The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
127
|
sequence length |
383
|
structure length |
382
|
Chain Sequence |
ETPTRVYAEIDLDAVRANVRALRARAPRSALMAVVKSNAYGHGAVPCARAAQEAGAAWLGTATPEEALELRAAGIQGRIMCWLWTPGGPWREAIETDIDVSVSGMWALDEVRAAARAAGRTARIQLADTGLGRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPATLTLPETHFDLVRTGLAVYGVSPSPELGTPAQLGLRPAMTLRASLALVKTVPAGHGVSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLVAGKIRRAAGRIAMDQFVVDLGEDLAEAGDEAVILGDAERGEPTAEDWAQAAHTIAYEIVTRIGGRVPRVYLGGLEHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
alanine racemase
|
publication title |
Structural evidence that alanine racemase from a D-cycloserine-producing microorganism exhibits resistance to its own product.
pubmed doi rcsb |
source organism |
Streptomyces lavendulae
|
molecule tags |
Isomerase
|
total genus |
127
|
structure length |
382
|
sequence length |
383
|
chains with identical sequence |
B
|
ec nomenclature |
ec
5.1.1.1: Alanine racemase. |
pdb deposition date | 2004-04-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00842 | Ala_racemase_C | Alanine racemase, C-terminal domain |
A | PF01168 | Ala_racemase_N | Alanine racemase, N-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Lyase, Ornithine Decarboxylase; Chain A, domain 1 | Lyase, Ornithine Decarboxylase; Chain A, domain 1 | ||
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Alanine racemase |