T05A 3PAJA 3ZR4A 1G4PA 5AB3A 3WD3A 3RM4A 3WMCA 5AC8A 4GABA 3DG6A 3NAVA 4H6EA 1EA9C 4PUUA 3ZLHA 4A3RA 2GOKA 3CV6A 2AMXA 1JCMP 3DKLA 3D47A 3DHPA 1E40A 1ICSA 4UWMA 1NU5A 1PX8A 4HYWA 5CC6A 4UXDA 3GR4A 3LYEA 5AYZA 2J9ZA 3AALA 3MQTA 5LIYX 1E1EA 3W2LA 1XH2A 3WQVA 4DEFA 1Q8JA 4J2MA 2YOCA 1TRIA 1Q6OA 5AHFA 2Y5JA 4ILSA 4LANA 3U7BA 2DT1A 2IPJA 3LLFA 4BJHA 3QOMA 5BW6A 4UMAA 3H7UA 1JD7A 1TIWA 3B8TA 5F2IA 4ZOAA 2XIJA 1TJRA 3S2JA 9RUBA 2G96A 5A3HA 4DBDA 1E73M 3B0XA 4H04A 4P8UA 1X7IA 2HVNA 1EGVA 3VCCA 1QNVA 1VCGA 3C2RA 1GEHA 4XZWA 2OG9A 1CI1A 3SRHA 3TA6A 3BCDA 4MNJA 4U5KA 3GG0A 5A2CA 2BASA 4LUYA 2WCAA 4A3HA 3V1HA 2XINA 3S6OA 1KFLA 3LPGA 2Z00A 3E3HA 4Q32A 4QG9A 1K9DA 1RH9A 3L4WA 2EPLX 2DQXA 3OO2A 4UTFA 1M7JA 5G4WA 4J3XA 3EGJA 1UIOA 3CUFA 1XLMA 1UC5A 3GFXA 2Y62A 3NZ1A 4KCUA 1IXPA 5FI8A 2XH0A 3CK5A 2D24A 2Y6ZA 2ODOA 1UOKA 1UH2A 1EFZA 3H54A 4WOQA 1Q4WA 2ACQA 2Z0IA 4LFYA 5BXTA 1K8ZA 3KVLA 4W7VA 3JZUA 1H2JA 5E9XA 1VFUA 4RJEA 3CWNA 3TMQA 1XIDA 5KETA 1EUNA 5LNWA 2CXEA 3GDLA 4LBSA 1LOLA 2XFWA 3LI1A 4E3TA 4NX5A 1KCXA 1XICA 4RW5A 1M9HA 2JGQA 1BLIA 3A9BA 3WUFA 1HKJA 4FIQA 3W7KA 3SBFA 1XPGA 2I16A 3TYCA 4C7GA 3KBNA 2W9MA 3WQ5A 3NXLA 4TTGA 2NLYA 4D6EA 2I9EA 4H7CA 2IKJA 4U4MA 2ZVRA 3QV7A 3PZIA 4KCVA 1CLVA 7TIMA 5BMXA 4L80A 1Q5MA 1R9XA 4TX6A 1ZALA 2CLLA 4GH1A 1TV4A 4QDMA 1FWNA 2FH6A 2IPFA 5A5WA 1JI1A 1V02E 4PL2A 3E9AA 3WFLA 1YBQB 2FFCA 3A23A 2VTFA 4QGCA 4HTBA 3CM4A 3TEVA 3W75A 3WCZA 2PDLA 3SJ3A 3AOFA 3C61A 1FWSA 2XN0A 4CLMA 2XZ9A 3V4BA 4IM4A 4QE5A 3TX9A 5I3IA 1S5VA 1WDSA 3WDQA 4QJ4B 1B3VA 1QXLA 3AIQA 1X97A 3BMWA 4JIRA 2ZTKA 2C91A 4W85A 4ZO9A 3NQFA 2V82A 4KMQA 4R9OA 1O68A 5CPTA 1ISWA 2Q09A 4HN8A 2TYSA 1CECA 3GB6A 1T8XA 3VOIA 3KVJA 2ASHA 1SSDA 2X1SA 1JZ2A 1FFQA 4AC1X 4OZOA 3S42A 3NEHA 4KIRA 4ZO6A 6A3HA 3PTDA 1TTIA 2FVMA 3W2NA 5TIMA 4QAWA 3IPWA 2EEXA 2JGYA 2AL1A 2OEMA 3BJSA 3PPFA 1W5PA 8A3HA 4JTHA 1P1MA 3G8EA 4LVGA 3GUGA 1AJZA 4ZE5A 1SVDA 1QPRA 4BQ5A 1K7EA 3CLMA 2WO5A 3GG8A 4UBPC 3I6RA 2G8ZA 2Z28A 2DZBA 2QJIA 5DMMA 1E0VA 4OWGA 3NURA 4GRSA 1VFSA 3MHGA 1XBXA 1OJXA 1XPYA 2RDUA 2X8RA 4JYEA 4N6EA 5XIMA 1R87A 4N2YA 1EOKA 5FIPA 1NDVA 3HZ3A 2QV4A 2OT0A 3TTOA 2BXYA 3THUA 4ES4A 1RSCA 3T0AA 4PYSA 2J7CA 1DORA 4RV3A 1JCYA 4AVOA 1Y0EA 4Z2JA 5K9CA 1JF5A 3UXKA 4PCNA 3L68A 3PHAA 3ZXWA 1A5MC 3PPGA 3MBFA 1FWEC 4Q8WA 3PFMA 4Z2LA 3LHYA 2Y85A 5CZTA 5L6UA 2QS8A 3TXVA 4PODA 4HNCA 2CLOA 3MMDA 4J3SA 1ZTVA 3LSBA 1CDGA 1ONRA 3COTA 3UPBA 1OF8A 1UR0A 1XIIA 2WVUA 2BOFX 2HV5A 1Z41A 4GLEA 1GQJA 2QXWA 2OYMA 4P8XA 3P60A 1PWLA 1QI2A 5ENLA 1P6WA 3CPGA 4RDZA 1MQRA 1ONEA 3BLKA 4IIBA 5U4NA 3G6LA 3N14A 2G50A 4PMDA 2UZ9A 1XS2A 2YKKA 3NIYA 3UGVA 3VGDA 3THAA 2BDQA 4TO8A 4DJEC 2VOMA 3KXQA 2AL2B 1DTNA 1EZ2A 2I1OA 4AVNA 1P0EA 4HU0A 1K70A 1EGMA 1P0KA 5FJJA 4UTMA 4XBJA 4K7VA 5I02A 2QULA 1E5NA 2QJJA 2R1LA 1ICQA 2EGZA 3WDJA 5GQBA 3UNDA 1F7BA 1H5YA 4IMEA 4EKJA 3IGUA 1FH7A 1PKNA 1W1PA 5DMNA 4Y9MA 3GH4A 2CKSA 5I3DA 1XR2A 3TMLA 2OWCA 3OGSA 1C7SA 3HG5A 2FZMA 5D9MA 1SFLA 1PWMA 5CZSA 2AKZA 4FZIA 4U31A 4JTEA 1CXFA 3DUGA 2YDSA 4BFAA 3K8MA 1CXIA 1J5SA 2UY4A 3L21A 1V5XA 1UC4A 2WV8A 3UG4A 3S2NA 3TC3A 3FYOA 1BVZA 2Q71A 2HSAA 2C79A 5C2CA 1MRQA 1RBAA 5F2GA 3ANVA 1F5ZA 1NDWA 3UJ2A 1J0KA 2PLCA 2GJRA 4ZZ9A 1B4KA 4K6AA 1K77A 4HCDA 3CO8A 4BEQA 3PJWA 2XGBA 1MUCA 1ZU8A 3BJFA 1AH4A 1YNQA 2WANA 3BVJA 3GH7A 3NEVA 1V0NA 2W61A 1YRRA 4O8AA 4I9TA 5TBOA 1QOPA 3KBVA 4O10A 2OVLA 1PEZA 4E38A 4Z42C 4S3JA 4O16A 1FXQA 4YCPA 3DX5A 1XYAA 3SFWA 1I6NA 1HL8A 3M64A 1CZ1A 4K7YA 4CCZA 1US2A 5D32A 4RNHA 3CZLA 1TCMA 2DIEA 1KBBA 1ZP3A 3REQB 3UG3A 4TX8A 5E93A 4AHPA 4XAYA 2WNQA 2JKPA 3VE7A 1SYTA 4S39A 3AMCA 4HSNA 1JG9A 1EP1A 3ZVIA 3MP3A 1WX0A 3KZSA 3R4IA 1XH0A 4M24A 3WQPA 4BWLC 1ZPTA 4GIEA 4AG0A 3IK4A 4DUXA 1UKTA 4NY2A 2ZYFA 1UB3A 5CEWA 1W3JA 3WMSA 1FOBA 3SQMA 1E0UA 4XAFA 3PVFA 5M1TA 5D2TA 1TPFA 2CYGA 4MWAD 1JUKA 1TO3A 2RGLA 1QHPA 3BLIA 1EPVA 3UPWA 1FHUA 1QCWA 3BGGA 5BWAA 3LTYA 1EDQA 2UV8G 1RJPA 5CZKA 3BLDA 3WUBA 4H83A 1VAHA 1XGDA 3T81A 3QY7A 4AXKA 3ZLFA 1OD0A 4MFDA 1WV2A 1XRVA 1OC6A 1J96A 1H60A 3ZVHA 1EP3A 3SCRA 4QM1A 5F7UA 1MI3A 2J8TA 4UQEA 2A5HA 1YW1A 4I90A 2QLYA 1NSJA 4PCTA 3WZ0E 5E70A 3EMZA 4C6NA 1IWPA 4YU1A 3LRMA 1FXPA 1GVRA 3E2SA 2PDQA 1W8SA 4W9TA 3MSDA 4QNEA 4TXEA 3W85A 3H8AA 5E6YA 5CXPA 3VDGA 1WYIA 3EX1A 2VR5A 3VX0A 1XLGA 3H24A 3SI9A 3H2CA 3M7SA 2OYLA 5HR7A 3AXKA 3BSHA 4HHLA 3CAQA 3OW1A 1ZCCA 4LV4A 5DBUA 4LW7A 1IYXA 4K38A 3LU2A 2BLEA 3CUHA 1HP4A 5HAOA 2ZX5A 4ZXLA 1KKOA 3WLNA 4OJYA 3LG3A 4B5UA 3DFYA 4GQQA 2WKLA 3G1YA 3N6QA 4O0KA 3NDOA 4NZ5A 2RFGA 3V3WA 4M7SA 1E0WA 3S1WA 2XYLA 1MFUA 4UQBA 3PG9A 1OVDA 4C6DA 1E55A 1R3RA 3G1VA 3UA4A 1TWSA 3WLOA 4J28A 1Q8AA 2QPXA 4HPXA 3QC0A 3VKAA 1TV2A 3VVGA 4DF2A 3KCOA 4ZB0A 3OQ8A 5BCAA 2OZTA 2G3IA 3SCOA 4RDYA 4GQ0A 2DQWA 1U5HA 4CVWA 3CHVA 5T9BG 1O95A 1D3HA 4C6IA 1OYBA 5D30A 2P53A 4IGSA 2D23A 3UJEA 4AIOA 8CGTA 3BG5A 4LS0A 2JEPA 2QUUA 1GW9A 3ONBA 5DO8A 4ZA0A 1D9EA 2QPUA 3G1AA 1NQ6A 1BKSA 4BQ3A 1EC8A 4F0MA 3U9IA 3TCEA 2FHCA 4B3LA 1RPKA 4M29A 2CEQA 3NUKA 3CASA 2RDWA 4M3PA 2X1RA 3TN4A 2CLMA 1NJJA 1QI4A 1QO5A 2CU0A 3M1ZA 3E0VA 3V5CA 4M7TA 2Z27A 2PDXA 3S47A 4M6PA 2NSOA 4HD5A 4DUVA 2F6KA 1JYVA 5LIKX 1FKWA 4ZE4A 5CPNA 4EOUA 1K4HA 3AJXA 4U2YA 4OBRA 4BZYA 3GNPA 5I3FA 2DZSA 1THFD 3QSTA 2NVAA 4ZBCA 4AH7A 1MEWA 3UCCA 3ISIX 2W5FA 1KGUA 3ITOA 3W86A 3LCXA 1MSSA 2IQDA 3EWZA 3WBWA 1OCNA 3ZQ9A 2ACRA 1U1HA 1K03A 2BVWA 3U2CA 3W70A 1H62A 4PSRA 3M41A 4ZO8A 2O56A 3O0FA 1UWQA 4CVUA 2HPMA 4R3UA 2GPTA 1SW3A 4QSHA 3SIZA 3PJUA 2PZ0A 4GWEA 2C7FA 4GZ7A 4HKPA 5HJYA 1OFPA 1GVEA 1VZWA 4IUOA 4UQCA 2V8ZA 3LM7A 1J0YA 2A4AA 4IXHA 4X22A 1HG3A 1TX2A 2QQ6A 3S9ZA 2OLSA 3OYXA 4NL1A 2PDBA 3L65A 2DSZA 4MYXA 2PUZA 2H6RA 5LZLA 3AMDA 1XDJA 1AH3A 2YDAA 2EPKX 4MB1A 1XIBA 1GVYA 5DT7A 5F2MA 2WJDA 5DEZA 4GQBA 1CT5A 3VIPA 2VENA 2E68A 1J2WA 2QCMA 4F2UA 3T9PA 2E1WA 1O5RA 1F74A 3N29A 1QBBA 1KFBA 2YXOA 3NG3A 3PUDA 1LTDA 3CEUA 1IZJA 3GFYA 3IGXA 3WH6A 2HMCA 1J0ZA 4H6KA 5EYWA 3RO6A 4B3KA 5AVNA 1N55A 1W1A1 3FLUA 1X1NA 2IPGA 2GSEA 1SR9A 2PGFA 4D72A 2YZ5A 2YYTA 2ZZ1A 1GTEA 1QPQA 5L9FA 3IRSA 4LUTB 2PP0A 3WMLA 5CZ0A 2RAGA 1C93A 3BAIA 3KOXA 2AGKA 1GKQA 5D04C 4LY8A 5AN7A 3VGFA 3N17A 1XDMA 3RIKA 2WOQA 4YYCA 1A5KC 2H8ZA 3FAXA 2NQHA 5REQB 2PLMA 4P7QA 1E0TA 1F6YA 3GX9A 1KTCA 2DZUA 4RNJA 5HWNA 2P8CA 1S1PA 2F9RA 2V3DA 2MNRA 1V7YA 1PKYA 3AS1A 1TB3A 2Z24A 2YGYA 4AIUA 4HNLA 3O07A 4HP5A 3M0YA 4XZIA 3WSUA 3OQEA 1RV8A 5C9XA 1KLZA 1XLFA 3KWXA 4Q6JA 2ZA3A 3TTYA 4M0XA 2PWVA 3VD4A 2A7NA 1E6PA 1UHVA 3DFNA 4FO4A 5FL0A 1KCLA 1ITXA 5A8QA 2IKHA 3SCNA 4ZMGA 2V5BA 1QR7A 3GK0A 3IIZA 3XIMA 2ZRXA 5AYXA 1QI0A 5C0QA 4YTQA 3QMTA 1UJQA 3PANA 4U3CA 4ZQRA 4F48A 2WW5A 3DYMA 5F1UA 4WF7A 4UFKA 2I5QA 2ISDA 3UJSA 1K6AA 3WD2A 3P0WA 1V4YA 3HGSA 4R34A 1ADSA 3IJLA 5FJOA 3QHMA 5IXEA 3BLEA 1AQFA 3DERA 3NVDA 2VX4A 4BI6A 2OX4A 4B3ZA 4QIUA 4WGXA 4P7OA 4L1GA 1Q13A 4DVOA 3GU9A 2Y7GA 5BU9A 2GUUA 3OZOA 3RJYA 1BXCA 2VX5A 4L4OA 1XD0A 2QDDA 2QCGA 5EMLA 2QGHA 2XGIA 1WOBA 2XH2A 3MHUA 3T0TA 5D02A 5IHSA 1JAKA 1FP9A 3WYZA 3AXMA 1YXYA 4ICNA 3CHEA 1DKWA 1VD6A 1UR1A 1JGIA 4QLJA 3WUEA 2AQVA 2A7PA 4WKAA 4BK9A 1TVPA 4FXFA 4JN8A 4BF7A 1WOAA 1DWIM 3W26A 4JD4A 3D3FA 1P6CA 2FQIA 4C5YA 3P3BA 5DBTA 3KW3A 4PRRA 3AAMA 4LUTA 4WSJA 1TR1A 1CXLA 2CZDA 3W2UA 4X60A 4A8IA 4UC5A 2V63A 4IGMA 5KZEA 2CERA 1LQAA 5DCEA 1OT1A 4LC6A 4YPJA 1SFTA 4UMBA 1LOQA 3K4AA 3L9CA 3CWOX 4QJ5B 5C9ZA 2G4JA 2BGQA 3CT2A 3NQ6A 2O9OA 2AQWA 2Z29A 1BYDA 1GVFA 4ML9A 4KRZA 1EC9A 3GS6A 2ZWZA 4D1IA 5LGXA 3V0SA 2PSNA 2Q02A 2NUWA 1ONXA 4PUMA 3W1NA 1XI3A 1GZ1A 1J79A 2ISFA 4HNVA 2OOGA 1EIXA 1UR3M 2RJHA 3KP1A 2PP3A 4Z2IA 2PURA 4RUBA 4IQDA 2WZMA 4LAKA 4CGTA 1I60A 2DT0A 3UWWA 1F3XA 4PEKA 3VYLA 3M5ZA 3OBKA 5AZ0A 3O06A 2FPYA 3PZUA 3ITVA 3DZ1A 4EAYA 5DCDA 4EPDC 4GYKA 1HIZA 4QRNA 1V0KA 3E6EA 1A53A 3E5BA 5A8GA 2FTWA 4B91A 3WMBA 3GDTA 1ZLPA 3ZZ1A 5JU6A 1OFDA 3TN6A 3U0HA 2WJFA 1G6CA 1JULA 3CAVA 3QKZA 3FIGA 2QDGA 1TPVA 1W1YA 3E2VA 3M0KA 4A3YA 4P61A 4EP8C 4JZ5A 1IZKA 4DQWA 1OIFA 3PZVA 2ABAA 1FWGC 5LKYA 3G1XA 3U4AA 4FF5A 1XP3A 1S38A 3MYOA 3M0LA 3GXNA 1CIUA 1JNEA 3V75A 3SN1A 1EJ7L 3ZWTA 4D6DA 2J25A 1CBGA 1T6MA 4NT0A 2J7DA 4W88A 3CQIA 1RVGA 2FHBA 1QMLA 2WNNA 3SRKA 1A80A 4PMUA 1NFBA 2V5KA 2ZZ5A 5CC7A 2CHNA 5ECUA 2ZX7A 3XISA 5BXPA 1SO5A 3TC6A 5HWJA 3C2FA 3GUWA 3S6DA 2PFHA 1OFEA 4R5EA 3T0DA 1SJDA 1LG2A 5DMLA 3BWWA 1C8QA 2R1KA 3ABXA 2X2YA 5M17A 1VEOA 1Z6KA 5I23A 1JD9A 3S83A 3OHMB 2OR2A 3BXWA 3MUCA 4LSBA 4M82A 1ESWA 3OP2A 1SZEA 4C1KA 2YL6A 1HFBA 1MO0A 3A5VA 3O3RA 2TODA 3F5LA 3UXLA 3LN3A 3M7WA 5JBDA 1HJSA 3QF0A 5HNTA 3LV6A 2JEQA 2YDRA 4A22A 2X0HA 1WUEA 4C6EA 1HJXA 1POKA 3OIXA 4YVPA 4ZSTA 3PAOA 2HPIA 7TAAA 3U2EA 4N0RA 3L4TA 2WSQA 2OODA 3UYIA 4AW7A 3LCHA 1XV8A 5FJPA 2J7EA 1JDEA 3EOOA 3F1QA 4I9JA 3W1QA 3HJEA 1QOXA 3ABQA 3PBUA 1OCJA 1XLLA 2DZAA 4GXMA 1W54A 4O4VA 3QW3A 1S3TC 1F3TA 4UQAA 3HQ1A 2YSWA 3Q45A 1S2WA 1GHSA 3RCYA 1D3GA 4JHOA 1FH9A 5C9RA 1UJPA 4IMGA 1GHRA 5FESA 3MSGA 3I10A 3PN8A 1MEIA 2Y5SA 1S2TA 1F3WA 1BKHA 4O53A 3W38A 4Q8VA 1Y5VA 4K3ZA 4CUCA 4MM1A 5FF3A 3UP8A 4GI6A 5CG7A 4IGHA 4GA8A 4NRRA 4JKLA 2Z2AA 1H7OA 3WNKA 3N13A 4IIEA 5K9XA 2ZZ6A 4LJ3A 8XIMA 2VI0A 4E4FA 4DN1A 3GLCA 3WELA 4H9TA 1I2PA 2VQUA 3AUJA 3S4TA 3MP4A 3LV5A 3PBMA 4KS0A 4PUEA 1J12A 1QNRA 2VFDA 3QPZA 1H7PA 3O63A 1I9CB 4FNTA 2WM0A 2GDVA 3BJTA 3MSYA 4O18A 1I2RA 3MDWA 1VRXA 4OOZA 2CKRA 3UR5A 1Y5XA 4P5UA 4MNLA 5AY7A 5K9DA 3GZAA 1YDYA 2VYOA 3O6CA 5TQLA 2WSYA 1OC5A 4HCLA 1QHOA 1NF7A 2DW6A 3OA5A 3GXTA 4JTCA 1RA5A 3L4VA 4IUGA 4K68A 1JCLA 3OBAA 4PB3A 3CB8A 1V08A 1O5QA 4GVHA 2OQYA 5HWMA 1P5BA 3B0VC 2IUZA 3WK1A 1NWTA 3W1MA 2A6NA 2YJQA 4TVDA 1VHNA 4K8HA 3SQSA 1LBLA 1A4LA 1AW5A 1MQQA 2A3EA 4D6FA 2VFEA 1O12A 5CC5A 3TYEA 4EF8A 2WBGA 1UD3A 1HO1A 1H1NA 2YCJA 4W7WA 3RITA 3VDCA 3G2GA 1B0IA 4BF9A 4JNZA 2KAUC 2YBUA 2NWSA 2SFPA 3DFHA 4U5IA 3NNTA 2WVVA 1MMFA 3WBEA 1BEUA 1L8NA 3C0SA 3VGGA 1UUQA 2PF0A 4JKKA 2RDXA 3I3BA 5LNSA 5XIAA 1OHLA 2FLIA 1UZ1A 4HMDA 4B2DA 3SUUA 1AA1B 3BV4A 2HXTA 4HN4A 2X41A 4NZ3A 2MANA 2Y88A 4PR4A 1KCKA 4TMBA 1CYGA 1Z3NA 3QV9A 3T0CA 2GJXB 3LMYA 2YL5A 4F66A 4ZFMA 4AX7A 3GRIA 4OKDA 4AVFA 1P48A 3C2YA 4JFVA 3ZVHB 1GOOA 2GOUA 2OJPA 3KDOA 3SUSA 2FB2A 4FOKA 4MGGA 1S3HA 1L6YA 2O9RA 3ARPA 3UPMA 3WFAA 1SR0A 3LHTA 1PJ9A 1Q6QA 2XVGA 1XX1A 4HU4A 3P0XA 4GIYA 4IISA 1ZFJA 3KRZA 4N9CA 2YDQA 4PTWA 4NRSA 1CXKA 1NOFA 1HP5A 4FXSA 1DP0A 4HZ7A 1VRDA 4NSBA 3YPIA 1QW8A 3ITYA 1CX9A 4KIEA 3F4WA 2J79A 4KFNA 3PB2A 3IAPA 3NFUA 2E0PA 2Y63A 1BXBA 2OSXA 4V33A 1K8CA 3VINA 4GXPA 1Q65A 3CXOA 2FB3A 3PTQA 4US5A 3CB3A 4FLQA 4DYKA 4EPEC 4L1XA 2W67A 3QFWA 2WVTA 3DC8A 1A0EA 1W5MA 3GTXA 5CPMA 3L2MA 4W93A 2ZICA 1FWHC 1DV7A 4RDVA 3OU8A 1T7LA 3HU7A 1D7KA 1VEMA 2HK0A 2IQTA 4FXJA 3M0XA 4WSHA 3WQEA 3CU2A 4HZ6A 4LF1A 2YFOA 3H22A 4QLLA 2VWTA 1VEPA 1Z48A 3TYAA 4AC7C 1RZMA 4E2BA 1XLIA 3DEQA 3CUXA 4LYQA 3GH5A 3NYDA 1B57A 2YXGA 2ISSA 1P7TB 1UWSA 1RBLA 2VCCA 4QS5A 5A6KA 2CBVA 4JQ3A 2NT0A 5C55A 2BXVA 3FA3A 1MZRA 2FGZA 2QKFA 2VCBA 4YNGA 3ZR5A 4JTRA 4D6CA 5DCBA 5DLCA 1PCWA 5LIXX 3B8UA 1A49A 1AVAA 2D0HA 3M43A 1XFCA 2V3EA 4LBRA 4PCSA 1GWJA 3T08A 3T44A 1Q6GA 1J11A 2I7GA 3WK3A 4J7RA 4ZL1A 4DJFA 4OHQA 3G1RA 3DH7A 1DJWA 4OUIA 4TQTA 1JYXA 2IKGA 1NP0A 2OGJA 4ENLA 1PYFA 3CQ0A 5FKYA 1DXEA 1BXNA 1ISXA 3N12A 3D6NA 4D8LA 2VZTA 1W2VA 2QUMA 4JHZA 1E1FA 2OMAA 3G0XA 3C0JA 2EJAA 3IUIA 2D2JA 4GO9A 4UQ9A 3MYPA 4X0VA 4ZTXA 4O19A 1ZAJA 5I3GA 4P7RA 1R2SA 3AXHA 4H7VA 4GIAA 4IP7A 3E74A 5HOSA 1WZKA 2E40A 2O0TA 4FX6M 2Z26A 4MJ4A 3KWSA 3M46A 3QLLA 5TNVA 4E8GA 1I0DA 1Q6EA 1AG1O 2R24A 2ZA2A 1EF2A 1SMDA 3L67A 3L0NA 5DXXA 3WNLA 1MW0A 1RP8A 4C1NA 3MB9A 4PZVA 3VU2A 3RNDA 3CUZA 3LLDA 3DC0A 3POCA 1IIGA 1DOSA 1XIEA 4OTKA 5ABGA 3QZEA 2XUCA 1VBUA 4XBSA 4UFIA 4H19A 5DN1A 2OT1A 4PB4A 3PWGA 3ZR6A 4KKXA 4C60A 3W01A 5CH9A 1SJBA 1J0JA 1Q3NA 1TWIA 1OZMA 3N4AA 2J8FA 2WC4A 4DWSB 5C7HA 3SY8A 3FYPA 3GYCA 2E4TA 4AFYA 3TNOA 2CLFA 4B5WA 5H8UA 1FRBA 3CBWA 3ZYZA 4MNMA 5EMJA 3G3MA 3NDYA 2V5LA 3MV11 2WZEA 5J5RA 3GIPA 2WZHA 4IH3A 4Q3MA 3MUAA 1KCZA 3PP7A 1V6VA 5M5DA 4GUFA 1KFJA 4M80A 1AD1A 2PMQA 2V68A 4XAPA 3TYUA 2J7HA 1JQXA 1DQUA 3IEBA 4Q4SA 3DHUA 4H8VA 3T8LA 2PWHA 3BOFA 3OLEA 3OVGA 1IXQA 1E4MM 2GQAA 3W24A 1HJUA 2I5GA 3GVVA 3P62A 4WKHA 2FGBA 3QMRA 1LCOA 4D6HA 3THDA 4HOXA 3LENA 2WYSA 4ZQOA 1MXSA 4WK9A 1TTQA 3W7RA 2C0AA 2TAAA 3K30A 1ZQ5A 4WIWA 5A1AA 4J3UA 4JTKA 3G77A 3B03A 3VD5A 4CNNA 5FF7A 2YYUA 3HO8A 3NQGA 2ZC1A 3RHGA 3VIIA 1XSIA 3LI0A 3HN3A 4H8HA 2ICSA 1MEHA 1FQ0A 3TC7A 1R7OA 3ABZA 3CJPA 4UNKA 3UCQA 3R10A 3RLVA 2F61A 4O17A 3AI0A 1DXFA 1J6PA 5FEWA 2E3ZA 2PI6A 3V35A 1IXNA 1PHWA 1QPNA 1UD4A 3NGJA 1E4IA 3ID7A 1TG7A 1ZAHA 2PBGA 5I09A 1ZENA 3VGHA 2A3AA 1EF3A 3N15A 3VX1A 3BLPX 1EX1A 3CZEA 4MJ2A 4AD1A 2D20A 5FEXA 4E8DA 3O6DA 1GYMA 3N2TA 5IDZA 2A79A 4NJIA 1JNDA 2ATSA 3NL3A 1DEDA 1U5VA 3GU2A 3QPEA 4REQB 4ORIA 3RRAA 5CPOA 2KX9A 4EIVA 4J9JA 3A12A 1S2VA 3S1XA 3WQGA 4EE9A 3H7VA 3H53A 3KL5A 1QWKA 4M81A 5DFAA 1ZRQA 4CD4A 2PTYA 3R2GA 2E6FA 9XIMA 2J88A 4XAZA 1GG1A 5LNRA 1XLBA 2IPWA 2EBNA 4XG1A 3TZFA 1S5MA 1LLOA 3AMGA 5A69A 3AWOA 2P76A 4EF9A 1EDGA 3AQUA 3NOEA 4GYFA 1B3WA 3EX3A 4PMXA 4RLIA 2REQA 4L6HA 4FR1A 1F3EA 4JTSA 4JIEA 3UVAA 3WG6A 3MV01 4LH8A 7REQA 1O66A 1AFSA 3CH0A 3SCQA 4PRWA 3WNOA 4M51A 4O28A 4Z1AA 4DRSA 1OG0A 1WO2A 2NUXA 4L1WA 1KO0A 3DN5A 3AXIA 4B92A 4BI7A 4LVBA 4F9JA 1CCWB 3I3DA 3AHVA 2E1DA 4LTSA 2NLIA 4UTUA 1R6WA 2AMGA 3W2JA 1EEXA 2XPKA 2V38A 3H6OA 4PFHA 1E1CB 3C3UA 3U2ZA 3ZIZA 1EP2A 5M03A 3TR2A 1S46A 4E8CA 3DOPA 3NM3A 1J8VA 1VFLA 2QAFA 1OM0A 1WDPA 2GWNA 3QV8A 1EBGA 1VFTA 2INZA 4Q7IA 3GY1A 3V18A 2FDMA 4RL3A 4Y6GA 3WBYA 2ZIDA 1DJZA 2RDTA 4NAFA 3L7RA 4R53A 3WLPA 3LGEA 4DO5A 2GGEA 3TWBA 4V1XA 4C5ZA 1DJGA 3O6AA 3RR1A 3EZ4A 4O1AA 2B0MA 4RZ6A 4I7WA 4PMVA 2J7BA 4Q7BA 5HPCA 2ZOXA 5E0FA 4DUOA 4OFCA 4UFLA 3ARSA 3N2OA 2ZUWA 5A6LA 3TNBA 4IX0A 1Z8AA 1MXDA 1H63A 2V5JA 3HMCA 3U57A 1A5CA 2D2GA 4MIMA 3NOYA 2VXNA 2VVSA 4R7JA 4IIGA 4IG2A 1A5OC 3NYZA 4ACZA 4J3VA 2J62A 4Z2HA 3OJGA 3V1PA 1U30A 4H01A 5D38A 3BW4A 1LRNA 3SCUA 2H9AA 3G18A 5I6SA 4N4QA 1Q7MA 3P7YA 1SQ7A 1NARA 3IJ6A 3QLDA 3CTTA 3QH2A 2BMBA 3CZ8A 4HA1A 1M7OA 3VKDA 2EG7A 4NZ1A 2P0IA 3ALGA 2NQ9A 1KR1A 5C9UA 4QEEA 3MP5A 4BKNA 3UXIA 1N8IA 4HSHA 1FDZA 1QDSA 3UETA 4L9ZA 2G0WA 1W31A 4GACA 4IHCA 1V6YA 2W0UA 3WLIA 3S2CA 3NQAA 1AMYA 1AODA 4ICMA 1H4PA 2QVNA 3R25A 4FPSA 1BG4A 1CENA 1DJXA 1K9EA 3MCNA 3BQ6A 2VNCA 3PUGA 2HE5A 1G4EA 2Y8UA 4GHRA 5D2XA 3W7IA 3WX7A 4ZXOA 1W3KA 4G5DA 2EPNA 3BK0A 4Y96A 3PBGA 1KR0A 3S0CA 1MXGA 1DJIA 3HF3A 2VKZG 2PDHA 4PBEA 5D05A 2TSYA 1OD8A 2BFGA 5D2WA 4FI4A 4LB3A 1C90A 1M68A 3MY9A 4GVGA 2C1IA 1SZGA 1L2UA 1IEQA 5HMEA 1WB0A 2C3ZA 1XIMA 4HJWA 2V69A 1ODUA 4JXCA 2EO7A 5D9PA 3PWIA 4EACA 5G2IA 5JIPA 3P14A 3PB0A 3RMJA 3I7RA 1DL3A 2WMHA 3IIPA 4KQNA 4UFJA 3G5EA 2QMJA 1XYMA 3CL8A 3VZXA 1B3YA 5ECVA 2HVOA 1CNVA 3UW6A 1VYRA 1F05A 5IM51 1R5YA 2OXNA 3FW6A 1WKYA 3VKJA 5A2AA 3T8QA 3MHFA 2E6AA 2ZUUA 1NWUA 1JCJA 1D3CA 1XBVA 3SAZA 3NQ2A 1A4MA 3QW4B 2ZX6A 1RA0A 4B4FA 2V2CA 4DZHA 3VILA 1FDYA 3R0DA 1TJ2A 2GQ8A 4ATDA 3FSUA 1UQZA 3CPRA 4XKMA 3T2QA 5AFDA 2RHGA 1MYRA 4Z1BA 5T91A 3L4UA 2FGLA 5MKGB 4MSSA 1G1YA 3MTWA 1LWHA 3SCVA 3UWYA 3EOEA 3P93A 1RK5A 1TYGA 4IQEA 3KCJA 4XIMA 2ZRVA 3EB4A 4JIPA 2DT2A 4I7VA 4WVXA 5AECA 3UESA 2WHLA 4GI4A 4UOZA 4WDXA 3WH9A 3D5HA 3K1DA 4KFPA 3TN3A 1JZ3A 3MWCA 2C18A 2YA0A 3GD6A 3GXFA 3CO4A 2EHHA 3LX9A 4RXGA 1GK8A 2G95A 3B8VA 4WQ6A 2O92A 4F79A 4GY7A 5BRPA 3JW7A 2W79A 1VENA 2NQLA 4RZ5A 1MNZA 5E0CA 2WBKA 4R7OA 5I06A 3MVTA 3ZJ6A 3N6HA 1E3ZA 3TIMA 3PZNA 1GPWA 5A94A 3K2GA 3ERPA 3MC5A 2ACUA 4LS2A 5G2WA 5AYYA 4CN6A 3EA2A 3TOYA 1DE6A 1LUCB 2AGTA 5F1VA 1Z69A 4QLKA 4O12A 2ALRA 3DFPA 3VD3A 2DW7A 3C0QA 1LP6A 4C6QA 2NQJA 4JEQA 3EXTA 2I9UA 3N04A 1Q63A 4EK7A 2HS8A 3W84A 3M0ZA 1H50A 2PDIA 2XTKA 1K8YA 3AIEA 1O1HA 4YIWA 2V81A 4HBKA 1R38A 2FZ9A 2VO5A 4DAIA 1DTUA 5H91A 3UWQA 5D4YA 3QPYA 3K46A 1XQKA 3TP4A 3LXAA 3TKFA 4R88A 3W7LA 1NDZA 4D6GA 4NZJA 3IJ9A 3FYYA 3APTA 3RF9A 3TLLA 2EAWA 3A3XA 4WRHA 3WF1A 1F6KA 3BLOA 2QDEA 2POTA 3CV7A 4A8RA 2WHKA 4C6MA 3ES8A 5K4XA 4DIAA 1VKFA 1UZDA 2P0OA 6TIMA 1V6WA 1E9LA 1SO3A 4GY0A 3GTIA 4AEEA 2D3LA 1XCWA 3AZTA 2PGRA 4UCGA 3GIYA 3ARZA 5GNXA 5HINA 4JGDA 1YTDA 3KVKA 4JTFA 5ABFA 4MLJA 3SCTA 5AOUA 4AB4A 1S5WA 2Z7GA 3GHTA 1EUAA 4C6PA 1QK0A 3E5PA 1QRQA 4WXZA 4XZBA 2Y70A 4Y8FA 3BCJA 2NVCA 2BY0A 4HK7A 4N02A 4O4WA 1F4HA 3P6LA 5HANA 2Q8XA 1W9XA 4HOWA 4DO4A 3GG1A 4MY8A 1EO7A 4IP5A 4ZENA 1NWSA 3H2FA 4N9EA 5EBUA 2C16A 4DPPA 3PULA 2YL8A 2Z6JA 3IGHX 4B5TA 3EMCA 3T2OA 3P8JA 4DJFD 5AHEA 3HIJA 4JNYA 1UPMB 4JQAA 1V3JA 2ZKMX 4AEOA 3HV9A 1OFRA 1NIUA 4WZHA 1HN1A 1TPH1 3IS4A 2VGFA 1OB0A 3NWRA 3DFSA 2Z1WA 1GZJA 2ANUA 1S5NA 3OLIA 3SDOA 5JBFA 3WQOA 2O7QA 2C13A 2GJXA 2Y8VA 5M2FX 4D1JA 4RPPA 3ARQA 4JTUA 3N3MA 3HA1A 3AMKA 2AAMA 3VE9A 1EJUC