1VFSA

Crystal structure of d-cycloserine-bound form of alanine racemase from d-cycloserine-producing streptomyces lavendulae
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
383
structure length
382
Chain Sequence
ETPTRVYAEIDLDAVRANVRALRARAPRSALMAVVKSNAYGHGAVPCARAAQEAGAAWLGTATPEEALELRAAGIQGRIMCWLWTPGGPWREAIETDIDVSVSGMWALDEVRAAARAAGRTARIQLADTGLGRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPATLTLPETHFDLVRTGLAVYGVSPSPELGTPAQLGLRPAMTLRASLALVKTVPAGHGVSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLVAGKIRRAAGRIAMDQFVVDLGEDLAEAGDEAVILGDAERGEPTAEDWAQAAHTIAYEIVTRIGGRVPRVYLGGLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alanine racemase
publication title Structural evidence that alanine racemase from a D-cycloserine-producing microorganism exhibits resistance to its own product.
pubmed doi rcsb
source organism Streptomyces lavendulae
molecule tags Isomerase
total genus 127
structure length 382
sequence length 383
chains with identical sequence B
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2004-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 1vfsA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 1vfsA02
4PB3A 1SZRA 5GJMA 3WQCA 5FACA 5IRPA 3B8TA 1HKWA 1VFSA 2DY3A 4ILSA 3ANVA 5FAJA 3S46A 4AIBA 2VD9A 3VABA 1RCQA 1TUFA 4Y2WA 1SFTA 3CO8A 3MT1A 1HKVA 1QU4A 4XG1A 3B8WA 2J66A 4DYJA 3N2BA 2ODOA 4PB5A 3UW6A 1F3TA 2P3EA 2RJGA 2O0TA 4LUYA 4FS9A 3AWOA 3NZPA 4LUSA 3GWQA 3R79A 3WQEA 4LUSB 1TWIA 5GJNA 7ODCA 1KO0A 3WQGA 4DZAA 4BEQA 4QHRA 4A3QA 1XFCA 1L6GA 4WR3A 5BWAA 3SY1A 1BD0A 1B54A 1XQLA 3LLXA 2NV9A 1KNWA 2PLKA 1CT5A 3E6EA 4BHYA 3E5PA 3B8VA 2QGHA 4KBXA 4ZGYA 3HA1A 2SFPA 3HURA 4V15A 4LUTA 1L6FA 4BF5A 3N2OA 2TODA 1W8GA 2VD8A 3BTNA 3AWNA 3CPGA 5FAGA 4PB4A 3NZQA 1VFTA 4XBJA 3WQFA 1NJJA 2OO0A 2YXXA 2RJHA 3OO2A 4BEUA 1FTXA 1NIUA 2NVAA 1D7KA 5GJPA 1XQKA 3C5QA 2ON3A 3ANUA 3B8UA 3KW3A 1VFHA 1EPVA 2PLJA 4LUTB 3WQDA 4ECLA 3N29A
chains in the Genus database with same CATH superfamily
4CCDA 4DJED 5U7SA 1GPFA 3RLVA 5K4ZA 3AYSA 3LLFA 4JQAA 2J7CA 3ONBA 4BI6A 4ALDA 2ZUWA 1W5QA 4IX2A 4S3BA 5ABFB 4IH3A 4W5ZA 5C6MA 5A69A 3SRFA 4CCZA 4HNOA 3VM7A 3R58A 2O0TA 4IG2A 4WHBA 4PODA 4OQVA 4LB3A 3JUGA 4MB4A 3B9AA 3TKFA 5BU9A 4PMRA 4WJ8A 3W53A 2VRJA 3MP5A 3U2CA 1DQWA 1SJAA 2EG6A 3A47A 3HQPA 4HMDA 3WFZA 4B92A 3THCA 1X1OA 1GVIA 3UJRA 2XFRA 2FZMA 3FJ6A 1J10A 2GUYA 5EKYA 1W3LA 4A2SA 3RRXA 3H2OA 4X9YA 3TYUA 2WSYA 1I2NA 4J3WA 2VZUA 1WUFA 1W5MA 1SZEA 3CZ8A 1UD3A 1DIDA 2D24A 3W7DA 4K6AA 4PUUA 2O56A 4UMCA 4F4RA 3RR4A 3W22A 1KRBC 1E15A 3A4WA 1G7VA 1IZJA 1LG1A 1DIEA 2L5HA 1R9ZA 1P1XA 3BJTA 4DWDA 4DWSB 3QC0A 4MDPA 3UGVA 1OYAA 1JCJA 2CKRA 3UZXA 4PSPA 2ZCGA 3A13A 1OX4B 3NXFA 1FCVA 1G67A 1HP4A 2J6XA 4X0VA 1J18A 3F03K 3I65A 1UUMA 1XISA 4NZJA 3VGHA 3LQGA 4JX5A 4W7VA 1PIGA 3UR2A 2NQLA 4U3CA 4AD1A 3WLSA 4AHQA 1EIBA 1Q8JA 3N18A 4W84A 1ZS2A 3WQGA 4Z2LA 2X41A 4QRNA 3FYPA 4EAMA 2NV9A 2BS9A 4MUPA 1DE6A 1GHRA 2EPKX 4H7ZA 2KAUC 4L7ZA 3HB9A 4E8DA 1TV2A 3W0KA 1QW9A 3DBPA 4ZB0A 3UXDA 4I9JA 1L6FA 3BDKA 3R0KA 2VQTA 4E5TA 1PVNA 3C8FA 1RAKA 1NWTA 1H41A 3Q67A 4E6MA 4IFKA 1IEXA 3HFYA 4O14A 3WSUA 1H1ZA 5HULA 3GTIA 1LLWA 3DI0A 2XH4A 4LB4A 1ZLPA 1OINA 4O1EA 1V3KA 2XIOA 3WMLA 1DYSA 4U5IA 5I79A 4GGBA 5BRPA 1XL9A 5FJTA 1F6PA 1DWIM 2VX4A 5B80A 3CUIA 3QHOA 4XSLA 2FYMA 5AN7A 2E68A 1NFBA 4IMFA 1J0KA 3GUWA 3KP0A 3LDVA 4ZR8A 4QNEA 4JAWA 1M41A 1TJ0A 2QR6A 1V7YA 1Z89A 3WY1A 3A9IA 2FFIA 3KWSA 3E2VA 3AYRA 1EGMA 4QX4A 4O0KA 3GNNA 2JEPA 4J3SA 4EVZA 1HIZA 4XTDA 4QLJA 4ZA0A 2YLLA 2IMRA 2B31A 3WLRA 1UP0A 2A7PA 4BY3A 2DPEA 1CEOA 3H24A 2C0HA 3TIMA 1LUCB 2VGIA 4R33A 4W86A 1TPWA 3WH6A 2ZKMX 2VDHA 4QGCA 1XX1A 3LV6A 1TJ1A 2TPSA 3SADA 3VVGA 3VDCA 3MV01 5FF2A 4NY2A 3NZQA 2PS2A 3MI6A 2WQDA 3HGSA 5I24A 3TROA 3VYLA 4R85A 2OOGA 4KWVA 1TUXA 3BQ6A 1ADSA 1F07A 4AYSA 2XFWA 3GAKA 4IMEA 5H6HA 3SCUA 1POJA 3CQ0A 3KBMA 2WBKA 3U0HA 3R2GA 2ZFAA 1ODZA 5CPMA 4HNNA 4DN1A 4KESA 5BZAA 4UTKA 4C6EA 1S2AA 5BRQA 4AIEA 4KETA 1FVPA 3GVQA 3HG4A 2HEJA 4HSHA 3PPFA 1AODA 3ITOA 2A5HA 3CMGA 2BASA 1HFBA 1TREA 3TW6A 4GOAA 4PA8A 4ERGA 2WVVB 3ARVA 4JTJA 4QEEA 2RUSA 2PTDA 5DO8A 3PFMA 3G1AA 1E1CB 2G5WA 4U2YA 3UNDA 3KBNA 1H7XA 4B3KA 2QCHA 1AZ1A 1E9ZB 1B3OA 2EPLX 2E77A 5JVLA 3EOEA 1M04A 2GSEA 3MMUA 3WBEA 1EYEA 3N13A 3W24A 2ZXAA 4NI8A 3ISIX 5E9XA 3UERA 1NOUA 2FB2A 3UWVA 4B5SA 5I09A 3S1XA 2OLSA 4EPDC 4O57A 3ABSA 2QT3A 1UB3A 1V3HA 3MO4A 3K1DA 5HQMA 1XIIA 3REQB 2G95A 4FNUA 2VCAA 2VFHA 1O12A 4WGHA 3KVLA 2AAAA 1H7WA 7TIMA 1O5XA 1SO6A 3WK1A 3L67A 2Z6JA 2AKZA 3VKBA 1J8VA 1B3YA 3HF3A 3GXNA 1BVWA 3MY9A 2AGTA 1JCYA 4CN6A 1S2CA 3CUXA 1W2VA 1F3XA 3H53A 4LYPA 4TX9A 3W01A 3DGRA 3ES7A 1W17A 3CK5A 2D22A 1MEHA 4KEZA 1UR8A 3UPWA 1MO0A 1JYNA 3E0FA 4N9DA 3PG9A 4V28A 2WZIA 5BW6A 5D04C 1WOBA 2YZ5A 3GDLA 4HK7A 2BGQA 4LCQA 1M6JA 4IGMA 4JIHA 1TPB1 5XIAA 4HYRA 5AZ0A 4GRSA 1OT1A 3MKKA 3TNOA 4BWLA 4GACA 4NKCA 2AQOA 2HTMA 3LNPA 1KLZA 3EB4A 2CLEA 3MQTA 2Z7GA 2GWNA 1IEQA 1AD4A 1EO7A 1XG4A 1R9YA 2Y88A 4H00A 1W3NA 1AK5A 1D8CA 2XIQA 4ZFCA 3RMJA 3VDAA 4H6QA 2UY3A 1DBTA 1UWTA 3S9ZA 1GONA 3MDUA 4QCFA 3I6TA 1GEHA 1MXGA 2X1UA 5E9AA 3BVJA 2VWSA 4INFA 2XN0A 2PTZA 3DI1A 3GD6A 3PZQA 2VR2A 1CDGA 1AL8A 3FEMA 3N2MA 1HJVA 3GK0A 4CU7A 1ITUA 1ZSXA 2FTWA 2R91A 1FTXA 3AMKA 3AHVA 3EOOA 3H6OA 2OYLA 2REQA 4LFYA 3FAXA 1RVGA 4H6KA 1EPVA 4QM1A 3NWRA 4KH2A 1JAKA 1QJWA 2ZZ1A 4O52A 2ZVIA 3UR8A 4LBSA 2VZOA 4ZO6A 2Z1XA 4JDYA 1XHGA 4S3EA 1QWKA 3BMWA 5TBOA 3OGVA 1Q6EA 3EOUA 3QZEA 1HO4A 2H3BA 1U83A 4AVNA 4JEQA 2A7NA 4W88A 4E8GA 3ARZA 1Y5VA 1JRCA 2C79A 3MBFA 1F3TA 2XM2A 1G0CA 4J5NA 2WPGA 1XDJA 1TX0A 3KTCA 1GW9A 4HPJA 2QCCA 4GJJA 5AYYA 2DT2A 2QJMA 1Y8BA 3GB6A 3L2IA 3M0KA 4GQGA 2F2KA 4IZGA 3A4JA 4HYVA 1VAHA 2DZUA 2P0OA 1NDYA 3LCFA 1QBBA 1A5LC 3AHYA 1HQTA 2BNJA 3O7UA 2V63A 1KXQA 3FOKA 3NQBA 1PKMA 2G4FA 3RN6A 4S2CA 4X22A 1EBGA 4DELA 1NVMA 3GNOA 5HQLA 3P5YA 1JVNA 1E72M 2JE8A 3PBWA 4ADTA 4UMBA 3IUDA 3UXAA 4E2OA 5C55A 1YXDA 4O16A 4HZ7A 5D2VA 1SUXA 3PZVA 4FMVA 3W6YA 4QEHA 1MFVA 4DO7A 3TYDA 3KTSA 3ZZ1A 1Q4WA 2PZ0A 1TJRA 3BJFA 1XYAA 3FKRA 3W7PA 3RM9A 3GVGA 3WEOA 1NAL1 4DYEA 2HNHA 3VDGA 4KCUA 1SO4A 4H9UA 1T8QA 5BRBA 2E6AA 1VS1A 1EH9A 1UR4A 2VC5A 1RA0A 1EJWC 4K39A 4TVCA 2DVUA 1H1NA 1K8XA 2OSXA 3DC0A 5CBBA 1XYLA 3CYVA 3ENLA 3CZJA 5AYZA 3S1VA 2QW5A 2NWRA 1OYBA 2VUNA 2MUCA 4FP1A 1BG4A 1EOKA 1EJ7L 3EMQA 4IJRA 4S3AA 1JI2A 3ONCA 3L2LA 3RO6A 1ZFJA 2ZOXA 2DSKA 3FS2A 1F61A 3GXFA 4GUGA 5LIWX 1JNDA 2WLYA 1FX6A 4Q8WA 2JBMA 2W9MA 1BRLA 4RUBA 3PJWA 1GG1A 4PRTA 4Q32A 1AJZA 1SR9A 4MKSA 1QO2A 2XIJA 1VFTA 3WYZA 4JYFA 4Q6XA 4IFKB 2E1WA 3A3WA 1DWHM 4FAMA 3RPTA 1TPUA 2F8QA 2PD5A 1PTGA 1ICQA 4HT3A 1XIEA 5EGRA 4ORIA 3DHDA 4FK9A 3PZTA 4WDUA 2R1NA 1CGYA 4E8CA 3QMRA 4D8AA 3C4UA 4UNIA 1X39A 4Q4SA 2W91A 3NPWA 2V8ZA 3DFPA 2WCGA 2CWXA 1JXJA 5E1QA 4XKMA 3WLJA 5CBJA 1B9BA 2YDSA 1PWLA 3GXMA 5D2TA 1PCWA 1RY8A 4C6OA 2ZRWA 3DFOA 4YCPA 4HTYA 1S46A 2PB1A 5LGZA 4CQ8A 1V03A 1E6QM 1FQ0A 3V4BA 5LXXA 2JKPA 4XD4A 3UYIA 3L2MA 1QI4A 1MXSA 1VCVA 2O55A 1HG3A 4NNBA 4LF1A 5ECUA 2YB4A 2YCLB 2Y5SA 2VR4A 3AOFA 2R94A 3IGXA 2GQ3A 2FFCA 4G1NA 4Z2IA 1OABA 4V33A 5KZEA 4O4VA 1OIFA 2BGNE 1UR2A 2OSWA 4C7DA 4A2RA 1W1A1 5DEZA 4XD6A 3QV6A 3AS0A 4LV9A 3FGCA 5DT7A 4LYKA 3RIKA 1E4IA 4S38A 1UOZA 1EQCA 3T2OA 1OY0A 1E70M 1RUSA 3B40A 4V27A 1KM2A 2V3DA 2DZXA 4DUOA 1A3HA 5C54A 1Q7MA 2MNRA 3OO2A 2ZZ3A 4JKKA 2H90A 3E96A 1XIGA 2GZXA 2Y7EA 1FHDA 3PBVA 4P8UA 2ZC1A 3OPSA 1OFBA 5AFDA 1XR2A 2CBVA 2V3GA 2DVXA 4PB3A 1BKSA 3BG9A 4ZENA 3WLIA 2WM1A 2R1PA 4I7UA 3WG6A 1D3GA 4HOXA 3CV2A 3AIUA 1S5MA 3F1QA 1XBXA 4K38A 1PTAA 3E38A 1KR0A 4XUYA 1GVYA 5I07A 4G7FA 4M1BA 2RDWA 1MDRA 2VL4A 3EPNA 5A6MA 5CH9A 5F1UA 4DJDC 1UP3A 1QXLA 4EF9A 3HPZA 1BSLA 3IJ9A 4O0ZA 1W6TA 4WX2A 1ME7A 2Z25A 1BTMA 4HZ8A 2Q71A 3VUPA 3H2NA 4NZFA 4D8ZA 3L4ZA 4Z0JA 1FCBA 3VGDA 4W93A 3H7UA 4PMXA 1VJZA 3S5NA 2QULA 4HYWA 4UIOA 1CXKA 1YTKA 1IEIA 5AHMA 3W00A 1E9LA 2YXGA 4UQCA 3EGJA 3GS6A 2QCEA 1ADOA 3K13A 1O5RA 1UWUA 2ACRA 2C18A 4LQ1A 3BLEA 4HVXA 4MKVA 3NQ8A 1B30A 1GPWA 4MY9A 2VC7A 3O07A 5G1TA 3NR0A 5HMEA 1TQJA 3Q65A 3MYPA 1A50A 1UR3M 3ALFA 4YN5A 2CXEA 1VRDA 5IXEA 2UZ9A 4J27A 3C2RA 3KBWA 3L68A 5FI8A 4CQBA 5I3FA 4MM1A 3GC4A 3MJMA 1BGGA 4LS0A 1HVQA 1SMDA 3IK2A 2OZ8A 3VGBA 3WH8A 2Z1WA 3KCOA 1TJ2A 3CUJA 2BOGX 3PBUA 3CWHA 4KEVA 1H51A 3DFYA 1XC6A 4OBSA 3IUIA 1YW1A 4NZ1A 1O5KA 2GGEA 4GJ1A 5F2IA 1ESWA 1IZCA 1UQYA 3ZIZA 6ALDA 3CNYA 4B9ZA 1K7XA 3W1TA 1P0KA 2PLKA 1A5NC 3JZUA 2A1YA 2ACQA 2EPMX 3W3OA 4B3LA 1Q6FA 4WCJA 4YNGA 2ZZ4A 4MHBA 3W1UA 5D38A 4KIRA 1XLBA 3GKFA 3FA5A 4YMZA 3STCA 4UCFA 1JPKA 1G7UA 1RK6A 4F9DA 1OZQA 4ATLA 4ZMGA 5H8PA 3QFWA 2WKLA 3LS9A 3L0KA 2ZZ6A 3PAJA 4JQ2A 1AH4A 2PUZA 2E8ZA 4PTXA 2W63A 3MW7A 4AEEA 2GVJA 4L5ZA 4H8VA 1KA9F 3T42A 3VA8A 2DZPA 3PPCA 3N04A 3THAA 1TTIA 5FSDC 1CIUA 2GGJA 1DOSA 1WZMA 2BX7A 4H9YA 3LRKA 3I3EA 3B03A 3W2MA 4F0MA 1OD8A 5EFDA 4NASA 2TAAA 4JTIA 4ES4A 4GZIA 4QROA 3B97A 4I3GA 4AF0A 1XC4A 1E4LA 1EXPA 1QOXA 2VWTA 4HCLA 4H8UA 3U9IA 3L5AA 1UH2A 4AZHA 4JN6A 5FOOA 4NZCA 4F0RA 2R1KA 3SRDA 1U30A 4C91A 5DRCA 1JUKA 1XSIA 1JEZA 4QP0A 3W38A 3CUGA 4GYJA 1N2VA 4JFVA 4LEFA 4ZB5A 2OLHA 2BHZA 4J2PA 5LSMA 2ICSA 4J3TA 4OGZA 3TSBA 1ZAIA 2CU0A 4P8VA 2E6YA 3LENA 1J5TA 3E2QA 2CW6A 4YHGA 2Y5EA 2NLIA 3IJ8A 3WH5A 5HWMA 4R27A 3WF2A 2XGBA 4HOZA 4HBKA 3GM8A 3N4EA 8A3HA 3RGTA 5I6SA 3GC5A 1B1YA 1QK2A 4HCHA 2ZZ5A 1RCQA 5EMLA 2WSRA 4CQ9A 1YDNA 3H7VA 1K6AA 2ZX7A 4ATWA 1VEPA 1JPHA 5CPNA 1E73M 1XSKA 3JR2A 2GK1A 3B8DA 2GGGA 4YU1A 2FZBA 4QSFA 1ONWA 4I9MA 3N4AA 1O66A 5CG7A 1KXVA 4IP7A 4F3HA 1I1XA 4IPJA 4UR7A 1NARA 4NSBA 4HN4A 4X63A 3O2LA 3VDHA 5CPQA 1UCWA 4H6RA 3T4WA 3V0TA 4UMAA 2HJPA 1H0GA 1J9YA 4ROQA 4H01A 4NIRA 3L4UA 1SFJA 3EDEA 4LU0A 1EF2A 4FOKA 3LQLA 4DEFA 3WNMA 2PWEA 5XINA 1K8ZA 4JIIX 4AH7A 2WZHA 1MVYA 1IWBA 3TYAA 2X05A 1A3WA 1BRLB 3CTTA 1J5SA 2YBTA 1Q6DA 2Y8UA 2ZUNA 3W29A 3C61A 3V0SA 3VXGA 1M65A 5A2AA 4KS0A 2VMFA 4BS0A 3VOFA 1Q85A 1H11A 4UTTC 1UOKA 3VK5A 2QDDA 4B91A 2OODA 3NYZA 3W84A 4BKNA 4H9ZA 5MHBA 4QG9A 3BANA 4ZQRA 2BOFX 4FNQA 4AXKA 1VFSA 2YLAA 5A6KA 1EJUC 1QNPA 1KWGA 2OR2A 2HXUA 2F6KA 1WDRA 3A21A 4DAFA 1FXPA 1CW2A 2YDQA 3KZSA 4JQ4A 1TPEA 4LW7A 1FKXA 3I6EA 4NUWA 1RK5A 5G2IA 1PX4A 2FTPA 4NYUA 5C7HA 2FVMA 3BWWA 3P7YA 2UY5A 1OWQA 4OVXA 4B2DD 4L1WA 3U8GA 1CNVA 3GG0A 2WKGA 1P7TA 3UG8A 1ZQ5A 3CGTA 3G3DA 4XSMA 2PDXA 5ABTA 4ICCX 4YJ5A 1GW1A 4JQ1A 3TDFA 3VUSA 2JIEA 4UQDA 3GVWA 2CPUA 3I3DA 1OFPA 1QAPA 3I7QA 2HXTA 3W23A 4EP8C 3FGCB 5D03A 4YYFA 1T41A 3NL6A 4XQ6A 5FEXA 3P84A 3S47A 4Q4KA 1P0NA 3CUHA 3LK6A 4HU8A 4TMCA 1FXQA 1TYGA 1UROA 3UPMA 3TX9A 4A05A 4GQ0A 4KWOA 3B3DA 1UG6A 3H23A 3GG8A 4UNLA 4NNAA 4LNYA 3O0KA 2CITA 5CAKA 2V2CA 3WLTA 1C9WA 4R9OA 4O8AA 1ZRQA 5LNWA 3D0CA 3OLEA 1TWWA 2Q01A 1K1DA 3AALA 2FH6A 1SR0A 4Q4OA 2FHBA 3EWXA 2AL2A 2GQ8A 2PURA 2EHHA 4QIUA 4IL2A 4PRWA 2E6FA 1MZHA 4QSHA 4C7FA 1G4SA 4FLRA 3VIHA 1UHVA 1V8EA 2WZTA 2FGBA 2V5DA 1B2YA 2PDFA 4L9ZA 3SQMA 4MLRA 1VH7A 4C6IA 5KMYA 1R3WA 3CS2A 4RE2A 1PIFA 3W1RA 3AMGA 1DWFM 1Z6KA 4C6KA 4I7VA 4A4AA 4QJ3B 3GTHA 3S1WA 2QUNA 3P0XA 3TN4A 3Q4DA 3BGJA 3O05A 2Z2BA 5FL1A 3GW3A 1W8GA 3AWNA 3LCWA 4NRSA 2JQXA 1YKWA 3W7QA 3OZMA 2FPYA 4Q8OA 4Q4RA 3C6CA 1CTNA 3CPUA 4IIHA 3W7LA 5FIPA 3NL2A 3FIGA 4S3GA 1P43A 1N82A 4QFUA 2VX6A 1NWUA 1HT6A 4IPLA 1X1ZA 4AC7C 4WGXA 4AVFA 1F76A 3UF9A 3A6OA 4K36A 4R5EA 4GBUA 1VLWA 3ZJKA 1R3TA 3PUGA 1UUOA 6ENLA 2NQ5A 3NURA 1KBBA 3QYSA 2BBFA 3VD5A 3ERPA 4DRSA 3ARPA 2XWEA 3NSMA 1R86A 3SB0A 3VOHA 2OGJA 4ZBCA 4KGJA 2ZADA 4NRRA 4IISA 1EC8A 4UUIA 4NX0A 3WF4A 2BLEA 3FCPA 1QNQA 5DQPA 3BLIA 2ADAA 3UWYA 1I0BA 3GNRA 1C92A 4UTHA 1R8LA 4IFRA 3T44A 2OOFA 3QR0A 3UWEA 2ZX5A 3RX3A 1E6ZA 3QFEA 1E0TA 5C71A 1I45A 4XZ9A 3SM0A 4K1GA 1JG9A 4CCCA 2A6LA 1PS9A 3BV7A 5DLCA 5PTDA 3GY1A 3W1LA 3OG2A 3VX0A 1R3RA 3HN3A 5FF0A 1U5JA 1JNEA 4QG6A 2RFGA 3G0UA 2G3IA 2RJHA 1R38A 3S6OA 4H3DA 1ZU8A 2Y61A 1W37A 3HM7A 1OC7A 4LAZA 3H54A 2F61A 4JTAA 4GVHA 4AVOA 5BWFA 1V6UA 4HKPA 4ECLA 3OTRA 1S39A 3WD0A 1FFQA 1O60A 3AUOA 4JHMA 2WWCA 3B05A 3GHSA 5FJUA 4DJDA 1OEPA 3CL6A 2V2HA 3EOSA 1OBAA 1TUFA 1EP3A 3O3RA 4HZMA 3CL7A 4GZJA 1IV8A 1FP8A 2E67A 2WMJA 2FDMA 1E9YB 3RCMA 3ELFA 2QV4A 3LBOA 2WWDA 1PO9A 2RJGA 4AG0A 1UWRA 3PK7A 3NDOA 4TR9A 3KEHA 2CC0A 1EUAA 1Q6LA 4C6NA 5HNTA 3ZQ9A 1F3EA 1M68A 4XZWA 3KBVA 3PSVA 5C2GA 1B3VA 2ZUUA 4Y9OA 3OHMB 1J0JA 1P4CA 4JX4A 2Y7FA 4AHPA 1FWAC 1WKDA 5JH1A 3W2NA 3UZJA 4DBEA 4HK5A 5K9XA 3T08A 2Z1BA 1RQEA 1TPH1 5C9WA 1LTDA 2PP3A 3WNNA 4J4KA 1PKYA 1Q2SA 1XF0A 3IGHX 1EDQA 4TTGA 2EBNA 4BEUA 2X2GA 4WUIA 1D7KA 3HU7A 3F4DA 4QJ4B 1XI3A 3DG3A 3S0CA 5EBUA 2WLZA 4DWSC 4LUTB 3WQDA 4OTKA 3N29A 3POCA 3QQ1A 1BFNA 3CEPA 4K8GA 4QCEA 3ABZA 3SCVA 1JYXA 4GGHA 3WNOA 1LROA 2CBIA 1H4PA 4FPSA 4KEUA 3F2BA 1SJBA 3CWNA 1Q4NX 4PCSA 3IIOA 3EKZA 1EWDA 3IJ7A 1FY6A 2CBUA 1V7AA 1UWAA 3BZGA 1EZ2A 2OYMA 1CLKA 3ZLFA 2R14A 2VFEA 3DU0A 3EDJA 3E74A 3VKDA 3GFZA 2Y0FA 1XD1A 5C9XA 4O50A 3LD5A 1DJXA 1XPYA 3ARYA 2YW4A 4GPNA 4W5UA 4DQWA 3UCCA 1DWGM 3FY1A 3C0SA 1HGWA 2Q8ZA 4WK9A 3BLKA 4GNJA 3EX1A 3WDRA 2ISFA 4JN8A 5EL1A 3GFYA 3VNJA 3UWQA 1ALDA 2EQDA 1O68A 2WANA 2AQVA 1ZNNA 3R10A 1EDTA 3N2OA 3TJIA 3MWAA 3TTEA 3EWBX 2X0SA 3W25A 2XFFA 1KFCA 1RPXA 1EP2A 4LPCA 1WDDA 3IVSA 1OFEA 5T8GA 3WF1A 1Y7VA 1TWSA 4J7RA 3VCRA 1VHNA 4RV3A 4B4HA 1MW1A 2YCIX 1D2KA 3TWAA 1HO1A 1K6WA 3U4AA 4DPQA 2E7FA 2FKPA 3WJXA 4RDVA 1BAGA 4DAIA 2OKTA 2OKOA 2PTXA 2J8FA 3DHUA 3PBMA 3KZPA 4DI8A 3MHUA 1QHOA 4G6CA 2I9EA 1FUYA 2ZE3A 3E3HA 3WD1A 2ZRUA 3T55A 4QG8A 3FFSA 1LWHA 3MS8A 1FWRA 3N34A 4RE0A 3LU2A 1FWNA 1WP6A 4YWSA 7TAAA 4M6PA 3EDDA 2QKFA 5C5YA 2PRLA 4WZHA 3GWQA 3N17A 1P7TB 5GJNA 1WDSA 2ZRZA 2V5LA 3L66A 1G1YA 3VC5A 4Y8EA 1W5OA 4H8HA 4FSAA 3GXDA 4ZQCA 3VIMA 4GA8A 1VBJA 4WJXA 4BHYA 3ZFHA 4GXMA 4K7YA 5GQBA 7ENLA 5C2XA 1P1MA 3USBA 2VENA 5HXMA 1OK6A 4P7OA 4F2TA 1VBUA 1ZP3A 3OIHA 3T05A 4LC6A 4ACYA 1EPXA 2GJPA 2ZDRA 4DJEC 7PTDA 3QMTA 3FSUA 3S42A 1Z3NA 1VFHA 4Z2JA 4C7GA 2BG5A 4GCXA 3ID7A 5JBFA 2ACUA 4MG4A 3TYEA 2OJPA 1UH3A 4IGSA 5DMLA 1OC5A 3M0XA 4EXQA 3R8GA 4IQJA 3GAYA 5LHEA 4Y2WA 1V6XA 3UR5A 3IRDA 3O15A 1E6RA 5DX7A 2EAWA 3BE7A 1U1HA 2AL2B 2Q8XA 3NYDA 3SJNA 3H21A 4MMWA 1K70A 4W89A 3KRBA 4EWND 3WL0A 3SCQA 1OCNA 1OK4A 4CLMA 2YL5A 1C29A 1VLIA 3P80A 5D8ZA 1LWJA 3KLLA 4F66A 3N9RA 3R11A 1XCFA 4LT9A 4PBEA 1JDEA 2D23A 3CL8A 1W1B1 4DZAA 1R2SA 5BWAA 2C7FA 1VJSA 1MSSA 1E1EA 2VJXA 5G2WA 1DPMA 5CLWA 1WZLA 3OVGA 4TVDA 1POKA 1TELA 2NVCA 4BCEA 3E5PA 3LCGA 3NSXA 3U2EA 4PFHA 1I60A 2J8GA 4CNOA 2QNEA 3B0XA 2PAJA 5AB3A 4JS3A 3TH6A 3SURA 2OLAA 3L5LA 4Q4PA 4UTTA 2ZQ0A 3ZJ6A 4IP5A 2ZZ7A 4IMGA 1SU5A 1IF2A 2OQYA 3ANUA 1TV7A 1LRQA 3VIIA 4WF7A 1TCDA 3VINA 3DG7A 4KFNA 1Z8AA 3DHFA 1DIKA 1KFKA 1YTDA 5HPCA 1S1RA 3LI0A 4K37A 2Y8KA 1ONEA 4JYEA 4I9TA 4N0RA 3LV5A 3HPXA 2PDUA 6REQA 3W2UA 2Z2UA 2H3DA 5D8WA 5I7GA 3C2YA 4PBGA 2NT1A 1SZFA 3MMTA 2ISVA 4S39A 3BQ5A 3NQ7A 4Z2HA 4PR4A 3GFXA 3VO0A 5DXXA 1TMHA 3RG6A 3URNA 4LSBA 1CLVA 2RDTA 1E0WA 1M01A 3GG1A 4FO4A 1W3KA 2I56A 4KRTA 3RF9A 2A0NA 3LLXA 5BMWA 2ZRXA 1M7OA 2CLKA 1XLCA 3P14A 3N15A 2AGKA 4E4UA 4NJKA 1W1IE 4JTCA 3M5ZA 3RLHA 2GWGA 3ZSSA 5E0KA 4I5UA 4JQ3A 3CPGA 1WKEA 2QCDB 2ZWZA 5HJLA 1W9BM 4MZ8A 4W4QA 2CLLA 1KRCC 1GOWA 3NQAA 4KEMA 5LGXA 2POTA 4OECA 3OYZA 4RNJA 4Z1DA 1E4NA 5C0QA 4X2RA 4O19A 3ARRA 3H4GA 3PZGA 1PHQA 4N42A 4HMCA 1JXKA 1HF6A 4L64A 5CQ1A 4P7QA 2AL1A 5TNVA 1ICPA 4MWAA 1AZ2A 4PMYA 3T78A 3IACA 3F7JA 1K8CA 2B81A 1K9EA 1UKPA 3MSDA 1EIXA 2QPSA 4L4MA 4Z17A 5I77A 3AICA 2W4XA 3KDOA 3QGKC 1IIHA 3EX2A 4C6LA 5D33A 3QKZA 2QUTA 1RP8A 4QAIA 1K9TA 3SCTA 1QASA 2X1SA 3IJQA 4O1AA 5CJMA 5FESA 2XM1A 5MKGA 4YL2A 1CGUA 1HVXA 3WX7A 4G7EA 1DJYA 1OIMA 4HMEA 1XBYA 4IX0A 4TVUA 1EXBA 3WJYA 1AVAA 4DB7A 3P8IA 1ZB5A 4I5XA 1KFBA 2J88A 1BF6A 1SQ7A 4JD4A 3M5XA 2BZNA 3HURA 2ZDSA 1ENUA 3I6RA 5DF0A 3QGAC 3TQPA 1BXNA 4PTVA 2BY1A 3P82A 2VR5A 4HB7A 4O1DA 2OEJA 3GDBA 8CGTA 1ITQA 1JYVA 4AMAA 4UB9A 3F2CA 4FIRA 3KRUA 2XYLA 3LRMA 1MNZA 4MY1A 3RJYA 1KM0A 1U5HA 2PFHA 2FLIA 4E4PA 3O06A 3E0LA 4S3DA 1T0OA 4J28A 4DJFD 3WBYA 3ANVA 3FVMA 4R88A 5AC7A 3U5UA 1ZZMA 1U5VA 4UFLA 1BXCA 4IUOA 3T2QA 1DJGA 5DN1A 4O12A 2FGLA 3WQPA 3V1PA 3ZVIA 2WJFA 4OZOA 3AJXA 1KV5A 4GMEA 1WDQA 1UYQA 2J13A 1MQPA 1RPKA 1YHTA 1JAEA 2E28A 2VOMA 5HMDA 1VPXA 3BCFA 3RM4A 4HA1A 5B7YA 1XFCA 3ZT6A 1F74A 1B54A 4I8YA 4REQA 1TV5A 5HUPA 3BCJA 2WK2A 3NDYA 3QEZA 4E2BA 3F4VA 3UA3A 1VRXA 2XFYA 2SFPA 3T0AA 3BAYA 1W9XA 1FWTA 4B5NA 2IKHA 3M0MA 3EWWA 1RA5A 1ONRA 3GG7A 3OGRA 2I16A 3TAOA 3KL0A 3KXQA 1IHIA 2DVTA 3HZ3A 3B9OA 5AYBA 3NG3A 5I0DA 3L5MA 1K9DA 4JTKA 5ABFA 3FX4A 3UQNA 4D1IA 3M0IA 3G1VA 1V02E 1B31A 3UFYA 2WNQA 5HA7A 5K3VA 4DIAA 3ZWTA 1UD2A 5FAJA 5DCBA 5CJ5A 3S5ZA 3G24A 2YGYA 1J96A 3D6NA 2C6QA 4I90A 5FCZA 2OZ0A 4F0HA 3TN6A 1AQHA 1KM5A 4R7OA 1W32A 2PEVA 3CIWA 3WELA 3FW6A 2WQPA 4AW7A 2XSXA 4S3KA 5LA2A 3SUUA 2P3EA 2VCCA 1W1PA 5A3HA 2X7VA 3C0JA 1QPNA 2PDYA 1PB0A 3PVFA 1O7AA 1VC4A 3M0HA 5BXPA 3T0BA 3MSYA 3USZA 1KO0A 3MYOA 2D0FA 3TV8A 2HVMA 5GNZA 4K3ZA 3LTPA 3SY1A 1OCBA 4QISA 2JKEA 3G1XA 1XRVA 1QMLA 2FPVA 4MF4A 3BLDA 1UJQA 2YJQA 3FJNA 4HIBA 1CB7B 2I5IA 4JTQA 1YNYA 1RLDA 1Y5XA 4H41A 3FXGA 3ZR4A 3UP8A 5U4NA 2AMGA 4GVFA 3PZ9A 2Q02A 3AUJA 4XAYA 3W2LA 1EC7A 1H1YA 4DWSA 4GI8A 3G0XA 4ASTA 3NOYA 1OFDA 3SUWA 1XUUA 4LVFA 1GG0A 2HNEA 1CGWA 1OX4A 4ZB2A 2CYGA 3MKCA 1CXIA 1W0MA 2XGIA 6XIMA 1NU5A 3WQCA 3TSMA 2PI6A 4PZVA 2D2HA 3CMFA 3BAKA 1SZNA 2YDAA 2A7RA 1AH3A 1JZ3A 4R53A 3BOFA 2CLPA 3LM3A 4PMJA 4G2DA 1L2UA 1KBKA 1LL7A 5LNVA 2TSYA 3HJEA 2OPJA 3GTNA 1R7AA 3POHA 4R9XA 3MUZ1 4F0SA 5CXPA 1UA7A 2F84A 3TC3A 3NAVA 3U2OA 3L4YA 4U28A 3GU9A 3VGGA 3DAQA 5BROA 2Y7DA 4E4FA 1E6PA 2FHFA 3PY2A 4YTSA 4IIFA 1FDJA 2AQWA 1NDVA 5D9NA 1V6VA 3F5LA 1W3JA 5J04A 4Q8PA 5AZ1A 3FN9A 5JBEA 1KFJA 4XTIA 3URQA 2NUWA 5TAOA 6A3HA 1FWCC 4DF1A 1F3WA 2Y4SA 1QHPA 1RQBA 3E12A 4ZO8A 1OFRA 1UMYA 2VM8A 4QITA 4NJGA 3R7MA 3E02A 1XLMA 2VEIA 4LNCA 3VNZA 1WCGA 2XZ7A 3VM5A 3K8LA 4LYRA 1Q6OA 3LMZA 2FHCA 1H61A 3TAKA 2X8RA 1HP5A 4B3ZA 2IQDA 5JUVA 1XSJA 1X7FA 2DIKA 3CH0A 4RPQA 4M56A 3W28A 4N9EA 2J27A 5FJRA 3A12A 6REQB 1GJUA 3RXZA 4PRRA 3CHVA 5I3DA 3MV11 3VNKA 2ZTJA 4CD8A 4YLWA 1P0EA 4JNYA 1A4LA 3V0UA 4CD6A 3TEVA 3PN8A 8XIAA 3NTYA 1B9ZA 2HE5A 4EANA 3WQEA 4MGGA 4JFSA 5CPLA 3VD3A 1NQ6A 3DYOA 5I3IA 2VYOA 4S2BA 4GISA 1MDLA 3GR7A 1R46A 1YE4A 2CZFA 4NYYA 4H9XA 3T9PA 1IWPA 1G69A 2V5JA 3PSWA 5D37A 1WV2A 1XIBA 3AROA 4N6EA 4ZO7A 3WK2A 2XH2A 3GO2A 2H9AA 2VFIA 2DSWA 1EYWA 4DJEA 1M9HA 3STPA 4FX7A 3MUIA 1QPQA 3DXIA 3VC6A 1NTHA 7XIMA 3E1F1 1XDLA 1PX8A 2W62A 2ZUTA 3QKEA 1KWKA 3G1RA 5IFTA 1YPFA 3D3AA 3GTXA 1E5JA 1HJQA 1GQJA 2IW0A 3GNPA 2C71A 4Y9AA 1LT8A 5BXRA 4EOUA 4HNTA 2WVVA 2O7QA 2J24A 3W88A 1VR6A 1ADDA 1H7PA 2J47A 3NQFA 3SGGA 3QM3A 4GBDA 4IMDA 1E1CA 2BVWA 2O9PA 4FF7A 4K2SA 2DZVA 3MP3A 4KMQA 3OGSA 2E3ZA 2IQTA 4YVXA 3KM8A 2E1DA 1OJXA 2NQ9A 2FB3A 4HHHA 4JN7A 5ECVA 2W6RA 4BI7A 2VO5A 3I68A 3UT0A 1EL3A 2XDFA 2WJEA 3W2KA 5AVNA 1E5NA 3AXHA 2WVSA 4XD5A 3RLGA 3XISA 5I00A 3KOFA 4GK8A 2Z1KA 1MW2A 3WLPA 4OT7A 3QHNA 4WOQA 3N11A 3MKVA 1Z44A 4G7EB 1BQCA 3DENA 2FPTA 2CBJA 5GVJA 4K68A 2DGAA 4GQBA 3ES8A 3TXZA 4GO8A 3UU0A 1H49A 5A2CA 2B7QA 2X16A 1PDZA 5A6BD 4BF5A 2P10A 3HO8A 2VGGA 3TNBA 4GKTA 1PE1A 1LL6A 3RILA 4C1LA 1VIZA 1F05A 4MDOA 4Q6JA 3TN3A 4KRZA 3BPWA 1GVQA 1CYGA 4I8DA 3CXOA 1JCMP 3SZ8A 4JBRA 2WO5A 5D2WA 4M6VA 2WMGA 1UJPA 2VFFA 3HFTA 3EXTA 3G3MA 1AG1O 2XISA 4ML9A 3QV8A 5LNUA 1FH8A 3R43A 4EPKA 1PZ0A 1EF3A 1ZENA 2PCEA 1A5CA 3A5VA 4HJFA 2G96A 1XH0A 4MB5A 3P61A 4QS5A 4KCVA 3R0UA 2BV9A 3UZ5A 7A3HA 1US2A 2GJNA 3OYXA 4L61A 3N2BA 3CO4A 3APTA 3XINA 3KRSA 1QNOA 1JL8A 4IGNA 1ZP4A 5H1WA 1GVOA 2J62A 3Q58A 3MC5A 3NGJA 3R8HA 1WXYA 2D2JA 3AHTA 4LJ3A 3T07A 1TZ9A 4DZIA 5T26A 1L8NA 1UC5A 3ZR5A 4REQB 1H09A 3RX4A 3ZWSA 3CIVA 5GNYA 1G6CA 3DEQA 1GZ1A 2QGHA 1HXJA 1R87A 4X60A 1XGZA 1KKOA 5CSYA 3V36A 4RNFA 2OG9A 5ABHA 3PBYA 3BTNA 5A8PA 9CGTA 3EBVA 3NPVA 4ACZB 3UJEA 1Z41A 3W7IA 4D6CA 4G56A 2EPHA 4WLCA 4R7JA 1MQRA 5A8GA 3UY8A 4AU0A 3B04A 3WLNA 3HJZA 4GY1A 3QSTA 4GIYA 3B9NA 1RVKA 2RDXA 1THFD 4UOQA 2GSHA 5CZTA 4ML4A 3RU6A 3E2RA 3OP2A 3PWAA 4ZQMA 3FK4A 3P81A 2DY3A 2ZX8A 3O6AA 1XLGA 1FWSA 5DBTA 1CBGA 4O10A 3CZGA 3I7RA 3FJ4A 4LUJA 3P6LA 3DH7A 3SQSA 3SCOA 4K8EA 5G1MA 2P0IA 3LXAA 1SGJA 1FDYA 4QQ3A 2D0GA 3R89A 1S1PA 1YDOA 1Z7AA 4XBSA 3EKLA 3QY6A 3CBWA 4H2CA 3A22A 1TPDA 4E2VA 1R2TA 1I2PA 4DO5A 4MOZA 4AD2A 1XCXA 3G1FA 3S2MA 4PUEA 2J7FA 4MNKA 5E0FA 4JCMA 1XXXA 3W7CA 2DJXA 3PG8A 1X8CA 1G4TA 1QTWA 3LGDA 1JI1A 3T2PA 3M41A 1A47A 1GT8A 3KHJA 3KRZA 3KL3A 2Y7GA 3BLOA 1JIBA 4B5XA 2VGBA 5KITA 1IYXA 3EZ4A 5CC7A 4BR1A 5A8NA 4URIA 1Q45A 4GX8A 3OEXA 1V3MA 2ZC8A 5AC4A 1IGSA 3MMWA 5K9DA 4H1ZA 2G8ZA 4DX3A 1TMLA 4CVWA 4DXKA 2XVPA 3PP7A 5EMKA 3R1ZA 4Q8QA 2J7EA 3ZR6A 4NU7A 2YA2A 3SN0A 3W7KA 2VX7A 3PJXA 1X6UA 2KX9A 1UASA 3BXWA 4PUWA 3HV8A 3N1AA 2V0TA 3N2XA 2FZ8A 2RAGA 4DUXA 1X97A 2DUXA 3IARA 3W74A 5MF5A 3WF0A 3WQWA 1KB3A 4AAJA 3MU7A 3WEMA 4XG1A 3BLLA 1XYZA 2Z0IA 4RX0A 3DC8A 3OBAA 1AW5A 1GK8A 3UGRA 1R2RA 1QI5A 2DJLA 1H7OA 1ZPTA 3QSRA 1DL3A 2YBVA 4ZL1A 3NJ3A 3EXSA 1U1JA 1FH9A 2FDSA 3EKGA 2V81A 1NFGA 4NAEA 1ISYA 4EKJA 3EB2A 3HIJA 3WH9A 4PEKA 3VIFA 4OWGA 1XQLA 3WQOA 3NQDA 4QR6A 4TV6A 1Q3NA 3WF3A 4IIBA 4JZ5A 3HTWA 3W7MA 1UWQA 3VFCA 2YCJA 2QDGA 3GX9A 1JUEA 5LA1A 3EX6A 3EWDA 3EA3A 2P76A 1L6WA 2IKGA 4GI6A 3GLCA 1SZGA 3RITA 1W3IA 1T8XA 4IWWA 2DT0A 4PBFA 2WC3A 1VIWA 2VQUA 3BAJA 3CHFA 3QF0A 1C3FA 3URAA 3VE9A 3DYMA 5IBXC 2OSYA 3N12A 1E51A 5F2LA 3FNDA 1PIIA 4I7WA 3BH4A 3S5YA 1A5SA 2BHUA 4X61A 3CZEA 2YCLA 3VOIA 3MBDA 1YPIA 5HQEA 4KWWA 1DVJA 3EYPA 2VDGA 1MMFA 1YNPA 4MZYA 1TO3A 2Y8VA 4J3XA 1C93A 3E0IA 3L4TA 2WMIA 3LCXA 4GHRA 3EMCA 4J3UA 2Q3OA 1QNVA 1H7NA 3F4WA 3MZNA 3K4AA 1R47A 1TR1A 1IQ8A 1AH0A 1QI2A 2HCVA 5JQ9A 4JIEA 2V5BA 3LHYA 1T6MA 1TWDA 4CNNA 2INFA 1V6WA 4FXSA 2E8YA 2QAPA 3TA6A 2GJRA 4I6KA 1HTIA 4UTLA 1E9IA 3T40A 4JTLA 3TC6A 2H9AB 2ONEA 1V77A 2FGZA 4PE8A 3TFCA 3WK0A 3KBJA 1Q5MA 2DEPA 2WNNA 2YKKA 5H91A 3BJSA 2PE4A 3W1AA 1NP2A 1RCXB 4PCNA 2QF8A 4D6JA 1RBLA 3M47A 3JU2A 1GGOA 3Q37A 4K8HA 4UTWC 9XIMA 1JR1A 3DHPA 4AEOA 5JBDA 2NXIA 1NSJA 2AAMA 2ZVRA 4XVDA 1CXHA 3KS5A 3E0WA 1LBFA 1DWAM 1TPC1 3GXPA 3K4DA 1BEUA 3S2CA 1FCUA 2QCNA 4KWUA 1KQZA 3S46A 1IXOA 1A0EA 2XSAA 3OU8A 3D3FA 3NDZA 3ITYA 1RBAA 4PMDA 3ZLGA 1BXBA 3PZUA 1IXNA 4US5D 1M7PA 4MNJA 2DU2A 2CLHA 4JGDA 4HGXA 4JEJA 4HPHA 3QOMA 2P88A 3VTRA 3LYEA 4BJHA 4UCGA 4HU4A 1N8FA 5AHNA 1Z69A 3M7SA 1KFEA 3UYCA 1E0XA 1DV7A 4QHRA 1NQKA 3CT7A 3WENA 4DLFA 2HDJA 5BOOA 4RW5A 2V68A 5C70A 2INZA 5FEPA 1JJKA 2QS8A 2FMOA 4C6DA 3ARUA 2PDIA 3TZFA 4X9SA 1PZ3A 4U2ZA 2Y1HA 1VB9A 3M0VA 3GSMA 1GUVA 1UPMB 3QH2A 4RL3A 4MY8A 2QJHA 1FKWA 4XVEA 2CLFA 3DGBA 4KT2A 3UCDA 4M7TA 2OO0A 1PAMA 4Y96A 4C6CA 4UZUA 1AQ0A 2P3ZA 2Y89A 5CSUA 2DP3A 4ERIA 5A8MA 1GORA 4LAUA 3MDWA 4NJJA 4RDWA 1UBSA 1QI3A 3NQGA 2IPJA 1E71M 3HG5A 2GJXB 4MNMA 4IHCA 1DORA 2TMDA 4OV9A 4UBPC 2OX4A 1GOKA 4EAYA 4W7WA 4PL2A 4JNZA 3FAWA 1XP3A 5HANA 4GH1A 4DO4A 2B0MA 2NWSA 3SJ3A 3CYJA 2YA1A 1S3TC 2DW7A 1OHLA 4WY0B 1EGZA 5AKQA 3U2ZA 2VOTA 1OFAA 5FEWA 2HVNA 3V7PA 3RYSA 3UZZA 4B5TA 3UA4A 3LHWA 1L6YA 4B9YA 3U57A 2HPMA 4DI9A 3AZRA 3W73A 1GVFA 4YCOA 3MA8A 2GLKA 1B3WA 2V82A 2DV0A 1XBZA 5AOUA 4IJCA 5HNNA 5HJYA 3QTGA 3W85A 4ADUA 2EXOA 4M7SA 5I78A 4UFIA 3KVMA 3C8NA 3KAOA 4FEZA 1FWGC 3PZNA 5G4EA 3CC1A 1VP5A 3NQCA 3HPSA 3LHVA 3W1NA 3ZM8A 1LOQA 2NSOA 4EF8A 4L65A 3NL5A 5FJPA 1WZAA 4IPIA 3NQ2A 4CEXC 2ZA1A 1SZRA 3TONA 3P67A 3P5ZA 3EXRA 2JEQA 2EG7A 3QPZA 4MAZA 4QE4A 3OQ8A 1DKWA 4KF1A 4O0QA 4MYXA 1DP0A 1Y0EA 2ZUSA 4GG9A 2DT3A 3NQ6A 2I1OA 2J7HA 1AD1A 4NILA 2ZRYA 1OGBA 4GXWA 1YADA 3H2FA 1J0YA 1W91A 2HK1A 3W4RA 4W8LA 4CGTA 1F8MA 3H2MA 5EBAA 1H60A 1MYRA 2I57A 3PBGA 3QPYA 3QVQA 2BVTA 1AQMA 3SFKA 3GYCA 4CU8A 2RKXA 4G8TA 1OQFA 2Q8LA 4GE8A 4XIAA 4ICMA 4GQQA 3H22A 3GVRA 4O53A 3WFAA 4XWUA 3MZ2A 4MWAD 4ZXOA 3P8JA 1V6TA 1G4PA 1J0HA 3KCJA 3IK4A 2PGWA 1W1YA 2E5CA 2PDKA 4CNSA 4GVGA 2JF7A 1AW1A 1GOIA 4GFSA 2G4JA 4X0NA 1UIPA 4Y90A 4DUWA 3W7GA 1HJXA 3MP4A 3RPMA 4WKAA 1HNYA 4HNUA 3VFLA 5FF3A 4GVIA 2DH2A 3IUHA 3WDIA 2PZNA 3H2CA 4M19A 5ABEA 2GGHA 3LTYA 1DXEA 3ATZA 4HPGA 4M51A 5A6JA 1FP9A 4RDZA 2PWGA 1Y65A 3F5JA 3G0SA 3ARQA 3AIEA 3PPHA 2LLEA 1BHGA 4A3HA 1NOWA 2WHJA 4LBRA 4CN1A 9XIAA 1F7BA 2WOQA 2PCQA 4BQ5A 4CVUA 1RD5A 2A2IA 2YSWA 2PDBA 2J66A 1LLZA 3H12A 2I5QA 2HS8A 4BFAA 1AMKA 2PU0A 3WJSA 3V75A 4QAWA 1H5YA 3OA5A 4L1GA 5DMMA 1ISZA 4PTDA 3ITCA 2OO6A 4ZE5A 2WCSA 3SSJA 4GNVA 1B90A 3FV9A 3K8MA 4NAEB 4QDWA 3WLLA 3N9SA 3QQWA 2W67A 4XO6A 3ZYZA 1EUNA 4Z1YA 4RPPA 4MTVA 1L6SA 4ZSUA 3S8HA 1J11A 4Q3MA 5BXTA 3IGSA 4ZGYA 2ZXDA 3BSMA 4C1NB 3R8RA 3P3BA 3ITGA 1LORA 2NX9A 1DJZA 3KOWA 1LBMA 1V79A 3VGFA 4NZ5A 3WUBA 4GD0A 3DOPA 1ZL1A 2QCLA 1MRAA 2QIWA 1REQB 1VHCA 2HMCA 2QGYA 2NUXA 3GC2A 3LSCA 1J0IA 4J40A 1EA0A 3WNKA 2G3JA 3TTYA 1DXFA 1EEXA 4NZ3A 2IKIA 3PWGA 4AXNA 1IWAA 2FVLA 3W7EA 2IUZA 1XRTA 2VXNA 1XIMA 3C56A 4CQDA 1VCGA 3ICJA 2O9OA 3E0VA 3AO0A 1DJQA 1NF7A 3EWYA 1S3HA 3CWOX 5CZJA 2W5FA 1PTDA 3M16A 1E6XM 3NA8A 3M0YA 3S2LA 3UWWA 3APGA 5C8BB 4PMNA 2QVNA 1QOQA 4MJ4A 4YHEA 4ZCWA 3NQVA 2BY3A 1N8WA 2NX3A 4LTSA 3R94A 1RLCL 2YBUA 3WL1A 4GY7A 3N6JA 2V38A 4JIQA 2WMIB 2O92A 3H55A 3SN4A 1LJYA 1OC6A 1IT7A 2HBVA 3HV9A 1BWKA 4OBTA 4UR9A 2ASHA 1IGWA 4NF7A 1UZ1A 1KFLA 4L6HA 4YTRA 3UVAA 3P74A 1FHLA 4WDTA 5REQA 3TTQA 3DIPA 1W5NA 3ZOAA 4KBXA 1NFPA 3UG3A 4AX7A 3GBEA 4P61A 1ZTVA 1VFMA 4PSRA 4DYKA 1EWEA 2YA0A 5IDIA 4BWLC 4PMOA 1EEPA 3DX5A 3Q45A 4A8RA 3NQMA 4ZQPA 3W07A 2ABAA 4PMUA 2QJGA 5F2GA 1DJHA 2PGEA 1UP2A 2DIEA 5HNRA 4FX6M 1NWSA 2PLJA 4GXPA 2JK2A 2XH0A 3SY8A 5H8UA 3V5FA 4WVXA 3UG4A 1ITXA 1R9XA 2B7PA 3HG2A 4XKYB 1E0VA 4PTMA 4XB3A 4JTUA 3OIXA 2VFGA 4CNTA 3H4WA 1E55A 3DERA 1HKVA 5DY2A 1EA9C 4WD0A 4DXXA 3MCMA 1MW0A 1P5BA 3T1GA 3ME3A 3GTFA 1HGYA 4DWSD 1XLHA 3BO9A 2ZBTA 4A3RA 5J5DA 4XAGA 4IL0A 1WA3A 3MSRA 4TU1A 1PDYA 1JZ5A 1A49A 4BQ3A 3D5HA 3LPGA 3TCEA 5CPOA 2X30A 1OM0A 3AYTA 4W8BA 1PXGA 1T99A 4OV4A 3PPGA 4WQ6A 3UY7A 5M1TA 4Q7IA 1UW9A 2NLYA 3W83A 4NZ4A 2BTMA 4V15A 3BMXA 4P7NA 1ODUA 4DM2A 3AHZA 1V0KA 1BTCA 4PB4A 2BWGA 3L9CA 3TMLA 1QBAA 2VZVA 4C6MA 4FR6A 1VD6A 4MB3A 1A80A 3ZXWA 3VE7A 3FDKA 3DFQA 3THQA 3C5QA 1I9CB 4IQEA 2IQ0A 4D6EA 4JNMA 1W1ZA 5IBXA 1P6CA 3LM7A 4LC8A 3QLDA 1A53A 3N73A 5FACA 3LLDA 4KFPA 3ATYA 4EPEC 1UKOA 3BG3A 2OVLA 2OZTA 4AUBA 2NT0A 4EWJA 1G9HA 4HTBA 4NG3A 3GDRA 3SO7A 4RK8A 2EPOA 3MT1A 1AJ2A 4XAPA 1ZAHA 4ORMA 2Z24A 2C1HA 4MPQA 4TO8A 2WPBA 1M7XA 1LM1A 1MRQA 3APYA 2HK0A 5JXQA 5LNRA 1VEMA 2I7GA 3QGVA 2C15A 1OFOA 1TV3A 3CV6A 3EWCA 3W9ZA 1AJ0A 4JTRA 3BCDA 1TIMA 5F2MA 1O94A 3UETA 1WDWA 4QQUA 2OWXA 1JZ8A 2ZA2A 2NV2A 4E0CA 1LG2A 3HBLA 4MJZA 2W0UA 4CEUC 1A3XA 1KV8A 4GNKB 1W9VA 1FDZA 1KR1A 3NPUA 1BGAA 4M81A 5F4WA 2VHLA 1Q8AA 4D8LA 3AS2A 1VF8A 3CB8A 4L9YA 4JTDA 1CZ1A 2F6XA 4UTWA 1JGIA 4B5VA 3N19B 3E49A 4Y9PA 4JY8A 3U48A 1HKMA 5EMJA 3SQLA 1M53A 4MYAA 4K1WA 2HSAA 4ZXLA 4QTGA 4OHQA 1YDVA 2DZAA 3VOGA 4AIOA 3BZJA 1JULA 1XS2A 3ARXA 2V9DA 2X1TA 4X2PA 4GI9A 1XLKA 1CI1A 3QMSA 3TC7A 1GNXA 3DUGA 4DF2A 2NW0A 2JFEX 4IT1A 3T7VA 2ZXBA 1OVDA 2W61A 4UQ9A 1JF5A 3PS7A 3GU1A 5C7VA 4IICA 4R3UA 1NOFA 4ZOEA 3GR4A 2WZEA 3MVIA 3ZJ8A 2OELA 2HROA 3AYVA 1UUQA 1ISWA 4HA3A 3TW7A 2PGFA 5JU6A 4EACA 2XINA 5AYIA 3WUEA 3G8EA 1J0ZA 2AMXA 2R24A 3OHIA 1EBHA 3DKJA 1ZGDA 4P7RA 1LOSA 4HU0A 2WXDM 4F40A 3OVRA 3S5OA 1DHPA 3W7RA 4RNIA 4GYPC 3LX9A 1ZY9A 3E6EA 1VGAA 5D09A 5CSRA 4ZVJA 3DFTA 2Z29A 2ANUA 4LUTA 3HPFA 3M44A 1TFVA 3RLUA 2EG8A 3I7SA 4EXBA 3BLPX 3ITLA 1XYCA 4JIRA 4J3VA 1ZUAX 1LZOA 3LSBA 2QZRA 5LHFA 1YLVA 1L8PA 4Y7EA 3UXLA 4P5UA 2G97A 3T0TA 3M5YA 4EXAA 3SIMA 2V30A 3O1NA 5A6AA 1UH4A 2J6VA 1NH6A 3VNDA 1TZ7A 4FLOA 3WBWA 4KKXA 3PTKA 4JL2A 1SJDA 3ABQA 1V0MA 1IT0A 3NNTA 4QLKA 3RHGA 4IF2A 4WXYA 1W56A 4LAKA 3CAQA 3W70A 2ODOA 2JF6A 3W81A 1GYLA 4DNHA 1I6NA 2BFGA 2XVLA 2E9BA 3AIQA 1XH1A 3H2AA 5DCDA 3U7VA 2VEGA 1JUBA 1SM9A 3AWOA 4YS1A 3TN5A 1GTHA 1P48A 5L9FA 1ZJAA 4QLLA 4LV4A 2ISDA 4DPPA 1RV8A 5ENLA 3NZGA 4MVAA 1QW7A 2EPNA 4L4OA 3MO7A 2CIPA 2WKJA 3PTMA 1ZBCA 4C6JA 2I17A 1ZCOA 3UNTA 3N2TA 3QYQA 4AFYA 4D9PA 3RNDA 4FXJA 4YWIA 3M0LA 1V4YA 2VC9A 1A5MC 4U10A 4OFCA 3ZVHB 3ZJ7A 3M07A 4GIEA 3WH7A 4FLSA 4HHPA 1KCZA 3TQVA 4R34A 5D05A 3FHQA 1E6NA 2KZHA 3QY8A 5EA9A 4L6OA 3AI0A 3WUGA 4S1FA 3WO8A 4O11A 3MMDA 3WLKX 3CUZA 3ZSTA 4CUCA 3KL5A 4DJFC 3M1ZA 4GYKA 2FZDA 1P6WA 4KERA 3ORWA 2PDLA 3PNZA 1LBLA 2CLOA 3TJXA 5I3KA 1T40A 3TU9A 2DT1A 4TIMA 4AZ6A 2GPTA 4F8XA 3M6YA 3VIKA 2VZTA 3UR7A 1HKWA 1C91A 3NL3A 5BMXA 1SFSA 1FA2A 4OUIA 3GNXA 3TE9A 5DMYA 3OG3A 1BPLB 1RQHA 3CO8A 5IM51 4XISA 3PUDA 5F4XA 1QU4A 1V51A 3ARSA 3LHUA 3IANA 1ZBVA 5IFPA 1XIDA 1F2JA 1XH2A 1WBHA 3TP4A 3C3UA 3TOPA 4JOMA 3TSDA 1XBVA 4FA3A 2IPWA 2PWHA 3WQ5A 3OZOA 5EPDA 1OT2A 1ONXA 3VKCA 3BAXA 1KRAC 2INEA 3AXXA 4NXSA 1EC9A 3BW3A 2QXWA 1WUEA 3WFLA 2ZWYA 3SUVA 2DZBA 3IVUA 3DESA 2O4QA 3VAVA 4IM4A 1TV8A 3MANA 2O7SA 1VENA 3OVPA 3CT2A 3LCLA 5REQB 4BK9A 1NY1A 4LANA 5FD0A 4U4MA 3W27A 2A3EA 3JRKA 1NM9A 4EPBC 4M5PA 2D3NA 1LCOA 2BVDA 3ANYA 1VYSX 5DY3A 2WBGA 3L65A 1OF6A 2Y70A 4PTNA 2YXXA 4W8AA 3U5YA 2WZMA 3AIRA 4CQAA 2EJ1A 3MJYA 5G4WA 2D20A 3R12A 4UTFA 4Z42C 3KW3A 2WAGA 3NEVA 3UXKA 1R6WA 1Z32X 3KWXA 4JHZA 2Y24A 1FH7A 1QNRA 2OFJA 1HL8A 3S2NA 1JRBA 4LVDA 2A3AA 3QN3A 1EJRC 1ZHAA 1FHUA 1MFUA 3TMQA 4MZ1A 3SBFA 3W1QA 4AZ7A 2UY2A 4FZIA 1QHZA 2ZZ2A 5BU6A 3BSHA 4JICA 3WBXA 2PC8A 2V2DA 3LZ5A 4LVAA 2W79A 4YTTA 3C2FA 1H7RA 2P8BA 5CZKA 4MLJA 2YL6A 4QJ5B 2CHRA 2QHAA 3STEA 3GQYA 5DCEA 3WNPA 3L4XA 3SFWA 1EJTC 3KHDA 3DKLA 3WJWA 4NJHA 4WXZA 3VZZA 2PDCA 2HV5A 3WD4A 4GIRA 4C6PA 3EPMA 5FJOA 3PJTA 1SVDA 1DQXA 4LALA 5M3WA 3W86A 1X6LA 4JTSA 3QV9A 2PSNA 5CZSA 1GKQA 1O4UA 4ZTYA 2D69A 5G2HA 2VEPA 5F1VA 3TWBA 4TX8A 4GQRA 2E6DA 1QWGA 3VIJA 2GVGA 3FHAA 2HWGA 3N4FA 1RR2A 2Y62A 1VYPX 1NDWA 4JTTA 1A5BA 5AY7A 5HJXA 4D1JA 3B0YA 4NL1A 4N4PA 4JTFA 2VGFA 4AY7A 1SO3A 4NT0A 4FIQA 1QPOA 1W54A 3C0QA 5K7JA 3A9BA 3STFA 3TZNA 3UJSA 2QLYA 1P6BA 3R13A 1YNQA 3QW3A 2WVTA 3U7BA 4UOJA 1OCQA 3K46A 3WBAA 1SJCA 1O95A 1EJVC 2G3FA 4TOQA 1XM3A 3AIVA 3N14A 4FNPA 4IQDA 1V6YA 4DZ5A 3GNDA 1WBJA 2YL8A 2TRSA 4FNSA 1OCJA 2B4GA 4XK2A 3WQVA 1Z9AA 3GDMA 4M1RA 3KOXA 5CEWA 4V1XA 5A6LA 2BXZA 2PWUA 2XIIA 1RJRA 1MWOA 5AHIA 3FA4A 3QTPA 3AISA 5TD4A 4E3VA 4ONVA 2QCDA 3CASA 1CGTA 3DG6A 2GFTA 4MADA 3LY0A 3WQ8A 2CHNA 3IV3A 3VMOA 1KM4A 5E70A 4MFEA 2VEKA 3T8QA 1KBLA 3KE0A 4AQLA 3EX4A 3W1PA 1FWFC 2V69A 3ITVA 4C6BA 3PWIA 3EX3A 4AWUA 1US0A 3LZ3A 3OBKA 4JKMA 4F0LA 1J6PA 2GUBA 3CAVA 2H8ZA 1WQ5A 3AMLA 3SCWA 4GC4A 1W9UA 1XFBA 3R5EA 1XKYA 3TA9A 3VGEA 1CXFA 3L12A 1OD0A 2VTFA 4BF7A 3UJ2A 3CV1A 1EX1A 1DWJM 2GJLA 2A3HA 1QFEA 2JGQA 4ATDA 2Y63A 1A0CA 1UZHA 2J78A 4L4LA 3F4NA 4RV8A 3CQJA 4AZCA 1MI3A 2E4TA 1VBGA 1Q6RA 2POZA 2GQ9A 3G1DA 5CLTA 1O1ZA 1J79A 3HQOA 3C2EA 4P7LA 1SW0A 5I3JA 3AHXA 3BGAA 2QIIA 4RDYA 1QW8A 3DBNA 3E2SA 1KRMA 2G3MA 4BEQA 4FOUA 2HE8A 4A3QA 3OLGA 1M5WA 1JZ6A 4IQLA 4JFTA 1JDFA 3DYPA 4ZQNA 1BG9A 1XUZA 2Z4GA 4Q7NA 2QCFA 4IIEA 1HKJA 1I8JA 4IG2B 1GYMA 1DTUA 1S5VA 3LEPA 4FLQA 4LS1A 2E9LA 2ZUVA 4HPXA 2VKZG 2OEKA 4JR5A 2GVLA 5DBUA 1F8IA 4YIWA 4RR4A 4A6GA 1R3VA 2QUVA 4EX4A 2XH7A 2WYSA 3G5EA 4PUJA 4MJMA 4RKAA 2OQHA 4O15A 4UQEA 2HZGA 2ZX9A 3CV7A 4P2VA 4CD4A 1E1FA 1MQQA 1N55A 4AYGA 2XIBA 2Z00A 2R9RA 1V3IA 1VFOA 1UWIA 2B7OA 5KEZA 2NX1A 4UNKA 2PDQA 1GOXA 2WM0A 2YR1A 1RBOB 3PC0A 1PYMA 1L0PA 3AZTA 2C0AA 3SUSA 3W75A 1ME8A 1XYMA 1HJWA 5KINA 3WCZA 2XWDA 2PDHA 3UVIA 4A35A 1QUMA 2DQXA 2E40A 2VI0A 1P0BA 4ROPA 5FA5A 4LVGA 4Q7BA 3VZYA 1B3XA 5LIYX 1EOMA 5GNXA 2VDIA 3N3TA 1GQNA 5CC5A 3IEBA 1QO5A 4ZFMA 4FXFA 1PZ1A 1R3YA 1DTNA 4AY1A 4LXFA 5KTLA 3A64A 2ZYFA 3VNLA 5LZLA 2WHLA 1KGWA 3VNMA 1HKIA 4NP7A 4GUFA 3TK7A 4ENLA 2WB5A 5C9ZA 3CJPA 3ITTA 5HINA 3MTWA 2PLCA 4FI4A 3C3NA 4OUEA 4ZOCA 4O1CA 3B4YA 1XRSA 3CMJA 3NUKA 1C8XA 4OOZA 3F4CA 2VVSA 3IPWA 2GVYA 5G1YA 3SECA 3JZEA 3BV4A 3A4XA 4UFHA 1F4AA 2WNZA 3DDMA 1VBHA 4PEEA 3CQKA 1UQZA 1TRIA 3NFUA 3QV7A 1RALA 1WXZA 3GIYA 4HNVA 4WSKA 4DNMA 4H9TA 4OBRA 3S5SA 2QAFA 3DZ1A 3WDJA 1XDMA 1LL4A 5IHRA 2BOEX 1TTJA 4G5DA 4UR8A 5D9MA 4MWAE 4FB7A 3QLLA 1E6SM 3TOYA 4ZOBA 2P5NA 1QK0A 1V0LA 1UZ4A 3PHAA 4I9AA 3SRKA 3PM6A 2XG9A 4LUSA 4GYPA 1TWIA 4X3ZA 3CUFA 5CPTA 3TUUA 3UWZA 3QPEA 4FNTA 2HPIA 1GYNA 3DFHA 2YL9A 4IP4A 4QJ1A 2ZICA 1C7TA 2C13A 2C1GA 2OU4A 1EHAA 3QBUA 5D32A 5KZ6A 3NEHA 4GABA 4HHLA 2QMKA 4Z0SA 1CXLA 2QCGA 3SI9A 3VKKA 3AZSA 4Y6GA 1KM6A 3S6DA 1RJQA 5GJPA 5TQLA 4HSOA 4AX6A 1VFLA 4PMVA 2E5BA 1XLJA 5FF4A 3QR3A 3SCNA 1P0DA 1BKHA 3AFBA 3LRLA 1CWYA 1JCLA 4JPGA 3C52A 4E3TA 5GJMA 4IIDA 2Q6ZA 5A1AA 4O4WA 3RMEA 4B5UA 4DF0A 4AIBA 3IV8A 3TYCA 1ISXA 4JKLA 5A95A 1K3UA 4J3ZA 1TWZA 3OLDA 2EF9A 3WUFA 1OFQA 4B15A 2CNCA 3ARTA 4PL1A 1Q66A 5CBIA 1R30A 3RK8A 4UFMA 2V5CA 3QW4B 4R7WA 1PBGA 4H7VA 4EE9A 4MAVA 1BF2A 2QCMA 2ZXQA 6PTDA 4N4QA 1LT7A 4XAFA 1EP1A 3QJAA 1XLEA 1KCXA 1XYBA 1W1VA 4JFUA 3UBPC 2IPFA 1WX0A 1TX2A 3GU2A 4HOWA 4DUVA 3VOJA 5E93A 1EJXC 3CLMA 2GSJA 3LPFA 5AECA 3MSGA 1DJNA 7REQA 4AWTA 1YE6A 3OQEA 4XBKA 3UZYA 3G8RA 5M2FX 4QS6A 3NIYA 4XZMX 4DJFA 3O6YX 3ECQA 3W2JA 3WQFA 2OWWA 3WKZA 1GCYA 1TTQA 3L4WA 1TKKA 1JPDX 4C5ZA 3V16A 3MUXA 2P8CA 1PX3A 4GO9A 1S5TA 5CGMA 4ICNA 3VX1A 2PWDA 2XPKA 3VIPA 4D6DA 4LCSA 3AJ7A 3P60A 2PC4A 2PD9A 2PDMA 1I2RA 4B16A 2PP1A 3ZO9A 3O16A 4P8WA 1LLOA 1E56A 3U6WA 4I5RA 4C65A 5C9RA 1W2PA 3T8LA 1V3LA 5DMNA 3DECA 2I5GA 3N6QA 2C14A 5EMMA 3W6LA 5DELA 3SR7A 1QT1A 5CC6A 4Q4MA 3WQ6A 2BGSA 1Q13A 1KFWA 2BMBA 3PNUA 3S83A 3F2DA 3RO8A 4GJIA 4HMNA 5I3GA 4RCXA 2NQHA 1PPIA 2QPUA 4H2HA 1WE5A 1T5AA 5AYXA 3P93A 3H7RA 2J75A 3ZMRA 5CZ0A 3IS4A 4A8NA 3KOZA 1YRRA 3BLFA 3IWPA 5BNKA 2ATSA 4JX6A 3LHZA 2FZNA 3L0GA 3RRAA 3GH4A 1PUDA 2WNWA 4C1KA 4DBSA 3GIQA 3MPGA 2ISWA 2J7GA 2J8TA 1VEOA 3UCQA 3PUEA 3EDKA 2BXVA 1H2JA 2E0PA 1PWMA 1X1NA 3WD2A 4ILSA 1C90A 1UBPC 3VOCA 1SSDA 1WAWA 1KGUA 4IXHA 1M7JA 1K4HA 4C60A 4ZZ9A 4O17A 3AIWA 2QEZA 2REQB 3TFXA 2XJ7A 1GHSA 4AZCB 3B8WA 1K7FA 3B0VC 2MANA 2YDRA 1LQ2A 4G1KA 2FJUB 3WIJA 3GZ3A 1Q2RA 5HAOA 4JL1A 2VELA 1I0DA 3SGUA 2PODA 3K8KA 1VFUA 4LAMA 3VZXA 2V3FA 4MNLA 2O9TA 1MXDA 1FRBA 1W31A 2QQ6A 3PJUA 3SN1A 3O63A 3M6DA 4Z08A 3BAWA 5FEZA 1NF0A 3GYEA 2V3EA 4CN4A 4H04A 1K8YA 2DZTA 2F38A 3BAIA 4AWSA 3NM1A 3S3GA 1LWIA 9RUBA 4FXRA 1E3ZA 5I2UA 3LNMA 3L0NA 2PDWA 3B8IA 3WN6A 3P0WA 3FKKA 4N2YA 2O9RA 3OLIA 1QDSA 3FLUA 3GRIA 1Q7QA 3UG5A 5LYRA 1B57A 3OOQA 3TQKA 1Z42A 1AA1B 3MCNA 1IIGA 4GI4A 1JZ4A 4LH8A 1PSCA 1GQKA 1E0UA 1PCKA 2DW6A 4QBXA 1FWJC 3AQUA 1X8FA 4XD3A 2RGMA 4JYDA 5BOEA 2XGZA 4PH6A 4M0XA 1YTEA 4WJEA 2VD9A 1RD6A 3CIXA 4PMZA 4UC5A 5FJJA 3PR2A 1JYWA 1OX5A 2Z7KA 1NELA 1A4MA 1XG3A 1JQXA 2D73A 4DBDA 2G37A 2C16A 4AY8A 2CCRA 4F2UA 3QRHA 4U3AA 2QDEA 1BYDA 3WZ0E 4AD0A 4J9JA 4WDWA 3A3HA 4XZIA 1I1WA 4RXFA 2WSPA 1KC7A 4ACZA 5CGQA 3W7HA 2Q09A 4TUFA 5AVHA 5BOFA 4M24A 2WC7A 1WPCA 1SYTA 4GUJA 4Y8FA 4OE7A 2W3ZA 1TRDA 1XIFA 3IJ6A 1TIWA 4NXKA 2Z1SA 1QATA 3ALGA 4MKNA 4IUGA 5L6UA 3VKAA 3QXBA 5LIKX 3ZT7A 3LBMA 3G1HA 2PA6A 3BG5A 3NO5A 2PU1A 4AC1X 2RGLA 1XGEA 2GL5A 1F9CA 3NQEA 5A5WA 3EWZA 4DVOA 1I75A 4HSNA 1G94A 2WCAA 1EO5A 2GOKA 1RJPA 1O1HA 3VILA 1UZDA 2J25A 3MUY1 1IEVA 3O8AA 1FWIC 1VPQA 4DO6A 3KTXA 1R0MA 3FEQA 2YW3A 2G0WA 2QJIA 3MVTA 2JKAA 2PTYA 1SPQA 4G9PA 5JH2A 1GOMA 1OGSA 1VFFA 2YX0A 3O0FA 3W71A 3K30A 4RE4A 3UW6A 3LGEA 1VPYA 1YMYA 1GZGA 4LUYA 4NAFA 3S9YA 4F2BA 1MUMA 3B8SA 5IHSA 2XSBA 3VIGA 4LUSB 2BVYA 3G1SA 3K5XA 1S38A 3PZMA 3LMYA 2Y6ZA 1GOQA 1TV4A 4S23A 4IMCA 4WEVX 3FYYA 5XIMA 4D2JA 2R6OA 4HCDA 1S2UA 3IIPA 1JPIA 3WLHA 4JXCA 3B06A 1M1BA 1TE1A 5M5DA 3VMNA 1CPUA 2QYGA 4LX4A 4FHAA 1KTCA 1EGVA 4YPJA 4FX8A 2G3NA 4LVBA 3H26A 1L9WA 4UQBA 4D6HA 2VUYA 3KFTA 1FWHC 4S3JA 4B90A 1NIUA 2VX5A 2PMQA 2V6AA 1UR0A 2D2GA 3IJDA 4UTUA 4C90A 3IVTA 2YXOA 2BODX 3TYZA 4AISA 5I02A 5KSWA 5CG0A 4N6FA 1HL2A 1OYCA 3PB2A 2ZA3A 5HMFA 4YXGA 1KGXA 1OG0A 2C8NA 3W87A 4XZBA 3LA4A 1V5XA 1C7SA 4KGLA 2ATMA 1ECEA 4Q33A 4GWEA 1EDGA 3T0DA 1BLIA 5D9PA 1TA3A 3BC9A 3GE7A 4NI3A 1JGMA 3I10A 5I06A 3K4WA 1ZJBA 5A6SA 5FF7A 1H63A 2E5DA 5A6BA 1R3QA 3FVDA 3IAPA 3IJIA 4RNHA 2HBXA 2BP1A 4PUDA 7ODCA 4TTUA 2UY4A 1LDCA 4MWAC 3TR2A 3G77A 1WNOA 6TAAA 1KNWA 3ABOA 2XTKA 4S3CA 2DQWA 4LAOA 1YBQA 2WHMA 7REQB 1F6YA 2GYIA 4FOJA 5D9OA 1MNSA 2DZWA 2F2HA 3TJ4A 3GZAA 2YB1A 1GWJA 3VD4A 1OSEA 2R1LA 1XKJA 1JQVA 3RUBL 5FSEC 1F6KA 1OADA 2CHOA 2Z6IA 3VD9A 4AWEA 4DY1A 3WNLA 3WDHA 1VJIA 5F4SA 5EMUA 1TPFA 2VNCA 1K02A 1U22A 3FXYA 3RCYA 3UESA 1K77A 1XCWA 3W1MA 2OB3A 1G01A 4LY4A 1AW2A 1VBRA 1VYRA 5T9BG 2DIJA 1FWEC 2J9ZA 5CGTA 1TJPA 3SAZA 4U31A 1XGDA 3G6MA 3HQNA 2J9YA 4N7QA 4D72A 2HS6A 1J2BA 1W3TA 3PTQA 3FYOA 4Q8UA 3S9IA 3I3BA 4F9JA 2G50A 1Q6CA 4UFJA 2XVGA 3BW2A 4F0KA 2A85A 1QRQA 2WHKA 2Y2WA 4JTHA 1UPPA 1CT5A 1Q63A 2RDUA 1WKFA 2CZDA 3THUA 3G1YA 1GVEA 2R82A 4WY0F 4ZEPA 3N6HA 5E6ZA 1A5OC 5AHEA 4H19A 2VD8A 5CC3A 5DRIA 4QDMA 4PTWA 3V5OA 2CESA 3THDA 3A24A 4BQ2A 5CSSA 2V5KA 3IGUA 3Q2DA 2JGYA 3ITXA 1XIHA 3MB9A 1O6IA 5EFFA 3UEQA 5LIUX 3S2JA 4ZODA 3INPA 2ZIDA 2ON3A 3N3MA 4GH3A 4IPNB 5CJNA 2ALDA 2QPXA 1W9DM 3QR1A 2CERA 1FWWA 4LGXA 2X1RA 4BZYA 1KW1A 4GUIA 5HWJA 5K9CA 3IRSA 4PN2A 2E09A 1R5YA 2OMAA 2G41A 1WYIA 1GVSA 3E5BA 4RE3A 5G5IA 4DHGA 2J4GA 3U3HA 3BARA 4O13A 1B0IA 3WLMA 3AXIA 3TJLA 4AIUA 2PRMA 2BY2A 4GYFA 3W6MA 3P2VA 2F6UA 3KS6A 1CENA 4FNRA 1YPXA 2J7BA 4M3PA 2FH8A 1E43A 3VPLA 4RZ4A 4H9VA 2NQZA 4HJWA 4LY8A 4L56A 4HA4A 4PULA 3CM4A 1KM3A 1GZJA 1RCOB 3BOXA 1GQIA 2PDGA 3EPOA 3VMPA 4DLMA 1BD0A 1DHKA 1UD6A 1KD0A 4JDBA 1EZWA 4KWSA 1H0IA 2OGYA 3NCOA 4HZ6A 4M6UA 1C8VA 2JIWA 1HL9A 4PC8A 2GDUA 2W27A 4AF0B 1S2TA 3WMSA 3CB3A 1GOOA 2GJXA 3G2GA 4YYCA 1JD7A 4O28A 1WXJA 4XX6A 3OW1A 2PPGA 4WSHA 3W76A 1HZYA 1D9EA 1GQLA 1IR2A 3UD6A 4W87A 1CGVA 1OX6A 5EY5A 4A29A 1IXPA 1PL9A 1WZKA 1LRTA 4WY0A 4AD3A 1KKRA 2UWFA 5IRPA 2Z2AA 5CPSA 3H70A 2OTDA 3GIPA 3M0JA 3R25A 1KCLA 3WQ4A 5HOSA 2Y85A 2D0HA 2WC4A 4OU1A 3NZ1A 4IJBA 2R1MA 3RCNA 3WLOA 3RM8A 4HQVA 1C8YA 1XJBA 1BYBA 1OZMA 1HW6A 2QV5A 5D4YA 3L7RA 2CZVA 3TYBA 1CB2A 3HMJG 3W37A 4D6IA 3R79A 3KBSA 3JVAA 4LRSA 1Q7ZA 3B4UA 3KP1A 4UOZA 2GK1B 3E9AA 5C2CA 2EJAA 3UXIA 4PFMA 1ML1A 3D47A 2P53A 2RH9A 4HHMA 4Q8VA 1U1UA 3MI3A 1X7IA 3LB0A 1YXYA 1LP6A 1QOPA 4DM1A 4L4PA 1GTEA 3AIBA 4XBJA 3GXIA 2NSXA 1CCWB 5DXYA 4KCWA 3V18A 3VNIA 1UD5A 2XHYA 2FVKA 1OGGA 3K1GA 1BVNP 1TCMA 1KQYA 1EFZA 2X42A 2EEXA 4UXDA 1YEYA 2TYSA 5T9CE 1DJIA 2VEMA 1TE6A 3GXTA 4NQ1A 5EB8A 2ZRVA 3L4VA 5M03A 3M5VA 2IPGA 1E3XA 2IXUA 1VZWA 1D7FA 4PYSA 4L80A 4L1XA 3AMCA 4YVPA 2GDVA 3LHTA 3URBA 3S1GA 1SFTA 1FWDC 1PJ9A 4KIEA 1OF8A 4AHOA 3EB3A 2C19A 4CNPA 1B3ZA 2J9XA 3TTOA 3LPOA 4AMCA 4PB5A 1Q6GA 5E6YA 4PCFA 1PZ2A 4AZGA 4MSSA 4FS9A 8TIMA 2WMFA 2QMJA 1TSIA 4NAFB 5LKYA 3NZPA 3KLKA 3S1UA 1S2VA 4DJDD 5IDZA 1IT8A 3N2CA 1DXIA 3W02A 1ZAJA 3BL3A 4PCPA 3BICA 1JFXA 3C2OA 2GQAA 1FCQA 3BGGA 2YPIA 2Q3RA 1H62A 2I9UA 3M0ZA 1R3SA 4Z1CA 5KZDA 2P1FA 2O4MA 3B8VA 4FF5A 4PCTA 4NJIA 3EA2A 1UD8A 4Q22A 5BYWA 2BXYA 3BUVA 2P50A 1US3A 2BHYA 2YIHA 1ZJIA 3CEUA 2J74A 1RSCA 4QE1A 1UWSA 1CECA 5H8MA 4PUNA 3WMBA 2FJKA 2QUUA 3SRHA 3AU2A 4AB4A 2YZRA 3RX2A 4US5A 1DE5A 1F73A 1XRFA 5ABGA 1XLAA 3M64A 1L2QA 1HUVA 2FTYA 1UR1A 4N9BA 4H4IA 2PP0A 3KX6A 4GIAA 3AAMA 3OZPA 2OCZA 1BYAA 4MJ2A 2VRKA 3EWUA 2GGIA 2ZX6A 1MUWA 2YYTA 3AU6A 4GC3A 4KPLA 1F4HA 4Z1AA 1JCNA 4JCLA 1TA3B 3N25A 2Z1VA 3TQ0A 1IEWA 1EJSC 2V67A 4YTQA 3WJZA 4C1NA 3TLLA 2YFOA 3SW6A 3CU2A 2BY0A 3CHCA 1GVRA 2FZ9A 5LXEA 5E0CA 6TIMA 3LUTA 1GEQA 2AKMA 4NNCA 1GJWA 3I4KA 3EEZA 1KXHA 1A5UA 1REQA 2EGZA 5CAHA 2E25A 3H4XA 1HJUA 1JDCA 5A6TC 3TW9A 4E2DA 4F79A 1YBQB 2VZSA 1ECQA 1X38A 3PZOA 4BI5A 4GKLA 2AOSA 2W92A 1GKPA 1J2WA 1A5KC 5H2ZA 1KCKA 1JD9A 4UWMA 3QZAA 1SW3A 4LF2A 2DUZA 4MIMA 2NVAA 2WJDA 3EAUA 1CLXA 4J35A 1BWVA 1HX0A 3FJLA 1YXCA 3NPXA 2XN1A 1AL7A 3MHFA 2OT0A 3SGZA 4DXVA 4YTUA 4XO7A 3GVVA 3GH7A 1J6OA 1RHCA 2WVUA 1TZZA 3AS3A 4ZSTA 2Z27A 3SSZA 4CU6A 3C2VA 3TLQA 3SIZA 4RW3A 1PHWA 4ZQOA 4BQ4A 1TPVA 3JS3A 4KFOA 2A6NA 3GDKA 4LCRA 5KZMA 1B4KA 4MUZA 1WKYA 4H8NA 2OYKA 3TCSA 2A3CA 1M3UA 3L21A 3BSGA 2PWFA 4IFOA 4BF9A 1FBAA 1ICSA 4A22A 1NWRA 1I2OA 2OT1A 2A3BA 2IS7A 5E09A 3PB0A 1TB3A 3Q94A 4ERAA 4QXIA 4JY9A 2R8WA 3II1A 5DT5A 5HATA 4PGLA 5HNUA 2X1IA 4GCAA 4AD5A 1X96A 2PLMA 1ITCA 3TTSA 3GKAA 4AD4A 3OVQA 3WDPP 1YQ2A 4LRTA 3OODA 4QDPA 2VURA 4ADSA 4IMAA 1VCFA 3G22A 3KVJA 3LCIA 4W7UA 4GY0A 4XKYA 4OJYA 4NHVA 5EMYA 4US6A 4O54A 5DFAA 2QDHA 4IGHA 3LCHA 1ELSA 2CETA 2DSZA 4TMBA 4M6QA 4UTMA 4LEQA 4W9TA 3LXBA 4O18A 1LOLA 1WDPA 2XZ9A 4EK7A 2CZ5A 3VDBA 1B5TA 1HJSA 1XICA 2Z26A 2X0YA 1UD4A 1BWLA 2ABBA 1RP9A 1D3HA 4H9MA 4HNCA 3GDTA 4MFDA 4UTJA 2YFNA 1Y5WA 5JIPA 4PUKA 4BA0A 2X2YA 3UJFA 4CCEA 1H3GA 1TVPA 3VCCA 1C9DA 1KXTA 1XW8A 1E40A 2NUYA 1QPRA 3VCNA 1N8IA 3GHRA 3V1HA 8RUCA 1LRNA 1FHVA 3NM3A 4MPKA 5GPRA 5D30A 2Y5JA 3B9EA 1JZ7A 1EKOA 5HDRA 2UV8G 3T0CA 2GOUA 4OOUA 1BVZA 1T7LA 2CLIA 2VRQA 2FIQA 3P62A 3TR9A 2DFAA 3O6CA 4A3YA 1Q6QA 2XN2A 1SSGA 1SW7A 2BB0A 5K4XA 1TVLA 3A4AA 3W26A 4CNUA 4GUHA 1MW3A 3CHEA 3CPRA 3XIMA 2IKJA 1OB0A 2DSVA 3HA1A 5HPOA 5D2XA 1M03A 1W8SA 2CXGA 3PULA 3LERA 4JTGA 1XIJA 3HMCA 2PDJA 3RJXA 1QPKA 3U4FA 3RPDA 4XZNX 1CGXA 1I4NA 1XLLA 1W9PA 3FSTA 1WOAA 3HGRA 3A3XA 2NV1A 5T91A 2NXGA 3GW0A 4M80A 1FOBA 5FL0A 5I23A 2X7WA 4RXGA 1EHNA 2VP8A 2NXHA 4JTEA 1U2YA 3CZLA 3HGJA 5A94A 3RAOA 4K7VA 3C86A 4H6EA 2QJJA 1EX5A 1AFSA 4V2XA 3C0LA 4GFIA 3DN5A 5LNSA 5KETA 7CGTA 1E4MM 4LS2A 2B7NA 3STGA 3QY7A 2VEFA 5FKYA 2J79A 2ACSA 2GVEA 2EKCA 2UBPC 3RR1A 3W1XA 4TQTA 1FWBC 3NOEA 3CQHA 4Z2GA 5HR7A 4DZHA 2HVOA 5K2ZA 1S2WA 1LQAA 2CLMA 3GR8A 4RLIA 5CKSA 4C6FA 5D02A 1K4GA 1UIOA 3PTDA 2A21A 2FMNA 3GBDA