1VFSA

Crystal structure of d-cycloserine-bound form of alanine racemase from d-cycloserine-producing streptomyces lavendulae
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
383
structure length
382
Chain Sequence
ETPTRVYAEIDLDAVRANVRALRARAPRSALMAVVKSNAYGHGAVPCARAAQEAGAAWLGTATPEEALELRAAGIQGRIMCWLWTPGGPWREAIETDIDVSVSGMWALDEVRAAARAAGRTARIQLADTGLGRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPATLTLPETHFDLVRTGLAVYGVSPSPELGTPAQLGLRPAMTLRASLALVKTVPAGHGVSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLVAGKIRRAAGRIAMDQFVVDLGEDLAEAGDEAVILGDAERGEPTAEDWAQAAHTIAYEIVTRIGGRVPRVYLGGLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords alanine racemase
publication title Structural evidence that alanine racemase from a D-cycloserine-producing microorganism exhibits resistance to its own product.
pubmed doi rcsb
source organism Streptomyces lavendulae
total genus 127
structure length 382
sequence length 383
chains with identical sequence B
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2004-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 1vfsA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 1vfsA02
3CO8A 2O0TA 4A3QA 3WQEA 3VABA 4XG1A 3HA1A 2ODOA 4KBXA 1FTXA 4ECLA 1EPVA 2RJGA 5GJPA 3GWQA 1XQLA 3WQFA 3BTNA 2SFPA 3B8UA 4Y2WA 3MT1A 2YXXA 4BEUA 1W8GA 1NIUA 4LUTB 4LUSA 4LUYA 3ANUA 1SFTA 3SY1A 3E6EA 3AWNA 4V15A 4BF5A 4PB5A 1VFHA 4DZAA 1NJJA 3B8VA 1HKVA 1L6FA 4AIBA 4PB3A 5FAJA 3WQDA 4WR3A 1BD0A 2J66A 1L6GA 2TODA 5IRPA 2PLKA 3C5QA 3B8TA 3E5PA 4BHYA 1XFCA 1KNWA 1KO0A 4ILSA 3WQGA 2VD8A 3N2BA 3AWOA 3HURA 1CT5A 2OO0A 1VFSA 3LLXA 3NZPA 2QGHA 2P3EA 3R79A 3B8WA 5FAGA 4LUSB 4FS9A 4XBJA 3S46A 1SZRA 4BEQA 4ZGYA 3OO2A 1VFTA 1QU4A 2DY3A 1TUFA 2NV9A 1B54A 1D7KA 3CPGA 3N29A 1F3TA 3KW3A 5GJMA 2VD9A 4LUTA 5FACA 1TWIA 5GJNA 7ODCA 4PB4A 3UW6A 2PLJA 3N2OA 2ON3A 4DYJA 1RCQA 1HKWA 2NVAA 5BWAA 3WQCA 1XQKA 2RJHA 3ANVA 3NZQA 4QHRA
chains in the Genus database with same CATH superfamily
2XN2A 4PTMA 5CGMA 3PAOA 2CKSA 2HCVA 3FIGA 1R3RA 1K8CA 3G0XA 4ML4A 1AZ2A 3QFWA 1YNQA 1HF6A 4FNSA 4L80A 3N1AA 1RJQA 2W0UA 3QYQA 2ASHA 4RUBA 4H83A 2RDUA 1TX0A 1FKXA 5D04C 1P6WA 3BLLA 1KRAC 3GHRA 1M68A 3MBDA 4HK5A 1DJQA 4HHHA 4EK7A 3T6CA 1UR1A 4CVUA 1ODZA 1TPC1 2C7FA 3RIKA 1E3XA 2GQ3A 1CXLA 3IUDA 4C6CA 4O18A 2EJ1A 3IJ8A 4UMAA 3PC0A 5F4XA 2TSYA 2JALA 3QHNA 1DJNA 4IG2B 2AQWA 2EPHA 2YCLB 2WM1A 4NZ5A 3RXZA 1GOKA 1TWZA 2ZUNA 4MY8A 1EOMA 1UKQA 2OX4A 2Q6ZA 3T8QA 3ECQA 3LCHA 1OIFA 3W53A 3MC5A 4AW7A 1HVQA 1BXCA 4IGMA 3UW6A 1TJ1A 5D30A 4Z1BA 3V1HA 4DJEA 1ZBWA 3SCNA 1QATA 2NQ5A 4I6KA 3HG3A 3W37A 2JF7A 2DSVA 1CI1A 3GFYA 3CM4A 2PI6A 5MHBA 3A13A 3WLPA 3GTNA 2WQDA 1M53A 1LL7A 1OX4B 2G3IA 3RX3A 1RVGA 1GZJA 3VE9A 4DJDD 1CIUA 1KGXA 2B4GA 3EDJA 4CGTA 1GW9A 2OZTA 3BDKA 2H6RA 1W9DM 4J3VA 4QE1A 5DANA 4K7VA 3KZSA 3CLWA 5HNUA 5F4SA 3VDBA 4DF0A 3TW7A 3UJEA 1JVNA 5CZJA 1PIFA 1XD0A 2OSXA 1A5MC 2QF8A 3ISIX 4YIWA 1UKOA 1TQXA 5CG0A 4HYVA 3LBOA 5FA5A 1VBRA 1NFBA 2DSWA 3M6DA 3ONCA 3VNMA 1Q4NX 2C0AA 3G1DA 5FEPA 4CD7A 3AS3A 1H0IA 4B5WA 1BWVA 1JZ5A 3P74A 3G3MA 3B8IA 3VOIA 3O6AA 4ZGYA 3OYXA 4EPBC 3WDPP 3IIZA 1GHRA 1B2YA 3MKCA 2XH2A 3V7PA 3IIVA 1M04A 2H9AA 3R89A 3MHFA 2BHZA 3L2IA 3SDOA 1E5JA 2R9RA 2BODX 3KZPA 4GQRA 4JX5A 1OY0A 2Z26A 4DY1A 4EACA 1TKKA 4MDOA 4XD3A 3CHFA 4QDMA 1VHNA 3VIMA 4GI9A 1JYWA 4OZOA 1H7RA 4O1CA 1ELSA 2J88A 3ABQA 4QJ5B 2WMGA 3TSDA 4O16A 3UXLA 4ZO8A 1XXXA 5FJOA 1QHZA 4ACZB 3WD4A 1XICA 5EBAA 3VKKA 3REQA 3ARRA 3IUIA 2V6AA 1SMAA 3R43A 3PNZA 1H5VA 5DMLA 5HR6A 3RPDA 4A3RA 3GKFA 1I1WA 3G1SA 2AOSA 4ZA0A 2DW7A 2ZZ1A 3KS6A 3IS4A 4AG0A 3R2GA 3BH4A 3IJDA 3W87A 1UZ1A 2XUCA 3RX4A 3F4DA 4KEUA 4M29A 2W66A 4RDYA 1PUDA 3W82A 2AKMA 3T08A 3NL2A 2OMAA 5LZLA 1JF6A 1E72M 3SCSA 4HOZA 1ISZA 2ADAA 3HJZA 5T26A 3GHUA 3AYRA 3M0YA 2V30A 2YDSA 1ML1A 1Z3NA 3WK0A 4ACYA 5E0KA 1UH2A 2QUVA 3QW3A 2DZBA 1W5QA 2PDBA 4I5RA 2XWEA 1FWAC 2J74A 1W1TA 1V08A 2CZFA 2O92A 3GVQA 3T0AA 4L7ZA 4O0ZA 5KSWA 4S3AA 4IMCA 1ITXA 1GQIA 2VQUA 4NZ1A 1EHAA 1OVDA 4YVVA 5I3IA 4QIUA 3C8FA 4W88A 2WV8A 2CWXA 3GDBA 4H6RA 4WSHA 3AAMA 1THFD 3SIZA 4MJMA 1AJ0A 3BLIA 3N04A 2QPUA 3LSBA 1E1CA 2FFCA 3FK4A 1DKWA 3THQA 3V0SA 1Z44A 5AYBA 3CPUA 4FF5A 2NX3A 2D2JA 4XAPA 4DM2A 1KBBA 1MUWA 1R3TA 2QDGA 2WBGA 4C6EA 4ERGA 2OO0A 1YTEA 3TK7A 2V3DA 1Z41A 4XIMA 3AI0A 1MXDA 3KLKA 1D8CA 3RFAA 1SQ7A 2V2HA 5CJ5A 1EBHA 4LS1A 3QLDA 2R91A 3HGSA 3H55A 2J27A 1W5PA 3HBLA 2P8BA 3TCSA 1MRQA 1W1YA 1BKHA 3GHTA 5HJXA 1K9EA 3T0BA 4FHAA 4HQVA 3BV4A 1RCQA 2UZ9A 3WK1A 4UFKA 5G4HC 1K8YA 4IQEA 3W86A 1FBAA 1I4NA 4KBXA 1F3EA 4PUNA 2FLIA 3AALA 2I5QA 2PU1A 1UD2A 3TSMA 3QKEA 3WLTA 3QGAC 3AQUA 5CPSA 3KL3A 3BAWA 4J7RA 4AY1A 4J2MA 1GT8A 3TLLA 5HJYA 4F8XA 1MXSA 2Y5SA 3L65A 4AIUA 4HMDA 1E9IA 5BU6A 1XS2A 1OYCA 5EMMA 5LYRA 3I7SA 4PUMA 4TU1A 2CZVA 1Q13A 1RA0A 3F5KA 5G2IA 2Q8LA 1JPHA 3QTPA 5IRPA 4ZSTA 1OFOA 2JIEA 4NNAA 5H8PA 3CT2A 4A4AA 4MNKA 3KBSA 3WF0A 5D37A 2D20A 4N4QA 4AIEA 2DZTA 1RALA 1UH4A 1TV4A 1QOQA 3RN6A 5L9FA 2QZRA 5A8QA 5D9MA 5KTLA 1QT1A 1TZ7A 5AHFA 4JKKA 1ZU8A 2W63A 1ISXA 1V0LA 5C2XA 4GYFA 2WYSA 1KBJA 2QHAA 1MSSA 4J1OA 4GYJA 1BTMA 2VJXA 2QCGA 4JQ4A 1JDCA 2YLLA 3C2EA 2YCLA 3A21A 2PURA 4ZO6A 5JH1A 1E15A 4XQ6A 3VUPA 4HTBA 4PBFA 2QEZA 4OBTA 4BF7A 1V6YA 3QZ6A 1RQEA 3CIWA 4GQGA 1D2KA 5D33A 1V6WA 1K8ZA 2DIKA 2ONEA 4DX3A 1KB3A 1MZHA 2VFHA 2WHKA 4LY8A 1KFWA 3NXLA 4Q22A 3WBXA 3M7SA 3HV8A 3BMWA 2XVKA 2BSLA 3WF4A 3GKAA 1BQGA 1XKYA 5AFDA 2X8RA 2G4JA 3UZZA 2ZICA 2BY2A 2IPFA 1EGVA 4U3AA 5J8LA 4PZVA 1B30A 3PZGA 2OKOA 1QR7A 1QOPA 2CHRA 4ERAA 3CAQA 3MI2A 4H2CA 1G01A 3W7GA 5GJNA 1SO6A 1W9VA 3IJ7A 2VEIA 4WKAA 4ZQPA 5D03A 5D2YA 4QS5A 1R38A 1RPXA 3S1VA 2VTFA 3LS9A 1J5SA 4U33A 1OFPA 5HUPA 4GABA 1V3IA 2VRKA 2Z27A 3QV7A 4R7OA 3L4WA 1Q4WA 1XG3A 1L9WA 2W61A 3P14A 3KE0A 4C65A 4H9UA 1W8GA 3W9ZA 5AYZA 3T40A 4PCSA 1SZFA 5AYXA 2F2KA 3DC8A 3K30A 4IZGA 4AD0A 2B7OA 5TD4A 4PB3A 1UWRA 3HG4A 4O17A 5CBJA 1Z8AA 1RHCA 4TX6A 4FXJA 2POTA 2WANA 1FWIC 4AVNA 2C15A 3SN0A 3BSMA 3QHMA 2PTXA 4GPNA 3EAUA 4RKAA 1TV8A 4HA3A 1BKSA 1GTEA 4DUXA 1TFVA 4MWAD 5FI8A 2DH2A 2JQXA 3TV8A 4S3BA 1ZJHA 4G5DA 2HE5A 2WMIB 2BG5A 3AZRA 1VPXA 4HNLA 3FEQA 3T4CA 2J25A 1WB0A 4HB7A 4LYPA 4O0QA 4UQCA 4Y6GA 3CL7A 3S5SA 3TH6A 3ZVIA 3WQ6A 3V4BA 4ZXOA 2BDQA 2PC4A 5C7VA 3SI9A 1DOSA 1JUEA 1IQ8A 2DIJA 2WC3A 4JTRA 3GNDA 3L4TA 4M1BA 3WNKA 4O1FA 5CAKA 1TTPA 2I9UA 4I9MA 2DZSA 3B4UA 5BXSA 5KETA 1UC4A 3E12A 5AY7A 4X0NA 2X2YA 1CB7B 2DT2A 2QVNA 4XD6A 1TO3A 4JAWA 4K8GA 1JZ2A 1EEXA 3EEGA 1V8EA 2J7HA 2PTZA 2Z2UA 4U10A 5CAHA 5LSMA 3G6LA 3WMSA 3BJSA 4QFUA 3TA9A 2YFNA 2AMGA 1A5AA 1ITUA 3EX2A 4Q8PA 5E0CA 5FJUA 3SCWA 2F6KA 1JYXA 4F2UA 1N8WA 3TWAA 4DI8A 2J7DA 1KNWA 2QPXA 2OOFA 5MF5A 1DP0A 2WVUA 3B3DA 1W2VA 3JRKA 4B90A 2YW4A 1UOKA 1XI3A 3QZEA 1GZ1A 4WSKA 1XH1A 3OVQA 4EXQA 1UCWA 4BQ4A 4C6FA 1VFLA 2YCJA 2Y1HA 2VFEA 4ZEPA 2EPNA 3AMDA 3DHDA 2ALDA 1LOSA 1TPUA 1OFRA 3VO0A 2O55A 4M6QA 2CZ5A 3RILA 3OA3A 1XDJA 1HJXA 1B5TA 1JPDX 1MW0A 2A5HA 2Y62A 4J2PA 5BOEA 1M65A 4LRSA 4DM1A 3FDKA 1J93A 2YA0A 4HCLA 3RM4A 2L5HA 5EYWA 4XG1A 4Q4KA 1ME7A 1XUUA 1RK5A 4GYPC 2QJMA 3MUAA 4W7UA 1FWRA 1XD1A 3SQMA 1AH0A 1TVPA 5IFTA 3R0KA 2C13A 3SSZA 3NQBA 1Z69A 2BOEX 1EJRC 4WDXA 2J24A 3R8GA 4GYKA 2VCCA 4HNVA 1D3HA 1HGWA 1WZMA 1C92A 4Z17A 1JL8A 4W8BA 3RX2A 1EYWA 4B4FA 2O9RA 4O28A 2PWDA 2J66A 3TSBA 1IWAA 1N2VA 2XWDA 2REQB 3AUOA 3QC0A 4WDTA 4ZOEA 3WLHA 3AUJA 1MQPA 4UCFA 4UQ9A 1XL9A 4AYGA 3PJTA 3PFMA 1QCWA 3A4JA 1M9HA 3QLLA 1JZ7A 3PUGA 2XH4A 4UTLA 3WJWA 4WGHA 1Q6QA 4JTHA 4PA8A 5TIMA 1WDWA 5DY2A 3LQGA 4DXKA 2FVLA 1MNZA 4ZR8A 1ECEA 2X1SA 2ACRA 3PUOA 2WZMA 1XV8A 3HPAA 1TA3A 1Z48A 3IJ6A 3WD0A 5LXEA 1VBJA 4CQAA 1PJ9A 3U3HA 6PTDA 4X61A 2VWTA 4W7VA 3GWQA 4I7WA 4O1AA 5LHEA 3BL3A 1RD6A 3TONA 3F5JA 4GIAA 2R1PA 3G1VA 4ZSUA 3QC3A 2A7RA 3NQ8A 3EA2A 3FJNA 4QQ3A 3TFXA 3RLHA 4EAYA 4H00A 5KITA 2CXGA 4MOZA 1EO5A 4HU0A 4KS0A 5IOBA 1W1ZA 3WMLA 1DL3A 2QCHA 4H8HA 1TJ0A 4R7WA 3UETA 1UR8A 2AL1A 4FNTA 1BYBA 4M6VA 2NXGA 3VVGA 1B90A 1VEMA 4L9XA 2BBFA 2Y7DA 3SCVA 3CU2A 2YLAA 1WDDA 2NT0A 3BV7A 1BRLA 3STFA 4K68A 1XGEA 4RZ5A 3WO8A 1W1B1 1JIBA 3M5YA 3CUZA 3G8EA 1MWOA 2DY3A 2ZWZA 3IK2A 1GVYA 1JPKA 3DFHA 4GNKB 2VVSA 2KAUC 2YB1A 2NQHA 3WH6A 4XAYA 2ZVRA 4PULA 3LCGA 4K2SA 4RJEA 5AHLA 5IDIA 4XAZA 4X63A 5IXEA 2OWCA 4PEKA 4BQ2A 3QV6A 2GSJA 3SBFA 3BAIA 4FO4A 1TR9A 4BCEA 2XGIA 2OSWA 4C1KA 5REQB 1F3XA 1WZKA 2PD9A 1LLOA 2E6FA 4UNLA 2FIQA 5AHNA 3KOZA 3P80A 4KH2A 1CB2A 3ZJKA 1O95A 4JN8A 1V79A 3MU7A 5I79A 2V3FA 3I10A 4JIIX 4K1WA 4WLCA 3MPGA 4QXIA 1PV8A 1K7EA 4WSJA 4C6PA 1DJWA 4LX4A 3EX3A 3ELFA 3SCPA 3HV9A 4Z1AA 5DO8A 4MNJA 3RGTA 2HMCA 2CLFA 5IDZA 3CV6A 4JQ1A 1F76A 1MDRA 2OLHA 4U5KA 5BYWA 4HZ6A 1UR2A 4NJHA 4LANA 1XFCA 2PDFA 4ICCX 4YYCA 3R12A 1UJPA 3MKKA 1FXPA 4GY0A 3W73A 2E5BA 4O8RA 1FH8A 4E6MA 1ZAHA 4P2VA 4BI6A 2GVEA 2RFGA 5BMWA 3JVAA 5E09A 1K6AA 1LCOA 1E0TA 3BLKA 2VGIA 4Q7NA 5IFPA 4DRSA 1E9YB 4UOZA 4DO4A 3XISA 4Q8UA 1NEYA 2DSZA 3DHPA 3K46A 2A0NA 1E4MM 3O3RA 1KQZA 2RUSA 2EJAA 2I14A 2WPGA 3W1PA 3OBEA 4S2CA 3W7QA 3UY8A 1V0KA 5HWMA 2E40A 3UXAA 1K6WA 2ZC8A 1ECQA 4I8YA 3CK5A 1JCLA 3CEUA 3RU8X 3DHUA 4AF0B 1QNPA 4M82A 5LXXA 2VMFA 5HJLA 1TE1A 1UWSA 4HU4A 1EGZA 4DJDC 3LD5A 5CZSA 4D6FA 2POZA 3KAOA 4BZYA 4NSBA 1W54A 3EMQA 1HJVA 1Q6DA 2WWDA 2QUUA 4H1ZA 2QCMA 1GONA 4P8VA 1NM9A 3W24A 1CDGA 3HG2A 3T9PA 2CKRA 1CXHA 3GZ3A 3HG5A 1MW2A 1B9ZA 1XLCA 4FIRA 1KO0A 4LV9A 2VYOA 4DXVA 1VZWA 3KTCA 3OGVA 2VC9A 3K8LA 1US0A 3TYCA 2G3FA 1I75A 3MZ2A 3AIEA 5CPTA 3M47A 2J9YA 2OZ0A 3NWRA 5HANA 3CMJA 4GVFA 4S3FA 5C70A 3UJFA 3K4WA 2F2HA 2VRQA 2CHNA 5DT7A 3CJPA 1T7LA 1QPKA 5LA2A 4D6DA 4LQ1A 1DPMA 1GKQA 3MMWA 3CASA 4GFIA 4UR9A 2RDWA 3W27A 3ANVA 3P6LA 1JDAA 3TN5A 4PCPA 3NSMA 2AAAA 7REQB 4PMYA 1T8XA 1EZ2A 2JBMA 3U0HA 3KVMA 4LCQA 4QS6A 3HN3A 1IIGA 1ZAJA 4AEOA 4HGXA 4IP7A 4I5UA 1YW1A 4PMQA 2TMDA 4BEUA 2WHJA 4DBUA 1D7FA 2HWGA 3NYDA 4IIEA 5FF7A 2RDTA 4B92A 1VLWA 4FXRA 2W67A 2PLMA 2EPOA 2XFWA 4GX9A 1S2UA 3RM8A 3ZVHB 3N18A 1YLVA 3IIPA 1VS1A 1EPXA 3HGRA 2NWSA 4ZQCA 3VD5A 3JZUA 3S1WA 4TTUA 3GFXA 3CHDA 5HR7A 1VCGA 3L21A 3CHVA 3N2BA 4F9DA 3OU8A 1FP8A 2V3EA 2ZQ0A 1U1HA 4WJXA 4TX9A 2XIQA 4WD0A 5GJMA 3ARXA 1JZ6A 4JGDA 3NQGA 3N2OA 3UG4A 1KRBC 1FP9A 4BK9A 3FKRA 1Q6RA 2PMQA 1SO3A 1ICSA 5HMFA 3ATZA 4JFVA 1YE4A 3PZQA 3AIBA 1G5AA 2FTWA 1SPQA 2XFYA 3QV8A 5AVNA 4GJ1A 2AKZA 1H51A 2G96A 1H7OA 2X2GA 1K3UA 1ZHAA 3E2SA 4AEEA 3E38A 5I3KA 4YN5A 5HNRA 2E9BA 3VA8A 3W7LA 1S2AA 3VNDA 4L5ZA 3EA3A 1WXYA 5EKYA 4YHEA 1GVFA 1BPLB 1QHPA 4V33A 1C8QA 4NQ1A 4JS3A 1P0NA 1TMHA 1XRSA 3ZLGA 1H49A 2VGBA 2BZNA 2F9RA 5FJJA 3JR2A 1EJWC 4NHVA 4NL1A 1QI3A 2XVPA 4JNYA 3AIRA 4C1NB 1ISWA 4E4PA 3GLCA 2X16A 2PS2A 4PGLA 5EMYA 1NWSA 4JTEA 2QJNA 3QJAA 3USBA 4AD1A 3H22A 4BY3A 1SJDA 3QPYA 3VKJA 2BNJA 3N6JA 4OECA 4P8XA 3T4WA 4Z2IA 3AXIA 3VGBA 1TIWA 4FAMA 2AMXA 4F4RA 5ABEA 4D8AA 1HW6A 3GY1A 5ABTA 1W9PA 4WF7A 4JTDA 4AZHA 3TR2A 1OFDA 1UPPA 1UA7A 2BGSA 4ZQRA 1GTHA 2INFA 1EQCA 4JCLA 3VIGA 2V82A 1AQHA 1X38A 2X42A 3U5UA 4QEEA 3O0KA 2OKTA 3AXXA 3O15A 3I3BA 2E4TA 3N17A 2Z0IA 1XRFA 1WDRA 1XCFA 3W7IA 4GZ7A 5EGRA 4E2OA 3PBGA 3HPFA 4FOUA 4OT7A 2ZC1A 1JDDA 4QAIA 1JCMP 1OGGA 2DVTA 3N34A 2E67A 3TQPA 2NXHA 5A6LA 2PDUA 1P1XA 4WY0F 1OWQA 5CPLA 3TYDA 3CEPA 3PM6A 3TAKA 4LUIA 3UA3A 1QDSA 4G7EB 2CWNA 3W1QA 3VMPA 4F2TA 4WY0B 1GQKA 4AFYA 2GVYA 3ZWTA 4DWSB 3NDZA 1PKLA 4M7TA 4MVAA 3NL3A 3WSUA 3H2CA 3ATYA 4DQWA 3WF3A 2VOMA 2ISSA 2Y7GA 1F3TA 4AEFA 3H2NA 3DCPA 4HA0A 3AOFA 4IPIA 1KM1A 3IARA 4ES4A 4RW5A 1EC9A 2EKCA 2ZYFA 3CHEA 1ZENA 3E5BA 2I5IA 3RLVA 2ZDRA 5E9XA 4HYRA 5DEZA 2VEFA 3AHZA 4CUCA 5LGZA 4D1IA 2HK1A 1GW1A 4R9OA 2YJQA 2GPTA 1WX0A 3FS2A 5DQPA 3TX9A 2GJRA 2RJGA 2V5LA 4RCXA 4LU0A 3UVAA 4Z1DA 3PSWA 1E4LA 2HXUA 4G8TA 4PRRA 3WD1A 4JR5A 1KR1A 5DBTA 3ZT7A 1ONXA 4HHLA 4XD4A 3L0GA 3ZM8A 3RNDA 3V18A 3VD9A 5A6MA 3EWBX 4W4QA 1F74A 5I03A 3LTYA 3UWEA 1OT2A 3TFCA 1YYAA 5AC8A 4GHRA 3C5QA 3PPCA 2DVXA 3O0FA 5F7UA 3SQLA 1OT1A 4XIAA 1A49A 1W3LA 3URAA 5BCAA 4HHPA 4C5YA 2W91A 4CU8A 2GQ9A 4GC4A 1SR0A 1Q7ZA 3LV6A 2JK2A 1VFTA 1JR1A 1LL4A 3CPGA 1OD0A 4ZTXA 4QLJA 3OBKA 1I2OA 3TYBA 3MYOA 4NAFB 3STCA 4XK2A 3R25A 5HXMA 4WOQA 2ISFA 5M03A 1OBAA 1HUVA 5LIWX 3N3MA 2V69A 1E9LA 2Y61A 3NZQA 4ROQA 2ISWA 2EQDA 2O0TA 1G4SA 1U1UA 4Y7EA 3VGEA 4OHQA 5F1VA 3C2FA 4POCA 2ZRZA 2E6YA 2WNQA 4CD4A 2YL6A 3WLMA 2QKFA 3NQEA 4G7FA 2YXXA 2D1ZA 3NXFA 2EG6A 1RJPA 1VGAA 4PCNA 3G6MA 4PH6A 2CLIA 2Q01A 1G4EA 2HS8A 4OBRA 4JFUA 4Z08A 3M07A 3UFYA 2JFEX 4L6HA 1PZ0A 1EWEA 3WUFA 4H01A 3DG6A 3MO4A 1OK6A 2MNRA 3Q58A 3PUDA 4QQUA 5G1YA 4YTRA 1R86A 5JQ9A 1Q6LA 3BURA 2R14A 4RZBA 5FEZA 1SFSA 1AQFA 1X6LA 5HMDA 1JUKA 5DXXA 4TMCA 3FXYA 1ZLPA 3FVDA 4M56A 2V5CA 1PWMA 3WLOA 2HNEA 1BSIA 2C3ZA 3COTA 2QGHA 1KBLA 2JGQA 3IJLA 3VGGA 3PWAA 3UR8A 1V3KA 3VFLA 4FALA 3T2OA 1AJZA 4JTIA 5D02A 4Z2GA 1Q6OA 3P93A 3PN8A 4R34A 4AMCA 2ZX7A 4UNKA 4GYPA 1FRBA 4ZXLA 4MWAC 1NFPA 3MJYA 5FJIA 5TAOA 5KZMA 1PSCA 3GBEA 2OWWA 1IR2A 5IM51 3B0YA 2RHGA 4FEZA 1CGUA 3IV3A 4ZVJA 3L4XA 3IIXA 4HPNA 4UQEA 4I5XA 1NVMA 5DF0A 2X7VA 1DJZA 1HKMA 3T55A 4REQA 3G0SA 3L4VA 5L6UA 1KM2A 4XAGA 3R94A 1EPVA 1T40A 5CZ0A 1NP2A 3BCJA 1TB3A 4IIBA 1RY8A 2PLCA 2IMRA 3GTIA 5ECVA 4G6CA 3I6TA 4LNYA 4E2BA 3HPSA 3TC6A 3N73A 4US6A 4D6EA 4P8UA 3FGCB 1HKVA 4GKTA 3ZLFA 2UY2A 1E6NA 1G7VA 1O7AA 2I56A 3G3DA 4KIEA 2BHUA 4QE5A 1B57A 2VCBA 1G7UA 1JZ4A 3BMVA 1IZCA 4FNPA 2VR5A 1EZWA 1XF0A 2G95A 1DIEA 1OF8A 3S2MA 1VFUA 5CZTA 4KEVA 2YGYA 3PVFA 4TVUA 3W22A 3T2PA 1FXQA 3PUEA 4IHCA 2YW3A 3KUMA 2XU2A 4AD2A 1GHSA 1YNYA 2QIWA 5D2TA 1ADOA 2HJPA 1E6ZA 4B3LA 4LUTA 1G6CA 3KVKA 3ABXA 1UP0A 1A5SA 4TV5A 3PBYA 1VEOA 4YWIA 4J4KA 4BFAA 1R9ZA 3WK2A 5I6SA 4HPGA 4OV9A 2PGEA 3WLNA 3M0KA 1KCKA 1JGMA 1ZNNA 4AX7A 3GXTA 4K8HA 3CUGA 1WZLA 4RPPA 2EGZA 4WHBA 4HMEA 1RQHA 4HNTA 1R5YA 2MANA 2CBVA 4GISA 4ZO7A 2Z29A 2C14A 2X0SA 1SUXA 5SWUA 1YTKA 2NUWA 3IEBA 1WAUA 2ZFAA 3KCOA 4AZCB 4NU7A 4TO8A 2PDPA 3MUZ1 1C29A 1CGWA 3LEPA 5A8PA 2VZUA 2Q3OA 1MW1A 3R58A 3EWWA 2D22A 3TYEA 4PB5A 1AL8A 3DFTA 3W25A 1N8FA 3OTRA 3SB0A 1E3ZA 4QG8A 1TREA 1TCMA 3G22A 1P0BA 3AYSA 3I6RA 5G4WA 1J2BA 4EWJA 3S1XA 3OODA 1MFUA 4DAFA 5D9NA 3NDYA 4YWSA 1VPQA 4MWAE 3BC9A 4IXXA 2INEA 2WSRA 3LM7A 3FEMA 3W70A 3Q2DA 2YKKA 4HKPA 5CQ1A 1VEPA 4GK8A 1ZCCA 1DWFM 1PZ2A 3WMBA 3MV11 4TVCA 3MSDA 4WY0A 3RITA 4HNOA 2QAPA 3S9IA 4G9PA 5HUOA 1TE6A 3BLFA 4Q8NA 1VJIA 1E6SM 4AAJA 5T91A 1MFVA 2YCEA 1XSJA 3U2EA 3EXRA 3BG9A 5FF2A 4QNWA 1QK2A 1FDYA 2VWSA 1QWKA 4S38A 1OABA 1QO5A 4AHOA 3SO7A 2ZZ6A 2QLYA 1XHGA 6XIAA 1ZY9A 3SJNA 2YBVA 1SFTA 5E9AA 4DO5A 2EHHA 2ZKMX 3E74A 1VFHA 2RAGA 3QYSA 1KFBA 1H3GA 4N0RA 5EMLA 4L61A 3IJIA 1R3SA 1KWKA 1KD0A 2YL9A 1TTJA 3WQPA 1C9WA 4PYSA 1X97A 1RLCL 4KT2A 5EBUA 3ITXA 1FX6A 3SRKA 2CBUA 3WQ4A 3WNMA 3P67A 2X30A 4HK7A 3WEZA 3WBYA 2G3JA 1FHVA 5KMYA 2HPMA 3CTLA 3TMQA 4LAUA 3CV7A 1F73A 4AWTA 4DJFD 3F5LA 2DT1A 4QSFA 1XUZA 1OC5A 3CGTA 3CYVA 3GU1A 1M41A 3WLRA 1U2YA 1VC4A 4H41A 2GWGA 4JNZA 4MGGA 3O06A 4PSRA 5LHFA 5DCDA 4DPQA 4L4PA 4UCGA 5CKSA 4DJDA 4PUUA 4LF2A 4WCJA 4Y9MA 5JBFA 1VJZA 1F9CA 3Q65A 2VKZG 1PDZA 3UZJA 4AYSA 2RGLA 3IGXA 1DV7A 3B05A 1VFOA 3MT1A 1T99A 1XGDA 3K1GA 5HQEA 2A2IA 1UW9A 1JYNA 4UBPC 4Z2JA 1V02E 4HN4A 5U4NA 3VX0A 1DXFA 3FDGA 3CTTA 2HK0A 3NZRA 4UQAA 3NVDA 2WZIA 3C0LA 1S3TC 2WKGA 2Z1KA 1AH3A 4JICA 1VRDA 4A8RA 2ACUA 4N9CA 4O11A 3H7VA 1NY1A 3UG8A 2ZRUA 1P43A 3TLQA 1TJ2A 4R9XA 3PSVA 3SECA 3ZOAA 3M7WA 4GVHA 5A2AA 3ANYA 2O56A 3APTA 3ONBA 2VCAA 3XIMA 4JD4A 3CUHA 3H2FA 4CN4A 3RK8A 1EX1A 3W1MA 1QU4A 3GQYA 2B0MA 2VDGA 5A3HA 4HK6A 4A29A 3VM5A 2YA1A 4HSOA 3P2VA 1P7TB 3DI0A 1R3QA 2BVDA 2J6VA 1YPFA 3WNOA 3HZ3A 1W8SA 3OA5A 1BSLA 2EF9A 2C18A 3PAJA 2WO5A 3SUSA 1XQKA 2RJHA 5DN1A 3T0CA 2GJPA 1O68A 4I9AA 1SW3A 4JQ3A 1H7PA 3VDHA 4M6UA 2PWUA 4PTWA 5BXRA 4ZB5A 1FTXA 3URQA 2OGJA 2ZDSA 3C4UA 1TMQA 3STGA 4GIRA 3UXKA 2PP1A 4LUSA 3TOYA 2XH0A 1VYRA 1LWIA 2G50A 1IEWA 3SCUA 5ABFA 1TWWA 1BWKA 1A5BA 1YEYA 2XZ7A 3O6DA 3QR1A 3FFSA 3BARA 1XPYA 4DZ5A 1Q6CA 1SVDA 1XYLA 3HTWA 4GBDA 2ZXDA 4PMRA 3EKGA 1A3WA 4NZFA 1P48A 1SZGA 1PO9A 2INZA 3NM1A 1NWRA 1N82A 1VP5A 2R1NA 2DVUA 3C2YA 1W3IA 1E56A 1HG3A 3FGCA 4WJ8A 3UPBA 1FCBA 2OLSA 1W9BM 1CXEA 4CQ8A 2QXWA 4BWLC 3I6EA 1Z32X 4GX8A 1SGJA 3AMKA 1FHDA 1IXNA 3PWIA 3MYPA 1FWWA 3O2LA 4D9PA 4KW2A 1KRCC 4G1KA 4CQCA 3WNPA 3SFWA 2ZX9A 1LQ0A 1RP8A 2PEVA 3GNXA 1IEIA 2EKGA 4XB3A 1EJVC 1F2JA 3A9IA 1E73M 2Z00A 4CNUA 4ZOBA 3VKAA 3WQCA 3TJ4A 3GTXA 3QY6A 2F6UA 4PL2A 4KWSA 1QJWA 2YFOA 1JXKA 3WNLA 2A3LA 3OIHA 5GJPA 2HV5A 1SJCA 3K5XA 1VHCA 4O15A 3G5EA 2WNNA 4L1GA 2G97A 3ZR6A 2X09A 3KVJA 3QHOA 2RH9A 2PWEA 3BO9A 1M03A 4H7CA 5LA0A 1FWJC 4GY1A 1HXJA 2VZOA 2HISA 1JGIA 3QR3A 2PU0A 1L6GA 1WP6A 1ZJAA 2QW5A 2W92A 1PZ3A 2TODA 4PBGA 1TV5A 1XLFA 3TN6A 3H70A 3TYAA 3P5ZA 1UZ4A 2QCFA 4NI3A 3BUVA 2FJUB 3E5PA 3IAPA 4ZL1A 3LBMA 2FGLA 3FYOA 3FXGA 1E6XM 3LOTA 3UY7A 3JZEA 5KINA 1J0JA 3N4EA 2GDQA 4E8DA 4MTVA 2Z1WA 3AFBA 4AMAA 4J5NA 4V28A 4C5ZA 3LNMA 4NVTA 4HIBA 5D9OA 3B9EA 1LRTA 2DUZA 2ZTJA 1GYMA 2J7CA 2J8GA 3T81A 3CB8A 2YXOA 4O13A 1AODA 5ABGA 1PTGA 2OYMA 2VUYA 4GCXA 1VFMA 1FWFC 5CSUA 2PDJA 3LTPA 3EWYA 2O7SA 4XZBA 3LM3A 2A21A 4ATDA 2QYGA 3VDGA 3W00A 3OP2A 2NLYA 3E2QA 1PDYA 3B9OA 4MADA 1S2WA 3MSGA 3F4CA 1XLDA 3VINA 4IFOA 1G94A 4RLIA 1H5YA 6ENLA 2QJJA 3PULA 4DBSA 2ACSA 1UQYA 4WVXA 4Y9AA 3HM7A 4W93A 3K8KA 3TAOA 4DNMA 1IT0A 4H3DA 1UBPC 3OPSA 4LVBA 4LXFA 4MKNA 3WQGA 1ISVA 4JEJA 3DAQA 1X8CA 3MP4A 4GUGA 3CZLA 4C60A 2CLOA 3VNJA 2ZRVA 2C1GA 3MSRA 3AYVA 1FOBA 2XN1A 3D5HA 2PRLA 4EIVA 3VKCA 5K9XA 4OWGA 4QAWA 4ZE5A 1YIXA 3SSJA 3ITVA 1OK4A 3HIJA 3T0DA 3MCMA 3W01A 3R0DA 1B9BA 5C9XA 1HO4A 1FWBC 4B5TA 2Y63A 3STEA 2BGNE 4LVDA 5AC4A 4FR6A 3JU2A 4B91A 3ERPA 2GGIA 2VEGA 4RZ4A 4IICA 3DHFA 3HMJG 4C6MA 2WVSA 3IJ9A 4Z2KA 3AJ7A 3D47A 4KRZA 4OTKA 4KRTA 3Q94A 4JFSA 2CIPA 1ITCA 3LCFA 1KV8A 3NQ7A 1XLKA 1MRAA 3S6OA 4IFKA 3EB3A 1ZS2A 3SUVA 3PG8A 2R94A 4M0XA 1BVZA 4XX6A 3U6WA 1ZUAX 2BVWA 2H9AB 1XJBA 4Y8FA 3V35A 3NO5A 2PGFA 1H62A 1ME8A 2XDFA 4I9JA 3NFUA 5LGXA 1UR3M 3P3BA 3LPFA 4F2BA 4ZZ9A 4FR1A 3SIMA 2VELA 4GC3A 2A6LA 3AZSA 3TNBA 4CNPA 3TJXA 1PHWA 4MJ2A 3WX7A 1X39A 2QUTA 3MMTA 3FCPA 4XUYA 3B8TA 1QXLA 4UTMA 3QH2A 1CXKA 4GNVA 3UU0A 1EL3A 4JTFA 1NFGA 1I9CB 2PZNA 1B31A 4GO8A 3REQB 2WMHA 4RNHA 2Y4SA 4UTWC 2I16A 2GZXA 3CLMA 4JTKA 5HULA 4E3VA 2C91A 1FCVA 2PDQA 1Q8JA 2IS7A 4WRHA 3KW3A 3M0LA 3GYCA 1Y0EA 3MBFA 1AMYA 4RDWA 3DXIA 4NJIA 4PMZA 5JVLA 2WM0A 4S3KA 1J6OA 3PFRA 4YVXA 4O1BA 2GVLA 4PMOA 2O9OA 2FPYA 1TZ9A 4XISA 3W6MA 3N4AA 4TQTA 4INFA 3WBAA 1DWJM 4L64A 2YCIX 5MKGB 1O66A 4IPPA 3AIUA 1UP3A 1A4MA 1P7TA 1QI5A 1KXVA 2GQAA 4MYAA 1ALDA 5EB8A 3OIXA 4MNMA 3ITYA 4AD3A 4P7RA 4FF7A 1XPGA 1QUMA 3VZXA 3FSTA 3LERA 3NQ6A 4KMQA 4O0KA 5I2UA 4RNJA 2PCEA 2YBTA 4LAOA 3OQ8A 3VI2A 3W4RA 1ICQA 1Q65A 1TRIA 3M0JA 5CC6A 3PZMA 2QJHA 1NWTA 3EWXA 2V2DA 4K6AA 3HFYA 1R8LA 1WNOA 3BSGA 4DVOA 1Z89A 2VP8A 2AAMA 1RCXB 4LBUA 3P8IA 3LUTA 4MZYA 3CL8A 2GVJA 3K4AA 4MWAA 1JPIA 2I17A 4FXSA 3GXIA 1LM1A 1AW1A 4GCAA 5M5DA 3WD3A 2GFTA 5FF3A 3VAVA 3BGAA 1EKOA 3PJXA 4KGLA 3B8WA 1VPYA 4ZQMA 4PE8A 1U5VA 3H7UA 2X0HA 5G5IA 1F8IA 3ABZA 1A50A 4DBWA 4LF1A 3UESA 4JTTA 1EGMA 1VKFA 2HROA 1FWHC 2FMOA 2YOCA 3KVLA 4DIAA 2FVKA 1E1CB 3W7KA 3ZJ7A 1TV3A 1VBHA 2V81A 4Q4MA 3PNUA 1WUFA 1JJKA 4JTUA 3BGGA 1OIMA 1YBQA 2CW6A 2PDIA 2BB0A 1U5JA 4NNCA 1OHLA 1E4NA 4X3ZA 4TR9A 4DUWA 3AXKA 2Y85A 1UH3A 2NT1A 3NSNA 1U33A 3POHA 4HMNA 3NA8A 4LBRA 1X1ZA 4UFHA 1GJWA 1J12A 3P82A 5AC6A 1ITQA 5D32A 4CLMA 3P61A 5ABHA 3E6EA 4LYKA 1R46A 4V15A 1GCYA 4JDYA 4M81A 3TW6A 2O7QA 4QLKA 3ICJA 2F7FA 1WBHA 3VCRA 2DDXA 2FH8A 1VR6A 4Y9PA 1XC6A 4U3CA 4QEHA 1O12A 1KFJA 1VQTA 2J62A 2VUNA 3RAOA 3LNPA 3GR4A 3EOUA 2Q8XA 2HPIA 4ZB0A 3WKZA 1LL6A 1L8PA 1GYLA 1X6UA 3TW9A 4PMNA 4RK8A 1UB3A 2P3EA 4LC8A 1CLKA 1GG1A 2VO5A 1SZRA 3GXMA 3HF3A 2D3NA 2J75A 5M1TA 1XH2A 3MSYA 3AXMA 4DEFA 3ITGA 4W89A 1BYDA 2Z7GA 3KX6A 1ONEA 1OINA 5CC7A 1GG0A 3QM3A 1N55A 1WV2A 3QN3A 4Q33A 1D9EA 4JBRA 4IIGA 2OWXA 3MB9A 1XIDA 4A3QA 1YPIA 3N3TA 3SCQA 1Q2RA 2WHLA 2Q02A 2J7EA 1VENA 4DF1A 4NAEA 1DHPA 3CQKA 1V02A 3GH7A 2X1TA 5E70A 3ENLA 5BW6A 1KKOA 2J9XA 4GD0A 2PBOA 1QPOA 3AHYA 3WUGA 5GNZA 3ARSA 4PEEA 4WK9A 1A3HA 1EHNA 3W2LA 3A12A 1REQA 4JL1A 4XZNX 1W3TA 7A3HA 2QMJA 4XSMA 1EFZA 1Y8BA 1PL9A 2EPKX 3S2LA 2OB3A 2XHYA 3WN6A 3M44A 1V3HA 3W7OA 2EPMX 3GO2A 1XLMA 1XIGA 1B4KA 2EG8A 3DBNA 3DOPA 1R85A 4KIRA 3SM0A 1J79A 2VGGA 5FIPA 1I2PA 4MFEA 4QBXA 3GYEA 3KRZA 4RE2A 1OF6A 1NSJA 4F0HA 5U7SA 2ZUWA 3QQ0A 3FHQA 3VMOA 6A3HA 3B0XA 3FYPA 1LWJA 4C90A 5FAGA 3CQJA 1MZRA 1O60A 3OO2A 7ENLA 3DI1A 4U31A 4JFTA 2WZHA 5DMMA 3NOEA 3R8HA 3LHTA 1A4LA 1QK0A 4R7JA 3USZA 4IP4A 1ENUA 4BQ3A 4Z2HA 5A8NA 2Q71A 1BG9A 5C9UA 4H6EA 4Q7BA 1JNDA 4L1XA 1EUAA 4QJ3B 2DORA 1QWGA 4KRUA 3MUY1 3P7YA 1KC7A 4Q8OA 2J4GA 5A6BD 3UJRA 1CGYA 4LS2A 1XR2A 2YXGA 3UCDA 2Z4GA 4ECLA 4IMGA 3R8RA 1PWLA 3QMSA 3GNNA 3UZ5A 1UA3A 1UC5A 4N6FA 3AROA 1K4GA 4D6JA 5H8MA 3MP3A 3EGJA 4DB7A 2ZUUA 5FJPA 5C8BB 2FDSA 3S1UA 1XISA 4A8IA 5I3FA 3AS2A 1RCOB 1X7IA 3H6OA 3SY8A 1R3VA 3L4ZA 4C7GA 1E70M 1O4UA 1VIZA 3G1HA 1GKPA 4TMBA 1GK8A 3LSCA 3PTMA 3SQSA 2YSWA 4UFJA 2MUCA 1FWNA 4K38A 3F7JA 4WZHA 4RE4A 1ZGDA 4R85A 4LB4A 5E0FA 1HFBA 1US2A 4IQLA 2P0OA 3THDA 2CESA 3ABOA 3R79A 1W37A 2GL5A 3S46A 4WUIA 3F2DA 2FTYA 1JCNA 3KP1A 4C6LA 1AA1B 1P4CA 2IKIA 4PMXA 1VF8A 4N7QA 2WMKA 3K2GA 3SUUA 3AHTA 3MMDA 2Z24A 1PKMA 4GI8A 4MB5A 3WJXA 2W27A 2GLKA 4ROPA 2ZX5A 2DSKA 2F61A 2FJKA 1X6NA 2OZ8A 4AC7C 3GNOA 3I4EA 2PRMA 1ZTVA 4F48A 1AH4A 1RPKA 3AISA 2PRHA 4WIWA 4HJWA 5K2ZA 2OOGA 5ECUA 4N4PA 3M41A 4OV4A 4HOXA 3QRHA 4GNJA 2IUZA 4ORMA 4ENLA 3R10A 2DP3A 2V38A 1MI3A 5AHEA 5MKGA 3FHAA 2G8ZA 3SN1A 1ONWA 1KXQA 3PPHA 2NUXA 2E8ZA 1B4EA 1YNPA 1KKRA 3SUWA 3O63A 2R6OA 4OOZA 3VCNA 3VGHA 1UR9A 3AC0A 4E2DA 1BF2A 3KBVA 4AXKA 1TCDA 1SZEA 3ZLHA 1XSIA 1XLLA 4ZBCA 2ISVA 1OGSA 2PF8A 1E6QM 1W5NA 1W9XA 1WQ5A 3WQOA 1B3XA 2D3LA 1WOAA 3W26A 3E0IA 3WLIA 1JPMA 2VEMA 1TUXA 3VTRA 1AZ1A 1C7SA 4UZSA 3QY8A 4DJFC 2DPEA 1FHUA 4UFIA 4QSHA 3RMEA 2XVNA 4IGNA 3RM9A 3RPMA 5T8GA 3KL0A 4F0KA 1HJQA 2YDRA 2JKEA 4MY1A 2C6QA 3UWYA 2ZBTA 4LVAA 3WDRA 1XLIA 2DZAA 3DU0A 1H50A 3PPFA 1HIZA 2JEPA 3IGHX 2PGRA 4GWEA 1TV2A 1GOOA 4ICNA 2XM1A 2QVHA 3E0VA 4Q8WA 4BWLA 3WQDA 1EP2A 3H4XA 4WKHA 4D8ZA 1ZCOA 4PRTA 4LUJA 3UWUA 1EJ7L 4NZCA 3ZSTA 2D0GA 3RRXA 4U5IA 5C9RA 2PLKA 1X1OA 3EOSA 3NEVA 5TNVA 1EX5A 1S2TA 5BZAA 3KOWA 2XIBA 5T9CE 2CEQA 1NELA 1EO7A 2JE8A 3THAA 2QDEA 3FLUA 3UEQA 3W7DA 2PF0A 4E4UA 3OGRA 3S1GA 4BEQA 1PB0A 4GMEA 1WDPA 7PTDA 3W2KA 3HQNA 3V16A 3WDHA 4Q8TA 5K3VA 1OD8A 4LCSA 1B1YA 5J5RA 1OZMA 3KBMA 2XVGA 4IPJA 5HATA 3U7VA 2GOKA 3LRLA 1IGSA 5AYIA 4O8AA 3WH9A 1EF3A 1UG6A 2P3ZA 4JPGA 3IJQA 4JX6A 5AVHA 4V1XA 3YPIA 2A6NA 1DE6A 3TC7A 3NZ1A 2J8FA 1L0PA 2ZTKA 5AZ0A 1NOWA 4HPHA 4TUFA 3T78A 4U2ZA 1W32A 3RJXA 3STPA 2VVNA 3NGJA 2E6AA 5GVJA 4J3TA 1S3HA 4GJJA 4PMDA 3OGSA 1ZBCA 1DXIA 2Y2WA 2TYSA 1TA3B 4LCRA 3T7VA 3TP4A 3DKLA 4WR3A 3M6YA 3EBVA 3E9AA 3S83A 1X98A 3GX9A 4PRWA 3VOCA 3LZ5A 3W1XA 5AC5A 4NUWA 4S3GA 1NF0A 4UNIA 1X1NA 2HDJA 2CBJA 4ILSA 1ZZMA 3IPWA 4PUWA 3LLXA 3QOKA 4Z0SA 4AD5A 4N6EA 4PFMA 2A3BA 3F2CA 4KQNA 2D23A 3JUGA 3ARQA 5FSEC 2J6XA 4M80A 4JXCA 4HCHA 2B7PA 3LPOA 5CGQA 3H23A 1RQBA 5D9PA 1PX4A 3MS8A 3AZTA 3QVQA 3B8SA 1TR1A 1VYSX 3S5NA 3TJIA 1BRLB 4KWVA 2J7FA 3WH8A 3UYCA 3BLDA 4FLQA 4M19A 3HGOA 2NV1A 3QEZA 3DN5A 4UMCA 3WELA 3GAKA 3DFSA 3HQPA 1TG7A 1QO2A 4F0SA 3IGUA 4YNGA 3N9SA 2P50A 2E09A 3WFAA 3OBAA 1HKJA 1WDSA 3GXPA 4J9JA 2WHMA 3V5CA 3AIWA 3MUCA 1LUCA 3RDKA 2UV8G 1C90A 4GXWA 3ES7A 2IPWA 2W5FA 1XBXA 3B40A 1N8IA 3UJSA 5C9ZA 3EMCA 1EXBA 3TYZA 2VD8A 3VXGA 4OQVA 4RW3A 4DLFA 3UBPC 3NZPA 3P5YA 4AWSA 4DLMA 2XIOA 3E96A 3ARWA 2WBKA 1F3WA 1LDCA 1IT8A 1IHIA 3M5XA 4TV6A 3M1ZA 4IIHA 1Q6GA 3S9YA 3P81A 1YTDA 1ZBKA 2CETA 1YDNA 4LALA 4IX0A 5H91A 3TVAA 3GU2A 3TTYA 3OHIA 5I02A 1CLXA 2AL2B 5I0DA 2FPTA 4AUBA 4E0CA 3CUFA 3I7QA 1S5WA 5FSDC 1G0CA 3LGDA 2PWVA 2D24A 3BICA 2GDUA 3SUTA 1WAWA 4JTGA 4Q7IA 2Q3RA 2ZXBA 1E0VA 2BP1A 4FLOA 4ZQOA 2VFIA 3ALGA 3EPOA 2Y7FA 3T2QA 3E1F1 3NIYA 2BY1A 4MAVA 2Z28A 3OHMB 3N19B 1QNRA 4JTQA 2DT3A 1KV5A 2CBIA 3MHUA 2BXYA 3B8VA 2H3DA 4FI4A 4LEQA 1XYZA 1AMKA 5A6SA 1WCGA 4S39A 4UTWA 3GC5A 4XKMA 1VJSA 3CAWA 1NU5A 4JY9A 1I6NA 4B4HA 4JTCA 1GGOA 2QNEA 5I3JA 1LROA 3UZWA 4AZBA 1MEWA 1PVNA 3Q37A 3UYIA 4AZGA 5CPMA 3V36A 4FIQA 2FQIA 1BVNP 3TA6A 1JZ3A 2GJXA 4CQDA 4F3HA 1W1PA 3TNOA 4NXSA 3VC5A 1YDOA 3THUA 3V0TA 4AC1X 5B80A 3W7CA 1TIMA 3U4FA 3LRKA 3MQTA 4MB4A 4FSAA 3S8HA 3UWZA 3IGSA 1F5ZA 2OYKA 2WSKA 3VX1A 4IT1A 3TXZA 3BE7A 1MEIA 4MY9A 1EB3A 4B2DD 3W83A 3F4VA 3ZR5A 4A3HA 5TF0A 2ACQA 2PCQA 1UD5A 3U48A 1YQ2A 3MI3A 2QCDA 1D8WA 3PJWA 2OFJA 2Q09A 3S5YA 2NQJA 2UY5A 1C91A 3PJUA 2PDCA 3CO8A 2CZEA 3I3DA 5I07A 5GNXA 4IWWA 3IIOA 3MDUA 2NUYA 3NQVA 4PTVA 2D73A 3E2VA 5DCEA 1U1JA 4KWOA 3GRIA 3UCQA 1VCVA 1OCJA 2GUBA 1XH0A 1GPFA 1J10A 4NYUA 4FLRA 1M1BA 4RE0A 2WPBA 3C6CA 4HOWA 1DWGM 1KCXA 1GKRA 1WA3A 4XSLA 2CLHA 4YLWA 3FAWA 4O57A 1PIGA 2YDQA 3RF9A 2OR2A 1RAKA 1G9HA 4TTGA 4GZJA 3AMLA 4W8LA 2OLAA 4N02A 3N4FA 4IISA 5CLTA 4X2PA 2VZTA 1Q2SA 1QW9A 2ANUA 4LBSA 3FKKA 4K8EA 1J8VA 4GGHA 2E77A 2G37A 5A6AA 1HL2A 4XBJA 3E49A 7TAAA 4RE3A 1R3YA 3GUWA 4MM1A 3EB4A 3OVPA 1S5TA 3WH5A 3HU7A 5HWJA 1TJPA 1YE6A 1TWDA 2WVVA 1F05A 3GG7A 1FWDC 1MDLA 4M5PA 4A21A 1O94A 2WMFA 1E0WA 1K1DA 2IXVA 2NVAA 5BWAA 1M7JA 3MUIA 2DW6A 4PL1A 4A2SA 1G4TA 1W56A 3EMZA 1P0DA 2WSYA 3SCTA 1TYGA 4ZB2A 3BJFA 4BI7A 3QGKC 5JBEA 1V0MA 2HVMA 3VNLA 3L5LA 3MVTA 1UWTA 3W81A 3VOJA 2FHBA 4KETA 2NSOA 4Z0JA 1JNEA 1OM0A 1W0MA 3AWNA 2ABBA 5RUBA 4Y9OA 1ESWA 4IUOA 4WDUA 2PB1A 2ZA3A 3LGGA 3QV9A 5BOFA 2Y7EA 4G1NA 3W7HA 1XLGA 3KLLA 8XIAA 3SY5A 1OGBA 1PYFA 2CLPA 3H2OA 4B5NA 5HOSA 4UR7A 3WK3A 4BHYA 1E5NA 1N7KA 4M7SA 4JX4A 1EEPA 3EXTA 1BAGA 4GZEA 3HFTA 1UMLA 3ABSA 1DIKA 3GFZA 4AZ6A 3M0ZA 4AVOA 1A5CA 1XCWA 2AGTA 4ALDA 1AW5A 3KHJA 1TX2A 3PF3A 3GBDA 2OT1A 1ODUA 1XLHA 4E2VA 5C9WA 1F07A 1IXPA 3DIPA 1XBZA 6TAAA 4KCUA 3ZWSA 1EYEA 5F2GA 4HTYA 4B3ZA 2ON3A 4JEQA 1JULA 4WEVX 3GIQA 4JTLA 4M8UA 4IMFA 3S3GA 5I06A 3V0UA 1PXGA 3VABA 3GHSA 1WOBA 3MHGA 1W1IE 4S3JA 4JIQA 4LYRA 1QTWA 3GH4A 1MUMA 5DRIA 3WQ5A 1DWAM 3RJYA 3Q45A 3N12A 3B8UA 1J2WA 1E4IA 1R9XA 4WXYA 4K3ZA 4IMAA 1X8FA 4OBSA 3PR2A 5FKYA 4C6DA 1I8JA 1Q7QA 3FOKA 1QFEA 1A0EA 1WKDA 2J7BA 4JYDA 3V75A 3B0UX 3H54A 2QJGA 2Y0FA 3S2CA 1TV7A 4MZ8A 4UQDA 5EFDA 2BY3A 1OCNA 3N25A 3HPXA 3C0JA 5EMJA 2X1RA 3WLSA 4L56A 2ZZ5A 1HL9A 4WXZA 3CB3A 3TQKA 3WZ0E 3GSMA 2DZUA 1BHGA 4GQ0A 2Y88A 2ZXAA 1T41A 5H6HA 4HD5A 4UTHA 3CS2A 4J3SA 1TQJA 1MW3A 2I7GA 2E5CA 4V2XA 4M24A 4Z2LA 2G41A 1PCKA 3LPGA 3PTQA 1PX3A 3M0HA 1OCQA 3L66A 4I7VA 4KEMA 3BJTA 2IQ0A 3UQNA 1CNVA 2Y6ZA 2XJ7A 2A1YA 4FB7A 2CFFA 3QGVA 4DAIA 1CBGA 1XRVA 1XWYA 4CCZA 2Y70A 1RZMA 3CH9A 1V3LA 3RR4A 4RZ6A 4DYEA 3L2LA 3NQFA 3U5YA 1NARA 7XIMA 4LUYA 2AL2A 3KOXA 4RDVA 2XZ9A 1A5LC 4DWSD 4BF5A 3N11A 2WVTA 4MKSA 4CU7A 3B8DA 2D2HA 4AHQA 9XIMA 3GXNA 4ML9A 2PD5A 5LNWA 3EDDA 3DG3A 5DRCA 2E9LA 3II1A 5GPRA 3O05A 4PTNA 2VEKA 4HHMA 3MJMA 3TIMA 3E0FA 4N2YA 3W7MA 4H7VA 4C7DA 4UIOA 4ZQNA 1DYSA 2YYTA 4EOUA 1EF2A 3ZR4A 1EJSC 3F4WA 5C6MA 5I23A 4IQDA 2IPGA 4BJHA 1SR9A 3UWQA 4EXAA 1MYRA 1X96A 4I3GA 4D1JA 3KRUA 4XAFA 1EUNA 3A47A 3S5OA 1TPDA 3TQ0A 1RD5A 5EA9A 2W62A 1YXYA 2NQZA 1H41A 3GM8A 3VNYA 5LNRA 2NX1A 5HBFA 4MLJA 4QR6A 4H9XA 4S1FA 1KCZA 4AZ7A 5EY5A 2J77A 3SGZA 1ADSA 3NQMA 3BOLA 1A5OC 3VK5A 5T9BG 3AS1A 1WXJA 1XLAA 2VRJA 4J3UA 1LRNA 1O6IA 5FJTA 4K37A 4F40A 1PKNA 1V6UA 3VU2A 3G1YA 5AHIA 3HQOA 3WJYA 1CENA 4I6VA 1OB0A 2JKPA 3LRMA 4H9MA 3PZIA 4LYQA 1OQFA 3WL0A 2YL5A 4XTIA 4Y9NA 3UCCA 5LIKX 3H7RA 4DJFA 3PP7A 2NX9A 3HPZA 1PS9A 2DH3A 4BS0A 4NX5A 2DUXA 5K7JA 3LHWA 3H4GA 4A05A 4XUGA 4CKQA 3GVWA 3VIKA 3LBCA 4LGXA 3LV5A 3QPEA 2OQYA 4M1RA 2HVNA 4KFOA 1ZL1A 3MWCA 2TPSA 1L6SA 3W07A 1JRBA 3IRSA 1M01A 4Y8EA 3H24A 1TRDA 1LG1A 4PTDA 1XM3A 1K9TA 1R2SA 3CQ0A 3MCNA 4KFNA 1GJUA 3Q67A 3NM3A 3PS7A 4LPCA 4ZFCA 1EC8A 1GOQA 5HMSA 1KGWA 3AIVA 2P0IA 4B5VA 4GIYA 1Z42A 4YYFA 3T09A 1JDFA 1BLIA 2BY0A 4HJFA 2RGMA 4WQ6A 3FX4A 4R27A 1M7PA 1C8XA 4HPXA 1AD4A 5FOOA 4J3XA 3ZT5A 3W84A 2IQDA 1UBSA 5A2BA 2HNHA 1GORA 3G8RA 3O9NA 2PE4A 3KRBA 1PAMA 2WC7A 2X1IA 2IQTA 3K8MA 4HSNA 4C6KA 3H26A 3WDIA 2ZOXA 4ADTA 4GRSA 5JIPA 5JUVA 4REQB 1UWAA 1QI2A 2HRWA 5BNKA 1HJUA 4GO9A 1R9YA 2XFRA 3MVIA 3G18A 4D6CA 1F6YA 3EWDA 1ZRQA 3INPA 4EXBA 3U7BA 4PFHA 5C2GA 1OX5A 4HA4A 3B06A 2XIIA 2D2GA 2VGFA 1JG9A 4YCPA 4A8NA 2E25A 1XIJA 4H9VA 3FN9A 2OQHA 1EDTA 4V1YA 2BASA 3BG3A 3I68A 4PCTA 5CZKA 3VZYA 3MY9A 4TVDA 1K77A 2O9PA 2NSXA 4F9JA 1AQMA 3BK0A 4UTJA 3PZ9A 1EBGA 2VZSA 3AIQA 3TYUA 2G4FA 3WQEA 4FX6M 4IH3A 4CEUC 1TSIA 3WBWA 3QMRA 1LLZA 3S0CA 2A3EA 1M6JA 4PCFA 2OCZA 1BEUA 3DH7A 4H9YA 3GTHA 3TU9A 4JIHA 4LEFA 2EPLX 2H90A 1US3A 1GOWA 1BFNA 1IZJA 4O50A 4UR8A 4LUTB 3NO1A 3NJ3A 4AY8A 1LWHA 1VRXA 4HBKA 3FAXA 1H61A 4A6GA 2CU0A 4FXFA 3TMLA 2DZWA 4NZ3A 1H09A 3SN4A 5FAJA 5F2IA 4ASTA 2Z6IA 1HKKA 2GSHA 3LA4A 4BQ5A 1J0HA 1HX0A 3ZQ9A 2VURA 4QDPA 2WMJA 2IKJA 3UXIA 4QLLA 4NY2A 3E0WA 5HK4A 1I2QA 1IEQA 1XINA 1FA2A 3A9BA 1UD4A 3CAVA 3BG5A 5A8GA 2FPVA 1IGWA 3L4YA 3CBWA 3FSUA 4EKJA 3DUGA 2XGZA 3TDFA 3EYPA 3GDKA 1WUEA 3O7UA 2ESCA 1EA0A 5D4YA 3M43A 3IAQA 5D8WA 4MUPA 1J4EA 1T5AA 1KFLA 5E6ZA 4KCTA 2GK1A 1W3NA 1E9ZB 2X05A 3NPXA 4B15A 2VR2A 1JD7A 1GQNA 2PSNA 1XDMA 2WC4A 2VFFA 4TXEA 1IEVA 4MPQA 4IL0A 3GNRA 2YX0A 3TZFA 4DPPA 3CZJA 1SSGA 4RV3A 7TIMA 2ZXQA 2A7PA 3CUJA 2CITA 3GG8A 3SURA 3NR0A 4MUZA 3UD6A 5FCZA 3D3AA 3W23A 2PDXA 4NF7A 3MZNA 4W87A 3RLUA 3VDAA 1P0EA 2PTYA 3W38A 2OEMA 3CZ8A 1ZP4A 3GNPA 1LOLA 2PP3A 3CZEA 4U2YA 5HA7A 5LNSA 4H9ZA 2P10A 1UOZA 3BAJA 3O16A 1MQQA 3BGJA 2WCSA 1C3FA 3KL5A 3LY0A 3A6OA 1R87A 1U22A 2YIHA 2Y5EA 3LHVA 4H8NA 1GWJA 2VL4A 1PPIA 1JZ8A 3H53A 3VIOA 1K4HA 5A8MA 2DSUA 1QBAA 1NOUA 5JXQA 1EIBA 1ZALA 3O07A 4GXPA 1M7OA 2C8NA 3WY1A 1JCXA 3AYTA 3BAKA 3C86A 2YR1A 4B5XA 3LHUA 1Y5VA 4NZ4A 1RA5A 4PUDA 4C6QA 1W5OA 3OVRA 1YDYA 2IKGA 3L67A 3VYLA 4FK9A 4DF2A 3TTOA 4ERIA 5D09A 3W1NA 3VD3A 1BGGA 4JIPA 1PEZA 2H3BA 5CCZA 3W7PA 2WJDA 4IIFA 5KEZA 1SO5A 2ODOA 5DMYA 5AKQA 3WFLA 3ARTA 4OVXA 3M4HA 1KGUA 3KCJA 4IG2A 2W4XA 3KP0A 3BPWA 4GJIA 3M5ZA 1NDYA 4R33A 3KRSA 3SY1A 3C3UA 2CLMA 5K9DA 3EB2A 1F4HA 4W7WA 3PHAA 1UP2A 1BD0A 1BXNA 3KS5A 4AQLA 2HVOA 3I4KA 1L2QA 2JEQA 1QI4A 2YPIA 3KTXA 1VCFA 3W7EA 4D72A 2DEPA 4RNFA 2DGAA 3M0XA 4O52A 1OX4A 3DFPA 1EA9C 3VPLA 4EAMA 1HJWA 2ZCGA 2XYLA 4O1DA 2PBGA 3W71A 2QV5A 5LIXX 3GVVA 3F1QA 4IFRA 1S2VA 1UJQA 3A3WA 1V6TA 4OIFA 3GVGA 3NVTA 2AQVA 3DDMA 1RXOB 2GYIA 1FVPA 4GIEA 1LBMA 3ARZA 1SU5A 1DORA 4D6HA 5C54A 4L65A 4LB3A 1AJ2A 4A2RA 2EG7A 1HP5A 4O14A 5CBIA 2XISA 3BVJA 1LQ2A 1MQRA 3S2JA 3VE7A 1LBFA 4PUKA 4OJYA 1I0BA 4PUJA 4RR4A 1HT6A 5BOOA 1HZYA 1KM5A 2A3HA 2P5NA 2BS9A 3VOGA 4ORIA 3PPGA 1RLDA 4UC5A 3BW2A 5FF0A 5F2MA 3AXHA 3APGA 1Y7VA 1S1RA 1MUCA 3G24A 4LV4A 2A3AA 4NJKA 3CH0A 2B81A 1XFBA 3VNIA 4K7YA 4P7OA 3GD6A 3I7RA 1E71M 4A3YA 3C52A 3M0VA 1PTAA 4NIRA 1V0NA 1H63A 4XD5A 2Y8VA 1SSDA 2F84A 4YVPA 1BXBA 2HSAA 2OEJA 2VDHA 4I90A 1JQVA 4KGJA 3RLGA 1H7NA 2FHFA 5K4XA 1RBOB 2WAGA 4HMCA 4X22A 3ORWA 4LUSB 1CZ1A 4I8DA 4US5D 1OYBA 1GEQA 2OODA 3PWGA 1FDJA 4ZOCA 3M46A 3CO4A 5ABFB 3TJLA 3PZOA 4ACZA 3TR9A 4W9TA 1J11A 5AOUA 1MMFA 3ZJ6A 2VHLA 3RCMA 1T8QA 2PDMA 3LMZA 4S23A 4YTUA 1HP4A 4FOJA 2ZA1A 1P6BA 2NWRA 4JQ2A 4JKLA 1NH6A 4D2JA 3IUHA 3KWSA 5KZEA 3EOLA 3ZFHA 1NP0A 5M17A 1AL7A 1KCLA 3N14A 2C0HA 1Q66A 3WUEA 4LFYA 1GOXA 2WSQA 1B3VA 3M5VA 5CXPA 4LOCA 1KLYA 2QIIA 4JHMA 5D2VA 4Q8VA 1ISYA 3DKJA 2YZ5A 3UPMA 5C0QA 4WKFA 3BLPX 4OE7A 4CU6A 2NW0A 3GE7A 5EPDA 4ZENA 3O8AA 2J9ZA 4YU1A 3UERA 3OLIA 1HN1A 3C3NA 4U4MA 1TVNA 3C61A 3WEMA 1DXEA 3VM7A 3B0VC 1NQ6A 2OXNA 4AIBA 3NPVA 2A79A 2ZVIA 2I5GA 1RBLA 5D05A 2NVCA 4KEZA 1NQKA 2R1LA 1UROA 2WJFA 4CNNA 2R8WA 5CGTA 4UTTC 4NP7A 4JCMA 4PTXA 3VDCA 2ZRXA 3V5OA 1CT5A 1VFSA 3WJSA 3H4WA 1IF2A 3P60A 3POCA 3GR7A 5A8OA 3FJLA 1UYQA 5XIMA 4AWUA 4XTDA 1V4YA 2QUNA 1KTCA 3MKVA 2BOGX 2VXNA 4WX2A 1F6KA 1A80A 4FLSA 4P5UA 1RK6A 5DBUA 4CN6A 3CQHA 4LVGA 5E6YA 2PLJA 4CEXC 3CZKA 3UG3A 4UQBA 1KM4A 3NQCA 1Q5MA 1IWPA 4QHRA 1J0IA 5M3WA 4UB9A 5H1WA 4YL2A 5E93A 3C2OA 3R5EA 4E4FA 4ZOAA 4H19A 4ZO9A 4YJ5A 2GJNA 4RV8A 3CUXA 2I9EA 3NZGA 5K9CA 2SFPA 3P8JA 3WEOA 4GQQA 5I3GA 1GUVA 5AN7A 5FESA 2CXEA 1XSKA 2VFDA 3BW4A 4HPJA 4MKVA 4W5ZA 3ANUA 3L0KA 4F0RA 2OEKA 1QPRA 1ZJIA 3AU6A 1L6FA 5I09A 5FL1A 3LB0A 1FWSA 3PG9A 3LZ3A 4B5UA 4Z42C 3U2OA 4G56A 1H1YA 1GVOA 2FDMA 1W9UA 4E8GA 1H4PA 3EA1A 1D3CA 2WSPA 4F0LA 3C2RA 6CGTA 3N2XA 4OGZA 2Z1SA 4MFDA 1WPCA 4DZIA 4GUHA 3QR0A 2E8YA 3B4YA 5B7ZA 3QF0A 1SJAA 4XBKA 4DELA 3LYEA 4H8UA 4OOUA 3UP8A 3NPUA 4K39A 4JN6A 4GZIA 1DJYA 3R4IA 4EP8C 5EL1A 3W2UA 3N9KA 3QMTA 2WCGA 3URBA 5FF4A 1V6XA 4ADUA 2OZ3A 2P53A 3NEHA 3AJXA 1XRTA 3G1AA 1DBTA 2NLIA 1Q7MA 2BGQA 4QDWA 4DJED 4HZ8A 4XZMX 5IHRA 1KTNA 3MTWA 1ZSXA 2X1UA 1TMLA 4FPSA 3NL5A 2QJIA 3BW3A 5LIUX 3OLDA 3UPWA 4XO6A 1M7XA 4OUEA 2BVTA 1XGZA 1CLVA 1JI1A 2JGYA 1R7OA 2FTPA 4DBDA 1IR1A 1A53A 3K13A 4D6GA 3ZO9A 4AZ5A 4LNCA 3DEQA 2WXDM 3ZYZA 4C6IA 3DESA 3OEXA 1UHVA 4DO6A 5I7GA 4HU3A 2FYMA 2PUZA 2C19A 2WQPA 4PMJA 3DC0A 4NYYA 3VILA 3LPPA 3HURA 4IFKB 2PGWA 3ITTA 3U2CA 5CC3A 2BV9A 5PTDA 2GDVA 2V2CA 4H4IA 3GB6A 3T44A 1DIOA 3W1AA 4B3KA 3KBWA 3AMGA 2ZUVA 3DERA 3KTSA 1OG0A 3ZIZA 4NKCA 1LJYA 4M6PA 4W8AA 5LKYA 5KZ6A 1J18A 3L0NA 5D2WA 4UWMA 4E3TA 3UNTA 4P8WA 2OELA 4A22A 2ZA2A 5A6BA 1GVQA 2P76A 4UXDA 3ARPA 2G0WA 4UTIA 4EANA 4WDWA 1JD9A 4S3EA 1BYAA 4DI9A 2E3ZA 3W7JA 4NRRA 3R0UA 2VR4A 2A7NA 2QV4A 4IPLA 1XLEA 3B9DA 4V27A 2ZX8A 1J0ZA 1DTNA 1UWIA 2VX6A 4R88A 1NOFA 4GOAA 3CV1A 1YXCA 4GFSA 4KCWA 3PANA 1QMLA 4Z1CA 1ZPTA 1UUMA 1CCWB 3G77A 1DHKA 3S6TA 4EF9A 1PYMA 1JYVA 3SEPA 4FA3A 2CCRA 4N42A 3U8GA 5DXYA 3GTFA 2PDKA 4FNRA 2DU2A 3G1XA 1LG2A 1PIIA 2PPGA 4JN7A 3W3OA 3OW1A 3P0XA 3GAYA 2Z6JA 3VCCA 4DWSC 2YCKX 3DFOA 4KF1A 2FH6A 3UWVA 1M5WA 3A3HA 1HQTA 1V7AA 3UT0A 4ATLA 4AISA 4M51A 1KR0A 1KRMA 4CVWA 1E40A 4AWEA 2YDAA 3IVUA 1K03A 1DTUA 3ID7A 1E0UA 3SRFA 1NDVA 1JCYA 1QNSA 3CV2A 4JZ5A 3EPMA 1XYMA 5CJMA 4ZMGA 4XVEA 1J96A 2E1DA 4XO7A 2VEPA 4IF2A 4EF8A 3BZGA 4CN1A 1KW1A 1JAKA 3W0KA 2CYGA 1VAHA 5A5WA 1HKWA 3UG5A 2PDGA 4MWAB 1MO0A 2UY4A 4CD8A 3CL6A 4GY7A 1RBAA 3FW6A 3ZS4A 4L4LA 3EXSA 1CGVA 1MEHA 1A3XA 1BVWA 3GDMA 2IXUA 4MJZA 1OC7A 2QCEA 4DO7A 4GH1A 2NXIA 3TE9A 2X41A 5J04A 1A0DA 1WXZA 8RUCA 3OLEA 1PX8A 1SYTA 4OUIA 3VIHA 2FB2A 1FWGC 3A24A 3MCOA 1EP1A 1ZP3A 3RMJA 1FKWA 5IHSA 3S5ZA 1H1ZA 4IJCA 1PKYA 1R30A 3L68A 5H8UA 3WJZA 3LXCA 1G1YA 5I5RA 2WMIA 3WLKX 4RXGA 4Z1YA 5LNVA 2BHYA 4MAZA 5CC5A 3ITOA 4KWUA 2LLEA 1YBQB 3MANA 5CLWA 2GWNA 1OFQA 2VC6A 1K70A 3N6QA 1Y5XA 4XKYB 1U30A 1HL8A 3DFNA 2V67A 3WLJA 3QSRA 3LGEA 1YXDA 2FGBA 3BAXA 2XVLA 3EWUA 3GW0A 3GVRA 1XLJA 3KHDA 4H7ZA 2IW0A 1A47A 4KERA 5A6JA 4MSSA 3PB0A 5FEXA 3AS0A 2VDIA 3S4TA 2Y8UA 3W1RA 1CW2A 2ISDA 2NV9A 3N29A 4CNOA 3NSXA 4RL3A 3GDRA 3LLFA 4O53A 4MB1A 1DE5A 1RV8A 3A4AA 3FNDA 4HYWA 4DYJA 2ZWYA 1E43A 4JTJA 3VD7A 4X2RA 1EC7A 4GA8A 3VUSA 3M0IA 3CZGA 5HINA 3IK4A 4EVZA 2W9MA 1CYGA 5GQBA 3BCDA 4JY8A 1W6TA 3DYMA 4J3WA 4QJ1A 4HP5A 3P84A 2BTMA 4QG9A 4Y90A 4D8LA 1SFLA 3NQDA 4IIDA 2XINA 3GR8A 3I3EA 2BX7A 3TROA 2WWCA 3OG2A 3V3WA 5HNNA 1E1FA 1L6WA 1H7XA 3DZ1A 1HJSA 3H2AA 3S47A 3SGUA 1RSCA 2V5KA 1O1ZA 3DFQA 2KZHA 4TIMA 4R3UA 4GH3A 1TPH1 3VFCA 3LI1A 4RPQA 4A35A 1WKYA 4X60A 2EBNA 3BXWA 3EEZA 4MPKA 4PODA 2P1FA 3G0UA 1FWCC 3N2TA 3NNTA 4Q6JA 2WKJA 2DQWA 3ME3A 4NAEB 4NG3A 1KXHA 3D6NA 4UTUA 4IXHA 3KOFA 4NNBA 4ZTYA 2OX1A 2BMBA 3F4NA 2PDNA 3VNKA 1O5XA 5A6KA 1Z9AA 4C6NA 2AGKA 2PFHA 3WBEA 3B9NA 1XIIA 1REQB 2FGZA 1TUFA 1IXQA 1KWGA 3L12A 5JMUA 2QMKA 2VOTA 5JU6A 3BMXA 3UF9A 1E6RA 1KTBA 1SJBA 1H1NA 1UZDA 3U57A 4E38A 4GXMA 4A3UA 2BVYA 3EZ4A 3MDWA 2HEJA 2REQA 1UZHA 1UUOA 4L6OA 3LK6A 3DGRA 1E1EA 3OZYA 4JDBA 1V77A 3W7RA 3W6LA 3MW7A 3BOXA 3WQFA 2C71A 4FNQA 4IPNB 4Y2WA 3W85A 3VD4A 1XBYA 4JIRA 3EKZA 4QP0A 2ATMA 1Q3NA 2J47A 1KA9F 1FY6A 3EPNA 2BWGA 4FNUA 3RYSA 3C0QA 4JYEA 1A5KC 5H2ZA 5HPOA 2A4AA 3I65A 1Q85A 1FH9A 2V0TA 3A3XA 1J01A 1XG4A 3NGFA 3TTQA 1ONRA 3FY1A 4RNIA 1QHOA 2FMNA 4ATWA 3L5AA 3BWWA 3IWPA 1A5NC 2CNCA 1UKSA 4UTKA 4LAZA 4WOZA 1ME9A 4N9EA 2Z7KA 3GUGA 3OLGA 2DT0A 4IX2A 4HNUA 5HQLA 3SCOA 1CECA 2PTDA 4QG6A 4UOQA 5D38A 1O1HA 8TIMA 2C79A 1Q8AA 4JNMA 4PC8A 3H2MA 3L4UA 1MXGA 1JI2A 2I1OA 4YMZA 2ZIDA 1D3GA 4QTGA 4G2DA 4CCCA 3ZMRA 3M9YA 2PODA 3F2BA 2DIEA 1B3ZA 3OVGA 1RP9A 1YHTA 3PK7A 1ADDA 3NCOA 1SFJA 1S46A 3QTGA 5C55A 4LRTA 3WYZA 4EX4A 4CQBA 1LZOA 3BCFA 3C8NA 1FH7A 3UJ2A 4XZHA 2OG9A 1KFKA 1IIHA 2ICSA 2Z1VA 4L9YA 4Y96A 3BOFA 4KESA 5EFFA 3WENA 2E7FA 3TXVA 1OSEA 3UNDA 3OB8A 3U2ZA 3W1TA 4M3PA 3TCEA 3TTEA 1BTCA 4GG9A 3A5VA 1AW2A 4FX7A 4LWWA 1Z6KA 3W1LA 3SRHA 3GU9A 4PN2A 3CMFA 4QNEA 2JF6A 4CNTA 1GNXA 1SMDA 3FA4A 3OQEA 2PWGA 4HSHA 3A64A 1F8MA 3DX5A 1EDGA 1NTHA 2PDHA 3UZYA 3PBWA 5F2LA 3PZUA 1R2RA 1UD6A 3HGJA 2DZPA 3UGRA 1QAPA 4O10A 1FFQA 3C0SA 3QBUA 1ZQ5A 4H8VA 5I3HA 1G69A 2E68A 1R6WA 2WB5A 3D3FA 3LHYA 1F7BA 2ZE0A 4MB3A 4F66A 4JHOA 8A3HA 2OTDA 2WCAA 3WDJA 2D2OA 5CSYA 5REQA 4HNNA 3TN4A 3B03A 1J9YA 4KFPA 3VKDA 4KWWA 1BYCA 3C2VA 5BRBA 2O9TA 1VLIA 1WKEA 2B7QA 4O19A 1LORA 3NURA 1UQZA 3RO8A 3UR2A 2BXZA 1S5VA 4E5TA 3EOEA 3VIJA 4UFMA 4W85A 3ZT6A 4Q4RA 3LCWA 3TQVA 3N2CA 1CXFA 2FVMA 1OG6A 5K4ZA 1QNOA 1JCTA 4BF9A 4LAMA 3E02A 4W5UA 3TKFA 1DJXA 1UWQA 3W76A 4UUIA 3HOJA 2EO7A 1YMYA 1K8XA 3CWNA 4EPDC 1T0OA 2PWHA 2ZADA 1WZAA 3W2MA 1C8YA 5FD0A 3FVMA 2XFFA 1XW8A 3DECA 3VC6A 1TVLA 3NG3A 4DZAA 2E0PA 2UWFA 4O4WA 3T1GA 1AQ0A 2KX9A 1XCXA 2E6DA 5BMXA 2GGEA 1DIDA 1SZNA 4NI8A 4YCOA 5CPOA 1L8NA 3ARUA 5G2WA 3D0CA 3G1FA 4AVFA 3M0MA 1F4AA 1C7TA 1BQCA 1LTDA 3GH5A 4K1GA 2GGHA 3GG1A 3EKLA 3EDFA 3GC2A 4O4VA 3LCXA 4FOKA 4TX8A 2C16A 3IVTA 5I77A 2G3NA 5D8ZA 2VT0A 4MG4A 2HE8A 3PB2A 1EJUC 4B2DA 1FUYA 1V93A 1W3KA 4AF0A 5G1TA 1UKPA 4XKYA 4JQAA 3QQWA 1YX1A 1DQWA 5I00A 1PE1A 1UASA 7ODCA 4CQ9A 4PB4A 2DJLA 3QZAA 9XIAA 1FCUA 2VENA 2BLEA 2ZX6A 1LF1A 1WYIA 3LI0A 2HBXA 4ICMA 4HA1A 4MZ1A 4P61A 3WQVA 3KFTA 3LCLA 1IZKA 1KBIA 3DYOA 4KCVA 2DJXA 5A2CA 4L4OA 3A22A 3ARYA 4XWUA 2QCLA 3T0TA 5DMNA 1UKTA 2GSEA 1AG1O 4BR1A 4Q4PA 1Q6FA 1JFXA 2QCNA 3BTNA 1B0IA 1JDEA 3QFEA 2QCCA 4EPEC 1EOKA 5AHMA 1DJIA 4MIMA 1AVAA 7CGTA 4AHPA 1OJXA 4UTTA 4HCDA 2QPSA 5BRPA 3V1PA 5A6TC 2QDDA 5XINA 5BU9A 2WJEA 3TUUA 4F0MA 5JH2A 1KM3A 1T6MA 1UPMB 4NXKA 4H2HA 4AZIA 4BKNA 5M2FX 3P0WA 1I2RA 4FMVA 5BWFA 3KOYA 5DCBA 1LBLA 5FL0A 1PCWA 1AUSL 1FDZA 2X0YA 5G1MA 3V5FA 3VMNA 1X7FA 3DYPA 7REQA 5E5CA 1EJXC 3J7HA 1L6YA 1QPQA 4MJ4A 2PTWA 2V5JA 3NL6A 2OT0A 3W29A 1PHQA 5BXTA 3VZZA 1QW8A 2GVGA 1C93A 3LG3A 1GYNA 4RDZA 3VGFA 4L4MA 3Q4DA 4GE8A 1KQYA 2E28A 3OZPA 2J7GA 2OQLA 4MYXA 3KBNA 4X9SA 2C1HA 3ZJ8A 4JKMA 3MI6A 1E55A 3W28A 3EX6A 4GLEA 1LLWA 3R7MA 3ZVHA 1XIFA 1V5XA 1W31A 3RPTA 1GOMA 1ZB5A 2OJPA 3SJ3A 2XM2A 1LOQA 4ONVA 3A4XA 1TELA 5DELA 3SCRA 3XINA 1Y65A 3WDQA 3DENA 3IRDA 1DQXA 4GI6A 3OJGA 3ZXWA 2FZBA 2ATSA 1C8VA 4C6BA 1DQUA 3N13A 3GW3A 2G5WA 1M3UA 5HDRA 5JBDA 5A69A 3LTSA 1DEDA 2NVDA 1TJRA 4EWND 3MP5A 1JCJA 3G2GA 2ZUSA 3SW6A 1OYAA 3QXBA 3PZTA 1VB9A 3IANA 1EQPA 1XYAA 1VBGA 2FZMA 2GGJA 1ZAIA 1H60A 3GDTA 2V5BA 4BI5A 4QCEA 4AU0A 1S38A 3BQ5A 1E0XA 3QKZA 3TC3A 4NT0A 2YYUA 3AWOA 5IBXC 2XGBA 1XYFA 1BWLA 1WBJA 2QR6A 4QGCA 3ABRA 4D6IA 4XV0A 1AD1A 1GJPA 4P7NA 3E0LA 1KBKA 4L6DA 2FZ8A 2V3GA 5FACA 1TWIA 2O4MA 1OFAA 1LUCB 1XX1A 1LRQA 2G3MA 2ZE3A 1NDWA 6TIMA 4X0VA 2ZZ7A 8CGTA 1FQ0A 3LCIA 1GOIA 1CEOA 2DZVA 1J0YA 4P7QA 1NWUA 1MVYA 4AH7A 2W6RA 2P8CA 1R0MA 1WO2A 2Z25A 1L2UA 3OZOA 1V3JA 4YPJA 1GPWA 1WDQA 4AB4A 3FYYA 4GINA 3WF1A 4C1NA 2VZVA 2ZRYA 4B5SA 3JW7A 2FZ9A 3PBUA 5F1UA 1XBVA 3GZAA 3AHXA 1P5BA 1YPXA 5A94A 4MF4A 1YDVA 2CHOA 4LW7A 4JOMA 3CPRA 1HTIA 1LT7A 1TZZA 1VH7A 5A95A 3GK0A 1U83A 4XBSA 2IPJA 2WNWA 1POKA 5B7YA 3OG3A 5FJRA 4D71A 3B04A 2WLZA 3A5FA 3L7RA 4IQJA 2HS6A 4UMBA 3R13A 4OU1A 4HVXA 4J40A 5A1AA 4I7UA 1GVSA 4CNSA 1IWBA 2VX4A 3LMYA 1OX6A 1VIWA 3W7NA 2QDHA 4GVGA 3BSHA 1K02A 4DUVA 3AHVA 4CD6A 5XIAA 1MNSA 2V5DA 3BAYA 5KZDA 1KM6A 2Y89A 2BOFX 1JRCA 1AK5A 3PY2A 3L9CA 3TN3A 1OCBA 1E51A 4YTTA 4IM4A 3QOMA 4S3DA 4J3ZA 2PDYA 5ENLA 4NX0A 2GJXB 1ZJBA 2FHCA 1H11A 3CC1A 4G7EA 2CPUA 1XQLA 1Z7AA 1TPB1 3DBPA 3GIPA 3HJEA 4Q6XA 4DJEC 3SAZA 4DWSA 5C71A 3GXFA 3KM8A 4JFWA 1H2JA 3VOFA 3NDOA 3S2NA 3NOYA 3P62A 4GQBA 4PR4A 3MA8A 4AX6A 5HAOA 3H21A 1EH9A 2XG9A 9RUBA 3SZ8A 4IMDA 4H04A 4ZFMA 2WKLA 2QCDB 3M16A 3RO6A 3RCNA 3TTSA 5DFAA 4QJ4B 4JTAA 1QBBA 3TEVA 1VBUA 2QGYA 1WE5A 1W1VA 3SFKA 2XPKA 4FP1A 2WJZA 1ICPA 4JYFA 1ZBVA 3GS6A 2HBVA 2VNCA 4ZCWA 2PZ0A 3UXDA 3VOHA 4HZ7A 1W2PA 1HVXA 2ABAA 3NAVA 3RG6A 3RU6A 4N9BA 2IKHA 3LDVA 3RHGA 1CWYA 5C2CA 2VC7A 2B7NA 3M64A 5CEWA 1ZFJA 1O5RA 4PSPA 3HB9A 4J28A 3FA3A 1GQLA 3OOQA 5BXPA 3CNYA 5TQLA 4OKDA 2B31A 4LT9A 2WNZA 3T42A 1GVRA 2RDXA 4YXGA 4K36A 5BRQA 3EWCA 4DUOA 2GJLA 1HO1A 4DNHA 2QT3A 4DBEA 3KDOA 2XSAA 1K7XA 3RRAA 1TPEA 5EU9A 4GI4A 3SRDA 3H8AA 4EE9A 6XIMA 2I57A 2WVVB 3WF2A 4JIEA 3LXAA 1POJA 2XSXA 4NAFA 2HZGA 1K7FA 3GXDA 3U4AA 5G4EA 4IUGA 3CYJA 3AO0A 1QVBA 5HPCA 2R1MA 1B3OA 5AB3A 1TPVA 4AY7A 3PTDA 2EEXA 1JEZA 2QULA 1R47A 3N2MA 5BROA 1JF5A 1FCQA 1VYPX 2PDLA 2Z1XA 4KPLA 1EP3A 4JL2A 4LH8A 3LENA 2CLLA 4ADSA 5LA1A 4LAKA 3VKBA 3WD2A 4DWDA 2CERA 3TWBA 3WH7A 1GEHA 2CC0A 3HQ1A 3WMCA 2OPJA 3HO8A 1LYXA 1KFEA 3QSTA 2GOUA 3WIJA 4HU8A 4C7FA 2YBUA 2V8ZA 1XLBA 3NO3A 3PZVA 4IGSA 4LTSA 3ES8A 3EWZA 2XIMA 4WJEA 1YADA 2WK2A 1S2CA 4P7LA 3KDNA 1S5MA 2NZLA 3WLLA 1XKJA 2Y5JA 3O6YX 1HNYA 1K9DA 1DWHM 1KFCA 3LQLA 4FZIA 4HNCA 2DFAA 1GQJA 4MHBA 1RJRA 1EIXA 5C5YA 3EDKA 2X7WA 1UR4A 4R5EA 2V68A 1RR2A